data_1LWU
# 
_entry.id   1LWU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LWU         
RCSB  RCSB016359   
WWPDB D_1000016359 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1FZG 
_pdbx_database_related.details        'Human fragment with GHRP' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LWU 
_pdbx_database_status.recvd_initial_deposition_date   2002-06-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yang, Z.'        1 
'Spraggon, G.'    2 
'Pandi, L.'       3 
'Everse, S.J.'    4 
'Riley, M.'       5 
'Doolittle, R.F.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of fragment D from lamprey fibrinogen complexed with the peptide Gly-His-Arg-Pro-amide.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            41 
_citation.page_first                10218 
_citation.page_last                 10224 
_citation.year                      2002 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12162736 
_citation.pdbx_database_id_DOI      10.1021/bi020299t 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Yang, Z.'        1 ? 
primary 'Spraggon, G.'    2 ? 
primary 'Pandi, L.'       3 ? 
primary 'Everse, S.J.'    4 ? 
primary 'Riley, M.'       5 ? 
primary 'Doolittle, R.F.' 6 ? 
# 
_cell.entry_id           1LWU 
_cell.length_a           76.735 
_cell.length_b           47.654 
_cell.length_c           244.650 
_cell.angle_alpha        88.81 
_cell.angle_beta         97.23 
_cell.angle_gamma        86.17 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LWU 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'Fibrinogen alpha-1 chain'                                                                14074.052 4 ? ? 
fragment         ? 
2  polymer     nat 'Fibrinogen beta chain'                                                                   37061.211 4 ? ? 
'Segment 2 of 2' ? 
3  polymer     nat 'Fibrinogen gamma chain'                                                                  37475.555 4 ? ? ? ? 
4  polymer     syn 'Ligand Gly-His-Arg-Pro-NH2'                                                              465.530   4 ? ? ? ? 
5  branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1 ? ? ? ? 
6  non-polymer man 2-acetamido-2-deoxy-alpha-D-glucopyranose                                                 221.208   8 ? ? ? ? 
7  non-polymer man alpha-D-mannopyranose                                                                     180.156   9 ? ? ? ? 
8  non-polymer syn 'CALCIUM ION'                                                                             40.078    8 ? ? ? ? 
9  non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                  221.208   8 ? ? ? ? 
10 non-polymer man beta-D-mannopyranose                                                                      180.156   3 ? ? ? ? 
11 non-polymer man beta-D-galactopyranose                                                                    180.156   1 ? ? ? ? 
12 non-polymer syn 'AMINO GROUP'                                                                             16.023    4 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;AVSDTSGQTLNEHNELEVRYSEVLRELERRIIHLQRRINMQLQQLTLLQHNIKTQVSQILRVEVDIDVALRACKGSCARY
LEYRLDKEKNLQLEKAASYIANLKFERFEEVVVEETLNR
;
;AVSDTSGQTLNEHNELEVRYSEVLRELERRIIHLQRRINMQLQQLTLLQHNIKTQVSQILRVEVDIDVALRACKGSCARY
LEYRLDKEKNLQLEKAASYIANLKFERFEEVVVEETLNR
;
A,D,G,J ? 
2 'polypeptide(L)' no no  
;SSTHVNAQKEIENRYKEVKIRIESTVAGSLRSMKSVLEHLRAKMQRMEEAIKTQKELCSAPCTVNCRVPVVSGMHCEDIY
RNGGRTSEAYYIQPDLFSEPYKVFCDMESHGGGWTVVQNRVDGSSNFARDWNTYKAEFGNIAFGNGKSICNIPGEYWLGT
KTVHQLTKQHTQQVLFDMSDWEGSSVYAQYASFRPENEAQGYRLWVEDYSGNAGNALLEGATQLMGDNRTMTIHNGMQFS
TFDRDNDNWNPGDPTKHCSREDAGGWWYNRCHAANPNGRYYWGGIYTKEQADYGTDDGVVWMNWKGSWYSMRQMAMKLRP
KWP
;
;SSTHVNAQKEIENRYKEVKIRIESTVAGSLRSMKSVLEHLRAKMQRMEEAIKTQKELCSAPCTVNCRVPVVSGMHCEDIY
RNGGRTSEAYYIQPDLFSEPYKVFCDMESHGGGWTVVQNRVDGSSNFARDWNTYKAEFGNIAFGNGKSICNIPGEYWLGT
KTVHQLTKQHTQQVLFDMSDWEGSSVYAQYASFRPENEAQGYRLWVEDYSGNAGNALLEGATQLMGDNRTMTIHNGMQFS
TFDRDNDNWNPGDPTKHCSREDAGGWWYNRCHAANPNGRYYWGGIYTKEQADYGTDDGVVWMNWKGSWYSMRQMAMKLRP
KWP
;
B,E,H,K ? 
3 'polypeptide(L)' no no  
;DSGQKTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRPCQDTTANKISPITGKDCQQVV
DNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQHRHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTG
QQAYRLRIDLTDWENTHRYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPERDND
KYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDRWYSLKMTTMKLLPMGRDLSGHGGQQ
QSK
;
;DSGQKTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRPCQDTTANKISPITGKDCQQVV
DNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQHRHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTG
QQAYRLRIDLTDWENTHRYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPERDND
KYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDRWYSLKMTTMKLLPMGRDLSGHGGQQ
QSK
;
C,F,I,L ? 
4 'polypeptide(L)' no yes 'GHRP(NH2)' GHRPX M,N,O,P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   VAL n 
1 3   SER n 
1 4   ASP n 
1 5   THR n 
1 6   SER n 
1 7   GLY n 
1 8   GLN n 
1 9   THR n 
1 10  LEU n 
1 11  ASN n 
1 12  GLU n 
1 13  HIS n 
1 14  ASN n 
1 15  GLU n 
1 16  LEU n 
1 17  GLU n 
1 18  VAL n 
1 19  ARG n 
1 20  TYR n 
1 21  SER n 
1 22  GLU n 
1 23  VAL n 
1 24  LEU n 
1 25  ARG n 
1 26  GLU n 
1 27  LEU n 
1 28  GLU n 
1 29  ARG n 
1 30  ARG n 
1 31  ILE n 
1 32  ILE n 
1 33  HIS n 
1 34  LEU n 
1 35  GLN n 
1 36  ARG n 
1 37  ARG n 
1 38  ILE n 
1 39  ASN n 
1 40  MET n 
1 41  GLN n 
1 42  LEU n 
1 43  GLN n 
1 44  GLN n 
1 45  LEU n 
1 46  THR n 
1 47  LEU n 
1 48  LEU n 
1 49  GLN n 
1 50  HIS n 
1 51  ASN n 
1 52  ILE n 
1 53  LYS n 
1 54  THR n 
1 55  GLN n 
1 56  VAL n 
1 57  SER n 
1 58  GLN n 
1 59  ILE n 
1 60  LEU n 
1 61  ARG n 
1 62  VAL n 
1 63  GLU n 
1 64  VAL n 
1 65  ASP n 
1 66  ILE n 
1 67  ASP n 
1 68  VAL n 
1 69  ALA n 
1 70  LEU n 
1 71  ARG n 
1 72  ALA n 
1 73  CYS n 
1 74  LYS n 
1 75  GLY n 
1 76  SER n 
1 77  CYS n 
1 78  ALA n 
1 79  ARG n 
1 80  TYR n 
1 81  LEU n 
1 82  GLU n 
1 83  TYR n 
1 84  ARG n 
1 85  LEU n 
1 86  ASP n 
1 87  LYS n 
1 88  GLU n 
1 89  LYS n 
1 90  ASN n 
1 91  LEU n 
1 92  GLN n 
1 93  LEU n 
1 94  GLU n 
1 95  LYS n 
1 96  ALA n 
1 97  ALA n 
1 98  SER n 
1 99  TYR n 
1 100 ILE n 
1 101 ALA n 
1 102 ASN n 
1 103 LEU n 
1 104 LYS n 
1 105 PHE n 
1 106 GLU n 
1 107 ARG n 
1 108 PHE n 
1 109 GLU n 
1 110 GLU n 
1 111 VAL n 
1 112 VAL n 
1 113 VAL n 
1 114 GLU n 
1 115 GLU n 
1 116 THR n 
1 117 LEU n 
1 118 ASN n 
1 119 ARG n 
2 1   SER n 
2 2   SER n 
2 3   THR n 
2 4   HIS n 
2 5   VAL n 
2 6   ASN n 
2 7   ALA n 
2 8   GLN n 
2 9   LYS n 
2 10  GLU n 
2 11  ILE n 
2 12  GLU n 
2 13  ASN n 
2 14  ARG n 
2 15  TYR n 
2 16  LYS n 
2 17  GLU n 
2 18  VAL n 
2 19  LYS n 
2 20  ILE n 
2 21  ARG n 
2 22  ILE n 
2 23  GLU n 
2 24  SER n 
2 25  THR n 
2 26  VAL n 
2 27  ALA n 
2 28  GLY n 
2 29  SER n 
2 30  LEU n 
2 31  ARG n 
2 32  SER n 
2 33  MET n 
2 34  LYS n 
2 35  SER n 
2 36  VAL n 
2 37  LEU n 
2 38  GLU n 
2 39  HIS n 
2 40  LEU n 
2 41  ARG n 
2 42  ALA n 
2 43  LYS n 
2 44  MET n 
2 45  GLN n 
2 46  ARG n 
2 47  MET n 
2 48  GLU n 
2 49  GLU n 
2 50  ALA n 
2 51  ILE n 
2 52  LYS n 
2 53  THR n 
2 54  GLN n 
2 55  LYS n 
2 56  GLU n 
2 57  LEU n 
2 58  CYS n 
2 59  SER n 
2 60  ALA n 
2 61  PRO n 
2 62  CYS n 
2 63  THR n 
2 64  VAL n 
2 65  ASN n 
2 66  CYS n 
2 67  ARG n 
2 68  VAL n 
2 69  PRO n 
2 70  VAL n 
2 71  VAL n 
2 72  SER n 
2 73  GLY n 
2 74  MET n 
2 75  HIS n 
2 76  CYS n 
2 77  GLU n 
2 78  ASP n 
2 79  ILE n 
2 80  TYR n 
2 81  ARG n 
2 82  ASN n 
2 83  GLY n 
2 84  GLY n 
2 85  ARG n 
2 86  THR n 
2 87  SER n 
2 88  GLU n 
2 89  ALA n 
2 90  TYR n 
2 91  TYR n 
2 92  ILE n 
2 93  GLN n 
2 94  PRO n 
2 95  ASP n 
2 96  LEU n 
2 97  PHE n 
2 98  SER n 
2 99  GLU n 
2 100 PRO n 
2 101 TYR n 
2 102 LYS n 
2 103 VAL n 
2 104 PHE n 
2 105 CYS n 
2 106 ASP n 
2 107 MET n 
2 108 GLU n 
2 109 SER n 
2 110 HIS n 
2 111 GLY n 
2 112 GLY n 
2 113 GLY n 
2 114 TRP n 
2 115 THR n 
2 116 VAL n 
2 117 VAL n 
2 118 GLN n 
2 119 ASN n 
2 120 ARG n 
2 121 VAL n 
2 122 ASP n 
2 123 GLY n 
2 124 SER n 
2 125 SER n 
2 126 ASN n 
2 127 PHE n 
2 128 ALA n 
2 129 ARG n 
2 130 ASP n 
2 131 TRP n 
2 132 ASN n 
2 133 THR n 
2 134 TYR n 
2 135 LYS n 
2 136 ALA n 
2 137 GLU n 
2 138 PHE n 
2 139 GLY n 
2 140 ASN n 
2 141 ILE n 
2 142 ALA n 
2 143 PHE n 
2 144 GLY n 
2 145 ASN n 
2 146 GLY n 
2 147 LYS n 
2 148 SER n 
2 149 ILE n 
2 150 CYS n 
2 151 ASN n 
2 152 ILE n 
2 153 PRO n 
2 154 GLY n 
2 155 GLU n 
2 156 TYR n 
2 157 TRP n 
2 158 LEU n 
2 159 GLY n 
2 160 THR n 
2 161 LYS n 
2 162 THR n 
2 163 VAL n 
2 164 HIS n 
2 165 GLN n 
2 166 LEU n 
2 167 THR n 
2 168 LYS n 
2 169 GLN n 
2 170 HIS n 
2 171 THR n 
2 172 GLN n 
2 173 GLN n 
2 174 VAL n 
2 175 LEU n 
2 176 PHE n 
2 177 ASP n 
2 178 MET n 
2 179 SER n 
2 180 ASP n 
2 181 TRP n 
2 182 GLU n 
2 183 GLY n 
2 184 SER n 
2 185 SER n 
2 186 VAL n 
2 187 TYR n 
2 188 ALA n 
2 189 GLN n 
2 190 TYR n 
2 191 ALA n 
2 192 SER n 
2 193 PHE n 
2 194 ARG n 
2 195 PRO n 
2 196 GLU n 
2 197 ASN n 
2 198 GLU n 
2 199 ALA n 
2 200 GLN n 
2 201 GLY n 
2 202 TYR n 
2 203 ARG n 
2 204 LEU n 
2 205 TRP n 
2 206 VAL n 
2 207 GLU n 
2 208 ASP n 
2 209 TYR n 
2 210 SER n 
2 211 GLY n 
2 212 ASN n 
2 213 ALA n 
2 214 GLY n 
2 215 ASN n 
2 216 ALA n 
2 217 LEU n 
2 218 LEU n 
2 219 GLU n 
2 220 GLY n 
2 221 ALA n 
2 222 THR n 
2 223 GLN n 
2 224 LEU n 
2 225 MET n 
2 226 GLY n 
2 227 ASP n 
2 228 ASN n 
2 229 ARG n 
2 230 THR n 
2 231 MET n 
2 232 THR n 
2 233 ILE n 
2 234 HIS n 
2 235 ASN n 
2 236 GLY n 
2 237 MET n 
2 238 GLN n 
2 239 PHE n 
2 240 SER n 
2 241 THR n 
2 242 PHE n 
2 243 ASP n 
2 244 ARG n 
2 245 ASP n 
2 246 ASN n 
2 247 ASP n 
2 248 ASN n 
2 249 TRP n 
2 250 ASN n 
2 251 PRO n 
2 252 GLY n 
2 253 ASP n 
2 254 PRO n 
2 255 THR n 
2 256 LYS n 
2 257 HIS n 
2 258 CYS n 
2 259 SER n 
2 260 ARG n 
2 261 GLU n 
2 262 ASP n 
2 263 ALA n 
2 264 GLY n 
2 265 GLY n 
2 266 TRP n 
2 267 TRP n 
2 268 TYR n 
2 269 ASN n 
2 270 ARG n 
2 271 CYS n 
2 272 HIS n 
2 273 ALA n 
2 274 ALA n 
2 275 ASN n 
2 276 PRO n 
2 277 ASN n 
2 278 GLY n 
2 279 ARG n 
2 280 TYR n 
2 281 TYR n 
2 282 TRP n 
2 283 GLY n 
2 284 GLY n 
2 285 ILE n 
2 286 TYR n 
2 287 THR n 
2 288 LYS n 
2 289 GLU n 
2 290 GLN n 
2 291 ALA n 
2 292 ASP n 
2 293 TYR n 
2 294 GLY n 
2 295 THR n 
2 296 ASP n 
2 297 ASP n 
2 298 GLY n 
2 299 VAL n 
2 300 VAL n 
2 301 TRP n 
2 302 MET n 
2 303 ASN n 
2 304 TRP n 
2 305 LYS n 
2 306 GLY n 
2 307 SER n 
2 308 TRP n 
2 309 TYR n 
2 310 SER n 
2 311 MET n 
2 312 ARG n 
2 313 GLN n 
2 314 MET n 
2 315 ALA n 
2 316 MET n 
2 317 LYS n 
2 318 LEU n 
2 319 ARG n 
2 320 PRO n 
2 321 LYS n 
2 322 TRP n 
2 323 PRO n 
3 1   ASP n 
3 2   SER n 
3 3   GLY n 
3 4   GLN n 
3 5   LYS n 
3 6   THR n 
3 7   VAL n 
3 8   GLN n 
3 9   LYS n 
3 10  ILE n 
3 11  LEU n 
3 12  GLU n 
3 13  GLU n 
3 14  VAL n 
3 15  ARG n 
3 16  ILE n 
3 17  LEU n 
3 18  GLU n 
3 19  GLN n 
3 20  ILE n 
3 21  GLY n 
3 22  VAL n 
3 23  SER n 
3 24  HIS n 
3 25  ASP n 
3 26  ALA n 
3 27  GLN n 
3 28  ILE n 
3 29  GLN n 
3 30  GLU n 
3 31  LEU n 
3 32  SER n 
3 33  GLU n 
3 34  MET n 
3 35  TRP n 
3 36  ARG n 
3 37  VAL n 
3 38  ASN n 
3 39  GLN n 
3 40  GLN n 
3 41  PHE n 
3 42  VAL n 
3 43  THR n 
3 44  ARG n 
3 45  LEU n 
3 46  GLN n 
3 47  GLN n 
3 48  GLN n 
3 49  LEU n 
3 50  VAL n 
3 51  ASP n 
3 52  ILE n 
3 53  ARG n 
3 54  GLN n 
3 55  THR n 
3 56  CYS n 
3 57  SER n 
3 58  ARG n 
3 59  PRO n 
3 60  CYS n 
3 61  GLN n 
3 62  ASP n 
3 63  THR n 
3 64  THR n 
3 65  ALA n 
3 66  ASN n 
3 67  LYS n 
3 68  ILE n 
3 69  SER n 
3 70  PRO n 
3 71  ILE n 
3 72  THR n 
3 73  GLY n 
3 74  LYS n 
3 75  ASP n 
3 76  CYS n 
3 77  GLN n 
3 78  GLN n 
3 79  VAL n 
3 80  VAL n 
3 81  ASP n 
3 82  ASN n 
3 83  GLY n 
3 84  GLY n 
3 85  LYS n 
3 86  ASP n 
3 87  SER n 
3 88  GLY n 
3 89  LEU n 
3 90  TYR n 
3 91  TYR n 
3 92  ILE n 
3 93  LYS n 
3 94  PRO n 
3 95  LEU n 
3 96  LYS n 
3 97  ALA n 
3 98  LYS n 
3 99  GLN n 
3 100 PRO n 
3 101 PHE n 
3 102 LEU n 
3 103 VAL n 
3 104 PHE n 
3 105 CYS n 
3 106 GLU n 
3 107 ILE n 
3 108 GLU n 
3 109 ASN n 
3 110 GLY n 
3 111 ASN n 
3 112 GLY n 
3 113 TRP n 
3 114 THR n 
3 115 VAL n 
3 116 ILE n 
3 117 GLN n 
3 118 HIS n 
3 119 ARG n 
3 120 HIS n 
3 121 ASP n 
3 122 GLY n 
3 123 SER n 
3 124 VAL n 
3 125 ASN n 
3 126 PHE n 
3 127 THR n 
3 128 ARG n 
3 129 ASP n 
3 130 TRP n 
3 131 VAL n 
3 132 SER n 
3 133 TYR n 
3 134 ARG n 
3 135 GLU n 
3 136 GLY n 
3 137 PHE n 
3 138 GLY n 
3 139 TYR n 
3 140 LEU n 
3 141 ALA n 
3 142 PRO n 
3 143 THR n 
3 144 LEU n 
3 145 THR n 
3 146 THR n 
3 147 GLU n 
3 148 PHE n 
3 149 TRP n 
3 150 LEU n 
3 151 GLY n 
3 152 ASN n 
3 153 GLU n 
3 154 LYS n 
3 155 ILE n 
3 156 HIS n 
3 157 LEU n 
3 158 LEU n 
3 159 THR n 
3 160 GLY n 
3 161 GLN n 
3 162 GLN n 
3 163 ALA n 
3 164 TYR n 
3 165 ARG n 
3 166 LEU n 
3 167 ARG n 
3 168 ILE n 
3 169 ASP n 
3 170 LEU n 
3 171 THR n 
3 172 ASP n 
3 173 TRP n 
3 174 GLU n 
3 175 ASN n 
3 176 THR n 
3 177 HIS n 
3 178 ARG n 
3 179 TYR n 
3 180 ALA n 
3 181 ASP n 
3 182 TYR n 
3 183 GLY n 
3 184 HIS n 
3 185 PHE n 
3 186 LYS n 
3 187 LEU n 
3 188 THR n 
3 189 PRO n 
3 190 GLU n 
3 191 SER n 
3 192 ASP n 
3 193 GLU n 
3 194 TYR n 
3 195 ARG n 
3 196 LEU n 
3 197 PHE n 
3 198 TYR n 
3 199 SER n 
3 200 MET n 
3 201 TYR n 
3 202 LEU n 
3 203 ASP n 
3 204 GLY n 
3 205 ASP n 
3 206 ALA n 
3 207 GLY n 
3 208 ASN n 
3 209 ALA n 
3 210 PHE n 
3 211 ASP n 
3 212 GLY n 
3 213 PHE n 
3 214 ASP n 
3 215 PHE n 
3 216 GLY n 
3 217 ASP n 
3 218 ASP n 
3 219 PRO n 
3 220 GLN n 
3 221 ASP n 
3 222 LYS n 
3 223 PHE n 
3 224 TYR n 
3 225 THR n 
3 226 THR n 
3 227 HIS n 
3 228 LEU n 
3 229 GLY n 
3 230 MET n 
3 231 LEU n 
3 232 PHE n 
3 233 SER n 
3 234 THR n 
3 235 PRO n 
3 236 GLU n 
3 237 ARG n 
3 238 ASP n 
3 239 ASN n 
3 240 ASP n 
3 241 LYS n 
3 242 TYR n 
3 243 GLU n 
3 244 GLY n 
3 245 SER n 
3 246 CYS n 
3 247 ALA n 
3 248 GLU n 
3 249 GLN n 
3 250 ASP n 
3 251 GLY n 
3 252 SER n 
3 253 GLY n 
3 254 TRP n 
3 255 TRP n 
3 256 MET n 
3 257 ASN n 
3 258 ARG n 
3 259 CYS n 
3 260 HIS n 
3 261 ALA n 
3 262 GLY n 
3 263 HIS n 
3 264 LEU n 
3 265 ASN n 
3 266 GLY n 
3 267 LYS n 
3 268 TYR n 
3 269 TYR n 
3 270 PHE n 
3 271 GLY n 
3 272 GLY n 
3 273 ASN n 
3 274 TYR n 
3 275 ARG n 
3 276 LYS n 
3 277 THR n 
3 278 ASP n 
3 279 VAL n 
3 280 GLU n 
3 281 PHE n 
3 282 PRO n 
3 283 TYR n 
3 284 ASP n 
3 285 ASP n 
3 286 GLY n 
3 287 ILE n 
3 288 ILE n 
3 289 TRP n 
3 290 ALA n 
3 291 THR n 
3 292 TRP n 
3 293 HIS n 
3 294 ASP n 
3 295 ARG n 
3 296 TRP n 
3 297 TYR n 
3 298 SER n 
3 299 LEU n 
3 300 LYS n 
3 301 MET n 
3 302 THR n 
3 303 THR n 
3 304 MET n 
3 305 LYS n 
3 306 LEU n 
3 307 LEU n 
3 308 PRO n 
3 309 MET n 
3 310 GLY n 
3 311 ARG n 
3 312 ASP n 
3 313 LEU n 
3 314 SER n 
3 315 GLY n 
3 316 HIS n 
3 317 GLY n 
3 318 GLY n 
3 319 GLN n 
3 320 GLN n 
3 321 GLN n 
3 322 SER n 
3 323 LYS n 
4 1   GLY n 
4 2   HIS n 
4 3   ARG n 
4 4   PRO n 
4 5   NH2 n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 'sea lamprey' 'Petromyzon marinus' 7757 Petromyzon ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? 'sea lamprey' 'Petromyzon marinus' 7757 Petromyzon ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? 'sea lamprey' 'Petromyzon marinus' 7757 Petromyzon ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 1 UNP FIB1_PETMA P02674 87  
;AVSDTSGQTLNEHNELEVRYSEVLRELERRIIHLQRRINMQLQQLTLLQHNIKTQVSQILRVEVDIDVALRTCKGSCARY
LEYRLDKEKNLQLEKAASYIANLKFERFEEVVVEETLNR
;
? 
2 2 UNP FIBB_PETMA P02678 119 
;SSTHVNAQKEIENRYKEVKIRIESTVAGSLRSMKSVLEHLRAKMQRMEEAIKTQKELCSAPCTVNCRVPVVSGMHCEDIY
RNGGRTSEAYYIQPDLFSEPYKVFCDMESHGGGWTVVQNRVDGSSNFARDWNTYKAEFGNIAFGNGKSICNIPGEYWLGT
KTVHQLTKQHTQQVLFDMSDWEGSSVYAQYASFRPENEAQGYRLWVEDYSGNAGNALLEGATQLMGDNRTMTIHNGMQFS
TFDRDNDNWNPGDPTKHCSREDAGGWWYNRCHAANPNGRYYWGGIYTKEQADYGTDDGVVWMNWKGSWYSMRQMAMKLRP
KWP
;
? 
3 3 UNP FIBG_PETMA P04115 103 
;DSGQKTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRSCQDTTANKISPITGKDCQQVV
DNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQHRHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTG
QQAYRLRIDLTDWENTHRYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPERDND
KYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDRWYSLKMTTMKLLPMGRDLSGHGGQQ
QSK
;
? 
4 4 PDB 1LWU       1LWU   ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1LWU A 1 ? 119 ? P02674 87  ? 205 ? 82  200 
2  1 1LWU D 1 ? 119 ? P02674 87  ? 205 ? 82  200 
3  1 1LWU G 1 ? 119 ? P02674 87  ? 205 ? 82  200 
4  1 1LWU J 1 ? 119 ? P02674 87  ? 205 ? 82  200 
5  2 1LWU B 1 ? 323 ? P02678 119 ? 441 ? 157 479 
6  2 1LWU E 1 ? 323 ? P02678 119 ? 441 ? 157 479 
7  2 1LWU H 1 ? 323 ? P02678 119 ? 441 ? 157 479 
8  2 1LWU K 1 ? 323 ? P02678 119 ? 441 ? 157 479 
9  3 1LWU C 1 ? 323 ? P04115 103 ? 425 ? 79  401 
10 3 1LWU F 1 ? 323 ? P04115 103 ? 425 ? 79  401 
11 3 1LWU I 1 ? 323 ? P04115 103 ? 425 ? 79  401 
12 3 1LWU L 1 ? 323 ? P04115 103 ? 425 ? 79  401 
13 4 1LWU M 1 ? 5   ? 1LWU   1   ? 5   ? 1   5   
14 4 1LWU N 1 ? 5   ? 1LWU   1   ? 5   ? 1   5   
15 4 1LWU O 1 ? 5   ? 1LWU   1   ? 5   ? 1   5   
16 4 1LWU P 1 ? 5   ? 1LWU   1   ? 5   ? 1   5   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  1LWU ALA A 72 ? UNP P02674 THR 158 'SEE REMARK 999' 153 1 
2  1LWU ALA D 72 ? UNP P02674 THR 158 'SEE REMARK 999' 153 2 
3  1LWU ALA G 72 ? UNP P02674 THR 158 'SEE REMARK 999' 153 3 
4  1LWU ALA J 72 ? UNP P02674 THR 158 'SEE REMARK 999' 153 4 
9  1LWU PRO C 59 ? UNP P04115 SER 161 ENGINEERED       137 5 
10 1LWU PRO F 59 ? UNP P04115 SER 161 ENGINEERED       137 6 
11 1LWU PRO I 59 ? UNP P04115 SER 161 ENGINEERED       137 7 
12 1LWU PRO L 59 ? UNP P04115 SER 161 ENGINEERED       137 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                   ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                  ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                           ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                      ? 'C6 H12 O6'      180.156 
CA  non-polymer                   . 'CALCIUM ION'                             ? 'Ca 2'           40.078  
CYS 'L-peptide linking'           y CYSTEINE                                  ? 'C3 H7 N O2 S'   121.158 
GAL 'D-saccharide, beta linking'  . beta-D-galactopyranose                    ? 'C6 H12 O6'      180.156 
GLN 'L-peptide linking'           y GLUTAMINE                                 ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                           ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                   ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                 ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'           y ISOLEUCINE                                ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                   ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                    ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                     ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                                ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose  ? 'C8 H15 N O6'    221.208 
NDG 'D-saccharide, alpha linking' . 2-acetamido-2-deoxy-alpha-D-glucopyranose ? 'C8 H15 N O6'    221.208 
NH2 non-polymer                   . 'AMINO GROUP'                             ? 'H2 N'           16.023  
PHE 'L-peptide linking'           y PHENYLALANINE                             ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                   ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                    ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                 ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                  ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                    ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1LWU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   50.47 
_exptl_crystal.density_Matthews      2.48 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.75 
_exptl_crystal_grow.pdbx_details    'PEG 3350, MES buffer, pH 6.75, 10 mM CaCl2, VAPOR DIFFUSION, SITTING DROP at 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'BRANDEIS - B4' 
_diffrn_detector.pdbx_collection_date   1998-08-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1000 
# 
_reflns.entry_id                     1LWU 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.80 
_reflns.d_resolution_low             20.0 
_reflns.number_all                   74102 
_reflns.number_obs                   74102 
_reflns.percent_possible_obs         88.3 
_reflns.pdbx_Rmerge_I_obs            0.078 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.87 
_reflns_shell.percent_possible_all   58.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1LWU 
_refine.ls_d_res_high                            2.80 
_refine.ls_d_res_low                             20.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     73940 
_refine.ls_number_reflns_obs                     73940 
_refine.ls_number_reflns_R_free                  3737 
_refine.ls_percent_reflns_obs                    87.9 
_refine.ls_R_factor_all                          0.251 
_refine.ls_R_factor_obs                          0.251 
_refine.ls_R_factor_R_work                       0.245 
_refine.ls_R_factor_R_free                       0.287 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 5.05 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        23934 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         426 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               24360 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.38  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1LWU 
_struct.title                     
'Crystal structure of fragment D from lamprey fibrinogen complexed with the peptide Gly-His-Arg-Pro-amide' 
_struct.pdbx_descriptor           'Fibrinogen alpha-1, beta, gamma chains/GHRP peptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LWU 
_struct_keywords.pdbx_keywords   'BLOOD CLOTTING' 
_struct_keywords.text            'heterotrimer, protein-peptide complex, BLOOD CLOTTING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 1  ? 
E  N N 2  ? 
F  N N 3  ? 
G  N N 1  ? 
H  N N 2  ? 
I  N N 3  ? 
J  N N 1  ? 
K  N N 2  ? 
L  N N 3  ? 
M  N N 4  ? 
N  N N 4  ? 
O  N N 4  ? 
P  N N 4  ? 
Q  N N 5  ? 
R  N N 6  ? 
S  N N 7  ? 
T  N N 8  ? 
U  N N 9  ? 
V  N N 9  ? 
W  N N 7  ? 
X  N N 8  ? 
Y  N N 6  ? 
Z  N N 9  ? 
AA N N 10 ? 
BA N N 10 ? 
CA N N 8  ? 
DA N N 9  ? 
EA N N 9  ? 
FA N N 7  ? 
GA N N 8  ? 
HA N N 6  ? 
IA N N 6  ? 
JA N N 7  ? 
KA N N 10 ? 
LA N N 7  ? 
MA N N 9  ? 
NA N N 11 ? 
OA N N 8  ? 
PA N N 9  ? 
QA N N 9  ? 
RA N N 8  ? 
SA N N 7  ? 
TA N N 6  ? 
UA N N 8  ? 
VA N N 7  ? 
WA N N 8  ? 
XA N N 12 ? 
YA N N 6  ? 
ZA N N 12 ? 
AB N N 6  ? 
BB N N 7  ? 
CB N N 12 ? 
DB N N 6  ? 
EB N N 12 ? 
FB N N 7  ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLU A 17  ? ARG A 25  ? GLU A 98  ARG A 106 1 ? 9  
HELX_P HELX_P2   2   LEU A 27  ? CYS A 73  ? LEU A 108 CYS A 154 1 ? 47 
HELX_P HELX_P3   3   LYS A 74  ? SER A 76  ? LYS A 155 SER A 157 5 ? 3  
HELX_P HELX_P4   4   GLU A 88  ? ILE A 100 ? GLU A 169 ILE A 181 1 ? 13 
HELX_P HELX_P5   5   ALA A 101 ? PHE A 105 ? ALA A 182 PHE A 186 5 ? 5  
HELX_P HELX_P6   6   ALA B 7   ? TYR B 15  ? ALA B 163 TYR B 171 1 ? 9  
HELX_P HELX_P7   7   TYR B 15  ? SER B 24  ? TYR B 171 SER B 180 1 ? 10 
HELX_P HELX_P8   8   VAL B 26  ? SER B 35  ? VAL B 182 SER B 191 1 ? 10 
HELX_P HELX_P9   9   SER B 35  ? LEU B 57  ? SER B 191 LEU B 213 1 ? 23 
HELX_P HELX_P10  10  HIS B 75  ? ASN B 82  ? HIS B 231 ASN B 238 1 ? 8  
HELX_P HELX_P11  11  GLU B 108 ? GLY B 112 ? GLU B 264 GLY B 268 5 ? 5  
HELX_P HELX_P12  12  ASP B 130 ? ALA B 136 ? ASP B 286 ALA B 292 1 ? 7  
HELX_P HELX_P13  13  GLY B 159 ? HIS B 170 ? GLY B 315 HIS B 326 1 ? 12 
HELX_P HELX_P14  14  ASN B 197 ? GLY B 201 ? ASN B 353 GLY B 357 5 ? 5  
HELX_P HELX_P15  15  ASN B 215 ? GLY B 220 ? ASN B 371 GLY B 376 1 ? 6  
HELX_P HELX_P16  16  GLY B 226 ? MET B 231 ? GLY B 382 MET B 387 1 ? 6  
HELX_P HELX_P17  17  MET B 302 ? GLY B 306 ? MET B 458 GLY B 462 1 ? 5  
HELX_P HELX_P18  18  LYS C 5   ? CYS C 56  ? LYS C 83  CYS C 134 1 ? 52 
HELX_P HELX_P19  19  THR C 63  ? LYS C 67  ? THR C 141 LYS C 145 1 ? 5  
HELX_P HELX_P20  20  ASP C 75  ? ASP C 81  ? ASP C 153 ASP C 159 1 ? 7  
HELX_P HELX_P21  21  ASP C 129 ? GLY C 136 ? ASP C 207 GLY C 214 1 ? 8  
HELX_P HELX_P22  22  GLY C 151 ? GLY C 160 ? GLY C 229 GLY C 238 1 ? 10 
HELX_P HELX_P23  23  PRO C 189 ? GLU C 193 ? PRO C 267 GLU C 271 5 ? 5  
HELX_P HELX_P24  24  GLN C 220 ? THR C 225 ? GLN C 298 THR C 303 1 ? 6  
HELX_P HELX_P25  25  SER C 245 ? GLY C 251 ? SER C 323 GLY C 329 1 ? 7  
HELX_P HELX_P26  26  THR C 291 ? HIS C 293 ? THR C 369 HIS C 371 5 ? 3  
HELX_P HELX_P27  27  GLU D 17  ? ARG D 25  ? GLU D 98  ARG D 106 1 ? 9  
HELX_P HELX_P28  28  LEU D 27  ? ARG D 71  ? LEU D 108 ARG D 152 1 ? 45 
HELX_P HELX_P29  29  ALA D 72  ? SER D 76  ? ALA D 153 SER D 157 5 ? 5  
HELX_P HELX_P30  30  GLU D 88  ? ILE D 100 ? GLU D 169 ILE D 181 1 ? 13 
HELX_P HELX_P31  31  ARG D 107 ? VAL D 111 ? ARG D 188 VAL D 192 5 ? 5  
HELX_P HELX_P32  32  ALA E 7   ? TYR E 15  ? ALA E 163 TYR E 171 1 ? 9  
HELX_P HELX_P33  33  TYR E 15  ? SER E 24  ? TYR E 171 SER E 180 1 ? 10 
HELX_P HELX_P34  34  VAL E 26  ? LEU E 57  ? VAL E 182 LEU E 213 1 ? 32 
HELX_P HELX_P35  35  HIS E 75  ? ASN E 82  ? HIS E 231 ASN E 238 1 ? 8  
HELX_P HELX_P36  36  GLU E 108 ? GLY E 112 ? GLU E 264 GLY E 268 5 ? 5  
HELX_P HELX_P37  37  ASP E 130 ? ALA E 136 ? ASP E 286 ALA E 292 1 ? 7  
HELX_P HELX_P38  38  GLY E 159 ? HIS E 170 ? GLY E 315 HIS E 326 1 ? 12 
HELX_P HELX_P39  39  ASN E 197 ? GLY E 201 ? ASN E 353 GLY E 357 5 ? 5  
HELX_P HELX_P40  40  ASN E 215 ? GLY E 220 ? ASN E 371 GLY E 376 1 ? 6  
HELX_P HELX_P41  41  MET E 225 ? MET E 231 ? MET E 381 MET E 387 1 ? 7  
HELX_P HELX_P42  42  MET E 302 ? GLY E 306 ? MET E 458 GLY E 462 1 ? 5  
HELX_P HELX_P43  43  LYS F 5   ? CYS F 56  ? LYS F 83  CYS F 134 1 ? 52 
HELX_P HELX_P44  44  THR F 63  ? LYS F 67  ? THR F 141 LYS F 145 1 ? 5  
HELX_P HELX_P45  45  ASP F 75  ? ASP F 81  ? ASP F 153 ASP F 159 1 ? 7  
HELX_P HELX_P46  46  ASP F 129 ? GLY F 136 ? ASP F 207 GLY F 214 1 ? 8  
HELX_P HELX_P47  47  GLY F 151 ? GLY F 160 ? GLY F 229 GLY F 238 1 ? 10 
HELX_P HELX_P48  48  PRO F 189 ? GLU F 193 ? PRO F 267 GLU F 271 5 ? 5  
HELX_P HELX_P49  49  GLN F 220 ? THR F 225 ? GLN F 298 THR F 303 1 ? 6  
HELX_P HELX_P50  50  SER F 245 ? GLY F 251 ? SER F 323 GLY F 329 1 ? 7  
HELX_P HELX_P51  51  THR F 291 ? HIS F 293 ? THR F 369 HIS F 371 5 ? 3  
HELX_P HELX_P52  52  GLU G 15  ? ARG G 29  ? GLU G 96  ARG G 110 1 ? 15 
HELX_P HELX_P53  53  ARG G 29  ? GLY G 75  ? ARG G 110 GLY G 156 1 ? 47 
HELX_P HELX_P54  54  GLN G 92  ? ILE G 100 ? GLN G 173 ILE G 181 1 ? 9  
HELX_P HELX_P55  55  LYS H 9   ? ARG H 14  ? LYS H 165 ARG H 170 1 ? 6  
HELX_P HELX_P56  56  ARG H 14  ? GLU H 23  ? ARG H 170 GLU H 179 1 ? 10 
HELX_P HELX_P57  57  GLY H 28  ? CYS H 58  ? GLY H 184 CYS H 214 1 ? 31 
HELX_P HELX_P58  58  HIS H 75  ? ASN H 82  ? HIS H 231 ASN H 238 1 ? 8  
HELX_P HELX_P59  59  GLU H 108 ? GLY H 112 ? GLU H 264 GLY H 268 5 ? 5  
HELX_P HELX_P60  60  ASP H 130 ? ALA H 136 ? ASP H 286 ALA H 292 1 ? 7  
HELX_P HELX_P61  61  GLY H 159 ? HIS H 170 ? GLY H 315 HIS H 326 1 ? 12 
HELX_P HELX_P62  62  ASN H 197 ? GLY H 201 ? ASN H 353 GLY H 357 5 ? 5  
HELX_P HELX_P63  63  ASN H 215 ? GLY H 220 ? ASN H 371 GLY H 376 1 ? 6  
HELX_P HELX_P64  64  MET H 225 ? MET H 231 ? MET H 381 MET H 387 1 ? 7  
HELX_P HELX_P65  65  MET H 302 ? GLY H 306 ? MET H 458 GLY H 462 1 ? 5  
HELX_P HELX_P66  66  GLN I 8   ? HIS I 24  ? GLN I 86  HIS I 102 1 ? 17 
HELX_P HELX_P67  67  ALA I 26  ? CYS I 56  ? ALA I 104 CYS I 134 1 ? 31 
HELX_P HELX_P68  68  THR I 63  ? LYS I 67  ? THR I 141 LYS I 145 1 ? 5  
HELX_P HELX_P69  69  ASP I 75  ? ASP I 81  ? ASP I 153 ASP I 159 1 ? 7  
HELX_P HELX_P70  70  ASP I 129 ? GLY I 136 ? ASP I 207 GLY I 214 1 ? 8  
HELX_P HELX_P71  71  GLY I 151 ? GLY I 160 ? GLY I 229 GLY I 238 1 ? 10 
HELX_P HELX_P72  72  PRO I 189 ? GLU I 193 ? PRO I 267 GLU I 271 5 ? 5  
HELX_P HELX_P73  73  GLN I 220 ? THR I 225 ? GLN I 298 THR I 303 1 ? 6  
HELX_P HELX_P74  74  SER I 245 ? GLY I 251 ? SER I 323 GLY I 329 1 ? 7  
HELX_P HELX_P75  75  THR I 291 ? HIS I 293 ? THR I 369 HIS I 371 5 ? 3  
HELX_P HELX_P76  76  GLU J 15  ? GLU J 26  ? GLU J 96  GLU J 107 1 ? 12 
HELX_P HELX_P77  77  ARG J 29  ? GLY J 75  ? ARG J 110 GLY J 156 1 ? 47 
HELX_P HELX_P78  78  GLN J 92  ? ILE J 100 ? GLN J 173 ILE J 181 1 ? 9  
HELX_P HELX_P79  79  LYS K 9   ? ARG K 14  ? LYS K 165 ARG K 170 1 ? 6  
HELX_P HELX_P80  80  GLU K 17  ? ILE K 22  ? GLU K 173 ILE K 178 1 ? 6  
HELX_P HELX_P81  81  GLY K 28  ? ARG K 46  ? GLY K 184 ARG K 202 1 ? 19 
HELX_P HELX_P82  82  ARG K 46  ? CYS K 58  ? ARG K 202 CYS K 214 1 ? 13 
HELX_P HELX_P83  83  HIS K 75  ? ASN K 82  ? HIS K 231 ASN K 238 1 ? 8  
HELX_P HELX_P84  84  GLU K 108 ? GLY K 112 ? GLU K 264 GLY K 268 5 ? 5  
HELX_P HELX_P85  85  ASP K 130 ? ALA K 136 ? ASP K 286 ALA K 292 1 ? 7  
HELX_P HELX_P86  86  GLY K 159 ? HIS K 170 ? GLY K 315 HIS K 326 1 ? 12 
HELX_P HELX_P87  87  ASN K 197 ? GLY K 201 ? ASN K 353 GLY K 357 5 ? 5  
HELX_P HELX_P88  88  ASN K 215 ? GLY K 220 ? ASN K 371 GLY K 376 1 ? 6  
HELX_P HELX_P89  89  MET K 225 ? MET K 231 ? MET K 381 MET K 387 1 ? 7  
HELX_P HELX_P90  90  MET K 302 ? GLY K 306 ? MET K 458 GLY K 462 1 ? 5  
HELX_P HELX_P91  91  GLN L 8   ? HIS L 24  ? GLN L 86  HIS L 102 1 ? 17 
HELX_P HELX_P92  92  ALA L 26  ? CYS L 56  ? ALA L 104 CYS L 134 1 ? 31 
HELX_P HELX_P93  93  THR L 63  ? LYS L 67  ? THR L 141 LYS L 145 1 ? 5  
HELX_P HELX_P94  94  ASP L 75  ? ASP L 81  ? ASP L 153 ASP L 159 1 ? 7  
HELX_P HELX_P95  95  ASP L 129 ? GLY L 136 ? ASP L 207 GLY L 214 1 ? 8  
HELX_P HELX_P96  96  GLY L 151 ? GLY L 160 ? GLY L 229 GLY L 238 1 ? 10 
HELX_P HELX_P97  97  PRO L 189 ? GLU L 193 ? PRO L 267 GLU L 271 5 ? 5  
HELX_P HELX_P98  98  GLN L 220 ? THR L 225 ? GLN L 298 THR L 303 1 ? 6  
HELX_P HELX_P99  99  SER L 245 ? GLY L 251 ? SER L 323 GLY L 329 1 ? 7  
HELX_P HELX_P100 100 THR L 291 ? HIS L 293 ? THR L 369 HIS L 371 5 ? 3  
HELX_P HELX_P101 101 ASP L 312 ? HIS L 316 ? ASP L 390 HIS L 394 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A  CYS 73  SG  ? ? ? 1_555 C  CYS 56  SG  ? ? A CYS 154 C CYS 134 1_555 ? ? ? ? ? ? ? 2.017 ? ? 
disulf2  disulf ?    ? A  CYS 77  SG  ? ? ? 1_555 B  CYS 58  SG  ? ? A CYS 158 B CYS 214 1_555 ? ? ? ? ? ? ? 2.023 ? ? 
disulf3  disulf ?    ? B  CYS 62  SG  ? ? ? 1_555 C  CYS 60  SG  ? ? B CYS 218 C CYS 138 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf4  disulf ?    ? B  CYS 66  SG  ? ? ? 1_555 B  CYS 150 SG  ? ? B CYS 222 B CYS 306 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf5  disulf ?    ? B  CYS 76  SG  ? ? ? 1_555 B  CYS 105 SG  ? ? B CYS 232 B CYS 261 1_555 ? ? ? ? ? ? ? 2.023 ? ? 
disulf6  disulf ?    ? B  CYS 258 SG  ? ? ? 1_555 B  CYS 271 SG  ? ? B CYS 414 B CYS 427 1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf7  disulf ?    ? C  CYS 76  SG  ? ? ? 1_555 C  CYS 105 SG  ? ? C CYS 154 C CYS 183 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf8  disulf ?    ? C  CYS 246 SG  ? ? ? 1_555 C  CYS 259 SG  ? ? C CYS 324 C CYS 337 1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf9  disulf ?    ? D  CYS 73  SG  ? ? ? 1_555 F  CYS 56  SG  ? ? D CYS 154 F CYS 134 1_555 ? ? ? ? ? ? ? 2.021 ? ? 
disulf10 disulf ?    ? D  CYS 77  SG  ? ? ? 1_555 E  CYS 58  SG  ? ? D CYS 158 E CYS 214 1_555 ? ? ? ? ? ? ? 2.005 ? ? 
disulf11 disulf ?    ? E  CYS 62  SG  ? ? ? 1_555 F  CYS 60  SG  ? ? E CYS 218 F CYS 138 1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf12 disulf ?    ? E  CYS 66  SG  ? ? ? 1_555 E  CYS 150 SG  ? ? E CYS 222 E CYS 306 1_555 ? ? ? ? ? ? ? 2.023 ? ? 
disulf13 disulf ?    ? E  CYS 76  SG  ? ? ? 1_555 E  CYS 105 SG  ? ? E CYS 232 E CYS 261 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf14 disulf ?    ? E  CYS 258 SG  ? ? ? 1_555 E  CYS 271 SG  ? ? E CYS 414 E CYS 427 1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf15 disulf ?    ? F  CYS 76  SG  ? ? ? 1_555 F  CYS 105 SG  ? ? F CYS 154 F CYS 183 1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf16 disulf ?    ? F  CYS 246 SG  ? ? ? 1_555 F  CYS 259 SG  ? ? F CYS 324 F CYS 337 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf17 disulf ?    ? G  CYS 73  SG  ? ? ? 1_555 I  CYS 56  SG  ? ? G CYS 154 I CYS 134 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf18 disulf ?    ? G  CYS 77  SG  ? ? ? 1_555 H  CYS 58  SG  ? ? G CYS 158 H CYS 214 1_555 ? ? ? ? ? ? ? 2.024 ? ? 
disulf19 disulf ?    ? H  CYS 62  SG  ? ? ? 1_555 I  CYS 60  SG  ? ? H CYS 218 I CYS 138 1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf20 disulf ?    ? H  CYS 66  SG  ? ? ? 1_555 H  CYS 150 SG  ? ? H CYS 222 H CYS 306 1_555 ? ? ? ? ? ? ? 2.024 ? ? 
disulf21 disulf ?    ? H  CYS 76  SG  ? ? ? 1_555 H  CYS 105 SG  ? ? H CYS 232 H CYS 261 1_555 ? ? ? ? ? ? ? 2.015 ? ? 
disulf22 disulf ?    ? H  CYS 258 SG  ? ? ? 1_555 H  CYS 271 SG  ? ? H CYS 414 H CYS 427 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf23 disulf ?    ? I  CYS 76  SG  ? ? ? 1_555 I  CYS 105 SG  ? ? I CYS 154 I CYS 183 1_555 ? ? ? ? ? ? ? 2.021 ? ? 
disulf24 disulf ?    ? I  CYS 246 SG  ? ? ? 1_555 I  CYS 259 SG  ? ? I CYS 324 I CYS 337 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf25 disulf ?    ? J  CYS 73  SG  ? ? ? 1_555 L  CYS 56  SG  ? ? J CYS 154 L CYS 134 1_555 ? ? ? ? ? ? ? 2.027 ? ? 
disulf26 disulf ?    ? J  CYS 77  SG  ? ? ? 1_555 K  CYS 58  SG  ? ? J CYS 158 K CYS 214 1_555 ? ? ? ? ? ? ? 2.027 ? ? 
disulf27 disulf ?    ? K  CYS 62  SG  ? ? ? 1_555 L  CYS 60  SG  ? ? K CYS 218 L CYS 138 1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf28 disulf ?    ? K  CYS 66  SG  ? ? ? 1_555 K  CYS 150 SG  ? ? K CYS 222 K CYS 306 1_555 ? ? ? ? ? ? ? 2.022 ? ? 
disulf29 disulf ?    ? K  CYS 76  SG  ? ? ? 1_555 K  CYS 105 SG  ? ? K CYS 232 K CYS 261 1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf30 disulf ?    ? K  CYS 258 SG  ? ? ? 1_555 K  CYS 271 SG  ? ? K CYS 414 K CYS 427 1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf31 disulf ?    ? L  CYS 76  SG  ? ? ? 1_555 L  CYS 105 SG  ? ? L CYS 154 L CYS 183 1_555 ? ? ? ? ? ? ? 2.023 ? ? 
disulf32 disulf ?    ? L  CYS 246 SG  ? ? ? 1_555 L  CYS 259 SG  ? ? L CYS 324 L CYS 337 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale1  covale one  ? C  ASN 125 ND2 ? ? ? 1_555 U  NAG .   C1  ? ? C ASN 203 C NAG 570 1_555 ? ? ? ? ? ? ? 1.205 ? 
N-Glycosylation 
covale2  covale none ? C  ASN 125 ND2 ? ? ? 1_555 U  NAG .   O5  ? ? C ASN 203 C NAG 570 1_555 ? ? ? ? ? ? ? 1.553 ? ? 
covale3  covale one  ? F  ASN 125 ND2 ? ? ? 1_555 DA NAG .   C1  ? ? F ASN 203 F NAG 570 1_555 ? ? ? ? ? ? ? 1.363 ? 
N-Glycosylation 
covale4  covale none ? F  ASN 125 ND2 ? ? ? 1_555 DA NAG .   O5  ? ? F ASN 203 F NAG 570 1_555 ? ? ? ? ? ? ? 1.940 ? ? 
covale5  covale one  ? I  ASN 125 ND2 ? ? ? 1_555 PA NAG .   C1  ? ? I ASN 203 I NAG 570 1_555 ? ? ? ? ? ? ? 1.248 ? 
N-Glycosylation 
covale6  covale none ? I  ASN 125 ND2 ? ? ? 1_555 PA NAG .   O5  ? ? I ASN 203 I NAG 570 1_555 ? ? ? ? ? ? ? 1.994 ? ? 
covale7  covale one  ? L  ASN 125 ND2 ? ? ? 1_555 Q  NAG .   C1  ? ? L ASN 203 Q NAG 1   1_555 ? ? ? ? ? ? ? 1.332 ? 
N-Glycosylation 
covale8  covale none ? L  ASN 125 ND2 ? ? ? 1_555 Q  NAG .   O5  ? ? L ASN 203 Q NAG 1   1_555 ? ? ? ? ? ? ? 1.893 ? ? 
covale9  covale both ? M  PRO 4   C   ? ? ? 1_555 XA NH2 .   N   ? ? M PRO 4   M NH2 6   1_555 ? ? ? ? ? ? ? 1.255 ? ? 
covale10 covale both ? N  PRO 4   C   ? ? ? 1_555 ZA NH2 .   N   ? ? N PRO 4   N NH2 6   1_555 ? ? ? ? ? ? ? 1.256 ? ? 
covale11 covale both ? O  PRO 4   C   ? ? ? 1_555 CB NH2 .   N   ? ? O PRO 4   O NH2 6   1_555 ? ? ? ? ? ? ? 1.252 ? ? 
covale12 covale both ? P  PRO 4   C   ? ? ? 1_555 EB NH2 .   N   ? ? P PRO 4   P NH2 6   1_555 ? ? ? ? ? ? ? 1.248 ? ? 
covale13 covale both ? Q  NAG .   O4  ? ? ? 1_555 Q  NAG .   C1  ? ? Q NAG 1   Q NAG 2   1_555 ? ? ? ? ? ? ? 1.985 ? ? 
metalc1  metalc ?    ? T  CA  .   CA  ? ? ? 1_555 B  ASP 245 OD1 ? ? B CA  1   B ASP 401 1_555 ? ? ? ? ? ? ? 2.966 ? ? 
metalc2  metalc ?    ? T  CA  .   CA  ? ? ? 1_555 B  ASP 245 OD2 ? ? B CA  1   B ASP 401 1_555 ? ? ? ? ? ? ? 2.426 ? ? 
metalc3  metalc ?    ? T  CA  .   CA  ? ? ? 1_555 B  ASP 247 OD1 ? ? B CA  1   B ASP 403 1_555 ? ? ? ? ? ? ? 1.996 ? ? 
metalc4  metalc ?    ? T  CA  .   CA  ? ? ? 1_555 B  TRP 249 O   ? ? B CA  1   B TRP 405 1_555 ? ? ? ? ? ? ? 2.390 ? ? 
metalc5  metalc ?    ? T  CA  .   CA  ? ? ? 1_555 B  LYS 256 O   ? ? B CA  1   B LYS 412 1_555 ? ? ? ? ? ? ? 2.259 ? ? 
metalc6  metalc ?    ? X  CA  .   CA  ? ? ? 1_555 C  ASP 238 OD1 ? ? C CA  5   C ASP 316 1_555 ? ? ? ? ? ? ? 2.273 ? ? 
metalc7  metalc ?    ? X  CA  .   CA  ? ? ? 1_555 C  ASP 238 OD2 ? ? C CA  5   C ASP 316 1_555 ? ? ? ? ? ? ? 2.695 ? ? 
metalc8  metalc ?    ? X  CA  .   CA  ? ? ? 1_555 C  ASP 240 OD1 ? ? C CA  5   C ASP 318 1_555 ? ? ? ? ? ? ? 2.811 ? ? 
metalc9  metalc ?    ? X  CA  .   CA  ? ? ? 1_555 C  TYR 242 O   ? ? C CA  5   C TYR 320 1_555 ? ? ? ? ? ? ? 2.489 ? ? 
metalc10 metalc ?    ? X  CA  .   CA  ? ? ? 1_555 C  GLY 244 O   ? ? C CA  5   C GLY 322 1_555 ? ? ? ? ? ? ? 3.043 ? ? 
metalc11 metalc ?    ? CA CA  .   CA  ? ? ? 1_555 E  ASP 245 OD2 ? ? E CA  2   E ASP 401 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc12 metalc ?    ? CA CA  .   CA  ? ? ? 1_555 E  ASP 245 OD1 ? ? E CA  2   E ASP 401 1_555 ? ? ? ? ? ? ? 2.944 ? ? 
metalc13 metalc ?    ? CA CA  .   CA  ? ? ? 1_555 E  ASP 247 OD1 ? ? E CA  2   E ASP 403 1_555 ? ? ? ? ? ? ? 2.358 ? ? 
metalc14 metalc ?    ? CA CA  .   CA  ? ? ? 1_555 E  TRP 249 O   ? ? E CA  2   E TRP 405 1_555 ? ? ? ? ? ? ? 2.530 ? ? 
metalc15 metalc ?    ? CA CA  .   CA  ? ? ? 1_555 E  LYS 256 O   ? ? E CA  2   E LYS 412 1_555 ? ? ? ? ? ? ? 2.505 ? ? 
metalc16 metalc ?    ? GA CA  .   CA  ? ? ? 1_555 F  ASP 238 OD1 ? ? F CA  6   F ASP 316 1_555 ? ? ? ? ? ? ? 2.216 ? ? 
metalc17 metalc ?    ? GA CA  .   CA  ? ? ? 1_555 F  ASP 238 OD2 ? ? F CA  6   F ASP 316 1_555 ? ? ? ? ? ? ? 2.426 ? ? 
metalc18 metalc ?    ? GA CA  .   CA  ? ? ? 1_555 F  ASP 240 OD1 ? ? F CA  6   F ASP 318 1_555 ? ? ? ? ? ? ? 2.091 ? ? 
metalc19 metalc ?    ? GA CA  .   CA  ? ? ? 1_555 F  TYR 242 O   ? ? F CA  6   F TYR 320 1_555 ? ? ? ? ? ? ? 2.110 ? ? 
metalc20 metalc ?    ? GA CA  .   CA  ? ? ? 1_555 F  GLY 244 O   ? ? F CA  6   F GLY 322 1_555 ? ? ? ? ? ? ? 2.419 ? ? 
metalc21 metalc ?    ? OA CA  .   CA  ? ? ? 1_555 H  ASP 245 OD2 ? ? H CA  3   H ASP 401 1_555 ? ? ? ? ? ? ? 2.396 ? ? 
metalc22 metalc ?    ? OA CA  .   CA  ? ? ? 1_555 H  ASP 245 OD1 ? ? H CA  3   H ASP 401 1_555 ? ? ? ? ? ? ? 3.000 ? ? 
metalc23 metalc ?    ? OA CA  .   CA  ? ? ? 1_555 H  ASP 247 OD1 ? ? H CA  3   H ASP 403 1_555 ? ? ? ? ? ? ? 2.290 ? ? 
metalc24 metalc ?    ? OA CA  .   CA  ? ? ? 1_555 H  TRP 249 O   ? ? H CA  3   H TRP 405 1_555 ? ? ? ? ? ? ? 2.424 ? ? 
metalc25 metalc ?    ? OA CA  .   CA  ? ? ? 1_555 H  LYS 256 O   ? ? H CA  3   H LYS 412 1_555 ? ? ? ? ? ? ? 2.502 ? ? 
metalc26 metalc ?    ? RA CA  .   CA  ? ? ? 1_555 I  ASP 238 OD2 ? ? I CA  7   I ASP 316 1_555 ? ? ? ? ? ? ? 2.517 ? ? 
metalc27 metalc ?    ? RA CA  .   CA  ? ? ? 1_555 I  ASP 238 OD1 ? ? I CA  7   I ASP 316 1_555 ? ? ? ? ? ? ? 2.246 ? ? 
metalc28 metalc ?    ? RA CA  .   CA  ? ? ? 1_555 I  ASP 240 OD1 ? ? I CA  7   I ASP 318 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc29 metalc ?    ? RA CA  .   CA  ? ? ? 1_555 I  TYR 242 O   ? ? I CA  7   I TYR 320 1_555 ? ? ? ? ? ? ? 2.193 ? ? 
metalc30 metalc ?    ? RA CA  .   CA  ? ? ? 1_555 I  GLY 244 O   ? ? I CA  7   I GLY 322 1_555 ? ? ? ? ? ? ? 2.629 ? ? 
metalc31 metalc ?    ? UA CA  .   CA  ? ? ? 1_555 K  ASP 245 OD2 ? ? K CA  4   K ASP 401 1_555 ? ? ? ? ? ? ? 2.405 ? ? 
metalc32 metalc ?    ? UA CA  .   CA  ? ? ? 1_555 K  ASP 245 OD1 ? ? K CA  4   K ASP 401 1_555 ? ? ? ? ? ? ? 3.178 ? ? 
metalc33 metalc ?    ? UA CA  .   CA  ? ? ? 1_555 K  ASP 247 OD1 ? ? K CA  4   K ASP 403 1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc34 metalc ?    ? UA CA  .   CA  ? ? ? 1_555 K  TRP 249 O   ? ? K CA  4   K TRP 405 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc35 metalc ?    ? UA CA  .   CA  ? ? ? 1_555 K  LYS 256 O   ? ? K CA  4   K LYS 412 1_555 ? ? ? ? ? ? ? 2.182 ? ? 
metalc36 metalc ?    ? WA CA  .   CA  ? ? ? 1_555 L  ASP 238 OD1 ? ? L CA  8   L ASP 316 1_555 ? ? ? ? ? ? ? 2.138 ? ? 
metalc37 metalc ?    ? WA CA  .   CA  ? ? ? 1_555 L  ASP 238 OD2 ? ? L CA  8   L ASP 316 1_555 ? ? ? ? ? ? ? 2.702 ? ? 
metalc38 metalc ?    ? WA CA  .   CA  ? ? ? 1_555 L  ASP 240 OD1 ? ? L CA  8   L ASP 318 1_555 ? ? ? ? ? ? ? 2.971 ? ? 
metalc39 metalc ?    ? WA CA  .   CA  ? ? ? 1_555 L  TYR 242 O   ? ? L CA  8   L TYR 320 1_555 ? ? ? ? ? ? ? 2.808 ? ? 
metalc40 metalc ?    ? WA CA  .   CA  ? ? ? 1_555 L  GLY 244 O   ? ? L CA  8   L GLY 322 1_555 ? ? ? ? ? ? ? 3.274 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
1   ? 1  ? 
2   ? 13 ? 
7   ? 1  ? 
12  ? 1  ? 
25  ? 1  ? 
28  ? 1  ? 
29  ? 13 ? 
30  ? 10 ? 
34  ? 1  ? 
40  ? 1  ? 
53  ? 1  ? 
56  ? 1  ? 
57  ? 13 ? 
58  ? 10 ? 
62  ? 1  ? 
68  ? 1  ? 
81  ? 1  ? 
84  ? 1  ? 
85  ? 13 ? 
86  ? 10 ? 
90  ? 1  ? 
96  ? 1  ? 
109 ? 1  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
2  1  2  ? anti-parallel 
2  2  3  ? anti-parallel 
2  3  4  ? anti-parallel 
2  4  5  ? anti-parallel 
2  5  6  ? anti-parallel 
2  6  7  ? anti-parallel 
2  7  8  ? anti-parallel 
2  8  9  ? anti-parallel 
2  9  10 ? anti-parallel 
2  10 11 ? anti-parallel 
2  11 12 ? anti-parallel 
2  12 13 ? anti-parallel 
29 1  2  ? anti-parallel 
29 2  3  ? anti-parallel 
29 3  4  ? anti-parallel 
29 4  5  ? anti-parallel 
29 5  6  ? anti-parallel 
29 6  7  ? anti-parallel 
29 7  8  ? anti-parallel 
29 8  9  ? anti-parallel 
29 9  10 ? anti-parallel 
29 10 11 ? anti-parallel 
29 11 12 ? anti-parallel 
29 12 13 ? anti-parallel 
30 1  2  ? anti-parallel 
30 2  3  ? anti-parallel 
30 3  4  ? anti-parallel 
30 4  5  ? anti-parallel 
30 5  6  ? anti-parallel 
30 6  7  ? anti-parallel 
30 7  8  ? anti-parallel 
30 8  9  ? anti-parallel 
30 9  10 ? anti-parallel 
57 1  2  ? anti-parallel 
57 2  3  ? anti-parallel 
57 3  4  ? anti-parallel 
57 4  5  ? anti-parallel 
57 5  6  ? anti-parallel 
57 6  7  ? anti-parallel 
57 7  8  ? anti-parallel 
57 8  9  ? anti-parallel 
57 9  10 ? anti-parallel 
57 10 11 ? anti-parallel 
57 11 12 ? anti-parallel 
57 12 13 ? anti-parallel 
58 1  2  ? anti-parallel 
58 2  3  ? anti-parallel 
58 3  4  ? anti-parallel 
58 4  5  ? anti-parallel 
58 5  6  ? anti-parallel 
58 6  7  ? anti-parallel 
58 7  8  ? anti-parallel 
58 8  9  ? anti-parallel 
58 9  10 ? anti-parallel 
85 1  2  ? anti-parallel 
85 2  3  ? anti-parallel 
85 3  4  ? anti-parallel 
85 4  5  ? anti-parallel 
85 5  6  ? anti-parallel 
85 6  7  ? anti-parallel 
85 7  8  ? anti-parallel 
85 8  9  ? anti-parallel 
85 9  10 ? anti-parallel 
85 10 11 ? anti-parallel 
85 11 12 ? anti-parallel 
85 12 13 ? anti-parallel 
86 1  2  ? anti-parallel 
86 2  3  ? anti-parallel 
86 3  4  ? anti-parallel 
86 4  5  ? anti-parallel 
86 5  6  ? anti-parallel 
86 6  7  ? anti-parallel 
86 7  8  ? anti-parallel 
86 8  9  ? anti-parallel 
86 9  10 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
1   1  GLN C 61  ? ASP C 62  ? GLN C 139 ASP C 140 
2   1  PHE C 137 ? LEU C 140 ? PHE C 215 LEU C 218 
2   2  PHE C 148 ? TRP C 149 ? PHE C 226 TRP C 227 
2   3  GLY C 112 ? ARG C 119 ? GLY C 190 ARG C 197 
2   4  PHE C 101 ? ILE C 107 ? PHE C 179 ILE C 185 
2   5  GLY C 88  ? ILE C 92  ? GLY C 166 ILE C 170 
2   6  PHE C 101 ? ILE C 107 ? PHE C 179 ILE C 185 
2   7  GLY C 112 ? ARG C 119 ? GLY C 190 ARG C 197 
2   8  MET C 301 ? PRO C 308 ? MET C 379 PRO C 386 
2   9  TYR C 164 ? THR C 171 ? TYR C 242 THR C 249 
2   10 HIS C 177 ? LEU C 187 ? HIS C 255 LEU C 265 
2   11 LEU C 196 ? PHE C 197 ? LEU C 274 PHE C 275 
2   12 HIS C 177 ? LEU C 187 ? HIS C 255 LEU C 265 
2   13 TYR C 201 ? ASP C 203 ? TYR C 279 ASP C 281 
7   1  ILE B 152 ? PRO B 153 ? ILE B 308 PRO B 309 
12  1  VAL B 300 ? TRP B 301 ? VAL B 456 TRP B 457 
25  1  ILE C 288 ? TRP C 289 ? ILE C 366 TRP C 367 
28  1  GLN F 61  ? ASP F 62  ? GLN F 139 ASP F 140 
29  1  PHE F 137 ? LEU F 140 ? PHE F 215 LEU F 218 
29  2  PHE F 148 ? TRP F 149 ? PHE F 226 TRP F 227 
29  3  GLY F 112 ? ARG F 119 ? GLY F 190 ARG F 197 
29  4  PHE F 101 ? ILE F 107 ? PHE F 179 ILE F 185 
29  5  GLY F 88  ? ILE F 92  ? GLY F 166 ILE F 170 
29  6  PHE F 101 ? ILE F 107 ? PHE F 179 ILE F 185 
29  7  GLY F 112 ? ARG F 119 ? GLY F 190 ARG F 197 
29  8  MET F 301 ? PRO F 308 ? MET F 379 PRO F 386 
29  9  TYR F 164 ? THR F 171 ? TYR F 242 THR F 249 
29  10 HIS F 177 ? LEU F 187 ? HIS F 255 LEU F 265 
29  11 LEU F 196 ? PHE F 197 ? LEU F 274 PHE F 275 
29  12 HIS F 177 ? LEU F 187 ? HIS F 255 LEU F 265 
29  13 TYR F 201 ? ASP F 203 ? TYR F 279 ASP F 281 
30  1  TYR E 101 ? ASP E 106 ? TYR E 257 ASP E 262 
30  2  TRP E 114 ? ARG E 120 ? TRP E 270 ARG E 276 
30  3  TYR E 156 ? LEU E 158 ? TYR E 312 LEU E 314 
30  4  GLU E 137 ? GLY E 139 ? GLU E 293 GLY E 295 
30  5  TYR E 156 ? LEU E 158 ? TYR E 312 LEU E 314 
30  6  TRP E 114 ? ARG E 120 ? TRP E 270 ARG E 276 
30  7  GLN E 313 ? ARG E 319 ? GLN E 469 ARG E 475 
30  8  GLN E 172 ? SER E 179 ? GLN E 328 SER E 335 
30  9  SER E 185 ? PRO E 195 ? SER E 341 PRO E 351 
30  10 LEU E 204 ? GLU E 207 ? LEU E 360 GLU E 363 
34  1  ILE E 152 ? PRO E 153 ? ILE E 308 PRO E 309 
40  1  VAL E 300 ? TRP E 301 ? VAL E 456 TRP E 457 
53  1  ILE F 288 ? TRP F 289 ? ILE F 366 TRP F 367 
56  1  GLN I 61  ? ASP I 62  ? GLN I 139 ASP I 140 
57  1  PHE I 137 ? LEU I 140 ? PHE I 215 LEU I 218 
57  2  PHE I 148 ? TRP I 149 ? PHE I 226 TRP I 227 
57  3  GLY I 112 ? ARG I 119 ? GLY I 190 ARG I 197 
57  4  PHE I 101 ? ILE I 107 ? PHE I 179 ILE I 185 
57  5  GLY I 88  ? ILE I 92  ? GLY I 166 ILE I 170 
57  6  PHE I 101 ? ILE I 107 ? PHE I 179 ILE I 185 
57  7  GLY I 112 ? ARG I 119 ? GLY I 190 ARG I 197 
57  8  MET I 301 ? PRO I 308 ? MET I 379 PRO I 386 
57  9  TYR I 164 ? THR I 171 ? TYR I 242 THR I 249 
57  10 HIS I 177 ? LEU I 187 ? HIS I 255 LEU I 265 
57  11 LEU I 196 ? PHE I 197 ? LEU I 274 PHE I 275 
57  12 HIS I 177 ? LEU I 187 ? HIS I 255 LEU I 265 
57  13 TYR I 201 ? ASP I 203 ? TYR I 279 ASP I 281 
58  1  TYR H 101 ? ASP H 106 ? TYR H 257 ASP H 262 
58  2  TRP H 114 ? ARG H 120 ? TRP H 270 ARG H 276 
58  3  TYR H 156 ? LEU H 158 ? TYR H 312 LEU H 314 
58  4  GLU H 137 ? GLY H 139 ? GLU H 293 GLY H 295 
58  5  TYR H 156 ? LEU H 158 ? TYR H 312 LEU H 314 
58  6  TRP H 114 ? ARG H 120 ? TRP H 270 ARG H 276 
58  7  GLN H 313 ? ARG H 319 ? GLN H 469 ARG H 475 
58  8  GLN H 172 ? SER H 179 ? GLN H 328 SER H 335 
58  9  SER H 185 ? PRO H 195 ? SER H 341 PRO H 351 
58  10 LEU H 204 ? GLU H 207 ? LEU H 360 GLU H 363 
62  1  ILE H 152 ? PRO H 153 ? ILE H 308 PRO H 309 
68  1  VAL H 300 ? TRP H 301 ? VAL H 456 TRP H 457 
81  1  ILE I 288 ? TRP I 289 ? ILE I 366 TRP I 367 
84  1  GLN L 61  ? ASP L 62  ? GLN L 139 ASP L 140 
85  1  PHE L 137 ? LEU L 140 ? PHE L 215 LEU L 218 
85  2  PHE L 148 ? TRP L 149 ? PHE L 226 TRP L 227 
85  3  GLY L 112 ? ARG L 119 ? GLY L 190 ARG L 197 
85  4  PHE L 101 ? ILE L 107 ? PHE L 179 ILE L 185 
85  5  GLY L 88  ? ILE L 92  ? GLY L 166 ILE L 170 
85  6  PHE L 101 ? ILE L 107 ? PHE L 179 ILE L 185 
85  7  GLY L 112 ? ARG L 119 ? GLY L 190 ARG L 197 
85  8  MET L 301 ? PRO L 308 ? MET L 379 PRO L 386 
85  9  TYR L 164 ? THR L 171 ? TYR L 242 THR L 249 
85  10 HIS L 177 ? LEU L 187 ? HIS L 255 LEU L 265 
85  11 LEU L 196 ? PHE L 197 ? LEU L 274 PHE L 275 
85  12 HIS L 177 ? LEU L 187 ? HIS L 255 LEU L 265 
85  13 TYR L 201 ? ASP L 203 ? TYR L 279 ASP L 281 
86  1  TYR K 101 ? ASP K 106 ? TYR K 257 ASP K 262 
86  2  TRP K 114 ? ARG K 120 ? TRP K 270 ARG K 276 
86  3  TYR K 156 ? LEU K 158 ? TYR K 312 LEU K 314 
86  4  GLU K 137 ? GLY K 139 ? GLU K 293 GLY K 295 
86  5  TYR K 156 ? LEU K 158 ? TYR K 312 LEU K 314 
86  6  TRP K 114 ? ARG K 120 ? TRP K 270 ARG K 276 
86  7  GLN K 313 ? ARG K 319 ? GLN K 469 ARG K 475 
86  8  GLN K 172 ? SER K 179 ? GLN K 328 SER K 335 
86  9  SER K 185 ? PRO K 195 ? SER K 341 PRO K 351 
86  10 LEU K 204 ? GLU K 207 ? LEU K 360 GLU K 363 
90  1  ILE K 152 ? PRO K 153 ? ILE K 308 PRO K 309 
96  1  VAL K 300 ? TRP K 301 ? VAL K 456 TRP K 457 
109 1  ILE L 288 ? TRP L 289 ? ILE L 366 TRP L 367 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
2  1  2  O PHE C 137 ? O PHE C 215 N TRP C 149 ? N TRP C 227 
2  2  3  N PHE C 148 ? N PHE C 226 O HIS C 118 ? O HIS C 196 
2  3  4  N VAL C 115 ? N VAL C 193 O PHE C 104 ? O PHE C 182 
2  4  5  N CYS C 105 ? N CYS C 183 O GLY C 88  ? O GLY C 166 
2  5  6  N ILE C 92  ? N ILE C 170 O PHE C 101 ? O PHE C 179 
2  6  7  N GLU C 106 ? N GLU C 184 O TRP C 113 ? O TRP C 191 
2  7  8  N ARG C 119 ? N ARG C 197 O THR C 302 ? O THR C 380 
2  8  9  O LEU C 307 ? O LEU C 385 N ARG C 165 ? N ARG C 243 
2  9  10 N LEU C 170 ? N LEU C 248 O ARG C 178 ? O ARG C 256 
2  10 11 N LYS C 186 ? N LYS C 264 O PHE C 197 ? O PHE C 275 
2  11 12 O PHE C 197 ? O PHE C 275 N LYS C 186 ? N LYS C 264 
2  12 13 O ASP C 181 ? O ASP C 259 N LEU C 202 ? N LEU C 280 
29 1  2  O PHE F 137 ? O PHE F 215 N TRP F 149 ? N TRP F 227 
29 2  3  N PHE F 148 ? N PHE F 226 O HIS F 118 ? O HIS F 196 
29 3  4  N VAL F 115 ? N VAL F 193 O PHE F 104 ? O PHE F 182 
29 4  5  N CYS F 105 ? N CYS F 183 O GLY F 88  ? O GLY F 166 
29 5  6  N ILE F 92  ? N ILE F 170 O PHE F 101 ? O PHE F 179 
29 6  7  N GLU F 106 ? N GLU F 184 O TRP F 113 ? O TRP F 191 
29 7  8  N ARG F 119 ? N ARG F 197 O THR F 302 ? O THR F 380 
29 8  9  O LEU F 307 ? O LEU F 385 N ARG F 165 ? N ARG F 243 
29 9  10 N LEU F 170 ? N LEU F 248 O ARG F 178 ? O ARG F 256 
29 10 11 N LYS F 186 ? N LYS F 264 O PHE F 197 ? O PHE F 275 
29 11 12 O PHE F 197 ? O PHE F 275 N LYS F 186 ? N LYS F 264 
29 12 13 O ASP F 181 ? O ASP F 259 N LEU F 202 ? N LEU F 280 
30 1  2  N ASP E 106 ? N ASP E 262 O TRP E 114 ? O TRP E 270 
30 2  3  N ASN E 119 ? N ASN E 275 O TYR E 156 ? O TYR E 312 
30 3  4  N TRP E 157 ? N TRP E 313 O PHE E 138 ? O PHE E 294 
30 4  5  O PHE E 138 ? O PHE E 294 N TRP E 157 ? N TRP E 313 
30 5  6  N LEU E 158 ? N LEU E 314 O VAL E 117 ? O VAL E 273 
30 6  7  N ARG E 120 ? N ARG E 276 O MET E 314 ? O MET E 470 
30 7  8  O ARG E 319 ? O ARG E 475 N GLN E 173 ? N GLN E 329 
30 8  9  N MET E 178 ? N MET E 334 O VAL E 186 ? O VAL E 342 
30 9  10 O ARG E 194 ? O ARG E 350 N TRP E 205 ? N TRP E 361 
57 1  2  O PHE I 137 ? O PHE I 215 N TRP I 149 ? N TRP I 227 
57 2  3  O PHE I 148 ? O PHE I 226 N HIS I 118 ? N HIS I 196 
57 3  4  N VAL I 115 ? N VAL I 193 O PHE I 104 ? O PHE I 182 
57 4  5  N CYS I 105 ? N CYS I 183 O GLY I 88  ? O GLY I 166 
57 5  6  O ILE I 92  ? O ILE I 170 N PHE I 101 ? N PHE I 179 
57 6  7  N GLU I 106 ? N GLU I 184 O TRP I 113 ? O TRP I 191 
57 7  8  N ARG I 119 ? N ARG I 197 O THR I 302 ? O THR I 380 
57 8  9  O LEU I 307 ? O LEU I 385 N ARG I 165 ? N ARG I 243 
57 9  10 N LEU I 170 ? N LEU I 248 O ARG I 178 ? O ARG I 256 
57 10 11 N LYS I 186 ? N LYS I 264 O PHE I 197 ? O PHE I 275 
57 11 12 O PHE I 197 ? O PHE I 275 N LYS I 186 ? N LYS I 264 
57 12 13 O ASP I 181 ? O ASP I 259 N LEU I 202 ? N LEU I 280 
58 1  2  N ASP H 106 ? N ASP H 262 O TRP H 114 ? O TRP H 270 
58 2  3  N ASN H 119 ? N ASN H 275 O TYR H 156 ? O TYR H 312 
58 3  4  N TRP H 157 ? N TRP H 313 O PHE H 138 ? O PHE H 294 
58 4  5  O PHE H 138 ? O PHE H 294 N TRP H 157 ? N TRP H 313 
58 5  6  N LEU H 158 ? N LEU H 314 O VAL H 117 ? O VAL H 273 
58 6  7  N ARG H 120 ? N ARG H 276 O MET H 314 ? O MET H 470 
58 7  8  O ARG H 319 ? O ARG H 475 N GLN H 173 ? N GLN H 329 
58 8  9  N MET H 178 ? N MET H 334 O VAL H 186 ? O VAL H 342 
58 9  10 N ARG H 194 ? N ARG H 350 O TRP H 205 ? O TRP H 361 
85 1  2  O PHE L 137 ? O PHE L 215 N TRP L 149 ? N TRP L 227 
85 2  3  N PHE L 148 ? N PHE L 226 O HIS L 118 ? O HIS L 196 
85 3  4  N VAL L 115 ? N VAL L 193 O PHE L 104 ? O PHE L 182 
85 4  5  N CYS L 105 ? N CYS L 183 O GLY L 88  ? O GLY L 166 
85 5  6  N ILE L 92  ? N ILE L 170 O PHE L 101 ? O PHE L 179 
85 6  7  N GLU L 106 ? N GLU L 184 O TRP L 113 ? O TRP L 191 
85 7  8  N ARG L 119 ? N ARG L 197 O THR L 302 ? O THR L 380 
85 8  9  O LEU L 307 ? O LEU L 385 N ARG L 165 ? N ARG L 243 
85 9  10 N LEU L 170 ? N LEU L 248 O ARG L 178 ? O ARG L 256 
85 10 11 N LYS L 186 ? N LYS L 264 O PHE L 197 ? O PHE L 275 
85 11 12 O PHE L 197 ? O PHE L 275 N LYS L 186 ? N LYS L 264 
85 12 13 O ASP L 181 ? O ASP L 259 N LEU L 202 ? N LEU L 280 
86 1  2  N ASP K 106 ? N ASP K 262 O TRP K 114 ? O TRP K 270 
86 2  3  N ASN K 119 ? N ASN K 275 O TYR K 156 ? O TYR K 312 
86 3  4  N TRP K 157 ? N TRP K 313 O PHE K 138 ? O PHE K 294 
86 4  5  O PHE K 138 ? O PHE K 294 N TRP K 157 ? N TRP K 313 
86 5  6  N LEU K 158 ? N LEU K 314 O VAL K 117 ? O VAL K 273 
86 6  7  N ARG K 120 ? N ARG K 276 O MET K 314 ? O MET K 470 
86 7  8  O ARG K 319 ? O ARG K 475 N GLN K 173 ? N GLN K 329 
86 8  9  N MET K 178 ? N MET K 334 O VAL K 186 ? O VAL K 342 
86 9  10 O ARG K 194 ? O ARG K 350 N TRP K 205 ? N TRP K 361 
# 
_database_PDB_matrix.entry_id          1LWU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LWU 
_atom_sites.fract_transf_matrix[1][1]   0.013032 
_atom_sites.fract_transf_matrix[1][2]   -0.000872 
_atom_sites.fract_transf_matrix[1][3]   0.001680 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021032 
_atom_sites.fract_transf_matrix[2][3]   -0.000620 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004122 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . ASN A  1  14  ? 35.113  8.123   152.490  1.00 141.21 ? 95  ASN A N   1 
ATOM   2     C  CA  . ASN A  1  14  ? 34.356  8.293   153.761  1.00 138.60 ? 95  ASN A CA  1 
ATOM   3     C  C   . ASN A  1  14  ? 34.823  9.528   154.520  1.00 140.70 ? 95  ASN A C   1 
ATOM   4     O  O   . ASN A  1  14  ? 34.452  9.735   155.677  1.00 139.15 ? 95  ASN A O   1 
ATOM   5     C  CB  . ASN A  1  14  ? 34.515  7.049   154.647  1.00 135.16 ? 95  ASN A CB  1 
ATOM   6     C  CG  . ASN A  1  14  ? 35.967  6.728   154.966  1.00 127.59 ? 95  ASN A CG  1 
ATOM   7     O  OD1 . ASN A  1  14  ? 36.705  7.565   155.490  1.00 114.20 ? 95  ASN A OD1 1 
ATOM   8     N  ND2 . ASN A  1  14  ? 36.379  5.501   154.658  1.00 123.13 ? 95  ASN A ND2 1 
ATOM   9     N  N   . GLU A  1  15  ? 35.641  10.345  153.862  1.00 141.20 ? 96  GLU A N   1 
ATOM   10    C  CA  . GLU A  1  15  ? 36.157  11.561  154.474  1.00 141.58 ? 96  GLU A CA  1 
ATOM   11    C  C   . GLU A  1  15  ? 35.089  12.220  155.337  1.00 142.06 ? 96  GLU A C   1 
ATOM   12    O  O   . GLU A  1  15  ? 35.345  12.594  156.484  1.00 141.96 ? 96  GLU A O   1 
ATOM   13    C  CB  . GLU A  1  15  ? 36.618  12.546  153.394  1.00 140.29 ? 96  GLU A CB  1 
ATOM   14    C  CG  . GLU A  1  15  ? 37.861  12.109  152.649  1.00 143.31 ? 96  GLU A CG  1 
ATOM   15    C  CD  . GLU A  1  15  ? 39.060  11.977  153.565  1.00 146.11 ? 96  GLU A CD  1 
ATOM   16    O  OE1 . GLU A  1  15  ? 39.448  12.992  154.183  1.00 146.94 ? 96  GLU A OE1 1 
ATOM   17    O  OE2 . GLU A  1  15  ? 39.611  10.861  153.671  1.00 146.36 ? 96  GLU A OE2 1 
ATOM   18    N  N   . LEU A  1  16  ? 33.883  12.334  154.786  1.00 140.59 ? 97  LEU A N   1 
ATOM   19    C  CA  . LEU A  1  16  ? 32.786  12.970  155.497  1.00 136.21 ? 97  LEU A CA  1 
ATOM   20    C  C   . LEU A  1  16  ? 31.590  12.069  155.769  1.00 135.26 ? 97  LEU A C   1 
ATOM   21    O  O   . LEU A  1  16  ? 30.486  12.557  155.995  1.00 136.83 ? 97  LEU A O   1 
ATOM   22    C  CB  . LEU A  1  16  ? 32.319  14.204  154.729  1.00 133.69 ? 97  LEU A CB  1 
ATOM   23    C  CG  . LEU A  1  16  ? 31.480  15.209  155.514  1.00 131.19 ? 97  LEU A CG  1 
ATOM   24    C  CD1 . LEU A  1  16  ? 32.315  15.859  156.615  1.00 127.16 ? 97  LEU A CD1 1 
ATOM   25    C  CD2 . LEU A  1  16  ? 30.975  16.247  154.561  1.00 127.99 ? 97  LEU A CD2 1 
ATOM   26    N  N   . GLU A  1  17  ? 31.790  10.759  155.729  1.00 134.51 ? 98  GLU A N   1 
ATOM   27    C  CA  . GLU A  1  17  ? 30.692  9.850   156.027  1.00 136.66 ? 98  GLU A CA  1 
ATOM   28    C  C   . GLU A  1  17  ? 31.009  9.287   157.402  1.00 136.19 ? 98  GLU A C   1 
ATOM   29    O  O   . GLU A  1  17  ? 30.112  8.944   158.173  1.00 134.72 ? 98  GLU A O   1 
ATOM   30    C  CB  . GLU A  1  17  ? 30.605  8.723   154.991  1.00 138.46 ? 98  GLU A CB  1 
ATOM   31    C  CG  . GLU A  1  17  ? 31.386  7.446   155.310  1.00 138.22 ? 98  GLU A CG  1 
ATOM   32    C  CD  . GLU A  1  17  ? 30.725  6.573   156.375  1.00 135.21 ? 98  GLU A CD  1 
ATOM   33    O  OE1 . GLU A  1  17  ? 31.024  6.745   157.575  1.00 132.82 ? 98  GLU A OE1 1 
ATOM   34    O  OE2 . GLU A  1  17  ? 29.900  5.711   156.010  1.00 138.63 ? 98  GLU A OE2 1 
ATOM   35    N  N   . VAL A  1  18  ? 32.306  9.206   157.693  1.00 137.49 ? 99  VAL A N   1 
ATOM   36    C  CA  . VAL A  1  18  ? 32.809  8.694   158.964  1.00 140.32 ? 99  VAL A CA  1 
ATOM   37    C  C   . VAL A  1  18  ? 32.177  9.413   160.150  1.00 138.72 ? 99  VAL A C   1 
ATOM   38    O  O   . VAL A  1  18  ? 31.447  8.809   160.943  1.00 138.41 ? 99  VAL A O   1 
ATOM   39    C  CB  . VAL A  1  18  ? 34.346  8.861   159.059  1.00 141.92 ? 99  VAL A CB  1 
ATOM   40    C  CG1 . VAL A  1  18  ? 34.837  8.440   160.441  1.00 142.01 ? 99  VAL A CG1 1 
ATOM   41    C  CG2 . VAL A  1  18  ? 35.024  8.030   157.981  1.00 145.20 ? 99  VAL A CG2 1 
ATOM   42    N  N   . ARG A  1  19  ? 32.471  10.704  160.266  1.00 135.02 ? 100 ARG A N   1 
ATOM   43    C  CA  . ARG A  1  19  ? 31.942  11.524  161.348  1.00 126.78 ? 100 ARG A CA  1 
ATOM   44    C  C   . ARG A  1  19  ? 30.430  11.340  161.451  1.00 125.15 ? 100 ARG A C   1 
ATOM   45    O  O   . ARG A  1  19  ? 29.932  10.793  162.432  1.00 129.20 ? 100 ARG A O   1 
ATOM   46    C  CB  . ARG A  1  19  ? 32.255  12.994  161.090  1.00 124.48 ? 100 ARG A CB  1 
ATOM   47    C  CG  . ARG A  1  19  ? 33.625  13.256  160.501  1.00 114.79 ? 100 ARG A CG  1 
ATOM   48    C  CD  . ARG A  1  19  ? 33.780  14.731  160.230  1.00 117.20 ? 100 ARG A CD  1 
ATOM   49    N  NE  . ARG A  1  19  ? 34.941  15.026  159.404  1.00 119.72 ? 100 ARG A NE  1 
ATOM   50    C  CZ  . ARG A  1  19  ? 35.312  16.255  159.064  1.00 120.19 ? 100 ARG A CZ  1 
ATOM   51    N  NH1 . ARG A  1  19  ? 34.606  17.297  159.484  1.00 120.33 ? 100 ARG A NH1 1 
ATOM   52    N  NH2 . ARG A  1  19  ? 36.384  16.442  158.307  1.00 115.75 ? 100 ARG A NH2 1 
ATOM   53    N  N   . TYR A  1  20  ? 29.707  11.794  160.429  1.00 119.65 ? 101 TYR A N   1 
ATOM   54    C  CA  . TYR A  1  20  ? 28.253  11.683  160.399  1.00 114.43 ? 101 TYR A CA  1 
ATOM   55    C  C   . TYR A  1  20  ? 27.724  10.365  160.953  1.00 116.12 ? 101 TYR A C   1 
ATOM   56    O  O   . TYR A  1  20  ? 27.168  10.325  162.050  1.00 119.43 ? 101 TYR A O   1 
ATOM   57    C  CB  . TYR A  1  20  ? 27.730  11.839  158.977  1.00 105.58 ? 101 TYR A CB  1 
ATOM   58    C  CG  . TYR A  1  20  ? 26.229  11.671  158.876  1.00 105.89 ? 101 TYR A CG  1 
ATOM   59    C  CD1 . TYR A  1  20  ? 25.364  12.703  159.261  1.00 105.60 ? 101 TYR A CD1 1 
ATOM   60    C  CD2 . TYR A  1  20  ? 25.666  10.482  158.398  1.00 102.30 ? 101 TYR A CD2 1 
ATOM   61    C  CE1 . TYR A  1  20  ? 23.976  12.560  159.169  1.00 100.92 ? 101 TYR A CE1 1 
ATOM   62    C  CE2 . TYR A  1  20  ? 24.277  10.326  158.303  1.00 99.74  ? 101 TYR A CE2 1 
ATOM   63    C  CZ  . TYR A  1  20  ? 23.442  11.372  158.689  1.00 101.98 ? 101 TYR A CZ  1 
ATOM   64    O  OH  . TYR A  1  20  ? 22.076  11.241  158.594  1.00 104.20 ? 101 TYR A OH  1 
ATOM   65    N  N   . SER A  1  21  ? 27.890  9.289   160.188  1.00 117.70 ? 102 SER A N   1 
ATOM   66    C  CA  . SER A  1  21  ? 27.402  7.978   160.603  1.00 120.52 ? 102 SER A CA  1 
ATOM   67    C  C   . SER A  1  21  ? 27.782  7.553   162.019  1.00 123.54 ? 102 SER A C   1 
ATOM   68    O  O   . SER A  1  21  ? 27.023  6.833   162.667  1.00 127.95 ? 102 SER A O   1 
ATOM   69    C  CB  . SER A  1  21  ? 27.837  6.903   159.605  1.00 116.29 ? 102 SER A CB  1 
ATOM   70    O  OG  . SER A  1  21  ? 27.030  6.946   158.441  1.00 109.32 ? 102 SER A OG  1 
ATOM   71    N  N   . GLU A  1  22  ? 28.940  7.982   162.511  1.00 122.95 ? 103 GLU A N   1 
ATOM   72    C  CA  . GLU A  1  22  ? 29.323  7.607   163.866  1.00 124.82 ? 103 GLU A CA  1 
ATOM   73    C  C   . GLU A  1  22  ? 28.683  8.554   164.879  1.00 125.20 ? 103 GLU A C   1 
ATOM   74    O  O   . GLU A  1  22  ? 28.476  8.186   166.038  1.00 129.35 ? 103 GLU A O   1 
ATOM   75    C  CB  . GLU A  1  22  ? 30.841  7.603   164.037  1.00 128.93 ? 103 GLU A CB  1 
ATOM   76    C  CG  . GLU A  1  22  ? 31.475  8.965   164.110  1.00 135.79 ? 103 GLU A CG  1 
ATOM   77    C  CD  . GLU A  1  22  ? 32.877  8.892   164.659  1.00 143.35 ? 103 GLU A CD  1 
ATOM   78    O  OE1 . GLU A  1  22  ? 33.026  8.579   165.862  1.00 149.73 ? 103 GLU A OE1 1 
ATOM   79    O  OE2 . GLU A  1  22  ? 33.827  9.137   163.886  1.00 146.28 ? 103 GLU A OE2 1 
ATOM   80    N  N   . VAL A  1  23  ? 28.380  9.777   164.447  1.00 118.98 ? 104 VAL A N   1 
ATOM   81    C  CA  . VAL A  1  23  ? 27.719  10.738  165.322  1.00 114.29 ? 104 VAL A CA  1 
ATOM   82    C  C   . VAL A  1  23  ? 26.284  10.244  165.424  1.00 114.59 ? 104 VAL A C   1 
ATOM   83    O  O   . VAL A  1  23  ? 25.567  10.571  166.369  1.00 118.92 ? 104 VAL A O   1 
ATOM   84    C  CB  . VAL A  1  23  ? 27.720  12.168  164.731  1.00 110.82 ? 104 VAL A CB  1 
ATOM   85    C  CG1 . VAL A  1  23  ? 26.763  13.061  165.512  1.00 103.35 ? 104 VAL A CG1 1 
ATOM   86    C  CG2 . VAL A  1  23  ? 29.125  12.751  164.785  1.00 113.85 ? 104 VAL A CG2 1 
ATOM   87    N  N   . LEU A  1  24  ? 25.885  9.437   164.440  1.00 111.67 ? 105 LEU A N   1 
ATOM   88    C  CA  . LEU A  1  24  ? 24.545  8.865   164.393  1.00 107.59 ? 105 LEU A CA  1 
ATOM   89    C  C   . LEU A  1  24  ? 24.485  7.662   165.327  1.00 109.17 ? 105 LEU A C   1 
ATOM   90    O  O   . LEU A  1  24  ? 23.489  7.462   166.015  1.00 113.60 ? 105 LEU A O   1 
ATOM   91    C  CB  . LEU A  1  24  ? 24.193  8.436   162.969  1.00 99.47  ? 105 LEU A CB  1 
ATOM   92    C  CG  . LEU A  1  24  ? 22.731  8.651   162.569  1.00 98.66  ? 105 LEU A CG  1 
ATOM   93    C  CD1 . LEU A  1  24  ? 22.434  10.144  162.553  1.00 87.49  ? 105 LEU A CD1 1 
ATOM   94    C  CD2 . LEU A  1  24  ? 22.462  8.052   161.200  1.00 93.82  ? 105 LEU A CD2 1 
ATOM   95    N  N   . ARG A  1  25  ? 25.549  6.862   165.348  1.00 109.30 ? 106 ARG A N   1 
ATOM   96    C  CA  . ARG A  1  25  ? 25.608  5.703   166.237  1.00 114.10 ? 106 ARG A CA  1 
ATOM   97    C  C   . ARG A  1  25  ? 26.127  6.190   167.586  1.00 112.61 ? 106 ARG A C   1 
ATOM   98    O  O   . ARG A  1  25  ? 26.605  5.411   168.414  1.00 107.27 ? 106 ARG A O   1 
ATOM   99    C  CB  . ARG A  1  25  ? 26.540  4.624   165.679  1.00 124.27 ? 106 ARG A CB  1 
ATOM   100   C  CG  . ARG A  1  25  ? 28.003  5.028   165.586  1.00 135.88 ? 106 ARG A CG  1 
ATOM   101   C  CD  . ARG A  1  25  ? 28.875  3.836   165.206  1.00 145.97 ? 106 ARG A CD  1 
ATOM   102   N  NE  . ARG A  1  25  ? 28.410  3.164   163.993  1.00 156.56 ? 106 ARG A NE  1 
ATOM   103   C  CZ  . ARG A  1  25  ? 28.410  3.711   162.780  1.00 159.53 ? 106 ARG A CZ  1 
ATOM   104   N  NH1 . ARG A  1  25  ? 28.855  4.947   162.608  1.00 164.20 ? 106 ARG A NH1 1 
ATOM   105   N  NH2 . ARG A  1  25  ? 27.967  3.022   161.735  1.00 157.44 ? 106 ARG A NH2 1 
ATOM   106   N  N   . GLU A  1  26  ? 26.040  7.502   167.776  1.00 111.43 ? 107 GLU A N   1 
ATOM   107   C  CA  . GLU A  1  26  ? 26.459  8.155   169.004  1.00 108.93 ? 107 GLU A CA  1 
ATOM   108   C  C   . GLU A  1  26  ? 25.214  8.775   169.627  1.00 109.54 ? 107 GLU A C   1 
ATOM   109   O  O   . GLU A  1  26  ? 25.241  9.275   170.752  1.00 114.08 ? 107 GLU A O   1 
ATOM   110   C  CB  . GLU A  1  26  ? 27.504  9.232   168.710  1.00 106.37 ? 107 GLU A CB  1 
ATOM   111   C  CG  . GLU A  1  26  ? 27.874  10.078  169.915  1.00 104.74 ? 107 GLU A CG  1 
ATOM   112   C  CD  . GLU A  1  26  ? 28.352  9.267   171.104  1.00 104.59 ? 107 GLU A CD  1 
ATOM   113   O  OE1 . GLU A  1  26  ? 28.498  9.860   172.196  1.00 102.48 ? 107 GLU A OE1 1 
ATOM   114   O  OE2 . GLU A  1  26  ? 28.585  8.048   170.946  1.00 99.19  ? 107 GLU A OE2 1 
ATOM   115   N  N   . LEU A  1  27  ? 24.121  8.752   168.873  1.00 105.70 ? 108 LEU A N   1 
ATOM   116   C  CA  . LEU A  1  27  ? 22.855  9.264   169.368  1.00 103.35 ? 108 LEU A CA  1 
ATOM   117   C  C   . LEU A  1  27  ? 22.217  8.103   170.108  1.00 107.99 ? 108 LEU A C   1 
ATOM   118   O  O   . LEU A  1  27  ? 21.721  8.260   171.223  1.00 115.76 ? 108 LEU A O   1 
ATOM   119   C  CB  . LEU A  1  27  ? 21.938  9.694   168.222  1.00 93.67  ? 108 LEU A CB  1 
ATOM   120   C  CG  . LEU A  1  27  ? 21.680  11.192  168.070  1.00 91.19  ? 108 LEU A CG  1 
ATOM   121   C  CD1 . LEU A  1  27  ? 20.420  11.397  167.244  1.00 82.09  ? 108 LEU A CD1 1 
ATOM   122   C  CD2 . LEU A  1  27  ? 21.511  11.834  169.436  1.00 84.48  ? 108 LEU A CD2 1 
ATOM   123   N  N   . GLU A  1  28  ? 22.242  6.932   169.478  1.00 108.17 ? 109 GLU A N   1 
ATOM   124   C  CA  . GLU A  1  28  ? 21.678  5.731   170.077  1.00 108.52 ? 109 GLU A CA  1 
ATOM   125   C  C   . GLU A  1  28  ? 22.433  5.364   171.343  1.00 107.23 ? 109 GLU A C   1 
ATOM   126   O  O   . GLU A  1  28  ? 21.838  4.953   172.333  1.00 104.80 ? 109 GLU A O   1 
ATOM   127   C  CB  . GLU A  1  28  ? 21.739  4.570   169.095  1.00 106.25 ? 109 GLU A CB  1 
ATOM   128   C  CG  . GLU A  1  28  ? 20.841  4.744   167.903  1.00 103.07 ? 109 GLU A CG  1 
ATOM   129   C  CD  . GLU A  1  28  ? 20.896  3.551   166.990  1.00 111.43 ? 109 GLU A CD  1 
ATOM   130   O  OE1 . GLU A  1  28  ? 20.180  3.553   165.968  1.00 118.01 ? 109 GLU A OE1 1 
ATOM   131   O  OE2 . GLU A  1  28  ? 21.660  2.608   167.300  1.00 112.83 ? 109 GLU A OE2 1 
ATOM   132   N  N   . ARG A  1  29  ? 23.751  5.512   171.314  1.00 107.69 ? 110 ARG A N   1 
ATOM   133   C  CA  . ARG A  1  29  ? 24.541  5.203   172.494  1.00 110.93 ? 110 ARG A CA  1 
ATOM   134   C  C   . ARG A  1  29  ? 24.161  6.192   173.593  1.00 107.70 ? 110 ARG A C   1 
ATOM   135   O  O   . ARG A  1  29  ? 24.559  6.043   174.750  1.00 104.58 ? 110 ARG A O   1 
ATOM   136   C  CB  . ARG A  1  29  ? 26.041  5.293   172.173  1.00 119.92 ? 110 ARG A CB  1 
ATOM   137   C  CG  . ARG A  1  29  ? 26.805  6.424   172.856  1.00 120.12 ? 110 ARG A CG  1 
ATOM   138   C  CD  . ARG A  1  29  ? 28.219  5.971   173.156  1.00 124.00 ? 110 ARG A CD  1 
ATOM   139   N  NE  . ARG A  1  29  ? 28.198  4.791   174.017  1.00 134.94 ? 110 ARG A NE  1 
ATOM   140   C  CZ  . ARG A  1  29  ? 29.268  4.073   174.340  1.00 138.75 ? 110 ARG A CZ  1 
ATOM   141   N  NH1 . ARG A  1  29  ? 30.461  4.414   173.871  1.00 144.54 ? 110 ARG A NH1 1 
ATOM   142   N  NH2 . ARG A  1  29  ? 29.143  3.012   175.133  1.00 129.82 ? 110 ARG A NH2 1 
ATOM   143   N  N   . ARG A  1  30  ? 23.383  7.204   173.214  1.00 101.68 ? 111 ARG A N   1 
ATOM   144   C  CA  . ARG A  1  30  ? 22.933  8.226   174.146  1.00 95.44  ? 111 ARG A CA  1 
ATOM   145   C  C   . ARG A  1  30  ? 21.433  8.094   174.427  1.00 93.43  ? 111 ARG A C   1 
ATOM   146   O  O   . ARG A  1  30  ? 20.951  8.479   175.494  1.00 95.46  ? 111 ARG A O   1 
ATOM   147   C  CB  . ARG A  1  30  ? 23.246  9.621   173.595  1.00 90.60  ? 111 ARG A CB  1 
ATOM   148   C  CG  . ARG A  1  30  ? 22.847  10.734  174.549  1.00 94.96  ? 111 ARG A CG  1 
ATOM   149   C  CD  . ARG A  1  30  ? 23.357  12.098  174.127  1.00 85.58  ? 111 ARG A CD  1 
ATOM   150   N  NE  . ARG A  1  30  ? 24.814  12.150  174.077  1.00 88.80  ? 111 ARG A NE  1 
ATOM   151   C  CZ  . ARG A  1  30  ? 25.518  13.277  174.054  1.00 83.73  ? 111 ARG A CZ  1 
ATOM   152   N  NH1 . ARG A  1  30  ? 24.894  14.448  174.084  1.00 78.93  ? 111 ARG A NH1 1 
ATOM   153   N  NH2 . ARG A  1  30  ? 26.843  13.232  173.989  1.00 71.40  ? 111 ARG A NH2 1 
ATOM   154   N  N   . ILE A  1  31  ? 20.700  7.545   173.465  1.00 87.09  ? 112 ILE A N   1 
ATOM   155   C  CA  . ILE A  1  31  ? 19.269  7.355   173.618  1.00 81.80  ? 112 ILE A CA  1 
ATOM   156   C  C   . ILE A  1  31  ? 18.983  5.997   174.228  1.00 79.26  ? 112 ILE A C   1 
ATOM   157   O  O   . ILE A  1  31  ? 18.114  5.869   175.084  1.00 84.05  ? 112 ILE A O   1 
ATOM   158   C  CB  . ILE A  1  31  ? 18.540  7.474   172.261  1.00 84.32  ? 112 ILE A CB  1 
ATOM   159   C  CG1 . ILE A  1  31  ? 18.446  8.955   171.865  1.00 82.48  ? 112 ILE A CG1 1 
ATOM   160   C  CG2 . ILE A  1  31  ? 17.152  6.821   172.337  1.00 82.88  ? 112 ILE A CG2 1 
ATOM   161   C  CD1 . ILE A  1  31  ? 17.631  9.220   170.604  1.00 72.64  ? 112 ILE A CD1 1 
ATOM   162   N  N   . ILE A  1  32  ? 19.721  4.984   173.792  1.00 81.18  ? 113 ILE A N   1 
ATOM   163   C  CA  . ILE A  1  32  ? 19.531  3.639   174.320  1.00 84.75  ? 113 ILE A CA  1 
ATOM   164   C  C   . ILE A  1  32  ? 19.900  3.618   175.799  1.00 88.42  ? 113 ILE A C   1 
ATOM   165   O  O   . ILE A  1  32  ? 19.576  2.673   176.516  1.00 94.93  ? 113 ILE A O   1 
ATOM   166   C  CB  . ILE A  1  32  ? 20.399  2.596   173.576  1.00 90.10  ? 113 ILE A CB  1 
ATOM   167   C  CG1 . ILE A  1  32  ? 19.875  1.186   173.867  1.00 76.38  ? 113 ILE A CG1 1 
ATOM   168   C  CG2 . ILE A  1  32  ? 21.862  2.708   174.025  1.00 98.22  ? 113 ILE A CG2 1 
ATOM   169   C  CD1 . ILE A  1  32  ? 20.541  0.103   173.055  1.00 73.48  ? 113 ILE A CD1 1 
ATOM   170   N  N   . HIS A  1  33  ? 20.597  4.651   176.257  1.00 86.91  ? 114 HIS A N   1 
ATOM   171   C  CA  . HIS A  1  33  ? 20.940  4.707   177.665  1.00 85.49  ? 114 HIS A CA  1 
ATOM   172   C  C   . HIS A  1  33  ? 19.725  5.276   178.372  1.00 89.26  ? 114 HIS A C   1 
ATOM   173   O  O   . HIS A  1  33  ? 19.342  4.795   179.441  1.00 96.76  ? 114 HIS A O   1 
ATOM   174   C  CB  . HIS A  1  33  ? 22.141  5.605   177.929  1.00 86.79  ? 114 HIS A CB  1 
ATOM   175   C  CG  . HIS A  1  33  ? 22.607  5.556   179.350  1.00 94.52  ? 114 HIS A CG  1 
ATOM   176   N  ND1 . HIS A  1  33  ? 23.253  4.459   179.881  1.00 92.38  ? 114 HIS A ND1 1 
ATOM   177   C  CD2 . HIS A  1  33  ? 22.450  6.432   180.371  1.00 93.79  ? 114 HIS A CD2 1 
ATOM   178   C  CE1 . HIS A  1  33  ? 23.471  4.661   181.169  1.00 94.37  ? 114 HIS A CE1 1 
ATOM   179   N  NE2 . HIS A  1  33  ? 22.993  5.850   181.492  1.00 100.02 ? 114 HIS A NE2 1 
ATOM   180   N  N   . LEU A  1  34  ? 19.119  6.302   177.772  1.00 86.68  ? 115 LEU A N   1 
ATOM   181   C  CA  . LEU A  1  34  ? 17.921  6.913   178.343  1.00 83.36  ? 115 LEU A CA  1 
ATOM   182   C  C   . LEU A  1  34  ? 16.952  5.787   178.692  1.00 83.93  ? 115 LEU A C   1 
ATOM   183   O  O   . LEU A  1  34  ? 16.101  5.934   179.566  1.00 78.38  ? 115 LEU A O   1 
ATOM   184   C  CB  . LEU A  1  34  ? 17.267  7.873   177.345  1.00 69.30  ? 115 LEU A CB  1 
ATOM   185   C  CG  . LEU A  1  34  ? 17.467  9.366   177.601  1.00 67.74  ? 115 LEU A CG  1 
ATOM   186   C  CD1 . LEU A  1  34  ? 16.845  10.163  176.487  1.00 70.14  ? 115 LEU A CD1 1 
ATOM   187   C  CD2 . LEU A  1  34  ? 16.840  9.758   178.917  1.00 74.40  ? 115 LEU A CD2 1 
ATOM   188   N  N   . GLN A  1  35  ? 17.105  4.664   177.997  1.00 83.16  ? 116 GLN A N   1 
ATOM   189   C  CA  . GLN A  1  35  ? 16.288  3.484   178.224  1.00 93.24  ? 116 GLN A CA  1 
ATOM   190   C  C   . GLN A  1  35  ? 16.736  2.803   179.513  1.00 97.35  ? 116 GLN A C   1 
ATOM   191   O  O   . GLN A  1  35  ? 15.930  2.598   180.420  1.00 105.82 ? 116 GLN A O   1 
ATOM   192   C  CB  . GLN A  1  35  ? 16.435  2.500   177.061  1.00 104.54 ? 116 GLN A CB  1 
ATOM   193   C  CG  . GLN A  1  35  ? 16.053  3.062   175.703  1.00 115.06 ? 116 GLN A CG  1 
ATOM   194   C  CD  . GLN A  1  35  ? 14.579  3.382   175.600  1.00 124.24 ? 116 GLN A CD  1 
ATOM   195   O  OE1 . GLN A  1  35  ? 14.034  4.121   176.420  1.00 130.75 ? 116 GLN A OE1 1 
ATOM   196   N  NE2 . GLN A  1  35  ? 13.924  2.830   174.585  1.00 125.38 ? 116 GLN A NE2 1 
ATOM   197   N  N   . ARG A  1  36  ? 18.020  2.452   179.593  1.00 97.06  ? 117 ARG A N   1 
ATOM   198   C  CA  . ARG A  1  36  ? 18.555  1.791   180.785  1.00 94.52  ? 117 ARG A CA  1 
ATOM   199   C  C   . ARG A  1  36  ? 18.261  2.656   182.007  1.00 86.70  ? 117 ARG A C   1 
ATOM   200   O  O   . ARG A  1  36  ? 18.173  2.158   183.129  1.00 92.30  ? 117 ARG A O   1 
ATOM   201   C  CB  . ARG A  1  36  ? 20.068  1.559   180.648  1.00 101.99 ? 117 ARG A CB  1 
ATOM   202   C  CG  . ARG A  1  36  ? 20.607  0.417   181.518  1.00 106.11 ? 117 ARG A CG  1 
ATOM   203   C  CD  . ARG A  1  36  ? 21.312  0.903   182.784  1.00 112.40 ? 117 ARG A CD  1 
ATOM   204   N  NE  . ARG A  1  36  ? 22.719  1.232   182.546  1.00 117.91 ? 117 ARG A NE  1 
ATOM   205   C  CZ  . ARG A  1  36  ? 23.579  1.607   183.493  1.00 118.15 ? 117 ARG A CZ  1 
ATOM   206   N  NH1 . ARG A  1  36  ? 23.183  1.710   184.756  1.00 114.58 ? 117 ARG A NH1 1 
ATOM   207   N  NH2 . ARG A  1  36  ? 24.842  1.871   183.180  1.00 112.89 ? 117 ARG A NH2 1 
ATOM   208   N  N   . ARG A  1  37  ? 18.100  3.954   181.771  1.00 80.56  ? 118 ARG A N   1 
ATOM   209   C  CA  . ARG A  1  37  ? 17.792  4.910   182.828  1.00 77.37  ? 118 ARG A CA  1 
ATOM   210   C  C   . ARG A  1  37  ? 16.309  4.846   183.191  1.00 75.99  ? 118 ARG A C   1 
ATOM   211   O  O   . ARG A  1  37  ? 15.938  4.844   184.370  1.00 82.94  ? 118 ARG A O   1 
ATOM   212   C  CB  . ARG A  1  37  ? 18.152  6.320   182.372  1.00 70.89  ? 118 ARG A CB  1 
ATOM   213   C  CG  . ARG A  1  37  ? 17.375  7.391   183.088  1.00 84.91  ? 118 ARG A CG  1 
ATOM   214   C  CD  . ARG A  1  37  ? 18.184  8.642   183.153  1.00 85.20  ? 118 ARG A CD  1 
ATOM   215   N  NE  . ARG A  1  37  ? 19.443  8.357   183.816  1.00 88.60  ? 118 ARG A NE  1 
ATOM   216   C  CZ  . ARG A  1  37  ? 20.431  9.229   183.939  1.00 98.10  ? 118 ARG A CZ  1 
ATOM   217   N  NH1 . ARG A  1  37  ? 20.308  10.453  183.439  1.00 99.75  ? 118 ARG A NH1 1 
ATOM   218   N  NH2 . ARG A  1  37  ? 21.543  8.874   184.564  1.00 110.84 ? 118 ARG A NH2 1 
ATOM   219   N  N   . ILE A  1  38  ? 15.466  4.812   182.167  1.00 72.41  ? 119 ILE A N   1 
ATOM   220   C  CA  . ILE A  1  38  ? 14.030  4.724   182.364  1.00 70.01  ? 119 ILE A CA  1 
ATOM   221   C  C   . ILE A  1  38  ? 13.731  3.424   183.082  1.00 67.07  ? 119 ILE A C   1 
ATOM   222   O  O   . ILE A  1  38  ? 12.888  3.388   183.972  1.00 63.13  ? 119 ILE A O   1 
ATOM   223   C  CB  . ILE A  1  38  ? 13.272  4.732   181.024  1.00 75.61  ? 119 ILE A CB  1 
ATOM   224   C  CG1 . ILE A  1  38  ? 13.473  6.079   180.323  1.00 76.14  ? 119 ILE A CG1 1 
ATOM   225   C  CG2 . ILE A  1  38  ? 11.803  4.432   181.258  1.00 75.17  ? 119 ILE A CG2 1 
ATOM   226   C  CD1 . ILE A  1  38  ? 13.290  7.272   181.225  1.00 85.59  ? 119 ILE A CD1 1 
ATOM   227   N  N   . ASN A  1  39  ? 14.420  2.356   182.692  1.00 66.43  ? 120 ASN A N   1 
ATOM   228   C  CA  . ASN A  1  39  ? 14.218  1.075   183.347  1.00 74.48  ? 120 ASN A CA  1 
ATOM   229   C  C   . ASN A  1  39  ? 14.491  1.222   184.831  1.00 79.07  ? 120 ASN A C   1 
ATOM   230   O  O   . ASN A  1  39  ? 13.674  0.820   185.659  1.00 82.20  ? 120 ASN A O   1 
ATOM   231   C  CB  . ASN A  1  39  ? 15.132  0.009   182.767  1.00 78.86  ? 120 ASN A CB  1 
ATOM   232   C  CG  . ASN A  1  39  ? 14.740  -0.377  181.366  1.00 91.40  ? 120 ASN A CG  1 
ATOM   233   O  OD1 . ASN A  1  39  ? 13.553  -0.432  181.036  1.00 82.82  ? 120 ASN A OD1 1 
ATOM   234   N  ND2 . ASN A  1  39  ? 15.735  -0.659  180.527  1.00 101.84 ? 120 ASN A ND2 1 
ATOM   235   N  N   . MET A  1  40  ? 15.636  1.795   185.175  1.00 77.02  ? 121 MET A N   1 
ATOM   236   C  CA  . MET A  1  40  ? 15.938  1.989   186.576  1.00 86.52  ? 121 MET A CA  1 
ATOM   237   C  C   . MET A  1  40  ? 14.818  2.796   187.235  1.00 85.44  ? 121 MET A C   1 
ATOM   238   O  O   . MET A  1  40  ? 14.356  2.463   188.333  1.00 82.56  ? 121 MET A O   1 
ATOM   239   C  CB  . MET A  1  40  ? 17.263  2.723   186.735  1.00 96.39  ? 121 MET A CB  1 
ATOM   240   C  CG  . MET A  1  40  ? 18.474  1.856   186.507  1.00 105.42 ? 121 MET A CG  1 
ATOM   241   S  SD  . MET A  1  40  ? 19.942  2.699   187.110  1.00 132.82 ? 121 MET A SD  1 
ATOM   242   C  CE  . MET A  1  40  ? 19.659  2.638   188.919  1.00 121.22 ? 121 MET A CE  1 
ATOM   243   N  N   . GLN A  1  41  ? 14.376  3.851   186.553  1.00 75.53  ? 122 GLN A N   1 
ATOM   244   C  CA  . GLN A  1  41  ? 13.320  4.704   187.083  1.00 72.02  ? 122 GLN A CA  1 
ATOM   245   C  C   . GLN A  1  41  ? 12.021  3.958   187.368  1.00 64.30  ? 122 GLN A C   1 
ATOM   246   O  O   . GLN A  1  41  ? 11.259  4.337   188.254  1.00 62.88  ? 122 GLN A O   1 
ATOM   247   C  CB  . GLN A  1  41  ? 13.059  5.872   186.130  1.00 69.43  ? 122 GLN A CB  1 
ATOM   248   C  CG  . GLN A  1  41  ? 14.215  6.848   186.051  1.00 75.67  ? 122 GLN A CG  1 
ATOM   249   C  CD  . GLN A  1  41  ? 13.837  8.151   185.370  1.00 86.82  ? 122 GLN A CD  1 
ATOM   250   O  OE1 . GLN A  1  41  ? 14.587  9.130   185.409  1.00 90.98  ? 122 GLN A OE1 1 
ATOM   251   N  NE2 . GLN A  1  41  ? 12.669  8.170   184.740  1.00 88.55  ? 122 GLN A NE2 1 
ATOM   252   N  N   . LEU A  1  42  ? 11.764  2.896   186.620  1.00 65.33  ? 123 LEU A N   1 
ATOM   253   C  CA  . LEU A  1  42  ? 10.550  2.125   186.839  1.00 66.90  ? 123 LEU A CA  1 
ATOM   254   C  C   . LEU A  1  42  ? 10.835  1.014   187.839  1.00 74.18  ? 123 LEU A C   1 
ATOM   255   O  O   . LEU A  1  42  ? 9.928   0.308   188.267  1.00 76.89  ? 123 LEU A O   1 
ATOM   256   C  CB  . LEU A  1  42  ? 10.033  1.552   185.521  1.00 48.78  ? 123 LEU A CB  1 
ATOM   257   C  CG  . LEU A  1  42  ? 9.744   2.610   184.448  1.00 54.08  ? 123 LEU A CG  1 
ATOM   258   C  CD1 . LEU A  1  42  ? 9.198   1.942   183.205  1.00 39.21  ? 123 LEU A CD1 1 
ATOM   259   C  CD2 . LEU A  1  42  ? 8.760   3.638   184.960  1.00 43.85  ? 123 LEU A CD2 1 
ATOM   260   N  N   . GLN A  1  43  ? 12.106  0.862   188.205  1.00 80.03  ? 124 GLN A N   1 
ATOM   261   C  CA  . GLN A  1  43  ? 12.501  -0.138  189.189  1.00 80.56  ? 124 GLN A CA  1 
ATOM   262   C  C   . GLN A  1  43  ? 12.112  0.478   190.523  1.00 78.68  ? 124 GLN A C   1 
ATOM   263   O  O   . GLN A  1  43  ? 11.465  -0.150  191.361  1.00 72.48  ? 124 GLN A O   1 
ATOM   264   C  CB  . GLN A  1  43  ? 14.017  -0.347  189.180  1.00 91.73  ? 124 GLN A CB  1 
ATOM   265   C  CG  . GLN A  1  43  ? 14.596  -0.921  187.900  1.00 109.05 ? 124 GLN A CG  1 
ATOM   266   C  CD  . GLN A  1  43  ? 14.368  -2.415  187.771  1.00 118.15 ? 124 GLN A CD  1 
ATOM   267   O  OE1 . GLN A  1  43  ? 14.820  -3.200  188.609  1.00 122.67 ? 124 GLN A OE1 1 
ATOM   268   N  NE2 . GLN A  1  43  ? 13.667  -2.817  186.717  1.00 120.45 ? 124 GLN A NE2 1 
ATOM   269   N  N   . GLN A  1  44  ? 12.520  1.730   190.690  1.00 75.24  ? 125 GLN A N   1 
ATOM   270   C  CA  . GLN A  1  44  ? 12.264  2.481   191.903  1.00 89.75  ? 125 GLN A CA  1 
ATOM   271   C  C   . GLN A  1  44  ? 10.802  2.876   192.023  1.00 88.17  ? 125 GLN A C   1 
ATOM   272   O  O   . GLN A  1  44  ? 10.222  2.825   193.112  1.00 84.98  ? 125 GLN A O   1 
ATOM   273   C  CB  . GLN A  1  44  ? 13.161  3.722   191.928  1.00 99.46  ? 125 GLN A CB  1 
ATOM   274   C  CG  . GLN A  1  44  ? 14.643  3.377   192.014  1.00 117.44 ? 125 GLN A CG  1 
ATOM   275   C  CD  . GLN A  1  44  ? 15.541  4.482   191.488  1.00 130.86 ? 125 GLN A CD  1 
ATOM   276   O  OE1 . GLN A  1  44  ? 15.505  5.618   191.970  1.00 133.51 ? 125 GLN A OE1 1 
ATOM   277   N  NE2 . GLN A  1  44  ? 16.358  4.150   190.489  1.00 132.83 ? 125 GLN A NE2 1 
ATOM   278   N  N   . LEU A  1  45  ? 10.205  3.265   190.902  1.00 86.64  ? 126 LEU A N   1 
ATOM   279   C  CA  . LEU A  1  45  ? 8.806   3.664   190.901  1.00 78.80  ? 126 LEU A CA  1 
ATOM   280   C  C   . LEU A  1  45  ? 7.880   2.526   191.302  1.00 78.01  ? 126 LEU A C   1 
ATOM   281   O  O   . LEU A  1  45  ? 6.862   2.754   191.955  1.00 80.59  ? 126 LEU A O   1 
ATOM   282   C  CB  . LEU A  1  45  ? 8.425   4.206   189.530  1.00 69.45  ? 126 LEU A CB  1 
ATOM   283   C  CG  . LEU A  1  45  ? 8.893   5.649   189.368  1.00 63.49  ? 126 LEU A CG  1 
ATOM   284   C  CD1 . LEU A  1  45  ? 8.695   6.121   187.947  1.00 65.60  ? 126 LEU A CD1 1 
ATOM   285   C  CD2 . LEU A  1  45  ? 8.112   6.519   190.340  1.00 68.90  ? 126 LEU A CD2 1 
ATOM   286   N  N   . THR A  1  46  ? 8.241   1.304   190.916  1.00 73.87  ? 127 THR A N   1 
ATOM   287   C  CA  . THR A  1  46  ? 7.445   0.126   191.249  1.00 74.42  ? 127 THR A CA  1 
ATOM   288   C  C   . THR A  1  46  ? 7.507   -0.157  192.743  1.00 76.78  ? 127 THR A C   1 
ATOM   289   O  O   . THR A  1  46  ? 6.491   -0.429  193.385  1.00 75.54  ? 127 THR A O   1 
ATOM   290   C  CB  . THR A  1  46  ? 7.952   -1.104  190.501  1.00 71.29  ? 127 THR A CB  1 
ATOM   291   O  OG1 . THR A  1  46  ? 7.840   -0.878  189.091  1.00 74.79  ? 127 THR A OG1 1 
ATOM   292   C  CG2 . THR A  1  46  ? 7.138   -2.321  190.883  1.00 58.85  ? 127 THR A CG2 1 
ATOM   293   N  N   . LEU A  1  47  ? 8.720   -0.099  193.279  1.00 83.38  ? 128 LEU A N   1 
ATOM   294   C  CA  . LEU A  1  47  ? 8.975   -0.318  194.695  1.00 79.90  ? 128 LEU A CA  1 
ATOM   295   C  C   . LEU A  1  47  ? 8.366   0.840   195.498  1.00 72.79  ? 128 LEU A C   1 
ATOM   296   O  O   . LEU A  1  47  ? 7.789   0.634   196.561  1.00 74.19  ? 128 LEU A O   1 
ATOM   297   C  CB  . LEU A  1  47  ? 10.498  -0.418  194.922  1.00 79.65  ? 128 LEU A CB  1 
ATOM   298   C  CG  . LEU A  1  47  ? 11.166  -0.351  196.308  1.00 85.53  ? 128 LEU A CG  1 
ATOM   299   C  CD1 . LEU A  1  47  ? 11.115  1.082   196.838  1.00 84.76  ? 128 LEU A CD1 1 
ATOM   300   C  CD2 . LEU A  1  47  ? 10.502  -1.327  197.284  1.00 79.66  ? 128 LEU A CD2 1 
ATOM   301   N  N   . LEU A  1  48  ? 8.485   2.054   194.977  1.00 67.77  ? 129 LEU A N   1 
ATOM   302   C  CA  . LEU A  1  48  ? 7.949   3.233   195.652  1.00 72.30  ? 129 LEU A CA  1 
ATOM   303   C  C   . LEU A  1  48  ? 6.424   3.185   195.639  1.00 70.92  ? 129 LEU A C   1 
ATOM   304   O  O   . LEU A  1  48  ? 5.752   3.884   196.395  1.00 71.03  ? 129 LEU A O   1 
ATOM   305   C  CB  . LEU A  1  48  ? 8.439   4.500   194.942  1.00 68.03  ? 129 LEU A CB  1 
ATOM   306   C  CG  . LEU A  1  48  ? 8.264   5.840   195.647  1.00 60.54  ? 129 LEU A CG  1 
ATOM   307   C  CD1 . LEU A  1  48  ? 8.939   5.796   197.004  1.00 70.91  ? 129 LEU A CD1 1 
ATOM   308   C  CD2 . LEU A  1  48  ? 8.874   6.938   194.791  1.00 69.57  ? 129 LEU A CD2 1 
ATOM   309   N  N   . GLN A  1  49  ? 5.887   2.350   194.762  1.00 70.14  ? 130 GLN A N   1 
ATOM   310   C  CA  . GLN A  1  49  ? 4.448   2.192   194.627  1.00 70.86  ? 130 GLN A CA  1 
ATOM   311   C  C   . GLN A  1  49  ? 3.942   1.240   195.689  1.00 70.45  ? 130 GLN A C   1 
ATOM   312   O  O   . GLN A  1  49  ? 2.895   1.454   196.296  1.00 68.82  ? 130 GLN A O   1 
ATOM   313   C  CB  . GLN A  1  49  ? 4.126   1.628   193.251  1.00 78.26  ? 130 GLN A CB  1 
ATOM   314   C  CG  . GLN A  1  49  ? 2.688   1.211   193.058  1.00 75.75  ? 130 GLN A CG  1 
ATOM   315   C  CD  . GLN A  1  49  ? 2.514   0.400   191.797  1.00 79.88  ? 130 GLN A CD  1 
ATOM   316   O  OE1 . GLN A  1  49  ? 3.048   -0.709  191.677  1.00 64.26  ? 130 GLN A OE1 1 
ATOM   317   N  NE2 . GLN A  1  49  ? 1.778   0.951   190.839  1.00 75.67  ? 130 GLN A NE2 1 
ATOM   318   N  N   . HIS A  1  50  ? 4.693   0.170   195.898  1.00 74.81  ? 131 HIS A N   1 
ATOM   319   C  CA  . HIS A  1  50  ? 4.317   -0.810  196.893  1.00 75.79  ? 131 HIS A CA  1 
ATOM   320   C  C   . HIS A  1  50  ? 4.482   -0.254  198.304  1.00 71.72  ? 131 HIS A C   1 
ATOM   321   O  O   . HIS A  1  50  ? 3.845   -0.726  199.238  1.00 71.51  ? 131 HIS A O   1 
ATOM   322   C  CB  . HIS A  1  50  ? 5.149   -2.073  196.730  1.00 84.57  ? 131 HIS A CB  1 
ATOM   323   C  CG  . HIS A  1  50  ? 4.719   -3.180  197.632  1.00 96.90  ? 131 HIS A CG  1 
ATOM   324   N  ND1 . HIS A  1  50  ? 5.120   -3.264  198.947  1.00 99.07  ? 131 HIS A ND1 1 
ATOM   325   C  CD2 . HIS A  1  50  ? 3.864   -4.211  197.431  1.00 101.02 ? 131 HIS A CD2 1 
ATOM   326   C  CE1 . HIS A  1  50  ? 4.530   -4.298  199.519  1.00 105.50 ? 131 HIS A CE1 1 
ATOM   327   N  NE2 . HIS A  1  50  ? 3.762   -4.889  198.620  1.00 107.14 ? 131 HIS A NE2 1 
ATOM   328   N  N   . ASN A  1  51  ? 5.331   0.753   198.461  1.00 64.35  ? 132 ASN A N   1 
ATOM   329   C  CA  . ASN A  1  51  ? 5.526   1.353   199.768  1.00 61.38  ? 132 ASN A CA  1 
ATOM   330   C  C   . ASN A  1  51  ? 4.386   2.329   200.076  1.00 64.90  ? 132 ASN A C   1 
ATOM   331   O  O   . ASN A  1  51  ? 3.836   2.324   201.185  1.00 64.17  ? 132 ASN A O   1 
ATOM   332   C  CB  . ASN A  1  51  ? 6.875   2.073   199.835  1.00 76.91  ? 132 ASN A CB  1 
ATOM   333   C  CG  . ASN A  1  51  ? 8.058   1.113   199.863  1.00 76.56  ? 132 ASN A CG  1 
ATOM   334   O  OD1 . ASN A  1  51  ? 9.207   1.539   199.988  1.00 86.34  ? 132 ASN A OD1 1 
ATOM   335   N  ND2 . ASN A  1  51  ? 7.782   -0.181  199.743  1.00 76.01  ? 132 ASN A ND2 1 
ATOM   336   N  N   . ILE A  1  52  ? 4.033   3.173   199.107  1.00 59.27  ? 133 ILE A N   1 
ATOM   337   C  CA  . ILE A  1  52  ? 2.936   4.102   199.321  1.00 56.07  ? 133 ILE A CA  1 
ATOM   338   C  C   . ILE A  1  52  ? 1.732   3.223   199.617  1.00 54.21  ? 133 ILE A C   1 
ATOM   339   O  O   . ILE A  1  52  ? 0.904   3.534   200.466  1.00 55.12  ? 133 ILE A O   1 
ATOM   340   C  CB  . ILE A  1  52  ? 2.672   4.965   198.079  1.00 50.87  ? 133 ILE A CB  1 
ATOM   341   C  CG1 . ILE A  1  52  ? 3.832   5.945   197.891  1.00 55.68  ? 133 ILE A CG1 1 
ATOM   342   C  CG2 . ILE A  1  52  ? 1.358   5.727   198.238  1.00 42.34  ? 133 ILE A CG2 1 
ATOM   343   C  CD1 . ILE A  1  52  ? 3.651   6.916   196.734  1.00 48.27  ? 133 ILE A CD1 1 
ATOM   344   N  N   . LYS A  1  53  ? 1.664   2.105   198.912  1.00 55.25  ? 134 LYS A N   1 
ATOM   345   C  CA  . LYS A  1  53  ? 0.601   1.131   199.094  1.00 58.95  ? 134 LYS A CA  1 
ATOM   346   C  C   . LYS A  1  53  ? 0.476   0.778   200.563  1.00 54.75  ? 134 LYS A C   1 
ATOM   347   O  O   . LYS A  1  53  ? -0.613  0.857   201.141  1.00 55.25  ? 134 LYS A O   1 
ATOM   348   C  CB  . LYS A  1  53  ? 0.929   -0.139  198.308  1.00 72.32  ? 134 LYS A CB  1 
ATOM   349   C  CG  . LYS A  1  53  ? 0.149   -1.380  198.719  1.00 68.76  ? 134 LYS A CG  1 
ATOM   350   C  CD  . LYS A  1  53  ? -1.276  -1.359  198.209  1.00 63.81  ? 134 LYS A CD  1 
ATOM   351   C  CE  . LYS A  1  53  ? -1.912  -2.704  198.485  1.00 73.97  ? 134 LYS A CE  1 
ATOM   352   N  NZ  . LYS A  1  53  ? -0.988  -3.812  198.097  1.00 70.36  ? 134 LYS A NZ  1 
ATOM   353   N  N   . THR A  1  54  ? 1.601   0.389   201.159  1.00 56.86  ? 135 THR A N   1 
ATOM   354   C  CA  . THR A  1  54  ? 1.624   -0.003  202.564  1.00 65.12  ? 135 THR A CA  1 
ATOM   355   C  C   . THR A  1  54  ? 1.953   1.104   203.554  1.00 66.11  ? 135 THR A C   1 
ATOM   356   O  O   . THR A  1  54  ? 2.567   0.846   204.583  1.00 85.12  ? 135 THR A O   1 
ATOM   357   C  CB  . THR A  1  54  ? 2.606   -1.174  202.809  1.00 64.22  ? 135 THR A CB  1 
ATOM   358   O  OG1 . THR A  1  54  ? 3.896   -0.835  202.292  1.00 83.39  ? 135 THR A OG1 1 
ATOM   359   C  CG2 . THR A  1  54  ? 2.109   -2.449  202.137  1.00 61.02  ? 135 THR A CG2 1 
ATOM   360   N  N   . GLN A  1  55  ? 1.559   2.335   203.244  1.00 67.96  ? 136 GLN A N   1 
ATOM   361   C  CA  . GLN A  1  55  ? 1.781   3.463   204.147  1.00 66.36  ? 136 GLN A CA  1 
ATOM   362   C  C   . GLN A  1  55  ? 0.460   4.205   204.229  1.00 67.07  ? 136 GLN A C   1 
ATOM   363   O  O   . GLN A  1  55  ? 0.150   4.858   205.224  1.00 71.38  ? 136 GLN A O   1 
ATOM   364   C  CB  . GLN A  1  55  ? 2.862   4.414   203.627  1.00 60.00  ? 136 GLN A CB  1 
ATOM   365   C  CG  . GLN A  1  55  ? 3.241   5.461   204.659  1.00 54.92  ? 136 GLN A CG  1 
ATOM   366   C  CD  . GLN A  1  55  ? 4.222   6.499   204.149  1.00 64.27  ? 136 GLN A CD  1 
ATOM   367   O  OE1 . GLN A  1  55  ? 3.839   7.450   203.467  1.00 65.06  ? 136 GLN A OE1 1 
ATOM   368   N  NE2 . GLN A  1  55  ? 5.498   6.323   204.483  1.00 64.07  ? 136 GLN A NE2 1 
ATOM   369   N  N   . VAL A  1  56  ? -0.311  4.095   203.153  1.00 65.33  ? 137 VAL A N   1 
ATOM   370   C  CA  . VAL A  1  56  ? -1.622  4.720   203.066  1.00 64.94  ? 137 VAL A CA  1 
ATOM   371   C  C   . VAL A  1  56  ? -2.550  3.853   203.900  1.00 60.68  ? 137 VAL A C   1 
ATOM   372   O  O   . VAL A  1  56  ? -3.509  4.333   204.504  1.00 44.86  ? 137 VAL A O   1 
ATOM   373   C  CB  . VAL A  1  56  ? -2.138  4.754   201.600  1.00 64.54  ? 137 VAL A CB  1 
ATOM   374   C  CG1 . VAL A  1  56  ? -3.538  5.337   201.556  1.00 68.92  ? 137 VAL A CG1 1 
ATOM   375   C  CG2 . VAL A  1  56  ? -1.214  5.583   200.739  1.00 56.32  ? 137 VAL A CG2 1 
ATOM   376   N  N   . SER A  1  57  ? -2.248  2.561   203.919  1.00 67.02  ? 138 SER A N   1 
ATOM   377   C  CA  . SER A  1  57  ? -3.028  1.604   204.686  1.00 68.46  ? 138 SER A CA  1 
ATOM   378   C  C   . SER A  1  57  ? -2.716  1.795   206.164  1.00 65.44  ? 138 SER A C   1 
ATOM   379   O  O   . SER A  1  57  ? -3.617  1.940   206.989  1.00 63.11  ? 138 SER A O   1 
ATOM   380   C  CB  . SER A  1  57  ? -2.670  0.177   204.262  1.00 67.97  ? 138 SER A CB  1 
ATOM   381   O  OG  . SER A  1  57  ? -3.093  -0.764  205.233  1.00 75.29  ? 138 SER A OG  1 
ATOM   382   N  N   . GLN A  1  58  ? -1.426  1.811   206.480  1.00 60.56  ? 139 GLN A N   1 
ATOM   383   C  CA  . GLN A  1  58  ? -0.968  1.974   207.849  1.00 61.28  ? 139 GLN A CA  1 
ATOM   384   C  C   . GLN A  1  58  ? -1.451  3.279   208.454  1.00 60.71  ? 139 GLN A C   1 
ATOM   385   O  O   . GLN A  1  58  ? -2.013  3.287   209.552  1.00 61.18  ? 139 GLN A O   1 
ATOM   386   C  CB  . GLN A  1  58  ? 0.554   1.930   207.903  1.00 63.29  ? 139 GLN A CB  1 
ATOM   387   C  CG  . GLN A  1  58  ? 1.102   1.716   209.291  1.00 76.98  ? 139 GLN A CG  1 
ATOM   388   C  CD  . GLN A  1  58  ? 2.612   1.639   209.299  1.00 91.22  ? 139 GLN A CD  1 
ATOM   389   O  OE1 . GLN A  1  58  ? 3.214   1.094   208.373  1.00 94.80  ? 139 GLN A OE1 1 
ATOM   390   N  NE2 . GLN A  1  58  ? 3.236   2.170   210.349  1.00 94.62  ? 139 GLN A NE2 1 
ATOM   391   N  N   . ILE A  1  59  ? -1.235  4.382   207.743  1.00 53.89  ? 140 ILE A N   1 
ATOM   392   C  CA  . ILE A  1  59  ? -1.662  5.670   208.255  1.00 48.64  ? 140 ILE A CA  1 
ATOM   393   C  C   . ILE A  1  59  ? -3.164  5.734   208.421  1.00 56.27  ? 140 ILE A C   1 
ATOM   394   O  O   . ILE A  1  59  ? -3.659  6.392   209.340  1.00 62.07  ? 140 ILE A O   1 
ATOM   395   C  CB  . ILE A  1  59  ? -1.219  6.816   207.353  1.00 44.25  ? 140 ILE A CB  1 
ATOM   396   C  CG1 . ILE A  1  59  ? 0.295   6.963   207.440  1.00 49.50  ? 140 ILE A CG1 1 
ATOM   397   C  CG2 . ILE A  1  59  ? -1.888  8.114   207.793  1.00 36.04  ? 140 ILE A CG2 1 
ATOM   398   C  CD1 . ILE A  1  59  ? 0.851   8.066   206.601  1.00 57.44  ? 140 ILE A CD1 1 
ATOM   399   N  N   . LEU A  1  60  ? -3.901  5.056   207.547  1.00 55.87  ? 141 LEU A N   1 
ATOM   400   C  CA  . LEU A  1  60  ? -5.348  5.085   207.666  1.00 56.44  ? 141 LEU A CA  1 
ATOM   401   C  C   . LEU A  1  60  ? -5.758  4.404   208.953  1.00 57.21  ? 141 LEU A C   1 
ATOM   402   O  O   . LEU A  1  60  ? -6.515  4.958   209.748  1.00 58.72  ? 141 LEU A O   1 
ATOM   403   C  CB  . LEU A  1  60  ? -6.018  4.383   206.495  1.00 61.33  ? 141 LEU A CB  1 
ATOM   404   C  CG  . LEU A  1  60  ? -7.534  4.238   206.699  1.00 71.71  ? 141 LEU A CG  1 
ATOM   405   C  CD1 . LEU A  1  60  ? -8.127  5.572   207.229  1.00 62.95  ? 141 LEU A CD1 1 
ATOM   406   C  CD2 . LEU A  1  60  ? -8.187  3.779   205.380  1.00 48.50  ? 141 LEU A CD2 1 
ATOM   407   N  N   . ARG A  1  61  ? -5.259  3.190   209.145  1.00 59.97  ? 142 ARG A N   1 
ATOM   408   C  CA  . ARG A  1  61  ? -5.555  2.421   210.343  1.00 56.64  ? 142 ARG A CA  1 
ATOM   409   C  C   . ARG A  1  61  ? -5.256  3.285   211.571  1.00 60.26  ? 142 ARG A C   1 
ATOM   410   O  O   . ARG A  1  61  ? -6.114  3.477   212.441  1.00 55.54  ? 142 ARG A O   1 
ATOM   411   C  CB  . ARG A  1  61  ? -4.695  1.158   210.377  1.00 41.43  ? 142 ARG A CB  1 
ATOM   412   C  CG  . ARG A  1  61  ? -4.836  0.372   211.655  1.00 68.90  ? 142 ARG A CG  1 
ATOM   413   C  CD  . ARG A  1  61  ? -5.831  -0.774  211.534  1.00 77.55  ? 142 ARG A CD  1 
ATOM   414   N  NE  . ARG A  1  61  ? -5.184  -1.975  211.014  1.00 86.95  ? 142 ARG A NE  1 
ATOM   415   C  CZ  . ARG A  1  61  ? -4.837  -2.147  209.744  1.00 89.10  ? 142 ARG A CZ  1 
ATOM   416   N  NH1 . ARG A  1  61  ? -5.083  -1.199  208.851  1.00 89.17  ? 142 ARG A NH1 1 
ATOM   417   N  NH2 . ARG A  1  61  ? -4.223  -3.261  209.375  1.00 91.71  ? 142 ARG A NH2 1 
ATOM   418   N  N   . VAL A  1  62  ? -4.038  3.817   211.622  1.00 55.13  ? 143 VAL A N   1 
ATOM   419   C  CA  . VAL A  1  62  ? -3.625  4.653   212.738  1.00 51.70  ? 143 VAL A CA  1 
ATOM   420   C  C   . VAL A  1  62  ? -4.632  5.759   213.023  1.00 54.08  ? 143 VAL A C   1 
ATOM   421   O  O   . VAL A  1  62  ? -5.019  5.969   214.164  1.00 62.23  ? 143 VAL A O   1 
ATOM   422   C  CB  . VAL A  1  62  ? -2.263  5.307   212.476  1.00 42.59  ? 143 VAL A CB  1 
ATOM   423   C  CG1 . VAL A  1  62  ? -1.804  6.043   213.703  1.00 39.88  ? 143 VAL A CG1 1 
ATOM   424   C  CG2 . VAL A  1  62  ? -1.252  4.259   212.100  1.00 46.53  ? 143 VAL A CG2 1 
ATOM   425   N  N   . GLU A  1  63  ? -5.061  6.468   211.991  1.00 49.91  ? 144 GLU A N   1 
ATOM   426   C  CA  . GLU A  1  63  ? -6.011  7.541   212.203  1.00 47.11  ? 144 GLU A CA  1 
ATOM   427   C  C   . GLU A  1  63  ? -7.299  7.099   212.869  1.00 42.34  ? 144 GLU A C   1 
ATOM   428   O  O   . GLU A  1  63  ? -7.840  7.831   213.678  1.00 52.82  ? 144 GLU A O   1 
ATOM   429   C  CB  . GLU A  1  63  ? -6.356  8.237   210.891  1.00 59.17  ? 144 GLU A CB  1 
ATOM   430   C  CG  . GLU A  1  63  ? -7.338  9.380   211.073  1.00 49.15  ? 144 GLU A CG  1 
ATOM   431   C  CD  . GLU A  1  63  ? -7.643  10.058  209.766  1.00 71.09  ? 144 GLU A CD  1 
ATOM   432   O  OE1 . GLU A  1  63  ? -8.119  9.360   208.845  1.00 75.62  ? 144 GLU A OE1 1 
ATOM   433   O  OE2 . GLU A  1  63  ? -7.406  11.280  209.651  1.00 70.72  ? 144 GLU A OE2 1 
ATOM   434   N  N   . VAL A  1  64  ? -7.824  5.930   212.531  1.00 41.89  ? 145 VAL A N   1 
ATOM   435   C  CA  . VAL A  1  64  ? -9.060  5.523   213.193  1.00 59.01  ? 145 VAL A CA  1 
ATOM   436   C  C   . VAL A  1  64  ? -8.714  5.079   214.608  1.00 56.41  ? 145 VAL A C   1 
ATOM   437   O  O   . VAL A  1  64  ? -9.487  5.318   215.536  1.00 50.28  ? 145 VAL A O   1 
ATOM   438   C  CB  . VAL A  1  64  ? -9.823  4.380   212.432  1.00 66.24  ? 145 VAL A CB  1 
ATOM   439   C  CG1 . VAL A  1  64  ? -10.767 3.660   213.378  1.00 69.84  ? 145 VAL A CG1 1 
ATOM   440   C  CG2 . VAL A  1  64  ? -10.670 4.969   211.302  1.00 56.55  ? 145 VAL A CG2 1 
ATOM   441   N  N   . ASP A  1  65  ? -7.551  4.441   214.768  1.00 58.73  ? 146 ASP A N   1 
ATOM   442   C  CA  . ASP A  1  65  ? -7.092  4.003   216.087  1.00 51.40  ? 146 ASP A CA  1 
ATOM   443   C  C   . ASP A  1  65  ? -7.042  5.237   216.991  1.00 53.48  ? 146 ASP A C   1 
ATOM   444   O  O   . ASP A  1  65  ? -7.397  5.179   218.172  1.00 63.77  ? 146 ASP A O   1 
ATOM   445   C  CB  . ASP A  1  65  ? -5.702  3.358   215.996  1.00 53.88  ? 146 ASP A CB  1 
ATOM   446   C  CG  . ASP A  1  65  ? -5.756  1.856   215.655  1.00 72.43  ? 146 ASP A CG  1 
ATOM   447   O  OD1 . ASP A  1  65  ? -4.686  1.268   215.369  1.00 67.77  ? 146 ASP A OD1 1 
ATOM   448   O  OD2 . ASP A  1  65  ? -6.857  1.256   215.681  1.00 69.41  ? 146 ASP A OD2 1 
ATOM   449   N  N   . ILE A  1  66  ? -6.619  6.359   216.415  1.00 46.21  ? 147 ILE A N   1 
ATOM   450   C  CA  . ILE A  1  66  ? -6.534  7.627   217.126  1.00 31.34  ? 147 ILE A CA  1 
ATOM   451   C  C   . ILE A  1  66  ? -7.898  8.299   217.308  1.00 38.87  ? 147 ILE A C   1 
ATOM   452   O  O   . ILE A  1  66  ? -8.150  8.898   218.345  1.00 51.23  ? 147 ILE A O   1 
ATOM   453   C  CB  . ILE A  1  66  ? -5.630  8.587   216.392  1.00 25.15  ? 147 ILE A CB  1 
ATOM   454   C  CG1 . ILE A  1  66  ? -4.180  8.148   216.542  1.00 31.30  ? 147 ILE A CG1 1 
ATOM   455   C  CG2 . ILE A  1  66  ? -5.853  9.994   216.891  1.00 28.16  ? 147 ILE A CG2 1 
ATOM   456   C  CD1 . ILE A  1  66  ? -3.218  8.933   215.616  1.00 30.19  ? 147 ILE A CD1 1 
ATOM   457   N  N   . ASP A  1  67  ? -8.771  8.231   216.307  1.00 45.32  ? 148 ASP A N   1 
ATOM   458   C  CA  . ASP A  1  67  ? -10.094 8.836   216.445  1.00 44.72  ? 148 ASP A CA  1 
ATOM   459   C  C   . ASP A  1  67  ? -10.825 8.115   217.571  1.00 42.24  ? 148 ASP A C   1 
ATOM   460   O  O   . ASP A  1  67  ? -11.559 8.733   218.346  1.00 53.34  ? 148 ASP A O   1 
ATOM   461   C  CB  . ASP A  1  67  ? -10.906 8.715   215.146  1.00 41.51  ? 148 ASP A CB  1 
ATOM   462   C  CG  . ASP A  1  67  ? -12.358 9.189   215.313  1.00 54.65  ? 148 ASP A CG  1 
ATOM   463   O  OD1 . ASP A  1  67  ? -12.567 10.351  215.747  1.00 49.58  ? 148 ASP A OD1 1 
ATOM   464   O  OD2 . ASP A  1  67  ? -13.294 8.400   215.015  1.00 45.94  ? 148 ASP A OD2 1 
ATOM   465   N  N   . VAL A  1  68  ? -10.609 6.805   217.658  1.00 41.19  ? 149 VAL A N   1 
ATOM   466   C  CA  . VAL A  1  68  ? -11.228 5.968   218.687  1.00 45.71  ? 149 VAL A CA  1 
ATOM   467   C  C   . VAL A  1  68  ? -10.704 6.278   220.100  1.00 41.88  ? 149 VAL A C   1 
ATOM   468   O  O   . VAL A  1  68  ? -11.498 6.362   221.047  1.00 41.28  ? 149 VAL A O   1 
ATOM   469   C  CB  . VAL A  1  68  ? -11.020 4.457   218.353  1.00 48.35  ? 149 VAL A CB  1 
ATOM   470   C  CG1 . VAL A  1  68  ? -11.320 3.580   219.552  1.00 44.06  ? 149 VAL A CG1 1 
ATOM   471   C  CG2 . VAL A  1  68  ? -11.941 4.065   217.219  1.00 59.16  ? 149 VAL A CG2 1 
ATOM   472   N  N   . ALA A  1  69  ? -9.384  6.453   220.231  1.00 32.55  ? 150 ALA A N   1 
ATOM   473   C  CA  . ALA A  1  69  ? -8.748  6.762   221.514  1.00 25.06  ? 150 ALA A CA  1 
ATOM   474   C  C   . ALA A  1  69  ? -9.095  8.163   222.008  1.00 36.08  ? 150 ALA A C   1 
ATOM   475   O  O   . ALA A  1  69  ? -9.637  8.316   223.104  1.00 42.42  ? 150 ALA A O   1 
ATOM   476   C  CB  . ALA A  1  69  ? -7.241  6.617   221.403  1.00 19.59  ? 150 ALA A CB  1 
ATOM   477   N  N   . LEU A  1  70  ? -8.770  9.182   221.213  1.00 31.64  ? 151 LEU A N   1 
ATOM   478   C  CA  . LEU A  1  70  ? -9.073  10.559  221.573  1.00 25.73  ? 151 LEU A CA  1 
ATOM   479   C  C   . LEU A  1  70  ? -10.491 10.727  222.120  1.00 46.67  ? 151 LEU A C   1 
ATOM   480   O  O   . LEU A  1  70  ? -10.727 11.486  223.065  1.00 62.18  ? 151 LEU A O   1 
ATOM   481   C  CB  . LEU A  1  70  ? -8.921  11.452  220.360  1.00 40.36  ? 151 LEU A CB  1 
ATOM   482   C  CG  . LEU A  1  70  ? -7.654  12.287  220.307  1.00 41.67  ? 151 LEU A CG  1 
ATOM   483   C  CD1 . LEU A  1  70  ? -6.558  11.593  221.102  1.00 48.93  ? 151 LEU A CD1 1 
ATOM   484   C  CD2 . LEU A  1  70  ? -7.253  12.485  218.837  1.00 15.96  ? 151 LEU A CD2 1 
ATOM   485   N  N   . ARG A  1  71  ? -11.442 10.027  221.519  1.00 41.58  ? 152 ARG A N   1 
ATOM   486   C  CA  . ARG A  1  71  ? -12.815 10.127  221.957  1.00 33.48  ? 152 ARG A CA  1 
ATOM   487   C  C   . ARG A  1  71  ? -12.924 9.639   223.392  1.00 37.81  ? 152 ARG A C   1 
ATOM   488   O  O   . ARG A  1  71  ? -13.777 10.098  224.153  1.00 36.51  ? 152 ARG A O   1 
ATOM   489   C  CB  . ARG A  1  71  ? -13.687 9.307   221.013  1.00 34.91  ? 152 ARG A CB  1 
ATOM   490   C  CG  . ARG A  1  71  ? -15.169 9.406   221.253  1.00 35.43  ? 152 ARG A CG  1 
ATOM   491   C  CD  . ARG A  1  71  ? -15.933 9.041   219.991  1.00 56.72  ? 152 ARG A CD  1 
ATOM   492   N  NE  . ARG A  1  71  ? -15.968 10.152  219.040  1.00 63.68  ? 152 ARG A NE  1 
ATOM   493   C  CZ  . ARG A  1  71  ? -15.312 10.189  217.881  1.00 65.77  ? 152 ARG A CZ  1 
ATOM   494   N  NH1 . ARG A  1  71  ? -14.551 9.174   217.497  1.00 38.34  ? 152 ARG A NH1 1 
ATOM   495   N  NH2 . ARG A  1  71  ? -15.424 11.255  217.098  1.00 75.75  ? 152 ARG A NH2 1 
ATOM   496   N  N   . ALA A  1  72  ? -12.034 8.718   223.764  1.00 46.23  ? 153 ALA A N   1 
ATOM   497   C  CA  . ALA A  1  72  ? -12.017 8.139   225.113  1.00 45.37  ? 153 ALA A CA  1 
ATOM   498   C  C   . ALA A  1  72  ? -11.799 9.216   226.171  1.00 43.28  ? 153 ALA A C   1 
ATOM   499   O  O   . ALA A  1  72  ? -12.361 9.139   227.266  1.00 45.61  ? 153 ALA A O   1 
ATOM   500   C  CB  . ALA A  1  72  ? -10.922 7.047   225.216  1.00 9.17   ? 153 ALA A CB  1 
ATOM   501   N  N   . CYS A  1  73  ? -11.008 10.232  225.823  1.00 33.05  ? 154 CYS A N   1 
ATOM   502   C  CA  . CYS A  1  73  ? -10.689 11.316  226.738  1.00 30.21  ? 154 CYS A CA  1 
ATOM   503   C  C   . CYS A  1  73  ? -11.850 12.140  227.240  1.00 39.81  ? 154 CYS A C   1 
ATOM   504   O  O   . CYS A  1  73  ? -11.735 12.801  228.267  1.00 44.63  ? 154 CYS A O   1 
ATOM   505   C  CB  . CYS A  1  73  ? -9.697  12.245  226.112  1.00 12.00  ? 154 CYS A CB  1 
ATOM   506   S  SG  . CYS A  1  73  ? -8.293  11.357  225.431  1.00 44.67  ? 154 CYS A SG  1 
ATOM   507   N  N   . LYS A  1  74  ? -12.960 12.133  226.520  1.00 40.21  ? 155 LYS A N   1 
ATOM   508   C  CA  . LYS A  1  74  ? -14.115 12.891  226.970  1.00 40.77  ? 155 LYS A CA  1 
ATOM   509   C  C   . LYS A  1  74  ? -14.411 12.481  228.413  1.00 46.90  ? 155 LYS A C   1 
ATOM   510   O  O   . LYS A  1  74  ? -14.508 13.317  229.311  1.00 40.20  ? 155 LYS A O   1 
ATOM   511   C  CB  . LYS A  1  74  ? -15.310 12.583  226.073  1.00 44.76  ? 155 LYS A CB  1 
ATOM   512   C  CG  . LYS A  1  74  ? -16.645 13.251  226.425  1.00 27.05  ? 155 LYS A CG  1 
ATOM   513   C  CD  . LYS A  1  74  ? -17.526 13.245  225.150  1.00 48.33  ? 155 LYS A CD  1 
ATOM   514   C  CE  . LYS A  1  74  ? -18.958 13.725  225.379  1.00 50.19  ? 155 LYS A CE  1 
ATOM   515   N  NZ  . LYS A  1  74  ? -19.850 12.695  225.996  1.00 37.81  ? 155 LYS A NZ  1 
ATOM   516   N  N   . GLY A  1  75  ? -14.528 11.181  228.641  1.00 53.35  ? 156 GLY A N   1 
ATOM   517   C  CA  . GLY A  1  75  ? -14.824 10.717  229.984  1.00 48.86  ? 156 GLY A CA  1 
ATOM   518   C  C   . GLY A  1  75  ? -13.608 10.583  230.877  1.00 48.71  ? 156 GLY A C   1 
ATOM   519   O  O   . GLY A  1  75  ? -13.720 10.011  231.965  1.00 36.20  ? 156 GLY A O   1 
ATOM   520   N  N   . SER A  1  76  ? -12.458 11.106  230.438  1.00 40.36  ? 157 SER A N   1 
ATOM   521   C  CA  . SER A  1  76  ? -11.231 11.025  231.232  1.00 32.28  ? 157 SER A CA  1 
ATOM   522   C  C   . SER A  1  76  ? -10.545 12.351  231.602  1.00 40.31  ? 157 SER A C   1 
ATOM   523   O  O   . SER A  1  76  ? -9.935  12.461  232.660  1.00 46.47  ? 157 SER A O   1 
ATOM   524   C  CB  . SER A  1  76  ? -10.231 10.141  230.511  1.00 36.83  ? 157 SER A CB  1 
ATOM   525   O  OG  . SER A  1  76  ? -9.004  10.094  231.207  1.00 47.32  ? 157 SER A OG  1 
ATOM   526   N  N   . CYS A  1  77  ? -10.655 13.353  230.734  1.00 48.77  ? 158 CYS A N   1 
ATOM   527   C  CA  . CYS A  1  77  ? -10.020 14.650  230.956  1.00 46.14  ? 158 CYS A CA  1 
ATOM   528   C  C   . CYS A  1  77  ? -10.949 15.834  231.263  1.00 50.17  ? 158 CYS A C   1 
ATOM   529   O  O   . CYS A  1  77  ? -12.126 15.852  230.891  1.00 40.51  ? 158 CYS A O   1 
ATOM   530   C  CB  . CYS A  1  77  ? -9.135  14.953  229.751  1.00 37.73  ? 158 CYS A CB  1 
ATOM   531   S  SG  . CYS A  1  77  ? -8.147  13.478  229.415  1.00 53.61  ? 158 CYS A SG  1 
ATOM   532   N  N   . ALA A  1  78  ? -10.390 16.822  231.957  1.00 54.94  ? 159 ALA A N   1 
ATOM   533   C  CA  . ALA A  1  78  ? -11.116 18.022  232.354  1.00 56.49  ? 159 ALA A CA  1 
ATOM   534   C  C   . ALA A  1  78  ? -11.740 18.729  231.152  1.00 54.01  ? 159 ALA A C   1 
ATOM   535   O  O   . ALA A  1  78  ? -12.893 19.161  231.205  1.00 52.36  ? 159 ALA A O   1 
ATOM   536   C  CB  . ALA A  1  78  ? -10.175 18.967  233.101  1.00 46.11  ? 159 ALA A CB  1 
ATOM   537   N  N   . ARG A  1  79  ? -10.975 18.854  230.074  1.00 46.53  ? 160 ARG A N   1 
ATOM   538   C  CA  . ARG A  1  79  ? -11.476 19.493  228.867  1.00 53.19  ? 160 ARG A CA  1 
ATOM   539   C  C   . ARG A  1  79  ? -11.371 18.516  227.718  1.00 55.15  ? 160 ARG A C   1 
ATOM   540   O  O   . ARG A  1  79  ? -10.376 17.797  227.587  1.00 61.69  ? 160 ARG A O   1 
ATOM   541   C  CB  . ARG A  1  79  ? -10.685 20.774  228.555  1.00 60.72  ? 160 ARG A CB  1 
ATOM   542   C  CG  . ARG A  1  79  ? -11.249 22.011  229.234  1.00 49.62  ? 160 ARG A CG  1 
ATOM   543   C  CD  . ARG A  1  79  ? -10.174 23.023  229.608  1.00 72.07  ? 160 ARG A CD  1 
ATOM   544   N  NE  . ARG A  1  79  ? -9.478  23.629  228.470  1.00 68.88  ? 160 ARG A NE  1 
ATOM   545   C  CZ  . ARG A  1  79  ? -10.077 24.215  227.440  1.00 45.99  ? 160 ARG A CZ  1 
ATOM   546   N  NH1 . ARG A  1  79  ? -11.399 24.270  227.384  1.00 45.17  ? 160 ARG A NH1 1 
ATOM   547   N  NH2 . ARG A  1  79  ? -9.348  24.769  226.486  1.00 39.78  ? 160 ARG A NH2 1 
ATOM   548   N  N   . TYR A  1  80  ? -12.412 18.482  226.895  1.00 57.88  ? 161 TYR A N   1 
ATOM   549   C  CA  . TYR A  1  80  ? -12.453 17.584  225.745  1.00 54.35  ? 161 TYR A CA  1 
ATOM   550   C  C   . TYR A  1  80  ? -12.763 18.337  224.470  1.00 51.29  ? 161 TYR A C   1 
ATOM   551   O  O   . TYR A  1  80  ? -13.737 19.081  224.406  1.00 44.08  ? 161 TYR A O   1 
ATOM   552   C  CB  . TYR A  1  80  ? -13.524 16.506  225.931  1.00 50.54  ? 161 TYR A CB  1 
ATOM   553   C  CG  . TYR A  1  80  ? -13.701 15.637  224.703  1.00 52.92  ? 161 TYR A CG  1 
ATOM   554   C  CD1 . TYR A  1  80  ? -12.655 14.836  224.241  1.00 49.76  ? 161 TYR A CD1 1 
ATOM   555   C  CD2 . TYR A  1  80  ? -14.895 15.639  223.986  1.00 42.56  ? 161 TYR A CD2 1 
ATOM   556   C  CE1 . TYR A  1  80  ? -12.784 14.067  223.103  1.00 39.52  ? 161 TYR A CE1 1 
ATOM   557   C  CE2 . TYR A  1  80  ? -15.032 14.868  222.842  1.00 40.05  ? 161 TYR A CE2 1 
ATOM   558   C  CZ  . TYR A  1  80  ? -13.969 14.084  222.406  1.00 41.91  ? 161 TYR A CZ  1 
ATOM   559   O  OH  . TYR A  1  80  ? -14.079 13.318  221.264  1.00 52.74  ? 161 TYR A OH  1 
ATOM   560   N  N   . LEU A  1  81  ? -11.951 18.135  223.444  1.00 52.82  ? 162 LEU A N   1 
ATOM   561   C  CA  . LEU A  1  81  ? -12.206 18.813  222.190  1.00 57.51  ? 162 LEU A CA  1 
ATOM   562   C  C   . LEU A  1  81  ? -13.050 17.977  221.224  1.00 62.12  ? 162 LEU A C   1 
ATOM   563   O  O   . LEU A  1  81  ? -14.275 18.043  221.271  1.00 68.72  ? 162 LEU A O   1 
ATOM   564   C  CB  . LEU A  1  81  ? -10.888 19.231  221.539  1.00 69.60  ? 162 LEU A CB  1 
ATOM   565   C  CG  . LEU A  1  81  ? -10.582 20.726  221.653  1.00 63.03  ? 162 LEU A CG  1 
ATOM   566   C  CD1 . LEU A  1  81  ? -11.490 21.513  220.733  1.00 60.26  ? 162 LEU A CD1 1 
ATOM   567   C  CD2 . LEU A  1  81  ? -10.778 21.172  223.079  1.00 69.46  ? 162 LEU A CD2 1 
ATOM   568   N  N   . GLU A  1  82  ? -12.405 17.193  220.362  1.00 55.06  ? 163 GLU A N   1 
ATOM   569   C  CA  . GLU A  1  82  ? -13.106 16.377  219.363  1.00 59.16  ? 163 GLU A CA  1 
ATOM   570   C  C   . GLU A  1  82  ? -12.276 16.366  218.086  1.00 56.46  ? 163 GLU A C   1 
ATOM   571   O  O   . GLU A  1  82  ? -12.087 17.403  217.456  1.00 55.53  ? 163 GLU A O   1 
ATOM   572   C  CB  . GLU A  1  82  ? -14.496 16.962  219.037  1.00 60.98  ? 163 GLU A CB  1 
ATOM   573   C  CG  . GLU A  1  82  ? -15.199 16.370  217.813  1.00 67.58  ? 163 GLU A CG  1 
ATOM   574   C  CD  . GLU A  1  82  ? -15.927 15.065  218.106  1.00 91.71  ? 163 GLU A CD  1 
ATOM   575   O  OE1 . GLU A  1  82  ? -16.321 14.365  217.142  1.00 100.17 ? 163 GLU A OE1 1 
ATOM   576   O  OE2 . GLU A  1  82  ? -16.116 14.739  219.298  1.00 100.53 ? 163 GLU A OE2 1 
ATOM   577   N  N   . TYR A  1  83  ? -11.762 15.201  217.713  1.00 53.83  ? 164 TYR A N   1 
ATOM   578   C  CA  . TYR A  1  83  ? -10.983 15.106  216.495  1.00 60.63  ? 164 TYR A CA  1 
ATOM   579   C  C   . TYR A  1  83  ? -11.967 14.843  215.373  1.00 74.36  ? 164 TYR A C   1 
ATOM   580   O  O   . TYR A  1  83  ? -12.847 13.984  215.491  1.00 72.90  ? 164 TYR A O   1 
ATOM   581   C  CB  . TYR A  1  83  ? -9.971  13.968  216.575  1.00 49.43  ? 164 TYR A CB  1 
ATOM   582   C  CG  . TYR A  1  83  ? -9.232  13.697  215.275  1.00 56.12  ? 164 TYR A CG  1 
ATOM   583   C  CD1 . TYR A  1  83  ? -8.367  14.641  214.719  1.00 56.90  ? 164 TYR A CD1 1 
ATOM   584   C  CD2 . TYR A  1  83  ? -9.376  12.474  214.620  1.00 58.60  ? 164 TYR A CD2 1 
ATOM   585   C  CE1 . TYR A  1  83  ? -7.656  14.366  213.543  1.00 63.06  ? 164 TYR A CE1 1 
ATOM   586   C  CE2 . TYR A  1  83  ? -8.679  12.191  213.450  1.00 67.65  ? 164 TYR A CE2 1 
ATOM   587   C  CZ  . TYR A  1  83  ? -7.820  13.136  212.917  1.00 66.82  ? 164 TYR A CZ  1 
ATOM   588   O  OH  . TYR A  1  83  ? -7.126  12.825  211.771  1.00 70.75  ? 164 TYR A OH  1 
ATOM   589   N  N   . ARG A  1  84  ? -11.823 15.594  214.286  1.00 85.40  ? 165 ARG A N   1 
ATOM   590   C  CA  . ARG A  1  84  ? -12.710 15.448  213.146  1.00 87.39  ? 165 ARG A CA  1 
ATOM   591   C  C   . ARG A  1  84  ? -12.017 14.836  211.942  1.00 86.85  ? 165 ARG A C   1 
ATOM   592   O  O   . ARG A  1  84  ? -10.968 15.319  211.507  1.00 91.76  ? 165 ARG A O   1 
ATOM   593   C  CB  . ARG A  1  84  ? -13.321 16.812  212.766  1.00 94.57  ? 165 ARG A CB  1 
ATOM   594   C  CG  . ARG A  1  84  ? -12.427 18.037  212.997  1.00 96.26  ? 165 ARG A CG  1 
ATOM   595   C  CD  . ARG A  1  84  ? -12.392 18.431  214.471  1.00 100.31 ? 165 ARG A CD  1 
ATOM   596   N  NE  . ARG A  1  84  ? -11.545 19.594  214.742  1.00 111.70 ? 165 ARG A NE  1 
ATOM   597   C  CZ  . ARG A  1  84  ? -11.922 20.866  214.609  1.00 111.63 ? 165 ARG A CZ  1 
ATOM   598   N  NH1 . ARG A  1  84  ? -13.150 21.173  214.204  1.00 105.27 ? 165 ARG A NH1 1 
ATOM   599   N  NH2 . ARG A  1  84  ? -11.064 21.838  214.892  1.00 110.80 ? 165 ARG A NH2 1 
ATOM   600   N  N   . LEU A  1  85  ? -12.599 13.758  211.421  1.00 83.76  ? 166 LEU A N   1 
ATOM   601   C  CA  . LEU A  1  85  ? -12.059 13.096  210.239  1.00 90.17  ? 166 LEU A CA  1 
ATOM   602   C  C   . LEU A  1  85  ? -12.346 13.977  209.025  1.00 97.74  ? 166 LEU A C   1 
ATOM   603   O  O   . LEU A  1  85  ? -12.655 15.161  209.180  1.00 98.64  ? 166 LEU A O   1 
ATOM   604   C  CB  . LEU A  1  85  ? -12.701 11.726  210.046  1.00 89.32  ? 166 LEU A CB  1 
ATOM   605   C  CG  . LEU A  1  85  ? -12.094 10.593  210.862  1.00 87.49  ? 166 LEU A CG  1 
ATOM   606   C  CD1 . LEU A  1  85  ? -12.768 9.284   210.501  1.00 75.56  ? 166 LEU A CD1 1 
ATOM   607   C  CD2 . LEU A  1  85  ? -10.605 10.519  210.569  1.00 93.26  ? 166 LEU A CD2 1 
ATOM   608   N  N   . ASP A  1  86  ? -12.269 13.417  207.819  1.00 97.91  ? 167 ASP A N   1 
ATOM   609   C  CA  . ASP A  1  86  ? -12.510 14.242  206.643  1.00 97.72  ? 167 ASP A CA  1 
ATOM   610   C  C   . ASP A  1  86  ? -12.815 13.490  205.337  1.00 101.84 ? 167 ASP A C   1 
ATOM   611   O  O   . ASP A  1  86  ? -13.751 12.685  205.251  1.00 96.92  ? 167 ASP A O   1 
ATOM   612   C  CB  . ASP A  1  86  ? -11.299 15.159  206.434  1.00 91.31  ? 167 ASP A CB  1 
ATOM   613   C  CG  . ASP A  1  86  ? -11.660 16.461  205.755  1.00 87.13  ? 167 ASP A CG  1 
ATOM   614   O  OD1 . ASP A  1  86  ? -12.565 16.451  204.893  1.00 86.04  ? 167 ASP A OD1 1 
ATOM   615   O  OD2 . ASP A  1  86  ? -11.028 17.489  206.079  1.00 73.61  ? 167 ASP A OD2 1 
ATOM   616   N  N   . LYS A  1  87  ? -12.001 13.785  204.326  1.00 103.39 ? 168 LYS A N   1 
ATOM   617   C  CA  . LYS A  1  87  ? -12.112 13.219  202.988  1.00 95.16  ? 168 LYS A CA  1 
ATOM   618   C  C   . LYS A  1  87  ? -11.427 11.867  202.834  1.00 104.43 ? 168 LYS A C   1 
ATOM   619   O  O   . LYS A  1  87  ? -10.414 11.566  203.477  1.00 102.05 ? 168 LYS A O   1 
ATOM   620   C  CB  . LYS A  1  87  ? -11.454 14.150  201.994  1.00 73.72  ? 168 LYS A CB  1 
ATOM   621   C  CG  . LYS A  1  87  ? -9.944  13.971  202.026  1.00 57.71  ? 168 LYS A CG  1 
ATOM   622   C  CD  . LYS A  1  87  ? -9.218  15.176  201.494  1.00 73.04  ? 168 LYS A CD  1 
ATOM   623   C  CE  . LYS A  1  87  ? -9.507  16.396  202.344  1.00 75.97  ? 168 LYS A CE  1 
ATOM   624   N  NZ  . LYS A  1  87  ? -9.143  16.169  203.760  1.00 63.60  ? 168 LYS A NZ  1 
ATOM   625   N  N   . GLU A  1  88  ? -11.988 11.068  201.942  1.00 110.67 ? 169 GLU A N   1 
ATOM   626   C  CA  . GLU A  1  88  ? -11.438 9.768   201.621  1.00 111.65 ? 169 GLU A CA  1 
ATOM   627   C  C   . GLU A  1  88  ? -10.876 10.016  200.229  1.00 108.46 ? 169 GLU A C   1 
ATOM   628   O  O   . GLU A  1  88  ? -10.437 9.100   199.537  1.00 106.36 ? 169 GLU A O   1 
ATOM   629   C  CB  . GLU A  1  88  ? -12.545 8.704   201.600  1.00 117.00 ? 169 GLU A CB  1 
ATOM   630   C  CG  . GLU A  1  88  ? -13.648 8.938   200.573  1.00 121.88 ? 169 GLU A CG  1 
ATOM   631   C  CD  . GLU A  1  88  ? -13.181 8.693   199.152  1.00 126.34 ? 169 GLU A CD  1 
ATOM   632   O  OE1 . GLU A  1  88  ? -12.783 7.548   198.843  1.00 125.46 ? 169 GLU A OE1 1 
ATOM   633   O  OE2 . GLU A  1  88  ? -13.205 9.648   198.347  1.00 127.71 ? 169 GLU A OE2 1 
ATOM   634   N  N   . LYS A  1  89  ? -10.915 11.288  199.831  1.00 101.21 ? 170 LYS A N   1 
ATOM   635   C  CA  . LYS A  1  89  ? -10.406 11.727  198.538  1.00 91.42  ? 170 LYS A CA  1 
ATOM   636   C  C   . LYS A  1  89  ? -8.971  11.234  198.408  1.00 85.97  ? 170 LYS A C   1 
ATOM   637   O  O   . LYS A  1  89  ? -8.421  11.133  197.316  1.00 75.79  ? 170 LYS A O   1 
ATOM   638   C  CB  . LYS A  1  89  ? -10.467 13.256  198.454  1.00 88.41  ? 170 LYS A CB  1 
ATOM   639   C  CG  . LYS A  1  89  ? -9.748  13.861  197.265  1.00 85.70  ? 170 LYS A CG  1 
ATOM   640   C  CD  . LYS A  1  89  ? -8.262  14.072  197.544  1.00 87.63  ? 170 LYS A CD  1 
ATOM   641   C  CE  . LYS A  1  89  ? -8.007  15.309  198.402  1.00 88.55  ? 170 LYS A CE  1 
ATOM   642   N  NZ  . LYS A  1  89  ? -8.389  16.580  197.713  1.00 81.95  ? 170 LYS A NZ  1 
ATOM   643   N  N   . ASN A  1  90  ? -8.371  10.929  199.548  1.00 88.09  ? 171 ASN A N   1 
ATOM   644   C  CA  . ASN A  1  90  ? -7.016  10.418  199.578  1.00 84.79  ? 171 ASN A CA  1 
ATOM   645   C  C   . ASN A  1  90  ? -7.023  8.972   199.071  1.00 87.86  ? 171 ASN A C   1 
ATOM   646   O  O   . ASN A  1  90  ? -6.048  8.516   198.488  1.00 85.68  ? 171 ASN A O   1 
ATOM   647   C  CB  . ASN A  1  90  ? -6.473  10.488  201.010  1.00 76.58  ? 171 ASN A CB  1 
ATOM   648   C  CG  . ASN A  1  90  ? -5.100  9.858   201.149  1.00 71.93  ? 171 ASN A CG  1 
ATOM   649   O  OD1 . ASN A  1  90  ? -4.946  8.644   201.039  1.00 72.92  ? 171 ASN A OD1 1 
ATOM   650   N  ND2 . ASN A  1  90  ? -4.091  10.686  201.386  1.00 73.86  ? 171 ASN A ND2 1 
ATOM   651   N  N   . LEU A  1  91  ? -8.125  8.255   199.291  1.00 91.50  ? 172 LEU A N   1 
ATOM   652   C  CA  . LEU A  1  91  ? -8.226  6.865   198.843  1.00 97.47  ? 172 LEU A CA  1 
ATOM   653   C  C   . LEU A  1  91  ? -8.385  6.782   197.329  1.00 96.29  ? 172 LEU A C   1 
ATOM   654   O  O   . LEU A  1  91  ? -8.089  5.756   196.719  1.00 88.31  ? 172 LEU A O   1 
ATOM   655   C  CB  . LEU A  1  91  ? -9.394  6.146   199.536  1.00 107.43 ? 172 LEU A CB  1 
ATOM   656   C  CG  . LEU A  1  91  ? -9.250  5.883   201.045  1.00 117.64 ? 172 LEU A CG  1 
ATOM   657   C  CD1 . LEU A  1  91  ? -10.442 5.064   201.546  1.00 112.64 ? 172 LEU A CD1 1 
ATOM   658   C  CD2 . LEU A  1  91  ? -7.942  5.139   201.325  1.00 114.52 ? 172 LEU A CD2 1 
ATOM   659   N  N   . GLN A  1  92  ? -8.865  7.864   196.728  1.00 103.81 ? 173 GLN A N   1 
ATOM   660   C  CA  . GLN A  1  92  ? -9.026  7.911   195.280  1.00 104.00 ? 173 GLN A CA  1 
ATOM   661   C  C   . GLN A  1  92  ? -7.613  8.044   194.749  1.00 100.59 ? 173 GLN A C   1 
ATOM   662   O  O   . GLN A  1  92  ? -7.113  7.176   194.037  1.00 98.10  ? 173 GLN A O   1 
ATOM   663   C  CB  . GLN A  1  92  ? -9.843  9.140   194.857  1.00 106.53 ? 173 GLN A CB  1 
ATOM   664   C  CG  . GLN A  1  92  ? -11.306 9.130   195.294  1.00 110.81 ? 173 GLN A CG  1 
ATOM   665   C  CD  . GLN A  1  92  ? -12.190 8.308   194.376  1.00 113.56 ? 173 GLN A CD  1 
ATOM   666   O  OE1 . GLN A  1  92  ? -11.924 7.130   194.131  1.00 113.59 ? 173 GLN A OE1 1 
ATOM   667   N  NE2 . GLN A  1  92  ? -13.253 8.927   193.862  1.00 111.34 ? 173 GLN A NE2 1 
ATOM   668   N  N   . LEU A  1  93  ? -6.974  9.144   195.138  1.00 98.32  ? 174 LEU A N   1 
ATOM   669   C  CA  . LEU A  1  93  ? -5.611  9.456   194.733  1.00 96.70  ? 174 LEU A CA  1 
ATOM   670   C  C   . LEU A  1  93  ? -4.677  8.267   194.964  1.00 91.98  ? 174 LEU A C   1 
ATOM   671   O  O   . LEU A  1  93  ? -3.880  7.910   194.097  1.00 87.87  ? 174 LEU A O   1 
ATOM   672   C  CB  . LEU A  1  93  ? -5.115  10.681  195.512  1.00 99.48  ? 174 LEU A CB  1 
ATOM   673   C  CG  . LEU A  1  93  ? -6.110  11.843  195.667  1.00 108.63 ? 174 LEU A CG  1 
ATOM   674   C  CD1 . LEU A  1  93  ? -5.422  13.024  196.351  1.00 105.08 ? 174 LEU A CD1 1 
ATOM   675   C  CD2 . LEU A  1  93  ? -6.654  12.258  194.302  1.00 104.63 ? 174 LEU A CD2 1 
ATOM   676   N  N   . GLU A  1  94  ? -4.782  7.657   196.138  1.00 93.17  ? 175 GLU A N   1 
ATOM   677   C  CA  . GLU A  1  94  ? -3.958  6.507   196.484  1.00 87.05  ? 175 GLU A CA  1 
ATOM   678   C  C   . GLU A  1  94  ? -4.169  5.407   195.472  1.00 82.38  ? 175 GLU A C   1 
ATOM   679   O  O   . GLU A  1  94  ? -3.269  4.596   195.231  1.00 60.76  ? 175 GLU A O   1 
ATOM   680   C  CB  . GLU A  1  94  ? -4.325  5.994   197.881  1.00 99.84  ? 175 GLU A CB  1 
ATOM   681   C  CG  . GLU A  1  94  ? -4.300  4.465   198.045  1.00 110.33 ? 175 GLU A CG  1 
ATOM   682   C  CD  . GLU A  1  94  ? -5.576  3.778   197.551  1.00 114.39 ? 175 GLU A CD  1 
ATOM   683   O  OE1 . GLU A  1  94  ? -6.663  4.041   198.112  1.00 114.42 ? 175 GLU A OE1 1 
ATOM   684   O  OE2 . GLU A  1  94  ? -5.488  2.969   196.603  1.00 115.81 ? 175 GLU A OE2 1 
ATOM   685   N  N   . LYS A  1  95  ? -5.369  5.393   194.891  1.00 84.12  ? 176 LYS A N   1 
ATOM   686   C  CA  . LYS A  1  95  ? -5.743  4.384   193.909  1.00 91.99  ? 176 LYS A CA  1 
ATOM   687   C  C   . LYS A  1  95  ? -5.023  4.589   192.582  1.00 87.78  ? 176 LYS A C   1 
ATOM   688   O  O   . LYS A  1  95  ? -4.480  3.635   192.025  1.00 90.77  ? 176 LYS A O   1 
ATOM   689   C  CB  . LYS A  1  95  ? -7.263  4.371   193.703  1.00 94.00  ? 176 LYS A CB  1 
ATOM   690   C  CG  . LYS A  1  95  ? -7.829  2.984   193.387  1.00 98.47  ? 176 LYS A CG  1 
ATOM   691   C  CD  . LYS A  1  95  ? -7.449  1.965   194.471  1.00 101.31 ? 176 LYS A CD  1 
ATOM   692   C  CE  . LYS A  1  95  ? -8.003  0.573   194.178  1.00 100.12 ? 176 LYS A CE  1 
ATOM   693   N  NZ  . LYS A  1  95  ? -7.489  -0.466  195.123  1.00 83.77  ? 176 LYS A NZ  1 
ATOM   694   N  N   . ALA A  1  96  ? -5.017  5.813   192.061  1.00 77.31  ? 177 ALA A N   1 
ATOM   695   C  CA  . ALA A  1  96  ? -4.294  6.037   190.821  1.00 72.25  ? 177 ALA A CA  1 
ATOM   696   C  C   . ALA A  1  96  ? -2.867  5.597   191.140  1.00 78.09  ? 177 ALA A C   1 
ATOM   697   O  O   . ALA A  1  96  ? -2.398  4.585   190.620  1.00 82.76  ? 177 ALA A O   1 
ATOM   698   C  CB  . ALA A  1  96  ? -4.321  7.506   190.424  1.00 60.39  ? 177 ALA A CB  1 
ATOM   699   N  N   . ALA A  1  97  ? -2.208  6.328   192.043  1.00 81.05  ? 178 ALA A N   1 
ATOM   700   C  CA  . ALA A  1  97  ? -0.826  6.050   192.448  1.00 78.83  ? 178 ALA A CA  1 
ATOM   701   C  C   . ALA A  1  97  ? -0.445  4.574   192.493  1.00 82.49  ? 178 ALA A C   1 
ATOM   702   O  O   . ALA A  1  97  ? 0.725   4.227   192.338  1.00 90.71  ? 178 ALA A O   1 
ATOM   703   C  CB  . ALA A  1  97  ? -0.525  6.703   193.797  1.00 58.96  ? 178 ALA A CB  1 
ATOM   704   N  N   . SER A  1  98  ? -1.416  3.698   192.707  1.00 86.59  ? 179 SER A N   1 
ATOM   705   C  CA  . SER A  1  98  ? -1.113  2.273   192.745  1.00 87.25  ? 179 SER A CA  1 
ATOM   706   C  C   . SER A  1  98  ? -1.661  1.621   191.497  1.00 83.87  ? 179 SER A C   1 
ATOM   707   O  O   . SER A  1  98  ? -0.937  0.954   190.774  1.00 83.10  ? 179 SER A O   1 
ATOM   708   C  CB  . SER A  1  98  ? -1.738  1.615   193.975  1.00 96.31  ? 179 SER A CB  1 
ATOM   709   O  OG  . SER A  1  98  ? -3.147  1.534   193.843  1.00 106.08 ? 179 SER A OG  1 
ATOM   710   N  N   . TYR A  1  99  ? -2.951  1.820   191.250  1.00 93.79  ? 180 TYR A N   1 
ATOM   711   C  CA  . TYR A  1  99  ? -3.591  1.247   190.078  1.00 99.47  ? 180 TYR A CA  1 
ATOM   712   C  C   . TYR A  1  99  ? -2.859  1.666   188.820  1.00 94.54  ? 180 TYR A C   1 
ATOM   713   O  O   . TYR A  1  99  ? -2.639  0.843   187.930  1.00 84.28  ? 180 TYR A O   1 
ATOM   714   C  CB  . TYR A  1  99  ? -5.067  1.648   190.015  1.00 114.33 ? 180 TYR A CB  1 
ATOM   715   C  CG  . TYR A  1  99  ? -5.980  0.507   190.403  1.00 137.45 ? 180 TYR A CG  1 
ATOM   716   C  CD1 . TYR A  1  99  ? -5.792  -0.185  191.602  1.00 142.82 ? 180 TYR A CD1 1 
ATOM   717   C  CD2 . TYR A  1  99  ? -6.998  0.080   189.550  1.00 149.11 ? 180 TYR A CD2 1 
ATOM   718   C  CE1 . TYR A  1  99  ? -6.592  -1.281  191.938  1.00 152.61 ? 180 TYR A CE1 1 
ATOM   719   C  CE2 . TYR A  1  99  ? -7.806  -1.013  189.877  1.00 155.74 ? 180 TYR A CE2 1 
ATOM   720   C  CZ  . TYR A  1  99  ? -7.596  -1.689  191.069  1.00 156.10 ? 180 TYR A CZ  1 
ATOM   721   O  OH  . TYR A  1  99  ? -8.382  -2.775  191.383  1.00 153.94 ? 180 TYR A OH  1 
ATOM   722   N  N   . ILE A  1  100 ? -2.478  2.938   188.741  1.00 92.68  ? 181 ILE A N   1 
ATOM   723   C  CA  . ILE A  1  100 ? -1.726  3.394   187.586  1.00 90.89  ? 181 ILE A CA  1 
ATOM   724   C  C   . ILE A  1  100 ? -0.357  2.721   187.747  1.00 93.63  ? 181 ILE A C   1 
ATOM   725   O  O   . ILE A  1  100 ? 0.648   3.354   188.069  1.00 85.71  ? 181 ILE A O   1 
ATOM   726   C  CB  . ILE A  1  100 ? -1.595  4.964   187.526  1.00 88.65  ? 181 ILE A CB  1 
ATOM   727   C  CG1 . ILE A  1  100 ? -0.635  5.488   188.599  1.00 76.42  ? 181 ILE A CG1 1 
ATOM   728   C  CG2 . ILE A  1  100 ? -2.974  5.610   187.684  1.00 81.80  ? 181 ILE A CG2 1 
ATOM   729   C  CD1 . ILE A  1  100 ? 0.648   6.074   188.046  1.00 60.76  ? 181 ILE A CD1 1 
ATOM   730   N  N   . ALA A  1  101 ? -0.347  1.409   187.529  1.00 94.98  ? 182 ALA A N   1 
ATOM   731   C  CA  . ALA A  1  101 ? 0.862   0.606   187.639  1.00 97.25  ? 182 ALA A CA  1 
ATOM   732   C  C   . ALA A  1  101 ? 1.581   0.480   186.290  1.00 102.88 ? 182 ALA A C   1 
ATOM   733   O  O   . ALA A  1  101 ? 2.197   -0.549  185.999  1.00 106.30 ? 182 ALA A O   1 
ATOM   734   C  CB  . ALA A  1  101 ? 0.514   -0.778  188.185  1.00 92.16  ? 182 ALA A CB  1 
ATOM   735   N  N   . ASN A  1  102 ? 1.502   1.529   185.471  1.00 101.53 ? 183 ASN A N   1 
ATOM   736   C  CA  . ASN A  1  102 ? 2.155   1.540   184.166  1.00 101.08 ? 183 ASN A CA  1 
ATOM   737   C  C   . ASN A  1  102 ? 3.659   1.381   184.394  1.00 102.09 ? 183 ASN A C   1 
ATOM   738   O  O   . ASN A  1  102 ? 4.447   1.265   183.449  1.00 100.53 ? 183 ASN A O   1 
ATOM   739   C  CB  . ASN A  1  102 ? 1.888   2.870   183.442  1.00 107.56 ? 183 ASN A CB  1 
ATOM   740   C  CG  . ASN A  1  102 ? 0.402   3.185   183.301  1.00 107.78 ? 183 ASN A CG  1 
ATOM   741   O  OD1 . ASN A  1  102 ? -0.392  2.339   182.888  1.00 108.30 ? 183 ASN A OD1 1 
ATOM   742   N  ND2 . ASN A  1  102 ? 0.026   4.417   183.628  1.00 103.23 ? 183 ASN A ND2 1 
ATOM   743   N  N   . LEU A  1  103 ? 4.032   1.375   185.670  1.00 100.34 ? 184 LEU A N   1 
ATOM   744   C  CA  . LEU A  1  103 ? 5.413   1.257   186.120  1.00 98.97  ? 184 LEU A CA  1 
ATOM   745   C  C   . LEU A  1  103 ? 6.128   -0.007  185.675  1.00 110.26 ? 184 LEU A C   1 
ATOM   746   O  O   . LEU A  1  103 ? 7.313   0.038   185.349  1.00 113.73 ? 184 LEU A O   1 
ATOM   747   C  CB  . LEU A  1  103 ? 5.451   1.352   187.641  1.00 72.04  ? 184 LEU A CB  1 
ATOM   748   C  CG  . LEU A  1  103 ? 4.593   2.523   188.118  1.00 70.41  ? 184 LEU A CG  1 
ATOM   749   C  CD1 . LEU A  1  103 ? 4.625   2.603   189.638  1.00 70.67  ? 184 LEU A CD1 1 
ATOM   750   C  CD2 . LEU A  1  103 ? 5.086   3.818   187.477  1.00 42.57  ? 184 LEU A CD2 1 
ATOM   751   N  N   . LYS A  1  104 ? 5.422   -1.134  185.679  1.00 124.05 ? 185 LYS A N   1 
ATOM   752   C  CA  . LYS A  1  104 ? 6.026   -2.395  185.259  1.00 134.00 ? 185 LYS A CA  1 
ATOM   753   C  C   . LYS A  1  104 ? 6.919   -2.171  184.038  1.00 138.57 ? 185 LYS A C   1 
ATOM   754   O  O   . LYS A  1  104 ? 8.109   -2.495  184.064  1.00 145.15 ? 185 LYS A O   1 
ATOM   755   C  CB  . LYS A  1  104 ? 4.949   -3.431  184.903  1.00 134.99 ? 185 LYS A CB  1 
ATOM   756   C  CG  . LYS A  1  104 ? 4.466   -4.312  186.050  1.00 132.93 ? 185 LYS A CG  1 
ATOM   757   C  CD  . LYS A  1  104 ? 3.568   -5.423  185.508  1.00 129.61 ? 185 LYS A CD  1 
ATOM   758   C  CE  . LYS A  1  104 ? 3.133   -6.398  186.588  1.00 128.36 ? 185 LYS A CE  1 
ATOM   759   N  NZ  . LYS A  1  104 ? 2.278   -7.480  186.019  1.00 126.41 ? 185 LYS A NZ  1 
ATOM   760   N  N   . PHE A  1  105 ? 6.326   -1.605  182.986  1.00 135.99 ? 186 PHE A N   1 
ATOM   761   C  CA  . PHE A  1  105 ? 6.994   -1.317  181.714  1.00 133.67 ? 186 PHE A CA  1 
ATOM   762   C  C   . PHE A  1  105 ? 8.517   -1.493  181.688  1.00 134.64 ? 186 PHE A C   1 
ATOM   763   O  O   . PHE A  1  105 ? 9.234   -0.896  182.490  1.00 138.56 ? 186 PHE A O   1 
ATOM   764   C  CB  . PHE A  1  105 ? 6.652   0.100   181.260  1.00 129.97 ? 186 PHE A CB  1 
ATOM   765   C  CG  . PHE A  1  105 ? 7.169   0.426   179.897  1.00 133.69 ? 186 PHE A CG  1 
ATOM   766   C  CD1 . PHE A  1  105 ? 6.686   -0.251  178.779  1.00 138.45 ? 186 PHE A CD1 1 
ATOM   767   C  CD2 . PHE A  1  105 ? 8.153   1.390   179.723  1.00 134.60 ? 186 PHE A CD2 1 
ATOM   768   C  CE1 . PHE A  1  105 ? 7.173   0.027   177.502  1.00 138.05 ? 186 PHE A CE1 1 
ATOM   769   C  CE2 . PHE A  1  105 ? 8.649   1.674   178.452  1.00 141.31 ? 186 PHE A CE2 1 
ATOM   770   C  CZ  . PHE A  1  105 ? 8.155   0.990   177.339  1.00 141.49 ? 186 PHE A CZ  1 
ATOM   771   N  N   . GLU A  1  106 ? 9.009   -2.301  180.751  1.00 131.25 ? 187 GLU A N   1 
ATOM   772   C  CA  . GLU A  1  106 ? 10.444  -2.537  180.645  1.00 128.06 ? 187 GLU A CA  1 
ATOM   773   C  C   . GLU A  1  106 ? 10.842  -3.282  179.367  1.00 130.35 ? 187 GLU A C   1 
ATOM   774   O  O   . GLU A  1  106 ? 10.693  -4.504  179.265  1.00 128.80 ? 187 GLU A O   1 
ATOM   775   C  CB  . GLU A  1  106 ? 10.928  -3.308  181.875  1.00 122.71 ? 187 GLU A CB  1 
ATOM   776   C  CG  . GLU A  1  106 ? 12.423  -3.550  181.916  1.00 123.35 ? 187 GLU A CG  1 
ATOM   777   C  CD  . GLU A  1  106 ? 12.864  -4.192  183.213  1.00 121.70 ? 187 GLU A CD  1 
ATOM   778   O  OE1 . GLU A  1  106 ? 12.643  -3.577  184.279  1.00 122.98 ? 187 GLU A OE1 1 
ATOM   779   O  OE2 . GLU A  1  106 ? 13.428  -5.307  183.167  1.00 113.79 ? 187 GLU A OE2 1 
ATOM   780   N  N   . ARG A  1  107 ? 11.353  -2.520  178.402  1.00 131.41 ? 188 ARG A N   1 
ATOM   781   C  CA  . ARG A  1  107 ? 11.802  -3.032  177.107  1.00 131.42 ? 188 ARG A CA  1 
ATOM   782   C  C   . ARG A  1  107 ? 12.889  -4.098  177.232  1.00 134.32 ? 188 ARG A C   1 
ATOM   783   O  O   . ARG A  1  107 ? 13.164  -4.587  178.328  1.00 136.03 ? 188 ARG A O   1 
ATOM   784   C  CB  . ARG A  1  107 ? 12.324  -1.875  176.261  1.00 126.81 ? 188 ARG A CB  1 
ATOM   785   C  CG  . ARG A  1  107 ? 13.261  -0.944  177.023  1.00 125.12 ? 188 ARG A CG  1 
ATOM   786   C  CD  . ARG A  1  107 ? 12.535  -0.138  178.108  1.00 117.65 ? 188 ARG A CD  1 
ATOM   787   N  NE  . ARG A  1  107 ? 12.059  1.158   177.630  1.00 124.40 ? 188 ARG A NE  1 
ATOM   788   C  CZ  . ARG A  1  107 ? 11.152  1.328   176.671  1.00 125.57 ? 188 ARG A CZ  1 
ATOM   789   N  NH1 . ARG A  1  107 ? 10.604  0.280   176.072  1.00 125.71 ? 188 ARG A NH1 1 
ATOM   790   N  NH2 . ARG A  1  107 ? 10.793  2.555   176.309  1.00 124.09 ? 188 ARG A NH2 1 
ATOM   791   N  N   . PHE A  1  108 ? 13.507  -4.461  176.112  1.00 134.59 ? 189 PHE A N   1 
ATOM   792   C  CA  . PHE A  1  108 ? 14.549  -5.481  176.142  1.00 140.27 ? 189 PHE A CA  1 
ATOM   793   C  C   . PHE A  1  108 ? 15.804  -5.136  175.355  1.00 143.24 ? 189 PHE A C   1 
ATOM   794   O  O   . PHE A  1  108 ? 16.916  -5.394  175.818  1.00 144.03 ? 189 PHE A O   1 
ATOM   795   C  CB  . PHE A  1  108 ? 13.996  -6.819  175.651  1.00 141.05 ? 189 PHE A CB  1 
ATOM   796   C  CG  . PHE A  1  108 ? 12.933  -7.391  176.537  1.00 146.18 ? 189 PHE A CG  1 
ATOM   797   C  CD1 . PHE A  1  108 ? 11.647  -6.857  176.539  1.00 150.62 ? 189 PHE A CD1 1 
ATOM   798   C  CD2 . PHE A  1  108 ? 13.225  -8.443  177.397  1.00 144.19 ? 189 PHE A CD2 1 
ATOM   799   C  CE1 . PHE A  1  108 ? 10.666  -7.361  177.388  1.00 150.50 ? 189 PHE A CE1 1 
ATOM   800   C  CE2 . PHE A  1  108 ? 12.253  -8.955  178.250  1.00 148.48 ? 189 PHE A CE2 1 
ATOM   801   C  CZ  . PHE A  1  108 ? 10.969  -8.412  178.246  1.00 151.43 ? 189 PHE A CZ  1 
ATOM   802   N  N   . GLU A  1  109 ? 15.634  -4.565  174.165  1.00 147.54 ? 190 GLU A N   1 
ATOM   803   C  CA  . GLU A  1  109 ? 16.781  -4.191  173.342  1.00 150.52 ? 190 GLU A CA  1 
ATOM   804   C  C   . GLU A  1  109 ? 17.634  -3.212  174.130  1.00 154.46 ? 190 GLU A C   1 
ATOM   805   O  O   . GLU A  1  109 ? 18.736  -2.842  173.719  1.00 154.23 ? 190 GLU A O   1 
ATOM   806   C  CB  . GLU A  1  109 ? 16.321  -3.559  172.029  1.00 147.75 ? 190 GLU A CB  1 
ATOM   807   C  CG  . GLU A  1  109 ? 15.301  -2.456  172.191  1.00 143.73 ? 190 GLU A CG  1 
ATOM   808   C  CD  . GLU A  1  109 ? 14.841  -1.916  170.859  1.00 141.67 ? 190 GLU A CD  1 
ATOM   809   O  OE1 . GLU A  1  109 ? 14.463  -2.734  169.997  1.00 142.00 ? 190 GLU A OE1 1 
ATOM   810   O  OE2 . GLU A  1  109 ? 14.854  -0.682  170.671  1.00 142.21 ? 190 GLU A OE2 1 
ATOM   811   N  N   . GLU A  1  110 ? 17.087  -2.794  175.267  1.00 156.82 ? 191 GLU A N   1 
ATOM   812   C  CA  . GLU A  1  110 ? 17.750  -1.889  176.194  1.00 157.09 ? 191 GLU A CA  1 
ATOM   813   C  C   . GLU A  1  110 ? 19.144  -2.460  176.438  1.00 156.92 ? 191 GLU A C   1 
ATOM   814   O  O   . GLU A  1  110 ? 20.130  -1.728  176.550  1.00 154.62 ? 191 GLU A O   1 
ATOM   815   C  CB  . GLU A  1  110 ? 16.974  -1.879  177.509  1.00 158.42 ? 191 GLU A CB  1 
ATOM   816   C  CG  . GLU A  1  110 ? 16.735  -3.296  178.036  1.00 162.34 ? 191 GLU A CG  1 
ATOM   817   C  CD  . GLU A  1  110 ? 15.957  -3.344  179.331  1.00 165.11 ? 191 GLU A CD  1 
ATOM   818   O  OE1 . GLU A  1  110 ? 14.795  -2.889  179.347  1.00 168.39 ? 191 GLU A OE1 1 
ATOM   819   O  OE2 . GLU A  1  110 ? 16.507  -3.842  180.335  1.00 165.82 ? 191 GLU A OE2 1 
ATOM   820   N  N   . VAL A  1  111 ? 19.196  -3.787  176.508  1.00 155.69 ? 192 VAL A N   1 
ATOM   821   C  CA  . VAL A  1  111 ? 20.427  -4.528  176.750  1.00 152.11 ? 192 VAL A CA  1 
ATOM   822   C  C   . VAL A  1  111 ? 21.139  -4.855  175.439  1.00 146.14 ? 192 VAL A C   1 
ATOM   823   O  O   . VAL A  1  111 ? 20.582  -4.681  174.354  1.00 146.43 ? 192 VAL A O   1 
ATOM   824   C  CB  . VAL A  1  111 ? 20.126  -5.859  177.490  1.00 155.93 ? 192 VAL A CB  1 
ATOM   825   C  CG1 . VAL A  1  111 ? 21.408  -6.443  178.072  1.00 158.06 ? 192 VAL A CG1 1 
ATOM   826   C  CG2 . VAL A  1  111 ? 19.088  -5.628  178.580  1.00 155.98 ? 192 VAL A CG2 1 
ATOM   827   N  N   . VAL A  1  112 ? 22.377  -5.328  175.559  1.00 138.28 ? 193 VAL A N   1 
ATOM   828   C  CA  . VAL A  1  112 ? 23.195  -5.709  174.413  1.00 125.37 ? 193 VAL A CA  1 
ATOM   829   C  C   . VAL A  1  112 ? 23.224  -7.240  174.327  1.00 125.16 ? 193 VAL A C   1 
ATOM   830   O  O   . VAL A  1  112 ? 22.706  -7.785  173.325  1.00 121.59 ? 193 VAL A O   1 
ATOM   831   C  CB  . VAL A  1  112 ? 24.644  -5.145  174.560  1.00 115.87 ? 193 VAL A CB  1 
ATOM   832   C  CG1 . VAL A  1  112 ? 25.558  -5.716  173.489  1.00 103.97 ? 193 VAL A CG1 1 
ATOM   833   C  CG2 . VAL A  1  112 ? 24.617  -3.627  174.457  1.00 103.66 ? 193 VAL A CG2 1 
ATOM   834   N  N   . ALA B  2  7   ? 19.206  3.661   160.593  1.00 124.28 ? 163 ALA B N   1 
ATOM   835   C  CA  . ALA B  2  7   ? 19.402  4.975   159.914  1.00 125.92 ? 163 ALA B CA  1 
ATOM   836   C  C   . ALA B  2  7   ? 18.831  6.127   160.748  1.00 123.89 ? 163 ALA B C   1 
ATOM   837   O  O   . ALA B  2  7   ? 18.904  6.114   161.977  1.00 118.05 ? 163 ALA B O   1 
ATOM   838   C  CB  . ALA B  2  7   ? 18.748  4.945   158.525  1.00 122.66 ? 163 ALA B CB  1 
ATOM   839   N  N   . GLN B  2  8   ? 18.267  7.123   160.075  1.00 127.07 ? 164 GLN B N   1 
ATOM   840   C  CA  . GLN B  2  8   ? 17.694  8.265   160.767  1.00 128.35 ? 164 GLN B CA  1 
ATOM   841   C  C   . GLN B  2  8   ? 16.400  7.900   161.476  1.00 132.01 ? 164 GLN B C   1 
ATOM   842   O  O   . GLN B  2  8   ? 16.283  8.084   162.685  1.00 133.60 ? 164 GLN B O   1 
ATOM   843   C  CB  . GLN B  2  8   ? 17.425  9.411   159.793  1.00 129.74 ? 164 GLN B CB  1 
ATOM   844   C  CG  . GLN B  2  8   ? 16.785  10.617  160.463  1.00 129.76 ? 164 GLN B CG  1 
ATOM   845   C  CD  . GLN B  2  8   ? 16.518  11.752  159.501  1.00 132.26 ? 164 GLN B CD  1 
ATOM   846   O  OE1 . GLN B  2  8   ? 17.433  12.265  158.858  1.00 137.56 ? 164 GLN B OE1 1 
ATOM   847   N  NE2 . GLN B  2  8   ? 15.258  12.156  159.399  1.00 130.38 ? 164 GLN B NE2 1 
ATOM   848   N  N   . LYS B  2  9   ? 15.424  7.392   160.727  1.00 136.23 ? 165 LYS B N   1 
ATOM   849   C  CA  . LYS B  2  9   ? 14.147  7.018   161.326  1.00 138.61 ? 165 LYS B CA  1 
ATOM   850   C  C   . LYS B  2  9   ? 14.327  5.960   162.399  1.00 140.28 ? 165 LYS B C   1 
ATOM   851   O  O   . LYS B  2  9   ? 13.538  5.887   163.339  1.00 141.11 ? 165 LYS B O   1 
ATOM   852   C  CB  . LYS B  2  9   ? 13.162  6.523   160.268  1.00 137.96 ? 165 LYS B CB  1 
ATOM   853   C  CG  . LYS B  2  9   ? 12.638  7.628   159.361  1.00 142.12 ? 165 LYS B CG  1 
ATOM   854   C  CD  . LYS B  2  9   ? 11.315  7.237   158.720  1.00 135.86 ? 165 LYS B CD  1 
ATOM   855   C  CE  . LYS B  2  9   ? 10.242  7.022   159.774  1.00 130.66 ? 165 LYS B CE  1 
ATOM   856   N  NZ  . LYS B  2  9   ? 8.944   6.618   159.176  1.00 123.98 ? 165 LYS B NZ  1 
ATOM   857   N  N   . GLU B  2  10  ? 15.362  5.137   162.258  1.00 141.04 ? 166 GLU B N   1 
ATOM   858   C  CA  . GLU B  2  10  ? 15.646  4.114   163.257  1.00 141.47 ? 166 GLU B CA  1 
ATOM   859   C  C   . GLU B  2  10  ? 15.827  4.834   164.592  1.00 137.32 ? 166 GLU B C   1 
ATOM   860   O  O   . GLU B  2  10  ? 15.502  4.303   165.653  1.00 133.06 ? 166 GLU B O   1 
ATOM   861   C  CB  . GLU B  2  10  ? 16.923  3.357   162.895  1.00 148.31 ? 166 GLU B CB  1 
ATOM   862   C  CG  . GLU B  2  10  ? 17.481  2.512   164.025  1.00 152.04 ? 166 GLU B CG  1 
ATOM   863   C  CD  . GLU B  2  10  ? 18.694  1.714   163.603  1.00 156.18 ? 166 GLU B CD  1 
ATOM   864   O  OE1 . GLU B  2  10  ? 19.621  2.306   163.005  1.00 155.10 ? 166 GLU B OE1 1 
ATOM   865   O  OE2 . GLU B  2  10  ? 18.722  0.495   163.875  1.00 159.12 ? 166 GLU B OE2 1 
ATOM   866   N  N   . ILE B  2  11  ? 16.361  6.049   164.518  1.00 133.79 ? 167 ILE B N   1 
ATOM   867   C  CA  . ILE B  2  11  ? 16.562  6.876   165.697  1.00 126.25 ? 167 ILE B CA  1 
ATOM   868   C  C   . ILE B  2  11  ? 15.225  7.527   166.030  1.00 128.42 ? 167 ILE B C   1 
ATOM   869   O  O   . ILE B  2  11  ? 14.760  7.447   167.164  1.00 131.96 ? 167 ILE B O   1 
ATOM   870   C  CB  . ILE B  2  11  ? 17.621  7.980   165.447  1.00 122.87 ? 167 ILE B CB  1 
ATOM   871   C  CG1 . ILE B  2  11  ? 19.025  7.381   165.536  1.00 119.35 ? 167 ILE B CG1 1 
ATOM   872   C  CG2 . ILE B  2  11  ? 17.453  9.113   166.450  1.00 117.25 ? 167 ILE B CG2 1 
ATOM   873   C  CD1 . ILE B  2  11  ? 20.142  8.406   165.427  1.00 110.07 ? 167 ILE B CD1 1 
ATOM   874   N  N   . GLU B  2  12  ? 14.606  8.164   165.037  1.00 127.82 ? 168 GLU B N   1 
ATOM   875   C  CA  . GLU B  2  12  ? 13.314  8.813   165.241  1.00 128.14 ? 168 GLU B CA  1 
ATOM   876   C  C   . GLU B  2  12  ? 12.303  7.860   165.879  1.00 127.15 ? 168 GLU B C   1 
ATOM   877   O  O   . GLU B  2  12  ? 11.279  8.294   166.411  1.00 127.62 ? 168 GLU B O   1 
ATOM   878   C  CB  . GLU B  2  12  ? 12.755  9.334   163.916  1.00 133.22 ? 168 GLU B CB  1 
ATOM   879   C  CG  . GLU B  2  12  ? 13.472  10.554  163.370  1.00 143.82 ? 168 GLU B CG  1 
ATOM   880   C  CD  . GLU B  2  12  ? 12.735  11.183  162.199  1.00 152.11 ? 168 GLU B CD  1 
ATOM   881   O  OE1 . GLU B  2  12  ? 12.570  10.504  161.163  1.00 156.52 ? 168 GLU B OE1 1 
ATOM   882   O  OE2 . GLU B  2  12  ? 12.318  12.356  162.315  1.00 151.80 ? 168 GLU B OE2 1 
ATOM   883   N  N   . ASN B  2  13  ? 12.588  6.563   165.815  1.00 124.32 ? 169 ASN B N   1 
ATOM   884   C  CA  . ASN B  2  13  ? 11.714  5.560   166.411  1.00 118.69 ? 169 ASN B CA  1 
ATOM   885   C  C   . ASN B  2  13  ? 12.070  5.452   167.892  1.00 113.64 ? 169 ASN B C   1 
ATOM   886   O  O   . ASN B  2  13  ? 11.262  5.780   168.762  1.00 108.82 ? 169 ASN B O   1 
ATOM   887   C  CB  . ASN B  2  13  ? 11.904  4.203   165.723  1.00 118.51 ? 169 ASN B CB  1 
ATOM   888   C  CG  . ASN B  2  13  ? 11.549  4.240   164.244  1.00 112.52 ? 169 ASN B CG  1 
ATOM   889   O  OD1 . ASN B  2  13  ? 10.499  4.755   163.858  1.00 105.81 ? 169 ASN B OD1 1 
ATOM   890   N  ND2 . ASN B  2  13  ? 12.422  3.682   163.411  1.00 109.09 ? 169 ASN B ND2 1 
ATOM   891   N  N   . ARG B  2  14  ? 13.291  4.996   168.161  1.00 110.89 ? 170 ARG B N   1 
ATOM   892   C  CA  . ARG B  2  14  ? 13.802  4.853   169.524  1.00 111.07 ? 170 ARG B CA  1 
ATOM   893   C  C   . ARG B  2  14  ? 13.474  6.081   170.373  1.00 104.95 ? 170 ARG B C   1 
ATOM   894   O  O   . ARG B  2  14  ? 12.861  5.965   171.429  1.00 98.69  ? 170 ARG B O   1 
ATOM   895   C  CB  . ARG B  2  14  ? 15.321  4.647   169.491  1.00 118.37 ? 170 ARG B CB  1 
ATOM   896   C  CG  . ARG B  2  14  ? 15.783  3.195   169.394  1.00 121.32 ? 170 ARG B CG  1 
ATOM   897   C  CD  . ARG B  2  14  ? 15.979  2.605   170.784  1.00 128.78 ? 170 ARG B CD  1 
ATOM   898   N  NE  . ARG B  2  14  ? 16.640  1.302   170.764  1.00 132.35 ? 170 ARG B NE  1 
ATOM   899   C  CZ  . ARG B  2  14  ? 17.037  0.652   171.856  1.00 136.32 ? 170 ARG B CZ  1 
ATOM   900   N  NH1 . ARG B  2  14  ? 16.839  1.185   173.057  1.00 140.12 ? 170 ARG B NH1 1 
ATOM   901   N  NH2 . ARG B  2  14  ? 17.630  -0.531  171.751  1.00 134.76 ? 170 ARG B NH2 1 
ATOM   902   N  N   . TYR B  2  15  ? 13.894  7.253   169.904  1.00 101.65 ? 171 TYR B N   1 
ATOM   903   C  CA  . TYR B  2  15  ? 13.641  8.510   170.602  1.00 103.83 ? 171 TYR B CA  1 
ATOM   904   C  C   . TYR B  2  15  ? 12.155  8.763   170.824  1.00 107.48 ? 171 TYR B C   1 
ATOM   905   O  O   . TYR B  2  15  ? 11.753  9.307   171.853  1.00 110.99 ? 171 TYR B O   1 
ATOM   906   C  CB  . TYR B  2  15  ? 14.217  9.677   169.805  1.00 98.56  ? 171 TYR B CB  1 
ATOM   907   C  CG  . TYR B  2  15  ? 13.495  10.990  170.031  1.00 97.05  ? 171 TYR B CG  1 
ATOM   908   C  CD1 . TYR B  2  15  ? 13.785  11.792  171.130  1.00 97.84  ? 171 TYR B CD1 1 
ATOM   909   C  CD2 . TYR B  2  15  ? 12.516  11.428  169.141  1.00 94.80  ? 171 TYR B CD2 1 
ATOM   910   C  CE1 . TYR B  2  15  ? 13.119  13.003  171.332  1.00 103.96 ? 171 TYR B CE1 1 
ATOM   911   C  CE2 . TYR B  2  15  ? 11.846  12.630  169.334  1.00 94.04  ? 171 TYR B CE2 1 
ATOM   912   C  CZ  . TYR B  2  15  ? 12.151  13.414  170.427  1.00 100.50 ? 171 TYR B CZ  1 
ATOM   913   O  OH  . TYR B  2  15  ? 11.501  14.616  170.605  1.00 99.36  ? 171 TYR B OH  1 
ATOM   914   N  N   . LYS B  2  16  ? 11.338  8.390   169.848  1.00 107.88 ? 172 LYS B N   1 
ATOM   915   C  CA  . LYS B  2  16  ? 9.909   8.606   169.973  1.00 114.60 ? 172 LYS B CA  1 
ATOM   916   C  C   . LYS B  2  16  ? 9.372   7.918   171.225  1.00 114.82 ? 172 LYS B C   1 
ATOM   917   O  O   . LYS B  2  16  ? 8.844   8.576   172.121  1.00 112.57 ? 172 LYS B O   1 
ATOM   918   C  CB  . LYS B  2  16  ? 9.172   8.073   168.739  1.00 122.90 ? 172 LYS B CB  1 
ATOM   919   C  CG  . LYS B  2  16  ? 8.021   8.961   168.237  1.00 128.14 ? 172 LYS B CG  1 
ATOM   920   C  CD  . LYS B  2  16  ? 7.112   9.452   169.364  1.00 125.16 ? 172 LYS B CD  1 
ATOM   921   C  CE  . LYS B  2  16  ? 7.701   10.674  170.062  1.00 127.34 ? 172 LYS B CE  1 
ATOM   922   N  NZ  . LYS B  2  16  ? 7.038   10.957  171.359  1.00 126.07 ? 172 LYS B NZ  1 
ATOM   923   N  N   . GLU B  2  17  ? 9.530   6.597   171.281  1.00 115.38 ? 173 GLU B N   1 
ATOM   924   C  CA  . GLU B  2  17  ? 9.049   5.789   172.402  1.00 114.83 ? 173 GLU B CA  1 
ATOM   925   C  C   . GLU B  2  17  ? 9.664   6.094   173.776  1.00 108.62 ? 173 GLU B C   1 
ATOM   926   O  O   . GLU B  2  17  ? 9.276   5.493   174.780  1.00 107.14 ? 173 GLU B O   1 
ATOM   927   C  CB  . GLU B  2  17  ? 9.215   4.297   172.070  1.00 120.44 ? 173 GLU B CB  1 
ATOM   928   C  CG  . GLU B  2  17  ? 10.598  3.918   171.562  1.00 135.35 ? 173 GLU B CG  1 
ATOM   929   C  CD  . GLU B  2  17  ? 10.683  2.470   171.108  1.00 143.06 ? 173 GLU B CD  1 
ATOM   930   O  OE1 . GLU B  2  17  ? 10.513  1.565   171.951  1.00 145.74 ? 173 GLU B OE1 1 
ATOM   931   O  OE2 . GLU B  2  17  ? 10.922  2.238   169.904  1.00 147.99 ? 173 GLU B OE2 1 
ATOM   932   N  N   . VAL B  2  18  ? 10.611  7.026   173.829  1.00 98.59  ? 174 VAL B N   1 
ATOM   933   C  CA  . VAL B  2  18  ? 11.232  7.385   175.098  1.00 90.10  ? 174 VAL B CA  1 
ATOM   934   C  C   . VAL B  2  18  ? 10.598  8.662   175.636  1.00 91.93  ? 174 VAL B C   1 
ATOM   935   O  O   . VAL B  2  18  ? 10.202  8.716   176.801  1.00 97.71  ? 174 VAL B O   1 
ATOM   936   C  CB  . VAL B  2  18  ? 12.761  7.580   174.954  1.00 83.30  ? 174 VAL B CB  1 
ATOM   937   C  CG1 . VAL B  2  18  ? 13.356  8.086   176.254  1.00 87.31  ? 174 VAL B CG1 1 
ATOM   938   C  CG2 . VAL B  2  18  ? 13.410  6.264   174.602  1.00 80.45  ? 174 VAL B CG2 1 
ATOM   939   N  N   . LYS B  2  19  ? 10.490  9.685   174.793  1.00 89.18  ? 175 LYS B N   1 
ATOM   940   C  CA  . LYS B  2  19  ? 9.882   10.945  175.218  1.00 85.77  ? 175 LYS B CA  1 
ATOM   941   C  C   . LYS B  2  19  ? 8.533   10.637  175.860  1.00 82.94  ? 175 LYS B C   1 
ATOM   942   O  O   . LYS B  2  19  ? 8.056   11.373  176.724  1.00 77.80  ? 175 LYS B O   1 
ATOM   943   C  CB  . LYS B  2  19  ? 9.686   11.876  174.019  1.00 83.36  ? 175 LYS B CB  1 
ATOM   944   C  CG  . LYS B  2  19  ? 9.489   13.337  174.398  1.00 75.90  ? 175 LYS B CG  1 
ATOM   945   C  CD  . LYS B  2  19  ? 9.413   14.209  173.154  1.00 82.83  ? 175 LYS B CD  1 
ATOM   946   C  CE  . LYS B  2  19  ? 9.644   15.692  173.464  1.00 87.73  ? 175 LYS B CE  1 
ATOM   947   N  NZ  . LYS B  2  19  ? 8.586   16.320  174.308  1.00 82.86  ? 175 LYS B NZ  1 
ATOM   948   N  N   . ILE B  2  20  ? 7.926   9.541   175.412  1.00 84.11  ? 176 ILE B N   1 
ATOM   949   C  CA  . ILE B  2  20  ? 6.649   9.071   175.932  1.00 83.40  ? 176 ILE B CA  1 
ATOM   950   C  C   . ILE B  2  20  ? 6.857   8.792   177.412  1.00 82.61  ? 176 ILE B C   1 
ATOM   951   O  O   . ILE B  2  20  ? 6.556   9.617   178.274  1.00 82.21  ? 176 ILE B O   1 
ATOM   952   C  CB  . ILE B  2  20  ? 6.243   7.728   175.302  1.00 87.65  ? 176 ILE B CB  1 
ATOM   953   C  CG1 . ILE B  2  20  ? 6.256   7.822   173.783  1.00 101.84 ? 176 ILE B CG1 1 
ATOM   954   C  CG2 . ILE B  2  20  ? 4.881   7.315   175.803  1.00 94.40  ? 176 ILE B CG2 1 
ATOM   955   C  CD1 . ILE B  2  20  ? 5.894   6.506   173.100  1.00 105.30 ? 176 ILE B CD1 1 
ATOM   956   N  N   . ARG B  2  21  ? 7.388   7.603   177.678  1.00 77.56  ? 177 ARG B N   1 
ATOM   957   C  CA  . ARG B  2  21  ? 7.662   7.135   179.021  1.00 77.23  ? 177 ARG B CA  1 
ATOM   958   C  C   . ARG B  2  21  ? 8.163   8.225   179.945  1.00 76.97  ? 177 ARG B C   1 
ATOM   959   O  O   . ARG B  2  21  ? 7.668   8.377   181.059  1.00 78.51  ? 177 ARG B O   1 
ATOM   960   C  CB  . ARG B  2  21  ? 8.669   5.987   178.963  1.00 85.34  ? 177 ARG B CB  1 
ATOM   961   C  CG  . ARG B  2  21  ? 8.121   4.758   178.265  1.00 98.94  ? 177 ARG B CG  1 
ATOM   962   C  CD  . ARG B  2  21  ? 6.858   4.283   178.967  1.00 114.59 ? 177 ARG B CD  1 
ATOM   963   N  NE  . ARG B  2  21  ? 6.202   3.174   178.282  1.00 130.79 ? 177 ARG B NE  1 
ATOM   964   C  CZ  . ARG B  2  21  ? 5.114   2.554   178.732  1.00 140.17 ? 177 ARG B CZ  1 
ATOM   965   N  NH1 . ARG B  2  21  ? 4.550   2.929   179.873  1.00 142.85 ? 177 ARG B NH1 1 
ATOM   966   N  NH2 . ARG B  2  21  ? 4.591   1.550   178.041  1.00 144.76 ? 177 ARG B NH2 1 
ATOM   967   N  N   . ILE B  2  22  ? 9.136   8.997   179.486  1.00 75.42  ? 178 ILE B N   1 
ATOM   968   C  CA  . ILE B  2  22  ? 9.677   10.063  180.313  1.00 78.57  ? 178 ILE B CA  1 
ATOM   969   C  C   . ILE B  2  22  ? 8.677   11.175  180.631  1.00 82.15  ? 178 ILE B C   1 
ATOM   970   O  O   . ILE B  2  22  ? 8.640   11.668  181.757  1.00 85.72  ? 178 ILE B O   1 
ATOM   971   C  CB  . ILE B  2  22  ? 10.936  10.684  179.673  1.00 77.22  ? 178 ILE B CB  1 
ATOM   972   C  CG1 . ILE B  2  22  ? 12.072  9.657   179.693  1.00 78.98  ? 178 ILE B CG1 1 
ATOM   973   C  CG2 . ILE B  2  22  ? 11.331  11.952  180.414  1.00 65.58  ? 178 ILE B CG2 1 
ATOM   974   C  CD1 . ILE B  2  22  ? 13.443  10.222  179.368  1.00 85.93  ? 178 ILE B CD1 1 
ATOM   975   N  N   . GLU B  2  23  ? 7.862   11.569  179.658  1.00 87.82  ? 179 GLU B N   1 
ATOM   976   C  CA  . GLU B  2  23  ? 6.887   12.637  179.882  1.00 87.25  ? 179 GLU B CA  1 
ATOM   977   C  C   . GLU B  2  23  ? 5.584   12.186  180.546  1.00 86.91  ? 179 GLU B C   1 
ATOM   978   O  O   . GLU B  2  23  ? 4.909   12.976  181.213  1.00 74.80  ? 179 GLU B O   1 
ATOM   979   C  CB  . GLU B  2  23  ? 6.544   13.323  178.563  1.00 93.22  ? 179 GLU B CB  1 
ATOM   980   C  CG  . GLU B  2  23  ? 7.649   14.147  177.973  1.00 94.69  ? 179 GLU B CG  1 
ATOM   981   C  CD  . GLU B  2  23  ? 7.169   14.939  176.784  1.00 100.84 ? 179 GLU B CD  1 
ATOM   982   O  OE1 . GLU B  2  23  ? 6.666   14.314  175.826  1.00 95.66  ? 179 GLU B OE1 1 
ATOM   983   O  OE2 . GLU B  2  23  ? 7.292   16.183  176.812  1.00 100.89 ? 179 GLU B OE2 1 
ATOM   984   N  N   . SER B  2  24  ? 5.221   10.924  180.352  1.00 81.67  ? 180 SER B N   1 
ATOM   985   C  CA  . SER B  2  24  ? 3.997   10.412  180.934  1.00 82.86  ? 180 SER B CA  1 
ATOM   986   C  C   . SER B  2  24  ? 4.255   9.337   181.964  1.00 89.99  ? 180 SER B C   1 
ATOM   987   O  O   . SER B  2  24  ? 4.177   9.580   183.169  1.00 98.64  ? 180 SER B O   1 
ATOM   988   C  CB  . SER B  2  24  ? 3.088   9.853   179.844  1.00 84.64  ? 180 SER B CB  1 
ATOM   989   O  OG  . SER B  2  24  ? 2.522   10.901  179.080  1.00 92.19  ? 180 SER B OG  1 
ATOM   990   N  N   . THR B  2  25  ? 4.570   8.143   181.480  1.00 87.19  ? 181 THR B N   1 
ATOM   991   C  CA  . THR B  2  25  ? 4.813   7.005   182.349  1.00 84.97  ? 181 THR B CA  1 
ATOM   992   C  C   . THR B  2  25  ? 5.659   7.289   183.591  1.00 79.70  ? 181 THR B C   1 
ATOM   993   O  O   . THR B  2  25  ? 5.542   6.578   184.582  1.00 85.46  ? 181 THR B O   1 
ATOM   994   C  CB  . THR B  2  25  ? 5.446   5.855   181.558  1.00 85.99  ? 181 THR B CB  1 
ATOM   995   O  OG1 . THR B  2  25  ? 4.702   5.650   180.347  1.00 87.53  ? 181 THR B OG1 1 
ATOM   996   C  CG2 . THR B  2  25  ? 5.421   4.574   182.384  1.00 92.07  ? 181 THR B CG2 1 
ATOM   997   N  N   . VAL B  2  26  ? 6.505   8.315   183.552  1.00 74.85  ? 182 VAL B N   1 
ATOM   998   C  CA  . VAL B  2  26  ? 7.326   8.635   184.719  1.00 70.64  ? 182 VAL B CA  1 
ATOM   999   C  C   . VAL B  2  26  ? 6.946   9.958   185.380  1.00 70.32  ? 182 VAL B C   1 
ATOM   1000  O  O   . VAL B  2  26  ? 6.544   9.973   186.544  1.00 73.06  ? 182 VAL B O   1 
ATOM   1001  C  CB  . VAL B  2  26  ? 8.850   8.646   184.386  1.00 63.44  ? 182 VAL B CB  1 
ATOM   1002  C  CG1 . VAL B  2  26  ? 9.624   9.372   185.477  1.00 50.93  ? 182 VAL B CG1 1 
ATOM   1003  C  CG2 . VAL B  2  26  ? 9.370   7.216   184.297  1.00 61.53  ? 182 VAL B CG2 1 
ATOM   1004  N  N   . ALA B  2  27  ? 7.066   11.066  184.660  1.00 58.10  ? 183 ALA B N   1 
ATOM   1005  C  CA  . ALA B  2  27  ? 6.714   12.349  185.253  1.00 63.22  ? 183 ALA B CA  1 
ATOM   1006  C  C   . ALA B  2  27  ? 5.258   12.319  185.737  1.00 64.59  ? 183 ALA B C   1 
ATOM   1007  O  O   . ALA B  2  27  ? 4.798   13.219  186.449  1.00 55.72  ? 183 ALA B O   1 
ATOM   1008  C  CB  . ALA B  2  27  ? 6.922   13.467  184.243  1.00 64.91  ? 183 ALA B CB  1 
ATOM   1009  N  N   . GLY B  2  28  ? 4.542   11.270  185.337  1.00 69.80  ? 184 GLY B N   1 
ATOM   1010  C  CA  . GLY B  2  28  ? 3.154   11.111  185.730  1.00 68.01  ? 184 GLY B CA  1 
ATOM   1011  C  C   . GLY B  2  28  ? 3.109   10.410  187.067  1.00 65.60  ? 184 GLY B C   1 
ATOM   1012  O  O   . GLY B  2  28  ? 2.491   10.897  188.013  1.00 57.51  ? 184 GLY B O   1 
ATOM   1013  N  N   . SER B  2  29  ? 3.764   9.256   187.148  1.00 66.16  ? 185 SER B N   1 
ATOM   1014  C  CA  . SER B  2  29  ? 3.803   8.517   188.398  1.00 71.05  ? 185 SER B CA  1 
ATOM   1015  C  C   . SER B  2  29  ? 4.512   9.423   189.384  1.00 75.05  ? 185 SER B C   1 
ATOM   1016  O  O   . SER B  2  29  ? 4.045   9.654   190.500  1.00 80.17  ? 185 SER B O   1 
ATOM   1017  C  CB  . SER B  2  29  ? 4.600   7.229   188.241  1.00 70.71  ? 185 SER B CB  1 
ATOM   1018  O  OG  . SER B  2  29  ? 4.007   6.385   187.279  1.00 91.82  ? 185 SER B OG  1 
ATOM   1019  N  N   . LEU B  2  30  ? 5.648   9.945   188.944  1.00 71.86  ? 186 LEU B N   1 
ATOM   1020  C  CA  . LEU B  2  30  ? 6.447   10.834  189.761  1.00 66.23  ? 186 LEU B CA  1 
ATOM   1021  C  C   . LEU B  2  30  ? 5.592   11.905  190.429  1.00 70.39  ? 186 LEU B C   1 
ATOM   1022  O  O   . LEU B  2  30  ? 5.606   12.048  191.645  1.00 63.50  ? 186 LEU B O   1 
ATOM   1023  C  CB  . LEU B  2  30  ? 7.512   11.495  188.896  1.00 77.87  ? 186 LEU B CB  1 
ATOM   1024  C  CG  . LEU B  2  30  ? 8.935   11.445  189.436  1.00 84.33  ? 186 LEU B CG  1 
ATOM   1025  C  CD1 . LEU B  2  30  ? 8.989   12.165  190.779  1.00 76.72  ? 186 LEU B CD1 1 
ATOM   1026  C  CD2 . LEU B  2  30  ? 9.375   9.991   189.560  1.00 75.84  ? 186 LEU B CD2 1 
ATOM   1027  N  N   . ARG B  2  31  ? 4.820   12.638  189.638  1.00 77.68  ? 187 ARG B N   1 
ATOM   1028  C  CA  . ARG B  2  31  ? 4.009   13.703  190.193  1.00 80.44  ? 187 ARG B CA  1 
ATOM   1029  C  C   . ARG B  2  31  ? 2.857   13.281  191.099  1.00 78.85  ? 187 ARG B C   1 
ATOM   1030  O  O   . ARG B  2  31  ? 2.804   13.689  192.261  1.00 70.47  ? 187 ARG B O   1 
ATOM   1031  C  CB  . ARG B  2  31  ? 3.499   14.609  189.071  1.00 95.86  ? 187 ARG B CB  1 
ATOM   1032  C  CG  . ARG B  2  31  ? 3.526   16.078  189.467  1.00 113.26 ? 187 ARG B CG  1 
ATOM   1033  C  CD  . ARG B  2  31  ? 4.871   16.410  190.128  1.00 125.98 ? 187 ARG B CD  1 
ATOM   1034  N  NE  . ARG B  2  31  ? 4.878   17.702  190.811  1.00 133.38 ? 187 ARG B NE  1 
ATOM   1035  C  CZ  . ARG B  2  31  ? 5.867   18.128  191.593  1.00 132.87 ? 187 ARG B CZ  1 
ATOM   1036  N  NH1 . ARG B  2  31  ? 6.936   17.365  191.797  1.00 131.87 ? 187 ARG B NH1 1 
ATOM   1037  N  NH2 . ARG B  2  31  ? 5.789   19.320  192.172  1.00 128.35 ? 187 ARG B NH2 1 
ATOM   1038  N  N   . SER B  2  32  ? 1.933   12.471  190.593  1.00 81.12  ? 188 SER B N   1 
ATOM   1039  C  CA  . SER B  2  32  ? 0.806   12.061  191.424  1.00 82.87  ? 188 SER B CA  1 
ATOM   1040  C  C   . SER B  2  32  ? 1.208   11.141  192.569  1.00 84.15  ? 188 SER B C   1 
ATOM   1041  O  O   . SER B  2  32  ? 0.362   10.449  193.138  1.00 89.92  ? 188 SER B O   1 
ATOM   1042  C  CB  . SER B  2  32  ? -0.297  11.412  190.574  1.00 86.36  ? 188 SER B CB  1 
ATOM   1043  O  OG  . SER B  2  32  ? -1.156  12.402  190.007  1.00 71.15  ? 188 SER B OG  1 
ATOM   1044  N  N   . MET B  2  33  ? 2.503   11.130  192.891  1.00 82.80  ? 189 MET B N   1 
ATOM   1045  C  CA  . MET B  2  33  ? 3.028   10.338  194.004  1.00 70.34  ? 189 MET B CA  1 
ATOM   1046  C  C   . MET B  2  33  ? 3.483   11.311  195.078  1.00 72.37  ? 189 MET B C   1 
ATOM   1047  O  O   . MET B  2  33  ? 3.186   11.124  196.257  1.00 83.03  ? 189 MET B O   1 
ATOM   1048  C  CB  . MET B  2  33  ? 4.203   9.451   193.575  1.00 54.09  ? 189 MET B CB  1 
ATOM   1049  C  CG  . MET B  2  33  ? 3.779   8.100   193.008  1.00 60.38  ? 189 MET B CG  1 
ATOM   1050  S  SD  . MET B  2  33  ? 5.164   7.060   192.494  1.00 74.13  ? 189 MET B SD  1 
ATOM   1051  C  CE  . MET B  2  33  ? 4.556   5.407   192.812  1.00 57.01  ? 189 MET B CE  1 
ATOM   1052  N  N   . LYS B  2  34  ? 4.190   12.362  194.670  1.00 71.49  ? 190 LYS B N   1 
ATOM   1053  C  CA  . LYS B  2  34  ? 4.656   13.363  195.624  1.00 70.51  ? 190 LYS B CA  1 
ATOM   1054  C  C   . LYS B  2  34  ? 3.454   14.090  196.226  1.00 75.66  ? 190 LYS B C   1 
ATOM   1055  O  O   . LYS B  2  34  ? 3.595   14.928  197.118  1.00 76.25  ? 190 LYS B O   1 
ATOM   1056  C  CB  . LYS B  2  34  ? 5.577   14.381  194.948  1.00 66.63  ? 190 LYS B CB  1 
ATOM   1057  C  CG  . LYS B  2  34  ? 6.019   15.493  195.885  1.00 65.04  ? 190 LYS B CG  1 
ATOM   1058  C  CD  . LYS B  2  34  ? 6.708   16.619  195.151  1.00 75.27  ? 190 LYS B CD  1 
ATOM   1059  C  CE  . LYS B  2  34  ? 6.974   17.772  196.103  1.00 85.78  ? 190 LYS B CE  1 
ATOM   1060  N  NZ  . LYS B  2  34  ? 7.489   18.982  195.401  1.00 88.70  ? 190 LYS B NZ  1 
ATOM   1061  N  N   . SER B  2  35  ? 2.266   13.777  195.726  1.00 78.55  ? 191 SER B N   1 
ATOM   1062  C  CA  . SER B  2  35  ? 1.064   14.408  196.244  1.00 79.50  ? 191 SER B CA  1 
ATOM   1063  C  C   . SER B  2  35  ? 0.535   13.520  197.377  1.00 75.31  ? 191 SER B C   1 
ATOM   1064  O  O   . SER B  2  35  ? 0.293   13.990  198.490  1.00 62.20  ? 191 SER B O   1 
ATOM   1065  C  CB  . SER B  2  35  ? 0.023   14.551  195.129  1.00 84.32  ? 191 SER B CB  1 
ATOM   1066  O  OG  . SER B  2  35  ? -0.876  15.614  195.400  1.00 77.06  ? 191 SER B OG  1 
ATOM   1067  N  N   . VAL B  2  36  ? 0.372   12.232  197.088  1.00 64.63  ? 192 VAL B N   1 
ATOM   1068  C  CA  . VAL B  2  36  ? -0.102  11.286  198.084  1.00 61.72  ? 192 VAL B CA  1 
ATOM   1069  C  C   . VAL B  2  36  ? 0.819   11.342  199.296  1.00 69.62  ? 192 VAL B C   1 
ATOM   1070  O  O   . VAL B  2  36  ? 0.354   11.472  200.429  1.00 77.32  ? 192 VAL B O   1 
ATOM   1071  C  CB  . VAL B  2  36  ? -0.122  9.848   197.526  1.00 57.92  ? 192 VAL B CB  1 
ATOM   1072  C  CG1 . VAL B  2  36  ? -0.158  8.842   198.657  1.00 58.88  ? 192 VAL B CG1 1 
ATOM   1073  C  CG2 . VAL B  2  36  ? -1.341  9.662   196.647  1.00 61.68  ? 192 VAL B CG2 1 
ATOM   1074  N  N   . LEU B  2  37  ? 2.124   11.239  199.064  1.00 60.29  ? 193 LEU B N   1 
ATOM   1075  C  CA  . LEU B  2  37  ? 3.072   11.308  200.167  1.00 47.05  ? 193 LEU B CA  1 
ATOM   1076  C  C   . LEU B  2  37  ? 2.876   12.614  200.920  1.00 51.74  ? 193 LEU B C   1 
ATOM   1077  O  O   . LEU B  2  37  ? 2.924   12.643  202.139  1.00 56.51  ? 193 LEU B O   1 
ATOM   1078  C  CB  . LEU B  2  37  ? 4.498   11.217  199.645  1.00 37.03  ? 193 LEU B CB  1 
ATOM   1079  C  CG  . LEU B  2  37  ? 4.849   9.808   199.160  1.00 32.92  ? 193 LEU B CG  1 
ATOM   1080  C  CD1 . LEU B  2  37  ? 6.103   9.824   198.319  1.00 54.00  ? 193 LEU B CD1 1 
ATOM   1081  C  CD2 . LEU B  2  37  ? 5.030   8.907   200.355  1.00 49.20  ? 193 LEU B CD2 1 
ATOM   1082  N  N   . GLU B  2  38  ? 2.631   13.689  200.184  1.00 57.85  ? 194 GLU B N   1 
ATOM   1083  C  CA  . GLU B  2  38  ? 2.416   15.005  200.774  1.00 66.62  ? 194 GLU B CA  1 
ATOM   1084  C  C   . GLU B  2  38  ? 1.065   15.054  201.505  1.00 69.57  ? 194 GLU B C   1 
ATOM   1085  O  O   . GLU B  2  38  ? 0.937   15.658  202.574  1.00 67.87  ? 194 GLU B O   1 
ATOM   1086  C  CB  . GLU B  2  38  ? 2.445   16.061  199.669  1.00 71.99  ? 194 GLU B CB  1 
ATOM   1087  C  CG  . GLU B  2  38  ? 3.181   17.340  200.027  1.00 92.85  ? 194 GLU B CG  1 
ATOM   1088  C  CD  . GLU B  2  38  ? 3.410   18.235  198.808  1.00 103.28 ? 194 GLU B CD  1 
ATOM   1089  O  OE1 . GLU B  2  38  ? 3.897   17.714  197.776  1.00 98.74  ? 194 GLU B OE1 1 
ATOM   1090  O  OE2 . GLU B  2  38  ? 3.113   19.451  198.883  1.00 98.82  ? 194 GLU B OE2 1 
ATOM   1091  N  N   . HIS B  2  39  ? 0.058   14.422  200.912  1.00 66.21  ? 195 HIS B N   1 
ATOM   1092  C  CA  . HIS B  2  39  ? -1.276  14.376  201.491  1.00 69.42  ? 195 HIS B CA  1 
ATOM   1093  C  C   . HIS B  2  39  ? -1.196  13.600  202.809  1.00 63.74  ? 195 HIS B C   1 
ATOM   1094  O  O   . HIS B  2  39  ? -1.690  14.039  203.850  1.00 53.93  ? 195 HIS B O   1 
ATOM   1095  C  CB  . HIS B  2  39  ? -2.232  13.674  200.518  1.00 85.88  ? 195 HIS B CB  1 
ATOM   1096  C  CG  . HIS B  2  39  ? -3.668  13.686  200.949  1.00 103.27 ? 195 HIS B CG  1 
ATOM   1097  N  ND1 . HIS B  2  39  ? -4.083  13.236  202.186  1.00 108.71 ? 195 HIS B ND1 1 
ATOM   1098  C  CD2 . HIS B  2  39  ? -4.791  14.066  200.292  1.00 110.32 ? 195 HIS B CD2 1 
ATOM   1099  C  CE1 . HIS B  2  39  ? -5.398  13.337  202.272  1.00 112.60 ? 195 HIS B CE1 1 
ATOM   1100  N  NE2 . HIS B  2  39  ? -5.852  13.836  201.136  1.00 118.36 ? 195 HIS B NE2 1 
ATOM   1101  N  N   . LEU B  2  40  ? -0.559  12.439  202.760  1.00 61.58  ? 196 LEU B N   1 
ATOM   1102  C  CA  . LEU B  2  40  ? -0.409  11.620  203.953  1.00 61.03  ? 196 LEU B CA  1 
ATOM   1103  C  C   . LEU B  2  40  ? 0.186   12.422  205.105  1.00 58.49  ? 196 LEU B C   1 
ATOM   1104  O  O   . LEU B  2  40  ? -0.327  12.389  206.222  1.00 58.40  ? 196 LEU B O   1 
ATOM   1105  C  CB  . LEU B  2  40  ? 0.485   10.413  203.660  1.00 53.83  ? 196 LEU B CB  1 
ATOM   1106  C  CG  . LEU B  2  40  ? -0.084  9.330   202.747  1.00 44.19  ? 196 LEU B CG  1 
ATOM   1107  C  CD1 . LEU B  2  40  ? 0.915   8.189   202.661  1.00 51.10  ? 196 LEU B CD1 1 
ATOM   1108  C  CD2 . LEU B  2  40  ? -1.410  8.837   203.292  1.00 27.77  ? 196 LEU B CD2 1 
ATOM   1109  N  N   . ARG B  2  41  ? 1.270   13.139  204.830  1.00 54.57  ? 197 ARG B N   1 
ATOM   1110  C  CA  . ARG B  2  41  ? 1.925   13.931  205.858  1.00 55.64  ? 197 ARG B CA  1 
ATOM   1111  C  C   . ARG B  2  41  ? 0.914   14.841  206.555  1.00 54.66  ? 197 ARG B C   1 
ATOM   1112  O  O   . ARG B  2  41  ? 0.713   14.743  207.764  1.00 55.02  ? 197 ARG B O   1 
ATOM   1113  C  CB  . ARG B  2  41  ? 3.046   14.758  205.243  1.00 59.70  ? 197 ARG B CB  1 
ATOM   1114  C  CG  . ARG B  2  41  ? 4.261   14.904  206.136  1.00 60.61  ? 197 ARG B CG  1 
ATOM   1115  C  CD  . ARG B  2  41  ? 4.986   16.196  205.830  1.00 74.70  ? 197 ARG B CD  1 
ATOM   1116  N  NE  . ARG B  2  41  ? 4.054   17.326  205.782  1.00 91.41  ? 197 ARG B NE  1 
ATOM   1117  C  CZ  . ARG B  2  41  ? 3.513   17.819  204.666  1.00 94.65  ? 197 ARG B CZ  1 
ATOM   1118  N  NH1 . ARG B  2  41  ? 3.808   17.294  203.483  1.00 93.89  ? 197 ARG B NH1 1 
ATOM   1119  N  NH2 . ARG B  2  41  ? 2.660   18.831  204.733  1.00 95.91  ? 197 ARG B NH2 1 
ATOM   1120  N  N   . ALA B  2  42  ? 0.267   15.712  205.791  1.00 51.58  ? 198 ALA B N   1 
ATOM   1121  C  CA  . ALA B  2  42  ? -0.728  16.616  206.351  1.00 59.28  ? 198 ALA B CA  1 
ATOM   1122  C  C   . ALA B  2  42  ? -1.787  15.867  207.172  1.00 63.17  ? 198 ALA B C   1 
ATOM   1123  O  O   . ALA B  2  42  ? -2.320  16.396  208.151  1.00 66.89  ? 198 ALA B O   1 
ATOM   1124  C  CB  . ALA B  2  42  ? -1.397  17.398  205.235  1.00 65.11  ? 198 ALA B CB  1 
ATOM   1125  N  N   . LYS B  2  43  ? -2.113  14.645  206.768  1.00 62.08  ? 199 LYS B N   1 
ATOM   1126  C  CA  . LYS B  2  43  ? -3.097  13.874  207.517  1.00 55.50  ? 199 LYS B CA  1 
ATOM   1127  C  C   . LYS B  2  43  ? -2.492  13.615  208.902  1.00 58.65  ? 199 LYS B C   1 
ATOM   1128  O  O   . LYS B  2  43  ? -3.163  13.795  209.928  1.00 54.73  ? 199 LYS B O   1 
ATOM   1129  C  CB  . LYS B  2  43  ? -3.424  12.544  206.801  1.00 35.02  ? 199 LYS B CB  1 
ATOM   1130  C  CG  . LYS B  2  43  ? -4.305  11.618  207.631  1.00 59.33  ? 199 LYS B CG  1 
ATOM   1131  C  CD  . LYS B  2  43  ? -4.748  10.380  206.883  1.00 56.65  ? 199 LYS B CD  1 
ATOM   1132  C  CE  . LYS B  2  43  ? -5.891  10.696  205.908  1.00 86.33  ? 199 LYS B CE  1 
ATOM   1133  N  NZ  . LYS B  2  43  ? -7.225  10.981  206.552  1.00 80.68  ? 199 LYS B NZ  1 
ATOM   1134  N  N   . MET B  2  44  ? -1.213  13.229  208.919  1.00 46.81  ? 200 MET B N   1 
ATOM   1135  C  CA  . MET B  2  44  ? -0.506  12.944  210.158  1.00 44.83  ? 200 MET B CA  1 
ATOM   1136  C  C   . MET B  2  44  ? -0.375  14.155  211.069  1.00 59.44  ? 200 MET B C   1 
ATOM   1137  O  O   . MET B  2  44  ? -0.493  14.028  212.288  1.00 69.60  ? 200 MET B O   1 
ATOM   1138  C  CB  . MET B  2  44  ? 0.863   12.371  209.857  1.00 25.48  ? 200 MET B CB  1 
ATOM   1139  C  CG  . MET B  2  44  ? 0.772   11.187  208.934  1.00 49.12  ? 200 MET B CG  1 
ATOM   1140  S  SD  . MET B  2  44  ? 1.949   9.880   209.270  1.00 49.60  ? 200 MET B SD  1 
ATOM   1141  C  CE  . MET B  2  44  ? 3.153   10.235  208.037  1.00 45.88  ? 200 MET B CE  1 
ATOM   1142  N  N   . GLN B  2  45  ? -0.125  15.329  210.497  1.00 65.74  ? 201 GLN B N   1 
ATOM   1143  C  CA  . GLN B  2  45  ? -0.032  16.533  211.315  1.00 61.44  ? 201 GLN B CA  1 
ATOM   1144  C  C   . GLN B  2  45  ? -1.389  16.774  211.977  1.00 58.01  ? 201 GLN B C   1 
ATOM   1145  O  O   . GLN B  2  45  ? -1.469  16.864  213.202  1.00 53.46  ? 201 GLN B O   1 
ATOM   1146  C  CB  . GLN B  2  45  ? 0.356   17.741  210.463  1.00 71.18  ? 201 GLN B CB  1 
ATOM   1147  C  CG  . GLN B  2  45  ? 1.797   17.712  209.982  1.00 84.59  ? 201 GLN B CG  1 
ATOM   1148  C  CD  . GLN B  2  45  ? 2.084   18.749  208.908  1.00 84.23  ? 201 GLN B CD  1 
ATOM   1149  O  OE1 . GLN B  2  45  ? 3.191   18.811  208.373  1.00 79.82  ? 201 GLN B OE1 1 
ATOM   1150  N  NE2 . GLN B  2  45  ? 1.085   19.565  208.587  1.00 73.11  ? 201 GLN B NE2 1 
ATOM   1151  N  N   . ARG B  2  46  ? -2.458  16.859  211.181  1.00 53.55  ? 202 ARG B N   1 
ATOM   1152  C  CA  . ARG B  2  46  ? -3.790  17.089  211.743  1.00 53.78  ? 202 ARG B CA  1 
ATOM   1153  C  C   . ARG B  2  46  ? -4.010  16.152  212.911  1.00 62.50  ? 202 ARG B C   1 
ATOM   1154  O  O   . ARG B  2  46  ? -4.691  16.503  213.880  1.00 62.29  ? 202 ARG B O   1 
ATOM   1155  C  CB  . ARG B  2  46  ? -4.890  16.847  210.715  1.00 50.84  ? 202 ARG B CB  1 
ATOM   1156  C  CG  . ARG B  2  46  ? -5.097  17.968  209.743  1.00 61.81  ? 202 ARG B CG  1 
ATOM   1157  C  CD  . ARG B  2  46  ? -6.489  17.898  209.138  1.00 77.14  ? 202 ARG B CD  1 
ATOM   1158  N  NE  . ARG B  2  46  ? -6.795  16.632  208.460  1.00 88.34  ? 202 ARG B NE  1 
ATOM   1159  C  CZ  . ARG B  2  46  ? -6.224  16.212  207.330  1.00 87.42  ? 202 ARG B CZ  1 
ATOM   1160  N  NH1 . ARG B  2  46  ? -5.296  16.952  206.731  1.00 84.40  ? 202 ARG B NH1 1 
ATOM   1161  N  NH2 . ARG B  2  46  ? -6.601  15.058  206.787  1.00 68.92  ? 202 ARG B NH2 1 
ATOM   1162  N  N   . MET B  2  47  ? -3.439  14.952  212.798  1.00 60.33  ? 203 MET B N   1 
ATOM   1163  C  CA  . MET B  2  47  ? -3.537  13.946  213.846  1.00 53.89  ? 203 MET B CA  1 
ATOM   1164  C  C   . MET B  2  47  ? -2.594  14.289  214.989  1.00 60.29  ? 203 MET B C   1 
ATOM   1165  O  O   . MET B  2  47  ? -3.019  14.328  216.145  1.00 67.99  ? 203 MET B O   1 
ATOM   1166  C  CB  . MET B  2  47  ? -3.186  12.559  213.310  1.00 49.83  ? 203 MET B CB  1 
ATOM   1167  C  CG  . MET B  2  47  ? -4.373  11.752  212.845  1.00 25.09  ? 203 MET B CG  1 
ATOM   1168  S  SD  . MET B  2  47  ? -3.877  10.207  212.102  1.00 49.03  ? 203 MET B SD  1 
ATOM   1169  C  CE  . MET B  2  47  ? -3.588  10.729  210.495  1.00 33.07  ? 203 MET B CE  1 
ATOM   1170  N  N   . GLU B  2  48  ? -1.322  14.541  214.681  1.00 54.76  ? 204 GLU B N   1 
ATOM   1171  C  CA  . GLU B  2  48  ? -0.367  14.870  215.733  1.00 61.53  ? 204 GLU B CA  1 
ATOM   1172  C  C   . GLU B  2  48  ? -0.838  16.075  216.525  1.00 59.49  ? 204 GLU B C   1 
ATOM   1173  O  O   . GLU B  2  48  ? -0.671  16.121  217.746  1.00 70.84  ? 204 GLU B O   1 
ATOM   1174  C  CB  . GLU B  2  48  ? 1.028   15.155  215.172  1.00 70.06  ? 204 GLU B CB  1 
ATOM   1175  C  CG  . GLU B  2  48  ? 2.114   15.181  216.256  1.00 66.61  ? 204 GLU B CG  1 
ATOM   1176  C  CD  . GLU B  2  48  ? 3.540   15.163  215.697  1.00 66.96  ? 204 GLU B CD  1 
ATOM   1177  O  OE1 . GLU B  2  48  ? 4.460   14.723  216.414  1.00 66.68  ? 204 GLU B OE1 1 
ATOM   1178  O  OE2 . GLU B  2  48  ? 3.755   15.590  214.548  1.00 71.83  ? 204 GLU B OE2 1 
ATOM   1179  N  N   . GLU B  2  49  ? -1.441  17.044  215.846  1.00 49.01  ? 205 GLU B N   1 
ATOM   1180  C  CA  . GLU B  2  49  ? -1.910  18.218  216.559  1.00 54.91  ? 205 GLU B CA  1 
ATOM   1181  C  C   . GLU B  2  49  ? -3.103  17.822  217.413  1.00 55.85  ? 205 GLU B C   1 
ATOM   1182  O  O   . GLU B  2  49  ? -3.143  18.133  218.611  1.00 62.16  ? 205 GLU B O   1 
ATOM   1183  C  CB  . GLU B  2  49  ? -2.267  19.352  215.586  1.00 58.07  ? 205 GLU B CB  1 
ATOM   1184  C  CG  . GLU B  2  49  ? -3.687  19.349  215.040  1.00 80.05  ? 205 GLU B CG  1 
ATOM   1185  C  CD  . GLU B  2  49  ? -4.586  20.380  215.723  1.00 93.62  ? 205 GLU B CD  1 
ATOM   1186  O  OE1 . GLU B  2  49  ? -4.867  20.226  216.935  1.00 95.40  ? 205 GLU B OE1 1 
ATOM   1187  O  OE2 . GLU B  2  49  ? -5.010  21.347  215.044  1.00 94.77  ? 205 GLU B OE2 1 
ATOM   1188  N  N   . ALA B  2  50  ? -4.057  17.105  216.821  1.00 52.34  ? 206 ALA B N   1 
ATOM   1189  C  CA  . ALA B  2  50  ? -5.234  16.671  217.576  1.00 54.41  ? 206 ALA B CA  1 
ATOM   1190  C  C   . ALA B  2  50  ? -4.843  15.918  218.857  1.00 50.40  ? 206 ALA B C   1 
ATOM   1191  O  O   . ALA B  2  50  ? -5.563  15.988  219.853  1.00 43.67  ? 206 ALA B O   1 
ATOM   1192  C  CB  . ALA B  2  50  ? -6.135  15.802  216.709  1.00 52.40  ? 206 ALA B CB  1 
ATOM   1193  N  N   . ILE B  2  51  ? -3.705  15.219  218.827  1.00 42.10  ? 207 ILE B N   1 
ATOM   1194  C  CA  . ILE B  2  51  ? -3.223  14.475  219.991  1.00 51.94  ? 207 ILE B CA  1 
ATOM   1195  C  C   . ILE B  2  51  ? -2.592  15.413  221.019  1.00 56.33  ? 207 ILE B C   1 
ATOM   1196  O  O   . ILE B  2  51  ? -2.875  15.326  222.229  1.00 47.95  ? 207 ILE B O   1 
ATOM   1197  C  CB  . ILE B  2  51  ? -2.160  13.415  219.596  1.00 60.25  ? 207 ILE B CB  1 
ATOM   1198  C  CG1 . ILE B  2  51  ? -2.766  12.392  218.632  1.00 70.52  ? 207 ILE B CG1 1 
ATOM   1199  C  CG2 . ILE B  2  51  ? -1.653  12.687  220.833  1.00 55.72  ? 207 ILE B CG2 1 
ATOM   1200  C  CD1 . ILE B  2  51  ? -3.989  11.690  219.179  1.00 56.62  ? 207 ILE B CD1 1 
ATOM   1201  N  N   . LYS B  2  52  ? -1.735  16.309  220.542  1.00 52.20  ? 208 LYS B N   1 
ATOM   1202  C  CA  . LYS B  2  52  ? -1.078  17.236  221.443  1.00 59.83  ? 208 LYS B CA  1 
ATOM   1203  C  C   . LYS B  2  52  ? -2.101  18.054  222.187  1.00 57.25  ? 208 LYS B C   1 
ATOM   1204  O  O   . LYS B  2  52  ? -1.952  18.307  223.384  1.00 53.86  ? 208 LYS B O   1 
ATOM   1205  C  CB  . LYS B  2  52  ? -0.127  18.132  220.670  1.00 63.01  ? 208 LYS B CB  1 
ATOM   1206  C  CG  . LYS B  2  52  ? 0.976   17.349  219.942  1.00 79.75  ? 208 LYS B CG  1 
ATOM   1207  C  CD  . LYS B  2  52  ? 1.822   16.485  220.895  1.00 84.92  ? 208 LYS B CD  1 
ATOM   1208  C  CE  . LYS B  2  52  ? 1.099   15.216  221.342  1.00 82.90  ? 208 LYS B CE  1 
ATOM   1209  N  NZ  . LYS B  2  52  ? 1.765   14.560  222.492  1.00 75.94  ? 208 LYS B NZ  1 
ATOM   1210  N  N   . THR B  2  53  ? -3.157  18.441  221.481  1.00 59.47  ? 209 THR B N   1 
ATOM   1211  C  CA  . THR B  2  53  ? -4.232  19.228  222.090  1.00 67.35  ? 209 THR B CA  1 
ATOM   1212  C  C   . THR B  2  53  ? -4.944  18.456  223.215  1.00 74.60  ? 209 THR B C   1 
ATOM   1213  O  O   . THR B  2  53  ? -5.143  18.990  224.311  1.00 70.27  ? 209 THR B O   1 
ATOM   1214  C  CB  . THR B  2  53  ? -5.270  19.682  221.022  1.00 53.73  ? 209 THR B CB  1 
ATOM   1215  O  OG1 . THR B  2  53  ? -4.720  20.765  220.266  1.00 47.47  ? 209 THR B OG1 1 
ATOM   1216  C  CG2 . THR B  2  53  ? -6.567  20.145  221.669  1.00 29.60  ? 209 THR B CG2 1 
ATOM   1217  N  N   . GLN B  2  54  ? -5.325  17.208  222.955  1.00 72.26  ? 210 GLN B N   1 
ATOM   1218  C  CA  . GLN B  2  54  ? -5.992  16.421  223.984  1.00 67.49  ? 210 GLN B CA  1 
ATOM   1219  C  C   . GLN B  2  54  ? -5.047  16.125  225.133  1.00 64.32  ? 210 GLN B C   1 
ATOM   1220  O  O   . GLN B  2  54  ? -5.451  16.193  226.286  1.00 53.85  ? 210 GLN B O   1 
ATOM   1221  C  CB  . GLN B  2  54  ? -6.528  15.100  223.421  1.00 79.25  ? 210 GLN B CB  1 
ATOM   1222  C  CG  . GLN B  2  54  ? -8.037  15.075  223.204  1.00 74.81  ? 210 GLN B CG  1 
ATOM   1223  C  CD  . GLN B  2  54  ? -8.798  15.577  224.412  1.00 66.57  ? 210 GLN B CD  1 
ATOM   1224  O  OE1 . GLN B  2  54  ? -8.463  15.251  225.551  1.00 61.82  ? 210 GLN B OE1 1 
ATOM   1225  N  NE2 . GLN B  2  54  ? -9.833  16.374  224.169  1.00 56.54  ? 210 GLN B NE2 1 
ATOM   1226  N  N   . LYS B  2  55  ? -3.794  15.793  224.825  1.00 67.01  ? 211 LYS B N   1 
ATOM   1227  C  CA  . LYS B  2  55  ? -2.832  15.505  225.883  1.00 70.11  ? 211 LYS B CA  1 
ATOM   1228  C  C   . LYS B  2  55  ? -2.766  16.703  226.825  1.00 70.88  ? 211 LYS B C   1 
ATOM   1229  O  O   . LYS B  2  55  ? -2.835  16.556  228.050  1.00 70.24  ? 211 LYS B O   1 
ATOM   1230  C  CB  . LYS B  2  55  ? -1.446  15.235  225.306  1.00 63.98  ? 211 LYS B CB  1 
ATOM   1231  C  CG  . LYS B  2  55  ? -0.440  14.800  226.366  1.00 65.45  ? 211 LYS B CG  1 
ATOM   1232  C  CD  . LYS B  2  55  ? 0.964   14.660  225.787  1.00 78.78  ? 211 LYS B CD  1 
ATOM   1233  C  CE  . LYS B  2  55  ? 1.964   14.135  226.820  1.00 84.06  ? 211 LYS B CE  1 
ATOM   1234  N  NZ  . LYS B  2  55  ? 1.719   12.720  227.243  1.00 75.36  ? 211 LYS B NZ  1 
ATOM   1235  N  N   . GLU B  2  56  ? -2.645  17.892  226.242  1.00 66.74  ? 212 GLU B N   1 
ATOM   1236  C  CA  . GLU B  2  56  ? -2.592  19.130  227.018  1.00 71.85  ? 212 GLU B CA  1 
ATOM   1237  C  C   . GLU B  2  56  ? -3.817  19.278  227.915  1.00 57.72  ? 212 GLU B C   1 
ATOM   1238  O  O   . GLU B  2  56  ? -3.694  19.596  229.090  1.00 69.24  ? 212 GLU B O   1 
ATOM   1239  C  CB  . GLU B  2  56  ? -2.494  20.342  226.082  1.00 79.53  ? 212 GLU B CB  1 
ATOM   1240  C  CG  . GLU B  2  56  ? -2.394  21.699  226.785  1.00 79.18  ? 212 GLU B CG  1 
ATOM   1241  C  CD  . GLU B  2  56  ? -1.178  21.811  227.704  1.00 88.97  ? 212 GLU B CD  1 
ATOM   1242  O  OE1 . GLU B  2  56  ? -0.062  21.442  227.262  1.00 87.62  ? 212 GLU B OE1 1 
ATOM   1243  O  OE2 . GLU B  2  56  ? -1.339  22.277  228.861  1.00 65.43  ? 212 GLU B OE2 1 
ATOM   1244  N  N   . LEU B  2  57  ? -4.994  19.040  227.359  1.00 53.62  ? 213 LEU B N   1 
ATOM   1245  C  CA  . LEU B  2  57  ? -6.240  19.135  228.118  1.00 52.86  ? 213 LEU B CA  1 
ATOM   1246  C  C   . LEU B  2  57  ? -6.503  17.975  229.083  1.00 55.87  ? 213 LEU B C   1 
ATOM   1247  O  O   . LEU B  2  57  ? -7.626  17.878  229.597  1.00 41.03  ? 213 LEU B O   1 
ATOM   1248  C  CB  . LEU B  2  57  ? -7.420  19.245  227.160  1.00 58.59  ? 213 LEU B CB  1 
ATOM   1249  C  CG  . LEU B  2  57  ? -7.354  20.393  226.152  1.00 55.86  ? 213 LEU B CG  1 
ATOM   1250  C  CD1 . LEU B  2  57  ? -8.398  20.184  225.065  1.00 52.52  ? 213 LEU B CD1 1 
ATOM   1251  C  CD2 . LEU B  2  57  ? -7.569  21.709  226.868  1.00 46.12  ? 213 LEU B CD2 1 
ATOM   1252  N  N   . CYS B  2  58  ? -5.493  17.102  229.296  1.00 63.71  ? 214 CYS B N   1 
ATOM   1253  C  CA  . CYS B  2  58  ? -5.593  15.961  230.228  1.00 69.15  ? 214 CYS B CA  1 
ATOM   1254  C  C   . CYS B  2  58  ? -4.636  16.151  231.388  1.00 77.27  ? 214 CYS B C   1 
ATOM   1255  O  O   . CYS B  2  58  ? -4.352  15.212  232.142  1.00 80.50  ? 214 CYS B O   1 
ATOM   1256  C  CB  . CYS B  2  58  ? -5.279  14.617  229.554  1.00 67.85  ? 214 CYS B CB  1 
ATOM   1257  S  SG  . CYS B  2  58  ? -6.543  14.101  228.351  1.00 64.05  ? 214 CYS B SG  1 
ATOM   1258  N  N   . SER B  2  59  ? -4.126  17.373  231.512  1.00 82.49  ? 215 SER B N   1 
ATOM   1259  C  CA  . SER B  2  59  ? -3.222  17.717  232.597  1.00 88.39  ? 215 SER B CA  1 
ATOM   1260  C  C   . SER B  2  59  ? -4.021  17.468  233.875  1.00 84.19  ? 215 SER B C   1 
ATOM   1261  O  O   . SER B  2  59  ? -3.494  16.988  234.883  1.00 83.72  ? 215 SER B O   1 
ATOM   1262  C  CB  . SER B  2  59  ? -2.820  19.191  232.491  1.00 91.39  ? 215 SER B CB  1 
ATOM   1263  O  OG  . SER B  2  59  ? -1.795  19.507  233.419  1.00 109.81 ? 215 SER B OG  1 
ATOM   1264  N  N   . ALA B  2  60  ? -5.310  17.789  233.802  1.00 73.65  ? 216 ALA B N   1 
ATOM   1265  C  CA  . ALA B  2  60  ? -6.229  17.598  234.913  1.00 69.55  ? 216 ALA B CA  1 
ATOM   1266  C  C   . ALA B  2  60  ? -7.310  16.596  234.499  1.00 66.07  ? 216 ALA B C   1 
ATOM   1267  O  O   . ALA B  2  60  ? -7.847  16.672  233.400  1.00 67.82  ? 216 ALA B O   1 
ATOM   1268  C  CB  . ALA B  2  60  ? -6.863  18.919  235.282  1.00 56.62  ? 216 ALA B CB  1 
ATOM   1269  N  N   . PRO B  2  61  ? -7.641  15.639  235.374  1.00 62.72  ? 217 PRO B N   1 
ATOM   1270  C  CA  . PRO B  2  61  ? -8.669  14.652  235.037  1.00 56.92  ? 217 PRO B CA  1 
ATOM   1271  C  C   . PRO B  2  61  ? -10.024 15.333  235.051  1.00 56.98  ? 217 PRO B C   1 
ATOM   1272  O  O   . PRO B  2  61  ? -10.125 16.507  235.393  1.00 59.34  ? 217 PRO B O   1 
ATOM   1273  C  CB  . PRO B  2  61  ? -8.555  13.647  236.169  1.00 52.28  ? 217 PRO B CB  1 
ATOM   1274  C  CG  . PRO B  2  61  ? -8.293  14.557  237.341  1.00 59.23  ? 217 PRO B CG  1 
ATOM   1275  C  CD  . PRO B  2  61  ? -7.213  15.484  236.777  1.00 60.45  ? 217 PRO B CD  1 
ATOM   1276  N  N   . CYS B  2  62  ? -11.066 14.603  234.677  1.00 55.02  ? 218 CYS B N   1 
ATOM   1277  C  CA  . CYS B  2  62  ? -12.397 15.172  234.710  1.00 48.44  ? 218 CYS B CA  1 
ATOM   1278  C  C   . CYS B  2  62  ? -12.981 14.804  236.049  1.00 41.70  ? 218 CYS B C   1 
ATOM   1279  O  O   . CYS B  2  62  ? -12.429 13.969  236.761  1.00 44.32  ? 218 CYS B O   1 
ATOM   1280  C  CB  . CYS B  2  62  ? -13.274 14.619  233.590  1.00 55.13  ? 218 CYS B CB  1 
ATOM   1281  S  SG  . CYS B  2  62  ? -13.327 12.812  233.453  1.00 58.58  ? 218 CYS B SG  1 
ATOM   1282  N  N   . THR B  2  63  ? -14.101 15.429  236.386  1.00 47.89  ? 219 THR B N   1 
ATOM   1283  C  CA  . THR B  2  63  ? -14.756 15.183  237.654  1.00 50.28  ? 219 THR B CA  1 
ATOM   1284  C  C   . THR B  2  63  ? -16.250 15.402  237.558  1.00 56.44  ? 219 THR B C   1 
ATOM   1285  O  O   . THR B  2  63  ? -16.723 16.256  236.807  1.00 52.63  ? 219 THR B O   1 
ATOM   1286  C  CB  . THR B  2  63  ? -14.239 16.143  238.732  1.00 62.82  ? 219 THR B CB  1 
ATOM   1287  O  OG1 . THR B  2  63  ? -14.433 17.494  238.291  1.00 46.55  ? 219 THR B OG1 1 
ATOM   1288  C  CG2 . THR B  2  63  ? -12.756 15.900  239.009  1.00 65.72  ? 219 THR B CG2 1 
ATOM   1289  N  N   . VAL B  2  64  ? -16.989 14.617  238.327  1.00 55.74  ? 220 VAL B N   1 
ATOM   1290  C  CA  . VAL B  2  64  ? -18.429 14.755  238.392  1.00 57.74  ? 220 VAL B CA  1 
ATOM   1291  C  C   . VAL B  2  64  ? -18.707 15.162  239.831  1.00 63.76  ? 220 VAL B C   1 
ATOM   1292  O  O   . VAL B  2  64  ? -18.372 14.434  240.777  1.00 60.64  ? 220 VAL B O   1 
ATOM   1293  C  CB  . VAL B  2  64  ? -19.155 13.440  238.057  1.00 58.66  ? 220 VAL B CB  1 
ATOM   1294  C  CG1 . VAL B  2  64  ? -19.120 13.206  236.563  1.00 62.34  ? 220 VAL B CG1 1 
ATOM   1295  C  CG2 . VAL B  2  64  ? -18.510 12.284  238.792  1.00 51.38  ? 220 VAL B CG2 1 
ATOM   1296  N  N   . ASN B  2  65  ? -19.301 16.342  239.987  1.00 69.23  ? 221 ASN B N   1 
ATOM   1297  C  CA  . ASN B  2  65  ? -19.592 16.886  241.305  1.00 71.11  ? 221 ASN B CA  1 
ATOM   1298  C  C   . ASN B  2  65  ? -21.077 16.822  241.577  1.00 71.64  ? 221 ASN B C   1 
ATOM   1299  O  O   . ASN B  2  65  ? -21.558 17.431  242.532  1.00 79.11  ? 221 ASN B O   1 
ATOM   1300  C  CB  . ASN B  2  65  ? -19.115 18.339  241.369  1.00 66.87  ? 221 ASN B CB  1 
ATOM   1301  C  CG  . ASN B  2  65  ? -17.715 18.524  240.785  1.00 78.30  ? 221 ASN B CG  1 
ATOM   1302  O  OD1 . ASN B  2  65  ? -16.710 18.166  241.407  1.00 84.43  ? 221 ASN B OD1 1 
ATOM   1303  N  ND2 . ASN B  2  65  ? -17.648 19.072  239.573  1.00 77.21  ? 221 ASN B ND2 1 
ATOM   1304  N  N   . CYS B  2  66  ? -21.803 16.076  240.746  1.00 67.29  ? 222 CYS B N   1 
ATOM   1305  C  CA  . CYS B  2  66  ? -23.249 15.976  240.903  1.00 67.54  ? 222 CYS B CA  1 
ATOM   1306  C  C   . CYS B  2  66  ? -23.670 15.382  242.242  1.00 57.99  ? 222 CYS B C   1 
ATOM   1307  O  O   . CYS B  2  66  ? -22.976 14.555  242.817  1.00 64.31  ? 222 CYS B O   1 
ATOM   1308  C  CB  . CYS B  2  66  ? -23.858 15.172  239.759  1.00 60.48  ? 222 CYS B CB  1 
ATOM   1309  S  SG  . CYS B  2  66  ? -23.256 13.475  239.673  1.00 91.49  ? 222 CYS B SG  1 
ATOM   1310  N  N   . ARG B  2  67  ? -24.824 15.825  242.721  1.00 46.00  ? 223 ARG B N   1 
ATOM   1311  C  CA  . ARG B  2  67  ? -25.388 15.407  243.992  1.00 36.67  ? 223 ARG B CA  1 
ATOM   1312  C  C   . ARG B  2  67  ? -25.821 13.944  244.020  1.00 46.35  ? 223 ARG B C   1 
ATOM   1313  O  O   . ARG B  2  67  ? -25.562 13.201  243.075  1.00 57.82  ? 223 ARG B O   1 
ATOM   1314  C  CB  . ARG B  2  67  ? -26.576 16.315  244.293  1.00 56.10  ? 223 ARG B CB  1 
ATOM   1315  C  CG  . ARG B  2  67  ? -26.212 17.795  244.241  1.00 55.81  ? 223 ARG B CG  1 
ATOM   1316  C  CD  . ARG B  2  67  ? -27.402 18.621  243.852  1.00 57.39  ? 223 ARG B CD  1 
ATOM   1317  N  NE  . ARG B  2  67  ? -27.108 20.048  243.903  1.00 80.92  ? 223 ARG B NE  1 
ATOM   1318  C  CZ  . ARG B  2  67  ? -27.987 21.003  243.596  1.00 101.39 ? 223 ARG B CZ  1 
ATOM   1319  N  NH1 . ARG B  2  67  ? -29.222 20.686  243.212  1.00 108.16 ? 223 ARG B NH1 1 
ATOM   1320  N  NH2 . ARG B  2  67  ? -27.639 22.282  243.680  1.00 97.37  ? 223 ARG B NH2 1 
ATOM   1321  N  N   . VAL B  2  68  ? -26.473 13.522  245.104  1.00 33.13  ? 224 VAL B N   1 
ATOM   1322  C  CA  . VAL B  2  68  ? -26.927 12.144  245.187  1.00 31.87  ? 224 VAL B CA  1 
ATOM   1323  C  C   . VAL B  2  68  ? -28.369 12.031  245.651  1.00 27.06  ? 224 VAL B C   1 
ATOM   1324  O  O   . VAL B  2  68  ? -28.775 12.624  246.642  1.00 37.75  ? 224 VAL B O   1 
ATOM   1325  C  CB  . VAL B  2  68  ? -25.969 11.262  246.079  1.00 32.80  ? 224 VAL B CB  1 
ATOM   1326  C  CG1 . VAL B  2  68  ? -25.090 12.150  246.920  1.00 38.97  ? 224 VAL B CG1 1 
ATOM   1327  C  CG2 . VAL B  2  68  ? -26.770 10.281  246.965  1.00 16.71  ? 224 VAL B CG2 1 
ATOM   1328  N  N   . PRO B  2  69  ? -29.173 11.285  244.895  1.00 28.87  ? 225 PRO B N   1 
ATOM   1329  C  CA  . PRO B  2  69  ? -30.588 11.051  245.175  1.00 41.58  ? 225 PRO B CA  1 
ATOM   1330  C  C   . PRO B  2  69  ? -30.759 10.465  246.568  1.00 39.62  ? 225 PRO B C   1 
ATOM   1331  O  O   . PRO B  2  69  ? -30.000 9.614   246.990  1.00 43.58  ? 225 PRO B O   1 
ATOM   1332  C  CB  . PRO B  2  69  ? -30.992 10.066  244.083  1.00 49.13  ? 225 PRO B CB  1 
ATOM   1333  C  CG  . PRO B  2  69  ? -30.107 10.471  242.940  1.00 41.31  ? 225 PRO B CG  1 
ATOM   1334  C  CD  . PRO B  2  69  ? -28.779 10.670  243.616  1.00 30.86  ? 225 PRO B CD  1 
ATOM   1335  N  N   . VAL B  2  70  ? -31.760 10.933  247.282  1.00 37.09  ? 226 VAL B N   1 
ATOM   1336  C  CA  . VAL B  2  70  ? -31.996 10.444  248.612  1.00 32.82  ? 226 VAL B CA  1 
ATOM   1337  C  C   . VAL B  2  70  ? -32.584 9.059   248.509  1.00 44.07  ? 226 VAL B C   1 
ATOM   1338  O  O   . VAL B  2  70  ? -32.201 8.160   249.251  1.00 46.11  ? 226 VAL B O   1 
ATOM   1339  C  CB  . VAL B  2  70  ? -32.970 11.374  249.364  1.00 28.29  ? 226 VAL B CB  1 
ATOM   1340  C  CG1 . VAL B  2  70  ? -33.466 10.720  250.626  1.00 28.64  ? 226 VAL B CG1 1 
ATOM   1341  C  CG2 . VAL B  2  70  ? -32.275 12.669  249.700  1.00 35.69  ? 226 VAL B CG2 1 
ATOM   1342  N  N   . VAL B  2  71  ? -33.513 8.889   247.575  1.00 53.53  ? 227 VAL B N   1 
ATOM   1343  C  CA  . VAL B  2  71  ? -34.181 7.603   247.384  1.00 40.72  ? 227 VAL B CA  1 
ATOM   1344  C  C   . VAL B  2  71  ? -33.142 6.571   246.939  1.00 40.05  ? 227 VAL B C   1 
ATOM   1345  O  O   . VAL B  2  71  ? -32.141 6.911   246.295  1.00 37.09  ? 227 VAL B O   1 
ATOM   1346  C  CB  . VAL B  2  71  ? -35.344 7.742   246.335  1.00 35.13  ? 227 VAL B CB  1 
ATOM   1347  C  CG1 . VAL B  2  71  ? -34.777 8.034   244.962  1.00 26.17  ? 227 VAL B CG1 1 
ATOM   1348  C  CG2 . VAL B  2  71  ? -36.204 6.514   246.306  1.00 10.79  ? 227 VAL B CG2 1 
ATOM   1349  N  N   . SER B  2  72  ? -33.367 5.318   247.314  1.00 36.47  ? 228 SER B N   1 
ATOM   1350  C  CA  . SER B  2  72  ? -32.457 4.245   246.961  1.00 40.85  ? 228 SER B CA  1 
ATOM   1351  C  C   . SER B  2  72  ? -33.120 2.894   247.167  1.00 48.04  ? 228 SER B C   1 
ATOM   1352  O  O   . SER B  2  72  ? -34.290 2.819   247.546  1.00 55.79  ? 228 SER B O   1 
ATOM   1353  C  CB  . SER B  2  72  ? -31.208 4.332   247.824  1.00 33.12  ? 228 SER B CB  1 
ATOM   1354  O  OG  . SER B  2  72  ? -30.312 3.294   247.506  1.00 43.24  ? 228 SER B OG  1 
ATOM   1355  N  N   . GLY B  2  73  ? -32.368 1.829   246.918  1.00 41.74  ? 229 GLY B N   1 
ATOM   1356  C  CA  . GLY B  2  73  ? -32.898 0.489   247.089  1.00 42.23  ? 229 GLY B CA  1 
ATOM   1357  C  C   . GLY B  2  73  ? -31.879 -0.584  246.759  1.00 53.25  ? 229 GLY B C   1 
ATOM   1358  O  O   . GLY B  2  73  ? -30.677 -0.316  246.713  1.00 49.96  ? 229 GLY B O   1 
ATOM   1359  N  N   . MET B  2  74  ? -32.360 -1.803  246.525  1.00 53.86  ? 230 MET B N   1 
ATOM   1360  C  CA  . MET B  2  74  ? -31.491 -2.927  246.200  1.00 55.56  ? 230 MET B CA  1 
ATOM   1361  C  C   . MET B  2  74  ? -31.153 -2.861  244.725  1.00 62.22  ? 230 MET B C   1 
ATOM   1362  O  O   . MET B  2  74  ? -29.994 -2.741  244.327  1.00 58.58  ? 230 MET B O   1 
ATOM   1363  C  CB  . MET B  2  74  ? -32.207 -4.253  246.468  1.00 63.17  ? 230 MET B CB  1 
ATOM   1364  C  CG  . MET B  2  74  ? -32.616 -4.516  247.909  1.00 83.74  ? 230 MET B CG  1 
ATOM   1365  S  SD  . MET B  2  74  ? -33.577 -6.050  248.043  1.00 88.33  ? 230 MET B SD  1 
ATOM   1366  C  CE  . MET B  2  74  ? -32.431 -7.240  247.295  1.00 85.14  ? 230 MET B CE  1 
ATOM   1367  N  N   . HIS B  2  75  ? -32.208 -2.963  243.927  1.00 70.07  ? 231 HIS B N   1 
ATOM   1368  C  CA  . HIS B  2  75  ? -32.150 -2.939  242.481  1.00 59.53  ? 231 HIS B CA  1 
ATOM   1369  C  C   . HIS B  2  75  ? -32.626 -1.536  242.121  1.00 58.00  ? 231 HIS B C   1 
ATOM   1370  O  O   . HIS B  2  75  ? -32.862 -0.728  243.015  1.00 49.72  ? 231 HIS B O   1 
ATOM   1371  C  CB  . HIS B  2  75  ? -33.137 -3.983  241.956  1.00 73.71  ? 231 HIS B CB  1 
ATOM   1372  C  CG  . HIS B  2  75  ? -33.015 -4.253  240.488  1.00 104.70 ? 231 HIS B CG  1 
ATOM   1373  N  ND1 . HIS B  2  75  ? -32.211 -5.251  239.980  1.00 112.08 ? 231 HIS B ND1 1 
ATOM   1374  C  CD2 . HIS B  2  75  ? -33.585 -3.648  239.419  1.00 108.61 ? 231 HIS B CD2 1 
ATOM   1375  C  CE1 . HIS B  2  75  ? -32.291 -5.250  238.661  1.00 118.30 ? 231 HIS B CE1 1 
ATOM   1376  N  NE2 . HIS B  2  75  ? -33.117 -4.286  238.295  1.00 120.38 ? 231 HIS B NE2 1 
ATOM   1377  N  N   . CYS B  2  76  ? -32.746 -1.229  240.831  1.00 61.16  ? 232 CYS B N   1 
ATOM   1378  C  CA  . CYS B  2  76  ? -33.281 0.071   240.419  1.00 55.18  ? 232 CYS B CA  1 
ATOM   1379  C  C   . CYS B  2  76  ? -34.791 -0.125  240.487  1.00 60.49  ? 232 CYS B C   1 
ATOM   1380  O  O   . CYS B  2  76  ? -35.549 0.814   240.740  1.00 64.38  ? 232 CYS B O   1 
ATOM   1381  C  CB  . CYS B  2  76  ? -32.922 0.419   238.987  1.00 42.46  ? 232 CYS B CB  1 
ATOM   1382  S  SG  . CYS B  2  76  ? -31.256 1.032   238.695  1.00 39.64  ? 232 CYS B SG  1 
ATOM   1383  N  N   . GLU B  2  77  ? -35.214 -1.360  240.228  1.00 56.63  ? 233 GLU B N   1 
ATOM   1384  C  CA  . GLU B  2  77  ? -36.619 -1.731  240.285  1.00 62.97  ? 233 GLU B CA  1 
ATOM   1385  C  C   . GLU B  2  77  ? -37.098 -1.287  241.662  1.00 63.76  ? 233 GLU B C   1 
ATOM   1386  O  O   . GLU B  2  77  ? -38.144 -0.649  241.822  1.00 66.69  ? 233 GLU B O   1 
ATOM   1387  C  CB  . GLU B  2  77  ? -36.754 -3.249  240.153  1.00 58.70  ? 233 GLU B CB  1 
ATOM   1388  C  CG  . GLU B  2  77  ? -38.126 -3.812  240.511  1.00 77.40  ? 233 GLU B CG  1 
ATOM   1389  C  CD  . GLU B  2  77  ? -39.169 -3.551  239.442  1.00 92.80  ? 233 GLU B CD  1 
ATOM   1390  O  OE1 . GLU B  2  77  ? -38.979 -4.022  238.296  1.00 107.79 ? 233 GLU B OE1 1 
ATOM   1391  O  OE2 . GLU B  2  77  ? -40.179 -2.880  239.746  1.00 88.81  ? 233 GLU B OE2 1 
ATOM   1392  N  N   . ASP B  2  78  ? -36.298 -1.625  242.659  1.00 55.24  ? 234 ASP B N   1 
ATOM   1393  C  CA  . ASP B  2  78  ? -36.624 -1.279  244.020  1.00 48.50  ? 234 ASP B CA  1 
ATOM   1394  C  C   . ASP B  2  78  ? -36.742 0.225   244.117  1.00 38.63  ? 234 ASP B C   1 
ATOM   1395  O  O   . ASP B  2  78  ? -37.652 0.725   244.763  1.00 33.77  ? 234 ASP B O   1 
ATOM   1396  C  CB  . ASP B  2  78  ? -35.534 -1.787  244.959  1.00 54.88  ? 234 ASP B CB  1 
ATOM   1397  C  CG  . ASP B  2  78  ? -36.051 -2.057  246.344  1.00 58.62  ? 234 ASP B CG  1 
ATOM   1398  O  OD1 . ASP B  2  78  ? -37.067 -2.774  246.450  1.00 53.68  ? 234 ASP B OD1 1 
ATOM   1399  O  OD2 . ASP B  2  78  ? -35.446 -1.563  247.322  1.00 72.92  ? 234 ASP B OD2 1 
ATOM   1400  N  N   . ILE B  2  79  ? -35.821 0.941   243.473  1.00 26.10  ? 235 ILE B N   1 
ATOM   1401  C  CA  . ILE B  2  79  ? -35.836 2.400   243.496  1.00 29.46  ? 235 ILE B CA  1 
ATOM   1402  C  C   . ILE B  2  79  ? -37.118 2.919   242.861  1.00 42.28  ? 235 ILE B C   1 
ATOM   1403  O  O   . ILE B  2  79  ? -37.745 3.846   243.373  1.00 39.86  ? 235 ILE B O   1 
ATOM   1404  C  CB  . ILE B  2  79  ? -34.622 2.991   242.740  1.00 31.11  ? 235 ILE B CB  1 
ATOM   1405  C  CG1 . ILE B  2  79  ? -33.354 2.790   243.571  1.00 21.57  ? 235 ILE B CG1 1 
ATOM   1406  C  CG2 . ILE B  2  79  ? -34.858 4.470   242.400  1.00 14.07  ? 235 ILE B CG2 1 
ATOM   1407  C  CD1 . ILE B  2  79  ? -32.137 3.527   243.000  1.00 35.12  ? 235 ILE B CD1 1 
ATOM   1408  N  N   . TYR B  2  80  ? -37.506 2.322   241.739  1.00 50.61  ? 236 TYR B N   1 
ATOM   1409  C  CA  . TYR B  2  80  ? -38.727 2.725   241.067  1.00 53.03  ? 236 TYR B CA  1 
ATOM   1410  C  C   . TYR B  2  80  ? -39.859 2.611   242.095  1.00 50.42  ? 236 TYR B C   1 
ATOM   1411  O  O   . TYR B  2  80  ? -40.606 3.564   242.332  1.00 53.25  ? 236 TYR B O   1 
ATOM   1412  C  CB  . TYR B  2  80  ? -38.997 1.800   239.881  1.00 55.54  ? 236 TYR B CB  1 
ATOM   1413  C  CG  . TYR B  2  80  ? -40.110 2.257   238.964  1.00 60.86  ? 236 TYR B CG  1 
ATOM   1414  C  CD1 . TYR B  2  80  ? -39.898 3.266   238.030  1.00 59.59  ? 236 TYR B CD1 1 
ATOM   1415  C  CD2 . TYR B  2  80  ? -41.379 1.678   239.031  1.00 57.61  ? 236 TYR B CD2 1 
ATOM   1416  C  CE1 . TYR B  2  80  ? -40.921 3.689   237.183  1.00 67.00  ? 236 TYR B CE1 1 
ATOM   1417  C  CE2 . TYR B  2  80  ? -42.407 2.093   238.190  1.00 62.79  ? 236 TYR B CE2 1 
ATOM   1418  C  CZ  . TYR B  2  80  ? -42.174 3.098   237.270  1.00 65.33  ? 236 TYR B CZ  1 
ATOM   1419  O  OH  . TYR B  2  80  ? -43.190 3.511   236.440  1.00 58.93  ? 236 TYR B OH  1 
ATOM   1420  N  N   . ARG B  2  81  ? -39.961 1.448   242.727  1.00 46.43  ? 237 ARG B N   1 
ATOM   1421  C  CA  . ARG B  2  81  ? -41.004 1.213   243.722  1.00 48.50  ? 237 ARG B CA  1 
ATOM   1422  C  C   . ARG B  2  81  ? -40.956 2.238   244.851  1.00 45.35  ? 237 ARG B C   1 
ATOM   1423  O  O   . ARG B  2  81  ? -41.905 2.372   245.621  1.00 45.68  ? 237 ARG B O   1 
ATOM   1424  C  CB  . ARG B  2  81  ? -40.857 -0.188  244.315  1.00 57.78  ? 237 ARG B CB  1 
ATOM   1425  C  CG  . ARG B  2  81  ? -40.643 -1.288  243.287  1.00 72.99  ? 237 ARG B CG  1 
ATOM   1426  C  CD  . ARG B  2  81  ? -40.277 -2.605  243.964  1.00 89.17  ? 237 ARG B CD  1 
ATOM   1427  N  NE  . ARG B  2  81  ? -41.438 -3.303  244.513  1.00 93.81  ? 237 ARG B NE  1 
ATOM   1428  C  CZ  . ARG B  2  81  ? -42.350 -3.923  243.770  1.00 94.03  ? 237 ARG B CZ  1 
ATOM   1429  N  NH1 . ARG B  2  81  ? -42.231 -3.931  242.448  1.00 92.47  ? 237 ARG B NH1 1 
ATOM   1430  N  NH2 . ARG B  2  81  ? -43.379 -4.535  244.345  1.00 89.20  ? 237 ARG B NH2 1 
ATOM   1431  N  N   . ASN B  2  82  ? -39.853 2.968   244.947  1.00 45.18  ? 238 ASN B N   1 
ATOM   1432  C  CA  . ASN B  2  82  ? -39.701 3.950   246.009  1.00 49.66  ? 238 ASN B CA  1 
ATOM   1433  C  C   . ASN B  2  82  ? -39.823 5.388   245.548  1.00 59.00  ? 238 ASN B C   1 
ATOM   1434  O  O   . ASN B  2  82  ? -39.471 6.316   246.282  1.00 72.44  ? 238 ASN B O   1 
ATOM   1435  C  CB  . ASN B  2  82  ? -38.368 3.744   246.723  1.00 44.31  ? 238 ASN B CB  1 
ATOM   1436  C  CG  . ASN B  2  82  ? -38.328 2.450   247.491  1.00 52.30  ? 238 ASN B CG  1 
ATOM   1437  O  OD1 . ASN B  2  82  ? -37.263 1.993   247.899  1.00 58.01  ? 238 ASN B OD1 1 
ATOM   1438  N  ND2 . ASN B  2  82  ? -39.496 1.848   247.697  1.00 32.43  ? 238 ASN B ND2 1 
ATOM   1439  N  N   . GLY B  2  83  ? -40.315 5.582   244.331  1.00 55.53  ? 239 GLY B N   1 
ATOM   1440  C  CA  . GLY B  2  83  ? -40.493 6.934   243.850  1.00 57.50  ? 239 GLY B CA  1 
ATOM   1441  C  C   . GLY B  2  83  ? -39.441 7.430   242.890  1.00 63.84  ? 239 GLY B C   1 
ATOM   1442  O  O   . GLY B  2  83  ? -39.593 8.503   242.295  1.00 69.67  ? 239 GLY B O   1 
ATOM   1443  N  N   . GLY B  2  84  ? -38.355 6.684   242.746  1.00 65.02  ? 240 GLY B N   1 
ATOM   1444  C  CA  . GLY B  2  84  ? -37.341 7.114   241.800  1.00 71.75  ? 240 GLY B CA  1 
ATOM   1445  C  C   . GLY B  2  84  ? -37.929 6.856   240.427  1.00 68.37  ? 240 GLY B C   1 
ATOM   1446  O  O   . GLY B  2  84  ? -37.938 5.709   239.964  1.00 69.60  ? 240 GLY B O   1 
ATOM   1447  N  N   . ARG B  2  85  ? -38.438 7.898   239.778  1.00 56.89  ? 241 ARG B N   1 
ATOM   1448  C  CA  . ARG B  2  85  ? -39.046 7.707   238.473  1.00 48.25  ? 241 ARG B CA  1 
ATOM   1449  C  C   . ARG B  2  85  ? -38.295 8.363   237.329  1.00 46.58  ? 241 ARG B C   1 
ATOM   1450  O  O   . ARG B  2  85  ? -38.627 8.160   236.164  1.00 45.33  ? 241 ARG B O   1 
ATOM   1451  C  CB  . ARG B  2  85  ? -40.501 8.178   238.494  1.00 49.51  ? 241 ARG B CB  1 
ATOM   1452  C  CG  . ARG B  2  85  ? -41.386 7.430   239.493  1.00 56.22  ? 241 ARG B CG  1 
ATOM   1453  C  CD  . ARG B  2  85  ? -41.055 5.948   239.519  1.00 54.08  ? 241 ARG B CD  1 
ATOM   1454  N  NE  . ARG B  2  85  ? -41.950 5.177   240.375  1.00 66.13  ? 241 ARG B NE  1 
ATOM   1455  C  CZ  . ARG B  2  85  ? -43.200 4.862   240.060  1.00 67.94  ? 241 ARG B CZ  1 
ATOM   1456  N  NH1 . ARG B  2  85  ? -43.716 5.252   238.906  1.00 76.27  ? 241 ARG B NH1 1 
ATOM   1457  N  NH2 . ARG B  2  85  ? -43.931 4.142   240.897  1.00 70.84  ? 241 ARG B NH2 1 
ATOM   1458  N  N   . THR B  2  86  ? -37.285 9.151   237.658  1.00 41.31  ? 242 THR B N   1 
ATOM   1459  C  CA  . THR B  2  86  ? -36.483 9.796   236.635  1.00 52.09  ? 242 THR B CA  1 
ATOM   1460  C  C   . THR B  2  86  ? -35.278 8.918   236.351  1.00 58.76  ? 242 THR B C   1 
ATOM   1461  O  O   . THR B  2  86  ? -34.784 8.243   237.247  1.00 70.86  ? 242 THR B O   1 
ATOM   1462  C  CB  . THR B  2  86  ? -35.977 11.146  237.108  1.00 48.76  ? 242 THR B CB  1 
ATOM   1463  O  OG1 . THR B  2  86  ? -35.524 11.028  238.460  1.00 60.17  ? 242 THR B OG1 1 
ATOM   1464  C  CG2 . THR B  2  86  ? -37.073 12.169  237.037  1.00 69.64  ? 242 THR B CG2 1 
ATOM   1465  N  N   . SER B  2  87  ? -34.805 8.913   235.110  1.00 62.53  ? 243 SER B N   1 
ATOM   1466  C  CA  . SER B  2  87  ? -33.639 8.110   234.759  1.00 57.63  ? 243 SER B CA  1 
ATOM   1467  C  C   . SER B  2  87  ? -32.408 8.948   235.039  1.00 60.23  ? 243 SER B C   1 
ATOM   1468  O  O   . SER B  2  87  ? -32.220 10.010  234.452  1.00 71.09  ? 243 SER B O   1 
ATOM   1469  C  CB  . SER B  2  87  ? -33.673 7.698   233.279  1.00 55.06  ? 243 SER B CB  1 
ATOM   1470  O  OG  . SER B  2  87  ? -34.675 6.720   233.034  1.00 56.20  ? 243 SER B OG  1 
ATOM   1471  N  N   . GLU B  2  88  ? -31.570 8.469   235.946  1.00 62.40  ? 244 GLU B N   1 
ATOM   1472  C  CA  . GLU B  2  88  ? -30.360 9.185   236.323  1.00 58.17  ? 244 GLU B CA  1 
ATOM   1473  C  C   . GLU B  2  88  ? -29.534 8.312   237.253  1.00 53.37  ? 244 GLU B C   1 
ATOM   1474  O  O   . GLU B  2  88  ? -29.931 7.197   237.584  1.00 54.08  ? 244 GLU B O   1 
ATOM   1475  C  CB  . GLU B  2  88  ? -30.731 10.475  237.048  1.00 52.78  ? 244 GLU B CB  1 
ATOM   1476  C  CG  . GLU B  2  88  ? -31.709 10.244  238.185  1.00 57.40  ? 244 GLU B CG  1 
ATOM   1477  C  CD  . GLU B  2  88  ? -32.037 11.505  238.957  1.00 67.69  ? 244 GLU B CD  1 
ATOM   1478  O  OE1 . GLU B  2  88  ? -31.163 11.998  239.710  1.00 64.02  ? 244 GLU B OE1 1 
ATOM   1479  O  OE2 . GLU B  2  88  ? -33.174 12.005  238.806  1.00 70.79  ? 244 GLU B OE2 1 
ATOM   1480  N  N   . ALA B  2  89  ? -28.389 8.830   237.680  1.00 48.14  ? 245 ALA B N   1 
ATOM   1481  C  CA  . ALA B  2  89  ? -27.507 8.098   238.575  1.00 38.47  ? 245 ALA B CA  1 
ATOM   1482  C  C   . ALA B  2  89  ? -28.109 7.948   239.956  1.00 35.92  ? 245 ALA B C   1 
ATOM   1483  O  O   . ALA B  2  89  ? -28.516 8.929   240.561  1.00 50.01  ? 245 ALA B O   1 
ATOM   1484  C  CB  . ALA B  2  89  ? -26.193 8.811   238.677  1.00 37.21  ? 245 ALA B CB  1 
ATOM   1485  N  N   . TYR B  2  90  ? -28.184 6.718   240.449  1.00 36.70  ? 246 TYR B N   1 
ATOM   1486  C  CA  . TYR B  2  90  ? -28.705 6.458   241.795  1.00 45.35  ? 246 TYR B CA  1 
ATOM   1487  C  C   . TYR B  2  90  ? -27.690 5.615   242.569  1.00 44.04  ? 246 TYR B C   1 
ATOM   1488  O  O   . TYR B  2  90  ? -26.680 5.171   242.020  1.00 55.81  ? 246 TYR B O   1 
ATOM   1489  C  CB  . TYR B  2  90  ? -30.016 5.672   241.759  1.00 60.32  ? 246 TYR B CB  1 
ATOM   1490  C  CG  . TYR B  2  90  ? -31.234 6.430   241.292  1.00 73.09  ? 246 TYR B CG  1 
ATOM   1491  C  CD1 . TYR B  2  90  ? -31.413 6.748   239.948  1.00 75.75  ? 246 TYR B CD1 1 
ATOM   1492  C  CD2 . TYR B  2  90  ? -32.227 6.802   242.194  1.00 66.77  ? 246 TYR B CD2 1 
ATOM   1493  C  CE1 . TYR B  2  90  ? -32.556 7.414   239.519  1.00 77.50  ? 246 TYR B CE1 1 
ATOM   1494  C  CE2 . TYR B  2  90  ? -33.364 7.467   241.778  1.00 64.65  ? 246 TYR B CE2 1 
ATOM   1495  C  CZ  . TYR B  2  90  ? -33.527 7.770   240.442  1.00 74.15  ? 246 TYR B CZ  1 
ATOM   1496  O  OH  . TYR B  2  90  ? -34.662 8.429   240.033  1.00 75.53  ? 246 TYR B OH  1 
ATOM   1497  N  N   . TYR B  2  91  ? -27.954 5.397   243.845  1.00 32.61  ? 247 TYR B N   1 
ATOM   1498  C  CA  . TYR B  2  91  ? -27.074 4.569   244.649  1.00 34.31  ? 247 TYR B CA  1 
ATOM   1499  C  C   . TYR B  2  91  ? -27.907 3.370   245.020  1.00 39.10  ? 247 TYR B C   1 
ATOM   1500  O  O   . TYR B  2  91  ? -29.056 3.519   245.421  1.00 38.33  ? 247 TYR B O   1 
ATOM   1501  C  CB  . TYR B  2  91  ? -26.627 5.286   245.934  1.00 40.64  ? 247 TYR B CB  1 
ATOM   1502  C  CG  . TYR B  2  91  ? -25.294 5.999   245.830  1.00 48.04  ? 247 TYR B CG  1 
ATOM   1503  C  CD1 . TYR B  2  91  ? -25.180 7.221   245.180  1.00 63.89  ? 247 TYR B CD1 1 
ATOM   1504  C  CD2 . TYR B  2  91  ? -24.140 5.434   246.353  1.00 46.71  ? 247 TYR B CD2 1 
ATOM   1505  C  CE1 . TYR B  2  91  ? -23.941 7.858   245.052  1.00 66.07  ? 247 TYR B CE1 1 
ATOM   1506  C  CE2 . TYR B  2  91  ? -22.899 6.063   246.228  1.00 44.28  ? 247 TYR B CE2 1 
ATOM   1507  C  CZ  . TYR B  2  91  ? -22.807 7.271   245.576  1.00 54.63  ? 247 TYR B CZ  1 
ATOM   1508  O  OH  . TYR B  2  91  ? -21.585 7.888   245.430  1.00 44.49  ? 247 TYR B OH  1 
ATOM   1509  N  N   . ILE B  2  92  ? -27.357 2.174   244.871  1.00 38.64  ? 248 ILE B N   1 
ATOM   1510  C  CA  . ILE B  2  92  ? -28.119 0.999   245.254  1.00 38.21  ? 248 ILE B CA  1 
ATOM   1511  C  C   . ILE B  2  92  ? -27.266 0.167   246.177  1.00 42.98  ? 248 ILE B C   1 
ATOM   1512  O  O   . ILE B  2  92  ? -26.052 0.351   246.243  1.00 46.10  ? 248 ILE B O   1 
ATOM   1513  C  CB  . ILE B  2  92  ? -28.519 0.116   244.040  1.00 40.30  ? 248 ILE B CB  1 
ATOM   1514  C  CG1 . ILE B  2  92  ? -27.276 -0.287  243.243  1.00 33.77  ? 248 ILE B CG1 1 
ATOM   1515  C  CG2 . ILE B  2  92  ? -29.523 0.839   243.173  1.00 37.10  ? 248 ILE B CG2 1 
ATOM   1516  C  CD1 . ILE B  2  92  ? -27.564 -1.252  242.117  1.00 27.37  ? 248 ILE B CD1 1 
ATOM   1517  N  N   . GLN B  2  93  ? -27.912 -0.738  246.898  1.00 47.09  ? 249 GLN B N   1 
ATOM   1518  C  CA  . GLN B  2  93  ? -27.215 -1.639  247.799  1.00 44.96  ? 249 GLN B CA  1 
ATOM   1519  C  C   . GLN B  2  93  ? -27.934 -2.976  247.804  1.00 42.05  ? 249 GLN B C   1 
ATOM   1520  O  O   . GLN B  2  93  ? -28.787 -3.231  248.657  1.00 45.29  ? 249 GLN B O   1 
ATOM   1521  C  CB  . GLN B  2  93  ? -27.154 -1.058  249.215  1.00 54.92  ? 249 GLN B CB  1 
ATOM   1522  C  CG  . GLN B  2  93  ? -26.607 -2.029  250.255  1.00 60.33  ? 249 GLN B CG  1 
ATOM   1523  C  CD  . GLN B  2  93  ? -26.191 -1.358  251.549  1.00 59.21  ? 249 GLN B CD  1 
ATOM   1524  O  OE1 . GLN B  2  93  ? -26.946 -0.596  252.142  1.00 56.09  ? 249 GLN B OE1 1 
ATOM   1525  N  NE2 . GLN B  2  93  ? -24.978 -1.651  251.997  1.00 74.97  ? 249 GLN B NE2 1 
ATOM   1526  N  N   . PRO B  2  94  ? -27.625 -3.835  246.816  1.00 45.44  ? 250 PRO B N   1 
ATOM   1527  C  CA  . PRO B  2  94  ? -28.278 -5.146  246.762  1.00 55.00  ? 250 PRO B CA  1 
ATOM   1528  C  C   . PRO B  2  94  ? -27.772 -6.097  247.855  1.00 66.72  ? 250 PRO B C   1 
ATOM   1529  O  O   . PRO B  2  94  ? -28.539 -6.926  248.347  1.00 71.72  ? 250 PRO B O   1 
ATOM   1530  C  CB  . PRO B  2  94  ? -27.978 -5.633  245.333  1.00 46.98  ? 250 PRO B CB  1 
ATOM   1531  C  CG  . PRO B  2  94  ? -26.698 -4.932  244.982  1.00 41.44  ? 250 PRO B CG  1 
ATOM   1532  C  CD  . PRO B  2  94  ? -26.870 -3.559  245.575  1.00 33.22  ? 250 PRO B CD  1 
ATOM   1533  N  N   . ASP B  2  95  ? -26.495 -5.968  248.238  1.00 75.50  ? 251 ASP B N   1 
ATOM   1534  C  CA  . ASP B  2  95  ? -25.892 -6.807  249.287  1.00 81.00  ? 251 ASP B CA  1 
ATOM   1535  C  C   . ASP B  2  95  ? -25.627 -5.992  250.541  1.00 79.04  ? 251 ASP B C   1 
ATOM   1536  O  O   . ASP B  2  95  ? -24.818 -5.066  250.530  1.00 77.52  ? 251 ASP B O   1 
ATOM   1537  C  CB  . ASP B  2  95  ? -24.566 -7.413  248.822  1.00 90.41  ? 251 ASP B CB  1 
ATOM   1538  C  CG  . ASP B  2  95  ? -24.751 -8.605  247.901  1.00 99.73  ? 251 ASP B CG  1 
ATOM   1539  O  OD1 . ASP B  2  95  ? -25.338 -8.439  246.810  1.00 105.65 ? 251 ASP B OD1 1 
ATOM   1540  O  OD2 . ASP B  2  95  ? -24.302 -9.712  248.267  1.00 98.01  ? 251 ASP B OD2 1 
ATOM   1541  N  N   . LEU B  2  96  ? -26.299 -6.348  251.625  1.00 77.97  ? 252 LEU B N   1 
ATOM   1542  C  CA  . LEU B  2  96  ? -26.138 -5.633  252.884  1.00 81.39  ? 252 LEU B CA  1 
ATOM   1543  C  C   . LEU B  2  96  ? -24.743 -5.722  253.491  1.00 85.41  ? 252 LEU B C   1 
ATOM   1544  O  O   . LEU B  2  96  ? -24.420 -4.984  254.422  1.00 87.80  ? 252 LEU B O   1 
ATOM   1545  C  CB  . LEU B  2  96  ? -27.165 -6.129  253.900  1.00 80.75  ? 252 LEU B CB  1 
ATOM   1546  C  CG  . LEU B  2  96  ? -28.527 -5.430  253.888  1.00 85.17  ? 252 LEU B CG  1 
ATOM   1547  C  CD1 . LEU B  2  96  ? -28.388 -4.067  254.558  1.00 82.11  ? 252 LEU B CD1 1 
ATOM   1548  C  CD2 . LEU B  2  96  ? -29.049 -5.300  252.453  1.00 81.69  ? 252 LEU B CD2 1 
ATOM   1549  N  N   . PHE B  2  97  ? -23.910 -6.617  252.972  1.00 93.94  ? 253 PHE B N   1 
ATOM   1550  C  CA  . PHE B  2  97  ? -22.564 -6.754  253.512  1.00 97.12  ? 253 PHE B CA  1 
ATOM   1551  C  C   . PHE B  2  97  ? -21.570 -6.069  252.592  1.00 86.31  ? 253 PHE B C   1 
ATOM   1552  O  O   . PHE B  2  97  ? -20.358 -6.171  252.777  1.00 85.68  ? 253 PHE B O   1 
ATOM   1553  C  CB  . PHE B  2  97  ? -22.204 -8.237  253.702  1.00 113.52 ? 253 PHE B CB  1 
ATOM   1554  C  CG  . PHE B  2  97  ? -21.823 -8.953  252.430  1.00 135.83 ? 253 PHE B CG  1 
ATOM   1555  C  CD1 . PHE B  2  97  ? -22.648 -8.919  251.308  1.00 144.99 ? 253 PHE B CD1 1 
ATOM   1556  C  CD2 . PHE B  2  97  ? -20.642 -9.692  252.367  1.00 144.87 ? 253 PHE B CD2 1 
ATOM   1557  C  CE1 . PHE B  2  97  ? -22.298 -9.614  250.142  1.00 150.01 ? 253 PHE B CE1 1 
ATOM   1558  C  CE2 . PHE B  2  97  ? -20.286 -10.389 251.206  1.00 148.39 ? 253 PHE B CE2 1 
ATOM   1559  C  CZ  . PHE B  2  97  ? -21.117 -10.349 250.093  1.00 147.95 ? 253 PHE B CZ  1 
ATOM   1560  N  N   . SER B  2  98  ? -22.102 -5.362  251.602  1.00 76.22  ? 254 SER B N   1 
ATOM   1561  C  CA  . SER B  2  98  ? -21.283 -4.640  250.641  1.00 69.81  ? 254 SER B CA  1 
ATOM   1562  C  C   . SER B  2  98  ? -21.804 -3.222  250.579  1.00 66.64  ? 254 SER B C   1 
ATOM   1563  O  O   . SER B  2  98  ? -23.007 -3.001  250.669  1.00 72.88  ? 254 SER B O   1 
ATOM   1564  C  CB  . SER B  2  98  ? -21.392 -5.281  249.261  1.00 75.22  ? 254 SER B CB  1 
ATOM   1565  O  OG  . SER B  2  98  ? -21.042 -6.652  249.305  1.00 88.96  ? 254 SER B OG  1 
ATOM   1566  N  N   . GLU B  2  99  ? -20.902 -2.263  250.421  1.00 62.20  ? 255 GLU B N   1 
ATOM   1567  C  CA  . GLU B  2  99  ? -21.288 -0.862  250.359  1.00 66.63  ? 255 GLU B CA  1 
ATOM   1568  C  C   . GLU B  2  99  ? -22.223 -0.575  249.186  1.00 66.99  ? 255 GLU B C   1 
ATOM   1569  O  O   . GLU B  2  99  ? -22.280 -1.339  248.223  1.00 65.65  ? 255 GLU B O   1 
ATOM   1570  C  CB  . GLU B  2  99  ? -20.045 0.017   250.229  1.00 68.42  ? 255 GLU B CB  1 
ATOM   1571  C  CG  . GLU B  2  99  ? -19.020 -0.156  251.346  1.00 98.12  ? 255 GLU B CG  1 
ATOM   1572  C  CD  . GLU B  2  99  ? -19.568 0.179   252.734  1.00 110.17 ? 255 GLU B CD  1 
ATOM   1573  O  OE1 . GLU B  2  99  ? -20.145 1.279   252.909  1.00 114.24 ? 255 GLU B OE1 1 
ATOM   1574  O  OE2 . GLU B  2  99  ? -19.410 -0.657  253.655  1.00 110.00 ? 255 GLU B OE2 1 
ATOM   1575  N  N   . PRO B  2  100 ? -22.990 0.525   249.264  1.00 65.60  ? 256 PRO B N   1 
ATOM   1576  C  CA  . PRO B  2  100 ? -23.900 0.870   248.173  1.00 55.74  ? 256 PRO B CA  1 
ATOM   1577  C  C   . PRO B  2  100 ? -23.043 1.466   247.080  1.00 48.14  ? 256 PRO B C   1 
ATOM   1578  O  O   . PRO B  2  100 ? -22.050 2.125   247.372  1.00 32.21  ? 256 PRO B O   1 
ATOM   1579  C  CB  . PRO B  2  100 ? -24.804 1.929   248.790  1.00 63.21  ? 256 PRO B CB  1 
ATOM   1580  C  CG  . PRO B  2  100 ? -24.727 1.655   250.250  1.00 66.80  ? 256 PRO B CG  1 
ATOM   1581  C  CD  . PRO B  2  100 ? -23.272 1.356   250.444  1.00 61.00  ? 256 PRO B CD  1 
ATOM   1582  N  N   . TYR B  2  101 ? -23.420 1.245   245.827  1.00 55.94  ? 257 TYR B N   1 
ATOM   1583  C  CA  . TYR B  2  101 ? -22.654 1.792   244.713  1.00 53.23  ? 257 TYR B CA  1 
ATOM   1584  C  C   . TYR B  2  101 ? -23.522 2.533   243.714  1.00 55.70  ? 257 TYR B C   1 
ATOM   1585  O  O   . TYR B  2  101 ? -24.710 2.233   243.557  1.00 62.39  ? 257 TYR B O   1 
ATOM   1586  C  CB  . TYR B  2  101 ? -21.885 0.680   244.008  1.00 51.57  ? 257 TYR B CB  1 
ATOM   1587  C  CG  . TYR B  2  101 ? -22.728 -0.504  243.601  1.00 51.33  ? 257 TYR B CG  1 
ATOM   1588  C  CD1 . TYR B  2  101 ? -23.412 -0.522  242.389  1.00 54.09  ? 257 TYR B CD1 1 
ATOM   1589  C  CD2 . TYR B  2  101 ? -22.811 -1.626  244.416  1.00 48.12  ? 257 TYR B CD2 1 
ATOM   1590  C  CE1 . TYR B  2  101 ? -24.150 -1.640  241.997  1.00 55.39  ? 257 TYR B CE1 1 
ATOM   1591  C  CE2 . TYR B  2  101 ? -23.544 -2.742  244.040  1.00 53.44  ? 257 TYR B CE2 1 
ATOM   1592  C  CZ  . TYR B  2  101 ? -24.207 -2.750  242.833  1.00 53.11  ? 257 TYR B CZ  1 
ATOM   1593  O  OH  . TYR B  2  101 ? -24.906 -3.884  242.474  1.00 50.83  ? 257 TYR B OH  1 
ATOM   1594  N  N   . LYS B  2  102 ? -22.909 3.511   243.055  1.00 56.57  ? 258 LYS B N   1 
ATOM   1595  C  CA  . LYS B  2  102 ? -23.564 4.351   242.052  1.00 57.45  ? 258 LYS B CA  1 
ATOM   1596  C  C   . LYS B  2  102 ? -23.824 3.501   240.815  1.00 59.03  ? 258 LYS B C   1 
ATOM   1597  O  O   . LYS B  2  102 ? -22.966 2.730   240.392  1.00 69.22  ? 258 LYS B O   1 
ATOM   1598  C  CB  . LYS B  2  102 ? -22.628 5.516   241.697  1.00 62.22  ? 258 LYS B CB  1 
ATOM   1599  C  CG  . LYS B  2  102 ? -23.230 6.773   241.068  1.00 47.77  ? 258 LYS B CG  1 
ATOM   1600  C  CD  . LYS B  2  102 ? -22.076 7.777   240.809  1.00 52.45  ? 258 LYS B CD  1 
ATOM   1601  C  CE  . LYS B  2  102 ? -22.500 9.097   240.148  1.00 42.11  ? 258 LYS B CE  1 
ATOM   1602  N  NZ  . LYS B  2  102 ? -23.411 9.892   241.036  1.00 53.62  ? 258 LYS B NZ  1 
ATOM   1603  N  N   . VAL B  2  103 ? -25.012 3.631   240.242  1.00 59.00  ? 259 VAL B N   1 
ATOM   1604  C  CA  . VAL B  2  103 ? -25.364 2.884   239.042  1.00 46.01  ? 259 VAL B CA  1 
ATOM   1605  C  C   . VAL B  2  103 ? -26.361 3.753   238.302  1.00 51.46  ? 259 VAL B C   1 
ATOM   1606  O  O   . VAL B  2  103 ? -27.054 4.565   238.918  1.00 48.79  ? 259 VAL B O   1 
ATOM   1607  C  CB  . VAL B  2  103 ? -26.016 1.503   239.379  1.00 34.52  ? 259 VAL B CB  1 
ATOM   1608  C  CG1 . VAL B  2  103 ? -27.476 1.663   239.794  1.00 26.02  ? 259 VAL B CG1 1 
ATOM   1609  C  CG2 . VAL B  2  103 ? -25.924 0.611   238.196  1.00 23.53  ? 259 VAL B CG2 1 
ATOM   1610  N  N   . PHE B  2  104 ? -26.431 3.608   236.986  1.00 56.42  ? 260 PHE B N   1 
ATOM   1611  C  CA  . PHE B  2  104 ? -27.373 4.410   236.231  1.00 54.03  ? 260 PHE B CA  1 
ATOM   1612  C  C   . PHE B  2  104 ? -28.665 3.635   236.021  1.00 50.65  ? 260 PHE B C   1 
ATOM   1613  O  O   . PHE B  2  104 ? -28.666 2.564   235.423  1.00 48.87  ? 260 PHE B O   1 
ATOM   1614  C  CB  . PHE B  2  104 ? -26.792 4.816   234.882  1.00 52.48  ? 260 PHE B CB  1 
ATOM   1615  C  CG  . PHE B  2  104 ? -27.624 5.832   234.167  1.00 62.24  ? 260 PHE B CG  1 
ATOM   1616  C  CD1 . PHE B  2  104 ? -27.202 7.148   234.076  1.00 61.44  ? 260 PHE B CD1 1 
ATOM   1617  C  CD2 . PHE B  2  104 ? -28.868 5.490   233.648  1.00 57.82  ? 260 PHE B CD2 1 
ATOM   1618  C  CE1 . PHE B  2  104 ? -28.006 8.107   233.486  1.00 60.51  ? 260 PHE B CE1 1 
ATOM   1619  C  CE2 . PHE B  2  104 ? -29.673 6.437   233.061  1.00 58.42  ? 260 PHE B CE2 1 
ATOM   1620  C  CZ  . PHE B  2  104 ? -29.242 7.752   232.980  1.00 64.53  ? 260 PHE B CZ  1 
ATOM   1621  N  N   . CYS B  2  105 ? -29.762 4.186   236.523  1.00 45.58  ? 261 CYS B N   1 
ATOM   1622  C  CA  . CYS B  2  105 ? -31.063 3.558   236.389  1.00 54.98  ? 261 CYS B CA  1 
ATOM   1623  C  C   . CYS B  2  105 ? -31.834 4.080   235.183  1.00 61.53  ? 261 CYS B C   1 
ATOM   1624  O  O   . CYS B  2  105 ? -31.823 5.275   234.896  1.00 70.82  ? 261 CYS B O   1 
ATOM   1625  C  CB  . CYS B  2  105 ? -31.911 3.809   237.632  1.00 53.59  ? 261 CYS B CB  1 
ATOM   1626  S  SG  . CYS B  2  105 ? -31.364 2.997   239.162  1.00 60.65  ? 261 CYS B SG  1 
ATOM   1627  N  N   . ASP B  2  106 ? -32.501 3.174   234.479  1.00 63.01  ? 262 ASP B N   1 
ATOM   1628  C  CA  . ASP B  2  106 ? -33.319 3.540   233.339  1.00 54.00  ? 262 ASP B CA  1 
ATOM   1629  C  C   . ASP B  2  106 ? -34.732 3.318   233.840  1.00 60.11  ? 262 ASP B C   1 
ATOM   1630  O  O   . ASP B  2  106 ? -35.189 2.177   233.973  1.00 52.13  ? 262 ASP B O   1 
ATOM   1631  C  CB  . ASP B  2  106 ? -33.050 2.627   232.147  1.00 73.00  ? 262 ASP B CB  1 
ATOM   1632  C  CG  . ASP B  2  106 ? -33.841 3.034   230.912  1.00 78.34  ? 262 ASP B CG  1 
ATOM   1633  O  OD1 . ASP B  2  106 ? -35.038 3.354   231.058  1.00 71.71  ? 262 ASP B OD1 1 
ATOM   1634  O  OD2 . ASP B  2  106 ? -33.273 3.028   229.796  1.00 81.50  ? 262 ASP B OD2 1 
ATOM   1635  N  N   . MET B  2  107 ? -35.415 4.415   234.140  1.00 60.64  ? 263 MET B N   1 
ATOM   1636  C  CA  . MET B  2  107 ? -36.772 4.340   234.651  1.00 65.68  ? 263 MET B CA  1 
ATOM   1637  C  C   . MET B  2  107 ? -37.823 4.587   233.570  1.00 59.72  ? 263 MET B C   1 
ATOM   1638  O  O   . MET B  2  107 ? -39.018 4.529   233.843  1.00 66.87  ? 263 MET B O   1 
ATOM   1639  C  CB  . MET B  2  107 ? -36.952 5.363   235.775  1.00 66.85  ? 263 MET B CB  1 
ATOM   1640  C  CG  . MET B  2  107 ? -35.914 5.284   236.886  1.00 72.05  ? 263 MET B CG  1 
ATOM   1641  S  SD  . MET B  2  107 ? -36.062 3.841   237.955  1.00 78.17  ? 263 MET B SD  1 
ATOM   1642  C  CE  . MET B  2  107 ? -35.064 2.684   237.061  1.00 83.53  ? 263 MET B CE  1 
ATOM   1643  N  N   . GLU B  2  108 ? -37.389 4.856   232.347  1.00 51.47  ? 264 GLU B N   1 
ATOM   1644  C  CA  . GLU B  2  108 ? -38.334 5.127   231.274  1.00 59.55  ? 264 GLU B CA  1 
ATOM   1645  C  C   . GLU B  2  108 ? -38.622 3.954   230.337  1.00 57.78  ? 264 GLU B C   1 
ATOM   1646  O  O   . GLU B  2  108 ? -39.781 3.599   230.122  1.00 55.11  ? 264 GLU B O   1 
ATOM   1647  C  CB  . GLU B  2  108 ? -37.852 6.339   230.472  1.00 70.12  ? 264 GLU B CB  1 
ATOM   1648  C  CG  . GLU B  2  108 ? -37.936 7.640   231.266  1.00 85.12  ? 264 GLU B CG  1 
ATOM   1649  C  CD  . GLU B  2  108 ? -36.765 8.572   231.008  1.00 95.08  ? 264 GLU B CD  1 
ATOM   1650  O  OE1 . GLU B  2  108 ? -36.689 9.626   231.679  1.00 83.86  ? 264 GLU B OE1 1 
ATOM   1651  O  OE2 . GLU B  2  108 ? -35.922 8.249   230.141  1.00 101.59 ? 264 GLU B OE2 1 
ATOM   1652  N  N   . SER B  2  109 ? -37.571 3.353   229.787  1.00 60.36  ? 265 SER B N   1 
ATOM   1653  C  CA  . SER B  2  109 ? -37.714 2.229   228.864  1.00 50.50  ? 265 SER B CA  1 
ATOM   1654  C  C   . SER B  2  109 ? -38.421 1.023   229.451  1.00 54.88  ? 265 SER B C   1 
ATOM   1655  O  O   . SER B  2  109 ? -38.417 0.792   230.659  1.00 57.17  ? 265 SER B O   1 
ATOM   1656  C  CB  . SER B  2  109 ? -36.352 1.776   228.355  1.00 46.69  ? 265 SER B CB  1 
ATOM   1657  O  OG  . SER B  2  109 ? -35.675 2.823   227.689  1.00 73.76  ? 265 SER B OG  1 
ATOM   1658  N  N   . HIS B  2  110 ? -39.030 0.252   228.566  1.00 51.57  ? 266 HIS B N   1 
ATOM   1659  C  CA  . HIS B  2  110 ? -39.729 -0.958  228.942  1.00 52.30  ? 266 HIS B CA  1 
ATOM   1660  C  C   . HIS B  2  110 ? -40.178 -1.068  230.398  1.00 51.26  ? 266 HIS B C   1 
ATOM   1661  O  O   . HIS B  2  110 ? -39.898 -2.060  231.072  1.00 46.93  ? 266 HIS B O   1 
ATOM   1662  C  CB  . HIS B  2  110 ? -38.848 -2.133  228.563  1.00 55.17  ? 266 HIS B CB  1 
ATOM   1663  C  CG  . HIS B  2  110 ? -38.375 -2.066  227.150  1.00 61.82  ? 266 HIS B CG  1 
ATOM   1664  N  ND1 . HIS B  2  110 ? -39.168 -2.429  226.083  1.00 73.11  ? 266 HIS B ND1 1 
ATOM   1665  C  CD2 . HIS B  2  110 ? -37.228 -1.585  226.620  1.00 70.75  ? 266 HIS B CD2 1 
ATOM   1666  C  CE1 . HIS B  2  110 ? -38.530 -2.171  224.957  1.00 78.35  ? 266 HIS B CE1 1 
ATOM   1667  N  NE2 . HIS B  2  110 ? -37.350 -1.657  225.254  1.00 69.71  ? 266 HIS B NE2 1 
ATOM   1668  N  N   . GLY B  2  111 ? -40.876 -0.043  230.877  1.00 56.43  ? 267 GLY B N   1 
ATOM   1669  C  CA  . GLY B  2  111 ? -41.386 -0.067  232.238  1.00 58.39  ? 267 GLY B CA  1 
ATOM   1670  C  C   . GLY B  2  111 ? -40.454 0.395   233.342  1.00 63.69  ? 267 GLY B C   1 
ATOM   1671  O  O   . GLY B  2  111 ? -40.826 0.372   234.519  1.00 72.55  ? 267 GLY B O   1 
ATOM   1672  N  N   . GLY B  2  112 ? -39.243 0.802   232.983  1.00 60.02  ? 268 GLY B N   1 
ATOM   1673  C  CA  . GLY B  2  112 ? -38.304 1.266   233.990  1.00 68.01  ? 268 GLY B CA  1 
ATOM   1674  C  C   . GLY B  2  112 ? -37.906 0.220   235.014  1.00 64.91  ? 268 GLY B C   1 
ATOM   1675  O  O   . GLY B  2  112 ? -38.306 -0.940  234.920  1.00 69.99  ? 268 GLY B O   1 
ATOM   1676  N  N   . GLY B  2  113 ? -37.123 0.635   236.005  1.00 57.68  ? 269 GLY B N   1 
ATOM   1677  C  CA  . GLY B  2  113 ? -36.668 -0.296  237.019  1.00 49.26  ? 269 GLY B CA  1 
ATOM   1678  C  C   . GLY B  2  113 ? -35.450 -1.025  236.487  1.00 53.86  ? 269 GLY B C   1 
ATOM   1679  O  O   . GLY B  2  113 ? -34.998 -2.008  237.062  1.00 60.17  ? 269 GLY B O   1 
ATOM   1680  N  N   . TRP B  2  114 ? -34.906 -0.520  235.385  1.00 52.59  ? 270 TRP B N   1 
ATOM   1681  C  CA  . TRP B  2  114 ? -33.757 -1.140  234.754  1.00 47.41  ? 270 TRP B CA  1 
ATOM   1682  C  C   . TRP B  2  114 ? -32.420 -0.652  235.237  1.00 47.12  ? 270 TRP B C   1 
ATOM   1683  O  O   . TRP B  2  114 ? -32.099 0.525   235.113  1.00 48.50  ? 270 TRP B O   1 
ATOM   1684  C  CB  . TRP B  2  114 ? -33.831 -0.967  233.240  1.00 51.09  ? 270 TRP B CB  1 
ATOM   1685  C  CG  . TRP B  2  114 ? -34.899 -1.805  232.611  1.00 56.01  ? 270 TRP B CG  1 
ATOM   1686  C  CD1 . TRP B  2  114 ? -36.127 -1.390  232.177  1.00 57.89  ? 270 TRP B CD1 1 
ATOM   1687  C  CD2 . TRP B  2  114 ? -34.844 -3.210  232.373  1.00 50.91  ? 270 TRP B CD2 1 
ATOM   1688  N  NE1 . TRP B  2  114 ? -36.837 -2.452  231.681  1.00 49.74  ? 270 TRP B NE1 1 
ATOM   1689  C  CE2 . TRP B  2  114 ? -36.073 -3.582  231.789  1.00 52.63  ? 270 TRP B CE2 1 
ATOM   1690  C  CE3 . TRP B  2  114 ? -33.873 -4.195  232.599  1.00 55.35  ? 270 TRP B CE3 1 
ATOM   1691  C  CZ2 . TRP B  2  114 ? -36.357 -4.896  231.426  1.00 64.27  ? 270 TRP B CZ2 1 
ATOM   1692  C  CZ3 . TRP B  2  114 ? -34.154 -5.498  232.242  1.00 65.75  ? 270 TRP B CZ3 1 
ATOM   1693  C  CH2 . TRP B  2  114 ? -35.390 -5.841  231.659  1.00 73.18  ? 270 TRP B CH2 1 
ATOM   1694  N  N   . THR B  2  115 ? -31.634 -1.580  235.775  1.00 45.33  ? 271 THR B N   1 
ATOM   1695  C  CA  . THR B  2  115 ? -30.305 -1.261  236.265  1.00 40.44  ? 271 THR B CA  1 
ATOM   1696  C  C   . THR B  2  115 ? -29.338 -1.451  235.121  1.00 40.32  ? 271 THR B C   1 
ATOM   1697  O  O   . THR B  2  115 ? -29.108 -2.571  234.692  1.00 55.97  ? 271 THR B O   1 
ATOM   1698  C  CB  . THR B  2  115 ? -29.902 -2.181  237.397  1.00 27.73  ? 271 THR B CB  1 
ATOM   1699  O  OG1 . THR B  2  115 ? -30.910 -2.139  238.408  1.00 36.15  ? 271 THR B OG1 1 
ATOM   1700  C  CG2 . THR B  2  115 ? -28.591 -1.733  238.006  1.00 29.54  ? 271 THR B CG2 1 
ATOM   1701  N  N   . VAL B  2  116 ? -28.800 -0.351  234.609  1.00 32.72  ? 272 VAL B N   1 
ATOM   1702  C  CA  . VAL B  2  116 ? -27.842 -0.401  233.514  1.00 27.96  ? 272 VAL B CA  1 
ATOM   1703  C  C   . VAL B  2  116 ? -26.527 -0.991  234.000  1.00 41.50  ? 272 VAL B C   1 
ATOM   1704  O  O   . VAL B  2  116 ? -25.899 -0.467  234.922  1.00 38.59  ? 272 VAL B O   1 
ATOM   1705  C  CB  . VAL B  2  116 ? -27.582 0.993   232.975  1.00 30.96  ? 272 VAL B CB  1 
ATOM   1706  C  CG1 . VAL B  2  116 ? -26.451 0.966   231.967  1.00 14.74  ? 272 VAL B CG1 1 
ATOM   1707  C  CG2 . VAL B  2  116 ? -28.854 1.529   232.369  1.00 25.46  ? 272 VAL B CG2 1 
ATOM   1708  N  N   . VAL B  2  117 ? -26.112 -2.078  233.360  1.00 53.19  ? 273 VAL B N   1 
ATOM   1709  C  CA  . VAL B  2  117 ? -24.891 -2.782  233.722  1.00 50.44  ? 273 VAL B CA  1 
ATOM   1710  C  C   . VAL B  2  117 ? -23.749 -2.470  232.768  1.00 48.67  ? 273 VAL B C   1 
ATOM   1711  O  O   . VAL B  2  117 ? -22.581 -2.640  233.108  1.00 53.27  ? 273 VAL B O   1 
ATOM   1712  C  CB  . VAL B  2  117 ? -25.144 -4.298  233.734  1.00 62.37  ? 273 VAL B CB  1 
ATOM   1713  C  CG1 . VAL B  2  117 ? -23.858 -5.033  234.016  1.00 73.22  ? 273 VAL B CG1 1 
ATOM   1714  C  CG2 . VAL B  2  117 ? -26.199 -4.643  234.789  1.00 49.21  ? 273 VAL B CG2 1 
ATOM   1715  N  N   . GLN B  2  118 ? -24.101 -2.015  231.571  1.00 46.45  ? 274 GLN B N   1 
ATOM   1716  C  CA  . GLN B  2  118 ? -23.129 -1.653  230.531  1.00 44.45  ? 274 GLN B CA  1 
ATOM   1717  C  C   . GLN B  2  118 ? -23.820 -0.616  229.664  1.00 39.61  ? 274 GLN B C   1 
ATOM   1718  O  O   . GLN B  2  118 ? -25.030 -0.676  229.494  1.00 45.54  ? 274 GLN B O   1 
ATOM   1719  C  CB  . GLN B  2  118 ? -22.750 -2.888  229.688  1.00 49.02  ? 274 GLN B CB  1 
ATOM   1720  C  CG  . GLN B  2  118 ? -21.823 -2.631  228.485  1.00 35.63  ? 274 GLN B CG  1 
ATOM   1721  C  CD  . GLN B  2  118 ? -22.586 -2.269  227.212  1.00 44.05  ? 274 GLN B CD  1 
ATOM   1722  O  OE1 . GLN B  2  118 ? -21.999 -2.108  226.137  1.00 40.83  ? 274 GLN B OE1 1 
ATOM   1723  N  NE2 . GLN B  2  118 ? -23.903 -2.144  227.330  1.00 40.04  ? 274 GLN B NE2 1 
ATOM   1724  N  N   . ASN B  2  119 ? -23.069 0.331   229.115  1.00 39.03  ? 275 ASN B N   1 
ATOM   1725  C  CA  . ASN B  2  119 ? -23.682 1.365   228.297  1.00 42.53  ? 275 ASN B CA  1 
ATOM   1726  C  C   . ASN B  2  119 ? -22.699 2.127   227.408  1.00 51.47  ? 275 ASN B C   1 
ATOM   1727  O  O   . ASN B  2  119 ? -21.707 2.661   227.894  1.00 51.30  ? 275 ASN B O   1 
ATOM   1728  C  CB  . ASN B  2  119 ? -24.415 2.335   229.220  1.00 48.46  ? 275 ASN B CB  1 
ATOM   1729  C  CG  . ASN B  2  119 ? -25.110 3.451   228.475  1.00 47.68  ? 275 ASN B CG  1 
ATOM   1730  O  OD1 . ASN B  2  119 ? -25.971 3.223   227.631  1.00 68.85  ? 275 ASN B OD1 1 
ATOM   1731  N  ND2 . ASN B  2  119 ? -24.743 4.671   228.798  1.00 52.65  ? 275 ASN B ND2 1 
ATOM   1732  N  N   . ARG B  2  120 ? -22.984 2.152   226.102  1.00 56.14  ? 276 ARG B N   1 
ATOM   1733  C  CA  . ARG B  2  120 ? -22.180 2.864   225.096  1.00 50.65  ? 276 ARG B CA  1 
ATOM   1734  C  C   . ARG B  2  120 ? -23.033 4.040   224.593  1.00 47.70  ? 276 ARG B C   1 
ATOM   1735  O  O   . ARG B  2  120 ? -24.262 3.941   224.554  1.00 46.29  ? 276 ARG B O   1 
ATOM   1736  C  CB  . ARG B  2  120 ? -21.839 1.946   223.912  1.00 28.31  ? 276 ARG B CB  1 
ATOM   1737  C  CG  . ARG B  2  120 ? -21.273 0.585   224.300  1.00 36.45  ? 276 ARG B CG  1 
ATOM   1738  C  CD  . ARG B  2  120 ? -20.098 0.706   225.239  1.00 31.33  ? 276 ARG B CD  1 
ATOM   1739  N  NE  . ARG B  2  120 ? -19.003 1.438   224.640  1.00 13.86  ? 276 ARG B NE  1 
ATOM   1740  C  CZ  . ARG B  2  120 ? -18.124 0.909   223.793  1.00 37.83  ? 276 ARG B CZ  1 
ATOM   1741  N  NH1 . ARG B  2  120 ? -18.211 -0.370  223.451  1.00 21.36  ? 276 ARG B NH1 1 
ATOM   1742  N  NH2 . ARG B  2  120 ? -17.161 1.668   223.271  1.00 38.84  ? 276 ARG B NH2 1 
ATOM   1743  N  N   . VAL B  2  121 ? -22.399 5.147   224.212  1.00 46.43  ? 277 VAL B N   1 
ATOM   1744  C  CA  . VAL B  2  121 ? -23.150 6.318   223.734  1.00 54.64  ? 277 VAL B CA  1 
ATOM   1745  C  C   . VAL B  2  121 ? -22.256 7.442   223.173  1.00 54.18  ? 277 VAL B C   1 
ATOM   1746  O  O   . VAL B  2  121 ? -22.738 8.441   222.656  1.00 52.93  ? 277 VAL B O   1 
ATOM   1747  C  CB  . VAL B  2  121 ? -24.041 6.896   224.874  1.00 54.61  ? 277 VAL B CB  1 
ATOM   1748  C  CG1 . VAL B  2  121 ? -23.184 7.616   225.902  1.00 36.83  ? 277 VAL B CG1 1 
ATOM   1749  C  CG2 . VAL B  2  121 ? -25.100 7.804   224.292  1.00 61.91  ? 277 VAL B CG2 1 
ATOM   1750  N  N   . ASP B  2  122 ? -20.951 7.246   223.278  1.00 55.12  ? 278 ASP B N   1 
ATOM   1751  C  CA  . ASP B  2  122 ? -19.921 8.173   222.812  1.00 43.46  ? 278 ASP B CA  1 
ATOM   1752  C  C   . ASP B  2  122 ? -18.664 7.470   223.313  1.00 55.59  ? 278 ASP B C   1 
ATOM   1753  O  O   . ASP B  2  122 ? -18.632 7.002   224.448  1.00 70.14  ? 278 ASP B O   1 
ATOM   1754  C  CB  . ASP B  2  122 ? -20.075 9.560   223.469  1.00 33.22  ? 278 ASP B CB  1 
ATOM   1755  C  CG  . ASP B  2  122 ? -20.303 9.496   225.004  1.00 47.14  ? 278 ASP B CG  1 
ATOM   1756  O  OD1 . ASP B  2  122 ? -19.571 8.784   225.723  1.00 42.19  ? 278 ASP B OD1 1 
ATOM   1757  O  OD2 . ASP B  2  122 ? -21.211 10.183  225.516  1.00 38.28  ? 278 ASP B OD2 1 
ATOM   1758  N  N   . GLY B  2  123 ? -17.631 7.361   222.499  1.00 41.60  ? 279 GLY B N   1 
ATOM   1759  C  CA  . GLY B  2  123 ? -16.458 6.652   222.977  1.00 42.39  ? 279 GLY B CA  1 
ATOM   1760  C  C   . GLY B  2  123 ? -15.794 7.320   224.167  1.00 47.51  ? 279 GLY B C   1 
ATOM   1761  O  O   . GLY B  2  123 ? -14.572 7.497   224.166  1.00 52.10  ? 279 GLY B O   1 
ATOM   1762  N  N   . SER B  2  124 ? -16.565 7.663   225.199  1.00 26.55  ? 280 SER B N   1 
ATOM   1763  C  CA  . SER B  2  124 ? -15.988 8.350   226.346  1.00 43.30  ? 280 SER B CA  1 
ATOM   1764  C  C   . SER B  2  124 ? -15.221 7.446   227.310  1.00 48.88  ? 280 SER B C   1 
ATOM   1765  O  O   . SER B  2  124 ? -14.560 7.932   228.228  1.00 61.69  ? 280 SER B O   1 
ATOM   1766  C  CB  . SER B  2  124 ? -17.074 9.106   227.103  1.00 26.51  ? 280 SER B CB  1 
ATOM   1767  O  OG  . SER B  2  124 ? -17.905 8.213   227.803  1.00 44.18  ? 280 SER B OG  1 
ATOM   1768  N  N   . SER B  2  125 ? -15.298 6.138   227.101  1.00 39.16  ? 281 SER B N   1 
ATOM   1769  C  CA  . SER B  2  125 ? -14.600 5.205   227.962  1.00 39.57  ? 281 SER B CA  1 
ATOM   1770  C  C   . SER B  2  125 ? -13.972 4.071   227.163  1.00 42.23  ? 281 SER B C   1 
ATOM   1771  O  O   . SER B  2  125 ? -14.547 3.587   226.189  1.00 37.93  ? 281 SER B O   1 
ATOM   1772  C  CB  . SER B  2  125 ? -15.568 4.632   229.000  1.00 39.80  ? 281 SER B CB  1 
ATOM   1773  O  OG  . SER B  2  125 ? -16.194 5.668   229.734  1.00 54.25  ? 281 SER B OG  1 
ATOM   1774  N  N   . ASN B  2  126 ? -12.785 3.650   227.587  1.00 43.32  ? 282 ASN B N   1 
ATOM   1775  C  CA  . ASN B  2  126 ? -12.075 2.554   226.934  1.00 30.73  ? 282 ASN B CA  1 
ATOM   1776  C  C   . ASN B  2  126 ? -12.633 1.227   227.436  1.00 24.51  ? 282 ASN B C   1 
ATOM   1777  O  O   . ASN B  2  126 ? -12.775 1.033   228.632  1.00 39.49  ? 282 ASN B O   1 
ATOM   1778  C  CB  . ASN B  2  126 ? -10.582 2.644   227.247  1.00 27.59  ? 282 ASN B CB  1 
ATOM   1779  C  CG  . ASN B  2  126 ? -9.803  1.519   226.637  1.00 40.23  ? 282 ASN B CG  1 
ATOM   1780  O  OD1 . ASN B  2  126 ? -10.330 0.739   225.838  1.00 45.58  ? 282 ASN B OD1 1 
ATOM   1781  N  ND2 . ASN B  2  126 ? -8.537  1.424   226.996  1.00 43.53  ? 282 ASN B ND2 1 
ATOM   1782  N  N   . PHE B  2  127 ? -12.962 0.320   226.527  1.00 30.06  ? 283 PHE B N   1 
ATOM   1783  C  CA  . PHE B  2  127 ? -13.528 -0.963  226.921  1.00 27.51  ? 283 PHE B CA  1 
ATOM   1784  C  C   . PHE B  2  127 ? -12.566 -2.107  226.718  1.00 33.82  ? 283 PHE B C   1 
ATOM   1785  O  O   . PHE B  2  127 ? -12.869 -3.261  227.021  1.00 38.92  ? 283 PHE B O   1 
ATOM   1786  C  CB  . PHE B  2  127 ? -14.820 -1.224  226.151  1.00 17.30  ? 283 PHE B CB  1 
ATOM   1787  C  CG  . PHE B  2  127 ? -15.983 -0.526  226.724  1.00 22.83  ? 283 PHE B CG  1 
ATOM   1788  C  CD1 . PHE B  2  127 ? -16.033 0.865   226.731  1.00 9.31   ? 283 PHE B CD1 1 
ATOM   1789  C  CD2 . PHE B  2  127 ? -17.000 -1.247  227.340  1.00 10.07  ? 283 PHE B CD2 1 
ATOM   1790  C  CE1 . PHE B  2  127 ? -17.080 1.521   227.351  1.00 28.29  ? 283 PHE B CE1 1 
ATOM   1791  C  CE2 . PHE B  2  127 ? -18.056 -0.601  227.966  1.00 19.91  ? 283 PHE B CE2 1 
ATOM   1792  C  CZ  . PHE B  2  127 ? -18.103 0.782   227.978  1.00 26.74  ? 283 PHE B CZ  1 
ATOM   1793  N  N   . ALA B  2  128 ? -11.402 -1.779  226.188  1.00 31.52  ? 284 ALA B N   1 
ATOM   1794  C  CA  . ALA B  2  128 ? -10.367 -2.771  225.961  1.00 33.39  ? 284 ALA B CA  1 
ATOM   1795  C  C   . ALA B  2  128 ? -9.610  -2.895  227.289  1.00 39.52  ? 284 ALA B C   1 
ATOM   1796  O  O   . ALA B  2  128 ? -8.439  -2.521  227.376  1.00 47.56  ? 284 ALA B O   1 
ATOM   1797  C  CB  . ALA B  2  128 ? -9.418  -2.291  224.839  1.00 29.00  ? 284 ALA B CB  1 
ATOM   1798  N  N   . ARG B  2  129 ? -10.283 -3.407  228.320  1.00 39.80  ? 285 ARG B N   1 
ATOM   1799  C  CA  . ARG B  2  129 ? -9.667  -3.543  229.639  1.00 43.80  ? 285 ARG B CA  1 
ATOM   1800  C  C   . ARG B  2  129 ? -9.463  -4.979  230.069  1.00 44.07  ? 285 ARG B C   1 
ATOM   1801  O  O   . ARG B  2  129 ? -10.217 -5.864  229.677  1.00 51.73  ? 285 ARG B O   1 
ATOM   1802  C  CB  . ARG B  2  129 ? -10.514 -2.848  230.680  1.00 41.25  ? 285 ARG B CB  1 
ATOM   1803  C  CG  . ARG B  2  129 ? -11.121 -1.577  230.193  1.00 37.49  ? 285 ARG B CG  1 
ATOM   1804  C  CD  . ARG B  2  129 ? -10.083 -0.525  229.909  1.00 27.12  ? 285 ARG B CD  1 
ATOM   1805  N  NE  . ARG B  2  129 ? -10.540 0.717   230.513  1.00 42.14  ? 285 ARG B NE  1 
ATOM   1806  C  CZ  . ARG B  2  129 ? -10.321 1.054   231.777  1.00 38.75  ? 285 ARG B CZ  1 
ATOM   1807  N  NH1 . ARG B  2  129 ? -9.631  0.246   232.570  1.00 61.94  ? 285 ARG B NH1 1 
ATOM   1808  N  NH2 . ARG B  2  129 ? -10.821 2.178   232.259  1.00 44.72  ? 285 ARG B NH2 1 
ATOM   1809  N  N   . ASP B  2  130 ? -8.452  -5.192  230.904  1.00 38.30  ? 286 ASP B N   1 
ATOM   1810  C  CA  . ASP B  2  130 ? -8.116  -6.529  231.386  1.00 36.15  ? 286 ASP B CA  1 
ATOM   1811  C  C   . ASP B  2  130 ? -9.198  -7.160  232.228  1.00 47.06  ? 286 ASP B C   1 
ATOM   1812  O  O   . ASP B  2  130 ? -10.224 -6.540  232.532  1.00 41.79  ? 286 ASP B O   1 
ATOM   1813  C  CB  . ASP B  2  130 ? -6.812  -6.529  232.201  1.00 23.64  ? 286 ASP B CB  1 
ATOM   1814  C  CG  . ASP B  2  130 ? -6.853  -5.579  233.389  1.00 40.59  ? 286 ASP B CG  1 
ATOM   1815  O  OD1 . ASP B  2  130 ? -7.911  -5.473  234.058  1.00 36.50  ? 286 ASP B OD1 1 
ATOM   1816  O  OD2 . ASP B  2  130 ? -5.813  -4.940  233.661  1.00 45.07  ? 286 ASP B OD2 1 
ATOM   1817  N  N   . TRP B  2  131 ? -8.928  -8.403  232.619  1.00 51.92  ? 287 TRP B N   1 
ATOM   1818  C  CA  . TRP B  2  131 ? -9.835  -9.199  233.432  1.00 45.84  ? 287 TRP B CA  1 
ATOM   1819  C  C   . TRP B  2  131 ? -10.134 -8.576  234.795  1.00 41.68  ? 287 TRP B C   1 
ATOM   1820  O  O   . TRP B  2  131 ? -11.283 -8.553  235.243  1.00 39.85  ? 287 TRP B O   1 
ATOM   1821  C  CB  . TRP B  2  131 ? -9.248  -10.597 233.602  1.00 38.10  ? 287 TRP B CB  1 
ATOM   1822  C  CG  . TRP B  2  131 ? -10.112 -11.509 234.385  1.00 38.83  ? 287 TRP B CG  1 
ATOM   1823  C  CD1 . TRP B  2  131 ? -10.095 -11.696 235.732  1.00 28.42  ? 287 TRP B CD1 1 
ATOM   1824  C  CD2 . TRP B  2  131 ? -11.158 -12.342 233.876  1.00 34.94  ? 287 TRP B CD2 1 
ATOM   1825  N  NE1 . TRP B  2  131 ? -11.067 -12.594 236.095  1.00 16.63  ? 287 TRP B NE1 1 
ATOM   1826  C  CE2 . TRP B  2  131 ? -11.733 -13.005 234.973  1.00 25.52  ? 287 TRP B CE2 1 
ATOM   1827  C  CE3 . TRP B  2  131 ? -11.667 -12.589 232.595  1.00 36.03  ? 287 TRP B CE3 1 
ATOM   1828  C  CZ2 . TRP B  2  131 ? -12.792 -13.902 234.833  1.00 34.84  ? 287 TRP B CZ2 1 
ATOM   1829  C  CZ3 . TRP B  2  131 ? -12.724 -13.483 232.455  1.00 35.76  ? 287 TRP B CZ3 1 
ATOM   1830  C  CH2 . TRP B  2  131 ? -13.273 -14.128 233.569  1.00 37.49  ? 287 TRP B CH2 1 
ATOM   1831  N  N   . ASN B  2  132 ? -9.100  -8.075  235.460  1.00 40.21  ? 288 ASN B N   1 
ATOM   1832  C  CA  . ASN B  2  132 ? -9.290  -7.451  236.765  1.00 41.27  ? 288 ASN B CA  1 
ATOM   1833  C  C   . ASN B  2  132 ? -10.227 -6.274  236.657  1.00 39.73  ? 288 ASN B C   1 
ATOM   1834  O  O   . ASN B  2  132 ? -11.125 -6.119  237.472  1.00 39.40  ? 288 ASN B O   1 
ATOM   1835  C  CB  . ASN B  2  132 ? -7.954  -6.978  237.331  1.00 41.61  ? 288 ASN B CB  1 
ATOM   1836  C  CG  . ASN B  2  132 ? -7.095  -8.125  237.819  1.00 54.02  ? 288 ASN B CG  1 
ATOM   1837  O  OD1 . ASN B  2  132 ? -5.870  -8.094  237.671  1.00 43.22  ? 288 ASN B OD1 1 
ATOM   1838  N  ND2 . ASN B  2  132 ? -7.733  -9.146  238.424  1.00 17.96  ? 288 ASN B ND2 1 
ATOM   1839  N  N   . THR B  2  133 ? -10.016 -5.451  235.633  1.00 37.75  ? 289 THR B N   1 
ATOM   1840  C  CA  . THR B  2  133 ? -10.829 -4.273  235.433  1.00 32.79  ? 289 THR B CA  1 
ATOM   1841  C  C   . THR B  2  133 ? -12.287 -4.575  235.088  1.00 41.48  ? 289 THR B C   1 
ATOM   1842  O  O   . THR B  2  133 ? -13.193 -3.896  235.578  1.00 41.01  ? 289 THR B O   1 
ATOM   1843  C  CB  . THR B  2  133 ? -10.230 -3.391  234.350  1.00 41.06  ? 289 THR B CB  1 
ATOM   1844  O  OG1 . THR B  2  133 ? -8.897  -3.046  234.720  1.00 32.77  ? 289 THR B OG1 1 
ATOM   1845  C  CG2 . THR B  2  133 ? -11.045 -2.125  234.180  1.00 34.03  ? 289 THR B CG2 1 
ATOM   1846  N  N   . TYR B  2  134 ? -12.528 -5.577  234.248  1.00 33.66  ? 290 TYR B N   1 
ATOM   1847  C  CA  . TYR B  2  134 ? -13.910 -5.914  233.881  1.00 36.47  ? 290 TYR B CA  1 
ATOM   1848  C  C   . TYR B  2  134 ? -14.668 -6.523  235.047  1.00 37.29  ? 290 TYR B C   1 
ATOM   1849  O  O   . TYR B  2  134 ? -15.894 -6.518  235.088  1.00 36.02  ? 290 TYR B O   1 
ATOM   1850  C  CB  . TYR B  2  134 ? -13.945 -6.889  232.703  1.00 38.27  ? 290 TYR B CB  1 
ATOM   1851  C  CG  . TYR B  2  134 ? -14.268 -6.244  231.369  1.00 49.46  ? 290 TYR B CG  1 
ATOM   1852  C  CD1 . TYR B  2  134 ? -15.574 -5.848  231.068  1.00 41.18  ? 290 TYR B CD1 1 
ATOM   1853  C  CD2 . TYR B  2  134 ? -13.264 -6.009  230.419  1.00 31.30  ? 290 TYR B CD2 1 
ATOM   1854  C  CE1 . TYR B  2  134 ? -15.875 -5.234  229.858  1.00 33.57  ? 290 TYR B CE1 1 
ATOM   1855  C  CE2 . TYR B  2  134 ? -13.558 -5.394  229.209  1.00 41.06  ? 290 TYR B CE2 1 
ATOM   1856  C  CZ  . TYR B  2  134 ? -14.863 -5.012  228.932  1.00 36.60  ? 290 TYR B CZ  1 
ATOM   1857  O  OH  . TYR B  2  134 ? -15.142 -4.437  227.716  1.00 35.41  ? 290 TYR B OH  1 
ATOM   1858  N  N   . LYS B  2  135 ? -13.926 -7.044  236.009  1.00 39.28  ? 291 LYS B N   1 
ATOM   1859  C  CA  . LYS B  2  135 ? -14.543 -7.667  237.158  1.00 34.13  ? 291 LYS B CA  1 
ATOM   1860  C  C   . LYS B  2  135 ? -14.925 -6.599  238.144  1.00 31.86  ? 291 LYS B C   1 
ATOM   1861  O  O   . LYS B  2  135 ? -15.993 -6.642  238.741  1.00 40.34  ? 291 LYS B O   1 
ATOM   1862  C  CB  . LYS B  2  135 ? -13.556 -8.634  237.809  1.00 45.02  ? 291 LYS B CB  1 
ATOM   1863  C  CG  . LYS B  2  135 ? -14.044 -9.247  239.117  1.00 50.19  ? 291 LYS B CG  1 
ATOM   1864  C  CD  . LYS B  2  135 ? -12.909 -9.970  239.816  1.00 46.68  ? 291 LYS B CD  1 
ATOM   1865  C  CE  . LYS B  2  135 ? -13.312 -10.448 241.188  1.00 48.91  ? 291 LYS B CE  1 
ATOM   1866  N  NZ  . LYS B  2  135 ? -12.104 -10.893 241.939  1.00 53.04  ? 291 LYS B NZ  1 
ATOM   1867  N  N   . ALA B  2  136 ? -14.036 -5.632  238.310  1.00 29.47  ? 292 ALA B N   1 
ATOM   1868  C  CA  . ALA B  2  136 ? -14.247 -4.552  239.259  1.00 32.81  ? 292 ALA B CA  1 
ATOM   1869  C  C   . ALA B  2  136 ? -15.242 -3.500  238.810  1.00 38.70  ? 292 ALA B C   1 
ATOM   1870  O  O   . ALA B  2  136 ? -16.006 -3.014  239.615  1.00 47.59  ? 292 ALA B O   1 
ATOM   1871  C  CB  . ALA B  2  136 ? -12.920 -3.895  239.575  1.00 37.54  ? 292 ALA B CB  1 
ATOM   1872  N  N   . GLU B  2  137 ? -15.218 -3.162  237.525  1.00 47.95  ? 293 GLU B N   1 
ATOM   1873  C  CA  . GLU B  2  137 ? -16.085 -2.158  236.911  1.00 55.11  ? 293 GLU B CA  1 
ATOM   1874  C  C   . GLU B  2  137 ? -15.184 -1.055  236.402  1.00 55.19  ? 293 GLU B C   1 
ATOM   1875  O  O   . GLU B  2  137 ? -14.067 -0.895  236.894  1.00 44.12  ? 293 GLU B O   1 
ATOM   1876  C  CB  . GLU B  2  137 ? -17.080 -1.516  237.903  1.00 73.75  ? 293 GLU B CB  1 
ATOM   1877  C  CG  . GLU B  2  137 ? -17.940 -0.357  237.282  1.00 88.15  ? 293 GLU B CG  1 
ATOM   1878  C  CD  . GLU B  2  137 ? -18.114 0.875   238.192  1.00 84.67  ? 293 GLU B CD  1 
ATOM   1879  O  OE1 . GLU B  2  137 ? -18.675 0.723   239.301  1.00 94.30  ? 293 GLU B OE1 1 
ATOM   1880  O  OE2 . GLU B  2  137 ? -17.697 1.995   237.793  1.00 51.93  ? 293 GLU B OE2 1 
ATOM   1881  N  N   . PHE B  2  138 ? -15.677 -0.292  235.426  1.00 50.68  ? 294 PHE B N   1 
ATOM   1882  C  CA  . PHE B  2  138 ? -14.923 0.818   234.890  1.00 39.36  ? 294 PHE B CA  1 
ATOM   1883  C  C   . PHE B  2  138 ? -15.803 1.761   234.116  1.00 40.36  ? 294 PHE B C   1 
ATOM   1884  O  O   . PHE B  2  138 ? -16.871 1.381   233.652  1.00 48.33  ? 294 PHE B O   1 
ATOM   1885  C  CB  . PHE B  2  138 ? -13.782 0.309   234.023  1.00 16.23  ? 294 PHE B CB  1 
ATOM   1886  C  CG  . PHE B  2  138 ? -14.216 -0.377  232.771  1.00 49.34  ? 294 PHE B CG  1 
ATOM   1887  C  CD1 . PHE B  2  138 ? -14.535 0.358   231.636  1.00 48.35  ? 294 PHE B CD1 1 
ATOM   1888  C  CD2 . PHE B  2  138 ? -14.249 -1.767  232.702  1.00 55.26  ? 294 PHE B CD2 1 
ATOM   1889  C  CE1 . PHE B  2  138 ? -14.874 -0.278  230.443  1.00 54.78  ? 294 PHE B CE1 1 
ATOM   1890  C  CE2 . PHE B  2  138 ? -14.589 -2.411  231.513  1.00 58.37  ? 294 PHE B CE2 1 
ATOM   1891  C  CZ  . PHE B  2  138 ? -14.900 -1.662  230.379  1.00 55.06  ? 294 PHE B CZ  1 
ATOM   1892  N  N   . GLY B  2  139 ? -15.352 3.004   233.999  1.00 39.74  ? 295 GLY B N   1 
ATOM   1893  C  CA  . GLY B  2  139 ? -16.112 3.992   233.263  1.00 41.49  ? 295 GLY B CA  1 
ATOM   1894  C  C   . GLY B  2  139 ? -16.823 4.996   234.148  1.00 39.19  ? 295 GLY B C   1 
ATOM   1895  O  O   . GLY B  2  139 ? -16.628 5.020   235.357  1.00 43.02  ? 295 GLY B O   1 
ATOM   1896  N  N   . ASN B  2  140 ? -17.659 5.822   233.531  1.00 35.37  ? 296 ASN B N   1 
ATOM   1897  C  CA  . ASN B  2  140 ? -18.410 6.840   234.240  1.00 33.35  ? 296 ASN B CA  1 
ATOM   1898  C  C   . ASN B  2  140 ? -19.879 6.498   234.212  1.00 32.57  ? 296 ASN B C   1 
ATOM   1899  O  O   . ASN B  2  140 ? -20.440 6.251   233.148  1.00 42.01  ? 296 ASN B O   1 
ATOM   1900  C  CB  . ASN B  2  140 ? -18.204 8.198   233.576  1.00 35.92  ? 296 ASN B CB  1 
ATOM   1901  C  CG  . ASN B  2  140 ? -16.798 8.711   233.731  1.00 43.71  ? 296 ASN B CG  1 
ATOM   1902  O  OD1 . ASN B  2  140 ? -16.294 8.875   234.853  1.00 44.03  ? 296 ASN B OD1 1 
ATOM   1903  N  ND2 . ASN B  2  140 ? -16.148 8.978   232.605  1.00 46.98  ? 296 ASN B ND2 1 
ATOM   1904  N  N   . ILE B  2  141 ? -20.512 6.497   235.374  1.00 23.99  ? 297 ILE B N   1 
ATOM   1905  C  CA  . ILE B  2  141 ? -21.917 6.161   235.427  1.00 36.70  ? 297 ILE B CA  1 
ATOM   1906  C  C   . ILE B  2  141 ? -22.752 7.231   234.764  1.00 40.86  ? 297 ILE B C   1 
ATOM   1907  O  O   . ILE B  2  141 ? -23.664 6.926   233.995  1.00 52.98  ? 297 ILE B O   1 
ATOM   1908  C  CB  . ILE B  2  141 ? -22.390 5.940   236.884  1.00 38.90  ? 297 ILE B CB  1 
ATOM   1909  C  CG1 . ILE B  2  141 ? -22.159 4.478   237.308  1.00 38.92  ? 297 ILE B CG1 1 
ATOM   1910  C  CG2 . ILE B  2  141 ? -23.870 6.228   236.993  1.00 54.93  ? 297 ILE B CG2 1 
ATOM   1911  C  CD1 . ILE B  2  141 ? -20.789 3.938   236.975  1.00 38.66  ? 297 ILE B CD1 1 
ATOM   1912  N  N   . ALA B  2  142 ? -22.430 8.486   235.057  1.00 41.80  ? 298 ALA B N   1 
ATOM   1913  C  CA  . ALA B  2  142 ? -23.160 9.614   234.497  1.00 42.92  ? 298 ALA B CA  1 
ATOM   1914  C  C   . ALA B  2  142 ? -22.389 10.912  234.653  1.00 43.88  ? 298 ALA B C   1 
ATOM   1915  O  O   . ALA B  2  142 ? -21.468 10.993  235.461  1.00 35.60  ? 298 ALA B O   1 
ATOM   1916  C  CB  . ALA B  2  142 ? -24.512 9.736   235.171  1.00 32.91  ? 298 ALA B CB  1 
ATOM   1917  N  N   . PHE B  2  143 ? -22.778 11.923  233.873  1.00 50.57  ? 299 PHE B N   1 
ATOM   1918  C  CA  . PHE B  2  143 ? -22.145 13.240  233.904  1.00 45.00  ? 299 PHE B CA  1 
ATOM   1919  C  C   . PHE B  2  143 ? -23.139 14.293  234.386  1.00 45.86  ? 299 PHE B C   1 
ATOM   1920  O  O   . PHE B  2  143 ? -24.353 14.064  234.323  1.00 50.73  ? 299 PHE B O   1 
ATOM   1921  C  CB  . PHE B  2  143 ? -21.666 13.600  232.518  1.00 38.11  ? 299 PHE B CB  1 
ATOM   1922  C  CG  . PHE B  2  143 ? -20.589 12.704  231.992  1.00 38.55  ? 299 PHE B CG  1 
ATOM   1923  C  CD1 . PHE B  2  143 ? -19.313 12.725  232.547  1.00 49.85  ? 299 PHE B CD1 1 
ATOM   1924  C  CD2 . PHE B  2  143 ? -20.828 11.882  230.904  1.00 42.26  ? 299 PHE B CD2 1 
ATOM   1925  C  CE1 . PHE B  2  143 ? -18.286 11.941  232.020  1.00 44.03  ? 299 PHE B CE1 1 
ATOM   1926  C  CE2 . PHE B  2  143 ? -19.809 11.095  230.368  1.00 48.44  ? 299 PHE B CE2 1 
ATOM   1927  C  CZ  . PHE B  2  143 ? -18.533 11.127  230.930  1.00 45.45  ? 299 PHE B CZ  1 
ATOM   1928  N  N   . GLY B  2  144 ? -22.619 15.431  234.867  1.00 50.86  ? 300 GLY B N   1 
ATOM   1929  C  CA  . GLY B  2  144 ? -23.453 16.524  235.371  1.00 45.34  ? 300 GLY B CA  1 
ATOM   1930  C  C   . GLY B  2  144 ? -24.299 17.158  234.281  1.00 50.78  ? 300 GLY B C   1 
ATOM   1931  O  O   . GLY B  2  144 ? -23.778 17.577  233.247  1.00 37.08  ? 300 GLY B O   1 
ATOM   1932  N  N   . ASN B  2  145 ? -25.607 17.231  234.501  1.00 52.73  ? 301 ASN B N   1 
ATOM   1933  C  CA  . ASN B  2  145 ? -26.504 17.795  233.498  1.00 55.15  ? 301 ASN B CA  1 
ATOM   1934  C  C   . ASN B  2  145 ? -26.432 19.309  233.439  1.00 65.48  ? 301 ASN B C   1 
ATOM   1935  O  O   . ASN B  2  145 ? -27.188 19.944  232.698  1.00 74.27  ? 301 ASN B O   1 
ATOM   1936  C  CB  . ASN B  2  145 ? -27.941 17.387  233.784  1.00 52.49  ? 301 ASN B CB  1 
ATOM   1937  C  CG  . ASN B  2  145 ? -28.622 18.327  234.753  1.00 54.19  ? 301 ASN B CG  1 
ATOM   1938  O  OD1 . ASN B  2  145 ? -27.984 18.900  235.632  1.00 37.42  ? 301 ASN B OD1 1 
ATOM   1939  N  ND2 . ASN B  2  145 ? -29.930 18.480  234.607  1.00 65.65  ? 301 ASN B ND2 1 
ATOM   1940  N  N   . GLY B  2  146 ? -25.529 19.894  234.217  1.00 65.40  ? 302 GLY B N   1 
ATOM   1941  C  CA  . GLY B  2  146 ? -25.408 21.341  234.208  1.00 73.79  ? 302 GLY B CA  1 
ATOM   1942  C  C   . GLY B  2  146 ? -25.790 21.892  235.561  1.00 68.31  ? 302 GLY B C   1 
ATOM   1943  O  O   . GLY B  2  146 ? -25.117 22.769  236.100  1.00 66.31  ? 302 GLY B O   1 
ATOM   1944  N  N   . LYS B  2  147 ? -26.892 21.389  236.100  1.00 68.34  ? 303 LYS B N   1 
ATOM   1945  C  CA  . LYS B  2  147 ? -27.333 21.806  237.419  1.00 70.14  ? 303 LYS B CA  1 
ATOM   1946  C  C   . LYS B  2  147 ? -26.350 21.035  238.276  1.00 65.70  ? 303 LYS B C   1 
ATOM   1947  O  O   . LYS B  2  147 ? -25.223 21.473  238.493  1.00 72.21  ? 303 LYS B O   1 
ATOM   1948  C  CB  . LYS B  2  147 ? -28.771 21.341  237.691  1.00 67.38  ? 303 LYS B CB  1 
ATOM   1949  C  CG  . LYS B  2  147 ? -29.786 21.645  236.570  1.00 74.64  ? 303 LYS B CG  1 
ATOM   1950  C  CD  . LYS B  2  147 ? -30.031 23.144  236.347  1.00 71.99  ? 303 LYS B CD  1 
ATOM   1951  C  CE  . LYS B  2  147 ? -28.945 23.818  235.501  1.00 68.37  ? 303 LYS B CE  1 
ATOM   1952  N  NZ  . LYS B  2  147 ? -28.852 23.277  234.110  1.00 58.56  ? 303 LYS B NZ  1 
ATOM   1953  N  N   . SER B  2  148 ? -26.764 19.864  238.725  1.00 69.94  ? 304 SER B N   1 
ATOM   1954  C  CA  . SER B  2  148 ? -25.891 19.019  239.516  1.00 70.50  ? 304 SER B CA  1 
ATOM   1955  C  C   . SER B  2  148 ? -26.515 17.649  239.667  1.00 63.39  ? 304 SER B C   1 
ATOM   1956  O  O   . SER B  2  148 ? -26.227 16.915  240.609  1.00 57.95  ? 304 SER B O   1 
ATOM   1957  C  CB  . SER B  2  148 ? -25.622 19.656  240.877  1.00 73.63  ? 304 SER B CB  1 
ATOM   1958  O  OG  . SER B  2  148 ? -24.726 20.749  240.735  1.00 52.61  ? 304 SER B OG  1 
ATOM   1959  N  N   . ILE B  2  149 ? -27.374 17.319  238.711  1.00 59.37  ? 305 ILE B N   1 
ATOM   1960  C  CA  . ILE B  2  149 ? -28.048 16.034  238.688  1.00 65.25  ? 305 ILE B CA  1 
ATOM   1961  C  C   . ILE B  2  149 ? -27.431 15.174  237.588  1.00 69.12  ? 305 ILE B C   1 
ATOM   1962  O  O   . ILE B  2  149 ? -27.431 15.548  236.416  1.00 72.03  ? 305 ILE B O   1 
ATOM   1963  C  CB  . ILE B  2  149 ? -29.550 16.224  238.444  1.00 67.71  ? 305 ILE B CB  1 
ATOM   1964  C  CG1 . ILE B  2  149 ? -29.762 17.244  237.320  1.00 73.61  ? 305 ILE B CG1 1 
ATOM   1965  C  CG2 . ILE B  2  149 ? -30.219 16.700  239.722  1.00 46.28  ? 305 ILE B CG2 1 
ATOM   1966  C  CD1 . ILE B  2  149 ? -31.221 17.629  237.071  1.00 93.73  ? 305 ILE B CD1 1 
ATOM   1967  N  N   . CYS B  2  150 ? -26.870 14.035  237.977  1.00 66.93  ? 306 CYS B N   1 
ATOM   1968  C  CA  . CYS B  2  150 ? -26.247 13.144  237.012  1.00 68.11  ? 306 CYS B CA  1 
ATOM   1969  C  C   . CYS B  2  150 ? -27.268 12.293  236.271  1.00 64.55  ? 306 CYS B C   1 
ATOM   1970  O  O   . CYS B  2  150 ? -27.513 11.135  236.629  1.00 60.88  ? 306 CYS B O   1 
ATOM   1971  C  CB  . CYS B  2  150 ? -25.221 12.247  237.704  1.00 68.88  ? 306 CYS B CB  1 
ATOM   1972  S  SG  . CYS B  2  150 ? -23.542 12.948  237.735  1.00 75.69  ? 306 CYS B SG  1 
ATOM   1973  N  N   . ASN B  2  151 ? -27.864 12.877  235.236  1.00 58.73  ? 307 ASN B N   1 
ATOM   1974  C  CA  . ASN B  2  151 ? -28.856 12.177  234.431  1.00 52.80  ? 307 ASN B CA  1 
ATOM   1975  C  C   . ASN B  2  151 ? -28.352 12.007  233.003  1.00 45.15  ? 307 ASN B C   1 
ATOM   1976  O  O   . ASN B  2  151 ? -29.084 11.576  232.118  1.00 56.38  ? 307 ASN B O   1 
ATOM   1977  C  CB  . ASN B  2  151 ? -30.192 12.927  234.440  1.00 41.11  ? 307 ASN B CB  1 
ATOM   1978  C  CG  . ASN B  2  151 ? -30.041 14.388  234.087  1.00 53.75  ? 307 ASN B CG  1 
ATOM   1979  O  OD1 . ASN B  2  151 ? -29.401 14.748  233.082  1.00 49.55  ? 307 ASN B OD1 1 
ATOM   1980  N  ND2 . ASN B  2  151 ? -30.633 15.247  234.908  1.00 34.60  ? 307 ASN B ND2 1 
ATOM   1981  N  N   . ILE B  2  152 ? -27.099 12.361  232.776  1.00 40.84  ? 308 ILE B N   1 
ATOM   1982  C  CA  . ILE B  2  152 ? -26.516 12.187  231.456  1.00 46.29  ? 308 ILE B CA  1 
ATOM   1983  C  C   . ILE B  2  152 ? -25.669 10.920  231.528  1.00 52.77  ? 308 ILE B C   1 
ATOM   1984  O  O   . ILE B  2  152 ? -24.515 10.948  231.950  1.00 58.72  ? 308 ILE B O   1 
ATOM   1985  C  CB  . ILE B  2  152 ? -25.607 13.354  231.073  1.00 37.03  ? 308 ILE B CB  1 
ATOM   1986  C  CG1 . ILE B  2  152 ? -26.445 14.601  230.835  1.00 43.05  ? 308 ILE B CG1 1 
ATOM   1987  C  CG2 . ILE B  2  152 ? -24.775 12.969  229.863  1.00 32.94  ? 308 ILE B CG2 1 
ATOM   1988  C  CD1 . ILE B  2  152 ? -25.648 15.799  230.410  1.00 46.04  ? 308 ILE B CD1 1 
ATOM   1989  N  N   . PRO B  2  153 ? -26.235 9.785   231.111  1.00 53.53  ? 309 PRO B N   1 
ATOM   1990  C  CA  . PRO B  2  153 ? -25.519 8.514   231.143  1.00 45.14  ? 309 PRO B CA  1 
ATOM   1991  C  C   . PRO B  2  153 ? -24.153 8.555   230.496  1.00 42.46  ? 309 PRO B C   1 
ATOM   1992  O  O   . PRO B  2  153 ? -23.958 9.208   229.479  1.00 46.24  ? 309 PRO B O   1 
ATOM   1993  C  CB  . PRO B  2  153 ? -26.475 7.578   230.427  1.00 44.92  ? 309 PRO B CB  1 
ATOM   1994  C  CG  . PRO B  2  153 ? -27.131 8.459   229.464  1.00 41.73  ? 309 PRO B CG  1 
ATOM   1995  C  CD  . PRO B  2  153 ? -27.459 9.657   230.305  1.00 56.74  ? 309 PRO B CD  1 
ATOM   1996  N  N   . GLY B  2  154 ? -23.204 7.850   231.098  1.00 44.68  ? 310 GLY B N   1 
ATOM   1997  C  CA  . GLY B  2  154 ? -21.861 7.818   230.549  1.00 50.94  ? 310 GLY B CA  1 
ATOM   1998  C  C   . GLY B  2  154 ? -21.525 6.411   230.101  1.00 49.11  ? 310 GLY B C   1 
ATOM   1999  O  O   . GLY B  2  154 ? -22.383 5.528   230.176  1.00 45.14  ? 310 GLY B O   1 
ATOM   2000  N  N   . GLU B  2  155 ? -20.300 6.199   229.625  1.00 38.03  ? 311 GLU B N   1 
ATOM   2001  C  CA  . GLU B  2  155 ? -19.896 4.868   229.193  1.00 36.97  ? 311 GLU B CA  1 
ATOM   2002  C  C   . GLU B  2  155 ? -19.278 4.095   230.352  1.00 41.93  ? 311 GLU B C   1 
ATOM   2003  O  O   . GLU B  2  155 ? -18.308 4.538   230.960  1.00 46.00  ? 311 GLU B O   1 
ATOM   2004  C  CB  . GLU B  2  155 ? -18.882 4.943   228.067  1.00 22.23  ? 311 GLU B CB  1 
ATOM   2005  C  CG  . GLU B  2  155 ? -19.394 5.597   226.824  1.00 46.63  ? 311 GLU B CG  1 
ATOM   2006  C  CD  . GLU B  2  155 ? -19.116 4.779   225.586  1.00 49.53  ? 311 GLU B CD  1 
ATOM   2007  O  OE1 . GLU B  2  155 ? -17.971 4.297   225.420  1.00 52.03  ? 311 GLU B OE1 1 
ATOM   2008  O  OE2 . GLU B  2  155 ? -20.047 4.637   224.768  1.00 52.13  ? 311 GLU B OE2 1 
ATOM   2009  N  N   . TYR B  2  156 ? -19.847 2.942   230.669  1.00 36.73  ? 312 TYR B N   1 
ATOM   2010  C  CA  . TYR B  2  156 ? -19.305 2.146   231.743  1.00 29.30  ? 312 TYR B CA  1 
ATOM   2011  C  C   . TYR B  2  156 ? -19.717 0.689   231.713  1.00 39.15  ? 312 TYR B C   1 
ATOM   2012  O  O   . TYR B  2  156 ? -20.628 0.275   231.002  1.00 50.43  ? 312 TYR B O   1 
ATOM   2013  C  CB  . TYR B  2  156 ? -19.693 2.732   233.098  1.00 17.09  ? 312 TYR B CB  1 
ATOM   2014  C  CG  . TYR B  2  156 ? -21.136 2.510   233.509  1.00 32.84  ? 312 TYR B CG  1 
ATOM   2015  C  CD1 . TYR B  2  156 ? -22.108 3.473   233.262  1.00 35.81  ? 312 TYR B CD1 1 
ATOM   2016  C  CD2 . TYR B  2  156 ? -21.526 1.344   234.171  1.00 40.63  ? 312 TYR B CD2 1 
ATOM   2017  C  CE1 . TYR B  2  156 ? -23.426 3.290   233.665  1.00 21.74  ? 312 TYR B CE1 1 
ATOM   2018  C  CE2 . TYR B  2  156 ? -22.839 1.149   234.574  1.00 29.87  ? 312 TYR B CE2 1 
ATOM   2019  C  CZ  . TYR B  2  156 ? -23.783 2.127   234.316  1.00 37.99  ? 312 TYR B CZ  1 
ATOM   2020  O  OH  . TYR B  2  156 ? -25.091 1.935   234.697  1.00 47.54  ? 312 TYR B OH  1 
ATOM   2021  N  N   . TRP B  2  157 ? -19.001 -0.088  232.503  1.00 42.53  ? 313 TRP B N   1 
ATOM   2022  C  CA  . TRP B  2  157 ? -19.275 -1.489  232.656  1.00 39.92  ? 313 TRP B CA  1 
ATOM   2023  C  C   . TRP B  2  157 ? -19.304 -1.692  234.164  1.00 41.11  ? 313 TRP B C   1 
ATOM   2024  O  O   . TRP B  2  157 ? -18.254 -1.722  234.790  1.00 41.96  ? 313 TRP B O   1 
ATOM   2025  C  CB  . TRP B  2  157 ? -18.162 -2.325  232.012  1.00 29.15  ? 313 TRP B CB  1 
ATOM   2026  C  CG  . TRP B  2  157 ? -18.301 -3.813  232.263  1.00 53.37  ? 313 TRP B CG  1 
ATOM   2027  C  CD1 . TRP B  2  157 ? -17.736 -4.533  233.281  1.00 45.81  ? 313 TRP B CD1 1 
ATOM   2028  C  CD2 . TRP B  2  157 ? -19.107 -4.741  231.521  1.00 57.22  ? 313 TRP B CD2 1 
ATOM   2029  N  NE1 . TRP B  2  157 ? -18.140 -5.842  233.219  1.00 41.19  ? 313 TRP B NE1 1 
ATOM   2030  C  CE2 . TRP B  2  157 ? -18.982 -6.001  232.153  1.00 45.07  ? 313 TRP B CE2 1 
ATOM   2031  C  CE3 . TRP B  2  157 ? -19.924 -4.630  230.385  1.00 45.17  ? 313 TRP B CE3 1 
ATOM   2032  C  CZ2 . TRP B  2  157 ? -19.642 -7.134  231.693  1.00 30.53  ? 313 TRP B CZ2 1 
ATOM   2033  C  CZ3 . TRP B  2  157 ? -20.580 -5.759  229.929  1.00 40.35  ? 313 TRP B CZ3 1 
ATOM   2034  C  CH2 . TRP B  2  157 ? -20.436 -6.996  230.585  1.00 40.92  ? 313 TRP B CH2 1 
ATOM   2035  N  N   . LEU B  2  158 ? -20.500 -1.759  234.750  1.00 42.16  ? 314 LEU B N   1 
ATOM   2036  C  CA  . LEU B  2  158 ? -20.640 -2.007  236.188  1.00 40.45  ? 314 LEU B CA  1 
ATOM   2037  C  C   . LEU B  2  158 ? -19.867 -3.302  236.271  1.00 48.95  ? 314 LEU B C   1 
ATOM   2038  O  O   . LEU B  2  158 ? -20.030 -4.153  235.391  1.00 68.44  ? 314 LEU B O   1 
ATOM   2039  C  CB  . LEU B  2  158 ? -22.104 -2.269  236.539  1.00 21.94  ? 314 LEU B CB  1 
ATOM   2040  C  CG  . LEU B  2  158 ? -22.490 -2.291  238.016  1.00 31.75  ? 314 LEU B CG  1 
ATOM   2041  C  CD1 . LEU B  2  158 ? -22.469 -0.887  238.595  1.00 21.91  ? 314 LEU B CD1 1 
ATOM   2042  C  CD2 . LEU B  2  158 ? -23.886 -2.857  238.162  1.00 26.16  ? 314 LEU B CD2 1 
ATOM   2043  N  N   . GLY B  2  159 ? -19.029 -3.485  237.279  1.00 30.26  ? 315 GLY B N   1 
ATOM   2044  C  CA  . GLY B  2  159 ? -18.260 -4.730  237.317  1.00 35.63  ? 315 GLY B CA  1 
ATOM   2045  C  C   . GLY B  2  159 ? -18.951 -6.092  237.141  1.00 20.26  ? 315 GLY B C   1 
ATOM   2046  O  O   . GLY B  2  159 ? -20.020 -6.348  237.702  1.00 7.35   ? 315 GLY B O   1 
ATOM   2047  N  N   . THR B  2  160 ? -18.330 -6.991  236.382  1.00 19.19  ? 316 THR B N   1 
ATOM   2048  C  CA  . THR B  2  160 ? -18.917 -8.322  236.189  1.00 33.27  ? 316 THR B CA  1 
ATOM   2049  C  C   . THR B  2  160 ? -19.243 -9.010  237.518  1.00 43.75  ? 316 THR B C   1 
ATOM   2050  O  O   . THR B  2  160 ? -20.309 -9.607  237.677  1.00 48.03  ? 316 THR B O   1 
ATOM   2051  C  CB  . THR B  2  160 ? -17.976 -9.254  235.426  1.00 42.14  ? 316 THR B CB  1 
ATOM   2052  O  OG1 . THR B  2  160 ? -17.719 -8.703  234.135  1.00 26.36  ? 316 THR B OG1 1 
ATOM   2053  C  CG2 . THR B  2  160 ? -18.606 -10.666 235.279  1.00 21.14  ? 316 THR B CG2 1 
ATOM   2054  N  N   . LYS B  2  161 ? -18.311 -8.937  238.464  1.00 38.57  ? 317 LYS B N   1 
ATOM   2055  C  CA  . LYS B  2  161 ? -18.508 -9.548  239.757  1.00 37.93  ? 317 LYS B CA  1 
ATOM   2056  C  C   . LYS B  2  161 ? -19.777 -9.032  240.437  1.00 41.55  ? 317 LYS B C   1 
ATOM   2057  O  O   . LYS B  2  161 ? -20.486 -9.779  241.112  1.00 33.58  ? 317 LYS B O   1 
ATOM   2058  C  CB  . LYS B  2  161 ? -17.295 -9.279  240.638  1.00 38.41  ? 317 LYS B CB  1 
ATOM   2059  C  CG  . LYS B  2  161 ? -17.365 -10.000 241.969  1.00 40.17  ? 317 LYS B CG  1 
ATOM   2060  C  CD  . LYS B  2  161 ? -17.441 -11.498 241.778  1.00 33.25  ? 317 LYS B CD  1 
ATOM   2061  C  CE  . LYS B  2  161 ? -17.610 -12.172 243.105  1.00 43.29  ? 317 LYS B CE  1 
ATOM   2062  N  NZ  . LYS B  2  161 ? -18.578 -11.405 243.915  1.00 43.66  ? 317 LYS B NZ  1 
ATOM   2063  N  N   . THR B  2  162 ? -20.054 -7.745  240.270  1.00 50.72  ? 318 THR B N   1 
ATOM   2064  C  CA  . THR B  2  162 ? -21.250 -7.150  240.859  1.00 46.55  ? 318 THR B CA  1 
ATOM   2065  C  C   . THR B  2  162 ? -22.442 -7.748  240.148  1.00 48.24  ? 318 THR B C   1 
ATOM   2066  O  O   . THR B  2  162 ? -23.413 -8.173  240.772  1.00 40.17  ? 318 THR B O   1 
ATOM   2067  C  CB  . THR B  2  162 ? -21.306 -5.635  240.642  1.00 47.46  ? 318 THR B CB  1 
ATOM   2068  O  OG1 . THR B  2  162 ? -20.278 -4.995  241.410  1.00 60.16  ? 318 THR B OG1 1 
ATOM   2069  C  CG2 . THR B  2  162 ? -22.674 -5.108  241.060  1.00 44.49  ? 318 THR B CG2 1 
ATOM   2070  N  N   . VAL B  2  163 ? -22.362 -7.759  238.824  1.00 35.81  ? 319 VAL B N   1 
ATOM   2071  C  CA  . VAL B  2  163 ? -23.423 -8.312  238.015  1.00 37.01  ? 319 VAL B CA  1 
ATOM   2072  C  C   . VAL B  2  163 ? -23.654 -9.755  238.474  1.00 46.35  ? 319 VAL B C   1 
ATOM   2073  O  O   . VAL B  2  163 ? -24.788 -10.169 238.700  1.00 49.23  ? 319 VAL B O   1 
ATOM   2074  C  CB  . VAL B  2  163 ? -23.032 -8.282  236.517  1.00 37.51  ? 319 VAL B CB  1 
ATOM   2075  C  CG1 . VAL B  2  163 ? -24.205 -8.693  235.643  1.00 17.00  ? 319 VAL B CG1 1 
ATOM   2076  C  CG2 . VAL B  2  163 ? -22.565 -6.901  236.147  1.00 34.92  ? 319 VAL B CG2 1 
ATOM   2077  N  N   . HIS B  2  164 ? -22.577 -10.516 238.636  1.00 48.65  ? 320 HIS B N   1 
ATOM   2078  C  CA  . HIS B  2  164 ? -22.719 -11.899 239.057  1.00 45.84  ? 320 HIS B CA  1 
ATOM   2079  C  C   . HIS B  2  164 ? -23.455 -11.991 240.369  1.00 48.07  ? 320 HIS B C   1 
ATOM   2080  O  O   . HIS B  2  164 ? -24.445 -12.709 240.471  1.00 52.94  ? 320 HIS B O   1 
ATOM   2081  C  CB  . HIS B  2  164 ? -21.367 -12.575 239.195  1.00 49.31  ? 320 HIS B CB  1 
ATOM   2082  C  CG  . HIS B  2  164 ? -21.430 -13.891 239.903  1.00 54.88  ? 320 HIS B CG  1 
ATOM   2083  N  ND1 . HIS B  2  164 ? -21.424 -13.999 241.278  1.00 44.71  ? 320 HIS B ND1 1 
ATOM   2084  C  CD2 . HIS B  2  164 ? -21.526 -15.154 239.427  1.00 53.99  ? 320 HIS B CD2 1 
ATOM   2085  C  CE1 . HIS B  2  164 ? -21.510 -15.272 241.616  1.00 37.58  ? 320 HIS B CE1 1 
ATOM   2086  N  NE2 . HIS B  2  164 ? -21.573 -15.994 240.512  1.00 37.67  ? 320 HIS B NE2 1 
ATOM   2087  N  N   . GLN B  2  165 ? -22.971 -11.273 241.378  1.00 45.38  ? 321 GLN B N   1 
ATOM   2088  C  CA  . GLN B  2  165 ? -23.628 -11.295 242.682  1.00 48.50  ? 321 GLN B CA  1 
ATOM   2089  C  C   . GLN B  2  165 ? -25.085 -10.915 242.513  1.00 48.06  ? 321 GLN B C   1 
ATOM   2090  O  O   . GLN B  2  165 ? -25.960 -11.468 243.154  1.00 49.01  ? 321 GLN B O   1 
ATOM   2091  C  CB  . GLN B  2  165 ? -22.963 -10.316 243.657  1.00 32.00  ? 321 GLN B CB  1 
ATOM   2092  C  CG  . GLN B  2  165 ? -21.580 -10.734 244.080  1.00 52.02  ? 321 GLN B CG  1 
ATOM   2093  C  CD  . GLN B  2  165 ? -21.581 -12.065 244.798  1.00 62.15  ? 321 GLN B CD  1 
ATOM   2094  O  OE1 . GLN B  2  165 ? -20.547 -12.729 244.908  1.00 72.30  ? 321 GLN B OE1 1 
ATOM   2095  N  NE2 . GLN B  2  165 ? -22.746 -12.462 245.301  1.00 68.85  ? 321 GLN B NE2 1 
ATOM   2096  N  N   . LEU B  2  166 ? -25.341 -9.970  241.625  1.00 61.15  ? 322 LEU B N   1 
ATOM   2097  C  CA  . LEU B  2  166 ? -26.696 -9.501  241.394  1.00 57.65  ? 322 LEU B CA  1 
ATOM   2098  C  C   . LEU B  2  166 ? -27.639 -10.635 241.010  1.00 58.46  ? 322 LEU B C   1 
ATOM   2099  O  O   . LEU B  2  166 ? -28.762 -10.720 241.510  1.00 52.91  ? 322 LEU B O   1 
ATOM   2100  C  CB  . LEU B  2  166 ? -26.687 -8.448  240.295  1.00 53.42  ? 322 LEU B CB  1 
ATOM   2101  C  CG  . LEU B  2  166 ? -27.586 -7.249  240.541  1.00 42.63  ? 322 LEU B CG  1 
ATOM   2102  C  CD1 . LEU B  2  166 ? -27.657 -6.410  239.269  1.00 64.07  ? 322 LEU B CD1 1 
ATOM   2103  C  CD2 . LEU B  2  166 ? -28.953 -7.725  240.933  1.00 47.61  ? 322 LEU B CD2 1 
ATOM   2104  N  N   . THR B  2  167 ? -27.172 -11.504 240.122  1.00 51.58  ? 323 THR B N   1 
ATOM   2105  C  CA  . THR B  2  167 ? -27.973 -12.623 239.656  1.00 58.11  ? 323 THR B CA  1 
ATOM   2106  C  C   . THR B  2  167 ? -27.895 -13.842 240.559  1.00 58.54  ? 323 THR B C   1 
ATOM   2107  O  O   . THR B  2  167 ? -28.753 -14.710 240.499  1.00 51.48  ? 323 THR B O   1 
ATOM   2108  C  CB  . THR B  2  167 ? -27.547 -13.050 238.253  1.00 57.49  ? 323 THR B CB  1 
ATOM   2109  O  OG1 . THR B  2  167 ? -26.182 -13.481 238.283  1.00 59.85  ? 323 THR B OG1 1 
ATOM   2110  C  CG2 . THR B  2  167 ? -27.693 -11.893 237.283  1.00 61.97  ? 323 THR B CG2 1 
ATOM   2111  N  N   . LYS B  2  168 ? -26.862 -13.917 241.389  1.00 69.61  ? 324 LYS B N   1 
ATOM   2112  C  CA  . LYS B  2  168 ? -26.717 -15.058 242.288  1.00 78.77  ? 324 LYS B CA  1 
ATOM   2113  C  C   . LYS B  2  168 ? -27.740 -14.931 243.407  1.00 84.41  ? 324 LYS B C   1 
ATOM   2114  O  O   . LYS B  2  168 ? -28.351 -15.918 243.819  1.00 87.43  ? 324 LYS B O   1 
ATOM   2115  C  CB  . LYS B  2  168 ? -25.300 -15.111 242.861  1.00 65.99  ? 324 LYS B CB  1 
ATOM   2116  C  CG  . LYS B  2  168 ? -24.969 -16.402 243.565  1.00 60.57  ? 324 LYS B CG  1 
ATOM   2117  C  CD  . LYS B  2  168 ? -25.022 -16.241 245.073  1.00 74.70  ? 324 LYS B CD  1 
ATOM   2118  C  CE  . LYS B  2  168 ? -23.901 -15.339 245.583  1.00 83.26  ? 324 LYS B CE  1 
ATOM   2119  N  NZ  . LYS B  2  168 ? -22.543 -15.936 245.383  1.00 78.25  ? 324 LYS B NZ  1 
ATOM   2120  N  N   . GLN B  2  169 ? -27.928 -13.704 243.885  1.00 97.05  ? 325 GLN B N   1 
ATOM   2121  C  CA  . GLN B  2  169 ? -28.892 -13.425 244.943  1.00 106.11 ? 325 GLN B CA  1 
ATOM   2122  C  C   . GLN B  2  169 ? -30.256 -13.901 244.455  1.00 109.55 ? 325 GLN B C   1 
ATOM   2123  O  O   . GLN B  2  169 ? -31.035 -14.472 245.220  1.00 109.32 ? 325 GLN B O   1 
ATOM   2124  C  CB  . GLN B  2  169 ? -28.925 -11.924 245.246  1.00 110.40 ? 325 GLN B CB  1 
ATOM   2125  C  CG  . GLN B  2  169 ? -29.831 -11.543 246.403  1.00 120.94 ? 325 GLN B CG  1 
ATOM   2126  C  CD  . GLN B  2  169 ? -29.824 -10.052 246.685  1.00 126.11 ? 325 GLN B CD  1 
ATOM   2127  O  OE1 . GLN B  2  169 ? -30.529 -9.575  247.578  1.00 126.83 ? 325 GLN B OE1 1 
ATOM   2128  N  NE2 . GLN B  2  169 ? -29.026 -9.305  245.924  1.00 124.24 ? 325 GLN B NE2 1 
ATOM   2129  N  N   . HIS B  2  170 ? -30.530 -13.659 243.174  1.00 112.99 ? 326 HIS B N   1 
ATOM   2130  C  CA  . HIS B  2  170 ? -31.772 -14.089 242.535  1.00 114.77 ? 326 HIS B CA  1 
ATOM   2131  C  C   . HIS B  2  170 ? -31.867 -13.665 241.079  1.00 104.45 ? 326 HIS B C   1 
ATOM   2132  O  O   . HIS B  2  170 ? -31.917 -12.479 240.758  1.00 102.39 ? 326 HIS B O   1 
ATOM   2133  C  CB  . HIS B  2  170 ? -33.000 -13.597 243.306  1.00 132.70 ? 326 HIS B CB  1 
ATOM   2134  C  CG  . HIS B  2  170 ? -33.904 -14.709 243.745  1.00 143.60 ? 326 HIS B CG  1 
ATOM   2135  N  ND1 . HIS B  2  170 ? -34.655 -15.452 242.859  1.00 141.91 ? 326 HIS B ND1 1 
ATOM   2136  C  CD2 . HIS B  2  170 ? -34.129 -15.246 244.969  1.00 145.72 ? 326 HIS B CD2 1 
ATOM   2137  C  CE1 . HIS B  2  170 ? -35.301 -16.399 243.518  1.00 142.60 ? 326 HIS B CE1 1 
ATOM   2138  N  NE2 . HIS B  2  170 ? -34.998 -16.296 244.799  1.00 145.11 ? 326 HIS B NE2 1 
ATOM   2139  N  N   . THR B  2  171 ? -31.898 -14.675 240.214  1.00 97.40  ? 327 THR B N   1 
ATOM   2140  C  CA  . THR B  2  171 ? -31.960 -14.530 238.761  1.00 88.98  ? 327 THR B CA  1 
ATOM   2141  C  C   . THR B  2  171 ? -32.652 -13.274 238.241  1.00 88.38  ? 327 THR B C   1 
ATOM   2142  O  O   . THR B  2  171 ? -33.737 -12.899 238.693  1.00 88.26  ? 327 THR B O   1 
ATOM   2143  C  CB  . THR B  2  171 ? -32.631 -15.763 238.127  1.00 80.69  ? 327 THR B CB  1 
ATOM   2144  O  OG1 . THR B  2  171 ? -32.089 -16.951 238.713  1.00 81.28  ? 327 THR B OG1 1 
ATOM   2145  C  CG2 . THR B  2  171 ? -32.363 -15.804 236.636  1.00 71.80  ? 327 THR B CG2 1 
ATOM   2146  N  N   . GLN B  2  172 ? -32.008 -12.640 237.267  1.00 82.45  ? 328 GLN B N   1 
ATOM   2147  C  CA  . GLN B  2  172 ? -32.512 -11.417 236.654  1.00 76.15  ? 328 GLN B CA  1 
ATOM   2148  C  C   . GLN B  2  172 ? -32.928 -11.655 235.204  1.00 69.50  ? 328 GLN B C   1 
ATOM   2149  O  O   . GLN B  2  172 ? -32.756 -12.743 234.650  1.00 69.64  ? 328 GLN B O   1 
ATOM   2150  C  CB  . GLN B  2  172 ? -31.415 -10.352 236.647  1.00 75.60  ? 328 GLN B CB  1 
ATOM   2151  C  CG  . GLN B  2  172 ? -30.704 -10.142 237.959  1.00 77.72  ? 328 GLN B CG  1 
ATOM   2152  C  CD  . GLN B  2  172 ? -31.460 -9.225  238.876  1.00 73.12  ? 328 GLN B CD  1 
ATOM   2153  O  OE1 . GLN B  2  172 ? -31.736 -8.074  238.537  1.00 77.09  ? 328 GLN B OE1 1 
ATOM   2154  N  NE2 . GLN B  2  172 ? -31.799 -9.724  240.047  1.00 75.26  ? 328 GLN B NE2 1 
ATOM   2155  N  N   . GLN B  2  173 ? -33.473 -10.614 234.595  1.00 56.23  ? 329 GLN B N   1 
ATOM   2156  C  CA  . GLN B  2  173 ? -33.861 -10.663 233.202  1.00 53.55  ? 329 GLN B CA  1 
ATOM   2157  C  C   . GLN B  2  173 ? -33.059 -9.534  232.589  1.00 57.43  ? 329 GLN B C   1 
ATOM   2158  O  O   . GLN B  2  173 ? -32.989 -8.449  233.155  1.00 63.71  ? 329 GLN B O   1 
ATOM   2159  C  CB  . GLN B  2  173 ? -35.360 -10.411 233.042  1.00 60.26  ? 329 GLN B CB  1 
ATOM   2160  C  CG  . GLN B  2  173 ? -35.868 -9.117  233.639  1.00 62.08  ? 329 GLN B CG  1 
ATOM   2161  C  CD  . GLN B  2  173 ? -37.364 -8.944  233.446  1.00 65.34  ? 329 GLN B CD  1 
ATOM   2162  O  OE1 . GLN B  2  173 ? -37.854 -8.924  232.325  1.00 52.62  ? 329 GLN B OE1 1 
ATOM   2163  N  NE2 . GLN B  2  173 ? -38.097 -8.819  234.548  1.00 77.39  ? 329 GLN B NE2 1 
ATOM   2164  N  N   . VAL B  2  174 ? -32.430 -9.790  231.450  1.00 53.46  ? 330 VAL B N   1 
ATOM   2165  C  CA  . VAL B  2  174 ? -31.621 -8.774  230.799  1.00 45.28  ? 330 VAL B CA  1 
ATOM   2166  C  C   . VAL B  2  174 ? -32.352 -8.179  229.598  1.00 54.96  ? 330 VAL B C   1 
ATOM   2167  O  O   . VAL B  2  174 ? -33.246 -8.804  229.032  1.00 61.74  ? 330 VAL B O   1 
ATOM   2168  C  CB  . VAL B  2  174 ? -30.283 -9.366  230.344  1.00 34.75  ? 330 VAL B CB  1 
ATOM   2169  C  CG1 . VAL B  2  174 ? -30.529 -10.487 229.380  1.00 30.72  ? 330 VAL B CG1 1 
ATOM   2170  C  CG2 . VAL B  2  174 ? -29.429 -8.315  229.718  1.00 28.39  ? 330 VAL B CG2 1 
ATOM   2171  N  N   . LEU B  2  175 ? -31.964 -6.965  229.223  1.00 42.94  ? 331 LEU B N   1 
ATOM   2172  C  CA  . LEU B  2  175 ? -32.570 -6.257  228.113  1.00 40.05  ? 331 LEU B CA  1 
ATOM   2173  C  C   . LEU B  2  175 ? -31.535 -5.385  227.417  1.00 42.62  ? 331 LEU B C   1 
ATOM   2174  O  O   . LEU B  2  175 ? -30.931 -4.523  228.035  1.00 44.54  ? 331 LEU B O   1 
ATOM   2175  C  CB  . LEU B  2  175 ? -33.698 -5.360  228.618  1.00 50.31  ? 331 LEU B CB  1 
ATOM   2176  C  CG  . LEU B  2  175 ? -33.956 -4.121  227.751  1.00 51.70  ? 331 LEU B CG  1 
ATOM   2177  C  CD1 . LEU B  2  175 ? -34.758 -4.514  226.537  1.00 47.31  ? 331 LEU B CD1 1 
ATOM   2178  C  CD2 . LEU B  2  175 ? -34.691 -3.065  228.551  1.00 56.27  ? 331 LEU B CD2 1 
ATOM   2179  N  N   . PHE B  2  176 ? -31.349 -5.597  226.124  1.00 43.06  ? 332 PHE B N   1 
ATOM   2180  C  CA  . PHE B  2  176 ? -30.385 -4.817  225.365  1.00 46.07  ? 332 PHE B CA  1 
ATOM   2181  C  C   . PHE B  2  176 ? -31.089 -3.745  224.531  1.00 54.49  ? 332 PHE B C   1 
ATOM   2182  O  O   . PHE B  2  176 ? -31.994 -4.040  223.749  1.00 67.75  ? 332 PHE B O   1 
ATOM   2183  C  CB  . PHE B  2  176 ? -29.576 -5.721  224.427  1.00 34.72  ? 332 PHE B CB  1 
ATOM   2184  C  CG  . PHE B  2  176 ? -28.713 -6.730  225.133  1.00 43.35  ? 332 PHE B CG  1 
ATOM   2185  C  CD1 . PHE B  2  176 ? -29.278 -7.758  225.883  1.00 47.79  ? 332 PHE B CD1 1 
ATOM   2186  C  CD2 . PHE B  2  176 ? -27.331 -6.677  225.017  1.00 42.44  ? 332 PHE B CD2 1 
ATOM   2187  C  CE1 . PHE B  2  176 ? -28.478 -8.720  226.503  1.00 42.01  ? 332 PHE B CE1 1 
ATOM   2188  C  CE2 . PHE B  2  176 ? -26.528 -7.634  225.632  1.00 40.22  ? 332 PHE B CE2 1 
ATOM   2189  C  CZ  . PHE B  2  176 ? -27.108 -8.659  226.377  1.00 34.27  ? 332 PHE B CZ  1 
ATOM   2190  N  N   . ASP B  2  177 ? -30.660 -2.502  224.702  1.00 45.48  ? 333 ASP B N   1 
ATOM   2191  C  CA  . ASP B  2  177 ? -31.221 -1.379  223.977  1.00 41.81  ? 333 ASP B CA  1 
ATOM   2192  C  C   . ASP B  2  177 ? -30.106 -0.825  223.117  1.00 47.87  ? 333 ASP B C   1 
ATOM   2193  O  O   . ASP B  2  177 ? -29.093 -0.374  223.642  1.00 62.07  ? 333 ASP B O   1 
ATOM   2194  C  CB  . ASP B  2  177 ? -31.683 -0.269  224.942  1.00 54.96  ? 333 ASP B CB  1 
ATOM   2195  C  CG  . ASP B  2  177 ? -32.963 -0.616  225.695  1.00 68.05  ? 333 ASP B CG  1 
ATOM   2196  O  OD1 . ASP B  2  177 ? -32.972 -1.611  226.447  1.00 87.79  ? 333 ASP B OD1 1 
ATOM   2197  O  OD2 . ASP B  2  177 ? -33.965 0.114   225.546  1.00 71.03  ? 333 ASP B OD2 1 
ATOM   2198  N  N   . MET B  2  178 ? -30.278 -0.856  221.802  1.00 51.58  ? 334 MET B N   1 
ATOM   2199  C  CA  . MET B  2  178 ? -29.273 -0.310  220.893  1.00 49.46  ? 334 MET B CA  1 
ATOM   2200  C  C   . MET B  2  178 ? -29.922 0.667   219.905  1.00 44.14  ? 334 MET B C   1 
ATOM   2201  O  O   . MET B  2  178 ? -31.106 0.563   219.602  1.00 46.45  ? 334 MET B O   1 
ATOM   2202  C  CB  . MET B  2  178 ? -28.563 -1.444  220.149  1.00 51.40  ? 334 MET B CB  1 
ATOM   2203  C  CG  . MET B  2  178 ? -29.500 -2.405  219.458  1.00 46.91  ? 334 MET B CG  1 
ATOM   2204  S  SD  . MET B  2  178 ? -28.751 -4.008  219.168  1.00 54.13  ? 334 MET B SD  1 
ATOM   2205  C  CE  . MET B  2  178 ? -29.214 -4.804  220.627  1.00 57.53  ? 334 MET B CE  1 
ATOM   2206  N  N   . SER B  2  179 ? -29.139 1.622   219.424  1.00 30.38  ? 335 SER B N   1 
ATOM   2207  C  CA  . SER B  2  179 ? -29.617 2.621   218.494  1.00 27.25  ? 335 SER B CA  1 
ATOM   2208  C  C   . SER B  2  179 ? -28.559 2.804   217.446  1.00 44.54  ? 335 SER B C   1 
ATOM   2209  O  O   . SER B  2  179 ? -27.376 2.886   217.771  1.00 51.74  ? 335 SER B O   1 
ATOM   2210  C  CB  . SER B  2  179 ? -29.824 3.963   219.188  1.00 17.29  ? 335 SER B CB  1 
ATOM   2211  O  OG  . SER B  2  179 ? -30.857 3.896   220.147  1.00 51.95  ? 335 SER B OG  1 
ATOM   2212  N  N   . ASP B  2  180 ? -28.981 2.892   216.189  1.00 54.19  ? 336 ASP B N   1 
ATOM   2213  C  CA  . ASP B  2  180 ? -28.045 3.082   215.086  1.00 63.30  ? 336 ASP B CA  1 
ATOM   2214  C  C   . ASP B  2  180 ? -27.782 4.572   214.913  1.00 54.98  ? 336 ASP B C   1 
ATOM   2215  O  O   . ASP B  2  180 ? -28.357 5.386   215.617  1.00 69.67  ? 336 ASP B O   1 
ATOM   2216  C  CB  . ASP B  2  180 ? -28.639 2.494   213.801  1.00 73.68  ? 336 ASP B CB  1 
ATOM   2217  C  CG  . ASP B  2  180 ? -29.786 3.322   213.255  1.00 76.99  ? 336 ASP B CG  1 
ATOM   2218  O  OD1 . ASP B  2  180 ? -30.416 4.065   214.039  1.00 65.07  ? 336 ASP B OD1 1 
ATOM   2219  O  OD2 . ASP B  2  180 ? -30.060 3.221   212.040  1.00 84.83  ? 336 ASP B OD2 1 
ATOM   2220  N  N   . TRP B  2  181 ? -26.912 4.930   213.985  1.00 51.05  ? 337 TRP B N   1 
ATOM   2221  C  CA  . TRP B  2  181 ? -26.623 6.333   213.740  1.00 54.97  ? 337 TRP B CA  1 
ATOM   2222  C  C   . TRP B  2  181 ? -27.646 6.933   212.771  1.00 67.47  ? 337 TRP B C   1 
ATOM   2223  O  O   . TRP B  2  181 ? -27.338 7.872   212.031  1.00 62.56  ? 337 TRP B O   1 
ATOM   2224  C  CB  . TRP B  2  181 ? -25.230 6.473   213.141  1.00 59.81  ? 337 TRP B CB  1 
ATOM   2225  C  CG  . TRP B  2  181 ? -24.164 6.069   214.067  1.00 78.34  ? 337 TRP B CG  1 
ATOM   2226  C  CD1 . TRP B  2  181 ? -23.852 4.804   214.451  1.00 87.77  ? 337 TRP B CD1 1 
ATOM   2227  C  CD2 . TRP B  2  181 ? -23.294 6.939   214.799  1.00 86.23  ? 337 TRP B CD2 1 
ATOM   2228  N  NE1 . TRP B  2  181 ? -22.841 4.827   215.384  1.00 91.96  ? 337 TRP B NE1 1 
ATOM   2229  C  CE2 . TRP B  2  181 ? -22.483 6.128   215.614  1.00 85.25  ? 337 TRP B CE2 1 
ATOM   2230  C  CE3 . TRP B  2  181 ? -23.128 8.330   214.848  1.00 84.24  ? 337 TRP B CE3 1 
ATOM   2231  C  CZ2 . TRP B  2  181 ? -21.520 6.659   216.469  1.00 81.44  ? 337 TRP B CZ2 1 
ATOM   2232  C  CZ3 . TRP B  2  181 ? -22.174 8.855   215.696  1.00 72.37  ? 337 TRP B CZ3 1 
ATOM   2233  C  CH2 . TRP B  2  181 ? -21.381 8.021   216.496  1.00 81.20  ? 337 TRP B CH2 1 
ATOM   2234  N  N   . GLU B  2  182 ? -28.862 6.394   212.772  1.00 70.82  ? 338 GLU B N   1 
ATOM   2235  C  CA  . GLU B  2  182 ? -29.887 6.881   211.858  1.00 71.27  ? 338 GLU B CA  1 
ATOM   2236  C  C   . GLU B  2  182 ? -31.297 6.945   212.422  1.00 67.61  ? 338 GLU B C   1 
ATOM   2237  O  O   . GLU B  2  182 ? -32.268 6.713   211.713  1.00 71.21  ? 338 GLU B O   1 
ATOM   2238  C  CB  . GLU B  2  182 ? -29.888 6.031   210.596  1.00 70.44  ? 338 GLU B CB  1 
ATOM   2239  C  CG  . GLU B  2  182 ? -28.582 6.070   209.842  1.00 83.93  ? 338 GLU B CG  1 
ATOM   2240  C  CD  . GLU B  2  182 ? -28.529 5.019   208.759  1.00 104.59 ? 338 GLU B CD  1 
ATOM   2241  O  OE1 . GLU B  2  182 ? -28.308 3.835   209.094  1.00 109.25 ? 338 GLU B OE1 1 
ATOM   2242  O  OE2 . GLU B  2  182 ? -28.724 5.372   207.575  1.00 112.02 ? 338 GLU B OE2 1 
ATOM   2243  N  N   . GLY B  2  183 ? -31.407 7.250   213.704  1.00 65.62  ? 339 GLY B N   1 
ATOM   2244  C  CA  . GLY B  2  183 ? -32.716 7.387   214.310  1.00 70.27  ? 339 GLY B CA  1 
ATOM   2245  C  C   . GLY B  2  183 ? -33.531 6.134   214.525  1.00 72.89  ? 339 GLY B C   1 
ATOM   2246  O  O   . GLY B  2  183 ? -34.718 6.221   214.844  1.00 72.53  ? 339 GLY B O   1 
ATOM   2247  N  N   . SER B  2  184 ? -32.913 4.971   214.365  1.00 72.72  ? 340 SER B N   1 
ATOM   2248  C  CA  . SER B  2  184 ? -33.622 3.711   214.568  1.00 68.39  ? 340 SER B CA  1 
ATOM   2249  C  C   . SER B  2  184 ? -33.119 3.057   215.855  1.00 70.00  ? 340 SER B C   1 
ATOM   2250  O  O   . SER B  2  184 ? -31.966 3.258   216.255  1.00 67.57  ? 340 SER B O   1 
ATOM   2251  C  CB  . SER B  2  184 ? -33.375 2.777   213.379  1.00 67.79  ? 340 SER B CB  1 
ATOM   2252  O  OG  . SER B  2  184 ? -33.658 3.424   212.152  1.00 68.64  ? 340 SER B OG  1 
ATOM   2253  N  N   . SER B  2  185 ? -33.975 2.271   216.500  1.00 69.37  ? 341 SER B N   1 
ATOM   2254  C  CA  . SER B  2  185 ? -33.583 1.599   217.740  1.00 71.23  ? 341 SER B CA  1 
ATOM   2255  C  C   . SER B  2  185 ? -34.293 0.274   217.970  1.00 65.60  ? 341 SER B C   1 
ATOM   2256  O  O   . SER B  2  185 ? -35.506 0.169   217.818  1.00 66.73  ? 341 SER B O   1 
ATOM   2257  C  CB  . SER B  2  185 ? -33.840 2.515   218.935  1.00 66.09  ? 341 SER B CB  1 
ATOM   2258  O  OG  . SER B  2  185 ? -33.162 3.749   218.764  1.00 90.69  ? 341 SER B OG  1 
ATOM   2259  N  N   . VAL B  2  186 ? -33.532 -0.742  218.350  1.00 65.36  ? 342 VAL B N   1 
ATOM   2260  C  CA  . VAL B  2  186 ? -34.122 -2.046  218.602  1.00 70.09  ? 342 VAL B CA  1 
ATOM   2261  C  C   . VAL B  2  186 ? -33.860 -2.521  220.024  1.00 67.09  ? 342 VAL B C   1 
ATOM   2262  O  O   . VAL B  2  186 ? -33.082 -1.914  220.750  1.00 69.59  ? 342 VAL B O   1 
ATOM   2263  C  CB  . VAL B  2  186 ? -33.602 -3.086  217.601  1.00 66.52  ? 342 VAL B CB  1 
ATOM   2264  C  CG1 . VAL B  2  186 ? -34.235 -2.849  216.253  1.00 62.40  ? 342 VAL B CG1 1 
ATOM   2265  C  CG2 . VAL B  2  186 ? -32.100 -2.982  217.483  1.00 69.43  ? 342 VAL B CG2 1 
ATOM   2266  N  N   . TYR B  2  187 ? -34.532 -3.603  220.411  1.00 70.95  ? 343 TYR B N   1 
ATOM   2267  C  CA  . TYR B  2  187 ? -34.415 -4.185  221.745  1.00 64.98  ? 343 TYR B CA  1 
ATOM   2268  C  C   . TYR B  2  187 ? -34.094 -5.643  221.575  1.00 65.68  ? 343 TYR B C   1 
ATOM   2269  O  O   . TYR B  2  187 ? -34.036 -6.153  220.463  1.00 69.86  ? 343 TYR B O   1 
ATOM   2270  C  CB  . TYR B  2  187 ? -35.737 -4.077  222.489  1.00 69.68  ? 343 TYR B CB  1 
ATOM   2271  C  CG  . TYR B  2  187 ? -36.441 -2.776  222.222  1.00 107.50 ? 343 TYR B CG  1 
ATOM   2272  C  CD1 . TYR B  2  187 ? -37.715 -2.748  221.646  1.00 111.52 ? 343 TYR B CD1 1 
ATOM   2273  C  CD2 . TYR B  2  187 ? -35.823 -1.557  222.523  1.00 120.95 ? 343 TYR B CD2 1 
ATOM   2274  C  CE1 . TYR B  2  187 ? -38.356 -1.531  221.377  1.00 122.46 ? 343 TYR B CE1 1 
ATOM   2275  C  CE2 . TYR B  2  187 ? -36.453 -0.338  222.258  1.00 126.60 ? 343 TYR B CE2 1 
ATOM   2276  C  CZ  . TYR B  2  187 ? -37.717 -0.332  221.687  1.00 124.77 ? 343 TYR B CZ  1 
ATOM   2277  O  OH  . TYR B  2  187 ? -38.336 0.871   221.437  1.00 122.58 ? 343 TYR B OH  1 
ATOM   2278  N  N   . ALA B  2  188 ? -33.910 -6.317  222.694  1.00 65.74  ? 344 ALA B N   1 
ATOM   2279  C  CA  . ALA B  2  188 ? -33.603 -7.737  222.697  1.00 61.57  ? 344 ALA B CA  1 
ATOM   2280  C  C   . ALA B  2  188 ? -33.468 -8.093  224.148  1.00 59.99  ? 344 ALA B C   1 
ATOM   2281  O  O   . ALA B  2  188 ? -32.443 -7.809  224.754  1.00 75.80  ? 344 ALA B O   1 
ATOM   2282  C  CB  . ALA B  2  188 ? -32.296 -8.001  221.982  1.00 45.08  ? 344 ALA B CB  1 
ATOM   2283  N  N   . GLN B  2  189 ? -34.504 -8.672  224.731  1.00 56.18  ? 345 GLN B N   1 
ATOM   2284  C  CA  . GLN B  2  189 ? -34.400 -9.042  226.127  1.00 63.20  ? 345 GLN B CA  1 
ATOM   2285  C  C   . GLN B  2  189 ? -34.640 -10.513 226.329  1.00 59.75  ? 345 GLN B C   1 
ATOM   2286  O  O   . GLN B  2  189 ? -35.353 -11.149 225.563  1.00 66.75  ? 345 GLN B O   1 
ATOM   2287  C  CB  . GLN B  2  189 ? -35.351 -8.219  226.994  1.00 63.02  ? 345 GLN B CB  1 
ATOM   2288  C  CG  . GLN B  2  189 ? -36.761 -8.128  226.496  1.00 74.04  ? 345 GLN B CG  1 
ATOM   2289  C  CD  . GLN B  2  189 ? -37.560 -7.104  227.280  1.00 84.28  ? 345 GLN B CD  1 
ATOM   2290  O  OE1 . GLN B  2  189 ? -37.758 -7.245  228.488  1.00 68.80  ? 345 GLN B OE1 1 
ATOM   2291  N  NE2 . GLN B  2  189 ? -38.014 -6.056  226.595  1.00 95.81  ? 345 GLN B NE2 1 
ATOM   2292  N  N   . TYR B  2  190 ? -33.999 -11.051 227.354  1.00 57.48  ? 346 TYR B N   1 
ATOM   2293  C  CA  . TYR B  2  190 ? -34.129 -12.453 227.685  1.00 56.79  ? 346 TYR B CA  1 
ATOM   2294  C  C   . TYR B  2  190 ? -34.760 -12.490 229.057  1.00 55.36  ? 346 TYR B C   1 
ATOM   2295  O  O   . TYR B  2  190 ? -34.359 -11.750 229.954  1.00 59.78  ? 346 TYR B O   1 
ATOM   2296  C  CB  . TYR B  2  190 ? -32.753 -13.110 227.669  1.00 56.37  ? 346 TYR B CB  1 
ATOM   2297  C  CG  . TYR B  2  190 ? -32.127 -13.067 226.297  1.00 50.02  ? 346 TYR B CG  1 
ATOM   2298  C  CD1 . TYR B  2  190 ? -32.007 -14.222 225.533  1.00 58.77  ? 346 TYR B CD1 1 
ATOM   2299  C  CD2 . TYR B  2  190 ? -31.719 -11.855 225.730  1.00 46.12  ? 346 TYR B CD2 1 
ATOM   2300  C  CE1 . TYR B  2  190 ? -31.501 -14.174 224.224  1.00 62.53  ? 346 TYR B CE1 1 
ATOM   2301  C  CE2 . TYR B  2  190 ? -31.213 -11.793 224.429  1.00 48.49  ? 346 TYR B CE2 1 
ATOM   2302  C  CZ  . TYR B  2  190 ? -31.111 -12.958 223.682  1.00 56.08  ? 346 TYR B CZ  1 
ATOM   2303  O  OH  . TYR B  2  190 ? -30.644 -12.914 222.389  1.00 72.32  ? 346 TYR B OH  1 
ATOM   2304  N  N   . ALA B  2  191 ? -35.767 -13.340 229.203  1.00 55.65  ? 347 ALA B N   1 
ATOM   2305  C  CA  . ALA B  2  191 ? -36.503 -13.461 230.452  1.00 57.91  ? 347 ALA B CA  1 
ATOM   2306  C  C   . ALA B  2  191 ? -35.653 -13.909 231.628  1.00 58.36  ? 347 ALA B C   1 
ATOM   2307  O  O   . ALA B  2  191 ? -36.015 -13.675 232.781  1.00 51.70  ? 347 ALA B O   1 
ATOM   2308  C  CB  . ALA B  2  191 ? -37.664 -14.411 230.265  1.00 69.28  ? 347 ALA B CB  1 
ATOM   2309  N  N   . SER B  2  192 ? -34.531 -14.559 231.340  1.00 59.94  ? 348 SER B N   1 
ATOM   2310  C  CA  . SER B  2  192 ? -33.644 -15.034 232.394  1.00 49.23  ? 348 SER B CA  1 
ATOM   2311  C  C   . SER B  2  192 ? -32.189 -14.729 232.074  1.00 53.70  ? 348 SER B C   1 
ATOM   2312  O  O   . SER B  2  192 ? -31.698 -15.031 230.987  1.00 59.25  ? 348 SER B O   1 
ATOM   2313  C  CB  . SER B  2  192 ? -33.818 -16.531 232.584  1.00 45.08  ? 348 SER B CB  1 
ATOM   2314  O  OG  . SER B  2  192 ? -33.034 -16.984 233.665  1.00 49.44  ? 348 SER B OG  1 
ATOM   2315  N  N   . PHE B  2  193 ? -31.508 -14.130 233.040  1.00 49.98  ? 349 PHE B N   1 
ATOM   2316  C  CA  . PHE B  2  193 ? -30.111 -13.753 232.898  1.00 45.63  ? 349 PHE B CA  1 
ATOM   2317  C  C   . PHE B  2  193 ? -29.369 -14.202 234.147  1.00 40.65  ? 349 PHE B C   1 
ATOM   2318  O  O   . PHE B  2  193 ? -29.838 -13.999 235.259  1.00 45.56  ? 349 PHE B O   1 
ATOM   2319  C  CB  . PHE B  2  193 ? -30.006 -12.239 232.759  1.00 40.54  ? 349 PHE B CB  1 
ATOM   2320  C  CG  . PHE B  2  193 ? -28.617 -11.742 232.559  1.00 37.17  ? 349 PHE B CG  1 
ATOM   2321  C  CD1 . PHE B  2  193 ? -28.023 -11.798 231.297  1.00 37.48  ? 349 PHE B CD1 1 
ATOM   2322  C  CD2 . PHE B  2  193 ? -27.917 -11.161 233.614  1.00 29.30  ? 349 PHE B CD2 1 
ATOM   2323  C  CE1 . PHE B  2  193 ? -26.741 -11.270 231.076  1.00 34.58  ? 349 PHE B CE1 1 
ATOM   2324  C  CE2 . PHE B  2  193 ? -26.637 -10.628 233.413  1.00 40.66  ? 349 PHE B CE2 1 
ATOM   2325  C  CZ  . PHE B  2  193 ? -26.046 -10.681 232.137  1.00 34.03  ? 349 PHE B CZ  1 
ATOM   2326  N  N   . ARG B  2  194 ? -28.208 -14.810 233.970  1.00 44.20  ? 350 ARG B N   1 
ATOM   2327  C  CA  . ARG B  2  194 ? -27.440 -15.277 235.108  1.00 41.49  ? 350 ARG B CA  1 
ATOM   2328  C  C   . ARG B  2  194 ? -26.075 -15.784 234.691  1.00 47.06  ? 350 ARG B C   1 
ATOM   2329  O  O   . ARG B  2  194 ? -25.955 -16.536 233.733  1.00 55.77  ? 350 ARG B O   1 
ATOM   2330  C  CB  . ARG B  2  194 ? -28.202 -16.402 235.822  1.00 45.50  ? 350 ARG B CB  1 
ATOM   2331  C  CG  . ARG B  2  194 ? -27.338 -17.594 236.245  1.00 66.73  ? 350 ARG B CG  1 
ATOM   2332  C  CD  . ARG B  2  194 ? -28.149 -18.826 236.663  1.00 65.11  ? 350 ARG B CD  1 
ATOM   2333  N  NE  . ARG B  2  194 ? -29.036 -18.558 237.794  1.00 94.80  ? 350 ARG B NE  1 
ATOM   2334  C  CZ  . ARG B  2  194 ? -28.641 -18.080 238.973  1.00 106.19 ? 350 ARG B CZ  1 
ATOM   2335  N  NH1 . ARG B  2  194 ? -27.360 -17.806 239.193  1.00 110.69 ? 350 ARG B NH1 1 
ATOM   2336  N  NH2 . ARG B  2  194 ? -29.531 -17.883 239.942  1.00 105.41 ? 350 ARG B NH2 1 
ATOM   2337  N  N   . PRO B  2  195 ? -25.017 -15.316 235.358  1.00 46.83  ? 351 PRO B N   1 
ATOM   2338  C  CA  . PRO B  2  195 ? -23.692 -15.804 235.001  1.00 50.95  ? 351 PRO B CA  1 
ATOM   2339  C  C   . PRO B  2  195 ? -23.131 -16.553 236.233  1.00 57.96  ? 351 PRO B C   1 
ATOM   2340  O  O   . PRO B  2  195 ? -23.446 -16.217 237.387  1.00 35.23  ? 351 PRO B O   1 
ATOM   2341  C  CB  . PRO B  2  195 ? -22.941 -14.516 234.666  1.00 56.79  ? 351 PRO B CB  1 
ATOM   2342  C  CG  . PRO B  2  195 ? -23.403 -13.611 235.714  1.00 69.67  ? 351 PRO B CG  1 
ATOM   2343  C  CD  . PRO B  2  195 ? -24.914 -13.933 235.859  1.00 70.54  ? 351 PRO B CD  1 
ATOM   2344  N  N   . GLU B  2  196 ? -22.342 -17.596 235.992  1.00 59.40  ? 352 GLU B N   1 
ATOM   2345  C  CA  . GLU B  2  196 ? -21.754 -18.348 237.093  1.00 56.60  ? 352 GLU B CA  1 
ATOM   2346  C  C   . GLU B  2  196 ? -20.635 -17.505 237.724  1.00 47.90  ? 352 GLU B C   1 
ATOM   2347  O  O   . GLU B  2  196 ? -20.317 -16.413 237.254  1.00 38.96  ? 352 GLU B O   1 
ATOM   2348  C  CB  . GLU B  2  196 ? -21.210 -19.700 236.591  1.00 67.66  ? 352 GLU B CB  1 
ATOM   2349  C  CG  . GLU B  2  196 ? -21.900 -20.945 237.193  1.00 89.51  ? 352 GLU B CG  1 
ATOM   2350  C  CD  . GLU B  2  196 ? -21.656 -21.129 238.709  1.00 102.07 ? 352 GLU B CD  1 
ATOM   2351  O  OE1 . GLU B  2  196 ? -22.043 -20.253 239.518  1.00 96.14  ? 352 GLU B OE1 1 
ATOM   2352  O  OE2 . GLU B  2  196 ? -21.075 -22.166 239.098  1.00 111.62 ? 352 GLU B OE2 1 
ATOM   2353  N  N   . ASN B  2  197 ? -20.036 -18.012 238.791  1.00 45.07  ? 353 ASN B N   1 
ATOM   2354  C  CA  . ASN B  2  197 ? -18.979 -17.291 239.482  1.00 51.48  ? 353 ASN B CA  1 
ATOM   2355  C  C   . ASN B  2  197 ? -17.687 -17.182 238.677  1.00 46.87  ? 353 ASN B C   1 
ATOM   2356  O  O   . ASN B  2  197 ? -17.519 -17.849 237.648  1.00 29.96  ? 353 ASN B O   1 
ATOM   2357  C  CB  . ASN B  2  197 ? -18.692 -17.966 240.817  1.00 57.86  ? 353 ASN B CB  1 
ATOM   2358  C  CG  . ASN B  2  197 ? -18.303 -19.403 240.653  1.00 69.33  ? 353 ASN B CG  1 
ATOM   2359  O  OD1 . ASN B  2  197 ? -17.328 -19.717 239.971  1.00 79.34  ? 353 ASN B OD1 1 
ATOM   2360  N  ND2 . ASN B  2  197 ? -19.067 -20.296 241.268  1.00 80.57  ? 353 ASN B ND2 1 
ATOM   2361  N  N   . GLU B  2  198 ? -16.770 -16.345 239.166  1.00 35.17  ? 354 GLU B N   1 
ATOM   2362  C  CA  . GLU B  2  198 ? -15.496 -16.132 238.504  1.00 33.17  ? 354 GLU B CA  1 
ATOM   2363  C  C   . GLU B  2  198 ? -14.766 -17.432 238.228  1.00 43.20  ? 354 GLU B C   1 
ATOM   2364  O  O   . GLU B  2  198 ? -14.222 -17.632 237.144  1.00 53.99  ? 354 GLU B O   1 
ATOM   2365  C  CB  . GLU B  2  198 ? -14.609 -15.212 239.332  1.00 14.58  ? 354 GLU B CB  1 
ATOM   2366  C  CG  . GLU B  2  198 ? -13.174 -15.139 238.812  1.00 40.77  ? 354 GLU B CG  1 
ATOM   2367  C  CD  . GLU B  2  198 ? -12.388 -13.971 239.394  1.00 42.67  ? 354 GLU B CD  1 
ATOM   2368  O  OE1 . GLU B  2  198 ? -12.715 -13.550 240.514  1.00 28.32  ? 354 GLU B OE1 1 
ATOM   2369  O  OE2 . GLU B  2  198 ? -11.437 -13.483 238.743  1.00 45.63  ? 354 GLU B OE2 1 
ATOM   2370  N  N   . ALA B  2  199 ? -14.750 -18.317 239.216  1.00 50.22  ? 355 ALA B N   1 
ATOM   2371  C  CA  . ALA B  2  199 ? -14.095 -19.604 239.058  1.00 52.28  ? 355 ALA B CA  1 
ATOM   2372  C  C   . ALA B  2  199 ? -14.593 -20.264 237.775  1.00 53.73  ? 355 ALA B C   1 
ATOM   2373  O  O   . ALA B  2  199 ? -13.897 -21.080 237.174  1.00 59.23  ? 355 ALA B O   1 
ATOM   2374  C  CB  . ALA B  2  199 ? -14.405 -20.481 240.247  1.00 55.12  ? 355 ALA B CB  1 
ATOM   2375  N  N   . GLN B  2  200 ? -15.803 -19.905 237.362  1.00 49.79  ? 356 GLN B N   1 
ATOM   2376  C  CA  . GLN B  2  200 ? -16.376 -20.452 236.151  1.00 46.77  ? 356 GLN B CA  1 
ATOM   2377  C  C   . GLN B  2  200 ? -16.351 -19.451 235.006  1.00 49.42  ? 356 GLN B C   1 
ATOM   2378  O  O   . GLN B  2  200 ? -17.130 -19.548 234.063  1.00 44.71  ? 356 GLN B O   1 
ATOM   2379  C  CB  . GLN B  2  200 ? -17.794 -20.922 236.428  1.00 57.94  ? 356 GLN B CB  1 
ATOM   2380  C  CG  . GLN B  2  200 ? -17.810 -22.128 237.335  1.00 63.40  ? 356 GLN B CG  1 
ATOM   2381  C  CD  . GLN B  2  200 ? -17.038 -23.289 236.736  1.00 71.53  ? 356 GLN B CD  1 
ATOM   2382  O  OE1 . GLN B  2  200 ? -16.446 -24.088 237.456  1.00 80.98  ? 356 GLN B OE1 1 
ATOM   2383  N  NE2 . GLN B  2  200 ? -17.050 -23.394 235.409  1.00 71.09  ? 356 GLN B NE2 1 
ATOM   2384  N  N   . GLY B  2  201 ? -15.439 -18.491 235.092  1.00 48.31  ? 357 GLY B N   1 
ATOM   2385  C  CA  . GLY B  2  201 ? -15.320 -17.496 234.047  1.00 54.01  ? 357 GLY B CA  1 
ATOM   2386  C  C   . GLY B  2  201 ? -16.593 -16.704 233.841  1.00 54.39  ? 357 GLY B C   1 
ATOM   2387  O  O   . GLY B  2  201 ? -16.892 -16.268 232.728  1.00 61.26  ? 357 GLY B O   1 
ATOM   2388  N  N   . TYR B  2  202 ? -17.349 -16.513 234.914  1.00 44.32  ? 358 TYR B N   1 
ATOM   2389  C  CA  . TYR B  2  202 ? -18.585 -15.764 234.823  1.00 33.97  ? 358 TYR B CA  1 
ATOM   2390  C  C   . TYR B  2  202 ? -19.401 -16.225 233.612  1.00 45.17  ? 358 TYR B C   1 
ATOM   2391  O  O   . TYR B  2  202 ? -19.974 -15.411 232.895  1.00 49.14  ? 358 TYR B O   1 
ATOM   2392  C  CB  . TYR B  2  202 ? -18.259 -14.283 234.712  1.00 20.08  ? 358 TYR B CB  1 
ATOM   2393  C  CG  . TYR B  2  202 ? -17.589 -13.705 235.942  1.00 30.77  ? 358 TYR B CG  1 
ATOM   2394  C  CD1 . TYR B  2  202 ? -18.270 -13.621 237.152  1.00 28.56  ? 358 TYR B CD1 1 
ATOM   2395  C  CD2 . TYR B  2  202 ? -16.281 -13.228 235.895  1.00 31.68  ? 358 TYR B CD2 1 
ATOM   2396  C  CE1 . TYR B  2  202 ? -17.669 -13.071 238.287  1.00 25.87  ? 358 TYR B CE1 1 
ATOM   2397  C  CE2 . TYR B  2  202 ? -15.664 -12.679 237.031  1.00 19.81  ? 358 TYR B CE2 1 
ATOM   2398  C  CZ  . TYR B  2  202 ? -16.366 -12.607 238.220  1.00 27.69  ? 358 TYR B CZ  1 
ATOM   2399  O  OH  . TYR B  2  202 ? -15.766 -12.104 239.355  1.00 36.45  ? 358 TYR B OH  1 
ATOM   2400  N  N   . ARG B  2  203 ? -19.454 -17.535 233.384  1.00 52.35  ? 359 ARG B N   1 
ATOM   2401  C  CA  . ARG B  2  203 ? -20.202 -18.094 232.253  1.00 46.52  ? 359 ARG B CA  1 
ATOM   2402  C  C   . ARG B  2  203 ? -21.618 -17.553 232.187  1.00 43.47  ? 359 ARG B C   1 
ATOM   2403  O  O   . ARG B  2  203 ? -22.358 -17.611 233.173  1.00 29.11  ? 359 ARG B O   1 
ATOM   2404  C  CB  . ARG B  2  203 ? -20.267 -19.629 232.338  1.00 40.34  ? 359 ARG B CB  1 
ATOM   2405  C  CG  . ARG B  2  203 ? -21.024 -20.275 231.187  1.00 42.93  ? 359 ARG B CG  1 
ATOM   2406  C  CD  . ARG B  2  203 ? -20.988 -21.801 231.182  1.00 44.15  ? 359 ARG B CD  1 
ATOM   2407  N  NE  . ARG B  2  203 ? -19.629 -22.333 231.117  1.00 47.34  ? 359 ARG B NE  1 
ATOM   2408  C  CZ  . ARG B  2  203 ? -18.923 -22.676 232.187  1.00 44.35  ? 359 ARG B CZ  1 
ATOM   2409  N  NH1 . ARG B  2  203 ? -19.456 -22.547 233.402  1.00 52.75  ? 359 ARG B NH1 1 
ATOM   2410  N  NH2 . ARG B  2  203 ? -17.689 -23.135 232.048  1.00 26.85  ? 359 ARG B NH2 1 
ATOM   2411  N  N   . LEU B  2  204 ? -21.979 -17.044 231.010  1.00 41.20  ? 360 LEU B N   1 
ATOM   2412  C  CA  . LEU B  2  204 ? -23.305 -16.481 230.741  1.00 42.30  ? 360 LEU B CA  1 
ATOM   2413  C  C   . LEU B  2  204 ? -24.419 -17.538 230.597  1.00 36.85  ? 360 LEU B C   1 
ATOM   2414  O  O   . LEU B  2  204 ? -24.181 -18.640 230.129  1.00 50.39  ? 360 LEU B O   1 
ATOM   2415  C  CB  . LEU B  2  204 ? -23.222 -15.632 229.467  1.00 33.07  ? 360 LEU B CB  1 
ATOM   2416  C  CG  . LEU B  2  204 ? -24.486 -15.129 228.768  1.00 29.63  ? 360 LEU B CG  1 
ATOM   2417  C  CD1 . LEU B  2  204 ? -25.297 -14.271 229.692  1.00 18.10  ? 360 LEU B CD1 1 
ATOM   2418  C  CD2 . LEU B  2  204 ? -24.088 -14.322 227.546  1.00 28.61  ? 360 LEU B CD2 1 
ATOM   2419  N  N   . TRP B  2  205 ? -25.635 -17.198 231.005  1.00 37.50  ? 361 TRP B N   1 
ATOM   2420  C  CA  . TRP B  2  205 ? -26.773 -18.106 230.880  1.00 34.68  ? 361 TRP B CA  1 
ATOM   2421  C  C   . TRP B  2  205 ? -28.076 -17.324 230.690  1.00 41.59  ? 361 TRP B C   1 
ATOM   2422  O  O   . TRP B  2  205 ? -28.723 -16.945 231.670  1.00 43.33  ? 361 TRP B O   1 
ATOM   2423  C  CB  . TRP B  2  205 ? -26.910 -18.972 232.127  1.00 44.26  ? 361 TRP B CB  1 
ATOM   2424  C  CG  . TRP B  2  205 ? -25.943 -20.089 232.236  1.00 44.52  ? 361 TRP B CG  1 
ATOM   2425  C  CD1 . TRP B  2  205 ? -25.132 -20.365 233.297  1.00 61.98  ? 361 TRP B CD1 1 
ATOM   2426  C  CD2 . TRP B  2  205 ? -25.694 -21.106 231.264  1.00 45.46  ? 361 TRP B CD2 1 
ATOM   2427  N  NE1 . TRP B  2  205 ? -24.387 -21.498 233.047  1.00 62.16  ? 361 TRP B NE1 1 
ATOM   2428  C  CE2 . TRP B  2  205 ? -24.712 -21.973 231.806  1.00 49.01  ? 361 TRP B CE2 1 
ATOM   2429  C  CE3 . TRP B  2  205 ? -26.202 -21.372 229.985  1.00 42.98  ? 361 TRP B CE3 1 
ATOM   2430  C  CZ2 . TRP B  2  205 ? -24.228 -23.083 231.115  1.00 58.80  ? 361 TRP B CZ2 1 
ATOM   2431  C  CZ3 . TRP B  2  205 ? -25.724 -22.474 229.293  1.00 43.04  ? 361 TRP B CZ3 1 
ATOM   2432  C  CH2 . TRP B  2  205 ? -24.743 -23.320 229.860  1.00 58.59  ? 361 TRP B CH2 1 
ATOM   2433  N  N   . VAL B  2  206 ? -28.469 -17.076 229.445  1.00 39.84  ? 362 VAL B N   1 
ATOM   2434  C  CA  . VAL B  2  206 ? -29.709 -16.341 229.205  1.00 51.17  ? 362 VAL B CA  1 
ATOM   2435  C  C   . VAL B  2  206 ? -30.831 -17.278 228.766  1.00 67.15  ? 362 VAL B C   1 
ATOM   2436  O  O   . VAL B  2  206 ? -30.587 -18.451 228.458  1.00 70.49  ? 362 VAL B O   1 
ATOM   2437  C  CB  . VAL B  2  206 ? -29.530 -15.272 228.126  1.00 47.60  ? 362 VAL B CB  1 
ATOM   2438  C  CG1 . VAL B  2  206 ? -28.444 -14.324 228.532  1.00 51.46  ? 362 VAL B CG1 1 
ATOM   2439  C  CG2 . VAL B  2  206 ? -29.197 -15.922 226.801  1.00 52.63  ? 362 VAL B CG2 1 
ATOM   2440  N  N   . GLU B  2  207 ? -32.059 -16.763 228.742  1.00 68.33  ? 363 GLU B N   1 
ATOM   2441  C  CA  . GLU B  2  207 ? -33.191 -17.572 228.318  1.00 67.91  ? 363 GLU B CA  1 
ATOM   2442  C  C   . GLU B  2  207 ? -34.412 -16.764 227.878  1.00 66.25  ? 363 GLU B C   1 
ATOM   2443  O  O   . GLU B  2  207 ? -34.719 -15.713 228.454  1.00 65.94  ? 363 GLU B O   1 
ATOM   2444  C  CB  . GLU B  2  207 ? -33.582 -18.557 229.427  1.00 72.02  ? 363 GLU B CB  1 
ATOM   2445  C  CG  . GLU B  2  207 ? -34.726 -19.485 229.030  1.00 102.56 ? 363 GLU B CG  1 
ATOM   2446  C  CD  . GLU B  2  207 ? -34.598 -20.002 227.590  1.00 112.69 ? 363 GLU B CD  1 
ATOM   2447  O  OE1 . GLU B  2  207 ? -33.543 -20.581 227.253  1.00 125.41 ? 363 GLU B OE1 1 
ATOM   2448  O  OE2 . GLU B  2  207 ? -35.548 -19.834 226.791  1.00 109.39 ? 363 GLU B OE2 1 
ATOM   2449  N  N   . ASP B  2  208 ? -35.086 -17.268 226.840  1.00 58.86  ? 364 ASP B N   1 
ATOM   2450  C  CA  . ASP B  2  208 ? -36.300 -16.671 226.271  1.00 58.69  ? 364 ASP B CA  1 
ATOM   2451  C  C   . ASP B  2  208 ? -36.118 -15.317 225.591  1.00 57.63  ? 364 ASP B C   1 
ATOM   2452  O  O   . ASP B  2  208 ? -36.299 -14.264 226.202  1.00 56.40  ? 364 ASP B O   1 
ATOM   2453  C  CB  . ASP B  2  208 ? -37.391 -16.556 227.345  1.00 69.17  ? 364 ASP B CB  1 
ATOM   2454  C  CG  . ASP B  2  208 ? -37.756 -17.903 227.957  1.00 78.48  ? 364 ASP B CG  1 
ATOM   2455  O  OD1 . ASP B  2  208 ? -37.990 -18.865 227.195  1.00 86.30  ? 364 ASP B OD1 1 
ATOM   2456  O  OD2 . ASP B  2  208 ? -37.818 -18.005 229.200  1.00 85.82  ? 364 ASP B OD2 1 
ATOM   2457  N  N   . TYR B  2  209 ? -35.770 -15.350 224.315  1.00 53.72  ? 365 TYR B N   1 
ATOM   2458  C  CA  . TYR B  2  209 ? -35.573 -14.125 223.563  1.00 58.83  ? 365 TYR B CA  1 
ATOM   2459  C  C   . TYR B  2  209 ? -36.904 -13.517 223.170  1.00 61.69  ? 365 TYR B C   1 
ATOM   2460  O  O   . TYR B  2  209 ? -37.947 -14.160 223.239  1.00 65.00  ? 365 TYR B O   1 
ATOM   2461  C  CB  . TYR B  2  209 ? -34.767 -14.400 222.296  1.00 63.22  ? 365 TYR B CB  1 
ATOM   2462  C  CG  . TYR B  2  209 ? -34.775 -13.261 221.298  1.00 70.07  ? 365 TYR B CG  1 
ATOM   2463  C  CD1 . TYR B  2  209 ? -33.957 -12.152 221.463  1.00 70.87  ? 365 TYR B CD1 1 
ATOM   2464  C  CD2 . TYR B  2  209 ? -35.614 -13.291 220.191  1.00 76.26  ? 365 TYR B CD2 1 
ATOM   2465  C  CE1 . TYR B  2  209 ? -33.974 -11.103 220.544  1.00 74.77  ? 365 TYR B CE1 1 
ATOM   2466  C  CE2 . TYR B  2  209 ? -35.639 -12.247 219.272  1.00 71.31  ? 365 TYR B CE2 1 
ATOM   2467  C  CZ  . TYR B  2  209 ? -34.818 -11.160 219.452  1.00 69.44  ? 365 TYR B CZ  1 
ATOM   2468  O  OH  . TYR B  2  209 ? -34.833 -10.135 218.534  1.00 68.87  ? 365 TYR B OH  1 
ATOM   2469  N  N   . SER B  2  210 ? -36.846 -12.266 222.745  1.00 64.14  ? 366 SER B N   1 
ATOM   2470  C  CA  . SER B  2  210 ? -38.016 -11.529 222.317  1.00 65.87  ? 366 SER B CA  1 
ATOM   2471  C  C   . SER B  2  210 ? -37.477 -10.160 221.997  1.00 67.21  ? 366 SER B C   1 
ATOM   2472  O  O   . SER B  2  210 ? -36.514 -9.715  222.619  1.00 76.06  ? 366 SER B O   1 
ATOM   2473  C  CB  . SER B  2  210 ? -39.048 -11.439 223.441  1.00 59.21  ? 366 SER B CB  1 
ATOM   2474  O  OG  . SER B  2  210 ? -38.522 -10.764 224.566  1.00 60.10  ? 366 SER B OG  1 
ATOM   2475  N  N   . GLY B  2  211 ? -38.082 -9.498  221.021  1.00 65.48  ? 367 GLY B N   1 
ATOM   2476  C  CA  . GLY B  2  211 ? -37.614 -8.180  220.652  1.00 64.17  ? 367 GLY B CA  1 
ATOM   2477  C  C   . GLY B  2  211 ? -37.412 -8.103  219.164  1.00 61.68  ? 367 GLY B C   1 
ATOM   2478  O  O   . GLY B  2  211 ? -37.735 -9.052  218.445  1.00 70.41  ? 367 GLY B O   1 
ATOM   2479  N  N   . ASN B  2  212 ? -36.859 -6.987  218.705  1.00 51.18  ? 368 ASN B N   1 
ATOM   2480  C  CA  . ASN B  2  212 ? -36.641 -6.785  217.287  1.00 49.16  ? 368 ASN B CA  1 
ATOM   2481  C  C   . ASN B  2  212 ? -35.179 -6.643  216.862  1.00 57.87  ? 368 ASN B C   1 
ATOM   2482  O  O   . ASN B  2  212 ? -34.900 -6.370  215.696  1.00 57.55  ? 368 ASN B O   1 
ATOM   2483  C  CB  . ASN B  2  212 ? -37.416 -5.549  216.842  1.00 62.31  ? 368 ASN B CB  1 
ATOM   2484  C  CG  . ASN B  2  212 ? -37.106 -4.340  217.692  1.00 68.90  ? 368 ASN B CG  1 
ATOM   2485  O  OD1 . ASN B  2  212 ? -36.083 -4.303  218.367  1.00 79.72  ? 368 ASN B OD1 1 
ATOM   2486  N  ND2 . ASN B  2  212 ? -37.977 -3.338  217.654  1.00 67.67  ? 368 ASN B ND2 1 
ATOM   2487  N  N   . ALA B  2  213 ? -34.243 -6.822  217.786  1.00 63.38  ? 369 ALA B N   1 
ATOM   2488  C  CA  . ALA B  2  213 ? -32.831 -6.681  217.435  1.00 63.22  ? 369 ALA B CA  1 
ATOM   2489  C  C   . ALA B  2  213 ? -32.259 -7.967  216.871  1.00 62.73  ? 369 ALA B C   1 
ATOM   2490  O  O   . ALA B  2  213 ? -31.390 -7.932  215.994  1.00 60.35  ? 369 ALA B O   1 
ATOM   2491  C  CB  . ALA B  2  213 ? -32.015 -6.232  218.650  1.00 58.96  ? 369 ALA B CB  1 
ATOM   2492  N  N   . GLY B  2  214 ? -32.748 -9.098  217.376  1.00 60.66  ? 370 GLY B N   1 
ATOM   2493  C  CA  . GLY B  2  214 ? -32.266 -10.386 216.906  1.00 63.68  ? 370 GLY B CA  1 
ATOM   2494  C  C   . GLY B  2  214 ? -31.641 -11.208 218.008  1.00 64.90  ? 370 GLY B C   1 
ATOM   2495  O  O   . GLY B  2  214 ? -30.702 -10.756 218.654  1.00 76.52  ? 370 GLY B O   1 
ATOM   2496  N  N   . ASN B  2  215 ? -32.166 -12.410 218.228  1.00 61.30  ? 371 ASN B N   1 
ATOM   2497  C  CA  . ASN B  2  215 ? -31.662 -13.314 219.263  1.00 56.10  ? 371 ASN B CA  1 
ATOM   2498  C  C   . ASN B  2  215 ? -30.189 -13.669 219.045  1.00 51.33  ? 371 ASN B C   1 
ATOM   2499  O  O   . ASN B  2  215 ? -29.848 -14.817 218.789  1.00 54.28  ? 371 ASN B O   1 
ATOM   2500  C  CB  . ASN B  2  215 ? -32.490 -14.594 219.266  1.00 61.15  ? 371 ASN B CB  1 
ATOM   2501  C  CG  . ASN B  2  215 ? -32.124 -15.529 220.393  1.00 63.61  ? 371 ASN B CG  1 
ATOM   2502  O  OD1 . ASN B  2  215 ? -30.948 -15.791 220.653  1.00 74.80  ? 371 ASN B OD1 1 
ATOM   2503  N  ND2 . ASN B  2  215 ? -33.136 -16.054 221.062  1.00 64.23  ? 371 ASN B ND2 1 
ATOM   2504  N  N   . ALA B  2  216 ? -29.315 -12.685 219.165  1.00 45.68  ? 372 ALA B N   1 
ATOM   2505  C  CA  . ALA B  2  216 ? -27.901 -12.911 218.957  1.00 44.18  ? 372 ALA B CA  1 
ATOM   2506  C  C   . ALA B  2  216 ? -27.282 -13.775 220.037  1.00 48.98  ? 372 ALA B C   1 
ATOM   2507  O  O   . ALA B  2  216 ? -26.348 -14.525 219.780  1.00 55.28  ? 372 ALA B O   1 
ATOM   2508  C  CB  . ALA B  2  216 ? -27.177 -11.584 218.897  1.00 51.65  ? 372 ALA B CB  1 
ATOM   2509  N  N   . LEU B  2  217 ? -27.801 -13.688 221.250  1.00 54.41  ? 373 LEU B N   1 
ATOM   2510  C  CA  . LEU B  2  217 ? -27.204 -14.440 222.344  1.00 54.29  ? 373 LEU B CA  1 
ATOM   2511  C  C   . LEU B  2  217 ? -27.298 -15.948 222.282  1.00 55.37  ? 373 LEU B C   1 
ATOM   2512  O  O   . LEU B  2  217 ? -26.286 -16.633 222.424  1.00 58.91  ? 373 LEU B O   1 
ATOM   2513  C  CB  . LEU B  2  217 ? -27.750 -13.965 223.693  1.00 40.07  ? 373 LEU B CB  1 
ATOM   2514  C  CG  . LEU B  2  217 ? -27.457 -12.529 224.117  1.00 28.47  ? 373 LEU B CG  1 
ATOM   2515  C  CD1 . LEU B  2  217 ? -27.763 -12.404 225.595  1.00 36.35  ? 373 LEU B CD1 1 
ATOM   2516  C  CD2 . LEU B  2  217 ? -26.004 -12.170 223.835  1.00 35.50  ? 373 LEU B CD2 1 
ATOM   2517  N  N   . LEU B  2  218 ? -28.496 -16.482 222.092  1.00 50.52  ? 374 LEU B N   1 
ATOM   2518  C  CA  . LEU B  2  218 ? -28.607 -17.928 222.069  1.00 57.39  ? 374 LEU B CA  1 
ATOM   2519  C  C   . LEU B  2  218 ? -28.953 -18.523 220.716  1.00 61.23  ? 374 LEU B C   1 
ATOM   2520  O  O   . LEU B  2  218 ? -29.144 -19.735 220.580  1.00 55.77  ? 374 LEU B O   1 
ATOM   2521  C  CB  . LEU B  2  218 ? -29.586 -18.396 223.154  1.00 54.43  ? 374 LEU B CB  1 
ATOM   2522  C  CG  . LEU B  2  218 ? -30.957 -17.756 223.297  1.00 45.94  ? 374 LEU B CG  1 
ATOM   2523  C  CD1 . LEU B  2  218 ? -31.889 -18.295 222.225  1.00 59.92  ? 374 LEU B CD1 1 
ATOM   2524  C  CD2 . LEU B  2  218 ? -31.496 -18.083 224.681  1.00 40.27  ? 374 LEU B CD2 1 
ATOM   2525  N  N   . GLU B  2  219 ? -28.981 -17.670 219.702  1.00 62.77  ? 375 GLU B N   1 
ATOM   2526  C  CA  . GLU B  2  219 ? -29.292 -18.131 218.367  1.00 60.21  ? 375 GLU B CA  1 
ATOM   2527  C  C   . GLU B  2  219 ? -28.156 -17.800 217.409  1.00 61.15  ? 375 GLU B C   1 
ATOM   2528  O  O   . GLU B  2  219 ? -28.155 -18.251 216.268  1.00 65.64  ? 375 GLU B O   1 
ATOM   2529  C  CB  . GLU B  2  219 ? -30.579 -17.474 217.894  1.00 72.20  ? 375 GLU B CB  1 
ATOM   2530  C  CG  . GLU B  2  219 ? -31.436 -18.334 216.987  1.00 79.86  ? 375 GLU B CG  1 
ATOM   2531  C  CD  . GLU B  2  219 ? -32.736 -17.643 216.625  1.00 89.84  ? 375 GLU B CD  1 
ATOM   2532  O  OE1 . GLU B  2  219 ? -32.722 -16.792 215.703  1.00 89.40  ? 375 GLU B OE1 1 
ATOM   2533  O  OE2 . GLU B  2  219 ? -33.765 -17.938 217.278  1.00 86.86  ? 375 GLU B OE2 1 
ATOM   2534  N  N   . GLY B  2  220 ? -27.181 -17.025 217.879  1.00 62.67  ? 376 GLY B N   1 
ATOM   2535  C  CA  . GLY B  2  220 ? -26.062 -16.640 217.027  1.00 51.05  ? 376 GLY B CA  1 
ATOM   2536  C  C   . GLY B  2  220 ? -26.539 -15.740 215.898  1.00 45.72  ? 376 GLY B C   1 
ATOM   2537  O  O   . GLY B  2  220 ? -27.733 -15.481 215.763  1.00 43.82  ? 376 GLY B O   1 
ATOM   2538  N  N   . ALA B  2  221 ? -25.616 -15.248 215.085  1.00 48.58  ? 377 ALA B N   1 
ATOM   2539  C  CA  . ALA B  2  221 ? -25.988 -14.386 213.964  1.00 57.28  ? 377 ALA B CA  1 
ATOM   2540  C  C   . ALA B  2  221 ? -26.715 -15.226 212.911  1.00 66.51  ? 377 ALA B C   1 
ATOM   2541  O  O   . ALA B  2  221 ? -26.104 -16.070 212.239  1.00 73.01  ? 377 ALA B O   1 
ATOM   2542  C  CB  . ALA B  2  221 ? -24.747 -13.736 213.362  1.00 44.62  ? 377 ALA B CB  1 
ATOM   2543  N  N   . THR B  2  222 ? -28.018 -14.996 212.770  1.00 65.43  ? 378 THR B N   1 
ATOM   2544  C  CA  . THR B  2  222 ? -28.832 -15.746 211.819  1.00 61.93  ? 378 THR B CA  1 
ATOM   2545  C  C   . THR B  2  222 ? -28.326 -15.650 210.378  1.00 73.48  ? 378 THR B C   1 
ATOM   2546  O  O   . THR B  2  222 ? -28.624 -16.521 209.553  1.00 77.73  ? 378 THR B O   1 
ATOM   2547  C  CB  . THR B  2  222 ? -30.292 -15.283 211.854  1.00 50.47  ? 378 THR B CB  1 
ATOM   2548  O  OG1 . THR B  2  222 ? -30.367 -13.938 211.375  1.00 57.47  ? 378 THR B OG1 1 
ATOM   2549  C  CG2 . THR B  2  222 ? -30.849 -15.362 213.276  1.00 34.90  ? 378 THR B CG2 1 
ATOM   2550  N  N   . GLN B  2  223 ? -27.569 -14.599 210.071  1.00 74.79  ? 379 GLN B N   1 
ATOM   2551  C  CA  . GLN B  2  223 ? -27.024 -14.429 208.727  1.00 67.36  ? 379 GLN B CA  1 
ATOM   2552  C  C   . GLN B  2  223 ? -25.878 -15.395 208.447  1.00 67.88  ? 379 GLN B C   1 
ATOM   2553  O  O   . GLN B  2  223 ? -25.237 -15.322 207.398  1.00 73.07  ? 379 GLN B O   1 
ATOM   2554  C  CB  . GLN B  2  223 ? -26.542 -13.001 208.522  1.00 64.68  ? 379 GLN B CB  1 
ATOM   2555  C  CG  . GLN B  2  223 ? -25.785 -12.440 209.701  1.00 71.48  ? 379 GLN B CG  1 
ATOM   2556  C  CD  . GLN B  2  223 ? -25.054 -11.167 209.349  1.00 67.86  ? 379 GLN B CD  1 
ATOM   2557  O  OE1 . GLN B  2  223 ? -24.041 -11.189 208.641  1.00 48.55  ? 379 GLN B OE1 1 
ATOM   2558  N  NE2 . GLN B  2  223 ? -25.569 -10.044 209.829  1.00 66.82  ? 379 GLN B NE2 1 
ATOM   2559  N  N   . LEU B  2  224 ? -25.609 -16.286 209.394  1.00 61.89  ? 380 LEU B N   1 
ATOM   2560  C  CA  . LEU B  2  224 ? -24.564 -17.281 209.216  1.00 65.67  ? 380 LEU B CA  1 
ATOM   2561  C  C   . LEU B  2  224 ? -25.278 -18.614 209.158  1.00 70.59  ? 380 LEU B C   1 
ATOM   2562  O  O   . LEU B  2  224 ? -26.324 -18.786 209.788  1.00 76.23  ? 380 LEU B O   1 
ATOM   2563  C  CB  . LEU B  2  224 ? -23.580 -17.267 210.386  1.00 64.19  ? 380 LEU B CB  1 
ATOM   2564  C  CG  . LEU B  2  224 ? -22.635 -16.069 210.505  1.00 60.02  ? 380 LEU B CG  1 
ATOM   2565  C  CD1 . LEU B  2  224 ? -21.642 -16.307 211.627  1.00 70.43  ? 380 LEU B CD1 1 
ATOM   2566  C  CD2 . LEU B  2  224 ? -21.896 -15.871 209.220  1.00 46.30  ? 380 LEU B CD2 1 
ATOM   2567  N  N   . MET B  2  225 ? -24.730 -19.556 208.401  1.00 72.49  ? 381 MET B N   1 
ATOM   2568  C  CA  . MET B  2  225 ? -25.362 -20.862 208.287  1.00 71.45  ? 381 MET B CA  1 
ATOM   2569  C  C   . MET B  2  225 ? -24.505 -21.979 208.867  1.00 70.04  ? 381 MET B C   1 
ATOM   2570  O  O   . MET B  2  225 ? -23.276 -21.872 208.925  1.00 64.19  ? 381 MET B O   1 
ATOM   2571  C  CB  . MET B  2  225 ? -25.673 -21.164 206.818  1.00 74.07  ? 381 MET B CB  1 
ATOM   2572  C  CG  . MET B  2  225 ? -26.601 -20.166 206.145  1.00 64.24  ? 381 MET B CG  1 
ATOM   2573  S  SD  . MET B  2  225 ? -28.057 -19.807 207.145  1.00 98.13  ? 381 MET B SD  1 
ATOM   2574  C  CE  . MET B  2  225 ? -28.731 -21.449 207.448  1.00 94.29  ? 381 MET B CE  1 
ATOM   2575  N  N   . GLY B  2  226 ? -25.166 -23.045 209.305  1.00 64.09  ? 382 GLY B N   1 
ATOM   2576  C  CA  . GLY B  2  226 ? -24.450 -24.187 209.844  1.00 64.29  ? 382 GLY B CA  1 
ATOM   2577  C  C   . GLY B  2  226 ? -23.579 -23.877 211.035  1.00 63.83  ? 382 GLY B C   1 
ATOM   2578  O  O   . GLY B  2  226 ? -23.912 -23.014 211.845  1.00 57.36  ? 382 GLY B O   1 
ATOM   2579  N  N   . ASP B  2  227 ? -22.454 -24.578 211.139  1.00 61.97  ? 383 ASP B N   1 
ATOM   2580  C  CA  . ASP B  2  227 ? -21.553 -24.379 212.264  1.00 70.26  ? 383 ASP B CA  1 
ATOM   2581  C  C   . ASP B  2  227 ? -21.066 -22.952 212.423  1.00 68.84  ? 383 ASP B C   1 
ATOM   2582  O  O   . ASP B  2  227 ? -20.716 -22.529 213.518  1.00 66.00  ? 383 ASP B O   1 
ATOM   2583  C  CB  . ASP B  2  227 ? -20.365 -25.329 212.166  1.00 73.36  ? 383 ASP B CB  1 
ATOM   2584  C  CG  . ASP B  2  227 ? -20.750 -26.748 212.483  1.00 75.35  ? 383 ASP B CG  1 
ATOM   2585  O  OD1 . ASP B  2  227 ? -21.514 -26.936 213.451  1.00 82.23  ? 383 ASP B OD1 1 
ATOM   2586  O  OD2 . ASP B  2  227 ? -20.295 -27.672 211.780  1.00 89.18  ? 383 ASP B OD2 1 
ATOM   2587  N  N   . ASN B  2  228 ? -21.037 -22.211 211.326  1.00 73.12  ? 384 ASN B N   1 
ATOM   2588  C  CA  . ASN B  2  228 ? -20.611 -20.824 211.373  1.00 70.16  ? 384 ASN B CA  1 
ATOM   2589  C  C   . ASN B  2  228 ? -21.560 -20.089 212.300  1.00 68.86  ? 384 ASN B C   1 
ATOM   2590  O  O   . ASN B  2  228 ? -21.136 -19.315 213.160  1.00 70.18  ? 384 ASN B O   1 
ATOM   2591  C  CB  . ASN B  2  228 ? -20.676 -20.205 209.974  1.00 77.93  ? 384 ASN B CB  1 
ATOM   2592  C  CG  . ASN B  2  228 ? -19.423 -20.459 209.169  1.00 79.07  ? 384 ASN B CG  1 
ATOM   2593  O  OD1 . ASN B  2  228 ? -18.864 -21.555 209.195  1.00 83.14  ? 384 ASN B OD1 1 
ATOM   2594  N  ND2 . ASN B  2  228 ? -18.978 -19.446 208.437  1.00 83.79  ? 384 ASN B ND2 1 
ATOM   2595  N  N   . ARG B  2  229 ? -22.852 -20.341 212.126  1.00 57.52  ? 385 ARG B N   1 
ATOM   2596  C  CA  . ARG B  2  229 ? -23.838 -19.680 212.954  1.00 59.86  ? 385 ARG B CA  1 
ATOM   2597  C  C   . ARG B  2  229 ? -23.611 -20.088 214.395  1.00 57.48  ? 385 ARG B C   1 
ATOM   2598  O  O   . ARG B  2  229 ? -23.326 -19.251 215.238  1.00 58.36  ? 385 ARG B O   1 
ATOM   2599  C  CB  . ARG B  2  229 ? -25.252 -20.070 212.531  1.00 66.35  ? 385 ARG B CB  1 
ATOM   2600  C  CG  . ARG B  2  229 ? -26.326 -19.060 212.920  1.00 65.09  ? 385 ARG B CG  1 
ATOM   2601  C  CD  . ARG B  2  229 ? -27.645 -19.751 213.229  1.00 78.82  ? 385 ARG B CD  1 
ATOM   2602  N  NE  . ARG B  2  229 ? -27.457 -20.718 214.308  1.00 85.58  ? 385 ARG B NE  1 
ATOM   2603  C  CZ  . ARG B  2  229 ? -28.438 -21.367 214.927  1.00 87.51  ? 385 ARG B CZ  1 
ATOM   2604  N  NH1 . ARG B  2  229 ? -29.701 -21.157 214.580  1.00 83.99  ? 385 ARG B NH1 1 
ATOM   2605  N  NH2 . ARG B  2  229 ? -28.149 -22.232 215.894  1.00 87.92  ? 385 ARG B NH2 1 
ATOM   2606  N  N   . THR B  2  230 ? -23.711 -21.382 214.670  1.00 63.71  ? 386 THR B N   1 
ATOM   2607  C  CA  . THR B  2  230 ? -23.541 -21.876 216.032  1.00 67.75  ? 386 THR B CA  1 
ATOM   2608  C  C   . THR B  2  230 ? -22.307 -21.356 216.753  1.00 69.50  ? 386 THR B C   1 
ATOM   2609  O  O   . THR B  2  230 ? -22.319 -21.257 217.984  1.00 69.40  ? 386 THR B O   1 
ATOM   2610  C  CB  . THR B  2  230 ? -23.519 -23.422 216.088  1.00 67.61  ? 386 THR B CB  1 
ATOM   2611  O  OG1 . THR B  2  230 ? -22.500 -23.926 215.212  1.00 72.83  ? 386 THR B OG1 1 
ATOM   2612  C  CG2 . THR B  2  230 ? -24.880 -23.983 215.691  1.00 59.48  ? 386 THR B CG2 1 
ATOM   2613  N  N   . MET B  2  231 ? -21.246 -21.017 216.018  1.00 63.67  ? 387 MET B N   1 
ATOM   2614  C  CA  . MET B  2  231 ? -20.046 -20.522 216.692  1.00 58.45  ? 387 MET B CA  1 
ATOM   2615  C  C   . MET B  2  231 ? -20.079 -19.031 217.035  1.00 54.14  ? 387 MET B C   1 
ATOM   2616  O  O   . MET B  2  231 ? -19.047 -18.420 217.321  1.00 40.73  ? 387 MET B O   1 
ATOM   2617  C  CB  . MET B  2  231 ? -18.763 -20.882 215.912  1.00 58.18  ? 387 MET B CB  1 
ATOM   2618  C  CG  . MET B  2  231 ? -18.645 -20.428 214.469  1.00 60.05  ? 387 MET B CG  1 
ATOM   2619  S  SD  . MET B  2  231 ? -16.988 -20.860 213.802  1.00 68.05  ? 387 MET B SD  1 
ATOM   2620  C  CE  . MET B  2  231 ? -17.075 -22.609 213.780  1.00 77.80  ? 387 MET B CE  1 
ATOM   2621  N  N   . THR B  2  232 ? -21.281 -18.460 217.015  1.00 55.12  ? 388 THR B N   1 
ATOM   2622  C  CA  . THR B  2  232 ? -21.484 -17.062 217.370  1.00 51.83  ? 388 THR B CA  1 
ATOM   2623  C  C   . THR B  2  232 ? -22.570 -16.985 218.443  1.00 58.41  ? 388 THR B C   1 
ATOM   2624  O  O   . THR B  2  232 ? -23.130 -15.923 218.716  1.00 63.70  ? 388 THR B O   1 
ATOM   2625  C  CB  . THR B  2  232 ? -21.914 -16.208 216.171  1.00 46.66  ? 388 THR B CB  1 
ATOM   2626  O  OG1 . THR B  2  232 ? -23.207 -16.627 215.723  1.00 37.55  ? 388 THR B OG1 1 
ATOM   2627  C  CG2 . THR B  2  232 ? -20.911 -16.326 215.051  1.00 32.93  ? 388 THR B CG2 1 
ATOM   2628  N  N   . ILE B  2  233 ? -22.869 -18.128 219.047  1.00 56.61  ? 389 ILE B N   1 
ATOM   2629  C  CA  . ILE B  2  233 ? -23.853 -18.177 220.114  1.00 56.76  ? 389 ILE B CA  1 
ATOM   2630  C  C   . ILE B  2  233 ? -23.093 -17.882 221.408  1.00 57.78  ? 389 ILE B C   1 
ATOM   2631  O  O   . ILE B  2  233 ? -22.100 -18.545 221.714  1.00 61.01  ? 389 ILE B O   1 
ATOM   2632  C  CB  . ILE B  2  233 ? -24.510 -19.568 220.185  1.00 54.39  ? 389 ILE B CB  1 
ATOM   2633  C  CG1 . ILE B  2  233 ? -25.277 -19.833 218.888  1.00 57.73  ? 389 ILE B CG1 1 
ATOM   2634  C  CG2 . ILE B  2  233 ? -25.447 -19.652 221.388  1.00 49.20  ? 389 ILE B CG2 1 
ATOM   2635  C  CD1 . ILE B  2  233 ? -25.869 -21.216 218.793  1.00 60.10  ? 389 ILE B CD1 1 
ATOM   2636  N  N   . HIS B  2  234 ? -23.550 -16.881 222.155  1.00 45.91  ? 390 HIS B N   1 
ATOM   2637  C  CA  . HIS B  2  234 ? -22.893 -16.493 223.393  1.00 36.00  ? 390 HIS B CA  1 
ATOM   2638  C  C   . HIS B  2  234 ? -23.360 -17.281 224.590  1.00 42.03  ? 390 HIS B C   1 
ATOM   2639  O  O   . HIS B  2  234 ? -22.598 -17.513 225.523  1.00 49.94  ? 390 HIS B O   1 
ATOM   2640  C  CB  . HIS B  2  234 ? -23.118 -15.009 223.635  1.00 32.24  ? 390 HIS B CB  1 
ATOM   2641  C  CG  . HIS B  2  234 ? -22.552 -14.146 222.554  1.00 42.88  ? 390 HIS B CG  1 
ATOM   2642  N  ND1 . HIS B  2  234 ? -21.195 -13.986 222.368  1.00 38.21  ? 390 HIS B ND1 1 
ATOM   2643  C  CD2 . HIS B  2  234 ? -23.152 -13.472 221.545  1.00 40.23  ? 390 HIS B CD2 1 
ATOM   2644  C  CE1 . HIS B  2  234 ? -20.985 -13.255 221.289  1.00 35.21  ? 390 HIS B CE1 1 
ATOM   2645  N  NE2 . HIS B  2  234 ? -22.155 -12.931 220.770  1.00 40.15  ? 390 HIS B NE2 1 
ATOM   2646  N  N   . ASN B  2  235 ? -24.613 -17.706 224.564  1.00 41.36  ? 391 ASN B N   1 
ATOM   2647  C  CA  . ASN B  2  235 ? -25.154 -18.448 225.685  1.00 37.49  ? 391 ASN B CA  1 
ATOM   2648  C  C   . ASN B  2  235 ? -24.230 -19.564 226.144  1.00 33.79  ? 391 ASN B C   1 
ATOM   2649  O  O   . ASN B  2  235 ? -23.633 -20.267 225.349  1.00 41.24  ? 391 ASN B O   1 
ATOM   2650  C  CB  . ASN B  2  235 ? -26.517 -19.020 225.326  1.00 50.20  ? 391 ASN B CB  1 
ATOM   2651  C  CG  . ASN B  2  235 ? -27.170 -19.716 226.490  1.00 60.77  ? 391 ASN B CG  1 
ATOM   2652  O  OD1 . ASN B  2  235 ? -27.473 -19.097 227.515  1.00 59.37  ? 391 ASN B OD1 1 
ATOM   2653  N  ND2 . ASN B  2  235 ? -27.382 -21.015 226.349  1.00 63.61  ? 391 ASN B ND2 1 
ATOM   2654  N  N   . GLY B  2  236 ? -24.103 -19.703 227.451  1.00 46.88  ? 392 GLY B N   1 
ATOM   2655  C  CA  . GLY B  2  236 ? -23.257 -20.739 228.008  1.00 43.99  ? 392 GLY B CA  1 
ATOM   2656  C  C   . GLY B  2  236 ? -21.776 -20.477 227.897  1.00 43.53  ? 392 GLY B C   1 
ATOM   2657  O  O   . GLY B  2  236 ? -20.980 -21.284 228.380  1.00 43.05  ? 392 GLY B O   1 
ATOM   2658  N  N   . MET B  2  237 ? -21.396 -19.365 227.268  1.00 36.03  ? 393 MET B N   1 
ATOM   2659  C  CA  . MET B  2  237 ? -19.982 -19.042 227.121  1.00 42.15  ? 393 MET B CA  1 
ATOM   2660  C  C   . MET B  2  237 ? -19.355 -18.415 228.358  1.00 48.52  ? 393 MET B C   1 
ATOM   2661  O  O   . MET B  2  237 ? -20.048 -17.984 229.287  1.00 53.02  ? 393 MET B O   1 
ATOM   2662  C  CB  . MET B  2  237 ? -19.760 -18.113 225.940  1.00 39.88  ? 393 MET B CB  1 
ATOM   2663  C  CG  . MET B  2  237 ? -20.140 -18.701 224.613  1.00 43.82  ? 393 MET B CG  1 
ATOM   2664  S  SD  . MET B  2  237 ? -19.446 -20.335 224.281  1.00 57.55  ? 393 MET B SD  1 
ATOM   2665  C  CE  . MET B  2  237 ? -17.701 -20.126 224.795  1.00 48.55  ? 393 MET B CE  1 
ATOM   2666  N  N   . GLN B  2  238 ? -18.029 -18.378 228.369  1.00 48.03  ? 394 GLN B N   1 
ATOM   2667  C  CA  . GLN B  2  238 ? -17.310 -17.792 229.485  1.00 52.50  ? 394 GLN B CA  1 
ATOM   2668  C  C   . GLN B  2  238 ? -16.795 -16.434 229.068  1.00 53.13  ? 394 GLN B C   1 
ATOM   2669  O  O   . GLN B  2  238 ? -16.557 -16.175 227.879  1.00 49.38  ? 394 GLN B O   1 
ATOM   2670  C  CB  . GLN B  2  238 ? -16.135 -18.681 229.904  1.00 50.46  ? 394 GLN B CB  1 
ATOM   2671  C  CG  . GLN B  2  238 ? -16.486 -19.714 230.952  1.00 52.48  ? 394 GLN B CG  1 
ATOM   2672  C  CD  . GLN B  2  238 ? -15.350 -20.678 231.223  1.00 58.79  ? 394 GLN B CD  1 
ATOM   2673  O  OE1 . GLN B  2  238 ? -14.219 -20.274 231.511  1.00 49.69  ? 394 GLN B OE1 1 
ATOM   2674  N  NE2 . GLN B  2  238 ? -15.647 -21.967 231.135  1.00 65.74  ? 394 GLN B NE2 1 
ATOM   2675  N  N   . PHE B  2  239 ? -16.619 -15.564 230.050  1.00 56.47  ? 395 PHE B N   1 
ATOM   2676  C  CA  . PHE B  2  239 ? -16.128 -14.228 229.773  1.00 56.38  ? 395 PHE B CA  1 
ATOM   2677  C  C   . PHE B  2  239 ? -14.659 -14.315 229.387  1.00 51.16  ? 395 PHE B C   1 
ATOM   2678  O  O   . PHE B  2  239 ? -13.896 -15.090 229.967  1.00 42.15  ? 395 PHE B O   1 
ATOM   2679  C  CB  . PHE B  2  239 ? -16.303 -13.340 231.002  1.00 55.58  ? 395 PHE B CB  1 
ATOM   2680  C  CG  . PHE B  2  239 ? -16.448 -11.888 230.671  1.00 62.84  ? 395 PHE B CG  1 
ATOM   2681  C  CD1 . PHE B  2  239 ? -15.327 -11.067 230.548  1.00 46.47  ? 395 PHE B CD1 1 
ATOM   2682  C  CD2 . PHE B  2  239 ? -17.711 -11.343 230.452  1.00 63.15  ? 395 PHE B CD2 1 
ATOM   2683  C  CE1 . PHE B  2  239 ? -15.461 -9.731  230.215  1.00 36.70  ? 395 PHE B CE1 1 
ATOM   2684  C  CE2 . PHE B  2  239 ? -17.856 -10.008 230.116  1.00 57.92  ? 395 PHE B CE2 1 
ATOM   2685  C  CZ  . PHE B  2  239 ? -16.725 -9.198  229.998  1.00 57.07  ? 395 PHE B CZ  1 
ATOM   2686  N  N   . SER B  2  240 ? -14.267 -13.531 228.394  1.00 44.92  ? 396 SER B N   1 
ATOM   2687  C  CA  . SER B  2  240 ? -12.884 -13.537 227.948  1.00 45.26  ? 396 SER B CA  1 
ATOM   2688  C  C   . SER B  2  240 ? -12.463 -12.105 227.807  1.00 44.30  ? 396 SER B C   1 
ATOM   2689  O  O   . SER B  2  240 ? -13.250 -11.255 227.397  1.00 38.77  ? 396 SER B O   1 
ATOM   2690  C  CB  . SER B  2  240 ? -12.741 -14.249 226.605  1.00 38.36  ? 396 SER B CB  1 
ATOM   2691  O  OG  . SER B  2  240 ? -13.375 -15.517 226.642  1.00 43.08  ? 396 SER B OG  1 
ATOM   2692  N  N   . THR B  2  241 ? -11.220 -11.833 228.167  1.00 51.02  ? 397 THR B N   1 
ATOM   2693  C  CA  . THR B  2  241 ? -10.710 -10.481 228.080  1.00 50.68  ? 397 THR B CA  1 
ATOM   2694  C  C   . THR B  2  241 ? -9.348  -10.404 227.454  1.00 53.69  ? 397 THR B C   1 
ATOM   2695  O  O   . THR B  2  241 ? -8.669  -11.400 227.218  1.00 56.00  ? 397 THR B O   1 
ATOM   2696  C  CB  . THR B  2  241 ? -10.548 -9.815  229.459  1.00 47.58  ? 397 THR B CB  1 
ATOM   2697  O  OG1 . THR B  2  241 ? -9.676  -10.609 230.265  1.00 51.05  ? 397 THR B OG1 1 
ATOM   2698  C  CG2 . THR B  2  241 ? -11.879 -9.649  230.157  1.00 39.69  ? 397 THR B CG2 1 
ATOM   2699  N  N   . PHE B  2  242 ? -8.989  -9.164  227.188  1.00 55.70  ? 398 PHE B N   1 
ATOM   2700  C  CA  . PHE B  2  242 ? -7.705  -8.754  226.663  1.00 62.33  ? 398 PHE B CA  1 
ATOM   2701  C  C   . PHE B  2  242 ? -6.635  -9.786  227.089  1.00 48.92  ? 398 PHE B C   1 
ATOM   2702  O  O   . PHE B  2  242 ? -5.991  -10.418 226.261  1.00 45.53  ? 398 PHE B O   1 
ATOM   2703  C  CB  . PHE B  2  242 ? -7.497  -7.358  227.285  1.00 82.29  ? 398 PHE B CB  1 
ATOM   2704  C  CG  . PHE B  2  242 ? -6.159  -6.739  227.074  1.00 82.35  ? 398 PHE B CG  1 
ATOM   2705  C  CD1 . PHE B  2  242 ? -5.718  -6.396  225.799  1.00 104.71 ? 398 PHE B CD1 1 
ATOM   2706  C  CD2 . PHE B  2  242 ? -5.393  -6.371  228.175  1.00 71.11  ? 398 PHE B CD2 1 
ATOM   2707  C  CE1 . PHE B  2  242 ? -4.528  -5.680  225.623  1.00 112.54 ? 398 PHE B CE1 1 
ATOM   2708  C  CE2 . PHE B  2  242 ? -4.213  -5.664  228.020  1.00 100.68 ? 398 PHE B CE2 1 
ATOM   2709  C  CZ  . PHE B  2  242 ? -3.774  -5.312  226.739  1.00 112.74 ? 398 PHE B CZ  1 
ATOM   2710  N  N   . ASP B  2  243 ? -6.511  -9.984  228.395  1.00 45.28  ? 399 ASP B N   1 
ATOM   2711  C  CA  . ASP B  2  243 ? -5.534  -10.888 228.982  1.00 41.56  ? 399 ASP B CA  1 
ATOM   2712  C  C   . ASP B  2  243 ? -6.103  -12.211 229.513  1.00 47.82  ? 399 ASP B C   1 
ATOM   2713  O  O   . ASP B  2  243 ? -5.543  -12.807 230.430  1.00 52.68  ? 399 ASP B O   1 
ATOM   2714  C  CB  . ASP B  2  243 ? -4.813  -10.157 230.122  1.00 41.01  ? 399 ASP B CB  1 
ATOM   2715  C  CG  . ASP B  2  243 ? -5.726  -9.885  231.324  1.00 43.67  ? 399 ASP B CG  1 
ATOM   2716  O  OD1 . ASP B  2  243 ? -6.932  -9.616  231.135  1.00 47.52  ? 399 ASP B OD1 1 
ATOM   2717  O  OD2 . ASP B  2  243 ? -5.233  -9.923  232.468  1.00 42.54  ? 399 ASP B OD2 1 
ATOM   2718  N  N   . ARG B  2  244 ? -7.220  -12.677 228.977  1.00 42.56  ? 400 ARG B N   1 
ATOM   2719  C  CA  . ARG B  2  244 ? -7.735  -13.945 229.451  1.00 40.29  ? 400 ARG B CA  1 
ATOM   2720  C  C   . ARG B  2  244 ? -8.659  -14.614 228.458  1.00 44.44  ? 400 ARG B C   1 
ATOM   2721  O  O   . ARG B  2  244 ? -9.862  -14.350 228.435  1.00 50.83  ? 400 ARG B O   1 
ATOM   2722  C  CB  . ARG B  2  244 ? -8.454  -13.762 230.771  1.00 45.32  ? 400 ARG B CB  1 
ATOM   2723  C  CG  . ARG B  2  244 ? -8.386  -14.988 231.648  1.00 54.91  ? 400 ARG B CG  1 
ATOM   2724  C  CD  . ARG B  2  244 ? -7.434  -14.741 232.797  1.00 56.56  ? 400 ARG B CD  1 
ATOM   2725  N  NE  . ARG B  2  244 ? -8.118  -14.886 234.079  1.00 52.37  ? 400 ARG B NE  1 
ATOM   2726  C  CZ  . ARG B  2  244 ? -7.749  -14.265 235.192  1.00 59.53  ? 400 ARG B CZ  1 
ATOM   2727  N  NH1 . ARG B  2  244 ? -6.701  -13.444 235.178  1.00 60.79  ? 400 ARG B NH1 1 
ATOM   2728  N  NH2 . ARG B  2  244 ? -8.421  -14.473 236.319  1.00 44.08  ? 400 ARG B NH2 1 
ATOM   2729  N  N   . ASP B  2  245 ? -8.083  -15.494 227.645  1.00 40.96  ? 401 ASP B N   1 
ATOM   2730  C  CA  . ASP B  2  245 ? -8.834  -16.212 226.628  1.00 52.18  ? 401 ASP B CA  1 
ATOM   2731  C  C   . ASP B  2  245 ? -9.602  -17.389 227.232  1.00 53.05  ? 401 ASP B C   1 
ATOM   2732  O  O   . ASP B  2  245 ? -9.002  -18.275 227.839  1.00 45.59  ? 401 ASP B O   1 
ATOM   2733  C  CB  . ASP B  2  245 ? -7.875  -16.727 225.548  1.00 50.17  ? 401 ASP B CB  1 
ATOM   2734  C  CG  . ASP B  2  245 ? -8.593  -17.438 224.411  1.00 54.46  ? 401 ASP B CG  1 
ATOM   2735  O  OD1 . ASP B  2  245 ? -9.773  -17.818 224.584  1.00 58.76  ? 401 ASP B OD1 1 
ATOM   2736  O  OD2 . ASP B  2  245 ? -7.968  -17.635 223.347  1.00 60.20  ? 401 ASP B OD2 1 
ATOM   2737  N  N   . ASN B  2  246 ? -10.924 -17.378 227.066  1.00 46.79  ? 402 ASN B N   1 
ATOM   2738  C  CA  . ASN B  2  246 ? -11.792 -18.448 227.552  1.00 40.24  ? 402 ASN B CA  1 
ATOM   2739  C  C   . ASN B  2  246 ? -12.806 -18.762 226.460  1.00 38.26  ? 402 ASN B C   1 
ATOM   2740  O  O   . ASN B  2  246 ? -13.791 -19.461 226.701  1.00 37.64  ? 402 ASN B O   1 
ATOM   2741  C  CB  . ASN B  2  246 ? -12.554 -18.032 228.821  1.00 36.27  ? 402 ASN B CB  1 
ATOM   2742  C  CG  . ASN B  2  246 ? -11.655 -17.890 230.026  1.00 51.08  ? 402 ASN B CG  1 
ATOM   2743  O  OD1 . ASN B  2  246 ? -10.812 -18.742 230.274  1.00 59.05  ? 402 ASN B OD1 1 
ATOM   2744  N  ND2 . ASN B  2  246 ? -11.839 -16.817 230.794  1.00 56.36  ? 402 ASN B ND2 1 
ATOM   2745  N  N   . ASP B  2  247 ? -12.575 -18.228 225.264  1.00 44.25  ? 403 ASP B N   1 
ATOM   2746  C  CA  . ASP B  2  247 ? -13.493 -18.457 224.158  1.00 50.54  ? 403 ASP B CA  1 
ATOM   2747  C  C   . ASP B  2  247 ? -13.403 -19.884 223.625  1.00 59.05  ? 403 ASP B C   1 
ATOM   2748  O  O   . ASP B  2  247 ? -12.553 -20.684 224.052  1.00 48.50  ? 403 ASP B O   1 
ATOM   2749  C  CB  . ASP B  2  247 ? -13.256 -17.450 223.018  1.00 55.89  ? 403 ASP B CB  1 
ATOM   2750  C  CG  . ASP B  2  247 ? -11.789 -17.329 222.619  1.00 65.16  ? 403 ASP B CG  1 
ATOM   2751  O  OD1 . ASP B  2  247 ? -11.128 -18.370 222.417  1.00 56.71  ? 403 ASP B OD1 1 
ATOM   2752  O  OD2 . ASP B  2  247 ? -11.300 -16.182 222.492  1.00 74.45  ? 403 ASP B OD2 1 
ATOM   2753  N  N   . ASN B  2  248 ? -14.311 -20.197 222.703  1.00 59.37  ? 404 ASN B N   1 
ATOM   2754  C  CA  . ASN B  2  248 ? -14.367 -21.511 222.085  1.00 54.62  ? 404 ASN B CA  1 
ATOM   2755  C  C   . ASN B  2  248 ? -13.657 -21.484 220.759  1.00 52.13  ? 404 ASN B C   1 
ATOM   2756  O  O   . ASN B  2  248 ? -14.172 -21.985 219.771  1.00 68.15  ? 404 ASN B O   1 
ATOM   2757  C  CB  . ASN B  2  248 ? -15.814 -21.947 221.871  1.00 22.07  ? 404 ASN B CB  1 
ATOM   2758  C  CG  . ASN B  2  248 ? -16.318 -22.783 223.000  1.00 42.01  ? 404 ASN B CG  1 
ATOM   2759  O  OD1 . ASN B  2  248 ? -15.736 -22.798 224.086  1.00 42.48  ? 404 ASN B OD1 1 
ATOM   2760  N  ND2 . ASN B  2  248 ? -17.407 -23.486 222.766  1.00 44.99  ? 404 ASN B ND2 1 
ATOM   2761  N  N   . TRP B  2  249 ? -12.466 -20.907 220.729  1.00 43.29  ? 405 TRP B N   1 
ATOM   2762  C  CA  . TRP B  2  249 ? -11.740 -20.838 219.484  1.00 50.69  ? 405 TRP B CA  1 
ATOM   2763  C  C   . TRP B  2  249 ? -10.323 -21.354 219.666  1.00 56.71  ? 405 TRP B C   1 
ATOM   2764  O  O   . TRP B  2  249 ? -9.442  -20.641 220.138  1.00 60.25  ? 405 TRP B O   1 
ATOM   2765  C  CB  . TRP B  2  249 ? -11.763 -19.396 218.965  1.00 49.55  ? 405 TRP B CB  1 
ATOM   2766  C  CG  . TRP B  2  249 ? -10.992 -19.157 217.710  1.00 48.76  ? 405 TRP B CG  1 
ATOM   2767  C  CD1 . TRP B  2  249 ? -10.760 -20.047 216.708  1.00 45.69  ? 405 TRP B CD1 1 
ATOM   2768  C  CD2 . TRP B  2  249 ? -10.395 -17.921 217.295  1.00 53.13  ? 405 TRP B CD2 1 
ATOM   2769  N  NE1 . TRP B  2  249 ? -10.055 -19.448 215.688  1.00 38.53  ? 405 TRP B NE1 1 
ATOM   2770  C  CE2 . TRP B  2  249 ? -9.818  -18.141 216.022  1.00 53.45  ? 405 TRP B CE2 1 
ATOM   2771  C  CE3 . TRP B  2  249 ? -10.294 -16.646 217.873  1.00 50.82  ? 405 TRP B CE3 1 
ATOM   2772  C  CZ2 . TRP B  2  249 ? -9.149  -17.131 215.314  1.00 48.48  ? 405 TRP B CZ2 1 
ATOM   2773  C  CZ3 . TRP B  2  249 ? -9.628  -15.640 217.167  1.00 50.79  ? 405 TRP B CZ3 1 
ATOM   2774  C  CH2 . TRP B  2  249 ? -9.066  -15.893 215.902  1.00 53.76  ? 405 TRP B CH2 1 
ATOM   2775  N  N   . ASN B  2  250 ? -10.122 -22.616 219.298  1.00 59.73  ? 406 ASN B N   1 
ATOM   2776  C  CA  . ASN B  2  250 ? -8.817  -23.255 219.396  1.00 48.37  ? 406 ASN B CA  1 
ATOM   2777  C  C   . ASN B  2  250 ? -8.199  -23.160 220.786  1.00 41.39  ? 406 ASN B C   1 
ATOM   2778  O  O   . ASN B  2  250 ? -7.076  -22.706 220.936  1.00 31.82  ? 406 ASN B O   1 
ATOM   2779  C  CB  . ASN B  2  250 ? -7.876  -22.636 218.374  1.00 53.70  ? 406 ASN B CB  1 
ATOM   2780  C  CG  . ASN B  2  250 ? -8.231  -23.017 216.952  1.00 61.86  ? 406 ASN B CG  1 
ATOM   2781  O  OD1 . ASN B  2  250 ? -9.402  -23.022 216.566  1.00 60.46  ? 406 ASN B OD1 1 
ATOM   2782  N  ND2 . ASN B  2  250 ? -7.215  -23.331 216.158  1.00 61.77  ? 406 ASN B ND2 1 
ATOM   2783  N  N   . PRO B  2  251 ? -8.931  -23.600 221.820  1.00 41.56  ? 407 PRO B N   1 
ATOM   2784  C  CA  . PRO B  2  251 ? -8.485  -23.581 223.215  1.00 53.83  ? 407 PRO B CA  1 
ATOM   2785  C  C   . PRO B  2  251 ? -6.991  -23.769 223.525  1.00 59.99  ? 407 PRO B C   1 
ATOM   2786  O  O   . PRO B  2  251 ? -6.545  -23.494 224.639  1.00 74.77  ? 407 PRO B O   1 
ATOM   2787  C  CB  . PRO B  2  251 ? -9.352  -24.657 223.851  1.00 41.21  ? 407 PRO B CB  1 
ATOM   2788  C  CG  . PRO B  2  251 ? -10.659 -24.419 223.182  1.00 46.11  ? 407 PRO B CG  1 
ATOM   2789  C  CD  . PRO B  2  251 ? -10.286 -24.181 221.725  1.00 39.89  ? 407 PRO B CD  1 
ATOM   2790  N  N   . GLY B  2  252 ? -6.209  -24.232 222.569  1.00 58.52  ? 408 GLY B N   1 
ATOM   2791  C  CA  . GLY B  2  252 ? -4.800  -24.395 222.859  1.00 62.27  ? 408 GLY B CA  1 
ATOM   2792  C  C   . GLY B  2  252 ? -3.964  -23.296 222.242  1.00 66.18  ? 408 GLY B C   1 
ATOM   2793  O  O   . GLY B  2  252 ? -3.057  -22.770 222.874  1.00 70.16  ? 408 GLY B O   1 
ATOM   2794  N  N   . ASP B  2  253 ? -4.277  -22.955 220.996  1.00 66.64  ? 409 ASP B N   1 
ATOM   2795  C  CA  . ASP B  2  253 ? -3.564  -21.928 220.250  1.00 63.11  ? 409 ASP B CA  1 
ATOM   2796  C  C   . ASP B  2  253 ? -3.817  -20.548 220.855  1.00 66.23  ? 409 ASP B C   1 
ATOM   2797  O  O   . ASP B  2  253 ? -4.932  -20.028 220.815  1.00 74.81  ? 409 ASP B O   1 
ATOM   2798  C  CB  . ASP B  2  253 ? -4.027  -21.940 218.785  1.00 68.01  ? 409 ASP B CB  1 
ATOM   2799  C  CG  . ASP B  2  253 ? -3.151  -21.092 217.883  1.00 69.35  ? 409 ASP B CG  1 
ATOM   2800  O  OD1 . ASP B  2  253 ? -2.699  -20.023 218.332  1.00 64.03  ? 409 ASP B OD1 1 
ATOM   2801  O  OD2 . ASP B  2  253 ? -2.925  -21.491 216.721  1.00 73.57  ? 409 ASP B OD2 1 
ATOM   2802  N  N   . PRO B  2  254 ? -2.783  -19.937 221.433  1.00 58.67  ? 410 PRO B N   1 
ATOM   2803  C  CA  . PRO B  2  254 ? -2.981  -18.614 222.021  1.00 60.17  ? 410 PRO B CA  1 
ATOM   2804  C  C   . PRO B  2  254 ? -3.130  -17.523 220.966  1.00 63.74  ? 410 PRO B C   1 
ATOM   2805  O  O   . PRO B  2  254 ? -3.365  -16.363 221.292  1.00 69.68  ? 410 PRO B O   1 
ATOM   2806  C  CB  . PRO B  2  254 ? -1.729  -18.432 222.871  1.00 63.44  ? 410 PRO B CB  1 
ATOM   2807  C  CG  . PRO B  2  254 ? -1.378  -19.835 223.253  1.00 73.01  ? 410 PRO B CG  1 
ATOM   2808  C  CD  . PRO B  2  254 ? -1.543  -20.540 221.935  1.00 66.50  ? 410 PRO B CD  1 
ATOM   2809  N  N   . THR B  2  255 ? -2.987  -17.895 219.702  1.00 56.16  ? 411 THR B N   1 
ATOM   2810  C  CA  . THR B  2  255 ? -3.113  -16.943 218.614  1.00 51.22  ? 411 THR B CA  1 
ATOM   2811  C  C   . THR B  2  255 ? -4.588  -16.741 218.315  1.00 56.69  ? 411 THR B C   1 
ATOM   2812  O  O   . THR B  2  255 ? -4.991  -15.720 217.759  1.00 68.60  ? 411 THR B O   1 
ATOM   2813  C  CB  . THR B  2  255 ? -2.421  -17.475 217.362  1.00 64.31  ? 411 THR B CB  1 
ATOM   2814  O  OG1 . THR B  2  255 ? -1.044  -17.709 217.667  1.00 72.82  ? 411 THR B OG1 1 
ATOM   2815  C  CG2 . THR B  2  255 ? -2.542  -16.493 216.196  1.00 61.72  ? 411 THR B CG2 1 
ATOM   2816  N  N   . LYS B  2  256 ? -5.393  -17.724 218.694  1.00 52.14  ? 412 LYS B N   1 
ATOM   2817  C  CA  . LYS B  2  256 ? -6.832  -17.667 218.464  1.00 58.74  ? 412 LYS B CA  1 
ATOM   2818  C  C   . LYS B  2  256 ? -7.553  -17.070 219.678  1.00 54.02  ? 412 LYS B C   1 
ATOM   2819  O  O   . LYS B  2  256 ? -8.227  -17.762 220.448  1.00 52.55  ? 412 LYS B O   1 
ATOM   2820  C  CB  . LYS B  2  256 ? -7.324  -19.076 218.149  1.00 64.67  ? 412 LYS B CB  1 
ATOM   2821  C  CG  . LYS B  2  256 ? -6.494  -19.737 217.053  1.00 66.67  ? 412 LYS B CG  1 
ATOM   2822  C  CD  . LYS B  2  256 ? -6.465  -18.876 215.803  1.00 55.64  ? 412 LYS B CD  1 
ATOM   2823  C  CE  . LYS B  2  256 ? -5.616  -19.495 214.706  1.00 59.71  ? 412 LYS B CE  1 
ATOM   2824  N  NZ  . LYS B  2  256 ? -4.171  -19.492 215.069  1.00 66.71  ? 412 LYS B NZ  1 
ATOM   2825  N  N   . HIS B  2  257 ? -7.412  -15.758 219.814  1.00 48.23  ? 413 HIS B N   1 
ATOM   2826  C  CA  . HIS B  2  257 ? -7.972  -15.020 220.936  1.00 48.42  ? 413 HIS B CA  1 
ATOM   2827  C  C   . HIS B  2  257 ? -9.105  -14.070 220.547  1.00 52.73  ? 413 HIS B C   1 
ATOM   2828  O  O   . HIS B  2  257 ? -8.848  -12.943 220.124  1.00 48.78  ? 413 HIS B O   1 
ATOM   2829  C  CB  . HIS B  2  257 ? -6.836  -14.233 221.574  1.00 35.29  ? 413 HIS B CB  1 
ATOM   2830  C  CG  . HIS B  2  257 ? -7.135  -13.743 222.948  1.00 43.25  ? 413 HIS B CG  1 
ATOM   2831  N  ND1 . HIS B  2  257 ? -6.147  -13.299 223.801  1.00 34.84  ? 413 HIS B ND1 1 
ATOM   2832  C  CD2 . HIS B  2  257 ? -8.302  -13.646 223.630  1.00 41.78  ? 413 HIS B CD2 1 
ATOM   2833  C  CE1 . HIS B  2  257 ? -6.694  -12.954 224.953  1.00 53.32  ? 413 HIS B CE1 1 
ATOM   2834  N  NE2 . HIS B  2  257 ? -7.999  -13.155 224.876  1.00 46.17  ? 413 HIS B NE2 1 
ATOM   2835  N  N   . CYS B  2  258 ? -10.355 -14.507 220.698  1.00 48.39  ? 414 CYS B N   1 
ATOM   2836  C  CA  . CYS B  2  258 ? -11.465 -13.644 220.333  1.00 47.08  ? 414 CYS B CA  1 
ATOM   2837  C  C   . CYS B  2  258 ? -11.441 -12.287 221.010  1.00 56.37  ? 414 CYS B C   1 
ATOM   2838  O  O   . CYS B  2  258 ? -12.047 -11.346 220.508  1.00 59.63  ? 414 CYS B O   1 
ATOM   2839  C  CB  . CYS B  2  258 ? -12.806 -14.311 220.614  1.00 30.20  ? 414 CYS B CB  1 
ATOM   2840  S  SG  . CYS B  2  258 ? -13.156 -15.536 219.348  1.00 54.68  ? 414 CYS B SG  1 
ATOM   2841  N  N   . SER B  2  259 ? -10.760 -12.162 222.143  1.00 52.43  ? 415 SER B N   1 
ATOM   2842  C  CA  . SER B  2  259 ? -10.744 -10.868 222.795  1.00 41.77  ? 415 SER B CA  1 
ATOM   2843  C  C   . SER B  2  259 ? -9.656  -9.959  222.236  1.00 42.37  ? 415 SER B C   1 
ATOM   2844  O  O   . SER B  2  259 ? -9.908  -8.775  222.038  1.00 56.76  ? 415 SER B O   1 
ATOM   2845  C  CB  . SER B  2  259 ? -10.594 -11.021 224.299  1.00 44.29  ? 415 SER B CB  1 
ATOM   2846  O  OG  . SER B  2  259 ? -10.796 -9.775  224.934  1.00 48.19  ? 415 SER B OG  1 
ATOM   2847  N  N   . ARG B  2  260 ? -8.462  -10.483 221.961  1.00 40.63  ? 416 ARG B N   1 
ATOM   2848  C  CA  . ARG B  2  260 ? -7.401  -9.636  221.405  1.00 53.07  ? 416 ARG B CA  1 
ATOM   2849  C  C   . ARG B  2  260 ? -7.967  -8.861  220.219  1.00 51.40  ? 416 ARG B C   1 
ATOM   2850  O  O   . ARG B  2  260 ? -7.910  -7.631  220.184  1.00 48.31  ? 416 ARG B O   1 
ATOM   2851  C  CB  . ARG B  2  260 ? -6.194  -10.456 220.938  1.00 71.40  ? 416 ARG B CB  1 
ATOM   2852  C  CG  . ARG B  2  260 ? -5.294  -11.001 222.049  1.00 95.05  ? 416 ARG B CG  1 
ATOM   2853  C  CD  . ARG B  2  260 ? -3.914  -11.357 221.478  1.00 105.73 ? 416 ARG B CD  1 
ATOM   2854  N  NE  . ARG B  2  260 ? -3.060  -12.111 222.399  1.00 114.87 ? 416 ARG B NE  1 
ATOM   2855  C  CZ  . ARG B  2  260 ? -2.683  -11.698 223.608  1.00 119.65 ? 416 ARG B CZ  1 
ATOM   2856  N  NH1 . ARG B  2  260 ? -3.082  -10.520 224.078  1.00 122.02 ? 416 ARG B NH1 1 
ATOM   2857  N  NH2 . ARG B  2  260 ? -1.890  -12.464 224.345  1.00 114.40 ? 416 ARG B NH2 1 
ATOM   2858  N  N   . GLU B  2  261 ? -8.491  -9.588  219.240  1.00 45.13  ? 417 GLU B N   1 
ATOM   2859  C  CA  . GLU B  2  261 ? -9.117  -8.959  218.086  1.00 48.77  ? 417 GLU B CA  1 
ATOM   2860  C  C   . GLU B  2  261 ? -10.533 -8.868  218.609  1.00 48.09  ? 417 GLU B C   1 
ATOM   2861  O  O   . GLU B  2  261 ? -10.895 -9.680  219.445  1.00 54.02  ? 417 GLU B O   1 
ATOM   2862  C  CB  . GLU B  2  261 ? -9.040  -9.885  216.861  1.00 63.08  ? 417 GLU B CB  1 
ATOM   2863  C  CG  . GLU B  2  261 ? -8.539  -11.310 217.155  1.00 59.41  ? 417 GLU B CG  1 
ATOM   2864  C  CD  . GLU B  2  261 ? -8.353  -12.173 215.897  1.00 67.28  ? 417 GLU B CD  1 
ATOM   2865  O  OE1 . GLU B  2  261 ? -9.358  -12.520 215.231  1.00 67.66  ? 417 GLU B OE1 1 
ATOM   2866  O  OE2 . GLU B  2  261 ? -7.191  -12.512 215.579  1.00 53.86  ? 417 GLU B OE2 1 
ATOM   2867  N  N   . ASP B  2  262 ? -11.325 -7.902  218.154  1.00 39.93  ? 418 ASP B N   1 
ATOM   2868  C  CA  . ASP B  2  262 ? -12.719 -7.736  218.629  1.00 37.81  ? 418 ASP B CA  1 
ATOM   2869  C  C   . ASP B  2  262 ? -12.820 -6.773  219.828  1.00 34.83  ? 418 ASP B C   1 
ATOM   2870  O  O   . ASP B  2  262 ? -13.907 -6.456  220.305  1.00 42.00  ? 418 ASP B O   1 
ATOM   2871  C  CB  . ASP B  2  262 ? -13.368 -9.091  218.955  1.00 34.59  ? 418 ASP B CB  1 
ATOM   2872  C  CG  . ASP B  2  262 ? -13.749 -9.901  217.694  1.00 52.93  ? 418 ASP B CG  1 
ATOM   2873  O  OD1 . ASP B  2  262 ? -13.022 -9.842  216.676  1.00 57.19  ? 418 ASP B OD1 1 
ATOM   2874  O  OD2 . ASP B  2  262 ? -14.774 -10.621 217.726  1.00 59.58  ? 418 ASP B OD2 1 
ATOM   2875  N  N   . ALA B  2  263 ? -11.652 -6.325  220.285  1.00 44.04  ? 419 ALA B N   1 
ATOM   2876  C  CA  . ALA B  2  263 ? -11.432 -5.321  221.345  1.00 45.63  ? 419 ALA B CA  1 
ATOM   2877  C  C   . ALA B  2  263 ? -12.347 -5.153  222.547  1.00 44.75  ? 419 ALA B C   1 
ATOM   2878  O  O   . ALA B  2  263 ? -12.613 -4.014  222.977  1.00 43.34  ? 419 ALA B O   1 
ATOM   2879  C  CB  . ALA B  2  263 ? -11.243 -3.935  220.681  1.00 36.10  ? 419 ALA B CB  1 
ATOM   2880  N  N   . GLY B  2  264 ? -12.807 -6.253  223.119  1.00 34.71  ? 420 GLY B N   1 
ATOM   2881  C  CA  . GLY B  2  264 ? -13.658 -6.114  224.278  1.00 43.96  ? 420 GLY B CA  1 
ATOM   2882  C  C   . GLY B  2  264 ? -13.674 -7.330  225.165  1.00 39.40  ? 420 GLY B C   1 
ATOM   2883  O  O   . GLY B  2  264 ? -13.286 -8.410  224.746  1.00 54.49  ? 420 GLY B O   1 
ATOM   2884  N  N   . GLY B  2  265 ? -14.088 -7.146  226.405  1.00 28.38  ? 421 GLY B N   1 
ATOM   2885  C  CA  . GLY B  2  265 ? -14.189 -8.271  227.300  1.00 33.27  ? 421 GLY B CA  1 
ATOM   2886  C  C   . GLY B  2  265 ? -15.622 -8.659  227.034  1.00 47.26  ? 421 GLY B C   1 
ATOM   2887  O  O   . GLY B  2  265 ? -16.510 -7.798  227.083  1.00 40.99  ? 421 GLY B O   1 
ATOM   2888  N  N   . TRP B  2  266 ? -15.861 -9.933  226.743  1.00 49.65  ? 422 TRP B N   1 
ATOM   2889  C  CA  . TRP B  2  266 ? -17.207 -10.369 226.423  1.00 41.87  ? 422 TRP B CA  1 
ATOM   2890  C  C   . TRP B  2  266 ? -17.312 -11.883 226.430  1.00 46.79  ? 422 TRP B C   1 
ATOM   2891  O  O   . TRP B  2  266 ? -16.301 -12.587 226.370  1.00 51.53  ? 422 TRP B O   1 
ATOM   2892  C  CB  . TRP B  2  266 ? -17.562 -9.831  225.038  1.00 41.20  ? 422 TRP B CB  1 
ATOM   2893  C  CG  . TRP B  2  266 ? -18.940 -10.126 224.614  1.00 41.22  ? 422 TRP B CG  1 
ATOM   2894  C  CD1 . TRP B  2  266 ? -19.327 -10.952 223.604  1.00 42.29  ? 422 TRP B CD1 1 
ATOM   2895  C  CD2 . TRP B  2  266 ? -20.135 -9.604  225.187  1.00 27.41  ? 422 TRP B CD2 1 
ATOM   2896  N  NE1 . TRP B  2  266 ? -20.690 -10.977 223.515  1.00 33.22  ? 422 TRP B NE1 1 
ATOM   2897  C  CE2 . TRP B  2  266 ? -21.211 -10.157 224.479  1.00 31.09  ? 422 TRP B CE2 1 
ATOM   2898  C  CE3 . TRP B  2  266 ? -20.401 -8.721  226.233  1.00 31.89  ? 422 TRP B CE3 1 
ATOM   2899  C  CZ2 . TRP B  2  266 ? -22.537 -9.856  224.784  1.00 41.39  ? 422 TRP B CZ2 1 
ATOM   2900  C  CZ3 . TRP B  2  266 ? -21.716 -8.425  226.532  1.00 36.64  ? 422 TRP B CZ3 1 
ATOM   2901  C  CH2 . TRP B  2  266 ? -22.766 -8.989  225.812  1.00 34.74  ? 422 TRP B CH2 1 
ATOM   2902  N  N   . TRP B  2  267 ? -18.539 -12.384 226.501  1.00 41.36  ? 423 TRP B N   1 
ATOM   2903  C  CA  . TRP B  2  267 ? -18.761 -13.821 226.484  1.00 42.10  ? 423 TRP B CA  1 
ATOM   2904  C  C   . TRP B  2  267 ? -18.522 -14.336 225.076  1.00 45.86  ? 423 TRP B C   1 
ATOM   2905  O  O   . TRP B  2  267 ? -19.419 -14.883 224.435  1.00 53.53  ? 423 TRP B O   1 
ATOM   2906  C  CB  . TRP B  2  267 ? -20.178 -14.146 226.949  1.00 29.54  ? 423 TRP B CB  1 
ATOM   2907  C  CG  . TRP B  2  267 ? -20.375 -13.792 228.383  1.00 30.49  ? 423 TRP B CG  1 
ATOM   2908  C  CD1 . TRP B  2  267 ? -19.956 -14.504 229.460  1.00 36.14  ? 423 TRP B CD1 1 
ATOM   2909  C  CD2 . TRP B  2  267 ? -20.937 -12.582 228.897  1.00 39.27  ? 423 TRP B CD2 1 
ATOM   2910  N  NE1 . TRP B  2  267 ? -20.215 -13.818 230.613  1.00 38.07  ? 423 TRP B NE1 1 
ATOM   2911  C  CE2 . TRP B  2  267 ? -20.816 -12.630 230.298  1.00 45.02  ? 423 TRP B CE2 1 
ATOM   2912  C  CE3 . TRP B  2  267 ? -21.529 -11.456 228.308  1.00 33.45  ? 423 TRP B CE3 1 
ATOM   2913  C  CZ2 . TRP B  2  267 ? -21.263 -11.595 231.126  1.00 44.61  ? 423 TRP B CZ2 1 
ATOM   2914  C  CZ3 . TRP B  2  267 ? -21.975 -10.429 229.129  1.00 38.96  ? 423 TRP B CZ3 1 
ATOM   2915  C  CH2 . TRP B  2  267 ? -21.839 -10.506 230.523  1.00 45.45  ? 423 TRP B CH2 1 
ATOM   2916  N  N   . TYR B  2  268 ? -17.295 -14.136 224.604  1.00 42.74  ? 424 TYR B N   1 
ATOM   2917  C  CA  . TYR B  2  268 ? -16.885 -14.579 223.285  1.00 49.98  ? 424 TYR B CA  1 
ATOM   2918  C  C   . TYR B  2  268 ? -16.920 -16.092 223.180  1.00 55.79  ? 424 TYR B C   1 
ATOM   2919  O  O   . TYR B  2  268 ? -16.443 -16.793 224.071  1.00 58.35  ? 424 TYR B O   1 
ATOM   2920  C  CB  . TYR B  2  268 ? -15.460 -14.118 222.984  1.00 54.20  ? 424 TYR B CB  1 
ATOM   2921  C  CG  . TYR B  2  268 ? -15.325 -12.653 222.679  1.00 54.00  ? 424 TYR B CG  1 
ATOM   2922  C  CD1 . TYR B  2  268 ? -16.027 -12.073 221.623  1.00 47.70  ? 424 TYR B CD1 1 
ATOM   2923  C  CD2 . TYR B  2  268 ? -14.485 -11.848 223.433  1.00 57.34  ? 424 TYR B CD2 1 
ATOM   2924  C  CE1 . TYR B  2  268 ? -15.895 -10.733 221.330  1.00 42.04  ? 424 TYR B CE1 1 
ATOM   2925  C  CE2 . TYR B  2  268 ? -14.343 -10.501 223.146  1.00 55.73  ? 424 TYR B CE2 1 
ATOM   2926  C  CZ  . TYR B  2  268 ? -15.051 -9.951  222.097  1.00 54.10  ? 424 TYR B CZ  1 
ATOM   2927  O  OH  . TYR B  2  268 ? -14.923 -8.610  221.821  1.00 69.55  ? 424 TYR B OH  1 
ATOM   2928  N  N   . ASN B  2  269 ? -17.462 -16.575 222.068  1.00 51.58  ? 425 ASN B N   1 
ATOM   2929  C  CA  . ASN B  2  269 ? -17.574 -17.997 221.778  1.00 58.51  ? 425 ASN B CA  1 
ATOM   2930  C  C   . ASN B  2  269 ? -17.134 -18.166 220.357  1.00 59.40  ? 425 ASN B C   1 
ATOM   2931  O  O   . ASN B  2  269 ? -17.939 -17.971 219.441  1.00 64.54  ? 425 ASN B O   1 
ATOM   2932  C  CB  . ASN B  2  269 ? -19.027 -18.444 221.870  1.00 69.64  ? 425 ASN B CB  1 
ATOM   2933  C  CG  . ASN B  2  269 ? -19.326 -19.638 220.983  1.00 64.31  ? 425 ASN B CG  1 
ATOM   2934  O  OD1 . ASN B  2  269 ? -18.587 -20.626 220.982  1.00 69.52  ? 425 ASN B OD1 1 
ATOM   2935  N  ND2 . ASN B  2  269 ? -20.412 -19.552 220.222  1.00 56.09  ? 425 ASN B ND2 1 
ATOM   2936  N  N   . ARG B  2  270 ? -15.881 -18.541 220.139  1.00 64.64  ? 426 ARG B N   1 
ATOM   2937  C  CA  . ARG B  2  270 ? -15.422 -18.659 218.749  1.00 71.30  ? 426 ARG B CA  1 
ATOM   2938  C  C   . ARG B  2  270 ? -15.787 -17.308 218.106  1.00 65.40  ? 426 ARG B C   1 
ATOM   2939  O  O   . ARG B  2  270 ? -16.105 -17.195 216.917  1.00 50.86  ? 426 ARG B O   1 
ATOM   2940  C  CB  . ARG B  2  270 ? -16.151 -19.784 218.036  1.00 65.69  ? 426 ARG B CB  1 
ATOM   2941  C  CG  . ARG B  2  270 ? -15.537 -20.131 216.711  1.00 68.16  ? 426 ARG B CG  1 
ATOM   2942  C  CD  . ARG B  2  270 ? -14.465 -21.176 216.862  1.00 55.23  ? 426 ARG B CD  1 
ATOM   2943  N  NE  . ARG B  2  270 ? -13.813 -21.415 215.586  1.00 53.49  ? 426 ARG B NE  1 
ATOM   2944  C  CZ  . ARG B  2  270 ? -12.779 -22.229 215.429  1.00 50.59  ? 426 ARG B CZ  1 
ATOM   2945  N  NH1 . ARG B  2  270 ? -12.301 -22.890 216.471  1.00 53.89  ? 426 ARG B NH1 1 
ATOM   2946  N  NH2 . ARG B  2  270 ? -12.179 -22.331 214.252  1.00 31.86  ? 426 ARG B NH2 1 
ATOM   2947  N  N   . CYS B  2  271 ? -15.765 -16.314 218.994  1.00 69.48  ? 427 CYS B N   1 
ATOM   2948  C  CA  . CYS B  2  271 ? -16.030 -14.907 218.776  1.00 46.69  ? 427 CYS B CA  1 
ATOM   2949  C  C   . CYS B  2  271 ? -17.449 -14.400 218.946  1.00 48.37  ? 427 CYS B C   1 
ATOM   2950  O  O   . CYS B  2  271 ? -17.944 -14.447 220.063  1.00 55.34  ? 427 CYS B O   1 
ATOM   2951  C  CB  . CYS B  2  271 ? -15.393 -14.461 217.486  1.00 43.81  ? 427 CYS B CB  1 
ATOM   2952  S  SG  . CYS B  2  271 ? -13.567 -14.506 217.635  1.00 40.55  ? 427 CYS B SG  1 
ATOM   2953  N  N   . HIS B  2  272 ? -18.146 -13.933 217.917  1.00 47.57  ? 428 HIS B N   1 
ATOM   2954  C  CA  . HIS B  2  272 ? -19.466 -13.389 218.252  1.00 48.26  ? 428 HIS B CA  1 
ATOM   2955  C  C   . HIS B  2  272 ? -20.521 -13.074 217.205  1.00 45.84  ? 428 HIS B C   1 
ATOM   2956  O  O   . HIS B  2  272 ? -20.256 -13.006 216.008  1.00 40.05  ? 428 HIS B O   1 
ATOM   2957  C  CB  . HIS B  2  272 ? -19.280 -12.083 219.017  1.00 40.77  ? 428 HIS B CB  1 
ATOM   2958  C  CG  . HIS B  2  272 ? -18.956 -10.925 218.124  1.00 48.07  ? 428 HIS B CG  1 
ATOM   2959  N  ND1 . HIS B  2  272 ? -17.669 -10.630 217.728  1.00 47.28  ? 428 HIS B ND1 1 
ATOM   2960  C  CD2 . HIS B  2  272 ? -19.759 -10.048 217.473  1.00 44.56  ? 428 HIS B CD2 1 
ATOM   2961  C  CE1 . HIS B  2  272 ? -17.693 -9.624  216.872  1.00 46.87  ? 428 HIS B CE1 1 
ATOM   2962  N  NE2 . HIS B  2  272 ? -18.949 -9.253  216.698  1.00 43.04  ? 428 HIS B NE2 1 
ATOM   2963  N  N   . ALA B  2  273 ? -21.716 -12.808 217.735  1.00 36.82  ? 429 ALA B N   1 
ATOM   2964  C  CA  . ALA B  2  273 ? -22.890 -12.394 216.984  1.00 35.41  ? 429 ALA B CA  1 
ATOM   2965  C  C   . ALA B  2  273 ? -23.119 -10.965 217.489  1.00 45.43  ? 429 ALA B C   1 
ATOM   2966  O  O   . ALA B  2  273 ? -23.390 -10.033 216.724  1.00 50.87  ? 429 ALA B O   1 
ATOM   2967  C  CB  . ALA B  2  273 ? -24.066 -13.254 217.346  1.00 34.00  ? 429 ALA B CB  1 
ATOM   2968  N  N   . ALA B  2  274 ? -23.004 -10.815 218.802  1.00 40.76  ? 430 ALA B N   1 
ATOM   2969  C  CA  . ALA B  2  274 ? -23.161 -9.528  219.464  1.00 54.08  ? 430 ALA B CA  1 
ATOM   2970  C  C   . ALA B  2  274 ? -21.815 -9.138  220.074  1.00 59.21  ? 430 ALA B C   1 
ATOM   2971  O  O   . ALA B  2  274 ? -21.097 -9.986  220.602  1.00 67.90  ? 430 ALA B O   1 
ATOM   2972  C  CB  . ALA B  2  274 ? -24.214 -9.629  220.549  1.00 53.81  ? 430 ALA B CB  1 
ATOM   2973  N  N   . ASN B  2  275 ? -21.468 -7.859  220.001  1.00 55.75  ? 431 ASN B N   1 
ATOM   2974  C  CA  . ASN B  2  275 ? -20.199 -7.406  220.545  1.00 35.93  ? 431 ASN B CA  1 
ATOM   2975  C  C   . ASN B  2  275 ? -20.234 -6.027  221.190  1.00 39.31  ? 431 ASN B C   1 
ATOM   2976  O  O   . ASN B  2  275 ? -19.481 -5.140  220.775  1.00 29.80  ? 431 ASN B O   1 
ATOM   2977  C  CB  . ASN B  2  275 ? -19.125 -7.418  219.456  1.00 33.72  ? 431 ASN B CB  1 
ATOM   2978  C  CG  . ASN B  2  275 ? -17.718 -7.140  220.003  1.00 41.31  ? 431 ASN B CG  1 
ATOM   2979  O  OD1 . ASN B  2  275 ? -17.336 -7.670  221.044  1.00 33.14  ? 431 ASN B OD1 1 
ATOM   2980  N  ND2 . ASN B  2  275 ? -16.938 -6.323  219.287  1.00 21.29  ? 431 ASN B ND2 1 
ATOM   2981  N  N   . PRO B  2  276 ? -21.129 -5.804  222.180  1.00 36.14  ? 432 PRO B N   1 
ATOM   2982  C  CA  . PRO B  2  276 ? -21.115 -4.466  222.802  1.00 33.98  ? 432 PRO B CA  1 
ATOM   2983  C  C   . PRO B  2  276 ? -19.723 -4.486  223.424  1.00 43.12  ? 432 PRO B C   1 
ATOM   2984  O  O   . PRO B  2  276 ? -19.074 -5.533  223.408  1.00 72.46  ? 432 PRO B O   1 
ATOM   2985  C  CB  . PRO B  2  276 ? -22.179 -4.558  223.891  1.00 40.97  ? 432 PRO B CB  1 
ATOM   2986  C  CG  . PRO B  2  276 ? -22.976 -5.846  223.553  1.00 43.09  ? 432 PRO B CG  1 
ATOM   2987  C  CD  . PRO B  2  276 ? -21.963 -6.751  222.944  1.00 40.12  ? 432 PRO B CD  1 
ATOM   2988  N  N   . ASN B  2  277 ? -19.240 -3.391  223.979  1.00 40.47  ? 433 ASN B N   1 
ATOM   2989  C  CA  . ASN B  2  277 ? -17.891 -3.429  224.577  1.00 44.53  ? 433 ASN B CA  1 
ATOM   2990  C  C   . ASN B  2  277 ? -16.780 -3.386  223.533  1.00 35.15  ? 433 ASN B C   1 
ATOM   2991  O  O   . ASN B  2  277 ? -15.593 -3.411  223.887  1.00 41.48  ? 433 ASN B O   1 
ATOM   2992  C  CB  . ASN B  2  277 ? -17.680 -4.689  225.439  1.00 22.83  ? 433 ASN B CB  1 
ATOM   2993  C  CG  . ASN B  2  277 ? -18.553 -4.718  226.658  1.00 27.75  ? 433 ASN B CG  1 
ATOM   2994  O  OD1 . ASN B  2  277 ? -19.398 -3.850  226.858  1.00 51.50  ? 433 ASN B OD1 1 
ATOM   2995  N  ND2 . ASN B  2  277 ? -18.358 -5.726  227.490  1.00 40.40  ? 433 ASN B ND2 1 
ATOM   2996  N  N   . GLY B  2  278 ? -17.158 -3.333  222.257  1.00 23.18  ? 434 GLY B N   1 
ATOM   2997  C  CA  . GLY B  2  278 ? -16.156 -3.265  221.201  1.00 29.77  ? 434 GLY B CA  1 
ATOM   2998  C  C   . GLY B  2  278 ? -15.768 -1.831  220.900  1.00 29.56  ? 434 GLY B C   1 
ATOM   2999  O  O   . GLY B  2  278 ? -16.264 -0.899  221.547  1.00 30.34  ? 434 GLY B O   1 
ATOM   3000  N  N   . ARG B  2  279 ? -14.889 -1.644  219.922  1.00 35.47  ? 435 ARG B N   1 
ATOM   3001  C  CA  . ARG B  2  279 ? -14.460 -0.303  219.525  1.00 34.05  ? 435 ARG B CA  1 
ATOM   3002  C  C   . ARG B  2  279 ? -15.649 0.569   219.105  1.00 42.38  ? 435 ARG B C   1 
ATOM   3003  O  O   . ARG B  2  279 ? -16.560 0.115   218.418  1.00 44.60  ? 435 ARG B O   1 
ATOM   3004  C  CB  . ARG B  2  279 ? -13.439 -0.394  218.390  1.00 48.17  ? 435 ARG B CB  1 
ATOM   3005  C  CG  . ARG B  2  279 ? -12.002 -0.613  218.885  1.00 59.08  ? 435 ARG B CG  1 
ATOM   3006  C  CD  . ARG B  2  279 ? -11.071 -1.157  217.801  1.00 74.53  ? 435 ARG B CD  1 
ATOM   3007  N  NE  . ARG B  2  279 ? -10.831 -0.238  216.689  1.00 76.63  ? 435 ARG B NE  1 
ATOM   3008  C  CZ  . ARG B  2  279 ? -9.773  0.560   216.593  1.00 83.43  ? 435 ARG B CZ  1 
ATOM   3009  N  NH1 . ARG B  2  279 ? -8.850  0.561   217.549  1.00 80.85  ? 435 ARG B NH1 1 
ATOM   3010  N  NH2 . ARG B  2  279 ? -9.624  1.336   215.525  1.00 74.62  ? 435 ARG B NH2 1 
ATOM   3011  N  N   . TYR B  2  280 ? -15.647 1.824   219.542  1.00 46.26  ? 436 TYR B N   1 
ATOM   3012  C  CA  . TYR B  2  280 ? -16.733 2.740   219.213  1.00 38.01  ? 436 TYR B CA  1 
ATOM   3013  C  C   . TYR B  2  280 ? -16.436 3.517   217.943  1.00 48.74  ? 436 TYR B C   1 
ATOM   3014  O  O   . TYR B  2  280 ? -15.961 4.649   218.010  1.00 46.18  ? 436 TYR B O   1 
ATOM   3015  C  CB  . TYR B  2  280 ? -16.938 3.738   220.332  1.00 37.59  ? 436 TYR B CB  1 
ATOM   3016  C  CG  . TYR B  2  280 ? -18.224 4.524   220.233  1.00 39.26  ? 436 TYR B CG  1 
ATOM   3017  C  CD1 . TYR B  2  280 ? -19.419 4.002   220.716  1.00 40.08  ? 436 TYR B CD1 1 
ATOM   3018  C  CD2 . TYR B  2  280 ? -18.249 5.785   219.648  1.00 36.35  ? 436 TYR B CD2 1 
ATOM   3019  C  CE1 . TYR B  2  280 ? -20.612 4.718   220.620  1.00 46.78  ? 436 TYR B CE1 1 
ATOM   3020  C  CE2 . TYR B  2  280 ? -19.442 6.509   219.547  1.00 40.36  ? 436 TYR B CE2 1 
ATOM   3021  C  CZ  . TYR B  2  280 ? -20.618 5.964   220.036  1.00 40.47  ? 436 TYR B CZ  1 
ATOM   3022  O  OH  . TYR B  2  280 ? -21.805 6.645   219.935  1.00 44.73  ? 436 TYR B OH  1 
ATOM   3023  N  N   . TYR B  2  281 ? -16.704 2.905   216.789  1.00 55.12  ? 437 TYR B N   1 
ATOM   3024  C  CA  . TYR B  2  281 ? -16.474 3.559   215.509  1.00 44.52  ? 437 TYR B CA  1 
ATOM   3025  C  C   . TYR B  2  281 ? -17.543 4.608   215.355  1.00 48.72  ? 437 TYR B C   1 
ATOM   3026  O  O   . TYR B  2  281 ? -18.713 4.355   215.669  1.00 47.36  ? 437 TYR B O   1 
ATOM   3027  C  CB  . TYR B  2  281 ? -16.579 2.579   214.344  1.00 34.87  ? 437 TYR B CB  1 
ATOM   3028  C  CG  . TYR B  2  281 ? -15.452 1.591   214.250  1.00 39.23  ? 437 TYR B CG  1 
ATOM   3029  C  CD1 . TYR B  2  281 ? -15.606 0.279   214.711  1.00 44.53  ? 437 TYR B CD1 1 
ATOM   3030  C  CD2 . TYR B  2  281 ? -14.224 1.964   213.708  1.00 26.90  ? 437 TYR B CD2 1 
ATOM   3031  C  CE1 . TYR B  2  281 ? -14.561 -0.638  214.633  1.00 32.95  ? 437 TYR B CE1 1 
ATOM   3032  C  CE2 . TYR B  2  281 ? -13.170 1.060   213.628  1.00 49.50  ? 437 TYR B CE2 1 
ATOM   3033  C  CZ  . TYR B  2  281 ? -13.345 -0.241  214.094  1.00 53.16  ? 437 TYR B CZ  1 
ATOM   3034  O  OH  . TYR B  2  281 ? -12.292 -1.130  214.044  1.00 59.70  ? 437 TYR B OH  1 
ATOM   3035  N  N   . TRP B  2  282 ? -17.138 5.776   214.863  1.00 47.33  ? 438 TRP B N   1 
ATOM   3036  C  CA  . TRP B  2  282 ? -18.057 6.887   214.680  1.00 56.92  ? 438 TRP B CA  1 
ATOM   3037  C  C   . TRP B  2  282 ? -18.773 6.817   213.343  1.00 63.39  ? 438 TRP B C   1 
ATOM   3038  O  O   . TRP B  2  282 ? -18.166 6.476   212.331  1.00 66.01  ? 438 TRP B O   1 
ATOM   3039  C  CB  . TRP B  2  282 ? -17.301 8.213   214.781  1.00 66.90  ? 438 TRP B CB  1 
ATOM   3040  C  CG  . TRP B  2  282 ? -18.220 9.393   214.822  1.00 75.62  ? 438 TRP B CG  1 
ATOM   3041  C  CD1 . TRP B  2  282 ? -18.829 9.997   213.759  1.00 78.03  ? 438 TRP B CD1 1 
ATOM   3042  C  CD2 . TRP B  2  282 ? -18.725 10.042  215.997  1.00 71.09  ? 438 TRP B CD2 1 
ATOM   3043  N  NE1 . TRP B  2  282 ? -19.688 10.974  214.200  1.00 73.38  ? 438 TRP B NE1 1 
ATOM   3044  C  CE2 . TRP B  2  282 ? -19.645 11.022  215.568  1.00 66.75  ? 438 TRP B CE2 1 
ATOM   3045  C  CE3 . TRP B  2  282 ? -18.494 9.884   217.372  1.00 68.36  ? 438 TRP B CE3 1 
ATOM   3046  C  CZ2 . TRP B  2  282 ? -20.336 11.841  216.465  1.00 74.00  ? 438 TRP B CZ2 1 
ATOM   3047  C  CZ3 . TRP B  2  282 ? -19.183 10.698  218.263  1.00 69.61  ? 438 TRP B CZ3 1 
ATOM   3048  C  CH2 . TRP B  2  282 ? -20.094 11.664  217.804  1.00 68.97  ? 438 TRP B CH2 1 
ATOM   3049  N  N   . GLY B  2  283 ? -20.067 7.126   213.338  1.00 60.20  ? 439 GLY B N   1 
ATOM   3050  C  CA  . GLY B  2  283 ? -20.801 7.102   212.090  1.00 68.65  ? 439 GLY B CA  1 
ATOM   3051  C  C   . GLY B  2  283 ? -21.382 5.773   211.652  1.00 73.48  ? 439 GLY B C   1 
ATOM   3052  O  O   . GLY B  2  283 ? -21.920 5.661   210.551  1.00 84.36  ? 439 GLY B O   1 
ATOM   3053  N  N   . GLY B  2  284 ? -21.269 4.753   212.487  1.00 71.08  ? 440 GLY B N   1 
ATOM   3054  C  CA  . GLY B  2  284 ? -21.843 3.474   212.115  1.00 67.41  ? 440 GLY B CA  1 
ATOM   3055  C  C   . GLY B  2  284 ? -21.007 2.504   211.301  1.00 62.73  ? 440 GLY B C   1 
ATOM   3056  O  O   . GLY B  2  284 ? -20.512 1.513   211.844  1.00 65.02  ? 440 GLY B O   1 
ATOM   3057  N  N   . ILE B  2  285 ? -20.842 2.766   210.009  1.00 57.27  ? 441 ILE B N   1 
ATOM   3058  C  CA  . ILE B  2  285 ? -20.079 1.835   209.183  1.00 62.20  ? 441 ILE B CA  1 
ATOM   3059  C  C   . ILE B  2  285 ? -18.562 1.952   209.325  1.00 54.18  ? 441 ILE B C   1 
ATOM   3060  O  O   . ILE B  2  285 ? -18.006 3.030   209.526  1.00 49.06  ? 441 ILE B O   1 
ATOM   3061  C  CB  . ILE B  2  285 ? -20.478 1.926   207.653  1.00 59.29  ? 441 ILE B CB  1 
ATOM   3062  C  CG1 . ILE B  2  285 ? -19.755 3.074   206.962  1.00 64.87  ? 441 ILE B CG1 1 
ATOM   3063  C  CG2 . ILE B  2  285 ? -21.974 2.116   207.506  1.00 42.27  ? 441 ILE B CG2 1 
ATOM   3064  C  CD1 . ILE B  2  285 ? -18.404 2.689   206.373  1.00 75.93  ? 441 ILE B CD1 1 
ATOM   3065  N  N   . TYR B  2  286 ? -17.907 0.806   209.236  1.00 47.26  ? 442 TYR B N   1 
ATOM   3066  C  CA  . TYR B  2  286 ? -16.465 0.729   209.327  1.00 46.89  ? 442 TYR B CA  1 
ATOM   3067  C  C   . TYR B  2  286 ? -16.087 -0.475  208.493  1.00 45.58  ? 442 TYR B C   1 
ATOM   3068  O  O   . TYR B  2  286 ? -16.906 -1.354  208.269  1.00 45.33  ? 442 TYR B O   1 
ATOM   3069  C  CB  . TYR B  2  286 ? -15.992 0.567   210.789  1.00 61.33  ? 442 TYR B CB  1 
ATOM   3070  C  CG  . TYR B  2  286 ? -16.389 -0.724  211.493  1.00 53.79  ? 442 TYR B CG  1 
ATOM   3071  C  CD1 . TYR B  2  286 ? -17.683 -0.908  211.993  1.00 57.55  ? 442 TYR B CD1 1 
ATOM   3072  C  CD2 . TYR B  2  286 ? -15.470 -1.765  211.645  1.00 35.14  ? 442 TYR B CD2 1 
ATOM   3073  C  CE1 . TYR B  2  286 ? -18.052 -2.098  212.628  1.00 38.74  ? 442 TYR B CE1 1 
ATOM   3074  C  CE2 . TYR B  2  286 ? -15.823 -2.950  212.269  1.00 27.14  ? 442 TYR B CE2 1 
ATOM   3075  C  CZ  . TYR B  2  286 ? -17.112 -3.114  212.761  1.00 41.76  ? 442 TYR B CZ  1 
ATOM   3076  O  OH  . TYR B  2  286 ? -17.445 -4.288  213.401  1.00 34.10  ? 442 TYR B OH  1 
ATOM   3077  N  N   . THR B  2  287 ? -14.846 -0.515  208.034  1.00 52.37  ? 443 THR B N   1 
ATOM   3078  C  CA  . THR B  2  287 ? -14.391 -1.591  207.176  1.00 49.68  ? 443 THR B CA  1 
ATOM   3079  C  C   . THR B  2  287 ? -13.294 -2.458  207.755  1.00 55.63  ? 443 THR B C   1 
ATOM   3080  O  O   . THR B  2  287 ? -12.542 -2.041  208.632  1.00 46.14  ? 443 THR B O   1 
ATOM   3081  C  CB  . THR B  2  287 ? -13.863 -1.032  205.855  1.00 53.50  ? 443 THR B CB  1 
ATOM   3082  O  OG1 . THR B  2  287 ? -12.601 -0.389  206.079  1.00 50.32  ? 443 THR B OG1 1 
ATOM   3083  C  CG2 . THR B  2  287 ? -14.844 -0.016  205.290  1.00 60.69  ? 443 THR B CG2 1 
ATOM   3084  N  N   . LYS B  2  288 ? -13.205 -3.672  207.226  1.00 67.40  ? 444 LYS B N   1 
ATOM   3085  C  CA  . LYS B  2  288 ? -12.192 -4.628  207.638  1.00 71.39  ? 444 LYS B CA  1 
ATOM   3086  C  C   . LYS B  2  288 ? -10.828 -3.944  207.572  1.00 67.73  ? 444 LYS B C   1 
ATOM   3087  O  O   . LYS B  2  288 ? -9.916  -4.263  208.331  1.00 64.00  ? 444 LYS B O   1 
ATOM   3088  C  CB  . LYS B  2  288 ? -12.233 -5.838  206.697  1.00 79.85  ? 444 LYS B CB  1 
ATOM   3089  C  CG  . LYS B  2  288 ? -11.166 -6.905  206.944  1.00 85.74  ? 444 LYS B CG  1 
ATOM   3090  C  CD  . LYS B  2  288 ? -11.369 -8.106  206.018  1.00 92.57  ? 444 LYS B CD  1 
ATOM   3091  C  CE  . LYS B  2  288 ? -12.753 -8.746  206.227  1.00 93.46  ? 444 LYS B CE  1 
ATOM   3092  N  NZ  . LYS B  2  288 ? -13.042 -9.893  205.311  1.00 80.76  ? 444 LYS B NZ  1 
ATOM   3093  N  N   . GLU B  2  289 ? -10.702 -2.989  206.660  1.00 73.37  ? 445 GLU B N   1 
ATOM   3094  C  CA  . GLU B  2  289 ? -9.450  -2.261  206.487  1.00 75.38  ? 445 GLU B CA  1 
ATOM   3095  C  C   . GLU B  2  289 ? -9.126  -1.377  207.694  1.00 68.25  ? 445 GLU B C   1 
ATOM   3096  O  O   . GLU B  2  289 ? -7.964  -1.141  208.005  1.00 60.65  ? 445 GLU B O   1 
ATOM   3097  C  CB  . GLU B  2  289 ? -9.519  -1.402  205.217  1.00 77.78  ? 445 GLU B CB  1 
ATOM   3098  C  CG  . GLU B  2  289 ? -9.561  -2.188  203.908  1.00 78.70  ? 445 GLU B CG  1 
ATOM   3099  C  CD  . GLU B  2  289 ? -10.795 -3.073  203.765  1.00 88.55  ? 445 GLU B CD  1 
ATOM   3100  O  OE1 . GLU B  2  289 ? -11.929 -2.544  203.785  1.00 83.62  ? 445 GLU B OE1 1 
ATOM   3101  O  OE2 . GLU B  2  289 ? -10.625 -4.305  203.626  1.00 93.96  ? 445 GLU B OE2 1 
ATOM   3102  N  N   . GLN B  2  290 ? -10.163 -0.910  208.379  1.00 67.78  ? 446 GLN B N   1 
ATOM   3103  C  CA  . GLN B  2  290 ? -9.995  -0.043  209.537  1.00 67.20  ? 446 GLN B CA  1 
ATOM   3104  C  C   . GLN B  2  290 ? -9.808  -0.811  210.845  1.00 73.28  ? 446 GLN B C   1 
ATOM   3105  O  O   . GLN B  2  290 ? -9.095  -0.350  211.741  1.00 80.22  ? 446 GLN B O   1 
ATOM   3106  C  CB  . GLN B  2  290 ? -11.208 0.876   209.669  1.00 50.92  ? 446 GLN B CB  1 
ATOM   3107  C  CG  . GLN B  2  290 ? -11.693 1.414   208.356  1.00 49.97  ? 446 GLN B CG  1 
ATOM   3108  C  CD  . GLN B  2  290 ? -12.795 2.423   208.523  1.00 47.73  ? 446 GLN B CD  1 
ATOM   3109  O  OE1 . GLN B  2  290 ? -13.875 2.115   209.028  1.00 48.38  ? 446 GLN B OE1 1 
ATOM   3110  N  NE2 . GLN B  2  290 ? -12.527 3.647   208.103  1.00 58.94  ? 446 GLN B NE2 1 
ATOM   3111  N  N   . ALA B  2  291 ? -10.462 -1.969  210.955  1.00 64.20  ? 447 ALA B N   1 
ATOM   3112  C  CA  . ALA B  2  291 ? -10.390 -2.793  212.157  1.00 58.51  ? 447 ALA B CA  1 
ATOM   3113  C  C   . ALA B  2  291 ? -8.953  -3.059  212.532  1.00 57.64  ? 447 ALA B C   1 
ATOM   3114  O  O   . ALA B  2  291 ? -8.142  -3.386  211.680  1.00 55.35  ? 447 ALA B O   1 
ATOM   3115  C  CB  . ALA B  2  291 ? -11.109 -4.093  211.937  1.00 70.11  ? 447 ALA B CB  1 
ATOM   3116  N  N   . ASP B  2  292 ? -8.643  -2.928  213.814  1.00 62.42  ? 448 ASP B N   1 
ATOM   3117  C  CA  . ASP B  2  292 ? -7.286  -3.129  214.292  1.00 59.63  ? 448 ASP B CA  1 
ATOM   3118  C  C   . ASP B  2  292 ? -6.718  -4.505  213.923  1.00 61.80  ? 448 ASP B C   1 
ATOM   3119  O  O   . ASP B  2  292 ? -5.518  -4.641  213.682  1.00 64.26  ? 448 ASP B O   1 
ATOM   3120  C  CB  . ASP B  2  292 ? -7.246  -2.909  215.802  1.00 65.67  ? 448 ASP B CB  1 
ATOM   3121  C  CG  . ASP B  2  292 ? -5.905  -2.423  216.278  1.00 82.17  ? 448 ASP B CG  1 
ATOM   3122  O  OD1 . ASP B  2  292 ? -5.839  -1.925  217.421  1.00 97.11  ? 448 ASP B OD1 1 
ATOM   3123  O  OD2 . ASP B  2  292 ? -4.918  -2.540  215.516  1.00 86.37  ? 448 ASP B OD2 1 
ATOM   3124  N  N   . TYR B  2  293 ? -7.572  -5.523  213.866  1.00 56.17  ? 449 TYR B N   1 
ATOM   3125  C  CA  . TYR B  2  293 ? -7.111  -6.860  213.506  1.00 59.02  ? 449 TYR B CA  1 
ATOM   3126  C  C   . TYR B  2  293 ? -7.864  -7.415  212.299  1.00 62.71  ? 449 TYR B C   1 
ATOM   3127  O  O   . TYR B  2  293 ? -7.903  -8.626  212.079  1.00 63.29  ? 449 TYR B O   1 
ATOM   3128  C  CB  . TYR B  2  293 ? -7.263  -7.827  214.689  1.00 61.30  ? 449 TYR B CB  1 
ATOM   3129  C  CG  . TYR B  2  293 ? -6.253  -7.609  215.782  1.00 63.44  ? 449 TYR B CG  1 
ATOM   3130  C  CD1 . TYR B  2  293 ? -6.572  -6.880  216.931  1.00 66.71  ? 449 TYR B CD1 1 
ATOM   3131  C  CD2 . TYR B  2  293 ? -4.956  -8.083  215.647  1.00 65.48  ? 449 TYR B CD2 1 
ATOM   3132  C  CE1 . TYR B  2  293 ? -5.613  -6.627  217.919  1.00 59.51  ? 449 TYR B CE1 1 
ATOM   3133  C  CE2 . TYR B  2  293 ? -3.991  -7.833  216.624  1.00 68.56  ? 449 TYR B CE2 1 
ATOM   3134  C  CZ  . TYR B  2  293 ? -4.324  -7.107  217.753  1.00 62.89  ? 449 TYR B CZ  1 
ATOM   3135  O  OH  . TYR B  2  293 ? -3.355  -6.860  218.695  1.00 54.10  ? 449 TYR B OH  1 
ATOM   3136  N  N   . GLY B  2  294 ? -8.465  -6.528  211.517  1.00 59.40  ? 450 GLY B N   1 
ATOM   3137  C  CA  . GLY B  2  294 ? -9.199  -6.975  210.353  1.00 55.30  ? 450 GLY B CA  1 
ATOM   3138  C  C   . GLY B  2  294 ? -10.434 -7.774  210.717  1.00 56.26  ? 450 GLY B C   1 
ATOM   3139  O  O   . GLY B  2  294 ? -11.039 -8.421  209.863  1.00 60.28  ? 450 GLY B O   1 
ATOM   3140  N  N   . THR B  2  295 ? -10.817 -7.742  211.986  1.00 49.80  ? 451 THR B N   1 
ATOM   3141  C  CA  . THR B  2  295 ? -12.008 -8.471  212.409  1.00 55.19  ? 451 THR B CA  1 
ATOM   3142  C  C   . THR B  2  295 ? -13.146 -7.503  212.641  1.00 46.22  ? 451 THR B C   1 
ATOM   3143  O  O   . THR B  2  295 ? -12.959 -6.287  212.581  1.00 54.18  ? 451 THR B O   1 
ATOM   3144  C  CB  . THR B  2  295 ? -11.768 -9.262  213.702  1.00 59.69  ? 451 THR B CB  1 
ATOM   3145  O  OG1 . THR B  2  295 ? -11.526 -8.354  214.787  1.00 68.44  ? 451 THR B OG1 1 
ATOM   3146  C  CG2 . THR B  2  295 ? -10.572 -10.189 213.523  1.00 59.89  ? 451 THR B CG2 1 
ATOM   3147  N  N   . ASP B  2  296 ? -14.333 -8.032  212.902  1.00 38.21  ? 452 ASP B N   1 
ATOM   3148  C  CA  . ASP B  2  296 ? -15.461 -7.150  213.129  1.00 45.72  ? 452 ASP B CA  1 
ATOM   3149  C  C   . ASP B  2  296 ? -15.560 -6.685  214.583  1.00 52.14  ? 452 ASP B C   1 
ATOM   3150  O  O   . ASP B  2  296 ? -16.539 -6.983  215.281  1.00 50.75  ? 452 ASP B O   1 
ATOM   3151  C  CB  . ASP B  2  296 ? -16.767 -7.807  212.648  1.00 39.51  ? 452 ASP B CB  1 
ATOM   3152  C  CG  . ASP B  2  296 ? -17.002 -9.176  213.249  1.00 47.35  ? 452 ASP B CG  1 
ATOM   3153  O  OD1 . ASP B  2  296 ? -16.043 -9.979  213.316  1.00 48.00  ? 452 ASP B OD1 1 
ATOM   3154  O  OD2 . ASP B  2  296 ? -18.160 -9.451  213.639  1.00 57.08  ? 452 ASP B OD2 1 
ATOM   3155  N  N   . ASP B  2  297 ? -14.520 -5.970  215.039  1.00 58.79  ? 453 ASP B N   1 
ATOM   3156  C  CA  . ASP B  2  297 ? -14.500 -5.409  216.394  1.00 47.60  ? 453 ASP B CA  1 
ATOM   3157  C  C   . ASP B  2  297 ? -15.359 -4.176  216.270  1.00 45.70  ? 453 ASP B C   1 
ATOM   3158  O  O   . ASP B  2  297 ? -15.448 -3.588  215.206  1.00 56.45  ? 453 ASP B O   1 
ATOM   3159  C  CB  . ASP B  2  297 ? -13.092 -5.014  216.850  1.00 26.11  ? 453 ASP B CB  1 
ATOM   3160  C  CG  . ASP B  2  297 ? -12.389 -4.066  215.884  1.00 47.27  ? 453 ASP B CG  1 
ATOM   3161  O  OD1 . ASP B  2  297 ? -13.061 -3.192  215.313  1.00 50.58  ? 453 ASP B OD1 1 
ATOM   3162  O  OD2 . ASP B  2  297 ? -11.151 -4.172  215.712  1.00 41.80  ? 453 ASP B OD2 1 
ATOM   3163  N  N   . GLY B  2  298 ? -16.011 -3.780  217.339  1.00 47.36  ? 454 GLY B N   1 
ATOM   3164  C  CA  . GLY B  2  298 ? -16.868 -2.627  217.221  1.00 45.47  ? 454 GLY B CA  1 
ATOM   3165  C  C   . GLY B  2  298 ? -18.146 -2.968  217.928  1.00 45.16  ? 454 GLY B C   1 
ATOM   3166  O  O   . GLY B  2  298 ? -18.356 -4.122  218.299  1.00 49.80  ? 454 GLY B O   1 
ATOM   3167  N  N   . VAL B  2  299 ? -19.003 -1.981  218.124  1.00 45.60  ? 455 VAL B N   1 
ATOM   3168  C  CA  . VAL B  2  299 ? -20.239 -2.234  218.829  1.00 47.72  ? 455 VAL B CA  1 
ATOM   3169  C  C   . VAL B  2  299 ? -21.213 -2.869  217.878  1.00 50.45  ? 455 VAL B C   1 
ATOM   3170  O  O   . VAL B  2  299 ? -22.144 -2.232  217.412  1.00 58.77  ? 455 VAL B O   1 
ATOM   3171  C  CB  . VAL B  2  299 ? -20.773 -0.948  219.398  1.00 43.38  ? 455 VAL B CB  1 
ATOM   3172  C  CG1 . VAL B  2  299 ? -21.931 -1.228  220.331  1.00 48.01  ? 455 VAL B CG1 1 
ATOM   3173  C  CG2 . VAL B  2  299 ? -19.626 -0.236  220.120  1.00 34.75  ? 455 VAL B CG2 1 
ATOM   3174  N  N   . VAL B  2  300 ? -20.965 -4.152  217.619  1.00 55.14  ? 456 VAL B N   1 
ATOM   3175  C  CA  . VAL B  2  300 ? -21.728 -4.985  216.694  1.00 52.60  ? 456 VAL B CA  1 
ATOM   3176  C  C   . VAL B  2  300 ? -22.888 -5.780  217.263  1.00 50.74  ? 456 VAL B C   1 
ATOM   3177  O  O   . VAL B  2  300 ? -22.862 -6.236  218.390  1.00 57.27  ? 456 VAL B O   1 
ATOM   3178  C  CB  . VAL B  2  300 ? -20.803 -6.016  216.012  1.00 59.13  ? 456 VAL B CB  1 
ATOM   3179  C  CG1 . VAL B  2  300 ? -21.625 -7.028  215.218  1.00 49.33  ? 456 VAL B CG1 1 
ATOM   3180  C  CG2 . VAL B  2  300 ? -19.794 -5.307  215.118  1.00 58.36  ? 456 VAL B CG2 1 
ATOM   3181  N  N   . TRP B  2  301 ? -23.912 -5.945  216.445  1.00 57.87  ? 457 TRP B N   1 
ATOM   3182  C  CA  . TRP B  2  301 ? -25.058 -6.750  216.810  1.00 56.41  ? 457 TRP B CA  1 
ATOM   3183  C  C   . TRP B  2  301 ? -25.526 -7.258  215.462  1.00 58.02  ? 457 TRP B C   1 
ATOM   3184  O  O   . TRP B  2  301 ? -26.564 -6.846  214.944  1.00 55.81  ? 457 TRP B O   1 
ATOM   3185  C  CB  . TRP B  2  301 ? -26.144 -5.927  217.489  1.00 45.80  ? 457 TRP B CB  1 
ATOM   3186  C  CG  . TRP B  2  301 ? -27.206 -6.798  218.072  1.00 46.82  ? 457 TRP B CG  1 
ATOM   3187  C  CD1 . TRP B  2  301 ? -28.260 -7.372  217.417  1.00 47.57  ? 457 TRP B CD1 1 
ATOM   3188  C  CD2 . TRP B  2  301 ? -27.281 -7.255  219.424  1.00 57.72  ? 457 TRP B CD2 1 
ATOM   3189  N  NE1 . TRP B  2  301 ? -28.987 -8.159  218.283  1.00 42.28  ? 457 TRP B NE1 1 
ATOM   3190  C  CE2 . TRP B  2  301 ? -28.407 -8.105  219.519  1.00 47.27  ? 457 TRP B CE2 1 
ATOM   3191  C  CE3 . TRP B  2  301 ? -26.503 -7.028  220.568  1.00 55.08  ? 457 TRP B CE3 1 
ATOM   3192  C  CZ2 . TRP B  2  301 ? -28.771 -8.726  220.708  1.00 49.61  ? 457 TRP B CZ2 1 
ATOM   3193  C  CZ3 . TRP B  2  301 ? -26.867 -7.644  221.749  1.00 43.20  ? 457 TRP B CZ3 1 
ATOM   3194  C  CH2 . TRP B  2  301 ? -27.992 -8.485  221.810  1.00 55.91  ? 457 TRP B CH2 1 
ATOM   3195  N  N   . MET B  2  302 ? -24.714 -8.144  214.894  1.00 57.80  ? 458 MET B N   1 
ATOM   3196  C  CA  . MET B  2  302 ? -24.963 -8.727  213.582  1.00 54.19  ? 458 MET B CA  1 
ATOM   3197  C  C   . MET B  2  302 ? -26.427 -8.921  213.247  1.00 47.76  ? 458 MET B C   1 
ATOM   3198  O  O   . MET B  2  302 ? -26.895 -8.441  212.216  1.00 42.48  ? 458 MET B O   1 
ATOM   3199  C  CB  . MET B  2  302 ? -24.215 -10.052 213.450  1.00 51.99  ? 458 MET B CB  1 
ATOM   3200  C  CG  . MET B  2  302 ? -22.716 -9.879  213.337  1.00 43.77  ? 458 MET B CG  1 
ATOM   3201  S  SD  . MET B  2  302 ? -21.868 -11.445 213.455  1.00 44.54  ? 458 MET B SD  1 
ATOM   3202  C  CE  . MET B  2  302 ? -21.727 -11.849 211.814  1.00 45.33  ? 458 MET B CE  1 
ATOM   3203  N  N   . ASN B  2  303 ? -27.150 -9.606  214.122  1.00 39.83  ? 459 ASN B N   1 
ATOM   3204  C  CA  . ASN B  2  303 ? -28.562 -9.854  213.902  1.00 44.23  ? 459 ASN B CA  1 
ATOM   3205  C  C   . ASN B  2  303 ? -29.368 -8.627  213.479  1.00 53.00  ? 459 ASN B C   1 
ATOM   3206  O  O   . ASN B  2  303 ? -30.546 -8.752  213.151  1.00 57.66  ? 459 ASN B O   1 
ATOM   3207  C  CB  . ASN B  2  303 ? -29.187 -10.443 215.161  1.00 57.31  ? 459 ASN B CB  1 
ATOM   3208  C  CG  . ASN B  2  303 ? -28.664 -11.810 215.468  1.00 62.26  ? 459 ASN B CG  1 
ATOM   3209  O  OD1 . ASN B  2  303 ? -29.391 -12.799 215.389  1.00 77.24  ? 459 ASN B OD1 1 
ATOM   3210  N  ND2 . ASN B  2  303 ? -27.388 -11.885 215.811  1.00 71.21  ? 459 ASN B ND2 1 
ATOM   3211  N  N   . TRP B  2  304 ? -28.761 -7.446  213.486  1.00 52.21  ? 460 TRP B N   1 
ATOM   3212  C  CA  . TRP B  2  304 ? -29.503 -6.263  213.092  1.00 51.87  ? 460 TRP B CA  1 
ATOM   3213  C  C   . TRP B  2  304 ? -28.860 -5.459  211.978  1.00 55.28  ? 460 TRP B C   1 
ATOM   3214  O  O   . TRP B  2  304 ? -29.522 -5.101  211.010  1.00 63.91  ? 460 TRP B O   1 
ATOM   3215  C  CB  . TRP B  2  304 ? -29.727 -5.354  214.290  1.00 46.82  ? 460 TRP B CB  1 
ATOM   3216  C  CG  . TRP B  2  304 ? -30.629 -4.192  213.976  1.00 71.68  ? 460 TRP B CG  1 
ATOM   3217  C  CD1 . TRP B  2  304 ? -31.827 -4.244  213.326  1.00 67.40  ? 460 TRP B CD1 1 
ATOM   3218  C  CD2 . TRP B  2  304 ? -30.462 -2.825  214.391  1.00 80.41  ? 460 TRP B CD2 1 
ATOM   3219  N  NE1 . TRP B  2  304 ? -32.421 -3.006  213.319  1.00 65.41  ? 460 TRP B NE1 1 
ATOM   3220  C  CE2 . TRP B  2  304 ? -31.606 -2.116  213.967  1.00 77.74  ? 460 TRP B CE2 1 
ATOM   3221  C  CE3 . TRP B  2  304 ? -29.461 -2.134  215.085  1.00 82.38  ? 460 TRP B CE3 1 
ATOM   3222  C  CZ2 . TRP B  2  304 ? -31.778 -0.747  214.216  1.00 81.05  ? 460 TRP B CZ2 1 
ATOM   3223  C  CZ3 . TRP B  2  304 ? -29.635 -0.770  215.333  1.00 83.09  ? 460 TRP B CZ3 1 
ATOM   3224  C  CH2 . TRP B  2  304 ? -30.785 -0.095  214.899  1.00 79.34  ? 460 TRP B CH2 1 
ATOM   3225  N  N   . LYS B  2  305 ? -27.570 -5.178  212.109  1.00 55.49  ? 461 LYS B N   1 
ATOM   3226  C  CA  . LYS B  2  305 ? -26.859 -4.379  211.120  1.00 36.59  ? 461 LYS B CA  1 
ATOM   3227  C  C   . LYS B  2  305 ? -25.664 -5.116  210.544  1.00 41.13  ? 461 LYS B C   1 
ATOM   3228  O  O   . LYS B  2  305 ? -24.824 -4.533  209.851  1.00 34.44  ? 461 LYS B O   1 
ATOM   3229  C  CB  . LYS B  2  305 ? -26.398 -3.077  211.765  1.00 40.31  ? 461 LYS B CB  1 
ATOM   3230  C  CG  . LYS B  2  305 ? -27.531 -2.175  212.257  1.00 57.87  ? 461 LYS B CG  1 
ATOM   3231  C  CD  . LYS B  2  305 ? -28.098 -1.341  211.115  1.00 63.70  ? 461 LYS B CD  1 
ATOM   3232  C  CE  . LYS B  2  305 ? -28.973 -0.216  211.626  1.00 64.26  ? 461 LYS B CE  1 
ATOM   3233  N  NZ  . LYS B  2  305 ? -29.424 0.654   210.500  1.00 77.70  ? 461 LYS B NZ  1 
ATOM   3234  N  N   . GLY B  2  306 ? -25.590 -6.408  210.827  1.00 36.72  ? 462 GLY B N   1 
ATOM   3235  C  CA  . GLY B  2  306 ? -24.487 -7.190  210.314  1.00 42.68  ? 462 GLY B CA  1 
ATOM   3236  C  C   . GLY B  2  306 ? -23.224 -6.950  211.099  1.00 42.57  ? 462 GLY B C   1 
ATOM   3237  O  O   . GLY B  2  306 ? -23.264 -6.316  212.150  1.00 50.69  ? 462 GLY B O   1 
ATOM   3238  N  N   . SER B  2  307 ? -22.103 -7.435  210.573  1.00 40.51  ? 463 SER B N   1 
ATOM   3239  C  CA  . SER B  2  307 ? -20.815 -7.304  211.234  1.00 48.82  ? 463 SER B CA  1 
ATOM   3240  C  C   . SER B  2  307 ? -20.072 -5.984  211.153  1.00 55.92  ? 463 SER B C   1 
ATOM   3241  O  O   . SER B  2  307 ? -19.273 -5.700  212.047  1.00 57.37  ? 463 SER B O   1 
ATOM   3242  C  CB  . SER B  2  307 ? -19.862 -8.407  210.761  1.00 50.99  ? 463 SER B CB  1 
ATOM   3243  O  OG  . SER B  2  307 ? -20.047 -9.596  211.511  1.00 51.59  ? 463 SER B OG  1 
ATOM   3244  N  N   . TRP B  2  308 ? -20.315 -5.171  210.121  1.00 58.05  ? 464 TRP B N   1 
ATOM   3245  C  CA  . TRP B  2  308 ? -19.555 -3.927  209.990  1.00 47.74  ? 464 TRP B CA  1 
ATOM   3246  C  C   . TRP B  2  308 ? -20.265 -2.629  210.270  1.00 50.04  ? 464 TRP B C   1 
ATOM   3247  O  O   . TRP B  2  308 ? -20.035 -1.624  209.593  1.00 53.63  ? 464 TRP B O   1 
ATOM   3248  C  CB  . TRP B  2  308 ? -18.888 -3.855  208.613  1.00 43.19  ? 464 TRP B CB  1 
ATOM   3249  C  CG  . TRP B  2  308 ? -18.139 -5.105  208.287  1.00 53.46  ? 464 TRP B CG  1 
ATOM   3250  C  CD1 . TRP B  2  308 ? -18.621 -6.190  207.617  1.00 40.87  ? 464 TRP B CD1 1 
ATOM   3251  C  CD2 . TRP B  2  308 ? -16.815 -5.454  208.713  1.00 54.97  ? 464 TRP B CD2 1 
ATOM   3252  N  NE1 . TRP B  2  308 ? -17.686 -7.191  207.603  1.00 46.91  ? 464 TRP B NE1 1 
ATOM   3253  C  CE2 . TRP B  2  308 ? -16.567 -6.768  208.269  1.00 59.77  ? 464 TRP B CE2 1 
ATOM   3254  C  CE3 . TRP B  2  308 ? -15.819 -4.787  209.428  1.00 53.10  ? 464 TRP B CE3 1 
ATOM   3255  C  CZ2 . TRP B  2  308 ? -15.361 -7.431  208.521  1.00 59.60  ? 464 TRP B CZ2 1 
ATOM   3256  C  CZ3 . TRP B  2  308 ? -14.620 -5.449  209.678  1.00 61.26  ? 464 TRP B CZ3 1 
ATOM   3257  C  CH2 . TRP B  2  308 ? -14.403 -6.757  209.224  1.00 53.90  ? 464 TRP B CH2 1 
ATOM   3258  N  N   . TYR B  2  309 ? -21.118 -2.633  211.278  1.00 43.16  ? 465 TYR B N   1 
ATOM   3259  C  CA  . TYR B  2  309 ? -21.808 -1.411  211.634  1.00 60.14  ? 465 TYR B CA  1 
ATOM   3260  C  C   . TYR B  2  309 ? -21.766 -1.289  213.141  1.00 56.38  ? 465 TYR B C   1 
ATOM   3261  O  O   . TYR B  2  309 ? -22.226 -2.187  213.841  1.00 59.59  ? 465 TYR B O   1 
ATOM   3262  C  CB  . TYR B  2  309 ? -23.255 -1.436  211.125  1.00 60.54  ? 465 TYR B CB  1 
ATOM   3263  C  CG  . TYR B  2  309 ? -24.016 -0.147  211.376  1.00 52.89  ? 465 TYR B CG  1 
ATOM   3264  C  CD1 . TYR B  2  309 ? -24.727 0.046   212.554  1.00 43.63  ? 465 TYR B CD1 1 
ATOM   3265  C  CD2 . TYR B  2  309 ? -24.000 0.886   210.445  1.00 53.97  ? 465 TYR B CD2 1 
ATOM   3266  C  CE1 . TYR B  2  309 ? -25.407 1.231   212.803  1.00 49.18  ? 465 TYR B CE1 1 
ATOM   3267  C  CE2 . TYR B  2  309 ? -24.672 2.079   210.686  1.00 56.83  ? 465 TYR B CE2 1 
ATOM   3268  C  CZ  . TYR B  2  309 ? -25.374 2.243   211.865  1.00 53.64  ? 465 TYR B CZ  1 
ATOM   3269  O  OH  . TYR B  2  309 ? -26.038 3.421   212.110  1.00 55.37  ? 465 TYR B OH  1 
ATOM   3270  N  N   . SER B  2  310 ? -21.195 -0.189  213.634  1.00 51.15  ? 466 SER B N   1 
ATOM   3271  C  CA  . SER B  2  310 ? -21.079 0.042   215.080  1.00 58.64  ? 466 SER B CA  1 
ATOM   3272  C  C   . SER B  2  310 ? -22.221 0.918   215.585  1.00 53.24  ? 466 SER B C   1 
ATOM   3273  O  O   . SER B  2  310 ? -22.410 2.031   215.116  1.00 55.58  ? 466 SER B O   1 
ATOM   3274  C  CB  . SER B  2  310 ? -19.730 0.704   215.411  1.00 54.82  ? 466 SER B CB  1 
ATOM   3275  O  OG  . SER B  2  310 ? -19.610 0.986   216.798  1.00 55.50  ? 466 SER B OG  1 
ATOM   3276  N  N   . MET B  2  311 ? -22.984 0.415   216.546  1.00 48.34  ? 467 MET B N   1 
ATOM   3277  C  CA  . MET B  2  311 ? -24.100 1.178   217.080  1.00 45.44  ? 467 MET B CA  1 
ATOM   3278  C  C   . MET B  2  311 ? -23.652 2.540   217.588  1.00 49.41  ? 467 MET B C   1 
ATOM   3279  O  O   . MET B  2  311 ? -22.470 2.756   217.887  1.00 48.43  ? 467 MET B O   1 
ATOM   3280  C  CB  . MET B  2  311 ? -24.768 0.425   218.234  1.00 57.32  ? 467 MET B CB  1 
ATOM   3281  C  CG  . MET B  2  311 ? -25.278 -0.964  217.893  1.00 66.19  ? 467 MET B CG  1 
ATOM   3282  S  SD  . MET B  2  311 ? -26.367 -0.973  216.477  1.00 68.48  ? 467 MET B SD  1 
ATOM   3283  C  CE  . MET B  2  311 ? -25.369 -1.846  215.277  1.00 47.86  ? 467 MET B CE  1 
ATOM   3284  N  N   . ARG B  2  312 ? -24.609 3.458   217.671  1.00 48.18  ? 468 ARG B N   1 
ATOM   3285  C  CA  . ARG B  2  312 ? -24.356 4.795   218.182  1.00 47.04  ? 468 ARG B CA  1 
ATOM   3286  C  C   . ARG B  2  312 ? -24.662 4.700   219.672  1.00 49.24  ? 468 ARG B C   1 
ATOM   3287  O  O   . ARG B  2  312 ? -24.114 5.441   220.492  1.00 43.78  ? 468 ARG B O   1 
ATOM   3288  C  CB  . ARG B  2  312 ? -25.292 5.809   217.525  1.00 51.97  ? 468 ARG B CB  1 
ATOM   3289  C  CG  . ARG B  2  312 ? -25.123 7.227   218.065  1.00 59.29  ? 468 ARG B CG  1 
ATOM   3290  C  CD  . ARG B  2  312 ? -26.090 8.196   217.416  1.00 65.86  ? 468 ARG B CD  1 
ATOM   3291  N  NE  . ARG B  2  312 ? -27.481 7.805   217.625  1.00 80.97  ? 468 ARG B NE  1 
ATOM   3292  C  CZ  . ARG B  2  312 ? -28.144 7.961   218.766  1.00 85.62  ? 468 ARG B CZ  1 
ATOM   3293  N  NH1 . ARG B  2  312 ? -27.546 8.511   219.814  1.00 89.35  ? 468 ARG B NH1 1 
ATOM   3294  N  NH2 . ARG B  2  312 ? -29.407 7.558   218.862  1.00 88.13  ? 468 ARG B NH2 1 
ATOM   3295  N  N   . GLN B  2  313 ? -25.555 3.774   220.007  1.00 47.87  ? 469 GLN B N   1 
ATOM   3296  C  CA  . GLN B  2  313 ? -25.945 3.528   221.388  1.00 49.33  ? 469 GLN B CA  1 
ATOM   3297  C  C   . GLN B  2  313 ? -26.190 2.058   221.654  1.00 51.76  ? 469 GLN B C   1 
ATOM   3298  O  O   . GLN B  2  313 ? -26.874 1.377   220.887  1.00 58.52  ? 469 GLN B O   1 
ATOM   3299  C  CB  . GLN B  2  313 ? -27.197 4.312   221.749  1.00 40.78  ? 469 GLN B CB  1 
ATOM   3300  C  CG  . GLN B  2  313 ? -26.927 5.777   221.990  1.00 44.27  ? 469 GLN B CG  1 
ATOM   3301  C  CD  . GLN B  2  313 ? -28.174 6.517   222.415  1.00 52.48  ? 469 GLN B CD  1 
ATOM   3302  O  OE1 . GLN B  2  313 ? -28.111 7.674   222.813  1.00 60.74  ? 469 GLN B OE1 1 
ATOM   3303  N  NE2 . GLN B  2  313 ? -29.321 5.850   222.328  1.00 51.40  ? 469 GLN B NE2 1 
ATOM   3304  N  N   . MET B  2  314 ? -25.615 1.573   222.744  1.00 46.07  ? 470 MET B N   1 
ATOM   3305  C  CA  . MET B  2  314 ? -25.771 0.181   223.139  1.00 48.17  ? 470 MET B CA  1 
ATOM   3306  C  C   . MET B  2  314 ? -25.764 0.120   224.649  1.00 48.50  ? 470 MET B C   1 
ATOM   3307  O  O   . MET B  2  314 ? -25.032 0.859   225.294  1.00 58.70  ? 470 MET B O   1 
ATOM   3308  C  CB  . MET B  2  314 ? -24.623 -0.657  222.600  1.00 47.00  ? 470 MET B CB  1 
ATOM   3309  C  CG  . MET B  2  314 ? -24.535 -2.031  223.226  1.00 45.69  ? 470 MET B CG  1 
ATOM   3310  S  SD  . MET B  2  314 ? -25.810 -3.152  222.665  1.00 45.75  ? 470 MET B SD  1 
ATOM   3311  C  CE  . MET B  2  314 ? -25.126 -3.540  221.046  1.00 24.43  ? 470 MET B CE  1 
ATOM   3312  N  N   . ALA B  2  315 ? -26.566 -0.760  225.221  1.00 41.16  ? 471 ALA B N   1 
ATOM   3313  C  CA  . ALA B  2  315 ? -26.603 -0.856  226.661  1.00 37.61  ? 471 ALA B CA  1 
ATOM   3314  C  C   . ALA B  2  315 ? -27.211 -2.160  227.146  1.00 45.49  ? 471 ALA B C   1 
ATOM   3315  O  O   . ALA B  2  315 ? -28.098 -2.715  226.507  1.00 57.09  ? 471 ALA B O   1 
ATOM   3316  C  CB  . ALA B  2  315 ? -27.374 0.296   227.212  1.00 32.20  ? 471 ALA B CB  1 
ATOM   3317  N  N   . MET B  2  316 ? -26.713 -2.646  228.277  1.00 46.20  ? 472 MET B N   1 
ATOM   3318  C  CA  . MET B  2  316 ? -27.205 -3.868  228.895  1.00 38.26  ? 472 MET B CA  1 
ATOM   3319  C  C   . MET B  2  316 ? -27.909 -3.445  230.165  1.00 35.15  ? 472 MET B C   1 
ATOM   3320  O  O   . MET B  2  316 ? -27.362 -2.678  230.947  1.00 51.11  ? 472 MET B O   1 
ATOM   3321  C  CB  . MET B  2  316 ? -26.048 -4.787  229.256  1.00 56.77  ? 472 MET B CB  1 
ATOM   3322  C  CG  . MET B  2  316 ? -25.671 -5.796  228.211  1.00 39.08  ? 472 MET B CG  1 
ATOM   3323  S  SD  . MET B  2  316 ? -24.731 -7.120  229.012  1.00 58.19  ? 472 MET B SD  1 
ATOM   3324  C  CE  . MET B  2  316 ? -25.910 -7.745  230.126  1.00 12.87  ? 472 MET B CE  1 
ATOM   3325  N  N   . LYS B  2  317 ? -29.113 -3.951  230.378  1.00 31.92  ? 473 LYS B N   1 
ATOM   3326  C  CA  . LYS B  2  317 ? -29.896 -3.589  231.554  1.00 40.18  ? 473 LYS B CA  1 
ATOM   3327  C  C   . LYS B  2  317 ? -30.457 -4.819  232.243  1.00 40.82  ? 473 LYS B C   1 
ATOM   3328  O  O   . LYS B  2  317 ? -30.901 -5.755  231.592  1.00 50.59  ? 473 LYS B O   1 
ATOM   3329  C  CB  . LYS B  2  317 ? -31.056 -2.673  231.154  1.00 38.88  ? 473 LYS B CB  1 
ATOM   3330  C  CG  . LYS B  2  317 ? -30.625 -1.348  230.601  1.00 46.74  ? 473 LYS B CG  1 
ATOM   3331  C  CD  . LYS B  2  317 ? -31.713 -0.731  229.752  1.00 52.18  ? 473 LYS B CD  1 
ATOM   3332  C  CE  . LYS B  2  317 ? -31.315 0.649   229.277  1.00 45.45  ? 473 LYS B CE  1 
ATOM   3333  N  NZ  . LYS B  2  317 ? -32.239 1.149   228.232  1.00 48.51  ? 473 LYS B NZ  1 
ATOM   3334  N  N   . LEU B  2  318 ? -30.457 -4.790  233.566  1.00 35.34  ? 474 LEU B N   1 
ATOM   3335  C  CA  . LEU B  2  318 ? -30.948 -5.892  234.366  1.00 45.24  ? 474 LEU B CA  1 
ATOM   3336  C  C   . LEU B  2  318 ? -32.162 -5.494  235.174  1.00 52.69  ? 474 LEU B C   1 
ATOM   3337  O  O   . LEU B  2  318 ? -32.294 -4.349  235.597  1.00 52.67  ? 474 LEU B O   1 
ATOM   3338  C  CB  . LEU B  2  318 ? -29.859 -6.364  235.329  1.00 41.68  ? 474 LEU B CB  1 
ATOM   3339  C  CG  . LEU B  2  318 ? -29.025 -7.588  234.975  1.00 33.76  ? 474 LEU B CG  1 
ATOM   3340  C  CD1 . LEU B  2  318 ? -28.801 -7.685  233.486  1.00 32.32  ? 474 LEU B CD1 1 
ATOM   3341  C  CD2 . LEU B  2  318 ? -27.713 -7.517  235.732  1.00 37.96  ? 474 LEU B CD2 1 
ATOM   3342  N  N   . ARG B  2  319 ? -33.044 -6.458  235.383  1.00 58.31  ? 475 ARG B N   1 
ATOM   3343  C  CA  . ARG B  2  319 ? -34.242 -6.256  236.169  1.00 60.49  ? 475 ARG B CA  1 
ATOM   3344  C  C   . ARG B  2  319 ? -34.622 -7.610  236.741  1.00 67.63  ? 475 ARG B C   1 
ATOM   3345  O  O   . ARG B  2  319 ? -34.380 -8.647  236.122  1.00 73.82  ? 475 ARG B O   1 
ATOM   3346  C  CB  . ARG B  2  319 ? -35.384 -5.714  235.315  1.00 52.57  ? 475 ARG B CB  1 
ATOM   3347  C  CG  . ARG B  2  319 ? -36.610 -5.386  236.152  1.00 71.65  ? 475 ARG B CG  1 
ATOM   3348  C  CD  . ARG B  2  319 ? -37.686 -4.682  235.363  1.00 83.97  ? 475 ARG B CD  1 
ATOM   3349  N  NE  . ARG B  2  319 ? -38.265 -5.553  234.352  1.00 102.71 ? 475 ARG B NE  1 
ATOM   3350  C  CZ  . ARG B  2  319 ? -39.255 -5.198  233.542  1.00 113.90 ? 475 ARG B CZ  1 
ATOM   3351  N  NH1 . ARG B  2  319 ? -39.774 -3.978  233.625  1.00 119.67 ? 475 ARG B NH1 1 
ATOM   3352  N  NH2 . ARG B  2  319 ? -39.730 -6.066  232.653  1.00 113.08 ? 475 ARG B NH2 1 
ATOM   3353  N  N   . PRO B  2  320 ? -35.204 -7.625  237.943  1.00 68.39  ? 476 PRO B N   1 
ATOM   3354  C  CA  . PRO B  2  320 ? -35.598 -8.891  238.557  1.00 77.80  ? 476 PRO B CA  1 
ATOM   3355  C  C   . PRO B  2  320 ? -36.890 -9.401  237.950  1.00 91.82  ? 476 PRO B C   1 
ATOM   3356  O  O   . PRO B  2  320 ? -36.884 -10.007 236.883  1.00 99.89  ? 476 PRO B O   1 
ATOM   3357  C  CB  . PRO B  2  320 ? -35.754 -8.519  240.023  1.00 67.31  ? 476 PRO B CB  1 
ATOM   3358  C  CG  . PRO B  2  320 ? -36.285 -7.133  239.935  1.00 61.86  ? 476 PRO B CG  1 
ATOM   3359  C  CD  . PRO B  2  320 ? -35.406 -6.508  238.880  1.00 66.61  ? 476 PRO B CD  1 
ATOM   3360  N  N   . LYS B  2  321 ? -37.997 -9.139  238.638  1.00 105.46 ? 477 LYS B N   1 
ATOM   3361  C  CA  . LYS B  2  321 ? -39.324 -9.560  238.196  1.00 108.91 ? 477 LYS B CA  1 
ATOM   3362  C  C   . LYS B  2  321 ? -40.410 -8.652  238.802  1.00 116.33 ? 477 LYS B C   1 
ATOM   3363  O  O   . LYS B  2  321 ? -41.055 -7.908  238.031  1.00 122.50 ? 477 LYS B O   1 
ATOM   3364  C  CB  . LYS B  2  321 ? -39.567 -11.020 238.608  1.00 95.80  ? 477 LYS B CB  1 
ATOM   3365  C  CG  . LYS B  2  321 ? -38.559 -11.992 238.028  1.00 68.50  ? 477 LYS B CG  1 
ATOM   3366  C  CD  . LYS B  2  321 ? -38.724 -12.110 236.525  1.00 56.26  ? 477 LYS B CD  1 
ATOM   3367  C  CE  . LYS B  2  321 ? -37.429 -12.580 235.870  1.00 74.79  ? 477 LYS B CE  1 
ATOM   3368  N  NZ  . LYS B  2  321 ? -36.816 -13.800 236.484  1.00 69.35  ? 477 LYS B NZ  1 
ATOM   3369  N  N   . LYS C  3  5   ? 16.058  20.062  159.540  1.00 118.78 ? 83  LYS C N   1 
ATOM   3370  C  CA  . LYS C  3  5   ? 16.727  20.324  160.845  1.00 119.22 ? 83  LYS C CA  1 
ATOM   3371  C  C   . LYS C  3  5   ? 16.363  19.261  161.872  1.00 116.88 ? 83  LYS C C   1 
ATOM   3372  O  O   . LYS C  3  5   ? 16.735  19.362  163.037  1.00 116.02 ? 83  LYS C O   1 
ATOM   3373  C  CB  . LYS C  3  5   ? 16.325  21.701  161.371  1.00 122.83 ? 83  LYS C CB  1 
ATOM   3374  C  CG  . LYS C  3  5   ? 14.836  21.856  161.641  1.00 124.51 ? 83  LYS C CG  1 
ATOM   3375  C  CD  . LYS C  3  5   ? 14.481  23.306  161.940  1.00 127.37 ? 83  LYS C CD  1 
ATOM   3376  C  CE  . LYS C  3  5   ? 14.782  24.203  160.745  1.00 127.69 ? 83  LYS C CE  1 
ATOM   3377  N  NZ  . LYS C  3  5   ? 14.471  25.636  161.016  1.00 129.90 ? 83  LYS C NZ  1 
ATOM   3378  N  N   . THR C  3  6   ? 15.627  18.247  161.433  1.00 120.47 ? 84  THR C N   1 
ATOM   3379  C  CA  . THR C  3  6   ? 15.219  17.159  162.313  1.00 123.07 ? 84  THR C CA  1 
ATOM   3380  C  C   . THR C  3  6   ? 16.448  16.460  162.886  1.00 125.71 ? 84  THR C C   1 
ATOM   3381  O  O   . THR C  3  6   ? 16.555  16.273  164.098  1.00 128.05 ? 84  THR C O   1 
ATOM   3382  C  CB  . THR C  3  6   ? 14.355  16.131  161.557  1.00 123.07 ? 84  THR C CB  1 
ATOM   3383  O  OG1 . THR C  3  6   ? 13.114  16.740  161.187  1.00 124.35 ? 84  THR C OG1 1 
ATOM   3384  C  CG2 . THR C  3  6   ? 14.073  14.917  162.423  1.00 124.46 ? 84  THR C CG2 1 
ATOM   3385  N  N   . VAL C  3  7   ? 17.374  16.078  162.010  1.00 122.02 ? 85  VAL C N   1 
ATOM   3386  C  CA  . VAL C  3  7   ? 18.597  15.411  162.437  1.00 118.00 ? 85  VAL C CA  1 
ATOM   3387  C  C   . VAL C  3  7   ? 19.232  16.239  163.552  1.00 113.72 ? 85  VAL C C   1 
ATOM   3388  O  O   . VAL C  3  7   ? 19.830  15.703  164.483  1.00 108.22 ? 85  VAL C O   1 
ATOM   3389  C  CB  . VAL C  3  7   ? 19.606  15.300  161.276  1.00 122.62 ? 85  VAL C CB  1 
ATOM   3390  C  CG1 . VAL C  3  7   ? 20.744  14.366  161.664  1.00 124.24 ? 85  VAL C CG1 1 
ATOM   3391  C  CG2 . VAL C  3  7   ? 18.904  14.815  160.014  1.00 122.05 ? 85  VAL C CG2 1 
ATOM   3392  N  N   . GLN C  3  8   ? 19.087  17.554  163.445  1.00 111.36 ? 86  GLN C N   1 
ATOM   3393  C  CA  . GLN C  3  8   ? 19.636  18.478  164.429  1.00 109.31 ? 86  GLN C CA  1 
ATOM   3394  C  C   . GLN C  3  8   ? 18.728  18.616  165.647  1.00 103.71 ? 86  GLN C C   1 
ATOM   3395  O  O   . GLN C  3  8   ? 19.184  18.984  166.726  1.00 99.65  ? 86  GLN C O   1 
ATOM   3396  C  CB  . GLN C  3  8   ? 19.836  19.852  163.796  1.00 115.65 ? 86  GLN C CB  1 
ATOM   3397  C  CG  . GLN C  3  8   ? 20.305  20.915  164.766  1.00 115.23 ? 86  GLN C CG  1 
ATOM   3398  C  CD  . GLN C  3  8   ? 19.812  22.294  164.381  1.00 121.56 ? 86  GLN C CD  1 
ATOM   3399  O  OE1 . GLN C  3  8   ? 18.605  22.547  164.346  1.00 120.30 ? 86  GLN C OE1 1 
ATOM   3400  N  NE2 . GLN C  3  8   ? 20.742  23.193  164.086  1.00 122.88 ? 86  GLN C NE2 1 
ATOM   3401  N  N   . LYS C  3  9   ? 17.442  18.338  165.467  1.00 100.90 ? 87  LYS C N   1 
ATOM   3402  C  CA  . LYS C  3  9   ? 16.485  18.427  166.565  1.00 99.37  ? 87  LYS C CA  1 
ATOM   3403  C  C   . LYS C  3  9   ? 16.453  17.133  167.367  1.00 94.40  ? 87  LYS C C   1 
ATOM   3404  O  O   . LYS C  3  9   ? 16.372  17.161  168.595  1.00 90.85  ? 87  LYS C O   1 
ATOM   3405  C  CB  . LYS C  3  9   ? 15.084  18.743  166.040  1.00 104.61 ? 87  LYS C CB  1 
ATOM   3406  C  CG  . LYS C  3  9   ? 14.912  20.181  165.598  1.00 108.79 ? 87  LYS C CG  1 
ATOM   3407  C  CD  . LYS C  3  9   ? 15.113  21.136  166.757  1.00 103.72 ? 87  LYS C CD  1 
ATOM   3408  C  CE  . LYS C  3  9   ? 15.055  22.576  166.289  1.00 105.40 ? 87  LYS C CE  1 
ATOM   3409  N  NZ  . LYS C  3  9   ? 15.307  23.522  167.404  1.00 110.27 ? 87  LYS C NZ  1 
ATOM   3410  N  N   . ILE C  3  10  ? 16.518  16.001  166.673  1.00 86.19  ? 88  ILE C N   1 
ATOM   3411  C  CA  . ILE C  3  10  ? 16.520  14.705  167.340  1.00 85.45  ? 88  ILE C CA  1 
ATOM   3412  C  C   . ILE C  3  10  ? 17.655  14.683  168.355  1.00 79.40  ? 88  ILE C C   1 
ATOM   3413  O  O   . ILE C  3  10  ? 17.782  13.746  169.130  1.00 73.91  ? 88  ILE C O   1 
ATOM   3414  C  CB  . ILE C  3  10  ? 16.742  13.559  166.340  1.00 93.41  ? 88  ILE C CB  1 
ATOM   3415  C  CG1 . ILE C  3  10  ? 15.701  13.642  165.224  1.00 98.03  ? 88  ILE C CG1 1 
ATOM   3416  C  CG2 . ILE C  3  10  ? 16.657  12.215  167.053  1.00 84.97  ? 88  ILE C CG2 1 
ATOM   3417  C  CD1 . ILE C  3  10  ? 15.956  12.685  164.077  1.00 108.49 ? 88  ILE C CD1 1 
ATOM   3418  N  N   . LEU C  3  11  ? 18.484  15.723  168.324  1.00 83.57  ? 89  LEU C N   1 
ATOM   3419  C  CA  . LEU C  3  11  ? 19.608  15.863  169.240  1.00 84.87  ? 89  LEU C CA  1 
ATOM   3420  C  C   . LEU C  3  11  ? 19.163  16.709  170.417  1.00 82.76  ? 89  LEU C C   1 
ATOM   3421  O  O   . LEU C  3  11  ? 19.040  16.206  171.529  1.00 82.08  ? 89  LEU C O   1 
ATOM   3422  C  CB  . LEU C  3  11  ? 20.794  16.540  168.548  1.00 86.07  ? 89  LEU C CB  1 
ATOM   3423  C  CG  . LEU C  3  11  ? 22.074  15.709  168.471  1.00 82.97  ? 89  LEU C CG  1 
ATOM   3424  C  CD1 . LEU C  3  11  ? 21.852  14.518  167.560  1.00 79.01  ? 89  LEU C CD1 1 
ATOM   3425  C  CD2 . LEU C  3  11  ? 23.205  16.566  167.957  1.00 79.21  ? 89  LEU C CD2 1 
ATOM   3426  N  N   . GLU C  3  12  ? 18.927  17.995  170.167  1.00 83.26  ? 90  GLU C N   1 
ATOM   3427  C  CA  . GLU C  3  12  ? 18.479  18.900  171.220  1.00 91.30  ? 90  GLU C CA  1 
ATOM   3428  C  C   . GLU C  3  12  ? 17.408  18.184  172.026  1.00 99.54  ? 90  GLU C C   1 
ATOM   3429  O  O   . GLU C  3  12  ? 17.383  18.264  173.255  1.00 105.36 ? 90  GLU C O   1 
ATOM   3430  C  CB  . GLU C  3  12  ? 17.892  20.177  170.626  1.00 86.64  ? 90  GLU C CB  1 
ATOM   3431  C  CG  . GLU C  3  12  ? 18.901  21.069  169.946  1.00 93.00  ? 90  GLU C CG  1 
ATOM   3432  C  CD  . GLU C  3  12  ? 18.244  22.234  169.233  1.00 98.89  ? 90  GLU C CD  1 
ATOM   3433  O  OE1 . GLU C  3  12  ? 18.971  23.121  168.736  1.00 93.63  ? 90  GLU C OE1 1 
ATOM   3434  O  OE2 . GLU C  3  12  ? 16.996  22.259  169.168  1.00 104.50 ? 90  GLU C OE2 1 
ATOM   3435  N  N   . GLU C  3  13  ? 16.522  17.478  171.330  1.00 97.93  ? 91  GLU C N   1 
ATOM   3436  C  CA  . GLU C  3  13  ? 15.469  16.743  172.008  1.00 97.23  ? 91  GLU C CA  1 
ATOM   3437  C  C   . GLU C  3  13  ? 16.111  15.819  173.032  1.00 93.05  ? 91  GLU C C   1 
ATOM   3438  O  O   . GLU C  3  13  ? 15.700  15.792  174.193  1.00 101.94 ? 91  GLU C O   1 
ATOM   3439  C  CB  . GLU C  3  13  ? 14.650  15.920  171.010  1.00 101.92 ? 91  GLU C CB  1 
ATOM   3440  C  CG  . GLU C  3  13  ? 13.806  16.746  170.046  1.00 110.07 ? 91  GLU C CG  1 
ATOM   3441  C  CD  . GLU C  3  13  ? 12.699  17.531  170.733  1.00 109.28 ? 91  GLU C CD  1 
ATOM   3442  O  OE1 . GLU C  3  13  ? 13.007  18.408  171.572  1.00 107.06 ? 91  GLU C OE1 1 
ATOM   3443  O  OE2 . GLU C  3  13  ? 11.517  17.271  170.426  1.00 106.95 ? 91  GLU C OE2 1 
ATOM   3444  N  N   . VAL C  3  14  ? 17.131  15.077  172.608  1.00 82.76  ? 92  VAL C N   1 
ATOM   3445  C  CA  . VAL C  3  14  ? 17.814  14.150  173.506  1.00 73.37  ? 92  VAL C CA  1 
ATOM   3446  C  C   . VAL C  3  14  ? 18.622  14.861  174.575  1.00 70.97  ? 92  VAL C C   1 
ATOM   3447  O  O   . VAL C  3  14  ? 18.780  14.349  175.672  1.00 76.06  ? 92  VAL C O   1 
ATOM   3448  C  CB  . VAL C  3  14  ? 18.731  13.195  172.738  1.00 61.87  ? 92  VAL C CB  1 
ATOM   3449  C  CG1 . VAL C  3  14  ? 19.388  12.228  173.689  1.00 59.93  ? 92  VAL C CG1 1 
ATOM   3450  C  CG2 . VAL C  3  14  ? 17.918  12.420  171.727  1.00 81.35  ? 92  VAL C CG2 1 
ATOM   3451  N  N   . ARG C  3  15  ? 19.138  16.041  174.263  1.00 77.15  ? 93  ARG C N   1 
ATOM   3452  C  CA  . ARG C  3  15  ? 19.891  16.801  175.253  1.00 83.29  ? 93  ARG C CA  1 
ATOM   3453  C  C   . ARG C  3  15  ? 18.922  17.155  176.376  1.00 85.90  ? 93  ARG C C   1 
ATOM   3454  O  O   . ARG C  3  15  ? 19.302  17.239  177.544  1.00 81.84  ? 93  ARG C O   1 
ATOM   3455  C  CB  . ARG C  3  15  ? 20.457  18.086  174.639  1.00 88.19  ? 93  ARG C CB  1 
ATOM   3456  C  CG  . ARG C  3  15  ? 21.099  19.014  175.661  1.00 95.36  ? 93  ARG C CG  1 
ATOM   3457  C  CD  . ARG C  3  15  ? 21.844  20.164  175.011  1.00 100.16 ? 93  ARG C CD  1 
ATOM   3458  N  NE  . ARG C  3  15  ? 22.465  21.019  176.017  1.00 110.09 ? 93  ARG C NE  1 
ATOM   3459  C  CZ  . ARG C  3  15  ? 23.303  22.014  175.746  1.00 117.92 ? 93  ARG C CZ  1 
ATOM   3460  N  NH1 . ARG C  3  15  ? 23.633  22.285  174.489  1.00 125.00 ? 93  ARG C NH1 1 
ATOM   3461  N  NH2 . ARG C  3  15  ? 23.808  22.742  176.734  1.00 120.77 ? 93  ARG C NH2 1 
ATOM   3462  N  N   . ILE C  3  16  ? 17.662  17.356  175.996  1.00 89.08  ? 94  ILE C N   1 
ATOM   3463  C  CA  . ILE C  3  16  ? 16.598  17.702  176.930  1.00 89.41  ? 94  ILE C CA  1 
ATOM   3464  C  C   . ILE C  3  16  ? 16.118  16.474  177.702  1.00 92.04  ? 94  ILE C C   1 
ATOM   3465  O  O   . ILE C  3  16  ? 15.997  16.515  178.928  1.00 91.00  ? 94  ILE C O   1 
ATOM   3466  C  CB  . ILE C  3  16  ? 15.389  18.316  176.189  1.00 85.10  ? 94  ILE C CB  1 
ATOM   3467  C  CG1 . ILE C  3  16  ? 15.795  19.641  175.536  1.00 80.84  ? 94  ILE C CG1 1 
ATOM   3468  C  CG2 . ILE C  3  16  ? 14.229  18.504  177.152  1.00 82.93  ? 94  ILE C CG2 1 
ATOM   3469  C  CD1 . ILE C  3  16  ? 16.265  20.704  176.516  1.00 70.85  ? 94  ILE C CD1 1 
ATOM   3470  N  N   . LEU C  3  17  ? 15.842  15.388  176.980  1.00 86.43  ? 95  LEU C N   1 
ATOM   3471  C  CA  . LEU C  3  17  ? 15.378  14.158  177.608  1.00 85.96  ? 95  LEU C CA  1 
ATOM   3472  C  C   . LEU C  3  17  ? 16.370  13.635  178.638  1.00 87.14  ? 95  LEU C C   1 
ATOM   3473  O  O   . LEU C  3  17  ? 16.003  12.893  179.550  1.00 92.02  ? 95  LEU C O   1 
ATOM   3474  C  CB  . LEU C  3  17  ? 15.124  13.071  176.560  1.00 82.70  ? 95  LEU C CB  1 
ATOM   3475  C  CG  . LEU C  3  17  ? 13.841  13.122  175.729  1.00 79.17  ? 95  LEU C CG  1 
ATOM   3476  C  CD1 . LEU C  3  17  ? 13.642  11.765  175.044  1.00 76.81  ? 95  LEU C CD1 1 
ATOM   3477  C  CD2 . LEU C  3  17  ? 12.645  13.427  176.626  1.00 81.13  ? 95  LEU C CD2 1 
ATOM   3478  N  N   . GLU C  3  18  ? 17.634  14.004  178.485  1.00 81.28  ? 96  GLU C N   1 
ATOM   3479  C  CA  . GLU C  3  18  ? 18.646  13.570  179.429  1.00 70.33  ? 96  GLU C CA  1 
ATOM   3480  C  C   . GLU C  3  18  ? 18.523  14.447  180.672  1.00 69.37  ? 96  GLU C C   1 
ATOM   3481  O  O   . GLU C  3  18  ? 18.485  13.947  181.793  1.00 57.76  ? 96  GLU C O   1 
ATOM   3482  C  CB  . GLU C  3  18  ? 20.037  13.691  178.800  1.00 74.21  ? 96  GLU C CB  1 
ATOM   3483  C  CG  . GLU C  3  18  ? 20.261  12.731  177.624  1.00 79.33  ? 96  GLU C CG  1 
ATOM   3484  C  CD  . GLU C  3  18  ? 21.684  12.763  177.061  1.00 84.99  ? 96  GLU C CD  1 
ATOM   3485  O  OE1 . GLU C  3  18  ? 22.118  13.827  176.559  1.00 75.13  ? 96  GLU C OE1 1 
ATOM   3486  O  OE2 . GLU C  3  18  ? 22.367  11.713  177.119  1.00 80.64  ? 96  GLU C OE2 1 
ATOM   3487  N  N   . GLN C  3  19  ? 18.434  15.756  180.466  1.00 71.99  ? 97  GLN C N   1 
ATOM   3488  C  CA  . GLN C  3  19  ? 18.304  16.695  181.572  1.00 80.06  ? 97  GLN C CA  1 
ATOM   3489  C  C   . GLN C  3  19  ? 17.111  16.331  182.445  1.00 79.93  ? 97  GLN C C   1 
ATOM   3490  O  O   . GLN C  3  19  ? 17.192  16.369  183.673  1.00 85.22  ? 97  GLN C O   1 
ATOM   3491  C  CB  . GLN C  3  19  ? 18.129  18.115  181.040  1.00 90.90  ? 97  GLN C CB  1 
ATOM   3492  C  CG  . GLN C  3  19  ? 19.280  18.597  180.173  1.00 104.12 ? 97  GLN C CG  1 
ATOM   3493  C  CD  . GLN C  3  19  ? 19.003  19.951  179.544  1.00 117.65 ? 97  GLN C CD  1 
ATOM   3494  O  OE1 . GLN C  3  19  ? 18.984  20.981  180.227  1.00 113.10 ? 97  GLN C OE1 1 
ATOM   3495  N  NE2 . GLN C  3  19  ? 18.775  19.955  178.231  1.00 122.92 ? 97  GLN C NE2 1 
ATOM   3496  N  N   . ILE C  3  20  ? 16.000  15.984  181.806  1.00 74.77  ? 98  ILE C N   1 
ATOM   3497  C  CA  . ILE C  3  20  ? 14.797  15.606  182.533  1.00 63.46  ? 98  ILE C CA  1 
ATOM   3498  C  C   . ILE C  3  20  ? 15.052  14.341  183.347  1.00 56.94  ? 98  ILE C C   1 
ATOM   3499  O  O   . ILE C  3  20  ? 14.974  14.381  184.564  1.00 48.15  ? 98  ILE C O   1 
ATOM   3500  C  CB  . ILE C  3  20  ? 13.613  15.357  181.572  1.00 69.09  ? 98  ILE C CB  1 
ATOM   3501  C  CG1 . ILE C  3  20  ? 13.296  16.630  180.796  1.00 63.60  ? 98  ILE C CG1 1 
ATOM   3502  C  CG2 . ILE C  3  20  ? 12.390  14.928  182.350  1.00 69.91  ? 98  ILE C CG2 1 
ATOM   3503  C  CD1 . ILE C  3  20  ? 13.047  17.813  181.685  1.00 72.52  ? 98  ILE C CD1 1 
ATOM   3504  N  N   . GLY C  3  21  ? 15.358  13.235  182.663  1.00 55.55  ? 99  GLY C N   1 
ATOM   3505  C  CA  . GLY C  3  21  ? 15.625  11.962  183.322  1.00 62.70  ? 99  GLY C CA  1 
ATOM   3506  C  C   . GLY C  3  21  ? 16.409  12.120  184.612  1.00 68.76  ? 99  GLY C C   1 
ATOM   3507  O  O   . GLY C  3  21  ? 16.036  11.574  185.658  1.00 59.07  ? 99  GLY C O   1 
ATOM   3508  N  N   . VAL C  3  22  ? 17.498  12.880  184.537  1.00 72.64  ? 100 VAL C N   1 
ATOM   3509  C  CA  . VAL C  3  22  ? 18.338  13.142  185.697  1.00 64.97  ? 100 VAL C CA  1 
ATOM   3510  C  C   . VAL C  3  22  ? 17.502  13.763  186.814  1.00 68.10  ? 100 VAL C C   1 
ATOM   3511  O  O   . VAL C  3  22  ? 17.594  13.338  187.963  1.00 76.82  ? 100 VAL C O   1 
ATOM   3512  C  CB  . VAL C  3  22  ? 19.510  14.078  185.333  1.00 64.92  ? 100 VAL C CB  1 
ATOM   3513  C  CG1 . VAL C  3  22  ? 20.220  14.551  186.590  1.00 68.53  ? 100 VAL C CG1 1 
ATOM   3514  C  CG2 . VAL C  3  22  ? 20.496  13.339  184.426  1.00 52.09  ? 100 VAL C CG2 1 
ATOM   3515  N  N   . SER C  3  23  ? 16.690  14.765  186.490  1.00 69.19  ? 101 SER C N   1 
ATOM   3516  C  CA  . SER C  3  23  ? 15.836  15.377  187.508  1.00 71.73  ? 101 SER C CA  1 
ATOM   3517  C  C   . SER C  3  23  ? 14.864  14.324  188.042  1.00 69.21  ? 101 SER C C   1 
ATOM   3518  O  O   . SER C  3  23  ? 14.538  14.295  189.228  1.00 66.98  ? 101 SER C O   1 
ATOM   3519  C  CB  . SER C  3  23  ? 15.060  16.549  186.921  1.00 69.70  ? 101 SER C CB  1 
ATOM   3520  O  OG  . SER C  3  23  ? 15.948  17.591  186.578  1.00 90.46  ? 101 SER C OG  1 
ATOM   3521  N  N   . HIS C  3  24  ? 14.399  13.452  187.159  1.00 67.44  ? 102 HIS C N   1 
ATOM   3522  C  CA  . HIS C  3  24  ? 13.502  12.405  187.584  1.00 70.23  ? 102 HIS C CA  1 
ATOM   3523  C  C   . HIS C  3  24  ? 14.225  11.518  188.576  1.00 79.18  ? 102 HIS C C   1 
ATOM   3524  O  O   . HIS C  3  24  ? 13.609  10.985  189.497  1.00 87.06  ? 102 HIS C O   1 
ATOM   3525  C  CB  . HIS C  3  24  ? 13.028  11.604  186.387  1.00 67.30  ? 102 HIS C CB  1 
ATOM   3526  C  CG  . HIS C  3  24  ? 11.921  12.269  185.638  1.00 67.94  ? 102 HIS C CG  1 
ATOM   3527  N  ND1 . HIS C  3  24  ? 11.313  11.699  184.541  1.00 68.07  ? 102 HIS C ND1 1 
ATOM   3528  C  CD2 . HIS C  3  24  ? 11.286  13.446  185.854  1.00 61.06  ? 102 HIS C CD2 1 
ATOM   3529  C  CE1 . HIS C  3  24  ? 10.349  12.497  184.115  1.00 75.25  ? 102 HIS C CE1 1 
ATOM   3530  N  NE2 . HIS C  3  24  ? 10.312  13.563  184.895  1.00 66.23  ? 102 HIS C NE2 1 
ATOM   3531  N  N   . ASP C  3  25  ? 15.536  11.369  188.396  1.00 75.40  ? 103 ASP C N   1 
ATOM   3532  C  CA  . ASP C  3  25  ? 16.337  10.563  189.312  1.00 67.08  ? 103 ASP C CA  1 
ATOM   3533  C  C   . ASP C  3  25  ? 16.459  11.279  190.664  1.00 68.49  ? 103 ASP C C   1 
ATOM   3534  O  O   . ASP C  3  25  ? 16.724  10.649  191.692  1.00 67.09  ? 103 ASP C O   1 
ATOM   3535  C  CB  . ASP C  3  25  ? 17.734  10.308  188.742  1.00 67.10  ? 103 ASP C CB  1 
ATOM   3536  C  CG  . ASP C  3  25  ? 17.720  9.365   187.554  1.00 76.70  ? 103 ASP C CG  1 
ATOM   3537  O  OD1 . ASP C  3  25  ? 17.076  8.299   187.656  1.00 68.79  ? 103 ASP C OD1 1 
ATOM   3538  O  OD2 . ASP C  3  25  ? 18.362  9.685   186.526  1.00 79.28  ? 103 ASP C OD2 1 
ATOM   3539  N  N   . ALA C  3  26  ? 16.265  12.595  190.659  1.00 61.09  ? 104 ALA C N   1 
ATOM   3540  C  CA  . ALA C  3  26  ? 16.341  13.376  191.889  1.00 61.00  ? 104 ALA C CA  1 
ATOM   3541  C  C   . ALA C  3  26  ? 14.987  13.332  192.554  1.00 69.33  ? 104 ALA C C   1 
ATOM   3542  O  O   . ALA C  3  26  ? 14.874  13.092  193.763  1.00 76.89  ? 104 ALA C O   1 
ATOM   3543  C  CB  . ALA C  3  26  ? 16.700  14.814  191.591  1.00 49.39  ? 104 ALA C CB  1 
ATOM   3544  N  N   . GLN C  3  27  ? 13.958  13.574  191.750  1.00 68.39  ? 105 GLN C N   1 
ATOM   3545  C  CA  . GLN C  3  27  ? 12.597  13.577  192.246  1.00 68.98  ? 105 GLN C CA  1 
ATOM   3546  C  C   . GLN C  3  27  ? 12.251  12.231  192.846  1.00 60.28  ? 105 GLN C C   1 
ATOM   3547  O  O   . GLN C  3  27  ? 11.503  12.151  193.813  1.00 60.87  ? 105 GLN C O   1 
ATOM   3548  C  CB  . GLN C  3  27  ? 11.632  13.920  191.118  1.00 72.36  ? 105 GLN C CB  1 
ATOM   3549  C  CG  . GLN C  3  27  ? 11.724  15.356  190.668  1.00 76.13  ? 105 GLN C CG  1 
ATOM   3550  C  CD  . GLN C  3  27  ? 10.689  15.685  189.627  1.00 79.99  ? 105 GLN C CD  1 
ATOM   3551  O  OE1 . GLN C  3  27  ? 9.502   15.416  189.815  1.00 83.48  ? 105 GLN C OE1 1 
ATOM   3552  N  NE2 . GLN C  3  27  ? 11.127  16.274  188.518  1.00 90.00  ? 105 GLN C NE2 1 
ATOM   3553  N  N   . ILE C  3  28  ? 12.798  11.171  192.273  1.00 54.26  ? 106 ILE C N   1 
ATOM   3554  C  CA  . ILE C  3  28  ? 12.538  9.847   192.798  1.00 62.36  ? 106 ILE C CA  1 
ATOM   3555  C  C   . ILE C  3  28  ? 13.125  9.748   194.203  1.00 70.29  ? 106 ILE C C   1 
ATOM   3556  O  O   . ILE C  3  28  ? 12.550  9.114   195.088  1.00 74.27  ? 106 ILE C O   1 
ATOM   3557  C  CB  . ILE C  3  28  ? 13.150  8.761   191.897  1.00 61.78  ? 106 ILE C CB  1 
ATOM   3558  C  CG1 . ILE C  3  28  ? 12.206  8.476   190.731  1.00 56.25  ? 106 ILE C CG1 1 
ATOM   3559  C  CG2 . ILE C  3  28  ? 13.418  7.494   192.698  1.00 76.32  ? 106 ILE C CG2 1 
ATOM   3560  C  CD1 . ILE C  3  28  ? 12.690  7.385   189.802  1.00 52.70  ? 106 ILE C CD1 1 
ATOM   3561  N  N   . GLN C  3  29  ? 14.268  10.388  194.413  1.00 77.82  ? 107 GLN C N   1 
ATOM   3562  C  CA  . GLN C  3  29  ? 14.899  10.354  195.724  1.00 77.95  ? 107 GLN C CA  1 
ATOM   3563  C  C   . GLN C  3  29  ? 14.139  11.247  196.682  1.00 72.53  ? 107 GLN C C   1 
ATOM   3564  O  O   . GLN C  3  29  ? 13.962  10.915  197.852  1.00 73.63  ? 107 GLN C O   1 
ATOM   3565  C  CB  . GLN C  3  29  ? 16.358  10.800  195.628  1.00 75.44  ? 107 GLN C CB  1 
ATOM   3566  C  CG  . GLN C  3  29  ? 17.182  9.905   194.727  1.00 94.84  ? 107 GLN C CG  1 
ATOM   3567  C  CD  . GLN C  3  29  ? 16.745  8.450   194.800  1.00 99.20  ? 107 GLN C CD  1 
ATOM   3568  O  OE1 . GLN C  3  29  ? 16.753  7.840   195.868  1.00 99.43  ? 107 GLN C OE1 1 
ATOM   3569  N  NE2 . GLN C  3  29  ? 16.355  7.890   193.658  1.00 105.26 ? 107 GLN C NE2 1 
ATOM   3570  N  N   . GLU C  3  30  ? 13.678  12.380  196.180  1.00 62.51  ? 108 GLU C N   1 
ATOM   3571  C  CA  . GLU C  3  30  ? 12.941  13.289  197.023  1.00 62.48  ? 108 GLU C CA  1 
ATOM   3572  C  C   . GLU C  3  30  ? 11.691  12.590  197.549  1.00 66.40  ? 108 GLU C C   1 
ATOM   3573  O  O   . GLU C  3  30  ? 11.161  12.956  198.602  1.00 65.12  ? 108 GLU C O   1 
ATOM   3574  C  CB  . GLU C  3  30  ? 12.549  14.543  196.247  1.00 62.60  ? 108 GLU C CB  1 
ATOM   3575  C  CG  . GLU C  3  30  ? 11.904  15.587  197.121  1.00 68.56  ? 108 GLU C CG  1 
ATOM   3576  C  CD  . GLU C  3  30  ? 11.140  16.603  196.324  1.00 81.54  ? 108 GLU C CD  1 
ATOM   3577  O  OE1 . GLU C  3  30  ? 10.374  16.188  195.425  1.00 91.40  ? 108 GLU C OE1 1 
ATOM   3578  O  OE2 . GLU C  3  30  ? 11.297  17.810  196.601  1.00 85.15  ? 108 GLU C OE2 1 
ATOM   3579  N  N   . LEU C  3  31  ? 11.216  11.583  196.817  1.00 69.27  ? 109 LEU C N   1 
ATOM   3580  C  CA  . LEU C  3  31  ? 10.025  10.848  197.242  1.00 69.07  ? 109 LEU C CA  1 
ATOM   3581  C  C   . LEU C  3  31  ? 10.375  9.804   198.283  1.00 68.08  ? 109 LEU C C   1 
ATOM   3582  O  O   . LEU C  3  31  ? 9.609   9.581   199.216  1.00 68.19  ? 109 LEU C O   1 
ATOM   3583  C  CB  . LEU C  3  31  ? 9.329   10.169  196.060  1.00 61.28  ? 109 LEU C CB  1 
ATOM   3584  C  CG  . LEU C  3  31  ? 8.723   11.110  195.027  1.00 51.09  ? 109 LEU C CG  1 
ATOM   3585  C  CD1 . LEU C  3  31  ? 7.732   10.340  194.210  1.00 46.87  ? 109 LEU C CD1 1 
ATOM   3586  C  CD2 . LEU C  3  31  ? 8.040   12.276  195.708  1.00 50.74  ? 109 LEU C CD2 1 
ATOM   3587  N  N   . SER C  3  32  ? 11.527  9.160   198.124  1.00 66.31  ? 110 SER C N   1 
ATOM   3588  C  CA  . SER C  3  32  ? 11.946  8.158   199.090  1.00 69.32  ? 110 SER C CA  1 
ATOM   3589  C  C   . SER C  3  32  ? 12.269  8.835   200.409  1.00 75.23  ? 110 SER C C   1 
ATOM   3590  O  O   . SER C  3  32  ? 11.984  8.298   201.478  1.00 77.19  ? 110 SER C O   1 
ATOM   3591  C  CB  . SER C  3  32  ? 13.149  7.384   198.577  1.00 63.41  ? 110 SER C CB  1 
ATOM   3592  O  OG  . SER C  3  32  ? 12.717  6.450   197.609  1.00 57.09  ? 110 SER C OG  1 
ATOM   3593  N  N   . GLU C  3  33  ? 12.861  10.020  200.334  1.00 79.00  ? 111 GLU C N   1 
ATOM   3594  C  CA  . GLU C  3  33  ? 13.172  10.767  201.542  1.00 79.36  ? 111 GLU C CA  1 
ATOM   3595  C  C   . GLU C  3  33  ? 11.815  11.046  202.191  1.00 83.29  ? 111 GLU C C   1 
ATOM   3596  O  O   . GLU C  3  33  ? 11.581  10.747  203.370  1.00 72.32  ? 111 GLU C O   1 
ATOM   3597  C  CB  . GLU C  3  33  ? 13.872  12.087  201.179  1.00 80.68  ? 111 GLU C CB  1 
ATOM   3598  C  CG  . GLU C  3  33  ? 14.200  12.981  202.367  1.00 85.97  ? 111 GLU C CG  1 
ATOM   3599  C  CD  . GLU C  3  33  ? 14.828  12.198  203.508  1.00 91.44  ? 111 GLU C CD  1 
ATOM   3600  O  OE1 . GLU C  3  33  ? 15.604  11.264  203.212  1.00 80.07  ? 111 GLU C OE1 1 
ATOM   3601  O  OE2 . GLU C  3  33  ? 14.551  12.515  204.690  1.00 86.88  ? 111 GLU C OE2 1 
ATOM   3602  N  N   . MET C  3  34  ? 10.919  11.596  201.375  1.00 84.10  ? 112 MET C N   1 
ATOM   3603  C  CA  . MET C  3  34  ? 9.571   11.950  201.790  1.00 81.98  ? 112 MET C CA  1 
ATOM   3604  C  C   . MET C  3  34  ? 8.844   10.762  202.394  1.00 78.43  ? 112 MET C C   1 
ATOM   3605  O  O   . MET C  3  34  ? 8.067   10.911  203.332  1.00 78.74  ? 112 MET C O   1 
ATOM   3606  C  CB  . MET C  3  34  ? 8.791   12.477  200.588  1.00 83.89  ? 112 MET C CB  1 
ATOM   3607  C  CG  . MET C  3  34  ? 7.724   13.500  200.934  1.00 93.01  ? 112 MET C CG  1 
ATOM   3608  S  SD  . MET C  3  34  ? 7.094   14.338  199.463  1.00 105.04 ? 112 MET C SD  1 
ATOM   3609  C  CE  . MET C  3  34  ? 8.609   15.053  198.810  1.00 72.57  ? 112 MET C CE  1 
ATOM   3610  N  N   . TRP C  3  35  ? 9.098   9.578   201.860  1.00 74.35  ? 113 TRP C N   1 
ATOM   3611  C  CA  . TRP C  3  35  ? 8.443   8.392   202.375  1.00 75.38  ? 113 TRP C CA  1 
ATOM   3612  C  C   . TRP C  3  35  ? 9.031   7.966   203.712  1.00 76.42  ? 113 TRP C C   1 
ATOM   3613  O  O   . TRP C  3  35  ? 8.292   7.622   204.640  1.00 73.28  ? 113 TRP C O   1 
ATOM   3614  C  CB  . TRP C  3  35  ? 8.565   7.239   201.387  1.00 78.80  ? 113 TRP C CB  1 
ATOM   3615  C  CG  . TRP C  3  35  ? 7.728   6.069   201.786  1.00 85.34  ? 113 TRP C CG  1 
ATOM   3616  C  CD1 . TRP C  3  35  ? 6.369   5.948   201.668  1.00 84.37  ? 113 TRP C CD1 1 
ATOM   3617  C  CD2 . TRP C  3  35  ? 8.183   4.874   202.427  1.00 86.52  ? 113 TRP C CD2 1 
ATOM   3618  N  NE1 . TRP C  3  35  ? 5.952   4.751   202.201  1.00 86.27  ? 113 TRP C NE1 1 
ATOM   3619  C  CE2 . TRP C  3  35  ? 7.045   4.072   202.673  1.00 87.80  ? 113 TRP C CE2 1 
ATOM   3620  C  CE3 . TRP C  3  35  ? 9.442   4.402   202.820  1.00 78.03  ? 113 TRP C CE3 1 
ATOM   3621  C  CZ2 . TRP C  3  35  ? 7.131   2.825   203.294  1.00 80.61  ? 113 TRP C CZ2 1 
ATOM   3622  C  CZ3 . TRP C  3  35  ? 9.526   3.168   203.434  1.00 65.45  ? 113 TRP C CZ3 1 
ATOM   3623  C  CH2 . TRP C  3  35  ? 8.376   2.392   203.666  1.00 79.25  ? 113 TRP C CH2 1 
ATOM   3624  N  N   . ARG C  3  36  ? 10.360  7.974   203.800  1.00 78.37  ? 114 ARG C N   1 
ATOM   3625  C  CA  . ARG C  3  36  ? 11.050  7.590   205.033  1.00 78.84  ? 114 ARG C CA  1 
ATOM   3626  C  C   . ARG C  3  36  ? 10.645  8.519   206.178  1.00 76.87  ? 114 ARG C C   1 
ATOM   3627  O  O   . ARG C  3  36  ? 10.381  8.070   207.291  1.00 82.50  ? 114 ARG C O   1 
ATOM   3628  C  CB  . ARG C  3  36  ? 12.571  7.623   204.827  1.00 75.52  ? 114 ARG C CB  1 
ATOM   3629  C  CG  . ARG C  3  36  ? 13.135  6.385   204.117  1.00 84.47  ? 114 ARG C CG  1 
ATOM   3630  C  CD  . ARG C  3  36  ? 14.522  6.648   203.524  1.00 94.88  ? 114 ARG C CD  1 
ATOM   3631  N  NE  . ARG C  3  36  ? 14.451  7.396   202.264  1.00 105.04 ? 114 ARG C NE  1 
ATOM   3632  C  CZ  . ARG C  3  36  ? 15.484  8.007   201.687  1.00 101.03 ? 114 ARG C CZ  1 
ATOM   3633  N  NH1 . ARG C  3  36  ? 16.683  7.967   202.256  1.00 102.53 ? 114 ARG C NH1 1 
ATOM   3634  N  NH2 . ARG C  3  36  ? 15.318  8.654   200.540  1.00 95.13  ? 114 ARG C NH2 1 
ATOM   3635  N  N   . VAL C  3  37  ? 10.598  9.815   205.901  1.00 67.23  ? 115 VAL C N   1 
ATOM   3636  C  CA  . VAL C  3  37  ? 10.197  10.785  206.902  1.00 63.52  ? 115 VAL C CA  1 
ATOM   3637  C  C   . VAL C  3  37  ? 8.813   10.407  207.411  1.00 69.27  ? 115 VAL C C   1 
ATOM   3638  O  O   . VAL C  3  37  ? 8.587   10.294  208.615  1.00 78.47  ? 115 VAL C O   1 
ATOM   3639  C  CB  . VAL C  3  37  ? 10.158  12.204  206.286  1.00 71.15  ? 115 VAL C CB  1 
ATOM   3640  C  CG1 . VAL C  3  37  ? 9.185   13.116  207.059  1.00 46.00  ? 115 VAL C CG1 1 
ATOM   3641  C  CG2 . VAL C  3  37  ? 11.567  12.785  206.276  1.00 71.42  ? 115 VAL C CG2 1 
ATOM   3642  N  N   . ASN C  3  38  ? 7.888   10.211  206.479  1.00 75.22  ? 116 ASN C N   1 
ATOM   3643  C  CA  . ASN C  3  38  ? 6.523   9.841   206.817  1.00 71.65  ? 116 ASN C CA  1 
ATOM   3644  C  C   . ASN C  3  38  ? 6.489   8.560   207.632  1.00 70.53  ? 116 ASN C C   1 
ATOM   3645  O  O   . ASN C  3  38  ? 5.860   8.513   208.691  1.00 64.38  ? 116 ASN C O   1 
ATOM   3646  C  CB  . ASN C  3  38  ? 5.693   9.675   205.539  1.00 68.91  ? 116 ASN C CB  1 
ATOM   3647  C  CG  . ASN C  3  38  ? 5.049   10.971  205.096  1.00 68.58  ? 116 ASN C CG  1 
ATOM   3648  O  OD1 . ASN C  3  38  ? 5.588   12.061  205.331  1.00 63.42  ? 116 ASN C OD1 1 
ATOM   3649  N  ND2 . ASN C  3  38  ? 3.891   10.864  204.445  1.00 62.91  ? 116 ASN C ND2 1 
ATOM   3650  N  N   . GLN C  3  39  ? 7.175   7.529   207.147  1.00 68.62  ? 117 GLN C N   1 
ATOM   3651  C  CA  . GLN C  3  39  ? 7.190   6.252   207.846  1.00 73.07  ? 117 GLN C CA  1 
ATOM   3652  C  C   . GLN C  3  39  ? 7.657   6.427   209.292  1.00 70.49  ? 117 GLN C C   1 
ATOM   3653  O  O   . GLN C  3  39  ? 7.363   5.605   210.159  1.00 67.90  ? 117 GLN C O   1 
ATOM   3654  C  CB  . GLN C  3  39  ? 8.080   5.254   207.106  1.00 79.83  ? 117 GLN C CB  1 
ATOM   3655  C  CG  . GLN C  3  39  ? 7.686   3.797   207.342  1.00 92.45  ? 117 GLN C CG  1 
ATOM   3656  C  CD  . GLN C  3  39  ? 6.213   3.523   207.037  1.00 97.13  ? 117 GLN C CD  1 
ATOM   3657  O  OE1 . GLN C  3  39  ? 5.723   3.834   205.950  1.00 99.51  ? 117 GLN C OE1 1 
ATOM   3658  N  NE2 . GLN C  3  39  ? 5.506   2.932   208.001  1.00 95.57  ? 117 GLN C NE2 1 
ATOM   3659  N  N   . GLN C  3  40  ? 8.383   7.508   209.548  1.00 63.42  ? 118 GLN C N   1 
ATOM   3660  C  CA  . GLN C  3  40  ? 8.854   7.796   210.888  1.00 56.51  ? 118 GLN C CA  1 
ATOM   3661  C  C   . GLN C  3  40  ? 7.727   8.499   211.623  1.00 60.74  ? 118 GLN C C   1 
ATOM   3662  O  O   . GLN C  3  40  ? 7.492   8.248   212.804  1.00 68.89  ? 118 GLN C O   1 
ATOM   3663  C  CB  . GLN C  3  40  ? 10.086  8.683   210.828  1.00 52.52  ? 118 GLN C CB  1 
ATOM   3664  C  CG  . GLN C  3  40  ? 11.300  7.969   210.240  1.00 73.85  ? 118 GLN C CG  1 
ATOM   3665  C  CD  . GLN C  3  40  ? 12.431  8.926   209.866  1.00 88.24  ? 118 GLN C CD  1 
ATOM   3666  O  OE1 . GLN C  3  40  ? 13.507  8.494   209.437  1.00 85.67  ? 118 GLN C OE1 1 
ATOM   3667  N  NE2 . GLN C  3  40  ? 12.188  10.233  210.020  1.00 79.74  ? 118 GLN C NE2 1 
ATOM   3668  N  N   . PHE C  3  41  ? 7.023   9.373   210.909  1.00 58.68  ? 119 PHE C N   1 
ATOM   3669  C  CA  . PHE C  3  41  ? 5.890   10.114  211.465  1.00 57.10  ? 119 PHE C CA  1 
ATOM   3670  C  C   . PHE C  3  41  ? 4.857   9.101   211.976  1.00 62.57  ? 119 PHE C C   1 
ATOM   3671  O  O   . PHE C  3  41  ? 4.282   9.266   213.055  1.00 65.79  ? 119 PHE C O   1 
ATOM   3672  C  CB  . PHE C  3  41  ? 5.254   10.985  210.378  1.00 43.30  ? 119 PHE C CB  1 
ATOM   3673  C  CG  . PHE C  3  41  ? 4.528   12.200  210.894  1.00 33.01  ? 119 PHE C CG  1 
ATOM   3674  C  CD1 . PHE C  3  41  ? 3.821   12.167  212.084  1.00 37.09  ? 119 PHE C CD1 1 
ATOM   3675  C  CD2 . PHE C  3  41  ? 4.514   13.379  210.146  1.00 45.47  ? 119 PHE C CD2 1 
ATOM   3676  C  CE1 . PHE C  3  41  ? 3.101   13.296  212.529  1.00 49.82  ? 119 PHE C CE1 1 
ATOM   3677  C  CE2 . PHE C  3  41  ? 3.797   14.516  210.577  1.00 43.91  ? 119 PHE C CE2 1 
ATOM   3678  C  CZ  . PHE C  3  41  ? 3.090   14.472  211.769  1.00 45.59  ? 119 PHE C CZ  1 
ATOM   3679  N  N   . VAL C  3  42  ? 4.621   8.052   211.193  1.00 65.18  ? 120 VAL C N   1 
ATOM   3680  C  CA  . VAL C  3  42  ? 3.667   7.015   211.574  1.00 69.45  ? 120 VAL C CA  1 
ATOM   3681  C  C   . VAL C  3  42  ? 4.105   6.359   212.880  1.00 75.32  ? 120 VAL C C   1 
ATOM   3682  O  O   . VAL C  3  42  ? 3.281   6.024   213.725  1.00 80.35  ? 120 VAL C O   1 
ATOM   3683  C  CB  . VAL C  3  42  ? 3.570   5.940   210.492  1.00 73.03  ? 120 VAL C CB  1 
ATOM   3684  C  CG1 . VAL C  3  42  ? 2.472   4.959   210.833  1.00 77.81  ? 120 VAL C CG1 1 
ATOM   3685  C  CG2 . VAL C  3  42  ? 3.310   6.594   209.158  1.00 78.90  ? 120 VAL C CG2 1 
ATOM   3686  N  N   . THR C  3  43  ? 5.410   6.167   213.035  1.00 76.42  ? 121 THR C N   1 
ATOM   3687  C  CA  . THR C  3  43  ? 5.949   5.581   214.253  1.00 68.89  ? 121 THR C CA  1 
ATOM   3688  C  C   . THR C  3  43  ? 5.659   6.550   215.399  1.00 64.84  ? 121 THR C C   1 
ATOM   3689  O  O   . THR C  3  43  ? 5.019   6.187   216.379  1.00 63.03  ? 121 THR C O   1 
ATOM   3690  C  CB  . THR C  3  43  ? 7.475   5.360   214.137  1.00 70.34  ? 121 THR C CB  1 
ATOM   3691  O  OG1 . THR C  3  43  ? 7.734   4.326   213.179  1.00 70.30  ? 121 THR C OG1 1 
ATOM   3692  C  CG2 . THR C  3  43  ? 8.068   4.967   215.479  1.00 56.30  ? 121 THR C CG2 1 
ATOM   3693  N  N   . ARG C  3  44  ? 6.123   7.788   215.266  1.00 60.12  ? 122 ARG C N   1 
ATOM   3694  C  CA  . ARG C  3  44  ? 5.893   8.794   216.298  1.00 61.19  ? 122 ARG C CA  1 
ATOM   3695  C  C   . ARG C  3  44  ? 4.413   8.847   216.701  1.00 61.40  ? 122 ARG C C   1 
ATOM   3696  O  O   . ARG C  3  44  ? 4.096   9.036   217.877  1.00 56.53  ? 122 ARG C O   1 
ATOM   3697  C  CB  . ARG C  3  44  ? 6.372   10.175  215.812  1.00 68.82  ? 122 ARG C CB  1 
ATOM   3698  C  CG  . ARG C  3  44  ? 6.126   11.327  216.803  1.00 76.69  ? 122 ARG C CG  1 
ATOM   3699  C  CD  . ARG C  3  44  ? 6.897   12.625  216.469  1.00 71.27  ? 122 ARG C CD  1 
ATOM   3700  N  NE  . ARG C  3  44  ? 6.462   13.301  215.243  1.00 72.33  ? 122 ARG C NE  1 
ATOM   3701  C  CZ  . ARG C  3  44  ? 6.881   12.998  214.011  1.00 79.15  ? 122 ARG C CZ  1 
ATOM   3702  N  NH1 . ARG C  3  44  ? 7.757   12.016  213.812  1.00 72.52  ? 122 ARG C NH1 1 
ATOM   3703  N  NH2 . ARG C  3  44  ? 6.434   13.691  212.970  1.00 69.45  ? 122 ARG C NH2 1 
ATOM   3704  N  N   . LEU C  3  45  ? 3.504   8.685   215.739  1.00 60.40  ? 123 LEU C N   1 
ATOM   3705  C  CA  . LEU C  3  45  ? 2.085   8.704   216.079  1.00 55.39  ? 123 LEU C CA  1 
ATOM   3706  C  C   . LEU C  3  45  ? 1.713   7.365   216.701  1.00 58.85  ? 123 LEU C C   1 
ATOM   3707  O  O   . LEU C  3  45  ? 0.823   7.295   217.545  1.00 60.50  ? 123 LEU C O   1 
ATOM   3708  C  CB  . LEU C  3  45  ? 1.204   8.969   214.855  1.00 48.28  ? 123 LEU C CB  1 
ATOM   3709  C  CG  . LEU C  3  45  ? 1.124   10.380  214.255  1.00 52.29  ? 123 LEU C CG  1 
ATOM   3710  C  CD1 . LEU C  3  45  ? 0.056   10.381  213.162  1.00 40.44  ? 123 LEU C CD1 1 
ATOM   3711  C  CD2 . LEU C  3  45  ? 0.769   11.427  215.318  1.00 44.56  ? 123 LEU C CD2 1 
ATOM   3712  N  N   . GLN C  3  46  ? 2.392   6.296   216.293  1.00 55.51  ? 124 GLN C N   1 
ATOM   3713  C  CA  . GLN C  3  46  ? 2.101   4.991   216.875  1.00 60.39  ? 124 GLN C CA  1 
ATOM   3714  C  C   . GLN C  3  46  ? 2.257   5.129   218.382  1.00 62.85  ? 124 GLN C C   1 
ATOM   3715  O  O   . GLN C  3  46  ? 1.344   4.803   219.139  1.00 56.69  ? 124 GLN C O   1 
ATOM   3716  C  CB  . GLN C  3  46  ? 3.063   3.923   216.347  1.00 73.66  ? 124 GLN C CB  1 
ATOM   3717  C  CG  . GLN C  3  46  ? 2.558   3.186   215.121  1.00 86.38  ? 124 GLN C CG  1 
ATOM   3718  C  CD  . GLN C  3  46  ? 1.113   2.751   215.286  1.00 103.34 ? 124 GLN C CD  1 
ATOM   3719  O  OE1 . GLN C  3  46  ? 0.722   2.244   216.340  1.00 110.16 ? 124 GLN C OE1 1 
ATOM   3720  N  NE2 . GLN C  3  46  ? 0.312   2.947   214.245  1.00 107.83 ? 124 GLN C NE2 1 
ATOM   3721  N  N   . GLN C  3  47  ? 3.419   5.640   218.792  1.00 69.28  ? 125 GLN C N   1 
ATOM   3722  C  CA  . GLN C  3  47  ? 3.767   5.872   220.196  1.00 69.19  ? 125 GLN C CA  1 
ATOM   3723  C  C   . GLN C  3  47  ? 2.754   6.789   220.893  1.00 69.62  ? 125 GLN C C   1 
ATOM   3724  O  O   . GLN C  3  47  ? 2.286   6.490   221.993  1.00 70.06  ? 125 GLN C O   1 
ATOM   3725  C  CB  . GLN C  3  47  ? 5.169   6.494   220.280  1.00 73.45  ? 125 GLN C CB  1 
ATOM   3726  C  CG  . GLN C  3  47  ? 5.259   7.814   221.079  1.00 85.00  ? 125 GLN C CG  1 
ATOM   3727  C  CD  . GLN C  3  47  ? 6.061   8.920   220.361  1.00 91.35  ? 125 GLN C CD  1 
ATOM   3728  O  OE1 . GLN C  3  47  ? 7.189   8.700   219.903  1.00 89.53  ? 125 GLN C OE1 1 
ATOM   3729  N  NE2 . GLN C  3  47  ? 5.477   10.117  220.277  1.00 65.30  ? 125 GLN C NE2 1 
ATOM   3730  N  N   . GLN C  3  48  ? 2.424   7.907   220.256  1.00 63.24  ? 126 GLN C N   1 
ATOM   3731  C  CA  . GLN C  3  48  ? 1.462   8.851   220.825  1.00 66.19  ? 126 GLN C CA  1 
ATOM   3732  C  C   . GLN C  3  48  ? 0.093   8.198   221.067  1.00 61.86  ? 126 GLN C C   1 
ATOM   3733  O  O   . GLN C  3  48  ? -0.618  8.530   222.027  1.00 48.00  ? 126 GLN C O   1 
ATOM   3734  C  CB  . GLN C  3  48  ? 1.329   10.086  219.909  1.00 59.89  ? 126 GLN C CB  1 
ATOM   3735  C  CG  . GLN C  3  48  ? 2.619   10.907  219.865  1.00 71.26  ? 126 GLN C CG  1 
ATOM   3736  C  CD  . GLN C  3  48  ? 2.556   12.140  218.980  1.00 79.86  ? 126 GLN C CD  1 
ATOM   3737  O  OE1 . GLN C  3  48  ? 1.621   12.943  219.056  1.00 80.09  ? 126 GLN C OE1 1 
ATOM   3738  N  NE2 . GLN C  3  48  ? 3.577   12.308  218.146  1.00 86.29  ? 126 GLN C NE2 1 
ATOM   3739  N  N   . LEU C  3  49  ? -0.265  7.254   220.203  1.00 57.24  ? 127 LEU C N   1 
ATOM   3740  C  CA  . LEU C  3  49  ? -1.537  6.574   220.336  1.00 54.07  ? 127 LEU C CA  1 
ATOM   3741  C  C   . LEU C  3  49  ? -1.568  5.722   221.596  1.00 61.52  ? 127 LEU C C   1 
ATOM   3742  O  O   . LEU C  3  49  ? -2.538  5.762   222.351  1.00 61.84  ? 127 LEU C O   1 
ATOM   3743  C  CB  . LEU C  3  49  ? -1.811  5.697   219.113  1.00 49.83  ? 127 LEU C CB  1 
ATOM   3744  C  CG  . LEU C  3  49  ? -3.077  4.848   219.272  1.00 47.06  ? 127 LEU C CG  1 
ATOM   3745  C  CD1 . LEU C  3  49  ? -4.282  5.748   219.482  1.00 41.34  ? 127 LEU C CD1 1 
ATOM   3746  C  CD2 . LEU C  3  49  ? -3.257  3.955   218.058  1.00 21.65  ? 127 LEU C CD2 1 
ATOM   3747  N  N   . VAL C  3  50  ? -0.522  4.940   221.833  1.00 57.93  ? 128 VAL C N   1 
ATOM   3748  C  CA  . VAL C  3  50  ? -0.521  4.124   223.036  1.00 60.97  ? 128 VAL C CA  1 
ATOM   3749  C  C   . VAL C  3  50  ? -0.456  5.059   224.240  1.00 62.89  ? 128 VAL C C   1 
ATOM   3750  O  O   . VAL C  3  50  ? -1.117  4.831   225.247  1.00 67.34  ? 128 VAL C O   1 
ATOM   3751  C  CB  . VAL C  3  50  ? 0.666   3.139   223.069  1.00 54.72  ? 128 VAL C CB  1 
ATOM   3752  C  CG1 . VAL C  3  50  ? 0.834   2.499   221.703  1.00 57.20  ? 128 VAL C CG1 1 
ATOM   3753  C  CG2 . VAL C  3  50  ? 1.933   3.844   223.513  1.00 55.69  ? 128 VAL C CG2 1 
ATOM   3754  N  N   . ASP C  3  51  ? 0.323   6.126   224.122  1.00 62.95  ? 129 ASP C N   1 
ATOM   3755  C  CA  . ASP C  3  51  ? 0.456   7.094   225.208  1.00 69.51  ? 129 ASP C CA  1 
ATOM   3756  C  C   . ASP C  3  51  ? -0.876  7.715   225.603  1.00 66.47  ? 129 ASP C C   1 
ATOM   3757  O  O   . ASP C  3  51  ? -1.198  7.828   226.788  1.00 62.21  ? 129 ASP C O   1 
ATOM   3758  C  CB  . ASP C  3  51  ? 1.421   8.212   224.809  1.00 83.13  ? 129 ASP C CB  1 
ATOM   3759  C  CG  . ASP C  3  51  ? 2.853   7.908   225.189  1.00 92.68  ? 129 ASP C CG  1 
ATOM   3760  O  OD1 . ASP C  3  51  ? 3.333   6.797   224.873  1.00 99.00  ? 129 ASP C OD1 1 
ATOM   3761  O  OD2 . ASP C  3  51  ? 3.499   8.786   225.801  1.00 94.06  ? 129 ASP C OD2 1 
ATOM   3762  N  N   . ILE C  3  52  ? -1.649  8.127   224.606  1.00 67.61  ? 130 ILE C N   1 
ATOM   3763  C  CA  . ILE C  3  52  ? -2.931  8.746   224.885  1.00 56.11  ? 130 ILE C CA  1 
ATOM   3764  C  C   . ILE C  3  52  ? -3.904  7.692   225.415  1.00 49.17  ? 130 ILE C C   1 
ATOM   3765  O  O   . ILE C  3  52  ? -4.635  7.957   226.379  1.00 55.17  ? 130 ILE C O   1 
ATOM   3766  C  CB  . ILE C  3  52  ? -3.489  9.461   223.624  1.00 43.80  ? 130 ILE C CB  1 
ATOM   3767  C  CG1 . ILE C  3  52  ? -4.676  10.341  224.001  1.00 41.39  ? 130 ILE C CG1 1 
ATOM   3768  C  CG2 . ILE C  3  52  ? -3.905  8.454   222.597  1.00 59.18  ? 130 ILE C CG2 1 
ATOM   3769  C  CD1 . ILE C  3  52  ? -4.338  11.455  224.967  1.00 47.03  ? 130 ILE C CD1 1 
ATOM   3770  N  N   . ARG C  3  53  ? -3.898  6.502   224.812  1.00 34.58  ? 131 ARG C N   1 
ATOM   3771  C  CA  . ARG C  3  53  ? -4.780  5.418   225.265  1.00 46.87  ? 131 ARG C CA  1 
ATOM   3772  C  C   . ARG C  3  53  ? -4.681  5.272   226.780  1.00 46.96  ? 131 ARG C C   1 
ATOM   3773  O  O   . ARG C  3  53  ? -5.695  5.131   227.465  1.00 58.48  ? 131 ARG C O   1 
ATOM   3774  C  CB  . ARG C  3  53  ? -4.408  4.075   224.614  1.00 47.76  ? 131 ARG C CB  1 
ATOM   3775  C  CG  . ARG C  3  53  ? -5.077  3.796   223.270  1.00 63.43  ? 131 ARG C CG  1 
ATOM   3776  C  CD  . ARG C  3  53  ? -4.407  2.637   222.539  1.00 61.13  ? 131 ARG C CD  1 
ATOM   3777  N  NE  . ARG C  3  53  ? -5.049  2.318   221.261  1.00 60.96  ? 131 ARG C NE  1 
ATOM   3778  C  CZ  . ARG C  3  53  ? -4.477  1.590   220.302  1.00 57.58  ? 131 ARG C CZ  1 
ATOM   3779  N  NH1 . ARG C  3  53  ? -3.250  1.111   220.476  1.00 52.73  ? 131 ARG C NH1 1 
ATOM   3780  N  NH2 . ARG C  3  53  ? -5.129  1.334   219.174  1.00 43.04  ? 131 ARG C NH2 1 
ATOM   3781  N  N   . GLN C  3  54  ? -3.461  5.319   227.308  1.00 41.20  ? 132 GLN C N   1 
ATOM   3782  C  CA  . GLN C  3  54  ? -3.275  5.184   228.743  1.00 46.15  ? 132 GLN C CA  1 
ATOM   3783  C  C   . GLN C  3  54  ? -3.798  6.370   229.514  1.00 53.26  ? 132 GLN C C   1 
ATOM   3784  O  O   . GLN C  3  54  ? -4.645  6.210   230.403  1.00 59.72  ? 132 GLN C O   1 
ATOM   3785  C  CB  . GLN C  3  54  ? -1.803  4.959   229.093  1.00 45.28  ? 132 GLN C CB  1 
ATOM   3786  C  CG  . GLN C  3  54  ? -1.327  3.555   228.790  1.00 70.65  ? 132 GLN C CG  1 
ATOM   3787  C  CD  . GLN C  3  54  ? -2.434  2.521   228.993  1.00 89.99  ? 132 GLN C CD  1 
ATOM   3788  O  OE1 . GLN C  3  54  ? -3.241  2.258   228.088  1.00 88.05  ? 132 GLN C OE1 1 
ATOM   3789  N  NE2 . GLN C  3  54  ? -2.491  1.945   230.192  1.00 100.19 ? 132 GLN C NE2 1 
ATOM   3790  N  N   . THR C  3  55  ? -3.317  7.563   229.174  1.00 49.68  ? 133 THR C N   1 
ATOM   3791  C  CA  . THR C  3  55  ? -3.760  8.745   229.895  1.00 57.12  ? 133 THR C CA  1 
ATOM   3792  C  C   . THR C  3  55  ? -5.280  8.870   229.910  1.00 57.03  ? 133 THR C C   1 
ATOM   3793  O  O   . THR C  3  55  ? -5.857  9.275   230.914  1.00 65.88  ? 133 THR C O   1 
ATOM   3794  C  CB  . THR C  3  55  ? -3.168  10.043  229.319  1.00 54.82  ? 133 THR C CB  1 
ATOM   3795  O  OG1 . THR C  3  55  ? -4.081  10.603  228.373  1.00 75.92  ? 133 THR C OG1 1 
ATOM   3796  C  CG2 . THR C  3  55  ? -1.840  9.770   228.637  1.00 57.39  ? 133 THR C CG2 1 
ATOM   3797  N  N   . CYS C  3  56  ? -5.944  8.503   228.820  1.00 55.88  ? 134 CYS C N   1 
ATOM   3798  C  CA  . CYS C  3  56  ? -7.392  8.638   228.804  1.00 53.83  ? 134 CYS C CA  1 
ATOM   3799  C  C   . CYS C  3  56  ? -8.181  7.409   229.230  1.00 55.64  ? 134 CYS C C   1 
ATOM   3800  O  O   . CYS C  3  56  ? -9.361  7.282   228.891  1.00 57.63  ? 134 CYS C O   1 
ATOM   3801  C  CB  . CYS C  3  56  ? -7.857  9.119   227.428  1.00 47.24  ? 134 CYS C CB  1 
ATOM   3802  S  SG  . CYS C  3  56  ? -7.253  10.789  227.063  1.00 44.92  ? 134 CYS C SG  1 
ATOM   3803  N  N   . SER C  3  57  ? -7.545  6.516   229.988  1.00 53.09  ? 135 SER C N   1 
ATOM   3804  C  CA  . SER C  3  57  ? -8.223  5.310   230.466  1.00 47.21  ? 135 SER C CA  1 
ATOM   3805  C  C   . SER C  3  57  ? -8.924  5.463   231.817  1.00 47.37  ? 135 SER C C   1 
ATOM   3806  O  O   . SER C  3  57  ? -9.825  4.686   232.139  1.00 43.99  ? 135 SER C O   1 
ATOM   3807  C  CB  . SER C  3  57  ? -7.244  4.152   230.536  1.00 36.76  ? 135 SER C CB  1 
ATOM   3808  O  OG  . SER C  3  57  ? -7.086  3.572   229.258  1.00 59.04  ? 135 SER C OG  1 
ATOM   3809  N  N   . ARG C  3  58  ? -8.524  6.465   232.598  1.00 41.77  ? 136 ARG C N   1 
ATOM   3810  C  CA  . ARG C  3  58  ? -9.120  6.700   233.906  1.00 40.25  ? 136 ARG C CA  1 
ATOM   3811  C  C   . ARG C  3  58  ? -10.404 7.515   233.764  1.00 44.33  ? 136 ARG C C   1 
ATOM   3812  O  O   . ARG C  3  58  ? -10.488 8.406   232.928  1.00 55.08  ? 136 ARG C O   1 
ATOM   3813  C  CB  . ARG C  3  58  ? -8.132  7.442   234.799  1.00 50.71  ? 136 ARG C CB  1 
ATOM   3814  C  CG  . ARG C  3  58  ? -6.694  6.985   234.640  1.00 74.47  ? 136 ARG C CG  1 
ATOM   3815  C  CD  . ARG C  3  58  ? -5.767  7.606   235.691  1.00 98.74  ? 136 ARG C CD  1 
ATOM   3816  N  NE  . ARG C  3  58  ? -5.706  6.834   236.938  1.00 116.22 ? 136 ARG C NE  1 
ATOM   3817  C  CZ  . ARG C  3  58  ? -6.705  6.701   237.812  1.00 123.39 ? 136 ARG C CZ  1 
ATOM   3818  N  NH1 . ARG C  3  58  ? -7.875  7.291   237.597  1.00 126.86 ? 136 ARG C NH1 1 
ATOM   3819  N  NH2 . ARG C  3  58  ? -6.536  5.969   238.909  1.00 121.23 ? 136 ARG C NH2 1 
ATOM   3820  N  N   . PRO C  3  59  ? -11.356 7.171   234.522  1.00 35.42  ? 137 PRO C N   1 
ATOM   3821  C  CA  . PRO C  3  59  ? -12.673 7.847   234.697  1.00 35.06  ? 137 PRO C CA  1 
ATOM   3822  C  C   . PRO C  3  59  ? -12.725 9.092   235.544  1.00 42.89  ? 137 PRO C C   1 
ATOM   3823  O  O   . PRO C  3  59  ? -11.942 9.158   236.454  1.00 44.70  ? 137 PRO C O   1 
ATOM   3824  C  CB  . PRO C  3  59  ? -13.565 6.728   235.220  1.00 28.65  ? 137 PRO C CB  1 
ATOM   3825  C  CG  . PRO C  3  59  ? -13.037 5.545   234.471  1.00 41.01  ? 137 PRO C CG  1 
ATOM   3826  C  CD  . PRO C  3  59  ? -11.659 5.828   234.042  1.00 42.30  ? 137 PRO C CD  1 
ATOM   3827  N  N   . CYS C  3  60  ? -13.621 10.002  235.269  1.00 40.36  ? 138 CYS C N   1 
ATOM   3828  C  CA  . CYS C  3  60  ? -13.724 11.154  236.133  1.00 44.44  ? 138 CYS C CA  1 
ATOM   3829  C  C   . CYS C  3  60  ? -13.791 10.771  237.592  1.00 54.13  ? 138 CYS C C   1 
ATOM   3830  O  O   . CYS C  3  60  ? -14.226 9.666   237.938  1.00 51.11  ? 138 CYS C O   1 
ATOM   3831  C  CB  . CYS C  3  60  ? -14.983 11.942  235.820  1.00 50.07  ? 138 CYS C CB  1 
ATOM   3832  S  SG  . CYS C  3  60  ? -15.195 12.296  234.074  1.00 45.88  ? 138 CYS C SG  1 
ATOM   3833  N  N   . GLN C  3  61  ? -13.375 11.718  238.432  1.00 58.97  ? 139 GLN C N   1 
ATOM   3834  C  CA  . GLN C  3  61  ? -13.406 11.577  239.878  1.00 55.05  ? 139 GLN C CA  1 
ATOM   3835  C  C   . GLN C  3  61  ? -14.772 12.072  240.326  1.00 54.89  ? 139 GLN C C   1 
ATOM   3836  O  O   . GLN C  3  61  ? -15.198 13.172  239.955  1.00 54.70  ? 139 GLN C O   1 
ATOM   3837  C  CB  . GLN C  3  61  ? -12.321 12.440  240.520  1.00 59.18  ? 139 GLN C CB  1 
ATOM   3838  C  CG  . GLN C  3  61  ? -10.925 11.890  240.381  1.00 78.47  ? 139 GLN C CG  1 
ATOM   3839  C  CD  . GLN C  3  61  ? -10.744 10.589  241.149  1.00 93.51  ? 139 GLN C CD  1 
ATOM   3840  O  OE1 . GLN C  3  61  ? -10.852 10.556  242.379  1.00 92.71  ? 139 GLN C OE1 1 
ATOM   3841  N  NE2 . GLN C  3  61  ? -10.470 9.506   240.425  1.00 99.70  ? 139 GLN C NE2 1 
ATOM   3842  N  N   . ASP C  3  62  ? -15.469 11.254  241.100  1.00 47.81  ? 140 ASP C N   1 
ATOM   3843  C  CA  . ASP C  3  62  ? -16.777 11.629  241.609  1.00 49.09  ? 140 ASP C CA  1 
ATOM   3844  C  C   . ASP C  3  62  ? -16.516 12.326  242.943  1.00 55.83  ? 140 ASP C C   1 
ATOM   3845  O  O   . ASP C  3  62  ? -16.627 11.712  244.005  1.00 65.54  ? 140 ASP C O   1 
ATOM   3846  C  CB  . ASP C  3  62  ? -17.620 10.378  241.818  1.00 44.22  ? 140 ASP C CB  1 
ATOM   3847  C  CG  . ASP C  3  62  ? -19.039 10.693  242.185  1.00 51.87  ? 140 ASP C CG  1 
ATOM   3848  O  OD1 . ASP C  3  62  ? -19.831 9.736   242.290  1.00 73.58  ? 140 ASP C OD1 1 
ATOM   3849  O  OD2 . ASP C  3  62  ? -19.365 11.888  242.366  1.00 56.70  ? 140 ASP C OD2 1 
ATOM   3850  N  N   . THR C  3  63  ? -16.159 13.606  242.878  1.00 53.22  ? 141 THR C N   1 
ATOM   3851  C  CA  . THR C  3  63  ? -15.835 14.383  244.065  1.00 48.33  ? 141 THR C CA  1 
ATOM   3852  C  C   . THR C  3  63  ? -16.887 14.299  245.157  1.00 52.79  ? 141 THR C C   1 
ATOM   3853  O  O   . THR C  3  63  ? -16.556 14.128  246.336  1.00 57.56  ? 141 THR C O   1 
ATOM   3854  C  CB  . THR C  3  63  ? -15.612 15.844  243.708  1.00 47.67  ? 141 THR C CB  1 
ATOM   3855  O  OG1 . THR C  3  63  ? -16.848 16.421  243.279  1.00 48.91  ? 141 THR C OG1 1 
ATOM   3856  C  CG2 . THR C  3  63  ? -14.602 15.954  242.586  1.00 35.93  ? 141 THR C CG2 1 
ATOM   3857  N  N   . THR C  3  64  ? -18.152 14.422  244.774  1.00 41.80  ? 142 THR C N   1 
ATOM   3858  C  CA  . THR C  3  64  ? -19.217 14.339  245.758  1.00 51.33  ? 142 THR C CA  1 
ATOM   3859  C  C   . THR C  3  64  ? -19.075 13.033  246.535  1.00 51.26  ? 142 THR C C   1 
ATOM   3860  O  O   . THR C  3  64  ? -19.019 13.016  247.770  1.00 50.42  ? 142 THR C O   1 
ATOM   3861  C  CB  . THR C  3  64  ? -20.589 14.405  245.081  1.00 37.56  ? 142 THR C CB  1 
ATOM   3862  O  OG1 . THR C  3  64  ? -20.871 15.765  244.744  1.00 60.76  ? 142 THR C OG1 1 
ATOM   3863  C  CG2 . THR C  3  64  ? -21.689 13.880  246.004  1.00 44.63  ? 142 THR C CG2 1 
ATOM   3864  N  N   . ALA C  3  65  ? -18.994 11.938  245.798  1.00 48.49  ? 143 ALA C N   1 
ATOM   3865  C  CA  . ALA C  3  65  ? -18.853 10.635  246.417  1.00 50.77  ? 143 ALA C CA  1 
ATOM   3866  C  C   . ALA C  3  65  ? -17.575 10.583  247.236  1.00 48.05  ? 143 ALA C C   1 
ATOM   3867  O  O   . ALA C  3  65  ? -17.500 9.869   248.235  1.00 50.23  ? 143 ALA C O   1 
ATOM   3868  C  CB  . ALA C  3  65  ? -18.841 9.550   245.353  1.00 40.94  ? 143 ALA C CB  1 
ATOM   3869  N  N   . ASN C  3  66  ? -16.572 11.342  246.815  1.00 40.62  ? 144 ASN C N   1 
ATOM   3870  C  CA  . ASN C  3  66  ? -15.311 11.364  247.528  1.00 53.22  ? 144 ASN C CA  1 
ATOM   3871  C  C   . ASN C  3  66  ? -15.402 12.132  248.862  1.00 53.81  ? 144 ASN C C   1 
ATOM   3872  O  O   . ASN C  3  66  ? -14.506 12.040  249.704  1.00 55.93  ? 144 ASN C O   1 
ATOM   3873  C  CB  . ASN C  3  66  ? -14.229 11.969  246.636  1.00 69.67  ? 144 ASN C CB  1 
ATOM   3874  C  CG  . ASN C  3  66  ? -12.879 12.040  247.328  1.00 99.57  ? 144 ASN C CG  1 
ATOM   3875  O  OD1 . ASN C  3  66  ? -12.363 11.028  247.818  1.00 108.72 ? 144 ASN C OD1 1 
ATOM   3876  N  ND2 . ASN C  3  66  ? -12.296 13.239  247.373  1.00 99.95  ? 144 ASN C ND2 1 
ATOM   3877  N  N   . LYS C  3  67  ? -16.481 12.878  249.066  1.00 44.55  ? 145 LYS C N   1 
ATOM   3878  C  CA  . LYS C  3  67  ? -16.622 13.625  250.305  1.00 38.32  ? 145 LYS C CA  1 
ATOM   3879  C  C   . LYS C  3  67  ? -17.587 12.986  251.286  1.00 44.79  ? 145 LYS C C   1 
ATOM   3880  O  O   . LYS C  3  67  ? -18.101 13.650  252.186  1.00 57.34  ? 145 LYS C O   1 
ATOM   3881  C  CB  . LYS C  3  67  ? -17.044 15.060  250.014  1.00 40.44  ? 145 LYS C CB  1 
ATOM   3882  C  CG  . LYS C  3  67  ? -15.980 15.850  249.288  1.00 39.85  ? 145 LYS C CG  1 
ATOM   3883  C  CD  . LYS C  3  67  ? -16.479 17.226  248.924  1.00 52.51  ? 145 LYS C CD  1 
ATOM   3884  C  CE  . LYS C  3  67  ? -15.489 17.946  248.031  1.00 54.16  ? 145 LYS C CE  1 
ATOM   3885  N  NZ  . LYS C  3  67  ? -16.043 19.233  247.525  1.00 61.54  ? 145 LYS C NZ  1 
ATOM   3886  N  N   . ILE C  3  68  ? -17.831 11.692  251.118  1.00 43.59  ? 146 ILE C N   1 
ATOM   3887  C  CA  . ILE C  3  68  ? -18.723 10.963  252.013  1.00 41.15  ? 146 ILE C CA  1 
ATOM   3888  C  C   . ILE C  3  68  ? -17.818 10.252  253.002  1.00 45.73  ? 146 ILE C C   1 
ATOM   3889  O  O   . ILE C  3  68  ? -17.158 9.271   252.657  1.00 47.02  ? 146 ILE C O   1 
ATOM   3890  C  CB  . ILE C  3  68  ? -19.562 9.902   251.252  1.00 38.50  ? 146 ILE C CB  1 
ATOM   3891  C  CG1 . ILE C  3  68  ? -20.405 10.575  250.172  1.00 39.09  ? 146 ILE C CG1 1 
ATOM   3892  C  CG2 . ILE C  3  68  ? -20.453 9.136   252.223  1.00 39.38  ? 146 ILE C CG2 1 
ATOM   3893  C  CD1 . ILE C  3  68  ? -21.416 9.666   249.548  1.00 36.90  ? 146 ILE C CD1 1 
ATOM   3894  N  N   . SER C  3  69  ? -17.780 10.751  254.230  1.00 51.11  ? 147 SER C N   1 
ATOM   3895  C  CA  . SER C  3  69  ? -16.937 10.161  255.263  1.00 50.87  ? 147 SER C CA  1 
ATOM   3896  C  C   . SER C  3  69  ? -17.203 8.685   255.530  1.00 55.43  ? 147 SER C C   1 
ATOM   3897  O  O   . SER C  3  69  ? -18.293 8.166   255.290  1.00 50.80  ? 147 SER C O   1 
ATOM   3898  C  CB  . SER C  3  69  ? -17.091 10.932  256.577  1.00 59.50  ? 147 SER C CB  1 
ATOM   3899  O  OG  . SER C  3  69  ? -16.211 10.442  257.573  1.00 57.11  ? 147 SER C OG  1 
ATOM   3900  N  N   . PRO C  3  70  ? -16.180 7.983   256.022  1.00 63.03  ? 148 PRO C N   1 
ATOM   3901  C  CA  . PRO C  3  70  ? -16.239 6.557   256.351  1.00 60.13  ? 148 PRO C CA  1 
ATOM   3902  C  C   . PRO C  3  70  ? -16.757 6.340   257.775  1.00 61.08  ? 148 PRO C C   1 
ATOM   3903  O  O   . PRO C  3  70  ? -17.009 5.208   258.179  1.00 58.48  ? 148 PRO C O   1 
ATOM   3904  C  CB  . PRO C  3  70  ? -14.787 6.108   256.203  1.00 68.08  ? 148 PRO C CB  1 
ATOM   3905  C  CG  . PRO C  3  70  ? -14.177 7.153   255.288  1.00 64.13  ? 148 PRO C CG  1 
ATOM   3906  C  CD  . PRO C  3  70  ? -14.785 8.403   255.825  1.00 63.44  ? 148 PRO C CD  1 
ATOM   3907  N  N   . ILE C  3  71  ? -16.907 7.433   258.526  1.00 55.93  ? 149 ILE C N   1 
ATOM   3908  C  CA  . ILE C  3  71  ? -17.399 7.387   259.903  1.00 50.92  ? 149 ILE C CA  1 
ATOM   3909  C  C   . ILE C  3  71  ? -18.921 7.169   259.945  1.00 58.61  ? 149 ILE C C   1 
ATOM   3910  O  O   . ILE C  3  71  ? -19.634 7.600   259.036  1.00 69.21  ? 149 ILE C O   1 
ATOM   3911  C  CB  . ILE C  3  71  ? -17.053 8.685   260.612  1.00 50.55  ? 149 ILE C CB  1 
ATOM   3912  C  CG1 . ILE C  3  71  ? -15.565 8.969   260.439  1.00 46.36  ? 149 ILE C CG1 1 
ATOM   3913  C  CG2 . ILE C  3  71  ? -17.405 8.588   262.078  1.00 60.00  ? 149 ILE C CG2 1 
ATOM   3914  C  CD1 . ILE C  3  71  ? -15.167 10.325  260.928  1.00 44.09  ? 149 ILE C CD1 1 
ATOM   3915  N  N   . THR C  3  72  ? -19.419 6.517   260.999  1.00 53.53  ? 150 THR C N   1 
ATOM   3916  C  CA  . THR C  3  72  ? -20.852 6.214   261.122  1.00 50.76  ? 150 THR C CA  1 
ATOM   3917  C  C   . THR C  3  72  ? -21.396 6.402   262.533  1.00 59.63  ? 150 THR C C   1 
ATOM   3918  O  O   . THR C  3  72  ? -20.760 7.049   263.367  1.00 72.19  ? 150 THR C O   1 
ATOM   3919  C  CB  . THR C  3  72  ? -21.120 4.761   260.709  1.00 47.04  ? 150 THR C CB  1 
ATOM   3920  O  OG1 . THR C  3  72  ? -20.401 4.490   259.504  1.00 75.62  ? 150 THR C OG1 1 
ATOM   3921  C  CG2 . THR C  3  72  ? -22.599 4.517   260.449  1.00 49.25  ? 150 THR C CG2 1 
ATOM   3922  N  N   . GLY C  3  73  ? -22.573 5.834   262.795  1.00 55.10  ? 151 GLY C N   1 
ATOM   3923  C  CA  . GLY C  3  73  ? -23.186 5.944   264.110  1.00 60.73  ? 151 GLY C CA  1 
ATOM   3924  C  C   . GLY C  3  73  ? -24.707 5.901   264.120  1.00 62.48  ? 151 GLY C C   1 
ATOM   3925  O  O   . GLY C  3  73  ? -25.334 6.000   263.066  1.00 72.21  ? 151 GLY C O   1 
ATOM   3926  N  N   . LYS C  3  74  ? -25.294 5.742   265.308  1.00 54.50  ? 152 LYS C N   1 
ATOM   3927  C  CA  . LYS C  3  74  ? -26.749 5.700   265.485  1.00 61.48  ? 152 LYS C CA  1 
ATOM   3928  C  C   . LYS C  3  74  ? -27.385 6.877   264.756  1.00 61.61  ? 152 LYS C C   1 
ATOM   3929  O  O   . LYS C  3  74  ? -28.458 6.769   264.166  1.00 66.34  ? 152 LYS C O   1 
ATOM   3930  C  CB  . LYS C  3  74  ? -27.118 5.844   266.961  1.00 65.75  ? 152 LYS C CB  1 
ATOM   3931  C  CG  . LYS C  3  74  ? -26.423 4.898   267.912  1.00 90.04  ? 152 LYS C CG  1 
ATOM   3932  C  CD  . LYS C  3  74  ? -26.454 5.459   269.340  1.00 102.32 ? 152 LYS C CD  1 
ATOM   3933  C  CE  . LYS C  3  74  ? -27.877 5.678   269.868  1.00 103.84 ? 152 LYS C CE  1 
ATOM   3934  N  NZ  . LYS C  3  74  ? -28.630 4.406   270.100  1.00 95.07  ? 152 LYS C NZ  1 
ATOM   3935  N  N   . ASP C  3  75  ? -26.710 8.013   264.847  1.00 57.97  ? 153 ASP C N   1 
ATOM   3936  C  CA  . ASP C  3  75  ? -27.156 9.250   264.242  1.00 51.63  ? 153 ASP C CA  1 
ATOM   3937  C  C   . ASP C  3  75  ? -25.922 10.120  264.069  1.00 52.35  ? 153 ASP C C   1 
ATOM   3938  O  O   . ASP C  3  75  ? -24.808 9.682   264.339  1.00 56.39  ? 153 ASP C O   1 
ATOM   3939  C  CB  . ASP C  3  75  ? -28.146 9.952   265.160  1.00 59.70  ? 153 ASP C CB  1 
ATOM   3940  C  CG  . ASP C  3  75  ? -27.572 10.207  266.537  1.00 70.08  ? 153 ASP C CG  1 
ATOM   3941  O  OD1 . ASP C  3  75  ? -26.367 10.522  266.619  1.00 74.49  ? 153 ASP C OD1 1 
ATOM   3942  O  OD2 . ASP C  3  75  ? -28.318 10.103  267.535  1.00 71.05  ? 153 ASP C OD2 1 
ATOM   3943  N  N   . CYS C  3  76  ? -26.125 11.359  263.643  1.00 52.57  ? 154 CYS C N   1 
ATOM   3944  C  CA  . CYS C  3  76  ? -25.017 12.268  263.418  1.00 55.74  ? 154 CYS C CA  1 
ATOM   3945  C  C   . CYS C  3  76  ? -24.210 12.579  264.659  1.00 60.62  ? 154 CYS C C   1 
ATOM   3946  O  O   . CYS C  3  76  ? -23.030 12.920  264.570  1.00 57.42  ? 154 CYS C O   1 
ATOM   3947  C  CB  . CYS C  3  76  ? -25.520 13.560  262.807  1.00 56.72  ? 154 CYS C CB  1 
ATOM   3948  S  SG  . CYS C  3  76  ? -25.916 13.407  261.047  1.00 59.81  ? 154 CYS C SG  1 
ATOM   3949  N  N   . GLN C  3  77  ? -24.841 12.480  265.820  1.00 65.31  ? 155 GLN C N   1 
ATOM   3950  C  CA  . GLN C  3  77  ? -24.116 12.738  267.057  1.00 68.96  ? 155 GLN C CA  1 
ATOM   3951  C  C   . GLN C  3  77  ? -23.075 11.637  267.240  1.00 68.18  ? 155 GLN C C   1 
ATOM   3952  O  O   . GLN C  3  77  ? -21.878 11.918  267.323  1.00 66.45  ? 155 GLN C O   1 
ATOM   3953  C  CB  . GLN C  3  77  ? -25.062 12.763  268.261  1.00 66.85  ? 155 GLN C CB  1 
ATOM   3954  C  CG  . GLN C  3  77  ? -24.361 13.095  269.564  1.00 63.71  ? 155 GLN C CG  1 
ATOM   3955  C  CD  . GLN C  3  77  ? -23.470 14.321  269.436  1.00 72.96  ? 155 GLN C CD  1 
ATOM   3956  O  OE1 . GLN C  3  77  ? -23.913 15.386  269.010  1.00 76.34  ? 155 GLN C OE1 1 
ATOM   3957  N  NE2 . GLN C  3  77  ? -22.206 14.175  269.809  1.00 79.69  ? 155 GLN C NE2 1 
ATOM   3958  N  N   . GLN C  3  78  ? -23.523 10.382  267.283  1.00 59.08  ? 156 GLN C N   1 
ATOM   3959  C  CA  . GLN C  3  78  ? -22.583 9.291   267.452  1.00 56.55  ? 156 GLN C CA  1 
ATOM   3960  C  C   . GLN C  3  78  ? -21.446 9.481   266.469  1.00 52.97  ? 156 GLN C C   1 
ATOM   3961  O  O   . GLN C  3  78  ? -20.298 9.201   266.780  1.00 65.26  ? 156 GLN C O   1 
ATOM   3962  C  CB  . GLN C  3  78  ? -23.245 7.927   267.230  1.00 51.98  ? 156 GLN C CB  1 
ATOM   3963  C  CG  . GLN C  3  78  ? -22.238 6.782   267.383  1.00 65.53  ? 156 GLN C CG  1 
ATOM   3964  C  CD  . GLN C  3  78  ? -22.866 5.437   267.710  1.00 75.61  ? 156 GLN C CD  1 
ATOM   3965  O  OE1 . GLN C  3  78  ? -23.593 5.304   268.695  1.00 77.71  ? 156 GLN C OE1 1 
ATOM   3966  N  NE2 . GLN C  3  78  ? -22.572 4.425   266.893  1.00 82.63  ? 156 GLN C NE2 1 
ATOM   3967  N  N   . VAL C  3  79  ? -21.772 9.980   265.286  1.00 49.37  ? 157 VAL C N   1 
ATOM   3968  C  CA  . VAL C  3  79  ? -20.776 10.222  264.255  1.00 50.54  ? 157 VAL C CA  1 
ATOM   3969  C  C   . VAL C  3  79  ? -19.708 11.163  264.776  1.00 54.36  ? 157 VAL C C   1 
ATOM   3970  O  O   . VAL C  3  79  ? -18.518 10.919  264.591  1.00 60.35  ? 157 VAL C O   1 
ATOM   3971  C  CB  . VAL C  3  79  ? -21.420 10.823  262.989  1.00 43.42  ? 157 VAL C CB  1 
ATOM   3972  C  CG1 . VAL C  3  79  ? -20.348 11.302  262.010  1.00 23.61  ? 157 VAL C CG1 1 
ATOM   3973  C  CG2 . VAL C  3  79  ? -22.299 9.775   262.325  1.00 47.83  ? 157 VAL C CG2 1 
ATOM   3974  N  N   . VAL C  3  80  ? -20.130 12.241  265.423  1.00 59.00  ? 158 VAL C N   1 
ATOM   3975  C  CA  . VAL C  3  80  ? -19.175 13.192  265.979  1.00 71.73  ? 158 VAL C CA  1 
ATOM   3976  C  C   . VAL C  3  80  ? -18.391 12.474  267.077  1.00 73.22  ? 158 VAL C C   1 
ATOM   3977  O  O   . VAL C  3  80  ? -17.176 12.661  267.234  1.00 75.18  ? 158 VAL C O   1 
ATOM   3978  C  CB  . VAL C  3  80  ? -19.893 14.424  266.581  1.00 65.70  ? 158 VAL C CB  1 
ATOM   3979  C  CG1 . VAL C  3  80  ? -18.897 15.305  267.311  1.00 71.00  ? 158 VAL C CG1 1 
ATOM   3980  C  CG2 . VAL C  3  80  ? -20.558 15.217  265.482  1.00 70.91  ? 158 VAL C CG2 1 
ATOM   3981  N  N   . ASP C  3  81  ? -19.110 11.638  267.819  1.00 67.29  ? 159 ASP C N   1 
ATOM   3982  C  CA  . ASP C  3  81  ? -18.536 10.866  268.909  1.00 67.23  ? 159 ASP C CA  1 
ATOM   3983  C  C   . ASP C  3  81  ? -17.569 9.824   268.375  1.00 66.71  ? 159 ASP C C   1 
ATOM   3984  O  O   . ASP C  3  81  ? -16.897 9.149   269.149  1.00 82.02  ? 159 ASP C O   1 
ATOM   3985  C  CB  . ASP C  3  81  ? -19.644 10.151  269.693  1.00 67.02  ? 159 ASP C CB  1 
ATOM   3986  C  CG  . ASP C  3  81  ? -20.589 11.114  270.386  1.00 73.37  ? 159 ASP C CG  1 
ATOM   3987  O  OD1 . ASP C  3  81  ? -21.616 10.651  270.927  1.00 76.43  ? 159 ASP C OD1 1 
ATOM   3988  O  OD2 . ASP C  3  81  ? -20.305 12.332  270.396  1.00 73.44  ? 159 ASP C OD2 1 
ATOM   3989  N  N   . ASN C  3  82  ? -17.501 9.682   267.056  1.00 55.65  ? 160 ASN C N   1 
ATOM   3990  C  CA  . ASN C  3  82  ? -16.622 8.694   266.461  1.00 42.22  ? 160 ASN C CA  1 
ATOM   3991  C  C   . ASN C  3  82  ? -15.530 9.314   265.626  1.00 54.14  ? 160 ASN C C   1 
ATOM   3992  O  O   . ASN C  3  82  ? -14.791 8.603   264.943  1.00 57.51  ? 160 ASN C O   1 
ATOM   3993  C  CB  . ASN C  3  82  ? -17.437 7.717   265.619  1.00 51.94  ? 160 ASN C CB  1 
ATOM   3994  C  CG  . ASN C  3  82  ? -18.151 6.682   266.467  1.00 66.65  ? 160 ASN C CG  1 
ATOM   3995  O  OD1 . ASN C  3  82  ? -19.058 5.991   266.002  1.00 74.96  ? 160 ASN C OD1 1 
ATOM   3996  N  ND2 . ASN C  3  82  ? -17.731 6.561   267.720  1.00 76.21  ? 160 ASN C ND2 1 
ATOM   3997  N  N   . GLY C  3  83  ? -15.420 10.640  265.680  1.00 57.47  ? 161 GLY C N   1 
ATOM   3998  C  CA  . GLY C  3  83  ? -14.386 11.320  264.916  1.00 55.52  ? 161 GLY C CA  1 
ATOM   3999  C  C   . GLY C  3  83  ? -14.898 12.343  263.916  1.00 57.56  ? 161 GLY C C   1 
ATOM   4000  O  O   . GLY C  3  83  ? -14.142 13.175  263.403  1.00 50.11  ? 161 GLY C O   1 
ATOM   4001  N  N   . GLY C  3  84  ? -16.188 12.283  263.625  1.00 63.16  ? 162 GLY C N   1 
ATOM   4002  C  CA  . GLY C  3  84  ? -16.751 13.224  262.682  1.00 65.30  ? 162 GLY C CA  1 
ATOM   4003  C  C   . GLY C  3  84  ? -16.376 14.629  263.076  1.00 60.91  ? 162 GLY C C   1 
ATOM   4004  O  O   . GLY C  3  84  ? -16.710 15.076  264.169  1.00 71.20  ? 162 GLY C O   1 
ATOM   4005  N  N   . LYS C  3  85  ? -15.672 15.328  262.197  1.00 59.06  ? 163 LYS C N   1 
ATOM   4006  C  CA  . LYS C  3  85  ? -15.268 16.693  262.488  1.00 67.09  ? 163 LYS C CA  1 
ATOM   4007  C  C   . LYS C  3  85  ? -16.025 17.743  261.662  1.00 68.62  ? 163 LYS C C   1 
ATOM   4008  O  O   . LYS C  3  85  ? -16.624 18.660  262.217  1.00 67.90  ? 163 LYS C O   1 
ATOM   4009  C  CB  . LYS C  3  85  ? -13.762 16.854  262.269  1.00 77.39  ? 163 LYS C CB  1 
ATOM   4010  C  CG  . LYS C  3  85  ? -13.265 18.275  262.486  1.00 90.05  ? 163 LYS C CG  1 
ATOM   4011  C  CD  . LYS C  3  85  ? -11.869 18.494  261.915  1.00 102.92 ? 163 LYS C CD  1 
ATOM   4012  C  CE  . LYS C  3  85  ? -11.482 19.969  261.964  1.00 105.59 ? 163 LYS C CE  1 
ATOM   4013  N  NZ  . LYS C  3  85  ? -10.195 20.244  261.264  1.00 109.13 ? 163 LYS C NZ  1 
ATOM   4014  N  N   . ASP C  3  86  ? -16.015 17.607  260.340  1.00 72.04  ? 164 ASP C N   1 
ATOM   4015  C  CA  . ASP C  3  86  ? -16.682 18.582  259.478  1.00 72.97  ? 164 ASP C CA  1 
ATOM   4016  C  C   . ASP C  3  86  ? -18.076 18.191  259.012  1.00 75.00  ? 164 ASP C C   1 
ATOM   4017  O  O   . ASP C  3  86  ? -18.392 17.008  258.903  1.00 78.75  ? 164 ASP C O   1 
ATOM   4018  C  CB  . ASP C  3  86  ? -15.810 18.853  258.263  1.00 75.96  ? 164 ASP C CB  1 
ATOM   4019  C  CG  . ASP C  3  86  ? -14.396 19.192  258.644  1.00 84.39  ? 164 ASP C CG  1 
ATOM   4020  O  OD1 . ASP C  3  86  ? -14.210 20.149  259.422  1.00 93.67  ? 164 ASP C OD1 1 
ATOM   4021  O  OD2 . ASP C  3  86  ? -13.471 18.500  258.173  1.00 94.08  ? 164 ASP C OD2 1 
ATOM   4022  N  N   . SER C  3  87  ? -18.905 19.192  258.726  1.00 68.53  ? 165 SER C N   1 
ATOM   4023  C  CA  . SER C  3  87  ? -20.265 18.942  258.259  1.00 65.69  ? 165 SER C CA  1 
ATOM   4024  C  C   . SER C  3  87  ? -20.250 18.347  256.855  1.00 63.97  ? 165 SER C C   1 
ATOM   4025  O  O   . SER C  3  87  ? -19.518 18.812  255.979  1.00 66.48  ? 165 SER C O   1 
ATOM   4026  C  CB  . SER C  3  87  ? -21.083 20.240  258.254  1.00 70.11  ? 165 SER C CB  1 
ATOM   4027  O  OG  . SER C  3  87  ? -21.380 20.675  259.570  1.00 80.44  ? 165 SER C OG  1 
ATOM   4028  N  N   . GLY C  3  88  ? -21.062 17.317  256.643  1.00 60.75  ? 166 GLY C N   1 
ATOM   4029  C  CA  . GLY C  3  88  ? -21.120 16.688  255.336  1.00 60.23  ? 166 GLY C CA  1 
ATOM   4030  C  C   . GLY C  3  88  ? -22.010 15.457  255.300  1.00 59.45  ? 166 GLY C C   1 
ATOM   4031  O  O   . GLY C  3  88  ? -22.877 15.270  256.155  1.00 56.48  ? 166 GLY C O   1 
ATOM   4032  N  N   . LEU C  3  89  ? -21.790 14.611  254.300  1.00 57.53  ? 167 LEU C N   1 
ATOM   4033  C  CA  . LEU C  3  89  ? -22.569 13.397  254.146  1.00 46.48  ? 167 LEU C CA  1 
ATOM   4034  C  C   . LEU C  3  89  ? -21.929 12.268  254.915  1.00 42.19  ? 167 LEU C C   1 
ATOM   4035  O  O   . LEU C  3  89  ? -20.710 12.114  254.912  1.00 42.06  ? 167 LEU C O   1 
ATOM   4036  C  CB  . LEU C  3  89  ? -22.645 13.009  252.676  1.00 45.72  ? 167 LEU C CB  1 
ATOM   4037  C  CG  . LEU C  3  89  ? -23.202 14.090  251.760  1.00 54.17  ? 167 LEU C CG  1 
ATOM   4038  C  CD1 . LEU C  3  89  ? -23.158 13.590  250.340  1.00 57.69  ? 167 LEU C CD1 1 
ATOM   4039  C  CD2 . LEU C  3  89  ? -24.631 14.444  252.171  1.00 63.08  ? 167 LEU C CD2 1 
ATOM   4040  N  N   . TYR C  3  90  ? -22.760 11.481  255.577  1.00 37.65  ? 168 TYR C N   1 
ATOM   4041  C  CA  . TYR C  3  90  ? -22.288 10.345  256.343  1.00 48.31  ? 168 TYR C CA  1 
ATOM   4042  C  C   . TYR C  3  90  ? -23.381 9.315   256.304  1.00 54.83  ? 168 TYR C C   1 
ATOM   4043  O  O   . TYR C  3  90  ? -24.545 9.641   256.070  1.00 53.06  ? 168 TYR C O   1 
ATOM   4044  C  CB  . TYR C  3  90  ? -22.062 10.690  257.821  1.00 55.40  ? 168 TYR C CB  1 
ATOM   4045  C  CG  . TYR C  3  90  ? -20.994 11.713  258.111  1.00 69.57  ? 168 TYR C CG  1 
ATOM   4046  C  CD1 . TYR C  3  90  ? -21.207 13.064  257.852  1.00 68.45  ? 168 TYR C CD1 1 
ATOM   4047  C  CD2 . TYR C  3  90  ? -19.774 11.332  258.671  1.00 70.49  ? 168 TYR C CD2 1 
ATOM   4048  C  CE1 . TYR C  3  90  ? -20.235 14.005  258.143  1.00 64.69  ? 168 TYR C CE1 1 
ATOM   4049  C  CE2 . TYR C  3  90  ? -18.798 12.273  258.969  1.00 61.29  ? 168 TYR C CE2 1 
ATOM   4050  C  CZ  . TYR C  3  90  ? -19.037 13.602  258.701  1.00 55.88  ? 168 TYR C CZ  1 
ATOM   4051  O  OH  . TYR C  3  90  ? -18.081 14.537  258.992  1.00 66.52  ? 168 TYR C OH  1 
ATOM   4052  N  N   . TYR C  3  91  ? -23.004 8.067   256.536  1.00 60.69  ? 169 TYR C N   1 
ATOM   4053  C  CA  . TYR C  3  91  ? -23.984 7.005   256.591  1.00 56.93  ? 169 TYR C CA  1 
ATOM   4054  C  C   . TYR C  3  91  ? -24.242 6.798   258.071  1.00 61.05  ? 169 TYR C C   1 
ATOM   4055  O  O   . TYR C  3  91  ? -23.305 6.769   258.869  1.00 68.21  ? 169 TYR C O   1 
ATOM   4056  C  CB  . TYR C  3  91  ? -23.442 5.726   255.981  1.00 49.49  ? 169 TYR C CB  1 
ATOM   4057  C  CG  . TYR C  3  91  ? -23.590 5.654   254.485  1.00 60.18  ? 169 TYR C CG  1 
ATOM   4058  C  CD1 . TYR C  3  91  ? -22.595 6.146   253.629  1.00 56.97  ? 169 TYR C CD1 1 
ATOM   4059  C  CD2 . TYR C  3  91  ? -24.717 5.062   253.916  1.00 61.03  ? 169 TYR C CD2 1 
ATOM   4060  C  CE1 . TYR C  3  91  ? -22.723 6.040   252.239  1.00 51.82  ? 169 TYR C CE1 1 
ATOM   4061  C  CE2 . TYR C  3  91  ? -24.851 4.952   252.535  1.00 57.86  ? 169 TYR C CE2 1 
ATOM   4062  C  CZ  . TYR C  3  91  ? -23.853 5.439   251.704  1.00 52.13  ? 169 TYR C CZ  1 
ATOM   4063  O  OH  . TYR C  3  91  ? -23.985 5.297   250.348  1.00 56.27  ? 169 TYR C OH  1 
ATOM   4064  N  N   . ILE C  3  92  ? -25.510 6.691   258.442  1.00 55.56  ? 170 ILE C N   1 
ATOM   4065  C  CA  . ILE C  3  92  ? -25.867 6.485   259.833  1.00 54.83  ? 170 ILE C CA  1 
ATOM   4066  C  C   . ILE C  3  92  ? -26.824 5.313   259.832  1.00 60.01  ? 170 ILE C C   1 
ATOM   4067  O  O   . ILE C  3  92  ? -27.502 5.081   258.836  1.00 62.03  ? 170 ILE C O   1 
ATOM   4068  C  CB  . ILE C  3  92  ? -26.566 7.736   260.430  1.00 59.68  ? 170 ILE C CB  1 
ATOM   4069  C  CG1 . ILE C  3  92  ? -27.952 7.914   259.822  1.00 54.63  ? 170 ILE C CG1 1 
ATOM   4070  C  CG2 . ILE C  3  92  ? -25.746 8.998   260.140  1.00 43.68  ? 170 ILE C CG2 1 
ATOM   4071  C  CD1 . ILE C  3  92  ? -28.627 9.195   260.272  1.00 52.16  ? 170 ILE C CD1 1 
ATOM   4072  N  N   . LYS C  3  93  ? -26.868 4.558   260.925  1.00 52.60  ? 171 LYS C N   1 
ATOM   4073  C  CA  . LYS C  3  93  ? -27.772 3.419   260.987  1.00 55.03  ? 171 LYS C CA  1 
ATOM   4074  C  C   . LYS C  3  93  ? -28.565 3.368   262.280  1.00 59.66  ? 171 LYS C C   1 
ATOM   4075  O  O   . LYS C  3  93  ? -28.099 2.836   263.284  1.00 59.95  ? 171 LYS C O   1 
ATOM   4076  C  CB  . LYS C  3  93  ? -27.012 2.100   260.812  1.00 47.35  ? 171 LYS C CB  1 
ATOM   4077  C  CG  . LYS C  3  93  ? -27.905 0.857   260.952  1.00 45.62  ? 171 LYS C CG  1 
ATOM   4078  C  CD  . LYS C  3  93  ? -27.125 -0.417  260.691  1.00 53.29  ? 171 LYS C CD  1 
ATOM   4079  C  CE  . LYS C  3  93  ? -28.041 -1.622  260.531  1.00 47.25  ? 171 LYS C CE  1 
ATOM   4080  N  NZ  . LYS C  3  93  ? -27.276 -2.808  260.052  1.00 51.47  ? 171 LYS C NZ  1 
ATOM   4081  N  N   . PRO C  3  94  ? -29.776 3.941   262.276  1.00 64.02  ? 172 PRO C N   1 
ATOM   4082  C  CA  . PRO C  3  94  ? -30.597 3.921   263.481  1.00 64.27  ? 172 PRO C CA  1 
ATOM   4083  C  C   . PRO C  3  94  ? -30.786 2.479   263.927  1.00 58.43  ? 172 PRO C C   1 
ATOM   4084  O  O   . PRO C  3  94  ? -30.527 1.552   263.171  1.00 50.73  ? 172 PRO C O   1 
ATOM   4085  C  CB  . PRO C  3  94  ? -31.891 4.571   263.017  1.00 68.13  ? 172 PRO C CB  1 
ATOM   4086  C  CG  . PRO C  3  94  ? -31.399 5.582   262.048  1.00 68.84  ? 172 PRO C CG  1 
ATOM   4087  C  CD  . PRO C  3  94  ? -30.393 4.789   261.243  1.00 72.35  ? 172 PRO C CD  1 
ATOM   4088  N  N   . LEU C  3  95  ? -31.239 2.303   265.158  1.00 61.25  ? 173 LEU C N   1 
ATOM   4089  C  CA  . LEU C  3  95  ? -31.426 0.982   265.716  1.00 68.11  ? 173 LEU C CA  1 
ATOM   4090  C  C   . LEU C  3  95  ? -32.101 0.001   264.775  1.00 66.42  ? 173 LEU C C   1 
ATOM   4091  O  O   . LEU C  3  95  ? -31.428 -0.786  264.117  1.00 63.86  ? 173 LEU C O   1 
ATOM   4092  C  CB  . LEU C  3  95  ? -32.215 1.075   267.025  1.00 77.85  ? 173 LEU C CB  1 
ATOM   4093  C  CG  . LEU C  3  95  ? -32.472 -0.246  267.760  1.00 86.92  ? 173 LEU C CG  1 
ATOM   4094  C  CD1 . LEU C  3  95  ? -31.146 -0.947  268.052  1.00 89.14  ? 173 LEU C CD1 1 
ATOM   4095  C  CD2 . LEU C  3  95  ? -33.244 0.027   269.046  1.00 91.36  ? 173 LEU C CD2 1 
ATOM   4096  N  N   . LYS C  3  96  ? -33.427 0.048   264.715  1.00 62.71  ? 174 LYS C N   1 
ATOM   4097  C  CA  . LYS C  3  96  ? -34.181 -0.874  263.878  1.00 64.71  ? 174 LYS C CA  1 
ATOM   4098  C  C   . LYS C  3  96  ? -33.941 -0.700  262.380  1.00 73.75  ? 174 LYS C C   1 
ATOM   4099  O  O   . LYS C  3  96  ? -34.482 -1.455  261.571  1.00 81.42  ? 174 LYS C O   1 
ATOM   4100  C  CB  . LYS C  3  96  ? -35.673 -0.743  264.169  1.00 72.37  ? 174 LYS C CB  1 
ATOM   4101  C  CG  . LYS C  3  96  ? -36.038 -0.865  265.637  1.00 85.43  ? 174 LYS C CG  1 
ATOM   4102  C  CD  . LYS C  3  96  ? -35.759 -2.255  266.180  1.00 87.86  ? 174 LYS C CD  1 
ATOM   4103  C  CE  . LYS C  3  96  ? -36.263 -2.377  267.609  1.00 87.85  ? 174 LYS C CE  1 
ATOM   4104  N  NZ  . LYS C  3  96  ? -37.711 -2.026  267.691  1.00 84.88  ? 174 LYS C NZ  1 
ATOM   4105  N  N   . ALA C  3  97  ? -33.140 0.290   262.004  1.00 69.51  ? 175 ALA C N   1 
ATOM   4106  C  CA  . ALA C  3  97  ? -32.847 0.517   260.594  1.00 60.47  ? 175 ALA C CA  1 
ATOM   4107  C  C   . ALA C  3  97  ? -32.220 -0.738  260.009  1.00 68.17  ? 175 ALA C C   1 
ATOM   4108  O  O   . ALA C  3  97  ? -31.220 -1.244  260.514  1.00 78.19  ? 175 ALA C O   1 
ATOM   4109  C  CB  . ALA C  3  97  ? -31.899 1.690   260.439  1.00 63.37  ? 175 ALA C CB  1 
ATOM   4110  N  N   . LYS C  3  98  ? -32.804 -1.238  258.932  1.00 74.02  ? 176 LYS C N   1 
ATOM   4111  C  CA  . LYS C  3  98  ? -32.305 -2.448  258.300  1.00 74.34  ? 176 LYS C CA  1 
ATOM   4112  C  C   . LYS C  3  98  ? -31.112 -2.221  257.377  1.00 78.47  ? 176 LYS C C   1 
ATOM   4113  O  O   . LYS C  3  98  ? -30.287 -3.115  257.185  1.00 84.32  ? 176 LYS C O   1 
ATOM   4114  C  CB  . LYS C  3  98  ? -33.449 -3.119  257.534  1.00 68.19  ? 176 LYS C CB  1 
ATOM   4115  C  CG  . LYS C  3  98  ? -34.227 -2.163  256.648  1.00 82.23  ? 176 LYS C CG  1 
ATOM   4116  C  CD  . LYS C  3  98  ? -35.603 -2.718  256.311  1.00 90.61  ? 176 LYS C CD  1 
ATOM   4117  C  CE  . LYS C  3  98  ? -36.406 -1.748  255.448  1.00 90.40  ? 176 LYS C CE  1 
ATOM   4118  N  NZ  . LYS C  3  98  ? -35.769 -1.516  254.121  1.00 93.36  ? 176 LYS C NZ  1 
ATOM   4119  N  N   . GLN C  3  99  ? -31.004 -1.017  256.829  1.00 82.10  ? 177 GLN C N   1 
ATOM   4120  C  CA  . GLN C  3  99  ? -29.932 -0.693  255.890  1.00 80.84  ? 177 GLN C CA  1 
ATOM   4121  C  C   . GLN C  3  99  ? -29.453 0.742   256.135  1.00 72.88  ? 177 GLN C C   1 
ATOM   4122  O  O   . GLN C  3  99  ? -30.173 1.701   255.855  1.00 85.14  ? 177 GLN C O   1 
ATOM   4123  C  CB  . GLN C  3  99  ? -30.488 -0.844  254.466  1.00 81.45  ? 177 GLN C CB  1 
ATOM   4124  C  CG  . GLN C  3  99  ? -29.470 -0.928  253.354  1.00 101.39 ? 177 GLN C CG  1 
ATOM   4125  C  CD  . GLN C  3  99  ? -30.117 -1.233  252.006  1.00 110.51 ? 177 GLN C CD  1 
ATOM   4126  O  OE1 . GLN C  3  99  ? -30.831 -2.226  251.861  1.00 115.59 ? 177 GLN C OE1 1 
ATOM   4127  N  NE2 . GLN C  3  99  ? -29.866 -0.379  251.016  1.00 110.56 ? 177 GLN C NE2 1 
ATOM   4128  N  N   . PRO C  3  100 ? -28.228 0.913   256.649  1.00 56.92  ? 178 PRO C N   1 
ATOM   4129  C  CA  . PRO C  3  100 ? -27.734 2.273   256.902  1.00 55.67  ? 178 PRO C CA  1 
ATOM   4130  C  C   . PRO C  3  100 ? -27.963 3.191   255.701  1.00 61.36  ? 178 PRO C C   1 
ATOM   4131  O  O   . PRO C  3  100 ? -27.903 2.744   254.559  1.00 65.87  ? 178 PRO C O   1 
ATOM   4132  C  CB  . PRO C  3  100 ? -26.251 2.051   257.187  1.00 49.01  ? 178 PRO C CB  1 
ATOM   4133  C  CG  . PRO C  3  100 ? -25.932 0.860   256.351  1.00 39.36  ? 178 PRO C CG  1 
ATOM   4134  C  CD  . PRO C  3  100 ? -27.114 -0.045  256.594  1.00 49.61  ? 178 PRO C CD  1 
ATOM   4135  N  N   . PHE C  3  101 ? -28.221 4.471   255.957  1.00 64.09  ? 179 PHE C N   1 
ATOM   4136  C  CA  . PHE C  3  101 ? -28.463 5.439   254.886  1.00 50.91  ? 179 PHE C CA  1 
ATOM   4137  C  C   . PHE C  3  101 ? -27.622 6.708   254.958  1.00 51.22  ? 179 PHE C C   1 
ATOM   4138  O  O   . PHE C  3  101 ? -27.060 7.061   255.995  1.00 58.76  ? 179 PHE C O   1 
ATOM   4139  C  CB  . PHE C  3  101 ? -29.942 5.837   254.843  1.00 46.07  ? 179 PHE C CB  1 
ATOM   4140  C  CG  . PHE C  3  101 ? -30.508 6.237   256.178  1.00 36.93  ? 179 PHE C CG  1 
ATOM   4141  C  CD1 . PHE C  3  101 ? -31.141 5.299   256.987  1.00 38.71  ? 179 PHE C CD1 1 
ATOM   4142  C  CD2 . PHE C  3  101 ? -30.417 7.551   256.627  1.00 38.89  ? 179 PHE C CD2 1 
ATOM   4143  C  CE1 . PHE C  3  101 ? -31.677 5.663   258.221  1.00 29.01  ? 179 PHE C CE1 1 
ATOM   4144  C  CE2 . PHE C  3  101 ? -30.953 7.926   257.860  1.00 26.20  ? 179 PHE C CE2 1 
ATOM   4145  C  CZ  . PHE C  3  101 ? -31.582 6.983   258.655  1.00 35.11  ? 179 PHE C CZ  1 
ATOM   4146  N  N   . LEU C  3  102 ? -27.564 7.403   253.832  1.00 50.67  ? 180 LEU C N   1 
ATOM   4147  C  CA  . LEU C  3  102 ? -26.803 8.631   253.710  1.00 46.41  ? 180 LEU C CA  1 
ATOM   4148  C  C   . LEU C  3  102 ? -27.646 9.777   254.253  1.00 53.62  ? 180 LEU C C   1 
ATOM   4149  O  O   . LEU C  3  102 ? -28.858 9.825   254.030  1.00 53.98  ? 180 LEU C O   1 
ATOM   4150  C  CB  . LEU C  3  102 ? -26.465 8.864   252.247  1.00 30.03  ? 180 LEU C CB  1 
ATOM   4151  C  CG  . LEU C  3  102 ? -25.401 9.892   251.892  1.00 51.74  ? 180 LEU C CG  1 
ATOM   4152  C  CD1 . LEU C  3  102 ? -24.068 9.394   252.382  1.00 54.96  ? 180 LEU C CD1 1 
ATOM   4153  C  CD2 . LEU C  3  102 ? -25.360 10.110  250.378  1.00 44.05  ? 180 LEU C CD2 1 
ATOM   4154  N  N   . VAL C  3  103 ? -26.998 10.683  254.979  1.00 51.79  ? 181 VAL C N   1 
ATOM   4155  C  CA  . VAL C  3  103 ? -27.667 11.832  255.577  1.00 48.04  ? 181 VAL C CA  1 
ATOM   4156  C  C   . VAL C  3  103 ? -26.662 12.948  255.682  1.00 48.08  ? 181 VAL C C   1 
ATOM   4157  O  O   . VAL C  3  103 ? -25.466 12.689  255.677  1.00 54.57  ? 181 VAL C O   1 
ATOM   4158  C  CB  . VAL C  3  103 ? -28.128 11.532  256.987  1.00 36.37  ? 181 VAL C CB  1 
ATOM   4159  C  CG1 . VAL C  3  103 ? -29.130 10.419  256.974  1.00 40.48  ? 181 VAL C CG1 1 
ATOM   4160  C  CG2 . VAL C  3  103 ? -26.941 11.157  257.829  1.00 32.43  ? 181 VAL C CG2 1 
ATOM   4161  N  N   . PHE C  3  104 ? -27.135 14.186  255.768  1.00 45.76  ? 182 PHE C N   1 
ATOM   4162  C  CA  . PHE C  3  104 ? -26.216 15.308  255.900  1.00 52.55  ? 182 PHE C CA  1 
ATOM   4163  C  C   . PHE C  3  104 ? -26.096 15.708  257.354  1.00 49.79  ? 182 PHE C C   1 
ATOM   4164  O  O   . PHE C  3  104 ? -27.063 16.156  257.956  1.00 53.33  ? 182 PHE C O   1 
ATOM   4165  C  CB  . PHE C  3  104 ? -26.683 16.514  255.101  1.00 55.77  ? 182 PHE C CB  1 
ATOM   4166  C  CG  . PHE C  3  104 ? -25.782 17.716  255.241  1.00 47.07  ? 182 PHE C CG  1 
ATOM   4167  C  CD1 . PHE C  3  104 ? -25.683 18.400  256.446  1.00 45.04  ? 182 PHE C CD1 1 
ATOM   4168  C  CD2 . PHE C  3  104 ? -25.045 18.174  254.161  1.00 42.15  ? 182 PHE C CD2 1 
ATOM   4169  C  CE1 . PHE C  3  104 ? -24.866 19.528  256.566  1.00 39.50  ? 182 PHE C CE1 1 
ATOM   4170  C  CE2 . PHE C  3  104 ? -24.228 19.297  254.273  1.00 44.48  ? 182 PHE C CE2 1 
ATOM   4171  C  CZ  . PHE C  3  104 ? -24.141 19.975  255.479  1.00 37.16  ? 182 PHE C CZ  1 
ATOM   4172  N  N   . CYS C  3  105 ? -24.897 15.560  257.903  1.00 54.45  ? 183 CYS C N   1 
ATOM   4173  C  CA  . CYS C  3  105 ? -24.643 15.890  259.291  1.00 47.34  ? 183 CYS C CA  1 
ATOM   4174  C  C   . CYS C  3  105 ? -24.147 17.307  259.432  1.00 53.14  ? 183 CYS C C   1 
ATOM   4175  O  O   . CYS C  3  105 ? -23.208 17.700  258.738  1.00 43.35  ? 183 CYS C O   1 
ATOM   4176  C  CB  . CYS C  3  105 ? -23.588 14.961  259.866  1.00 34.53  ? 183 CYS C CB  1 
ATOM   4177  S  SG  . CYS C  3  105 ? -24.108 13.245  260.141  1.00 48.62  ? 183 CYS C SG  1 
ATOM   4178  N  N   . GLU C  3  106 ? -24.786 18.078  260.312  1.00 61.52  ? 184 GLU C N   1 
ATOM   4179  C  CA  . GLU C  3  106 ? -24.339 19.445  260.580  1.00 67.65  ? 184 GLU C CA  1 
ATOM   4180  C  C   . GLU C  3  106 ? -23.602 19.357  261.913  1.00 70.50  ? 184 GLU C C   1 
ATOM   4181  O  O   . GLU C  3  106 ? -24.181 18.945  262.931  1.00 59.53  ? 184 GLU C O   1 
ATOM   4182  C  CB  . GLU C  3  106 ? -25.501 20.426  260.719  1.00 65.54  ? 184 GLU C CB  1 
ATOM   4183  C  CG  . GLU C  3  106 ? -25.007 21.848  260.932  1.00 69.19  ? 184 GLU C CG  1 
ATOM   4184  C  CD  . GLU C  3  106 ? -26.122 22.836  261.134  1.00 82.15  ? 184 GLU C CD  1 
ATOM   4185  O  OE1 . GLU C  3  106 ? -27.034 22.885  260.285  1.00 99.24  ? 184 GLU C OE1 1 
ATOM   4186  O  OE2 . GLU C  3  106 ? -26.083 23.574  262.137  1.00 85.76  ? 184 GLU C OE2 1 
ATOM   4187  N  N   . ILE C  3  107 ? -22.327 19.731  261.905  1.00 64.50  ? 185 ILE C N   1 
ATOM   4188  C  CA  . ILE C  3  107 ? -21.535 19.656  263.116  1.00 72.36  ? 185 ILE C CA  1 
ATOM   4189  C  C   . ILE C  3  107 ? -21.107 21.021  263.627  1.00 74.97  ? 185 ILE C C   1 
ATOM   4190  O  O   . ILE C  3  107 ? -20.346 21.739  262.970  1.00 70.23  ? 185 ILE C O   1 
ATOM   4191  C  CB  . ILE C  3  107 ? -20.301 18.764  262.897  1.00 73.42  ? 185 ILE C CB  1 
ATOM   4192  C  CG1 . ILE C  3  107 ? -20.757 17.367  262.474  1.00 65.95  ? 185 ILE C CG1 1 
ATOM   4193  C  CG2 . ILE C  3  107 ? -19.489 18.666  264.182  1.00 74.99  ? 185 ILE C CG2 1 
ATOM   4194  C  CD1 . ILE C  3  107 ? -19.635 16.464  262.034  1.00 66.21  ? 185 ILE C CD1 1 
ATOM   4195  N  N   . GLU C  3  108 ? -21.620 21.370  264.806  1.00 86.10  ? 186 GLU C N   1 
ATOM   4196  C  CA  . GLU C  3  108 ? -21.312 22.642  265.448  1.00 92.56  ? 186 GLU C CA  1 
ATOM   4197  C  C   . GLU C  3  108 ? -20.222 22.457  266.486  1.00 95.69  ? 186 GLU C C   1 
ATOM   4198  O  O   . GLU C  3  108 ? -19.196 21.822  266.243  1.00 98.34  ? 186 GLU C O   1 
ATOM   4199  C  CB  . GLU C  3  108 ? -22.545 23.224  266.147  1.00 87.12  ? 186 GLU C CB  1 
ATOM   4200  C  CG  . GLU C  3  108 ? -23.590 23.776  265.220  1.00 97.91  ? 186 GLU C CG  1 
ATOM   4201  C  CD  . GLU C  3  108 ? -24.724 24.425  265.976  1.00 107.57 ? 186 GLU C CD  1 
ATOM   4202  O  OE1 . GLU C  3  108 ? -25.231 23.787  266.922  1.00 111.69 ? 186 GLU C OE1 1 
ATOM   4203  O  OE2 . GLU C  3  108 ? -25.113 25.564  265.627  1.00 112.73 ? 186 GLU C OE2 1 
ATOM   4204  N  N   . ASN C  3  109 ? -20.478 23.014  267.658  1.00 95.40  ? 187 ASN C N   1 
ATOM   4205  C  CA  . ASN C  3  109 ? -19.549 22.959  268.767  1.00 87.86  ? 187 ASN C CA  1 
ATOM   4206  C  C   . ASN C  3  109 ? -19.546 21.564  269.367  1.00 87.42  ? 187 ASN C C   1 
ATOM   4207  O  O   . ASN C  3  109 ? -19.767 21.392  270.566  1.00 93.67  ? 187 ASN C O   1 
ATOM   4208  C  CB  . ASN C  3  109 ? -19.983 23.994  269.797  1.00 89.66  ? 187 ASN C CB  1 
ATOM   4209  C  CG  . ASN C  3  109 ? -20.468 25.270  269.143  1.00 95.43  ? 187 ASN C CG  1 
ATOM   4210  O  OD1 . ASN C  3  109 ? -19.666 26.100  268.713  1.00 94.74  ? 187 ASN C OD1 1 
ATOM   4211  N  ND2 . ASN C  3  109 ? -21.790 25.418  269.031  1.00 97.66  ? 187 ASN C ND2 1 
ATOM   4212  N  N   . GLY C  3  110 ? -19.301 20.565  268.527  1.00 81.64  ? 188 GLY C N   1 
ATOM   4213  C  CA  . GLY C  3  110 ? -19.272 19.196  269.009  1.00 83.61  ? 188 GLY C CA  1 
ATOM   4214  C  C   . GLY C  3  110 ? -20.614 18.486  268.965  1.00 85.29  ? 188 GLY C C   1 
ATOM   4215  O  O   . GLY C  3  110 ? -20.781 17.435  269.595  1.00 84.76  ? 188 GLY C O   1 
ATOM   4216  N  N   . ASN C  3  111 ? -21.569 19.043  268.219  1.00 84.70  ? 189 ASN C N   1 
ATOM   4217  C  CA  . ASN C  3  111 ? -22.888 18.431  268.106  1.00 83.07  ? 189 ASN C CA  1 
ATOM   4218  C  C   . ASN C  3  111 ? -23.171 17.878  266.719  1.00 82.95  ? 189 ASN C C   1 
ATOM   4219  O  O   . ASN C  3  111 ? -22.871 18.515  265.708  1.00 84.06  ? 189 ASN C O   1 
ATOM   4220  C  CB  . ASN C  3  111 ? -23.975 19.435  268.458  1.00 86.09  ? 189 ASN C CB  1 
ATOM   4221  C  CG  . ASN C  3  111 ? -23.702 20.142  269.749  1.00 90.17  ? 189 ASN C CG  1 
ATOM   4222  O  OD1 . ASN C  3  111 ? -23.074 21.205  269.762  1.00 103.55 ? 189 ASN C OD1 1 
ATOM   4223  N  ND2 . ASN C  3  111 ? -24.151 19.552  270.857  1.00 75.48  ? 189 ASN C ND2 1 
ATOM   4224  N  N   . GLY C  3  112 ? -23.768 16.689  266.688  1.00 84.57  ? 190 GLY C N   1 
ATOM   4225  C  CA  . GLY C  3  112 ? -24.101 16.046  265.429  1.00 76.74  ? 190 GLY C CA  1 
ATOM   4226  C  C   . GLY C  3  112 ? -25.550 16.245  265.023  1.00 65.80  ? 190 GLY C C   1 
ATOM   4227  O  O   . GLY C  3  112 ? -26.411 15.396  265.284  1.00 67.23  ? 190 GLY C O   1 
ATOM   4228  N  N   . TRP C  3  113 ? -25.824 17.379  264.393  1.00 49.29  ? 191 TRP C N   1 
ATOM   4229  C  CA  . TRP C  3  113 ? -27.172 17.666  263.937  1.00 53.68  ? 191 TRP C CA  1 
ATOM   4230  C  C   . TRP C  3  113 ? -27.445 16.827  262.695  1.00 63.16  ? 191 TRP C C   1 
ATOM   4231  O  O   . TRP C  3  113 ? -26.810 17.024  261.649  1.00 60.74  ? 191 TRP C O   1 
ATOM   4232  C  CB  . TRP C  3  113 ? -27.320 19.140  263.562  1.00 59.61  ? 191 TRP C CB  1 
ATOM   4233  C  CG  . TRP C  3  113 ? -27.410 20.078  264.703  1.00 64.17  ? 191 TRP C CG  1 
ATOM   4234  C  CD1 . TRP C  3  113 ? -26.442 20.926  265.142  1.00 65.63  ? 191 TRP C CD1 1 
ATOM   4235  C  CD2 . TRP C  3  113 ? -28.554 20.314  265.524  1.00 67.03  ? 191 TRP C CD2 1 
ATOM   4236  N  NE1 . TRP C  3  113 ? -26.912 21.685  266.180  1.00 65.07  ? 191 TRP C NE1 1 
ATOM   4237  C  CE2 . TRP C  3  113 ? -28.208 21.330  266.436  1.00 71.06  ? 191 TRP C CE2 1 
ATOM   4238  C  CE3 . TRP C  3  113 ? -29.840 19.767  265.575  1.00 73.20  ? 191 TRP C CE3 1 
ATOM   4239  C  CZ2 . TRP C  3  113 ? -29.104 21.814  267.394  1.00 73.05  ? 191 TRP C CZ2 1 
ATOM   4240  C  CZ3 . TRP C  3  113 ? -30.731 20.246  266.524  1.00 77.68  ? 191 TRP C CZ3 1 
ATOM   4241  C  CH2 . TRP C  3  113 ? -30.357 21.261  267.422  1.00 74.13  ? 191 TRP C CH2 1 
ATOM   4242  N  N   . THR C  3  114 ? -28.379 15.889  262.796  1.00 58.21  ? 192 THR C N   1 
ATOM   4243  C  CA  . THR C  3  114 ? -28.697 15.069  261.641  1.00 56.52  ? 192 THR C CA  1 
ATOM   4244  C  C   . THR C  3  114 ? -29.936 15.648  260.938  1.00 57.80  ? 192 THR C C   1 
ATOM   4245  O  O   . THR C  3  114 ? -31.068 15.526  261.412  1.00 58.49  ? 192 THR C O   1 
ATOM   4246  C  CB  . THR C  3  114 ? -28.869 13.578  262.051  1.00 31.63  ? 192 THR C CB  1 
ATOM   4247  O  OG1 . THR C  3  114 ? -30.062 13.051  261.471  1.00 51.91  ? 192 THR C OG1 1 
ATOM   4248  C  CG2 . THR C  3  114 ? -28.902 13.439  263.557  1.00 47.03  ? 192 THR C CG2 1 
ATOM   4249  N  N   . VAL C  3  115 ? -29.683 16.307  259.808  1.00 51.70  ? 193 VAL C N   1 
ATOM   4250  C  CA  . VAL C  3  115 ? -30.710 16.958  259.002  1.00 47.01  ? 193 VAL C CA  1 
ATOM   4251  C  C   . VAL C  3  115 ? -31.810 16.067  258.437  1.00 52.64  ? 193 VAL C C   1 
ATOM   4252  O  O   . VAL C  3  115 ? -31.552 15.070  257.771  1.00 54.97  ? 193 VAL C O   1 
ATOM   4253  C  CB  . VAL C  3  115 ? -30.083 17.700  257.839  1.00 28.00  ? 193 VAL C CB  1 
ATOM   4254  C  CG1 . VAL C  3  115 ? -31.150 18.451  257.098  1.00 44.04  ? 193 VAL C CG1 1 
ATOM   4255  C  CG2 . VAL C  3  115 ? -29.009 18.635  258.348  1.00 38.59  ? 193 VAL C CG2 1 
ATOM   4256  N  N   . ILE C  3  116 ? -33.047 16.469  258.697  1.00 60.67  ? 194 ILE C N   1 
ATOM   4257  C  CA  . ILE C  3  116 ? -34.230 15.753  258.256  1.00 56.21  ? 194 ILE C CA  1 
ATOM   4258  C  C   . ILE C  3  116 ? -34.772 16.322  256.961  1.00 60.71  ? 194 ILE C C   1 
ATOM   4259  O  O   . ILE C  3  116 ? -35.164 15.570  256.071  1.00 69.81  ? 194 ILE C O   1 
ATOM   4260  C  CB  . ILE C  3  116 ? -35.330 15.832  259.328  1.00 61.55  ? 194 ILE C CB  1 
ATOM   4261  C  CG1 . ILE C  3  116 ? -35.022 14.845  260.440  1.00 74.42  ? 194 ILE C CG1 1 
ATOM   4262  C  CG2 . ILE C  3  116 ? -36.672 15.549  258.739  1.00 69.40  ? 194 ILE C CG2 1 
ATOM   4263  C  CD1 . ILE C  3  116 ? -34.795 13.451  259.939  1.00 84.78  ? 194 ILE C CD1 1 
ATOM   4264  N  N   . GLN C  3  117 ? -34.788 17.648  256.857  1.00 53.56  ? 195 GLN C N   1 
ATOM   4265  C  CA  . GLN C  3  117 ? -35.307 18.317  255.667  1.00 56.11  ? 195 GLN C CA  1 
ATOM   4266  C  C   . GLN C  3  117 ? -34.599 19.637  255.428  1.00 60.77  ? 195 GLN C C   1 
ATOM   4267  O  O   . GLN C  3  117 ? -33.979 20.189  256.337  1.00 76.41  ? 195 GLN C O   1 
ATOM   4268  C  CB  . GLN C  3  117 ? -36.813 18.581  255.834  1.00 58.77  ? 195 GLN C CB  1 
ATOM   4269  C  CG  . GLN C  3  117 ? -37.473 19.263  254.649  1.00 59.83  ? 195 GLN C CG  1 
ATOM   4270  C  CD  . GLN C  3  117 ? -37.811 20.726  254.889  1.00 61.92  ? 195 GLN C CD  1 
ATOM   4271  O  OE1 . GLN C  3  117 ? -36.973 21.521  255.309  1.00 54.55  ? 195 GLN C OE1 1 
ATOM   4272  N  NE2 . GLN C  3  117 ? -39.049 21.087  254.600  1.00 77.43  ? 195 GLN C NE2 1 
ATOM   4273  N  N   . HIS C  3  118 ? -34.696 20.146  254.205  1.00 55.69  ? 196 HIS C N   1 
ATOM   4274  C  CA  . HIS C  3  118 ? -34.089 21.429  253.879  1.00 63.84  ? 196 HIS C CA  1 
ATOM   4275  C  C   . HIS C  3  118 ? -34.648 21.986  252.580  1.00 69.18  ? 196 HIS C C   1 
ATOM   4276  O  O   . HIS C  3  118 ? -34.793 21.270  251.591  1.00 77.14  ? 196 HIS C O   1 
ATOM   4277  C  CB  . HIS C  3  118 ? -32.565 21.317  253.795  1.00 52.89  ? 196 HIS C CB  1 
ATOM   4278  C  CG  . HIS C  3  118 ? -31.878 22.619  253.524  1.00 57.03  ? 196 HIS C CG  1 
ATOM   4279  N  ND1 . HIS C  3  118 ? -31.682 23.107  252.251  1.00 55.25  ? 196 HIS C ND1 1 
ATOM   4280  C  CD2 . HIS C  3  118 ? -31.339 23.534  254.365  1.00 58.40  ? 196 HIS C CD2 1 
ATOM   4281  C  CE1 . HIS C  3  118 ? -31.046 24.264  252.318  1.00 53.74  ? 196 HIS C CE1 1 
ATOM   4282  N  NE2 . HIS C  3  118 ? -30.826 24.547  253.589  1.00 55.51  ? 196 HIS C NE2 1 
ATOM   4283  N  N   . ARG C  3  119 ? -34.976 23.272  252.612  1.00 68.11  ? 197 ARG C N   1 
ATOM   4284  C  CA  . ARG C  3  119 ? -35.532 23.984  251.478  1.00 55.65  ? 197 ARG C CA  1 
ATOM   4285  C  C   . ARG C  3  119 ? -34.435 24.951  251.088  1.00 56.25  ? 197 ARG C C   1 
ATOM   4286  O  O   . ARG C  3  119 ? -33.743 25.460  251.956  1.00 72.17  ? 197 ARG C O   1 
ATOM   4287  C  CB  . ARG C  3  119 ? -36.783 24.714  251.936  1.00 66.71  ? 197 ARG C CB  1 
ATOM   4288  C  CG  . ARG C  3  119 ? -37.957 24.501  251.040  1.00 71.69  ? 197 ARG C CG  1 
ATOM   4289  C  CD  . ARG C  3  119 ? -38.185 23.044  250.731  1.00 60.97  ? 197 ARG C CD  1 
ATOM   4290  N  NE  . ARG C  3  119 ? -38.936 22.953  249.486  1.00 78.09  ? 197 ARG C NE  1 
ATOM   4291  C  CZ  . ARG C  3  119 ? -40.228 23.247  249.361  1.00 80.39  ? 197 ARG C CZ  1 
ATOM   4292  N  NH1 . ARG C  3  119 ? -40.937 23.640  250.411  1.00 85.64  ? 197 ARG C NH1 1 
ATOM   4293  N  NH2 . ARG C  3  119 ? -40.803 23.186  248.171  1.00 89.95  ? 197 ARG C NH2 1 
ATOM   4294  N  N   . HIS C  3  120 ? -34.266 25.239  249.807  1.00 56.30  ? 198 HIS C N   1 
ATOM   4295  C  CA  . HIS C  3  120 ? -33.154 26.106  249.431  1.00 51.82  ? 198 HIS C CA  1 
ATOM   4296  C  C   . HIS C  3  120 ? -33.342 26.966  248.174  1.00 58.93  ? 198 HIS C C   1 
ATOM   4297  O  O   . HIS C  3  120 ? -32.725 28.030  248.049  1.00 51.18  ? 198 HIS C O   1 
ATOM   4298  C  CB  . HIS C  3  120 ? -31.922 25.214  249.243  1.00 59.73  ? 198 HIS C CB  1 
ATOM   4299  C  CG  . HIS C  3  120 ? -30.616 25.940  249.289  1.00 46.85  ? 198 HIS C CG  1 
ATOM   4300  N  ND1 . HIS C  3  120 ? -29.989 26.256  250.473  1.00 49.33  ? 198 HIS C ND1 1 
ATOM   4301  C  CD2 . HIS C  3  120 ? -29.806 26.390  248.300  1.00 48.59  ? 198 HIS C CD2 1 
ATOM   4302  C  CE1 . HIS C  3  120 ? -28.847 26.868  250.213  1.00 53.60  ? 198 HIS C CE1 1 
ATOM   4303  N  NE2 . HIS C  3  120 ? -28.711 26.963  248.902  1.00 44.51  ? 198 HIS C NE2 1 
ATOM   4304  N  N   . ASP C  3  121 ? -34.172 26.513  247.238  1.00 62.49  ? 199 ASP C N   1 
ATOM   4305  C  CA  . ASP C  3  121 ? -34.360 27.265  245.995  1.00 69.27  ? 199 ASP C CA  1 
ATOM   4306  C  C   . ASP C  3  121 ? -35.490 26.739  245.110  1.00 67.35  ? 199 ASP C C   1 
ATOM   4307  O  O   . ASP C  3  121 ? -35.475 26.917  243.888  1.00 39.57  ? 199 ASP C O   1 
ATOM   4308  C  CB  . ASP C  3  121 ? -33.054 27.246  245.208  1.00 72.77  ? 199 ASP C CB  1 
ATOM   4309  C  CG  . ASP C  3  121 ? -32.385 25.881  245.248  1.00 80.36  ? 199 ASP C CG  1 
ATOM   4310  O  OD1 . ASP C  3  121 ? -33.130 24.867  245.283  1.00 60.64  ? 199 ASP C OD1 1 
ATOM   4311  O  OD2 . ASP C  3  121 ? -31.131 25.826  245.244  1.00 74.37  ? 199 ASP C OD2 1 
ATOM   4312  N  N   . GLY C  3  122 ? -36.467 26.097  245.739  1.00 73.73  ? 200 GLY C N   1 
ATOM   4313  C  CA  . GLY C  3  122 ? -37.597 25.557  245.008  1.00 78.56  ? 200 GLY C CA  1 
ATOM   4314  C  C   . GLY C  3  122 ? -37.221 24.869  243.712  1.00 81.82  ? 200 GLY C C   1 
ATOM   4315  O  O   . GLY C  3  122 ? -37.868 25.079  242.683  1.00 90.61  ? 200 GLY C O   1 
ATOM   4316  N  N   . SER C  3  123 ? -36.176 24.048  243.760  1.00 76.27  ? 201 SER C N   1 
ATOM   4317  C  CA  . SER C  3  123 ? -35.729 23.318  242.581  1.00 76.48  ? 201 SER C CA  1 
ATOM   4318  C  C   . SER C  3  123 ? -36.153 21.852  242.658  1.00 70.59  ? 201 SER C C   1 
ATOM   4319  O  O   . SER C  3  123 ? -35.913 21.074  241.740  1.00 81.24  ? 201 SER C O   1 
ATOM   4320  C  CB  . SER C  3  123 ? -34.212 23.396  242.460  1.00 78.59  ? 201 SER C CB  1 
ATOM   4321  O  OG  . SER C  3  123 ? -33.605 22.801  243.590  1.00 86.27  ? 201 SER C OG  1 
ATOM   4322  N  N   . VAL C  3  124 ? -36.791 21.478  243.754  1.00 57.88  ? 202 VAL C N   1 
ATOM   4323  C  CA  . VAL C  3  124 ? -37.236 20.110  243.934  1.00 59.92  ? 202 VAL C CA  1 
ATOM   4324  C  C   . VAL C  3  124 ? -38.732 20.125  244.189  1.00 59.31  ? 202 VAL C C   1 
ATOM   4325  O  O   . VAL C  3  124 ? -39.176 20.649  245.211  1.00 54.06  ? 202 VAL C O   1 
ATOM   4326  C  CB  . VAL C  3  124 ? -36.515 19.469  245.146  1.00 62.21  ? 202 VAL C CB  1 
ATOM   4327  C  CG1 . VAL C  3  124 ? -36.976 18.033  245.358  1.00 55.02  ? 202 VAL C CG1 1 
ATOM   4328  C  CG2 . VAL C  3  124 ? -35.026 19.517  244.922  1.00 49.61  ? 202 VAL C CG2 1 
ATOM   4329  N  N   . ASN C  3  125 ? -39.507 19.559  243.267  1.00 60.09  ? 203 ASN C N   1 
ATOM   4330  C  CA  . ASN C  3  125 ? -40.967 19.519  243.414  1.00 65.94  ? 203 ASN C CA  1 
ATOM   4331  C  C   . ASN C  3  125 ? -41.291 18.691  244.665  1.00 68.16  ? 203 ASN C C   1 
ATOM   4332  O  O   . ASN C  3  125 ? -40.968 17.504  244.716  1.00 73.44  ? 203 ASN C O   1 
ATOM   4333  C  CB  . ASN C  3  125 ? -41.603 18.870  242.173  1.00 71.25  ? 203 ASN C CB  1 
ATOM   4334  C  CG  . ASN C  3  125 ? -43.120 19.081  242.089  1.00 74.00  ? 203 ASN C CG  1 
ATOM   4335  O  OD1 . ASN C  3  125 ? -43.815 19.094  243.106  1.00 77.68  ? 203 ASN C OD1 1 
ATOM   4336  N  ND2 . ASN C  3  125 ? -43.638 19.222  240.863  1.00 71.60  ? 203 ASN C ND2 1 
ATOM   4337  N  N   . PHE C  3  126 ? -41.915 19.312  245.668  1.00 62.84  ? 204 PHE C N   1 
ATOM   4338  C  CA  . PHE C  3  126 ? -42.253 18.607  246.903  1.00 64.30  ? 204 PHE C CA  1 
ATOM   4339  C  C   . PHE C  3  126 ? -43.629 17.990  246.906  1.00 68.66  ? 204 PHE C C   1 
ATOM   4340  O  O   . PHE C  3  126 ? -44.087 17.470  247.928  1.00 74.74  ? 204 PHE C O   1 
ATOM   4341  C  CB  . PHE C  3  126 ? -42.123 19.523  248.119  1.00 60.43  ? 204 PHE C CB  1 
ATOM   4342  C  CG  . PHE C  3  126 ? -40.780 19.463  248.771  1.00 56.67  ? 204 PHE C CG  1 
ATOM   4343  C  CD1 . PHE C  3  126 ? -39.673 20.045  248.169  1.00 52.87  ? 204 PHE C CD1 1 
ATOM   4344  C  CD2 . PHE C  3  126 ? -40.608 18.787  249.967  1.00 60.28  ? 204 PHE C CD2 1 
ATOM   4345  C  CE1 . PHE C  3  126 ? -38.411 19.953  248.748  1.00 46.41  ? 204 PHE C CE1 1 
ATOM   4346  C  CE2 . PHE C  3  126 ? -39.352 18.692  250.548  1.00 60.12  ? 204 PHE C CE2 1 
ATOM   4347  C  CZ  . PHE C  3  126 ? -38.253 19.281  249.929  1.00 45.07  ? 204 PHE C CZ  1 
ATOM   4348  N  N   . THR C  3  127 ? -44.294 18.053  245.763  1.00 68.24  ? 205 THR C N   1 
ATOM   4349  C  CA  . THR C  3  127 ? -45.617 17.476  245.650  1.00 65.25  ? 205 THR C CA  1 
ATOM   4350  C  C   . THR C  3  127 ? -45.369 16.010  245.355  1.00 61.80  ? 205 THR C C   1 
ATOM   4351  O  O   . THR C  3  127 ? -45.329 15.609  244.200  1.00 65.94  ? 205 THR C O   1 
ATOM   4352  C  CB  . THR C  3  127 ? -46.402 18.109  244.486  1.00 68.54  ? 205 THR C CB  1 
ATOM   4353  O  OG1 . THR C  3  127 ? -46.305 19.542  244.551  1.00 64.86  ? 205 THR C OG1 1 
ATOM   4354  C  CG2 . THR C  3  127 ? -47.860 17.696  244.561  1.00 66.06  ? 205 THR C CG2 1 
ATOM   4355  N  N   . ARG C  3  128 ? -45.175 15.212  246.395  1.00 51.24  ? 206 ARG C N   1 
ATOM   4356  C  CA  . ARG C  3  128 ? -44.912 13.802  246.182  1.00 52.32  ? 206 ARG C CA  1 
ATOM   4357  C  C   . ARG C  3  128 ? -45.910 12.945  246.899  1.00 52.08  ? 206 ARG C C   1 
ATOM   4358  O  O   . ARG C  3  128 ? -46.548 13.385  247.848  1.00 60.25  ? 206 ARG C O   1 
ATOM   4359  C  CB  . ARG C  3  128 ? -43.520 13.427  246.674  1.00 69.08  ? 206 ARG C CB  1 
ATOM   4360  C  CG  . ARG C  3  128 ? -42.407 14.280  246.138  1.00 63.82  ? 206 ARG C CG  1 
ATOM   4361  C  CD  . ARG C  3  128 ? -42.484 14.416  244.647  1.00 78.28  ? 206 ARG C CD  1 
ATOM   4362  N  NE  . ARG C  3  128 ? -41.216 14.906  244.128  1.00 84.33  ? 206 ARG C NE  1 
ATOM   4363  C  CZ  . ARG C  3  128 ? -40.128 14.154  244.018  1.00 76.45  ? 206 ARG C CZ  1 
ATOM   4364  N  NH1 . ARG C  3  128 ? -40.174 12.877  244.383  1.00 63.43  ? 206 ARG C NH1 1 
ATOM   4365  N  NH2 . ARG C  3  128 ? -38.996 14.688  243.569  1.00 72.26  ? 206 ARG C NH2 1 
ATOM   4366  N  N   . ASP C  3  129 ? -46.025 11.704  246.449  1.00 58.05  ? 207 ASP C N   1 
ATOM   4367  C  CA  . ASP C  3  129 ? -46.957 10.770  247.050  1.00 66.39  ? 207 ASP C CA  1 
ATOM   4368  C  C   . ASP C  3  129 ? -46.475 10.292  248.408  1.00 66.28  ? 207 ASP C C   1 
ATOM   4369  O  O   . ASP C  3  129 ? -45.420 10.692  248.889  1.00 68.95  ? 207 ASP C O   1 
ATOM   4370  C  CB  . ASP C  3  129 ? -47.161 9.567   246.140  1.00 66.60  ? 207 ASP C CB  1 
ATOM   4371  C  CG  . ASP C  3  129 ? -45.900 8.787   245.938  1.00 73.62  ? 207 ASP C CG  1 
ATOM   4372  O  OD1 . ASP C  3  129 ? -45.048 9.236   245.142  1.00 80.66  ? 207 ASP C OD1 1 
ATOM   4373  O  OD2 . ASP C  3  129 ? -45.755 7.735   246.590  1.00 73.85  ? 207 ASP C OD2 1 
ATOM   4374  N  N   . TRP C  3  130 ? -47.265 9.417   249.009  1.00 71.05  ? 208 TRP C N   1 
ATOM   4375  C  CA  . TRP C  3  130 ? -46.968 8.857   250.318  1.00 74.64  ? 208 TRP C CA  1 
ATOM   4376  C  C   . TRP C  3  130 ? -45.669 8.067   250.315  1.00 77.08  ? 208 TRP C C   1 
ATOM   4377  O  O   . TRP C  3  130 ? -44.706 8.426   250.998  1.00 81.56  ? 208 TRP C O   1 
ATOM   4378  C  CB  . TRP C  3  130 ? -48.121 7.955   250.752  1.00 70.97  ? 208 TRP C CB  1 
ATOM   4379  C  CG  . TRP C  3  130 ? -47.935 7.331   252.080  1.00 63.64  ? 208 TRP C CG  1 
ATOM   4380  C  CD1 . TRP C  3  130 ? -47.517 6.063   252.337  1.00 65.10  ? 208 TRP C CD1 1 
ATOM   4381  C  CD2 . TRP C  3  130 ? -48.179 7.942   253.350  1.00 71.09  ? 208 TRP C CD2 1 
ATOM   4382  N  NE1 . TRP C  3  130 ? -47.490 5.840   253.690  1.00 72.82  ? 208 TRP C NE1 1 
ATOM   4383  C  CE2 . TRP C  3  130 ? -47.892 6.981   254.335  1.00 77.01  ? 208 TRP C CE2 1 
ATOM   4384  C  CE3 . TRP C  3  130 ? -48.613 9.213   253.750  1.00 74.51  ? 208 TRP C CE3 1 
ATOM   4385  C  CZ2 . TRP C  3  130 ? -48.025 7.249   255.702  1.00 73.23  ? 208 TRP C CZ2 1 
ATOM   4386  C  CZ3 . TRP C  3  130 ? -48.744 9.479   255.102  1.00 68.23  ? 208 TRP C CZ3 1 
ATOM   4387  C  CH2 . TRP C  3  130 ? -48.451 8.500   256.062  1.00 72.81  ? 208 TRP C CH2 1 
ATOM   4388  N  N   . VAL C  3  131 ? -45.652 6.983   249.548  1.00 74.74  ? 209 VAL C N   1 
ATOM   4389  C  CA  . VAL C  3  131 ? -44.473 6.137   249.456  1.00 65.56  ? 209 VAL C CA  1 
ATOM   4390  C  C   . VAL C  3  131 ? -43.252 7.010   249.184  1.00 60.57  ? 209 VAL C C   1 
ATOM   4391  O  O   . VAL C  3  131 ? -42.174 6.765   249.717  1.00 63.57  ? 209 VAL C O   1 
ATOM   4392  C  CB  . VAL C  3  131 ? -44.630 5.052   248.337  1.00 50.53  ? 209 VAL C CB  1 
ATOM   4393  C  CG1 . VAL C  3  131 ? -45.997 5.175   247.659  1.00 53.22  ? 209 VAL C CG1 1 
ATOM   4394  C  CG2 . VAL C  3  131 ? -43.521 5.172   247.321  1.00 46.25  ? 209 VAL C CG2 1 
ATOM   4395  N  N   . SER C  3  132 ? -43.429 8.041   248.371  1.00 47.48  ? 210 SER C N   1 
ATOM   4396  C  CA  . SER C  3  132 ? -42.320 8.929   248.058  1.00 60.55  ? 210 SER C CA  1 
ATOM   4397  C  C   . SER C  3  132 ? -41.844 9.668   249.317  1.00 56.97  ? 210 SER C C   1 
ATOM   4398  O  O   . SER C  3  132 ? -40.647 9.865   249.526  1.00 64.10  ? 210 SER C O   1 
ATOM   4399  C  CB  . SER C  3  132 ? -42.739 9.934   246.976  1.00 51.12  ? 210 SER C CB  1 
ATOM   4400  O  OG  . SER C  3  132 ? -41.634 10.699  246.516  1.00 54.85  ? 210 SER C OG  1 
ATOM   4401  N  N   . TYR C  3  133 ? -42.782 10.065  250.160  1.00 53.45  ? 211 TYR C N   1 
ATOM   4402  C  CA  . TYR C  3  133 ? -42.439 10.782  251.378  1.00 57.13  ? 211 TYR C CA  1 
ATOM   4403  C  C   . TYR C  3  133 ? -41.866 9.881   252.457  1.00 59.39  ? 211 TYR C C   1 
ATOM   4404  O  O   . TYR C  3  133 ? -41.096 10.327  253.306  1.00 60.86  ? 211 TYR C O   1 
ATOM   4405  C  CB  . TYR C  3  133 ? -43.666 11.524  251.912  1.00 51.63  ? 211 TYR C CB  1 
ATOM   4406  C  CG  . TYR C  3  133 ? -43.654 12.992  251.563  1.00 56.74  ? 211 TYR C CG  1 
ATOM   4407  C  CD1 . TYR C  3  133 ? -42.973 13.906  252.358  1.00 54.66  ? 211 TYR C CD1 1 
ATOM   4408  C  CD2 . TYR C  3  133 ? -44.287 13.463  250.414  1.00 58.25  ? 211 TYR C CD2 1 
ATOM   4409  C  CE1 . TYR C  3  133 ? -42.924 15.256  252.024  1.00 58.16  ? 211 TYR C CE1 1 
ATOM   4410  C  CE2 . TYR C  3  133 ? -44.241 14.804  250.067  1.00 58.93  ? 211 TYR C CE2 1 
ATOM   4411  C  CZ  . TYR C  3  133 ? -43.561 15.697  250.876  1.00 66.90  ? 211 TYR C CZ  1 
ATOM   4412  O  OH  . TYR C  3  133 ? -43.535 17.029  250.530  1.00 70.78  ? 211 TYR C OH  1 
ATOM   4413  N  N   . ARG C  3  134 ? -42.231 8.609   252.429  1.00 61.65  ? 212 ARG C N   1 
ATOM   4414  C  CA  . ARG C  3  134 ? -41.724 7.697   253.438  1.00 64.88  ? 212 ARG C CA  1 
ATOM   4415  C  C   . ARG C  3  134 ? -40.346 7.164   253.074  1.00 65.04  ? 212 ARG C C   1 
ATOM   4416  O  O   . ARG C  3  134 ? -39.566 6.785   253.953  1.00 71.88  ? 212 ARG C O   1 
ATOM   4417  C  CB  . ARG C  3  134 ? -42.709 6.544   253.661  1.00 68.50  ? 212 ARG C CB  1 
ATOM   4418  C  CG  . ARG C  3  134 ? -42.465 5.249   252.890  1.00 58.73  ? 212 ARG C CG  1 
ATOM   4419  C  CD  . ARG C  3  134 ? -43.405 4.184   253.465  1.00 63.14  ? 212 ARG C CD  1 
ATOM   4420  N  NE  . ARG C  3  134 ? -43.257 2.860   252.880  1.00 67.81  ? 212 ARG C NE  1 
ATOM   4421  C  CZ  . ARG C  3  134 ? -43.585 2.549   251.633  1.00 73.30  ? 212 ARG C CZ  1 
ATOM   4422  N  NH1 . ARG C  3  134 ? -44.081 3.469   250.821  1.00 63.97  ? 212 ARG C NH1 1 
ATOM   4423  N  NH2 . ARG C  3  134 ? -43.421 1.311   251.200  1.00 76.06  ? 212 ARG C NH2 1 
ATOM   4424  N  N   . GLU C  3  135 ? -40.040 7.159   251.781  1.00 57.70  ? 213 GLU C N   1 
ATOM   4425  C  CA  . GLU C  3  135 ? -38.754 6.675   251.300  1.00 50.29  ? 213 GLU C CA  1 
ATOM   4426  C  C   . GLU C  3  135 ? -37.756 7.803   251.264  1.00 48.45  ? 213 GLU C C   1 
ATOM   4427  O  O   . GLU C  3  135 ? -36.581 7.619   251.565  1.00 54.46  ? 213 GLU C O   1 
ATOM   4428  C  CB  . GLU C  3  135 ? -38.891 6.076   249.899  1.00 62.58  ? 213 GLU C CB  1 
ATOM   4429  C  CG  . GLU C  3  135 ? -39.749 4.822   249.838  1.00 72.96  ? 213 GLU C CG  1 
ATOM   4430  C  CD  . GLU C  3  135 ? -39.340 3.817   250.886  1.00 85.23  ? 213 GLU C CD  1 
ATOM   4431  O  OE1 . GLU C  3  135 ? -38.122 3.555   250.993  1.00 90.19  ? 213 GLU C OE1 1 
ATOM   4432  O  OE2 . GLU C  3  135 ? -40.228 3.295   251.602  1.00 90.49  ? 213 GLU C OE2 1 
ATOM   4433  N  N   . GLY C  3  136 ? -38.231 8.980   250.890  1.00 46.01  ? 214 GLY C N   1 
ATOM   4434  C  CA  . GLY C  3  136 ? -37.351 10.124  250.818  1.00 46.18  ? 214 GLY C CA  1 
ATOM   4435  C  C   . GLY C  3  136 ? -37.165 10.537  249.384  1.00 46.91  ? 214 GLY C C   1 
ATOM   4436  O  O   . GLY C  3  136 ? -37.431 9.768   248.468  1.00 56.02  ? 214 GLY C O   1 
ATOM   4437  N  N   . PHE C  3  137 ? -36.714 11.764  249.185  1.00 47.05  ? 215 PHE C N   1 
ATOM   4438  C  CA  . PHE C  3  137 ? -36.500 12.279  247.848  1.00 39.17  ? 215 PHE C CA  1 
ATOM   4439  C  C   . PHE C  3  137 ? -35.712 13.571  247.985  1.00 49.86  ? 215 PHE C C   1 
ATOM   4440  O  O   . PHE C  3  137 ? -35.490 14.055  249.099  1.00 53.28  ? 215 PHE C O   1 
ATOM   4441  C  CB  . PHE C  3  137 ? -37.851 12.514  247.140  1.00 33.13  ? 215 PHE C CB  1 
ATOM   4442  C  CG  . PHE C  3  137 ? -38.796 13.409  247.895  1.00 51.02  ? 215 PHE C CG  1 
ATOM   4443  C  CD1 . PHE C  3  137 ? -38.671 14.800  247.829  1.00 58.12  ? 215 PHE C CD1 1 
ATOM   4444  C  CD2 . PHE C  3  137 ? -39.787 12.862  248.709  1.00 51.69  ? 215 PHE C CD2 1 
ATOM   4445  C  CE1 . PHE C  3  137 ? -39.520 15.635  248.570  1.00 60.97  ? 215 PHE C CE1 1 
ATOM   4446  C  CE2 . PHE C  3  137 ? -40.644 13.688  249.459  1.00 57.81  ? 215 PHE C CE2 1 
ATOM   4447  C  CZ  . PHE C  3  137 ? -40.510 15.074  249.390  1.00 59.30  ? 215 PHE C CZ  1 
ATOM   4448  N  N   . GLY C  3  138 ? -35.289 14.128  246.860  1.00 42.66  ? 216 GLY C N   1 
ATOM   4449  C  CA  . GLY C  3  138 ? -34.514 15.342  246.904  1.00 42.50  ? 216 GLY C CA  1 
ATOM   4450  C  C   . GLY C  3  138 ? -33.078 14.929  246.755  1.00 53.33  ? 216 GLY C C   1 
ATOM   4451  O  O   . GLY C  3  138 ? -32.788 13.765  246.495  1.00 56.67  ? 216 GLY C O   1 
ATOM   4452  N  N   . TYR C  3  139 ? -32.170 15.869  246.943  1.00 57.17  ? 217 TYR C N   1 
ATOM   4453  C  CA  . TYR C  3  139 ? -30.761 15.571  246.795  1.00 58.14  ? 217 TYR C CA  1 
ATOM   4454  C  C   . TYR C  3  139 ? -29.916 15.926  248.014  1.00 56.75  ? 217 TYR C C   1 
ATOM   4455  O  O   . TYR C  3  139 ? -30.206 16.891  248.722  1.00 65.37  ? 217 TYR C O   1 
ATOM   4456  C  CB  . TYR C  3  139 ? -30.246 16.311  245.568  1.00 56.79  ? 217 TYR C CB  1 
ATOM   4457  C  CG  . TYR C  3  139 ? -30.894 15.844  244.291  1.00 70.35  ? 217 TYR C CG  1 
ATOM   4458  C  CD1 . TYR C  3  139 ? -30.217 14.995  243.418  1.00 77.17  ? 217 TYR C CD1 1 
ATOM   4459  C  CD2 . TYR C  3  139 ? -32.198 16.217  243.966  1.00 68.55  ? 217 TYR C CD2 1 
ATOM   4460  C  CE1 . TYR C  3  139 ? -30.822 14.523  242.250  1.00 69.17  ? 217 TYR C CE1 1 
ATOM   4461  C  CE2 . TYR C  3  139 ? -32.811 15.749  242.793  1.00 56.56  ? 217 TYR C CE2 1 
ATOM   4462  C  CZ  . TYR C  3  139 ? -32.113 14.904  241.948  1.00 53.58  ? 217 TYR C CZ  1 
ATOM   4463  O  OH  . TYR C  3  139 ? -32.690 14.427  240.808  1.00 55.83  ? 217 TYR C OH  1 
ATOM   4464  N  N   . LEU C  3  140 ? -28.884 15.126  248.264  1.00 51.14  ? 218 LEU C N   1 
ATOM   4465  C  CA  . LEU C  3  140 ? -27.965 15.382  249.372  1.00 49.61  ? 218 LEU C CA  1 
ATOM   4466  C  C   . LEU C  3  140 ? -26.692 15.850  248.720  1.00 47.82  ? 218 LEU C C   1 
ATOM   4467  O  O   . LEU C  3  140 ? -26.486 15.617  247.536  1.00 50.51  ? 218 LEU C O   1 
ATOM   4468  C  CB  . LEU C  3  140 ? -27.684 14.115  250.166  1.00 32.42  ? 218 LEU C CB  1 
ATOM   4469  C  CG  . LEU C  3  140 ? -28.896 13.549  250.907  1.00 44.05  ? 218 LEU C CG  1 
ATOM   4470  C  CD1 . LEU C  3  140 ? -28.583 12.163  251.413  1.00 32.22  ? 218 LEU C CD1 1 
ATOM   4471  C  CD2 . LEU C  3  140 ? -29.278 14.470  252.048  1.00 37.30  ? 218 LEU C CD2 1 
ATOM   4472  N  N   . ALA C  3  141 ? -25.839 16.517  249.479  1.00 53.70  ? 219 ALA C N   1 
ATOM   4473  C  CA  . ALA C  3  141 ? -24.583 17.006  248.921  1.00 59.71  ? 219 ALA C CA  1 
ATOM   4474  C  C   . ALA C  3  141 ? -23.604 17.337  250.034  1.00 62.34  ? 219 ALA C C   1 
ATOM   4475  O  O   . ALA C  3  141 ? -23.926 17.221  251.213  1.00 67.05  ? 219 ALA C O   1 
ATOM   4476  C  CB  . ALA C  3  141 ? -24.826 18.232  248.045  1.00 59.92  ? 219 ALA C CB  1 
ATOM   4477  N  N   . PRO C  3  142 ? -22.387 17.744  249.674  1.00 55.97  ? 220 PRO C N   1 
ATOM   4478  C  CA  . PRO C  3  142 ? -21.441 18.056  250.737  1.00 52.63  ? 220 PRO C CA  1 
ATOM   4479  C  C   . PRO C  3  142 ? -21.693 19.368  251.456  1.00 51.80  ? 220 PRO C C   1 
ATOM   4480  O  O   . PRO C  3  142 ? -21.014 19.664  252.436  1.00 60.08  ? 220 PRO C O   1 
ATOM   4481  C  CB  . PRO C  3  142 ? -20.102 18.037  250.009  1.00 59.10  ? 220 PRO C CB  1 
ATOM   4482  C  CG  . PRO C  3  142 ? -20.323 17.041  248.911  1.00 60.39  ? 220 PRO C CG  1 
ATOM   4483  C  CD  . PRO C  3  142 ? -21.677 17.469  248.414  1.00 69.52  ? 220 PRO C CD  1 
ATOM   4484  N  N   . THR C  3  143 ? -22.674 20.147  251.010  1.00 56.45  ? 221 THR C N   1 
ATOM   4485  C  CA  . THR C  3  143 ? -22.912 21.436  251.658  1.00 61.14  ? 221 THR C CA  1 
ATOM   4486  C  C   . THR C  3  143 ? -24.292 21.839  252.155  1.00 66.80  ? 221 THR C C   1 
ATOM   4487  O  O   . THR C  3  143 ? -24.433 22.908  252.752  1.00 79.76  ? 221 THR C O   1 
ATOM   4488  C  CB  . THR C  3  143 ? -22.441 22.587  250.780  1.00 52.32  ? 221 THR C CB  1 
ATOM   4489  O  OG1 . THR C  3  143 ? -23.131 22.541  249.528  1.00 50.92  ? 221 THR C OG1 1 
ATOM   4490  C  CG2 . THR C  3  143 ? -20.956 22.507  250.564  1.00 60.60  ? 221 THR C CG2 1 
ATOM   4491  N  N   . LEU C  3  144 ? -25.312 21.029  251.928  1.00 65.02  ? 222 LEU C N   1 
ATOM   4492  C  CA  . LEU C  3  144 ? -26.642 21.408  252.411  1.00 64.24  ? 222 LEU C CA  1 
ATOM   4493  C  C   . LEU C  3  144 ? -27.110 22.676  251.710  1.00 63.69  ? 222 LEU C C   1 
ATOM   4494  O  O   . LEU C  3  144 ? -27.417 23.687  252.340  1.00 69.33  ? 222 LEU C O   1 
ATOM   4495  C  CB  . LEU C  3  144 ? -26.633 21.661  253.925  1.00 37.12  ? 222 LEU C CB  1 
ATOM   4496  C  CG  . LEU C  3  144 ? -28.040 21.853  254.483  1.00 34.94  ? 222 LEU C CG  1 
ATOM   4497  C  CD1 . LEU C  3  144 ? -28.782 20.524  254.449  1.00 47.59  ? 222 LEU C CD1 1 
ATOM   4498  C  CD2 . LEU C  3  144 ? -27.976 22.346  255.881  1.00 39.24  ? 222 LEU C CD2 1 
ATOM   4499  N  N   . THR C  3  145 ? -27.155 22.605  250.393  1.00 60.77  ? 223 THR C N   1 
ATOM   4500  C  CA  . THR C  3  145 ? -27.581 23.714  249.568  1.00 49.90  ? 223 THR C CA  1 
ATOM   4501  C  C   . THR C  3  145 ? -28.414 23.047  248.489  1.00 47.91  ? 223 THR C C   1 
ATOM   4502  O  O   . THR C  3  145 ? -28.523 23.520  247.352  1.00 48.10  ? 223 THR C O   1 
ATOM   4503  C  CB  . THR C  3  145 ? -26.380 24.377  248.956  1.00 37.23  ? 223 THR C CB  1 
ATOM   4504  O  OG1 . THR C  3  145 ? -25.664 23.413  248.190  1.00 29.32  ? 223 THR C OG1 1 
ATOM   4505  C  CG2 . THR C  3  145 ? -25.478 24.909  250.051  1.00 32.46  ? 223 THR C CG2 1 
ATOM   4506  N  N   . THR C  3  146 ? -28.992 21.923  248.888  1.00 32.57  ? 224 THR C N   1 
ATOM   4507  C  CA  . THR C  3  146 ? -29.814 21.105  248.034  1.00 48.48  ? 224 THR C CA  1 
ATOM   4508  C  C   . THR C  3  146 ? -31.061 20.818  248.835  1.00 54.76  ? 224 THR C C   1 
ATOM   4509  O  O   . THR C  3  146 ? -31.008 20.752  250.061  1.00 65.62  ? 224 THR C O   1 
ATOM   4510  C  CB  . THR C  3  146 ? -29.100 19.788  247.694  1.00 52.51  ? 224 THR C CB  1 
ATOM   4511  O  OG1 . THR C  3  146 ? -30.031 18.898  247.079  1.00 82.44  ? 224 THR C OG1 1 
ATOM   4512  C  CG2 . THR C  3  146 ? -28.545 19.138  248.935  1.00 61.07  ? 224 THR C CG2 1 
ATOM   4513  N  N   . GLU C  3  147 ? -32.188 20.644  248.159  1.00 58.36  ? 225 GLU C N   1 
ATOM   4514  C  CA  . GLU C  3  147 ? -33.438 20.394  248.871  1.00 51.01  ? 225 GLU C CA  1 
ATOM   4515  C  C   . GLU C  3  147 ? -33.780 18.909  248.970  1.00 44.54  ? 225 GLU C C   1 
ATOM   4516  O  O   . GLU C  3  147 ? -33.416 18.114  248.105  1.00 31.18  ? 225 GLU C O   1 
ATOM   4517  C  CB  . GLU C  3  147 ? -34.572 21.143  248.178  1.00 61.16  ? 225 GLU C CB  1 
ATOM   4518  C  CG  . GLU C  3  147 ? -34.197 22.551  247.759  1.00 73.17  ? 225 GLU C CG  1 
ATOM   4519  C  CD  . GLU C  3  147 ? -35.370 23.296  247.180  1.00 88.76  ? 225 GLU C CD  1 
ATOM   4520  O  OE1 . GLU C  3  147 ? -36.047 22.732  246.292  1.00 93.14  ? 225 GLU C OE1 1 
ATOM   4521  O  OE2 . GLU C  3  147 ? -35.614 24.442  247.612  1.00 93.36  ? 225 GLU C OE2 1 
ATOM   4522  N  N   . PHE C  3  148 ? -34.485 18.527  250.026  1.00 34.33  ? 226 PHE C N   1 
ATOM   4523  C  CA  . PHE C  3  148 ? -34.835 17.129  250.178  1.00 44.40  ? 226 PHE C CA  1 
ATOM   4524  C  C   . PHE C  3  148 ? -35.690 16.875  251.386  1.00 45.18  ? 226 PHE C C   1 
ATOM   4525  O  O   . PHE C  3  148 ? -35.910 17.752  252.210  1.00 52.52  ? 226 PHE C O   1 
ATOM   4526  C  CB  . PHE C  3  148 ? -33.579 16.278  250.324  1.00 57.18  ? 226 PHE C CB  1 
ATOM   4527  C  CG  . PHE C  3  148 ? -32.754 16.636  251.525  1.00 55.99  ? 226 PHE C CG  1 
ATOM   4528  C  CD1 . PHE C  3  148 ? -31.834 17.685  251.472  1.00 51.50  ? 226 PHE C CD1 1 
ATOM   4529  C  CD2 . PHE C  3  148 ? -32.923 15.951  252.723  1.00 53.87  ? 226 PHE C CD2 1 
ATOM   4530  C  CE1 . PHE C  3  148 ? -31.101 18.041  252.590  1.00 42.47  ? 226 PHE C CE1 1 
ATOM   4531  C  CE2 . PHE C  3  148 ? -32.191 16.303  253.850  1.00 48.30  ? 226 PHE C CE2 1 
ATOM   4532  C  CZ  . PHE C  3  148 ? -31.281 17.347  253.783  1.00 46.55  ? 226 PHE C CZ  1 
ATOM   4533  N  N   . TRP C  3  149 ? -36.155 15.642  251.476  1.00 46.90  ? 227 TRP C N   1 
ATOM   4534  C  CA  . TRP C  3  149 ? -36.965 15.181  252.585  1.00 52.88  ? 227 TRP C CA  1 
ATOM   4535  C  C   . TRP C  3  149 ? -36.436 13.771  252.845  1.00 61.81  ? 227 TRP C C   1 
ATOM   4536  O  O   . TRP C  3  149 ? -36.779 12.814  252.145  1.00 62.98  ? 227 TRP C O   1 
ATOM   4537  C  CB  . TRP C  3  149 ? -38.433 15.145  252.197  1.00 46.82  ? 227 TRP C CB  1 
ATOM   4538  C  CG  . TRP C  3  149 ? -39.283 14.629  253.290  1.00 38.25  ? 227 TRP C CG  1 
ATOM   4539  C  CD1 . TRP C  3  149 ? -39.813 13.371  253.409  1.00 45.42  ? 227 TRP C CD1 1 
ATOM   4540  C  CD2 . TRP C  3  149 ? -39.680 15.342  254.451  1.00 37.79  ? 227 TRP C CD2 1 
ATOM   4541  N  NE1 . TRP C  3  149 ? -40.520 13.260  254.580  1.00 26.04  ? 227 TRP C NE1 1 
ATOM   4542  C  CE2 . TRP C  3  149 ? -40.453 14.459  255.241  1.00 47.75  ? 227 TRP C CE2 1 
ATOM   4543  C  CE3 . TRP C  3  149 ? -39.459 16.647  254.907  1.00 42.01  ? 227 TRP C CE3 1 
ATOM   4544  C  CZ2 . TRP C  3  149 ? -41.004 14.843  256.465  1.00 57.11  ? 227 TRP C CZ2 1 
ATOM   4545  C  CZ3 . TRP C  3  149 ? -40.003 17.028  256.122  1.00 50.77  ? 227 TRP C CZ3 1 
ATOM   4546  C  CH2 . TRP C  3  149 ? -40.768 16.128  256.890  1.00 57.51  ? 227 TRP C CH2 1 
ATOM   4547  N  N   . LEU C  3  150 ? -35.570 13.668  253.845  1.00 54.98  ? 228 LEU C N   1 
ATOM   4548  C  CA  . LEU C  3  150 ? -34.931 12.416  254.187  1.00 42.93  ? 228 LEU C CA  1 
ATOM   4549  C  C   . LEU C  3  150 ? -35.815 11.216  254.029  1.00 37.53  ? 228 LEU C C   1 
ATOM   4550  O  O   . LEU C  3  150 ? -35.456 10.268  253.351  1.00 45.40  ? 228 LEU C O   1 
ATOM   4551  C  CB  . LEU C  3  150 ? -34.394 12.467  255.615  1.00 51.91  ? 228 LEU C CB  1 
ATOM   4552  C  CG  . LEU C  3  150 ? -33.568 11.257  256.058  1.00 38.39  ? 228 LEU C CG  1 
ATOM   4553  C  CD1 . LEU C  3  150 ? -32.428 11.021  255.099  1.00 38.36  ? 228 LEU C CD1 1 
ATOM   4554  C  CD2 . LEU C  3  150 ? -33.032 11.509  257.432  1.00 40.07  ? 228 LEU C CD2 1 
ATOM   4555  N  N   . GLY C  3  151 ? -36.971 11.241  254.661  1.00 28.14  ? 229 GLY C N   1 
ATOM   4556  C  CA  . GLY C  3  151 ? -37.853 10.100  254.548  1.00 37.42  ? 229 GLY C CA  1 
ATOM   4557  C  C   . GLY C  3  151 ? -38.554 9.862   255.862  1.00 57.06  ? 229 GLY C C   1 
ATOM   4558  O  O   . GLY C  3  151 ? -37.928 9.825   256.918  1.00 60.63  ? 229 GLY C O   1 
ATOM   4559  N  N   . ASN C  3  152 ? -39.867 9.700   255.805  1.00 67.68  ? 230 ASN C N   1 
ATOM   4560  C  CA  . ASN C  3  152 ? -40.638 9.482   257.011  1.00 68.48  ? 230 ASN C CA  1 
ATOM   4561  C  C   . ASN C  3  152 ? -40.248 8.219   257.759  1.00 68.22  ? 230 ASN C C   1 
ATOM   4562  O  O   . ASN C  3  152 ? -40.169 8.233   258.983  1.00 73.26  ? 230 ASN C O   1 
ATOM   4563  C  CB  . ASN C  3  152 ? -42.125 9.464   256.673  1.00 74.32  ? 230 ASN C CB  1 
ATOM   4564  C  CG  . ASN C  3  152 ? -42.648 10.836  256.294  1.00 74.34  ? 230 ASN C CG  1 
ATOM   4565  O  OD1 . ASN C  3  152 ? -43.795 10.980  255.881  1.00 82.67  ? 230 ASN C OD1 1 
ATOM   4566  N  ND2 . ASN C  3  152 ? -41.807 11.853  256.441  1.00 66.81  ? 230 ASN C ND2 1 
ATOM   4567  N  N   . GLU C  3  153 ? -39.991 7.131   257.041  1.00 64.87  ? 231 GLU C N   1 
ATOM   4568  C  CA  . GLU C  3  153 ? -39.616 5.891   257.713  1.00 63.74  ? 231 GLU C CA  1 
ATOM   4569  C  C   . GLU C  3  153 ? -38.292 6.029   258.467  1.00 62.97  ? 231 GLU C C   1 
ATOM   4570  O  O   . GLU C  3  153 ? -38.181 5.618   259.621  1.00 55.92  ? 231 GLU C O   1 
ATOM   4571  C  CB  . GLU C  3  153 ? -39.521 4.746   256.711  1.00 56.69  ? 231 GLU C CB  1 
ATOM   4572  C  CG  . GLU C  3  153 ? -39.093 3.423   257.322  1.00 53.55  ? 231 GLU C CG  1 
ATOM   4573  C  CD  . GLU C  3  153 ? -39.993 2.966   258.471  1.00 67.53  ? 231 GLU C CD  1 
ATOM   4574  O  OE1 . GLU C  3  153 ? -41.225 3.192   258.415  1.00 61.35  ? 231 GLU C OE1 1 
ATOM   4575  O  OE2 . GLU C  3  153 ? -39.467 2.355   259.427  1.00 71.48  ? 231 GLU C OE2 1 
ATOM   4576  N  N   . LYS C  3  154 ? -37.287 6.607   257.817  1.00 59.86  ? 232 LYS C N   1 
ATOM   4577  C  CA  . LYS C  3  154 ? -36.000 6.786   258.468  1.00 47.75  ? 232 LYS C CA  1 
ATOM   4578  C  C   . LYS C  3  154 ? -36.225 7.662   259.690  1.00 52.41  ? 232 LYS C C   1 
ATOM   4579  O  O   . LYS C  3  154 ? -35.868 7.290   260.803  1.00 49.69  ? 232 LYS C O   1 
ATOM   4580  C  CB  . LYS C  3  154 ? -35.009 7.475   257.531  1.00 33.23  ? 232 LYS C CB  1 
ATOM   4581  C  CG  . LYS C  3  154 ? -34.891 6.859   256.148  1.00 49.86  ? 232 LYS C CG  1 
ATOM   4582  C  CD  . LYS C  3  154 ? -33.908 7.683   255.322  1.00 55.91  ? 232 LYS C CD  1 
ATOM   4583  C  CE  . LYS C  3  154 ? -33.931 7.332   253.843  1.00 57.62  ? 232 LYS C CE  1 
ATOM   4584  N  NZ  . LYS C  3  154 ? -32.937 8.160   253.084  1.00 64.79  ? 232 LYS C NZ  1 
ATOM   4585  N  N   . ILE C  3  155 ? -36.825 8.830   259.468  1.00 56.34  ? 233 ILE C N   1 
ATOM   4586  C  CA  . ILE C  3  155 ? -37.109 9.772   260.542  1.00 51.92  ? 233 ILE C CA  1 
ATOM   4587  C  C   . ILE C  3  155 ? -37.761 9.080   261.721  1.00 58.56  ? 233 ILE C C   1 
ATOM   4588  O  O   . ILE C  3  155 ? -37.469 9.403   262.873  1.00 72.81  ? 233 ILE C O   1 
ATOM   4589  C  CB  . ILE C  3  155 ? -38.035 10.884  260.069  1.00 48.71  ? 233 ILE C CB  1 
ATOM   4590  C  CG1 . ILE C  3  155 ? -37.294 11.778  259.073  1.00 38.90  ? 233 ILE C CG1 1 
ATOM   4591  C  CG2 . ILE C  3  155 ? -38.521 11.692  261.252  1.00 42.74  ? 233 ILE C CG2 1 
ATOM   4592  C  CD1 . ILE C  3  155 ? -38.148 12.877  258.520  1.00 36.12  ? 233 ILE C CD1 1 
ATOM   4593  N  N   . HIS C  3  156 ? -38.651 8.137   261.435  1.00 51.77  ? 234 HIS C N   1 
ATOM   4594  C  CA  . HIS C  3  156 ? -39.324 7.394   262.490  1.00 60.08  ? 234 HIS C CA  1 
ATOM   4595  C  C   . HIS C  3  156 ? -38.297 6.564   263.263  1.00 64.46  ? 234 HIS C C   1 
ATOM   4596  O  O   . HIS C  3  156 ? -38.184 6.671   264.486  1.00 67.12  ? 234 HIS C O   1 
ATOM   4597  C  CB  . HIS C  3  156 ? -40.384 6.476   261.888  1.00 62.35  ? 234 HIS C CB  1 
ATOM   4598  C  CG  . HIS C  3  156 ? -40.936 5.475   262.854  1.00 63.98  ? 234 HIS C CG  1 
ATOM   4599  N  ND1 . HIS C  3  156 ? -41.481 5.834   264.070  1.00 57.37  ? 234 HIS C ND1 1 
ATOM   4600  C  CD2 . HIS C  3  156 ? -41.046 4.128   262.775  1.00 59.23  ? 234 HIS C CD2 1 
ATOM   4601  C  CE1 . HIS C  3  156 ? -41.903 4.751   264.696  1.00 58.23  ? 234 HIS C CE1 1 
ATOM   4602  N  NE2 . HIS C  3  156 ? -41.652 3.702   263.932  1.00 53.66  ? 234 HIS C NE2 1 
ATOM   4603  N  N   . LEU C  3  157 ? -37.554 5.737   262.533  1.00 67.91  ? 235 LEU C N   1 
ATOM   4604  C  CA  . LEU C  3  157 ? -36.513 4.886   263.106  1.00 60.02  ? 235 LEU C CA  1 
ATOM   4605  C  C   . LEU C  3  157 ? -35.529 5.715   263.918  1.00 61.95  ? 235 LEU C C   1 
ATOM   4606  O  O   . LEU C  3  157 ? -35.201 5.377   265.048  1.00 67.72  ? 235 LEU C O   1 
ATOM   4607  C  CB  . LEU C  3  157 ? -35.747 4.179   261.990  1.00 53.98  ? 235 LEU C CB  1 
ATOM   4608  C  CG  . LEU C  3  157 ? -36.494 3.083   261.240  1.00 51.32  ? 235 LEU C CG  1 
ATOM   4609  C  CD1 . LEU C  3  157 ? -35.780 2.754   259.949  1.00 46.77  ? 235 LEU C CD1 1 
ATOM   4610  C  CD2 . LEU C  3  157 ? -36.596 1.869   262.117  1.00 36.16  ? 235 LEU C CD2 1 
ATOM   4611  N  N   . LEU C  3  158 ? -35.059 6.800   263.317  1.00 58.85  ? 236 LEU C N   1 
ATOM   4612  C  CA  . LEU C  3  158 ? -34.104 7.696   263.944  1.00 60.64  ? 236 LEU C CA  1 
ATOM   4613  C  C   . LEU C  3  158 ? -34.622 8.262   265.262  1.00 69.54  ? 236 LEU C C   1 
ATOM   4614  O  O   . LEU C  3  158 ? -33.955 8.164   266.292  1.00 79.12  ? 236 LEU C O   1 
ATOM   4615  C  CB  . LEU C  3  158 ? -33.762 8.837   262.974  1.00 47.15  ? 236 LEU C CB  1 
ATOM   4616  C  CG  . LEU C  3  158 ? -32.684 9.833   263.397  1.00 53.00  ? 236 LEU C CG  1 
ATOM   4617  C  CD1 . LEU C  3  158 ? -31.525 9.104   264.041  1.00 63.28  ? 236 LEU C CD1 1 
ATOM   4618  C  CD2 . LEU C  3  158 ? -32.206 10.614  262.180  1.00 47.79  ? 236 LEU C CD2 1 
ATOM   4619  N  N   . THR C  3  159 ? -35.821 8.836   265.235  1.00 72.84  ? 237 THR C N   1 
ATOM   4620  C  CA  . THR C  3  159 ? -36.408 9.441   266.424  1.00 68.45  ? 237 THR C CA  1 
ATOM   4621  C  C   . THR C  3  159 ? -36.891 8.475   267.496  1.00 69.30  ? 237 THR C C   1 
ATOM   4622  O  O   . THR C  3  159 ? -36.832 8.796   268.679  1.00 87.39  ? 237 THR C O   1 
ATOM   4623  C  CB  . THR C  3  159 ? -37.577 10.370  266.053  1.00 67.05  ? 237 THR C CB  1 
ATOM   4624  O  OG1 . THR C  3  159 ? -38.544 9.637   265.292  1.00 65.71  ? 237 THR C OG1 1 
ATOM   4625  C  CG2 . THR C  3  159 ? -37.079 11.559  265.241  1.00 54.78  ? 237 THR C CG2 1 
ATOM   4626  N  N   . GLY C  3  160 ? -37.380 7.306   267.103  1.00 61.59  ? 238 GLY C N   1 
ATOM   4627  C  CA  . GLY C  3  160 ? -37.850 6.359   268.103  1.00 60.06  ? 238 GLY C CA  1 
ATOM   4628  C  C   . GLY C  3  160 ? -36.700 5.633   268.785  1.00 59.81  ? 238 GLY C C   1 
ATOM   4629  O  O   . GLY C  3  160 ? -36.893 4.801   269.667  1.00 56.86  ? 238 GLY C O   1 
ATOM   4630  N  N   . GLN C  3  161 ? -35.488 5.970   268.374  1.00 63.23  ? 239 GLN C N   1 
ATOM   4631  C  CA  . GLN C  3  161 ? -34.274 5.353   268.885  1.00 60.98  ? 239 GLN C CA  1 
ATOM   4632  C  C   . GLN C  3  161 ? -33.834 5.972   270.200  1.00 59.46  ? 239 GLN C C   1 
ATOM   4633  O  O   . GLN C  3  161 ? -33.338 5.282   271.095  1.00 52.34  ? 239 GLN C O   1 
ATOM   4634  C  CB  . GLN C  3  161 ? -33.201 5.523   267.817  1.00 71.57  ? 239 GLN C CB  1 
ATOM   4635  C  CG  . GLN C  3  161 ? -31.797 5.131   268.164  1.00 72.27  ? 239 GLN C CG  1 
ATOM   4636  C  CD  . GLN C  3  161 ? -30.855 5.458   267.015  1.00 62.43  ? 239 GLN C CD  1 
ATOM   4637  O  OE1 . GLN C  3  161 ? -30.774 6.600   266.575  1.00 58.82  ? 239 GLN C OE1 1 
ATOM   4638  N  NE2 . GLN C  3  161 ? -30.152 4.456   266.520  1.00 56.95  ? 239 GLN C NE2 1 
ATOM   4639  N  N   . GLN C  3  162 ? -34.022 7.283   270.295  1.00 52.34  ? 240 GLN C N   1 
ATOM   4640  C  CA  . GLN C  3  162 ? -33.661 8.053   271.474  1.00 54.73  ? 240 GLN C CA  1 
ATOM   4641  C  C   . GLN C  3  162 ? -34.666 9.176   271.658  1.00 64.11  ? 240 GLN C C   1 
ATOM   4642  O  O   . GLN C  3  162 ? -35.798 9.108   271.179  1.00 64.93  ? 240 GLN C O   1 
ATOM   4643  C  CB  . GLN C  3  162 ? -32.282 8.680   271.294  1.00 62.64  ? 240 GLN C CB  1 
ATOM   4644  C  CG  . GLN C  3  162 ? -31.135 7.911   271.891  1.00 72.75  ? 240 GLN C CG  1 
ATOM   4645  C  CD  . GLN C  3  162 ? -29.793 8.552   271.576  1.00 87.84  ? 240 GLN C CD  1 
ATOM   4646  O  OE1 . GLN C  3  162 ? -28.768 8.169   272.142  1.00 99.38  ? 240 GLN C OE1 1 
ATOM   4647  N  NE2 . GLN C  3  162 ? -29.792 9.530   270.662  1.00 80.88  ? 240 GLN C NE2 1 
ATOM   4648  N  N   . ALA C  3  163 ? -34.239 10.214  272.365  1.00 70.27  ? 241 ALA C N   1 
ATOM   4649  C  CA  . ALA C  3  163 ? -35.070 11.385  272.577  1.00 71.91  ? 241 ALA C CA  1 
ATOM   4650  C  C   . ALA C  3  163 ? -34.377 12.474  271.773  1.00 69.50  ? 241 ALA C C   1 
ATOM   4651  O  O   . ALA C  3  163 ? -33.243 12.833  272.076  1.00 68.56  ? 241 ALA C O   1 
ATOM   4652  C  CB  . ALA C  3  163 ? -35.097 11.745  274.039  1.00 76.05  ? 241 ALA C CB  1 
ATOM   4653  N  N   . TYR C  3  164 ? -35.034 12.975  270.732  1.00 66.15  ? 242 TYR C N   1 
ATOM   4654  C  CA  . TYR C  3  164 ? -34.413 14.005  269.914  1.00 56.88  ? 242 TYR C CA  1 
ATOM   4655  C  C   . TYR C  3  164 ? -35.030 15.376  270.018  1.00 54.60  ? 242 TYR C C   1 
ATOM   4656  O  O   . TYR C  3  164 ? -36.232 15.544  270.168  1.00 58.90  ? 242 TYR C O   1 
ATOM   4657  C  CB  . TYR C  3  164 ? -34.389 13.605  268.437  1.00 59.08  ? 242 TYR C CB  1 
ATOM   4658  C  CG  . TYR C  3  164 ? -33.398 12.522  268.104  1.00 53.77  ? 242 TYR C CG  1 
ATOM   4659  C  CD1 . TYR C  3  164 ? -33.721 11.186  268.288  1.00 36.99  ? 242 TYR C CD1 1 
ATOM   4660  C  CD2 . TYR C  3  164 ? -32.124 12.838  267.637  1.00 39.39  ? 242 TYR C CD2 1 
ATOM   4661  C  CE1 . TYR C  3  164 ? -32.806 10.190  268.018  1.00 51.23  ? 242 TYR C CE1 1 
ATOM   4662  C  CE2 . TYR C  3  164 ? -31.201 11.844  267.367  1.00 50.70  ? 242 TYR C CE2 1 
ATOM   4663  C  CZ  . TYR C  3  164 ? -31.551 10.521  267.561  1.00 40.82  ? 242 TYR C CZ  1 
ATOM   4664  O  OH  . TYR C  3  164 ? -30.651 9.520   267.304  1.00 50.02  ? 242 TYR C OH  1 
ATOM   4665  N  N   . ARG C  3  165 ? -34.168 16.364  269.923  1.00 47.40  ? 243 ARG C N   1 
ATOM   4666  C  CA  . ARG C  3  165 ? -34.570 17.739  269.978  1.00 51.12  ? 243 ARG C CA  1 
ATOM   4667  C  C   . ARG C  3  165 ? -34.599 18.196  268.534  1.00 67.02  ? 243 ARG C C   1 
ATOM   4668  O  O   . ARG C  3  165 ? -33.563 18.248  267.867  1.00 74.91  ? 243 ARG C O   1 
ATOM   4669  C  CB  . ARG C  3  165 ? -33.526 18.539  270.741  1.00 63.76  ? 243 ARG C CB  1 
ATOM   4670  C  CG  . ARG C  3  165 ? -33.746 20.027  270.718  1.00 65.19  ? 243 ARG C CG  1 
ATOM   4671  C  CD  . ARG C  3  165 ? -32.459 20.766  271.024  1.00 76.02  ? 243 ARG C CD  1 
ATOM   4672  N  NE  . ARG C  3  165 ? -32.724 21.967  271.802  1.00 76.23  ? 243 ARG C NE  1 
ATOM   4673  C  CZ  . ARG C  3  165 ? -32.799 21.975  273.124  1.00 73.97  ? 243 ARG C CZ  1 
ATOM   4674  N  NH1 . ARG C  3  165 ? -32.612 20.845  273.794  1.00 66.91  ? 243 ARG C NH1 1 
ATOM   4675  N  NH2 . ARG C  3  165 ? -33.084 23.101  273.770  1.00 80.94  ? 243 ARG C NH2 1 
ATOM   4676  N  N   . LEU C  3  166 ? -35.781 18.513  268.037  1.00 66.81  ? 244 LEU C N   1 
ATOM   4677  C  CA  . LEU C  3  166 ? -35.901 18.983  266.668  1.00 66.65  ? 244 LEU C CA  1 
ATOM   4678  C  C   . LEU C  3  166 ? -35.633 20.489  266.584  1.00 64.04  ? 244 LEU C C   1 
ATOM   4679  O  O   . LEU C  3  166 ? -36.092 21.249  267.429  1.00 78.89  ? 244 LEU C O   1 
ATOM   4680  C  CB  . LEU C  3  166 ? -37.311 18.697  266.147  1.00 63.43  ? 244 LEU C CB  1 
ATOM   4681  C  CG  . LEU C  3  166 ? -37.732 19.605  264.993  1.00 56.59  ? 244 LEU C CG  1 
ATOM   4682  C  CD1 . LEU C  3  166 ? -37.050 19.167  263.717  1.00 55.16  ? 244 LEU C CD1 1 
ATOM   4683  C  CD2 . LEU C  3  166 ? -39.225 19.565  264.849  1.00 55.79  ? 244 LEU C CD2 1 
ATOM   4684  N  N   . ARG C  3  167 ? -34.876 20.922  265.586  1.00 52.27  ? 245 ARG C N   1 
ATOM   4685  C  CA  . ARG C  3  167 ? -34.647 22.347  265.413  1.00 56.02  ? 245 ARG C CA  1 
ATOM   4686  C  C   . ARG C  3  167 ? -35.058 22.744  264.011  1.00 65.33  ? 245 ARG C C   1 
ATOM   4687  O  O   . ARG C  3  167 ? -34.803 22.025  263.045  1.00 68.85  ? 245 ARG C O   1 
ATOM   4688  C  CB  . ARG C  3  167 ? -33.193 22.754  265.614  1.00 52.68  ? 245 ARG C CB  1 
ATOM   4689  C  CG  . ARG C  3  167 ? -32.971 24.214  265.179  1.00 67.84  ? 245 ARG C CG  1 
ATOM   4690  C  CD  . ARG C  3  167 ? -31.701 24.818  265.741  1.00 79.61  ? 245 ARG C CD  1 
ATOM   4691  N  NE  . ARG C  3  167 ? -31.712 24.823  267.200  1.00 82.63  ? 245 ARG C NE  1 
ATOM   4692  C  CZ  . ARG C  3  167 ? -30.665 25.140  267.951  1.00 85.89  ? 245 ARG C CZ  1 
ATOM   4693  N  NH1 . ARG C  3  167 ? -29.517 25.486  267.379  1.00 93.64  ? 245 ARG C NH1 1 
ATOM   4694  N  NH2 . ARG C  3  167 ? -30.761 25.085  269.271  1.00 81.79  ? 245 ARG C NH2 1 
ATOM   4695  N  N   . ILE C  3  168 ? -35.693 23.901  263.909  1.00 67.40  ? 246 ILE C N   1 
ATOM   4696  C  CA  . ILE C  3  168 ? -36.149 24.404  262.635  1.00 63.42  ? 246 ILE C CA  1 
ATOM   4697  C  C   . ILE C  3  168 ? -35.463 25.726  262.400  1.00 65.42  ? 246 ILE C C   1 
ATOM   4698  O  O   . ILE C  3  168 ? -35.563 26.626  263.223  1.00 75.25  ? 246 ILE C O   1 
ATOM   4699  C  CB  . ILE C  3  168 ? -37.672 24.607  262.656  1.00 56.91  ? 246 ILE C CB  1 
ATOM   4700  C  CG1 . ILE C  3  168 ? -38.340 23.299  263.075  1.00 50.04  ? 246 ILE C CG1 1 
ATOM   4701  C  CG2 . ILE C  3  168 ? -38.167 25.057  261.284  1.00 50.71  ? 246 ILE C CG2 1 
ATOM   4702  C  CD1 . ILE C  3  168 ? -39.827 23.400  263.244  1.00 62.31  ? 246 ILE C CD1 1 
ATOM   4703  N  N   . ASP C  3  169 ? -34.744 25.836  261.291  1.00 65.49  ? 247 ASP C N   1 
ATOM   4704  C  CA  . ASP C  3  169 ? -34.068 27.079  260.966  1.00 71.39  ? 247 ASP C CA  1 
ATOM   4705  C  C   . ASP C  3  169 ? -34.723 27.677  259.733  1.00 73.92  ? 247 ASP C C   1 
ATOM   4706  O  O   . ASP C  3  169 ? -34.634 27.112  258.643  1.00 88.44  ? 247 ASP C O   1 
ATOM   4707  C  CB  . ASP C  3  169 ? -32.583 26.841  260.681  1.00 78.27  ? 247 ASP C CB  1 
ATOM   4708  C  CG  . ASP C  3  169 ? -31.843 26.257  261.865  1.00 87.60  ? 247 ASP C CG  1 
ATOM   4709  O  OD1 . ASP C  3  169 ? -32.035 26.755  262.996  1.00 89.39  ? 247 ASP C OD1 1 
ATOM   4710  O  OD2 . ASP C  3  169 ? -31.055 25.307  261.659  1.00 87.67  ? 247 ASP C OD2 1 
ATOM   4711  N  N   . LEU C  3  170 ? -35.391 28.812  259.900  1.00 66.50  ? 248 LEU C N   1 
ATOM   4712  C  CA  . LEU C  3  170 ? -36.027 29.468  258.770  1.00 64.63  ? 248 LEU C CA  1 
ATOM   4713  C  C   . LEU C  3  170 ? -35.190 30.666  258.353  1.00 69.14  ? 248 LEU C C   1 
ATOM   4714  O  O   . LEU C  3  170 ? -34.372 31.157  259.124  1.00 75.36  ? 248 LEU C O   1 
ATOM   4715  C  CB  . LEU C  3  170 ? -37.439 29.915  259.130  1.00 48.18  ? 248 LEU C CB  1 
ATOM   4716  C  CG  . LEU C  3  170 ? -38.314 28.804  259.697  1.00 53.94  ? 248 LEU C CG  1 
ATOM   4717  C  CD1 . LEU C  3  170 ? -38.038 27.492  258.985  1.00 34.66  ? 248 LEU C CD1 1 
ATOM   4718  C  CD2 . LEU C  3  170 ? -38.011 28.651  261.160  1.00 61.62  ? 248 LEU C CD2 1 
ATOM   4719  N  N   . THR C  3  171 ? -35.382 31.128  257.126  1.00 68.55  ? 249 THR C N   1 
ATOM   4720  C  CA  . THR C  3  171 ? -34.623 32.261  256.632  1.00 71.39  ? 249 THR C CA  1 
ATOM   4721  C  C   . THR C  3  171 ? -35.476 33.029  255.651  1.00 82.80  ? 249 THR C C   1 
ATOM   4722  O  O   . THR C  3  171 ? -35.987 32.458  254.682  1.00 77.43  ? 249 THR C O   1 
ATOM   4723  C  CB  . THR C  3  171 ? -33.332 31.814  255.924  1.00 66.17  ? 249 THR C CB  1 
ATOM   4724  O  OG1 . THR C  3  171 ? -32.474 31.155  256.864  1.00 65.98  ? 249 THR C OG1 1 
ATOM   4725  C  CG2 . THR C  3  171 ? -32.605 33.011  255.343  1.00 61.56  ? 249 THR C CG2 1 
ATOM   4726  N  N   . ASP C  3  172 ? -35.640 34.325  255.915  1.00 90.93  ? 250 ASP C N   1 
ATOM   4727  C  CA  . ASP C  3  172 ? -36.440 35.169  255.040  1.00 92.21  ? 250 ASP C CA  1 
ATOM   4728  C  C   . ASP C  3  172 ? -35.582 35.741  253.928  1.00 90.34  ? 250 ASP C C   1 
ATOM   4729  O  O   . ASP C  3  172 ? -34.352 35.642  253.961  1.00 89.90  ? 250 ASP C O   1 
ATOM   4730  C  CB  . ASP C  3  172 ? -37.130 36.299  255.822  1.00 90.15  ? 250 ASP C CB  1 
ATOM   4731  C  CG  . ASP C  3  172 ? -36.153 37.214  256.529  1.00 96.72  ? 250 ASP C CG  1 
ATOM   4732  O  OD1 . ASP C  3  172 ? -35.186 37.682  255.878  1.00 92.63  ? 250 ASP C OD1 1 
ATOM   4733  O  OD2 . ASP C  3  172 ? -36.374 37.474  257.737  1.00 86.19  ? 250 ASP C OD2 1 
ATOM   4734  N  N   . TRP C  3  173 ? -36.241 36.335  252.941  1.00 87.19  ? 251 TRP C N   1 
ATOM   4735  C  CA  . TRP C  3  173 ? -35.545 36.891  251.802  1.00 89.87  ? 251 TRP C CA  1 
ATOM   4736  C  C   . TRP C  3  173 ? -34.681 38.088  252.142  1.00 95.21  ? 251 TRP C C   1 
ATOM   4737  O  O   . TRP C  3  173 ? -33.813 38.485  251.361  1.00 92.27  ? 251 TRP C O   1 
ATOM   4738  C  CB  . TRP C  3  173 ? -36.558 37.209  250.722  1.00 86.15  ? 251 TRP C CB  1 
ATOM   4739  C  CG  . TRP C  3  173 ? -37.294 35.972  250.359  1.00 88.48  ? 251 TRP C CG  1 
ATOM   4740  C  CD1 . TRP C  3  173 ? -38.340 35.410  251.037  1.00 87.74  ? 251 TRP C CD1 1 
ATOM   4741  C  CD2 . TRP C  3  173 ? -36.983 35.075  249.284  1.00 88.14  ? 251 TRP C CD2 1 
ATOM   4742  N  NE1 . TRP C  3  173 ? -38.700 34.216  250.451  1.00 80.66  ? 251 TRP C NE1 1 
ATOM   4743  C  CE2 . TRP C  3  173 ? -37.884 33.988  249.373  1.00 88.83  ? 251 TRP C CE2 1 
ATOM   4744  C  CE3 . TRP C  3  173 ? -36.031 35.085  248.253  1.00 74.96  ? 251 TRP C CE3 1 
ATOM   4745  C  CZ2 . TRP C  3  173 ? -37.862 32.920  248.469  1.00 91.31  ? 251 TRP C CZ2 1 
ATOM   4746  C  CZ3 . TRP C  3  173 ? -36.009 34.023  247.353  1.00 75.91  ? 251 TRP C CZ3 1 
ATOM   4747  C  CH2 . TRP C  3  173 ? -36.920 32.955  247.468  1.00 80.72  ? 251 TRP C CH2 1 
ATOM   4748  N  N   . GLU C  3  174 ? -34.909 38.663  253.316  1.00 99.76  ? 252 GLU C N   1 
ATOM   4749  C  CA  . GLU C  3  174 ? -34.091 39.781  253.742  1.00 103.70 ? 252 GLU C CA  1 
ATOM   4750  C  C   . GLU C  3  174 ? -32.905 39.122  254.419  1.00 102.76 ? 252 GLU C C   1 
ATOM   4751  O  O   . GLU C  3  174 ? -32.008 39.784  254.937  1.00 104.65 ? 252 GLU C O   1 
ATOM   4752  C  CB  . GLU C  3  174 ? -34.842 40.665  254.726  1.00 111.57 ? 252 GLU C CB  1 
ATOM   4753  C  CG  . GLU C  3  174 ? -34.061 41.893  255.134  1.00 113.10 ? 252 GLU C CG  1 
ATOM   4754  C  CD  . GLU C  3  174 ? -34.876 42.819  255.995  1.00 120.56 ? 252 GLU C CD  1 
ATOM   4755  O  OE1 . GLU C  3  174 ? -35.844 43.409  255.470  1.00 122.87 ? 252 GLU C OE1 1 
ATOM   4756  O  OE2 . GLU C  3  174 ? -34.554 42.949  257.195  1.00 121.29 ? 252 GLU C OE2 1 
ATOM   4757  N  N   . ASN C  3  175 ? -32.935 37.794  254.411  1.00 104.08 ? 253 ASN C N   1 
ATOM   4758  C  CA  . ASN C  3  175 ? -31.879 36.968  254.975  1.00 104.64 ? 253 ASN C CA  1 
ATOM   4759  C  C   . ASN C  3  175 ? -31.784 36.999  256.494  1.00 95.17  ? 253 ASN C C   1 
ATOM   4760  O  O   . ASN C  3  175 ? -30.715 37.237  257.051  1.00 90.33  ? 253 ASN C O   1 
ATOM   4761  C  CB  . ASN C  3  175 ? -30.535 37.375  254.368  1.00 113.41 ? 253 ASN C CB  1 
ATOM   4762  C  CG  . ASN C  3  175 ? -29.415 36.459  254.786  1.00 123.87 ? 253 ASN C CG  1 
ATOM   4763  O  OD1 . ASN C  3  175 ? -29.399 35.279  254.432  1.00 138.45 ? 253 ASN C OD1 1 
ATOM   4764  N  ND2 . ASN C  3  175 ? -28.473 36.990  255.555  1.00 125.86 ? 253 ASN C ND2 1 
ATOM   4765  N  N   . THR C  3  176 ? -32.899 36.754  257.167  1.00 89.53  ? 254 THR C N   1 
ATOM   4766  C  CA  . THR C  3  176 ? -32.899 36.740  258.624  1.00 93.91  ? 254 THR C CA  1 
ATOM   4767  C  C   . THR C  3  176 ? -33.040 35.292  259.075  1.00 95.05  ? 254 THR C C   1 
ATOM   4768  O  O   . THR C  3  176 ? -33.835 34.542  258.511  1.00 95.01  ? 254 THR C O   1 
ATOM   4769  C  CB  . THR C  3  176 ? -34.054 37.585  259.200  1.00 88.51  ? 254 THR C CB  1 
ATOM   4770  O  OG1 . THR C  3  176 ? -33.899 38.948  258.781  1.00 87.83  ? 254 THR C OG1 1 
ATOM   4771  C  CG2 . THR C  3  176 ? -34.051 37.529  260.723  1.00 86.65  ? 254 THR C CG2 1 
ATOM   4772  N  N   . HIS C  3  177 ? -32.270 34.903  260.089  1.00 93.10  ? 255 HIS C N   1 
ATOM   4773  C  CA  . HIS C  3  177 ? -32.299 33.528  260.566  1.00 96.52  ? 255 HIS C CA  1 
ATOM   4774  C  C   . HIS C  3  177 ? -32.815 33.334  261.977  1.00 97.82  ? 255 HIS C C   1 
ATOM   4775  O  O   . HIS C  3  177 ? -32.070 33.516  262.939  1.00 105.65 ? 255 HIS C O   1 
ATOM   4776  C  CB  . HIS C  3  177 ? -30.900 32.913  260.491  1.00 99.90  ? 255 HIS C CB  1 
ATOM   4777  C  CG  . HIS C  3  177 ? -30.186 33.185  259.205  1.00 105.92 ? 255 HIS C CG  1 
ATOM   4778  N  ND1 . HIS C  3  177 ? -29.722 34.438  258.863  1.00 103.88 ? 255 HIS C ND1 1 
ATOM   4779  C  CD2 . HIS C  3  177 ? -29.848 32.366  258.181  1.00 104.22 ? 255 HIS C CD2 1 
ATOM   4780  C  CE1 . HIS C  3  177 ? -29.126 34.379  257.686  1.00 98.31  ? 255 HIS C CE1 1 
ATOM   4781  N  NE2 . HIS C  3  177 ? -29.189 33.133  257.251  1.00 105.53 ? 255 HIS C NE2 1 
ATOM   4782  N  N   . ARG C  3  178 ? -34.082 32.953  262.103  1.00 89.97  ? 256 ARG C N   1 
ATOM   4783  C  CA  . ARG C  3  178 ? -34.659 32.694  263.414  1.00 87.96  ? 256 ARG C CA  1 
ATOM   4784  C  C   . ARG C  3  178 ? -34.871 31.185  263.535  1.00 83.31  ? 256 ARG C C   1 
ATOM   4785  O  O   . ARG C  3  178 ? -34.804 30.474  262.535  1.00 86.57  ? 256 ARG C O   1 
ATOM   4786  C  CB  . ARG C  3  178 ? -35.966 33.472  263.588  1.00 94.12  ? 256 ARG C CB  1 
ATOM   4787  C  CG  . ARG C  3  178 ? -35.748 34.987  263.667  1.00 102.10 ? 256 ARG C CG  1 
ATOM   4788  C  CD  . ARG C  3  178 ? -36.981 35.711  264.175  1.00 106.50 ? 256 ARG C CD  1 
ATOM   4789  N  NE  . ARG C  3  178 ? -36.804 37.161  264.223  1.00 116.62 ? 256 ARG C NE  1 
ATOM   4790  C  CZ  . ARG C  3  178 ? -37.747 38.016  264.614  1.00 123.78 ? 256 ARG C CZ  1 
ATOM   4791  N  NH1 . ARG C  3  178 ? -38.939 37.571  264.995  1.00 122.34 ? 256 ARG C NH1 1 
ATOM   4792  N  NH2 . ARG C  3  178 ? -37.503 39.320  264.619  1.00 128.06 ? 256 ARG C NH2 1 
ATOM   4793  N  N   . TYR C  3  179 ? -35.110 30.685  264.744  1.00 71.71  ? 257 TYR C N   1 
ATOM   4794  C  CA  . TYR C  3  179 ? -35.278 29.252  264.918  1.00 68.10  ? 257 TYR C CA  1 
ATOM   4795  C  C   . TYR C  3  179 ? -36.322 28.844  265.950  1.00 74.16  ? 257 TYR C C   1 
ATOM   4796  O  O   . TYR C  3  179 ? -36.712 29.634  266.807  1.00 79.05  ? 257 TYR C O   1 
ATOM   4797  C  CB  . TYR C  3  179 ? -33.951 28.626  265.326  1.00 81.23  ? 257 TYR C CB  1 
ATOM   4798  C  CG  . TYR C  3  179 ? -33.642 28.812  266.797  1.00 85.40  ? 257 TYR C CG  1 
ATOM   4799  C  CD1 . TYR C  3  179 ? -33.212 30.046  267.291  1.00 80.76  ? 257 TYR C CD1 1 
ATOM   4800  C  CD2 . TYR C  3  179 ? -33.833 27.766  267.704  1.00 85.67  ? 257 TYR C CD2 1 
ATOM   4801  C  CE1 . TYR C  3  179 ? -32.982 30.237  268.650  1.00 87.98  ? 257 TYR C CE1 1 
ATOM   4802  C  CE2 . TYR C  3  179 ? -33.608 27.943  269.067  1.00 90.88  ? 257 TYR C CE2 1 
ATOM   4803  C  CZ  . TYR C  3  179 ? -33.184 29.181  269.535  1.00 94.77  ? 257 TYR C CZ  1 
ATOM   4804  O  OH  . TYR C  3  179 ? -32.971 29.358  270.884  1.00 87.73  ? 257 TYR C OH  1 
ATOM   4805  N  N   . ALA C  3  180 ? -36.737 27.583  265.873  1.00 66.99  ? 258 ALA C N   1 
ATOM   4806  C  CA  . ALA C  3  180 ? -37.719 27.015  266.785  1.00 72.96  ? 258 ALA C CA  1 
ATOM   4807  C  C   . ALA C  3  180 ? -37.232 25.638  267.224  1.00 78.93  ? 258 ALA C C   1 
ATOM   4808  O  O   . ALA C  3  180 ? -36.646 24.906  266.431  1.00 88.35  ? 258 ALA C O   1 
ATOM   4809  C  CB  . ALA C  3  180 ? -39.070 26.891  266.084  1.00 74.29  ? 258 ALA C CB  1 
ATOM   4810  N  N   . ASP C  3  181 ? -37.473 25.282  268.481  1.00 75.81  ? 259 ASP C N   1 
ATOM   4811  C  CA  . ASP C  3  181 ? -37.044 23.981  268.988  1.00 76.13  ? 259 ASP C CA  1 
ATOM   4812  C  C   . ASP C  3  181 ? -38.187 23.191  269.617  1.00 77.20  ? 259 ASP C C   1 
ATOM   4813  O  O   . ASP C  3  181 ? -39.103 23.761  270.212  1.00 89.03  ? 259 ASP C O   1 
ATOM   4814  C  CB  . ASP C  3  181 ? -35.920 24.160  270.014  1.00 74.28  ? 259 ASP C CB  1 
ATOM   4815  C  CG  . ASP C  3  181 ? -34.607 24.594  269.377  1.00 78.99  ? 259 ASP C CG  1 
ATOM   4816  O  OD1 . ASP C  3  181 ? -34.644 25.164  268.264  1.00 82.32  ? 259 ASP C OD1 1 
ATOM   4817  O  OD2 . ASP C  3  181 ? -33.539 24.377  269.997  1.00 60.63  ? 259 ASP C OD2 1 
ATOM   4818  N  N   . TYR C  3  182 ? -38.124 21.873  269.482  1.00 67.32  ? 260 TYR C N   1 
ATOM   4819  C  CA  . TYR C  3  182 ? -39.141 20.998  270.037  1.00 68.34  ? 260 TYR C CA  1 
ATOM   4820  C  C   . TYR C  3  182 ? -38.454 19.764  270.597  1.00 64.80  ? 260 TYR C C   1 
ATOM   4821  O  O   . TYR C  3  182 ? -37.662 19.116  269.918  1.00 76.28  ? 260 TYR C O   1 
ATOM   4822  C  CB  . TYR C  3  182 ? -40.150 20.625  268.949  1.00 71.19  ? 260 TYR C CB  1 
ATOM   4823  C  CG  . TYR C  3  182 ? -41.037 21.779  268.555  1.00 68.03  ? 260 TYR C CG  1 
ATOM   4824  C  CD1 . TYR C  3  182 ? -42.290 21.941  269.139  1.00 70.33  ? 260 TYR C CD1 1 
ATOM   4825  C  CD2 . TYR C  3  182 ? -40.609 22.736  267.627  1.00 57.58  ? 260 TYR C CD2 1 
ATOM   4826  C  CE1 . TYR C  3  182 ? -43.105 23.023  268.816  1.00 74.11  ? 260 TYR C CE1 1 
ATOM   4827  C  CE2 . TYR C  3  182 ? -41.415 23.828  267.295  1.00 62.87  ? 260 TYR C CE2 1 
ATOM   4828  C  CZ  . TYR C  3  182 ? -42.669 23.962  267.898  1.00 71.90  ? 260 TYR C CZ  1 
ATOM   4829  O  OH  . TYR C  3  182 ? -43.501 25.018  267.588  1.00 72.65  ? 260 TYR C OH  1 
ATOM   4830  N  N   . GLY C  3  183 ? -38.756 19.449  271.845  1.00 55.32  ? 261 GLY C N   1 
ATOM   4831  C  CA  . GLY C  3  183 ? -38.131 18.315  272.479  1.00 61.38  ? 261 GLY C CA  1 
ATOM   4832  C  C   . GLY C  3  183 ? -38.869 17.026  272.257  1.00 62.05  ? 261 GLY C C   1 
ATOM   4833  O  O   . GLY C  3  183 ? -40.045 17.031  271.899  1.00 62.33  ? 261 GLY C O   1 
ATOM   4834  N  N   . HIS C  3  184 ? -38.155 15.923  272.465  1.00 61.72  ? 262 HIS C N   1 
ATOM   4835  C  CA  . HIS C  3  184 ? -38.705 14.590  272.310  1.00 57.50  ? 262 HIS C CA  1 
ATOM   4836  C  C   . HIS C  3  184 ? -39.409 14.378  270.973  1.00 60.98  ? 262 HIS C C   1 
ATOM   4837  O  O   . HIS C  3  184 ? -40.268 13.512  270.845  1.00 49.31  ? 262 HIS C O   1 
ATOM   4838  C  CB  . HIS C  3  184 ? -39.641 14.331  273.474  1.00 61.82  ? 262 HIS C CB  1 
ATOM   4839  C  CG  . HIS C  3  184 ? -38.981 14.510  274.800  1.00 72.13  ? 262 HIS C CG  1 
ATOM   4840  N  ND1 . HIS C  3  184 ? -38.130 13.569  275.338  1.00 79.96  ? 262 HIS C ND1 1 
ATOM   4841  C  CD2 . HIS C  3  184 ? -38.968 15.560  275.652  1.00 75.72  ? 262 HIS C CD2 1 
ATOM   4842  C  CE1 . HIS C  3  184 ? -37.619 14.035  276.463  1.00 83.78  ? 262 HIS C CE1 1 
ATOM   4843  N  NE2 . HIS C  3  184 ? -38.111 15.242  276.676  1.00 85.33  ? 262 HIS C NE2 1 
ATOM   4844  N  N   . PHE C  3  185 ? -39.026 15.179  269.981  1.00 66.89  ? 263 PHE C N   1 
ATOM   4845  C  CA  . PHE C  3  185 ? -39.587 15.095  268.641  1.00 63.72  ? 263 PHE C CA  1 
ATOM   4846  C  C   . PHE C  3  185 ? -39.504 13.662  268.125  1.00 71.25  ? 263 PHE C C   1 
ATOM   4847  O  O   . PHE C  3  185 ? -38.530 12.951  268.382  1.00 82.81  ? 263 PHE C O   1 
ATOM   4848  C  CB  . PHE C  3  185 ? -38.817 16.001  267.685  1.00 66.94  ? 263 PHE C CB  1 
ATOM   4849  C  CG  . PHE C  3  185 ? -39.263 15.873  266.267  1.00 78.22  ? 263 PHE C CG  1 
ATOM   4850  C  CD1 . PHE C  3  185 ? -40.317 16.641  265.783  1.00 84.67  ? 263 PHE C CD1 1 
ATOM   4851  C  CD2 . PHE C  3  185 ? -38.688 14.928  265.433  1.00 78.05  ? 263 PHE C CD2 1 
ATOM   4852  C  CE1 . PHE C  3  185 ? -40.796 16.464  264.489  1.00 80.74  ? 263 PHE C CE1 1 
ATOM   4853  C  CE2 . PHE C  3  185 ? -39.160 14.742  264.139  1.00 83.38  ? 263 PHE C CE2 1 
ATOM   4854  C  CZ  . PHE C  3  185 ? -40.219 15.512  263.666  1.00 81.95  ? 263 PHE C CZ  1 
ATOM   4855  N  N   . LYS C  3  186 ? -40.522 13.243  267.384  1.00 66.18  ? 264 LYS C N   1 
ATOM   4856  C  CA  . LYS C  3  186 ? -40.563 11.891  266.842  1.00 71.47  ? 264 LYS C CA  1 
ATOM   4857  C  C   . LYS C  3  186 ? -41.804 11.716  265.983  1.00 73.67  ? 264 LYS C C   1 
ATOM   4858  O  O   . LYS C  3  186 ? -42.683 12.572  265.973  1.00 80.17  ? 264 LYS C O   1 
ATOM   4859  C  CB  . LYS C  3  186 ? -40.616 10.854  267.968  1.00 72.68  ? 264 LYS C CB  1 
ATOM   4860  C  CG  . LYS C  3  186 ? -41.911 10.922  268.774  1.00 80.83  ? 264 LYS C CG  1 
ATOM   4861  C  CD  . LYS C  3  186 ? -42.554 9.550   269.018  1.00 74.61  ? 264 LYS C CD  1 
ATOM   4862  C  CE  . LYS C  3  186 ? -41.942 8.808   270.207  1.00 77.96  ? 264 LYS C CE  1 
ATOM   4863  N  NZ  . LYS C  3  186 ? -42.757 7.611   270.592  1.00 55.70  ? 264 LYS C NZ  1 
ATOM   4864  N  N   . LEU C  3  187 ? -41.870 10.592  265.276  1.00 68.79  ? 265 LEU C N   1 
ATOM   4865  C  CA  . LEU C  3  187 ? -43.008 10.273  264.428  1.00 61.48  ? 265 LEU C CA  1 
ATOM   4866  C  C   . LEU C  3  187 ? -43.414 8.841   264.716  1.00 64.69  ? 265 LEU C C   1 
ATOM   4867  O  O   . LEU C  3  187 ? -42.560 7.978   264.894  1.00 76.12  ? 265 LEU C O   1 
ATOM   4868  C  CB  . LEU C  3  187 ? -42.638 10.398  262.951  1.00 59.55  ? 265 LEU C CB  1 
ATOM   4869  C  CG  . LEU C  3  187 ? -42.108 11.735  262.421  1.00 57.29  ? 265 LEU C CG  1 
ATOM   4870  C  CD1 . LEU C  3  187 ? -42.025 11.649  260.911  1.00 49.31  ? 265 LEU C CD1 1 
ATOM   4871  C  CD2 . LEU C  3  187 ? -43.007 12.887  262.827  1.00 49.92  ? 265 LEU C CD2 1 
ATOM   4872  N  N   . THR C  3  188 ? -44.713 8.583   264.778  1.00 63.79  ? 266 THR C N   1 
ATOM   4873  C  CA  . THR C  3  188 ? -45.190 7.230   265.034  1.00 66.60  ? 266 THR C CA  1 
ATOM   4874  C  C   . THR C  3  188 ? -44.939 6.429   263.764  1.00 63.39  ? 266 THR C C   1 
ATOM   4875  O  O   . THR C  3  188 ? -44.754 7.009   262.694  1.00 65.70  ? 266 THR C O   1 
ATOM   4876  C  CB  . THR C  3  188 ? -46.704 7.226   265.379  1.00 70.21  ? 266 THR C CB  1 
ATOM   4877  O  OG1 . THR C  3  188 ? -47.408 8.101   264.483  1.00 81.49  ? 266 THR C OG1 1 
ATOM   4878  C  CG2 . THR C  3  188 ? -46.926 7.695   266.805  1.00 60.33  ? 266 THR C CG2 1 
ATOM   4879  N  N   . PRO C  3  189 ? -44.911 5.089   263.863  1.00 65.16  ? 267 PRO C N   1 
ATOM   4880  C  CA  . PRO C  3  189 ? -44.677 4.257   262.676  1.00 69.67  ? 267 PRO C CA  1 
ATOM   4881  C  C   . PRO C  3  189 ? -45.812 4.362   261.661  1.00 74.84  ? 267 PRO C C   1 
ATOM   4882  O  O   . PRO C  3  189 ? -46.938 4.711   262.010  1.00 82.98  ? 267 PRO C O   1 
ATOM   4883  C  CB  . PRO C  3  189 ? -44.552 2.853   263.253  1.00 61.10  ? 267 PRO C CB  1 
ATOM   4884  C  CG  . PRO C  3  189 ? -45.461 2.900   264.425  1.00 62.96  ? 267 PRO C CG  1 
ATOM   4885  C  CD  . PRO C  3  189 ? -45.148 4.248   265.049  1.00 67.78  ? 267 PRO C CD  1 
ATOM   4886  N  N   . GLU C  3  190 ? -45.510 4.056   260.406  1.00 79.02  ? 268 GLU C N   1 
ATOM   4887  C  CA  . GLU C  3  190 ? -46.504 4.130   259.345  1.00 76.32  ? 268 GLU C CA  1 
ATOM   4888  C  C   . GLU C  3  190 ? -47.849 3.534   259.763  1.00 74.44  ? 268 GLU C C   1 
ATOM   4889  O  O   . GLU C  3  190 ? -48.887 3.897   259.216  1.00 74.28  ? 268 GLU C O   1 
ATOM   4890  C  CB  . GLU C  3  190 ? -45.964 3.438   258.093  1.00 79.84  ? 268 GLU C CB  1 
ATOM   4891  C  CG  . GLU C  3  190 ? -46.949 3.332   256.939  1.00 82.02  ? 268 GLU C CG  1 
ATOM   4892  C  CD  . GLU C  3  190 ? -46.264 3.048   255.617  1.00 79.57  ? 268 GLU C CD  1 
ATOM   4893  O  OE1 . GLU C  3  190 ? -45.318 2.232   255.596  1.00 77.67  ? 268 GLU C OE1 1 
ATOM   4894  O  OE2 . GLU C  3  190 ? -46.677 3.639   254.598  1.00 78.34  ? 268 GLU C OE2 1 
ATOM   4895  N  N   . SER C  3  191 ? -47.825 2.633   260.741  1.00 74.18  ? 269 SER C N   1 
ATOM   4896  C  CA  . SER C  3  191 ? -49.044 2.001   261.243  1.00 77.59  ? 269 SER C CA  1 
ATOM   4897  C  C   . SER C  3  191 ? -50.055 3.075   261.601  1.00 74.02  ? 269 SER C C   1 
ATOM   4898  O  O   . SER C  3  191 ? -51.200 3.042   261.162  1.00 74.46  ? 269 SER C O   1 
ATOM   4899  C  CB  . SER C  3  191 ? -48.736 1.187   262.498  1.00 88.07  ? 269 SER C CB  1 
ATOM   4900  O  OG  . SER C  3  191 ? -47.602 0.357   262.307  1.00 101.44 ? 269 SER C OG  1 
ATOM   4901  N  N   . ASP C  3  192 ? -49.605 4.018   262.420  1.00 74.78  ? 270 ASP C N   1 
ATOM   4902  C  CA  . ASP C  3  192 ? -50.406 5.148   262.878  1.00 78.02  ? 270 ASP C CA  1 
ATOM   4903  C  C   . ASP C  3  192 ? -50.034 6.339   261.995  1.00 72.49  ? 270 ASP C C   1 
ATOM   4904  O  O   . ASP C  3  192 ? -49.858 7.459   262.477  1.00 64.84  ? 270 ASP C O   1 
ATOM   4905  C  CB  . ASP C  3  192 ? -50.066 5.419   264.354  1.00 86.11  ? 270 ASP C CB  1 
ATOM   4906  C  CG  . ASP C  3  192 ? -50.637 6.732   264.872  1.00 94.27  ? 270 ASP C CG  1 
ATOM   4907  O  OD1 . ASP C  3  192 ? -51.810 7.034   264.563  1.00 100.15 ? 270 ASP C OD1 1 
ATOM   4908  O  OD2 . ASP C  3  192 ? -49.913 7.454   265.603  1.00 83.33  ? 270 ASP C OD2 1 
ATOM   4909  N  N   . GLU C  3  193 ? -49.934 6.084   260.692  1.00 71.98  ? 271 GLU C N   1 
ATOM   4910  C  CA  . GLU C  3  193 ? -49.525 7.111   259.742  1.00 76.63  ? 271 GLU C CA  1 
ATOM   4911  C  C   . GLU C  3  193 ? -48.199 7.569   260.314  1.00 77.73  ? 271 GLU C C   1 
ATOM   4912  O  O   . GLU C  3  193 ? -47.540 6.803   261.008  1.00 82.17  ? 271 GLU C O   1 
ATOM   4913  C  CB  . GLU C  3  193 ? -50.511 8.281   259.713  1.00 80.06  ? 271 GLU C CB  1 
ATOM   4914  C  CG  . GLU C  3  193 ? -51.961 7.879   259.484  1.00 83.68  ? 271 GLU C CG  1 
ATOM   4915  C  CD  . GLU C  3  193 ? -52.110 6.697   258.548  1.00 80.12  ? 271 GLU C CD  1 
ATOM   4916  O  OE1 . GLU C  3  193 ? -51.947 5.547   259.007  1.00 79.93  ? 271 GLU C OE1 1 
ATOM   4917  O  OE2 . GLU C  3  193 ? -52.382 6.917   257.354  1.00 76.92  ? 271 GLU C OE2 1 
ATOM   4918  N  N   . TYR C  3  194 ? -47.789 8.797   260.041  1.00 68.79  ? 272 TYR C N   1 
ATOM   4919  C  CA  . TYR C  3  194 ? -46.536 9.256   260.613  1.00 68.83  ? 272 TYR C CA  1 
ATOM   4920  C  C   . TYR C  3  194 ? -46.836 10.484  261.443  1.00 72.72  ? 272 TYR C C   1 
ATOM   4921  O  O   . TYR C  3  194 ? -46.399 11.600  261.142  1.00 74.04  ? 272 TYR C O   1 
ATOM   4922  C  CB  . TYR C  3  194 ? -45.514 9.547   259.517  1.00 76.85  ? 272 TYR C CB  1 
ATOM   4923  C  CG  . TYR C  3  194 ? -44.869 8.292   258.944  1.00 74.40  ? 272 TYR C CG  1 
ATOM   4924  C  CD1 . TYR C  3  194 ? -44.228 7.369   259.774  1.00 65.31  ? 272 TYR C CD1 1 
ATOM   4925  C  CD2 . TYR C  3  194 ? -44.877 8.044   257.571  1.00 74.55  ? 272 TYR C CD2 1 
ATOM   4926  C  CE1 . TYR C  3  194 ? -43.613 6.235   259.250  1.00 69.31  ? 272 TYR C CE1 1 
ATOM   4927  C  CE2 . TYR C  3  194 ? -44.261 6.909   257.036  1.00 73.73  ? 272 TYR C CE2 1 
ATOM   4928  C  CZ  . TYR C  3  194 ? -43.632 6.013   257.879  1.00 78.86  ? 272 TYR C CZ  1 
ATOM   4929  O  OH  . TYR C  3  194 ? -43.028 4.897   257.343  1.00 79.03  ? 272 TYR C OH  1 
ATOM   4930  N  N   . ARG C  3  195 ? -47.599 10.245  262.504  1.00 66.82  ? 273 ARG C N   1 
ATOM   4931  C  CA  . ARG C  3  195 ? -48.028 11.291  263.407  1.00 62.69  ? 273 ARG C CA  1 
ATOM   4932  C  C   . ARG C  3  195 ? -46.877 12.063  264.004  1.00 58.92  ? 273 ARG C C   1 
ATOM   4933  O  O   . ARG C  3  195 ? -45.842 11.504  264.333  1.00 62.26  ? 273 ARG C O   1 
ATOM   4934  C  CB  . ARG C  3  195 ? -48.868 10.695  264.530  1.00 71.12  ? 273 ARG C CB  1 
ATOM   4935  C  CG  . ARG C  3  195 ? -49.625 11.729  265.350  1.00 75.83  ? 273 ARG C CG  1 
ATOM   4936  C  CD  . ARG C  3  195 ? -50.059 11.138  266.677  1.00 85.88  ? 273 ARG C CD  1 
ATOM   4937  N  NE  . ARG C  3  195 ? -50.876 9.941   266.509  1.00 86.85  ? 273 ARG C NE  1 
ATOM   4938  C  CZ  . ARG C  3  195 ? -52.168 9.963   266.208  1.00 87.14  ? 273 ARG C CZ  1 
ATOM   4939  N  NH1 . ARG C  3  195 ? -52.788 11.122  266.045  1.00 86.01  ? 273 ARG C NH1 1 
ATOM   4940  N  NH2 . ARG C  3  195 ? -52.838 8.829   266.072  1.00 84.78  ? 273 ARG C NH2 1 
ATOM   4941  N  N   . LEU C  3  196 ? -47.074 13.364  264.140  1.00 66.15  ? 274 LEU C N   1 
ATOM   4942  C  CA  . LEU C  3  196 ? -46.076 14.237  264.731  1.00 70.84  ? 274 LEU C CA  1 
ATOM   4943  C  C   . LEU C  3  196 ? -46.199 14.191  266.259  1.00 78.64  ? 274 LEU C C   1 
ATOM   4944  O  O   . LEU C  3  196 ? -47.286 13.981  266.809  1.00 79.12  ? 274 LEU C O   1 
ATOM   4945  C  CB  . LEU C  3  196 ? -46.286 15.672  264.251  1.00 66.17  ? 274 LEU C CB  1 
ATOM   4946  C  CG  . LEU C  3  196 ? -45.423 16.700  264.973  1.00 66.13  ? 274 LEU C CG  1 
ATOM   4947  C  CD1 . LEU C  3  196 ? -43.973 16.338  264.749  1.00 70.33  ? 274 LEU C CD1 1 
ATOM   4948  C  CD2 . LEU C  3  196 ? -45.715 18.101  264.466  1.00 66.21  ? 274 LEU C CD2 1 
ATOM   4949  N  N   . PHE C  3  197 ? -45.080 14.378  266.946  1.00 79.53  ? 275 PHE C N   1 
ATOM   4950  C  CA  . PHE C  3  197 ? -45.088 14.379  268.399  1.00 73.98  ? 275 PHE C CA  1 
ATOM   4951  C  C   . PHE C  3  197 ? -43.825 14.961  268.968  1.00 74.58  ? 275 PHE C C   1 
ATOM   4952  O  O   . PHE C  3  197 ? -42.728 14.739  268.463  1.00 84.43  ? 275 PHE C O   1 
ATOM   4953  C  CB  . PHE C  3  197 ? -45.267 12.972  268.957  1.00 73.80  ? 275 PHE C CB  1 
ATOM   4954  C  CG  . PHE C  3  197 ? -45.091 12.891  270.455  1.00 76.39  ? 275 PHE C CG  1 
ATOM   4955  C  CD1 . PHE C  3  197 ? -43.820 12.925  271.028  1.00 70.63  ? 275 PHE C CD1 1 
ATOM   4956  C  CD2 . PHE C  3  197 ? -46.201 12.814  271.300  1.00 85.76  ? 275 PHE C CD2 1 
ATOM   4957  C  CE1 . PHE C  3  197 ? -43.655 12.887  272.420  1.00 65.30  ? 275 PHE C CE1 1 
ATOM   4958  C  CE2 . PHE C  3  197 ? -46.046 12.775  272.698  1.00 78.81  ? 275 PHE C CE2 1 
ATOM   4959  C  CZ  . PHE C  3  197 ? -44.770 12.812  273.254  1.00 60.30  ? 275 PHE C CZ  1 
ATOM   4960  N  N   . TYR C  3  198 ? -43.997 15.708  270.042  1.00 73.79  ? 276 TYR C N   1 
ATOM   4961  C  CA  . TYR C  3  198 ? -42.893 16.329  270.740  1.00 79.71  ? 276 TYR C CA  1 
ATOM   4962  C  C   . TYR C  3  198 ? -43.441 16.638  272.113  1.00 83.01  ? 276 TYR C C   1 
ATOM   4963  O  O   . TYR C  3  198 ? -44.655 16.607  272.320  1.00 83.15  ? 276 TYR C O   1 
ATOM   4964  C  CB  . TYR C  3  198 ? -42.458 17.612  270.030  1.00 78.72  ? 276 TYR C CB  1 
ATOM   4965  C  CG  . TYR C  3  198 ? -43.600 18.532  269.678  1.00 75.47  ? 276 TYR C CG  1 
ATOM   4966  C  CD1 . TYR C  3  198 ? -44.071 19.481  270.586  1.00 76.37  ? 276 TYR C CD1 1 
ATOM   4967  C  CD2 . TYR C  3  198 ? -44.207 18.455  268.433  1.00 71.92  ? 276 TYR C CD2 1 
ATOM   4968  C  CE1 . TYR C  3  198 ? -45.119 20.333  270.251  1.00 81.34  ? 276 TYR C CE1 1 
ATOM   4969  C  CE2 . TYR C  3  198 ? -45.251 19.296  268.088  1.00 83.33  ? 276 TYR C CE2 1 
ATOM   4970  C  CZ  . TYR C  3  198 ? -45.706 20.234  268.993  1.00 83.56  ? 276 TYR C CZ  1 
ATOM   4971  O  OH  . TYR C  3  198 ? -46.740 21.069  268.620  1.00 82.13  ? 276 TYR C OH  1 
ATOM   4972  N  N   . SER C  3  199 ? -42.555 16.920  273.055  1.00 84.70  ? 277 SER C N   1 
ATOM   4973  C  CA  . SER C  3  199 ? -42.985 17.225  274.405  1.00 74.92  ? 277 SER C CA  1 
ATOM   4974  C  C   . SER C  3  199 ? -43.475 18.662  274.488  1.00 69.15  ? 277 SER C C   1 
ATOM   4975  O  O   . SER C  3  199 ? -44.586 18.906  274.953  1.00 65.01  ? 277 SER C O   1 
ATOM   4976  C  CB  . SER C  3  199 ? -41.829 17.016  275.364  1.00 74.80  ? 277 SER C CB  1 
ATOM   4977  O  OG  . SER C  3  199 ? -40.703 17.745  274.909  1.00 91.67  ? 277 SER C OG  1 
ATOM   4978  N  N   . MET C  3  200 ? -42.662 19.602  274.013  1.00 61.11  ? 278 MET C N   1 
ATOM   4979  C  CA  . MET C  3  200 ? -43.027 21.013  274.077  1.00 68.07  ? 278 MET C CA  1 
ATOM   4980  C  C   . MET C  3  200 ? -42.096 21.901  273.269  1.00 61.09  ? 278 MET C C   1 
ATOM   4981  O  O   . MET C  3  200 ? -41.085 21.451  272.765  1.00 65.81  ? 278 MET C O   1 
ATOM   4982  C  CB  . MET C  3  200 ? -42.977 21.481  275.529  1.00 80.08  ? 278 MET C CB  1 
ATOM   4983  C  CG  . MET C  3  200 ? -41.601 21.286  276.154  1.00 90.74  ? 278 MET C CG  1 
ATOM   4984  S  SD  . MET C  3  200 ? -41.395 22.002  277.792  1.00 95.56  ? 278 MET C SD  1 
ATOM   4985  C  CE  . MET C  3  200 ? -40.676 23.618  277.348  1.00 90.98  ? 278 MET C CE  1 
ATOM   4986  N  N   . TYR C  3  201 ? -42.447 23.174  273.165  1.00 59.25  ? 279 TYR C N   1 
ATOM   4987  C  CA  . TYR C  3  201 ? -41.633 24.148  272.457  1.00 59.68  ? 279 TYR C CA  1 
ATOM   4988  C  C   . TYR C  3  201 ? -40.529 24.492  273.435  1.00 67.28  ? 279 TYR C C   1 
ATOM   4989  O  O   . TYR C  3  201 ? -40.755 25.199  274.405  1.00 68.99  ? 279 TYR C O   1 
ATOM   4990  C  CB  . TYR C  3  201 ? -42.471 25.378  272.161  1.00 63.42  ? 279 TYR C CB  1 
ATOM   4991  C  CG  . TYR C  3  201 ? -41.757 26.513  271.479  1.00 60.63  ? 279 TYR C CG  1 
ATOM   4992  C  CD1 . TYR C  3  201 ? -41.034 27.447  272.204  1.00 66.82  ? 279 TYR C CD1 1 
ATOM   4993  C  CD2 . TYR C  3  201 ? -41.851 26.683  270.111  1.00 60.56  ? 279 TYR C CD2 1 
ATOM   4994  C  CE1 . TYR C  3  201 ? -40.424 28.536  271.571  1.00 66.26  ? 279 TYR C CE1 1 
ATOM   4995  C  CE2 . TYR C  3  201 ? -41.250 27.757  269.474  1.00 65.48  ? 279 TYR C CE2 1 
ATOM   4996  C  CZ  . TYR C  3  201 ? -40.540 28.680  270.205  1.00 64.09  ? 279 TYR C CZ  1 
ATOM   4997  O  OH  . TYR C  3  201 ? -39.949 29.741  269.559  1.00 63.78  ? 279 TYR C OH  1 
ATOM   4998  N  N   . LEU C  3  202 ? -39.335 23.977  273.181  1.00 77.47  ? 280 LEU C N   1 
ATOM   4999  C  CA  . LEU C  3  202 ? -38.192 24.194  274.062  1.00 74.46  ? 280 LEU C CA  1 
ATOM   5000  C  C   . LEU C  3  202 ? -37.659 25.611  274.119  1.00 69.17  ? 280 LEU C C   1 
ATOM   5001  O  O   . LEU C  3  202 ? -37.155 26.041  275.152  1.00 70.17  ? 280 LEU C O   1 
ATOM   5002  C  CB  . LEU C  3  202 ? -37.054 23.241  273.684  1.00 78.99  ? 280 LEU C CB  1 
ATOM   5003  C  CG  . LEU C  3  202 ? -37.114 21.844  274.313  1.00 78.65  ? 280 LEU C CG  1 
ATOM   5004  C  CD1 . LEU C  3  202 ? -36.841 21.949  275.795  1.00 90.35  ? 280 LEU C CD1 1 
ATOM   5005  C  CD2 . LEU C  3  202 ? -38.468 21.226  274.094  1.00 91.06  ? 280 LEU C CD2 1 
ATOM   5006  N  N   . ASP C  3  203 ? -37.769 26.337  273.018  1.00 73.73  ? 281 ASP C N   1 
ATOM   5007  C  CA  . ASP C  3  203 ? -37.270 27.708  272.965  1.00 81.34  ? 281 ASP C CA  1 
ATOM   5008  C  C   . ASP C  3  203 ? -37.256 28.159  271.509  1.00 76.13  ? 281 ASP C C   1 
ATOM   5009  O  O   . ASP C  3  203 ? -37.679 27.411  270.629  1.00 71.78  ? 281 ASP C O   1 
ATOM   5010  C  CB  . ASP C  3  203 ? -35.851 27.758  273.546  1.00 87.18  ? 281 ASP C CB  1 
ATOM   5011  C  CG  . ASP C  3  203 ? -35.272 29.161  273.573  1.00 97.65  ? 281 ASP C CG  1 
ATOM   5012  O  OD1 . ASP C  3  203 ? -35.908 30.071  274.150  1.00 100.34 ? 281 ASP C OD1 1 
ATOM   5013  O  OD2 . ASP C  3  203 ? -34.168 29.348  273.022  1.00 100.67 ? 281 ASP C OD2 1 
ATOM   5014  N  N   . GLY C  3  204 ? -36.791 29.378  271.254  1.00 74.44  ? 282 GLY C N   1 
ATOM   5015  C  CA  . GLY C  3  204 ? -36.723 29.840  269.881  1.00 76.12  ? 282 GLY C CA  1 
ATOM   5016  C  C   . GLY C  3  204 ? -37.336 31.188  269.578  1.00 78.81  ? 282 GLY C C   1 
ATOM   5017  O  O   . GLY C  3  204 ? -38.450 31.496  270.006  1.00 81.16  ? 282 GLY C O   1 
ATOM   5018  N  N   . ASP C  3  205 ? -36.600 31.992  268.819  1.00 76.70  ? 283 ASP C N   1 
ATOM   5019  C  CA  . ASP C  3  205 ? -37.063 33.319  268.438  1.00 76.63  ? 283 ASP C CA  1 
ATOM   5020  C  C   . ASP C  3  205 ? -37.814 33.271  267.113  1.00 76.22  ? 283 ASP C C   1 
ATOM   5021  O  O   . ASP C  3  205 ? -37.801 34.233  266.350  1.00 72.19  ? 283 ASP C O   1 
ATOM   5022  C  CB  . ASP C  3  205 ? -35.874 34.274  268.315  1.00 82.56  ? 283 ASP C CB  1 
ATOM   5023  C  CG  . ASP C  3  205 ? -34.875 33.829  267.267  1.00 91.67  ? 283 ASP C CG  1 
ATOM   5024  O  OD1 . ASP C  3  205 ? -34.331 32.712  267.407  1.00 92.27  ? 283 ASP C OD1 1 
ATOM   5025  O  OD2 . ASP C  3  205 ? -34.634 34.595  266.308  1.00 92.94  ? 283 ASP C OD2 1 
ATOM   5026  N  N   . ALA C  3  206 ? -38.467 32.148  266.839  1.00 74.55  ? 284 ALA C N   1 
ATOM   5027  C  CA  . ALA C  3  206 ? -39.207 32.002  265.596  1.00 73.34  ? 284 ALA C CA  1 
ATOM   5028  C  C   . ALA C  3  206 ? -40.675 31.792  265.889  1.00 68.97  ? 284 ALA C C   1 
ATOM   5029  O  O   . ALA C  3  206 ? -41.514 31.888  265.001  1.00 70.84  ? 284 ALA C O   1 
ATOM   5030  C  CB  . ALA C  3  206 ? -38.663 30.837  264.797  1.00 82.41  ? 284 ALA C CB  1 
ATOM   5031  N  N   . GLY C  3  207 ? -40.976 31.480  267.140  1.00 65.97  ? 285 GLY C N   1 
ATOM   5032  C  CA  . GLY C  3  207 ? -42.359 31.290  267.528  1.00 65.79  ? 285 GLY C CA  1 
ATOM   5033  C  C   . GLY C  3  207 ? -42.867 29.880  267.370  1.00 65.87  ? 285 GLY C C   1 
ATOM   5034  O  O   . GLY C  3  207 ? -42.572 29.220  266.377  1.00 70.37  ? 285 GLY C O   1 
ATOM   5035  N  N   . ASN C  3  208 ? -43.641 29.429  268.354  1.00 63.95  ? 286 ASN C N   1 
ATOM   5036  C  CA  . ASN C  3  208 ? -44.200 28.086  268.349  1.00 67.78  ? 286 ASN C CA  1 
ATOM   5037  C  C   . ASN C  3  208 ? -45.369 27.948  267.385  1.00 70.67  ? 286 ASN C C   1 
ATOM   5038  O  O   . ASN C  3  208 ? -46.526 27.966  267.793  1.00 78.05  ? 286 ASN C O   1 
ATOM   5039  C  CB  . ASN C  3  208 ? -44.661 27.710  269.754  1.00 71.03  ? 286 ASN C CB  1 
ATOM   5040  C  CG  . ASN C  3  208 ? -45.210 26.297  269.825  1.00 81.42  ? 286 ASN C CG  1 
ATOM   5041  O  OD1 . ASN C  3  208 ? -46.095 25.919  269.057  1.00 87.23  ? 286 ASN C OD1 1 
ATOM   5042  N  ND2 . ASN C  3  208 ? -44.690 25.511  270.750  1.00 79.16  ? 286 ASN C ND2 1 
ATOM   5043  N  N   . ALA C  3  209 ? -45.076 27.797  266.103  1.00 78.82  ? 287 ALA C N   1 
ATOM   5044  C  CA  . ALA C  3  209 ? -46.141 27.656  265.126  1.00 83.89  ? 287 ALA C CA  1 
ATOM   5045  C  C   . ALA C  3  209 ? -46.795 26.272  265.209  1.00 85.80  ? 287 ALA C C   1 
ATOM   5046  O  O   . ALA C  3  209 ? -47.854 26.052  264.627  1.00 90.98  ? 287 ALA C O   1 
ATOM   5047  C  CB  . ALA C  3  209 ? -45.595 27.910  263.711  1.00 66.36  ? 287 ALA C CB  1 
ATOM   5048  N  N   . PHE C  3  210 ? -46.186 25.348  265.947  1.00 83.19  ? 288 PHE C N   1 
ATOM   5049  C  CA  . PHE C  3  210 ? -46.735 24.000  266.038  1.00 91.70  ? 288 PHE C CA  1 
ATOM   5050  C  C   . PHE C  3  210 ? -47.932 23.817  266.956  1.00 97.23  ? 288 PHE C C   1 
ATOM   5051  O  O   . PHE C  3  210 ? -48.869 23.081  266.626  1.00 96.57  ? 288 PHE C O   1 
ATOM   5052  C  CB  . PHE C  3  210 ? -45.643 22.997  266.423  1.00 93.86  ? 288 PHE C CB  1 
ATOM   5053  C  CG  . PHE C  3  210 ? -44.886 22.443  265.245  1.00 96.23  ? 288 PHE C CG  1 
ATOM   5054  C  CD1 . PHE C  3  210 ? -45.464 22.419  263.980  1.00 97.58  ? 288 PHE C CD1 1 
ATOM   5055  C  CD2 . PHE C  3  210 ? -43.613 21.913  265.403  1.00 95.47  ? 288 PHE C CD2 1 
ATOM   5056  C  CE1 . PHE C  3  210 ? -44.786 21.877  262.892  1.00 95.87  ? 288 PHE C CE1 1 
ATOM   5057  C  CE2 . PHE C  3  210 ? -42.929 21.369  264.321  1.00 94.10  ? 288 PHE C CE2 1 
ATOM   5058  C  CZ  . PHE C  3  210 ? -43.518 21.352  263.064  1.00 93.90  ? 288 PHE C CZ  1 
ATOM   5059  N  N   . ASP C  3  211 ? -47.901 24.466  268.114  1.00 98.90  ? 289 ASP C N   1 
ATOM   5060  C  CA  . ASP C  3  211 ? -49.004 24.355  269.055  1.00 97.11  ? 289 ASP C CA  1 
ATOM   5061  C  C   . ASP C  3  211 ? -50.192 25.147  268.535  1.00 99.48  ? 289 ASP C C   1 
ATOM   5062  O  O   . ASP C  3  211 ? -51.286 25.094  269.102  1.00 98.34  ? 289 ASP C O   1 
ATOM   5063  C  CB  . ASP C  3  211 ? -48.586 24.864  270.433  1.00 95.62  ? 289 ASP C CB  1 
ATOM   5064  C  CG  . ASP C  3  211 ? -47.733 23.860  271.187  1.00 98.15  ? 289 ASP C CG  1 
ATOM   5065  O  OD1 . ASP C  3  211 ? -48.209 22.724  271.423  1.00 94.93  ? 289 ASP C OD1 1 
ATOM   5066  O  OD2 . ASP C  3  211 ? -46.588 24.207  271.546  1.00 97.03  ? 289 ASP C OD2 1 
ATOM   5067  N  N   . GLY C  3  212 ? -49.967 25.875  267.445  1.00 98.76  ? 290 GLY C N   1 
ATOM   5068  C  CA  . GLY C  3  212 ? -51.028 26.661  266.845  1.00 94.98  ? 290 GLY C CA  1 
ATOM   5069  C  C   . GLY C  3  212 ? -50.763 28.152  266.833  1.00 96.32  ? 290 GLY C C   1 
ATOM   5070  O  O   . GLY C  3  212 ? -49.896 28.650  267.554  1.00 94.77  ? 290 GLY C O   1 
ATOM   5071  N  N   . PHE C  3  213 ? -51.520 28.865  266.006  1.00 97.99  ? 291 PHE C N   1 
ATOM   5072  C  CA  . PHE C  3  213 ? -51.391 30.313  265.891  1.00 104.07 ? 291 PHE C CA  1 
ATOM   5073  C  C   . PHE C  3  213 ? -52.728 30.973  265.557  1.00 110.68 ? 291 PHE C C   1 
ATOM   5074  O  O   . PHE C  3  213 ? -53.390 30.594  264.591  1.00 114.93 ? 291 PHE C O   1 
ATOM   5075  C  CB  . PHE C  3  213 ? -50.381 30.672  264.807  1.00 98.06  ? 291 PHE C CB  1 
ATOM   5076  C  CG  . PHE C  3  213 ? -50.182 32.144  264.645  1.00 94.73  ? 291 PHE C CG  1 
ATOM   5077  C  CD1 . PHE C  3  213 ? -49.471 32.867  265.594  1.00 90.70  ? 291 PHE C CD1 1 
ATOM   5078  C  CD2 . PHE C  3  213 ? -50.724 32.815  263.555  1.00 92.81  ? 291 PHE C CD2 1 
ATOM   5079  C  CE1 . PHE C  3  213 ? -49.301 34.244  265.460  1.00 96.76  ? 291 PHE C CE1 1 
ATOM   5080  C  CE2 . PHE C  3  213 ? -50.561 34.189  263.411  1.00 94.74  ? 291 PHE C CE2 1 
ATOM   5081  C  CZ  . PHE C  3  213 ? -49.848 34.907  264.366  1.00 95.13  ? 291 PHE C CZ  1 
ATOM   5082  N  N   . ASP C  3  214 ? -53.109 31.966  266.357  1.00 115.92 ? 292 ASP C N   1 
ATOM   5083  C  CA  . ASP C  3  214 ? -54.361 32.695  266.161  1.00 119.53 ? 292 ASP C CA  1 
ATOM   5084  C  C   . ASP C  3  214 ? -54.264 33.595  264.931  1.00 124.23 ? 292 ASP C C   1 
ATOM   5085  O  O   . ASP C  3  214 ? -53.268 34.296  264.739  1.00 121.92 ? 292 ASP C O   1 
ATOM   5086  C  CB  . ASP C  3  214 ? -54.669 33.549  267.396  1.00 121.07 ? 292 ASP C CB  1 
ATOM   5087  C  CG  . ASP C  3  214 ? -55.999 34.280  267.292  1.00 124.85 ? 292 ASP C CG  1 
ATOM   5088  O  OD1 . ASP C  3  214 ? -56.257 35.160  268.144  1.00 124.92 ? 292 ASP C OD1 1 
ATOM   5089  O  OD2 . ASP C  3  214 ? -56.788 33.973  266.368  1.00 125.31 ? 292 ASP C OD2 1 
ATOM   5090  N  N   . PHE C  3  215 ? -55.303 33.572  264.101  1.00 128.14 ? 293 PHE C N   1 
ATOM   5091  C  CA  . PHE C  3  215 ? -55.334 34.386  262.894  1.00 129.19 ? 293 PHE C CA  1 
ATOM   5092  C  C   . PHE C  3  215 ? -56.398 35.467  262.995  1.00 127.79 ? 293 PHE C C   1 
ATOM   5093  O  O   . PHE C  3  215 ? -56.323 36.491  262.313  1.00 123.10 ? 293 PHE C O   1 
ATOM   5094  C  CB  . PHE C  3  215 ? -55.603 33.501  261.675  1.00 135.02 ? 293 PHE C CB  1 
ATOM   5095  C  CG  . PHE C  3  215 ? -54.463 32.582  261.333  1.00 138.15 ? 293 PHE C CG  1 
ATOM   5096  C  CD1 . PHE C  3  215 ? -53.241 33.097  260.899  1.00 137.47 ? 293 PHE C CD1 1 
ATOM   5097  C  CD2 . PHE C  3  215 ? -54.603 31.205  261.455  1.00 135.23 ? 293 PHE C CD2 1 
ATOM   5098  C  CE1 . PHE C  3  215 ? -52.179 32.256  260.593  1.00 130.34 ? 293 PHE C CE1 1 
ATOM   5099  C  CE2 . PHE C  3  215 ? -53.545 30.356  261.152  1.00 132.13 ? 293 PHE C CE2 1 
ATOM   5100  C  CZ  . PHE C  3  215 ? -52.331 30.884  260.720  1.00 133.18 ? 293 PHE C CZ  1 
ATOM   5101  N  N   . GLY C  3  216 ? -57.385 35.230  263.856  1.00 129.88 ? 294 GLY C N   1 
ATOM   5102  C  CA  . GLY C  3  216 ? -58.461 36.185  264.043  1.00 132.76 ? 294 GLY C CA  1 
ATOM   5103  C  C   . GLY C  3  216 ? -59.581 35.992  263.039  1.00 134.42 ? 294 GLY C C   1 
ATOM   5104  O  O   . GLY C  3  216 ? -60.642 36.606  263.159  1.00 133.34 ? 294 GLY C O   1 
ATOM   5105  N  N   . ASP C  3  217 ? -59.340 35.136  262.048  1.00 135.96 ? 295 ASP C N   1 
ATOM   5106  C  CA  . ASP C  3  217 ? -60.323 34.855  261.005  1.00 138.09 ? 295 ASP C CA  1 
ATOM   5107  C  C   . ASP C  3  217 ? -61.442 33.959  261.511  1.00 138.51 ? 295 ASP C C   1 
ATOM   5108  O  O   . ASP C  3  217 ? -62.577 34.040  261.040  1.00 141.05 ? 295 ASP C O   1 
ATOM   5109  C  CB  . ASP C  3  217 ? -59.647 34.188  259.807  1.00 137.78 ? 295 ASP C CB  1 
ATOM   5110  C  CG  . ASP C  3  217 ? -58.610 35.075  259.162  1.00 139.53 ? 295 ASP C CG  1 
ATOM   5111  O  OD1 . ASP C  3  217 ? -57.641 35.459  259.851  1.00 137.69 ? 295 ASP C OD1 1 
ATOM   5112  O  OD2 . ASP C  3  217 ? -58.765 35.392  257.965  1.00 142.40 ? 295 ASP C OD2 1 
ATOM   5113  N  N   . ASP C  3  218 ? -61.115 33.102  262.470  1.00 136.16 ? 296 ASP C N   1 
ATOM   5114  C  CA  . ASP C  3  218 ? -62.099 32.194  263.040  1.00 136.72 ? 296 ASP C CA  1 
ATOM   5115  C  C   . ASP C  3  218 ? -61.899 32.103  264.554  1.00 135.60 ? 296 ASP C C   1 
ATOM   5116  O  O   . ASP C  3  218 ? -60.941 32.659  265.097  1.00 133.51 ? 296 ASP C O   1 
ATOM   5117  C  CB  . ASP C  3  218 ? -61.966 30.808  262.400  1.00 137.75 ? 296 ASP C CB  1 
ATOM   5118  C  CG  . ASP C  3  218 ? -63.306 30.229  261.976  1.00 137.88 ? 296 ASP C CG  1 
ATOM   5119  O  OD1 . ASP C  3  218 ? -63.973 30.842  261.113  1.00 134.88 ? 296 ASP C OD1 1 
ATOM   5120  O  OD2 . ASP C  3  218 ? -63.693 29.164  262.508  1.00 136.35 ? 296 ASP C OD2 1 
ATOM   5121  N  N   . PRO C  3  219 ? -62.815 31.417  265.256  1.00 136.30 ? 297 PRO C N   1 
ATOM   5122  C  CA  . PRO C  3  219 ? -62.705 31.277  266.711  1.00 136.39 ? 297 PRO C CA  1 
ATOM   5123  C  C   . PRO C  3  219 ? -61.661 30.255  267.145  1.00 135.84 ? 297 PRO C C   1 
ATOM   5124  O  O   . PRO C  3  219 ? -61.043 30.398  268.200  1.00 136.27 ? 297 PRO C O   1 
ATOM   5125  C  CB  . PRO C  3  219 ? -64.114 30.848  267.127  1.00 138.43 ? 297 PRO C CB  1 
ATOM   5126  C  CG  . PRO C  3  219 ? -64.987 31.379  266.028  1.00 140.10 ? 297 PRO C CG  1 
ATOM   5127  C  CD  . PRO C  3  219 ? -64.172 31.057  264.811  1.00 139.76 ? 297 PRO C CD  1 
ATOM   5128  N  N   . GLN C  3  220 ? -61.464 29.227  266.327  1.00 136.28 ? 298 GLN C N   1 
ATOM   5129  C  CA  . GLN C  3  220 ? -60.521 28.167  266.664  1.00 136.30 ? 298 GLN C CA  1 
ATOM   5130  C  C   . GLN C  3  220 ? -59.272 28.125  265.784  1.00 133.80 ? 298 GLN C C   1 
ATOM   5131  O  O   . GLN C  3  220 ? -58.906 27.062  265.285  1.00 137.71 ? 298 GLN C O   1 
ATOM   5132  C  CB  . GLN C  3  220 ? -61.223 26.802  266.596  1.00 136.00 ? 298 GLN C CB  1 
ATOM   5133  C  CG  . GLN C  3  220 ? -62.722 26.836  266.861  1.00 138.82 ? 298 GLN C CG  1 
ATOM   5134  C  CD  . GLN C  3  220 ? -63.515 27.430  265.706  1.00 141.18 ? 298 GLN C CD  1 
ATOM   5135  O  OE1 . GLN C  3  220 ? -64.738 27.533  265.768  1.00 145.65 ? 298 GLN C OE1 1 
ATOM   5136  N  NE2 . GLN C  3  220 ? -62.818 27.821  264.646  1.00 141.15 ? 298 GLN C NE2 1 
ATOM   5137  N  N   . ASP C  3  221 ? -58.612 29.262  265.592  1.00 126.19 ? 299 ASP C N   1 
ATOM   5138  C  CA  . ASP C  3  221 ? -57.406 29.274  264.773  1.00 120.14 ? 299 ASP C CA  1 
ATOM   5139  C  C   . ASP C  3  221 ? -56.297 28.450  265.419  1.00 118.08 ? 299 ASP C C   1 
ATOM   5140  O  O   . ASP C  3  221 ? -55.764 27.526  264.804  1.00 117.57 ? 299 ASP C O   1 
ATOM   5141  C  CB  . ASP C  3  221 ? -56.906 30.704  264.541  1.00 116.94 ? 299 ASP C CB  1 
ATOM   5142  C  CG  . ASP C  3  221 ? -57.732 31.454  263.519  1.00 116.81 ? 299 ASP C CG  1 
ATOM   5143  O  OD1 . ASP C  3  221 ? -57.987 30.892  262.432  1.00 118.64 ? 299 ASP C OD1 1 
ATOM   5144  O  OD2 . ASP C  3  221 ? -58.117 32.610  263.799  1.00 118.53 ? 299 ASP C OD2 1 
ATOM   5145  N  N   . LYS C  3  222 ? -55.954 28.773  266.662  1.00 112.62 ? 300 LYS C N   1 
ATOM   5146  C  CA  . LYS C  3  222 ? -54.893 28.052  267.352  1.00 110.10 ? 300 LYS C CA  1 
ATOM   5147  C  C   . LYS C  3  222 ? -55.207 26.560  267.468  1.00 109.97 ? 300 LYS C C   1 
ATOM   5148  O  O   . LYS C  3  222 ? -54.323 25.753  267.765  1.00 115.82 ? 300 LYS C O   1 
ATOM   5149  C  CB  . LYS C  3  222 ? -54.652 28.643  268.745  1.00 107.87 ? 300 LYS C CB  1 
ATOM   5150  C  CG  . LYS C  3  222 ? -53.218 28.460  269.240  1.00 105.11 ? 300 LYS C CG  1 
ATOM   5151  C  CD  . LYS C  3  222 ? -53.012 28.971  270.659  1.00 98.45  ? 300 LYS C CD  1 
ATOM   5152  C  CE  . LYS C  3  222 ? -53.688 28.065  271.666  1.00 102.71 ? 300 LYS C CE  1 
ATOM   5153  N  NZ  . LYS C  3  222 ? -53.181 26.669  271.558  1.00 107.20 ? 300 LYS C NZ  1 
ATOM   5154  N  N   . PHE C  3  223 ? -56.464 26.195  267.237  1.00 103.01 ? 301 PHE C N   1 
ATOM   5155  C  CA  . PHE C  3  223 ? -56.868 24.795  267.301  1.00 100.94 ? 301 PHE C CA  1 
ATOM   5156  C  C   . PHE C  3  223 ? -56.904 24.217  265.897  1.00 103.77 ? 301 PHE C C   1 
ATOM   5157  O  O   . PHE C  3  223 ? -56.667 23.028  265.692  1.00 105.35 ? 301 PHE C O   1 
ATOM   5158  C  CB  . PHE C  3  223 ? -58.252 24.657  267.919  1.00 102.94 ? 301 PHE C CB  1 
ATOM   5159  C  CG  . PHE C  3  223 ? -58.792 23.259  267.870  1.00 103.94 ? 301 PHE C CG  1 
ATOM   5160  C  CD1 . PHE C  3  223 ? -58.299 22.280  268.724  1.00 105.59 ? 301 PHE C CD1 1 
ATOM   5161  C  CD2 . PHE C  3  223 ? -59.779 22.914  266.954  1.00 107.77 ? 301 PHE C CD2 1 
ATOM   5162  C  CE1 . PHE C  3  223 ? -58.781 20.975  268.668  1.00 106.89 ? 301 PHE C CE1 1 
ATOM   5163  C  CE2 . PHE C  3  223 ? -60.269 21.612  266.889  1.00 110.10 ? 301 PHE C CE2 1 
ATOM   5164  C  CZ  . PHE C  3  223 ? -59.769 20.640  267.748  1.00 107.29 ? 301 PHE C CZ  1 
ATOM   5165  N  N   . TYR C  3  224 ? -57.222 25.075  264.936  1.00 110.16 ? 302 TYR C N   1 
ATOM   5166  C  CA  . TYR C  3  224 ? -57.292 24.694  263.530  1.00 112.81 ? 302 TYR C CA  1 
ATOM   5167  C  C   . TYR C  3  224 ? -55.893 24.660  262.911  1.00 105.78 ? 302 TYR C C   1 
ATOM   5168  O  O   . TYR C  3  224 ? -55.718 24.278  261.753  1.00 108.87 ? 302 TYR C O   1 
ATOM   5169  C  CB  . TYR C  3  224 ? -58.171 25.696  262.766  1.00 120.85 ? 302 TYR C CB  1 
ATOM   5170  C  CG  . TYR C  3  224 ? -59.655 25.392  262.814  1.00 129.51 ? 302 TYR C CG  1 
ATOM   5171  C  CD1 . TYR C  3  224 ? -60.211 24.676  263.882  1.00 128.89 ? 302 TYR C CD1 1 
ATOM   5172  C  CD2 . TYR C  3  224 ? -60.503 25.821  261.791  1.00 127.49 ? 302 TYR C CD2 1 
ATOM   5173  C  CE1 . TYR C  3  224 ? -61.572 24.393  263.927  1.00 132.06 ? 302 TYR C CE1 1 
ATOM   5174  C  CE2 . TYR C  3  224 ? -61.866 25.543  261.826  1.00 131.59 ? 302 TYR C CE2 1 
ATOM   5175  C  CZ  . TYR C  3  224 ? -62.393 24.829  262.897  1.00 138.18 ? 302 TYR C CZ  1 
ATOM   5176  O  OH  . TYR C  3  224 ? -63.740 24.553  262.940  1.00 148.34 ? 302 TYR C OH  1 
ATOM   5177  N  N   . THR C  3  225 ? -54.896 25.058  263.691  1.00 95.39  ? 303 THR C N   1 
ATOM   5178  C  CA  . THR C  3  225 ? -53.533 25.087  263.202  1.00 83.86  ? 303 THR C CA  1 
ATOM   5179  C  C   . THR C  3  225 ? -52.546 24.476  264.177  1.00 83.23  ? 303 THR C C   1 
ATOM   5180  O  O   . THR C  3  225 ? -51.365 24.809  264.162  1.00 81.09  ? 303 THR C O   1 
ATOM   5181  C  CB  . THR C  3  225 ? -53.106 26.512  262.911  1.00 79.35  ? 303 THR C CB  1 
ATOM   5182  O  OG1 . THR C  3  225 ? -53.152 27.273  264.124  1.00 86.17  ? 303 THR C OG1 1 
ATOM   5183  C  CG2 . THR C  3  225 ? -54.034 27.131  261.883  1.00 80.88  ? 303 THR C CG2 1 
ATOM   5184  N  N   . THR C  3  226 ? -53.029 23.590  265.036  1.00 84.03  ? 304 THR C N   1 
ATOM   5185  C  CA  . THR C  3  226 ? -52.142 22.934  265.981  1.00 87.77  ? 304 THR C CA  1 
ATOM   5186  C  C   . THR C  3  226 ? -51.667 21.670  265.276  1.00 83.09  ? 304 THR C C   1 
ATOM   5187  O  O   . THR C  3  226 ? -52.486 20.851  264.844  1.00 76.79  ? 304 THR C O   1 
ATOM   5188  C  CB  . THR C  3  226 ? -52.874 22.576  267.298  1.00 96.08  ? 304 THR C CB  1 
ATOM   5189  O  OG1 . THR C  3  226 ? -51.973 21.880  268.170  1.00 100.94 ? 304 THR C OG1 1 
ATOM   5190  C  CG2 . THR C  3  226 ? -54.101 21.708  267.020  1.00 98.27  ? 304 THR C CG2 1 
ATOM   5191  N  N   . HIS C  3  227 ? -50.350 21.524  265.137  1.00 76.95  ? 305 HIS C N   1 
ATOM   5192  C  CA  . HIS C  3  227 ? -49.789 20.364  264.455  1.00 69.21  ? 305 HIS C CA  1 
ATOM   5193  C  C   . HIS C  3  227 ? -49.512 19.189  265.368  1.00 67.93  ? 305 HIS C C   1 
ATOM   5194  O  O   . HIS C  3  227 ? -49.570 18.036  264.943  1.00 70.07  ? 305 HIS C O   1 
ATOM   5195  C  CB  . HIS C  3  227 ? -48.507 20.736  263.725  1.00 53.90  ? 305 HIS C CB  1 
ATOM   5196  C  CG  . HIS C  3  227 ? -48.707 21.739  262.636  1.00 61.31  ? 305 HIS C CG  1 
ATOM   5197  N  ND1 . HIS C  3  227 ? -48.776 23.095  262.874  1.00 57.94  ? 305 HIS C ND1 1 
ATOM   5198  C  CD2 . HIS C  3  227 ? -48.852 21.583  261.299  1.00 63.92  ? 305 HIS C CD2 1 
ATOM   5199  C  CE1 . HIS C  3  227 ? -48.949 23.732  261.728  1.00 61.48  ? 305 HIS C CE1 1 
ATOM   5200  N  NE2 . HIS C  3  227 ? -48.999 22.837  260.757  1.00 64.88  ? 305 HIS C NE2 1 
ATOM   5201  N  N   . LEU C  3  228 ? -49.197 19.471  266.623  1.00 66.12  ? 306 LEU C N   1 
ATOM   5202  C  CA  . LEU C  3  228 ? -48.928 18.392  267.552  1.00 66.45  ? 306 LEU C CA  1 
ATOM   5203  C  C   . LEU C  3  228 ? -50.014 17.332  267.397  1.00 68.71  ? 306 LEU C C   1 
ATOM   5204  O  O   . LEU C  3  228 ? -51.190 17.659  267.271  1.00 65.89  ? 306 LEU C O   1 
ATOM   5205  C  CB  . LEU C  3  228 ? -48.914 18.912  268.991  1.00 66.46  ? 306 LEU C CB  1 
ATOM   5206  C  CG  . LEU C  3  228 ? -48.760 17.809  270.041  1.00 63.02  ? 306 LEU C CG  1 
ATOM   5207  C  CD1 . LEU C  3  228 ? -47.468 17.043  269.775  1.00 82.20  ? 306 LEU C CD1 1 
ATOM   5208  C  CD2 . LEU C  3  228 ? -48.755 18.411  271.438  1.00 76.49  ? 306 LEU C CD2 1 
ATOM   5209  N  N   . GLY C  3  229 ? -49.611 16.065  267.384  1.00 76.80  ? 307 GLY C N   1 
ATOM   5210  C  CA  . GLY C  3  229 ? -50.566 14.975  267.258  1.00 73.81  ? 307 GLY C CA  1 
ATOM   5211  C  C   . GLY C  3  229 ? -51.117 14.731  265.860  1.00 74.61  ? 307 GLY C C   1 
ATOM   5212  O  O   . GLY C  3  229 ? -51.730 13.693  265.601  1.00 65.68  ? 307 GLY C O   1 
ATOM   5213  N  N   . MET C  3  230 ? -50.906 15.673  264.950  1.00 67.97  ? 308 MET C N   1 
ATOM   5214  C  CA  . MET C  3  230 ? -51.412 15.513  263.595  1.00 78.29  ? 308 MET C CA  1 
ATOM   5215  C  C   . MET C  3  230 ? -50.756 14.375  262.825  1.00 75.91  ? 308 MET C C   1 
ATOM   5216  O  O   . MET C  3  230 ? -49.546 14.178  262.894  1.00 84.45  ? 308 MET C O   1 
ATOM   5217  C  CB  . MET C  3  230 ? -51.254 16.821  262.807  1.00 86.35  ? 308 MET C CB  1 
ATOM   5218  C  CG  . MET C  3  230 ? -52.258 17.887  263.202  1.00 84.07  ? 308 MET C CG  1 
ATOM   5219  S  SD  . MET C  3  230 ? -53.926 17.190  263.207  1.00 89.70  ? 308 MET C SD  1 
ATOM   5220  C  CE  . MET C  3  230 ? -54.094 16.724  264.895  1.00 70.06  ? 308 MET C CE  1 
ATOM   5221  N  N   . LEU C  3  231 ? -51.565 13.619  262.095  1.00 69.68  ? 309 LEU C N   1 
ATOM   5222  C  CA  . LEU C  3  231 ? -51.041 12.524  261.294  1.00 67.66  ? 309 LEU C CA  1 
ATOM   5223  C  C   . LEU C  3  231 ? -50.368 13.115  260.069  1.00 69.24  ? 309 LEU C C   1 
ATOM   5224  O  O   . LEU C  3  231 ? -50.492 14.312  259.784  1.00 67.06  ? 309 LEU C O   1 
ATOM   5225  C  CB  . LEU C  3  231 ? -52.164 11.590  260.845  1.00 58.19  ? 309 LEU C CB  1 
ATOM   5226  C  CG  . LEU C  3  231 ? -52.721 10.613  261.876  1.00 66.32  ? 309 LEU C CG  1 
ATOM   5227  C  CD1 . LEU C  3  231 ? -52.972 11.319  263.194  1.00 69.37  ? 309 LEU C CD1 1 
ATOM   5228  C  CD2 . LEU C  3  231 ? -54.000 10.004  261.340  1.00 50.93  ? 309 LEU C CD2 1 
ATOM   5229  N  N   . PHE C  3  232 ? -49.643 12.280  259.342  1.00 71.24  ? 310 PHE C N   1 
ATOM   5230  C  CA  . PHE C  3  232 ? -48.988 12.773  258.152  1.00 79.01  ? 310 PHE C CA  1 
ATOM   5231  C  C   . PHE C  3  232 ? -49.922 12.570  256.975  1.00 81.11  ? 310 PHE C C   1 
ATOM   5232  O  O   . PHE C  3  232 ? -50.525 11.505  256.818  1.00 77.62  ? 310 PHE C O   1 
ATOM   5233  C  CB  . PHE C  3  232 ? -47.673 12.048  257.886  1.00 74.25  ? 310 PHE C CB  1 
ATOM   5234  C  CG  . PHE C  3  232 ? -46.780 12.784  256.932  1.00 64.21  ? 310 PHE C CG  1 
ATOM   5235  C  CD1 . PHE C  3  232 ? -46.018 13.862  257.372  1.00 59.04  ? 310 PHE C CD1 1 
ATOM   5236  C  CD2 . PHE C  3  232 ? -46.731 12.434  255.591  1.00 58.23  ? 310 PHE C CD2 1 
ATOM   5237  C  CE1 . PHE C  3  232 ? -45.220 14.580  256.491  1.00 59.01  ? 310 PHE C CE1 1 
ATOM   5238  C  CE2 . PHE C  3  232 ? -45.935 13.150  254.698  1.00 64.35  ? 310 PHE C CE2 1 
ATOM   5239  C  CZ  . PHE C  3  232 ? -45.178 14.225  255.150  1.00 56.75  ? 310 PHE C CZ  1 
ATOM   5240  N  N   . SER C  3  233 ? -50.049 13.601  256.152  1.00 78.42  ? 311 SER C N   1 
ATOM   5241  C  CA  . SER C  3  233 ? -50.914 13.520  254.993  1.00 75.44  ? 311 SER C CA  1 
ATOM   5242  C  C   . SER C  3  233 ? -50.179 13.969  253.743  1.00 74.97  ? 311 SER C C   1 
ATOM   5243  O  O   . SER C  3  233 ? -49.267 14.787  253.797  1.00 72.14  ? 311 SER C O   1 
ATOM   5244  C  CB  . SER C  3  233 ? -52.163 14.381  255.199  1.00 79.12  ? 311 SER C CB  1 
ATOM   5245  O  OG  . SER C  3  233 ? -52.978 13.870  256.238  1.00 77.12  ? 311 SER C OG  1 
ATOM   5246  N  N   . THR C  3  234 ? -50.587 13.410  252.614  1.00 79.30  ? 312 THR C N   1 
ATOM   5247  C  CA  . THR C  3  234 ? -49.996 13.745  251.335  1.00 76.41  ? 312 THR C CA  1 
ATOM   5248  C  C   . THR C  3  234 ? -51.126 13.898  250.324  1.00 77.65  ? 312 THR C C   1 
ATOM   5249  O  O   . THR C  3  234 ? -52.249 13.428  250.549  1.00 71.04  ? 312 THR C O   1 
ATOM   5250  C  CB  . THR C  3  234 ? -49.047 12.631  250.854  1.00 78.45  ? 312 THR C CB  1 
ATOM   5251  O  OG1 . THR C  3  234 ? -49.809 11.468  250.503  1.00 65.80  ? 312 THR C OG1 1 
ATOM   5252  C  CG2 . THR C  3  234 ? -48.067 12.268  251.952  1.00 81.87  ? 312 THR C CG2 1 
ATOM   5253  N  N   . PRO C  3  235 ? -50.843 14.566  249.198  1.00 77.76  ? 313 PRO C N   1 
ATOM   5254  C  CA  . PRO C  3  235 ? -51.815 14.794  248.130  1.00 76.50  ? 313 PRO C CA  1 
ATOM   5255  C  C   . PRO C  3  235 ? -52.813 13.663  247.873  1.00 83.04  ? 313 PRO C C   1 
ATOM   5256  O  O   . PRO C  3  235 ? -53.990 13.928  247.638  1.00 93.92  ? 313 PRO C O   1 
ATOM   5257  C  CB  . PRO C  3  235 ? -50.924 15.068  246.936  1.00 66.17  ? 313 PRO C CB  1 
ATOM   5258  C  CG  . PRO C  3  235 ? -49.853 15.921  247.562  1.00 68.78  ? 313 PRO C CG  1 
ATOM   5259  C  CD  . PRO C  3  235 ? -49.548 15.193  248.862  1.00 77.44  ? 313 PRO C CD  1 
ATOM   5260  N  N   . GLU C  3  236 ? -52.364 12.412  247.928  1.00 79.91  ? 314 GLU C N   1 
ATOM   5261  C  CA  . GLU C  3  236 ? -53.273 11.298  247.669  1.00 84.76  ? 314 GLU C CA  1 
ATOM   5262  C  C   . GLU C  3  236 ? -53.651 10.500  248.908  1.00 88.86  ? 314 GLU C C   1 
ATOM   5263  O  O   . GLU C  3  236 ? -54.152 9.371   248.804  1.00 87.44  ? 314 GLU C O   1 
ATOM   5264  C  CB  . GLU C  3  236 ? -52.676 10.357  246.609  1.00 89.83  ? 314 GLU C CB  1 
ATOM   5265  C  CG  . GLU C  3  236 ? -51.785 9.226   247.125  1.00 84.39  ? 314 GLU C CG  1 
ATOM   5266  C  CD  . GLU C  3  236 ? -50.618 9.709   247.957  1.00 89.99  ? 314 GLU C CD  1 
ATOM   5267  O  OE1 . GLU C  3  236 ? -50.172 10.859  247.752  1.00 97.00  ? 314 GLU C OE1 1 
ATOM   5268  O  OE2 . GLU C  3  236 ? -50.140 8.926   248.807  1.00 89.74  ? 314 GLU C OE2 1 
ATOM   5269  N  N   . ARG C  3  237 ? -53.423 11.087  250.078  1.00 91.17  ? 315 ARG C N   1 
ATOM   5270  C  CA  . ARG C  3  237 ? -53.742 10.411  251.331  1.00 94.30  ? 315 ARG C CA  1 
ATOM   5271  C  C   . ARG C  3  237 ? -54.134 11.451  252.382  1.00 95.43  ? 315 ARG C C   1 
ATOM   5272  O  O   . ARG C  3  237 ? -53.287 11.991  253.094  1.00 97.25  ? 315 ARG C O   1 
ATOM   5273  C  CB  . ARG C  3  237 ? -52.529 9.587   251.781  1.00 86.38  ? 315 ARG C CB  1 
ATOM   5274  C  CG  . ARG C  3  237 ? -52.827 8.468   252.765  1.00 74.40  ? 315 ARG C CG  1 
ATOM   5275  C  CD  . ARG C  3  237 ? -51.764 7.385   252.644  1.00 74.11  ? 315 ARG C CD  1 
ATOM   5276  N  NE  . ARG C  3  237 ? -51.699 6.521   253.817  1.00 77.91  ? 315 ARG C NE  1 
ATOM   5277  C  CZ  . ARG C  3  237 ? -50.970 5.409   253.887  1.00 90.78  ? 315 ARG C CZ  1 
ATOM   5278  N  NH1 . ARG C  3  237 ? -50.246 5.018   252.846  1.00 89.26  ? 315 ARG C NH1 1 
ATOM   5279  N  NH2 . ARG C  3  237 ? -50.957 4.688   255.004  1.00 94.69  ? 315 ARG C NH2 1 
ATOM   5280  N  N   . ASP C  3  238 ? -55.432 11.729  252.456  1.00 95.84  ? 316 ASP C N   1 
ATOM   5281  C  CA  . ASP C  3  238 ? -55.978 12.708  253.389  1.00 94.54  ? 316 ASP C CA  1 
ATOM   5282  C  C   . ASP C  3  238 ? -56.113 12.141  254.798  1.00 95.04  ? 316 ASP C C   1 
ATOM   5283  O  O   . ASP C  3  238 ? -56.948 11.269  255.056  1.00 92.11  ? 316 ASP C O   1 
ATOM   5284  C  CB  . ASP C  3  238 ? -57.351 13.171  252.906  1.00 102.21 ? 316 ASP C CB  1 
ATOM   5285  C  CG  . ASP C  3  238 ? -57.918 14.293  253.748  1.00 108.89 ? 316 ASP C CG  1 
ATOM   5286  O  OD1 . ASP C  3  238 ? -57.831 14.208  254.991  1.00 107.91 ? 316 ASP C OD1 1 
ATOM   5287  O  OD2 . ASP C  3  238 ? -58.463 15.256  253.163  1.00 108.74 ? 316 ASP C OD2 1 
ATOM   5288  N  N   . ASN C  3  239 ? -55.297 12.655  255.708  1.00 89.83  ? 317 ASN C N   1 
ATOM   5289  C  CA  . ASN C  3  239 ? -55.321 12.211  257.090  1.00 85.07  ? 317 ASN C CA  1 
ATOM   5290  C  C   . ASN C  3  239 ? -55.488 13.392  258.031  1.00 88.78  ? 317 ASN C C   1 
ATOM   5291  O  O   . ASN C  3  239 ? -55.227 13.289  259.229  1.00 90.26  ? 317 ASN C O   1 
ATOM   5292  C  CB  . ASN C  3  239 ? -54.029 11.466  257.410  1.00 83.93  ? 317 ASN C CB  1 
ATOM   5293  C  CG  . ASN C  3  239 ? -54.136 9.986   257.142  1.00 77.98  ? 317 ASN C CG  1 
ATOM   5294  O  OD1 . ASN C  3  239 ? -53.130 9.280   257.074  1.00 81.02  ? 317 ASN C OD1 1 
ATOM   5295  N  ND2 . ASN C  3  239 ? -55.363 9.500   257.006  1.00 49.55  ? 317 ASN C ND2 1 
ATOM   5296  N  N   . ASP C  3  240 ? -55.922 14.521  257.485  1.00 92.25  ? 318 ASP C N   1 
ATOM   5297  C  CA  . ASP C  3  240 ? -56.115 15.706  258.303  1.00 92.63  ? 318 ASP C CA  1 
ATOM   5298  C  C   . ASP C  3  240 ? -57.516 15.780  258.900  1.00 93.88  ? 318 ASP C C   1 
ATOM   5299  O  O   . ASP C  3  240 ? -58.372 14.924  258.648  1.00 85.50  ? 318 ASP C O   1 
ATOM   5300  C  CB  . ASP C  3  240 ? -55.818 16.985  257.498  1.00 91.71  ? 318 ASP C CB  1 
ATOM   5301  C  CG  . ASP C  3  240 ? -56.592 17.063  256.190  1.00 85.68  ? 318 ASP C CG  1 
ATOM   5302  O  OD1 . ASP C  3  240 ? -57.772 16.660  256.157  1.00 86.24  ? 318 ASP C OD1 1 
ATOM   5303  O  OD2 . ASP C  3  240 ? -56.019 17.550  255.193  1.00 83.77  ? 318 ASP C OD2 1 
ATOM   5304  N  N   . LYS C  3  241 ? -57.724 16.808  259.716  1.00 102.71 ? 319 LYS C N   1 
ATOM   5305  C  CA  . LYS C  3  241 ? -59.005 17.049  260.365  1.00 109.85 ? 319 LYS C CA  1 
ATOM   5306  C  C   . LYS C  3  241 ? -59.643 18.206  259.602  1.00 114.11 ? 319 LYS C C   1 
ATOM   5307  O  O   . LYS C  3  241 ? -59.847 19.293  260.147  1.00 113.00 ? 319 LYS C O   1 
ATOM   5308  C  CB  . LYS C  3  241 ? -58.790 17.443  261.832  1.00 108.49 ? 319 LYS C CB  1 
ATOM   5309  C  CG  . LYS C  3  241 ? -57.861 16.517  262.620  1.00 103.80 ? 319 LYS C CG  1 
ATOM   5310  C  CD  . LYS C  3  241 ? -58.310 15.061  262.564  1.00 99.88  ? 319 LYS C CD  1 
ATOM   5311  C  CE  . LYS C  3  241 ? -57.435 14.178  263.448  1.00 98.38  ? 319 LYS C CE  1 
ATOM   5312  N  NZ  . LYS C  3  241 ? -55.989 14.250  263.075  1.00 103.61 ? 319 LYS C NZ  1 
ATOM   5313  N  N   . TYR C  3  242 ? -59.939 17.954  258.330  1.00 118.29 ? 320 TYR C N   1 
ATOM   5314  C  CA  . TYR C  3  242 ? -60.532 18.947  257.439  1.00 118.95 ? 320 TYR C CA  1 
ATOM   5315  C  C   . TYR C  3  242 ? -61.268 18.205  256.329  1.00 122.25 ? 320 TYR C C   1 
ATOM   5316  O  O   . TYR C  3  242 ? -60.684 17.358  255.657  1.00 122.25 ? 320 TYR C O   1 
ATOM   5317  C  CB  . TYR C  3  242 ? -59.418 19.826  256.861  1.00 115.37 ? 320 TYR C CB  1 
ATOM   5318  C  CG  . TYR C  3  242 ? -59.842 20.870  255.850  1.00 112.96 ? 320 TYR C CG  1 
ATOM   5319  C  CD1 . TYR C  3  242 ? -60.251 20.508  254.570  1.00 106.44 ? 320 TYR C CD1 1 
ATOM   5320  C  CD2 . TYR C  3  242 ? -59.764 22.231  256.154  1.00 115.07 ? 320 TYR C CD2 1 
ATOM   5321  C  CE1 . TYR C  3  242 ? -60.562 21.469  253.612  1.00 104.95 ? 320 TYR C CE1 1 
ATOM   5322  C  CE2 . TYR C  3  242 ? -60.073 23.202  255.205  1.00 109.41 ? 320 TYR C CE2 1 
ATOM   5323  C  CZ  . TYR C  3  242 ? -60.466 22.814  253.937  1.00 108.18 ? 320 TYR C CZ  1 
ATOM   5324  O  OH  . TYR C  3  242 ? -60.726 23.775  252.989  1.00 110.78 ? 320 TYR C OH  1 
ATOM   5325  N  N   . GLU C  3  243 ? -62.549 18.520  256.150  1.00 130.68 ? 321 GLU C N   1 
ATOM   5326  C  CA  . GLU C  3  243 ? -63.376 17.873  255.132  1.00 137.69 ? 321 GLU C CA  1 
ATOM   5327  C  C   . GLU C  3  243 ? -62.602 17.589  253.853  1.00 135.33 ? 321 GLU C C   1 
ATOM   5328  O  O   . GLU C  3  243 ? -62.741 16.518  253.255  1.00 136.82 ? 321 GLU C O   1 
ATOM   5329  C  CB  . GLU C  3  243 ? -64.609 18.728  254.810  1.00 144.18 ? 321 GLU C CB  1 
ATOM   5330  C  CG  . GLU C  3  243 ? -64.325 20.200  254.527  1.00 153.72 ? 321 GLU C CG  1 
ATOM   5331  C  CD  . GLU C  3  243 ? -64.341 21.058  255.784  1.00 158.86 ? 321 GLU C CD  1 
ATOM   5332  O  OE1 . GLU C  3  243 ? -63.467 20.868  256.655  1.00 158.72 ? 321 GLU C OE1 1 
ATOM   5333  O  OE2 . GLU C  3  243 ? -65.236 21.925  255.901  1.00 161.12 ? 321 GLU C OE2 1 
ATOM   5334  N  N   . GLY C  3  244 ? -61.788 18.552  253.440  1.00 129.15 ? 322 GLY C N   1 
ATOM   5335  C  CA  . GLY C  3  244 ? -60.991 18.382  252.243  1.00 125.94 ? 322 GLY C CA  1 
ATOM   5336  C  C   . GLY C  3  244 ? -59.593 17.885  252.568  1.00 119.56 ? 322 GLY C C   1 
ATOM   5337  O  O   . GLY C  3  244 ? -59.324 17.427  253.677  1.00 109.41 ? 322 GLY C O   1 
ATOM   5338  N  N   . SER C  3  245 ? -58.699 17.985  251.592  1.00 118.14 ? 323 SER C N   1 
ATOM   5339  C  CA  . SER C  3  245 ? -57.326 17.543  251.760  1.00 113.85 ? 323 SER C CA  1 
ATOM   5340  C  C   . SER C  3  245 ? -56.374 18.738  251.776  1.00 110.71 ? 323 SER C C   1 
ATOM   5341  O  O   . SER C  3  245 ? -56.013 19.259  250.716  1.00 109.62 ? 323 SER C O   1 
ATOM   5342  C  CB  . SER C  3  245 ? -56.953 16.591  250.618  1.00 113.22 ? 323 SER C CB  1 
ATOM   5343  O  OG  . SER C  3  245 ? -55.670 16.022  250.810  1.00 124.74 ? 323 SER C OG  1 
ATOM   5344  N  N   . CYS C  3  246 ? -55.982 19.179  252.972  1.00 106.15 ? 324 CYS C N   1 
ATOM   5345  C  CA  . CYS C  3  246 ? -55.058 20.306  253.085  1.00 107.15 ? 324 CYS C CA  1 
ATOM   5346  C  C   . CYS C  3  246 ? -53.773 19.908  252.384  1.00 106.17 ? 324 CYS C C   1 
ATOM   5347  O  O   . CYS C  3  246 ? -53.052 20.753  251.842  1.00 105.73 ? 324 CYS C O   1 
ATOM   5348  C  CB  . CYS C  3  246 ? -54.779 20.643  254.555  1.00 108.96 ? 324 CYS C CB  1 
ATOM   5349  S  SG  . CYS C  3  246 ? -56.188 21.437  255.398  1.00 111.79 ? 324 CYS C SG  1 
ATOM   5350  N  N   . ALA C  3  247 ? -53.503 18.607  252.391  1.00 99.84  ? 325 ALA C N   1 
ATOM   5351  C  CA  . ALA C  3  247 ? -52.319 18.072  251.744  1.00 98.22  ? 325 ALA C CA  1 
ATOM   5352  C  C   . ALA C  3  247 ? -52.424 18.292  250.235  1.00 101.58 ? 325 ALA C C   1 
ATOM   5353  O  O   . ALA C  3  247 ? -51.460 18.707  249.592  1.00 104.93 ? 325 ALA C O   1 
ATOM   5354  C  CB  . ALA C  3  247 ? -52.188 16.591  252.051  1.00 98.23  ? 325 ALA C CB  1 
ATOM   5355  N  N   . GLU C  3  248 ? -53.602 18.021  249.677  1.00 103.27 ? 326 GLU C N   1 
ATOM   5356  C  CA  . GLU C  3  248 ? -53.824 18.186  248.244  1.00 97.75  ? 326 GLU C CA  1 
ATOM   5357  C  C   . GLU C  3  248 ? -54.002 19.641  247.838  1.00 95.19  ? 326 GLU C C   1 
ATOM   5358  O  O   . GLU C  3  248 ? -53.703 20.015  246.707  1.00 89.97  ? 326 GLU C O   1 
ATOM   5359  C  CB  . GLU C  3  248 ? -55.042 17.382  247.797  1.00 96.19  ? 326 GLU C CB  1 
ATOM   5360  C  CG  . GLU C  3  248 ? -55.437 17.648  246.352  1.00 104.95 ? 326 GLU C CG  1 
ATOM   5361  C  CD  . GLU C  3  248 ? -56.546 16.737  245.876  1.00 111.92 ? 326 GLU C CD  1 
ATOM   5362  O  OE1 . GLU C  3  248 ? -57.585 16.652  246.567  1.00 118.36 ? 326 GLU C OE1 1 
ATOM   5363  O  OE2 . GLU C  3  248 ? -56.378 16.107  244.809  1.00 107.64 ? 326 GLU C OE2 1 
ATOM   5364  N  N   . GLN C  3  249 ? -54.498 20.462  248.756  1.00 94.46  ? 327 GLN C N   1 
ATOM   5365  C  CA  . GLN C  3  249 ? -54.694 21.872  248.458  1.00 100.43 ? 327 GLN C CA  1 
ATOM   5366  C  C   . GLN C  3  249 ? -53.353 22.577  248.304  1.00 100.48 ? 327 GLN C C   1 
ATOM   5367  O  O   . GLN C  3  249 ? -53.097 23.239  247.293  1.00 94.60  ? 327 GLN C O   1 
ATOM   5368  C  CB  . GLN C  3  249 ? -55.507 22.550  249.566  1.00 106.54 ? 327 GLN C CB  1 
ATOM   5369  C  CG  . GLN C  3  249 ? -57.013 22.371  249.455  1.00 110.05 ? 327 GLN C CG  1 
ATOM   5370  C  CD  . GLN C  3  249 ? -57.764 23.123  250.540  1.00 112.07 ? 327 GLN C CD  1 
ATOM   5371  O  OE1 . GLN C  3  249 ? -57.541 24.316  250.755  1.00 110.85 ? 327 GLN C OE1 1 
ATOM   5372  N  NE2 . GLN C  3  249 ? -58.663 22.428  251.228  1.00 110.95 ? 327 GLN C NE2 1 
ATOM   5373  N  N   . ASP C  3  250 ? -52.503 22.438  249.320  1.00 102.32 ? 328 ASP C N   1 
ATOM   5374  C  CA  . ASP C  3  250 ? -51.187 23.061  249.299  1.00 102.37 ? 328 ASP C CA  1 
ATOM   5375  C  C   . ASP C  3  250 ? -50.287 22.240  248.392  1.00 101.24 ? 328 ASP C C   1 
ATOM   5376  O  O   . ASP C  3  250 ? -49.259 22.728  247.910  1.00 106.18 ? 328 ASP C O   1 
ATOM   5377  C  CB  . ASP C  3  250 ? -50.587 23.128  250.711  1.00 100.89 ? 328 ASP C CB  1 
ATOM   5378  C  CG  . ASP C  3  250 ? -51.381 24.027  251.651  1.00 101.87 ? 328 ASP C CG  1 
ATOM   5379  O  OD1 . ASP C  3  250 ? -51.573 25.222  251.337  1.00 100.70 ? 328 ASP C OD1 1 
ATOM   5380  O  OD2 . ASP C  3  250 ? -51.811 23.536  252.713  1.00 97.04  ? 328 ASP C OD2 1 
ATOM   5381  N  N   . GLY C  3  251 ? -50.688 20.989  248.163  1.00 98.75  ? 329 GLY C N   1 
ATOM   5382  C  CA  . GLY C  3  251 ? -49.924 20.092  247.305  1.00 98.82  ? 329 GLY C CA  1 
ATOM   5383  C  C   . GLY C  3  251 ? -48.536 19.742  247.820  1.00 94.91  ? 329 GLY C C   1 
ATOM   5384  O  O   . GLY C  3  251 ? -47.527 20.130  247.218  1.00 92.86  ? 329 GLY C O   1 
ATOM   5385  N  N   . SER C  3  252 ? -48.483 19.002  248.927  1.00 86.20  ? 330 SER C N   1 
ATOM   5386  C  CA  . SER C  3  252 ? -47.215 18.609  249.534  1.00 76.82  ? 330 SER C CA  1 
ATOM   5387  C  C   . SER C  3  252 ? -47.462 17.931  250.869  1.00 72.17  ? 330 SER C C   1 
ATOM   5388  O  O   . SER C  3  252 ? -47.960 18.561  251.798  1.00 79.13  ? 330 SER C O   1 
ATOM   5389  C  CB  . SER C  3  252 ? -46.329 19.840  249.759  1.00 77.04  ? 330 SER C CB  1 
ATOM   5390  O  OG  . SER C  3  252 ? -46.938 20.755  250.659  1.00 75.51  ? 330 SER C OG  1 
ATOM   5391  N  N   . GLY C  3  253 ? -47.106 16.654  250.963  1.00 72.22  ? 331 GLY C N   1 
ATOM   5392  C  CA  . GLY C  3  253 ? -47.289 15.911  252.201  1.00 68.38  ? 331 GLY C CA  1 
ATOM   5393  C  C   . GLY C  3  253 ? -46.780 16.644  253.434  1.00 70.98  ? 331 GLY C C   1 
ATOM   5394  O  O   . GLY C  3  253 ? -45.769 17.353  253.378  1.00 70.77  ? 331 GLY C O   1 
ATOM   5395  N  N   . TRP C  3  254 ? -47.481 16.467  254.553  1.00 71.19  ? 332 TRP C N   1 
ATOM   5396  C  CA  . TRP C  3  254 ? -47.129 17.125  255.810  1.00 73.32  ? 332 TRP C CA  1 
ATOM   5397  C  C   . TRP C  3  254 ? -48.172 16.764  256.865  1.00 77.04  ? 332 TRP C C   1 
ATOM   5398  O  O   . TRP C  3  254 ? -49.187 16.146  256.547  1.00 77.73  ? 332 TRP C O   1 
ATOM   5399  C  CB  . TRP C  3  254 ? -47.086 18.637  255.587  1.00 72.72  ? 332 TRP C CB  1 
ATOM   5400  C  CG  . TRP C  3  254 ? -46.671 19.438  256.762  1.00 76.27  ? 332 TRP C CG  1 
ATOM   5401  C  CD1 . TRP C  3  254 ? -47.474 19.919  257.747  1.00 80.79  ? 332 TRP C CD1 1 
ATOM   5402  C  CD2 . TRP C  3  254 ? -45.347 19.892  257.063  1.00 84.67  ? 332 TRP C CD2 1 
ATOM   5403  N  NE1 . TRP C  3  254 ? -46.737 20.652  258.644  1.00 85.29  ? 332 TRP C NE1 1 
ATOM   5404  C  CE2 . TRP C  3  254 ? -45.426 20.651  258.248  1.00 80.62  ? 332 TRP C CE2 1 
ATOM   5405  C  CE3 . TRP C  3  254 ? -44.100 19.731  256.445  1.00 94.55  ? 332 TRP C CE3 1 
ATOM   5406  C  CZ2 . TRP C  3  254 ? -44.304 21.253  258.831  1.00 83.02  ? 332 TRP C CZ2 1 
ATOM   5407  C  CZ3 . TRP C  3  254 ? -42.980 20.331  257.026  1.00 89.90  ? 332 TRP C CZ3 1 
ATOM   5408  C  CH2 . TRP C  3  254 ? -43.094 21.082  258.207  1.00 86.92  ? 332 TRP C CH2 1 
ATOM   5409  N  N   . TRP C  3  255 ? -47.915 17.121  258.121  1.00 82.70  ? 333 TRP C N   1 
ATOM   5410  C  CA  . TRP C  3  255 ? -48.857 16.831  259.205  1.00 86.12  ? 333 TRP C CA  1 
ATOM   5411  C  C   . TRP C  3  255 ? -49.975 17.859  259.154  1.00 94.70  ? 333 TRP C C   1 
ATOM   5412  O  O   . TRP C  3  255 ? -49.896 18.914  259.793  1.00 95.09  ? 333 TRP C O   1 
ATOM   5413  C  CB  . TRP C  3  255 ? -48.157 16.917  260.559  1.00 74.42  ? 333 TRP C CB  1 
ATOM   5414  C  CG  . TRP C  3  255 ? -47.023 15.979  260.682  1.00 66.52  ? 333 TRP C CG  1 
ATOM   5415  C  CD1 . TRP C  3  255 ? -47.074 14.662  261.040  1.00 61.46  ? 333 TRP C CD1 1 
ATOM   5416  C  CD2 . TRP C  3  255 ? -45.662 16.262  260.380  1.00 58.70  ? 333 TRP C CD2 1 
ATOM   5417  N  NE1 . TRP C  3  255 ? -45.824 14.107  260.975  1.00 53.10  ? 333 TRP C NE1 1 
ATOM   5418  C  CE2 . TRP C  3  255 ? -44.936 15.068  260.571  1.00 53.46  ? 333 TRP C CE2 1 
ATOM   5419  C  CE3 . TRP C  3  255 ? -44.982 17.412  259.961  1.00 58.67  ? 333 TRP C CE3 1 
ATOM   5420  C  CZ2 . TRP C  3  255 ? -43.560 14.988  260.357  1.00 53.67  ? 333 TRP C CZ2 1 
ATOM   5421  C  CZ3 . TRP C  3  255 ? -43.611 17.334  259.747  1.00 55.45  ? 333 TRP C CZ3 1 
ATOM   5422  C  CH2 . TRP C  3  255 ? -42.916 16.126  259.945  1.00 57.88  ? 333 TRP C CH2 1 
ATOM   5423  N  N   . MET C  3  256 ? -51.018 17.549  258.393  1.00 95.35  ? 334 MET C N   1 
ATOM   5424  C  CA  . MET C  3  256 ? -52.132 18.469  258.250  1.00 92.09  ? 334 MET C CA  1 
ATOM   5425  C  C   . MET C  3  256 ? -53.225 18.252  259.289  1.00 101.87 ? 334 MET C C   1 
ATOM   5426  O  O   . MET C  3  256 ? -53.550 17.117  259.654  1.00 98.62  ? 334 MET C O   1 
ATOM   5427  C  CB  . MET C  3  256 ? -52.719 18.366  256.837  1.00 82.27  ? 334 MET C CB  1 
ATOM   5428  C  CG  . MET C  3  256 ? -51.740 18.758  255.737  1.00 74.63  ? 334 MET C CG  1 
ATOM   5429  S  SD  . MET C  3  256 ? -51.086 20.441  255.950  1.00 67.62  ? 334 MET C SD  1 
ATOM   5430  C  CE  . MET C  3  256 ? -50.527 20.838  254.259  1.00 49.72  ? 334 MET C CE  1 
ATOM   5431  N  N   . ASN C  3  257 ? -53.769 19.373  259.761  1.00 109.49 ? 335 ASN C N   1 
ATOM   5432  C  CA  . ASN C  3  257 ? -54.847 19.431  260.752  1.00 109.55 ? 335 ASN C CA  1 
ATOM   5433  C  C   . ASN C  3  257 ? -55.966 20.198  260.040  1.00 112.73 ? 335 ASN C C   1 
ATOM   5434  O  O   . ASN C  3  257 ? -56.449 19.760  258.993  1.00 117.25 ? 335 ASN C O   1 
ATOM   5435  C  CB  . ASN C  3  257 ? -54.345 20.190  261.990  1.00 103.48 ? 335 ASN C CB  1 
ATOM   5436  C  CG  . ASN C  3  257 ? -55.457 20.581  262.936  1.00 98.06  ? 335 ASN C CG  1 
ATOM   5437  O  OD1 . ASN C  3  257 ? -56.371 19.802  263.192  1.00 93.02  ? 335 ASN C OD1 1 
ATOM   5438  N  ND2 . ASN C  3  257 ? -55.377 21.795  263.472  1.00 92.88  ? 335 ASN C ND2 1 
ATOM   5439  N  N   . ARG C  3  258 ? -56.390 21.328  260.591  1.00 110.54 ? 336 ARG C N   1 
ATOM   5440  C  CA  . ARG C  3  258 ? -57.395 22.137  259.914  1.00 109.87 ? 336 ARG C CA  1 
ATOM   5441  C  C   . ARG C  3  258 ? -56.512 22.985  259.012  1.00 106.18 ? 336 ARG C C   1 
ATOM   5442  O  O   . ARG C  3  258 ? -56.678 24.197  258.871  1.00 102.11 ? 336 ARG C O   1 
ATOM   5443  C  CB  . ARG C  3  258 ? -58.160 23.001  260.907  1.00 120.70 ? 336 ARG C CB  1 
ATOM   5444  C  CG  . ARG C  3  258 ? -59.589 22.545  261.149  1.00 127.31 ? 336 ARG C CG  1 
ATOM   5445  C  CD  . ARG C  3  258 ? -60.492 22.967  260.003  1.00 133.88 ? 336 ARG C CD  1 
ATOM   5446  N  NE  . ARG C  3  258 ? -61.864 22.505  260.190  1.00 137.52 ? 336 ARG C NE  1 
ATOM   5447  C  CZ  . ARG C  3  258 ? -62.883 22.849  259.408  1.00 138.72 ? 336 ARG C CZ  1 
ATOM   5448  N  NH1 . ARG C  3  258 ? -62.690 23.668  258.382  1.00 138.44 ? 336 ARG C NH1 1 
ATOM   5449  N  NH2 . ARG C  3  258 ? -64.096 22.366  259.645  1.00 138.86 ? 336 ARG C NH2 1 
ATOM   5450  N  N   . CYS C  3  259 ? -55.545 22.277  258.438  1.00 104.31 ? 337 CYS C N   1 
ATOM   5451  C  CA  . CYS C  3  259 ? -54.522 22.770  257.536  1.00 106.44 ? 337 CYS C CA  1 
ATOM   5452  C  C   . CYS C  3  259 ? -53.212 23.084  258.224  1.00 103.30 ? 337 CYS C C   1 
ATOM   5453  O  O   . CYS C  3  259 ? -52.505 22.157  258.616  1.00 103.74 ? 337 CYS C O   1 
ATOM   5454  C  CB  . CYS C  3  259 ? -55.004 23.956  256.701  1.00 108.43 ? 337 CYS C CB  1 
ATOM   5455  S  SG  . CYS C  3  259 ? -55.851 23.434  255.166  1.00 122.54 ? 337 CYS C SG  1 
ATOM   5456  N  N   . HIS C  3  260 ? -52.876 24.357  258.414  1.00 103.86 ? 338 HIS C N   1 
ATOM   5457  C  CA  . HIS C  3  260 ? -51.572 24.625  259.010  1.00 102.36 ? 338 HIS C CA  1 
ATOM   5458  C  C   . HIS C  3  260 ? -51.235 26.015  259.524  1.00 99.64  ? 338 HIS C C   1 
ATOM   5459  O  O   . HIS C  3  260 ? -51.786 27.020  259.078  1.00 98.05  ? 338 HIS C O   1 
ATOM   5460  C  CB  . HIS C  3  260 ? -50.514 24.247  257.988  1.00 101.41 ? 338 HIS C CB  1 
ATOM   5461  C  CG  . HIS C  3  260 ? -50.723 24.904  256.661  1.00 101.33 ? 338 HIS C CG  1 
ATOM   5462  N  ND1 . HIS C  3  260 ? -50.689 26.272  256.497  1.00 92.44  ? 338 HIS C ND1 1 
ATOM   5463  C  CD2 . HIS C  3  260 ? -50.995 24.384  255.439  1.00 106.92 ? 338 HIS C CD2 1 
ATOM   5464  C  CE1 . HIS C  3  260 ? -50.928 26.565  255.230  1.00 103.06 ? 338 HIS C CE1 1 
ATOM   5465  N  NE2 . HIS C  3  260 ? -51.117 25.437  254.567  1.00 100.52 ? 338 HIS C NE2 1 
ATOM   5466  N  N   . ALA C  3  261 ? -50.279 26.037  260.450  1.00 95.02  ? 339 ALA C N   1 
ATOM   5467  C  CA  . ALA C  3  261 ? -49.761 27.259  261.053  1.00 91.08  ? 339 ALA C CA  1 
ATOM   5468  C  C   . ALA C  3  261 ? -48.265 27.251  260.756  1.00 92.68  ? 339 ALA C C   1 
ATOM   5469  O  O   . ALA C  3  261 ? -47.588 28.277  260.835  1.00 87.52  ? 339 ALA C O   1 
ATOM   5470  C  CB  . ALA C  3  261 ? -49.996 27.247  262.547  1.00 89.35  ? 339 ALA C CB  1 
ATOM   5471  N  N   . GLY C  3  262 ? -47.770 26.061  260.417  1.00 99.28  ? 340 GLY C N   1 
ATOM   5472  C  CA  . GLY C  3  262 ? -46.370 25.861  260.084  1.00 96.27  ? 340 GLY C CA  1 
ATOM   5473  C  C   . GLY C  3  262 ? -46.282 24.812  258.990  1.00 91.82  ? 340 GLY C C   1 
ATOM   5474  O  O   . GLY C  3  262 ? -46.586 23.640  259.215  1.00 94.04  ? 340 GLY C O   1 
ATOM   5475  N  N   . HIS C  3  263 ? -45.873 25.233  257.799  1.00 84.06  ? 341 HIS C N   1 
ATOM   5476  C  CA  . HIS C  3  263 ? -45.769 24.329  256.663  1.00 76.55  ? 341 HIS C CA  1 
ATOM   5477  C  C   . HIS C  3  263 ? -44.443 24.568  255.956  1.00 82.22  ? 341 HIS C C   1 
ATOM   5478  O  O   . HIS C  3  263 ? -44.291 25.560  255.228  1.00 74.20  ? 341 HIS C O   1 
ATOM   5479  C  CB  . HIS C  3  263 ? -46.903 24.608  255.691  1.00 83.37  ? 341 HIS C CB  1 
ATOM   5480  C  CG  . HIS C  3  263 ? -47.159 23.500  254.723  1.00 87.53  ? 341 HIS C CG  1 
ATOM   5481  N  ND1 . HIS C  3  263 ? -47.858 23.689  253.550  1.00 93.39  ? 341 HIS C ND1 1 
ATOM   5482  C  CD2 . HIS C  3  263 ? -46.872 22.179  254.784  1.00 86.09  ? 341 HIS C CD2 1 
ATOM   5483  C  CE1 . HIS C  3  263 ? -47.994 22.531  252.932  1.00 97.04  ? 341 HIS C CE1 1 
ATOM   5484  N  NE2 . HIS C  3  263 ? -47.407 21.598  253.660  1.00 94.70  ? 341 HIS C NE2 1 
ATOM   5485  N  N   . LEU C  3  264 ? -43.493 23.656  256.153  1.00 83.02  ? 342 LEU C N   1 
ATOM   5486  C  CA  . LEU C  3  264 ? -42.172 23.792  255.544  1.00 79.55  ? 342 LEU C CA  1 
ATOM   5487  C  C   . LEU C  3  264 ? -42.019 23.030  254.224  1.00 77.98  ? 342 LEU C C   1 
ATOM   5488  O  O   . LEU C  3  264 ? -40.993 23.139  253.553  1.00 77.73  ? 342 LEU C O   1 
ATOM   5489  C  CB  . LEU C  3  264 ? -41.101 23.348  256.543  1.00 73.26  ? 342 LEU C CB  1 
ATOM   5490  C  CG  . LEU C  3  264 ? -41.151 24.060  257.897  1.00 66.05  ? 342 LEU C CG  1 
ATOM   5491  C  CD1 . LEU C  3  264 ? -40.228 23.362  258.869  1.00 67.20  ? 342 LEU C CD1 1 
ATOM   5492  C  CD2 . LEU C  3  264 ? -40.757 25.518  257.736  1.00 63.35  ? 342 LEU C CD2 1 
ATOM   5493  N  N   . ASN C  3  265 ? -43.039 22.266  253.851  1.00 77.74  ? 343 ASN C N   1 
ATOM   5494  C  CA  . ASN C  3  265 ? -43.005 21.513  252.604  1.00 78.13  ? 343 ASN C CA  1 
ATOM   5495  C  C   . ASN C  3  265 ? -43.854 22.197  251.532  1.00 81.53  ? 343 ASN C C   1 
ATOM   5496  O  O   . ASN C  3  265 ? -44.086 21.640  250.461  1.00 90.65  ? 343 ASN C O   1 
ATOM   5497  C  CB  . ASN C  3  265 ? -43.520 20.086  252.831  1.00 69.83  ? 343 ASN C CB  1 
ATOM   5498  C  CG  . ASN C  3  265 ? -42.550 19.233  253.620  1.00 69.08  ? 343 ASN C CG  1 
ATOM   5499  O  OD1 . ASN C  3  265 ? -41.374 19.579  253.760  1.00 64.16  ? 343 ASN C OD1 1 
ATOM   5500  N  ND2 . ASN C  3  265 ? -43.031 18.098  254.121  1.00 62.06  ? 343 ASN C ND2 1 
ATOM   5501  N  N   . GLY C  3  266 ? -44.318 23.406  251.825  1.00 84.28  ? 344 GLY C N   1 
ATOM   5502  C  CA  . GLY C  3  266 ? -45.151 24.133  250.882  1.00 78.53  ? 344 GLY C CA  1 
ATOM   5503  C  C   . GLY C  3  266 ? -44.434 24.522  249.606  1.00 75.94  ? 344 GLY C C   1 
ATOM   5504  O  O   . GLY C  3  266 ? -43.210 24.410  249.514  1.00 71.88  ? 344 GLY C O   1 
ATOM   5505  N  N   . LYS C  3  267 ? -45.196 24.986  248.619  1.00 76.12  ? 345 LYS C N   1 
ATOM   5506  C  CA  . LYS C  3  267 ? -44.608 25.378  247.346  1.00 71.69  ? 345 LYS C CA  1 
ATOM   5507  C  C   . LYS C  3  267 ? -43.647 26.532  247.568  1.00 71.92  ? 345 LYS C C   1 
ATOM   5508  O  O   . LYS C  3  267 ? -43.951 27.476  248.300  1.00 79.39  ? 345 LYS C O   1 
ATOM   5509  C  CB  . LYS C  3  267 ? -45.705 25.749  246.343  1.00 69.17  ? 345 LYS C CB  1 
ATOM   5510  C  CG  . LYS C  3  267 ? -46.727 24.635  246.129  1.00 69.63  ? 345 LYS C CG  1 
ATOM   5511  C  CD  . LYS C  3  267 ? -47.279 24.621  244.707  1.00 89.13  ? 345 LYS C CD  1 
ATOM   5512  C  CE  . LYS C  3  267 ? -48.002 25.918  244.352  1.00 93.21  ? 345 LYS C CE  1 
ATOM   5513  N  NZ  . LYS C  3  267 ? -48.547 25.891  242.960  1.00 94.72  ? 345 LYS C NZ  1 
ATOM   5514  N  N   . TYR C  3  268 ? -42.481 26.439  246.940  1.00 69.74  ? 346 TYR C N   1 
ATOM   5515  C  CA  . TYR C  3  268 ? -41.431 27.441  247.075  1.00 69.30  ? 346 TYR C CA  1 
ATOM   5516  C  C   . TYR C  3  268 ? -41.613 28.649  246.165  1.00 70.01  ? 346 TYR C C   1 
ATOM   5517  O  O   . TYR C  3  268 ? -41.230 28.615  244.997  1.00 74.33  ? 346 TYR C O   1 
ATOM   5518  C  CB  . TYR C  3  268 ? -40.076 26.780  246.801  1.00 72.98  ? 346 TYR C CB  1 
ATOM   5519  C  CG  . TYR C  3  268 ? -38.862 27.596  247.190  1.00 66.40  ? 346 TYR C CG  1 
ATOM   5520  C  CD1 . TYR C  3  268 ? -38.357 28.590  246.353  1.00 67.05  ? 346 TYR C CD1 1 
ATOM   5521  C  CD2 . TYR C  3  268 ? -38.209 27.360  248.393  1.00 66.36  ? 346 TYR C CD2 1 
ATOM   5522  C  CE1 . TYR C  3  268 ? -37.228 29.326  246.708  1.00 70.53  ? 346 TYR C CE1 1 
ATOM   5523  C  CE2 . TYR C  3  268 ? -37.083 28.088  248.759  1.00 66.54  ? 346 TYR C CE2 1 
ATOM   5524  C  CZ  . TYR C  3  268 ? -36.594 29.070  247.916  1.00 73.02  ? 346 TYR C CZ  1 
ATOM   5525  O  OH  . TYR C  3  268 ? -35.468 29.787  248.282  1.00 77.52  ? 346 TYR C OH  1 
ATOM   5526  N  N   . TYR C  3  269 ? -42.191 29.718  246.708  1.00 73.55  ? 347 TYR C N   1 
ATOM   5527  C  CA  . TYR C  3  269 ? -42.404 30.945  245.945  1.00 76.24  ? 347 TYR C CA  1 
ATOM   5528  C  C   . TYR C  3  269 ? -41.173 31.817  246.087  1.00 81.70  ? 347 TYR C C   1 
ATOM   5529  O  O   . TYR C  3  269 ? -40.791 32.166  247.205  1.00 85.13  ? 347 TYR C O   1 
ATOM   5530  C  CB  . TYR C  3  269 ? -43.620 31.715  246.470  1.00 72.42  ? 347 TYR C CB  1 
ATOM   5531  C  CG  . TYR C  3  269 ? -44.944 31.022  246.245  1.00 76.12  ? 347 TYR C CG  1 
ATOM   5532  C  CD1 . TYR C  3  269 ? -45.507 30.950  244.974  1.00 76.96  ? 347 TYR C CD1 1 
ATOM   5533  C  CD2 . TYR C  3  269 ? -45.616 30.400  247.299  1.00 78.44  ? 347 TYR C CD2 1 
ATOM   5534  C  CE1 . TYR C  3  269 ? -46.705 30.271  244.758  1.00 81.30  ? 347 TYR C CE1 1 
ATOM   5535  C  CE2 . TYR C  3  269 ? -46.809 29.720  247.093  1.00 74.11  ? 347 TYR C CE2 1 
ATOM   5536  C  CZ  . TYR C  3  269 ? -47.350 29.654  245.822  1.00 77.28  ? 347 TYR C CZ  1 
ATOM   5537  O  OH  . TYR C  3  269 ? -48.520 28.950  245.610  1.00 73.32  ? 347 TYR C OH  1 
ATOM   5538  N  N   . PHE C  3  270 ? -40.547 32.153  244.961  1.00 86.84  ? 348 PHE C N   1 
ATOM   5539  C  CA  . PHE C  3  270 ? -39.365 33.009  244.976  1.00 95.75  ? 348 PHE C CA  1 
ATOM   5540  C  C   . PHE C  3  270 ? -39.814 34.407  245.364  1.00 101.81 ? 348 PHE C C   1 
ATOM   5541  O  O   . PHE C  3  270 ? -41.012 34.664  245.496  1.00 99.42  ? 348 PHE C O   1 
ATOM   5542  C  CB  . PHE C  3  270 ? -38.698 33.054  243.599  1.00 94.73  ? 348 PHE C CB  1 
ATOM   5543  C  CG  . PHE C  3  270 ? -38.050 31.761  243.194  1.00 111.20 ? 348 PHE C CG  1 
ATOM   5544  C  CD1 . PHE C  3  270 ? -38.803 30.593  243.081  1.00 113.90 ? 348 PHE C CD1 1 
ATOM   5545  C  CD2 . PHE C  3  270 ? -36.683 31.708  242.921  1.00 115.81 ? 348 PHE C CD2 1 
ATOM   5546  C  CE1 . PHE C  3  270 ? -38.207 29.390  242.702  1.00 120.04 ? 348 PHE C CE1 1 
ATOM   5547  C  CE2 . PHE C  3  270 ? -36.073 30.513  242.541  1.00 119.68 ? 348 PHE C CE2 1 
ATOM   5548  C  CZ  . PHE C  3  270 ? -36.837 29.350  242.431  1.00 126.13 ? 348 PHE C CZ  1 
ATOM   5549  N  N   . GLY C  3  271 ? -38.856 35.308  245.543  1.00 106.04 ? 349 GLY C N   1 
ATOM   5550  C  CA  . GLY C  3  271 ? -39.193 36.668  245.923  1.00 109.47 ? 349 GLY C CA  1 
ATOM   5551  C  C   . GLY C  3  271 ? -39.744 36.765  247.337  1.00 108.96 ? 349 GLY C C   1 
ATOM   5552  O  O   . GLY C  3  271 ? -40.043 35.743  247.963  1.00 104.67 ? 349 GLY C O   1 
ATOM   5553  N  N   . GLY C  3  272 ? -39.883 37.996  247.831  1.00 105.39 ? 350 GLY C N   1 
ATOM   5554  C  CA  . GLY C  3  272 ? -40.387 38.223  249.174  1.00 105.10 ? 350 GLY C CA  1 
ATOM   5555  C  C   . GLY C  3  272 ? -41.508 37.300  249.618  1.00 104.34 ? 350 GLY C C   1 
ATOM   5556  O  O   . GLY C  3  272 ? -41.270 36.227  250.168  1.00 99.03  ? 350 GLY C O   1 
ATOM   5557  N  N   . ASN C  3  273 ? -42.743 37.716  249.381  1.00 107.43 ? 351 ASN C N   1 
ATOM   5558  C  CA  . ASN C  3  273 ? -43.886 36.912  249.781  1.00 108.66 ? 351 ASN C CA  1 
ATOM   5559  C  C   . ASN C  3  273 ? -44.917 36.820  248.674  1.00 111.26 ? 351 ASN C C   1 
ATOM   5560  O  O   . ASN C  3  273 ? -45.227 37.814  248.016  1.00 110.57 ? 351 ASN C O   1 
ATOM   5561  C  CB  . ASN C  3  273 ? -44.540 37.511  251.021  1.00 106.07 ? 351 ASN C CB  1 
ATOM   5562  C  CG  . ASN C  3  273 ? -45.042 38.921  250.794  1.00 107.85 ? 351 ASN C CG  1 
ATOM   5563  O  OD1 . ASN C  3  273 ? -44.276 39.820  250.440  1.00 112.44 ? 351 ASN C OD1 1 
ATOM   5564  N  ND2 . ASN C  3  273 ? -46.335 39.123  251.001  1.00 103.60 ? 351 ASN C ND2 1 
ATOM   5565  N  N   . TYR C  3  274 ? -45.445 35.620  248.466  1.00 110.15 ? 352 TYR C N   1 
ATOM   5566  C  CA  . TYR C  3  274 ? -46.454 35.432  247.443  1.00 108.85 ? 352 TYR C CA  1 
ATOM   5567  C  C   . TYR C  3  274 ? -47.712 36.078  247.994  1.00 116.25 ? 352 TYR C C   1 
ATOM   5568  O  O   . TYR C  3  274 ? -47.772 36.405  249.178  1.00 115.09 ? 352 TYR C O   1 
ATOM   5569  C  CB  . TYR C  3  274 ? -46.671 33.941  247.158  1.00 99.32  ? 352 TYR C CB  1 
ATOM   5570  C  CG  . TYR C  3  274 ? -47.300 33.142  248.280  1.00 89.90  ? 352 TYR C CG  1 
ATOM   5571  C  CD1 . TYR C  3  274 ? -46.748 33.128  249.562  1.00 81.72  ? 352 TYR C CD1 1 
ATOM   5572  C  CD2 . TYR C  3  274 ? -48.438 32.370  248.046  1.00 92.42  ? 352 TYR C CD2 1 
ATOM   5573  C  CE1 . TYR C  3  274 ? -47.318 32.360  250.582  1.00 70.63  ? 352 TYR C CE1 1 
ATOM   5574  C  CE2 . TYR C  3  274 ? -49.015 31.599  249.057  1.00 85.62  ? 352 TYR C CE2 1 
ATOM   5575  C  CZ  . TYR C  3  274 ? -48.451 31.600  250.317  1.00 80.44  ? 352 TYR C CZ  1 
ATOM   5576  O  OH  . TYR C  3  274 ? -49.030 30.833  251.298  1.00 83.08  ? 352 TYR C OH  1 
ATOM   5577  N  N   . ARG C  3  275 ? -48.707 36.278  247.141  1.00 127.13 ? 353 ARG C N   1 
ATOM   5578  C  CA  . ARG C  3  275 ? -49.945 36.912  247.571  1.00 133.47 ? 353 ARG C CA  1 
ATOM   5579  C  C   . ARG C  3  275 ? -51.175 36.246  246.982  1.00 137.06 ? 353 ARG C C   1 
ATOM   5580  O  O   . ARG C  3  275 ? -51.079 35.344  246.153  1.00 137.63 ? 353 ARG C O   1 
ATOM   5581  C  CB  . ARG C  3  275 ? -49.941 38.393  247.172  1.00 134.09 ? 353 ARG C CB  1 
ATOM   5582  C  CG  . ARG C  3  275 ? -48.996 39.273  247.977  1.00 138.54 ? 353 ARG C CG  1 
ATOM   5583  C  CD  . ARG C  3  275 ? -49.494 39.452  249.407  1.00 146.99 ? 353 ARG C CD  1 
ATOM   5584  N  NE  . ARG C  3  275 ? -48.685 40.408  250.162  1.00 148.63 ? 353 ARG C NE  1 
ATOM   5585  C  CZ  . ARG C  3  275 ? -48.930 40.771  251.419  1.00 148.33 ? 353 ARG C CZ  1 
ATOM   5586  N  NH1 . ARG C  3  275 ? -49.965 40.261  252.073  1.00 144.82 ? 353 ARG C NH1 1 
ATOM   5587  N  NH2 . ARG C  3  275 ? -48.138 41.645  252.024  1.00 149.82 ? 353 ARG C NH2 1 
ATOM   5588  N  N   . LYS C  3  276 ? -52.336 36.706  247.430  1.00 142.63 ? 354 LYS C N   1 
ATOM   5589  C  CA  . LYS C  3  276 ? -53.612 36.203  246.948  1.00 147.88 ? 354 LYS C CA  1 
ATOM   5590  C  C   . LYS C  3  276 ? -54.162 37.216  245.945  1.00 156.04 ? 354 LYS C C   1 
ATOM   5591  O  O   . LYS C  3  276 ? -55.364 37.242  245.667  1.00 158.24 ? 354 LYS C O   1 
ATOM   5592  C  CB  . LYS C  3  276 ? -54.583 36.033  248.119  1.00 144.60 ? 354 LYS C CB  1 
ATOM   5593  C  CG  . LYS C  3  276 ? -54.543 37.176  249.129  1.00 136.33 ? 354 LYS C CG  1 
ATOM   5594  C  CD  . LYS C  3  276 ? -55.538 36.955  250.260  1.00 131.72 ? 354 LYS C CD  1 
ATOM   5595  C  CE  . LYS C  3  276 ? -55.259 37.872  251.443  1.00 127.02 ? 354 LYS C CE  1 
ATOM   5596  N  NZ  . LYS C  3  276 ? -55.293 39.308  251.074  1.00 126.56 ? 354 LYS C NZ  1 
ATOM   5597  N  N   . THR C  3  277 ? -53.265 38.048  245.413  1.00 162.20 ? 355 THR C N   1 
ATOM   5598  C  CA  . THR C  3  277 ? -53.623 39.083  244.440  1.00 163.97 ? 355 THR C CA  1 
ATOM   5599  C  C   . THR C  3  277 ? -54.455 38.488  243.310  1.00 168.19 ? 355 THR C C   1 
ATOM   5600  O  O   . THR C  3  277 ? -54.164 37.391  242.826  1.00 170.54 ? 355 THR C O   1 
ATOM   5601  C  CB  . THR C  3  277 ? -52.364 39.740  243.824  1.00 161.27 ? 355 THR C CB  1 
ATOM   5602  O  OG1 . THR C  3  277 ? -51.523 40.240  244.870  1.00 159.18 ? 355 THR C OG1 1 
ATOM   5603  C  CG2 . THR C  3  277 ? -52.757 40.891  242.905  1.00 154.76 ? 355 THR C CG2 1 
ATOM   5604  N  N   . ASP C  3  278 ? -55.487 39.214  242.890  1.00 166.39 ? 356 ASP C N   1 
ATOM   5605  C  CA  . ASP C  3  278 ? -56.355 38.736  241.820  1.00 163.81 ? 356 ASP C CA  1 
ATOM   5606  C  C   . ASP C  3  278 ? -56.924 37.392  242.264  1.00 161.86 ? 356 ASP C C   1 
ATOM   5607  O  O   . ASP C  3  278 ? -56.830 36.394  241.547  1.00 159.08 ? 356 ASP C O   1 
ATOM   5608  C  CB  . ASP C  3  278 ? -55.548 38.579  240.527  1.00 163.27 ? 356 ASP C CB  1 
ATOM   5609  C  CG  . ASP C  3  278 ? -54.802 39.848  240.151  1.00 162.34 ? 356 ASP C CG  1 
ATOM   5610  O  OD1 . ASP C  3  278 ? -55.468 40.861  239.848  1.00 165.92 ? 356 ASP C OD1 1 
ATOM   5611  O  OD2 . ASP C  3  278 ? -53.552 39.835  240.165  1.00 157.93 ? 356 ASP C OD2 1 
ATOM   5612  N  N   . VAL C  3  279 ? -57.508 37.394  243.460  1.00 162.17 ? 357 VAL C N   1 
ATOM   5613  C  CA  . VAL C  3  279 ? -58.092 36.209  244.084  1.00 162.98 ? 357 VAL C CA  1 
ATOM   5614  C  C   . VAL C  3  279 ? -58.616 35.134  243.131  1.00 170.63 ? 357 VAL C C   1 
ATOM   5615  O  O   . VAL C  3  279 ? -59.745 35.218  242.638  1.00 172.04 ? 357 VAL C O   1 
ATOM   5616  C  CB  . VAL C  3  279 ? -59.238 36.600  245.052  1.00 156.73 ? 357 VAL C CB  1 
ATOM   5617  C  CG1 . VAL C  3  279 ? -59.745 35.370  245.789  1.00 149.72 ? 357 VAL C CG1 1 
ATOM   5618  C  CG2 . VAL C  3  279 ? -58.745 37.631  246.045  1.00 152.78 ? 357 VAL C CG2 1 
ATOM   5619  N  N   . GLU C  3  280 ? -57.779 34.128  242.878  1.00 173.29 ? 358 GLU C N   1 
ATOM   5620  C  CA  . GLU C  3  280 ? -58.139 32.998  242.026  1.00 171.55 ? 358 GLU C CA  1 
ATOM   5621  C  C   . GLU C  3  280 ? -58.737 31.968  242.974  1.00 172.89 ? 358 GLU C C   1 
ATOM   5622  O  O   . GLU C  3  280 ? -59.437 31.061  242.559  1.00 171.58 ? 358 GLU C O   1 
ATOM   5623  C  CB  . GLU C  3  280 ? -56.898 32.399  241.359  1.00 169.39 ? 358 GLU C CB  1 
ATOM   5624  C  CG  . GLU C  3  280 ? -56.128 33.356  240.466  1.00 173.62 ? 358 GLU C CG  1 
ATOM   5625  C  CD  . GLU C  3  280 ? -54.879 32.722  239.875  1.00 175.56 ? 358 GLU C CD  1 
ATOM   5626  O  OE1 . GLU C  3  280 ? -54.999 31.655  239.236  1.00 177.56 ? 358 GLU C OE1 1 
ATOM   5627  O  OE2 . GLU C  3  280 ? -53.778 33.288  240.045  1.00 174.55 ? 358 GLU C OE2 1 
ATOM   5628  N  N   . PHE C  3  281 ? -58.415 32.132  244.255  1.00 176.11 ? 359 PHE C N   1 
ATOM   5629  C  CA  . PHE C  3  281 ? -58.869 31.284  245.360  1.00 177.25 ? 359 PHE C CA  1 
ATOM   5630  C  C   . PHE C  3  281 ? -57.908 31.462  246.539  1.00 173.35 ? 359 PHE C C   1 
ATOM   5631  O  O   . PHE C  3  281 ? -56.822 32.019  246.377  1.00 173.06 ? 359 PHE C O   1 
ATOM   5632  C  CB  . PHE C  3  281 ? -58.967 29.797  244.944  1.00 183.08 ? 359 PHE C CB  1 
ATOM   5633  C  CG  . PHE C  3  281 ? -57.730 29.237  244.266  1.00 188.20 ? 359 PHE C CG  1 
ATOM   5634  C  CD1 . PHE C  3  281 ? -57.802 28.014  243.598  1.00 188.96 ? 359 PHE C CD1 1 
ATOM   5635  C  CD2 . PHE C  3  281 ? -56.509 29.911  244.291  1.00 187.09 ? 359 PHE C CD2 1 
ATOM   5636  C  CE1 . PHE C  3  281 ? -56.683 27.472  242.965  1.00 188.26 ? 359 PHE C CE1 1 
ATOM   5637  C  CE2 . PHE C  3  281 ? -55.382 29.377  243.661  1.00 186.18 ? 359 PHE C CE2 1 
ATOM   5638  C  CZ  . PHE C  3  281 ? -55.471 28.155  242.997  1.00 187.82 ? 359 PHE C CZ  1 
ATOM   5639  N  N   . PRO C  3  282 ? -58.299 31.012  247.744  1.00 168.82 ? 360 PRO C N   1 
ATOM   5640  C  CA  . PRO C  3  282 ? -57.407 31.164  248.901  1.00 162.95 ? 360 PRO C CA  1 
ATOM   5641  C  C   . PRO C  3  282 ? -56.035 30.508  248.709  1.00 155.52 ? 360 PRO C C   1 
ATOM   5642  O  O   . PRO C  3  282 ? -55.148 31.077  248.068  1.00 157.13 ? 360 PRO C O   1 
ATOM   5643  C  CB  . PRO C  3  282 ? -58.213 30.538  250.043  1.00 163.29 ? 360 PRO C CB  1 
ATOM   5644  C  CG  . PRO C  3  282 ? -59.076 29.526  249.343  1.00 163.63 ? 360 PRO C CG  1 
ATOM   5645  C  CD  . PRO C  3  282 ? -59.526 30.286  248.122  1.00 166.72 ? 360 PRO C CD  1 
ATOM   5646  N  N   . TYR C  3  283 ? -55.870 29.316  249.276  1.00 141.30 ? 361 TYR C N   1 
ATOM   5647  C  CA  . TYR C  3  283 ? -54.623 28.570  249.171  1.00 125.54 ? 361 TYR C CA  1 
ATOM   5648  C  C   . TYR C  3  283 ? -53.382 29.366  249.559  1.00 120.30 ? 361 TYR C C   1 
ATOM   5649  O  O   . TYR C  3  283 ? -52.914 30.231  248.814  1.00 121.81 ? 361 TYR C O   1 
ATOM   5650  C  CB  . TYR C  3  283 ? -54.452 28.028  247.750  1.00 126.72 ? 361 TYR C CB  1 
ATOM   5651  C  CG  . TYR C  3  283 ? -55.394 26.899  247.394  1.00 125.78 ? 361 TYR C CG  1 
ATOM   5652  C  CD1 . TYR C  3  283 ? -55.362 26.314  246.126  1.00 127.58 ? 361 TYR C CD1 1 
ATOM   5653  C  CD2 . TYR C  3  283 ? -56.311 26.406  248.322  1.00 124.77 ? 361 TYR C CD2 1 
ATOM   5654  C  CE1 . TYR C  3  283 ? -56.219 25.265  245.789  1.00 126.25 ? 361 TYR C CE1 1 
ATOM   5655  C  CE2 . TYR C  3  283 ? -57.173 25.358  247.997  1.00 125.66 ? 361 TYR C CE2 1 
ATOM   5656  C  CZ  . TYR C  3  283 ? -57.122 24.791  246.730  1.00 127.33 ? 361 TYR C CZ  1 
ATOM   5657  O  OH  . TYR C  3  283 ? -57.965 23.748  246.410  1.00 118.65 ? 361 TYR C OH  1 
ATOM   5658  N  N   . ASP C  3  284 ? -52.855 29.060  250.737  1.00 111.88 ? 362 ASP C N   1 
ATOM   5659  C  CA  . ASP C  3  284 ? -51.653 29.703  251.249  1.00 101.03 ? 362 ASP C CA  1 
ATOM   5660  C  C   . ASP C  3  284 ? -50.608 28.601  251.426  1.00 102.62 ? 362 ASP C C   1 
ATOM   5661  O  O   . ASP C  3  284 ? -49.948 28.498  252.458  1.00 108.26 ? 362 ASP C O   1 
ATOM   5662  C  CB  . ASP C  3  284 ? -51.959 30.405  252.577  1.00 90.64  ? 362 ASP C CB  1 
ATOM   5663  C  CG  . ASP C  3  284 ? -52.705 29.513  253.563  1.00 92.57  ? 362 ASP C CG  1 
ATOM   5664  O  OD1 . ASP C  3  284 ? -53.599 28.751  253.131  1.00 86.74  ? 362 ASP C OD1 1 
ATOM   5665  O  OD2 . ASP C  3  284 ? -52.410 29.589  254.779  1.00 87.20  ? 362 ASP C OD2 1 
ATOM   5666  N  N   . ASP C  3  285 ? -50.482 27.780  250.386  1.00 100.93 ? 363 ASP C N   1 
ATOM   5667  C  CA  . ASP C  3  285 ? -49.562 26.648  250.344  1.00 92.90  ? 363 ASP C CA  1 
ATOM   5668  C  C   . ASP C  3  285 ? -48.109 26.931  250.720  1.00 93.80  ? 363 ASP C C   1 
ATOM   5669  O  O   . ASP C  3  285 ? -47.498 26.148  251.449  1.00 98.92  ? 363 ASP C O   1 
ATOM   5670  C  CB  . ASP C  3  285 ? -49.608 26.011  248.951  1.00 89.22  ? 363 ASP C CB  1 
ATOM   5671  C  CG  . ASP C  3  285 ? -49.583 27.046  247.830  1.00 87.45  ? 363 ASP C CG  1 
ATOM   5672  O  OD1 . ASP C  3  285 ? -48.882 28.067  247.982  1.00 72.32  ? 363 ASP C OD1 1 
ATOM   5673  O  OD2 . ASP C  3  285 ? -50.250 26.835  246.791  1.00 77.85  ? 363 ASP C OD2 1 
ATOM   5674  N  N   . GLY C  3  286 ? -47.568 28.038  250.216  1.00 83.32  ? 364 GLY C N   1 
ATOM   5675  C  CA  . GLY C  3  286 ? -46.187 28.418  250.479  1.00 76.53  ? 364 GLY C CA  1 
ATOM   5676  C  C   . GLY C  3  286 ? -45.501 27.969  251.765  1.00 76.42  ? 364 GLY C C   1 
ATOM   5677  O  O   . GLY C  3  286 ? -46.122 27.464  252.709  1.00 64.10  ? 364 GLY C O   1 
ATOM   5678  N  N   . ILE C  3  287 ? -44.187 28.168  251.787  1.00 77.59  ? 365 ILE C N   1 
ATOM   5679  C  CA  . ILE C  3  287 ? -43.344 27.813  252.925  1.00 80.83  ? 365 ILE C CA  1 
ATOM   5680  C  C   . ILE C  3  287 ? -43.468 28.866  254.036  1.00 82.70  ? 365 ILE C C   1 
ATOM   5681  O  O   . ILE C  3  287 ? -42.717 29.847  254.064  1.00 72.55  ? 365 ILE C O   1 
ATOM   5682  C  CB  . ILE C  3  287 ? -41.880 27.714  252.469  1.00 82.22  ? 365 ILE C CB  1 
ATOM   5683  C  CG1 . ILE C  3  287 ? -41.773 26.652  251.376  1.00 83.23  ? 365 ILE C CG1 1 
ATOM   5684  C  CG2 . ILE C  3  287 ? -40.976 27.372  253.644  1.00 91.51  ? 365 ILE C CG2 1 
ATOM   5685  C  CD1 . ILE C  3  287 ? -40.432 26.603  250.699  1.00 79.99  ? 365 ILE C CD1 1 
ATOM   5686  N  N   . ILE C  3  288 ? -44.404 28.640  254.958  1.00 80.29  ? 366 ILE C N   1 
ATOM   5687  C  CA  . ILE C  3  288 ? -44.662 29.578  256.043  1.00 79.91  ? 366 ILE C CA  1 
ATOM   5688  C  C   . ILE C  3  288 ? -44.578 29.044  257.477  1.00 85.32  ? 366 ILE C C   1 
ATOM   5689  O  O   . ILE C  3  288 ? -44.644 27.839  257.725  1.00 81.07  ? 366 ILE C O   1 
ATOM   5690  C  CB  . ILE C  3  288 ? -46.044 30.249  255.843  1.00 81.91  ? 366 ILE C CB  1 
ATOM   5691  C  CG1 . ILE C  3  288 ? -47.121 29.200  255.517  1.00 71.98  ? 366 ILE C CG1 1 
ATOM   5692  C  CG2 . ILE C  3  288 ? -45.960 31.254  254.709  1.00 74.54  ? 366 ILE C CG2 1 
ATOM   5693  C  CD1 . ILE C  3  288 ? -47.567 28.364  256.698  1.00 78.01  ? 366 ILE C CD1 1 
ATOM   5694  N  N   . TRP C  3  289 ? -44.443 29.977  258.414  1.00 87.81  ? 367 TRP C N   1 
ATOM   5695  C  CA  . TRP C  3  289 ? -44.332 29.684  259.844  1.00 91.26  ? 367 TRP C CA  1 
ATOM   5696  C  C   . TRP C  3  289 ? -44.964 30.882  260.571  1.00 95.96  ? 367 TRP C C   1 
ATOM   5697  O  O   . TRP C  3  289 ? -44.280 31.713  261.176  1.00 98.39  ? 367 TRP C O   1 
ATOM   5698  C  CB  . TRP C  3  289 ? -42.846 29.521  260.218  1.00 84.71  ? 367 TRP C CB  1 
ATOM   5699  C  CG  . TRP C  3  289 ? -42.565 28.901  261.571  1.00 79.71  ? 367 TRP C CG  1 
ATOM   5700  C  CD1 . TRP C  3  289 ? -41.967 29.507  262.640  1.00 78.99  ? 367 TRP C CD1 1 
ATOM   5701  C  CD2 . TRP C  3  289 ? -42.817 27.546  261.972  1.00 78.39  ? 367 TRP C CD2 1 
ATOM   5702  N  NE1 . TRP C  3  289 ? -41.828 28.617  263.675  1.00 79.82  ? 367 TRP C NE1 1 
ATOM   5703  C  CE2 . TRP C  3  289 ? -42.342 27.406  263.294  1.00 72.59  ? 367 TRP C CE2 1 
ATOM   5704  C  CE3 . TRP C  3  289 ? -43.397 26.437  261.341  1.00 83.54  ? 367 TRP C CE3 1 
ATOM   5705  C  CZ2 . TRP C  3  289 ? -42.429 26.200  264.000  1.00 73.38  ? 367 TRP C CZ2 1 
ATOM   5706  C  CZ3 . TRP C  3  289 ? -43.484 25.231  262.047  1.00 78.60  ? 367 TRP C CZ3 1 
ATOM   5707  C  CH2 . TRP C  3  289 ? -43.002 25.126  263.362  1.00 70.76  ? 367 TRP C CH2 1 
ATOM   5708  N  N   . ALA C  3  290 ? -46.288 30.957  260.467  1.00 96.30  ? 368 ALA C N   1 
ATOM   5709  C  CA  . ALA C  3  290 ? -47.115 32.008  261.056  1.00 89.86  ? 368 ALA C CA  1 
ATOM   5710  C  C   . ALA C  3  290 ? -46.486 32.866  262.142  1.00 86.38  ? 368 ALA C C   1 
ATOM   5711  O  O   . ALA C  3  290 ? -46.415 34.083  262.001  1.00 88.44  ? 368 ALA C O   1 
ATOM   5712  C  CB  . ALA C  3  290 ? -48.410 31.396  261.586  1.00 90.12  ? 368 ALA C CB  1 
ATOM   5713  N  N   . THR C  3  291 ? -46.042 32.236  263.226  1.00 79.75  ? 369 THR C N   1 
ATOM   5714  C  CA  . THR C  3  291 ? -45.452 32.959  264.345  1.00 68.84  ? 369 THR C CA  1 
ATOM   5715  C  C   . THR C  3  291 ? -44.246 33.834  263.996  1.00 68.98  ? 369 THR C C   1 
ATOM   5716  O  O   . THR C  3  291 ? -43.569 34.331  264.894  1.00 67.79  ? 369 THR C O   1 
ATOM   5717  C  CB  . THR C  3  291 ? -45.057 31.987  265.470  1.00 70.36  ? 369 THR C CB  1 
ATOM   5718  O  OG1 . THR C  3  291 ? -44.016 31.115  265.013  1.00 67.88  ? 369 THR C OG1 1 
ATOM   5719  C  CG2 . THR C  3  291 ? -46.260 31.145  265.883  1.00 58.36  ? 369 THR C CG2 1 
ATOM   5720  N  N   . TRP C  3  292 ? -43.977 34.022  262.704  1.00 73.13  ? 370 TRP C N   1 
ATOM   5721  C  CA  . TRP C  3  292 ? -42.865 34.865  262.273  1.00 76.66  ? 370 TRP C CA  1 
ATOM   5722  C  C   . TRP C  3  292 ? -43.113 35.535  260.925  1.00 86.53  ? 370 TRP C C   1 
ATOM   5723  O  O   . TRP C  3  292 ? -42.200 36.114  260.334  1.00 85.75  ? 370 TRP C O   1 
ATOM   5724  C  CB  . TRP C  3  292 ? -41.561 34.066  262.200  1.00 81.75  ? 370 TRP C CB  1 
ATOM   5725  C  CG  . TRP C  3  292 ? -40.381 34.946  261.901  1.00 95.47  ? 370 TRP C CG  1 
ATOM   5726  C  CD1 . TRP C  3  292 ? -40.111 36.154  262.473  1.00 100.75 ? 370 TRP C CD1 1 
ATOM   5727  C  CD2 . TRP C  3  292 ? -39.334 34.714  260.941  1.00 103.70 ? 370 TRP C CD2 1 
ATOM   5728  N  NE1 . TRP C  3  292 ? -38.968 36.694  261.930  1.00 106.23 ? 370 TRP C NE1 1 
ATOM   5729  C  CE2 . TRP C  3  292 ? -38.468 35.833  260.989  1.00 101.80 ? 370 TRP C CE2 1 
ATOM   5730  C  CE3 . TRP C  3  292 ? -39.041 33.674  260.049  1.00 107.89 ? 370 TRP C CE3 1 
ATOM   5731  C  CZ2 . TRP C  3  292 ? -37.327 35.943  260.175  1.00 96.58  ? 370 TRP C CZ2 1 
ATOM   5732  C  CZ3 . TRP C  3  292 ? -37.898 33.785  259.236  1.00 104.75 ? 370 TRP C CZ3 1 
ATOM   5733  C  CH2 . TRP C  3  292 ? -37.060 34.913  259.311  1.00 94.81  ? 370 TRP C CH2 1 
ATOM   5734  N  N   . HIS C  3  293 ? -44.345 35.453  260.435  1.00 93.35  ? 371 HIS C N   1 
ATOM   5735  C  CA  . HIS C  3  293 ? -44.706 36.068  259.154  1.00 106.59 ? 371 HIS C CA  1 
ATOM   5736  C  C   . HIS C  3  293 ? -46.059 35.556  258.689  1.00 103.22 ? 371 HIS C C   1 
ATOM   5737  O  O   . HIS C  3  293 ? -46.388 34.379  258.871  1.00 99.12  ? 371 HIS C O   1 
ATOM   5738  C  CB  . HIS C  3  293 ? -43.672 35.750  258.076  1.00 115.98 ? 371 HIS C CB  1 
ATOM   5739  C  CG  . HIS C  3  293 ? -43.465 34.284  257.873  1.00 145.38 ? 371 HIS C CG  1 
ATOM   5740  N  ND1 . HIS C  3  293 ? -42.815 33.493  258.796  1.00 153.65 ? 371 HIS C ND1 1 
ATOM   5741  C  CD2 . HIS C  3  293 ? -43.864 33.454  256.879  1.00 154.03 ? 371 HIS C CD2 1 
ATOM   5742  C  CE1 . HIS C  3  293 ? -42.821 32.239  258.378  1.00 154.19 ? 371 HIS C CE1 1 
ATOM   5743  N  NE2 . HIS C  3  293 ? -43.452 32.188  257.219  1.00 155.04 ? 371 HIS C NE2 1 
ATOM   5744  N  N   . ASP C  3  294 ? -46.836 36.450  258.088  1.00 99.25  ? 372 ASP C N   1 
ATOM   5745  C  CA  . ASP C  3  294 ? -48.156 36.112  257.587  1.00 98.47  ? 372 ASP C CA  1 
ATOM   5746  C  C   . ASP C  3  294 ? -48.087 34.842  256.749  1.00 100.31 ? 372 ASP C C   1 
ATOM   5747  O  O   . ASP C  3  294 ? -47.035 34.514  256.192  1.00 98.45  ? 372 ASP C O   1 
ATOM   5748  C  CB  . ASP C  3  294 ? -48.697 37.269  256.747  1.00 98.64  ? 372 ASP C CB  1 
ATOM   5749  C  CG  . ASP C  3  294 ? -47.663 37.817  255.779  1.00 103.70 ? 372 ASP C CG  1 
ATOM   5750  O  OD1 . ASP C  3  294 ? -46.623 38.330  256.247  1.00 97.91  ? 372 ASP C OD1 1 
ATOM   5751  O  OD2 . ASP C  3  294 ? -47.888 37.731  254.552  1.00 111.77 ? 372 ASP C OD2 1 
ATOM   5752  N  N   . ARG C  3  295 ? -49.207 34.130  256.661  1.00 98.97  ? 373 ARG C N   1 
ATOM   5753  C  CA  . ARG C  3  295 ? -49.261 32.896  255.887  1.00 96.37  ? 373 ARG C CA  1 
ATOM   5754  C  C   . ARG C  3  295 ? -49.117 33.161  254.401  1.00 89.95  ? 373 ARG C C   1 
ATOM   5755  O  O   . ARG C  3  295 ? -49.380 32.285  253.579  1.00 85.09  ? 373 ARG C O   1 
ATOM   5756  C  CB  . ARG C  3  295 ? -50.567 32.141  256.162  1.00 99.65  ? 373 ARG C CB  1 
ATOM   5757  C  CG  . ARG C  3  295 ? -51.823 32.947  255.956  1.00 100.37 ? 373 ARG C CG  1 
ATOM   5758  C  CD  . ARG C  3  295 ? -53.018 32.199  256.498  1.00 104.52 ? 373 ARG C CD  1 
ATOM   5759  N  NE  . ARG C  3  295 ? -54.208 33.040  256.539  1.00 114.99 ? 373 ARG C NE  1 
ATOM   5760  C  CZ  . ARG C  3  295 ? -55.326 32.719  257.182  1.00 121.03 ? 373 ARG C CZ  1 
ATOM   5761  N  NH1 . ARG C  3  295 ? -55.409 31.570  257.841  1.00 118.69 ? 373 ARG C NH1 1 
ATOM   5762  N  NH2 . ARG C  3  295 ? -56.359 33.550  257.174  1.00 122.51 ? 373 ARG C NH2 1 
ATOM   5763  N  N   . TRP C  3  296 ? -48.691 34.373  254.066  1.00 91.35  ? 374 TRP C N   1 
ATOM   5764  C  CA  . TRP C  3  296 ? -48.498 34.756  252.679  1.00 97.13  ? 374 TRP C CA  1 
ATOM   5765  C  C   . TRP C  3  296 ? -47.094 35.295  252.445  1.00 94.62  ? 374 TRP C C   1 
ATOM   5766  O  O   . TRP C  3  296 ? -46.888 36.250  251.694  1.00 94.34  ? 374 TRP C O   1 
ATOM   5767  C  CB  . TRP C  3  296 ? -49.572 35.771  252.257  1.00 104.52 ? 374 TRP C CB  1 
ATOM   5768  C  CG  . TRP C  3  296 ? -50.822 35.082  251.778  1.00 112.05 ? 374 TRP C CG  1 
ATOM   5769  C  CD1 . TRP C  3  296 ? -50.979 34.393  250.603  1.00 117.19 ? 374 TRP C CD1 1 
ATOM   5770  C  CD2 . TRP C  3  296 ? -52.047 34.916  252.502  1.00 111.57 ? 374 TRP C CD2 1 
ATOM   5771  N  NE1 . TRP C  3  296 ? -52.220 33.803  250.556  1.00 114.55 ? 374 TRP C NE1 1 
ATOM   5772  C  CE2 . TRP C  3  296 ? -52.898 34.107  251.707  1.00 113.98 ? 374 TRP C CE2 1 
ATOM   5773  C  CE3 . TRP C  3  296 ? -52.509 35.367  253.744  1.00 110.62 ? 374 TRP C CE3 1 
ATOM   5774  C  CZ2 . TRP C  3  296 ? -54.186 33.740  252.117  1.00 113.98 ? 374 TRP C CZ2 1 
ATOM   5775  C  CZ3 . TRP C  3  296 ? -53.792 35.002  254.153  1.00 118.96 ? 374 TRP C CZ3 1 
ATOM   5776  C  CH2 . TRP C  3  296 ? -54.614 34.195  253.339  1.00 119.47 ? 374 TRP C CH2 1 
ATOM   5777  N  N   . TYR C  3  297 ? -46.132 34.652  253.101  1.00 93.38  ? 375 TYR C N   1 
ATOM   5778  C  CA  . TYR C  3  297 ? -44.723 35.004  252.986  1.00 101.53 ? 375 TYR C CA  1 
ATOM   5779  C  C   . TYR C  3  297 ? -43.911 33.710  252.976  1.00 104.28 ? 375 TYR C C   1 
ATOM   5780  O  O   . TYR C  3  297 ? -43.503 33.229  254.029  1.00 104.38 ? 375 TYR C O   1 
ATOM   5781  C  CB  . TYR C  3  297 ? -44.291 35.883  254.170  1.00 101.85 ? 375 TYR C CB  1 
ATOM   5782  C  CG  . TYR C  3  297 ? -42.830 36.320  254.135  1.00 106.50 ? 375 TYR C CG  1 
ATOM   5783  C  CD1 . TYR C  3  297 ? -42.298 36.957  253.011  1.00 100.69 ? 375 TYR C CD1 1 
ATOM   5784  C  CD2 . TYR C  3  297 ? -41.982 36.104  255.230  1.00 106.20 ? 375 TYR C CD2 1 
ATOM   5785  C  CE1 . TYR C  3  297 ? -40.967 37.368  252.968  1.00 93.53  ? 375 TYR C CE1 1 
ATOM   5786  C  CE2 . TYR C  3  297 ? -40.641 36.513  255.196  1.00 100.51 ? 375 TYR C CE2 1 
ATOM   5787  C  CZ  . TYR C  3  297 ? -40.146 37.143  254.056  1.00 95.91  ? 375 TYR C CZ  1 
ATOM   5788  O  OH  . TYR C  3  297 ? -38.833 37.545  253.978  1.00 93.47  ? 375 TYR C OH  1 
ATOM   5789  N  N   . SER C  3  298 ? -43.688 33.143  251.790  1.00 103.84 ? 376 SER C N   1 
ATOM   5790  C  CA  . SER C  3  298 ? -42.923 31.897  251.667  1.00 99.58  ? 376 SER C CA  1 
ATOM   5791  C  C   . SER C  3  298 ? -41.441 32.142  251.944  1.00 95.42  ? 376 SER C C   1 
ATOM   5792  O  O   . SER C  3  298 ? -40.820 33.004  251.315  1.00 92.64  ? 376 SER C O   1 
ATOM   5793  C  CB  . SER C  3  298 ? -43.094 31.295  250.268  1.00 100.64 ? 376 SER C CB  1 
ATOM   5794  O  OG  . SER C  3  298 ? -42.420 30.050  250.165  1.00 99.34  ? 376 SER C OG  1 
ATOM   5795  N  N   . LEU C  3  299 ? -40.882 31.370  252.874  1.00 86.17  ? 377 LEU C N   1 
ATOM   5796  C  CA  . LEU C  3  299 ? -39.482 31.507  253.269  1.00 80.42  ? 377 LEU C CA  1 
ATOM   5797  C  C   . LEU C  3  299 ? -38.478 31.170  252.179  1.00 82.07  ? 377 LEU C C   1 
ATOM   5798  O  O   . LEU C  3  299 ? -38.814 30.510  251.197  1.00 83.20  ? 377 LEU C O   1 
ATOM   5799  C  CB  . LEU C  3  299 ? -39.225 30.652  254.507  1.00 78.79  ? 377 LEU C CB  1 
ATOM   5800  C  CG  . LEU C  3  299 ? -39.973 31.218  255.714  1.00 75.68  ? 377 LEU C CG  1 
ATOM   5801  C  CD1 . LEU C  3  299 ? -40.112 30.204  256.833  1.00 66.23  ? 377 LEU C CD1 1 
ATOM   5802  C  CD2 . LEU C  3  299 ? -39.223 32.455  256.170  1.00 82.63  ? 377 LEU C CD2 1 
ATOM   5803  N  N   . LYS C  3  300 ? -37.243 31.635  252.360  1.00 83.63  ? 378 LYS C N   1 
ATOM   5804  C  CA  . LYS C  3  300 ? -36.165 31.404  251.392  1.00 81.96  ? 378 LYS C CA  1 
ATOM   5805  C  C   . LYS C  3  300 ? -35.432 30.086  251.664  1.00 77.58  ? 378 LYS C C   1 
ATOM   5806  O  O   . LYS C  3  300 ? -35.240 29.280  250.755  1.00 76.61  ? 378 LYS C O   1 
ATOM   5807  C  CB  . LYS C  3  300 ? -35.172 32.576  251.417  1.00 75.68  ? 378 LYS C CB  1 
ATOM   5808  C  CG  . LYS C  3  300 ? -34.064 32.471  250.388  1.00 74.82  ? 378 LYS C CG  1 
ATOM   5809  C  CD  . LYS C  3  300 ? -33.260 33.767  250.274  1.00 89.10  ? 378 LYS C CD  1 
ATOM   5810  C  CE  . LYS C  3  300 ? -32.539 34.116  251.572  1.00 97.44  ? 378 LYS C CE  1 
ATOM   5811  N  NZ  . LYS C  3  300 ? -31.721 35.362  251.457  1.00 102.53 ? 378 LYS C NZ  1 
ATOM   5812  N  N   . MET C  3  301 ? -35.018 29.876  252.912  1.00 71.56  ? 379 MET C N   1 
ATOM   5813  C  CA  . MET C  3  301 ? -34.339 28.646  253.295  1.00 57.48  ? 379 MET C CA  1 
ATOM   5814  C  C   . MET C  3  301 ? -35.105 27.962  254.401  1.00 50.02  ? 379 MET C C   1 
ATOM   5815  O  O   . MET C  3  301 ? -35.964 28.552  255.030  1.00 54.16  ? 379 MET C O   1 
ATOM   5816  C  CB  . MET C  3  301 ? -32.911 28.924  253.744  1.00 46.08  ? 379 MET C CB  1 
ATOM   5817  C  CG  . MET C  3  301 ? -31.962 29.164  252.587  1.00 69.11  ? 379 MET C CG  1 
ATOM   5818  S  SD  . MET C  3  301 ? -30.309 29.637  253.149  1.00 94.31  ? 379 MET C SD  1 
ATOM   5819  C  CE  . MET C  3  301 ? -30.180 31.290  252.486  1.00 74.52  ? 379 MET C CE  1 
ATOM   5820  N  N   . THR C  3  302 ? -34.793 26.701  254.630  1.00 55.98  ? 380 THR C N   1 
ATOM   5821  C  CA  . THR C  3  302 ? -35.478 25.934  255.649  1.00 63.50  ? 380 THR C CA  1 
ATOM   5822  C  C   . THR C  3  302 ? -34.679 24.679  255.946  1.00 71.78  ? 380 THR C C   1 
ATOM   5823  O  O   . THR C  3  302 ? -34.003 24.134  255.070  1.00 73.59  ? 380 THR C O   1 
ATOM   5824  C  CB  . THR C  3  302 ? -36.893 25.534  255.165  1.00 66.05  ? 380 THR C CB  1 
ATOM   5825  O  OG1 . THR C  3  302 ? -37.748 26.681  255.211  1.00 70.33  ? 380 THR C OG1 1 
ATOM   5826  C  CG2 . THR C  3  302 ? -37.479 24.424  256.019  1.00 67.74  ? 380 THR C CG2 1 
ATOM   5827  N  N   . THR C  3  303 ? -34.740 24.234  257.192  1.00 62.63  ? 381 THR C N   1 
ATOM   5828  C  CA  . THR C  3  303 ? -34.049 23.028  257.581  1.00 58.49  ? 381 THR C CA  1 
ATOM   5829  C  C   . THR C  3  303 ? -34.613 22.497  258.883  1.00 53.08  ? 381 THR C C   1 
ATOM   5830  O  O   . THR C  3  303 ? -34.878 23.251  259.811  1.00 54.38  ? 381 THR C O   1 
ATOM   5831  C  CB  . THR C  3  303 ? -32.514 23.255  257.689  1.00 61.22  ? 381 THR C CB  1 
ATOM   5832  O  OG1 . THR C  3  303 ? -31.987 22.436  258.739  1.00 76.93  ? 381 THR C OG1 1 
ATOM   5833  C  CG2 . THR C  3  303 ? -32.183 24.709  257.934  1.00 61.10  ? 381 THR C CG2 1 
ATOM   5834  N  N   . MET C  3  304 ? -34.839 21.194  258.924  1.00 42.67  ? 382 MET C N   1 
ATOM   5835  C  CA  . MET C  3  304 ? -35.365 20.556  260.118  1.00 61.29  ? 382 MET C CA  1 
ATOM   5836  C  C   . MET C  3  304 ? -34.325 19.554  260.587  1.00 66.19  ? 382 MET C C   1 
ATOM   5837  O  O   . MET C  3  304 ? -34.252 18.446  260.061  1.00 73.04  ? 382 MET C O   1 
ATOM   5838  C  CB  . MET C  3  304 ? -36.670 19.829  259.807  1.00 57.44  ? 382 MET C CB  1 
ATOM   5839  C  CG  . MET C  3  304 ? -37.808 20.735  259.429  1.00 59.23  ? 382 MET C CG  1 
ATOM   5840  S  SD  . MET C  3  304 ? -39.284 19.787  259.048  1.00 58.66  ? 382 MET C SD  1 
ATOM   5841  C  CE  . MET C  3  304 ? -39.655 19.089  260.594  1.00 53.29  ? 382 MET C CE  1 
ATOM   5842  N  N   . LYS C  3  305 ? -33.519 19.941  261.570  1.00 64.84  ? 383 LYS C N   1 
ATOM   5843  C  CA  . LYS C  3  305 ? -32.471 19.066  262.075  1.00 60.26  ? 383 LYS C CA  1 
ATOM   5844  C  C   . LYS C  3  305 ? -32.833 18.424  263.396  1.00 58.28  ? 383 LYS C C   1 
ATOM   5845  O  O   . LYS C  3  305 ? -33.606 18.974  264.170  1.00 68.25  ? 383 LYS C O   1 
ATOM   5846  C  CB  . LYS C  3  305 ? -31.153 19.839  262.217  1.00 46.83  ? 383 LYS C CB  1 
ATOM   5847  C  CG  . LYS C  3  305 ? -31.254 21.103  263.040  1.00 56.78  ? 383 LYS C CG  1 
ATOM   5848  C  CD  . LYS C  3  305 ? -30.758 22.318  262.257  1.00 59.12  ? 383 LYS C CD  1 
ATOM   5849  C  CE  . LYS C  3  305 ? -29.261 22.547  262.388  1.00 49.37  ? 383 LYS C CE  1 
ATOM   5850  N  NZ  . LYS C  3  305 ? -28.917 23.074  263.732  1.00 55.80  ? 383 LYS C NZ  1 
ATOM   5851  N  N   . LEU C  3  306 ? -32.271 17.246  263.636  1.00 58.24  ? 384 LEU C N   1 
ATOM   5852  C  CA  . LEU C  3  306 ? -32.500 16.505  264.862  1.00 54.09  ? 384 LEU C CA  1 
ATOM   5853  C  C   . LEU C  3  306 ? -31.205 16.373  265.648  1.00 62.39  ? 384 LEU C C   1 
ATOM   5854  O  O   . LEU C  3  306 ? -30.133 16.207  265.065  1.00 61.61  ? 384 LEU C O   1 
ATOM   5855  C  CB  . LEU C  3  306 ? -33.030 15.118  264.534  1.00 50.98  ? 384 LEU C CB  1 
ATOM   5856  C  CG  . LEU C  3  306 ? -34.532 14.899  264.689  1.00 62.31  ? 384 LEU C CG  1 
ATOM   5857  C  CD1 . LEU C  3  306 ? -35.287 16.123  264.203  1.00 47.14  ? 384 LEU C CD1 1 
ATOM   5858  C  CD2 . LEU C  3  306 ? -34.940 13.638  263.918  1.00 59.98  ? 384 LEU C CD2 1 
ATOM   5859  N  N   . LEU C  3  307 ? -31.313 16.451  266.974  1.00 75.23  ? 385 LEU C N   1 
ATOM   5860  C  CA  . LEU C  3  307 ? -30.162 16.322  267.869  1.00 72.76  ? 385 LEU C CA  1 
ATOM   5861  C  C   . LEU C  3  307 ? -30.597 15.571  269.122  1.00 73.12  ? 385 LEU C C   1 
ATOM   5862  O  O   . LEU C  3  307 ? -31.696 15.792  269.628  1.00 76.31  ? 385 LEU C O   1 
ATOM   5863  C  CB  . LEU C  3  307 ? -29.629 17.699  268.252  1.00 69.63  ? 385 LEU C CB  1 
ATOM   5864  C  CG  . LEU C  3  307 ? -28.170 17.757  268.711  1.00 74.97  ? 385 LEU C CG  1 
ATOM   5865  C  CD1 . LEU C  3  307 ? -27.736 19.196  268.784  1.00 69.12  ? 385 LEU C CD1 1 
ATOM   5866  C  CD2 . LEU C  3  307 ? -28.002 17.090  270.057  1.00 70.07  ? 385 LEU C CD2 1 
ATOM   5867  N  N   . PRO C  3  308 ? -29.751 14.659  269.634  1.00 74.71  ? 386 PRO C N   1 
ATOM   5868  C  CA  . PRO C  3  308 ? -30.149 13.923  270.836  1.00 72.49  ? 386 PRO C CA  1 
ATOM   5869  C  C   . PRO C  3  308 ? -30.564 14.858  271.961  1.00 69.38  ? 386 PRO C C   1 
ATOM   5870  O  O   . PRO C  3  308 ? -29.831 15.769  272.331  1.00 68.97  ? 386 PRO C O   1 
ATOM   5871  C  CB  . PRO C  3  308 ? -28.903 13.117  271.174  1.00 69.21  ? 386 PRO C CB  1 
ATOM   5872  C  CG  . PRO C  3  308 ? -28.343 12.817  269.827  1.00 76.98  ? 386 PRO C CG  1 
ATOM   5873  C  CD  . PRO C  3  308 ? -28.461 14.161  269.126  1.00 74.67  ? 386 PRO C CD  1 
ATOM   5874  N  N   . MET C  3  309 ? -31.760 14.632  272.482  1.00 75.48  ? 387 MET C N   1 
ATOM   5875  C  CA  . MET C  3  309 ? -32.295 15.436  273.567  1.00 78.60  ? 387 MET C CA  1 
ATOM   5876  C  C   . MET C  3  309 ? -31.206 15.610  274.631  1.00 82.01  ? 387 MET C C   1 
ATOM   5877  O  O   . MET C  3  309 ? -31.054 16.692  275.213  1.00 78.80  ? 387 MET C O   1 
ATOM   5878  C  CB  . MET C  3  309 ? -33.516 14.730  274.166  1.00 74.08  ? 387 MET C CB  1 
ATOM   5879  C  CG  . MET C  3  309 ? -34.481 15.634  274.900  1.00 77.24  ? 387 MET C CG  1 
ATOM   5880  S  SD  . MET C  3  309 ? -35.347 16.771  273.812  1.00 74.96  ? 387 MET C SD  1 
ATOM   5881  C  CE  . MET C  3  309 ? -34.322 18.226  273.955  1.00 65.19  ? 387 MET C CE  1 
ATOM   5882  N  N   . GLY C  3  310 ? -30.440 14.542  274.861  1.00 79.93  ? 388 GLY C N   1 
ATOM   5883  C  CA  . GLY C  3  310 ? -29.376 14.582  275.853  1.00 75.13  ? 388 GLY C CA  1 
ATOM   5884  C  C   . GLY C  3  310 ? -28.132 15.349  275.437  1.00 71.72  ? 388 GLY C C   1 
ATOM   5885  O  O   . GLY C  3  310 ? -27.069 14.760  275.291  1.00 72.25  ? 388 GLY C O   1 
ATOM   5886  N  N   . ARG C  3  311 ? -28.260 16.663  275.259  1.00 68.89  ? 389 ARG C N   1 
ATOM   5887  C  CA  . ARG C  3  311 ? -27.143 17.522  274.856  1.00 78.07  ? 389 ARG C CA  1 
ATOM   5888  C  C   . ARG C  3  311 ? -27.499 18.990  275.151  1.00 93.42  ? 389 ARG C C   1 
ATOM   5889  O  O   . ARG C  3  311 ? -28.602 19.279  275.609  1.00 100.33 ? 389 ARG C O   1 
ATOM   5890  C  CB  . ARG C  3  311 ? -26.906 17.413  273.346  1.00 70.20  ? 389 ARG C CB  1 
ATOM   5891  C  CG  . ARG C  3  311 ? -26.548 16.044  272.798  1.00 78.47  ? 389 ARG C CG  1 
ATOM   5892  C  CD  . ARG C  3  311 ? -25.079 15.723  273.001  1.00 83.91  ? 389 ARG C CD  1 
ATOM   5893  N  NE  . ARG C  3  311 ? -24.214 16.815  272.555  1.00 82.55  ? 389 ARG C NE  1 
ATOM   5894  C  CZ  . ARG C  3  311 ? -22.888 16.812  272.667  1.00 77.99  ? 389 ARG C CZ  1 
ATOM   5895  N  NH1 . ARG C  3  311 ? -22.262 15.769  273.208  1.00 78.85  ? 389 ARG C NH1 1 
ATOM   5896  N  NH2 . ARG C  3  311 ? -22.192 17.864  272.259  1.00 63.84  ? 389 ARG C NH2 1 
ATOM   5897  N  N   . ASP C  3  312 ? -26.567 19.908  274.882  1.00 102.60 ? 390 ASP C N   1 
ATOM   5898  C  CA  . ASP C  3  312 ? -26.792 21.362  275.017  1.00 110.39 ? 390 ASP C CA  1 
ATOM   5899  C  C   . ASP C  3  312 ? -26.589 22.159  276.313  1.00 111.70 ? 390 ASP C C   1 
ATOM   5900  O  O   . ASP C  3  312 ? -26.375 21.611  277.393  1.00 110.02 ? 390 ASP C O   1 
ATOM   5901  C  CB  . ASP C  3  312 ? -28.187 21.710  274.472  1.00 118.93 ? 390 ASP C CB  1 
ATOM   5902  C  CG  . ASP C  3  312 ? -28.479 23.202  274.518  1.00 128.32 ? 390 ASP C CG  1 
ATOM   5903  O  OD1 . ASP C  3  312 ? -27.766 23.969  273.836  1.00 132.39 ? 390 ASP C OD1 1 
ATOM   5904  O  OD2 . ASP C  3  312 ? -29.411 23.609  275.246  1.00 128.88 ? 390 ASP C OD2 1 
ATOM   5905  N  N   . LEU C  3  313 ? -26.670 23.482  276.138  1.00 119.51 ? 391 LEU C N   1 
ATOM   5906  C  CA  . LEU C  3  313 ? -26.542 24.524  277.163  1.00 131.95 ? 391 LEU C CA  1 
ATOM   5907  C  C   . LEU C  3  313 ? -25.535 24.350  278.295  1.00 135.33 ? 391 LEU C C   1 
ATOM   5908  O  O   . LEU C  3  313 ? -24.813 23.354  278.365  1.00 133.40 ? 391 LEU C O   1 
ATOM   5909  C  CB  . LEU C  3  313 ? -27.920 24.860  277.759  1.00 134.21 ? 391 LEU C CB  1 
ATOM   5910  C  CG  . LEU C  3  313 ? -28.786 25.888  277.013  1.00 130.25 ? 391 LEU C CG  1 
ATOM   5911  C  CD1 . LEU C  3  313 ? -30.082 26.121  277.782  1.00 122.63 ? 391 LEU C CD1 1 
ATOM   5912  C  CD2 . LEU C  3  313 ? -28.022 27.198  276.861  1.00 118.04 ? 391 LEU C CD2 1 
ATOM   5913  N  N   . SER C  3  314 ? -25.499 25.349  279.176  1.00 139.76 ? 392 SER C N   1 
ATOM   5914  C  CA  . SER C  3  314 ? -24.580 25.363  280.308  1.00 142.60 ? 392 SER C CA  1 
ATOM   5915  C  C   . SER C  3  314 ? -25.243 25.755  281.628  1.00 143.78 ? 392 SER C C   1 
ATOM   5916  O  O   . SER C  3  314 ? -26.442 26.039  281.682  1.00 139.13 ? 392 SER C O   1 
ATOM   5917  C  CB  . SER C  3  314 ? -23.421 26.324  280.018  1.00 143.39 ? 392 SER C CB  1 
ATOM   5918  O  OG  . SER C  3  314 ? -23.894 27.630  279.728  1.00 138.97 ? 392 SER C OG  1 
ATOM   5919  N  N   . GLY C  3  315 ? -24.437 25.766  282.687  1.00 146.33 ? 393 GLY C N   1 
ATOM   5920  C  CA  . GLY C  3  315 ? -24.919 26.123  284.010  1.00 148.47 ? 393 GLY C CA  1 
ATOM   5921  C  C   . GLY C  3  315 ? -23.807 26.692  284.879  1.00 151.26 ? 393 GLY C C   1 
ATOM   5922  O  O   . GLY C  3  315 ? -22.674 26.846  284.420  1.00 149.50 ? 393 GLY C O   1 
ATOM   5923  N  N   . HIS C  3  316 ? -24.128 26.997  286.136  1.00 154.93 ? 394 HIS C N   1 
ATOM   5924  C  CA  . HIS C  3  316 ? -23.157 27.560  287.074  1.00 154.69 ? 394 HIS C CA  1 
ATOM   5925  C  C   . HIS C  3  316 ? -23.746 27.700  288.481  1.00 153.74 ? 394 HIS C C   1 
ATOM   5926  O  O   . HIS C  3  316 ? -23.196 28.408  289.326  1.00 153.50 ? 394 HIS C O   1 
ATOM   5927  C  CB  . HIS C  3  316 ? -22.699 28.933  286.579  1.00 157.21 ? 394 HIS C CB  1 
ATOM   5928  C  CG  . HIS C  3  316 ? -23.830 29.847  286.221  1.00 162.59 ? 394 HIS C CG  1 
ATOM   5929  N  ND1 . HIS C  3  316 ? -24.708 29.576  285.194  1.00 163.69 ? 394 HIS C ND1 1 
ATOM   5930  C  CD2 . HIS C  3  316 ? -24.244 31.013  286.771  1.00 164.14 ? 394 HIS C CD2 1 
ATOM   5931  C  CE1 . HIS C  3  316 ? -25.614 30.534  285.126  1.00 164.30 ? 394 HIS C CE1 1 
ATOM   5932  N  NE2 . HIS C  3  316 ? -25.356 31.418  286.073  1.00 167.03 ? 394 HIS C NE2 1 
ATOM   5933  N  N   . GLY C  3  317 ? -24.863 27.019  288.724  1.00 151.68 ? 395 GLY C N   1 
ATOM   5934  C  CA  . GLY C  3  317 ? -25.514 27.089  290.021  1.00 150.89 ? 395 GLY C CA  1 
ATOM   5935  C  C   . GLY C  3  317 ? -24.635 26.725  291.202  1.00 151.51 ? 395 GLY C C   1 
ATOM   5936  O  O   . GLY C  3  317 ? -24.323 25.553  291.417  1.00 149.58 ? 395 GLY C O   1 
ATOM   5937  N  N   . GLY C  3  318 ? -24.236 27.734  291.972  1.00 152.94 ? 396 GLY C N   1 
ATOM   5938  C  CA  . GLY C  3  318 ? -23.404 27.498  293.137  1.00 158.62 ? 396 GLY C CA  1 
ATOM   5939  C  C   . GLY C  3  318 ? -24.209 26.910  294.282  1.00 163.81 ? 396 GLY C C   1 
ATOM   5940  O  O   . GLY C  3  318 ? -25.424 26.737  294.171  1.00 164.27 ? 396 GLY C O   1 
ATOM   5941  N  N   . GLN C  3  319 ? -23.533 26.605  295.387  1.00 168.97 ? 397 GLN C N   1 
ATOM   5942  C  CA  . GLN C  3  319 ? -24.180 26.024  296.566  1.00 171.90 ? 397 GLN C CA  1 
ATOM   5943  C  C   . GLN C  3  319 ? -25.335 26.891  297.078  1.00 173.48 ? 397 GLN C C   1 
ATOM   5944  O  O   . GLN C  3  319 ? -26.501 26.617  296.785  1.00 170.94 ? 397 GLN C O   1 
ATOM   5945  C  CB  . GLN C  3  319 ? -23.151 25.834  297.689  1.00 172.38 ? 397 GLN C CB  1 
ATOM   5946  C  CG  . GLN C  3  319 ? -21.900 25.055  297.288  1.00 169.47 ? 397 GLN C CG  1 
ATOM   5947  C  CD  . GLN C  3  319 ? -22.190 23.611  296.930  1.00 166.25 ? 397 GLN C CD  1 
ATOM   5948  O  OE1 . GLN C  3  319 ? -22.685 22.842  297.755  1.00 159.70 ? 397 GLN C OE1 1 
ATOM   5949  N  NE2 . GLN C  3  319 ? -21.878 23.233  295.693  1.00 163.74 ? 397 GLN C NE2 1 
ATOM   5950  N  N   . GLN C  3  320 ? -24.988 27.923  297.850  1.00 176.02 ? 398 GLN C N   1 
ATOM   5951  C  CA  . GLN C  3  320 ? -25.936 28.876  298.440  1.00 178.68 ? 398 GLN C CA  1 
ATOM   5952  C  C   . GLN C  3  320 ? -26.393 28.507  299.854  1.00 178.52 ? 398 GLN C C   1 
ATOM   5953  O  O   . GLN C  3  320 ? -27.331 27.728  300.034  1.00 182.28 ? 398 GLN C O   1 
ATOM   5954  C  CB  . GLN C  3  320 ? -27.163 29.064  297.534  1.00 181.01 ? 398 GLN C CB  1 
ATOM   5955  C  CG  . GLN C  3  320 ? -28.241 29.996  298.095  1.00 183.40 ? 398 GLN C CG  1 
ATOM   5956  C  CD  . GLN C  3  320 ? -27.731 31.401  298.383  1.00 183.15 ? 398 GLN C CD  1 
ATOM   5957  O  OE1 . GLN C  3  320 ? -27.137 32.050  297.521  1.00 184.42 ? 398 GLN C OE1 1 
ATOM   5958  N  NE2 . GLN C  3  320 ? -27.971 31.879  299.599  1.00 181.14 ? 398 GLN C NE2 1 
ATOM   5959  N  N   . GLN C  3  321 ? -25.720 29.084  300.849  1.00 175.00 ? 399 GLN C N   1 
ATOM   5960  C  CA  . GLN C  3  321 ? -26.024 28.860  302.262  1.00 169.76 ? 399 GLN C CA  1 
ATOM   5961  C  C   . GLN C  3  321 ? -25.978 27.391  302.677  1.00 167.99 ? 399 GLN C C   1 
ATOM   5962  O  O   . GLN C  3  321 ? -25.067 27.039  303.454  1.00 167.59 ? 399 GLN C O   1 
ATOM   5963  C  CB  . GLN C  3  321 ? -27.398 29.455  302.601  1.00 170.61 ? 399 GLN C CB  1 
ATOM   5964  C  CG  . GLN C  3  321 ? -27.475 30.975  302.449  1.00 167.92 ? 399 GLN C CG  1 
ATOM   5965  C  CD  . GLN C  3  321 ? -28.861 31.534  302.740  1.00 167.65 ? 399 GLN C CD  1 
ATOM   5966  O  OE1 . GLN C  3  321 ? -29.843 31.143  302.109  1.00 168.63 ? 399 GLN C OE1 1 
ATOM   5967  N  NE2 . GLN C  3  321 ? -28.942 32.457  303.695  1.00 158.35 ? 399 GLN C NE2 1 
ATOM   5968  N  N   . ASN D  1  14  ? 16.935  28.808  20.548   1.00 139.86 ? 95  ASN D N   1 
ATOM   5969  C  CA  . ASN D  1  14  ? 17.729  28.849  19.291   1.00 135.83 ? 95  ASN D CA  1 
ATOM   5970  C  C   . ASN D  1  14  ? 17.473  30.140  18.522   1.00 136.30 ? 95  ASN D C   1 
ATOM   5971  O  O   . ASN D  1  14  ? 17.890  30.281  17.374   1.00 139.39 ? 95  ASN D O   1 
ATOM   5972  C  CB  . ASN D  1  14  ? 17.389  27.639  18.409   1.00 136.40 ? 95  ASN D CB  1 
ATOM   5973  C  CG  . ASN D  1  14  ? 15.910  27.547  18.076   1.00 136.66 ? 95  ASN D CG  1 
ATOM   5974  O  OD1 . ASN D  1  14  ? 15.320  28.489  17.548   1.00 138.40 ? 95  ASN D OD1 1 
ATOM   5975  N  ND2 . ASN D  1  14  ? 15.305  26.401  18.377   1.00 135.78 ? 95  ASN D ND2 1 
ATOM   5976  N  N   . GLU D  1  15  ? 16.787  31.081  19.162   1.00 136.77 ? 96  GLU D N   1 
ATOM   5977  C  CA  . GLU D  1  15  ? 16.479  32.360  18.537   1.00 136.60 ? 96  GLU D CA  1 
ATOM   5978  C  C   . GLU D  1  15  ? 17.648  32.838  17.689   1.00 135.93 ? 96  GLU D C   1 
ATOM   5979  O  O   . GLU D  1  15  ? 17.468  33.243  16.538   1.00 134.87 ? 96  GLU D O   1 
ATOM   5980  C  CB  . GLU D  1  15  ? 16.162  33.410  19.607   1.00 138.80 ? 96  GLU D CB  1 
ATOM   5981  C  CG  . GLU D  1  15  ? 14.846  33.182  20.336   1.00 145.96 ? 96  GLU D CG  1 
ATOM   5982  C  CD  . GLU D  1  15  ? 13.646  33.235  19.403   1.00 149.88 ? 96  GLU D CD  1 
ATOM   5983  O  OE1 . GLU D  1  15  ? 13.426  34.293  18.775   1.00 152.39 ? 96  GLU D OE1 1 
ATOM   5984  O  OE2 . GLU D  1  15  ? 12.923  32.220  19.295   1.00 146.70 ? 96  GLU D OE2 1 
ATOM   5985  N  N   . LEU D  1  16  ? 18.848  32.764  18.261   1.00 135.68 ? 97  LEU D N   1 
ATOM   5986  C  CA  . LEU D  1  16  ? 20.051  33.213  17.571   1.00 130.45 ? 97  LEU D CA  1 
ATOM   5987  C  C   . LEU D  1  16  ? 21.095  32.132  17.326   1.00 126.41 ? 97  LEU D C   1 
ATOM   5988  O  O   . LEU D  1  16  ? 22.268  32.436  17.132   1.00 125.44 ? 97  LEU D O   1 
ATOM   5989  C  CB  . LEU D  1  16  ? 20.698  34.362  18.344   1.00 129.17 ? 97  LEU D CB  1 
ATOM   5990  C  CG  . LEU D  1  16  ? 21.703  35.218  17.575   1.00 126.74 ? 97  LEU D CG  1 
ATOM   5991  C  CD1 . LEU D  1  16  ? 20.996  35.986  16.461   1.00 121.93 ? 97  LEU D CD1 1 
ATOM   5992  C  CD2 . LEU D  1  16  ? 22.370  36.175  18.536   1.00 123.05 ? 97  LEU D CD2 1 
ATOM   5993  N  N   . GLU D  1  17  ? 20.686  30.871  17.355   1.00 123.88 ? 98  GLU D N   1 
ATOM   5994  C  CA  . GLU D  1  17  ? 21.626  29.798  17.081   1.00 123.61 ? 98  GLU D CA  1 
ATOM   5995  C  C   . GLU D  1  17  ? 21.244  29.288  15.702   1.00 124.28 ? 98  GLU D C   1 
ATOM   5996  O  O   . GLU D  1  17  ? 22.088  28.814  14.944   1.00 128.11 ? 98  GLU D O   1 
ATOM   5997  C  CB  . GLU D  1  17  ? 21.513  28.681  18.125   1.00 124.76 ? 98  GLU D CB  1 
ATOM   5998  C  CG  . GLU D  1  17  ? 20.545  27.540  17.797   1.00 129.01 ? 98  GLU D CG  1 
ATOM   5999  C  CD  . GLU D  1  17  ? 21.074  26.560  16.749   1.00 128.93 ? 98  GLU D CD  1 
ATOM   6000  O  OE1 . GLU D  1  17  ? 20.826  26.770  15.545   1.00 131.38 ? 98  GLU D OE1 1 
ATOM   6001  O  OE2 . GLU D  1  17  ? 21.743  25.575  17.130   1.00 126.67 ? 98  GLU D OE2 1 
ATOM   6002  N  N   . VAL D  1  18  ? 19.956  29.404  15.390   1.00 126.62 ? 99  VAL D N   1 
ATOM   6003  C  CA  . VAL D  1  18  ? 19.400  28.973  14.110   1.00 126.51 ? 99  VAL D CA  1 
ATOM   6004  C  C   . VAL D  1  18  ? 20.159  29.587  12.942   1.00 125.06 ? 99  VAL D C   1 
ATOM   6005  O  O   . VAL D  1  18  ? 20.805  28.883  12.165   1.00 124.33 ? 99  VAL D O   1 
ATOM   6006  C  CB  . VAL D  1  18  ? 17.912  29.376  13.989   1.00 129.68 ? 99  VAL D CB  1 
ATOM   6007  C  CG1 . VAL D  1  18  ? 17.384  29.031  12.609   1.00 133.37 ? 99  VAL D CG1 1 
ATOM   6008  C  CG2 . VAL D  1  18  ? 17.098  28.666  15.050   1.00 133.66 ? 99  VAL D CG2 1 
ATOM   6009  N  N   . ARG D  1  19  ? 20.070  30.906  12.823   1.00 122.13 ? 100 ARG D N   1 
ATOM   6010  C  CA  . ARG D  1  19  ? 20.742  31.623  11.752   1.00 118.70 ? 100 ARG D CA  1 
ATOM   6011  C  C   . ARG D  1  19  ? 22.204  31.195  11.671   1.00 116.95 ? 100 ARG D C   1 
ATOM   6012  O  O   . ARG D  1  19  ? 22.618  30.564  10.701   1.00 121.83 ? 100 ARG D O   1 
ATOM   6013  C  CB  . ARG D  1  19  ? 20.669  33.125  12.006   1.00 116.11 ? 100 ARG D CB  1 
ATOM   6014  C  CG  . ARG D  1  19  ? 19.346  33.599  12.555   1.00 107.87 ? 100 ARG D CG  1 
ATOM   6015  C  CD  . ARG D  1  19  ? 19.413  35.083  12.797   1.00 113.66 ? 100 ARG D CD  1 
ATOM   6016  N  NE  . ARG D  1  19  ? 18.306  35.563  13.612   1.00 117.12 ? 100 ARG D NE  1 
ATOM   6017  C  CZ  . ARG D  1  19  ? 18.131  36.838  13.945   1.00 116.88 ? 100 ARG D CZ  1 
ATOM   6018  N  NH1 . ARG D  1  19  ? 18.991  37.762  13.528   1.00 102.55 ? 100 ARG D NH1 1 
ATOM   6019  N  NH2 . ARG D  1  19  ? 17.100  37.187  14.701   1.00 122.01 ? 100 ARG D NH2 1 
ATOM   6020  N  N   . TYR D  1  20  ? 22.976  31.537  12.697   1.00 112.16 ? 101 TYR D N   1 
ATOM   6021  C  CA  . TYR D  1  20  ? 24.394  31.199  12.749   1.00 109.95 ? 101 TYR D CA  1 
ATOM   6022  C  C   . TYR D  1  20  ? 24.718  29.814  12.211   1.00 112.99 ? 101 TYR D C   1 
ATOM   6023  O  O   . TYR D  1  20  ? 25.289  29.680  11.131   1.00 117.93 ? 101 TYR D O   1 
ATOM   6024  C  CB  . TYR D  1  20  ? 24.914  31.283  14.178   1.00 104.56 ? 101 TYR D CB  1 
ATOM   6025  C  CG  . TYR D  1  20  ? 26.365  30.878  14.306   1.00 98.69  ? 101 TYR D CG  1 
ATOM   6026  C  CD1 . TYR D  1  20  ? 27.384  31.758  13.951   1.00 94.41  ? 101 TYR D CD1 1 
ATOM   6027  C  CD2 . TYR D  1  20  ? 26.721  29.611  14.780   1.00 93.81  ? 101 TYR D CD2 1 
ATOM   6028  C  CE1 . TYR D  1  20  ? 28.725  31.396  14.066   1.00 98.20  ? 101 TYR D CE1 1 
ATOM   6029  C  CE2 . TYR D  1  20  ? 28.059  29.235  14.897   1.00 93.81  ? 101 TYR D CE2 1 
ATOM   6030  C  CZ  . TYR D  1  20  ? 29.057  30.136  14.539   1.00 95.85  ? 101 TYR D CZ  1 
ATOM   6031  O  OH  . TYR D  1  20  ? 30.385  29.789  14.661   1.00 92.00  ? 101 TYR D OH  1 
ATOM   6032  N  N   . SER D  1  21  ? 24.362  28.784  12.972   1.00 114.26 ? 102 SER D N   1 
ATOM   6033  C  CA  . SER D  1  21  ? 24.646  27.412  12.571   1.00 118.67 ? 102 SER D CA  1 
ATOM   6034  C  C   . SER D  1  21  ? 24.231  27.044  11.150   1.00 119.79 ? 102 SER D C   1 
ATOM   6035  O  O   . SER D  1  21  ? 24.881  26.212  10.517   1.00 122.04 ? 102 SER D O   1 
ATOM   6036  C  CB  . SER D  1  21  ? 24.031  26.426  13.567   1.00 118.45 ? 102 SER D CB  1 
ATOM   6037  O  OG  . SER D  1  21  ? 24.813  26.359  14.751   1.00 116.21 ? 102 SER D OG  1 
ATOM   6038  N  N   . GLU D  1  22  ? 23.163  27.648  10.638   1.00 119.01 ? 103 GLU D N   1 
ATOM   6039  C  CA  . GLU D  1  22  ? 22.751  27.332  9.276    1.00 118.79 ? 103 GLU D CA  1 
ATOM   6040  C  C   . GLU D  1  22  ? 23.551  28.159  8.273    1.00 114.89 ? 103 GLU D C   1 
ATOM   6041  O  O   . GLU D  1  22  ? 23.722  27.755  7.126    1.00 118.22 ? 103 GLU D O   1 
ATOM   6042  C  CB  . GLU D  1  22  ? 21.256  27.569  9.075    1.00 125.16 ? 103 GLU D CB  1 
ATOM   6043  C  CG  . GLU D  1  22  ? 20.847  29.017  8.983    1.00 129.26 ? 103 GLU D CG  1 
ATOM   6044  C  CD  . GLU D  1  22  ? 19.462  29.169  8.403    1.00 131.65 ? 103 GLU D CD  1 
ATOM   6045  O  OE1 . GLU D  1  22  ? 19.285  28.878  7.200    1.00 131.55 ? 103 GLU D OE1 1 
ATOM   6046  O  OE2 . GLU D  1  22  ? 18.549  29.570  9.153    1.00 135.41 ? 103 GLU D OE2 1 
ATOM   6047  N  N   . VAL D  1  23  ? 24.029  29.323  8.700    1.00 110.01 ? 104 VAL D N   1 
ATOM   6048  C  CA  . VAL D  1  23  ? 24.849  30.160  7.832    1.00 108.89 ? 104 VAL D CA  1 
ATOM   6049  C  C   . VAL D  1  23  ? 26.192  29.443  7.755    1.00 109.56 ? 104 VAL D C   1 
ATOM   6050  O  O   . VAL D  1  23  ? 26.973  29.649  6.826    1.00 106.92 ? 104 VAL D O   1 
ATOM   6051  C  CB  . VAL D  1  23  ? 25.064  31.580  8.424    1.00 106.63 ? 104 VAL D CB  1 
ATOM   6052  C  CG1 . VAL D  1  23  ? 26.166  32.308  7.665    1.00 101.80 ? 104 VAL D CG1 1 
ATOM   6053  C  CG2 . VAL D  1  23  ? 23.773  32.378  8.344    1.00 100.16 ? 104 VAL D CG2 1 
ATOM   6054  N  N   . LEU D  1  24  ? 26.437  28.586  8.744    1.00 110.82 ? 105 LEU D N   1 
ATOM   6055  C  CA  . LEU D  1  24  ? 27.668  27.812  8.819    1.00 111.61 ? 105 LEU D CA  1 
ATOM   6056  C  C   . LEU D  1  24  ? 27.555  26.608  7.887    1.00 113.77 ? 105 LEU D C   1 
ATOM   6057  O  O   . LEU D  1  24  ? 28.517  26.250  7.210    1.00 117.59 ? 105 LEU D O   1 
ATOM   6058  C  CB  . LEU D  1  24  ? 27.916  27.346  10.257   1.00 106.01 ? 105 LEU D CB  1 
ATOM   6059  C  CG  . LEU D  1  24  ? 29.386  27.334  10.691   1.00 108.30 ? 105 LEU D CG  1 
ATOM   6060  C  CD1 . LEU D  1  24  ? 29.911  28.765  10.705   1.00 95.60  ? 105 LEU D CD1 1 
ATOM   6061  C  CD2 . LEU D  1  24  ? 29.534  26.702  12.068   1.00 100.75 ? 105 LEU D CD2 1 
ATOM   6062  N  N   . ARG D  1  25  ? 26.380  25.983  7.855    1.00 116.26 ? 106 ARG D N   1 
ATOM   6063  C  CA  . ARG D  1  25  ? 26.153  24.842  6.970    1.00 117.39 ? 106 ARG D CA  1 
ATOM   6064  C  C   . ARG D  1  25  ? 25.737  25.396  5.611    1.00 114.15 ? 106 ARG D C   1 
ATOM   6065  O  O   . ARG D  1  25  ? 25.153  24.695  4.779    1.00 108.43 ? 106 ARG D O   1 
ATOM   6066  C  CB  . ARG D  1  25  ? 25.055  23.924  7.516    1.00 127.32 ? 106 ARG D CB  1 
ATOM   6067  C  CG  . ARG D  1  25  ? 23.671  24.552  7.583    1.00 140.22 ? 106 ARG D CG  1 
ATOM   6068  C  CD  . ARG D  1  25  ? 22.614  23.514  7.945    1.00 149.14 ? 106 ARG D CD  1 
ATOM   6069  N  NE  . ARG D  1  25  ? 22.946  22.789  9.171    1.00 158.98 ? 106 ARG D NE  1 
ATOM   6070  C  CZ  . ARG D  1  25  ? 23.008  23.341  10.380   1.00 163.57 ? 106 ARG D CZ  1 
ATOM   6071  N  NH1 . ARG D  1  25  ? 22.759  24.633  10.539   1.00 164.69 ? 106 ARG D NH1 1 
ATOM   6072  N  NH2 . ARG D  1  25  ? 23.322  22.598  11.434   1.00 166.30 ? 106 ARG D NH2 1 
ATOM   6073  N  N   . GLU D  1  26  ? 26.034  26.679  5.418    1.00 114.55 ? 107 GLU D N   1 
ATOM   6074  C  CA  . GLU D  1  26  ? 25.745  27.389  4.179    1.00 111.16 ? 107 GLU D CA  1 
ATOM   6075  C  C   . GLU D  1  26  ? 27.081  27.804  3.577    1.00 107.99 ? 107 GLU D C   1 
ATOM   6076  O  O   . GLU D  1  26  ? 27.147  28.307  2.456    1.00 105.32 ? 107 GLU D O   1 
ATOM   6077  C  CB  . GLU D  1  26  ? 24.882  28.623  4.449    1.00 110.61 ? 107 GLU D CB  1 
ATOM   6078  C  CG  . GLU D  1  26  ? 24.681  29.515  3.237    1.00 110.17 ? 107 GLU D CG  1 
ATOM   6079  C  CD  . GLU D  1  26  ? 24.098  28.776  2.047    1.00 115.42 ? 107 GLU D CD  1 
ATOM   6080  O  OE1 . GLU D  1  26  ? 24.074  29.366  0.940    1.00 111.74 ? 107 GLU D OE1 1 
ATOM   6081  O  OE2 . GLU D  1  26  ? 23.663  27.612  2.219    1.00 109.01 ? 107 GLU D OE2 1 
ATOM   6082  N  N   . LEU D  1  27  ? 28.147  27.603  4.347    1.00 105.47 ? 108 LEU D N   1 
ATOM   6083  C  CA  . LEU D  1  27  ? 29.486  27.905  3.875    1.00 99.87  ? 108 LEU D CA  1 
ATOM   6084  C  C   . LEU D  1  27  ? 29.946  26.651  3.161    1.00 98.59  ? 108 LEU D C   1 
ATOM   6085  O  O   . LEU D  1  27  ? 30.485  26.716  2.061    1.00 103.58 ? 108 LEU D O   1 
ATOM   6086  C  CB  . LEU D  1  27  ? 30.439  28.201  5.032    1.00 93.18  ? 108 LEU D CB  1 
ATOM   6087  C  CG  . LEU D  1  27  ? 30.926  29.643  5.183    1.00 79.46  ? 108 LEU D CG  1 
ATOM   6088  C  CD1 . LEU D  1  27  ? 32.190  29.650  6.019    1.00 82.60  ? 108 LEU D CD1 1 
ATOM   6089  C  CD2 . LEU D  1  27  ? 31.221  30.245  3.834    1.00 80.28  ? 108 LEU D CD2 1 
ATOM   6090  N  N   . GLU D  1  28  ? 29.720  25.504  3.794    1.00 92.79  ? 109 GLU D N   1 
ATOM   6091  C  CA  . GLU D  1  28  ? 30.102  24.233  3.205    1.00 98.20  ? 109 GLU D CA  1 
ATOM   6092  C  C   . GLU D  1  28  ? 29.318  23.987  1.931    1.00 103.49 ? 109 GLU D C   1 
ATOM   6093  O  O   . GLU D  1  28  ? 29.855  23.479  0.954    1.00 108.62 ? 109 GLU D O   1 
ATOM   6094  C  CB  . GLU D  1  28  ? 29.849  23.095  4.177    1.00 94.23  ? 109 GLU D CB  1 
ATOM   6095  C  CG  . GLU D  1  28  ? 30.742  23.126  5.383    1.00 100.62 ? 109 GLU D CG  1 
ATOM   6096  C  CD  . GLU D  1  28  ? 30.491  21.951  6.296    1.00 109.34 ? 109 GLU D CD  1 
ATOM   6097  O  OE1 . GLU D  1  28  ? 31.179  21.846  7.331    1.00 114.03 ? 109 GLU D OE1 1 
ATOM   6098  O  OE2 . GLU D  1  28  ? 29.605  21.129  5.978    1.00 105.70 ? 109 GLU D OE2 1 
ATOM   6099  N  N   . ARG D  1  29  ? 28.041  24.342  1.935    1.00 107.17 ? 110 ARG D N   1 
ATOM   6100  C  CA  . ARG D  1  29  ? 27.234  24.149  0.740    1.00 109.49 ? 110 ARG D CA  1 
ATOM   6101  C  C   . ARG D  1  29  ? 27.784  25.061  -0.359   1.00 105.69 ? 110 ARG D C   1 
ATOM   6102  O  O   . ARG D  1  29  ? 27.389  24.971  -1.523   1.00 106.60 ? 110 ARG D O   1 
ATOM   6103  C  CB  . ARG D  1  29  ? 25.758  24.469  1.031    1.00 116.84 ? 110 ARG D CB  1 
ATOM   6104  C  CG  . ARG D  1  29  ? 25.192  25.705  0.335    1.00 124.36 ? 110 ARG D CG  1 
ATOM   6105  C  CD  . ARG D  1  29  ? 23.728  25.483  0.010    1.00 127.67 ? 110 ARG D CD  1 
ATOM   6106  N  NE  . ARG D  1  29  ? 23.572  24.308  -0.846   1.00 138.96 ? 110 ARG D NE  1 
ATOM   6107  C  CZ  . ARG D  1  29  ? 22.404  23.765  -1.182   1.00 143.44 ? 110 ARG D CZ  1 
ATOM   6108  N  NH1 . ARG D  1  29  ? 21.273  24.292  -0.732   1.00 148.51 ? 110 ARG D NH1 1 
ATOM   6109  N  NH2 . ARG D  1  29  ? 22.369  22.693  -1.968   1.00 138.28 ? 110 ARG D NH2 1 
ATOM   6110  N  N   . ARG D  1  30  ? 28.709  25.937  0.026    1.00 93.97  ? 111 ARG D N   1 
ATOM   6111  C  CA  . ARG D  1  30  ? 29.316  26.865  -0.910   1.00 85.69  ? 111 ARG D CA  1 
ATOM   6112  C  C   . ARG D  1  30  ? 30.776  26.498  -1.173   1.00 85.28  ? 111 ARG D C   1 
ATOM   6113  O  O   . ARG D  1  30  ? 31.316  26.788  -2.239   1.00 88.47  ? 111 ARG D O   1 
ATOM   6114  C  CB  . ARG D  1  30  ? 29.210  28.293  -0.372   1.00 72.30  ? 111 ARG D CB  1 
ATOM   6115  C  CG  . ARG D  1  30  ? 29.797  29.328  -1.310   1.00 75.48  ? 111 ARG D CG  1 
ATOM   6116  C  CD  . ARG D  1  30  ? 29.508  30.752  -0.865   1.00 65.62  ? 111 ARG D CD  1 
ATOM   6117  N  NE  . ARG D  1  30  ? 28.077  31.037  -0.847   1.00 68.19  ? 111 ARG D NE  1 
ATOM   6118  C  CZ  . ARG D  1  30  ? 27.560  32.263  -0.834   1.00 77.44  ? 111 ARG D CZ  1 
ATOM   6119  N  NH1 . ARG D  1  30  ? 28.362  33.319  -0.841   1.00 85.93  ? 111 ARG D NH1 1 
ATOM   6120  N  NH2 . ARG D  1  30  ? 26.243  32.437  -0.811   1.00 73.72  ? 111 ARG D NH2 1 
ATOM   6121  N  N   . ILE D  1  31  ? 31.409  25.856  -0.198   1.00 83.75  ? 112 ILE D N   1 
ATOM   6122  C  CA  . ILE D  1  31  ? 32.803  25.443  -0.327   1.00 78.65  ? 112 ILE D CA  1 
ATOM   6123  C  C   . ILE D  1  31  ? 32.883  24.046  -0.930   1.00 78.90  ? 112 ILE D C   1 
ATOM   6124  O  O   . ILE D  1  31  ? 33.746  23.772  -1.764   1.00 68.53  ? 112 ILE D O   1 
ATOM   6125  C  CB  . ILE D  1  31  ? 33.529  25.453  1.054    1.00 76.51  ? 112 ILE D CB  1 
ATOM   6126  C  CG1 . ILE D  1  31  ? 33.849  26.897  1.451    1.00 73.04  ? 112 ILE D CG1 1 
ATOM   6127  C  CG2 . ILE D  1  31  ? 34.797  24.600  1.003    1.00 65.04  ? 112 ILE D CG2 1 
ATOM   6128  C  CD1 . ILE D  1  31  ? 34.662  27.022  2.714    1.00 61.90  ? 112 ILE D CD1 1 
ATOM   6129  N  N   . ILE D  1  32  ? 31.977  23.168  -0.509   1.00 82.03  ? 113 ILE D N   1 
ATOM   6130  C  CA  . ILE D  1  32  ? 31.955  21.802  -1.012   1.00 84.88  ? 113 ILE D CA  1 
ATOM   6131  C  C   . ILE D  1  32  ? 31.622  21.830  -2.491   1.00 82.90  ? 113 ILE D C   1 
ATOM   6132  O  O   . ILE D  1  32  ? 31.821  20.845  -3.196   1.00 87.46  ? 113 ILE D O   1 
ATOM   6133  C  CB  . ILE D  1  32  ? 30.915  20.915  -0.264   1.00 89.64  ? 113 ILE D CB  1 
ATOM   6134  C  CG1 . ILE D  1  32  ? 31.214  19.436  -0.528   1.00 83.79  ? 113 ILE D CG1 1 
ATOM   6135  C  CG2 . ILE D  1  32  ? 29.495  21.242  -0.732   1.00 92.94  ? 113 ILE D CG2 1 
ATOM   6136  C  CD1 . ILE D  1  32  ? 30.366  18.486  0.285    1.00 75.19  ? 113 ILE D CD1 1 
ATOM   6137  N  N   . HIS D  1  33  ? 31.099  22.955  -2.964   1.00 82.21  ? 114 HIS D N   1 
ATOM   6138  C  CA  . HIS D  1  33  ? 30.793  23.058  -4.379   1.00 82.51  ? 114 HIS D CA  1 
ATOM   6139  C  C   . HIS D  1  33  ? 32.097  23.425  -5.073   1.00 86.44  ? 114 HIS D C   1 
ATOM   6140  O  O   . HIS D  1  33  ? 32.427  22.879  -6.128   1.00 84.94  ? 114 HIS D O   1 
ATOM   6141  C  CB  . HIS D  1  33  ? 29.748  24.134  -4.662   1.00 79.84  ? 114 HIS D CB  1 
ATOM   6142  C  CG  . HIS D  1  33  ? 29.303  24.156  -6.090   1.00 78.14  ? 114 HIS D CG  1 
ATOM   6143  N  ND1 . HIS D  1  33  ? 28.499  23.175  -6.630   1.00 70.53  ? 114 HIS D ND1 1 
ATOM   6144  C  CD2 . HIS D  1  33  ? 29.624  24.984  -7.113   1.00 79.21  ? 114 HIS D CD2 1 
ATOM   6145  C  CE1 . HIS D  1  33  ? 28.349  23.395  -7.924   1.00 72.81  ? 114 HIS D CE1 1 
ATOM   6146  N  NE2 . HIS D  1  33  ? 29.022  24.486  -8.243   1.00 80.01  ? 114 HIS D NE2 1 
ATOM   6147  N  N   . LEU D  1  34  ? 32.839  24.353  -4.472   1.00 87.99  ? 115 LEU D N   1 
ATOM   6148  C  CA  . LEU D  1  34  ? 34.119  24.765  -5.024   1.00 86.60  ? 115 LEU D CA  1 
ATOM   6149  C  C   . LEU D  1  34  ? 34.896  23.497  -5.348   1.00 90.26  ? 115 LEU D C   1 
ATOM   6150  O  O   . LEU D  1  34  ? 35.768  23.500  -6.209   1.00 91.08  ? 115 LEU D O   1 
ATOM   6151  C  CB  . LEU D  1  34  ? 34.893  25.617  -4.014   1.00 81.74  ? 115 LEU D CB  1 
ATOM   6152  C  CG  . LEU D  1  34  ? 34.922  27.126  -4.280   1.00 83.15  ? 115 LEU D CG  1 
ATOM   6153  C  CD1 . LEU D  1  34  ? 35.647  27.838  -3.156   1.00 81.98  ? 115 LEU D CD1 1 
ATOM   6154  C  CD2 . LEU D  1  34  ? 35.618  27.396  -5.604   1.00 84.36  ? 115 LEU D CD2 1 
ATOM   6155  N  N   . GLN D  1  35  ? 34.559  22.414  -4.649   1.00 95.79  ? 116 GLN D N   1 
ATOM   6156  C  CA  . GLN D  1  35  ? 35.190  21.117  -4.855   1.00 97.31  ? 116 GLN D CA  1 
ATOM   6157  C  C   . GLN D  1  35  ? 34.661  20.514  -6.151   1.00 97.81  ? 116 GLN D C   1 
ATOM   6158  O  O   . GLN D  1  35  ? 35.438  20.191  -7.046   1.00 102.36 ? 116 GLN D O   1 
ATOM   6159  C  CB  . GLN D  1  35  ? 34.874  20.169  -3.693   1.00 104.72 ? 116 GLN D CB  1 
ATOM   6160  C  CG  . GLN D  1  35  ? 35.321  20.667  -2.331   1.00 118.26 ? 116 GLN D CG  1 
ATOM   6161  C  CD  . GLN D  1  35  ? 36.827  20.749  -2.205   1.00 127.43 ? 116 GLN D CD  1 
ATOM   6162  O  OE1 . GLN D  1  35  ? 37.494  21.387  -3.019   1.00 131.63 ? 116 GLN D OE1 1 
ATOM   6163  N  NE2 . GLN D  1  35  ? 37.371  20.106  -1.178   1.00 127.92 ? 116 GLN D NE2 1 
ATOM   6164  N  N   . ARG D  1  36  ? 33.340  20.366  -6.251   1.00 97.15  ? 117 ARG D N   1 
ATOM   6165  C  CA  . ARG D  1  36  ? 32.727  19.792  -7.450   1.00 93.50  ? 117 ARG D CA  1 
ATOM   6166  C  C   . ARG D  1  36  ? 33.172  20.588  -8.669   1.00 85.66  ? 117 ARG D C   1 
ATOM   6167  O  O   . ARG D  1  36  ? 33.191  20.072  -9.785   1.00 73.13  ? 117 ARG D O   1 
ATOM   6168  C  CB  . ARG D  1  36  ? 31.195  19.802  -7.339   1.00 101.05 ? 117 ARG D CB  1 
ATOM   6169  C  CG  . ARG D  1  36  ? 30.501  18.751  -8.214   1.00 105.71 ? 117 ARG D CG  1 
ATOM   6170  C  CD  . ARG D  1  36  ? 29.900  19.331  -9.487   1.00 107.20 ? 117 ARG D CD  1 
ATOM   6171  N  NE  . ARG D  1  36  ? 28.562  19.880  -9.270   1.00 110.48 ? 117 ARG D NE  1 
ATOM   6172  C  CZ  . ARG D  1  36  ? 27.791  20.387  -10.230  1.00 114.30 ? 117 ARG D CZ  1 
ATOM   6173  N  NH1 . ARG D  1  36  ? 28.221  20.423  -11.484  1.00 115.68 ? 117 ARG D NH1 1 
ATOM   6174  N  NH2 . ARG D  1  36  ? 26.584  20.857  -9.938   1.00 116.07 ? 117 ARG D NH2 1 
ATOM   6175  N  N   . ARG D  1  37  ? 33.539  21.845  -8.433   1.00 80.62  ? 118 ARG D N   1 
ATOM   6176  C  CA  . ARG D  1  37  ? 34.018  22.734  -9.486   1.00 81.26  ? 118 ARG D CA  1 
ATOM   6177  C  C   . ARG D  1  37  ? 35.479  22.446  -9.824   1.00 78.79  ? 118 ARG D C   1 
ATOM   6178  O  O   . ARG D  1  37  ? 35.871  22.414  -10.992  1.00 76.37  ? 118 ARG D O   1 
ATOM   6179  C  CB  . ARG D  1  37  ? 33.890  24.186  -9.045   1.00 80.93  ? 118 ARG D CB  1 
ATOM   6180  C  CG  . ARG D  1  37  ? 34.844  25.120  -9.765   1.00 76.86  ? 118 ARG D CG  1 
ATOM   6181  C  CD  . ARG D  1  37  ? 34.234  26.482  -9.848   1.00 83.76  ? 118 ARG D CD  1 
ATOM   6182  N  NE  . ARG D  1  37  ? 32.946  26.395  -10.524  1.00 82.43  ? 118 ARG D NE  1 
ATOM   6183  C  CZ  . ARG D  1  37  ? 32.100  27.407  -10.653  1.00 80.34  ? 118 ARG D CZ  1 
ATOM   6184  N  NH1 . ARG D  1  37  ? 32.402  28.595  -10.150  1.00 80.69  ? 118 ARG D NH1 1 
ATOM   6185  N  NH2 . ARG D  1  37  ? 30.955  27.225  -11.289  1.00 86.90  ? 118 ARG D NH2 1 
ATOM   6186  N  N   . ILE D  1  38  ? 36.285  22.267  -8.787   1.00 74.59  ? 119 ILE D N   1 
ATOM   6187  C  CA  . ILE D  1  38  ? 37.691  21.961  -8.969   1.00 68.96  ? 119 ILE D CA  1 
ATOM   6188  C  C   . ILE D  1  38  ? 37.785  20.618  -9.679   1.00 69.08  ? 119 ILE D C   1 
ATOM   6189  O  O   . ILE D  1  38  ? 38.625  20.427  -10.554  1.00 60.42  ? 119 ILE D O   1 
ATOM   6190  C  CB  . ILE D  1  38  ? 38.426  21.865  -7.619   1.00 71.80  ? 119 ILE D CB  1 
ATOM   6191  C  CG1 . ILE D  1  38  ? 38.427  23.226  -6.921   1.00 69.42  ? 119 ILE D CG1 1 
ATOM   6192  C  CG2 . ILE D  1  38  ? 39.831  21.344  -7.830   1.00 73.89  ? 119 ILE D CG2 1 
ATOM   6193  C  CD1 . ILE D  1  38  ? 38.799  24.368  -7.817   1.00 76.76  ? 119 ILE D CD1 1 
ATOM   6194  N  N   . ASN D  1  39  ? 36.917  19.684  -9.302   1.00 68.90  ? 120 ASN D N   1 
ATOM   6195  C  CA  . ASN D  1  39  ? 36.930  18.382  -9.940   1.00 74.52  ? 120 ASN D CA  1 
ATOM   6196  C  C   . ASN D  1  39  ? 36.723  18.563  -11.420  1.00 77.13  ? 120 ASN D C   1 
ATOM   6197  O  O   . ASN D  1  39  ? 37.490  18.044  -12.219  1.00 90.81  ? 120 ASN D O   1 
ATOM   6198  C  CB  . ASN D  1  39  ? 35.846  17.470  -9.378   1.00 72.37  ? 120 ASN D CB  1 
ATOM   6199  C  CG  . ASN D  1  39  ? 36.149  17.029  -7.970   1.00 77.82  ? 120 ASN D CG  1 
ATOM   6200  O  OD1 . ASN D  1  39  ? 37.310  16.795  -7.618   1.00 68.69  ? 120 ASN D OD1 1 
ATOM   6201  N  ND2 . ASN D  1  39  ? 35.110  16.903  -7.153   1.00 72.95  ? 120 ASN D ND2 1 
ATOM   6202  N  N   . MET D  1  40  ? 35.689  19.303  -11.796  1.00 80.09  ? 121 MET D N   1 
ATOM   6203  C  CA  . MET D  1  40  ? 35.443  19.531  -13.210  1.00 79.60  ? 121 MET D CA  1 
ATOM   6204  C  C   . MET D  1  40  ? 36.681  20.154  -13.849  1.00 76.29  ? 121 MET D C   1 
ATOM   6205  O  O   . MET D  1  40  ? 37.096  19.750  -14.928  1.00 75.73  ? 121 MET D O   1 
ATOM   6206  C  CB  . MET D  1  40  ? 34.250  20.460  -13.406  1.00 93.72  ? 121 MET D CB  1 
ATOM   6207  C  CG  . MET D  1  40  ? 32.903  19.808  -13.178  1.00 107.41 ? 121 MET D CG  1 
ATOM   6208  S  SD  . MET D  1  40  ? 31.567  20.854  -13.802  1.00 128.39 ? 121 MET D SD  1 
ATOM   6209  C  CE  . MET D  1  40  ? 31.883  20.751  -15.597  1.00 122.65 ? 121 MET D CE  1 
ATOM   6210  N  N   . GLN D  1  41  ? 37.276  21.128  -13.170  1.00 69.47  ? 122 GLN D N   1 
ATOM   6211  C  CA  . GLN D  1  41  ? 38.460  21.799  -13.685  1.00 64.00  ? 122 GLN D CA  1 
ATOM   6212  C  C   . GLN D  1  41  ? 39.632  20.853  -13.918  1.00 62.90  ? 122 GLN D C   1 
ATOM   6213  O  O   . GLN D  1  41  ? 40.481  21.102  -14.762  1.00 73.38  ? 122 GLN D O   1 
ATOM   6214  C  CB  . GLN D  1  41  ? 38.882  22.930  -12.743  1.00 63.79  ? 122 GLN D CB  1 
ATOM   6215  C  CG  . GLN D  1  41  ? 37.889  24.080  -12.690  1.00 57.40  ? 122 GLN D CG  1 
ATOM   6216  C  CD  . GLN D  1  41  ? 38.440  25.294  -11.984  1.00 56.08  ? 122 GLN D CD  1 
ATOM   6217  O  OE1 . GLN D  1  41  ? 37.841  26.359  -12.019  1.00 45.81  ? 122 GLN D OE1 1 
ATOM   6218  N  NE2 . GLN D  1  41  ? 39.587  25.139  -11.335  1.00 68.47  ? 122 GLN D NE2 1 
ATOM   6219  N  N   . LEU D  1  42  ? 39.694  19.766  -13.171  1.00 61.32  ? 123 LEU D N   1 
ATOM   6220  C  CA  . LEU D  1  42  ? 40.776  18.825  -13.367  1.00 60.84  ? 123 LEU D CA  1 
ATOM   6221  C  C   . LEU D  1  42  ? 40.331  17.771  -14.373  1.00 68.01  ? 123 LEU D C   1 
ATOM   6222  O  O   . LEU D  1  42  ? 41.111  16.920  -14.781  1.00 76.66  ? 123 LEU D O   1 
ATOM   6223  C  CB  . LEU D  1  42  ? 41.157  18.180  -12.040  1.00 54.86  ? 123 LEU D CB  1 
ATOM   6224  C  CG  . LEU D  1  42  ? 41.583  19.190  -10.976  1.00 55.95  ? 123 LEU D CG  1 
ATOM   6225  C  CD1 . LEU D  1  42  ? 41.974  18.452  -9.716   1.00 53.55  ? 123 LEU D CD1 1 
ATOM   6226  C  CD2 . LEU D  1  42  ? 42.744  20.033  -11.482  1.00 46.10  ? 123 LEU D CD2 1 
ATOM   6227  N  N   . GLN D  1  43  ? 39.062  17.826  -14.763  1.00 71.78  ? 124 GLN D N   1 
ATOM   6228  C  CA  . GLN D  1  43  ? 38.529  16.894  -15.752  1.00 76.73  ? 124 GLN D CA  1 
ATOM   6229  C  C   . GLN D  1  43  ? 39.035  17.428  -17.080  1.00 77.50  ? 124 GLN D C   1 
ATOM   6230  O  O   . GLN D  1  43  ? 39.602  16.702  -17.897  1.00 72.01  ? 124 GLN D O   1 
ATOM   6231  C  CB  . GLN D  1  43  ? 36.996  16.921  -15.770  1.00 82.31  ? 124 GLN D CB  1 
ATOM   6232  C  CG  . GLN D  1  43  ? 36.311  16.449  -14.496  1.00 100.11 ? 124 GLN D CG  1 
ATOM   6233  C  CD  . GLN D  1  43  ? 36.301  14.937  -14.354  1.00 107.43 ? 124 GLN D CD  1 
ATOM   6234  O  OE1 . GLN D  1  43  ? 35.744  14.228  -15.195  1.00 109.05 ? 124 GLN D OE1 1 
ATOM   6235  N  NE2 . GLN D  1  43  ? 36.915  14.438  -13.286  1.00 105.94 ? 124 GLN D NE2 1 
ATOM   6236  N  N   . GLN D  1  44  ? 38.822  18.724  -17.269  1.00 77.39  ? 125 GLN D N   1 
ATOM   6237  C  CA  . GLN D  1  44  ? 39.223  19.422  -18.477  1.00 81.13  ? 125 GLN D CA  1 
ATOM   6238  C  C   . GLN D  1  44  ? 40.738  19.584  -18.563  1.00 79.16  ? 125 GLN D C   1 
ATOM   6239  O  O   . GLN D  1  44  ? 41.327  19.438  -19.632  1.00 71.84  ? 125 GLN D O   1 
ATOM   6240  C  CB  . GLN D  1  44  ? 38.534  20.784  -18.521  1.00 85.29  ? 125 GLN D CB  1 
ATOM   6241  C  CG  . GLN D  1  44  ? 37.024  20.677  -18.621  1.00 105.92 ? 125 GLN D CG  1 
ATOM   6242  C  CD  . GLN D  1  44  ? 36.310  21.915  -18.109  1.00 124.72 ? 125 GLN D CD  1 
ATOM   6243  O  OE1 . GLN D  1  44  ? 36.544  23.028  -18.585  1.00 126.44 ? 125 GLN D OE1 1 
ATOM   6244  N  NE2 . GLN D  1  44  ? 35.431  21.725  -17.128  1.00 133.87 ? 125 GLN D NE2 1 
ATOM   6245  N  N   . LEU D  1  45  ? 41.370  19.881  -17.436  1.00 77.98  ? 126 LEU D N   1 
ATOM   6246  C  CA  . LEU D  1  45  ? 42.813  20.049  -17.416  1.00 73.93  ? 126 LEU D CA  1 
ATOM   6247  C  C   . LEU D  1  45  ? 43.547  18.768  -17.796  1.00 80.38  ? 126 LEU D C   1 
ATOM   6248  O  O   . LEU D  1  45  ? 44.602  18.818  -18.425  1.00 84.58  ? 126 LEU D O   1 
ATOM   6249  C  CB  . LEU D  1  45  ? 43.261  20.526  -16.037  1.00 64.31  ? 126 LEU D CB  1 
ATOM   6250  C  CG  . LEU D  1  45  ? 43.025  22.024  -15.885  1.00 58.16  ? 126 LEU D CG  1 
ATOM   6251  C  CD1 . LEU D  1  45  ? 43.275  22.484  -14.465  1.00 53.07  ? 126 LEU D CD1 1 
ATOM   6252  C  CD2 . LEU D  1  45  ? 43.935  22.741  -16.855  1.00 63.22  ? 126 LEU D CD2 1 
ATOM   6253  N  N   . THR D  1  46  ? 42.985  17.621  -17.418  1.00 83.68  ? 127 THR D N   1 
ATOM   6254  C  CA  . THR D  1  46  ? 43.596  16.327  -17.726  1.00 80.70  ? 127 THR D CA  1 
ATOM   6255  C  C   . THR D  1  46  ? 43.513  16.050  -19.219  1.00 76.48  ? 127 THR D C   1 
ATOM   6256  O  O   . THR D  1  46  ? 44.480  15.612  -19.840  1.00 68.63  ? 127 THR D O   1 
ATOM   6257  C  CB  . THR D  1  46  ? 42.892  15.189  -16.978  1.00 80.37  ? 127 THR D CB  1 
ATOM   6258  O  OG1 . THR D  1  46  ? 43.015  15.397  -15.565  1.00 82.84  ? 127 THR D OG1 1 
ATOM   6259  C  CG2 . THR D  1  46  ? 43.516  13.855  -17.341  1.00 77.81  ? 127 THR D CG2 1 
ATOM   6260  N  N   . LEU D  1  47  ? 42.334  16.303  -19.774  1.00 73.82  ? 128 LEU D N   1 
ATOM   6261  C  CA  . LEU D  1  47  ? 42.068  16.126  -21.192  1.00 70.45  ? 128 LEU D CA  1 
ATOM   6262  C  C   . LEU D  1  47  ? 42.864  17.166  -21.994  1.00 72.14  ? 128 LEU D C   1 
ATOM   6263  O  O   . LEU D  1  47  ? 43.408  16.867  -23.056  1.00 76.16  ? 128 LEU D O   1 
ATOM   6264  C  CB  . LEU D  1  47  ? 40.557  16.274  -21.440  1.00 61.86  ? 128 LEU D CB  1 
ATOM   6265  C  CG  . LEU D  1  47  ? 39.931  16.429  -22.832  1.00 59.94  ? 128 LEU D CG  1 
ATOM   6266  C  CD1 . LEU D  1  47  ? 40.230  17.820  -23.355  1.00 67.38  ? 128 LEU D CD1 1 
ATOM   6267  C  CD2 . LEU D  1  47  ? 40.435  15.356  -23.789  1.00 58.30  ? 128 LEU D CD2 1 
ATOM   6268  N  N   . LEU D  1  48  ? 42.942  18.385  -21.471  1.00 71.34  ? 129 LEU D N   1 
ATOM   6269  C  CA  . LEU D  1  48  ? 43.669  19.463  -22.138  1.00 69.76  ? 129 LEU D CA  1 
ATOM   6270  C  C   . LEU D  1  48  ? 45.163  19.178  -22.097  1.00 68.23  ? 129 LEU D C   1 
ATOM   6271  O  O   . LEU D  1  48  ? 45.946  19.762  -22.838  1.00 64.61  ? 129 LEU D O   1 
ATOM   6272  C  CB  . LEU D  1  48  ? 43.373  20.793  -21.440  1.00 69.93  ? 129 LEU D CB  1 
ATOM   6273  C  CG  . LEU D  1  48  ? 43.767  22.087  -22.147  1.00 68.08  ? 129 LEU D CG  1 
ATOM   6274  C  CD1 . LEU D  1  48  ? 43.103  22.141  -23.510  1.00 61.01  ? 129 LEU D CD1 1 
ATOM   6275  C  CD2 . LEU D  1  48  ? 43.346  23.276  -21.300  1.00 64.32  ? 129 LEU D CD2 1 
ATOM   6276  N  N   . GLN D  1  49  ? 45.549  18.266  -21.219  1.00 74.23  ? 130 GLN D N   1 
ATOM   6277  C  CA  . GLN D  1  49  ? 46.945  17.885  -21.060  1.00 74.70  ? 130 GLN D CA  1 
ATOM   6278  C  C   . GLN D  1  49  ? 47.308  16.856  -22.113  1.00 72.06  ? 130 GLN D C   1 
ATOM   6279  O  O   . GLN D  1  49  ? 48.386  16.888  -22.700  1.00 70.81  ? 130 GLN D O   1 
ATOM   6280  C  CB  . GLN D  1  49  ? 47.149  17.281  -19.674  1.00 75.22  ? 130 GLN D CB  1 
ATOM   6281  C  CG  . GLN D  1  49  ? 48.495  16.637  -19.456  1.00 69.12  ? 130 GLN D CG  1 
ATOM   6282  C  CD  . GLN D  1  49  ? 48.510  15.812  -18.197  1.00 69.19  ? 130 GLN D CD  1 
ATOM   6283  O  OE1 . GLN D  1  49  ? 47.809  14.801  -18.094  1.00 53.85  ? 130 GLN D OE1 1 
ATOM   6284  N  NE2 . GLN D  1  49  ? 49.300  16.243  -17.220  1.00 67.16  ? 130 GLN D NE2 1 
ATOM   6285  N  N   . HIS D  1  50  ? 46.394  15.929  -22.341  1.00 73.78  ? 131 HIS D N   1 
ATOM   6286  C  CA  . HIS D  1  50  ? 46.635  14.893  -23.309  1.00 76.18  ? 131 HIS D CA  1 
ATOM   6287  C  C   . HIS D  1  50  ? 46.592  15.468  -24.710  1.00 71.89  ? 131 HIS D C   1 
ATOM   6288  O  O   . HIS D  1  50  ? 47.170  14.903  -25.633  1.00 81.30  ? 131 HIS D O   1 
ATOM   6289  C  CB  . HIS D  1  50  ? 45.606  13.775  -23.160  1.00 87.02  ? 131 HIS D CB  1 
ATOM   6290  C  CG  . HIS D  1  50  ? 45.873  12.607  -24.050  1.00 102.14 ? 131 HIS D CG  1 
ATOM   6291  N  ND1 . HIS D  1  50  ? 45.480  12.575  -25.370  1.00 100.91 ? 131 HIS D ND1 1 
ATOM   6292  C  CD2 . HIS D  1  50  ? 46.562  11.461  -23.833  1.00 110.39 ? 131 HIS D CD2 1 
ATOM   6293  C  CE1 . HIS D  1  50  ? 45.917  11.460  -25.929  1.00 108.24 ? 131 HIS D CE1 1 
ATOM   6294  N  NE2 . HIS D  1  50  ? 46.577  10.767  -25.018  1.00 116.76 ? 131 HIS D NE2 1 
ATOM   6295  N  N   . ASN D  1  51  ? 45.914  16.594  -24.874  1.00 61.26  ? 132 ASN D N   1 
ATOM   6296  C  CA  . ASN D  1  51  ? 45.834  17.210  -26.189  1.00 67.98  ? 132 ASN D CA  1 
ATOM   6297  C  C   . ASN D  1  51  ? 47.116  17.989  -26.492  1.00 67.04  ? 132 ASN D C   1 
ATOM   6298  O  O   . ASN D  1  51  ? 47.671  17.892  -27.591  1.00 72.37  ? 132 ASN D O   1 
ATOM   6299  C  CB  . ASN D  1  51  ? 44.613  18.130  -26.284  1.00 77.37  ? 132 ASN D CB  1 
ATOM   6300  C  CG  . ASN D  1  51  ? 43.305  17.366  -26.348  1.00 79.92  ? 132 ASN D CG  1 
ATOM   6301  O  OD1 . ASN D  1  51  ? 42.242  17.961  -26.510  1.00 91.91  ? 132 ASN D OD1 1 
ATOM   6302  N  ND2 . ASN D  1  51  ? 43.374  16.045  -26.216  1.00 85.35  ? 132 ASN D ND2 1 
ATOM   6303  N  N   . ILE D  1  52  ? 47.584  18.773  -25.528  1.00 61.27  ? 133 ILE D N   1 
ATOM   6304  C  CA  . ILE D  1  52  ? 48.821  19.513  -25.730  1.00 49.81  ? 133 ILE D CA  1 
ATOM   6305  C  C   . ILE D  1  52  ? 49.873  18.445  -26.003  1.00 55.54  ? 133 ILE D C   1 
ATOM   6306  O  O   . ILE D  1  52  ? 50.757  18.613  -26.840  1.00 43.79  ? 133 ILE D O   1 
ATOM   6307  C  CB  . ILE D  1  52  ? 49.200  20.323  -24.479  1.00 31.42  ? 133 ILE D CB  1 
ATOM   6308  C  CG1 . ILE D  1  52  ? 48.225  21.484  -24.320  1.00 36.57  ? 133 ILE D CG1 1 
ATOM   6309  C  CG2 . ILE D  1  52  ? 50.613  20.852  -24.600  1.00 35.07  ? 133 ILE D CG2 1 
ATOM   6310  C  CD1 . ILE D  1  52  ? 48.548  22.416  -23.166  1.00 49.98  ? 133 ILE D CD1 1 
ATOM   6311  N  N   . LYS D  1  53  ? 49.745  17.331  -25.292  1.00 64.57  ? 134 LYS D N   1 
ATOM   6312  C  CA  . LYS D  1  53  ? 50.642  16.197  -25.450  1.00 66.22  ? 134 LYS D CA  1 
ATOM   6313  C  C   . LYS D  1  53  ? 50.732  15.828  -26.918  1.00 58.73  ? 134 LYS D C   1 
ATOM   6314  O  O   . LYS D  1  53  ? 51.826  15.745  -27.485  1.00 66.57  ? 134 LYS D O   1 
ATOM   6315  C  CB  . LYS D  1  53  ? 50.101  15.000  -24.668  1.00 78.84  ? 134 LYS D CB  1 
ATOM   6316  C  CG  . LYS D  1  53  ? 50.689  13.646  -25.063  1.00 78.22  ? 134 LYS D CG  1 
ATOM   6317  C  CD  . LYS D  1  53  ? 52.092  13.435  -24.512  1.00 72.25  ? 134 LYS D CD  1 
ATOM   6318  C  CE  . LYS D  1  53  ? 52.528  12.014  -24.779  1.00 75.31  ? 134 LYS D CE  1 
ATOM   6319  N  NZ  . LYS D  1  53  ? 51.444  11.059  -24.411  1.00 78.38  ? 134 LYS D NZ  1 
ATOM   6320  N  N   . THR D  1  54  ? 49.570  15.611  -27.527  1.00 57.19  ? 135 THR D N   1 
ATOM   6321  C  CA  . THR D  1  54  ? 49.496  15.228  -28.929  1.00 58.99  ? 135 THR D CA  1 
ATOM   6322  C  C   . THR D  1  54  ? 49.356  16.370  -29.932  1.00 59.25  ? 135 THR D C   1 
ATOM   6323  O  O   . THR D  1  54  ? 48.716  16.211  -30.969  1.00 74.17  ? 135 THR D O   1 
ATOM   6324  C  CB  . THR D  1  54  ? 48.352  14.219  -29.173  1.00 60.53  ? 135 THR D CB  1 
ATOM   6325  O  OG1 . THR D  1  54  ? 47.123  14.746  -28.661  1.00 60.41  ? 135 THR D OG1 1 
ATOM   6326  C  CG2 . THR D  1  54  ? 48.661  12.883  -28.497  1.00 56.20  ? 135 THR D CG2 1 
ATOM   6327  N  N   . GLN D  1  55  ? 49.946  17.518  -29.624  1.00 57.11  ? 136 GLN D N   1 
ATOM   6328  C  CA  . GLN D  1  55  ? 49.919  18.656  -30.533  1.00 53.14  ? 136 GLN D CA  1 
ATOM   6329  C  C   . GLN D  1  55  ? 51.348  19.175  -30.592  1.00 56.91  ? 136 GLN D C   1 
ATOM   6330  O  O   . GLN D  1  55  ? 51.775  19.747  -31.592  1.00 64.35  ? 136 GLN D O   1 
ATOM   6331  C  CB  . GLN D  1  55  ? 48.991  19.764  -30.030  1.00 45.28  ? 136 GLN D CB  1 
ATOM   6332  C  CG  . GLN D  1  55  ? 48.782  20.841  -31.070  1.00 41.56  ? 136 GLN D CG  1 
ATOM   6333  C  CD  . GLN D  1  55  ? 47.996  22.038  -30.589  1.00 43.52  ? 136 GLN D CD  1 
ATOM   6334  O  OE1 . GLN D  1  55  ? 48.515  22.921  -29.894  1.00 42.61  ? 136 GLN D OE1 1 
ATOM   6335  N  NE2 . GLN D  1  55  ? 46.733  22.082  -30.969  1.00 50.39  ? 136 GLN D NE2 1 
ATOM   6336  N  N   . VAL D  1  56  ? 52.079  18.966  -29.499  1.00 56.91  ? 137 VAL D N   1 
ATOM   6337  C  CA  . VAL D  1  56  ? 53.474  19.373  -29.394  1.00 44.99  ? 137 VAL D CA  1 
ATOM   6338  C  C   . VAL D  1  56  ? 54.266  18.351  -30.205  1.00 55.60  ? 137 VAL D C   1 
ATOM   6339  O  O   . VAL D  1  56  ? 55.305  18.652  -30.785  1.00 50.52  ? 137 VAL D O   1 
ATOM   6340  C  CB  . VAL D  1  56  ? 53.965  19.333  -27.928  1.00 39.63  ? 137 VAL D CB  1 
ATOM   6341  C  CG1 . VAL D  1  56  ? 55.440  19.674  -27.869  1.00 50.30  ? 137 VAL D CG1 1 
ATOM   6342  C  CG2 . VAL D  1  56  ? 53.169  20.310  -27.074  1.00 32.40  ? 137 VAL D CG2 1 
ATOM   6343  N  N   . SER D  1  57  ? 53.755  17.129  -30.239  1.00 56.68  ? 138 SER D N   1 
ATOM   6344  C  CA  . SER D  1  57  ? 54.401  16.068  -30.982  1.00 58.16  ? 138 SER D CA  1 
ATOM   6345  C  C   . SER D  1  57  ? 54.147  16.288  -32.459  1.00 57.71  ? 138 SER D C   1 
ATOM   6346  O  O   . SER D  1  57  ? 55.071  16.242  -33.263  1.00 59.67  ? 138 SER D O   1 
ATOM   6347  C  CB  . SER D  1  57  ? 53.836  14.711  -30.565  1.00 64.40  ? 138 SER D CB  1 
ATOM   6348  O  OG  . SER D  1  57  ? 54.127  13.725  -31.545  1.00 58.96  ? 138 SER D OG  1 
ATOM   6349  N  N   . GLN D  1  58  ? 52.885  16.535  -32.801  1.00 60.12  ? 139 GLN D N   1 
ATOM   6350  C  CA  . GLN D  1  58  ? 52.473  16.746  -34.183  1.00 51.79  ? 139 GLN D CA  1 
ATOM   6351  C  C   . GLN D  1  58  ? 53.150  17.958  -34.782  1.00 52.45  ? 139 GLN D C   1 
ATOM   6352  O  O   . GLN D  1  58  ? 53.706  17.888  -35.880  1.00 43.83  ? 139 GLN D O   1 
ATOM   6353  C  CB  . GLN D  1  58  ? 50.967  16.929  -34.265  1.00 56.88  ? 139 GLN D CB  1 
ATOM   6354  C  CG  . GLN D  1  58  ? 50.420  16.794  -35.666  1.00 66.92  ? 139 GLN D CG  1 
ATOM   6355  C  CD  . GLN D  1  58  ? 48.915  16.954  -35.708  1.00 80.18  ? 139 GLN D CD  1 
ATOM   6356  O  OE1 . GLN D  1  58  ? 48.211  16.521  -34.792  1.00 81.52  ? 139 GLN D OE1 1 
ATOM   6357  N  NE2 . GLN D  1  58  ? 48.409  17.566  -36.777  1.00 79.15  ? 139 GLN D NE2 1 
ATOM   6358  N  N   . ILE D  1  59  ? 53.111  19.074  -34.066  1.00 48.53  ? 140 ILE D N   1 
ATOM   6359  C  CA  . ILE D  1  59  ? 53.745  20.279  -34.574  1.00 49.35  ? 140 ILE D CA  1 
ATOM   6360  C  C   . ILE D  1  59  ? 55.244  20.121  -34.716  1.00 52.13  ? 140 ILE D C   1 
ATOM   6361  O  O   . ILE D  1  59  ? 55.850  20.719  -35.607  1.00 56.25  ? 140 ILE D O   1 
ATOM   6362  C  CB  . ILE D  1  59  ? 53.467  21.494  -33.691  1.00 46.47  ? 140 ILE D CB  1 
ATOM   6363  C  CG1 . ILE D  1  59  ? 51.999  21.888  -33.818  1.00 37.62  ? 140 ILE D CG1 1 
ATOM   6364  C  CG2 . ILE D  1  59  ? 54.329  22.666  -34.136  1.00 39.58  ? 140 ILE D CG2 1 
ATOM   6365  C  CD1 . ILE D  1  59  ? 51.614  23.051  -32.982  1.00 33.15  ? 140 ILE D CD1 1 
ATOM   6366  N  N   . LEU D  1  60  ? 55.852  19.330  -33.839  1.00 54.25  ? 141 LEU D N   1 
ATOM   6367  C  CA  . LEU D  1  60  ? 57.291  19.119  -33.934  1.00 56.83  ? 141 LEU D CA  1 
ATOM   6368  C  C   . LEU D  1  60  ? 57.597  18.369  -35.213  1.00 50.79  ? 141 LEU D C   1 
ATOM   6369  O  O   . LEU D  1  60  ? 58.420  18.799  -36.013  1.00 53.22  ? 141 LEU D O   1 
ATOM   6370  C  CB  . LEU D  1  60  ? 57.823  18.319  -32.749  1.00 60.45  ? 141 LEU D CB  1 
ATOM   6371  C  CG  . LEU D  1  60  ? 59.302  17.948  -32.918  1.00 71.39  ? 141 LEU D CG  1 
ATOM   6372  C  CD1 . LEU D  1  60  ? 60.102  19.160  -33.447  1.00 61.34  ? 141 LEU D CD1 1 
ATOM   6373  C  CD2 . LEU D  1  60  ? 59.855  17.434  -31.586  1.00 56.83  ? 141 LEU D CD2 1 
ATOM   6374  N  N   . ARG D  1  61  ? 56.931  17.241  -35.395  1.00 45.12  ? 142 ARG D N   1 
ATOM   6375  C  CA  . ARG D  1  61  ? 57.120  16.435  -36.590  1.00 56.37  ? 142 ARG D CA  1 
ATOM   6376  C  C   . ARG D  1  61  ? 56.970  17.329  -37.830  1.00 55.70  ? 142 ARG D C   1 
ATOM   6377  O  O   . ARG D  1  61  ? 57.839  17.356  -38.702  1.00 49.88  ? 142 ARG D O   1 
ATOM   6378  C  CB  . ARG D  1  61  ? 56.084  15.298  -36.633  1.00 34.61  ? 142 ARG D CB  1 
ATOM   6379  C  CG  . ARG D  1  61  ? 56.100  14.519  -37.910  1.00 42.70  ? 142 ARG D CG  1 
ATOM   6380  C  CD  . ARG D  1  61  ? 56.887  13.232  -37.796  1.00 62.51  ? 142 ARG D CD  1 
ATOM   6381  N  NE  . ARG D  1  61  ? 56.055  12.155  -37.266  1.00 72.39  ? 142 ARG D NE  1 
ATOM   6382  C  CZ  . ARG D  1  61  ? 55.675  12.055  -35.998  1.00 72.68  ? 142 ARG D CZ  1 
ATOM   6383  N  NH1 . ARG D  1  61  ? 56.055  12.961  -35.108  1.00 71.95  ? 142 ARG D NH1 1 
ATOM   6384  N  NH2 . ARG D  1  61  ? 54.894  11.057  -35.628  1.00 85.79  ? 142 ARG D NH2 1 
ATOM   6385  N  N   . VAL D  1  62  ? 55.870  18.070  -37.890  1.00 55.63  ? 143 VAL D N   1 
ATOM   6386  C  CA  . VAL D  1  62  ? 55.607  18.936  -39.024  1.00 52.91  ? 143 VAL D CA  1 
ATOM   6387  C  C   . VAL D  1  62  ? 56.776  19.851  -39.300  1.00 48.02  ? 143 VAL D C   1 
ATOM   6388  O  O   . VAL D  1  62  ? 57.200  19.988  -40.442  1.00 51.44  ? 143 VAL D O   1 
ATOM   6389  C  CB  . VAL D  1  62  ? 54.363  19.801  -38.797  1.00 46.97  ? 143 VAL D CB  1 
ATOM   6390  C  CG1 . VAL D  1  62  ? 54.039  20.573  -40.046  1.00 48.23  ? 143 VAL D CG1 1 
ATOM   6391  C  CG2 . VAL D  1  62  ? 53.194  18.925  -38.419  1.00 63.56  ? 143 VAL D CG2 1 
ATOM   6392  N  N   . GLU D  1  63  ? 57.314  20.466  -38.256  1.00 42.66  ? 144 GLU D N   1 
ATOM   6393  C  CA  . GLU D  1  63  ? 58.428  21.381  -38.445  1.00 39.48  ? 144 GLU D CA  1 
ATOM   6394  C  C   . GLU D  1  63  ? 59.622  20.760  -39.103  1.00 33.42  ? 144 GLU D C   1 
ATOM   6395  O  O   . GLU D  1  63  ? 60.246  21.393  -39.934  1.00 48.14  ? 144 GLU D O   1 
ATOM   6396  C  CB  . GLU D  1  63  ? 58.872  22.002  -37.133  1.00 37.71  ? 144 GLU D CB  1 
ATOM   6397  C  CG  . GLU D  1  63  ? 59.974  23.008  -37.321  1.00 13.57  ? 144 GLU D CG  1 
ATOM   6398  C  CD  . GLU D  1  63  ? 60.366  23.643  -36.008  1.00 42.75  ? 144 GLU D CD  1 
ATOM   6399  O  OE1 . GLU D  1  63  ? 60.735  22.894  -35.075  1.00 45.88  ? 144 GLU D OE1 1 
ATOM   6400  O  OE2 . GLU D  1  63  ? 60.305  24.886  -35.904  1.00 44.42  ? 144 GLU D OE2 1 
ATOM   6401  N  N   . VAL D  1  64  ? 59.971  19.535  -38.742  1.00 40.81  ? 145 VAL D N   1 
ATOM   6402  C  CA  . VAL D  1  64  ? 61.124  18.920  -39.396  1.00 48.97  ? 145 VAL D CA  1 
ATOM   6403  C  C   . VAL D  1  64  ? 60.720  18.519  -40.807  1.00 55.14  ? 145 VAL D C   1 
ATOM   6404  O  O   . VAL D  1  64  ? 61.529  18.605  -41.730  1.00 61.92  ? 145 VAL D O   1 
ATOM   6405  C  CB  . VAL D  1  64  ? 61.669  17.686  -38.636  1.00 55.56  ? 145 VAL D CB  1 
ATOM   6406  C  CG1 . VAL D  1  64  ? 62.502  16.833  -39.572  1.00 55.46  ? 145 VAL D CG1 1 
ATOM   6407  C  CG2 . VAL D  1  64  ? 62.555  18.136  -37.475  1.00 52.10  ? 145 VAL D CG2 1 
ATOM   6408  N  N   . ASP D  1  65  ? 59.467  18.096  -40.980  1.00 57.88  ? 146 ASP D N   1 
ATOM   6409  C  CA  . ASP D  1  65  ? 58.964  17.723  -42.306  1.00 57.35  ? 146 ASP D CA  1 
ATOM   6410  C  C   . ASP D  1  65  ? 59.127  18.938  -43.216  1.00 52.58  ? 146 ASP D C   1 
ATOM   6411  O  O   . ASP D  1  65  ? 59.473  18.800  -44.394  1.00 49.10  ? 146 ASP D O   1 
ATOM   6412  C  CB  . ASP D  1  65  ? 57.483  17.311  -42.247  1.00 62.41  ? 146 ASP D CB  1 
ATOM   6413  C  CG  . ASP D  1  65  ? 57.283  15.825  -41.927  1.00 74.18  ? 146 ASP D CG  1 
ATOM   6414  O  OD1 . ASP D  1  65  ? 56.128  15.437  -41.655  1.00 78.60  ? 146 ASP D OD1 1 
ATOM   6415  O  OD2 . ASP D  1  65  ? 58.260  15.042  -41.953  1.00 82.40  ? 146 ASP D OD2 1 
ATOM   6416  N  N   . ILE D  1  66  ? 58.895  20.121  -42.645  1.00 47.75  ? 147 ILE D N   1 
ATOM   6417  C  CA  . ILE D  1  66  ? 59.015  21.389  -43.359  1.00 37.52  ? 147 ILE D CA  1 
ATOM   6418  C  C   . ILE D  1  66  ? 60.466  21.828  -43.527  1.00 42.91  ? 147 ILE D C   1 
ATOM   6419  O  O   . ILE D  1  66  ? 60.827  22.369  -44.573  1.00 51.43  ? 147 ILE D O   1 
ATOM   6420  C  CB  . ILE D  1  66  ? 58.262  22.497  -42.635  1.00 33.13  ? 147 ILE D CB  1 
ATOM   6421  C  CG1 . ILE D  1  66  ? 56.760  22.332  -42.850  1.00 30.82  ? 147 ILE D CG1 1 
ATOM   6422  C  CG2 . ILE D  1  66  ? 58.744  23.845  -43.106  1.00 22.81  ? 147 ILE D CG2 1 
ATOM   6423  C  CD1 . ILE D  1  66  ? 55.939  23.234  -41.929  1.00 23.67  ? 147 ILE D CD1 1 
ATOM   6424  N  N   . ASP D  1  67  ? 61.297  21.621  -42.510  1.00 35.19  ? 148 ASP D N   1 
ATOM   6425  C  CA  . ASP D  1  67  ? 62.702  22.003  -42.631  1.00 42.15  ? 148 ASP D CA  1 
ATOM   6426  C  C   . ASP D  1  67  ? 63.333  21.171  -43.747  1.00 41.02  ? 148 ASP D C   1 
ATOM   6427  O  O   . ASP D  1  67  ? 64.180  21.648  -44.508  1.00 46.56  ? 148 ASP D O   1 
ATOM   6428  C  CB  . ASP D  1  67  ? 63.464  21.773  -41.312  1.00 28.67  ? 148 ASP D CB  1 
ATOM   6429  C  CG  . ASP D  1  67  ? 64.969  22.019  -41.454  1.00 41.69  ? 148 ASP D CG  1 
ATOM   6430  O  OD1 . ASP D  1  67  ? 65.356  23.141  -41.853  1.00 52.41  ? 148 ASP D OD1 1 
ATOM   6431  O  OD2 . ASP D  1  67  ? 65.771  21.096  -41.182  1.00 41.95  ? 148 ASP D OD2 1 
ATOM   6432  N  N   . VAL D  1  68  ? 62.900  19.921  -43.842  1.00 44.81  ? 149 VAL D N   1 
ATOM   6433  C  CA  . VAL D  1  68  ? 63.400  18.996  -44.857  1.00 48.27  ? 149 VAL D CA  1 
ATOM   6434  C  C   . VAL D  1  68  ? 62.963  19.368  -46.278  1.00 37.52  ? 149 VAL D C   1 
ATOM   6435  O  O   . VAL D  1  68  ? 63.758  19.296  -47.205  1.00 38.85  ? 149 VAL D O   1 
ATOM   6436  C  CB  . VAL D  1  68  ? 62.950  17.544  -44.523  1.00 51.33  ? 149 VAL D CB  1 
ATOM   6437  C  CG1 . VAL D  1  68  ? 63.101  16.620  -45.726  1.00 39.55  ? 149 VAL D CG1 1 
ATOM   6438  C  CG2 . VAL D  1  68  ? 63.784  17.023  -43.371  1.00 57.74  ? 149 VAL D CG2 1 
ATOM   6439  N  N   . ALA D  1  69  ? 61.702  19.767  -46.438  1.00 44.81  ? 150 ALA D N   1 
ATOM   6440  C  CA  . ALA D  1  69  ? 61.158  20.148  -47.742  1.00 33.40  ? 150 ALA D CA  1 
ATOM   6441  C  C   . ALA D  1  69  ? 61.727  21.474  -48.211  1.00 40.98  ? 150 ALA D C   1 
ATOM   6442  O  O   . ALA D  1  69  ? 62.297  21.550  -49.298  1.00 48.61  ? 150 ALA D O   1 
ATOM   6443  C  CB  . ALA D  1  69  ? 59.640  20.238  -47.679  1.00 28.87  ? 150 ALA D CB  1 
ATOM   6444  N  N   . LEU D  1  70  ? 61.565  22.521  -47.404  1.00 26.57  ? 151 LEU D N   1 
ATOM   6445  C  CA  . LEU D  1  70  ? 62.075  23.833  -47.765  1.00 33.26  ? 151 LEU D CA  1 
ATOM   6446  C  C   . LEU D  1  70  ? 63.493  23.787  -48.318  1.00 41.25  ? 151 LEU D C   1 
ATOM   6447  O  O   . LEU D  1  70  ? 63.840  24.479  -49.278  1.00 58.34  ? 151 LEU D O   1 
ATOM   6448  C  CB  . LEU D  1  70  ? 62.046  24.740  -46.551  1.00 25.97  ? 151 LEU D CB  1 
ATOM   6449  C  CG  . LEU D  1  70  ? 60.918  25.749  -46.550  1.00 26.49  ? 151 LEU D CG  1 
ATOM   6450  C  CD1 . LEU D  1  70  ? 59.734  25.228  -47.356  1.00 19.16  ? 151 LEU D CD1 1 
ATOM   6451  C  CD2 . LEU D  1  70  ? 60.565  26.048  -45.113  1.00 9.22   ? 151 LEU D CD2 1 
ATOM   6452  N  N   . ARG D  1  71  ? 64.319  22.969  -47.697  1.00 41.65  ? 152 ARG D N   1 
ATOM   6453  C  CA  . ARG D  1  71  ? 65.697  22.838  -48.110  1.00 35.24  ? 152 ARG D CA  1 
ATOM   6454  C  C   . ARG D  1  71  ? 65.746  22.311  -49.545  1.00 28.83  ? 152 ARG D C   1 
ATOM   6455  O  O   . ARG D  1  71  ? 66.686  22.585  -50.287  1.00 33.04  ? 152 ARG D O   1 
ATOM   6456  C  CB  . ARG D  1  71  ? 66.400  21.900  -47.127  1.00 24.15  ? 152 ARG D CB  1 
ATOM   6457  C  CG  . ARG D  1  71  ? 67.862  21.728  -47.349  1.00 25.03  ? 152 ARG D CG  1 
ATOM   6458  C  CD  . ARG D  1  71  ? 68.532  21.255  -46.080  1.00 19.63  ? 152 ARG D CD  1 
ATOM   6459  N  NE  . ARG D  1  71  ? 68.747  22.355  -45.148  1.00 37.13  ? 152 ARG D NE  1 
ATOM   6460  C  CZ  . ARG D  1  71  ? 68.101  22.501  -44.001  1.00 41.83  ? 152 ARG D CZ  1 
ATOM   6461  N  NH1 . ARG D  1  71  ? 67.191  21.611  -43.638  1.00 45.36  ? 152 ARG D NH1 1 
ATOM   6462  N  NH2 . ARG D  1  71  ? 68.364  23.545  -43.223  1.00 65.50  ? 152 ARG D NH2 1 
ATOM   6463  N  N   . ALA D  1  72  ? 64.708  21.579  -49.936  1.00 29.77  ? 153 ALA D N   1 
ATOM   6464  C  CA  . ALA D  1  72  ? 64.632  20.995  -51.269  1.00 35.65  ? 153 ALA D CA  1 
ATOM   6465  C  C   . ALA D  1  72  ? 64.607  22.071  -52.322  1.00 36.35  ? 153 ALA D C   1 
ATOM   6466  O  O   . ALA D  1  72  ? 65.178  21.896  -53.400  1.00 47.59  ? 153 ALA D O   1 
ATOM   6467  C  CB  . ALA D  1  72  ? 63.388  20.089  -51.401  1.00 21.66  ? 153 ALA D CB  1 
ATOM   6468  N  N   . CYS D  1  73  ? 63.972  23.195  -51.992  1.00 41.58  ? 154 CYS D N   1 
ATOM   6469  C  CA  . CYS D  1  73  ? 63.836  24.330  -52.913  1.00 37.99  ? 154 CYS D CA  1 
ATOM   6470  C  C   . CYS D  1  73  ? 65.115  24.961  -53.418  1.00 39.90  ? 154 CYS D C   1 
ATOM   6471  O  O   . CYS D  1  73  ? 65.098  25.601  -54.469  1.00 17.58  ? 154 CYS D O   1 
ATOM   6472  C  CB  . CYS D  1  73  ? 62.998  25.413  -52.291  1.00 29.61  ? 154 CYS D CB  1 
ATOM   6473  S  SG  . CYS D  1  73  ? 61.439  24.777  -51.630  1.00 47.91  ? 154 CYS D SG  1 
ATOM   6474  N  N   . LYS D  1  74  ? 66.209  24.796  -52.675  1.00 38.94  ? 155 LYS D N   1 
ATOM   6475  C  CA  . LYS D  1  74  ? 67.492  25.338  -53.101  1.00 36.11  ? 155 LYS D CA  1 
ATOM   6476  C  C   . LYS D  1  74  ? 67.741  24.883  -54.537  1.00 40.31  ? 155 LYS D C   1 
ATOM   6477  O  O   . LYS D  1  74  ? 67.961  25.699  -55.430  1.00 46.11  ? 155 LYS D O   1 
ATOM   6478  C  CB  . LYS D  1  74  ? 68.601  24.827  -52.186  1.00 38.87  ? 155 LYS D CB  1 
ATOM   6479  C  CG  . LYS D  1  74  ? 70.031  25.254  -52.523  1.00 29.08  ? 155 LYS D CG  1 
ATOM   6480  C  CD  . LYS D  1  74  ? 70.876  25.143  -51.239  1.00 55.39  ? 155 LYS D CD  1 
ATOM   6481  C  CE  . LYS D  1  74  ? 72.367  25.407  -51.446  1.00 55.96  ? 155 LYS D CE  1 
ATOM   6482  N  NZ  . LYS D  1  74  ? 73.095  24.233  -52.013  1.00 63.66  ? 155 LYS D NZ  1 
ATOM   6483  N  N   . GLY D  1  75  ? 67.672  23.582  -54.773  1.00 31.61  ? 156 GLY D N   1 
ATOM   6484  C  CA  . GLY D  1  75  ? 67.903  23.104  -56.120  1.00 29.54  ? 156 GLY D CA  1 
ATOM   6485  C  C   . GLY D  1  75  ? 66.686  23.157  -57.022  1.00 33.88  ? 156 GLY D C   1 
ATOM   6486  O  O   . GLY D  1  75  ? 66.700  22.564  -58.104  1.00 31.86  ? 156 GLY D O   1 
ATOM   6487  N  N   . SER D  1  76  ? 65.635  23.860  -56.603  1.00 24.78  ? 157 SER D N   1 
ATOM   6488  C  CA  . SER D  1  76  ? 64.420  23.934  -57.423  1.00 37.93  ? 157 SER D CA  1 
ATOM   6489  C  C   . SER D  1  76  ? 63.949  25.344  -57.813  1.00 42.57  ? 157 SER D C   1 
ATOM   6490  O  O   . SER D  1  76  ? 63.366  25.541  -58.885  1.00 33.56  ? 157 SER D O   1 
ATOM   6491  C  CB  . SER D  1  76  ? 63.274  23.202  -56.715  1.00 37.74  ? 157 SER D CB  1 
ATOM   6492  O  OG  . SER D  1  76  ? 62.055  23.338  -57.420  1.00 27.79  ? 157 SER D OG  1 
ATOM   6493  N  N   . CYS D  1  77  ? 64.218  26.319  -56.950  1.00 45.77  ? 158 CYS D N   1 
ATOM   6494  C  CA  . CYS D  1  77  ? 63.795  27.695  -57.182  1.00 46.56  ? 158 CYS D CA  1 
ATOM   6495  C  C   . CYS D  1  77  ? 64.898  28.703  -57.467  1.00 47.28  ? 158 CYS D C   1 
ATOM   6496  O  O   . CYS D  1  77  ? 66.048  28.519  -57.065  1.00 51.96  ? 158 CYS D O   1 
ATOM   6497  C  CB  . CYS D  1  77  ? 62.965  28.133  -55.988  1.00 48.31  ? 158 CYS D CB  1 
ATOM   6498  S  SG  . CYS D  1  77  ? 61.751  26.828  -55.689  1.00 38.14  ? 158 CYS D SG  1 
ATOM   6499  N  N   . ALA D  1  78  ? 64.519  29.767  -58.176  1.00 51.85  ? 159 ALA D N   1 
ATOM   6500  C  CA  . ALA D  1  78  ? 65.423  30.855  -58.571  1.00 40.79  ? 159 ALA D CA  1 
ATOM   6501  C  C   . ALA D  1  78  ? 66.125  31.480  -57.370  1.00 36.90  ? 159 ALA D C   1 
ATOM   6502  O  O   . ALA D  1  78  ? 67.316  31.758  -57.428  1.00 37.00  ? 159 ALA D O   1 
ATOM   6503  C  CB  . ALA D  1  78  ? 64.645  31.926  -59.336  1.00 11.74  ? 159 ALA D CB  1 
ATOM   6504  N  N   . ARG D  1  79  ? 65.379  31.718  -56.295  1.00 28.65  ? 160 ARG D N   1 
ATOM   6505  C  CA  . ARG D  1  79  ? 65.948  32.271  -55.079  1.00 32.32  ? 160 ARG D CA  1 
ATOM   6506  C  C   . ARG D  1  79  ? 65.679  31.321  -53.919  1.00 30.67  ? 160 ARG D C   1 
ATOM   6507  O  O   . ARG D  1  79  ? 64.588  30.756  -53.798  1.00 28.34  ? 160 ARG D O   1 
ATOM   6508  C  CB  . ARG D  1  79  ? 65.356  33.654  -54.797  1.00 32.50  ? 160 ARG D CB  1 
ATOM   6509  C  CG  . ARG D  1  79  ? 66.111  34.762  -55.487  1.00 19.78  ? 160 ARG D CG  1 
ATOM   6510  C  CD  . ARG D  1  79  ? 65.218  35.946  -55.829  1.00 36.14  ? 160 ARG D CD  1 
ATOM   6511  N  NE  . ARG D  1  79  ? 64.596  36.631  -54.692  1.00 20.58  ? 160 ARG D NE  1 
ATOM   6512  C  CZ  . ARG D  1  79  ? 65.256  37.106  -53.639  1.00 30.18  ? 160 ARG D CZ  1 
ATOM   6513  N  NH1 . ARG D  1  79  ? 66.581  36.973  -53.541  1.00 39.92  ? 160 ARG D NH1 1 
ATOM   6514  N  NH2 . ARG D  1  79  ? 64.587  37.737  -52.692  1.00 11.85  ? 160 ARG D NH2 1 
ATOM   6515  N  N   . TYR D  1  80  ? 66.688  31.134  -53.076  1.00 38.08  ? 161 TYR D N   1 
ATOM   6516  C  CA  . TYR D  1  80  ? 66.560  30.243  -51.921  1.00 36.40  ? 161 TYR D CA  1 
ATOM   6517  C  C   . TYR D  1  80  ? 66.963  30.936  -50.653  1.00 25.57  ? 161 TYR D C   1 
ATOM   6518  O  O   . TYR D  1  80  ? 68.053  31.497  -50.586  1.00 31.21  ? 161 TYR D O   1 
ATOM   6519  C  CB  . TYR D  1  80  ? 67.447  29.005  -52.078  1.00 36.37  ? 161 TYR D CB  1 
ATOM   6520  C  CG  . TYR D  1  80  ? 67.459  28.136  -50.845  1.00 42.66  ? 161 TYR D CG  1 
ATOM   6521  C  CD1 . TYR D  1  80  ? 66.290  27.528  -50.390  1.00 43.84  ? 161 TYR D CD1 1 
ATOM   6522  C  CD2 . TYR D  1  80  ? 68.628  27.941  -50.115  1.00 41.19  ? 161 TYR D CD2 1 
ATOM   6523  C  CE1 . TYR D  1  80  ? 66.284  26.754  -49.250  1.00 34.38  ? 161 TYR D CE1 1 
ATOM   6524  C  CE2 . TYR D  1  80  ? 68.628  27.168  -48.964  1.00 29.27  ? 161 TYR D CE2 1 
ATOM   6525  C  CZ  . TYR D  1  80  ? 67.458  26.577  -48.540  1.00 38.05  ? 161 TYR D CZ  1 
ATOM   6526  O  OH  . TYR D  1  80  ? 67.466  25.776  -47.417  1.00 55.16  ? 161 TYR D OH  1 
ATOM   6527  N  N   . LEU D  1  81  ? 66.105  30.888  -49.638  1.00 38.70  ? 162 LEU D N   1 
ATOM   6528  C  CA  . LEU D  1  81  ? 66.435  31.507  -48.359  1.00 44.95  ? 162 LEU D CA  1 
ATOM   6529  C  C   . LEU D  1  81  ? 67.131  30.564  -47.369  1.00 53.85  ? 162 LEU D C   1 
ATOM   6530  O  O   . LEU D  1  81  ? 68.367  30.461  -47.372  1.00 61.72  ? 162 LEU D O   1 
ATOM   6531  C  CB  . LEU D  1  81  ? 65.193  32.120  -47.718  1.00 42.54  ? 162 LEU D CB  1 
ATOM   6532  C  CG  . LEU D  1  81  ? 65.118  33.648  -47.839  1.00 33.97  ? 162 LEU D CG  1 
ATOM   6533  C  CD1 . LEU D  1  81  ? 66.109  34.305  -46.936  1.00 28.44  ? 162 LEU D CD1 1 
ATOM   6534  C  CD2 . LEU D  1  81  ? 65.423  34.048  -49.261  1.00 59.49  ? 162 LEU D CD2 1 
ATOM   6535  N  N   . GLU D  1  82  ? 66.353  29.878  -46.537  1.00 42.52  ? 163 GLU D N   1 
ATOM   6536  C  CA  . GLU D  1  82  ? 66.911  28.967  -45.527  1.00 44.46  ? 163 GLU D CA  1 
ATOM   6537  C  C   . GLU D  1  82  ? 66.082  29.095  -44.270  1.00 41.81  ? 163 GLU D C   1 
ATOM   6538  O  O   . GLU D  1  82  ? 66.084  30.144  -43.624  1.00 49.63  ? 163 GLU D O   1 
ATOM   6539  C  CB  . GLU D  1  82  ? 68.373  29.331  -45.184  1.00 46.32  ? 163 GLU D CB  1 
ATOM   6540  C  CG  . GLU D  1  82  ? 68.970  28.646  -43.957  1.00 56.94  ? 163 GLU D CG  1 
ATOM   6541  C  CD  . GLU D  1  82  ? 69.468  27.229  -44.227  1.00 78.02  ? 163 GLU D CD  1 
ATOM   6542  O  OE1 . GLU D  1  82  ? 69.720  26.475  -43.251  1.00 80.64  ? 163 GLU D OE1 1 
ATOM   6543  O  OE2 . GLU D  1  82  ? 69.620  26.872  -45.414  1.00 80.23  ? 163 GLU D OE2 1 
ATOM   6544  N  N   . TYR D  1  83  ? 65.360  28.044  -43.919  1.00 30.09  ? 164 TYR D N   1 
ATOM   6545  C  CA  . TYR D  1  83  ? 64.571  28.086  -42.699  1.00 42.34  ? 164 TYR D CA  1 
ATOM   6546  C  C   . TYR D  1  83  ? 65.486  27.677  -41.561  1.00 54.25  ? 164 TYR D C   1 
ATOM   6547  O  O   . TYR D  1  83  ? 66.227  26.693  -41.669  1.00 59.26  ? 164 TYR D O   1 
ATOM   6548  C  CB  . TYR D  1  83  ? 63.393  27.127  -42.776  1.00 29.86  ? 164 TYR D CB  1 
ATOM   6549  C  CG  . TYR D  1  83  ? 62.618  26.976  -41.483  1.00 38.09  ? 164 TYR D CG  1 
ATOM   6550  C  CD1 . TYR D  1  83  ? 61.915  28.043  -40.936  1.00 29.25  ? 164 TYR D CD1 1 
ATOM   6551  C  CD2 . TYR D  1  83  ? 62.545  25.740  -40.831  1.00 47.58  ? 164 TYR D CD2 1 
ATOM   6552  C  CE1 . TYR D  1  83  ? 61.145  27.881  -39.774  1.00 42.96  ? 164 TYR D CE1 1 
ATOM   6553  C  CE2 . TYR D  1  83  ? 61.782  25.571  -39.672  1.00 45.12  ? 164 TYR D CE2 1 
ATOM   6554  C  CZ  . TYR D  1  83  ? 61.082  26.642  -39.155  1.00 45.37  ? 164 TYR D CZ  1 
ATOM   6555  O  OH  . TYR D  1  83  ? 60.293  26.456  -38.044  1.00 47.80  ? 164 TYR D OH  1 
ATOM   6556  N  N   . ARG D  1  84  ? 65.441  28.445  -40.477  1.00 74.83  ? 165 ARG D N   1 
ATOM   6557  C  CA  . ARG D  1  84  ? 66.269  28.169  -39.311  1.00 84.79  ? 165 ARG D CA  1 
ATOM   6558  C  C   . ARG D  1  84  ? 65.463  27.677  -38.112  1.00 82.83  ? 165 ARG D C   1 
ATOM   6559  O  O   . ARG D  1  84  ? 64.500  28.323  -37.695  1.00 80.32  ? 165 ARG D O   1 
ATOM   6560  C  CB  . ARG D  1  84  ? 67.083  29.418  -38.915  1.00 87.31  ? 165 ARG D CB  1 
ATOM   6561  C  CG  . ARG D  1  84  ? 66.401  30.758  -39.160  1.00 85.10  ? 165 ARG D CG  1 
ATOM   6562  C  CD  . ARG D  1  84  ? 66.467  31.144  -40.636  1.00 99.18  ? 165 ARG D CD  1 
ATOM   6563  N  NE  . ARG D  1  84  ? 65.811  32.418  -40.928  1.00 104.18 ? 165 ARG D NE  1 
ATOM   6564  C  CZ  . ARG D  1  84  ? 66.378  33.615  -40.810  1.00 98.92  ? 165 ARG D CZ  1 
ATOM   6565  N  NH1 . ARG D  1  84  ? 67.638  33.730  -40.401  1.00 93.11  ? 165 ARG D NH1 1 
ATOM   6566  N  NH2 . ARG D  1  84  ? 65.678  34.700  -41.112  1.00 98.23  ? 165 ARG D NH2 1 
ATOM   6567  N  N   . LEU D  1  85  ? 65.856  26.520  -37.581  1.00 79.03  ? 166 LEU D N   1 
ATOM   6568  C  CA  . LEU D  1  85  ? 65.206  25.950  -36.411  1.00 80.09  ? 166 LEU D CA  1 
ATOM   6569  C  C   . LEU D  1  85  ? 65.613  26.779  -35.203  1.00 85.85  ? 166 LEU D C   1 
ATOM   6570  O  O   . LEU D  1  85  ? 66.111  27.891  -35.364  1.00 89.94  ? 166 LEU D O   1 
ATOM   6571  C  CB  . LEU D  1  85  ? 65.629  24.500  -36.214  1.00 84.24  ? 166 LEU D CB  1 
ATOM   6572  C  CG  . LEU D  1  85  ? 64.861  23.463  -37.034  1.00 93.78  ? 166 LEU D CG  1 
ATOM   6573  C  CD1 . LEU D  1  85  ? 65.311  22.048  -36.662  1.00 87.75  ? 166 LEU D CD1 1 
ATOM   6574  C  CD2 . LEU D  1  85  ? 63.377  23.629  -36.759  1.00 93.74  ? 166 LEU D CD2 1 
ATOM   6575  N  N   . ASP D  1  86  ? 65.425  26.254  -33.995  1.00 90.37  ? 167 ASP D N   1 
ATOM   6576  C  CA  . ASP D  1  86  ? 65.777  27.035  -32.815  1.00 92.95  ? 167 ASP D CA  1 
ATOM   6577  C  C   . ASP D  1  86  ? 65.948  26.255  -31.502  1.00 101.97 ? 167 ASP D C   1 
ATOM   6578  O  O   . ASP D  1  86  ? 66.755  25.321  -31.396  1.00 104.34 ? 167 ASP D O   1 
ATOM   6579  C  CB  . ASP D  1  86  ? 64.720  28.125  -32.619  1.00 79.21  ? 167 ASP D CB  1 
ATOM   6580  C  CG  . ASP D  1  86  ? 65.269  29.350  -31.937  1.00 78.17  ? 167 ASP D CG  1 
ATOM   6581  O  OD1 . ASP D  1  86  ? 66.154  29.192  -31.067  1.00 72.82  ? 167 ASP D OD1 1 
ATOM   6582  O  OD2 . ASP D  1  86  ? 64.805  30.466  -32.268  1.00 73.18  ? 167 ASP D OD2 1 
ATOM   6583  N  N   . LYS D  1  87  ? 65.170  26.673  -30.506  1.00 107.71 ? 168 LYS D N   1 
ATOM   6584  C  CA  . LYS D  1  87  ? 65.174  26.101  -29.164  1.00 99.29  ? 168 LYS D CA  1 
ATOM   6585  C  C   . LYS D  1  87  ? 64.283  24.871  -29.021  1.00 105.30 ? 168 LYS D C   1 
ATOM   6586  O  O   . LYS D  1  87  ? 63.250  24.730  -29.688  1.00 98.97  ? 168 LYS D O   1 
ATOM   6587  C  CB  . LYS D  1  87  ? 64.654  27.130  -28.179  1.00 78.17  ? 168 LYS D CB  1 
ATOM   6588  C  CG  . LYS D  1  87  ? 63.139  27.192  -28.231  1.00 59.53  ? 168 LYS D CG  1 
ATOM   6589  C  CD  . LYS D  1  87  ? 62.614  28.499  -27.718  1.00 76.87  ? 168 LYS D CD  1 
ATOM   6590  C  CE  . LYS D  1  87  ? 63.105  29.638  -28.578  1.00 77.25  ? 168 LYS D CE  1 
ATOM   6591  N  NZ  . LYS D  1  87  ? 62.703  29.451  -29.995  1.00 65.10  ? 168 LYS D NZ  1 
ATOM   6592  N  N   . GLU D  1  88  ? 64.697  23.998  -28.114  1.00 110.99 ? 169 GLU D N   1 
ATOM   6593  C  CA  . GLU D  1  88  ? 63.949  22.799  -27.790  1.00 107.21 ? 169 GLU D CA  1 
ATOM   6594  C  C   . GLU D  1  88  ? 63.415  23.142  -26.406  1.00 102.21 ? 169 GLU D C   1 
ATOM   6595  O  O   . GLU D  1  88  ? 62.839  22.308  -25.709  1.00 97.33  ? 169 GLU D O   1 
ATOM   6596  C  CB  . GLU D  1  88  ? 64.875  21.575  -27.750  1.00 113.81 ? 169 GLU D CB  1 
ATOM   6597  C  CG  . GLU D  1  88  ? 65.981  21.629  -26.709  1.00 112.21 ? 169 GLU D CG  1 
ATOM   6598  C  CD  . GLU D  1  88  ? 65.454  21.472  -25.303  1.00 117.70 ? 169 GLU D CD  1 
ATOM   6599  O  OE1 . GLU D  1  88  ? 64.869  20.410  -25.004  1.00 114.40 ? 169 GLU D OE1 1 
ATOM   6600  O  OE2 . GLU D  1  88  ? 65.619  22.414  -24.501  1.00 123.04 ? 169 GLU D OE2 1 
ATOM   6601  N  N   . LYS D  1  89  ? 63.639  24.398  -26.023  1.00 95.97  ? 170 LYS D N   1 
ATOM   6602  C  CA  . LYS D  1  89  ? 63.184  24.920  -24.745  1.00 93.22  ? 170 LYS D CA  1 
ATOM   6603  C  C   . LYS D  1  89  ? 61.682  24.661  -24.635  1.00 88.85  ? 170 LYS D C   1 
ATOM   6604  O  O   . LYS D  1  89  ? 61.106  24.660  -23.552  1.00 85.18  ? 170 LYS D O   1 
ATOM   6605  C  CB  . LYS D  1  89  ? 63.490  26.419  -24.664  1.00 92.80  ? 170 LYS D CB  1 
ATOM   6606  C  CG  . LYS D  1  89  ? 62.861  27.135  -23.477  1.00 100.16 ? 170 LYS D CG  1 
ATOM   6607  C  CD  . LYS D  1  89  ? 61.427  27.588  -23.773  1.00 106.21 ? 170 LYS D CD  1 
ATOM   6608  C  CE  . LYS D  1  89  ? 61.383  28.850  -24.642  1.00 105.81 ? 170 LYS D CE  1 
ATOM   6609  N  NZ  . LYS D  1  89  ? 61.945  30.055  -23.953  1.00 90.15  ? 170 LYS D NZ  1 
ATOM   6610  N  N   . ASN D  1  90  ? 61.055  24.442  -25.779  1.00 86.35  ? 171 ASN D N   1 
ATOM   6611  C  CA  . ASN D  1  90  ? 59.638  24.152  -25.828  1.00 76.20  ? 171 ASN D CA  1 
ATOM   6612  C  C   . ASN D  1  90  ? 59.414  22.725  -25.315  1.00 79.27  ? 171 ASN D C   1 
ATOM   6613  O  O   . ASN D  1  90  ? 58.373  22.426  -24.738  1.00 71.45  ? 171 ASN D O   1 
ATOM   6614  C  CB  . ASN D  1  90  ? 59.146  24.302  -27.271  1.00 69.89  ? 171 ASN D CB  1 
ATOM   6615  C  CG  . ASN D  1  90  ? 57.699  23.894  -27.449  1.00 73.29  ? 171 ASN D CG  1 
ATOM   6616  O  OD1 . ASN D  1  90  ? 57.356  22.714  -27.361  1.00 83.13  ? 171 ASN D OD1 1 
ATOM   6617  N  ND2 . ASN D  1  90  ? 56.837  24.871  -27.702  1.00 69.91  ? 171 ASN D ND2 1 
ATOM   6618  N  N   . LEU D  1  91  ? 60.393  21.845  -25.516  1.00 87.34  ? 172 LEU D N   1 
ATOM   6619  C  CA  . LEU D  1  91  ? 60.269  20.458  -25.061  1.00 93.40  ? 172 LEU D CA  1 
ATOM   6620  C  C   . LEU D  1  91  ? 60.399  20.358  -23.550  1.00 93.61  ? 172 LEU D C   1 
ATOM   6621  O  O   . LEU D  1  91  ? 59.952  19.384  -22.942  1.00 91.34  ? 172 LEU D O   1 
ATOM   6622  C  CB  . LEU D  1  91  ? 61.313  19.556  -25.732  1.00 103.32 ? 172 LEU D CB  1 
ATOM   6623  C  CG  . LEU D  1  91  ? 61.149  19.312  -27.240  1.00 119.64 ? 172 LEU D CG  1 
ATOM   6624  C  CD1 . LEU D  1  91  ? 62.203  18.306  -27.709  1.00 119.62 ? 172 LEU D CD1 1 
ATOM   6625  C  CD2 . LEU D  1  91  ? 59.740  18.796  -27.548  1.00 112.47 ? 172 LEU D CD2 1 
ATOM   6626  N  N   . GLN D  1  92  ? 61.025  21.361  -22.944  1.00 93.27  ? 173 GLN D N   1 
ATOM   6627  C  CA  . GLN D  1  92  ? 61.164  21.384  -21.494  1.00 97.26  ? 173 GLN D CA  1 
ATOM   6628  C  C   . GLN D  1  92  ? 59.781  21.744  -20.988  1.00 93.08  ? 173 GLN D C   1 
ATOM   6629  O  O   . GLN D  1  92  ? 59.146  20.975  -20.276  1.00 94.87  ? 173 GLN D O   1 
ATOM   6630  C  CB  . GLN D  1  92  ? 62.155  22.466  -21.049  1.00 104.08 ? 173 GLN D CB  1 
ATOM   6631  C  CG  . GLN D  1  92  ? 63.602  22.226  -21.456  1.00 115.52 ? 173 GLN D CG  1 
ATOM   6632  C  CD  . GLN D  1  92  ? 64.330  21.281  -20.522  1.00 117.93 ? 173 GLN D CD  1 
ATOM   6633  O  OE1 . GLN D  1  92  ? 63.877  20.163  -20.271  1.00 121.53 ? 173 GLN D OE1 1 
ATOM   6634  N  NE2 . GLN D  1  92  ? 65.471  21.726  -20.005  1.00 118.87 ? 173 GLN D NE2 1 
ATOM   6635  N  N   . LEU D  1  93  ? 59.323  22.924  -21.393  1.00 88.80  ? 174 LEU D N   1 
ATOM   6636  C  CA  . LEU D  1  93  ? 58.021  23.452  -21.010  1.00 87.36  ? 174 LEU D CA  1 
ATOM   6637  C  C   . LEU D  1  93  ? 56.915  22.437  -21.257  1.00 87.06  ? 174 LEU D C   1 
ATOM   6638  O  O   . LEU D  1  93  ? 56.044  22.235  -20.409  1.00 87.66  ? 174 LEU D O   1 
ATOM   6639  C  CB  . LEU D  1  93  ? 57.736  24.734  -21.797  1.00 100.03 ? 174 LEU D CB  1 
ATOM   6640  C  CG  . LEU D  1  93  ? 58.910  25.719  -21.944  1.00 113.68 ? 174 LEU D CG  1 
ATOM   6641  C  CD1 . LEU D  1  93  ? 58.429  26.991  -22.645  1.00 116.90 ? 174 LEU D CD1 1 
ATOM   6642  C  CD2 . LEU D  1  93  ? 59.502  26.053  -20.573  1.00 115.84 ? 174 LEU D CD2 1 
ATOM   6643  N  N   . GLU D  1  94  ? 56.950  21.803  -22.424  1.00 90.38  ? 175 GLU D N   1 
ATOM   6644  C  CA  . GLU D  1  94  ? 55.956  20.793  -22.777  1.00 92.40  ? 175 GLU D CA  1 
ATOM   6645  C  C   . GLU D  1  94  ? 55.972  19.665  -21.759  1.00 88.86  ? 175 GLU D C   1 
ATOM   6646  O  O   . GLU D  1  94  ? 54.954  19.000  -21.535  1.00 79.30  ? 175 GLU D O   1 
ATOM   6647  C  CB  . GLU D  1  94  ? 56.246  20.227  -24.172  1.00 100.34 ? 175 GLU D CB  1 
ATOM   6648  C  CG  . GLU D  1  94  ? 55.988  18.716  -24.330  1.00 121.49 ? 175 GLU D CG  1 
ATOM   6649  C  CD  . GLU D  1  94  ? 57.135  17.838  -23.801  1.00 130.65 ? 175 GLU D CD  1 
ATOM   6650  O  OE1 . GLU D  1  94  ? 58.265  17.916  -24.340  1.00 134.74 ? 175 GLU D OE1 1 
ATOM   6651  O  OE2 . GLU D  1  94  ? 56.904  17.065  -22.846  1.00 129.30 ? 175 GLU D OE2 1 
ATOM   6652  N  N   . LYS D  1  95  ? 57.142  19.456  -21.157  1.00 87.27  ? 176 LYS D N   1 
ATOM   6653  C  CA  . LYS D  1  95  ? 57.331  18.403  -20.171  1.00 84.44  ? 176 LYS D CA  1 
ATOM   6654  C  C   . LYS D  1  95  ? 56.626  18.735  -18.859  1.00 81.29  ? 176 LYS D C   1 
ATOM   6655  O  O   . LYS D  1  95  ? 55.924  17.892  -18.308  1.00 82.57  ? 176 LYS D O   1 
ATOM   6656  C  CB  . LYS D  1  95  ? 58.824  18.163  -19.937  1.00 85.39  ? 176 LYS D CB  1 
ATOM   6657  C  CG  . LYS D  1  95  ? 59.157  16.726  -19.603  1.00 90.73  ? 176 LYS D CG  1 
ATOM   6658  C  CD  . LYS D  1  95  ? 58.647  15.783  -20.690  1.00 98.29  ? 176 LYS D CD  1 
ATOM   6659  C  CE  . LYS D  1  95  ? 58.971  14.321  -20.375  1.00 103.94 ? 176 LYS D CE  1 
ATOM   6660  N  NZ  . LYS D  1  95  ? 58.315  13.361  -21.318  1.00 100.46 ? 176 LYS D NZ  1 
ATOM   6661  N  N   . ALA D  1  96  ? 56.805  19.950  -18.349  1.00 70.05  ? 177 ALA D N   1 
ATOM   6662  C  CA  . ALA D  1  96  ? 56.114  20.303  -17.125  1.00 63.31  ? 177 ALA D CA  1 
ATOM   6663  C  C   . ALA D  1  96  ? 54.651  20.091  -17.463  1.00 62.10  ? 177 ALA D C   1 
ATOM   6664  O  O   . ALA D  1  96  ? 54.033  19.157  -16.964  1.00 62.55  ? 177 ALA D O   1 
ATOM   6665  C  CB  . ALA D  1  96  ? 56.370  21.755  -16.742  1.00 45.65  ? 177 ALA D CB  1 
ATOM   6666  N  N   . ALA D  1  97  ? 54.129  20.926  -18.362  1.00 64.80  ? 178 ALA D N   1 
ATOM   6667  C  CA  . ALA D  1  97  ? 52.726  20.873  -18.780  1.00 63.96  ? 178 ALA D CA  1 
ATOM   6668  C  C   . ALA D  1  97  ? 52.127  19.472  -18.834  1.00 67.08  ? 178 ALA D C   1 
ATOM   6669  O  O   . ALA D  1  97  ? 50.919  19.310  -18.687  1.00 72.85  ? 178 ALA D O   1 
ATOM   6670  C  CB  . ALA D  1  97  ? 52.548  21.573  -20.126  1.00 47.88  ? 178 ALA D CB  1 
ATOM   6671  N  N   . SER D  1  98  ? 52.954  18.456  -19.040  1.00 71.18  ? 179 SER D N   1 
ATOM   6672  C  CA  . SER D  1  98  ? 52.434  17.097  -19.083  1.00 81.98  ? 179 SER D CA  1 
ATOM   6673  C  C   . SER D  1  98  ? 52.855  16.370  -17.821  1.00 80.98  ? 179 SER D C   1 
ATOM   6674  O  O   . SER D  1  98  ? 52.024  15.825  -17.102  1.00 80.49  ? 179 SER D O   1 
ATOM   6675  C  CB  . SER D  1  98  ? 52.959  16.345  -20.306  1.00 79.66  ? 179 SER D CB  1 
ATOM   6676  O  OG  . SER D  1  98  ? 54.331  16.047  -20.150  1.00 87.77  ? 179 SER D OG  1 
ATOM   6677  N  N   . TYR D  1  99  ? 54.154  16.367  -17.553  1.00 89.05  ? 180 TYR D N   1 
ATOM   6678  C  CA  . TYR D  1  99  ? 54.667  15.703  -16.367  1.00 100.86 ? 180 TYR D CA  1 
ATOM   6679  C  C   . TYR D  1  99  ? 53.992  16.240  -15.118  1.00 98.65  ? 180 TYR D C   1 
ATOM   6680  O  O   . TYR D  1  99  ? 53.640  15.468  -14.225  1.00 91.99  ? 180 TYR D O   1 
ATOM   6681  C  CB  . TYR D  1  99  ? 56.183  15.859  -16.280  1.00 120.63 ? 180 TYR D CB  1 
ATOM   6682  C  CG  . TYR D  1  99  ? 56.904  14.583  -16.648  1.00 142.05 ? 180 TYR D CG  1 
ATOM   6683  C  CD1 . TYR D  1  99  ? 56.621  13.920  -17.845  1.00 148.56 ? 180 TYR D CD1 1 
ATOM   6684  C  CD2 . TYR D  1  99  ? 57.830  14.007  -15.779  1.00 152.10 ? 180 TYR D CD2 1 
ATOM   6685  C  CE1 . TYR D  1  99  ? 57.238  12.710  -18.164  1.00 154.44 ? 180 TYR D CE1 1 
ATOM   6686  C  CE2 . TYR D  1  99  ? 58.455  12.798  -16.089  1.00 158.25 ? 180 TYR D CE2 1 
ATOM   6687  C  CZ  . TYR D  1  99  ? 58.153  12.155  -17.282  1.00 158.26 ? 180 TYR D CZ  1 
ATOM   6688  O  OH  . TYR D  1  99  ? 58.757  10.955  -17.584  1.00 160.14 ? 180 TYR D OH  1 
ATOM   6689  N  N   . ILE D  1  100 ? 53.817  17.558  -15.042  1.00 92.76  ? 181 ILE D N   1 
ATOM   6690  C  CA  . ILE D  1  100 ? 53.118  18.125  -13.899  1.00 86.79  ? 181 ILE D CA  1 
ATOM   6691  C  C   . ILE D  1  100 ? 51.677  17.661  -14.147  1.00 89.38  ? 181 ILE D C   1 
ATOM   6692  O  O   . ILE D  1  100 ? 50.761  18.452  -14.387  1.00 83.72  ? 181 ILE D O   1 
ATOM   6693  C  CB  . ILE D  1  100 ? 53.230  19.694  -13.842  1.00 80.79  ? 181 ILE D CB  1 
ATOM   6694  C  CG1 . ILE D  1  100 ? 52.382  20.357  -14.934  1.00 69.33  ? 181 ILE D CG1 1 
ATOM   6695  C  CG2 . ILE D  1  100 ? 54.696  20.116  -13.982  1.00 79.65  ? 181 ILE D CG2 1 
ATOM   6696  C  CD1 . ILE D  1  100 ? 51.191  21.121  -14.409  1.00 53.25  ? 181 ILE D CD1 1 
ATOM   6697  N  N   . ALA D  1  101 ? 51.521  16.338  -14.147  1.00 88.83  ? 182 ALA D N   1 
ATOM   6698  C  CA  . ALA D  1  101 ? 50.241  15.680  -14.371  1.00 96.93  ? 182 ALA D CA  1 
ATOM   6699  C  C   . ALA D  1  101 ? 49.505  15.583  -13.050  1.00 100.80 ? 182 ALA D C   1 
ATOM   6700  O  O   . ALA D  1  101 ? 48.861  14.573  -12.750  1.00 97.41  ? 182 ALA D O   1 
ATOM   6701  C  CB  . ALA D  1  101 ? 50.451  14.283  -14.960  1.00 97.80  ? 182 ALA D CB  1 
ATOM   6702  N  N   . ASN D  1  102 ? 49.629  16.643  -12.258  1.00 102.93 ? 183 ASN D N   1 
ATOM   6703  C  CA  . ASN D  1  102 ? 48.971  16.724  -10.968  1.00 103.93 ? 183 ASN D CA  1 
ATOM   6704  C  C   . ASN D  1  102 ? 47.515  16.331  -11.201  1.00 102.75 ? 183 ASN D C   1 
ATOM   6705  O  O   . ASN D  1  102 ? 47.188  15.145  -11.220  1.00 104.73 ? 183 ASN D O   1 
ATOM   6706  C  CB  . ASN D  1  102 ? 49.064  18.156  -10.430  1.00 105.83 ? 183 ASN D CB  1 
ATOM   6707  C  CG  . ASN D  1  102 ? 50.418  18.798  -10.706  1.00 105.56 ? 183 ASN D CG  1 
ATOM   6708  O  OD1 . ASN D  1  102 ? 51.446  18.117  -10.752  1.00 102.42 ? 183 ASN D OD1 1 
ATOM   6709  N  ND2 . ASN D  1  102 ? 50.425  20.117  -10.878  1.00 107.34 ? 183 ASN D ND2 1 
ATOM   6710  N  N   . LEU D  1  103 ? 46.656  17.329  -11.399  1.00 95.28  ? 184 LEU D N   1 
ATOM   6711  C  CA  . LEU D  1  103 ? 45.236  17.102  -11.651  1.00 92.14  ? 184 LEU D CA  1 
ATOM   6712  C  C   . LEU D  1  103 ? 44.782  15.770  -11.054  1.00 96.26  ? 184 LEU D C   1 
ATOM   6713  O  O   . LEU D  1  103 ? 45.152  15.448  -9.926   1.00 98.45  ? 184 LEU D O   1 
ATOM   6714  C  CB  . LEU D  1  103 ? 44.967  17.130  -13.156  1.00 80.47  ? 184 LEU D CB  1 
ATOM   6715  C  CG  . LEU D  1  103 ? 45.955  17.947  -13.997  1.00 78.94  ? 184 LEU D CG  1 
ATOM   6716  C  CD1 . LEU D  1  103 ? 45.516  17.851  -15.435  1.00 75.81  ? 184 LEU D CD1 1 
ATOM   6717  C  CD2 . LEU D  1  103 ? 46.047  19.406  -13.543  1.00 51.28  ? 184 LEU D CD2 1 
ATOM   6718  N  N   . LYS D  1  104 ? 44.002  14.991  -11.804  1.00 106.46 ? 185 LYS D N   1 
ATOM   6719  C  CA  . LYS D  1  104 ? 43.506  13.703  -11.308  1.00 119.17 ? 185 LYS D CA  1 
ATOM   6720  C  C   . LYS D  1  104 ? 42.649  13.916  -10.060  1.00 127.20 ? 185 LYS D C   1 
ATOM   6721  O  O   . LYS D  1  104 ? 41.424  13.733  -10.084  1.00 128.02 ? 185 LYS D O   1 
ATOM   6722  C  CB  . LYS D  1  104 ? 44.671  12.767  -10.949  1.00 119.41 ? 185 LYS D CB  1 
ATOM   6723  C  CG  . LYS D  1  104 ? 45.222  11.928  -12.092  1.00 119.76 ? 185 LYS D CG  1 
ATOM   6724  C  CD  . LYS D  1  104 ? 46.182  10.873  -11.554  1.00 118.42 ? 185 LYS D CD  1 
ATOM   6725  C  CE  . LYS D  1  104 ? 46.669  9.932   -12.647  1.00 120.13 ? 185 LYS D CE  1 
ATOM   6726  N  NZ  . LYS D  1  104 ? 47.596  8.887   -12.110  1.00 117.75 ? 185 LYS D NZ  1 
ATOM   6727  N  N   . PHE D  1  105 ? 43.329  14.287  -8.974   1.00 131.26 ? 186 PHE D N   1 
ATOM   6728  C  CA  . PHE D  1  105 ? 42.730  14.568  -7.673   1.00 131.06 ? 186 PHE D CA  1 
ATOM   6729  C  C   . PHE D  1  105 ? 41.249  14.910  -7.779   1.00 131.42 ? 186 PHE D C   1 
ATOM   6730  O  O   . PHE D  1  105 ? 40.869  16.065  -7.953   1.00 132.43 ? 186 PHE D O   1 
ATOM   6731  C  CB  . PHE D  1  105 ? 43.502  15.714  -7.007   1.00 130.30 ? 186 PHE D CB  1 
ATOM   6732  C  CG  . PHE D  1  105 ? 42.728  16.437  -5.945   1.00 141.58 ? 186 PHE D CG  1 
ATOM   6733  C  CD1 . PHE D  1  105 ? 42.261  15.764  -4.821   1.00 146.98 ? 186 PHE D CD1 1 
ATOM   6734  C  CD2 . PHE D  1  105 ? 42.455  17.795  -6.075   1.00 144.32 ? 186 PHE D CD2 1 
ATOM   6735  C  CE1 . PHE D  1  105 ? 41.534  16.435  -3.845   1.00 148.09 ? 186 PHE D CE1 1 
ATOM   6736  C  CE2 . PHE D  1  105 ? 41.728  18.474  -5.104   1.00 146.17 ? 186 PHE D CE2 1 
ATOM   6737  C  CZ  . PHE D  1  105 ? 41.267  17.795  -3.989   1.00 147.77 ? 186 PHE D CZ  1 
ATOM   6738  N  N   . GLU D  1  106 ? 40.409  13.893  -7.674   1.00 134.16 ? 187 GLU D N   1 
ATOM   6739  C  CA  . GLU D  1  106 ? 38.983  14.109  -7.772   1.00 140.50 ? 187 GLU D CA  1 
ATOM   6740  C  C   . GLU D  1  106 ? 38.330  13.941  -6.404   1.00 147.85 ? 187 GLU D C   1 
ATOM   6741  O  O   . GLU D  1  106 ? 38.028  12.822  -5.987   1.00 155.51 ? 187 GLU D O   1 
ATOM   6742  C  CB  . GLU D  1  106 ? 38.393  13.126  -8.782   1.00 137.21 ? 187 GLU D CB  1 
ATOM   6743  C  CG  . GLU D  1  106 ? 37.118  13.612  -9.435   1.00 139.35 ? 187 GLU D CG  1 
ATOM   6744  C  CD  . GLU D  1  106 ? 36.844  12.908  -10.742  1.00 136.87 ? 187 GLU D CD  1 
ATOM   6745  O  OE1 . GLU D  1  106 ? 37.753  12.893  -11.599  1.00 134.77 ? 187 GLU D OE1 1 
ATOM   6746  O  OE2 . GLU D  1  106 ? 35.727  12.376  -10.914  1.00 131.44 ? 187 GLU D OE2 1 
ATOM   6747  N  N   . ARG D  1  107 ? 38.125  15.061  -5.711   1.00 149.60 ? 188 ARG D N   1 
ATOM   6748  C  CA  . ARG D  1  107 ? 37.509  15.060  -4.386   1.00 152.49 ? 188 ARG D CA  1 
ATOM   6749  C  C   . ARG D  1  107 ? 36.416  14.011  -4.208   1.00 154.26 ? 188 ARG D C   1 
ATOM   6750  O  O   . ARG D  1  107 ? 35.313  14.141  -4.742   1.00 156.37 ? 188 ARG D O   1 
ATOM   6751  C  CB  . ARG D  1  107 ? 36.947  16.449  -4.062   1.00 154.43 ? 188 ARG D CB  1 
ATOM   6752  C  CG  . ARG D  1  107 ? 37.963  17.347  -3.400   1.00 163.05 ? 188 ARG D CG  1 
ATOM   6753  C  CD  . ARG D  1  107 ? 38.525  16.627  -2.183   1.00 180.07 ? 188 ARG D CD  1 
ATOM   6754  N  NE  . ARG D  1  107 ? 39.735  17.246  -1.654   1.00 193.08 ? 188 ARG D NE  1 
ATOM   6755  C  CZ  . ARG D  1  107 ? 40.582  16.635  -0.830   1.00 198.52 ? 188 ARG D CZ  1 
ATOM   6756  N  NH1 . ARG D  1  107 ? 40.350  15.386  -0.440   1.00 199.15 ? 188 ARG D NH1 1 
ATOM   6757  N  NH2 . ARG D  1  107 ? 41.670  17.265  -0.408   1.00 201.31 ? 188 ARG D NH2 1 
ATOM   6758  N  N   . PHE D  1  108 ? 36.732  12.972  -3.442   1.00 152.68 ? 189 PHE D N   1 
ATOM   6759  C  CA  . PHE D  1  108 ? 35.791  11.891  -3.191   1.00 150.71 ? 189 PHE D CA  1 
ATOM   6760  C  C   . PHE D  1  108 ? 34.755  12.328  -2.165   1.00 152.34 ? 189 PHE D C   1 
ATOM   6761  O  O   . PHE D  1  108 ? 33.599  11.906  -2.224   1.00 148.85 ? 189 PHE D O   1 
ATOM   6762  C  CB  . PHE D  1  108 ? 36.542  10.660  -2.686   1.00 147.04 ? 189 PHE D CB  1 
ATOM   6763  C  CG  . PHE D  1  108 ? 37.831  10.404  -3.412   1.00 143.51 ? 189 PHE D CG  1 
ATOM   6764  C  CD1 . PHE D  1  108 ? 39.052  10.540  -2.756   1.00 141.50 ? 189 PHE D CD1 1 
ATOM   6765  C  CD2 . PHE D  1  108 ? 37.829  10.054  -4.761   1.00 140.83 ? 189 PHE D CD2 1 
ATOM   6766  C  CE1 . PHE D  1  108 ? 40.255  10.334  -3.431   1.00 137.87 ? 189 PHE D CE1 1 
ATOM   6767  C  CE2 . PHE D  1  108 ? 39.027  9.846   -5.447   1.00 140.31 ? 189 PHE D CE2 1 
ATOM   6768  C  CZ  . PHE D  1  108 ? 40.242  9.987   -4.779   1.00 138.99 ? 189 PHE D CZ  1 
ATOM   6769  N  N   . GLU D  1  109 ? 35.175  13.179  -1.230   1.00 156.23 ? 190 GLU D N   1 
ATOM   6770  C  CA  . GLU D  1  109 ? 34.279  13.679  -0.190   1.00 159.00 ? 190 GLU D CA  1 
ATOM   6771  C  C   . GLU D  1  109 ? 33.218  14.627  -0.741   1.00 159.71 ? 190 GLU D C   1 
ATOM   6772  O  O   . GLU D  1  109 ? 32.500  15.284  0.016    1.00 157.92 ? 190 GLU D O   1 
ATOM   6773  C  CB  . GLU D  1  109 ? 35.076  14.358  0.943    1.00 157.69 ? 190 GLU D CB  1 
ATOM   6774  C  CG  . GLU D  1  109 ? 36.274  15.196  0.507    1.00 152.45 ? 190 GLU D CG  1 
ATOM   6775  C  CD  . GLU D  1  109 ? 37.096  15.702  1.690    1.00 149.26 ? 190 GLU D CD  1 
ATOM   6776  O  OE1 . GLU D  1  109 ? 37.417  14.890  2.583    1.00 146.75 ? 190 GLU D OE1 1 
ATOM   6777  O  OE2 . GLU D  1  109 ? 37.430  16.907  1.725    1.00 144.76 ? 190 GLU D OE2 1 
ATOM   6778  N  N   . GLU D  1  110 ? 33.124  14.690  -2.065   1.00 161.53 ? 191 GLU D N   1 
ATOM   6779  C  CA  . GLU D  1  110 ? 32.127  15.530  -2.712   1.00 162.33 ? 191 GLU D CA  1 
ATOM   6780  C  C   . GLU D  1  110 ? 30.855  14.688  -2.741   1.00 161.87 ? 191 GLU D C   1 
ATOM   6781  O  O   . GLU D  1  110 ? 29.743  15.213  -2.677   1.00 161.13 ? 191 GLU D O   1 
ATOM   6782  C  CB  . GLU D  1  110 ? 32.535  15.863  -4.150   1.00 163.59 ? 191 GLU D CB  1 
ATOM   6783  C  CG  . GLU D  1  110 ? 32.116  14.793  -5.154   1.00 169.26 ? 191 GLU D CG  1 
ATOM   6784  C  CD  . GLU D  1  110 ? 32.223  15.249  -6.593   1.00 173.40 ? 191 GLU D CD  1 
ATOM   6785  O  OE1 . GLU D  1  110 ? 33.352  15.300  -7.120   1.00 177.65 ? 191 GLU D OE1 1 
ATOM   6786  O  OE2 . GLU D  1  110 ? 31.174  15.561  -7.197   1.00 174.95 ? 191 GLU D OE2 1 
ATOM   6787  N  N   . VAL D  1  111 ? 31.046  13.372  -2.840   1.00 160.90 ? 192 VAL D N   1 
ATOM   6788  C  CA  . VAL D  1  111 ? 29.952  12.403  -2.893   1.00 158.13 ? 192 VAL D CA  1 
ATOM   6789  C  C   . VAL D  1  111 ? 29.061  12.479  -1.652   1.00 157.93 ? 192 VAL D C   1 
ATOM   6790  O  O   . VAL D  1  111 ? 29.237  11.706  -0.704   1.00 157.11 ? 192 VAL D O   1 
ATOM   6791  C  CB  . VAL D  1  111 ? 30.496  10.957  -3.015   1.00 156.77 ? 192 VAL D CB  1 
ATOM   6792  C  CG1 . VAL D  1  111 ? 29.349  9.985   -3.264   1.00 149.45 ? 192 VAL D CG1 1 
ATOM   6793  C  CG2 . VAL D  1  111 ? 31.529  10.881  -4.129   1.00 152.16 ? 192 VAL D CG2 1 
ATOM   6794  N  N   . VAL D  1  112 ? 28.105  13.408  -1.675   1.00 152.22 ? 193 VAL D N   1 
ATOM   6795  C  CA  . VAL D  1  112 ? 27.173  13.614  -0.566   1.00 144.74 ? 193 VAL D CA  1 
ATOM   6796  C  C   . VAL D  1  112 ? 26.928  12.319  0.203    1.00 146.47 ? 193 VAL D C   1 
ATOM   6797  O  O   . VAL D  1  112 ? 27.293  12.274  1.399    1.00 146.72 ? 193 VAL D O   1 
ATOM   6798  C  CB  . VAL D  1  112 ? 25.813  14.156  -1.073   1.00 140.12 ? 193 VAL D CB  1 
ATOM   6799  C  CG1 . VAL D  1  112 ? 24.910  14.488  0.102    1.00 135.54 ? 193 VAL D CG1 1 
ATOM   6800  C  CG2 . VAL D  1  112 ? 26.032  15.385  -1.931   1.00 131.29 ? 193 VAL D CG2 1 
ATOM   6801  N  N   . ALA E  2  7   ? 32.043  21.852  12.728   1.00 110.62 ? 163 ALA E N   1 
ATOM   6802  C  CA  . ALA E  2  7   ? 32.049  23.183  13.403   1.00 112.53 ? 163 ALA E CA  1 
ATOM   6803  C  C   . ALA E  2  7   ? 32.810  24.220  12.575   1.00 113.78 ? 163 ALA E C   1 
ATOM   6804  O  O   . ALA E  2  7   ? 32.757  24.208  11.345   1.00 102.73 ? 163 ALA E O   1 
ATOM   6805  C  CB  . ALA E  2  7   ? 32.673  23.056  14.802   1.00 111.68 ? 163 ALA E CB  1 
ATOM   6806  N  N   . GLN E  2  8   ? 33.515  25.120  13.254   1.00 121.07 ? 164 GLN E N   1 
ATOM   6807  C  CA  . GLN E  2  8   ? 34.281  26.153  12.569   1.00 127.98 ? 164 GLN E CA  1 
ATOM   6808  C  C   . GLN E  2  8   ? 35.515  25.580  11.878   1.00 134.36 ? 164 GLN E C   1 
ATOM   6809  O  O   . GLN E  2  8   ? 35.676  25.723  10.666   1.00 139.77 ? 164 GLN E O   1 
ATOM   6810  C  CB  . GLN E  2  8   ? 34.714  27.250  13.544   1.00 121.50 ? 164 GLN E CB  1 
ATOM   6811  C  CG  . GLN E  2  8   ? 35.544  28.334  12.882   1.00 121.24 ? 164 GLN E CG  1 
ATOM   6812  C  CD  . GLN E  2  8   ? 35.969  29.417  13.841   1.00 126.76 ? 164 GLN E CD  1 
ATOM   6813  O  OE1 . GLN E  2  8   ? 35.135  30.067  14.468   1.00 133.36 ? 164 GLN E OE1 1 
ATOM   6814  N  NE2 . GLN E  2  8   ? 37.274  29.621  13.961   1.00 127.88 ? 164 GLN E NE2 1 
ATOM   6815  N  N   . LYS E  2  9   ? 36.390  24.936  12.645   1.00 138.09 ? 165 LYS E N   1 
ATOM   6816  C  CA  . LYS E  2  9   ? 37.596  24.360  12.067   1.00 138.99 ? 165 LYS E CA  1 
ATOM   6817  C  C   . LYS E  2  9   ? 37.259  23.341  10.990   1.00 137.79 ? 165 LYS E C   1 
ATOM   6818  O  O   . LYS E  2  9   ? 38.027  23.151  10.053   1.00 141.65 ? 165 LYS E O   1 
ATOM   6819  C  CB  . LYS E  2  9   ? 38.472  23.720  13.147   1.00 141.34 ? 165 LYS E CB  1 
ATOM   6820  C  CG  . LYS E  2  9   ? 39.148  24.732  14.065   1.00 144.01 ? 165 LYS E CG  1 
ATOM   6821  C  CD  . LYS E  2  9   ? 40.381  24.140  14.731   1.00 143.70 ? 165 LYS E CD  1 
ATOM   6822  C  CE  . LYS E  2  9   ? 41.424  23.741  13.691   1.00 142.24 ? 165 LYS E CE  1 
ATOM   6823  N  NZ  . LYS E  2  9   ? 42.642  23.143  14.307   1.00 138.51 ? 165 LYS E NZ  1 
ATOM   6824  N  N   . GLU E  2  10  ? 36.111  22.685  11.123   1.00 134.96 ? 166 GLU E N   1 
ATOM   6825  C  CA  . GLU E  2  10  ? 35.686  21.716  10.123   1.00 133.11 ? 166 GLU E CA  1 
ATOM   6826  C  C   . GLU E  2  10  ? 35.646  22.450  8.789    1.00 126.70 ? 166 GLU E C   1 
ATOM   6827  O  O   . GLU E  2  10  ? 35.903  21.873  7.734    1.00 126.17 ? 166 GLU E O   1 
ATOM   6828  C  CB  . GLU E  2  10  ? 34.301  21.172  10.465   1.00 140.33 ? 166 GLU E CB  1 
ATOM   6829  C  CG  . GLU E  2  10  ? 33.636  20.413  9.332    1.00 151.04 ? 166 GLU E CG  1 
ATOM   6830  C  CD  . GLU E  2  10  ? 32.303  19.818  9.738    1.00 159.06 ? 166 GLU E CD  1 
ATOM   6831  O  OE1 . GLU E  2  10  ? 31.471  20.551  10.317   1.00 161.33 ? 166 GLU E OE1 1 
ATOM   6832  O  OE2 . GLU E  2  10  ? 32.086  18.616  9.473    1.00 163.15 ? 166 GLU E OE2 1 
ATOM   6833  N  N   . ILE E  2  11  ? 35.314  23.735  8.851    1.00 122.49 ? 167 ILE E N   1 
ATOM   6834  C  CA  . ILE E  2  11  ? 35.264  24.572  7.665    1.00 120.98 ? 167 ILE E CA  1 
ATOM   6835  C  C   . ILE E  2  11  ? 36.688  25.001  7.352    1.00 123.09 ? 167 ILE E C   1 
ATOM   6836  O  O   . ILE E  2  11  ? 37.149  24.846  6.224    1.00 125.86 ? 167 ILE E O   1 
ATOM   6837  C  CB  . ILE E  2  11  ? 34.386  25.830  7.886    1.00 118.52 ? 167 ILE E CB  1 
ATOM   6838  C  CG1 . ILE E  2  11  ? 32.907  25.458  7.766    1.00 118.87 ? 167 ILE E CG1 1 
ATOM   6839  C  CG2 . ILE E  2  11  ? 34.745  26.912  6.880    1.00 112.29 ? 167 ILE E CG2 1 
ATOM   6840  C  CD1 . ILE E  2  11  ? 31.965  26.640  7.856    1.00 114.32 ? 167 ILE E CD1 1 
ATOM   6841  N  N   . GLU E  2  12  ? 37.385  25.531  8.354    1.00 123.92 ? 168 GLU E N   1 
ATOM   6842  C  CA  . GLU E  2  12  ? 38.764  25.970  8.166    1.00 127.96 ? 168 GLU E CA  1 
ATOM   6843  C  C   . GLU E  2  12  ? 39.619  24.868  7.543    1.00 129.70 ? 168 GLU E C   1 
ATOM   6844  O  O   . GLU E  2  12  ? 40.705  25.133  7.022    1.00 131.73 ? 168 GLU E O   1 
ATOM   6845  C  CB  . GLU E  2  12  ? 39.381  26.405  9.498    1.00 133.58 ? 168 GLU E CB  1 
ATOM   6846  C  CG  . GLU E  2  12  ? 38.857  27.727  10.030   1.00 141.98 ? 168 GLU E CG  1 
ATOM   6847  C  CD  . GLU E  2  12  ? 39.663  28.239  11.210   1.00 146.20 ? 168 GLU E CD  1 
ATOM   6848  O  OE1 . GLU E  2  12  ? 39.701  27.547  12.251   1.00 148.21 ? 168 GLU E OE1 1 
ATOM   6849  O  OE2 . GLU E  2  12  ? 40.260  29.333  11.095   1.00 146.21 ? 168 GLU E OE2 1 
ATOM   6850  N  N   . ASN E  2  13  ? 39.131  23.631  7.607    1.00 125.69 ? 169 ASN E N   1 
ATOM   6851  C  CA  . ASN E  2  13  ? 39.845  22.498  7.028    1.00 118.15 ? 169 ASN E CA  1 
ATOM   6852  C  C   . ASN E  2  13  ? 39.495  22.440  5.544    1.00 113.67 ? 169 ASN E C   1 
ATOM   6853  O  O   . ASN E  2  13  ? 40.358  22.638  4.687    1.00 118.55 ? 169 ASN E O   1 
ATOM   6854  C  CB  . ASN E  2  13  ? 39.435  21.188  7.712    1.00 119.57 ? 169 ASN E CB  1 
ATOM   6855  C  CG  . ASN E  2  13  ? 39.775  21.166  9.197    1.00 120.37 ? 169 ASN E CG  1 
ATOM   6856  O  OD1 . ASN E  2  13  ? 40.892  21.505  9.601    1.00 115.71 ? 169 ASN E OD1 1 
ATOM   6857  N  ND2 . ASN E  2  13  ? 38.812  20.752  10.016   1.00 119.76 ? 169 ASN E ND2 1 
ATOM   6858  N  N   . ARG E  2  14  ? 38.223  22.175  5.256    1.00 104.21 ? 170 ARG E N   1 
ATOM   6859  C  CA  . ARG E  2  14  ? 37.721  22.110  3.887    1.00 93.30  ? 170 ARG E CA  1 
ATOM   6860  C  C   . ARG E  2  14  ? 38.256  23.267  3.040    1.00 86.76  ? 170 ARG E C   1 
ATOM   6861  O  O   . ARG E  2  14  ? 38.864  23.049  2.001    1.00 78.19  ? 170 ARG E O   1 
ATOM   6862  C  CB  . ARG E  2  14  ? 36.193  22.151  3.901    1.00 99.86  ? 170 ARG E CB  1 
ATOM   6863  C  CG  . ARG E  2  14  ? 35.507  20.794  3.990    1.00 107.41 ? 170 ARG E CG  1 
ATOM   6864  C  CD  . ARG E  2  14  ? 35.224  20.245  2.596    1.00 117.95 ? 170 ARG E CD  1 
ATOM   6865  N  NE  . ARG E  2  14  ? 34.368  19.061  2.609    1.00 120.03 ? 170 ARG E NE  1 
ATOM   6866  C  CZ  . ARG E  2  14  ? 33.890  18.477  1.514    1.00 124.73 ? 170 ARG E CZ  1 
ATOM   6867  N  NH1 . ARG E  2  14  ? 34.183  18.967  0.317    1.00 128.68 ? 170 ARG E NH1 1 
ATOM   6868  N  NH2 . ARG E  2  14  ? 33.120  17.402  1.613    1.00 123.93 ? 170 ARG E NH2 1 
ATOM   6869  N  N   . TYR E  2  15  ? 38.021  24.494  3.495    1.00 88.47  ? 171 TYR E N   1 
ATOM   6870  C  CA  . TYR E  2  15  ? 38.481  25.688  2.797    1.00 90.13  ? 171 TYR E CA  1 
ATOM   6871  C  C   . TYR E  2  15  ? 39.987  25.697  2.602    1.00 97.84  ? 171 TYR E C   1 
ATOM   6872  O  O   . TYR E  2  15  ? 40.481  26.157  1.577    1.00 102.75 ? 171 TYR E O   1 
ATOM   6873  C  CB  . TYR E  2  15  ? 38.091  26.939  3.579    1.00 91.86  ? 171 TYR E CB  1 
ATOM   6874  C  CG  . TYR E  2  15  ? 39.021  28.123  3.358    1.00 97.08  ? 171 TYR E CG  1 
ATOM   6875  C  CD1 . TYR E  2  15  ? 38.881  28.958  2.250    1.00 98.70  ? 171 TYR E CD1 1 
ATOM   6876  C  CD2 . TYR E  2  15  ? 40.038  28.409  4.265    1.00 100.15 ? 171 TYR E CD2 1 
ATOM   6877  C  CE1 . TYR E  2  15  ? 39.726  30.049  2.059    1.00 92.09  ? 171 TYR E CE1 1 
ATOM   6878  C  CE2 . TYR E  2  15  ? 40.886  29.495  4.080    1.00 96.71  ? 171 TYR E CE2 1 
ATOM   6879  C  CZ  . TYR E  2  15  ? 40.722  30.310  2.980    1.00 93.01  ? 171 TYR E CZ  1 
ATOM   6880  O  OH  . TYR E  2  15  ? 41.544  31.397  2.819    1.00 99.81  ? 171 TYR E OH  1 
ATOM   6881  N  N   . LYS E  2  16  ? 40.721  25.213  3.594    1.00 103.73 ? 172 LYS E N   1 
ATOM   6882  C  CA  . LYS E  2  16  ? 42.170  25.196  3.488    1.00 114.00 ? 172 LYS E CA  1 
ATOM   6883  C  C   . LYS E  2  16  ? 42.611  24.421  2.243    1.00 114.74 ? 172 LYS E C   1 
ATOM   6884  O  O   . LYS E  2  16  ? 43.257  24.976  1.348    1.00 115.96 ? 172 LYS E O   1 
ATOM   6885  C  CB  . LYS E  2  16  ? 42.797  24.562  4.738    1.00 119.76 ? 172 LYS E CB  1 
ATOM   6886  C  CG  . LYS E  2  16  ? 44.063  25.266  5.263    1.00 125.34 ? 172 LYS E CG  1 
ATOM   6887  C  CD  . LYS E  2  16  ? 45.059  25.605  4.155    1.00 129.51 ? 172 LYS E CD  1 
ATOM   6888  C  CE  . LYS E  2  16  ? 44.685  26.903  3.447    1.00 129.54 ? 172 LYS E CE  1 
ATOM   6889  N  NZ  . LYS E  2  16  ? 45.391  27.057  2.148    1.00 130.83 ? 172 LYS E NZ  1 
ATOM   6890  N  N   . GLU E  2  17  ? 42.239  23.145  2.188    1.00 109.55 ? 173 GLU E N   1 
ATOM   6891  C  CA  . GLU E  2  17  ? 42.601  22.269  1.079    1.00 106.85 ? 173 GLU E CA  1 
ATOM   6892  C  C   . GLU E  2  17  ? 42.067  22.658  -0.298   1.00 98.46  ? 173 GLU E C   1 
ATOM   6893  O  O   . GLU E  2  17  ? 42.363  21.992  -1.287   1.00 99.97  ? 173 GLU E O   1 
ATOM   6894  C  CB  . GLU E  2  17  ? 42.194  20.829  1.407    1.00 117.13 ? 173 GLU E CB  1 
ATOM   6895  C  CG  . GLU E  2  17  ? 40.760  20.676  1.886    1.00 135.47 ? 173 GLU E CG  1 
ATOM   6896  C  CD  . GLU E  2  17  ? 40.435  19.261  2.348    1.00 144.49 ? 173 GLU E CD  1 
ATOM   6897  O  OE1 . GLU E  2  17  ? 40.467  18.337  1.512    1.00 144.61 ? 173 GLU E OE1 1 
ATOM   6898  O  OE2 . GLU E  2  17  ? 40.146  19.071  3.550    1.00 151.23 ? 173 GLU E OE2 1 
ATOM   6899  N  N   . VAL E  2  18  ? 41.288  23.729  -0.374   1.00 90.22  ? 174 VAL E N   1 
ATOM   6900  C  CA  . VAL E  2  18  ? 40.759  24.168  -1.661   1.00 82.78  ? 174 VAL E CA  1 
ATOM   6901  C  C   . VAL E  2  18  ? 41.596  25.324  -2.201   1.00 80.45  ? 174 VAL E C   1 
ATOM   6902  O  O   . VAL E  2  18  ? 42.008  25.302  -3.359   1.00 70.64  ? 174 VAL E O   1 
ATOM   6903  C  CB  . VAL E  2  18  ? 39.272  24.605  -1.554   1.00 79.37  ? 174 VAL E CB  1 
ATOM   6904  C  CG1 . VAL E  2  18  ? 38.797  25.188  -2.867   1.00 74.67  ? 174 VAL E CG1 1 
ATOM   6905  C  CG2 . VAL E  2  18  ? 38.411  23.414  -1.208   1.00 77.77  ? 174 VAL E CG2 1 
ATOM   6906  N  N   . LYS E  2  19  ? 41.855  26.324  -1.358   1.00 83.07  ? 175 LYS E N   1 
ATOM   6907  C  CA  . LYS E  2  19  ? 42.655  27.477  -1.767   1.00 83.84  ? 175 LYS E CA  1 
ATOM   6908  C  C   . LYS E  2  19  ? 43.947  26.950  -2.379   1.00 89.14  ? 175 LYS E C   1 
ATOM   6909  O  O   . LYS E  2  19  ? 44.557  27.589  -3.235   1.00 83.42  ? 175 LYS E O   1 
ATOM   6910  C  CB  . LYS E  2  19  ? 42.978  28.369  -0.567   1.00 77.65  ? 175 LYS E CB  1 
ATOM   6911  C  CG  . LYS E  2  19  ? 43.406  29.786  -0.947   1.00 79.07  ? 175 LYS E CG  1 
ATOM   6912  C  CD  . LYS E  2  19  ? 43.605  30.648  0.296    1.00 86.25  ? 175 LYS E CD  1 
ATOM   6913  C  CE  . LYS E  2  19  ? 43.609  32.142  -0.018   1.00 91.26  ? 175 LYS E CE  1 
ATOM   6914  N  NZ  . LYS E  2  19  ? 44.759  32.578  -0.859   1.00 102.19 ? 175 LYS E NZ  1 
ATOM   6915  N  N   . ILE E  2  20  ? 44.353  25.773  -1.918   1.00 94.80  ? 176 ILE E N   1 
ATOM   6916  C  CA  . ILE E  2  20  ? 45.547  25.109  -2.417   1.00 93.60  ? 176 ILE E CA  1 
ATOM   6917  C  C   . ILE E  2  20  ? 45.324  24.861  -3.901   1.00 90.16  ? 176 ILE E C   1 
ATOM   6918  O  O   . ILE E  2  20  ? 45.764  25.624  -4.759   1.00 90.83  ? 176 ILE E O   1 
ATOM   6919  C  CB  . ILE E  2  20  ? 45.725  23.725  -1.778   1.00 96.11  ? 176 ILE E CB  1 
ATOM   6920  C  CG1 . ILE E  2  20  ? 45.657  23.829  -0.257   1.00 102.95 ? 176 ILE E CG1 1 
ATOM   6921  C  CG2 . ILE E  2  20  ? 47.013  23.096  -2.270   1.00 92.64  ? 176 ILE E CG2 1 
ATOM   6922  C  CD1 . ILE E  2  20  ? 45.835  22.484  0.443    1.00 111.68 ? 176 ILE E CD1 1 
ATOM   6923  N  N   . ARG E  2  21  ? 44.621  23.769  -4.170   1.00 82.18  ? 177 ARG E N   1 
ATOM   6924  C  CA  . ARG E  2  21  ? 44.303  23.343  -5.515   1.00 84.21  ? 177 ARG E CA  1 
ATOM   6925  C  C   . ARG E  2  21  ? 43.989  24.490  -6.448   1.00 83.39  ? 177 ARG E C   1 
ATOM   6926  O  O   . ARG E  2  21  ? 44.502  24.541  -7.562   1.00 88.64  ? 177 ARG E O   1 
ATOM   6927  C  CB  . ARG E  2  21  ? 43.129  22.368  -5.475   1.00 95.49  ? 177 ARG E CB  1 
ATOM   6928  C  CG  . ARG E  2  21  ? 43.461  21.078  -4.754   1.00 109.01 ? 177 ARG E CG  1 
ATOM   6929  C  CD  . ARG E  2  21  ? 44.636  20.394  -5.435   1.00 124.58 ? 177 ARG E CD  1 
ATOM   6930  N  NE  . ARG E  2  21  ? 45.099  19.199  -4.734   1.00 136.59 ? 177 ARG E NE  1 
ATOM   6931  C  CZ  . ARG E  2  21  ? 46.087  18.415  -5.164   1.00 140.78 ? 177 ARG E CZ  1 
ATOM   6932  N  NH1 . ARG E  2  21  ? 46.721  18.695  -6.298   1.00 144.94 ? 177 ARG E NH1 1 
ATOM   6933  N  NH2 . ARG E  2  21  ? 46.442  17.348  -4.461   1.00 139.90 ? 177 ARG E NH2 1 
ATOM   6934  N  N   . ILE E  2  22  ? 43.153  25.416  -5.999   1.00 80.57  ? 178 ILE E N   1 
ATOM   6935  C  CA  . ILE E  2  22  ? 42.794  26.545  -6.840   1.00 79.01  ? 178 ILE E CA  1 
ATOM   6936  C  C   . ILE E  2  22  ? 43.959  27.476  -7.142   1.00 82.37  ? 178 ILE E C   1 
ATOM   6937  O  O   . ILE E  2  22  ? 44.083  27.949  -8.269   1.00 90.72  ? 178 ILE E O   1 
ATOM   6938  C  CB  . ILE E  2  22  ? 41.640  27.364  -6.225   1.00 80.08  ? 178 ILE E CB  1 
ATOM   6939  C  CG1 . ILE E  2  22  ? 40.354  26.535  -6.264   1.00 72.66  ? 178 ILE E CG1 1 
ATOM   6940  C  CG2 . ILE E  2  22  ? 41.471  28.681  -6.971   1.00 76.01  ? 178 ILE E CG2 1 
ATOM   6941  C  CD1 . ILE E  2  22  ? 39.092  27.313  -5.978   1.00 73.16  ? 178 ILE E CD1 1 
ATOM   6942  N  N   . GLU E  2  23  ? 44.818  27.732  -6.157   1.00 86.81  ? 179 GLU E N   1 
ATOM   6943  C  CA  . GLU E  2  23  ? 45.958  28.631  -6.360   1.00 90.05  ? 179 GLU E CA  1 
ATOM   6944  C  C   . GLU E  2  23  ? 47.176  27.989  -6.995   1.00 83.00  ? 179 GLU E C   1 
ATOM   6945  O  O   . GLU E  2  23  ? 47.972  28.669  -7.637   1.00 78.20  ? 179 GLU E O   1 
ATOM   6946  C  CB  . GLU E  2  23  ? 46.389  29.266  -5.043   1.00 97.21  ? 179 GLU E CB  1 
ATOM   6947  C  CG  . GLU E  2  23  ? 45.417  30.285  -4.485   1.00 115.10 ? 179 GLU E CG  1 
ATOM   6948  C  CD  . GLU E  2  23  ? 45.986  31.005  -3.278   1.00 120.27 ? 179 GLU E CD  1 
ATOM   6949  O  OE1 . GLU E  2  23  ? 46.364  30.314  -2.303   1.00 117.25 ? 179 GLU E OE1 1 
ATOM   6950  O  OE2 . GLU E  2  23  ? 46.060  32.256  -3.309   1.00 115.22 ? 179 GLU E OE2 1 
ATOM   6951  N  N   . SER E  2  24  ? 47.329  26.686  -6.808   1.00 82.15  ? 180 SER E N   1 
ATOM   6952  C  CA  . SER E  2  24  ? 48.469  25.981  -7.371   1.00 82.69  ? 180 SER E CA  1 
ATOM   6953  C  C   . SER E  2  24  ? 48.073  24.955  -8.405   1.00 80.33  ? 180 SER E C   1 
ATOM   6954  O  O   . SER E  2  24  ? 48.220  25.172  -9.605   1.00 87.09  ? 180 SER E O   1 
ATOM   6955  C  CB  . SER E  2  24  ? 49.265  25.293  -6.265   1.00 82.10  ? 180 SER E CB  1 
ATOM   6956  O  OG  . SER E  2  24  ? 49.979  26.251  -5.501   1.00 92.00  ? 180 SER E OG  1 
ATOM   6957  N  N   . THR E  2  25  ? 47.562  23.832  -7.928   1.00 79.29  ? 181 THR E N   1 
ATOM   6958  C  CA  . THR E  2  25  ? 47.157  22.744  -8.800   1.00 84.01  ? 181 THR E CA  1 
ATOM   6959  C  C   . THR E  2  25  ? 46.382  23.154  -10.053  1.00 80.42  ? 181 THR E C   1 
ATOM   6960  O  O   . THR E  2  25  ? 46.403  22.425  -11.043  1.00 80.12  ? 181 THR E O   1 
ATOM   6961  C  CB  . THR E  2  25  ? 46.343  21.709  -8.017   1.00 94.04  ? 181 THR E CB  1 
ATOM   6962  O  OG1 . THR E  2  25  ? 47.033  21.400  -6.797   1.00 103.76 ? 181 THR E OG1 1 
ATOM   6963  C  CG2 . THR E  2  25  ? 46.173  20.428  -8.835   1.00 91.33  ? 181 THR E CG2 1 
ATOM   6964  N  N   . VAL E  2  26  ? 45.697  24.298  -10.027  1.00 73.59  ? 182 VAL E N   1 
ATOM   6965  C  CA  . VAL E  2  26  ? 44.956  24.739  -11.211  1.00 67.29  ? 182 VAL E CA  1 
ATOM   6966  C  C   . VAL E  2  26  ? 45.553  25.976  -11.868  1.00 68.61  ? 182 VAL E C   1 
ATOM   6967  O  O   . VAL E  2  26  ? 45.966  25.919  -13.029  1.00 68.99  ? 182 VAL E O   1 
ATOM   6968  C  CB  . VAL E  2  26  ? 43.455  24.989  -10.911  1.00 62.33  ? 182 VAL E CB  1 
ATOM   6969  C  CG1 . VAL E  2  26  ? 42.827  25.824  -12.011  1.00 53.88  ? 182 VAL E CG1 1 
ATOM   6970  C  CG2 . VAL E  2  26  ? 42.719  23.657  -10.836  1.00 59.83  ? 182 VAL E CG2 1 
ATOM   6971  N  N   . ALA E  2  27  ? 45.612  27.090  -11.148  1.00 62.90  ? 183 ALA E N   1 
ATOM   6972  C  CA  . ALA E  2  27  ? 46.179  28.306  -11.732  1.00 68.27  ? 183 ALA E CA  1 
ATOM   6973  C  C   . ALA E  2  27  ? 47.615  28.047  -12.192  1.00 72.02  ? 183 ALA E C   1 
ATOM   6974  O  O   . ALA E  2  27  ? 48.219  28.863  -12.899  1.00 75.41  ? 183 ALA E O   1 
ATOM   6975  C  CB  . ALA E  2  27  ? 46.145  29.445  -10.726  1.00 60.39  ? 183 ALA E CB  1 
ATOM   6976  N  N   . GLY E  2  28  ? 48.150  26.901  -11.779  1.00 71.80  ? 184 GLY E N   1 
ATOM   6977  C  CA  . GLY E  2  28  ? 49.499  26.521  -12.151  1.00 67.94  ? 184 GLY E CA  1 
ATOM   6978  C  C   . GLY E  2  28  ? 49.454  25.807  -13.481  1.00 64.25  ? 184 GLY E C   1 
ATOM   6979  O  O   . GLY E  2  28  ? 50.168  26.169  -14.411  1.00 62.35  ? 184 GLY E O   1 
ATOM   6980  N  N   . SER E  2  29  ? 48.616  24.782  -13.575  1.00 65.55  ? 185 SER E N   1 
ATOM   6981  C  CA  . SER E  2  29  ? 48.485  24.052  -14.825  1.00 67.54  ? 185 SER E CA  1 
ATOM   6982  C  C   . SER E  2  29  ? 47.941  25.057  -15.813  1.00 67.30  ? 185 SER E C   1 
ATOM   6983  O  O   . SER E  2  29  ? 48.448  25.201  -16.920  1.00 74.83  ? 185 SER E O   1 
ATOM   6984  C  CB  . SER E  2  29  ? 47.495  22.895  -14.687  1.00 70.81  ? 185 SER E CB  1 
ATOM   6985  O  OG  . SER E  2  29  ? 47.913  21.972  -13.699  1.00 90.04  ? 185 SER E OG  1 
ATOM   6986  N  N   . LEU E  2  30  ? 46.909  25.770  -15.386  1.00 67.00  ? 186 LEU E N   1 
ATOM   6987  C  CA  . LEU E  2  30  ? 46.272  26.768  -16.223  1.00 65.68  ? 186 LEU E CA  1 
ATOM   6988  C  C   . LEU E  2  30  ? 47.287  27.678  -16.889  1.00 63.23  ? 186 LEU E C   1 
ATOM   6989  O  O   . LEU E  2  30  ? 47.298  27.828  -18.114  1.00 71.18  ? 186 LEU E O   1 
ATOM   6990  C  CB  . LEU E  2  30  ? 45.304  27.608  -15.391  1.00 69.88  ? 186 LEU E CB  1 
ATOM   6991  C  CG  . LEU E  2  30  ? 43.888  27.768  -15.945  1.00 71.06  ? 186 LEU E CG  1 
ATOM   6992  C  CD1 . LEU E  2  30  ? 43.960  28.456  -17.286  1.00 66.31  ? 186 LEU E CD1 1 
ATOM   6993  C  CD2 . LEU E  2  30  ? 43.212  26.400  -16.073  1.00 72.78  ? 186 LEU E CD2 1 
ATOM   6994  N  N   . ARG E  2  31  ? 48.162  28.266  -16.090  1.00 67.02  ? 187 ARG E N   1 
ATOM   6995  C  CA  . ARG E  2  31  ? 49.141  29.186  -16.637  1.00 75.04  ? 187 ARG E CA  1 
ATOM   6996  C  C   . ARG E  2  31  ? 50.228  28.581  -17.526  1.00 72.36  ? 187 ARG E C   1 
ATOM   6997  O  O   . ARG E  2  31  ? 50.369  28.962  -18.689  1.00 62.48  ? 187 ARG E O   1 
ATOM   6998  C  CB  . ARG E  2  31  ? 49.769  30.010  -15.508  1.00 83.93  ? 187 ARG E CB  1 
ATOM   6999  C  CG  . ARG E  2  31  ? 49.974  31.468  -15.911  1.00 109.00 ? 187 ARG E CG  1 
ATOM   7000  C  CD  . ARG E  2  31  ? 48.709  32.009  -16.594  1.00 121.98 ? 187 ARG E CD  1 
ATOM   7001  N  NE  . ARG E  2  31  ? 48.917  33.281  -17.285  1.00 131.50 ? 187 ARG E NE  1 
ATOM   7002  C  CZ  . ARG E  2  31  ? 48.020  33.854  -18.085  1.00 132.50 ? 187 ARG E CZ  1 
ATOM   7003  N  NH1 . ARG E  2  31  ? 46.847  33.268  -18.299  1.00 129.48 ? 187 ARG E NH1 1 
ATOM   7004  N  NH2 . ARG E  2  31  ? 48.294  35.014  -18.670  1.00 128.91 ? 187 ARG E NH2 1 
ATOM   7005  N  N   . SER E  2  32  ? 51.001  27.641  -17.004  1.00 77.51  ? 188 SER E N   1 
ATOM   7006  C  CA  . SER E  2  32  ? 52.056  27.054  -17.820  1.00 80.24  ? 188 SER E CA  1 
ATOM   7007  C  C   . SER E  2  32  ? 51.528  26.210  -18.977  1.00 76.61  ? 188 SER E C   1 
ATOM   7008  O  O   . SER E  2  32  ? 52.258  25.400  -19.546  1.00 79.31  ? 188 SER E O   1 
ATOM   7009  C  CB  . SER E  2  32  ? 53.023  26.240  -16.950  1.00 86.18  ? 188 SER E CB  1 
ATOM   7010  O  OG  . SER E  2  32  ? 54.009  27.080  -16.358  1.00 82.22  ? 188 SER E OG  1 
ATOM   7011  N  N   . MET E  2  33  ? 50.253  26.398  -19.315  1.00 70.54  ? 189 MET E N   1 
ATOM   7012  C  CA  . MET E  2  33  ? 49.636  25.694  -20.437  1.00 62.94  ? 189 MET E CA  1 
ATOM   7013  C  C   . MET E  2  33  ? 49.346  26.731  -21.515  1.00 68.26  ? 189 MET E C   1 
ATOM   7014  O  O   . MET E  2  33  ? 49.608  26.501  -22.700  1.00 73.12  ? 189 MET E O   1 
ATOM   7015  C  CB  . MET E  2  33  ? 48.334  24.993  -20.033  1.00 49.90  ? 189 MET E CB  1 
ATOM   7016  C  CG  . MET E  2  33  ? 48.527  23.590  -19.488  1.00 57.00  ? 189 MET E CG  1 
ATOM   7017  S  SD  . MET E  2  33  ? 46.985  22.799  -18.996  1.00 69.42  ? 189 MET E SD  1 
ATOM   7018  C  CE  . MET E  2  33  ? 47.330  21.083  -19.302  1.00 47.31  ? 189 MET E CE  1 
ATOM   7019  N  N   . LYS E  2  34  ? 48.809  27.877  -21.107  1.00 61.51  ? 190 LYS E N   1 
ATOM   7020  C  CA  . LYS E  2  34  ? 48.524  28.932  -22.067  1.00 64.10  ? 190 LYS E CA  1 
ATOM   7021  C  C   . LYS E  2  34  ? 49.833  29.441  -22.666  1.00 67.86  ? 190 LYS E C   1 
ATOM   7022  O  O   . LYS E  2  34  ? 49.832  30.268  -23.579  1.00 71.32  ? 190 LYS E O   1 
ATOM   7023  C  CB  . LYS E  2  34  ? 47.794  30.098  -21.402  1.00 58.04  ? 190 LYS E CB  1 
ATOM   7024  C  CG  . LYS E  2  34  ? 47.555  31.259  -22.345  1.00 50.59  ? 190 LYS E CG  1 
ATOM   7025  C  CD  . LYS E  2  34  ? 47.038  32.480  -21.633  1.00 57.42  ? 190 LYS E CD  1 
ATOM   7026  C  CE  . LYS E  2  34  ? 46.963  33.648  -22.599  1.00 65.02  ? 190 LYS E CE  1 
ATOM   7027  N  NZ  . LYS E  2  34  ? 46.648  34.934  -21.927  1.00 61.25  ? 190 LYS E NZ  1 
ATOM   7028  N  N   . SER E  2  35  ? 50.952  28.951  -22.144  1.00 67.09  ? 191 SER E N   1 
ATOM   7029  C  CA  . SER E  2  35  ? 52.252  29.378  -22.638  1.00 63.92  ? 191 SER E CA  1 
ATOM   7030  C  C   . SER E  2  35  ? 52.658  28.433  -23.757  1.00 61.46  ? 191 SER E C   1 
ATOM   7031  O  O   . SER E  2  35  ? 52.981  28.870  -24.855  1.00 48.18  ? 191 SER E O   1 
ATOM   7032  C  CB  . SER E  2  35  ? 53.283  29.357  -21.503  1.00 69.80  ? 191 SER E CB  1 
ATOM   7033  O  OG  . SER E  2  35  ? 54.330  30.288  -21.739  1.00 63.47  ? 191 SER E OG  1 
ATOM   7034  N  N   . VAL E  2  36  ? 52.631  27.135  -23.470  1.00 63.16  ? 192 VAL E N   1 
ATOM   7035  C  CA  . VAL E  2  36  ? 52.960  26.124  -24.464  1.00 60.24  ? 192 VAL E CA  1 
ATOM   7036  C  C   . VAL E  2  36  ? 52.061  26.302  -25.681  1.00 63.30  ? 192 VAL E C   1 
ATOM   7037  O  O   . VAL E  2  36  ? 52.544  26.320  -26.810  1.00 71.62  ? 192 VAL E O   1 
ATOM   7038  C  CB  . VAL E  2  36  ? 52.765  24.705  -23.914  1.00 58.32  ? 192 VAL E CB  1 
ATOM   7039  C  CG1 . VAL E  2  36  ? 52.655  23.716  -25.055  1.00 52.27  ? 192 VAL E CG1 1 
ATOM   7040  C  CG2 . VAL E  2  36  ? 53.938  24.342  -23.025  1.00 48.92  ? 192 VAL E CG2 1 
ATOM   7041  N  N   . LEU E  2  37  ? 50.755  26.423  -25.458  1.00 52.36  ? 193 LEU E N   1 
ATOM   7042  C  CA  . LEU E  2  37  ? 49.845  26.626  -26.572  1.00 48.64  ? 193 LEU E CA  1 
ATOM   7043  C  C   . LEU E  2  37  ? 50.259  27.875  -27.339  1.00 54.28  ? 193 LEU E C   1 
ATOM   7044  O  O   . LEU E  2  37  ? 50.228  27.891  -28.571  1.00 61.58  ? 193 LEU E O   1 
ATOM   7045  C  CB  . LEU E  2  37  ? 48.417  26.766  -26.067  1.00 36.45  ? 193 LEU E CB  1 
ATOM   7046  C  CG  . LEU E  2  37  ? 47.820  25.444  -25.604  1.00 44.19  ? 193 LEU E CG  1 
ATOM   7047  C  CD1 . LEU E  2  37  ? 46.566  25.673  -24.798  1.00 52.02  ? 193 LEU E CD1 1 
ATOM   7048  C  CD2 . LEU E  2  37  ? 47.526  24.596  -26.821  1.00 52.74  ? 193 LEU E CD2 1 
ATOM   7049  N  N   . GLU E  2  38  ? 50.662  28.910  -26.607  1.00 50.06  ? 194 GLU E N   1 
ATOM   7050  C  CA  . GLU E  2  38  ? 51.083  30.172  -27.203  1.00 53.76  ? 194 GLU E CA  1 
ATOM   7051  C  C   . GLU E  2  38  ? 52.426  29.999  -27.918  1.00 58.99  ? 194 GLU E C   1 
ATOM   7052  O  O   . GLU E  2  38  ? 52.651  30.543  -29.000  1.00 66.52  ? 194 GLU E O   1 
ATOM   7053  C  CB  . GLU E  2  38  ? 51.210  31.230  -26.110  1.00 64.97  ? 194 GLU E CB  1 
ATOM   7054  C  CG  . GLU E  2  38  ? 50.669  32.601  -26.476  1.00 81.53  ? 194 GLU E CG  1 
ATOM   7055  C  CD  . GLU E  2  38  ? 50.573  33.526  -25.267  1.00 91.69  ? 194 GLU E CD  1 
ATOM   7056  O  OE1 . GLU E  2  38  ? 49.994  33.108  -24.239  1.00 88.93  ? 194 GLU E OE1 1 
ATOM   7057  O  OE2 . GLU E  2  38  ? 51.068  34.673  -25.347  1.00 100.99 ? 194 GLU E OE2 1 
ATOM   7058  N  N   . HIS E  2  39  ? 53.319  29.236  -27.303  1.00 60.54  ? 195 HIS E N   1 
ATOM   7059  C  CA  . HIS E  2  39  ? 54.637  28.976  -27.865  1.00 55.14  ? 195 HIS E CA  1 
ATOM   7060  C  C   . HIS E  2  39  ? 54.448  28.213  -29.172  1.00 51.99  ? 195 HIS E C   1 
ATOM   7061  O  O   . HIS E  2  39  ? 55.012  28.563  -30.201  1.00 53.40  ? 195 HIS E O   1 
ATOM   7062  C  CB  . HIS E  2  39  ? 55.456  28.143  -26.873  1.00 79.22  ? 195 HIS E CB  1 
ATOM   7063  C  CG  . HIS E  2  39  ? 56.883  27.930  -27.276  1.00 102.75 ? 195 HIS E CG  1 
ATOM   7064  N  ND1 . HIS E  2  39  ? 57.244  27.412  -28.502  1.00 115.71 ? 195 HIS E ND1 1 
ATOM   7065  C  CD2 . HIS E  2  39  ? 58.040  28.127  -26.597  1.00 113.87 ? 195 HIS E CD2 1 
ATOM   7066  C  CE1 . HIS E  2  39  ? 58.560  27.299  -28.561  1.00 116.58 ? 195 HIS E CE1 1 
ATOM   7067  N  NE2 . HIS E  2  39  ? 59.067  27.726  -27.418  1.00 116.87 ? 195 HIS E NE2 1 
ATOM   7068  N  N   . LEU E  2  40  ? 53.643  27.165  -29.129  1.00 51.06  ? 196 LEU E N   1 
ATOM   7069  C  CA  . LEU E  2  40  ? 53.390  26.373  -30.317  1.00 50.88  ? 196 LEU E CA  1 
ATOM   7070  C  C   . LEU E  2  40  ? 52.942  27.251  -31.471  1.00 56.99  ? 196 LEU E C   1 
ATOM   7071  O  O   . LEU E  2  40  ? 53.436  27.115  -32.588  1.00 61.10  ? 196 LEU E O   1 
ATOM   7072  C  CB  . LEU E  2  40  ? 52.312  25.325  -30.043  1.00 52.63  ? 196 LEU E CB  1 
ATOM   7073  C  CG  . LEU E  2  40  ? 52.660  24.171  -29.104  1.00 51.07  ? 196 LEU E CG  1 
ATOM   7074  C  CD1 . LEU E  2  40  ? 51.489  23.214  -29.038  1.00 43.49  ? 196 LEU E CD1 1 
ATOM   7075  C  CD2 . LEU E  2  40  ? 53.893  23.451  -29.618  1.00 60.74  ? 196 LEU E CD2 1 
ATOM   7076  N  N   . ARG E  2  41  ? 52.006  28.155  -31.200  1.00 54.47  ? 197 ARG E N   1 
ATOM   7077  C  CA  . ARG E  2  41  ? 51.493  29.020  -32.245  1.00 49.28  ? 197 ARG E CA  1 
ATOM   7078  C  C   . ARG E  2  41  ? 52.640  29.735  -32.933  1.00 50.30  ? 197 ARG E C   1 
ATOM   7079  O  O   . ARG E  2  41  ? 52.845  29.579  -34.142  1.00 59.90  ? 197 ARG E O   1 
ATOM   7080  C  CB  . ARG E  2  41  ? 50.510  30.026  -31.670  1.00 42.96  ? 197 ARG E CB  1 
ATOM   7081  C  CG  . ARG E  2  41  ? 49.352  30.359  -32.603  1.00 52.95  ? 197 ARG E CG  1 
ATOM   7082  C  CD  . ARG E  2  41  ? 48.811  31.741  -32.319  1.00 65.56  ? 197 ARG E CD  1 
ATOM   7083  N  NE  . ARG E  2  41  ? 49.907  32.707  -32.249  1.00 93.07  ? 197 ARG E NE  1 
ATOM   7084  C  CZ  . ARG E  2  41  ? 50.489  33.115  -31.120  1.00 105.32 ? 197 ARG E CZ  1 
ATOM   7085  N  NH1 . ARG E  2  41  ? 50.081  32.656  -29.939  1.00 104.02 ? 197 ARG E NH1 1 
ATOM   7086  N  NH2 . ARG E  2  41  ? 51.502  33.971  -31.172  1.00 110.19 ? 197 ARG E NH2 1 
ATOM   7087  N  N   . ALA E  2  42  ? 53.402  30.504  -32.168  1.00 44.38  ? 198 ALA E N   1 
ATOM   7088  C  CA  . ALA E  2  42  ? 54.538  31.235  -32.728  1.00 37.81  ? 198 ALA E CA  1 
ATOM   7089  C  C   . ALA E  2  42  ? 55.479  30.325  -33.533  1.00 40.68  ? 198 ALA E C   1 
ATOM   7090  O  O   . ALA E  2  42  ? 56.109  30.747  -34.506  1.00 37.57  ? 198 ALA E O   1 
ATOM   7091  C  CB  . ALA E  2  42  ? 55.304  31.921  -31.612  1.00 47.62  ? 198 ALA E CB  1 
ATOM   7092  N  N   . LYS E  2  43  ? 55.597  29.072  -33.120  1.00 52.95  ? 199 LYS E N   1 
ATOM   7093  C  CA  . LYS E  2  43  ? 56.457  28.159  -33.851  1.00 53.45  ? 199 LYS E CA  1 
ATOM   7094  C  C   . LYS E  2  43  ? 55.837  28.000  -35.233  1.00 53.15  ? 199 LYS E C   1 
ATOM   7095  O  O   . LYS E  2  43  ? 56.537  28.099  -36.241  1.00 58.86  ? 199 LYS E O   1 
ATOM   7096  C  CB  . LYS E  2  43  ? 56.557  26.800  -33.136  1.00 48.14  ? 199 LYS E CB  1 
ATOM   7097  C  CG  . LYS E  2  43  ? 57.295  25.734  -33.940  1.00 51.67  ? 199 LYS E CG  1 
ATOM   7098  C  CD  . LYS E  2  43  ? 57.536  24.446  -33.159  1.00 55.64  ? 199 LYS E CD  1 
ATOM   7099  C  CE  . LYS E  2  43  ? 58.690  24.589  -32.156  1.00 71.09  ? 199 LYS E CE  1 
ATOM   7100  N  NZ  . LYS E  2  43  ? 60.070  24.654  -32.759  1.00 62.12  ? 199 LYS E NZ  1 
ATOM   7101  N  N   . MET E  2  44  ? 54.519  27.795  -35.268  1.00 38.67  ? 200 MET E N   1 
ATOM   7102  C  CA  . MET E  2  44  ? 53.796  27.620  -36.520  1.00 41.00  ? 200 MET E CA  1 
ATOM   7103  C  C   . MET E  2  44  ? 53.887  28.846  -37.427  1.00 49.75  ? 200 MET E C   1 
ATOM   7104  O  O   . MET E  2  44  ? 54.041  28.711  -38.641  1.00 57.46  ? 200 MET E O   1 
ATOM   7105  C  CB  . MET E  2  44  ? 52.339  27.276  -36.236  1.00 32.53  ? 200 MET E CB  1 
ATOM   7106  C  CG  . MET E  2  44  ? 52.208  26.128  -35.294  1.00 41.92  ? 200 MET E CG  1 
ATOM   7107  S  SD  . MET E  2  44  ? 50.850  25.037  -35.658  1.00 39.59  ? 200 MET E SD  1 
ATOM   7108  C  CE  . MET E  2  44  ? 49.723  25.585  -34.452  1.00 39.43  ? 200 MET E CE  1 
ATOM   7109  N  N   . GLN E  2  45  ? 53.785  30.041  -36.859  1.00 41.55  ? 201 GLN E N   1 
ATOM   7110  C  CA  . GLN E  2  45  ? 53.907  31.231  -37.681  1.00 43.15  ? 201 GLN E CA  1 
ATOM   7111  C  C   . GLN E  2  45  ? 55.293  31.243  -38.327  1.00 41.65  ? 201 GLN E C   1 
ATOM   7112  O  O   . GLN E  2  45  ? 55.396  31.297  -39.546  1.00 51.53  ? 201 GLN E O   1 
ATOM   7113  C  CB  . GLN E  2  45  ? 53.703  32.490  -36.843  1.00 43.63  ? 201 GLN E CB  1 
ATOM   7114  C  CG  . GLN E  2  45  ? 52.270  32.702  -36.404  1.00 62.60  ? 201 GLN E CG  1 
ATOM   7115  C  CD  . GLN E  2  45  ? 52.136  33.763  -35.326  1.00 70.93  ? 201 GLN E CD  1 
ATOM   7116  O  OE1 . GLN E  2  45  ? 51.049  33.992  -34.795  1.00 81.11  ? 201 GLN E OE1 1 
ATOM   7117  N  NE2 . GLN E  2  45  ? 53.242  34.411  -34.993  1.00 75.00  ? 201 GLN E NE2 1 
ATOM   7118  N  N   . ARG E  2  46  ? 56.354  31.173  -37.523  1.00 40.20  ? 202 ARG E N   1 
ATOM   7119  C  CA  . ARG E  2  46  ? 57.709  31.176  -38.068  1.00 36.40  ? 202 ARG E CA  1 
ATOM   7120  C  C   . ARG E  2  46  ? 57.800  30.206  -39.220  1.00 38.66  ? 202 ARG E C   1 
ATOM   7121  O  O   . ARG E  2  46  ? 58.560  30.414  -40.162  1.00 35.91  ? 202 ARG E O   1 
ATOM   7122  C  CB  . ARG E  2  46  ? 58.741  30.775  -37.017  1.00 41.35  ? 202 ARG E CB  1 
ATOM   7123  C  CG  . ARG E  2  46  ? 59.129  31.868  -36.054  1.00 45.87  ? 202 ARG E CG  1 
ATOM   7124  C  CD  . ARG E  2  46  ? 60.476  31.585  -35.415  1.00 57.21  ? 202 ARG E CD  1 
ATOM   7125  N  NE  . ARG E  2  46  ? 60.552  30.287  -34.728  1.00 77.10  ? 202 ARG E NE  1 
ATOM   7126  C  CZ  . ARG E  2  46  ? 59.902  29.969  -33.608  1.00 65.79  ? 202 ARG E CZ  1 
ATOM   7127  N  NH1 . ARG E  2  46  ? 59.108  30.847  -33.022  1.00 68.73  ? 202 ARG E NH1 1 
ATOM   7128  N  NH2 . ARG E  2  46  ? 60.059  28.772  -33.062  1.00 58.03  ? 202 ARG E NH2 1 
ATOM   7129  N  N   . MET E  2  47  ? 57.023  29.134  -39.127  1.00 34.12  ? 203 MET E N   1 
ATOM   7130  C  CA  . MET E  2  47  ? 56.988  28.122  -40.165  1.00 37.22  ? 203 MET E CA  1 
ATOM   7131  C  C   . MET E  2  47  ? 56.143  28.595  -41.320  1.00 40.25  ? 203 MET E C   1 
ATOM   7132  O  O   . MET E  2  47  ? 56.585  28.524  -42.462  1.00 48.87  ? 203 MET E O   1 
ATOM   7133  C  CB  . MET E  2  47  ? 56.408  26.812  -39.643  1.00 41.88  ? 203 MET E CB  1 
ATOM   7134  C  CG  . MET E  2  47  ? 57.428  25.822  -39.101  1.00 41.95  ? 203 MET E CG  1 
ATOM   7135  S  SD  . MET E  2  47  ? 56.579  24.381  -38.380  1.00 39.63  ? 203 MET E SD  1 
ATOM   7136  C  CE  . MET E  2  47  ? 56.399  24.949  -36.829  1.00 6.97   ? 203 MET E CE  1 
ATOM   7137  N  N   . GLU E  2  48  ? 54.932  29.078  -41.036  1.00 40.49  ? 204 GLU E N   1 
ATOM   7138  C  CA  . GLU E  2  48  ? 54.053  29.548  -42.101  1.00 33.95  ? 204 GLU E CA  1 
ATOM   7139  C  C   . GLU E  2  48  ? 54.728  30.643  -42.893  1.00 36.76  ? 204 GLU E C   1 
ATOM   7140  O  O   . GLU E  2  48  ? 54.614  30.698  -44.120  1.00 48.97  ? 204 GLU E O   1 
ATOM   7141  C  CB  . GLU E  2  48  ? 52.730  30.081  -41.563  1.00 38.05  ? 204 GLU E CB  1 
ATOM   7142  C  CG  . GLU E  2  48  ? 51.670  30.215  -42.662  1.00 48.50  ? 204 GLU E CG  1 
ATOM   7143  C  CD  . GLU E  2  48  ? 50.246  30.404  -42.135  1.00 59.86  ? 204 GLU E CD  1 
ATOM   7144  O  OE1 . GLU E  2  48  ? 49.300  30.124  -42.902  1.00 52.34  ? 204 GLU E OE1 1 
ATOM   7145  O  OE2 . GLU E  2  48  ? 50.063  30.836  -40.973  1.00 60.13  ? 204 GLU E OE2 1 
ATOM   7146  N  N   . GLU E  2  49  ? 55.452  31.516  -42.213  1.00 22.00  ? 205 GLU E N   1 
ATOM   7147  C  CA  . GLU E  2  49  ? 56.104  32.581  -42.942  1.00 28.95  ? 205 GLU E CA  1 
ATOM   7148  C  C   . GLU E  2  49  ? 57.225  31.983  -43.765  1.00 25.12  ? 205 GLU E C   1 
ATOM   7149  O  O   . GLU E  2  49  ? 57.333  32.265  -44.951  1.00 47.59  ? 205 GLU E O   1 
ATOM   7150  C  CB  . GLU E  2  49  ? 56.609  33.684  -41.998  1.00 21.27  ? 205 GLU E CB  1 
ATOM   7151  C  CG  . GLU E  2  49  ? 57.998  33.460  -41.400  1.00 70.41  ? 205 GLU E CG  1 
ATOM   7152  C  CD  . GLU E  2  49  ? 59.085  34.306  -42.069  1.00 70.96  ? 205 GLU E CD  1 
ATOM   7153  O  OE1 . GLU E  2  49  ? 59.358  34.105  -43.270  1.00 70.73  ? 205 GLU E OE1 1 
ATOM   7154  O  OE2 . GLU E  2  49  ? 59.668  35.180  -41.390  1.00 78.70  ? 205 GLU E OE2 1 
ATOM   7155  N  N   . ALA E  2  50  ? 58.040  31.127  -43.161  1.00 38.51  ? 206 ALA E N   1 
ATOM   7156  C  CA  . ALA E  2  50  ? 59.154  30.514  -43.895  1.00 42.83  ? 206 ALA E CA  1 
ATOM   7157  C  C   . ALA E  2  50  ? 58.682  29.828  -45.179  1.00 38.23  ? 206 ALA E C   1 
ATOM   7158  O  O   . ALA E  2  50  ? 59.422  29.769  -46.157  1.00 40.03  ? 206 ALA E O   1 
ATOM   7159  C  CB  . ALA E  2  50  ? 59.912  29.511  -42.999  1.00 33.45  ? 206 ALA E CB  1 
ATOM   7160  N  N   . ILE E  2  51  ? 57.451  29.322  -45.172  1.00 42.12  ? 207 ILE E N   1 
ATOM   7161  C  CA  . ILE E  2  51  ? 56.877  28.643  -46.334  1.00 45.43  ? 207 ILE E CA  1 
ATOM   7162  C  C   . ILE E  2  51  ? 56.399  29.649  -47.370  1.00 49.40  ? 207 ILE E C   1 
ATOM   7163  O  O   . ILE E  2  51  ? 56.658  29.495  -48.561  1.00 57.02  ? 207 ILE E O   1 
ATOM   7164  C  CB  . ILE E  2  51  ? 55.661  27.769  -45.950  1.00 56.92  ? 207 ILE E CB  1 
ATOM   7165  C  CG1 . ILE E  2  51  ? 56.075  26.679  -44.959  1.00 53.37  ? 207 ILE E CG1 1 
ATOM   7166  C  CG2 . ILE E  2  51  ? 55.071  27.136  -47.194  1.00 50.23  ? 207 ILE E CG2 1 
ATOM   7167  C  CD1 . ILE E  2  51  ? 57.158  25.800  -45.478  1.00 42.26  ? 207 ILE E CD1 1 
ATOM   7168  N  N   . LYS E  2  52  ? 55.688  30.678  -46.920  1.00 49.75  ? 208 LYS E N   1 
ATOM   7169  C  CA  . LYS E  2  52  ? 55.197  31.689  -47.838  1.00 36.99  ? 208 LYS E CA  1 
ATOM   7170  C  C   . LYS E  2  52  ? 56.365  32.322  -48.563  1.00 42.71  ? 208 LYS E C   1 
ATOM   7171  O  O   . LYS E  2  52  ? 56.298  32.552  -49.774  1.00 37.06  ? 208 LYS E O   1 
ATOM   7172  C  CB  . LYS E  2  52  ? 54.398  32.735  -47.079  1.00 46.99  ? 208 LYS E CB  1 
ATOM   7173  C  CG  . LYS E  2  52  ? 53.182  32.159  -46.352  1.00 65.81  ? 208 LYS E CG  1 
ATOM   7174  C  CD  . LYS E  2  52  ? 52.222  31.436  -47.310  1.00 73.75  ? 208 LYS E CD  1 
ATOM   7175  C  CE  . LYS E  2  52  ? 52.734  30.055  -47.734  1.00 71.83  ? 208 LYS E CE  1 
ATOM   7176  N  NZ  . LYS E  2  52  ? 51.978  29.495  -48.894  1.00 52.30  ? 208 LYS E NZ  1 
ATOM   7177  N  N   . THR E  2  53  ? 57.445  32.577  -47.826  1.00 36.09  ? 209 THR E N   1 
ATOM   7178  C  CA  . THR E  2  53  ? 58.637  33.171  -48.410  1.00 37.20  ? 209 THR E CA  1 
ATOM   7179  C  C   . THR E  2  53  ? 59.227  32.286  -49.512  1.00 44.00  ? 209 THR E C   1 
ATOM   7180  O  O   . THR E  2  53  ? 59.526  32.773  -50.601  1.00 51.38  ? 209 THR E O   1 
ATOM   7181  C  CB  . THR E  2  53  ? 59.705  33.447  -47.324  1.00 31.98  ? 209 THR E CB  1 
ATOM   7182  O  OG1 . THR E  2  53  ? 59.296  34.571  -46.546  1.00 38.56  ? 209 THR E OG1 1 
ATOM   7183  C  CG2 . THR E  2  53  ? 61.080  33.751  -47.944  1.00 23.24  ? 209 THR E CG2 1 
ATOM   7184  N  N   . GLN E  2  54  ? 59.397  30.993  -49.248  1.00 39.67  ? 210 GLN E N   1 
ATOM   7185  C  CA  . GLN E  2  54  ? 59.962  30.116  -50.266  1.00 42.94  ? 210 GLN E CA  1 
ATOM   7186  C  C   . GLN E  2  54  ? 59.006  29.970  -51.433  1.00 44.94  ? 210 GLN E C   1 
ATOM   7187  O  O   . GLN E  2  54  ? 59.430  29.981  -52.582  1.00 36.35  ? 210 GLN E O   1 
ATOM   7188  C  CB  . GLN E  2  54  ? 60.283  28.727  -49.702  1.00 53.98  ? 210 GLN E CB  1 
ATOM   7189  C  CG  . GLN E  2  54  ? 61.762  28.465  -49.445  1.00 55.09  ? 210 GLN E CG  1 
ATOM   7190  C  CD  . GLN E  2  54  ? 62.609  28.795  -50.643  1.00 46.00  ? 210 GLN E CD  1 
ATOM   7191  O  OE1 . GLN E  2  54  ? 62.236  28.501  -51.766  1.00 51.13  ? 210 GLN E OE1 1 
ATOM   7192  N  NE2 . GLN E  2  54  ? 63.763  29.407  -50.409  1.00 65.17  ? 210 GLN E NE2 1 
ATOM   7193  N  N   . LYS E  2  55  ? 57.713  29.839  -51.147  1.00 46.11  ? 211 LYS E N   1 
ATOM   7194  C  CA  . LYS E  2  55  ? 56.744  29.686  -52.219  1.00 43.71  ? 211 LYS E CA  1 
ATOM   7195  C  C   . LYS E  2  55  ? 56.874  30.881  -53.160  1.00 44.85  ? 211 LYS E C   1 
ATOM   7196  O  O   . LYS E  2  55  ? 56.933  30.719  -54.377  1.00 45.19  ? 211 LYS E O   1 
ATOM   7197  C  CB  . LYS E  2  55  ? 55.328  29.601  -51.660  1.00 35.75  ? 211 LYS E CB  1 
ATOM   7198  C  CG  . LYS E  2  55  ? 54.283  29.303  -52.724  1.00 46.60  ? 211 LYS E CG  1 
ATOM   7199  C  CD  . LYS E  2  55  ? 52.865  29.446  -52.182  1.00 65.76  ? 211 LYS E CD  1 
ATOM   7200  C  CE  . LYS E  2  55  ? 51.812  29.112  -53.243  1.00 71.71  ? 211 LYS E CE  1 
ATOM   7201  N  NZ  . LYS E  2  55  ? 51.852  27.681  -53.662  1.00 77.30  ? 211 LYS E NZ  1 
ATOM   7202  N  N   . GLU E  2  56  ? 56.932  32.078  -52.588  1.00 42.59  ? 212 GLU E N   1 
ATOM   7203  C  CA  . GLU E  2  56  ? 57.076  33.295  -53.373  1.00 39.77  ? 212 GLU E CA  1 
ATOM   7204  C  C   . GLU E  2  56  ? 58.332  33.245  -54.240  1.00 34.56  ? 212 GLU E C   1 
ATOM   7205  O  O   . GLU E  2  56  ? 58.292  33.589  -55.413  1.00 42.00  ? 212 GLU E O   1 
ATOM   7206  C  CB  . GLU E  2  56  ? 57.133  34.508  -52.445  1.00 55.54  ? 212 GLU E CB  1 
ATOM   7207  C  CG  . GLU E  2  56  ? 57.280  35.844  -53.157  1.00 73.94  ? 212 GLU E CG  1 
ATOM   7208  C  CD  . GLU E  2  56  ? 56.126  36.135  -54.095  1.00 78.58  ? 212 GLU E CD  1 
ATOM   7209  O  OE1 . GLU E  2  56  ? 54.954  35.929  -53.681  1.00 63.90  ? 212 GLU E OE1 1 
ATOM   7210  O  OE2 . GLU E  2  56  ? 56.404  36.575  -55.236  1.00 65.30  ? 212 GLU E OE2 1 
ATOM   7211  N  N   . LEU E  2  57  ? 59.444  32.794  -53.665  1.00 44.79  ? 213 LEU E N   1 
ATOM   7212  C  CA  . LEU E  2  57  ? 60.718  32.707  -54.384  1.00 40.32  ? 213 LEU E CA  1 
ATOM   7213  C  C   . LEU E  2  57  ? 60.849  31.548  -55.358  1.00 42.05  ? 213 LEU E C   1 
ATOM   7214  O  O   . LEU E  2  57  ? 61.937  31.287  -55.858  1.00 44.69  ? 213 LEU E O   1 
ATOM   7215  C  CB  . LEU E  2  57  ? 61.874  32.642  -53.392  1.00 32.82  ? 213 LEU E CB  1 
ATOM   7216  C  CG  . LEU E  2  57  ? 61.982  33.811  -52.409  1.00 26.10  ? 213 LEU E CG  1 
ATOM   7217  C  CD1 . LEU E  2  57  ? 62.963  33.463  -51.324  1.00 25.94  ? 213 LEU E CD1 1 
ATOM   7218  C  CD2 . LEU E  2  57  ? 62.410  35.046  -53.127  1.00 22.98  ? 213 LEU E CD2 1 
ATOM   7219  N  N   . CYS E  2  58  ? 59.759  30.838  -55.616  1.00 53.00  ? 214 CYS E N   1 
ATOM   7220  C  CA  . CYS E  2  58  ? 59.779  29.719  -56.556  1.00 53.57  ? 214 CYS E CA  1 
ATOM   7221  C  C   . CYS E  2  58  ? 58.931  30.091  -57.746  1.00 65.85  ? 214 CYS E C   1 
ATOM   7222  O  O   . CYS E  2  58  ? 58.538  29.232  -58.538  1.00 76.53  ? 214 CYS E O   1 
ATOM   7223  C  CB  . CYS E  2  58  ? 59.223  28.444  -55.929  1.00 47.48  ? 214 CYS E CB  1 
ATOM   7224  S  SG  . CYS E  2  58  ? 60.299  27.743  -54.652  1.00 45.32  ? 214 CYS E SG  1 
ATOM   7225  N  N   . SER E  2  59  ? 58.637  31.383  -57.857  1.00 67.11  ? 215 SER E N   1 
ATOM   7226  C  CA  . SER E  2  59  ? 57.850  31.884  -58.964  1.00 63.52  ? 215 SER E CA  1 
ATOM   7227  C  C   . SER E  2  59  ? 58.630  31.512  -60.218  1.00 53.05  ? 215 SER E C   1 
ATOM   7228  O  O   . SER E  2  59  ? 58.058  31.150  -61.240  1.00 65.79  ? 215 SER E O   1 
ATOM   7229  C  CB  . SER E  2  59  ? 57.700  33.397  -58.853  1.00 60.28  ? 215 SER E CB  1 
ATOM   7230  O  OG  . SER E  2  59  ? 56.785  33.876  -59.821  1.00 92.72  ? 215 SER E OG  1 
ATOM   7231  N  N   . ALA E  2  60  ? 59.950  31.590  -60.111  1.00 41.93  ? 216 ALA E N   1 
ATOM   7232  C  CA  . ALA E  2  60  ? 60.844  31.252  -61.211  1.00 45.42  ? 216 ALA E CA  1 
ATOM   7233  C  C   . ALA E  2  60  ? 61.724  30.088  -60.780  1.00 37.69  ? 216 ALA E C   1 
ATOM   7234  O  O   . ALA E  2  60  ? 62.211  30.056  -59.660  1.00 40.32  ? 216 ALA E O   1 
ATOM   7235  C  CB  . ALA E  2  60  ? 61.715  32.459  -61.571  1.00 42.14  ? 216 ALA E CB  1 
ATOM   7236  N  N   . PRO E  2  61  ? 61.943  29.116  -61.664  1.00 32.09  ? 217 PRO E N   1 
ATOM   7237  C  CA  . PRO E  2  61  ? 62.784  27.962  -61.324  1.00 40.55  ? 217 PRO E CA  1 
ATOM   7238  C  C   . PRO E  2  61  ? 64.224  28.385  -61.300  1.00 37.83  ? 217 PRO E C   1 
ATOM   7239  O  O   . PRO E  2  61  ? 64.536  29.514  -61.657  1.00 39.38  ? 217 PRO E O   1 
ATOM   7240  C  CB  . PRO E  2  61  ? 62.544  27.009  -62.475  1.00 37.65  ? 217 PRO E CB  1 
ATOM   7241  C  CG  . PRO E  2  61  ? 62.463  27.948  -63.611  1.00 32.22  ? 217 PRO E CG  1 
ATOM   7242  C  CD  . PRO E  2  61  ? 61.538  29.055  -63.072  1.00 32.03  ? 217 PRO E CD  1 
ATOM   7243  N  N   . CYS E  2  62  ? 65.106  27.488  -60.881  1.00 40.49  ? 218 CYS E N   1 
ATOM   7244  C  CA  . CYS E  2  62  ? 66.520  27.821  -60.873  1.00 48.10  ? 218 CYS E CA  1 
ATOM   7245  C  C   . CYS E  2  62  ? 67.080  27.368  -62.197  1.00 46.07  ? 218 CYS E C   1 
ATOM   7246  O  O   . CYS E  2  62  ? 66.425  26.629  -62.934  1.00 45.66  ? 218 CYS E O   1 
ATOM   7247  C  CB  . CYS E  2  62  ? 67.267  27.133  -59.729  1.00 47.99  ? 218 CYS E CB  1 
ATOM   7248  S  SG  . CYS E  2  62  ? 67.048  25.342  -59.578  1.00 42.50  ? 218 CYS E SG  1 
ATOM   7249  N  N   . THR E  2  63  ? 68.290  27.816  -62.499  1.00 47.91  ? 219 THR E N   1 
ATOM   7250  C  CA  . THR E  2  63  ? 68.925  27.468  -63.756  1.00 44.93  ? 219 THR E CA  1 
ATOM   7251  C  C   . THR E  2  63  ? 70.439  27.438  -63.637  1.00 41.81  ? 219 THR E C   1 
ATOM   7252  O  O   . THR E  2  63  ? 71.037  28.209  -62.889  1.00 43.38  ? 219 THR E O   1 
ATOM   7253  C  CB  . THR E  2  63  ? 68.596  28.500  -64.823  1.00 46.23  ? 219 THR E CB  1 
ATOM   7254  O  OG1 . THR E  2  63  ? 68.975  29.791  -64.337  1.00 40.20  ? 219 THR E OG1 1 
ATOM   7255  C  CG2 . THR E  2  63  ? 67.116  28.495  -65.145  1.00 46.62  ? 219 THR E CG2 1 
ATOM   7256  N  N   . VAL E  2  64  ? 71.052  26.531  -64.379  1.00 32.71  ? 220 VAL E N   1 
ATOM   7257  C  CA  . VAL E  2  64  ? 72.499  26.444  -64.416  1.00 43.26  ? 220 VAL E CA  1 
ATOM   7258  C  C   . VAL E  2  64  ? 72.867  26.813  -65.853  1.00 55.73  ? 220 VAL E C   1 
ATOM   7259  O  O   . VAL E  2  64  ? 72.420  26.181  -66.831  1.00 38.43  ? 220 VAL E O   1 
ATOM   7260  C  CB  . VAL E  2  64  ? 73.005  25.033  -64.074  1.00 36.13  ? 220 VAL E CB  1 
ATOM   7261  C  CG1 . VAL E  2  64  ? 72.889  24.800  -62.573  1.00 53.24  ? 220 VAL E CG1 1 
ATOM   7262  C  CG2 . VAL E  2  64  ? 72.205  23.998  -64.841  1.00 42.53  ? 220 VAL E CG2 1 
ATOM   7263  N  N   . ASN E  2  65  ? 73.662  27.869  -65.974  1.00 62.87  ? 221 ASN E N   1 
ATOM   7264  C  CA  . ASN E  2  65  ? 74.073  28.357  -67.275  1.00 61.26  ? 221 ASN E CA  1 
ATOM   7265  C  C   . ASN E  2  65  ? 75.536  28.052  -67.503  1.00 57.47  ? 221 ASN E C   1 
ATOM   7266  O  O   . ASN E  2  65  ? 76.142  28.589  -68.425  1.00 66.83  ? 221 ASN E O   1 
ATOM   7267  C  CB  . ASN E  2  65  ? 73.848  29.861  -67.332  1.00 69.64  ? 221 ASN E CB  1 
ATOM   7268  C  CG  . ASN E  2  65  ? 72.497  30.266  -66.768  1.00 85.68  ? 221 ASN E CG  1 
ATOM   7269  O  OD1 . ASN E  2  65  ? 71.457  30.085  -67.411  1.00 95.68  ? 221 ASN E OD1 1 
ATOM   7270  N  ND2 . ASN E  2  65  ? 72.504  30.806  -65.548  1.00 83.63  ? 221 ASN E ND2 1 
ATOM   7271  N  N   . CYS E  2  66  ? 76.099  27.180  -66.673  1.00 43.71  ? 222 CYS E N   1 
ATOM   7272  C  CA  . CYS E  2  66  ? 77.507  26.848  -66.780  1.00 49.56  ? 222 CYS E CA  1 
ATOM   7273  C  C   . CYS E  2  66  ? 77.865  26.195  -68.115  1.00 42.01  ? 222 CYS E C   1 
ATOM   7274  O  O   . CYS E  2  66  ? 77.050  25.513  -68.731  1.00 45.65  ? 222 CYS E O   1 
ATOM   7275  C  CB  . CYS E  2  66  ? 77.931  25.962  -65.610  1.00 47.88  ? 222 CYS E CB  1 
ATOM   7276  S  SG  . CYS E  2  66  ? 77.068  24.377  -65.570  1.00 80.63  ? 222 CYS E SG  1 
ATOM   7277  N  N   . ARG E  2  67  ? 79.101  26.427  -68.542  1.00 33.20  ? 223 ARG E N   1 
ATOM   7278  C  CA  . ARG E  2  67  ? 79.632  25.926  -69.801  1.00 41.36  ? 223 ARG E CA  1 
ATOM   7279  C  C   . ARG E  2  67  ? 79.815  24.403  -69.836  1.00 41.74  ? 223 ARG E C   1 
ATOM   7280  O  O   . ARG E  2  67  ? 79.427  23.705  -68.903  1.00 45.93  ? 223 ARG E O   1 
ATOM   7281  C  CB  . ARG E  2  67  ? 80.955  26.639  -70.067  1.00 35.53  ? 223 ARG E CB  1 
ATOM   7282  C  CG  . ARG E  2  67  ? 80.825  28.159  -70.022  1.00 22.84  ? 223 ARG E CG  1 
ATOM   7283  C  CD  . ARG E  2  67  ? 82.110  28.763  -69.583  1.00 37.35  ? 223 ARG E CD  1 
ATOM   7284  N  NE  . ARG E  2  67  ? 82.068  30.212  -69.631  1.00 65.38  ? 223 ARG E NE  1 
ATOM   7285  C  CZ  . ARG E  2  67  ? 83.094  30.999  -69.308  1.00 88.91  ? 223 ARG E CZ  1 
ATOM   7286  N  NH1 . ARG E  2  67  ? 84.246  30.466  -68.905  1.00 89.96  ? 223 ARG E NH1 1 
ATOM   7287  N  NH2 . ARG E  2  67  ? 82.974  32.322  -69.397  1.00 93.62  ? 223 ARG E NH2 1 
ATOM   7288  N  N   . VAL E  2  68  ? 80.382  23.880  -70.919  1.00 32.52  ? 224 VAL E N   1 
ATOM   7289  C  CA  . VAL E  2  68  ? 80.594  22.440  -71.008  1.00 25.19  ? 224 VAL E CA  1 
ATOM   7290  C  C   . VAL E  2  68  ? 82.010  22.100  -71.443  1.00 31.99  ? 224 VAL E C   1 
ATOM   7291  O  O   . VAL E  2  68  ? 82.517  22.630  -72.435  1.00 33.74  ? 224 VAL E O   1 
ATOM   7292  C  CB  . VAL E  2  68  ? 79.536  21.754  -71.936  1.00 30.07  ? 224 VAL E CB  1 
ATOM   7293  C  CG1 . VAL E  2  68  ? 78.845  22.779  -72.789  1.00 38.33  ? 224 VAL E CG1 1 
ATOM   7294  C  CG2 . VAL E  2  68  ? 80.179  20.686  -72.810  1.00 27.80  ? 224 VAL E CG2 1 
ATOM   7295  N  N   . PRO E  2  69  ? 82.680  21.220  -70.676  1.00 28.27  ? 225 PRO E N   1 
ATOM   7296  C  CA  . PRO E  2  69  ? 84.046  20.749  -70.893  1.00 25.54  ? 225 PRO E CA  1 
ATOM   7297  C  C   . PRO E  2  69  ? 84.163  20.139  -72.260  1.00 38.96  ? 225 PRO E C   1 
ATOM   7298  O  O   . PRO E  2  69  ? 83.296  19.384  -72.676  1.00 43.39  ? 225 PRO E O   1 
ATOM   7299  C  CB  . PRO E  2  69  ? 84.222  19.716  -69.808  1.00 29.14  ? 225 PRO E CB  1 
ATOM   7300  C  CG  . PRO E  2  69  ? 83.396  20.230  -68.726  1.00 40.84  ? 225 PRO E CG  1 
ATOM   7301  C  CD  . PRO E  2  69  ? 82.143  20.635  -69.444  1.00 29.66  ? 225 PRO E CD  1 
ATOM   7302  N  N   . VAL E  2  70  ? 85.238  20.460  -72.961  1.00 47.92  ? 226 VAL E N   1 
ATOM   7303  C  CA  . VAL E  2  70  ? 85.423  19.936  -74.300  1.00 39.94  ? 226 VAL E CA  1 
ATOM   7304  C  C   . VAL E  2  70  ? 85.771  18.478  -74.197  1.00 43.75  ? 226 VAL E C   1 
ATOM   7305  O  O   . VAL E  2  70  ? 85.258  17.655  -74.951  1.00 59.44  ? 226 VAL E O   1 
ATOM   7306  C  CB  . VAL E  2  70  ? 86.537  20.694  -75.044  1.00 40.37  ? 226 VAL E CB  1 
ATOM   7307  C  CG1 . VAL E  2  70  ? 86.923  19.954  -76.299  1.00 26.55  ? 226 VAL E CG1 1 
ATOM   7308  C  CG2 . VAL E  2  70  ? 86.061  22.111  -75.385  1.00 31.90  ? 226 VAL E CG2 1 
ATOM   7309  N  N   . VAL E  2  71  ? 86.631  18.153  -73.245  1.00 41.15  ? 227 VAL E N   1 
ATOM   7310  C  CA  . VAL E  2  71  ? 87.049  16.775  -73.058  1.00 28.85  ? 227 VAL E CA  1 
ATOM   7311  C  C   . VAL E  2  71  ? 85.844  15.930  -72.639  1.00 33.88  ? 227 VAL E C   1 
ATOM   7312  O  O   . VAL E  2  71  ? 84.924  16.413  -71.981  1.00 24.82  ? 227 VAL E O   1 
ATOM   7313  C  CB  . VAL E  2  71  ? 88.168  16.686  -71.998  1.00 30.82  ? 227 VAL E CB  1 
ATOM   7314  C  CG1 . VAL E  2  71  ? 87.611  17.030  -70.633  1.00 22.46  ? 227 VAL E CG1 1 
ATOM   7315  C  CG2 . VAL E  2  71  ? 88.805  15.309  -72.007  1.00 15.69  ? 227 VAL E CG2 1 
ATOM   7316  N  N   . SER E  2  72  ? 85.848  14.668  -73.050  1.00 36.72  ? 228 SER E N   1 
ATOM   7317  C  CA  . SER E  2  72  ? 84.763  13.760  -72.732  1.00 32.18  ? 228 SER E CA  1 
ATOM   7318  C  C   . SER E  2  72  ? 85.197  12.323  -72.934  1.00 40.98  ? 228 SER E C   1 
ATOM   7319  O  O   . SER E  2  72  ? 86.334  12.066  -73.311  1.00 53.60  ? 228 SER E O   1 
ATOM   7320  C  CB  . SER E  2  72  ? 83.579  14.059  -73.627  1.00 20.81  ? 228 SER E CB  1 
ATOM   7321  O  OG  . SER E  2  72  ? 82.531  13.146  -73.418  1.00 28.50  ? 228 SER E OG  1 
ATOM   7322  N  N   . GLY E  2  73  ? 84.286  11.390  -72.679  1.00 39.42  ? 229 GLY E N   1 
ATOM   7323  C  CA  . GLY E  2  73  ? 84.588  9.978   -72.849  1.00 33.75  ? 229 GLY E CA  1 
ATOM   7324  C  C   . GLY E  2  73  ? 83.398  9.080   -72.557  1.00 39.31  ? 229 GLY E C   1 
ATOM   7325  O  O   . GLY E  2  73  ? 82.255  9.533   -72.533  1.00 33.55  ? 229 GLY E O   1 
ATOM   7326  N  N   . MET E  2  74  ? 83.665  7.801   -72.323  1.00 42.32  ? 230 MET E N   1 
ATOM   7327  C  CA  . MET E  2  74  ? 82.604  6.846   -72.033  1.00 52.11  ? 230 MET E CA  1 
ATOM   7328  C  C   . MET E  2  74  ? 82.236  6.965   -70.564  1.00 61.52  ? 230 MET E C   1 
ATOM   7329  O  O   . MET E  2  74  ? 81.098  7.264   -70.192  1.00 56.50  ? 230 MET E O   1 
ATOM   7330  C  CB  . MET E  2  74  ? 83.089  5.417   -72.290  1.00 53.92  ? 230 MET E CB  1 
ATOM   7331  C  CG  . MET E  2  74  ? 83.488  5.096   -73.717  1.00 84.24  ? 230 MET E CG  1 
ATOM   7332  S  SD  . MET E  2  74  ? 84.172  3.424   -73.838  1.00 94.54  ? 230 MET E SD  1 
ATOM   7333  C  CE  . MET E  2  74  ? 82.822  2.447   -73.134  1.00 89.16  ? 230 MET E CE  1 
ATOM   7334  N  N   . HIS E  2  75  ? 83.241  6.697   -69.742  1.00 69.38  ? 231 HIS E N   1 
ATOM   7335  C  CA  . HIS E  2  75  ? 83.145  6.715   -68.296  1.00 59.73  ? 231 HIS E CA  1 
ATOM   7336  C  C   . HIS E  2  75  ? 83.833  8.016   -67.912  1.00 55.67  ? 231 HIS E C   1 
ATOM   7337  O  O   . HIS E  2  75  ? 84.202  8.778   -68.792  1.00 58.01  ? 231 HIS E O   1 
ATOM   7338  C  CB  . HIS E  2  75  ? 83.932  5.514   -67.760  1.00 65.69  ? 231 HIS E CB  1 
ATOM   7339  C  CG  . HIS E  2  75  ? 83.732  5.261   -66.296  1.00 103.75 ? 231 HIS E CG  1 
ATOM   7340  N  ND1 . HIS E  2  75  ? 82.761  4.408   -65.814  1.00 109.27 ? 231 HIS E ND1 1 
ATOM   7341  C  CD2 . HIS E  2  75  ? 84.364  5.763   -65.206  1.00 101.82 ? 231 HIS E CD2 1 
ATOM   7342  C  CE1 . HIS E  2  75  ? 82.804  4.396   -64.493  1.00 112.85 ? 231 HIS E CE1 1 
ATOM   7343  N  NE2 . HIS E  2  75  ? 83.768  5.209   -64.099  1.00 105.61 ? 231 HIS E NE2 1 
ATOM   7344  N  N   . CYS E  2  76  ? 83.979  8.294   -66.618  1.00 55.75  ? 232 CYS E N   1 
ATOM   7345  C  CA  . CYS E  2  76  ? 84.709  9.483   -66.180  1.00 45.51  ? 232 CYS E CA  1 
ATOM   7346  C  C   . CYS E  2  76  ? 86.165  9.040   -66.197  1.00 52.17  ? 232 CYS E C   1 
ATOM   7347  O  O   . CYS E  2  76  ? 87.070  9.844   -66.394  1.00 57.10  ? 232 CYS E O   1 
ATOM   7348  C  CB  . CYS E  2  76  ? 84.365  9.884   -64.756  1.00 44.33  ? 232 CYS E CB  1 
ATOM   7349  S  SG  . CYS E  2  76  ? 82.806  10.778  -64.483  1.00 52.47  ? 232 CYS E SG  1 
ATOM   7350  N  N   . GLU E  2  77  ? 86.369  7.745   -65.963  1.00 55.47  ? 233 GLU E N   1 
ATOM   7351  C  CA  . GLU E  2  77  ? 87.691  7.138   -65.983  1.00 57.04  ? 233 GLU E CA  1 
ATOM   7352  C  C   . GLU E  2  77  ? 88.278  7.502   -67.335  1.00 55.61  ? 233 GLU E C   1 
ATOM   7353  O  O   . GLU E  2  77  ? 89.419  7.960   -67.446  1.00 56.48  ? 233 GLU E O   1 
ATOM   7354  C  CB  . GLU E  2  77  ? 87.562  5.617   -65.872  1.00 69.25  ? 233 GLU E CB  1 
ATOM   7355  C  CG  . GLU E  2  77  ? 88.828  4.818   -66.195  1.00 82.75  ? 233 GLU E CG  1 
ATOM   7356  C  CD  . GLU E  2  77  ? 89.867  4.874   -65.091  1.00 95.80  ? 233 GLU E CD  1 
ATOM   7357  O  OE1 . GLU E  2  77  ? 89.562  4.418   -63.963  1.00 94.87  ? 233 GLU E OE1 1 
ATOM   7358  O  OE2 . GLU E  2  77  ? 90.987  5.370   -65.354  1.00 101.74 ? 233 GLU E OE2 1 
ATOM   7359  N  N   . ASP E  2  78  ? 87.469  7.304   -68.363  1.00 44.04  ? 234 ASP E N   1 
ATOM   7360  C  CA  . ASP E  2  78  ? 87.882  7.608   -69.719  1.00 42.69  ? 234 ASP E CA  1 
ATOM   7361  C  C   . ASP E  2  78  ? 88.243  9.082   -69.809  1.00 44.14  ? 234 ASP E C   1 
ATOM   7362  O  O   . ASP E  2  78  ? 89.225  9.450   -70.445  1.00 44.92  ? 234 ASP E O   1 
ATOM   7363  C  CB  . ASP E  2  78  ? 86.751  7.286   -70.687  1.00 49.27  ? 234 ASP E CB  1 
ATOM   7364  C  CG  . ASP E  2  78  ? 87.253  6.949   -72.057  1.00 59.36  ? 234 ASP E CG  1 
ATOM   7365  O  OD1 . ASP E  2  78  ? 88.165  6.100   -72.150  1.00 62.47  ? 234 ASP E OD1 1 
ATOM   7366  O  OD2 . ASP E  2  78  ? 86.739  7.525   -73.037  1.00 71.37  ? 234 ASP E OD2 1 
ATOM   7367  N  N   . ILE E  2  79  ? 87.447  9.929   -69.166  1.00 47.93  ? 235 ILE E N   1 
ATOM   7368  C  CA  . ILE E  2  79  ? 87.708  11.363  -69.173  1.00 40.37  ? 235 ILE E CA  1 
ATOM   7369  C  C   . ILE E  2  79  ? 89.041  11.646  -68.503  1.00 34.69  ? 235 ILE E C   1 
ATOM   7370  O  O   . ILE E  2  79  ? 89.829  12.450  -68.989  1.00 31.00  ? 235 ILE E O   1 
ATOM   7371  C  CB  . ILE E  2  79  ? 86.591  12.146  -68.449  1.00 37.64  ? 235 ILE E CB  1 
ATOM   7372  C  CG1 . ILE E  2  79  ? 85.327  12.156  -69.318  1.00 39.61  ? 235 ILE E CG1 1 
ATOM   7373  C  CG2 . ILE E  2  79  ? 87.056  13.566  -68.144  1.00 34.89  ? 235 ILE E CG2 1 
ATOM   7374  C  CD1 . ILE E  2  79  ? 84.222  13.064  -68.801  1.00 40.93  ? 235 ILE E CD1 1 
ATOM   7375  N  N   . TYR E  2  80  ? 89.292  10.983  -67.383  1.00 41.26  ? 236 TYR E N   1 
ATOM   7376  C  CA  . TYR E  2  80  ? 90.550  11.167  -66.675  1.00 51.42  ? 236 TYR E CA  1 
ATOM   7377  C  C   . TYR E  2  80  ? 91.674  10.872  -67.667  1.00 50.28  ? 236 TYR E C   1 
ATOM   7378  O  O   . TYR E  2  80  ? 92.575  11.684  -67.868  1.00 56.70  ? 236 TYR E O   1 
ATOM   7379  C  CB  . TYR E  2  80  ? 90.634  10.205  -65.493  1.00 55.77  ? 236 TYR E CB  1 
ATOM   7380  C  CG  . TYR E  2  80  ? 91.779  10.475  -64.545  1.00 57.84  ? 236 TYR E CG  1 
ATOM   7381  C  CD1 . TYR E  2  80  ? 91.712  11.501  -63.614  1.00 61.72  ? 236 TYR E CD1 1 
ATOM   7382  C  CD2 . TYR E  2  80  ? 92.936  9.703   -64.587  1.00 64.91  ? 236 TYR E CD2 1 
ATOM   7383  C  CE1 . TYR E  2  80  ? 92.773  11.752  -62.746  1.00 76.51  ? 236 TYR E CE1 1 
ATOM   7384  C  CE2 . TYR E  2  80  ? 94.000  9.945   -63.726  1.00 59.61  ? 236 TYR E CE2 1 
ATOM   7385  C  CZ  . TYR E  2  80  ? 93.914  10.969  -62.810  1.00 72.80  ? 236 TYR E CZ  1 
ATOM   7386  O  OH  . TYR E  2  80  ? 94.968  11.211  -61.958  1.00 79.40  ? 236 TYR E OH  1 
ATOM   7387  N  N   . ARG E  2  81  ? 91.601  9.713   -68.307  1.00 47.40  ? 237 ARG E N   1 
ATOM   7388  C  CA  . ARG E  2  81  ? 92.607  9.319   -69.287  1.00 44.02  ? 237 ARG E CA  1 
ATOM   7389  C  C   . ARG E  2  81  ? 92.753  10.353  -70.404  1.00 45.13  ? 237 ARG E C   1 
ATOM   7390  O  O   . ARG E  2  81  ? 93.733  10.352  -71.143  1.00 52.09  ? 237 ARG E O   1 
ATOM   7391  C  CB  . ARG E  2  81  ? 92.236  7.972   -69.903  1.00 39.19  ? 237 ARG E CB  1 
ATOM   7392  C  CG  . ARG E  2  81  ? 91.819  6.912   -68.892  1.00 73.03  ? 237 ARG E CG  1 
ATOM   7393  C  CD  . ARG E  2  81  ? 91.243  5.671   -69.586  1.00 91.53  ? 237 ARG E CD  1 
ATOM   7394  N  NE  . ARG E  2  81  ? 92.286  4.788   -70.101  1.00 103.24 ? 237 ARG E NE  1 
ATOM   7395  C  CZ  . ARG E  2  81  ? 93.070  4.034   -69.335  1.00 108.79 ? 237 ARG E CZ  1 
ATOM   7396  N  NH1 . ARG E  2  81  ? 92.926  4.050   -68.013  1.00 100.27 ? 237 ARG E NH1 1 
ATOM   7397  N  NH2 . ARG E  2  81  ? 94.006  3.272   -69.891  1.00 112.27 ? 237 ARG E NH2 1 
ATOM   7398  N  N   . ASN E  2  82  ? 91.784  11.244  -70.527  1.00 44.94  ? 238 ASN E N   1 
ATOM   7399  C  CA  . ASN E  2  82  ? 91.836  12.242  -71.580  1.00 46.10  ? 238 ASN E CA  1 
ATOM   7400  C  C   . ASN E  2  82  ? 92.183  13.632  -71.112  1.00 46.06  ? 238 ASN E C   1 
ATOM   7401  O  O   . ASN E  2  82  ? 92.010  14.603  -71.848  1.00 58.73  ? 238 ASN E O   1 
ATOM   7402  C  CB  . ASN E  2  82  ? 90.512  12.269  -72.330  1.00 48.44  ? 238 ASN E CB  1 
ATOM   7403  C  CG  . ASN E  2  82  ? 90.276  11.002  -73.116  1.00 54.84  ? 238 ASN E CG  1 
ATOM   7404  O  OD1 . ASN E  2  82  ? 89.174  10.742  -73.591  1.00 49.18  ? 238 ASN E OD1 1 
ATOM   7405  N  ND2 . ASN E  2  82  ? 91.323  10.204  -73.267  1.00 58.70  ? 238 ASN E ND2 1 
ATOM   7406  N  N   . GLY E  2  83  ? 92.668  13.740  -69.887  1.00 42.92  ? 239 GLY E N   1 
ATOM   7407  C  CA  . GLY E  2  83  ? 93.054  15.046  -69.391  1.00 55.07  ? 239 GLY E CA  1 
ATOM   7408  C  C   . GLY E  2  83  ? 92.081  15.704  -68.446  1.00 54.92  ? 239 GLY E C   1 
ATOM   7409  O  O   . GLY E  2  83  ? 92.408  16.718  -67.835  1.00 67.18  ? 239 GLY E O   1 
ATOM   7410  N  N   . GLY E  2  84  ? 90.877  15.162  -68.334  1.00 50.20  ? 240 GLY E N   1 
ATOM   7411  C  CA  . GLY E  2  84  ? 89.932  15.752  -67.408  1.00 49.72  ? 240 GLY E CA  1 
ATOM   7412  C  C   . GLY E  2  84  ? 90.431  15.384  -66.030  1.00 48.69  ? 240 GLY E C   1 
ATOM   7413  O  O   . GLY E  2  84  ? 90.219  14.256  -65.582  1.00 48.51  ? 240 GLY E O   1 
ATOM   7414  N  N   . ARG E  2  85  ? 91.104  16.315  -65.358  1.00 41.84  ? 241 ARG E N   1 
ATOM   7415  C  CA  . ARG E  2  85  ? 91.635  16.017  -64.038  1.00 45.34  ? 241 ARG E CA  1 
ATOM   7416  C  C   . ARG E  2  85  ? 90.978  16.793  -62.909  1.00 46.10  ? 241 ARG E C   1 
ATOM   7417  O  O   . ARG E  2  85  ? 91.265  16.564  -61.743  1.00 45.98  ? 241 ARG E O   1 
ATOM   7418  C  CB  . ARG E  2  85  ? 93.150  16.245  -64.022  1.00 44.16  ? 241 ARG E CB  1 
ATOM   7419  C  CG  . ARG E  2  85  ? 93.924  15.364  -64.985  1.00 47.41  ? 241 ARG E CG  1 
ATOM   7420  C  CD  . ARG E  2  85  ? 93.345  13.965  -65.026  1.00 56.42  ? 241 ARG E CD  1 
ATOM   7421  N  NE  . ARG E  2  85  ? 94.110  13.063  -65.877  1.00 70.07  ? 241 ARG E NE  1 
ATOM   7422  C  CZ  . ARG E  2  85  ? 95.279  12.537  -65.538  1.00 79.99  ? 241 ARG E CZ  1 
ATOM   7423  N  NH1 . ARG E  2  85  ? 95.817  12.829  -64.360  1.00 90.96  ? 241 ARG E NH1 1 
ATOM   7424  N  NH2 . ARG E  2  85  ? 95.907  11.717  -66.368  1.00 77.60  ? 241 ARG E NH2 1 
ATOM   7425  N  N   . THR E  2  86  ? 90.104  17.725  -63.254  1.00 42.93  ? 242 THR E N   1 
ATOM   7426  C  CA  . THR E  2  86  ? 89.410  18.498  -62.243  1.00 39.98  ? 242 THR E CA  1 
ATOM   7427  C  C   . THR E  2  86  ? 88.071  17.836  -61.996  1.00 37.51  ? 242 THR E C   1 
ATOM   7428  O  O   . THR E  2  86  ? 87.506  17.257  -62.905  1.00 34.79  ? 242 THR E O   1 
ATOM   7429  C  CB  . THR E  2  86  ? 89.154  19.903  -62.736  1.00 42.81  ? 242 THR E CB  1 
ATOM   7430  O  OG1 . THR E  2  86  ? 88.733  19.840  -64.101  1.00 42.98  ? 242 THR E OG1 1 
ATOM   7431  C  CG2 . THR E  2  86  ? 90.405  20.740  -62.629  1.00 51.63  ? 242 THR E CG2 1 
ATOM   7432  N  N   . SER E  2  87  ? 87.569  17.906  -60.772  1.00 46.46  ? 243 SER E N   1 
ATOM   7433  C  CA  . SER E  2  87  ? 86.274  17.314  -60.462  1.00 43.56  ? 243 SER E CA  1 
ATOM   7434  C  C   . SER E  2  87  ? 85.208  18.351  -60.763  1.00 38.50  ? 243 SER E C   1 
ATOM   7435  O  O   . SER E  2  87  ? 85.184  19.418  -60.168  1.00 45.79  ? 243 SER E O   1 
ATOM   7436  C  CB  . SER E  2  87  ? 86.197  16.901  -58.989  1.00 43.51  ? 243 SER E CB  1 
ATOM   7437  O  OG  . SER E  2  87  ? 87.019  15.785  -58.730  1.00 50.23  ? 243 SER E OG  1 
ATOM   7438  N  N   . GLU E  2  88  ? 84.324  18.028  -61.688  1.00 33.74  ? 244 GLU E N   1 
ATOM   7439  C  CA  . GLU E  2  88  ? 83.264  18.935  -62.078  1.00 41.84  ? 244 GLU E CA  1 
ATOM   7440  C  C   . GLU E  2  88  ? 82.326  18.216  -63.033  1.00 41.49  ? 244 GLU E C   1 
ATOM   7441  O  O   . GLU E  2  88  ? 82.538  17.061  -63.359  1.00 48.99  ? 244 GLU E O   1 
ATOM   7442  C  CB  . GLU E  2  88  ? 83.869  20.144  -62.777  1.00 39.58  ? 244 GLU E CB  1 
ATOM   7443  C  CG  . GLU E  2  88  ? 84.817  19.750  -63.908  1.00 51.26  ? 244 GLU E CG  1 
ATOM   7444  C  CD  . GLU E  2  88  ? 85.384  20.934  -64.672  1.00 50.77  ? 244 GLU E CD  1 
ATOM   7445  O  OE1 . GLU E  2  88  ? 84.639  21.552  -65.462  1.00 50.87  ? 244 GLU E OE1 1 
ATOM   7446  O  OE2 . GLU E  2  88  ? 86.576  21.250  -64.477  1.00 38.77  ? 244 GLU E OE2 1 
ATOM   7447  N  N   . ALA E  2  89  ? 81.293  18.914  -63.487  1.00 45.03  ? 245 ALA E N   1 
ATOM   7448  C  CA  . ALA E  2  89  ? 80.321  18.348  -64.418  1.00 38.55  ? 245 ALA E CA  1 
ATOM   7449  C  C   . ALA E  2  89  ? 80.930  18.103  -65.797  1.00 41.22  ? 245 ALA E C   1 
ATOM   7450  O  O   . ALA E  2  89  ? 81.523  19.003  -66.390  1.00 51.18  ? 245 ALA E O   1 
ATOM   7451  C  CB  . ALA E  2  89  ? 79.154  19.290  -64.550  1.00 31.24  ? 245 ALA E CB  1 
ATOM   7452  N  N   . TYR E  2  90  ? 80.797  16.886  -66.304  1.00 33.67  ? 246 TYR E N   1 
ATOM   7453  C  CA  . TYR E  2  90  ? 81.314  16.549  -67.631  1.00 37.35  ? 246 TYR E CA  1 
ATOM   7454  C  C   . TYR E  2  90  ? 80.197  15.894  -68.425  1.00 35.02  ? 246 TYR E C   1 
ATOM   7455  O  O   . TYR E  2  90  ? 79.118  15.603  -67.900  1.00 39.82  ? 246 TYR E O   1 
ATOM   7456  C  CB  . TYR E  2  90  ? 82.469  15.538  -67.563  1.00 39.77  ? 246 TYR E CB  1 
ATOM   7457  C  CG  . TYR E  2  90  ? 83.790  16.071  -67.060  1.00 59.21  ? 246 TYR E CG  1 
ATOM   7458  C  CD1 . TYR E  2  90  ? 83.998  16.322  -65.704  1.00 55.23  ? 246 TYR E CD1 1 
ATOM   7459  C  CD2 . TYR E  2  90  ? 84.841  16.311  -67.941  1.00 50.52  ? 246 TYR E CD2 1 
ATOM   7460  C  CE1 . TYR E  2  90  ? 85.220  16.800  -65.244  1.00 51.58  ? 246 TYR E CE1 1 
ATOM   7461  C  CE2 . TYR E  2  90  ? 86.065  16.788  -67.484  1.00 53.28  ? 246 TYR E CE2 1 
ATOM   7462  C  CZ  . TYR E  2  90  ? 86.247  17.031  -66.138  1.00 47.93  ? 246 TYR E CZ  1 
ATOM   7463  O  OH  . TYR E  2  90  ? 87.450  17.519  -65.695  1.00 47.48  ? 246 TYR E OH  1 
ATOM   7464  N  N   . TYR E  2  91  ? 80.447  15.673  -69.701  1.00 25.75  ? 247 TYR E N   1 
ATOM   7465  C  CA  . TYR E  2  91  ? 79.468  14.978  -70.516  1.00 37.01  ? 247 TYR E CA  1 
ATOM   7466  C  C   . TYR E  2  91  ? 80.090  13.625  -70.857  1.00 30.78  ? 247 TYR E C   1 
ATOM   7467  O  O   . TYR E  2  91  ? 81.277  13.533  -71.177  1.00 26.66  ? 247 TYR E O   1 
ATOM   7468  C  CB  . TYR E  2  91  ? 79.166  15.752  -71.806  1.00 39.76  ? 247 TYR E CB  1 
ATOM   7469  C  CG  . TYR E  2  91  ? 77.979  16.667  -71.718  1.00 46.81  ? 247 TYR E CG  1 
ATOM   7470  C  CD1 . TYR E  2  91  ? 78.063  17.895  -71.076  1.00 60.17  ? 247 TYR E CD1 1 
ATOM   7471  C  CD2 . TYR E  2  91  ? 76.766  16.303  -72.278  1.00 55.36  ? 247 TYR E CD2 1 
ATOM   7472  C  CE1 . TYR E  2  91  ? 76.953  18.741  -70.999  1.00 77.88  ? 247 TYR E CE1 1 
ATOM   7473  C  CE2 . TYR E  2  91  ? 75.656  17.137  -72.209  1.00 65.53  ? 247 TYR E CE2 1 
ATOM   7474  C  CZ  . TYR E  2  91  ? 75.750  18.351  -71.573  1.00 69.48  ? 247 TYR E CZ  1 
ATOM   7475  O  OH  . TYR E  2  91  ? 74.637  19.161  -71.520  1.00 69.36  ? 247 TYR E OH  1 
ATOM   7476  N  N   . ILE E  2  92  ? 79.322  12.556  -70.753  1.00 26.22  ? 248 ILE E N   1 
ATOM   7477  C  CA  . ILE E  2  92  ? 79.891  11.269  -71.131  1.00 38.87  ? 248 ILE E CA  1 
ATOM   7478  C  C   . ILE E  2  92  ? 78.944  10.576  -72.076  1.00 39.79  ? 248 ILE E C   1 
ATOM   7479  O  O   . ILE E  2  92  ? 77.774  10.931  -72.163  1.00 50.40  ? 248 ILE E O   1 
ATOM   7480  C  CB  . ILE E  2  92  ? 80.119  10.341  -69.934  1.00 36.51  ? 248 ILE E CB  1 
ATOM   7481  C  CG1 . ILE E  2  92  ? 78.791  10.121  -69.195  1.00 34.66  ? 248 ILE E CG1 1 
ATOM   7482  C  CG2 . ILE E  2  92  ? 81.252  10.886  -69.079  1.00 10.61  ? 248 ILE E CG2 1 
ATOM   7483  C  CD1 . ILE E  2  92  ? 78.858  9.104   -68.066  1.00 23.51  ? 248 ILE E CD1 1 
ATOM   7484  N  N   . GLN E  2  93  ? 79.459  9.592   -72.792  1.00 32.07  ? 249 GLN E N   1 
ATOM   7485  C  CA  . GLN E  2  93  ? 78.648  8.829   -73.722  1.00 46.76  ? 249 GLN E CA  1 
ATOM   7486  C  C   . GLN E  2  93  ? 79.137  7.387   -73.732  1.00 46.73  ? 249 GLN E C   1 
ATOM   7487  O  O   . GLN E  2  93  ? 79.953  6.987   -74.570  1.00 41.02  ? 249 GLN E O   1 
ATOM   7488  C  CB  . GLN E  2  93  ? 78.708  9.431   -75.137  1.00 50.87  ? 249 GLN E CB  1 
ATOM   7489  C  CG  . GLN E  2  93  ? 78.035  8.572   -76.189  1.00 53.33  ? 249 GLN E CG  1 
ATOM   7490  C  CD  . GLN E  2  93  ? 77.764  9.304   -77.482  1.00 64.55  ? 249 GLN E CD  1 
ATOM   7491  O  OE1 . GLN E  2  93  ? 78.644  9.949   -78.049  1.00 70.48  ? 249 GLN E OE1 1 
ATOM   7492  N  NE2 . GLN E  2  93  ? 76.535  9.198   -77.964  1.00 66.62  ? 249 GLN E NE2 1 
ATOM   7493  N  N   . PRO E  2  94  ? 78.665  6.591   -72.763  1.00 52.21  ? 250 PRO E N   1 
ATOM   7494  C  CA  . PRO E  2  94  ? 79.074  5.189   -72.700  1.00 55.52  ? 250 PRO E CA  1 
ATOM   7495  C  C   . PRO E  2  94  ? 78.427  4.332   -73.800  1.00 58.63  ? 250 PRO E C   1 
ATOM   7496  O  O   . PRO E  2  94  ? 79.034  3.365   -74.265  1.00 68.68  ? 250 PRO E O   1 
ATOM   7497  C  CB  . PRO E  2  94  ? 78.673  4.780   -71.287  1.00 48.18  ? 250 PRO E CB  1 
ATOM   7498  C  CG  . PRO E  2  94  ? 77.507  5.669   -70.995  1.00 49.09  ? 250 PRO E CG  1 
ATOM   7499  C  CD  . PRO E  2  94  ? 77.939  6.990   -71.544  1.00 40.29  ? 250 PRO E CD  1 
ATOM   7500  N  N   . ASP E  2  95  ? 77.212  4.690   -74.225  1.00 67.85  ? 251 ASP E N   1 
ATOM   7501  C  CA  . ASP E  2  95  ? 76.508  3.966   -75.301  1.00 68.42  ? 251 ASP E CA  1 
ATOM   7502  C  C   . ASP E  2  95  ? 76.424  4.826   -76.556  1.00 62.89  ? 251 ASP E C   1 
ATOM   7503  O  O   . ASP E  2  95  ? 75.796  5.883   -76.560  1.00 66.13  ? 251 ASP E O   1 
ATOM   7504  C  CB  . ASP E  2  95  ? 75.086  3.586   -74.886  1.00 76.35  ? 251 ASP E CB  1 
ATOM   7505  C  CG  . ASP E  2  95  ? 75.044  2.383   -73.970  1.00 96.65  ? 251 ASP E CG  1 
ATOM   7506  O  OD1 . ASP E  2  95  ? 75.627  2.443   -72.866  1.00 110.28 ? 251 ASP E OD1 1 
ATOM   7507  O  OD2 . ASP E  2  95  ? 74.426  1.369   -74.352  1.00 91.36  ? 251 ASP E OD2 1 
ATOM   7508  N  N   . LEU E  2  96  ? 77.053  4.364   -77.624  1.00 54.96  ? 252 LEU E N   1 
ATOM   7509  C  CA  . LEU E  2  96  ? 77.047  5.097   -78.872  1.00 54.07  ? 252 LEU E CA  1 
ATOM   7510  C  C   . LEU E  2  96  ? 75.678  5.255   -79.510  1.00 56.29  ? 252 LEU E C   1 
ATOM   7511  O  O   . LEU E  2  96  ? 75.516  6.048   -80.439  1.00 66.96  ? 252 LEU E O   1 
ATOM   7512  C  CB  . LEU E  2  96  ? 78.002  4.437   -79.861  1.00 48.71  ? 252 LEU E CB  1 
ATOM   7513  C  CG  . LEU E  2  96  ? 79.461  4.909   -79.819  1.00 60.65  ? 252 LEU E CG  1 
ATOM   7514  C  CD1 . LEU E  2  96  ? 79.568  6.275   -80.482  1.00 61.40  ? 252 LEU E CD1 1 
ATOM   7515  C  CD2 . LEU E  2  96  ? 79.963  4.950   -78.370  1.00 67.07  ? 252 LEU E CD2 1 
ATOM   7516  N  N   . PHE E  2  97  ? 74.692  4.513   -79.024  1.00 67.28  ? 253 PHE E N   1 
ATOM   7517  C  CA  . PHE E  2  97  ? 73.356  4.605   -79.595  1.00 81.35  ? 253 PHE E CA  1 
ATOM   7518  C  C   . PHE E  2  97  ? 72.463  5.441   -78.698  1.00 76.40  ? 253 PHE E C   1 
ATOM   7519  O  O   . PHE E  2  97  ? 71.256  5.549   -78.915  1.00 75.43  ? 253 PHE E O   1 
ATOM   7520  C  CB  . PHE E  2  97  ? 72.763  3.205   -79.810  1.00 101.80 ? 253 PHE E CB  1 
ATOM   7521  C  CG  . PHE E  2  97  ? 72.231  2.559   -78.561  1.00 129.85 ? 253 PHE E CG  1 
ATOM   7522  C  CD1 . PHE E  2  97  ? 73.017  2.452   -77.418  1.00 138.85 ? 253 PHE E CD1 1 
ATOM   7523  C  CD2 . PHE E  2  97  ? 70.940  2.028   -78.539  1.00 142.74 ? 253 PHE E CD2 1 
ATOM   7524  C  CE1 . PHE E  2  97  ? 72.525  1.823   -76.271  1.00 148.76 ? 253 PHE E CE1 1 
ATOM   7525  C  CE2 . PHE E  2  97  ? 70.440  1.397   -77.397  1.00 148.66 ? 253 PHE E CE2 1 
ATOM   7526  C  CZ  . PHE E  2  97  ? 71.234  1.294   -76.261  1.00 150.21 ? 253 PHE E CZ  1 
ATOM   7527  N  N   . SER E  2  98  ? 73.079  6.045   -77.691  1.00 72.75  ? 254 SER E N   1 
ATOM   7528  C  CA  . SER E  2  98  ? 72.368  6.894   -76.748  1.00 63.38  ? 254 SER E CA  1 
ATOM   7529  C  C   . SER E  2  98  ? 73.128  8.192   -76.662  1.00 53.22  ? 254 SER E C   1 
ATOM   7530  O  O   . SER E  2  98  ? 74.355  8.193   -76.734  1.00 53.20  ? 254 SER E O   1 
ATOM   7531  C  CB  . SER E  2  98  ? 72.316  6.240   -75.375  1.00 69.05  ? 254 SER E CB  1 
ATOM   7532  O  OG  . SER E  2  98  ? 71.741  4.951   -75.460  1.00 84.94  ? 254 SER E OG  1 
ATOM   7533  N  N   . GLU E  2  99  ? 72.399  9.294   -76.514  1.00 51.61  ? 255 GLU E N   1 
ATOM   7534  C  CA  . GLU E  2  99  ? 73.009  10.618  -76.429  1.00 60.07  ? 255 GLU E CA  1 
ATOM   7535  C  C   . GLU E  2  99  ? 73.936  10.742  -75.225  1.00 59.64  ? 255 GLU E C   1 
ATOM   7536  O  O   . GLU E  2  99  ? 73.817  9.996   -74.250  1.00 56.24  ? 255 GLU E O   1 
ATOM   7537  C  CB  . GLU E  2  99  ? 71.928  11.698  -76.333  1.00 67.50  ? 255 GLU E CB  1 
ATOM   7538  C  CG  . GLU E  2  99  ? 70.909  11.701  -77.469  1.00 95.36  ? 255 GLU E CG  1 
ATOM   7539  C  CD  . GLU E  2  99  ? 71.529  11.945  -78.838  1.00 106.43 ? 255 GLU E CD  1 
ATOM   7540  O  OE1 . GLU E  2  99  ? 72.283  12.935  -78.989  1.00 109.75 ? 255 GLU E OE1 1 
ATOM   7541  O  OE2 . GLU E  2  99  ? 71.250  11.148  -79.764  1.00 109.98 ? 255 GLU E OE2 1 
ATOM   7542  N  N   . PRO E  2  100 ? 74.893  11.677  -75.287  1.00 56.79  ? 256 PRO E N   1 
ATOM   7543  C  CA  . PRO E  2  100 ? 75.813  11.866  -74.170  1.00 55.07  ? 256 PRO E CA  1 
ATOM   7544  C  C   . PRO E  2  100 ? 75.022  12.579  -73.090  1.00 50.74  ? 256 PRO E C   1 
ATOM   7545  O  O   . PRO E  2  100 ? 74.118  13.352  -73.404  1.00 50.74  ? 256 PRO E O   1 
ATOM   7546  C  CB  . PRO E  2  100 ? 76.894  12.770  -74.760  1.00 46.33  ? 256 PRO E CB  1 
ATOM   7547  C  CG  . PRO E  2  100 ? 76.825  12.509  -76.198  1.00 40.26  ? 256 PRO E CG  1 
ATOM   7548  C  CD  . PRO E  2  100 ? 75.352  12.440  -76.454  1.00 57.06  ? 256 PRO E CD  1 
ATOM   7549  N  N   . TYR E  2  101 ? 75.349  12.324  -71.829  1.00 46.96  ? 257 TYR E N   1 
ATOM   7550  C  CA  . TYR E  2  101 ? 74.647  12.978  -70.734  1.00 45.83  ? 257 TYR E CA  1 
ATOM   7551  C  C   . TYR E  2  101 ? 75.602  13.553  -69.707  1.00 53.16  ? 257 TYR E C   1 
ATOM   7552  O  O   . TYR E  2  101 ? 76.714  13.047  -69.521  1.00 61.55  ? 257 TYR E O   1 
ATOM   7553  C  CB  . TYR E  2  101 ? 73.674  12.008  -70.063  1.00 39.80  ? 257 TYR E CB  1 
ATOM   7554  C  CG  . TYR E  2  101 ? 74.284  10.696  -69.627  1.00 42.41  ? 257 TYR E CG  1 
ATOM   7555  C  CD1 . TYR E  2  101 ? 74.926  10.566  -68.393  1.00 50.76  ? 257 TYR E CD1 1 
ATOM   7556  C  CD2 . TYR E  2  101 ? 74.202  9.577   -70.442  1.00 33.00  ? 257 TYR E CD2 1 
ATOM   7557  C  CE1 . TYR E  2  101 ? 75.462  9.339   -67.982  1.00 49.35  ? 257 TYR E CE1 1 
ATOM   7558  C  CE2 . TYR E  2  101 ? 74.736  8.358   -70.049  1.00 53.46  ? 257 TYR E CE2 1 
ATOM   7559  C  CZ  . TYR E  2  101 ? 75.361  8.243   -68.817  1.00 52.01  ? 257 TYR E CZ  1 
ATOM   7560  O  OH  . TYR E  2  101 ? 75.868  7.023   -68.427  1.00 69.26  ? 257 TYR E OH  1 
ATOM   7561  N  N   . LYS E  2  102 ? 75.152  14.627  -69.062  1.00 50.53  ? 258 LYS E N   1 
ATOM   7562  C  CA  . LYS E  2  102 ? 75.906  15.337  -68.034  1.00 40.20  ? 258 LYS E CA  1 
ATOM   7563  C  C   . LYS E  2  102 ? 75.985  14.443  -66.788  1.00 47.66  ? 258 LYS E C   1 
ATOM   7564  O  O   . LYS E  2  102 ? 75.001  13.815  -66.386  1.00 38.25  ? 258 LYS E O   1 
ATOM   7565  C  CB  . LYS E  2  102 ? 75.167  16.638  -67.712  1.00 46.89  ? 258 LYS E CB  1 
ATOM   7566  C  CG  . LYS E  2  102 ? 75.958  17.778  -67.078  1.00 50.69  ? 258 LYS E CG  1 
ATOM   7567  C  CD  . LYS E  2  102 ? 74.987  18.971  -66.842  1.00 56.67  ? 258 LYS E CD  1 
ATOM   7568  C  CE  . LYS E  2  102 ? 75.609  20.186  -66.139  1.00 35.89  ? 258 LYS E CE  1 
ATOM   7569  N  NZ  . LYS E  2  102 ? 76.650  20.816  -66.999  1.00 57.14  ? 258 LYS E NZ  1 
ATOM   7570  N  N   . VAL E  2  103 ? 77.165  14.374  -66.187  1.00 43.13  ? 259 VAL E N   1 
ATOM   7571  C  CA  . VAL E  2  103 ? 77.357  13.573  -64.991  1.00 34.25  ? 259 VAL E CA  1 
ATOM   7572  C  C   . VAL E  2  103 ? 78.464  14.242  -64.210  1.00 34.89  ? 259 VAL E C   1 
ATOM   7573  O  O   . VAL E  2  103 ? 79.307  14.912  -64.791  1.00 43.16  ? 259 VAL E O   1 
ATOM   7574  C  CB  . VAL E  2  103 ? 77.775  12.122  -65.332  1.00 33.88  ? 259 VAL E CB  1 
ATOM   7575  C  CG1 . VAL E  2  103 ? 79.241  12.049  -65.708  1.00 25.96  ? 259 VAL E CG1 1 
ATOM   7576  C  CG2 . VAL E  2  103 ? 77.503  11.236  -64.163  1.00 38.06  ? 259 VAL E CG2 1 
ATOM   7577  N  N   . PHE E  2  104 ? 78.469  14.080  -62.896  1.00 39.99  ? 260 PHE E N   1 
ATOM   7578  C  CA  . PHE E  2  104 ? 79.519  14.702  -62.109  1.00 47.38  ? 260 PHE E CA  1 
ATOM   7579  C  C   . PHE E  2  104 ? 80.651  13.722  -61.853  1.00 44.87  ? 260 PHE E C   1 
ATOM   7580  O  O   . PHE E  2  104 ? 80.459  12.676  -61.233  1.00 40.63  ? 260 PHE E O   1 
ATOM   7581  C  CB  . PHE E  2  104 ? 78.986  15.214  -60.775  1.00 51.01  ? 260 PHE E CB  1 
ATOM   7582  C  CG  . PHE E  2  104 ? 79.961  16.080  -60.045  1.00 46.46  ? 260 PHE E CG  1 
ATOM   7583  C  CD1 . PHE E  2  104 ? 79.752  17.447  -59.940  1.00 38.14  ? 260 PHE E CD1 1 
ATOM   7584  C  CD2 . PHE E  2  104 ? 81.124  15.535  -59.511  1.00 40.20  ? 260 PHE E CD2 1 
ATOM   7585  C  CE1 . PHE E  2  104 ? 80.685  18.258  -59.323  1.00 34.15  ? 260 PHE E CE1 1 
ATOM   7586  C  CE2 . PHE E  2  104 ? 82.061  16.336  -58.893  1.00 43.71  ? 260 PHE E CE2 1 
ATOM   7587  C  CZ  . PHE E  2  104 ? 81.842  17.702  -58.801  1.00 47.82  ? 260 PHE E CZ  1 
ATOM   7588  N  N   . CYS E  2  105 ? 81.834  14.086  -62.329  1.00 41.90  ? 261 CYS E N   1 
ATOM   7589  C  CA  . CYS E  2  105 ? 83.017  13.267  -62.179  1.00 42.43  ? 261 CYS E CA  1 
ATOM   7590  C  C   . CYS E  2  105 ? 83.839  13.650  -60.967  1.00 45.34  ? 261 CYS E C   1 
ATOM   7591  O  O   . CYS E  2  105 ? 84.054  14.827  -60.710  1.00 41.60  ? 261 CYS E O   1 
ATOM   7592  C  CB  . CYS E  2  105 ? 83.913  13.401  -63.403  1.00 43.86  ? 261 CYS E CB  1 
ATOM   7593  S  SG  . CYS E  2  105 ? 83.252  12.704  -64.942  1.00 42.05  ? 261 CYS E SG  1 
ATOM   7594  N  N   . ASP E  2  106 ? 84.297  12.640  -60.233  1.00 46.45  ? 262 ASP E N   1 
ATOM   7595  C  CA  . ASP E  2  106 ? 85.147  12.844  -59.074  1.00 47.43  ? 262 ASP E CA  1 
ATOM   7596  C  C   . ASP E  2  106 ? 86.525  12.387  -59.526  1.00 52.28  ? 262 ASP E C   1 
ATOM   7597  O  O   . ASP E  2  106 ? 86.794  11.188  -59.624  1.00 47.91  ? 262 ASP E O   1 
ATOM   7598  C  CB  . ASP E  2  106 ? 84.691  11.986  -57.903  1.00 62.59  ? 262 ASP E CB  1 
ATOM   7599  C  CG  . ASP E  2  106 ? 85.504  12.240  -56.648  1.00 67.74  ? 262 ASP E CG  1 
ATOM   7600  O  OD1 . ASP E  2  106 ? 86.742  12.378  -56.764  1.00 58.87  ? 262 ASP E OD1 1 
ATOM   7601  O  OD2 . ASP E  2  106 ? 84.904  12.292  -55.550  1.00 66.48  ? 262 ASP E OD2 1 
ATOM   7602  N  N   . MET E  2  107 ? 87.393  13.347  -59.815  1.00 55.22  ? 263 MET E N   1 
ATOM   7603  C  CA  . MET E  2  107 ? 88.729  13.047  -60.290  1.00 47.56  ? 263 MET E CA  1 
ATOM   7604  C  C   . MET E  2  107 ? 89.768  13.114  -59.183  1.00 47.17  ? 263 MET E C   1 
ATOM   7605  O  O   . MET E  2  107 ? 90.939  12.854  -59.417  1.00 66.36  ? 263 MET E O   1 
ATOM   7606  C  CB  . MET E  2  107 ? 89.107  14.029  -61.398  1.00 48.46  ? 263 MET E CB  1 
ATOM   7607  C  CG  . MET E  2  107 ? 88.094  14.132  -62.534  1.00 67.12  ? 263 MET E CG  1 
ATOM   7608  S  SD  . MET E  2  107 ? 87.977  12.684  -63.618  1.00 62.85  ? 263 MET E SD  1 
ATOM   7609  C  CE  . MET E  2  107 ? 86.821  11.726  -62.774  1.00 63.37  ? 263 MET E CE  1 
ATOM   7610  N  N   . GLU E  2  108 ? 89.353  13.452  -57.973  1.00 43.78  ? 264 GLU E N   1 
ATOM   7611  C  CA  . GLU E  2  108 ? 90.305  13.566  -56.878  1.00 52.26  ? 264 GLU E CA  1 
ATOM   7612  C  C   . GLU E  2  108 ? 90.376  12.356  -55.950  1.00 56.22  ? 264 GLU E C   1 
ATOM   7613  O  O   . GLU E  2  108 ? 91.463  11.813  -55.722  1.00 48.46  ? 264 GLU E O   1 
ATOM   7614  C  CB  . GLU E  2  108 ? 90.006  14.836  -56.075  1.00 56.53  ? 264 GLU E CB  1 
ATOM   7615  C  CG  . GLU E  2  108 ? 90.333  16.105  -56.845  1.00 82.50  ? 264 GLU E CG  1 
ATOM   7616  C  CD  . GLU E  2  108 ? 89.323  17.211  -56.615  1.00 96.49  ? 264 GLU E CD  1 
ATOM   7617  O  OE1 . GLU E  2  108 ? 89.438  18.262  -57.285  1.00 101.75 ? 264 GLU E OE1 1 
ATOM   7618  O  OE2 . GLU E  2  108 ? 88.417  17.029  -55.771  1.00 93.99  ? 264 GLU E OE2 1 
ATOM   7619  N  N   . SER E  2  109 ? 89.221  11.939  -55.426  1.00 53.73  ? 265 SER E N   1 
ATOM   7620  C  CA  . SER E  2  109 ? 89.134  10.799  -54.517  1.00 51.12  ? 265 SER E CA  1 
ATOM   7621  C  C   . SER E  2  109 ? 89.644  9.486   -55.092  1.00 58.73  ? 265 SER E C   1 
ATOM   7622  O  O   . SER E  2  109 ? 89.603  9.250   -56.299  1.00 58.42  ? 265 SER E O   1 
ATOM   7623  C  CB  . SER E  2  109 ? 87.692  10.584  -54.058  1.00 48.51  ? 265 SER E CB  1 
ATOM   7624  O  OG  . SER E  2  109 ? 87.199  11.721  -53.371  1.00 85.50  ? 265 SER E OG  1 
ATOM   7625  N  N   . HIS E  2  110 ? 90.121  8.634   -54.199  1.00 53.22  ? 266 HIS E N   1 
ATOM   7626  C  CA  . HIS E  2  110 ? 90.617  7.321   -54.553  1.00 49.31  ? 266 HIS E CA  1 
ATOM   7627  C  C   . HIS E  2  110 ? 91.060  7.150   -55.995  1.00 50.66  ? 266 HIS E C   1 
ATOM   7628  O  O   . HIS E  2  110 ? 90.615  6.231   -56.686  1.00 53.31  ? 266 HIS E O   1 
ATOM   7629  C  CB  . HIS E  2  110 ? 89.546  6.301   -54.205  1.00 52.97  ? 266 HIS E CB  1 
ATOM   7630  C  CG  . HIS E  2  110 ? 89.043  6.441   -52.804  1.00 56.19  ? 266 HIS E CG  1 
ATOM   7631  N  ND1 . HIS E  2  110 ? 89.719  5.931   -51.719  1.00 50.59  ? 266 HIS E ND1 1 
ATOM   7632  C  CD2 . HIS E  2  110 ? 87.986  7.121   -52.302  1.00 58.22  ? 266 HIS E CD2 1 
ATOM   7633  C  CE1 . HIS E  2  110 ? 89.104  6.293   -50.610  1.00 41.63  ? 266 HIS E CE1 1 
ATOM   7634  N  NE2 . HIS E  2  110 ? 88.051  7.017   -50.935  1.00 44.31  ? 266 HIS E NE2 1 
ATOM   7635  N  N   . GLY E  2  111 ? 91.936  8.042   -56.446  1.00 50.73  ? 267 GLY E N   1 
ATOM   7636  C  CA  . GLY E  2  111 ? 92.460  7.948   -57.800  1.00 63.00  ? 267 GLY E CA  1 
ATOM   7637  C  C   . GLY E  2  111 ? 91.653  8.568   -58.930  1.00 65.61  ? 267 GLY E C   1 
ATOM   7638  O  O   . GLY E  2  111 ? 92.060  8.499   -60.090  1.00 70.45  ? 267 GLY E O   1 
ATOM   7639  N  N   . GLY E  2  112 ? 90.515  9.170   -58.604  1.00 66.44  ? 268 GLY E N   1 
ATOM   7640  C  CA  . GLY E  2  112 ? 89.693  9.789   -59.627  1.00 61.20  ? 268 GLY E CA  1 
ATOM   7641  C  C   . GLY E  2  112 ? 89.149  8.815   -60.655  1.00 54.94  ? 268 GLY E C   1 
ATOM   7642  O  O   . GLY E  2  112 ? 89.346  7.604   -60.557  1.00 48.57  ? 268 GLY E O   1 
ATOM   7643  N  N   . GLY E  2  113 ? 88.472  9.355   -61.659  1.00 48.42  ? 269 GLY E N   1 
ATOM   7644  C  CA  . GLY E  2  113 ? 87.891  8.512   -62.683  1.00 51.00  ? 269 GLY E CA  1 
ATOM   7645  C  C   . GLY E  2  113 ? 86.562  7.978   -62.187  1.00 45.32  ? 269 GLY E C   1 
ATOM   7646  O  O   . GLY E  2  113 ? 85.970  7.068   -62.770  1.00 59.44  ? 269 GLY E O   1 
ATOM   7647  N  N   . TRP E  2  114 ? 86.083  8.567   -61.103  1.00 39.50  ? 270 TRP E N   1 
ATOM   7648  C  CA  . TRP E  2  114 ? 84.828  8.159   -60.510  1.00 38.66  ? 270 TRP E CA  1 
ATOM   7649  C  C   . TRP E  2  114 ? 83.602  8.881   -61.038  1.00 34.00  ? 270 TRP E C   1 
ATOM   7650  O  O   . TRP E  2  114 ? 83.483  10.094  -60.937  1.00 41.88  ? 270 TRP E O   1 
ATOM   7651  C  CB  . TRP E  2  114 ? 84.895  8.327   -58.999  1.00 32.22  ? 270 TRP E CB  1 
ATOM   7652  C  CG  . TRP E  2  114 ? 85.787  7.330   -58.352  1.00 50.22  ? 270 TRP E CG  1 
ATOM   7653  C  CD1 . TRP E  2  114 ? 87.045  7.539   -57.869  1.00 54.08  ? 270 TRP E CD1 1 
ATOM   7654  C  CD2 . TRP E  2  114 ? 85.492  5.949   -58.126  1.00 56.34  ? 270 TRP E CD2 1 
ATOM   7655  N  NE1 . TRP E  2  114 ? 87.552  6.370   -57.354  1.00 60.60  ? 270 TRP E NE1 1 
ATOM   7656  C  CE2 . TRP E  2  114 ? 86.618  5.379   -57.501  1.00 56.77  ? 270 TRP E CE2 1 
ATOM   7657  C  CE3 . TRP E  2  114 ? 84.383  5.137   -58.394  1.00 63.47  ? 270 TRP E CE3 1 
ATOM   7658  C  CZ2 . TRP E  2  114 ? 86.667  4.035   -57.140  1.00 64.00  ? 270 TRP E CZ2 1 
ATOM   7659  C  CZ3 . TRP E  2  114 ? 84.433  3.801   -58.037  1.00 68.01  ? 270 TRP E CZ3 1 
ATOM   7660  C  CH2 . TRP E  2  114 ? 85.568  3.263   -57.417  1.00 69.25  ? 270 TRP E CH2 1 
ATOM   7661  N  N   . THR E  2  115 ? 82.686  8.107   -61.600  1.00 34.63  ? 271 THR E N   1 
ATOM   7662  C  CA  . THR E  2  115 ? 81.447  8.639   -62.129  1.00 39.73  ? 271 THR E CA  1 
ATOM   7663  C  C   . THR E  2  115 ? 80.432  8.607   -60.999  1.00 45.71  ? 271 THR E C   1 
ATOM   7664  O  O   . THR E  2  115 ? 80.012  7.534   -60.570  1.00 51.12  ? 271 THR E O   1 
ATOM   7665  C  CB  . THR E  2  115 ? 80.926  7.776   -63.283  1.00 33.95  ? 271 THR E CB  1 
ATOM   7666  O  OG1 . THR E  2  115 ? 81.961  7.636   -64.257  1.00 49.30  ? 271 THR E OG1 1 
ATOM   7667  C  CG2 . THR E  2  115 ? 79.730  8.411   -63.940  1.00 12.75  ? 271 THR E CG2 1 
ATOM   7668  N  N   . VAL E  2  116 ? 80.053  9.785   -60.513  1.00 46.18  ? 272 VAL E N   1 
ATOM   7669  C  CA  . VAL E  2  116 ? 79.082  9.897   -59.440  1.00 39.72  ? 272 VAL E CA  1 
ATOM   7670  C  C   . VAL E  2  116 ? 77.700  9.524   -59.952  1.00 40.75  ? 272 VAL E C   1 
ATOM   7671  O  O   . VAL E  2  116 ? 77.189  10.125  -60.886  1.00 27.84  ? 272 VAL E O   1 
ATOM   7672  C  CB  . VAL E  2  116 ? 79.056  11.315  -58.894  1.00 38.59  ? 272 VAL E CB  1 
ATOM   7673  C  CG1 . VAL E  2  116 ? 77.954  11.457  -57.866  1.00 40.35  ? 272 VAL E CG1 1 
ATOM   7674  C  CG2 . VAL E  2  116 ? 80.388  11.628  -58.285  1.00 40.04  ? 272 VAL E CG2 1 
ATOM   7675  N  N   . VAL E  2  117 ? 77.092  8.534   -59.316  1.00 42.88  ? 273 VAL E N   1 
ATOM   7676  C  CA  . VAL E  2  117 ? 75.789  8.046   -59.726  1.00 38.71  ? 273 VAL E CA  1 
ATOM   7677  C  C   . VAL E  2  117 ? 74.694  8.536   -58.796  1.00 38.38  ? 273 VAL E C   1 
ATOM   7678  O  O   . VAL E  2  117 ? 73.523  8.569   -59.163  1.00 42.36  ? 273 VAL E O   1 
ATOM   7679  C  CB  . VAL E  2  117 ? 75.790  6.503   -59.748  1.00 52.27  ? 273 VAL E CB  1 
ATOM   7680  C  CG1 . VAL E  2  117 ? 74.416  5.995   -60.076  1.00 65.14  ? 273 VAL E CG1 1 
ATOM   7681  C  CG2 . VAL E  2  117 ? 76.807  5.992   -60.774  1.00 38.51  ? 273 VAL E CG2 1 
ATOM   7682  N  N   . GLN E  2  118 ? 75.088  8.904   -57.583  1.00 32.60  ? 274 GLN E N   1 
ATOM   7683  C  CA  . GLN E  2  118 ? 74.167  9.414   -56.561  1.00 23.94  ? 274 GLN E CA  1 
ATOM   7684  C  C   . GLN E  2  118 ? 74.997  10.315  -55.658  1.00 22.86  ? 274 GLN E C   1 
ATOM   7685  O  O   . GLN E  2  118 ? 76.169  10.044  -55.431  1.00 28.34  ? 274 GLN E O   1 
ATOM   7686  C  CB  . GLN E  2  118 ? 73.559  8.254   -55.756  1.00 15.81  ? 274 GLN E CB  1 
ATOM   7687  C  CG  . GLN E  2  118 ? 72.657  8.661   -54.564  1.00 24.64  ? 274 GLN E CG  1 
ATOM   7688  C  CD  . GLN E  2  118 ? 73.430  8.903   -53.266  1.00 27.05  ? 274 GLN E CD  1 
ATOM   7689  O  OE1 . GLN E  2  118 ? 72.841  9.141   -52.220  1.00 33.19  ? 274 GLN E OE1 1 
ATOM   7690  N  NE2 . GLN E  2  118 ? 74.753  8.839   -53.336  1.00 29.07  ? 274 GLN E NE2 1 
ATOM   7691  N  N   . ASN E  2  119 ? 74.406  11.387  -55.146  1.00 31.17  ? 275 ASN E N   1 
ATOM   7692  C  CA  . ASN E  2  119 ? 75.160  12.305  -54.306  1.00 33.71  ? 275 ASN E CA  1 
ATOM   7693  C  C   . ASN E  2  119 ? 74.296  13.217  -53.430  1.00 39.37  ? 275 ASN E C   1 
ATOM   7694  O  O   . ASN E  2  119 ? 73.426  13.913  -53.936  1.00 45.38  ? 275 ASN E O   1 
ATOM   7695  C  CB  . ASN E  2  119 ? 76.067  13.137  -55.207  1.00 24.63  ? 275 ASN E CB  1 
ATOM   7696  C  CG  . ASN E  2  119 ? 76.924  14.103  -54.442  1.00 42.70  ? 275 ASN E CG  1 
ATOM   7697  O  OD1 . ASN E  2  119 ? 77.669  13.716  -53.540  1.00 48.74  ? 275 ASN E OD1 1 
ATOM   7698  N  ND2 . ASN E  2  119 ? 76.829  15.384  -54.798  1.00 36.46  ? 275 ASN E ND2 1 
ATOM   7699  N  N   . ARG E  2  120 ? 74.540  13.183  -52.116  1.00 43.18  ? 276 ARG E N   1 
ATOM   7700  C  CA  . ARG E  2  120 ? 73.840  14.014  -51.128  1.00 39.79  ? 276 ARG E CA  1 
ATOM   7701  C  C   . ARG E  2  120 ? 74.864  15.027  -50.583  1.00 43.48  ? 276 ARG E C   1 
ATOM   7702  O  O   . ARG E  2  120 ? 76.055  14.707  -50.483  1.00 41.40  ? 276 ARG E O   1 
ATOM   7703  C  CB  . ARG E  2  120 ? 73.317  13.158  -49.968  1.00 26.86  ? 276 ARG E CB  1 
ATOM   7704  C  CG  . ARG E  2  120 ? 72.572  11.912  -50.382  1.00 36.64  ? 276 ARG E CG  1 
ATOM   7705  C  CD  . ARG E  2  120 ? 71.429  12.242  -51.319  1.00 40.86  ? 276 ARG E CD  1 
ATOM   7706  N  NE  . ARG E  2  120 ? 70.461  13.151  -50.722  1.00 25.71  ? 276 ARG E NE  1 
ATOM   7707  C  CZ  . ARG E  2  120 ? 69.480  12.784  -49.902  1.00 33.93  ? 276 ARG E CZ  1 
ATOM   7708  N  NH1 . ARG E  2  120 ? 69.294  11.515  -49.555  1.00 10.71  ? 276 ARG E NH1 1 
ATOM   7709  N  NH2 . ARG E  2  120 ? 68.672  13.709  -49.417  1.00 50.52  ? 276 ARG E NH2 1 
ATOM   7710  N  N   . VAL E  2  121 ? 74.417  16.235  -50.235  1.00 41.34  ? 277 VAL E N   1 
ATOM   7711  C  CA  . VAL E  2  121 ? 75.338  17.262  -49.720  1.00 44.98  ? 277 VAL E CA  1 
ATOM   7712  C  C   . VAL E  2  121 ? 74.624  18.507  -49.154  1.00 45.69  ? 277 VAL E C   1 
ATOM   7713  O  O   . VAL E  2  121 ? 75.247  19.400  -48.602  1.00 39.60  ? 277 VAL E O   1 
ATOM   7714  C  CB  . VAL E  2  121 ? 76.342  17.702  -50.825  1.00 34.72  ? 277 VAL E CB  1 
ATOM   7715  C  CG1 . VAL E  2  121 ? 75.656  18.579  -51.852  1.00 32.39  ? 277 VAL E CG1 1 
ATOM   7716  C  CG2 . VAL E  2  121 ? 77.516  18.413  -50.207  1.00 51.53  ? 277 VAL E CG2 1 
ATOM   7717  N  N   . ASP E  2  122 ? 73.306  18.531  -49.291  1.00 54.43  ? 278 ASP E N   1 
ATOM   7718  C  CA  . ASP E  2  122 ? 72.438  19.615  -48.828  1.00 39.39  ? 278 ASP E CA  1 
ATOM   7719  C  C   . ASP E  2  122 ? 71.112  19.134  -49.379  1.00 39.67  ? 278 ASP E C   1 
ATOM   7720  O  O   . ASP E  2  122 ? 71.055  18.694  -50.515  1.00 55.92  ? 278 ASP E O   1 
ATOM   7721  C  CB  . ASP E  2  122 ? 72.833  20.966  -49.461  1.00 28.97  ? 278 ASP E CB  1 
ATOM   7722  C  CG  . ASP E  2  122 ? 73.077  20.883  -50.986  1.00 41.13  ? 278 ASP E CG  1 
ATOM   7723  O  OD1 . ASP E  2  122 ? 72.266  20.295  -51.738  1.00 25.73  ? 278 ASP E OD1 1 
ATOM   7724  O  OD2 . ASP E  2  122 ? 74.090  21.436  -51.442  1.00 39.58  ? 278 ASP E OD2 1 
ATOM   7725  N  N   . GLY E  2  123 ? 70.050  19.181  -48.602  1.00 33.07  ? 279 GLY E N   1 
ATOM   7726  C  CA  . GLY E  2  123 ? 68.776  18.695  -49.120  1.00 30.85  ? 279 GLY E CA  1 
ATOM   7727  C  C   . GLY E  2  123 ? 68.239  19.479  -50.310  1.00 28.51  ? 279 GLY E C   1 
ATOM   7728  O  O   . GLY E  2  123 ? 67.067  19.838  -50.323  1.00 30.54  ? 279 GLY E O   1 
ATOM   7729  N  N   . SER E  2  124 ? 69.080  19.729  -51.312  1.00 14.04  ? 280 SER E N   1 
ATOM   7730  C  CA  . SER E  2  124 ? 68.679  20.495  -52.471  1.00 15.24  ? 280 SER E CA  1 
ATOM   7731  C  C   . SER E  2  124 ? 67.803  19.723  -53.467  1.00 27.58  ? 280 SER E C   1 
ATOM   7732  O  O   . SER E  2  124 ? 67.240  20.312  -54.395  1.00 44.92  ? 280 SER E O   1 
ATOM   7733  C  CB  . SER E  2  124 ? 69.919  21.055  -53.161  1.00 7.65   ? 280 SER E CB  1 
ATOM   7734  O  OG  . SER E  2  124 ? 70.604  20.062  -53.907  1.00 42.96  ? 280 SER E OG  1 
ATOM   7735  N  N   . SER E  2  125 ? 67.674  18.415  -53.282  1.00 20.74  ? 281 SER E N   1 
ATOM   7736  C  CA  . SER E  2  125 ? 66.834  17.617  -54.174  1.00 21.49  ? 281 SER E CA  1 
ATOM   7737  C  C   . SER E  2  125 ? 66.003  16.603  -53.401  1.00 22.18  ? 281 SER E C   1 
ATOM   7738  O  O   . SER E  2  125 ? 66.447  16.049  -52.408  1.00 31.02  ? 281 SER E O   1 
ATOM   7739  C  CB  . SER E  2  125 ? 67.676  16.895  -55.214  1.00 2.53   ? 281 SER E CB  1 
ATOM   7740  O  OG  . SER E  2  125 ? 68.497  17.813  -55.917  1.00 54.88  ? 281 SER E OG  1 
ATOM   7741  N  N   . ASN E  2  126 ? 64.787  16.370  -53.864  1.00 32.01  ? 282 ASN E N   1 
ATOM   7742  C  CA  . ASN E  2  126 ? 63.903  15.429  -53.217  1.00 23.56  ? 282 ASN E CA  1 
ATOM   7743  C  C   . ASN E  2  126 ? 64.239  14.030  -53.722  1.00 29.88  ? 282 ASN E C   1 
ATOM   7744  O  O   . ASN E  2  126 ? 64.361  13.810  -54.921  1.00 31.03  ? 282 ASN E O   1 
ATOM   7745  C  CB  . ASN E  2  126 ? 62.450  15.790  -53.525  1.00 18.98  ? 282 ASN E CB  1 
ATOM   7746  C  CG  . ASN E  2  126 ? 61.476  14.793  -52.950  1.00 39.40  ? 282 ASN E CG  1 
ATOM   7747  O  OD1 . ASN E  2  126 ? 61.847  13.958  -52.120  1.00 51.63  ? 282 ASN E OD1 1 
ATOM   7748  N  ND2 . ASN E  2  126 ? 60.219  14.873  -53.376  1.00 43.37  ? 282 ASN E ND2 1 
ATOM   7749  N  N   . PHE E  2  127 ? 64.405  13.084  -52.805  1.00 38.17  ? 283 PHE E N   1 
ATOM   7750  C  CA  . PHE E  2  127 ? 64.735  11.725  -53.200  1.00 35.35  ? 283 PHE E CA  1 
ATOM   7751  C  C   . PHE E  2  127 ? 63.587  10.771  -53.047  1.00 35.25  ? 283 PHE E C   1 
ATOM   7752  O  O   . PHE E  2  127 ? 63.694  9.591   -53.395  1.00 39.38  ? 283 PHE E O   1 
ATOM   7753  C  CB  . PHE E  2  127 ? 65.934  11.231  -52.415  1.00 28.87  ? 283 PHE E CB  1 
ATOM   7754  C  CG  . PHE E  2  127 ? 67.218  11.724  -52.955  1.00 32.43  ? 283 PHE E CG  1 
ATOM   7755  C  CD1 . PHE E  2  127 ? 67.506  13.080  -52.937  1.00 14.07  ? 283 PHE E CD1 1 
ATOM   7756  C  CD2 . PHE E  2  127 ? 68.112  10.844  -53.559  1.00 9.61   ? 283 PHE E CD2 1 
ATOM   7757  C  CE1 . PHE E  2  127 ? 68.675  13.560  -53.522  1.00 20.14  ? 283 PHE E CE1 1 
ATOM   7758  C  CE2 . PHE E  2  127 ? 69.273  11.310  -54.141  1.00 24.48  ? 283 PHE E CE2 1 
ATOM   7759  C  CZ  . PHE E  2  127 ? 69.557  12.681  -54.124  1.00 26.50  ? 283 PHE E CZ  1 
ATOM   7760  N  N   . ALA E  2  128 ? 62.486  11.290  -52.521  1.00 25.73  ? 284 ALA E N   1 
ATOM   7761  C  CA  . ALA E  2  128 ? 61.277  10.498  -52.341  1.00 33.28  ? 284 ALA E CA  1 
ATOM   7762  C  C   . ALA E  2  128 ? 60.530  10.474  -53.686  1.00 37.03  ? 284 ALA E C   1 
ATOM   7763  O  O   . ALA E  2  128 ? 59.421  10.992  -53.790  1.00 34.04  ? 284 ALA E O   1 
ATOM   7764  C  CB  . ALA E  2  128 ? 60.414  11.132  -51.262  1.00 17.72  ? 284 ALA E CB  1 
ATOM   7765  N  N   . ARG E  2  129 ? 61.142  9.861   -54.700  1.00 30.51  ? 285 ARG E N   1 
ATOM   7766  C  CA  . ARG E  2  129 ? 60.556  9.830   -56.020  1.00 37.54  ? 285 ARG E CA  1 
ATOM   7767  C  C   . ARG E  2  129 ? 60.123  8.458   -56.462  1.00 36.98  ? 285 ARG E C   1 
ATOM   7768  O  O   . ARG E  2  129 ? 60.696  7.465   -56.032  1.00 44.15  ? 285 ARG E O   1 
ATOM   7769  C  CB  . ARG E  2  129 ? 61.550  10.376  -57.023  1.00 53.76  ? 285 ARG E CB  1 
ATOM   7770  C  CG  . ARG E  2  129 ? 62.338  11.535  -56.505  1.00 43.83  ? 285 ARG E CG  1 
ATOM   7771  C  CD  . ARG E  2  129 ? 61.484  12.739  -56.241  1.00 26.62  ? 285 ARG E CD  1 
ATOM   7772  N  NE  . ARG E  2  129 ? 62.157  13.891  -56.831  1.00 40.64  ? 285 ARG E NE  1 
ATOM   7773  C  CZ  . ARG E  2  129 ? 62.024  14.265  -58.096  1.00 38.76  ? 285 ARG E CZ  1 
ATOM   7774  N  NH1 . ARG E  2  129 ? 61.225  13.589  -58.918  1.00 45.23  ? 285 ARG E NH1 1 
ATOM   7775  N  NH2 . ARG E  2  129 ? 62.718  15.298  -58.547  1.00 42.90  ? 285 ARG E NH2 1 
ATOM   7776  N  N   . ASP E  2  130 ? 59.125  8.426   -57.350  1.00 32.95  ? 286 ASP E N   1 
ATOM   7777  C  CA  . ASP E  2  130 ? 58.566  7.183   -57.859  1.00 28.70  ? 286 ASP E CA  1 
ATOM   7778  C  C   . ASP E  2  130 ? 59.531  6.375   -58.688  1.00 34.85  ? 286 ASP E C   1 
ATOM   7779  O  O   . ASP E  2  130 ? 60.650  6.829   -58.972  1.00 33.28  ? 286 ASP E O   1 
ATOM   7780  C  CB  . ASP E  2  130 ? 57.296  7.438   -58.681  1.00 30.71  ? 286 ASP E CB  1 
ATOM   7781  C  CG  . ASP E  2  130 ? 57.532  8.342   -59.871  1.00 33.82  ? 286 ASP E CG  1 
ATOM   7782  O  OD1 . ASP E  2  130 ? 58.604  8.267   -60.506  1.00 24.59  ? 286 ASP E OD1 1 
ATOM   7783  O  OD2 . ASP E  2  130 ? 56.622  9.131   -60.183  1.00 48.80  ? 286 ASP E OD2 1 
ATOM   7784  N  N   . TRP E  2  131 ? 59.064  5.189   -59.094  1.00 23.44  ? 287 TRP E N   1 
ATOM   7785  C  CA  . TRP E  2  131 ? 59.852  4.257   -59.878  1.00 32.33  ? 287 TRP E CA  1 
ATOM   7786  C  C   . TRP E  2  131 ? 60.299  4.810   -61.224  1.00 36.95  ? 287 TRP E C   1 
ATOM   7787  O  O   . TRP E  2  131 ? 61.448  4.623   -61.635  1.00 33.84  ? 287 TRP E O   1 
ATOM   7788  C  CB  . TRP E  2  131 ? 59.067  2.969   -60.064  1.00 36.75  ? 287 TRP E CB  1 
ATOM   7789  C  CG  . TRP E  2  131 ? 59.802  1.937   -60.840  1.00 27.62  ? 287 TRP E CG  1 
ATOM   7790  C  CD1 . TRP E  2  131 ? 59.783  1.764   -62.183  1.00 23.33  ? 287 TRP E CD1 1 
ATOM   7791  C  CD2 . TRP E  2  131 ? 60.679  0.936   -60.316  1.00 35.50  ? 287 TRP E CD2 1 
ATOM   7792  N  NE1 . TRP E  2  131 ? 60.595  0.716   -62.538  1.00 22.01  ? 287 TRP E NE1 1 
ATOM   7793  C  CE2 . TRP E  2  131 ? 61.156  0.189   -61.407  1.00 35.27  ? 287 TRP E CE2 1 
ATOM   7794  C  CE3 . TRP E  2  131 ? 61.110  0.600   -59.029  1.00 27.38  ? 287 TRP E CE3 1 
ATOM   7795  C  CZ2 . TRP E  2  131 ? 62.047  -0.879  -61.250  1.00 33.50  ? 287 TRP E CZ2 1 
ATOM   7796  C  CZ3 . TRP E  2  131 ? 61.990  -0.452  -58.878  1.00 22.74  ? 287 TRP E CZ3 1 
ATOM   7797  C  CH2 . TRP E  2  131 ? 62.450  -1.181  -59.980  1.00 26.50  ? 287 TRP E CH2 1 
ATOM   7798  N  N   . ASN E  2  132 ? 59.391  5.491   -61.912  1.00 46.21  ? 288 ASN E N   1 
ATOM   7799  C  CA  . ASN E  2  132 ? 59.715  6.085   -63.205  1.00 38.23  ? 288 ASN E CA  1 
ATOM   7800  C  C   . ASN E  2  132 ? 60.833  7.102   -63.064  1.00 30.61  ? 288 ASN E C   1 
ATOM   7801  O  O   . ASN E  2  132 ? 61.763  7.141   -63.877  1.00 23.75  ? 288 ASN E O   1 
ATOM   7802  C  CB  . ASN E  2  132 ? 58.489  6.773   -63.783  1.00 41.57  ? 288 ASN E CB  1 
ATOM   7803  C  CG  . ASN E  2  132 ? 57.496  5.798   -64.305  1.00 53.41  ? 288 ASN E CG  1 
ATOM   7804  O  OD1 . ASN E  2  132 ? 56.286  6.027   -64.235  1.00 68.31  ? 288 ASN E OD1 1 
ATOM   7805  N  ND2 . ASN E  2  132 ? 57.998  4.688   -64.848  1.00 27.60  ? 288 ASN E ND2 1 
ATOM   7806  N  N   . THR E  2  133 ? 60.736  7.922   -62.025  1.00 19.95  ? 289 THR E N   1 
ATOM   7807  C  CA  . THR E  2  133 ? 61.724  8.953   -61.787  1.00 28.98  ? 289 THR E CA  1 
ATOM   7808  C  C   . THR E  2  133 ? 63.091  8.404   -61.418  1.00 34.04  ? 289 THR E C   1 
ATOM   7809  O  O   . THR E  2  133 ? 64.104  8.902   -61.898  1.00 34.94  ? 289 THR E O   1 
ATOM   7810  C  CB  . THR E  2  133 ? 61.255  9.906   -60.697  1.00 37.58  ? 289 THR E CB  1 
ATOM   7811  O  OG1 . THR E  2  133 ? 60.027  10.517  -61.108  1.00 27.57  ? 289 THR E OG1 1 
ATOM   7812  C  CG2 . THR E  2  133 ? 62.299  10.979  -60.440  1.00 34.26  ? 289 THR E CG2 1 
ATOM   7813  N  N   . TYR E  2  134 ? 63.134  7.371   -60.581  1.00 33.61  ? 290 TYR E N   1 
ATOM   7814  C  CA  . TYR E  2  134 ? 64.429  6.806   -60.192  1.00 33.59  ? 290 TYR E CA  1 
ATOM   7815  C  C   . TYR E  2  134 ? 65.111  6.109   -61.349  1.00 28.23  ? 290 TYR E C   1 
ATOM   7816  O  O   . TYR E  2  134 ? 66.336  5.983   -61.385  1.00 41.74  ? 290 TYR E O   1 
ATOM   7817  C  CB  . TYR E  2  134 ? 64.271  5.837   -59.014  1.00 31.73  ? 290 TYR E CB  1 
ATOM   7818  C  CG  . TYR E  2  134 ? 64.681  6.428   -57.677  1.00 36.15  ? 290 TYR E CG  1 
ATOM   7819  C  CD1 . TYR E  2  134 ? 66.027  6.586   -57.343  1.00 30.54  ? 290 TYR E CD1 1 
ATOM   7820  C  CD2 . TYR E  2  134 ? 63.723  6.828   -56.745  1.00 26.02  ? 290 TYR E CD2 1 
ATOM   7821  C  CE1 . TYR E  2  134 ? 66.403  7.118   -56.112  1.00 16.59  ? 290 TYR E CE1 1 
ATOM   7822  C  CE2 . TYR E  2  134 ? 64.089  7.360   -55.519  1.00 20.71  ? 290 TYR E CE2 1 
ATOM   7823  C  CZ  . TYR E  2  134 ? 65.427  7.499   -55.208  1.00 17.77  ? 290 TYR E CZ  1 
ATOM   7824  O  OH  . TYR E  2  134 ? 65.795  7.997   -53.986  1.00 25.26  ? 290 TYR E OH  1 
ATOM   7825  N  N   . LYS E  2  135 ? 64.312  5.666   -62.308  1.00 24.45  ? 291 LYS E N   1 
ATOM   7826  C  CA  . LYS E  2  135 ? 64.840  4.975   -63.469  1.00 21.20  ? 291 LYS E CA  1 
ATOM   7827  C  C   . LYS E  2  135 ? 65.429  5.966   -64.440  1.00 31.15  ? 291 LYS E C   1 
ATOM   7828  O  O   . LYS E  2  135 ? 66.488  5.729   -65.022  1.00 33.46  ? 291 LYS E O   1 
ATOM   7829  C  CB  . LYS E  2  135 ? 63.726  4.212   -64.160  1.00 24.00  ? 291 LYS E CB  1 
ATOM   7830  C  CG  . LYS E  2  135 ? 64.133  3.554   -65.469  1.00 38.47  ? 291 LYS E CG  1 
ATOM   7831  C  CD  . LYS E  2  135 ? 62.918  2.975   -66.184  1.00 39.04  ? 291 LYS E CD  1 
ATOM   7832  C  CE  . LYS E  2  135 ? 63.273  2.462   -67.570  1.00 49.69  ? 291 LYS E CE  1 
ATOM   7833  N  NZ  . LYS E  2  135 ? 62.054  2.174   -68.367  1.00 45.78  ? 291 LYS E NZ  1 
ATOM   7834  N  N   . ALA E  2  136 ? 64.737  7.088   -64.596  1.00 33.74  ? 292 ALA E N   1 
ATOM   7835  C  CA  . ALA E  2  136 ? 65.146  8.123   -65.522  1.00 29.95  ? 292 ALA E CA  1 
ATOM   7836  C  C   . ALA E  2  136 ? 66.293  8.984   -65.044  1.00 27.66  ? 292 ALA E C   1 
ATOM   7837  O  O   . ALA E  2  136 ? 67.154  9.345   -65.829  1.00 25.30  ? 292 ALA E O   1 
ATOM   7838  C  CB  . ALA E  2  136 ? 63.954  8.998   -65.856  1.00 43.52  ? 292 ALA E CB  1 
ATOM   7839  N  N   . GLU E  2  137 ? 66.297  9.294   -63.756  1.00 24.61  ? 293 GLU E N   1 
ATOM   7840  C  CA  . GLU E  2  137 ? 67.306  10.143  -63.118  1.00 40.94  ? 293 GLU E CA  1 
ATOM   7841  C  C   . GLU E  2  137 ? 66.603  11.392  -62.623  1.00 35.67  ? 293 GLU E C   1 
ATOM   7842  O  O   . GLU E  2  137 ? 65.554  11.772  -63.141  1.00 35.05  ? 293 GLU E O   1 
ATOM   7843  C  CB  . GLU E  2  137 ? 68.419  10.610  -64.083  1.00 68.35  ? 293 GLU E CB  1 
ATOM   7844  C  CG  . GLU E  2  137 ? 69.445  11.610  -63.435  1.00 88.37  ? 293 GLU E CG  1 
ATOM   7845  C  CD  . GLU E  2  137 ? 69.863  12.790  -64.336  1.00 88.13  ? 293 GLU E CD  1 
ATOM   7846  O  OE1 . GLU E  2  137 ? 70.423  12.550  -65.432  1.00 89.97  ? 293 GLU E OE1 1 
ATOM   7847  O  OE2 . GLU E  2  137 ? 69.639  13.959  -63.936  1.00 76.08  ? 293 GLU E OE2 1 
ATOM   7848  N  N   . PHE E  2  138 ? 67.196  12.041  -61.632  1.00 24.01  ? 294 PHE E N   1 
ATOM   7849  C  CA  . PHE E  2  138 ? 66.620  13.253  -61.114  1.00 36.19  ? 294 PHE E CA  1 
ATOM   7850  C  C   . PHE E  2  138 ? 67.625  14.051  -60.297  1.00 37.02  ? 294 PHE E C   1 
ATOM   7851  O  O   . PHE E  2  138 ? 68.617  13.516  -59.824  1.00 39.89  ? 294 PHE E O   1 
ATOM   7852  C  CB  . PHE E  2  138 ? 65.382  12.917  -60.300  1.00 12.47  ? 294 PHE E CB  1 
ATOM   7853  C  CG  . PHE E  2  138 ? 65.660  12.181  -59.044  1.00 28.10  ? 294 PHE E CG  1 
ATOM   7854  C  CD1 . PHE E  2  138 ? 66.073  12.855  -57.898  1.00 37.11  ? 294 PHE E CD1 1 
ATOM   7855  C  CD2 . PHE E  2  138 ? 65.454  10.817  -58.978  1.00 31.56  ? 294 PHE E CD2 1 
ATOM   7856  C  CE1 . PHE E  2  138 ? 66.268  12.176  -56.694  1.00 31.25  ? 294 PHE E CE1 1 
ATOM   7857  C  CE2 . PHE E  2  138 ? 65.646  10.135  -57.788  1.00 34.94  ? 294 PHE E CE2 1 
ATOM   7858  C  CZ  . PHE E  2  138 ? 66.052  10.819  -56.641  1.00 34.05  ? 294 PHE E CZ  1 
ATOM   7859  N  N   . GLY E  2  139 ? 67.368  15.345  -60.161  1.00 32.88  ? 295 GLY E N   1 
ATOM   7860  C  CA  . GLY E  2  139 ? 68.258  16.193  -59.405  1.00 29.27  ? 295 GLY E CA  1 
ATOM   7861  C  C   . GLY E  2  139 ? 69.150  17.048  -60.273  1.00 28.31  ? 295 GLY E C   1 
ATOM   7862  O  O   . GLY E  2  139 ? 68.996  17.085  -61.490  1.00 28.33  ? 295 GLY E O   1 
ATOM   7863  N  N   . ASN E  2  140 ? 70.092  17.728  -59.631  1.00 28.70  ? 296 ASN E N   1 
ATOM   7864  C  CA  . ASN E  2  140 ? 71.028  18.604  -60.315  1.00 39.67  ? 296 ASN E CA  1 
ATOM   7865  C  C   . ASN E  2  140 ? 72.419  18.017  -60.255  1.00 38.93  ? 296 ASN E C   1 
ATOM   7866  O  O   . ASN E  2  140 ? 72.895  17.681  -59.175  1.00 45.95  ? 296 ASN E O   1 
ATOM   7867  C  CB  . ASN E  2  140 ? 71.033  19.977  -59.651  1.00 34.77  ? 296 ASN E CB  1 
ATOM   7868  C  CG  . ASN E  2  140 ? 69.740  20.697  -59.838  1.00 33.83  ? 296 ASN E CG  1 
ATOM   7869  O  OD1 . ASN E  2  140 ? 69.286  20.880  -60.968  1.00 46.39  ? 296 ASN E OD1 1 
ATOM   7870  N  ND2 . ASN E  2  140 ? 69.128  21.114  -58.738  1.00 32.00  ? 296 ASN E ND2 1 
ATOM   7871  N  N   . ILE E  2  141 ? 73.075  17.903  -61.405  1.00 36.84  ? 297 ILE E N   1 
ATOM   7872  C  CA  . ILE E  2  141 ? 74.412  17.343  -61.427  1.00 41.56  ? 297 ILE E CA  1 
ATOM   7873  C  C   . ILE E  2  141 ? 75.390  18.273  -60.719  1.00 36.82  ? 297 ILE E C   1 
ATOM   7874  O  O   . ILE E  2  141 ? 76.203  17.831  -59.905  1.00 39.37  ? 297 ILE E O   1 
ATOM   7875  C  CB  . ILE E  2  141 ? 74.875  17.067  -62.877  1.00 36.60  ? 297 ILE E CB  1 
ATOM   7876  C  CG1 . ILE E  2  141 ? 74.427  15.683  -63.314  1.00 35.80  ? 297 ILE E CG1 1 
ATOM   7877  C  CG2 . ILE E  2  141 ? 76.367  17.080  -62.952  1.00 53.20  ? 297 ILE E CG2 1 
ATOM   7878  C  CD1 . ILE E  2  141 ? 72.987  15.386  -63.036  1.00 56.66  ? 297 ILE E CD1 1 
ATOM   7879  N  N   . ALA E  2  142 ? 75.295  19.562  -61.020  1.00 36.80  ? 298 ALA E N   1 
ATOM   7880  C  CA  . ALA E  2  142 ? 76.183  20.559  -60.418  1.00 43.72  ? 298 ALA E CA  1 
ATOM   7881  C  C   . ALA E  2  142 ? 75.639  21.978  -60.578  1.00 40.40  ? 298 ALA E C   1 
ATOM   7882  O  O   . ALA E  2  142 ? 74.753  22.223  -61.388  1.00 42.97  ? 298 ALA E O   1 
ATOM   7883  C  CB  . ALA E  2  142 ? 77.569  20.465  -61.051  1.00 37.87  ? 298 ALA E CB  1 
ATOM   7884  N  N   . PHE E  2  143 ? 76.189  22.906  -59.804  1.00 52.05  ? 299 PHE E N   1 
ATOM   7885  C  CA  . PHE E  2  143 ? 75.780  24.308  -59.840  1.00 44.70  ? 299 PHE E CA  1 
ATOM   7886  C  C   . PHE E  2  143 ? 76.961  25.168  -60.277  1.00 45.12  ? 299 PHE E C   1 
ATOM   7887  O  O   . PHE E  2  143 ? 78.107  24.738  -60.158  1.00 45.06  ? 299 PHE E O   1 
ATOM   7888  C  CB  . PHE E  2  143 ? 75.330  24.750  -58.456  1.00 41.35  ? 299 PHE E CB  1 
ATOM   7889  C  CG  . PHE E  2  143 ? 74.093  24.047  -57.951  1.00 42.80  ? 299 PHE E CG  1 
ATOM   7890  C  CD1 . PHE E  2  143 ? 72.852  24.273  -58.548  1.00 50.42  ? 299 PHE E CD1 1 
ATOM   7891  C  CD2 . PHE E  2  143 ? 74.161  23.195  -56.846  1.00 32.22  ? 299 PHE E CD2 1 
ATOM   7892  C  CE1 . PHE E  2  143 ? 71.690  23.665  -58.052  1.00 28.26  ? 299 PHE E CE1 1 
ATOM   7893  C  CE2 . PHE E  2  143 ? 73.012  22.580  -56.339  1.00 22.50  ? 299 PHE E CE2 1 
ATOM   7894  C  CZ  . PHE E  2  143 ? 71.776  22.817  -56.944  1.00 40.03  ? 299 PHE E CZ  1 
ATOM   7895  N  N   . GLY E  2  144 ? 76.665  26.374  -60.781  1.00 55.09  ? 300 GLY E N   1 
ATOM   7896  C  CA  . GLY E  2  144 ? 77.684  27.311  -61.250  1.00 37.54  ? 300 GLY E CA  1 
ATOM   7897  C  C   . GLY E  2  144 ? 78.583  27.793  -60.130  1.00 46.51  ? 300 GLY E C   1 
ATOM   7898  O  O   . GLY E  2  144 ? 78.118  28.287  -59.109  1.00 50.03  ? 300 GLY E O   1 
ATOM   7899  N  N   . ASN E  2  145 ? 79.885  27.647  -60.311  1.00 47.36  ? 301 ASN E N   1 
ATOM   7900  C  CA  . ASN E  2  145 ? 80.832  28.047  -59.285  1.00 43.10  ? 301 ASN E CA  1 
ATOM   7901  C  C   . ASN E  2  145 ? 81.017  29.555  -59.225  1.00 50.87  ? 301 ASN E C   1 
ATOM   7902  O  O   . ASN E  2  145 ? 81.862  30.045  -58.472  1.00 63.96  ? 301 ASN E O   1 
ATOM   7903  C  CB  . ASN E  2  145 ? 82.181  27.394  -59.543  1.00 38.54  ? 301 ASN E CB  1 
ATOM   7904  C  CG  . ASN E  2  145 ? 83.029  28.194  -60.493  1.00 46.98  ? 301 ASN E CG  1 
ATOM   7905  O  OD1 . ASN E  2  145 ? 82.512  28.836  -61.407  1.00 52.74  ? 301 ASN E OD1 1 
ATOM   7906  N  ND2 . ASN E  2  145 ? 84.342  28.153  -60.296  1.00 63.10  ? 301 ASN E ND2 1 
ATOM   7907  N  N   . GLY E  2  146 ? 80.244  30.293  -60.014  1.00 42.32  ? 302 GLY E N   1 
ATOM   7908  C  CA  . GLY E  2  146 ? 80.374  31.737  -59.985  1.00 47.42  ? 302 GLY E CA  1 
ATOM   7909  C  C   . GLY E  2  146 ? 80.874  32.224  -61.321  1.00 55.49  ? 302 GLY E C   1 
ATOM   7910  O  O   . GLY E  2  146 ? 80.376  33.207  -61.866  1.00 54.13  ? 302 GLY E O   1 
ATOM   7911  N  N   . LYS E  2  147 ? 81.889  31.545  -61.839  1.00 58.94  ? 303 LYS E N   1 
ATOM   7912  C  CA  . LYS E  2  147 ? 82.426  31.885  -63.142  1.00 55.61  ? 303 LYS E CA  1 
ATOM   7913  C  C   . LYS E  2  147 ? 81.349  31.277  -64.027  1.00 60.61  ? 303 LYS E C   1 
ATOM   7914  O  O   . LYS E  2  147 ? 80.308  31.884  -64.263  1.00 69.84  ? 303 LYS E O   1 
ATOM   7915  C  CB  . LYS E  2  147 ? 83.765  31.182  -63.372  1.00 58.27  ? 303 LYS E CB  1 
ATOM   7916  C  CG  . LYS E  2  147 ? 84.781  31.309  -62.222  1.00 71.56  ? 303 LYS E CG  1 
ATOM   7917  C  CD  . LYS E  2  147 ? 85.278  32.750  -61.995  1.00 78.28  ? 303 LYS E CD  1 
ATOM   7918  C  CE  . LYS E  2  147 ? 84.293  33.597  -61.177  1.00 80.40  ? 303 LYS E CE  1 
ATOM   7919  N  NZ  . LYS E  2  147 ? 84.074  33.075  -59.792  1.00 70.96  ? 303 LYS E NZ  1 
ATOM   7920  N  N   . SER E  2  148 ? 81.580  30.058  -64.482  1.00 56.88  ? 304 SER E N   1 
ATOM   7921  C  CA  . SER E  2  148 ? 80.594  29.378  -65.297  1.00 55.04  ? 304 SER E CA  1 
ATOM   7922  C  C   . SER E  2  148 ? 80.982  27.928  -65.444  1.00 50.57  ? 304 SER E C   1 
ATOM   7923  O  O   . SER E  2  148 ? 80.613  27.258  -66.407  1.00 38.79  ? 304 SER E O   1 
ATOM   7924  C  CB  . SER E  2  148 ? 80.475  30.053  -66.658  1.00 59.12  ? 304 SER E CB  1 
ATOM   7925  O  OG  . SER E  2  148 ? 79.778  31.282  -66.532  1.00 54.31  ? 304 SER E OG  1 
ATOM   7926  N  N   . ILE E  2  149 ? 81.747  27.455  -64.468  1.00 48.83  ? 305 ILE E N   1 
ATOM   7927  C  CA  . ILE E  2  149 ? 82.201  26.074  -64.447  1.00 51.48  ? 305 ILE E CA  1 
ATOM   7928  C  C   . ILE E  2  149 ? 81.420  25.326  -63.371  1.00 53.43  ? 305 ILE E C   1 
ATOM   7929  O  O   . ILE E  2  149 ? 81.446  25.685  -62.198  1.00 60.45  ? 305 ILE E O   1 
ATOM   7930  C  CB  . ILE E  2  149 ? 83.707  26.007  -64.169  1.00 54.30  ? 305 ILE E CB  1 
ATOM   7931  C  CG1 . ILE E  2  149 ? 84.058  26.979  -63.039  1.00 78.51  ? 305 ILE E CG1 1 
ATOM   7932  C  CG2 . ILE E  2  149 ? 84.489  26.395  -65.415  1.00 28.02  ? 305 ILE E CG2 1 
ATOM   7933  C  CD1 . ILE E  2  149 ? 85.562  27.125  -62.747  1.00 89.86  ? 305 ILE E CD1 1 
ATOM   7934  N  N   . CYS E  2  150 ? 80.683  24.306  -63.788  1.00 50.09  ? 306 CYS E N   1 
ATOM   7935  C  CA  . CYS E  2  150 ? 79.894  23.532  -62.857  1.00 45.61  ? 306 CYS E CA  1 
ATOM   7936  C  C   . CYS E  2  150 ? 80.745  22.531  -62.096  1.00 45.82  ? 306 CYS E C   1 
ATOM   7937  O  O   . CYS E  2  150 ? 80.805  21.355  -62.452  1.00 54.11  ? 306 CYS E O   1 
ATOM   7938  C  CB  . CYS E  2  150 ? 78.768  22.811  -63.595  1.00 33.92  ? 306 CYS E CB  1 
ATOM   7939  S  SG  . CYS E  2  150 ? 77.227  23.766  -63.648  1.00 61.48  ? 306 CYS E SG  1 
ATOM   7940  N  N   . ASN E  2  151 ? 81.410  23.007  -61.050  1.00 44.44  ? 307 ASN E N   1 
ATOM   7941  C  CA  . ASN E  2  151 ? 82.240  22.146  -60.223  1.00 45.24  ? 307 ASN E CA  1 
ATOM   7942  C  C   . ASN E  2  151 ? 81.679  22.057  -58.800  1.00 42.90  ? 307 ASN E C   1 
ATOM   7943  O  O   . ASN E  2  151 ? 82.331  21.534  -57.897  1.00 45.52  ? 307 ASN E O   1 
ATOM   7944  C  CB  . ASN E  2  151 ? 83.677  22.660  -60.186  1.00 35.81  ? 307 ASN E CB  1 
ATOM   7945  C  CG  . ASN E  2  151 ? 83.756  24.110  -59.806  1.00 24.16  ? 307 ASN E CG  1 
ATOM   7946  O  OD1 . ASN E  2  151 ? 83.114  24.551  -58.858  1.00 40.06  ? 307 ASN E OD1 1 
ATOM   7947  N  ND2 . ASN E  2  151 ? 84.542  24.867  -60.541  1.00 28.81  ? 307 ASN E ND2 1 
ATOM   7948  N  N   . ILE E  2  152 ? 80.480  22.588  -58.599  1.00 35.82  ? 308 ILE E N   1 
ATOM   7949  C  CA  . ILE E  2  152 ? 79.845  22.515  -57.293  1.00 45.76  ? 308 ILE E CA  1 
ATOM   7950  C  C   . ILE E  2  152 ? 78.806  21.418  -57.401  1.00 47.93  ? 308 ILE E C   1 
ATOM   7951  O  O   . ILE E  2  152 ? 77.695  21.645  -57.864  1.00 52.60  ? 308 ILE E O   1 
ATOM   7952  C  CB  . ILE E  2  152 ? 79.150  23.825  -56.927  1.00 50.63  ? 308 ILE E CB  1 
ATOM   7953  C  CG1 . ILE E  2  152 ? 80.200  24.903  -56.629  1.00 41.56  ? 308 ILE E CG1 1 
ATOM   7954  C  CG2 . ILE E  2  152 ? 78.216  23.594  -55.753  1.00 51.91  ? 308 ILE E CG2 1 
ATOM   7955  C  CD1 . ILE E  2  152 ? 79.611  26.218  -56.237  1.00 37.55  ? 308 ILE E CD1 1 
ATOM   7956  N  N   . PRO E  2  153 ? 79.157  20.205  -56.967  1.00 52.71  ? 309 PRO E N   1 
ATOM   7957  C  CA  . PRO E  2  153 ? 78.239  19.069  -57.034  1.00 48.84  ? 309 PRO E CA  1 
ATOM   7958  C  C   . PRO E  2  153 ? 76.877  19.320  -56.408  1.00 42.50  ? 309 PRO E C   1 
ATOM   7959  O  O   . PRO E  2  153 ? 76.766  19.964  -55.367  1.00 33.44  ? 309 PRO E O   1 
ATOM   7960  C  CB  . PRO E  2  153 ? 79.014  17.971  -56.319  1.00 51.36  ? 309 PRO E CB  1 
ATOM   7961  C  CG  . PRO E  2  153 ? 79.784  18.727  -55.312  1.00 57.17  ? 309 PRO E CG  1 
ATOM   7962  C  CD  . PRO E  2  153 ? 80.313  19.880  -56.117  1.00 48.80  ? 309 PRO E CD  1 
ATOM   7963  N  N   . GLY E  2  154 ? 75.838  18.804  -57.056  1.00 37.68  ? 310 GLY E N   1 
ATOM   7964  C  CA  . GLY E  2  154 ? 74.501  18.973  -56.527  1.00 33.69  ? 310 GLY E CA  1 
ATOM   7965  C  C   . GLY E  2  154 ? 73.923  17.641  -56.110  1.00 36.72  ? 310 GLY E C   1 
ATOM   7966  O  O   . GLY E  2  154 ? 74.601  16.619  -56.192  1.00 46.62  ? 310 GLY E O   1 
ATOM   7967  N  N   . GLU E  2  155 ? 72.676  17.638  -55.652  1.00 34.62  ? 311 GLU E N   1 
ATOM   7968  C  CA  . GLU E  2  155 ? 72.046  16.398  -55.246  1.00 26.79  ? 311 GLU E CA  1 
ATOM   7969  C  C   . GLU E  2  155 ? 71.353  15.760  -56.430  1.00 36.23  ? 311 GLU E C   1 
ATOM   7970  O  O   . GLU E  2  155 ? 70.503  16.389  -57.068  1.00 38.22  ? 311 GLU E O   1 
ATOM   7971  C  CB  . GLU E  2  155 ? 71.021  16.638  -54.147  1.00 10.83  ? 311 GLU E CB  1 
ATOM   7972  C  CG  . GLU E  2  155 ? 71.598  17.215  -52.898  1.00 37.66  ? 311 GLU E CG  1 
ATOM   7973  C  CD  . GLU E  2  155 ? 71.150  16.477  -51.654  1.00 54.22  ? 311 GLU E CD  1 
ATOM   7974  O  OE1 . GLU E  2  155 ? 69.931  16.155  -51.564  1.00 45.05  ? 311 GLU E OE1 1 
ATOM   7975  O  OE2 . GLU E  2  155 ? 72.021  16.246  -50.767  1.00 25.99  ? 311 GLU E OE2 1 
ATOM   7976  N  N   . TYR E  2  156 ? 71.728  14.523  -56.740  1.00 31.97  ? 312 TYR E N   1 
ATOM   7977  C  CA  . TYR E  2  156 ? 71.082  13.821  -57.833  1.00 29.48  ? 312 TYR E CA  1 
ATOM   7978  C  C   . TYR E  2  156 ? 71.232  12.313  -57.809  1.00 30.11  ? 312 TYR E C   1 
ATOM   7979  O  O   . TYR E  2  156 ? 72.034  11.744  -57.084  1.00 36.54  ? 312 TYR E O   1 
ATOM   7980  C  CB  . TYR E  2  156 ? 71.578  14.336  -59.187  1.00 24.89  ? 312 TYR E CB  1 
ATOM   7981  C  CG  . TYR E  2  156 ? 72.974  13.887  -59.582  1.00 37.31  ? 312 TYR E CG  1 
ATOM   7982  C  CD1 . TYR E  2  156 ? 74.090  14.672  -59.296  1.00 36.79  ? 312 TYR E CD1 1 
ATOM   7983  C  CD2 . TYR E  2  156 ? 73.181  12.673  -60.247  1.00 37.67  ? 312 TYR E CD2 1 
ATOM   7984  C  CE1 . TYR E  2  156 ? 75.367  14.265  -59.660  1.00 7.94   ? 312 TYR E CE1 1 
ATOM   7985  C  CE2 . TYR E  2  156 ? 74.462  12.257  -60.610  1.00 15.17  ? 312 TYR E CE2 1 
ATOM   7986  C  CZ  . TYR E  2  156 ? 75.541  13.055  -60.313  1.00 15.32  ? 312 TYR E CZ  1 
ATOM   7987  O  OH  . TYR E  2  156 ? 76.804  12.645  -60.668  1.00 28.33  ? 312 TYR E OH  1 
ATOM   7988  N  N   . TRP E  2  157 ? 70.418  11.679  -58.627  1.00 37.85  ? 313 TRP E N   1 
ATOM   7989  C  CA  . TRP E  2  157 ? 70.451  10.253  -58.802  1.00 33.27  ? 313 TRP E CA  1 
ATOM   7990  C  C   . TRP E  2  157 ? 70.474  10.055  -60.313  1.00 32.74  ? 313 TRP E C   1 
ATOM   7991  O  O   . TRP E  2  157 ? 69.437  10.178  -60.960  1.00 28.27  ? 313 TRP E O   1 
ATOM   7992  C  CB  . TRP E  2  157 ? 69.202  9.609   -58.197  1.00 23.40  ? 313 TRP E CB  1 
ATOM   7993  C  CG  . TRP E  2  157 ? 69.098  8.127   -58.457  1.00 38.58  ? 313 TRP E CG  1 
ATOM   7994  C  CD1 . TRP E  2  157 ? 68.437  7.518   -59.483  1.00 37.52  ? 313 TRP E CD1 1 
ATOM   7995  C  CD2 . TRP E  2  157 ? 69.725  7.076   -57.710  1.00 42.38  ? 313 TRP E CD2 1 
ATOM   7996  N  NE1 . TRP E  2  157 ? 68.614  6.160   -59.427  1.00 31.17  ? 313 TRP E NE1 1 
ATOM   7997  C  CE2 . TRP E  2  157 ? 69.402  5.861   -58.349  1.00 41.54  ? 313 TRP E CE2 1 
ATOM   7998  C  CE3 . TRP E  2  157 ? 70.530  7.043   -56.566  1.00 21.89  ? 313 TRP E CE3 1 
ATOM   7999  C  CZ2 . TRP E  2  157 ? 69.859  4.631   -57.882  1.00 32.31  ? 313 TRP E CZ2 1 
ATOM   8000  C  CZ3 . TRP E  2  157 ? 70.980  5.828   -56.110  1.00 20.28  ? 313 TRP E CZ3 1 
ATOM   8001  C  CH2 . TRP E  2  157 ? 70.645  4.636   -56.767  1.00 20.96  ? 313 TRP E CH2 1 
ATOM   8002  N  N   . LEU E  2  158 ? 71.661  9.828   -60.878  1.00 29.17  ? 314 LEU E N   1 
ATOM   8003  C  CA  . LEU E  2  158 ? 71.796  9.547   -62.311  1.00 28.11  ? 314 LEU E CA  1 
ATOM   8004  C  C   . LEU E  2  158 ? 70.827  8.388   -62.425  1.00 41.39  ? 314 LEU E C   1 
ATOM   8005  O  O   . LEU E  2  158 ? 70.837  7.505   -61.562  1.00 64.09  ? 314 LEU E O   1 
ATOM   8006  C  CB  . LEU E  2  158 ? 73.205  9.046   -62.614  1.00 21.87  ? 314 LEU E CB  1 
ATOM   8007  C  CG  . LEU E  2  158 ? 73.619  8.938   -64.075  1.00 38.11  ? 314 LEU E CG  1 
ATOM   8008  C  CD1 . LEU E  2  158 ? 73.888  10.322  -64.629  1.00 30.86  ? 314 LEU E CD1 1 
ATOM   8009  C  CD2 . LEU E  2  158 ? 74.883  8.123   -64.195  1.00 32.70  ? 314 LEU E CD2 1 
ATOM   8010  N  N   . GLY E  2  159 ? 69.987  8.355   -63.443  1.00 16.43  ? 315 GLY E N   1 
ATOM   8011  C  CA  . GLY E  2  159 ? 69.023  7.254   -63.506  1.00 27.19  ? 315 GLY E CA  1 
ATOM   8012  C  C   . GLY E  2  159 ? 69.461  5.790   -63.350  1.00 29.72  ? 315 GLY E C   1 
ATOM   8013  O  O   . GLY E  2  159 ? 70.465  5.340   -63.917  1.00 22.47  ? 315 GLY E O   1 
ATOM   8014  N  N   . THR E  2  160 ? 68.688  5.015   -62.596  1.00 31.96  ? 316 THR E N   1 
ATOM   8015  C  CA  . THR E  2  160 ? 69.025  3.603   -62.407  1.00 35.38  ? 316 THR E CA  1 
ATOM   8016  C  C   . THR E  2  160 ? 69.273  2.875   -63.725  1.00 37.95  ? 316 THR E C   1 
ATOM   8017  O  O   . THR E  2  160 ? 70.224  2.116   -63.855  1.00 46.10  ? 316 THR E O   1 
ATOM   8018  C  CB  . THR E  2  160 ? 67.923  2.857   -61.685  1.00 32.68  ? 316 THR E CB  1 
ATOM   8019  O  OG1 . THR E  2  160 ? 67.730  3.446   -60.395  1.00 27.69  ? 316 THR E OG1 1 
ATOM   8020  C  CG2 . THR E  2  160 ? 68.297  1.369   -61.539  1.00 31.86  ? 316 THR E CG2 1 
ATOM   8021  N  N   . LYS E  2  161 ? 68.400  3.099   -64.697  1.00 37.94  ? 317 LYS E N   1 
ATOM   8022  C  CA  . LYS E  2  161 ? 68.533  2.466   -65.994  1.00 29.63  ? 317 LYS E CA  1 
ATOM   8023  C  C   . LYS E  2  161 ? 69.886  2.777   -66.646  1.00 39.48  ? 317 LYS E C   1 
ATOM   8024  O  O   . LYS E  2  161 ? 70.476  1.933   -67.324  1.00 25.37  ? 317 LYS E O   1 
ATOM   8025  C  CB  . LYS E  2  161 ? 67.420  2.932   -66.913  1.00 28.34  ? 317 LYS E CB  1 
ATOM   8026  C  CG  . LYS E  2  161 ? 67.444  2.216   -68.240  1.00 21.21  ? 317 LYS E CG  1 
ATOM   8027  C  CD  . LYS E  2  161 ? 67.203  0.737   -68.052  1.00 29.16  ? 317 LYS E CD  1 
ATOM   8028  C  CE  . LYS E  2  161 ? 67.270  0.059   -69.387  1.00 45.84  ? 317 LYS E CE  1 
ATOM   8029  N  NZ  . LYS E  2  161 ? 68.355  0.692   -70.184  1.00 38.91  ? 317 LYS E NZ  1 
ATOM   8030  N  N   . THR E  2  162 ? 70.367  4.002   -66.466  1.00 43.19  ? 318 THR E N   1 
ATOM   8031  C  CA  . THR E  2  162 ? 71.655  4.383   -67.025  1.00 33.78  ? 318 THR E CA  1 
ATOM   8032  C  C   . THR E  2  162 ? 72.702  3.583   -66.275  1.00 39.67  ? 318 THR E C   1 
ATOM   8033  O  O   . THR E  2  162 ? 73.600  2.989   -66.878  1.00 33.01  ? 318 THR E O   1 
ATOM   8034  C  CB  . THR E  2  162 ? 71.957  5.872   -66.808  1.00 38.58  ? 318 THR E CB  1 
ATOM   8035  O  OG1 . THR E  2  162 ? 71.092  6.663   -67.625  1.00 46.08  ? 318 THR E OG1 1 
ATOM   8036  C  CG2 . THR E  2  162 ? 73.405  6.177   -67.150  1.00 30.88  ? 318 THR E CG2 1 
ATOM   8037  N  N   . VAL E  2  163 ? 72.584  3.583   -64.948  1.00 33.98  ? 319 VAL E N   1 
ATOM   8038  C  CA  . VAL E  2  163 ? 73.517  2.845   -64.112  1.00 38.61  ? 319 VAL E CA  1 
ATOM   8039  C  C   . VAL E  2  163 ? 73.523  1.381   -64.563  1.00 39.66  ? 319 VAL E C   1 
ATOM   8040  O  O   . VAL E  2  163 ? 74.575  0.787   -64.759  1.00 43.61  ? 319 VAL E O   1 
ATOM   8041  C  CB  . VAL E  2  163 ? 73.120  2.936   -62.642  1.00 34.94  ? 319 VAL E CB  1 
ATOM   8042  C  CG1 . VAL E  2  163 ? 74.192  2.329   -61.777  1.00 25.05  ? 319 VAL E CG1 1 
ATOM   8043  C  CG2 . VAL E  2  163 ? 72.887  4.382   -62.279  1.00 38.27  ? 319 VAL E CG2 1 
ATOM   8044  N  N   . HIS E  2  164 ? 72.345  0.807   -64.759  1.00 39.25  ? 320 HIS E N   1 
ATOM   8045  C  CA  . HIS E  2  164 ? 72.268  -0.575  -65.196  1.00 42.99  ? 320 HIS E CA  1 
ATOM   8046  C  C   . HIS E  2  164 ? 73.001  -0.778  -66.512  1.00 51.18  ? 320 HIS E C   1 
ATOM   8047  O  O   . HIS E  2  164 ? 73.852  -1.657  -66.623  1.00 62.16  ? 320 HIS E O   1 
ATOM   8048  C  CB  . HIS E  2  164 ? 70.827  -1.009  -65.362  1.00 42.02  ? 320 HIS E CB  1 
ATOM   8049  C  CG  . HIS E  2  164 ? 70.681  -2.303  -66.087  1.00 47.86  ? 320 HIS E CG  1 
ATOM   8050  N  ND1 . HIS E  2  164 ? 70.688  -2.394  -67.461  1.00 54.11  ? 320 HIS E ND1 1 
ATOM   8051  C  CD2 . HIS E  2  164 ? 70.554  -3.569  -65.627  1.00 56.79  ? 320 HIS E CD2 1 
ATOM   8052  C  CE1 . HIS E  2  164 ? 70.567  -3.661  -67.818  1.00 52.04  ? 320 HIS E CE1 1 
ATOM   8053  N  NE2 . HIS E  2  164 ? 70.484  -4.394  -66.723  1.00 45.96  ? 320 HIS E NE2 1 
ATOM   8054  N  N   . GLN E  2  165 ? 72.670  0.018   -67.519  1.00 44.38  ? 321 GLN E N   1 
ATOM   8055  C  CA  . GLN E  2  165 ? 73.349  -0.114  -68.800  1.00 42.43  ? 321 GLN E CA  1 
ATOM   8056  C  C   . GLN E  2  165 ? 74.844  0.020   -68.579  1.00 44.04  ? 321 GLN E C   1 
ATOM   8057  O  O   . GLN E  2  165 ? 75.638  -0.677  -69.182  1.00 38.70  ? 321 GLN E O   1 
ATOM   8058  C  CB  . GLN E  2  165 ? 72.888  0.969   -69.784  1.00 24.85  ? 321 GLN E CB  1 
ATOM   8059  C  CG  . GLN E  2  165 ? 71.466  0.801   -70.248  1.00 37.03  ? 321 GLN E CG  1 
ATOM   8060  C  CD  . GLN E  2  165 ? 71.259  -0.508  -70.985  1.00 52.09  ? 321 GLN E CD  1 
ATOM   8061  O  OE1 . GLN E  2  165 ? 70.130  -0.990  -71.125  1.00 46.38  ? 321 GLN E OE1 1 
ATOM   8062  N  NE2 . GLN E  2  165 ? 72.356  -1.093  -71.467  1.00 48.56  ? 321 GLN E NE2 1 
ATOM   8063  N  N   . LEU E  2  166 ? 75.225  0.923   -67.691  1.00 53.03  ? 322 LEU E N   1 
ATOM   8064  C  CA  . LEU E  2  166 ? 76.631  1.150   -67.425  1.00 54.27  ? 322 LEU E CA  1 
ATOM   8065  C  C   . LEU E  2  166 ? 77.355  -0.137  -67.037  1.00 57.29  ? 322 LEU E C   1 
ATOM   8066  O  O   . LEU E  2  166 ? 78.449  -0.419  -67.543  1.00 43.01  ? 322 LEU E O   1 
ATOM   8067  C  CB  . LEU E  2  166 ? 76.781  2.181   -66.311  1.00 53.18  ? 322 LEU E CB  1 
ATOM   8068  C  CG  . LEU E  2  166 ? 77.883  3.216   -66.504  1.00 53.23  ? 322 LEU E CG  1 
ATOM   8069  C  CD1 . LEU E  2  166 ? 78.076  4.006   -65.219  1.00 57.63  ? 322 LEU E CD1 1 
ATOM   8070  C  CD2 . LEU E  2  166 ? 79.145  2.520   -66.876  1.00 12.08  ? 322 LEU E CD2 1 
ATOM   8071  N  N   . THR E  2  167 ? 76.738  -0.911  -66.144  1.00 52.05  ? 323 THR E N   1 
ATOM   8072  C  CA  . THR E  2  167 ? 77.328  -2.158  -65.669  1.00 52.58  ? 323 THR E CA  1 
ATOM   8073  C  C   . THR E  2  167 ? 77.070  -3.350  -66.586  1.00 51.82  ? 323 THR E C   1 
ATOM   8074  O  O   . THR E  2  167 ? 77.774  -4.353  -66.518  1.00 49.57  ? 323 THR E O   1 
ATOM   8075  C  CB  . THR E  2  167 ? 76.811  -2.515  -64.280  1.00 49.71  ? 323 THR E CB  1 
ATOM   8076  O  OG1 . THR E  2  167 ? 75.399  -2.721  -64.348  1.00 41.06  ? 323 THR E OG1 1 
ATOM   8077  C  CG2 . THR E  2  167 ? 77.130  -1.407  -63.294  1.00 51.38  ? 323 THR E CG2 1 
ATOM   8078  N  N   . LYS E  2  168 ? 76.062  -3.247  -67.441  1.00 49.96  ? 324 LYS E N   1 
ATOM   8079  C  CA  . LYS E  2  168 ? 75.761  -4.335  -68.351  1.00 52.04  ? 324 LYS E CA  1 
ATOM   8080  C  C   . LYS E  2  168 ? 76.818  -4.363  -69.440  1.00 65.65  ? 324 LYS E C   1 
ATOM   8081  O  O   . LYS E  2  168 ? 77.261  -5.433  -69.854  1.00 74.48  ? 324 LYS E O   1 
ATOM   8082  C  CB  . LYS E  2  168 ? 74.378  -4.151  -68.966  1.00 53.39  ? 324 LYS E CB  1 
ATOM   8083  C  CG  . LYS E  2  168 ? 73.855  -5.372  -69.695  1.00 35.72  ? 324 LYS E CG  1 
ATOM   8084  C  CD  . LYS E  2  168 ? 73.937  -5.204  -71.201  1.00 63.57  ? 324 LYS E CD  1 
ATOM   8085  C  CE  . LYS E  2  168 ? 73.008  -4.114  -71.721  1.00 69.43  ? 324 LYS E CE  1 
ATOM   8086  N  NZ  . LYS E  2  168 ? 71.565  -4.466  -71.555  1.00 72.55  ? 324 LYS E NZ  1 
ATOM   8087  N  N   . GLN E  2  169 ? 77.225  -3.181  -69.896  1.00 76.62  ? 325 GLN E N   1 
ATOM   8088  C  CA  . GLN E  2  169 ? 78.246  -3.064  -70.930  1.00 87.41  ? 325 GLN E CA  1 
ATOM   8089  C  C   . GLN E  2  169 ? 79.500  -3.759  -70.421  1.00 93.16  ? 325 GLN E C   1 
ATOM   8090  O  O   . GLN E  2  169 ? 80.197  -4.443  -71.175  1.00 98.10  ? 325 GLN E O   1 
ATOM   8091  C  CB  . GLN E  2  169 ? 78.537  -1.593  -71.221  1.00 99.07  ? 325 GLN E CB  1 
ATOM   8092  C  CG  . GLN E  2  169 ? 79.521  -1.364  -72.357  1.00 115.12 ? 325 GLN E CG  1 
ATOM   8093  C  CD  . GLN E  2  169 ? 79.771  0.111   -72.627  1.00 122.92 ? 325 GLN E CD  1 
ATOM   8094  O  OE1 . GLN E  2  169 ? 80.570  0.467   -73.496  1.00 132.91 ? 325 GLN E OE1 1 
ATOM   8095  N  NE2 . GLN E  2  169 ? 79.085  0.976   -71.885  1.00 117.78 ? 325 GLN E NE2 1 
ATOM   8096  N  N   . HIS E  2  170 ? 79.780  -3.566  -69.134  1.00 99.22  ? 326 HIS E N   1 
ATOM   8097  C  CA  . HIS E  2  170 ? 80.916  -4.199  -68.467  1.00 102.10 ? 326 HIS E CA  1 
ATOM   8098  C  C   . HIS E  2  170 ? 81.038  -3.807  -67.002  1.00 88.21  ? 326 HIS E C   1 
ATOM   8099  O  O   . HIS E  2  170 ? 81.284  -2.654  -66.671  1.00 78.96  ? 326 HIS E O   1 
ATOM   8100  C  CB  . HIS E  2  170 ? 82.231  -3.920  -69.202  1.00 119.80 ? 326 HIS E CB  1 
ATOM   8101  C  CG  . HIS E  2  170 ? 82.944  -5.168  -69.629  1.00 138.32 ? 326 HIS E CG  1 
ATOM   8102  N  ND1 . HIS E  2  170 ? 83.534  -6.033  -68.731  1.00 140.76 ? 326 HIS E ND1 1 
ATOM   8103  C  CD2 . HIS E  2  170 ? 83.104  -5.730  -70.852  1.00 142.95 ? 326 HIS E CD2 1 
ATOM   8104  C  CE1 . HIS E  2  170 ? 84.024  -7.074  -69.381  1.00 142.02 ? 326 HIS E CE1 1 
ATOM   8105  N  NE2 . HIS E  2  170 ? 83.776  -6.915  -70.669  1.00 147.62 ? 326 HIS E NE2 1 
ATOM   8106  N  N   . THR E  2  171 ? 80.855  -4.810  -66.144  1.00 82.95  ? 327 THR E N   1 
ATOM   8107  C  CA  . THR E  2  171 ? 80.901  -4.695  -64.688  1.00 63.15  ? 327 THR E CA  1 
ATOM   8108  C  C   . THR E  2  171 ? 81.780  -3.583  -64.138  1.00 52.65  ? 327 THR E C   1 
ATOM   8109  O  O   . THR E  2  171 ? 82.916  -3.387  -64.564  1.00 42.53  ? 327 THR E O   1 
ATOM   8110  C  CB  . THR E  2  171 ? 81.343  -6.025  -64.052  1.00 62.78  ? 327 THR E CB  1 
ATOM   8111  O  OG1 . THR E  2  171 ? 80.625  -7.103  -64.661  1.00 64.45  ? 327 THR E OG1 1 
ATOM   8112  C  CG2 . THR E  2  171 ? 81.051  -6.028  -62.564  1.00 48.22  ? 327 THR E CG2 1 
ATOM   8113  N  N   . GLN E  2  172 ? 81.229  -2.871  -63.164  1.00 47.30  ? 328 GLN E N   1 
ATOM   8114  C  CA  . GLN E  2  172 ? 81.906  -1.756  -62.522  1.00 49.88  ? 328 GLN E CA  1 
ATOM   8115  C  C   . GLN E  2  172 ? 82.229  -2.068  -61.064  1.00 46.94  ? 328 GLN E C   1 
ATOM   8116  O  O   . GLN E  2  172 ? 81.828  -3.094  -60.508  1.00 38.41  ? 328 GLN E O   1 
ATOM   8117  C  CB  . GLN E  2  172 ? 81.009  -0.507  -62.546  1.00 48.24  ? 328 GLN E CB  1 
ATOM   8118  C  CG  . GLN E  2  172 ? 80.381  -0.152  -63.882  1.00 47.28  ? 328 GLN E CG  1 
ATOM   8119  C  CD  . GLN E  2  172 ? 81.315  0.621   -64.776  1.00 48.08  ? 328 GLN E CD  1 
ATOM   8120  O  OE1 . GLN E  2  172 ? 81.777  1.703   -64.422  1.00 56.25  ? 328 GLN E OE1 1 
ATOM   8121  N  NE2 . GLN E  2  172 ? 81.597  0.073   -65.946  1.00 51.64  ? 328 GLN E NE2 1 
ATOM   8122  N  N   . GLN E  2  173 ? 82.968  -1.156  -60.453  1.00 41.60  ? 329 GLN E N   1 
ATOM   8123  C  CA  . GLN E  2  173 ? 83.309  -1.251  -59.053  1.00 45.36  ? 329 GLN E CA  1 
ATOM   8124  C  C   . GLN E  2  173 ? 82.696  0.013   -58.446  1.00 57.51  ? 329 GLN E C   1 
ATOM   8125  O  O   . GLN E  2  173 ? 82.839  1.118   -58.999  1.00 52.68  ? 329 GLN E O   1 
ATOM   8126  C  CB  . GLN E  2  173 ? 84.823  -1.265  -58.867  1.00 47.99  ? 329 GLN E CB  1 
ATOM   8127  C  CG  . GLN E  2  173 ? 85.553  -0.074  -59.453  1.00 53.96  ? 329 GLN E CG  1 
ATOM   8128  C  CD  . GLN E  2  173 ? 87.045  -0.138  -59.207  1.00 57.72  ? 329 GLN E CD  1 
ATOM   8129  O  OE1 . GLN E  2  173 ? 87.494  -0.216  -58.064  1.00 65.38  ? 329 GLN E OE1 1 
ATOM   8130  N  NE2 . GLN E  2  173 ? 87.823  -0.105  -60.279  1.00 65.39  ? 329 GLN E NE2 1 
ATOM   8131  N  N   . VAL E  2  174 ? 81.992  -0.147  -57.329  1.00 54.05  ? 330 VAL E N   1 
ATOM   8132  C  CA  . VAL E  2  174 ? 81.346  0.987   -56.680  1.00 53.56  ? 330 VAL E CA  1 
ATOM   8133  C  C   . VAL E  2  174 ? 82.137  1.445   -55.472  1.00 47.02  ? 330 VAL E C   1 
ATOM   8134  O  O   . VAL E  2  174 ? 82.899  0.677   -54.898  1.00 44.78  ? 330 VAL E O   1 
ATOM   8135  C  CB  . VAL E  2  174 ? 79.903  0.634   -56.249  1.00 49.90  ? 330 VAL E CB  1 
ATOM   8136  C  CG1 . VAL E  2  174 ? 79.913  -0.500  -55.278  1.00 32.34  ? 330 VAL E CG1 1 
ATOM   8137  C  CG2 . VAL E  2  174 ? 79.249  1.821   -55.629  1.00 43.15  ? 330 VAL E CG2 1 
ATOM   8138  N  N   . LEU E  2  175 ? 81.957  2.709   -55.110  1.00 44.15  ? 331 LEU E N   1 
ATOM   8139  C  CA  . LEU E  2  175 ? 82.645  3.311   -53.976  1.00 37.58  ? 331 LEU E CA  1 
ATOM   8140  C  C   . LEU E  2  175 ? 81.739  4.330   -53.301  1.00 38.25  ? 331 LEU E C   1 
ATOM   8141  O  O   . LEU E  2  175 ? 81.269  5.265   -53.945  1.00 34.52  ? 331 LEU E O   1 
ATOM   8142  C  CB  . LEU E  2  175 ? 83.913  4.016   -54.443  1.00 29.66  ? 331 LEU E CB  1 
ATOM   8143  C  CG  . LEU E  2  175 ? 84.334  5.185   -53.548  1.00 35.31  ? 331 LEU E CG  1 
ATOM   8144  C  CD1 . LEU E  2  175 ? 85.016  4.673   -52.325  1.00 47.55  ? 331 LEU E CD1 1 
ATOM   8145  C  CD2 . LEU E  2  175 ? 85.244  6.103   -54.308  1.00 51.60  ? 331 LEU E CD2 1 
ATOM   8146  N  N   . PHE E  2  176 ? 81.495  4.148   -52.007  1.00 40.88  ? 332 PHE E N   1 
ATOM   8147  C  CA  . PHE E  2  176 ? 80.653  5.070   -51.254  1.00 44.82  ? 332 PHE E CA  1 
ATOM   8148  C  C   . PHE E  2  176 ? 81.505  6.007   -50.385  1.00 44.56  ? 332 PHE E C   1 
ATOM   8149  O  O   . PHE E  2  176 ? 82.320  5.555   -49.578  1.00 49.13  ? 332 PHE E O   1 
ATOM   8150  C  CB  . PHE E  2  176 ? 79.671  4.311   -50.354  1.00 26.22  ? 332 PHE E CB  1 
ATOM   8151  C  CG  . PHE E  2  176 ? 78.677  3.481   -51.096  1.00 30.35  ? 332 PHE E CG  1 
ATOM   8152  C  CD1 . PHE E  2  176 ? 79.081  2.376   -51.840  1.00 40.31  ? 332 PHE E CD1 1 
ATOM   8153  C  CD2 . PHE E  2  176 ? 77.323  3.765   -51.012  1.00 40.60  ? 332 PHE E CD2 1 
ATOM   8154  C  CE1 . PHE E  2  176 ? 78.144  1.551   -52.492  1.00 36.50  ? 332 PHE E CE1 1 
ATOM   8155  C  CE2 . PHE E  2  176 ? 76.378  2.949   -51.658  1.00 48.36  ? 332 PHE E CE2 1 
ATOM   8156  C  CZ  . PHE E  2  176 ? 76.796  1.834   -52.401  1.00 23.65  ? 332 PHE E CZ  1 
ATOM   8157  N  N   . ASP E  2  177 ? 81.306  7.310   -50.563  1.00 39.10  ? 333 ASP E N   1 
ATOM   8158  C  CA  . ASP E  2  177 ? 82.019  8.325   -49.806  1.00 33.49  ? 333 ASP E CA  1 
ATOM   8159  C  C   . ASP E  2  177 ? 80.982  9.053   -48.982  1.00 36.38  ? 333 ASP E C   1 
ATOM   8160  O  O   . ASP E  2  177 ? 80.075  9.665   -49.535  1.00 49.12  ? 333 ASP E O   1 
ATOM   8161  C  CB  . ASP E  2  177 ? 82.698  9.345   -50.730  1.00 43.62  ? 333 ASP E CB  1 
ATOM   8162  C  CG  . ASP E  2  177 ? 83.915  8.781   -51.457  1.00 70.96  ? 333 ASP E CG  1 
ATOM   8163  O  OD1 . ASP E  2  177 ? 83.776  7.795   -52.216  1.00 90.23  ? 333 ASP E OD1 1 
ATOM   8164  O  OD2 . ASP E  2  177 ? 85.020  9.330   -51.279  1.00 64.62  ? 333 ASP E OD2 1 
ATOM   8165  N  N   . MET E  2  178 ? 81.104  8.982   -47.662  1.00 40.73  ? 334 MET E N   1 
ATOM   8166  C  CA  . MET E  2  178 ? 80.180  9.684   -46.772  1.00 46.54  ? 334 MET E CA  1 
ATOM   8167  C  C   . MET E  2  178 ? 80.972  10.526  -45.773  1.00 40.97  ? 334 MET E C   1 
ATOM   8168  O  O   . MET E  2  178 ? 82.125  10.232  -45.477  1.00 41.77  ? 334 MET E O   1 
ATOM   8169  C  CB  . MET E  2  178 ? 79.260  8.694   -46.042  1.00 41.62  ? 334 MET E CB  1 
ATOM   8170  C  CG  . MET E  2  178 ? 79.980  7.594   -45.311  1.00 35.26  ? 334 MET E CG  1 
ATOM   8171  S  SD  . MET E  2  178 ? 78.929  6.165   -45.107  1.00 37.24  ? 334 MET E SD  1 
ATOM   8172  C  CE  . MET E  2  178 ? 79.342  5.290   -46.542  1.00 46.39  ? 334 MET E CE  1 
ATOM   8173  N  N   . SER E  2  179 ? 80.350  11.592  -45.288  1.00 42.68  ? 335 SER E N   1 
ATOM   8174  C  CA  . SER E  2  179 ? 80.967  12.503  -44.332  1.00 34.60  ? 335 SER E CA  1 
ATOM   8175  C  C   . SER E  2  179 ? 79.911  12.852  -43.300  1.00 43.34  ? 335 SER E C   1 
ATOM   8176  O  O   . SER E  2  179 ? 78.750  13.102  -43.641  1.00 47.43  ? 335 SER E O   1 
ATOM   8177  C  CB  . SER E  2  179 ? 81.422  13.796  -45.018  1.00 29.00  ? 335 SER E CB  1 
ATOM   8178  O  OG  . SER E  2  179 ? 82.468  13.575  -45.941  1.00 43.89  ? 335 SER E OG  1 
ATOM   8179  N  N   . ASP E  2  180 ? 80.316  12.872  -42.038  1.00 37.09  ? 336 ASP E N   1 
ATOM   8180  C  CA  . ASP E  2  180 ? 79.402  13.209  -40.958  1.00 50.34  ? 336 ASP E CA  1 
ATOM   8181  C  C   . ASP E  2  180 ? 79.400  14.723  -40.763  1.00 52.92  ? 336 ASP E C   1 
ATOM   8182  O  O   . ASP E  2  180 ? 80.132  15.447  -41.429  1.00 44.65  ? 336 ASP E O   1 
ATOM   8183  C  CB  . ASP E  2  180 ? 79.840  12.522  -39.664  1.00 61.42  ? 336 ASP E CB  1 
ATOM   8184  C  CG  . ASP E  2  180 ? 81.084  13.143  -39.069  1.00 63.45  ? 336 ASP E CG  1 
ATOM   8185  O  OD1 . ASP E  2  180 ? 81.852  13.799  -39.807  1.00 64.24  ? 336 ASP E OD1 1 
ATOM   8186  O  OD2 . ASP E  2  180 ? 81.298  12.961  -37.857  1.00 57.24  ? 336 ASP E OD2 1 
ATOM   8187  N  N   . TRP E  2  181 ? 78.577  15.205  -39.847  1.00 56.69  ? 337 TRP E N   1 
ATOM   8188  C  CA  . TRP E  2  181 ? 78.510  16.633  -39.604  1.00 62.41  ? 337 TRP E CA  1 
ATOM   8189  C  C   . TRP E  2  181 ? 79.581  17.044  -38.612  1.00 69.67  ? 337 TRP E C   1 
ATOM   8190  O  O   . TRP E  2  181 ? 79.397  18.001  -37.861  1.00 75.43  ? 337 TRP E O   1 
ATOM   8191  C  CB  . TRP E  2  181 ? 77.139  17.008  -39.048  1.00 62.53  ? 337 TRP E CB  1 
ATOM   8192  C  CG  . TRP E  2  181 ? 76.038  16.795  -40.007  1.00 53.33  ? 337 TRP E CG  1 
ATOM   8193  C  CD1 . TRP E  2  181 ? 75.521  15.608  -40.396  1.00 46.92  ? 337 TRP E CD1 1 
ATOM   8194  C  CD2 . TRP E  2  181 ? 75.357  17.802  -40.760  1.00 65.92  ? 337 TRP E CD2 1 
ATOM   8195  N  NE1 . TRP E  2  181 ? 74.556  15.802  -41.354  1.00 67.33  ? 337 TRP E NE1 1 
ATOM   8196  C  CE2 . TRP E  2  181 ? 74.436  17.144  -41.597  1.00 70.23  ? 337 TRP E CE2 1 
ATOM   8197  C  CE3 . TRP E  2  181 ? 75.438  19.200  -40.813  1.00 59.92  ? 337 TRP E CE3 1 
ATOM   8198  C  CZ2 . TRP E  2  181 ? 73.600  17.833  -42.479  1.00 66.31  ? 337 TRP E CZ2 1 
ATOM   8199  C  CZ3 . TRP E  2  181 ? 74.607  19.885  -41.689  1.00 56.79  ? 337 TRP E CZ3 1 
ATOM   8200  C  CH2 . TRP E  2  181 ? 73.701  19.200  -42.510  1.00 66.21  ? 337 TRP E CH2 1 
ATOM   8201  N  N   . GLU E  2  182 ? 80.704  16.334  -38.605  1.00 71.45  ? 338 GLU E N   1 
ATOM   8202  C  CA  . GLU E  2  182 ? 81.762  16.657  -37.656  1.00 65.32  ? 338 GLU E CA  1 
ATOM   8203  C  C   . GLU E  2  182 ? 83.172  16.495  -38.183  1.00 61.98  ? 338 GLU E C   1 
ATOM   8204  O  O   . GLU E  2  182 ? 84.073  16.111  -37.444  1.00 72.55  ? 338 GLU E O   1 
ATOM   8205  C  CB  . GLU E  2  182 ? 81.593  15.813  -36.393  1.00 69.58  ? 338 GLU E CB  1 
ATOM   8206  C  CG  . GLU E  2  182 ? 80.286  16.060  -35.669  1.00 80.58  ? 338 GLU E CG  1 
ATOM   8207  C  CD  . GLU E  2  182 ? 80.017  15.024  -34.605  1.00 99.59  ? 338 GLU E CD  1 
ATOM   8208  O  OE1 . GLU E  2  182 ? 79.596  13.897  -34.956  1.00 111.47 ? 338 GLU E OE1 1 
ATOM   8209  O  OE2 . GLU E  2  182 ? 80.239  15.332  -33.415  1.00 107.37 ? 338 GLU E OE2 1 
ATOM   8210  N  N   . GLY E  2  183 ? 83.367  16.780  -39.460  1.00 53.69  ? 339 GLY E N   1 
ATOM   8211  C  CA  . GLY E  2  183 ? 84.696  16.680  -40.030  1.00 57.21  ? 339 GLY E CA  1 
ATOM   8212  C  C   . GLY E  2  183 ? 85.291  15.299  -40.230  1.00 66.33  ? 339 GLY E C   1 
ATOM   8213  O  O   . GLY E  2  183 ? 86.487  15.184  -40.488  1.00 77.26  ? 339 GLY E O   1 
ATOM   8214  N  N   . SER E  2  184 ? 84.477  14.252  -40.118  1.00 59.09  ? 340 SER E N   1 
ATOM   8215  C  CA  . SER E  2  184 ? 84.965  12.891  -40.307  1.00 57.63  ? 340 SER E CA  1 
ATOM   8216  C  C   . SER E  2  184 ? 84.398  12.317  -41.608  1.00 61.57  ? 340 SER E C   1 
ATOM   8217  O  O   . SER E  2  184 ? 83.300  12.689  -42.036  1.00 52.30  ? 340 SER E O   1 
ATOM   8218  C  CB  . SER E  2  184 ? 84.545  12.011  -39.124  1.00 66.92  ? 340 SER E CB  1 
ATOM   8219  O  OG  . SER E  2  184 ? 84.941  12.582  -37.887  1.00 78.61  ? 340 SER E OG  1 
ATOM   8220  N  N   . SER E  2  185 ? 85.134  11.404  -42.234  1.00 55.86  ? 341 SER E N   1 
ATOM   8221  C  CA  . SER E  2  185 ? 84.663  10.820  -43.478  1.00 54.61  ? 341 SER E CA  1 
ATOM   8222  C  C   . SER E  2  185 ? 85.148  9.402   -43.688  1.00 56.03  ? 341 SER E C   1 
ATOM   8223  O  O   . SER E  2  185 ? 86.313  9.097   -43.467  1.00 70.52  ? 341 SER E O   1 
ATOM   8224  C  CB  . SER E  2  185 ? 85.107  11.687  -44.659  1.00 47.20  ? 341 SER E CB  1 
ATOM   8225  O  OG  . SER E  2  185 ? 84.629  13.012  -44.519  1.00 55.68  ? 341 SER E OG  1 
ATOM   8226  N  N   . VAL E  2  186 ? 84.253  8.533   -44.130  1.00 52.96  ? 342 VAL E N   1 
ATOM   8227  C  CA  . VAL E  2  186 ? 84.627  7.157   -44.380  1.00 50.60  ? 342 VAL E CA  1 
ATOM   8228  C  C   . VAL E  2  186 ? 84.322  6.743   -45.817  1.00 58.98  ? 342 VAL E C   1 
ATOM   8229  O  O   . VAL E  2  186 ? 83.696  7.481   -46.571  1.00 54.53  ? 342 VAL E O   1 
ATOM   8230  C  CB  . VAL E  2  186 ? 83.922  6.214   -43.402  1.00 50.85  ? 342 VAL E CB  1 
ATOM   8231  C  CG1 . VAL E  2  186 ? 84.542  6.351   -42.038  1.00 25.36  ? 342 VAL E CG1 1 
ATOM   8232  C  CG2 . VAL E  2  186 ? 82.449  6.553   -43.328  1.00 70.05  ? 342 VAL E CG2 1 
ATOM   8233  N  N   . TYR E  2  187 ? 84.791  5.555   -46.184  1.00 73.22  ? 343 TYR E N   1 
ATOM   8234  C  CA  . TYR E  2  187 ? 84.614  5.004   -47.523  1.00 65.37  ? 343 TYR E CA  1 
ATOM   8235  C  C   . TYR E  2  187 ? 84.050  3.615   -47.369  1.00 58.05  ? 343 TYR E C   1 
ATOM   8236  O  O   . TYR E  2  187 ? 83.890  3.106   -46.265  1.00 54.43  ? 343 TYR E O   1 
ATOM   8237  C  CB  . TYR E  2  187 ? 85.964  4.891   -48.237  1.00 71.88  ? 343 TYR E CB  1 
ATOM   8238  C  CG  . TYR E  2  187 ? 86.872  6.053   -47.951  1.00 106.99 ? 343 TYR E CG  1 
ATOM   8239  C  CD1 . TYR E  2  187 ? 88.118  5.861   -47.345  1.00 113.85 ? 343 TYR E CD1 1 
ATOM   8240  C  CD2 . TYR E  2  187 ? 86.472  7.361   -48.253  1.00 118.11 ? 343 TYR E CD2 1 
ATOM   8241  C  CE1 . TYR E  2  187 ? 88.947  6.954   -47.043  1.00 126.94 ? 343 TYR E CE1 1 
ATOM   8242  C  CE2 . TYR E  2  187 ? 87.290  8.457   -47.959  1.00 125.90 ? 343 TYR E CE2 1 
ATOM   8243  C  CZ  . TYR E  2  187 ? 88.525  8.247   -47.355  1.00 127.95 ? 343 TYR E CZ  1 
ATOM   8244  O  OH  . TYR E  2  187 ? 89.333  9.324   -47.077  1.00 124.91 ? 343 TYR E OH  1 
ATOM   8245  N  N   . ALA E  2  188 ? 83.768  3.000   -48.498  1.00 54.69  ? 344 ALA E N   1 
ATOM   8246  C  CA  . ALA E  2  188 ? 83.251  1.657   -48.524  1.00 51.28  ? 344 ALA E CA  1 
ATOM   8247  C  C   . ALA E  2  188 ? 83.105  1.339   -49.986  1.00 55.71  ? 344 ALA E C   1 
ATOM   8248  O  O   . ALA E  2  188 ? 82.165  1.812   -50.619  1.00 62.56  ? 344 ALA E O   1 
ATOM   8249  C  CB  . ALA E  2  188 ? 81.912  1.601   -47.842  1.00 43.60  ? 344 ALA E CB  1 
ATOM   8250  N  N   . GLN E  2  189 ? 84.042  0.578   -50.542  1.00 47.71  ? 345 GLN E N   1 
ATOM   8251  C  CA  . GLN E  2  189 ? 83.921  0.238   -51.943  1.00 52.76  ? 345 GLN E CA  1 
ATOM   8252  C  C   . GLN E  2  189 ? 83.902  -1.248  -52.157  1.00 49.71  ? 345 GLN E C   1 
ATOM   8253  O  O   . GLN E  2  189 ? 84.466  -2.004  -51.369  1.00 57.71  ? 345 GLN E O   1 
ATOM   8254  C  CB  . GLN E  2  189 ? 85.023  0.895   -52.777  1.00 49.86  ? 345 GLN E CB  1 
ATOM   8255  C  CG  . GLN E  2  189 ? 86.404  0.757   -52.240  1.00 51.96  ? 345 GLN E CG  1 
ATOM   8256  C  CD  . GLN E  2  189 ? 87.377  1.636   -52.991  1.00 60.12  ? 345 GLN E CD  1 
ATOM   8257  O  OE1 . GLN E  2  189 ? 87.585  1.471   -54.191  1.00 62.83  ? 345 GLN E OE1 1 
ATOM   8258  N  NE2 . GLN E  2  189 ? 87.974  2.586   -52.288  1.00 74.35  ? 345 GLN E NE2 1 
ATOM   8259  N  N   . TYR E  2  190 ? 83.208  -1.657  -53.214  1.00 39.11  ? 346 TYR E N   1 
ATOM   8260  C  CA  . TYR E  2  190 ? 83.090  -3.055  -53.561  1.00 40.97  ? 346 TYR E CA  1 
ATOM   8261  C  C   . TYR E  2  190 ? 83.746  -3.214  -54.911  1.00 38.58  ? 346 TYR E C   1 
ATOM   8262  O  O   . TYR E  2  190 ? 83.503  -2.424  -55.821  1.00 46.87  ? 346 TYR E O   1 
ATOM   8263  C  CB  . TYR E  2  190 ? 81.614  -3.457  -53.579  1.00 36.56  ? 346 TYR E CB  1 
ATOM   8264  C  CG  . TYR E  2  190 ? 80.976  -3.331  -52.214  1.00 34.85  ? 346 TYR E CG  1 
ATOM   8265  C  CD1 . TYR E  2  190 ? 80.641  -4.462  -51.466  1.00 36.63  ? 346 TYR E CD1 1 
ATOM   8266  C  CD2 . TYR E  2  190 ? 80.771  -2.076  -51.635  1.00 34.36  ? 346 TYR E CD2 1 
ATOM   8267  C  CE1 . TYR E  2  190 ? 80.126  -4.344  -50.174  1.00 30.79  ? 346 TYR E CE1 1 
ATOM   8268  C  CE2 . TYR E  2  190 ? 80.254  -1.944  -50.352  1.00 23.84  ? 346 TYR E CE2 1 
ATOM   8269  C  CZ  . TYR E  2  190 ? 79.936  -3.081  -49.621  1.00 29.19  ? 346 TYR E CZ  1 
ATOM   8270  O  OH  . TYR E  2  190 ? 79.437  -2.962  -48.333  1.00 30.70  ? 346 TYR E OH  1 
ATOM   8271  N  N   . ALA E  2  191 ? 84.598  -4.223  -55.025  1.00 36.15  ? 347 ALA E N   1 
ATOM   8272  C  CA  . ALA E  2  191 ? 85.341  -4.442  -56.251  1.00 43.90  ? 347 ALA E CA  1 
ATOM   8273  C  C   . ALA E  2  191 ? 84.455  -4.742  -57.441  1.00 44.03  ? 347 ALA E C   1 
ATOM   8274  O  O   . ALA E  2  191 ? 84.875  -4.579  -58.578  1.00 49.35  ? 347 ALA E O   1 
ATOM   8275  C  CB  . ALA E  2  191 ? 86.351  -5.560  -56.045  1.00 54.98  ? 347 ALA E CB  1 
ATOM   8276  N  N   . SER E  2  192 ? 83.232  -5.181  -57.183  1.00 38.60  ? 348 SER E N   1 
ATOM   8277  C  CA  . SER E  2  192 ? 82.333  -5.496  -58.270  1.00 42.99  ? 348 SER E CA  1 
ATOM   8278  C  C   . SER E  2  192 ? 80.956  -4.929  -57.987  1.00 48.06  ? 348 SER E C   1 
ATOM   8279  O  O   . SER E  2  192 ? 80.411  -5.106  -56.886  1.00 36.35  ? 348 SER E O   1 
ATOM   8280  C  CB  . SER E  2  192 ? 82.254  -7.010  -58.466  1.00 37.56  ? 348 SER E CB  1 
ATOM   8281  O  OG  . SER E  2  192 ? 81.435  -7.345  -59.572  1.00 48.16  ? 348 SER E OG  1 
ATOM   8282  N  N   . PHE E  2  193 ? 80.411  -4.233  -58.986  1.00 35.07  ? 349 PHE E N   1 
ATOM   8283  C  CA  . PHE E  2  193 ? 79.095  -3.624  -58.890  1.00 32.80  ? 349 PHE E CA  1 
ATOM   8284  C  C   . PHE E  2  193 ? 78.300  -3.944  -60.147  1.00 28.63  ? 349 PHE E C   1 
ATOM   8285  O  O   . PHE E  2  193 ? 78.794  -3.782  -61.245  1.00 44.45  ? 349 PHE E O   1 
ATOM   8286  C  CB  . PHE E  2  193 ? 79.246  -2.110  -58.741  1.00 20.95  ? 349 PHE E CB  1 
ATOM   8287  C  CG  . PHE E  2  193 ? 77.948  -1.382  -58.543  1.00 37.33  ? 349 PHE E CG  1 
ATOM   8288  C  CD1 . PHE E  2  193 ? 77.310  -1.365  -57.297  1.00 42.02  ? 349 PHE E CD1 1 
ATOM   8289  C  CD2 . PHE E  2  193 ? 77.369  -0.689  -59.598  1.00 44.46  ? 349 PHE E CD2 1 
ATOM   8290  C  CE1 . PHE E  2  193 ? 76.116  -0.661  -57.106  1.00 37.94  ? 349 PHE E CE1 1 
ATOM   8291  C  CE2 . PHE E  2  193 ? 76.174  0.020   -59.419  1.00 51.03  ? 349 PHE E CE2 1 
ATOM   8292  C  CZ  . PHE E  2  193 ? 75.548  0.036   -58.173  1.00 30.36  ? 349 PHE E CZ  1 
ATOM   8293  N  N   . ARG E  2  194 ? 77.062  -4.386  -59.998  1.00 37.12  ? 350 ARG E N   1 
ATOM   8294  C  CA  . ARG E  2  194 ? 76.259  -4.704  -61.166  1.00 30.88  ? 350 ARG E CA  1 
ATOM   8295  C  C   . ARG E  2  194 ? 74.804  -4.972  -60.799  1.00 38.51  ? 350 ARG E C   1 
ATOM   8296  O  O   . ARG E  2  194 ? 74.528  -5.717  -59.861  1.00 46.84  ? 350 ARG E O   1 
ATOM   8297  C  CB  . ARG E  2  194 ? 76.846  -5.942  -61.857  1.00 42.16  ? 350 ARG E CB  1 
ATOM   8298  C  CG  . ARG E  2  194 ? 75.797  -6.976  -62.303  1.00 71.75  ? 350 ARG E CG  1 
ATOM   8299  C  CD  . ARG E  2  194 ? 76.388  -8.319  -62.738  1.00 57.57  ? 350 ARG E CD  1 
ATOM   8300  N  NE  . ARG E  2  194 ? 77.342  -8.181  -63.843  1.00 96.39  ? 350 ARG E NE  1 
ATOM   8301  C  CZ  . ARG E  2  194 ? 77.069  -7.622  -65.026  1.00 100.90 ? 350 ARG E CZ  1 
ATOM   8302  N  NH1 . ARG E  2  194 ? 75.856  -7.134  -65.270  1.00 105.99 ? 350 ARG E NH1 1 
ATOM   8303  N  NH2 . ARG E  2  194 ? 78.001  -7.569  -65.981  1.00 70.45  ? 350 ARG E NH2 1 
ATOM   8304  N  N   . PRO E  2  195 ? 73.854  -4.317  -61.490  1.00 29.29  ? 351 PRO E N   1 
ATOM   8305  C  CA  . PRO E  2  195 ? 72.454  -4.577  -61.173  1.00 38.74  ? 351 PRO E CA  1 
ATOM   8306  C  C   . PRO E  2  195 ? 71.814  -5.221  -62.409  1.00 41.87  ? 351 PRO E C   1 
ATOM   8307  O  O   . PRO E  2  195 ? 72.220  -4.941  -63.540  1.00 31.99  ? 351 PRO E O   1 
ATOM   8308  C  CB  . PRO E  2  195 ? 71.917  -3.187  -60.859  1.00 40.77  ? 351 PRO E CB  1 
ATOM   8309  C  CG  . PRO E  2  195 ? 72.558  -2.384  -61.871  1.00 49.39  ? 351 PRO E CG  1 
ATOM   8310  C  CD  . PRO E  2  195 ? 73.991  -2.939  -61.977  1.00 50.27  ? 351 PRO E CD  1 
ATOM   8311  N  N   . GLU E  2  196 ? 70.858  -6.122  -62.198  1.00 47.08  ? 352 GLU E N   1 
ATOM   8312  C  CA  . GLU E  2  196 ? 70.188  -6.772  -63.313  1.00 43.39  ? 352 GLU E CA  1 
ATOM   8313  C  C   . GLU E  2  196 ? 69.238  -5.757  -63.963  1.00 40.93  ? 352 GLU E C   1 
ATOM   8314  O  O   . GLU E  2  196 ? 69.078  -4.647  -63.466  1.00 53.77  ? 352 GLU E O   1 
ATOM   8315  C  CB  . GLU E  2  196 ? 69.421  -8.003  -62.813  1.00 52.82  ? 352 GLU E CB  1 
ATOM   8316  C  CG  . GLU E  2  196 ? 69.881  -9.335  -63.437  1.00 89.31  ? 352 GLU E CG  1 
ATOM   8317  C  CD  . GLU E  2  196 ? 69.629  -9.452  -64.975  1.00 97.81  ? 352 GLU E CD  1 
ATOM   8318  O  OE1 . GLU E  2  196 ? 70.162  -8.642  -65.775  1.00 79.20  ? 352 GLU E OE1 1 
ATOM   8319  O  OE2 . GLU E  2  196 ? 68.896  -10.381 -65.389  1.00 104.17 ? 352 GLU E OE2 1 
ATOM   8320  N  N   . ASN E  2  197 ? 68.619  -6.125  -65.076  1.00 37.17  ? 353 ASN E N   1 
ATOM   8321  C  CA  . ASN E  2  197 ? 67.692  -5.237  -65.772  1.00 36.97  ? 353 ASN E CA  1 
ATOM   8322  C  C   . ASN E  2  197 ? 66.404  -4.902  -64.989  1.00 35.16  ? 353 ASN E C   1 
ATOM   8323  O  O   . ASN E  2  197 ? 66.104  -5.499  -63.957  1.00 36.18  ? 353 ASN E O   1 
ATOM   8324  C  CB  . ASN E  2  197 ? 67.327  -5.849  -67.122  1.00 46.68  ? 353 ASN E CB  1 
ATOM   8325  C  CG  . ASN E  2  197 ? 66.693  -7.209  -66.988  1.00 47.38  ? 353 ASN E CG  1 
ATOM   8326  O  OD1 . ASN E  2  197 ? 65.647  -7.359  -66.360  1.00 48.69  ? 353 ASN E OD1 1 
ATOM   8327  N  ND2 . ASN E  2  197 ? 67.324  -8.212  -67.576  1.00 46.29  ? 353 ASN E ND2 1 
ATOM   8328  N  N   . GLU E  2  198 ? 65.646  -3.938  -65.491  1.00 30.59  ? 354 GLU E N   1 
ATOM   8329  C  CA  . GLU E  2  198 ? 64.423  -3.522  -64.839  1.00 29.29  ? 354 GLU E CA  1 
ATOM   8330  C  C   . GLU E  2  198 ? 63.486  -4.684  -64.604  1.00 27.02  ? 354 GLU E C   1 
ATOM   8331  O  O   . GLU E  2  198 ? 62.888  -4.804  -63.547  1.00 33.99  ? 354 GLU E O   1 
ATOM   8332  C  CB  . GLU E  2  198 ? 63.719  -2.445  -65.667  1.00 26.59  ? 354 GLU E CB  1 
ATOM   8333  C  CG  . GLU E  2  198 ? 62.301  -2.146  -65.203  1.00 36.81  ? 354 GLU E CG  1 
ATOM   8334  C  CD  . GLU E  2  198 ? 61.733  -0.880  -65.812  1.00 51.12  ? 354 GLU E CD  1 
ATOM   8335  O  OE1 . GLU E  2  198 ? 62.126  -0.535  -66.952  1.00 37.69  ? 354 GLU E OE1 1 
ATOM   8336  O  OE2 . GLU E  2  198 ? 60.881  -0.241  -65.153  1.00 48.45  ? 354 GLU E OE2 1 
ATOM   8337  N  N   . ALA E  2  199 ? 63.348  -5.543  -65.597  1.00 40.33  ? 355 ALA E N   1 
ATOM   8338  C  CA  . ALA E  2  199 ? 62.466  -6.693  -65.467  1.00 46.38  ? 355 ALA E CA  1 
ATOM   8339  C  C   . ALA E  2  199 ? 62.800  -7.425  -64.170  1.00 48.08  ? 355 ALA E C   1 
ATOM   8340  O  O   . ALA E  2  199 ? 61.957  -8.097  -63.579  1.00 57.33  ? 355 ALA E O   1 
ATOM   8341  C  CB  . ALA E  2  199 ? 62.644  -7.627  -66.665  1.00 37.27  ? 355 ALA E CB  1 
ATOM   8342  N  N   . GLN E  2  200 ? 64.039  -7.282  -63.727  1.00 44.96  ? 356 GLN E N   1 
ATOM   8343  C  CA  . GLN E  2  200 ? 64.475  -7.931  -62.520  1.00 23.68  ? 356 GLN E CA  1 
ATOM   8344  C  C   . GLN E  2  200 ? 64.599  -6.949  -61.376  1.00 43.27  ? 356 GLN E C   1 
ATOM   8345  O  O   . GLN E  2  200 ? 65.338  -7.182  -60.418  1.00 57.25  ? 356 GLN E O   1 
ATOM   8346  C  CB  . GLN E  2  200 ? 65.797  -8.626  -62.777  1.00 36.65  ? 356 GLN E CB  1 
ATOM   8347  C  CG  . GLN E  2  200 ? 65.642  -9.815  -63.686  1.00 40.92  ? 356 GLN E CG  1 
ATOM   8348  C  CD  . GLN E  2  200 ? 64.689  -10.859 -63.101  1.00 39.88  ? 356 GLN E CD  1 
ATOM   8349  O  OE1 . GLN E  2  200 ? 63.997  -11.564 -63.831  1.00 43.95  ? 356 GLN E OE1 1 
ATOM   8350  N  NE2 . GLN E  2  200 ? 64.663  -10.961 -61.781  1.00 27.26  ? 356 GLN E NE2 1 
ATOM   8351  N  N   . GLY E  2  201 ? 63.866  -5.846  -61.471  1.00 34.23  ? 357 GLY E N   1 
ATOM   8352  C  CA  . GLY E  2  201 ? 63.902  -4.853  -60.410  1.00 32.04  ? 357 GLY E CA  1 
ATOM   8353  C  C   . GLY E  2  201 ? 65.284  -4.271  -60.178  1.00 38.61  ? 357 GLY E C   1 
ATOM   8354  O  O   . GLY E  2  201 ? 65.620  -3.859  -59.069  1.00 24.42  ? 357 GLY E O   1 
ATOM   8355  N  N   . TYR E  2  202 ? 66.092  -4.235  -61.231  1.00 35.10  ? 358 TYR E N   1 
ATOM   8356  C  CA  . TYR E  2  202 ? 67.429  -3.693  -61.111  1.00 28.33  ? 358 TYR E CA  1 
ATOM   8357  C  C   . TYR E  2  202 ? 68.127  -4.286  -59.898  1.00 29.83  ? 358 TYR E C   1 
ATOM   8358  O  O   . TYR E  2  202 ? 68.818  -3.584  -59.178  1.00 26.09  ? 358 TYR E O   1 
ATOM   8359  C  CB  . TYR E  2  202 ? 67.348  -2.174  -60.989  1.00 31.59  ? 358 TYR E CB  1 
ATOM   8360  C  CG  . TYR E  2  202 ? 66.825  -1.487  -62.232  1.00 42.54  ? 358 TYR E CG  1 
ATOM   8361  C  CD1 . TYR E  2  202 ? 67.522  -1.552  -63.436  1.00 34.01  ? 358 TYR E CD1 1 
ATOM   8362  C  CD2 . TYR E  2  202 ? 65.632  -0.773  -62.210  1.00 51.85  ? 358 TYR E CD2 1 
ATOM   8363  C  CE1 . TYR E  2  202 ? 67.041  -0.925  -64.583  1.00 38.99  ? 358 TYR E CE1 1 
ATOM   8364  C  CE2 . TYR E  2  202 ? 65.146  -0.140  -63.365  1.00 39.10  ? 358 TYR E CE2 1 
ATOM   8365  C  CZ  . TYR E  2  202 ? 65.856  -0.226  -64.539  1.00 31.13  ? 358 TYR E CZ  1 
ATOM   8366  O  OH  . TYR E  2  202 ? 65.379  0.359   -65.682  1.00 36.68  ? 358 TYR E OH  1 
ATOM   8367  N  N   . ARG E  2  203 ? 67.947  -5.588  -59.681  1.00 35.18  ? 359 ARG E N   1 
ATOM   8368  C  CA  . ARG E  2  203 ? 68.567  -6.258  -58.542  1.00 37.88  ? 359 ARG E CA  1 
ATOM   8369  C  C   . ARG E  2  203 ? 70.063  -5.946  -58.404  1.00 34.11  ? 359 ARG E C   1 
ATOM   8370  O  O   . ARG E  2  203 ? 70.832  -6.085  -59.354  1.00 22.56  ? 359 ARG E O   1 
ATOM   8371  C  CB  . ARG E  2  203 ? 68.364  -7.780  -58.633  1.00 40.37  ? 359 ARG E CB  1 
ATOM   8372  C  CG  . ARG E  2  203 ? 68.959  -8.553  -57.439  1.00 43.38  ? 359 ARG E CG  1 
ATOM   8373  C  CD  . ARG E  2  203 ? 68.668  -10.043 -57.454  1.00 39.16  ? 359 ARG E CD  1 
ATOM   8374  N  NE  . ARG E  2  203 ? 67.235  -10.339 -57.434  1.00 34.70  ? 359 ARG E NE  1 
ATOM   8375  C  CZ  . ARG E  2  203 ? 66.521  -10.569 -58.532  1.00 37.20  ? 359 ARG E CZ  1 
ATOM   8376  N  NH1 . ARG E  2  203 ? 67.120  -10.530 -59.722  1.00 32.52  ? 359 ARG E NH1 1 
ATOM   8377  N  NH2 . ARG E  2  203 ? 65.223  -10.846 -58.451  1.00 33.81  ? 359 ARG E NH2 1 
ATOM   8378  N  N   . LEU E  2  204 ? 70.464  -5.529  -57.208  1.00 22.87  ? 360 LEU E N   1 
ATOM   8379  C  CA  . LEU E  2  204 ? 71.857  -5.190  -56.922  1.00 25.00  ? 360 LEU E CA  1 
ATOM   8380  C  C   . LEU E  2  204 ? 72.760  -6.422  -56.743  1.00 31.91  ? 360 LEU E C   1 
ATOM   8381  O  O   . LEU E  2  204 ? 72.319  -7.470  -56.275  1.00 30.17  ? 360 LEU E O   1 
ATOM   8382  C  CB  . LEU E  2  204 ? 71.884  -4.328  -55.658  1.00 18.98  ? 360 LEU E CB  1 
ATOM   8383  C  CG  . LEU E  2  204 ? 73.186  -4.034  -54.919  1.00 26.54  ? 360 LEU E CG  1 
ATOM   8384  C  CD1 . LEU E  2  204 ? 74.142  -3.310  -55.811  1.00 14.61  ? 360 LEU E CD1 1 
ATOM   8385  C  CD2 . LEU E  2  204 ? 72.882  -3.183  -53.693  1.00 32.01  ? 360 LEU E CD2 1 
ATOM   8386  N  N   . TRP E  2  205 ? 74.029  -6.291  -57.114  1.00 33.45  ? 361 TRP E N   1 
ATOM   8387  C  CA  . TRP E  2  205 ? 75.002  -7.378  -56.973  1.00 27.60  ? 361 TRP E CA  1 
ATOM   8388  C  C   . TRP E  2  205 ? 76.414  -6.819  -56.747  1.00 31.78  ? 361 TRP E C   1 
ATOM   8389  O  O   . TRP E  2  205 ? 77.141  -6.524  -57.700  1.00 38.49  ? 361 TRP E O   1 
ATOM   8390  C  CB  . TRP E  2  205 ? 75.021  -8.256  -58.230  1.00 30.26  ? 361 TRP E CB  1 
ATOM   8391  C  CG  . TRP E  2  205 ? 73.883  -9.194  -58.373  1.00 29.93  ? 361 TRP E CG  1 
ATOM   8392  C  CD1 . TRP E  2  205 ? 73.058  -9.320  -59.454  1.00 40.00  ? 361 TRP E CD1 1 
ATOM   8393  C  CD2 . TRP E  2  205 ? 73.442  -10.162 -57.416  1.00 39.41  ? 361 TRP E CD2 1 
ATOM   8394  N  NE1 . TRP E  2  205 ? 72.123  -10.307 -59.229  1.00 48.61  ? 361 TRP E NE1 1 
ATOM   8395  C  CE2 . TRP E  2  205 ? 72.336  -10.840 -57.985  1.00 42.88  ? 361 TRP E CE2 1 
ATOM   8396  C  CE3 . TRP E  2  205 ? 73.869  -10.522 -56.132  1.00 26.20  ? 361 TRP E CE3 1 
ATOM   8397  C  CZ2 . TRP E  2  205 ? 71.652  -11.855 -57.313  1.00 33.32  ? 361 TRP E CZ2 1 
ATOM   8398  C  CZ3 . TRP E  2  205 ? 73.187  -11.532 -55.462  1.00 27.01  ? 361 TRP E CZ3 1 
ATOM   8399  C  CH2 . TRP E  2  205 ? 72.090  -12.185 -56.055  1.00 34.58  ? 361 TRP E CH2 1 
ATOM   8400  N  N   . VAL E  2  206 ? 76.815  -6.675  -55.492  1.00 43.79  ? 362 VAL E N   1 
ATOM   8401  C  CA  . VAL E  2  206 ? 78.150  -6.157  -55.210  1.00 47.36  ? 362 VAL E CA  1 
ATOM   8402  C  C   . VAL E  2  206 ? 79.076  -7.270  -54.739  1.00 51.38  ? 362 VAL E C   1 
ATOM   8403  O  O   . VAL E  2  206 ? 78.630  -8.377  -54.419  1.00 51.71  ? 362 VAL E O   1 
ATOM   8404  C  CB  . VAL E  2  206 ? 78.116  -5.077  -54.127  1.00 48.61  ? 362 VAL E CB  1 
ATOM   8405  C  CG1 . VAL E  2  206 ? 77.205  -3.951  -54.549  1.00 47.31  ? 362 VAL E CG1 1 
ATOM   8406  C  CG2 . VAL E  2  206 ? 77.646  -5.677  -52.821  1.00 35.53  ? 362 VAL E CG2 1 
ATOM   8407  N  N   . GLU E  2  207 ? 80.370  -6.971  -54.695  1.00 60.49  ? 363 GLU E N   1 
ATOM   8408  C  CA  . GLU E  2  207 ? 81.350  -7.950  -54.248  1.00 60.51  ? 363 GLU E CA  1 
ATOM   8409  C  C   . GLU E  2  207 ? 82.686  -7.364  -53.765  1.00 53.51  ? 363 GLU E C   1 
ATOM   8410  O  O   . GLU E  2  207 ? 83.210  -6.394  -54.319  1.00 45.68  ? 363 GLU E O   1 
ATOM   8411  C  CB  . GLU E  2  207 ? 81.598  -8.986  -55.357  1.00 58.64  ? 363 GLU E CB  1 
ATOM   8412  C  CG  . GLU E  2  207 ? 82.558  -10.098 -54.940  1.00 100.12 ? 363 GLU E CG  1 
ATOM   8413  C  CD  . GLU E  2  207 ? 82.309  -10.591 -53.506  1.00 116.74 ? 363 GLU E CD  1 
ATOM   8414  O  OE1 . GLU E  2  207 ? 81.161  -10.988 -53.200  1.00 132.65 ? 363 GLU E OE1 1 
ATOM   8415  O  OE2 . GLU E  2  207 ? 83.257  -10.584 -52.682  1.00 111.33 ? 363 GLU E OE2 1 
ATOM   8416  N  N   . ASP E  2  208 ? 83.215  -7.967  -52.707  1.00 50.22  ? 364 ASP E N   1 
ATOM   8417  C  CA  . ASP E  2  208 ? 84.496  -7.590  -52.124  1.00 51.55  ? 364 ASP E CA  1 
ATOM   8418  C  C   . ASP E  2  208 ? 84.533  -6.237  -51.446  1.00 47.38  ? 364 ASP E C   1 
ATOM   8419  O  O   . ASP E  2  208 ? 84.929  -5.238  -52.047  1.00 47.16  ? 364 ASP E O   1 
ATOM   8420  C  CB  . ASP E  2  208 ? 85.605  -7.654  -53.180  1.00 53.83  ? 364 ASP E CB  1 
ATOM   8421  C  CG  . ASP E  2  208 ? 85.770  -9.043  -53.774  1.00 65.86  ? 364 ASP E CG  1 
ATOM   8422  O  OD1 . ASP E  2  208 ? 85.808  -10.029 -53.003  1.00 69.14  ? 364 ASP E OD1 1 
ATOM   8423  O  OD2 . ASP E  2  208 ? 85.867  -9.150  -55.016  1.00 72.85  ? 364 ASP E OD2 1 
ATOM   8424  N  N   . TYR E  2  209 ? 84.138  -6.213  -50.181  1.00 46.89  ? 365 TYR E N   1 
ATOM   8425  C  CA  . TYR E  2  209 ? 84.143  -4.975  -49.412  1.00 49.09  ? 365 TYR E CA  1 
ATOM   8426  C  C   . TYR E  2  209 ? 85.545  -4.596  -48.976  1.00 44.83  ? 365 TYR E C   1 
ATOM   8427  O  O   . TYR E  2  209 ? 86.467  -5.398  -49.006  1.00 51.85  ? 365 TYR E O   1 
ATOM   8428  C  CB  . TYR E  2  209 ? 83.269  -5.113  -48.169  1.00 42.75  ? 365 TYR E CB  1 
ATOM   8429  C  CG  . TYR E  2  209 ? 83.453  -4.001  -47.166  1.00 56.59  ? 365 TYR E CG  1 
ATOM   8430  C  CD1 . TYR E  2  209 ? 82.852  -2.767  -47.345  1.00 63.71  ? 365 TYR E CD1 1 
ATOM   8431  C  CD2 . TYR E  2  209 ? 84.230  -4.187  -46.038  1.00 60.07  ? 365 TYR E CD2 1 
ATOM   8432  C  CE1 . TYR E  2  209 ? 83.017  -1.749  -46.414  1.00 72.80  ? 365 TYR E CE1 1 
ATOM   8433  C  CE2 . TYR E  2  209 ? 84.403  -3.178  -45.108  1.00 65.91  ? 365 TYR E CE2 1 
ATOM   8434  C  CZ  . TYR E  2  209 ? 83.797  -1.964  -45.291  1.00 64.92  ? 365 TYR E CZ  1 
ATOM   8435  O  OH  . TYR E  2  209 ? 83.964  -0.978  -44.331  1.00 63.53  ? 365 TYR E OH  1 
ATOM   8436  N  N   . SER E  2  210 ? 85.684  -3.357  -48.552  1.00 52.13  ? 366 SER E N   1 
ATOM   8437  C  CA  . SER E  2  210 ? 86.948  -2.831  -48.084  1.00 61.37  ? 366 SER E CA  1 
ATOM   8438  C  C   . SER E  2  210 ? 86.642  -1.383  -47.772  1.00 62.08  ? 366 SER E C   1 
ATOM   8439  O  O   . SER E  2  210 ? 85.785  -0.778  -48.418  1.00 63.79  ? 366 SER E O   1 
ATOM   8440  C  CB  . SER E  2  210 ? 88.012  -2.925  -49.174  1.00 49.83  ? 366 SER E CB  1 
ATOM   8441  O  OG  . SER E  2  210 ? 87.653  -2.131  -50.280  1.00 61.43  ? 366 SER E OG  1 
ATOM   8442  N  N   . GLY E  2  211 ? 87.329  -0.834  -46.780  1.00 58.01  ? 367 GLY E N   1 
ATOM   8443  C  CA  . GLY E  2  211 ? 87.083  0.541   -46.399  1.00 55.29  ? 367 GLY E CA  1 
ATOM   8444  C  C   . GLY E  2  211 ? 86.857  0.642   -44.905  1.00 61.07  ? 367 GLY E C   1 
ATOM   8445  O  O   . GLY E  2  211 ? 87.000  -0.340  -44.172  1.00 64.31  ? 367 GLY E O   1 
ATOM   8446  N  N   . ASN E  2  212 ? 86.478  1.829   -44.450  1.00 60.27  ? 368 ASN E N   1 
ATOM   8447  C  CA  . ASN E  2  212 ? 86.264  2.057   -43.028  1.00 47.63  ? 368 ASN E CA  1 
ATOM   8448  C  C   . ASN E  2  212 ? 84.844  2.447   -42.647  1.00 45.15  ? 368 ASN E C   1 
ATOM   8449  O  O   . ASN E  2  212 ? 84.590  2.761   -41.492  1.00 41.18  ? 368 ASN E O   1 
ATOM   8450  C  CB  . ASN E  2  212 ? 87.221  3.142   -42.547  1.00 46.65  ? 368 ASN E CB  1 
ATOM   8451  C  CG  . ASN E  2  212 ? 87.146  4.377   -43.390  1.00 51.31  ? 368 ASN E CG  1 
ATOM   8452  O  OD1 . ASN E  2  212 ? 86.160  4.592   -44.086  1.00 71.16  ? 368 ASN E OD1 1 
ATOM   8453  N  ND2 . ASN E  2  212 ? 88.174  5.205   -43.331  1.00 52.29  ? 368 ASN E ND2 1 
ATOM   8454  N  N   . ALA E  2  213 ? 83.919  2.441   -43.601  1.00 48.99  ? 369 ALA E N   1 
ATOM   8455  C  CA  . ALA E  2  213 ? 82.547  2.809   -43.291  1.00 41.87  ? 369 ALA E CA  1 
ATOM   8456  C  C   . ALA E  2  213 ? 81.748  1.624   -42.763  1.00 37.48  ? 369 ALA E C   1 
ATOM   8457  O  O   . ALA E  2  213 ? 80.864  1.798   -41.930  1.00 43.58  ? 369 ALA E O   1 
ATOM   8458  C  CB  . ALA E  2  213 ? 81.875  3.396   -44.515  1.00 30.13  ? 369 ALA E CB  1 
ATOM   8459  N  N   . GLY E  2  214 ? 82.059  0.424   -43.247  1.00 35.79  ? 370 GLY E N   1 
ATOM   8460  C  CA  . GLY E  2  214 ? 81.346  -0.765  -42.803  1.00 47.25  ? 370 GLY E CA  1 
ATOM   8461  C  C   . GLY E  2  214 ? 80.623  -1.478  -43.932  1.00 48.45  ? 370 GLY E C   1 
ATOM   8462  O  O   . GLY E  2  214 ? 79.804  -0.875  -44.617  1.00 51.64  ? 370 GLY E O   1 
ATOM   8463  N  N   . ASN E  2  215 ? 80.932  -2.757  -44.129  1.00 44.01  ? 371 ASN E N   1 
ATOM   8464  C  CA  . ASN E  2  215 ? 80.318  -3.554  -45.181  1.00 48.67  ? 371 ASN E CA  1 
ATOM   8465  C  C   . ASN E  2  215 ? 78.806  -3.649  -45.014  1.00 53.03  ? 371 ASN E C   1 
ATOM   8466  O  O   . ASN E  2  215 ? 78.261  -4.723  -44.778  1.00 62.46  ? 371 ASN E O   1 
ATOM   8467  C  CB  . ASN E  2  215 ? 80.916  -4.953  -45.170  1.00 55.79  ? 371 ASN E CB  1 
ATOM   8468  C  CG  . ASN E  2  215 ? 80.431  -5.803  -46.314  1.00 56.66  ? 371 ASN E CG  1 
ATOM   8469  O  OD1 . ASN E  2  215 ? 79.244  -5.854  -46.620  1.00 66.01  ? 371 ASN E OD1 1 
ATOM   8470  N  ND2 . ASN E  2  215 ? 81.354  -6.495  -46.944  1.00 77.41  ? 371 ASN E ND2 1 
ATOM   8471  N  N   . ALA E  2  216 ? 78.120  -2.525  -45.157  1.00 53.23  ? 372 ALA E N   1 
ATOM   8472  C  CA  . ALA E  2  216 ? 76.674  -2.502  -45.007  1.00 47.45  ? 372 ALA E CA  1 
ATOM   8473  C  C   . ALA E  2  216 ? 75.941  -3.254  -46.107  1.00 43.81  ? 372 ALA E C   1 
ATOM   8474  O  O   . ALA E  2  216 ? 74.895  -3.840  -45.872  1.00 42.94  ? 372 ALA E O   1 
ATOM   8475  C  CB  . ALA E  2  216 ? 76.190  -1.069  -44.963  1.00 18.10  ? 372 ALA E CB  1 
ATOM   8476  N  N   . LEU E  2  217 ? 76.496  -3.254  -47.309  1.00 37.88  ? 373 LEU E N   1 
ATOM   8477  C  CA  . LEU E  2  217 ? 75.814  -3.898  -48.417  1.00 39.02  ? 373 LEU E CA  1 
ATOM   8478  C  C   . LEU E  2  217 ? 75.652  -5.399  -48.369  1.00 38.98  ? 373 LEU E C   1 
ATOM   8479  O  O   . LEU E  2  217 ? 74.547  -5.907  -48.536  1.00 32.56  ? 373 LEU E O   1 
ATOM   8480  C  CB  . LEU E  2  217 ? 76.473  -3.524  -49.738  1.00 32.39  ? 373 LEU E CB  1 
ATOM   8481  C  CG  . LEU E  2  217 ? 76.431  -2.051  -50.153  1.00 35.78  ? 373 LEU E CG  1 
ATOM   8482  C  CD1 . LEU E  2  217 ? 76.796  -1.956  -51.638  1.00 15.32  ? 373 LEU E CD1 1 
ATOM   8483  C  CD2 . LEU E  2  217 ? 75.051  -1.456  -49.863  1.00 19.91  ? 373 LEU E CD2 1 
ATOM   8484  N  N   . LEU E  2  218 ? 76.738  -6.126  -48.170  1.00 40.62  ? 374 LEU E N   1 
ATOM   8485  C  CA  . LEU E  2  218 ? 76.605  -7.569  -48.140  1.00 46.52  ? 374 LEU E CA  1 
ATOM   8486  C  C   . LEU E  2  218 ? 76.813  -8.207  -46.788  1.00 52.08  ? 374 LEU E C   1 
ATOM   8487  O  O   . LEU E  2  218 ? 76.808  -9.432  -46.669  1.00 57.73  ? 374 LEU E O   1 
ATOM   8488  C  CB  . LEU E  2  218 ? 77.514  -8.207  -49.193  1.00 43.29  ? 374 LEU E CB  1 
ATOM   8489  C  CG  . LEU E  2  218 ? 78.965  -7.789  -49.294  1.00 33.00  ? 374 LEU E CG  1 
ATOM   8490  C  CD1 . LEU E  2  218 ? 79.752  -8.488  -48.194  1.00 57.91  ? 374 LEU E CD1 1 
ATOM   8491  C  CD2 . LEU E  2  218 ? 79.501  -8.175  -50.662  1.00 29.13  ? 374 LEU E CD2 1 
ATOM   8492  N  N   . GLU E  2  219 ? 76.951  -7.378  -45.760  1.00 59.98  ? 375 GLU E N   1 
ATOM   8493  C  CA  . GLU E  2  219 ? 77.141  -7.882  -44.412  1.00 55.53  ? 375 GLU E CA  1 
ATOM   8494  C  C   . GLU E  2  219 ? 76.051  -7.379  -43.492  1.00 43.48  ? 375 GLU E C   1 
ATOM   8495  O  O   . GLU E  2  219 ? 75.937  -7.838  -42.372  1.00 57.34  ? 375 GLU E O   1 
ATOM   8496  C  CB  . GLU E  2  219 ? 78.503  -7.450  -43.884  1.00 55.41  ? 375 GLU E CB  1 
ATOM   8497  C  CG  . GLU E  2  219 ? 79.172  -8.435  -42.941  1.00 59.04  ? 375 GLU E CG  1 
ATOM   8498  C  CD  . GLU E  2  219 ? 80.566  -7.983  -42.555  1.00 66.29  ? 375 GLU E CD  1 
ATOM   8499  O  OE1 . GLU E  2  219 ? 80.680  -7.165  -41.616  1.00 52.68  ? 375 GLU E OE1 1 
ATOM   8500  O  OE2 . GLU E  2  219 ? 81.543  -8.425  -43.209  1.00 69.44  ? 375 GLU E OE2 1 
ATOM   8501  N  N   . GLY E  2  220 ? 75.247  -6.439  -43.967  1.00 43.88  ? 376 GLY E N   1 
ATOM   8502  C  CA  . GLY E  2  220 ? 74.183  -5.893  -43.143  1.00 36.56  ? 376 GLY E CA  1 
ATOM   8503  C  C   . GLY E  2  220 ? 74.764  -5.091  -42.000  1.00 43.24  ? 376 GLY E C   1 
ATOM   8504  O  O   . GLY E  2  220 ? 75.982  -5.033  -41.852  1.00 46.17  ? 376 GLY E O   1 
ATOM   8505  N  N   . ALA E  2  221 ? 73.915  -4.466  -41.191  1.00 46.57  ? 377 ALA E N   1 
ATOM   8506  C  CA  . ALA E  2  221 ? 74.405  -3.678  -40.059  1.00 49.04  ? 377 ALA E CA  1 
ATOM   8507  C  C   . ALA E  2  221 ? 74.946  -4.628  -39.003  1.00 51.92  ? 377 ALA E C   1 
ATOM   8508  O  O   . ALA E  2  221 ? 74.183  -5.358  -38.377  1.00 53.53  ? 377 ALA E O   1 
ATOM   8509  C  CB  . ALA E  2  221 ? 73.290  -2.836  -39.477  1.00 36.83  ? 377 ALA E CB  1 
ATOM   8510  N  N   . THR E  2  222 ? 76.262  -4.612  -38.811  1.00 54.71  ? 378 THR E N   1 
ATOM   8511  C  CA  . THR E  2  222 ? 76.918  -5.485  -37.848  1.00 52.16  ? 378 THR E CA  1 
ATOM   8512  C  C   . THR E  2  222 ? 76.396  -5.315  -36.422  1.00 58.57  ? 378 THR E C   1 
ATOM   8513  O  O   . THR E  2  222 ? 76.518  -6.229  -35.605  1.00 74.38  ? 378 THR E O   1 
ATOM   8514  C  CB  . THR E  2  222 ? 78.441  -5.268  -37.847  1.00 45.52  ? 378 THR E CB  1 
ATOM   8515  O  OG1 . THR E  2  222 ? 78.732  -3.937  -37.417  1.00 47.92  ? 378 THR E OG1 1 
ATOM   8516  C  CG2 . THR E  2  222 ? 79.012  -5.483  -39.231  1.00 47.35  ? 378 THR E CG2 1 
ATOM   8517  N  N   . GLN E  2  223 ? 75.822  -4.153  -36.119  1.00 52.39  ? 379 GLN E N   1 
ATOM   8518  C  CA  . GLN E  2  223 ? 75.265  -3.904  -34.789  1.00 45.91  ? 379 GLN E CA  1 
ATOM   8519  C  C   . GLN E  2  223 ? 73.959  -4.662  -34.554  1.00 42.93  ? 379 GLN E C   1 
ATOM   8520  O  O   . GLN E  2  223 ? 73.291  -4.468  -33.546  1.00 49.04  ? 379 GLN E O   1 
ATOM   8521  C  CB  . GLN E  2  223 ? 75.014  -2.421  -34.579  1.00 46.22  ? 379 GLN E CB  1 
ATOM   8522  C  CG  . GLN E  2  223 ? 74.425  -1.747  -35.782  1.00 63.27  ? 379 GLN E CG  1 
ATOM   8523  C  CD  . GLN E  2  223 ? 73.886  -0.389  -35.462  1.00 63.15  ? 379 GLN E CD  1 
ATOM   8524  O  OE1 . GLN E  2  223 ? 72.847  -0.268  -34.805  1.00 40.61  ? 379 GLN E OE1 1 
ATOM   8525  N  NE2 . GLN E  2  223 ? 74.588  0.654   -35.916  1.00 59.27  ? 379 GLN E NE2 1 
ATOM   8526  N  N   . LEU E  2  224 ? 73.587  -5.511  -35.498  1.00 35.67  ? 380 LEU E N   1 
ATOM   8527  C  CA  . LEU E  2  224 ? 72.387  -6.313  -35.360  1.00 36.02  ? 380 LEU E CA  1 
ATOM   8528  C  C   . LEU E  2  224 ? 72.864  -7.756  -35.307  1.00 45.79  ? 380 LEU E C   1 
ATOM   8529  O  O   . LEU E  2  224 ? 73.891  -8.112  -35.906  1.00 47.16  ? 380 LEU E O   1 
ATOM   8530  C  CB  . LEU E  2  224 ? 71.445  -6.116  -36.552  1.00 43.62  ? 380 LEU E CB  1 
ATOM   8531  C  CG  . LEU E  2  224 ? 70.727  -4.774  -36.696  1.00 51.85  ? 380 LEU E CG  1 
ATOM   8532  C  CD1 . LEU E  2  224 ? 69.741  -4.851  -37.842  1.00 64.08  ? 380 LEU E CD1 1 
ATOM   8533  C  CD2 . LEU E  2  224 ? 69.986  -4.445  -35.433  1.00 39.18  ? 380 LEU E CD2 1 
ATOM   8534  N  N   . MET E  2  225 ? 72.127  -8.599  -34.599  1.00 39.42  ? 381 MET E N   1 
ATOM   8535  C  CA  . MET E  2  225 ? 72.539  -9.981  -34.489  1.00 47.66  ? 381 MET E CA  1 
ATOM   8536  C  C   . MET E  2  225 ? 71.524  -10.925 -35.090  1.00 53.88  ? 381 MET E C   1 
ATOM   8537  O  O   . MET E  2  225 ? 70.339  -10.606 -35.173  1.00 44.19  ? 381 MET E O   1 
ATOM   8538  C  CB  . MET E  2  225 ? 72.774  -10.352 -33.015  1.00 70.47  ? 381 MET E CB  1 
ATOM   8539  C  CG  . MET E  2  225 ? 73.848  -9.519  -32.309  1.00 88.37  ? 381 MET E CG  1 
ATOM   8540  S  SD  . MET E  2  225 ? 75.384  -9.373  -33.267  1.00 97.12  ? 381 MET E SD  1 
ATOM   8541  C  CE  . MET E  2  225 ? 75.770  -11.119 -33.523  1.00 93.15  ? 381 MET E CE  1 
ATOM   8542  N  N   . GLY E  2  226 ? 72.008  -12.091 -35.518  1.00 60.53  ? 382 GLY E N   1 
ATOM   8543  C  CA  . GLY E  2  226 ? 71.138  -13.109 -36.078  1.00 55.27  ? 382 GLY E CA  1 
ATOM   8544  C  C   . GLY E  2  226 ? 70.363  -12.662 -37.288  1.00 56.07  ? 382 GLY E C   1 
ATOM   8545  O  O   . GLY E  2  226 ? 70.870  -11.889 -38.094  1.00 58.48  ? 382 GLY E O   1 
ATOM   8546  N  N   . ASP E  2  227 ? 69.132  -13.146 -37.415  1.00 55.23  ? 383 ASP E N   1 
ATOM   8547  C  CA  . ASP E  2  227 ? 68.301  -12.792 -38.556  1.00 59.98  ? 383 ASP E CA  1 
ATOM   8548  C  C   . ASP E  2  227 ? 68.066  -11.299 -38.713  1.00 58.82  ? 383 ASP E C   1 
ATOM   8549  O  O   . ASP E  2  227 ? 67.822  -10.820 -39.816  1.00 68.55  ? 383 ASP E O   1 
ATOM   8550  C  CB  . ASP E  2  227 ? 66.964  -13.521 -38.493  1.00 59.95  ? 383 ASP E CB  1 
ATOM   8551  C  CG  . ASP E  2  227 ? 67.099  -14.980 -38.828  1.00 66.19  ? 383 ASP E CG  1 
ATOM   8552  O  OD1 . ASP E  2  227 ? 67.854  -15.292 -39.784  1.00 52.51  ? 383 ASP E OD1 1 
ATOM   8553  O  OD2 . ASP E  2  227 ? 66.446  -15.805 -38.149  1.00 65.57  ? 383 ASP E OD2 1 
ATOM   8554  N  N   . ASN E  2  228 ? 68.135  -10.565 -37.611  1.00 54.10  ? 384 ASN E N   1 
ATOM   8555  C  CA  . ASN E  2  228 ? 67.951  -9.130  -37.668  1.00 48.00  ? 384 ASN E CA  1 
ATOM   8556  C  C   . ASN E  2  228 ? 69.038  -8.563  -38.568  1.00 51.46  ? 384 ASN E C   1 
ATOM   8557  O  O   . ASN E  2  228 ? 68.786  -7.724  -39.440  1.00 51.09  ? 384 ASN E O   1 
ATOM   8558  C  CB  . ASN E  2  228 ? 68.071  -8.524  -36.267  1.00 56.83  ? 384 ASN E CB  1 
ATOM   8559  C  CG  . ASN E  2  228 ? 66.767  -8.563  -35.497  1.00 51.33  ? 384 ASN E CG  1 
ATOM   8560  O  OD1 . ASN E  2  228 ? 66.039  -9.555  -35.508  1.00 49.36  ? 384 ASN E OD1 1 
ATOM   8561  N  ND2 . ASN E  2  228 ? 66.480  -7.485  -34.802  1.00 62.69  ? 384 ASN E ND2 1 
ATOM   8562  N  N   . ARG E  2  229 ? 70.254  -9.045  -38.367  1.00 44.22  ? 385 ARG E N   1 
ATOM   8563  C  CA  . ARG E  2  229 ? 71.364  -8.557  -39.152  1.00 48.59  ? 385 ARG E CA  1 
ATOM   8564  C  C   . ARG E  2  229 ? 71.106  -8.907  -40.597  1.00 49.55  ? 385 ARG E C   1 
ATOM   8565  O  O   . ARG E  2  229 ? 70.994  -8.030  -41.438  1.00 50.27  ? 385 ARG E O   1 
ATOM   8566  C  CB  . ARG E  2  229 ? 72.688  -9.181  -38.682  1.00 35.57  ? 385 ARG E CB  1 
ATOM   8567  C  CG  . ARG E  2  229 ? 73.938  -8.360  -39.022  1.00 44.05  ? 385 ARG E CG  1 
ATOM   8568  C  CD  . ARG E  2  229 ? 75.128  -9.234  -39.321  1.00 43.72  ? 385 ARG E CD  1 
ATOM   8569  N  NE  . ARG E  2  229 ? 74.803  -10.154 -40.416  1.00 77.10  ? 385 ARG E NE  1 
ATOM   8570  C  CZ  . ARG E  2  229 ? 75.667  -10.966 -41.024  1.00 75.74  ? 385 ARG E CZ  1 
ATOM   8571  N  NH1 . ARG E  2  229 ? 76.947  -10.989 -40.657  1.00 62.26  ? 385 ARG E NH1 1 
ATOM   8572  N  NH2 . ARG E  2  229 ? 75.242  -11.759 -42.003  1.00 70.88  ? 385 ARG E NH2 1 
ATOM   8573  N  N   . THR E  2  230 ? 70.983  -10.198 -40.879  1.00 61.12  ? 386 THR E N   1 
ATOM   8574  C  CA  . THR E  2  230 ? 70.774  -10.648 -42.249  1.00 67.21  ? 386 THR E CA  1 
ATOM   8575  C  C   . THR E  2  230 ? 69.668  -9.912  -42.987  1.00 62.46  ? 386 THR E C   1 
ATOM   8576  O  O   . THR E  2  230 ? 69.738  -9.775  -44.210  1.00 62.96  ? 386 THR E O   1 
ATOM   8577  C  CB  . THR E  2  230 ? 70.500  -12.167 -42.326  1.00 60.15  ? 386 THR E CB  1 
ATOM   8578  O  OG1 . THR E  2  230 ? 69.392  -12.494 -41.487  1.00 73.81  ? 386 THR E OG1 1 
ATOM   8579  C  CG2 . THR E  2  230 ? 71.727  -12.953 -41.881  1.00 64.50  ? 386 THR E CG2 1 
ATOM   8580  N  N   . MET E  2  231 ? 68.661  -9.417  -42.271  1.00 49.67  ? 387 MET E N   1 
ATOM   8581  C  CA  . MET E  2  231 ? 67.591  -8.713  -42.966  1.00 41.78  ? 387 MET E CA  1 
ATOM   8582  C  C   . MET E  2  231 ? 67.887  -7.247  -43.293  1.00 40.93  ? 387 MET E C   1 
ATOM   8583  O  O   . MET E  2  231 ? 66.982  -6.470  -43.583  1.00 36.94  ? 387 MET E O   1 
ATOM   8584  C  CB  . MET E  2  231 ? 66.243  -8.864  -42.225  1.00 37.78  ? 387 MET E CB  1 
ATOM   8585  C  CG  . MET E  2  231 ? 66.152  -8.369  -40.814  1.00 31.82  ? 387 MET E CG  1 
ATOM   8586  S  SD  . MET E  2  231 ? 64.463  -8.540  -40.146  1.00 45.99  ? 387 MET E SD  1 
ATOM   8587  C  CE  . MET E  2  231 ? 64.253  -10.254 -40.168  1.00 51.26  ? 387 MET E CE  1 
ATOM   8588  N  N   . THR E  2  232 ? 69.168  -6.881  -43.256  1.00 38.97  ? 388 THR E N   1 
ATOM   8589  C  CA  . THR E  2  232 ? 69.600  -5.529  -43.605  1.00 28.72  ? 388 THR E CA  1 
ATOM   8590  C  C   . THR E  2  232 ? 70.693  -5.631  -44.660  1.00 31.07  ? 388 THR E C   1 
ATOM   8591  O  O   . THR E  2  232 ? 71.397  -4.672  -44.934  1.00 28.94  ? 388 THR E O   1 
ATOM   8592  C  CB  . THR E  2  232 ? 70.129  -4.712  -42.386  1.00 17.25  ? 388 THR E CB  1 
ATOM   8593  O  OG1 . THR E  2  232 ? 71.355  -5.257  -41.905  1.00 23.15  ? 388 THR E OG1 1 
ATOM   8594  C  CG2 . THR E  2  232 ? 69.114  -4.716  -41.285  1.00 22.93  ? 388 THR E CG2 1 
ATOM   8595  N  N   . ILE E  2  233 ? 70.828  -6.811  -45.254  1.00 34.43  ? 389 ILE E N   1 
ATOM   8596  C  CA  . ILE E  2  233 ? 71.819  -7.018  -46.296  1.00 32.77  ? 389 ILE E CA  1 
ATOM   8597  C  C   . ILE E  2  233 ? 71.144  -6.589  -47.596  1.00 45.55  ? 389 ILE E C   1 
ATOM   8598  O  O   . ILE E  2  233 ? 70.055  -7.062  -47.910  1.00 45.81  ? 389 ILE E O   1 
ATOM   8599  C  CB  . ILE E  2  233 ? 72.236  -8.502  -46.366  1.00 22.96  ? 389 ILE E CB  1 
ATOM   8600  C  CG1 . ILE E  2  233 ? 72.938  -8.891  -45.069  1.00 43.22  ? 389 ILE E CG1 1 
ATOM   8601  C  CG2 . ILE E  2  233 ? 73.168  -8.742  -47.538  1.00 16.69  ? 389 ILE E CG2 1 
ATOM   8602  C  CD1 . ILE E  2  233 ? 73.266  -10.351 -44.952  1.00 49.19  ? 389 ILE E CD1 1 
ATOM   8603  N  N   . HIS E  2  234 ? 71.781  -5.684  -48.339  1.00 45.35  ? 390 HIS E N   1 
ATOM   8604  C  CA  . HIS E  2  234 ? 71.230  -5.174  -49.597  1.00 26.34  ? 390 HIS E CA  1 
ATOM   8605  C  C   . HIS E  2  234 ? 71.604  -6.015  -50.796  1.00 35.33  ? 390 HIS E C   1 
ATOM   8606  O  O   . HIS E  2  234 ? 70.862  -6.078  -51.776  1.00 29.89  ? 390 HIS E O   1 
ATOM   8607  C  CB  . HIS E  2  234 ? 71.702  -3.739  -49.823  1.00 17.00  ? 390 HIS E CB  1 
ATOM   8608  C  CG  . HIS E  2  234 ? 71.272  -2.796  -48.741  1.00 28.48  ? 390 HIS E CG  1 
ATOM   8609  N  ND1 . HIS E  2  234 ? 69.960  -2.414  -48.572  1.00 9.98   ? 390 HIS E ND1 1 
ATOM   8610  C  CD2 . HIS E  2  234 ? 71.956  -2.250  -47.709  1.00 32.43  ? 390 HIS E CD2 1 
ATOM   8611  C  CE1 . HIS E  2  234 ? 69.850  -1.683  -47.482  1.00 22.95  ? 390 HIS E CE1 1 
ATOM   8612  N  NE2 . HIS E  2  234 ? 71.047  -1.569  -46.937  1.00 34.83  ? 390 HIS E NE2 1 
ATOM   8613  N  N   . ASN E  2  235 ? 72.759  -6.664  -50.722  1.00 39.55  ? 391 ASN E N   1 
ATOM   8614  C  CA  . ASN E  2  235 ? 73.209  -7.479  -51.827  1.00 28.13  ? 391 ASN E CA  1 
ATOM   8615  C  C   . ASN E  2  235 ? 72.117  -8.416  -52.308  1.00 24.99  ? 391 ASN E C   1 
ATOM   8616  O  O   . ASN E  2  235 ? 71.378  -9.002  -51.510  1.00 25.61  ? 391 ASN E O   1 
ATOM   8617  C  CB  . ASN E  2  235 ? 74.443  -8.271  -51.432  1.00 32.44  ? 391 ASN E CB  1 
ATOM   8618  C  CG  . ASN E  2  235 ? 74.988  -9.078  -52.577  1.00 40.91  ? 391 ASN E CG  1 
ATOM   8619  O  OD1 . ASN E  2  235 ? 75.405  -8.538  -53.613  1.00 36.22  ? 391 ASN E OD1 1 
ATOM   8620  N  ND2 . ASN E  2  235 ? 74.981  -10.386 -52.407  1.00 49.52  ? 391 ASN E ND2 1 
ATOM   8621  N  N   . GLY E  2  236 ? 72.011  -8.535  -53.626  1.00 35.17  ? 392 GLY E N   1 
ATOM   8622  C  CA  . GLY E  2  236 ? 71.015  -9.401  -54.231  1.00 28.48  ? 392 GLY E CA  1 
ATOM   8623  C  C   . GLY E  2  236 ? 69.585  -8.914  -54.132  1.00 32.53  ? 392 GLY E C   1 
ATOM   8624  O  O   . GLY E  2  236 ? 68.677  -9.591  -54.585  1.00 35.01  ? 392 GLY E O   1 
ATOM   8625  N  N   . MET E  2  237 ? 69.374  -7.744  -53.539  1.00 40.29  ? 393 MET E N   1 
ATOM   8626  C  CA  . MET E  2  237 ? 68.026  -7.213  -53.409  1.00 22.94  ? 393 MET E CA  1 
ATOM   8627  C  C   . MET E  2  237 ? 67.568  -6.503  -54.665  1.00 24.80  ? 393 MET E C   1 
ATOM   8628  O  O   . MET E  2  237 ? 68.363  -6.205  -55.558  1.00 29.97  ? 393 MET E O   1 
ATOM   8629  C  CB  . MET E  2  237 ? 67.941  -6.243  -52.235  1.00 24.68  ? 393 MET E CB  1 
ATOM   8630  C  CG  . MET E  2  237 ? 68.145  -6.866  -50.882  1.00 26.32  ? 393 MET E CG  1 
ATOM   8631  S  SD  . MET E  2  237 ? 67.171  -8.370  -50.608  1.00 43.54  ? 393 MET E SD  1 
ATOM   8632  C  CE  . MET E  2  237 ? 65.547  -7.881  -51.187  1.00 66.09  ? 393 MET E CE  1 
ATOM   8633  N  N   . GLN E  2  238 ? 66.269  -6.243  -54.736  1.00 29.93  ? 394 GLN E N   1 
ATOM   8634  C  CA  . GLN E  2  238 ? 65.695  -5.502  -55.857  1.00 23.62  ? 394 GLN E CA  1 
ATOM   8635  C  C   . GLN E  2  238 ? 65.412  -4.061  -55.428  1.00 35.49  ? 394 GLN E C   1 
ATOM   8636  O  O   . GLN E  2  238 ? 65.208  -3.757  -54.244  1.00 45.57  ? 394 GLN E O   1 
ATOM   8637  C  CB  . GLN E  2  238 ? 64.396  -6.134  -56.331  1.00 17.66  ? 394 GLN E CB  1 
ATOM   8638  C  CG  . GLN E  2  238 ? 64.600  -7.231  -57.368  1.00 43.27  ? 394 GLN E CG  1 
ATOM   8639  C  CD  . GLN E  2  238 ? 63.326  -8.001  -57.654  1.00 38.60  ? 394 GLN E CD  1 
ATOM   8640  O  OE1 . GLN E  2  238 ? 62.276  -7.417  -57.895  1.00 39.24  ? 394 GLN E OE1 1 
ATOM   8641  N  NE2 . GLN E  2  238 ? 63.413  -9.321  -57.612  1.00 62.95  ? 394 GLN E NE2 1 
ATOM   8642  N  N   . PHE E  2  239 ? 65.401  -3.169  -56.401  1.00 36.10  ? 395 PHE E N   1 
ATOM   8643  C  CA  . PHE E  2  239 ? 65.128  -1.777  -56.119  1.00 32.09  ? 395 PHE E CA  1 
ATOM   8644  C  C   . PHE E  2  239 ? 63.659  -1.621  -55.741  1.00 21.63  ? 395 PHE E C   1 
ATOM   8645  O  O   . PHE E  2  239 ? 62.793  -2.298  -56.273  1.00 28.34  ? 395 PHE E O   1 
ATOM   8646  C  CB  . PHE E  2  239 ? 65.471  -0.929  -57.337  1.00 21.85  ? 395 PHE E CB  1 
ATOM   8647  C  CG  . PHE E  2  239 ? 65.857  0.473   -56.989  1.00 39.88  ? 395 PHE E CG  1 
ATOM   8648  C  CD1 . PHE E  2  239 ? 64.895  1.461   -56.867  1.00 35.80  ? 395 PHE E CD1 1 
ATOM   8649  C  CD2 . PHE E  2  239 ? 67.186  0.798   -56.739  1.00 35.21  ? 395 PHE E CD2 1 
ATOM   8650  C  CE1 . PHE E  2  239 ? 65.252  2.755   -56.499  1.00 36.28  ? 395 PHE E CE1 1 
ATOM   8651  C  CE2 . PHE E  2  239 ? 67.550  2.090   -56.370  1.00 32.57  ? 395 PHE E CE2 1 
ATOM   8652  C  CZ  . PHE E  2  239 ? 66.582  3.068   -56.248  1.00 27.93  ? 395 PHE E CZ  1 
ATOM   8653  N  N   . SER E  2  240 ? 63.379  -0.755  -54.786  1.00 20.09  ? 396 SER E N   1 
ATOM   8654  C  CA  . SER E  2  240 ? 62.005  -0.559  -54.364  1.00 34.43  ? 396 SER E CA  1 
ATOM   8655  C  C   . SER E  2  240 ? 61.816  0.913   -54.212  1.00 39.30  ? 396 SER E C   1 
ATOM   8656  O  O   . SER E  2  240 ? 62.711  1.613   -53.744  1.00 38.84  ? 396 SER E O   1 
ATOM   8657  C  CB  . SER E  2  240 ? 61.729  -1.249  -53.025  1.00 30.60  ? 396 SER E CB  1 
ATOM   8658  O  OG  . SER E  2  240 ? 62.127  -2.609  -53.073  1.00 40.34  ? 396 SER E OG  1 
ATOM   8659  N  N   . THR E  2  241 ? 60.648  1.390   -54.617  1.00 41.63  ? 397 THR E N   1 
ATOM   8660  C  CA  . THR E  2  241 ? 60.371  2.804   -54.517  1.00 42.05  ? 397 THR E CA  1 
ATOM   8661  C  C   . THR E  2  241 ? 59.028  3.098   -53.917  1.00 42.74  ? 397 THR E C   1 
ATOM   8662  O  O   . THR E  2  241 ? 58.199  2.227   -53.706  1.00 42.26  ? 397 THR E O   1 
ATOM   8663  C  CB  . THR E  2  241 ? 60.363  3.505   -55.887  1.00 32.08  ? 397 THR E CB  1 
ATOM   8664  O  OG1 . THR E  2  241 ? 59.408  2.867   -56.730  1.00 37.79  ? 397 THR E OG1 1 
ATOM   8665  C  CG2 . THR E  2  241 ? 61.710  3.469   -56.541  1.00 29.75  ? 397 THR E CG2 1 
ATOM   8666  N  N   . PHE E  2  242 ? 58.865  4.380   -53.647  1.00 57.97  ? 398 PHE E N   1 
ATOM   8667  C  CA  . PHE E  2  242 ? 57.653  5.004   -53.148  1.00 58.43  ? 398 PHE E CA  1 
ATOM   8668  C  C   . PHE E  2  242 ? 56.439  4.168   -53.610  1.00 53.06  ? 398 PHE E C   1 
ATOM   8669  O  O   . PHE E  2  242 ? 55.679  3.637   -52.805  1.00 40.57  ? 398 PHE E O   1 
ATOM   8670  C  CB  . PHE E  2  242 ? 57.700  6.416   -53.764  1.00 73.20  ? 398 PHE E CB  1 
ATOM   8671  C  CG  . PHE E  2  242 ? 56.482  7.250   -53.588  1.00 68.82  ? 398 PHE E CG  1 
ATOM   8672  C  CD1 . PHE E  2  242 ? 56.078  7.665   -52.326  1.00 101.12 ? 398 PHE E CD1 1 
ATOM   8673  C  CD2 . PHE E  2  242 ? 55.821  7.743   -54.704  1.00 61.04  ? 398 PHE E CD2 1 
ATOM   8674  C  CE1 . PHE E  2  242 ? 55.031  8.576   -52.173  1.00 108.58 ? 398 PHE E CE1 1 
ATOM   8675  C  CE2 . PHE E  2  242 ? 54.785  8.643   -54.575  1.00 98.28  ? 398 PHE E CE2 1 
ATOM   8676  C  CZ  . PHE E  2  242 ? 54.383  9.068   -53.303  1.00 110.53 ? 398 PHE E CZ  1 
ATOM   8677  N  N   . ASP E  2  243 ? 56.318  4.006   -54.923  1.00 50.50  ? 399 ASP E N   1 
ATOM   8678  C  CA  . ASP E  2  243 ? 55.215  3.278   -55.535  1.00 41.97  ? 399 ASP E CA  1 
ATOM   8679  C  C   . ASP E  2  243 ? 55.554  1.878   -56.040  1.00 36.60  ? 399 ASP E C   1 
ATOM   8680  O  O   . ASP E  2  243 ? 54.893  1.371   -56.925  1.00 41.22  ? 399 ASP E O   1 
ATOM   8681  C  CB  . ASP E  2  243 ? 54.666  4.112   -56.701  1.00 47.00  ? 399 ASP E CB  1 
ATOM   8682  C  CG  . ASP E  2  243 ? 55.659  4.232   -57.869  1.00 47.26  ? 399 ASP E CG  1 
ATOM   8683  O  OD1 . ASP E  2  243 ? 56.880  4.313   -57.628  1.00 44.62  ? 399 ASP E OD1 1 
ATOM   8684  O  OD2 . ASP E  2  243 ? 55.219  4.262   -59.037  1.00 62.54  ? 399 ASP E OD2 1 
ATOM   8685  N  N   . ARG E  2  244 ? 56.585  1.244   -55.512  1.00 39.64  ? 400 ARG E N   1 
ATOM   8686  C  CA  . ARG E  2  244 ? 56.890  -0.098  -55.986  1.00 39.16  ? 400 ARG E CA  1 
ATOM   8687  C  C   . ARG E  2  244 ? 57.670  -0.913  -54.975  1.00 40.41  ? 400 ARG E C   1 
ATOM   8688  O  O   . ARG E  2  244 ? 58.897  -0.847  -54.927  1.00 45.74  ? 400 ARG E O   1 
ATOM   8689  C  CB  . ARG E  2  244 ? 57.663  -0.041  -57.292  1.00 36.51  ? 400 ARG E CB  1 
ATOM   8690  C  CG  . ARG E  2  244 ? 57.416  -1.227  -58.186  1.00 48.18  ? 400 ARG E CG  1 
ATOM   8691  C  CD  . ARG E  2  244 ? 56.540  -0.829  -59.353  1.00 46.20  ? 400 ARG E CD  1 
ATOM   8692  N  NE  . ARG E  2  244 ? 57.213  -1.088  -60.624  1.00 57.44  ? 400 ARG E NE  1 
ATOM   8693  C  CZ  . ARG E  2  244 ? 56.979  -0.411  -61.741  1.00 63.35  ? 400 ARG E CZ  1 
ATOM   8694  N  NH1 . ARG E  2  244 ? 56.085  0.575   -61.742  1.00 73.61  ? 400 ARG E NH1 1 
ATOM   8695  N  NH2 . ARG E  2  244 ? 57.635  -0.719  -62.853  1.00 46.67  ? 400 ARG E NH2 1 
ATOM   8696  N  N   . ASP E  2  245 ? 56.937  -1.684  -54.177  1.00 25.79  ? 401 ASP E N   1 
ATOM   8697  C  CA  . ASP E  2  245 ? 57.529  -2.522  -53.157  1.00 33.20  ? 401 ASP E CA  1 
ATOM   8698  C  C   . ASP E  2  245 ? 58.103  -3.795  -53.762  1.00 35.74  ? 401 ASP E C   1 
ATOM   8699  O  O   . ASP E  2  245 ? 57.388  -4.556  -54.393  1.00 35.23  ? 401 ASP E O   1 
ATOM   8700  C  CB  . ASP E  2  245 ? 56.464  -2.883  -52.121  1.00 39.22  ? 401 ASP E CB  1 
ATOM   8701  C  CG  . ASP E  2  245 ? 57.009  -3.714  -50.984  1.00 44.16  ? 401 ASP E CG  1 
ATOM   8702  O  OD1 . ASP E  2  245 ? 58.124  -4.265  -51.123  1.00 55.84  ? 401 ASP E OD1 1 
ATOM   8703  O  OD2 . ASP E  2  245 ? 56.316  -3.828  -49.951  1.00 48.59  ? 401 ASP E OD2 1 
ATOM   8704  N  N   . ASN E  2  246 ? 59.397  -4.011  -53.564  1.00 39.91  ? 402 ASN E N   1 
ATOM   8705  C  CA  . ASN E  2  246 ? 60.081  -5.210  -54.041  1.00 31.24  ? 402 ASN E CA  1 
ATOM   8706  C  C   . ASN E  2  246 ? 60.997  -5.706  -52.922  1.00 35.45  ? 402 ASN E C   1 
ATOM   8707  O  O   . ASN E  2  246 ? 61.851  -6.570  -53.145  1.00 39.43  ? 402 ASN E O   1 
ATOM   8708  C  CB  . ASN E  2  246 ? 60.941  -4.908  -55.275  1.00 51.63  ? 402 ASN E CB  1 
ATOM   8709  C  CG  . ASN E  2  246 ? 60.118  -4.634  -56.503  1.00 47.08  ? 402 ASN E CG  1 
ATOM   8710  O  OD1 . ASN E  2  246 ? 59.150  -5.335  -56.767  1.00 50.78  ? 402 ASN E OD1 1 
ATOM   8711  N  ND2 . ASN E  2  246 ? 60.509  -3.622  -57.277  1.00 45.14  ? 402 ASN E ND2 1 
ATOM   8712  N  N   . ASP E  2  247 ? 60.838  -5.136  -51.728  1.00 35.72  ? 403 ASP E N   1 
ATOM   8713  C  CA  . ASP E  2  247 ? 61.672  -5.526  -50.604  1.00 46.37  ? 403 ASP E CA  1 
ATOM   8714  C  C   . ASP E  2  247 ? 61.331  -6.925  -50.098  1.00 56.48  ? 403 ASP E C   1 
ATOM   8715  O  O   . ASP E  2  247 ? 60.368  -7.555  -50.564  1.00 44.50  ? 403 ASP E O   1 
ATOM   8716  C  CB  . ASP E  2  247 ? 61.572  -4.502  -49.456  1.00 50.27  ? 403 ASP E CB  1 
ATOM   8717  C  CG  . ASP E  2  247 ? 60.131  -4.140  -49.086  1.00 47.30  ? 403 ASP E CG  1 
ATOM   8718  O  OD1 . ASP E  2  247 ? 59.282  -5.048  -48.891  1.00 16.70  ? 403 ASP E OD1 1 
ATOM   8719  O  OD2 . ASP E  2  247 ? 59.862  -2.923  -48.970  1.00 52.62  ? 403 ASP E OD2 1 
ATOM   8720  N  N   . ASN E  2  248 ? 62.138  -7.403  -49.152  1.00 55.48  ? 404 ASN E N   1 
ATOM   8721  C  CA  . ASN E  2  248 ? 61.953  -8.718  -48.553  1.00 46.98  ? 404 ASN E CA  1 
ATOM   8722  C  C   . ASN E  2  248 ? 61.215  -8.587  -47.245  1.00 52.33  ? 404 ASN E C   1 
ATOM   8723  O  O   . ASN E  2  248 ? 61.589  -9.207  -46.253  1.00 73.23  ? 404 ASN E O   1 
ATOM   8724  C  CB  . ASN E  2  248 ? 63.304  -9.380  -48.303  1.00 30.48  ? 404 ASN E CB  1 
ATOM   8725  C  CG  . ASN E  2  248 ? 63.713  -10.298 -49.425  1.00 36.79  ? 404 ASN E CG  1 
ATOM   8726  O  OD1 . ASN E  2  248 ? 63.179  -10.224 -50.530  1.00 42.41  ? 404 ASN E OD1 1 
ATOM   8727  N  ND2 . ASN E  2  248 ? 64.666  -11.169 -49.154  1.00 38.28  ? 404 ASN E ND2 1 
ATOM   8728  N  N   . TRP E  2  249 ? 60.164  -7.779  -47.229  1.00 41.64  ? 405 TRP E N   1 
ATOM   8729  C  CA  . TRP E  2  249 ? 59.420  -7.602  -45.997  1.00 44.42  ? 405 TRP E CA  1 
ATOM   8730  C  C   . TRP E  2  249 ? 57.939  -7.890  -46.197  1.00 43.53  ? 405 TRP E C   1 
ATOM   8731  O  O   . TRP E  2  249 ? 57.189  -7.038  -46.662  1.00 51.58  ? 405 TRP E O   1 
ATOM   8732  C  CB  . TRP E  2  249 ? 59.671  -6.185  -45.466  1.00 18.60  ? 405 TRP E CB  1 
ATOM   8733  C  CG  . TRP E  2  249 ? 58.916  -5.830  -44.240  1.00 19.73  ? 405 TRP E CG  1 
ATOM   8734  C  CD1 . TRP E  2  249 ? 58.497  -6.673  -43.265  1.00 15.50  ? 405 TRP E CD1 1 
ATOM   8735  C  CD2 . TRP E  2  249 ? 58.526  -4.518  -43.829  1.00 28.45  ? 405 TRP E CD2 1 
ATOM   8736  N  NE1 . TRP E  2  249 ? 57.868  -5.978  -42.262  1.00 27.27  ? 405 TRP E NE1 1 
ATOM   8737  C  CE2 . TRP E  2  249 ? 57.870  -4.646  -42.583  1.00 36.51  ? 405 TRP E CE2 1 
ATOM   8738  C  CE3 . TRP E  2  249 ? 58.664  -3.247  -44.389  1.00 20.51  ? 405 TRP E CE3 1 
ATOM   8739  C  CZ2 . TRP E  2  249 ? 57.353  -3.543  -41.884  1.00 24.81  ? 405 TRP E CZ2 1 
ATOM   8740  C  CZ3 . TRP E  2  249 ? 58.148  -2.149  -43.689  1.00 36.50  ? 405 TRP E CZ3 1 
ATOM   8741  C  CH2 . TRP E  2  249 ? 57.504  -2.311  -42.454  1.00 32.90  ? 405 TRP E CH2 1 
ATOM   8742  N  N   . ASN E  2  250 ? 57.534  -9.112  -45.858  1.00 39.60  ? 406 ASN E N   1 
ATOM   8743  C  CA  . ASN E  2  250 ? 56.143  -9.529  -45.994  1.00 38.22  ? 406 ASN E CA  1 
ATOM   8744  C  C   . ASN E  2  250 ? 55.582  -9.309  -47.399  1.00 39.51  ? 406 ASN E C   1 
ATOM   8745  O  O   . ASN E  2  250 ? 54.553  -8.662  -47.568  1.00 32.83  ? 406 ASN E O   1 
ATOM   8746  C  CB  . ASN E  2  250 ? 55.276  -8.773  -45.001  1.00 47.12  ? 406 ASN E CB  1 
ATOM   8747  C  CG  . ASN E  2  250 ? 55.522  -9.194  -43.571  1.00 48.07  ? 406 ASN E CG  1 
ATOM   8748  O  OD1 . ASN E  2  250 ? 56.664  -9.404  -43.154  1.00 39.71  ? 406 ASN E OD1 1 
ATOM   8749  N  ND2 . ASN E  2  250 ? 54.444  -9.301  -42.801  1.00 42.83  ? 406 ASN E ND2 1 
ATOM   8750  N  N   . PRO E  2  251 ? 56.242  -9.868  -48.423  1.00 37.60  ? 407 PRO E N   1 
ATOM   8751  C  CA  . PRO E  2  251 ? 55.844  -9.758  -49.823  1.00 41.40  ? 407 PRO E CA  1 
ATOM   8752  C  C   . PRO E  2  251 ? 54.357  -9.684  -50.170  1.00 47.13  ? 407 PRO E C   1 
ATOM   8753  O  O   . PRO E  2  251 ? 53.995  -9.296  -51.276  1.00 71.62  ? 407 PRO E O   1 
ATOM   8754  C  CB  . PRO E  2  251 ? 56.539  -10.948 -50.457  1.00 28.41  ? 407 PRO E CB  1 
ATOM   8755  C  CG  . PRO E  2  251 ? 57.851  -10.926 -49.773  1.00 32.49  ? 407 PRO E CG  1 
ATOM   8756  C  CD  . PRO E  2  251 ? 57.467  -10.679 -48.306  1.00 40.20  ? 407 PRO E CD  1 
ATOM   8757  N  N   . GLY E  2  252 ? 53.481  -10.038 -49.255  1.00 41.65  ? 408 GLY E N   1 
ATOM   8758  C  CA  . GLY E  2  252 ? 52.072  -9.941  -49.586  1.00 49.38  ? 408 GLY E CA  1 
ATOM   8759  C  C   . GLY E  2  252 ? 51.393  -8.729  -48.962  1.00 55.88  ? 408 GLY E C   1 
ATOM   8760  O  O   . GLY E  2  252 ? 50.557  -8.097  -49.598  1.00 44.13  ? 408 GLY E O   1 
ATOM   8761  N  N   . ASP E  2  253 ? 51.753  -8.423  -47.714  1.00 51.38  ? 409 ASP E N   1 
ATOM   8762  C  CA  . ASP E  2  253 ? 51.197  -7.304  -46.971  1.00 49.89  ? 409 ASP E CA  1 
ATOM   8763  C  C   . ASP E  2  253 ? 51.690  -5.983  -47.559  1.00 48.52  ? 409 ASP E C   1 
ATOM   8764  O  O   . ASP E  2  253 ? 52.877  -5.659  -47.506  1.00 52.17  ? 409 ASP E O   1 
ATOM   8765  C  CB  . ASP E  2  253 ? 51.610  -7.408  -45.499  1.00 55.56  ? 409 ASP E CB  1 
ATOM   8766  C  CG  . ASP E  2  253 ? 50.858  -6.440  -44.614  1.00 63.05  ? 409 ASP E CG  1 
ATOM   8767  O  OD1 . ASP E  2  253 ? 50.608  -5.308  -45.061  1.00 72.56  ? 409 ASP E OD1 1 
ATOM   8768  O  OD2 . ASP E  2  253 ? 50.526  -6.804  -43.469  1.00 72.64  ? 409 ASP E OD2 1 
ATOM   8769  N  N   . PRO E  2  254 ? 50.781  -5.195  -48.131  1.00 44.42  ? 410 PRO E N   1 
ATOM   8770  C  CA  . PRO E  2  254 ? 51.223  -3.927  -48.709  1.00 56.89  ? 410 PRO E CA  1 
ATOM   8771  C  C   . PRO E  2  254 ? 51.526  -2.878  -47.658  1.00 52.84  ? 410 PRO E C   1 
ATOM   8772  O  O   . PRO E  2  254 ? 51.952  -1.777  -47.974  1.00 45.70  ? 410 PRO E O   1 
ATOM   8773  C  CB  . PRO E  2  254 ? 50.059  -3.534  -49.612  1.00 52.92  ? 410 PRO E CB  1 
ATOM   8774  C  CG  . PRO E  2  254 ? 49.494  -4.859  -50.013  1.00 65.92  ? 410 PRO E CG  1 
ATOM   8775  C  CD  . PRO E  2  254 ? 49.475  -5.572  -48.679  1.00 58.39  ? 410 PRO E CD  1 
ATOM   8776  N  N   . THR E  2  255 ? 51.302  -3.231  -46.404  1.00 53.45  ? 411 THR E N   1 
ATOM   8777  C  CA  . THR E  2  255 ? 51.557  -2.327  -45.295  1.00 50.06  ? 411 THR E CA  1 
ATOM   8778  C  C   . THR E  2  255 ? 53.042  -2.369  -44.961  1.00 48.67  ? 411 THR E C   1 
ATOM   8779  O  O   . THR E  2  255 ? 53.601  -1.435  -44.380  1.00 44.49  ? 411 THR E O   1 
ATOM   8780  C  CB  . THR E  2  255 ? 50.762  -2.764  -44.054  1.00 48.26  ? 411 THR E CB  1 
ATOM   8781  O  OG1 . THR E  2  255 ? 49.369  -2.774  -44.370  1.00 72.53  ? 411 THR E OG1 1 
ATOM   8782  C  CG2 . THR E  2  255 ? 50.991  -1.812  -42.897  1.00 76.85  ? 411 THR E CG2 1 
ATOM   8783  N  N   . LYS E  2  256 ? 53.677  -3.467  -45.347  1.00 52.55  ? 412 LYS E N   1 
ATOM   8784  C  CA  . LYS E  2  256 ? 55.088  -3.673  -45.079  1.00 50.69  ? 412 LYS E CA  1 
ATOM   8785  C  C   . LYS E  2  256 ? 55.907  -3.204  -46.272  1.00 49.64  ? 412 LYS E C   1 
ATOM   8786  O  O   . LYS E  2  256 ? 56.428  -4.006  -47.055  1.00 57.43  ? 412 LYS E O   1 
ATOM   8787  C  CB  . LYS E  2  256 ? 55.308  -5.154  -44.778  1.00 42.05  ? 412 LYS E CB  1 
ATOM   8788  C  CG  . LYS E  2  256 ? 54.358  -5.675  -43.700  1.00 35.18  ? 412 LYS E CG  1 
ATOM   8789  C  CD  . LYS E  2  256 ? 54.448  -4.831  -42.436  1.00 50.28  ? 412 LYS E CD  1 
ATOM   8790  C  CE  . LYS E  2  256 ? 53.482  -5.304  -41.356  1.00 45.55  ? 412 LYS E CE  1 
ATOM   8791  N  NZ  . LYS E  2  256 ? 52.081  -5.058  -41.738  1.00 62.93  ? 412 LYS E NZ  1 
ATOM   8792  N  N   . HIS E  2  257 ? 56.029  -1.885  -46.380  1.00 40.85  ? 413 HIS E N   1 
ATOM   8793  C  CA  . HIS E  2  257 ? 56.731  -1.242  -47.483  1.00 30.34  ? 413 HIS E CA  1 
ATOM   8794  C  C   . HIS E  2  257 ? 58.003  -0.493  -47.040  1.00 28.71  ? 413 HIS E C   1 
ATOM   8795  O  O   . HIS E  2  257 ? 57.945  0.636   -46.572  1.00 18.65  ? 413 HIS E O   1 
ATOM   8796  C  CB  . HIS E  2  257 ? 55.741  -0.289  -48.150  1.00 26.64  ? 413 HIS E CB  1 
ATOM   8797  C  CG  . HIS E  2  257 ? 56.147  0.159   -49.511  1.00 45.05  ? 413 HIS E CG  1 
ATOM   8798  N  ND1 . HIS E  2  257 ? 55.259  0.732   -50.393  1.00 35.05  ? 413 HIS E ND1 1 
ATOM   8799  C  CD2 . HIS E  2  257 ? 57.343  0.125   -50.143  1.00 50.07  ? 413 HIS E CD2 1 
ATOM   8800  C  CE1 . HIS E  2  257 ? 55.889  1.031   -51.513  1.00 50.39  ? 413 HIS E CE1 1 
ATOM   8801  N  NE2 . HIS E  2  257 ? 57.154  0.674   -51.388  1.00 65.28  ? 413 HIS E NE2 1 
ATOM   8802  N  N   . CYS E  2  258 ? 59.161  -1.115  -47.199  1.00 36.62  ? 414 CYS E N   1 
ATOM   8803  C  CA  . CYS E  2  258 ? 60.394  -0.457  -46.794  1.00 36.74  ? 414 CYS E CA  1 
ATOM   8804  C  C   . CYS E  2  258 ? 60.610  0.879   -47.453  1.00 35.86  ? 414 CYS E C   1 
ATOM   8805  O  O   . CYS E  2  258 ? 61.347  1.695   -46.939  1.00 50.44  ? 414 CYS E O   1 
ATOM   8806  C  CB  . CYS E  2  258 ? 61.617  -1.350  -47.059  1.00 31.10  ? 414 CYS E CB  1 
ATOM   8807  S  SG  . CYS E  2  258 ? 61.724  -2.633  -45.798  1.00 37.16  ? 414 CYS E SG  1 
ATOM   8808  N  N   . SER E  2  259 ? 59.997  1.115   -48.603  1.00 46.76  ? 415 SER E N   1 
ATOM   8809  C  CA  . SER E  2  259 ? 60.202  2.400   -49.243  1.00 32.86  ? 415 SER E CA  1 
ATOM   8810  C  C   . SER E  2  259 ? 59.264  3.473   -48.699  1.00 34.00  ? 415 SER E C   1 
ATOM   8811  O  O   . SER E  2  259 ? 59.701  4.599   -48.500  1.00 34.66  ? 415 SER E O   1 
ATOM   8812  C  CB  . SER E  2  259 ? 60.043  2.287   -50.746  1.00 35.87  ? 415 SER E CB  1 
ATOM   8813  O  OG  . SER E  2  259 ? 60.487  3.478   -51.367  1.00 44.50  ? 415 SER E OG  1 
ATOM   8814  N  N   . ARG E  2  260 ? 57.992  3.149   -48.454  1.00 21.27  ? 416 ARG E N   1 
ATOM   8815  C  CA  . ARG E  2  260 ? 57.084  4.155   -47.919  1.00 38.54  ? 416 ARG E CA  1 
ATOM   8816  C  C   . ARG E  2  260 ? 57.746  4.821   -46.718  1.00 38.96  ? 416 ARG E C   1 
ATOM   8817  O  O   . ARG E  2  260 ? 57.903  6.039   -46.688  1.00 47.36  ? 416 ARG E O   1 
ATOM   8818  C  CB  . ARG E  2  260 ? 55.737  3.557   -47.492  1.00 56.94  ? 416 ARG E CB  1 
ATOM   8819  C  CG  . ARG E  2  260 ? 54.784  3.195   -48.619  1.00 77.82  ? 416 ARG E CG  1 
ATOM   8820  C  CD  . ARG E  2  260 ? 53.347  3.092   -48.083  1.00 88.57  ? 416 ARG E CD  1 
ATOM   8821  N  NE  . ARG E  2  260 ? 52.398  2.492   -49.030  1.00 109.01 ? 416 ARG E NE  1 
ATOM   8822  C  CZ  . ARG E  2  260 ? 52.129  2.958   -50.250  1.00 112.09 ? 416 ARG E CZ  1 
ATOM   8823  N  NH1 . ARG E  2  260 ? 52.737  4.046   -50.706  1.00 110.41 ? 416 ARG E NH1 1 
ATOM   8824  N  NH2 . ARG E  2  260 ? 51.241  2.334   -51.016  1.00 106.13 ? 416 ARG E NH2 1 
ATOM   8825  N  N   . GLU E  2  261 ? 58.115  4.025   -45.721  1.00 46.64  ? 417 GLU E N   1 
ATOM   8826  C  CA  . GLU E  2  261 ? 58.804  4.543   -44.539  1.00 37.77  ? 417 GLU E CA  1 
ATOM   8827  C  C   . GLU E  2  261 ? 60.217  4.403   -45.027  1.00 30.02  ? 417 GLU E C   1 
ATOM   8828  O  O   . GLU E  2  261 ? 60.459  3.563   -45.876  1.00 43.45  ? 417 GLU E O   1 
ATOM   8829  C  CB  . GLU E  2  261 ? 58.544  3.636   -43.326  1.00 41.83  ? 417 GLU E CB  1 
ATOM   8830  C  CG  . GLU E  2  261 ? 57.805  2.330   -43.647  1.00 29.75  ? 417 GLU E CG  1 
ATOM   8831  C  CD  . GLU E  2  261 ? 57.446  1.498   -42.420  1.00 40.53  ? 417 GLU E CD  1 
ATOM   8832  O  OE1 . GLU E  2  261 ? 58.357  0.980   -41.729  1.00 39.47  ? 417 GLU E OE1 1 
ATOM   8833  O  OE2 . GLU E  2  261 ? 56.234  1.357   -42.152  1.00 31.01  ? 417 GLU E OE2 1 
ATOM   8834  N  N   . ASP E  2  262 ? 61.142  5.217   -44.547  1.00 26.47  ? 418 ASP E N   1 
ATOM   8835  C  CA  . ASP E  2  262 ? 62.555  5.141   -45.001  1.00 31.93  ? 418 ASP E CA  1 
ATOM   8836  C  C   . ASP E  2  262 ? 62.855  6.090   -46.177  1.00 32.78  ? 418 ASP E C   1 
ATOM   8837  O  O   . ASP E  2  262 ? 64.004  6.239   -46.603  1.00 47.47  ? 418 ASP E O   1 
ATOM   8838  C  CB  . ASP E  2  262 ? 62.968  3.688   -45.342  1.00 24.05  ? 418 ASP E CB  1 
ATOM   8839  C  CG  . ASP E  2  262 ? 63.173  2.797   -44.076  1.00 27.99  ? 418 ASP E CG  1 
ATOM   8840  O  OD1 . ASP E  2  262 ? 62.460  2.963   -43.066  1.00 32.86  ? 418 ASP E OD1 1 
ATOM   8841  O  OD2 . ASP E  2  262 ? 64.041  1.912   -44.096  1.00 37.47  ? 418 ASP E OD2 1 
ATOM   8842  N  N   . ALA E  2  263 ? 61.792  6.729   -46.671  1.00 37.91  ? 419 ALA E N   1 
ATOM   8843  C  CA  . ALA E  2  263 ? 61.778  7.762   -47.728  1.00 24.88  ? 419 ALA E CA  1 
ATOM   8844  C  C   . ALA E  2  263 ? 62.720  7.781   -48.927  1.00 35.60  ? 419 ALA E C   1 
ATOM   8845  O  O   . ALA E  2  263 ? 63.136  8.865   -49.382  1.00 35.55  ? 419 ALA E O   1 
ATOM   8846  C  CB  . ALA E  2  263 ? 61.840  9.131   -47.060  1.00 25.36  ? 419 ALA E CB  1 
ATOM   8847  N  N   . GLY E  2  264 ? 63.052  6.618   -49.461  1.00 29.44  ? 420 GLY E N   1 
ATOM   8848  C  CA  . GLY E  2  264 ? 63.924  6.610   -50.608  1.00 34.14  ? 420 GLY E CA  1 
ATOM   8849  C  C   . GLY E  2  264 ? 63.756  5.411   -51.509  1.00 35.37  ? 420 GLY E C   1 
ATOM   8850  O  O   . GLY E  2  264 ? 63.177  4.411   -51.113  1.00 48.24  ? 420 GLY E O   1 
ATOM   8851  N  N   . GLY E  2  265 ? 64.235  5.523   -52.736  1.00 21.01  ? 421 GLY E N   1 
ATOM   8852  C  CA  . GLY E  2  265 ? 64.157  4.398   -53.624  1.00 20.68  ? 421 GLY E CA  1 
ATOM   8853  C  C   . GLY E  2  265 ? 65.491  3.775   -53.311  1.00 37.34  ? 421 GLY E C   1 
ATOM   8854  O  O   . GLY E  2  265 ? 66.509  4.469   -53.292  1.00 29.05  ? 421 GLY E O   1 
ATOM   8855  N  N   . TRP E  2  266 ? 65.503  2.477   -53.045  1.00 42.96  ? 422 TRP E N   1 
ATOM   8856  C  CA  . TRP E  2  266 ? 66.748  1.817   -52.700  1.00 40.17  ? 422 TRP E CA  1 
ATOM   8857  C  C   . TRP E  2  266 ? 66.601  0.309   -52.739  1.00 42.88  ? 422 TRP E C   1 
ATOM   8858  O  O   . TRP E  2  266 ? 65.485  -0.213  -52.766  1.00 48.21  ? 422 TRP E O   1 
ATOM   8859  C  CB  . TRP E  2  266 ? 67.152  2.256   -51.298  1.00 42.38  ? 422 TRP E CB  1 
ATOM   8860  C  CG  . TRP E  2  266 ? 68.449  1.721   -50.852  1.00 32.69  ? 422 TRP E CG  1 
ATOM   8861  C  CD1 . TRP E  2  266 ? 68.668  0.852   -49.817  1.00 27.96  ? 422 TRP E CD1 1 
ATOM   8862  C  CD2 . TRP E  2  266 ? 69.730  2.037   -51.395  1.00 25.10  ? 422 TRP E CD2 1 
ATOM   8863  N  NE1 . TRP E  2  266 ? 70.016  0.612   -49.682  1.00 22.20  ? 422 TRP E NE1 1 
ATOM   8864  C  CE2 . TRP E  2  266 ? 70.691  1.326   -50.637  1.00 28.92  ? 422 TRP E CE2 1 
ATOM   8865  C  CE3 . TRP E  2  266 ? 70.163  2.852   -52.447  1.00 28.42  ? 422 TRP E CE3 1 
ATOM   8866  C  CZ2 . TRP E  2  266 ? 72.058  1.407   -50.899  1.00 21.74  ? 422 TRP E CZ2 1 
ATOM   8867  C  CZ3 . TRP E  2  266 ? 71.526  2.934   -52.708  1.00 30.37  ? 422 TRP E CZ3 1 
ATOM   8868  C  CH2 . TRP E  2  266 ? 72.456  2.216   -51.937  1.00 29.85  ? 422 TRP E CH2 1 
ATOM   8869  N  N   . TRP E  2  267 ? 67.731  -0.391  -52.739  1.00 38.56  ? 423 TRP E N   1 
ATOM   8870  C  CA  . TRP E  2  267 ? 67.706  -1.846  -52.740  1.00 32.61  ? 423 TRP E CA  1 
ATOM   8871  C  C   . TRP E  2  267 ? 67.348  -2.338  -51.353  1.00 29.37  ? 423 TRP E C   1 
ATOM   8872  O  O   . TRP E  2  267 ? 68.095  -3.073  -50.727  1.00 26.23  ? 423 TRP E O   1 
ATOM   8873  C  CB  . TRP E  2  267 ? 69.051  -2.392  -53.180  1.00 24.03  ? 423 TRP E CB  1 
ATOM   8874  C  CG  . TRP E  2  267 ? 69.319  -2.056  -54.610  1.00 34.34  ? 423 TRP E CG  1 
ATOM   8875  C  CD1 . TRP E  2  267 ? 68.804  -2.683  -55.711  1.00 33.25  ? 423 TRP E CD1 1 
ATOM   8876  C  CD2 . TRP E  2  267 ? 70.104  -0.963  -55.103  1.00 30.83  ? 423 TRP E CD2 1 
ATOM   8877  N  NE1 . TRP E  2  267 ? 69.219  -2.045  -56.858  1.00 14.12  ? 423 TRP E NE1 1 
ATOM   8878  C  CE2 . TRP E  2  267 ? 70.020  -0.990  -56.515  1.00 33.48  ? 423 TRP E CE2 1 
ATOM   8879  C  CE3 . TRP E  2  267 ? 70.866  0.040   -54.491  1.00 14.02  ? 423 TRP E CE3 1 
ATOM   8880  C  CZ2 . TRP E  2  267 ? 70.678  -0.047  -57.329  1.00 37.88  ? 423 TRP E CZ2 1 
ATOM   8881  C  CZ3 . TRP E  2  267 ? 71.520  0.977   -55.298  1.00 28.99  ? 423 TRP E CZ3 1 
ATOM   8882  C  CH2 . TRP E  2  267 ? 71.422  0.925   -56.704  1.00 25.96  ? 423 TRP E CH2 1 
ATOM   8883  N  N   . TYR E  2  268 ? 66.180  -1.906  -50.890  1.00 26.20  ? 424 TYR E N   1 
ATOM   8884  C  CA  . TYR E  2  268 ? 65.652  -2.291  -49.599  1.00 33.44  ? 424 TYR E CA  1 
ATOM   8885  C  C   . TYR E  2  268 ? 65.438  -3.792  -49.517  1.00 45.63  ? 424 TYR E C   1 
ATOM   8886  O  O   . TYR E  2  268 ? 64.904  -4.415  -50.443  1.00 39.19  ? 424 TYR E O   1 
ATOM   8887  C  CB  . TYR E  2  268 ? 64.317  -1.597  -49.347  1.00 32.09  ? 424 TYR E CB  1 
ATOM   8888  C  CG  . TYR E  2  268 ? 64.433  -0.128  -49.040  1.00 40.75  ? 424 TYR E CG  1 
ATOM   8889  C  CD1 . TYR E  2  268 ? 65.218  0.323   -47.987  1.00 36.93  ? 424 TYR E CD1 1 
ATOM   8890  C  CD2 . TYR E  2  268 ? 63.748  0.809   -49.791  1.00 37.77  ? 424 TYR E CD2 1 
ATOM   8891  C  CE1 . TYR E  2  268 ? 65.310  1.666   -47.701  1.00 45.75  ? 424 TYR E CE1 1 
ATOM   8892  C  CE2 . TYR E  2  268 ? 63.836  2.149   -49.509  1.00 37.60  ? 424 TYR E CE2 1 
ATOM   8893  C  CZ  . TYR E  2  268 ? 64.615  2.574   -48.470  1.00 36.47  ? 424 TYR E CZ  1 
ATOM   8894  O  OH  . TYR E  2  268 ? 64.702  3.915   -48.204  1.00 37.24  ? 424 TYR E OH  1 
ATOM   8895  N  N   . ASN E  2  269 ? 65.838  -4.353  -48.383  1.00 44.60  ? 425 ASN E N   1 
ATOM   8896  C  CA  . ASN E  2  269 ? 65.704  -5.773  -48.111  1.00 50.07  ? 425 ASN E CA  1 
ATOM   8897  C  C   . ASN E  2  269 ? 65.203  -5.866  -46.709  1.00 49.83  ? 425 ASN E C   1 
ATOM   8898  O  O   . ASN E  2  269 ? 66.004  -5.800  -45.775  1.00 65.86  ? 425 ASN E O   1 
ATOM   8899  C  CB  . ASN E  2  269 ? 67.063  -6.459  -48.172  1.00 62.83  ? 425 ASN E CB  1 
ATOM   8900  C  CG  . ASN E  2  269 ? 67.136  -7.686  -47.286  1.00 56.38  ? 425 ASN E CG  1 
ATOM   8901  O  OD1 . ASN E  2  269 ? 66.224  -8.516  -47.282  1.00 50.06  ? 425 ASN E OD1 1 
ATOM   8902  N  ND2 . ASN E  2  269 ? 68.224  -7.805  -46.528  1.00 46.54  ? 425 ASN E ND2 1 
ATOM   8903  N  N   . ARG E  2  270 ? 63.901  -6.028  -46.526  1.00 45.45  ? 426 ARG E N   1 
ATOM   8904  C  CA  . ARG E  2  270 ? 63.391  -6.080  -45.152  1.00 51.49  ? 426 ARG E CA  1 
ATOM   8905  C  C   . ARG E  2  270 ? 63.978  -4.828  -44.485  1.00 50.09  ? 426 ARG E C   1 
ATOM   8906  O  O   . ARG E  2  270 ? 64.301  -4.791  -43.293  1.00 40.02  ? 426 ARG E O   1 
ATOM   8907  C  CB  . ARG E  2  270 ? 63.888  -7.326  -44.447  1.00 43.15  ? 426 ARG E CB  1 
ATOM   8908  C  CG  . ARG E  2  270 ? 63.191  -7.557  -43.159  1.00 43.35  ? 426 ARG E CG  1 
ATOM   8909  C  CD  . ARG E  2  270 ? 61.992  -8.451  -43.335  1.00 24.34  ? 426 ARG E CD  1 
ATOM   8910  N  NE  . ARG E  2  270 ? 61.300  -8.581  -42.055  1.00 40.06  ? 426 ARG E NE  1 
ATOM   8911  C  CZ  . ARG E  2  270 ? 60.144  -9.199  -41.906  1.00 25.74  ? 426 ARG E CZ  1 
ATOM   8912  N  NH1 . ARG E  2  270 ? 59.568  -9.760  -42.964  1.00 37.39  ? 426 ARG E NH1 1 
ATOM   8913  N  NH2 . ARG E  2  270 ? 59.534  -9.182  -40.733  1.00 10.41  ? 426 ARG E NH2 1 
ATOM   8914  N  N   . CYS E  2  271 ? 64.140  -3.835  -45.357  1.00 63.05  ? 427 CYS E N   1 
ATOM   8915  C  CA  . CYS E  2  271 ? 64.639  -2.491  -45.124  1.00 48.54  ? 427 CYS E CA  1 
ATOM   8916  C  C   . CYS E  2  271 ? 66.120  -2.229  -45.260  1.00 50.45  ? 427 CYS E C   1 
ATOM   8917  O  O   . CYS E  2  271 ? 66.625  -2.354  -46.381  1.00 57.89  ? 427 CYS E O   1 
ATOM   8918  C  CB  . CYS E  2  271 ? 64.057  -1.931  -43.852  1.00 35.76  ? 427 CYS E CB  1 
ATOM   8919  S  SG  . CYS E  2  271 ? 62.252  -1.684  -44.060  1.00 48.76  ? 427 CYS E SG  1 
ATOM   8920  N  N   . HIS E  2  272 ? 66.857  -1.888  -44.207  1.00 40.82  ? 428 HIS E N   1 
ATOM   8921  C  CA  . HIS E  2  272 ? 68.264  -1.579  -44.501  1.00 41.06  ? 428 HIS E CA  1 
ATOM   8922  C  C   . HIS E  2  272 ? 69.317  -1.465  -43.423  1.00 35.12  ? 428 HIS E C   1 
ATOM   8923  O  O   . HIS E  2  272 ? 69.032  -1.380  -42.236  1.00 45.93  ? 428 HIS E O   1 
ATOM   8924  C  CB  . HIS E  2  272 ? 68.333  -0.251  -45.271  1.00 30.40  ? 428 HIS E CB  1 
ATOM   8925  C  CG  . HIS E  2  272 ? 68.176  0.949   -44.390  1.00 28.51  ? 428 HIS E CG  1 
ATOM   8926  N  ND1 . HIS E  2  272 ? 66.949  1.487   -44.077  1.00 23.09  ? 428 HIS E ND1 1 
ATOM   8927  C  CD2 . HIS E  2  272 ? 69.084  1.644   -43.666  1.00 34.06  ? 428 HIS E CD2 1 
ATOM   8928  C  CE1 . HIS E  2  272 ? 67.106  2.458   -43.196  1.00 27.48  ? 428 HIS E CE1 1 
ATOM   8929  N  NE2 . HIS E  2  272 ? 68.392  2.572   -42.928  1.00 29.18  ? 428 HIS E NE2 1 
ATOM   8930  N  N   . ALA E  2  273 ? 70.549  -1.392  -43.913  1.00 32.80  ? 429 ALA E N   1 
ATOM   8931  C  CA  . ALA E  2  273 ? 71.756  -1.177  -43.130  1.00 33.95  ? 429 ALA E CA  1 
ATOM   8932  C  C   . ALA E  2  273 ? 72.223  0.210   -43.617  1.00 40.59  ? 429 ALA E C   1 
ATOM   8933  O  O   . ALA E  2  273 ? 72.609  1.084   -42.831  1.00 40.10  ? 429 ALA E O   1 
ATOM   8934  C  CB  . ALA E  2  273 ? 72.805  -2.214  -43.480  1.00 19.77  ? 429 ALA E CB  1 
ATOM   8935  N  N   . ALA E  2  274 ? 72.186  0.382   -44.939  1.00 34.77  ? 430 ALA E N   1 
ATOM   8936  C  CA  . ALA E  2  274 ? 72.570  1.625   -45.590  1.00 36.00  ? 430 ALA E CA  1 
ATOM   8937  C  C   . ALA E  2  274 ? 71.324  2.237   -46.211  1.00 40.98  ? 430 ALA E C   1 
ATOM   8938  O  O   . ALA E  2  274 ? 70.481  1.516   -46.734  1.00 46.73  ? 430 ALA E O   1 
ATOM   8939  C  CB  . ALA E  2  274 ? 73.598  1.361   -46.657  1.00 25.44  ? 430 ALA E CB  1 
ATOM   8940  N  N   . ASN E  2  275 ? 71.203  3.561   -46.148  1.00 34.16  ? 431 ASN E N   1 
ATOM   8941  C  CA  . ASN E  2  275 ? 70.049  4.224   -46.711  1.00 25.18  ? 431 ASN E CA  1 
ATOM   8942  C  C   . ASN E  2  275 ? 70.346  5.572   -47.343  1.00 35.64  ? 431 ASN E C   1 
ATOM   8943  O  O   . ASN E  2  275 ? 69.764  6.575   -46.936  1.00 42.09  ? 431 ASN E O   1 
ATOM   8944  C  CB  . ASN E  2  275 ? 68.962  4.400   -45.639  1.00 25.33  ? 431 ASN E CB  1 
ATOM   8945  C  CG  . ASN E  2  275 ? 67.602  4.862   -46.221  1.00 26.81  ? 431 ASN E CG  1 
ATOM   8946  O  OD1 . ASN E  2  275 ? 67.153  4.357   -47.242  1.00 16.51  ? 431 ASN E OD1 1 
ATOM   8947  N  ND2 . ASN E  2  275 ? 66.948  5.812   -45.549  1.00 3.28   ? 431 ASN E ND2 1 
ATOM   8948  N  N   . PRO E  2  276 ? 71.267  5.635   -48.328  1.00 41.27  ? 432 PRO E N   1 
ATOM   8949  C  CA  . PRO E  2  276 ? 71.496  6.968   -48.921  1.00 35.47  ? 432 PRO E CA  1 
ATOM   8950  C  C   . PRO E  2  276 ? 70.129  7.192   -49.559  1.00 46.19  ? 432 PRO E C   1 
ATOM   8951  O  O   . PRO E  2  276 ? 69.300  6.278   -49.541  1.00 70.83  ? 432 PRO E O   1 
ATOM   8952  C  CB  . PRO E  2  276 ? 72.557  6.713   -49.997  1.00 29.63  ? 432 PRO E CB  1 
ATOM   8953  C  CG  . PRO E  2  276 ? 73.092  5.313   -49.692  1.00 39.45  ? 432 PRO E CG  1 
ATOM   8954  C  CD  . PRO E  2  276 ? 71.917  4.577   -49.120  1.00 33.98  ? 432 PRO E CD  1 
ATOM   8955  N  N   . ASN E  2  277 ? 69.855  8.348   -50.130  1.00 40.69  ? 433 ASN E N   1 
ATOM   8956  C  CA  . ASN E  2  277 ? 68.527  8.533   -50.753  1.00 45.40  ? 433 ASN E CA  1 
ATOM   8957  C  C   . ASN E  2  277 ? 67.400  8.751   -49.739  1.00 40.58  ? 433 ASN E C   1 
ATOM   8958  O  O   . ASN E  2  277 ? 66.231  8.954   -50.112  1.00 37.93  ? 433 ASN E O   1 
ATOM   8959  C  CB  . ASN E  2  277 ? 68.139  7.342   -51.647  1.00 2.31   ? 433 ASN E CB  1 
ATOM   8960  C  CG  . ASN E  2  277 ? 69.060  7.174   -52.839  1.00 23.47  ? 433 ASN E CG  1 
ATOM   8961  O  OD1 . ASN E  2  277 ? 70.062  7.879   -52.981  1.00 26.82  ? 433 ASN E OD1 1 
ATOM   8962  N  ND2 . ASN E  2  277 ? 68.730  6.225   -53.702  1.00 30.97  ? 433 ASN E ND2 1 
ATOM   8963  N  N   . GLY E  2  278 ? 67.750  8.711   -48.462  1.00 29.71  ? 434 GLY E N   1 
ATOM   8964  C  CA  . GLY E  2  278 ? 66.756  8.953   -47.438  1.00 30.63  ? 434 GLY E CA  1 
ATOM   8965  C  C   . GLY E  2  278 ? 66.638  10.436  -47.126  1.00 28.09  ? 434 GLY E C   1 
ATOM   8966  O  O   . GLY E  2  278 ? 67.305  11.267  -47.758  1.00 23.76  ? 434 GLY E O   1 
ATOM   8967  N  N   . ARG E  2  279 ? 65.809  10.760  -46.135  1.00 23.78  ? 435 ARG E N   1 
ATOM   8968  C  CA  . ARG E  2  279 ? 65.584  12.139  -45.740  1.00 28.44  ? 435 ARG E CA  1 
ATOM   8969  C  C   . ARG E  2  279 ? 66.876  12.818  -45.306  1.00 33.14  ? 435 ARG E C   1 
ATOM   8970  O  O   . ARG E  2  279 ? 67.682  12.232  -44.602  1.00 34.21  ? 435 ARG E O   1 
ATOM   8971  C  CB  . ARG E  2  279 ? 64.518  12.194  -44.633  1.00 24.95  ? 435 ARG E CB  1 
ATOM   8972  C  CG  . ARG E  2  279 ? 63.075  12.243  -45.185  1.00 50.13  ? 435 ARG E CG  1 
ATOM   8973  C  CD  . ARG E  2  279 ? 62.023  11.876  -44.151  1.00 57.33  ? 435 ARG E CD  1 
ATOM   8974  N  NE  . ARG E  2  279 ? 61.914  12.821  -43.042  1.00 65.79  ? 435 ARG E NE  1 
ATOM   8975  C  CZ  . ARG E  2  279 ? 61.005  13.787  -42.966  1.00 72.50  ? 435 ARG E CZ  1 
ATOM   8976  N  NH1 . ARG E  2  279 ? 60.114  13.948  -43.945  1.00 57.67  ? 435 ARG E NH1 1 
ATOM   8977  N  NH2 . ARG E  2  279 ? 60.980  14.579  -41.897  1.00 65.01  ? 435 ARG E NH2 1 
ATOM   8978  N  N   . TYR E  2  280 ? 67.089  14.053  -45.750  1.00 34.29  ? 436 TYR E N   1 
ATOM   8979  C  CA  . TYR E  2  280 ? 68.299  14.765  -45.381  1.00 37.48  ? 436 TYR E CA  1 
ATOM   8980  C  C   . TYR E  2  280 ? 68.104  15.574  -44.112  1.00 49.25  ? 436 TYR E C   1 
ATOM   8981  O  O   . TYR E  2  280 ? 67.838  16.776  -44.179  1.00 55.48  ? 436 TYR E O   1 
ATOM   8982  C  CB  . TYR E  2  280 ? 68.718  15.712  -46.489  1.00 42.76  ? 436 TYR E CB  1 
ATOM   8983  C  CG  . TYR E  2  280 ? 70.114  16.277  -46.315  1.00 37.37  ? 436 TYR E CG  1 
ATOM   8984  C  CD1 . TYR E  2  280 ? 71.220  15.572  -46.757  1.00 35.59  ? 436 TYR E CD1 1 
ATOM   8985  C  CD2 . TYR E  2  280 ? 70.326  17.526  -45.727  1.00 44.15  ? 436 TYR E CD2 1 
ATOM   8986  C  CE1 . TYR E  2  280 ? 72.508  16.088  -46.630  1.00 29.94  ? 436 TYR E CE1 1 
ATOM   8987  C  CE2 . TYR E  2  280 ? 71.612  18.046  -45.591  1.00 33.44  ? 436 TYR E CE2 1 
ATOM   8988  C  CZ  . TYR E  2  280 ? 72.698  17.316  -46.049  1.00 35.25  ? 436 TYR E CZ  1 
ATOM   8989  O  OH  . TYR E  2  280 ? 73.980  17.803  -45.928  1.00 38.65  ? 436 TYR E OH  1 
ATOM   8990  N  N   . TYR E  2  281 ? 68.223  14.920  -42.959  1.00 49.88  ? 437 TYR E N   1 
ATOM   8991  C  CA  . TYR E  2  281 ? 68.078  15.610  -41.689  1.00 37.46  ? 437 TYR E CA  1 
ATOM   8992  C  C   . TYR E  2  281 ? 69.317  16.459  -41.499  1.00 43.13  ? 437 TYR E C   1 
ATOM   8993  O  O   . TYR E  2  281 ? 70.437  15.996  -41.771  1.00 34.04  ? 437 TYR E O   1 
ATOM   8994  C  CB  . TYR E  2  281 ? 67.984  14.631  -40.529  1.00 25.52  ? 437 TYR E CB  1 
ATOM   8995  C  CG  . TYR E  2  281 ? 66.708  13.851  -40.467  1.00 28.51  ? 437 TYR E CG  1 
ATOM   8996  C  CD1 . TYR E  2  281 ? 66.646  12.545  -40.944  1.00 36.37  ? 437 TYR E CD1 1 
ATOM   8997  C  CD2 . TYR E  2  281 ? 65.560  14.410  -39.935  1.00 15.04  ? 437 TYR E CD2 1 
ATOM   8998  C  CE1 . TYR E  2  281 ? 65.466  11.812  -40.892  1.00 7.45   ? 437 TYR E CE1 1 
ATOM   8999  C  CE2 . TYR E  2  281 ? 64.380  13.685  -39.885  1.00 38.19  ? 437 TYR E CE2 1 
ATOM   9000  C  CZ  . TYR E  2  281 ? 64.349  12.380  -40.374  1.00 20.58  ? 437 TYR E CZ  1 
ATOM   9001  O  OH  . TYR E  2  281 ? 63.175  11.661  -40.384  1.00 52.17  ? 437 TYR E OH  1 
ATOM   9002  N  N   . TRP E  2  282 ? 69.106  17.689  -41.025  1.00 46.18  ? 438 TRP E N   1 
ATOM   9003  C  CA  . TRP E  2  282 ? 70.191  18.631  -40.793  1.00 45.52  ? 438 TRP E CA  1 
ATOM   9004  C  C   . TRP E  2  282 ? 70.846  18.433  -39.435  1.00 48.01  ? 438 TRP E C   1 
ATOM   9005  O  O   . TRP E  2  282 ? 70.172  18.190  -38.437  1.00 50.36  ? 438 TRP E O   1 
ATOM   9006  C  CB  . TRP E  2  282 ? 69.667  20.066  -40.898  1.00 56.50  ? 438 TRP E CB  1 
ATOM   9007  C  CG  . TRP E  2  282 ? 70.771  21.068  -40.901  1.00 58.11  ? 438 TRP E CG  1 
ATOM   9008  C  CD1 . TRP E  2  282 ? 71.451  21.544  -39.816  1.00 54.81  ? 438 TRP E CD1 1 
ATOM   9009  C  CD2 . TRP E  2  282 ? 71.407  21.633  -42.053  1.00 42.08  ? 438 TRP E CD2 1 
ATOM   9010  N  NE1 . TRP E  2  282 ? 72.475  22.362  -40.224  1.00 56.10  ? 438 TRP E NE1 1 
ATOM   9011  C  CE2 . TRP E  2  282 ? 72.470  22.433  -41.592  1.00 49.50  ? 438 TRP E CE2 1 
ATOM   9012  C  CE3 . TRP E  2  282 ? 71.186  21.533  -43.427  1.00 45.89  ? 438 TRP E CE3 1 
ATOM   9013  C  CZ2 . TRP E  2  282 ? 73.311  23.130  -42.460  1.00 57.30  ? 438 TRP E CZ2 1 
ATOM   9014  C  CZ3 . TRP E  2  282 ? 72.025  22.221  -44.291  1.00 52.94  ? 438 TRP E CZ3 1 
ATOM   9015  C  CH2 . TRP E  2  282 ? 73.074  23.010  -43.804  1.00 53.20  ? 438 TRP E CH2 1 
ATOM   9016  N  N   . GLY E  2  283 ? 72.165  18.524  -39.393  1.00 48.91  ? 439 GLY E N   1 
ATOM   9017  C  CA  . GLY E  2  283 ? 72.842  18.371  -38.118  1.00 57.52  ? 439 GLY E CA  1 
ATOM   9018  C  C   . GLY E  2  283 ? 73.183  16.963  -37.680  1.00 54.73  ? 439 GLY E C   1 
ATOM   9019  O  O   . GLY E  2  283 ? 73.681  16.760  -36.581  1.00 66.95  ? 439 GLY E O   1 
ATOM   9020  N  N   . GLY E  2  284 ? 72.910  15.980  -38.520  1.00 58.40  ? 440 GLY E N   1 
ATOM   9021  C  CA  . GLY E  2  284 ? 73.252  14.621  -38.157  1.00 46.44  ? 440 GLY E CA  1 
ATOM   9022  C  C   . GLY E  2  284 ? 72.248  13.811  -37.363  1.00 51.93  ? 440 GLY E C   1 
ATOM   9023  O  O   . GLY E  2  284 ? 71.600  12.931  -37.921  1.00 58.31  ? 440 GLY E O   1 
ATOM   9024  N  N   . ILE E  2  285 ? 72.107  14.081  -36.069  1.00 52.67  ? 441 ILE E N   1 
ATOM   9025  C  CA  . ILE E  2  285 ? 71.183  13.281  -35.274  1.00 53.15  ? 441 ILE E CA  1 
ATOM   9026  C  C   . ILE E  2  285 ? 69.718  13.658  -35.449  1.00 50.32  ? 441 ILE E C   1 
ATOM   9027  O  O   . ILE E  2  285 ? 69.369  14.831  -35.646  1.00 46.14  ? 441 ILE E O   1 
ATOM   9028  C  CB  . ILE E  2  285 ? 71.551  13.295  -33.749  1.00 50.39  ? 441 ILE E CB  1 
ATOM   9029  C  CG1 . ILE E  2  285 ? 71.026  14.555  -33.062  1.00 67.49  ? 441 ILE E CG1 1 
ATOM   9030  C  CG2 . ILE E  2  285 ? 73.046  13.226  -33.578  1.00 55.83  ? 441 ILE E CG2 1 
ATOM   9031  C  CD1 . ILE E  2  285 ? 69.616  14.408  -32.486  1.00 81.40  ? 441 ILE E CD1 1 
ATOM   9032  N  N   . TYR E  2  286 ? 68.871  12.637  -35.386  1.00 36.68  ? 442 TYR E N   1 
ATOM   9033  C  CA  . TYR E  2  286 ? 67.440  12.804  -35.514  1.00 36.94  ? 442 TYR E CA  1 
ATOM   9034  C  C   . TYR E  2  286 ? 66.845  11.682  -34.710  1.00 33.28  ? 442 TYR E C   1 
ATOM   9035  O  O   . TYR E  2  286 ? 67.493  10.678  -34.476  1.00 43.88  ? 442 TYR E O   1 
ATOM   9036  C  CB  . TYR E  2  286 ? 66.981  12.732  -36.989  1.00 51.86  ? 442 TYR E CB  1 
ATOM   9037  C  CG  . TYR E  2  286 ? 67.179  11.400  -37.699  1.00 41.07  ? 442 TYR E CG  1 
ATOM   9038  C  CD1 . TYR E  2  286 ? 68.432  11.016  -38.181  1.00 35.63  ? 442 TYR E CD1 1 
ATOM   9039  C  CD2 . TYR E  2  286 ? 66.113  10.521  -37.865  1.00 26.99  ? 442 TYR E CD2 1 
ATOM   9040  C  CE1 . TYR E  2  286 ? 68.614  9.789   -38.806  1.00 30.12  ? 442 TYR E CE1 1 
ATOM   9041  C  CE2 . TYR E  2  286 ? 66.282  9.298   -38.485  1.00 24.50  ? 442 TYR E CE2 1 
ATOM   9042  C  CZ  . TYR E  2  286 ? 67.529  8.934   -38.955  1.00 32.67  ? 442 TYR E CZ  1 
ATOM   9043  O  OH  . TYR E  2  286 ? 67.683  7.723   -39.590  1.00 38.84  ? 442 TYR E OH  1 
ATOM   9044  N  N   . THR E  2  287 ? 65.600  11.848  -34.296  1.00 49.25  ? 443 THR E N   1 
ATOM   9045  C  CA  . THR E  2  287 ? 64.939  10.861  -33.460  1.00 46.93  ? 443 THR E CA  1 
ATOM   9046  C  C   . THR E  2  287 ? 63.718  10.188  -34.063  1.00 47.31  ? 443 THR E C   1 
ATOM   9047  O  O   . THR E  2  287 ? 63.048  10.727  -34.935  1.00 46.15  ? 443 THR E O   1 
ATOM   9048  C  CB  . THR E  2  287 ? 64.478  11.501  -32.160  1.00 45.58  ? 443 THR E CB  1 
ATOM   9049  O  OG1 . THR E  2  287 ? 63.375  12.369  -32.435  1.00 42.37  ? 443 THR E OG1 1 
ATOM   9050  C  CG2 . THR E  2  287 ? 65.596  12.312  -31.541  1.00 54.67  ? 443 THR E CG2 1 
ATOM   9051  N  N   . LYS E  2  288 ? 63.426  9.003   -33.554  1.00 50.80  ? 444 LYS E N   1 
ATOM   9052  C  CA  . LYS E  2  288 ? 62.277  8.239   -33.993  1.00 56.54  ? 444 LYS E CA  1 
ATOM   9053  C  C   . LYS E  2  288 ? 61.046  9.147   -33.951  1.00 54.48  ? 444 LYS E C   1 
ATOM   9054  O  O   . LYS E  2  288 ? 60.093  8.985   -34.714  1.00 39.63  ? 444 LYS E O   1 
ATOM   9055  C  CB  . LYS E  2  288 ? 62.091  7.040   -33.055  1.00 67.03  ? 444 LYS E CB  1 
ATOM   9056  C  CG  . LYS E  2  288 ? 60.869  6.167   -33.332  1.00 76.98  ? 444 LYS E CG  1 
ATOM   9057  C  CD  . LYS E  2  288 ? 60.850  4.943   -32.418  1.00 86.91  ? 444 LYS E CD  1 
ATOM   9058  C  CE  . LYS E  2  288 ? 62.107  4.087   -32.603  1.00 96.15  ? 444 LYS E CE  1 
ATOM   9059  N  NZ  . LYS E  2  288 ? 62.171  2.890   -31.712  1.00 91.91  ? 444 LYS E NZ  1 
ATOM   9060  N  N   . GLU E  2  289 ? 61.078  10.116  -33.050  1.00 58.17  ? 445 GLU E N   1 
ATOM   9061  C  CA  . GLU E  2  289 ? 59.959  11.028  -32.896  1.00 58.69  ? 445 GLU E CA  1 
ATOM   9062  C  C   . GLU E  2  289 ? 59.822  11.951  -34.098  1.00 57.51  ? 445 GLU E C   1 
ATOM   9063  O  O   . GLU E  2  289 ? 58.715  12.386  -34.431  1.00 51.29  ? 445 GLU E O   1 
ATOM   9064  C  CB  . GLU E  2  289 ? 60.126  11.850  -31.615  1.00 61.55  ? 445 GLU E CB  1 
ATOM   9065  C  CG  . GLU E  2  289 ? 59.981  11.053  -30.314  1.00 69.42  ? 445 GLU E CG  1 
ATOM   9066  C  CD  . GLU E  2  289 ? 61.038  9.964   -30.135  1.00 73.32  ? 445 GLU E CD  1 
ATOM   9067  O  OE1 . GLU E  2  289 ? 62.245  10.295  -30.105  1.00 73.88  ? 445 GLU E OE1 1 
ATOM   9068  O  OE2 . GLU E  2  289 ? 60.658  8.777   -30.014  1.00 65.89  ? 445 GLU E OE2 1 
ATOM   9069  N  N   . GLN E  2  290 ? 60.946  12.220  -34.759  1.00 48.59  ? 446 GLN E N   1 
ATOM   9070  C  CA  . GLN E  2  290 ? 60.970  13.114  -35.913  1.00 56.04  ? 446 GLN E CA  1 
ATOM   9071  C  C   . GLN E  2  290 ? 60.693  12.420  -37.236  1.00 57.29  ? 446 GLN E C   1 
ATOM   9072  O  O   . GLN E  2  290 ? 60.115  13.015  -38.154  1.00 67.83  ? 446 GLN E O   1 
ATOM   9073  C  CB  . GLN E  2  290 ? 62.325  13.811  -35.998  1.00 45.41  ? 446 GLN E CB  1 
ATOM   9074  C  CG  . GLN E  2  290 ? 62.841  14.270  -34.662  1.00 37.06  ? 446 GLN E CG  1 
ATOM   9075  C  CD  . GLN E  2  290 ? 64.103  15.084  -34.775  1.00 41.55  ? 446 GLN E CD  1 
ATOM   9076  O  OE1 . GLN E  2  290 ? 65.133  14.597  -35.222  1.00 49.19  ? 446 GLN E OE1 1 
ATOM   9077  N  NE2 . GLN E  2  290 ? 64.027  16.341  -34.369  1.00 64.14  ? 446 GLN E NE2 1 
ATOM   9078  N  N   . ALA E  2  291 ? 61.125  11.166  -37.336  1.00 56.61  ? 447 ALA E N   1 
ATOM   9079  C  CA  . ALA E  2  291 ? 60.942  10.373  -38.548  1.00 50.99  ? 447 ALA E CA  1 
ATOM   9080  C  C   . ALA E  2  291 ? 59.486  10.336  -38.972  1.00 46.30  ? 447 ALA E C   1 
ATOM   9081  O  O   . ALA E  2  291 ? 58.596  10.106  -38.164  1.00 38.26  ? 447 ALA E O   1 
ATOM   9082  C  CB  . ALA E  2  291 ? 61.448  8.972   -38.325  1.00 63.28  ? 447 ALA E CB  1 
ATOM   9083  N  N   . ASP E  2  292 ? 59.246  10.547  -40.255  1.00 52.66  ? 448 ASP E N   1 
ATOM   9084  C  CA  . ASP E  2  292 ? 57.885  10.567  -40.761  1.00 60.96  ? 448 ASP E CA  1 
ATOM   9085  C  C   . ASP E  2  292 ? 57.074  9.309   -40.414  1.00 54.54  ? 448 ASP E C   1 
ATOM   9086  O  O   . ASP E  2  292 ? 55.857  9.384   -40.223  1.00 54.83  ? 448 ASP E O   1 
ATOM   9087  C  CB  . ASP E  2  292 ? 57.916  10.808  -42.271  1.00 56.22  ? 448 ASP E CB  1 
ATOM   9088  C  CG  . ASP E  2  292 ? 56.680  11.506  -42.770  1.00 67.58  ? 448 ASP E CG  1 
ATOM   9089  O  OD1 . ASP E  2  292 ? 56.725  12.018  -43.903  1.00 83.29  ? 448 ASP E OD1 1 
ATOM   9090  O  OD2 . ASP E  2  292 ? 55.664  11.541  -42.039  1.00 72.21  ? 448 ASP E OD2 1 
ATOM   9091  N  N   . TYR E  2  293 ? 57.742  8.162   -40.323  1.00 51.46  ? 449 TYR E N   1 
ATOM   9092  C  CA  . TYR E  2  293 ? 57.048  6.915   -39.995  1.00 48.81  ? 449 TYR E CA  1 
ATOM   9093  C  C   . TYR E  2  293 ? 57.665  6.237   -38.785  1.00 49.66  ? 449 TYR E C   1 
ATOM   9094  O  O   . TYR E  2  293 ? 57.501  5.040   -38.589  1.00 43.17  ? 449 TYR E O   1 
ATOM   9095  C  CB  . TYR E  2  293 ? 57.063  5.936   -41.183  1.00 49.14  ? 449 TYR E CB  1 
ATOM   9096  C  CG  . TYR E  2  293 ? 56.140  6.329   -42.311  1.00 53.75  ? 449 TYR E CG  1 
ATOM   9097  C  CD1 . TYR E  2  293 ? 56.612  7.007   -43.440  1.00 50.31  ? 449 TYR E CD1 1 
ATOM   9098  C  CD2 . TYR E  2  293 ? 54.779  6.078   -42.221  1.00 41.45  ? 449 TYR E CD2 1 
ATOM   9099  C  CE1 . TYR E  2  293 ? 55.730  7.423   -44.445  1.00 53.97  ? 449 TYR E CE1 1 
ATOM   9100  C  CE2 . TYR E  2  293 ? 53.903  6.485   -43.209  1.00 43.93  ? 449 TYR E CE2 1 
ATOM   9101  C  CZ  . TYR E  2  293 ? 54.372  7.155   -44.312  1.00 52.45  ? 449 TYR E CZ  1 
ATOM   9102  O  OH  . TYR E  2  293 ? 53.459  7.557   -45.258  1.00 57.15  ? 449 TYR E OH  1 
ATOM   9103  N  N   . GLY E  2  294 ? 58.377  7.005   -37.975  1.00 46.36  ? 450 GLY E N   1 
ATOM   9104  C  CA  . GLY E  2  294 ? 58.993  6.427   -36.803  1.00 42.12  ? 450 GLY E CA  1 
ATOM   9105  C  C   . GLY E  2  294 ? 60.095  5.448   -37.146  1.00 41.73  ? 450 GLY E C   1 
ATOM   9106  O  O   . GLY E  2  294 ? 60.569  4.709   -36.285  1.00 46.53  ? 450 GLY E O   1 
ATOM   9107  N  N   . THR E  2  295 ? 60.511  5.430   -38.403  1.00 38.57  ? 451 THR E N   1 
ATOM   9108  C  CA  . THR E  2  295 ? 61.581  4.526   -38.796  1.00 46.73  ? 451 THR E CA  1 
ATOM   9109  C  C   . THR E  2  295 ? 62.879  5.290   -39.004  1.00 41.30  ? 451 THR E C   1 
ATOM   9110  O  O   . THR E  2  295 ? 62.905  6.519   -38.969  1.00 41.92  ? 451 THR E O   1 
ATOM   9111  C  CB  . THR E  2  295 ? 61.238  3.797   -40.075  1.00 44.17  ? 451 THR E CB  1 
ATOM   9112  O  OG1 . THR E  2  295 ? 61.196  4.737   -41.160  1.00 53.08  ? 451 THR E OG1 1 
ATOM   9113  C  CG2 . THR E  2  295 ? 59.885  3.096   -39.912  1.00 29.31  ? 451 THR E CG2 1 
ATOM   9114  N  N   . ASP E  2  296 ? 63.967  4.570   -39.221  1.00 32.96  ? 452 ASP E N   1 
ATOM   9115  C  CA  . ASP E  2  296 ? 65.232  5.250   -39.415  1.00 32.41  ? 452 ASP E CA  1 
ATOM   9116  C  C   . ASP E  2  296 ? 65.441  5.704   -40.849  1.00 40.42  ? 452 ASP E C   1 
ATOM   9117  O  O   . ASP E  2  296 ? 66.386  5.271   -41.517  1.00 47.87  ? 452 ASP E O   1 
ATOM   9118  C  CB  . ASP E  2  296 ? 66.408  4.374   -38.939  1.00 14.33  ? 452 ASP E CB  1 
ATOM   9119  C  CG  . ASP E  2  296 ? 66.407  2.991   -39.545  1.00 22.46  ? 452 ASP E CG  1 
ATOM   9120  O  OD1 . ASP E  2  296 ? 65.331  2.360   -39.653  1.00 38.78  ? 452 ASP E OD1 1 
ATOM   9121  O  OD2 . ASP E  2  296 ? 67.505  2.524   -39.908  1.00 44.07  ? 452 ASP E OD2 1 
ATOM   9122  N  N   . ASP E  2  297 ? 64.542  6.568   -41.327  1.00 47.52  ? 453 ASP E N   1 
ATOM   9123  C  CA  . ASP E  2  297 ? 64.660  7.120   -42.680  1.00 45.35  ? 453 ASP E CA  1 
ATOM   9124  C  C   . ASP E  2  297 ? 65.722  8.179   -42.525  1.00 43.80  ? 453 ASP E C   1 
ATOM   9125  O  O   . ASP E  2  297 ? 65.883  8.736   -41.452  1.00 52.86  ? 453 ASP E O   1 
ATOM   9126  C  CB  . ASP E  2  297 ? 63.345  7.754   -43.179  1.00 38.18  ? 453 ASP E CB  1 
ATOM   9127  C  CG  . ASP E  2  297 ? 62.786  8.813   -42.239  1.00 40.98  ? 453 ASP E CG  1 
ATOM   9128  O  OD1 . ASP E  2  297 ? 63.572  9.578   -41.648  1.00 44.53  ? 453 ASP E OD1 1 
ATOM   9129  O  OD2 . ASP E  2  297 ? 61.546  8.898   -42.105  1.00 32.65  ? 453 ASP E OD2 1 
ATOM   9130  N  N   . GLY E  2  298 ? 66.463  8.464   -43.571  1.00 38.64  ? 454 GLY E N   1 
ATOM   9131  C  CA  . GLY E  2  298 ? 67.498  9.453   -43.405  1.00 35.85  ? 454 GLY E CA  1 
ATOM   9132  C  C   . GLY E  2  298 ? 68.712  8.915   -44.095  1.00 39.22  ? 454 GLY E C   1 
ATOM   9133  O  O   . GLY E  2  298 ? 68.731  7.751   -44.476  1.00 43.93  ? 454 GLY E O   1 
ATOM   9134  N  N   . VAL E  2  299 ? 69.724  9.748   -44.275  1.00 37.09  ? 455 VAL E N   1 
ATOM   9135  C  CA  . VAL E  2  299 ? 70.912  9.296   -44.957  1.00 34.63  ? 455 VAL E CA  1 
ATOM   9136  C  C   . VAL E  2  299 ? 71.733  8.506   -43.969  1.00 37.70  ? 455 VAL E C   1 
ATOM   9137  O  O   . VAL E  2  299 ? 72.729  8.981   -43.453  1.00 47.67  ? 455 VAL E O   1 
ATOM   9138  C  CB  . VAL E  2  299 ? 71.664  10.484  -45.489  1.00 24.60  ? 455 VAL E CB  1 
ATOM   9139  C  CG1 . VAL E  2  299 ? 72.785  10.047  -46.389  1.00 33.32  ? 455 VAL E CG1 1 
ATOM   9140  C  CG2 . VAL E  2  299 ? 70.694  11.350  -46.236  1.00 34.16  ? 455 VAL E CG2 1 
ATOM   9141  N  N   . VAL E  2  300 ? 71.276  7.282   -43.733  1.00 35.87  ? 456 VAL E N   1 
ATOM   9142  C  CA  . VAL E  2  300 ? 71.856  6.341   -42.794  1.00 23.99  ? 456 VAL E CA  1 
ATOM   9143  C  C   . VAL E  2  300 ? 72.882  5.384   -43.347  1.00 31.49  ? 456 VAL E C   1 
ATOM   9144  O  O   . VAL E  2  300 ? 72.809  4.964   -44.490  1.00 42.93  ? 456 VAL E O   1 
ATOM   9145  C  CB  . VAL E  2  300 ? 70.755  5.460   -42.175  1.00 22.35  ? 456 VAL E CB  1 
ATOM   9146  C  CG1 . VAL E  2  300 ? 71.379  4.322   -41.354  1.00 15.95  ? 456 VAL E CG1 1 
ATOM   9147  C  CG2 . VAL E  2  300 ? 69.824  6.304   -41.319  1.00 20.85  ? 456 VAL E CG2 1 
ATOM   9148  N  N   . TRP E  2  301 ? 73.841  5.035   -42.505  1.00 37.61  ? 457 TRP E N   1 
ATOM   9149  C  CA  . TRP E  2  301 ? 74.841  4.051   -42.852  1.00 42.48  ? 457 TRP E CA  1 
ATOM   9150  C  C   . TRP E  2  301 ? 75.168  3.451   -41.515  1.00 49.89  ? 457 TRP E C   1 
ATOM   9151  O  O   . TRP E  2  301 ? 76.248  3.674   -40.972  1.00 59.96  ? 457 TRP E O   1 
ATOM   9152  C  CB  . TRP E  2  301 ? 76.080  4.675   -43.475  1.00 35.77  ? 457 TRP E CB  1 
ATOM   9153  C  CG  . TRP E  2  301 ? 76.991  3.632   -44.056  1.00 39.06  ? 457 TRP E CG  1 
ATOM   9154  C  CD1 . TRP E  2  301 ? 77.923  2.888   -43.390  1.00 35.39  ? 457 TRP E CD1 1 
ATOM   9155  C  CD2 . TRP E  2  301 ? 77.018  3.184   -45.413  1.00 41.78  ? 457 TRP E CD2 1 
ATOM   9156  N  NE1 . TRP E  2  301 ? 78.532  2.012   -44.250  1.00 30.33  ? 457 TRP E NE1 1 
ATOM   9157  C  CE2 . TRP E  2  301 ? 77.995  2.169   -45.498  1.00 34.37  ? 457 TRP E CE2 1 
ATOM   9158  C  CE3 . TRP E  2  301 ? 76.311  3.541   -46.569  1.00 38.15  ? 457 TRP E CE3 1 
ATOM   9159  C  CZ2 . TRP E  2  301 ? 78.284  1.512   -46.687  1.00 38.86  ? 457 TRP E CZ2 1 
ATOM   9160  C  CZ3 . TRP E  2  301 ? 76.604  2.884   -47.758  1.00 30.61  ? 457 TRP E CZ3 1 
ATOM   9161  C  CH2 . TRP E  2  301 ? 77.580  1.884   -47.806  1.00 19.64  ? 457 TRP E CH2 1 
ATOM   9162  N  N   . MET E  2  302 ? 74.202  2.704   -40.981  1.00 51.21  ? 458 MET E N   1 
ATOM   9163  C  CA  . MET E  2  302 ? 74.322  2.069   -39.669  1.00 49.52  ? 458 MET E CA  1 
ATOM   9164  C  C   . MET E  2  302 ? 75.722  1.618   -39.290  1.00 42.37  ? 458 MET E C   1 
ATOM   9165  O  O   . MET E  2  302 ? 76.223  1.978   -38.234  1.00 54.48  ? 458 MET E O   1 
ATOM   9166  C  CB  . MET E  2  302 ? 73.350  0.898   -39.572  1.00 43.20  ? 458 MET E CB  1 
ATOM   9167  C  CG  . MET E  2  302 ? 71.915  1.340   -39.488  1.00 34.40  ? 458 MET E CG  1 
ATOM   9168  S  SD  . MET E  2  302 ? 70.828  -0.025  -39.669  1.00 37.87  ? 458 MET E SD  1 
ATOM   9169  C  CE  . MET E  2  302 ? 70.540  -0.441  -38.015  1.00 25.10  ? 458 MET E CE  1 
ATOM   9170  N  N   . ASN E  2  303 ? 76.352  0.837   -40.152  1.00 36.29  ? 459 ASN E N   1 
ATOM   9171  C  CA  . ASN E  2  303 ? 77.696  0.365   -39.891  1.00 40.19  ? 459 ASN E CA  1 
ATOM   9172  C  C   . ASN E  2  303 ? 78.690  1.430   -39.423  1.00 43.97  ? 459 ASN E C   1 
ATOM   9173  O  O   . ASN E  2  303 ? 79.810  1.092   -39.041  1.00 40.74  ? 459 ASN E O   1 
ATOM   9174  C  CB  . ASN E  2  303 ? 78.242  -0.310  -41.141  1.00 41.00  ? 459 ASN E CB  1 
ATOM   9175  C  CG  . ASN E  2  303 ? 77.497  -1.552  -41.473  1.00 42.12  ? 459 ASN E CG  1 
ATOM   9176  O  OD1 . ASN E  2  303 ? 78.039  -2.654  -41.400  1.00 64.60  ? 459 ASN E OD1 1 
ATOM   9177  N  ND2 . ASN E  2  303 ? 76.234  -1.394  -41.823  1.00 33.78  ? 459 ASN E ND2 1 
ATOM   9178  N  N   . TRP E  2  304 ? 78.305  2.704   -39.454  1.00 41.16  ? 460 TRP E N   1 
ATOM   9179  C  CA  . TRP E  2  304 ? 79.215  3.757   -39.022  1.00 35.70  ? 460 TRP E CA  1 
ATOM   9180  C  C   . TRP E  2  304 ? 78.686  4.653   -37.926  1.00 43.38  ? 460 TRP E C   1 
ATOM   9181  O  O   . TRP E  2  304 ? 79.381  4.907   -36.948  1.00 57.08  ? 460 TRP E O   1 
ATOM   9182  C  CB  . TRP E  2  304 ? 79.608  4.631   -40.191  1.00 33.93  ? 460 TRP E CB  1 
ATOM   9183  C  CG  . TRP E  2  304 ? 80.683  5.617   -39.855  1.00 53.10  ? 460 TRP E CG  1 
ATOM   9184  C  CD1 . TRP E  2  304 ? 81.836  5.361   -39.185  1.00 60.92  ? 460 TRP E CD1 1 
ATOM   9185  C  CD2 . TRP E  2  304 ? 80.762  6.992   -40.268  1.00 61.04  ? 460 TRP E CD2 1 
ATOM   9186  N  NE1 . TRP E  2  304 ? 82.635  6.480   -39.157  1.00 46.13  ? 460 TRP E NE1 1 
ATOM   9187  C  CE2 . TRP E  2  304 ? 81.997  7.496   -39.814  1.00 53.06  ? 460 TRP E CE2 1 
ATOM   9188  C  CE3 . TRP E  2  304 ? 79.911  7.843   -40.983  1.00 65.20  ? 460 TRP E CE3 1 
ATOM   9189  C  CZ2 . TRP E  2  304 ? 82.405  8.815   -40.050  1.00 56.79  ? 460 TRP E CZ2 1 
ATOM   9190  C  CZ3 . TRP E  2  304 ? 80.321  9.155   -41.220  1.00 54.70  ? 460 TRP E CZ3 1 
ATOM   9191  C  CH2 . TRP E  2  304 ? 81.556  9.625   -40.753  1.00 46.23  ? 460 TRP E CH2 1 
ATOM   9192  N  N   . LYS E  2  305 ? 77.461  5.141   -38.084  1.00 40.04  ? 461 LYS E N   1 
ATOM   9193  C  CA  . LYS E  2  305 ? 76.869  6.040   -37.099  1.00 30.17  ? 461 LYS E CA  1 
ATOM   9194  C  C   . LYS E  2  305 ? 75.544  5.529   -36.574  1.00 38.14  ? 461 LYS E C   1 
ATOM   9195  O  O   . LYS E  2  305 ? 74.788  6.278   -35.943  1.00 43.92  ? 461 LYS E O   1 
ATOM   9196  C  CB  . LYS E  2  305 ? 76.663  7.415   -37.716  1.00 29.53  ? 461 LYS E CB  1 
ATOM   9197  C  CG  . LYS E  2  305 ? 77.943  8.080   -38.176  1.00 33.12  ? 461 LYS E CG  1 
ATOM   9198  C  CD  . LYS E  2  305 ? 78.610  8.800   -37.026  1.00 47.73  ? 461 LYS E CD  1 
ATOM   9199  C  CE  . LYS E  2  305 ? 79.661  9.789   -37.508  1.00 55.21  ? 461 LYS E CE  1 
ATOM   9200  N  NZ  . LYS E  2  305 ? 80.199  10.611  -36.380  1.00 58.02  ? 461 LYS E NZ  1 
ATOM   9201  N  N   . GLY E  2  306 ? 75.259  4.257   -36.837  1.00 37.04  ? 462 GLY E N   1 
ATOM   9202  C  CA  . GLY E  2  306 ? 74.023  3.664   -36.363  1.00 27.50  ? 462 GLY E CA  1 
ATOM   9203  C  C   . GLY E  2  306 ? 72.833  4.121   -37.171  1.00 27.94  ? 462 GLY E C   1 
ATOM   9204  O  O   . GLY E  2  306 ? 72.983  4.750   -38.213  1.00 41.77  ? 462 GLY E O   1 
ATOM   9205  N  N   . SER E  2  307 ? 71.645  3.816   -36.682  1.00 26.57  ? 463 SER E N   1 
ATOM   9206  C  CA  . SER E  2  307 ? 70.421  4.172   -37.375  1.00 43.97  ? 463 SER E CA  1 
ATOM   9207  C  C   . SER E  2  307 ? 69.914  5.609   -37.305  1.00 46.97  ? 463 SER E C   1 
ATOM   9208  O  O   . SER E  2  307 ? 69.213  6.047   -38.216  1.00 53.24  ? 463 SER E O   1 
ATOM   9209  C  CB  . SER E  2  307 ? 69.287  3.244   -36.925  1.00 29.45  ? 463 SER E CB  1 
ATOM   9210  O  OG  . SER E  2  307 ? 69.317  2.035   -37.655  1.00 33.52  ? 463 SER E OG  1 
ATOM   9211  N  N   . TRP E  2  308 ? 70.254  6.355   -36.259  1.00 43.62  ? 464 TRP E N   1 
ATOM   9212  C  CA  . TRP E  2  308 ? 69.710  7.700   -36.155  1.00 34.83  ? 464 TRP E CA  1 
ATOM   9213  C  C   . TRP E  2  308 ? 70.631  8.858   -36.403  1.00 39.36  ? 464 TRP E C   1 
ATOM   9214  O  O   . TRP E  2  308 ? 70.540  9.881   -35.728  1.00 52.31  ? 464 TRP E O   1 
ATOM   9215  C  CB  . TRP E  2  308 ? 69.013  7.888   -34.809  1.00 15.68  ? 464 TRP E CB  1 
ATOM   9216  C  CG  . TRP E  2  308 ? 68.067  6.770   -34.515  1.00 35.99  ? 464 TRP E CG  1 
ATOM   9217  C  CD1 . TRP E  2  308 ? 68.341  5.628   -33.831  1.00 25.43  ? 464 TRP E CD1 1 
ATOM   9218  C  CD2 . TRP E  2  308 ? 66.723  6.639   -34.985  1.00 39.70  ? 464 TRP E CD2 1 
ATOM   9219  N  NE1 . TRP E  2  308 ? 67.260  4.794   -33.849  1.00 31.58  ? 464 TRP E NE1 1 
ATOM   9220  C  CE2 . TRP E  2  308 ? 66.251  5.388   -34.553  1.00 42.68  ? 464 TRP E CE2 1 
ATOM   9221  C  CE3 . TRP E  2  308 ? 65.872  7.459   -35.730  1.00 44.81  ? 464 TRP E CE3 1 
ATOM   9222  C  CZ2 . TRP E  2  308 ? 64.962  4.931   -34.845  1.00 49.55  ? 464 TRP E CZ2 1 
ATOM   9223  C  CZ3 . TRP E  2  308 ? 64.596  7.010   -36.018  1.00 42.84  ? 464 TRP E CZ3 1 
ATOM   9224  C  CH2 . TRP E  2  308 ? 64.152  5.755   -35.577  1.00 50.61  ? 464 TRP E CH2 1 
ATOM   9225  N  N   . TYR E  2  309 ? 71.506  8.720   -37.385  1.00 30.82  ? 465 TYR E N   1 
ATOM   9226  C  CA  . TYR E  2  309 ? 72.400  9.812   -37.707  1.00 34.53  ? 465 TYR E CA  1 
ATOM   9227  C  C   . TYR E  2  309 ? 72.424  9.942   -39.207  1.00 29.59  ? 465 TYR E C   1 
ATOM   9228  O  O   . TYR E  2  309 ? 72.765  8.981   -39.892  1.00 33.41  ? 465 TYR E O   1 
ATOM   9229  C  CB  . TYR E  2  309 ? 73.805  9.547   -37.163  1.00 34.21  ? 465 TYR E CB  1 
ATOM   9230  C  CG  . TYR E  2  309 ? 74.770  10.696  -37.385  1.00 24.38  ? 465 TYR E CG  1 
ATOM   9231  C  CD1 . TYR E  2  309 ? 75.525  10.780  -38.548  1.00 23.40  ? 465 TYR E CD1 1 
ATOM   9232  C  CD2 . TYR E  2  309 ? 74.917  11.699  -36.438  1.00 26.25  ? 465 TYR E CD2 1 
ATOM   9233  C  CE1 . TYR E  2  309 ? 76.403  11.820  -38.762  1.00 23.33  ? 465 TYR E CE1 1 
ATOM   9234  C  CE2 . TYR E  2  309 ? 75.794  12.759  -36.648  1.00 31.23  ? 465 TYR E CE2 1 
ATOM   9235  C  CZ  . TYR E  2  309 ? 76.535  12.812  -37.812  1.00 37.25  ? 465 TYR E CZ  1 
ATOM   9236  O  OH  . TYR E  2  309 ? 77.413  13.858  -38.032  1.00 48.29  ? 465 TYR E OH  1 
ATOM   9237  N  N   . SER E  2  310 ? 72.050  11.122  -39.710  1.00 27.15  ? 466 SER E N   1 
ATOM   9238  C  CA  . SER E  2  310 ? 72.015  11.380  -41.146  1.00 31.36  ? 466 SER E CA  1 
ATOM   9239  C  C   . SER E  2  310 ? 73.313  12.031  -41.609  1.00 25.74  ? 466 SER E C   1 
ATOM   9240  O  O   . SER E  2  310 ? 73.679  13.070  -41.106  1.00 25.36  ? 466 SER E O   1 
ATOM   9241  C  CB  . SER E  2  310 ? 70.805  12.269  -41.498  1.00 40.20  ? 466 SER E CB  1 
ATOM   9242  O  OG  . SER E  2  310 ? 70.745  12.568  -42.896  1.00 63.64  ? 466 SER E OG  1 
ATOM   9243  N  N   . MET E  2  311 ? 74.005  11.419  -42.567  1.00 22.25  ? 467 MET E N   1 
ATOM   9244  C  CA  . MET E  2  311 ? 75.247  11.985  -43.051  1.00 24.58  ? 467 MET E CA  1 
ATOM   9245  C  C   . MET E  2  311 ? 75.060  13.410  -43.578  1.00 35.86  ? 467 MET E C   1 
ATOM   9246  O  O   . MET E  2  311 ? 73.946  13.813  -43.948  1.00 34.22  ? 467 MET E O   1 
ATOM   9247  C  CB  . MET E  2  311 ? 75.804  11.135  -44.180  1.00 33.73  ? 467 MET E CB  1 
ATOM   9248  C  CG  . MET E  2  311 ? 76.061  9.703   -43.826  1.00 48.48  ? 467 MET E CG  1 
ATOM   9249  S  SD  . MET E  2  311 ? 77.096  9.523   -42.360  1.00 31.90  ? 467 MET E SD  1 
ATOM   9250  C  CE  . MET E  2  311 ? 75.938  8.819   -41.247  1.00 25.27  ? 467 MET E CE  1 
ATOM   9251  N  N   . ARG E  2  312 ? 76.161  14.158  -43.619  1.00 26.60  ? 468 ARG E N   1 
ATOM   9252  C  CA  . ARG E  2  312 ? 76.150  15.511  -44.131  1.00 28.74  ? 468 ARG E CA  1 
ATOM   9253  C  C   . ARG E  2  312 ? 76.465  15.383  -45.608  1.00 40.99  ? 468 ARG E C   1 
ATOM   9254  O  O   . ARG E  2  312 ? 76.079  16.226  -46.427  1.00 41.11  ? 468 ARG E O   1 
ATOM   9255  C  CB  . ARG E  2  312 ? 77.222  16.355  -43.453  1.00 35.03  ? 468 ARG E CB  1 
ATOM   9256  C  CG  . ARG E  2  312 ? 77.294  17.790  -43.979  1.00 57.56  ? 468 ARG E CG  1 
ATOM   9257  C  CD  . ARG E  2  312 ? 78.393  18.579  -43.294  1.00 60.15  ? 468 ARG E CD  1 
ATOM   9258  N  NE  . ARG E  2  312 ? 79.699  17.956  -43.474  1.00 62.09  ? 468 ARG E NE  1 
ATOM   9259  C  CZ  . ARG E  2  312 ? 80.402  18.003  -44.598  1.00 55.51  ? 468 ARG E CZ  1 
ATOM   9260  N  NH1 . ARG E  2  312 ? 79.927  18.654  -45.645  1.00 56.44  ? 468 ARG E NH1 1 
ATOM   9261  N  NH2 . ARG E  2  312 ? 81.575  17.389  -44.674  1.00 63.93  ? 468 ARG E NH2 1 
ATOM   9262  N  N   . GLN E  2  313 ? 77.190  14.315  -45.932  1.00 44.58  ? 469 GLN E N   1 
ATOM   9263  C  CA  . GLN E  2  313 ? 77.565  14.018  -47.310  1.00 46.86  ? 469 GLN E CA  1 
ATOM   9264  C  C   . GLN E  2  313 ? 77.562  12.531  -47.576  1.00 42.08  ? 469 GLN E C   1 
ATOM   9265  O  O   . GLN E  2  313 ? 78.086  11.752  -46.793  1.00 52.09  ? 469 GLN E O   1 
ATOM   9266  C  CB  . GLN E  2  313 ? 78.942  14.583  -47.638  1.00 41.32  ? 469 GLN E CB  1 
ATOM   9267  C  CG  . GLN E  2  313 ? 78.929  16.071  -47.890  1.00 44.61  ? 469 GLN E CG  1 
ATOM   9268  C  CD  . GLN E  2  313 ? 80.291  16.583  -48.287  1.00 46.93  ? 469 GLN E CD  1 
ATOM   9269  O  OE1 . GLN E  2  313 ? 80.446  17.733  -48.687  1.00 56.54  ? 469 GLN E OE1 1 
ATOM   9270  N  NE2 . GLN E  2  313 ? 81.293  15.726  -48.171  1.00 56.22  ? 469 GLN E NE2 1 
ATOM   9271  N  N   . MET E  2  314 ? 76.954  12.145  -48.687  1.00 37.02  ? 470 MET E N   1 
ATOM   9272  C  CA  . MET E  2  314 ? 76.882  10.753  -49.084  1.00 30.83  ? 470 MET E CA  1 
ATOM   9273  C  C   . MET E  2  314 ? 76.902  10.709  -50.597  1.00 45.04  ? 470 MET E C   1 
ATOM   9274  O  O   . MET E  2  314 ? 76.304  11.567  -51.245  1.00 62.15  ? 470 MET E O   1 
ATOM   9275  C  CB  . MET E  2  314 ? 75.593  10.137  -48.586  1.00 18.77  ? 470 MET E CB  1 
ATOM   9276  C  CG  . MET E  2  314 ? 75.276  8.804   -49.220  1.00 36.36  ? 470 MET E CG  1 
ATOM   9277  S  SD  . MET E  2  314 ? 76.308  7.488   -48.629  1.00 44.33  ? 470 MET E SD  1 
ATOM   9278  C  CE  . MET E  2  314 ? 75.556  7.236   -47.020  1.00 3.67   ? 470 MET E CE  1 
ATOM   9279  N  N   . ALA E  2  315 ? 77.579  9.720   -51.171  1.00 45.51  ? 471 ALA E N   1 
ATOM   9280  C  CA  . ALA E  2  315 ? 77.632  9.616   -52.617  1.00 30.22  ? 471 ALA E CA  1 
ATOM   9281  C  C   . ALA E  2  315 ? 78.010  8.238   -53.085  1.00 40.89  ? 471 ALA E C   1 
ATOM   9282  O  O   . ALA E  2  315 ? 78.766  7.545   -52.415  1.00 38.06  ? 471 ALA E O   1 
ATOM   9283  C  CB  . ALA E  2  315 ? 78.603  10.594  -53.154  1.00 20.47  ? 471 ALA E CB  1 
ATOM   9284  N  N   . MET E  2  316 ? 77.467  7.854   -54.239  1.00 43.53  ? 472 MET E N   1 
ATOM   9285  C  CA  . MET E  2  316 ? 77.750  6.570   -54.863  1.00 41.86  ? 472 MET E CA  1 
ATOM   9286  C  C   . MET E  2  316 ? 78.555  6.874   -56.105  1.00 44.42  ? 472 MET E C   1 
ATOM   9287  O  O   . MET E  2  316 ? 78.161  7.726   -56.900  1.00 56.74  ? 472 MET E O   1 
ATOM   9288  C  CB  . MET E  2  316 ? 76.467  5.869   -55.280  1.00 47.42  ? 472 MET E CB  1 
ATOM   9289  C  CG  . MET E  2  316 ? 75.919  4.903   -54.277  1.00 43.70  ? 472 MET E CG  1 
ATOM   9290  S  SD  . MET E  2  316 ? 74.816  3.726   -55.102  1.00 47.89  ? 472 MET E SD  1 
ATOM   9291  C  CE  . MET E  2  316 ? 75.873  2.942   -56.077  1.00 33.69  ? 472 MET E CE  1 
ATOM   9292  N  N   . LYS E  2  317 ? 79.673  6.180   -56.281  1.00 43.01  ? 473 LYS E N   1 
ATOM   9293  C  CA  . LYS E  2  317 ? 80.534  6.410   -57.438  1.00 45.55  ? 473 LYS E CA  1 
ATOM   9294  C  C   . LYS E  2  317 ? 80.892  5.106   -58.115  1.00 41.92  ? 473 LYS E C   1 
ATOM   9295  O  O   . LYS E  2  317 ? 81.129  4.101   -57.444  1.00 42.73  ? 473 LYS E O   1 
ATOM   9296  C  CB  . LYS E  2  317 ? 81.816  7.115   -57.006  1.00 49.56  ? 473 LYS E CB  1 
ATOM   9297  C  CG  . LYS E  2  317 ? 81.603  8.497   -56.460  1.00 35.23  ? 473 LYS E CG  1 
ATOM   9298  C  CD  . LYS E  2  317 ? 82.742  8.898   -55.558  1.00 38.97  ? 473 LYS E CD  1 
ATOM   9299  C  CE  . LYS E  2  317 ? 82.588  10.335  -55.094  1.00 45.28  ? 473 LYS E CE  1 
ATOM   9300  N  NZ  . LYS E  2  317 ? 83.554  10.690  -54.014  1.00 43.08  ? 473 LYS E NZ  1 
ATOM   9301  N  N   . LEU E  2  318 ? 80.951  5.144   -59.442  1.00 29.33  ? 474 LEU E N   1 
ATOM   9302  C  CA  . LEU E  2  318 ? 81.257  3.971   -60.242  1.00 36.58  ? 474 LEU E CA  1 
ATOM   9303  C  C   . LEU E  2  318 ? 82.541  4.146   -61.016  1.00 42.25  ? 474 LEU E C   1 
ATOM   9304  O  O   . LEU E  2  318 ? 82.882  5.251   -61.430  1.00 44.08  ? 474 LEU E O   1 
ATOM   9305  C  CB  . LEU E  2  318 ? 80.125  3.706   -61.230  1.00 27.52  ? 474 LEU E CB  1 
ATOM   9306  C  CG  . LEU E  2  318 ? 79.106  2.628   -60.917  1.00 22.62  ? 474 LEU E CG  1 
ATOM   9307  C  CD1 . LEU E  2  318 ? 78.846  2.552   -59.451  1.00 19.63  ? 474 LEU E CD1 1 
ATOM   9308  C  CD2 . LEU E  2  318 ? 77.834  2.915   -61.707  1.00 46.42  ? 474 LEU E CD2 1 
ATOM   9309  N  N   . ARG E  2  319 ? 83.252  3.044   -61.209  1.00 46.84  ? 475 ARG E N   1 
ATOM   9310  C  CA  . ARG E  2  319 ? 84.484  3.056   -61.977  1.00 46.48  ? 475 ARG E CA  1 
ATOM   9311  C  C   . ARG E  2  319 ? 84.638  1.661   -62.551  1.00 50.14  ? 475 ARG E C   1 
ATOM   9312  O  O   . ARG E  2  319 ? 84.197  0.691   -61.953  1.00 62.62  ? 475 ARG E O   1 
ATOM   9313  C  CB  . ARG E  2  319 ? 85.686  3.396   -61.099  1.00 42.10  ? 475 ARG E CB  1 
ATOM   9314  C  CG  . ARG E  2  319 ? 86.962  3.542   -61.892  1.00 56.90  ? 475 ARG E CG  1 
ATOM   9315  C  CD  . ARG E  2  319 ? 88.116  4.036   -61.058  1.00 72.00  ? 475 ARG E CD  1 
ATOM   9316  N  NE  . ARG E  2  319 ? 88.509  3.070   -60.042  1.00 88.21  ? 475 ARG E NE  1 
ATOM   9317  C  CZ  . ARG E  2  319 ? 89.519  3.252   -59.199  1.00 98.47  ? 475 ARG E CZ  1 
ATOM   9318  N  NH1 . ARG E  2  319 ? 90.237  4.369   -59.255  1.00 100.31 ? 475 ARG E NH1 1 
ATOM   9319  N  NH2 . ARG E  2  319 ? 89.816  2.313   -58.307  1.00 100.41 ? 475 ARG E NH2 1 
ATOM   9320  N  N   . PRO E  2  320 ? 85.238  1.544   -63.737  1.00 56.07  ? 476 PRO E N   1 
ATOM   9321  C  CA  . PRO E  2  320 ? 85.424  0.232   -64.349  1.00 55.12  ? 476 PRO E CA  1 
ATOM   9322  C  C   . PRO E  2  320 ? 86.596  -0.486  -63.708  1.00 71.88  ? 476 PRO E C   1 
ATOM   9323  O  O   . PRO E  2  320 ? 86.452  -1.090  -62.651  1.00 67.26  ? 476 PRO E O   1 
ATOM   9324  C  CB  . PRO E  2  320 ? 85.685  0.581   -65.805  1.00 48.86  ? 476 PRO E CB  1 
ATOM   9325  C  CG  . PRO E  2  320 ? 86.445  1.864   -65.698  1.00 37.75  ? 476 PRO E CG  1 
ATOM   9326  C  CD  . PRO E  2  320 ? 85.646  2.615   -64.662  1.00 58.06  ? 476 PRO E CD  1 
ATOM   9327  N  N   . LYS E  2  321 ? 87.756  -0.405  -64.360  1.00 97.71  ? 477 LYS E N   1 
ATOM   9328  C  CA  . LYS E  2  321 ? 88.992  -1.043  -63.893  1.00 108.77 ? 477 LYS E CA  1 
ATOM   9329  C  C   . LYS E  2  321 ? 90.227  -0.321  -64.468  1.00 114.03 ? 477 LYS E C   1 
ATOM   9330  O  O   . LYS E  2  321 ? 90.962  0.304   -63.672  1.00 120.32 ? 477 LYS E O   1 
ATOM   9331  C  CB  . LYS E  2  321 ? 89.016  -2.530  -64.307  1.00 96.27  ? 477 LYS E CB  1 
ATOM   9332  C  CG  . LYS E  2  321 ? 87.853  -3.342  -63.767  1.00 67.20  ? 477 LYS E CG  1 
ATOM   9333  C  CD  . LYS E  2  321 ? 87.945  -3.492  -62.268  1.00 52.49  ? 477 LYS E CD  1 
ATOM   9334  C  CE  . LYS E  2  321 ? 86.559  -3.719  -61.666  1.00 72.32  ? 477 LYS E CE  1 
ATOM   9335  N  NZ  . LYS E  2  321 ? 85.753  -4.821  -62.293  1.00 48.84  ? 477 LYS E NZ  1 
ATOM   9336  N  N   . LYS F  3  5   ? 37.739  37.544  13.786   1.00 122.43 ? 83  LYS F N   1 
ATOM   9337  C  CA  . LYS F  3  5   ? 37.144  37.902  12.466   1.00 120.94 ? 83  LYS F CA  1 
ATOM   9338  C  C   . LYS F  3  5   ? 37.352  36.788  11.453   1.00 119.35 ? 83  LYS F C   1 
ATOM   9339  O  O   . LYS F  3  5   ? 37.022  36.943  10.279   1.00 120.15 ? 83  LYS F O   1 
ATOM   9340  C  CB  . LYS F  3  5   ? 37.770  39.195  11.937   1.00 124.10 ? 83  LYS F CB  1 
ATOM   9341  C  CG  . LYS F  3  5   ? 39.271  39.114  11.684   1.00 125.55 ? 83  LYS F CG  1 
ATOM   9342  C  CD  . LYS F  3  5   ? 39.856  40.490  11.398   1.00 128.41 ? 83  LYS F CD  1 
ATOM   9343  C  CE  . LYS F  3  5   ? 39.682  41.427  12.594   1.00 128.87 ? 83  LYS F CE  1 
ATOM   9344  N  NZ  . LYS F  3  5   ? 40.212  42.793  12.335   1.00 127.70 ? 83  LYS F NZ  1 
ATOM   9345  N  N   . THR F  3  6   ? 37.906  35.670  11.911   1.00 118.21 ? 84  THR F N   1 
ATOM   9346  C  CA  . THR F  3  6   ? 38.152  34.525  11.042   1.00 122.17 ? 84  THR F CA  1 
ATOM   9347  C  C   . THR F  3  6   ? 36.837  34.030  10.448   1.00 125.70 ? 84  THR F C   1 
ATOM   9348  O  O   . THR F  3  6   ? 36.717  33.864  9.233    1.00 130.05 ? 84  THR F O   1 
ATOM   9349  C  CB  . THR F  3  6   ? 38.828  33.369  11.814   1.00 120.38 ? 84  THR F CB  1 
ATOM   9350  O  OG1 . THR F  3  6   ? 40.143  33.770  12.213   1.00 129.16 ? 84  THR F OG1 1 
ATOM   9351  C  CG2 . THR F  3  6   ? 38.937  32.130  10.948   1.00 117.01 ? 84  THR F CG2 1 
ATOM   9352  N  N   . VAL F  3  7   ? 35.852  33.799  11.310   1.00 124.17 ? 85  VAL F N   1 
ATOM   9353  C  CA  . VAL F  3  7   ? 34.546  33.333  10.863   1.00 116.85 ? 85  VAL F CA  1 
ATOM   9354  C  C   . VAL F  3  7   ? 34.079  34.245  9.739    1.00 110.30 ? 85  VAL F C   1 
ATOM   9355  O  O   . VAL F  3  7   ? 33.437  33.803  8.793    1.00 108.37 ? 85  VAL F O   1 
ATOM   9356  C  CB  . VAL F  3  7   ? 33.508  33.389  12.007   1.00 119.44 ? 85  VAL F CB  1 
ATOM   9357  C  CG1 . VAL F  3  7   ? 32.246  32.642  11.604   1.00 118.21 ? 85  VAL F CG1 1 
ATOM   9358  C  CG2 . VAL F  3  7   ? 34.101  32.802  13.282   1.00 122.87 ? 85  VAL F CG2 1 
ATOM   9359  N  N   . GLN F  3  8   ? 34.423  35.523  9.851    1.00 109.15 ? 86  GLN F N   1 
ATOM   9360  C  CA  . GLN F  3  8   ? 34.047  36.521  8.858    1.00 108.81 ? 86  GLN F CA  1 
ATOM   9361  C  C   . GLN F  3  8   ? 34.980  36.505  7.654    1.00 107.50 ? 86  GLN F C   1 
ATOM   9362  O  O   . GLN F  3  8   ? 34.602  36.935  6.563    1.00 108.68 ? 86  GLN F O   1 
ATOM   9363  C  CB  . GLN F  3  8   ? 34.062  37.914  9.487    1.00 109.10 ? 86  GLN F CB  1 
ATOM   9364  C  CG  . GLN F  3  8   ? 33.776  39.032  8.508    1.00 114.85 ? 86  GLN F CG  1 
ATOM   9365  C  CD  . GLN F  3  8   ? 34.474  40.315  8.892    1.00 119.84 ? 86  GLN F CD  1 
ATOM   9366  O  OE1 . GLN F  3  8   ? 35.703  40.371  8.942    1.00 123.42 ? 86  GLN F OE1 1 
ATOM   9367  N  NE2 . GLN F  3  8   ? 33.696  41.356  9.168    1.00 120.73 ? 86  GLN F NE2 1 
ATOM   9368  N  N   . LYS F  3  9   ? 36.203  36.023  7.857    1.00 105.40 ? 87  LYS F N   1 
ATOM   9369  C  CA  . LYS F  3  9   ? 37.179  35.954  6.776    1.00 101.11 ? 87  LYS F CA  1 
ATOM   9370  C  C   . LYS F  3  9   ? 37.022  34.671  5.979    1.00 96.84  ? 87  LYS F C   1 
ATOM   9371  O  O   . LYS F  3  9   ? 37.147  34.680  4.755    1.00 97.32  ? 87  LYS F O   1 
ATOM   9372  C  CB  . LYS F  3  9   ? 38.601  36.054  7.325    1.00 101.73 ? 87  LYS F CB  1 
ATOM   9373  C  CG  . LYS F  3  9   ? 38.987  37.456  7.760    1.00 107.28 ? 87  LYS F CG  1 
ATOM   9374  C  CD  . LYS F  3  9   ? 38.966  38.420  6.587    1.00 104.60 ? 87  LYS F CD  1 
ATOM   9375  C  CE  . LYS F  3  9   ? 39.246  39.833  7.049    1.00 107.57 ? 87  LYS F CE  1 
ATOM   9376  N  NZ  . LYS F  3  9   ? 39.171  40.787  5.916    1.00 110.61 ? 87  LYS F NZ  1 
ATOM   9377  N  N   . ILE F  3  10  ? 36.741  33.570  6.671    1.00 91.08  ? 88  ILE F N   1 
ATOM   9378  C  CA  . ILE F  3  10  ? 36.548  32.286  6.008    1.00 91.92  ? 88  ILE F CA  1 
ATOM   9379  C  C   . ILE F  3  10  ? 35.441  32.434  4.969    1.00 93.12  ? 88  ILE F C   1 
ATOM   9380  O  O   . ILE F  3  10  ? 35.181  31.520  4.185    1.00 94.55  ? 88  ILE F O   1 
ATOM   9381  C  CB  . ILE F  3  10  ? 36.137  31.195  7.008    1.00 94.94  ? 88  ILE F CB  1 
ATOM   9382  C  CG1 . ILE F  3  10  ? 37.165  31.111  8.133    1.00 97.47  ? 88  ILE F CG1 1 
ATOM   9383  C  CG2 . ILE F  3  10  ? 36.033  29.850  6.302    1.00 90.74  ? 88  ILE F CG2 1 
ATOM   9384  C  CD1 . ILE F  3  10  ? 36.736  30.217  9.273    1.00 105.42 ? 88  ILE F CD1 1 
ATOM   9385  N  N   . LEU F  3  11  ? 34.783  33.592  4.986    1.00 95.78  ? 89  LEU F N   1 
ATOM   9386  C  CA  . LEU F  3  11  ? 33.714  33.912  4.043    1.00 91.72  ? 89  LEU F CA  1 
ATOM   9387  C  C   . LEU F  3  11  ? 34.311  34.675  2.865    1.00 91.59  ? 89  LEU F C   1 
ATOM   9388  O  O   . LEU F  3  11  ? 34.368  34.157  1.746    1.00 93.13  ? 89  LEU F O   1 
ATOM   9389  C  CB  . LEU F  3  11  ? 32.646  34.771  4.710    1.00 79.21  ? 89  LEU F CB  1 
ATOM   9390  C  CG  . LEU F  3  11  ? 31.261  34.137  4.760    1.00 73.84  ? 89  LEU F CG  1 
ATOM   9391  C  CD1 . LEU F  3  11  ? 31.281  32.927  5.663    1.00 70.94  ? 89  LEU F CD1 1 
ATOM   9392  C  CD2 . LEU F  3  11  ? 30.269  35.155  5.270    1.00 78.29  ? 89  LEU F CD2 1 
ATOM   9393  N  N   . GLU F  3  12  ? 34.754  35.906  3.118    1.00 85.13  ? 90  GLU F N   1 
ATOM   9394  C  CA  . GLU F  3  12  ? 35.370  36.719  2.076    1.00 87.05  ? 90  GLU F CA  1 
ATOM   9395  C  C   . GLU F  3  12  ? 36.320  35.831  1.281    1.00 91.76  ? 90  GLU F C   1 
ATOM   9396  O  O   . GLU F  3  12  ? 36.357  35.880  0.052    1.00 93.16  ? 90  GLU F O   1 
ATOM   9397  C  CB  . GLU F  3  12  ? 36.151  37.877  2.691    1.00 78.48  ? 90  GLU F CB  1 
ATOM   9398  C  CG  . GLU F  3  12  ? 35.284  38.923  3.352    1.00 94.25  ? 90  GLU F CG  1 
ATOM   9399  C  CD  . GLU F  3  12  ? 36.101  39.974  4.070    1.00 101.70 ? 90  GLU F CD  1 
ATOM   9400  O  OE1 . GLU F  3  12  ? 35.514  40.972  4.551    1.00 99.62  ? 90  GLU F OE1 1 
ATOM   9401  O  OE2 . GLU F  3  12  ? 37.336  39.795  4.155    1.00 107.15 ? 90  GLU F OE2 1 
ATOM   9402  N  N   . GLU F  3  13  ? 37.089  35.013  1.992    1.00 93.87  ? 91  GLU F N   1 
ATOM   9403  C  CA  . GLU F  3  13  ? 38.017  34.108  1.337    1.00 94.53  ? 91  GLU F CA  1 
ATOM   9404  C  C   . GLU F  3  13  ? 37.248  33.290  0.312    1.00 93.65  ? 91  GLU F C   1 
ATOM   9405  O  O   . GLU F  3  13  ? 37.664  33.195  -0.840   1.00 103.36 ? 91  GLU F O   1 
ATOM   9406  C  CB  . GLU F  3  13  ? 38.677  33.169  2.351    1.00 99.70  ? 91  GLU F CB  1 
ATOM   9407  C  CG  . GLU F  3  13  ? 39.620  33.848  3.331    1.00 108.03 ? 91  GLU F CG  1 
ATOM   9408  C  CD  . GLU F  3  13  ? 40.845  34.451  2.663    1.00 114.07 ? 91  GLU F CD  1 
ATOM   9409  O  OE1 . GLU F  3  13  ? 40.682  35.353  1.813    1.00 109.90 ? 91  GLU F OE1 1 
ATOM   9410  O  OE2 . GLU F  3  13  ? 41.972  34.022  2.995    1.00 116.88 ? 91  GLU F OE2 1 
ATOM   9411  N  N   . VAL F  3  14  ? 36.122  32.712  0.727    1.00 82.93  ? 92  VAL F N   1 
ATOM   9412  C  CA  . VAL F  3  14  ? 35.316  31.905  -0.178   1.00 73.79  ? 92  VAL F CA  1 
ATOM   9413  C  C   . VAL F  3  14  ? 34.636  32.740  -1.268   1.00 76.59  ? 92  VAL F C   1 
ATOM   9414  O  O   . VAL F  3  14  ? 34.395  32.246  -2.369   1.00 76.69  ? 92  VAL F O   1 
ATOM   9415  C  CB  . VAL F  3  14  ? 34.260  31.109  0.579    1.00 60.12  ? 92  VAL F CB  1 
ATOM   9416  C  CG1 . VAL F  3  14  ? 33.460  30.258  -0.391   1.00 63.71  ? 92  VAL F CG1 1 
ATOM   9417  C  CG2 . VAL F  3  14  ? 34.928  30.228  1.604    1.00 59.47  ? 92  VAL F CG2 1 
ATOM   9418  N  N   . ARG F  3  15  ? 34.326  33.997  -0.971   1.00 64.87  ? 93  ARG F N   1 
ATOM   9419  C  CA  . ARG F  3  15  ? 33.711  34.849  -1.972   1.00 70.72  ? 93  ARG F CA  1 
ATOM   9420  C  C   . ARG F  3  15  ? 34.743  35.036  -3.076   1.00 76.26  ? 93  ARG F C   1 
ATOM   9421  O  O   . ARG F  3  15  ? 34.410  35.160  -4.254   1.00 77.57  ? 93  ARG F O   1 
ATOM   9422  C  CB  . ARG F  3  15  ? 33.337  36.210  -1.371   1.00 82.36  ? 93  ARG F CB  1 
ATOM   9423  C  CG  . ARG F  3  15  ? 32.861  37.221  -2.408   1.00 93.14  ? 93  ARG F CG  1 
ATOM   9424  C  CD  . ARG F  3  15  ? 32.305  38.483  -1.779   1.00 97.29  ? 93  ARG F CD  1 
ATOM   9425  N  NE  . ARG F  3  15  ? 31.840  39.422  -2.799   1.00 110.60 ? 93  ARG F NE  1 
ATOM   9426  C  CZ  . ARG F  3  15  ? 31.168  40.544  -2.545   1.00 115.52 ? 93  ARG F CZ  1 
ATOM   9427  N  NH1 . ARG F  3  15  ? 30.873  40.878  -1.295   1.00 121.39 ? 93  ARG F NH1 1 
ATOM   9428  N  NH2 . ARG F  3  15  ? 30.794  41.337  -3.541   1.00 111.41 ? 93  ARG F NH2 1 
ATOM   9429  N  N   . ILE F  3  16  ? 36.007  35.044  -2.674   1.00 80.84  ? 94  ILE F N   1 
ATOM   9430  C  CA  . ILE F  3  16  ? 37.123  35.210  -3.595   1.00 82.46  ? 94  ILE F CA  1 
ATOM   9431  C  C   . ILE F  3  16  ? 37.409  33.915  -4.357   1.00 82.62  ? 94  ILE F C   1 
ATOM   9432  O  O   . ILE F  3  16  ? 37.537  33.928  -5.578   1.00 85.56  ? 94  ILE F O   1 
ATOM   9433  C  CB  . ILE F  3  16  ? 38.402  35.630  -2.833   1.00 82.23  ? 94  ILE F CB  1 
ATOM   9434  C  CG1 . ILE F  3  16  ? 38.199  37.001  -2.181   1.00 72.20  ? 94  ILE F CG1 1 
ATOM   9435  C  CG2 . ILE F  3  16  ? 39.590  35.639  -3.775   1.00 86.81  ? 94  ILE F CG2 1 
ATOM   9436  C  CD1 . ILE F  3  16  ? 37.910  38.117  -3.156   1.00 74.86  ? 94  ILE F CD1 1 
ATOM   9437  N  N   . LEU F  3  17  ? 37.516  32.803  -3.634   1.00 78.54  ? 95  LEU F N   1 
ATOM   9438  C  CA  . LEU F  3  17  ? 37.785  31.511  -4.261   1.00 82.68  ? 95  LEU F CA  1 
ATOM   9439  C  C   . LEU F  3  17  ? 36.732  31.151  -5.303   1.00 84.21  ? 95  LEU F C   1 
ATOM   9440  O  O   . LEU F  3  17  ? 36.988  30.364  -6.211   1.00 91.37  ? 95  LEU F O   1 
ATOM   9441  C  CB  . LEU F  3  17  ? 37.851  30.390  -3.217   1.00 79.35  ? 95  LEU F CB  1 
ATOM   9442  C  CG  . LEU F  3  17  ? 39.104  30.233  -2.354   1.00 70.28  ? 95  LEU F CG  1 
ATOM   9443  C  CD1 . LEU F  3  17  ? 39.062  28.882  -1.634   1.00 56.56  ? 95  LEU F CD1 1 
ATOM   9444  C  CD2 . LEU F  3  17  ? 40.333  30.313  -3.228   1.00 61.36  ? 95  LEU F CD2 1 
ATOM   9445  N  N   . GLU F  3  18  ? 35.540  31.709  -5.164   1.00 80.12  ? 96  GLU F N   1 
ATOM   9446  C  CA  . GLU F  3  18  ? 34.491  31.432  -6.120   1.00 76.72  ? 96  GLU F CA  1 
ATOM   9447  C  C   . GLU F  3  18  ? 34.769  32.269  -7.363   1.00 73.69  ? 96  GLU F C   1 
ATOM   9448  O  O   . GLU F  3  18  ? 34.723  31.761  -8.480   1.00 71.81  ? 96  GLU F O   1 
ATOM   9449  C  CB  . GLU F  3  18  ? 33.121  31.774  -5.519   1.00 84.12  ? 96  GLU F CB  1 
ATOM   9450  C  CG  . GLU F  3  18  ? 32.727  30.876  -4.347   1.00 90.28  ? 96  GLU F CG  1 
ATOM   9451  C  CD  . GLU F  3  18  ? 31.316  31.136  -3.825   1.00 90.21  ? 96  GLU F CD  1 
ATOM   9452  O  OE1 . GLU F  3  18  ? 31.051  32.261  -3.339   1.00 75.92  ? 96  GLU F OE1 1 
ATOM   9453  O  OE2 . GLU F  3  18  ? 30.480  30.202  -3.902   1.00 83.95  ? 96  GLU F OE2 1 
ATOM   9454  N  N   . GLN F  3  19  ? 35.076  33.548  -7.158   1.00 71.66  ? 97  GLN F N   1 
ATOM   9455  C  CA  . GLN F  3  19  ? 35.363  34.457  -8.264   1.00 74.79  ? 97  GLN F CA  1 
ATOM   9456  C  C   . GLN F  3  19  ? 36.497  33.915  -9.118   1.00 67.80  ? 97  GLN F C   1 
ATOM   9457  O  O   . GLN F  3  19  ? 36.450  33.980  -10.347  1.00 69.75  ? 97  GLN F O   1 
ATOM   9458  C  CB  . GLN F  3  19  ? 35.744  35.838  -7.735   1.00 88.71  ? 97  GLN F CB  1 
ATOM   9459  C  CG  . GLN F  3  19  ? 34.670  36.500  -6.887   1.00 103.31 ? 97  GLN F CG  1 
ATOM   9460  C  CD  . GLN F  3  19  ? 35.148  37.799  -6.254   1.00 116.71 ? 97  GLN F CD  1 
ATOM   9461  O  OE1 . GLN F  3  19  ? 35.338  38.812  -6.939   1.00 114.09 ? 97  GLN F OE1 1 
ATOM   9462  N  NE2 . GLN F  3  19  ? 35.356  37.771  -4.939   1.00 115.91 ? 97  GLN F NE2 1 
ATOM   9463  N  N   . ILE F  3  20  ? 37.518  33.384  -8.459   1.00 65.17  ? 98  ILE F N   1 
ATOM   9464  C  CA  . ILE F  3  20  ? 38.657  32.807  -9.160   1.00 67.12  ? 98  ILE F CA  1 
ATOM   9465  C  C   . ILE F  3  20  ? 38.215  31.584  -9.973   1.00 66.80  ? 98  ILE F C   1 
ATOM   9466  O  O   . ILE F  3  20  ? 38.308  31.587  -11.199  1.00 64.50  ? 98  ILE F O   1 
ATOM   9467  C  CB  . ILE F  3  20  ? 39.769  32.377  -8.177   1.00 67.25  ? 98  ILE F CB  1 
ATOM   9468  C  CG1 . ILE F  3  20  ? 40.290  33.585  -7.406   1.00 63.47  ? 98  ILE F CG1 1 
ATOM   9469  C  CG2 . ILE F  3  20  ? 40.911  31.755  -8.934   1.00 78.87  ? 98  ILE F CG2 1 
ATOM   9470  C  CD1 . ILE F  3  20  ? 40.741  34.719  -8.297   1.00 81.15  ? 98  ILE F CD1 1 
ATOM   9471  N  N   . GLY F  3  21  ? 37.734  30.548  -9.285   1.00 63.68  ? 99  GLY F N   1 
ATOM   9472  C  CA  . GLY F  3  21  ? 37.279  29.342  -9.959   1.00 67.22  ? 99  GLY F CA  1 
ATOM   9473  C  C   . GLY F  3  21  ? 36.551  29.635  -11.261  1.00 71.35  ? 99  GLY F C   1 
ATOM   9474  O  O   . GLY F  3  21  ? 36.851  29.051  -12.306  1.00 67.50  ? 99  GLY F O   1 
ATOM   9475  N  N   . VAL F  3  22  ? 35.589  30.550  -11.199  1.00 73.42  ? 100 VAL F N   1 
ATOM   9476  C  CA  . VAL F  3  22  ? 34.824  30.940  -12.375  1.00 70.36  ? 100 VAL F CA  1 
ATOM   9477  C  C   . VAL F  3  22  ? 35.767  31.407  -13.486  1.00 75.60  ? 100 VAL F C   1 
ATOM   9478  O  O   . VAL F  3  22  ? 35.630  30.989  -14.638  1.00 79.72  ? 100 VAL F O   1 
ATOM   9479  C  CB  . VAL F  3  22  ? 33.816  32.064  -12.035  1.00 59.09  ? 100 VAL F CB  1 
ATOM   9480  C  CG1 . VAL F  3  22  ? 33.195  32.613  -13.303  1.00 64.08  ? 100 VAL F CG1 1 
ATOM   9481  C  CG2 . VAL F  3  22  ? 32.725  31.518  -11.127  1.00 60.30  ? 100 VAL F CG2 1 
ATOM   9482  N  N   . SER F  3  23  ? 36.723  32.271  -13.151  1.00 70.47  ? 101 SER F N   1 
ATOM   9483  C  CA  . SER F  3  23  ? 37.675  32.734  -14.156  1.00 68.14  ? 101 SER F CA  1 
ATOM   9484  C  C   . SER F  3  23  ? 38.471  31.538  -14.671  1.00 70.47  ? 101 SER F C   1 
ATOM   9485  O  O   . SER F  3  23  ? 38.795  31.451  -15.856  1.00 70.76  ? 101 SER F O   1 
ATOM   9486  C  CB  . SER F  3  23  ? 38.625  33.772  -13.566  1.00 58.85  ? 101 SER F CB  1 
ATOM   9487  O  OG  . SER F  3  23  ? 37.914  34.942  -13.218  1.00 81.67  ? 101 SER F OG  1 
ATOM   9488  N  N   . HIS F  3  24  ? 38.787  30.611  -13.779  1.00 68.49  ? 102 HIS F N   1 
ATOM   9489  C  CA  . HIS F  3  24  ? 39.516  29.433  -14.193  1.00 70.84  ? 102 HIS F CA  1 
ATOM   9490  C  C   . HIS F  3  24  ? 38.673  28.666  -15.189  1.00 73.05  ? 102 HIS F C   1 
ATOM   9491  O  O   . HIS F  3  24  ? 39.209  28.023  -16.091  1.00 73.25  ? 102 HIS F O   1 
ATOM   9492  C  CB  . HIS F  3  24  ? 39.853  28.560  -12.991  1.00 76.51  ? 102 HIS F CB  1 
ATOM   9493  C  CG  . HIS F  3  24  ? 41.034  29.051  -12.216  1.00 74.58  ? 102 HIS F CG  1 
ATOM   9494  N  ND1 . HIS F  3  24  ? 41.516  28.406  -11.098  1.00 68.60  ? 102 HIS F ND1 1 
ATOM   9495  C  CD2 . HIS F  3  24  ? 41.844  30.118  -12.416  1.00 64.14  ? 102 HIS F CD2 1 
ATOM   9496  C  CE1 . HIS F  3  24  ? 42.575  29.054  -10.645  1.00 68.02  ? 102 HIS F CE1 1 
ATOM   9497  N  NE2 . HIS F  3  24  ? 42.795  30.096  -11.427  1.00 55.58  ? 102 HIS F NE2 1 
ATOM   9498  N  N   . ASP F  3  25  ? 37.353  28.741  -15.031  1.00 67.72  ? 103 ASP F N   1 
ATOM   9499  C  CA  . ASP F  3  25  ? 36.448  28.062  -15.951  1.00 67.16  ? 103 ASP F CA  1 
ATOM   9500  C  C   . ASP F  3  25  ? 36.452  28.770  -17.308  1.00 60.37  ? 103 ASP F C   1 
ATOM   9501  O  O   . ASP F  3  25  ? 36.105  28.177  -18.327  1.00 66.05  ? 103 ASP F O   1 
ATOM   9502  C  CB  . ASP F  3  25  ? 35.023  28.031  -15.394  1.00 76.20  ? 103 ASP F CB  1 
ATOM   9503  C  CG  . ASP F  3  25  ? 34.878  27.113  -14.198  1.00 73.63  ? 103 ASP F CG  1 
ATOM   9504  O  OD1 . ASP F  3  25  ? 35.363  25.962  -14.261  1.00 81.03  ? 103 ASP F OD1 1 
ATOM   9505  O  OD2 . ASP F  3  25  ? 34.263  27.542  -13.199  1.00 74.59  ? 103 ASP F OD2 1 
ATOM   9506  N  N   . ALA F  3  26  ? 36.843  30.040  -17.311  1.00 50.88  ? 104 ALA F N   1 
ATOM   9507  C  CA  . ALA F  3  26  ? 36.922  30.818  -18.542  1.00 41.43  ? 104 ALA F CA  1 
ATOM   9508  C  C   . ALA F  3  26  ? 38.273  30.559  -19.196  1.00 48.58  ? 104 ALA F C   1 
ATOM   9509  O  O   . ALA F  3  26  ? 38.364  30.298  -20.406  1.00 34.70  ? 104 ALA F O   1 
ATOM   9510  C  CB  . ALA F  3  26  ? 36.792  32.287  -18.237  1.00 32.49  ? 104 ALA F CB  1 
ATOM   9511  N  N   . GLN F  3  27  ? 39.322  30.652  -18.382  1.00 52.08  ? 105 GLN F N   1 
ATOM   9512  C  CA  . GLN F  3  27  ? 40.676  30.430  -18.849  1.00 53.09  ? 105 GLN F CA  1 
ATOM   9513  C  C   . GLN F  3  27  ? 40.821  29.040  -19.430  1.00 56.58  ? 105 GLN F C   1 
ATOM   9514  O  O   . GLN F  3  27  ? 41.572  28.835  -20.372  1.00 64.44  ? 105 GLN F O   1 
ATOM   9515  C  CB  . GLN F  3  27  ? 41.654  30.623  -17.708  1.00 61.61  ? 105 GLN F CB  1 
ATOM   9516  C  CG  . GLN F  3  27  ? 41.772  32.055  -17.250  1.00 66.21  ? 105 GLN F CG  1 
ATOM   9517  C  CD  . GLN F  3  27  ? 42.827  32.230  -16.180  1.00 67.34  ? 105 GLN F CD  1 
ATOM   9518  O  OE1 . GLN F  3  27  ? 43.966  31.778  -16.333  1.00 76.98  ? 105 GLN F OE1 1 
ATOM   9519  N  NE2 . GLN F  3  27  ? 42.458  32.890  -15.092  1.00 68.59  ? 105 GLN F NE2 1 
ATOM   9520  N  N   . ILE F  3  28  ? 40.107  28.079  -18.864  1.00 64.41  ? 106 ILE F N   1 
ATOM   9521  C  CA  . ILE F  3  28  ? 40.152  26.721  -19.381  1.00 69.31  ? 106 ILE F CA  1 
ATOM   9522  C  C   . ILE F  3  28  ? 39.574  26.711  -20.799  1.00 72.98  ? 106 ILE F C   1 
ATOM   9523  O  O   . ILE F  3  28  ? 40.059  25.994  -21.677  1.00 78.60  ? 106 ILE F O   1 
ATOM   9524  C  CB  . ILE F  3  28  ? 39.357  25.748  -18.476  1.00 71.17  ? 106 ILE F CB  1 
ATOM   9525  C  CG1 . ILE F  3  28  ? 40.240  25.317  -17.299  1.00 66.64  ? 106 ILE F CG1 1 
ATOM   9526  C  CG2 . ILE F  3  28  ? 38.872  24.544  -19.278  1.00 72.28  ? 106 ILE F CG2 1 
ATOM   9527  C  CD1 . ILE F  3  28  ? 39.585  24.322  -16.371  1.00 57.45  ? 106 ILE F CD1 1 
ATOM   9528  N  N   . GLN F  3  29  ? 38.546  27.520  -21.026  1.00 72.58  ? 107 GLN F N   1 
ATOM   9529  C  CA  . GLN F  3  29  ? 37.936  27.587  -22.344  1.00 76.59  ? 107 GLN F CA  1 
ATOM   9530  C  C   . GLN F  3  29  ? 38.834  28.349  -23.295  1.00 67.72  ? 107 GLN F C   1 
ATOM   9531  O  O   . GLN F  3  29  ? 38.952  28.012  -24.477  1.00 67.48  ? 107 GLN F O   1 
ATOM   9532  C  CB  . GLN F  3  29  ? 36.565  28.259  -22.270  1.00 87.23  ? 107 GLN F CB  1 
ATOM   9533  C  CG  . GLN F  3  29  ? 35.594  27.504  -21.381  1.00 104.26 ? 107 GLN F CG  1 
ATOM   9534  C  CD  . GLN F  3  29  ? 35.804  25.996  -21.447  1.00 109.14 ? 107 GLN F CD  1 
ATOM   9535  O  OE1 . GLN F  3  29  ? 35.716  25.385  -22.518  1.00 105.50 ? 107 GLN F OE1 1 
ATOM   9536  N  NE2 . GLN F  3  29  ? 36.089  25.390  -20.295  1.00 112.47 ? 107 GLN F NE2 1 
ATOM   9537  N  N   . GLU F  3  30  ? 39.480  29.378  -22.775  1.00 58.64  ? 108 GLU F N   1 
ATOM   9538  C  CA  . GLU F  3  30  ? 40.364  30.160  -23.608  1.00 61.31  ? 108 GLU F CA  1 
ATOM   9539  C  C   . GLU F  3  30  ? 41.489  29.269  -24.108  1.00 58.35  ? 108 GLU F C   1 
ATOM   9540  O  O   . GLU F  3  30  ? 42.069  29.534  -25.156  1.00 69.66  ? 108 GLU F O   1 
ATOM   9541  C  CB  . GLU F  3  30  ? 40.938  31.341  -22.831  1.00 57.90  ? 108 GLU F CB  1 
ATOM   9542  C  CG  . GLU F  3  30  ? 41.757  32.262  -23.698  1.00 70.40  ? 108 GLU F CG  1 
ATOM   9543  C  CD  . GLU F  3  30  ? 42.654  33.153  -22.889  1.00 72.31  ? 108 GLU F CD  1 
ATOM   9544  O  OE1 . GLU F  3  30  ? 43.324  32.630  -21.977  1.00 76.91  ? 108 GLU F OE1 1 
ATOM   9545  O  OE2 . GLU F  3  30  ? 42.697  34.367  -23.170  1.00 78.41  ? 108 GLU F OE2 1 
ATOM   9546  N  N   . LEU F  3  31  ? 41.796  28.212  -23.362  1.00 63.00  ? 109 LEU F N   1 
ATOM   9547  C  CA  . LEU F  3  31  ? 42.853  27.292  -23.762  1.00 60.56  ? 109 LEU F CA  1 
ATOM   9548  C  C   . LEU F  3  31  ? 42.363  26.325  -24.814  1.00 63.09  ? 109 LEU F C   1 
ATOM   9549  O  O   . LEU F  3  31  ? 43.099  26.001  -25.746  1.00 68.54  ? 109 LEU F O   1 
ATOM   9550  C  CB  . LEU F  3  31  ? 43.390  26.513  -22.564  1.00 55.60  ? 109 LEU F CB  1 
ATOM   9551  C  CG  . LEU F  3  31  ? 44.125  27.364  -21.525  1.00 61.83  ? 109 LEU F CG  1 
ATOM   9552  C  CD1 . LEU F  3  31  ? 44.988  26.462  -20.666  1.00 51.59  ? 109 LEU F CD1 1 
ATOM   9553  C  CD2 . LEU F  3  31  ? 44.992  28.414  -22.213  1.00 48.74  ? 109 LEU F CD2 1 
ATOM   9554  N  N   . SER F  3  32  ? 41.125  25.858  -24.667  1.00 62.81  ? 110 SER F N   1 
ATOM   9555  C  CA  . SER F  3  32  ? 40.558  24.937  -25.642  1.00 61.36  ? 110 SER F CA  1 
ATOM   9556  C  C   . SER F  3  32  ? 40.356  25.647  -26.969  1.00 61.74  ? 110 SER F C   1 
ATOM   9557  O  O   . SER F  3  32  ? 40.536  25.055  -28.033  1.00 62.90  ? 110 SER F O   1 
ATOM   9558  C  CB  . SER F  3  32  ? 39.238  24.365  -25.140  1.00 58.36  ? 110 SER F CB  1 
ATOM   9559  O  OG  . SER F  3  32  ? 39.481  23.392  -24.145  1.00 51.66  ? 110 SER F OG  1 
ATOM   9560  N  N   . GLU F  3  33  ? 39.980  26.916  -26.907  1.00 61.84  ? 111 GLU F N   1 
ATOM   9561  C  CA  . GLU F  3  33  ? 39.806  27.690  -28.125  1.00 67.64  ? 111 GLU F CA  1 
ATOM   9562  C  C   . GLU F  3  33  ? 41.200  27.753  -28.752  1.00 66.72  ? 111 GLU F C   1 
ATOM   9563  O  O   . GLU F  3  33  ? 41.404  27.434  -29.927  1.00 60.32  ? 111 GLU F O   1 
ATOM   9564  C  CB  . GLU F  3  33  ? 39.314  29.104  -27.784  1.00 66.09  ? 111 GLU F CB  1 
ATOM   9565  C  CG  . GLU F  3  33  ? 39.155  30.030  -28.983  1.00 68.99  ? 111 GLU F CG  1 
ATOM   9566  C  CD  . GLU F  3  33  ? 38.422  29.359  -30.130  1.00 80.49  ? 111 GLU F CD  1 
ATOM   9567  O  OE1 . GLU F  3  33  ? 37.513  28.546  -29.840  1.00 76.38  ? 111 GLU F OE1 1 
ATOM   9568  O  OE2 . GLU F  3  33  ? 38.746  29.645  -31.309  1.00 67.63  ? 111 GLU F OE2 1 
ATOM   9569  N  N   . MET F  3  34  ? 42.158  28.144  -27.923  1.00 63.77  ? 112 MET F N   1 
ATOM   9570  C  CA  . MET F  3  34  ? 43.541  28.283  -28.326  1.00 65.32  ? 112 MET F CA  1 
ATOM   9571  C  C   . MET F  3  34  ? 44.066  26.994  -28.923  1.00 63.06  ? 112 MET F C   1 
ATOM   9572  O  O   . MET F  3  34  ? 44.838  27.011  -29.874  1.00 69.92  ? 112 MET F O   1 
ATOM   9573  C  CB  . MET F  3  34  ? 44.384  28.676  -27.116  1.00 72.41  ? 112 MET F CB  1 
ATOM   9574  C  CG  . MET F  3  34  ? 45.592  29.529  -27.443  1.00 83.17  ? 112 MET F CG  1 
ATOM   9575  S  SD  . MET F  3  34  ? 46.320  30.259  -25.964  1.00 83.49  ? 112 MET F SD  1 
ATOM   9576  C  CE  . MET F  3  34  ? 44.939  31.203  -25.334  1.00 75.38  ? 112 MET F CE  1 
ATOM   9577  N  N   . TRP F  3  35  ? 43.646  25.869  -28.368  1.00 64.25  ? 113 TRP F N   1 
ATOM   9578  C  CA  . TRP F  3  35  ? 44.107  24.589  -28.872  1.00 62.23  ? 113 TRP F CA  1 
ATOM   9579  C  C   . TRP F  3  35  ? 43.482  24.257  -30.215  1.00 59.58  ? 113 TRP F C   1 
ATOM   9580  O  O   . TRP F  3  35  ? 44.174  23.803  -31.120  1.00 56.50  ? 113 TRP F O   1 
ATOM   9581  C  CB  . TRP F  3  35  ? 43.789  23.475  -27.885  1.00 61.28  ? 113 TRP F CB  1 
ATOM   9582  C  CG  . TRP F  3  35  ? 44.431  22.188  -28.268  1.00 64.88  ? 113 TRP F CG  1 
ATOM   9583  C  CD1 . TRP F  3  35  ? 45.743  21.848  -28.110  1.00 60.38  ? 113 TRP F CD1 1 
ATOM   9584  C  CD2 . TRP F  3  35  ? 43.806  21.082  -28.919  1.00 60.50  ? 113 TRP F CD2 1 
ATOM   9585  N  NE1 . TRP F  3  35  ? 45.973  20.597  -28.624  1.00 66.99  ? 113 TRP F NE1 1 
ATOM   9586  C  CE2 . TRP F  3  35  ? 44.799  20.105  -29.128  1.00 63.70  ? 113 TRP F CE2 1 
ATOM   9587  C  CE3 . TRP F  3  35  ? 42.503  20.823  -29.348  1.00 61.90  ? 113 TRP F CE3 1 
ATOM   9588  C  CZ2 . TRP F  3  35  ? 44.529  18.889  -29.746  1.00 72.30  ? 113 TRP F CZ2 1 
ATOM   9589  C  CZ3 . TRP F  3  35  ? 42.234  19.618  -29.962  1.00 67.41  ? 113 TRP F CZ3 1 
ATOM   9590  C  CH2 . TRP F  3  35  ? 43.243  18.664  -30.157  1.00 79.46  ? 113 TRP F CH2 1 
ATOM   9591  N  N   . ARG F  3  36  ? 42.172  24.468  -30.333  1.00 65.54  ? 114 ARG F N   1 
ATOM   9592  C  CA  . ARG F  3  36  ? 41.450  24.194  -31.576  1.00 64.94  ? 114 ARG F CA  1 
ATOM   9593  C  C   . ARG F  3  36  ? 42.007  25.037  -32.723  1.00 59.66  ? 114 ARG F C   1 
ATOM   9594  O  O   . ARG F  3  36  ? 42.177  24.544  -33.837  1.00 56.85  ? 114 ARG F O   1 
ATOM   9595  C  CB  . ARG F  3  36  ? 39.949  24.471  -31.398  1.00 64.20  ? 114 ARG F CB  1 
ATOM   9596  C  CG  . ARG F  3  36  ? 39.186  23.348  -30.698  1.00 85.59  ? 114 ARG F CG  1 
ATOM   9597  C  CD  . ARG F  3  36  ? 37.849  23.826  -30.122  1.00 96.58  ? 114 ARG F CD  1 
ATOM   9598  N  NE  . ARG F  3  36  ? 38.018  24.559  -28.865  1.00 98.42  ? 114 ARG F NE  1 
ATOM   9599  C  CZ  . ARG F  3  36  ? 37.087  25.332  -28.312  1.00 100.12 ? 114 ARG F CZ  1 
ATOM   9600  N  NH1 . ARG F  3  36  ? 35.909  25.483  -28.905  1.00 100.50 ? 114 ARG F NH1 1 
ATOM   9601  N  NH2 . ARG F  3  36  ? 37.336  25.957  -27.167  1.00 98.21  ? 114 ARG F NH2 1 
ATOM   9602  N  N   . VAL F  3  37  ? 42.286  26.305  -32.442  1.00 50.00  ? 115 VAL F N   1 
ATOM   9603  C  CA  . VAL F  3  37  ? 42.839  27.202  -33.440  1.00 53.55  ? 115 VAL F CA  1 
ATOM   9604  C  C   . VAL F  3  37  ? 44.157  26.606  -33.924  1.00 63.94  ? 115 VAL F C   1 
ATOM   9605  O  O   . VAL F  3  37  ? 44.392  26.443  -35.126  1.00 67.89  ? 115 VAL F O   1 
ATOM   9606  C  CB  . VAL F  3  37  ? 43.083  28.606  -32.829  1.00 66.15  ? 115 VAL F CB  1 
ATOM   9607  C  CG1 . VAL F  3  37  ? 44.191  29.344  -33.587  1.00 58.36  ? 115 VAL F CG1 1 
ATOM   9608  C  CG2 . VAL F  3  37  ? 41.787  29.414  -32.858  1.00 60.15  ? 115 VAL F CG2 1 
ATOM   9609  N  N   . ASN F  3  38  ? 45.019  26.276  -32.970  1.00 67.80  ? 116 ASN F N   1 
ATOM   9610  C  CA  . ASN F  3  38  ? 46.310  25.684  -33.282  1.00 63.45  ? 116 ASN F CA  1 
ATOM   9611  C  C   . ASN F  3  38  ? 46.154  24.411  -34.096  1.00 56.81  ? 116 ASN F C   1 
ATOM   9612  O  O   . ASN F  3  38  ? 46.778  24.256  -35.138  1.00 58.76  ? 116 ASN F O   1 
ATOM   9613  C  CB  . ASN F  3  38  ? 47.077  25.393  -31.989  1.00 54.57  ? 116 ASN F CB  1 
ATOM   9614  C  CG  . ASN F  3  38  ? 47.901  26.580  -31.528  1.00 63.05  ? 116 ASN F CG  1 
ATOM   9615  O  OD1 . ASN F  3  38  ? 47.540  27.736  -31.779  1.00 65.69  ? 116 ASN F OD1 1 
ATOM   9616  N  ND2 . ASN F  3  38  ? 49.009  26.305  -30.845  1.00 57.63  ? 116 ASN F ND2 1 
ATOM   9617  N  N   . GLN F  3  39  ? 45.312  23.503  -33.626  1.00 61.25  ? 117 GLN F N   1 
ATOM   9618  C  CA  . GLN F  3  39  ? 45.105  22.245  -34.327  1.00 69.16  ? 117 GLN F CA  1 
ATOM   9619  C  C   . GLN F  3  39  ? 44.702  22.487  -35.776  1.00 67.88  ? 117 GLN F C   1 
ATOM   9620  O  O   . GLN F  3  39  ? 44.899  21.626  -36.636  1.00 71.51  ? 117 GLN F O   1 
ATOM   9621  C  CB  . GLN F  3  39  ? 44.045  21.405  -33.613  1.00 68.71  ? 117 GLN F CB  1 
ATOM   9622  C  CG  . GLN F  3  39  ? 44.222  19.906  -33.828  1.00 72.60  ? 117 GLN F CG  1 
ATOM   9623  C  CD  . GLN F  3  39  ? 45.641  19.420  -33.519  1.00 74.50  ? 117 GLN F CD  1 
ATOM   9624  O  OE1 . GLN F  3  39  ? 46.187  19.661  -32.434  1.00 68.71  ? 117 GLN F OE1 1 
ATOM   9625  N  NE2 . GLN F  3  39  ? 46.239  18.725  -34.480  1.00 61.00  ? 117 GLN F NE2 1 
ATOM   9626  N  N   . GLN F  3  40  ? 44.140  23.661  -36.044  1.00 61.92  ? 118 GLN F N   1 
ATOM   9627  C  CA  . GLN F  3  40  ? 43.741  24.011  -37.397  1.00 58.84  ? 118 GLN F CA  1 
ATOM   9628  C  C   . GLN F  3  40  ? 44.982  24.521  -38.114  1.00 59.34  ? 118 GLN F C   1 
ATOM   9629  O  O   . GLN F  3  40  ? 45.204  24.216  -39.289  1.00 63.22  ? 118 GLN F O   1 
ATOM   9630  C  CB  . GLN F  3  40  ? 42.656  25.086  -37.368  1.00 58.86  ? 118 GLN F CB  1 
ATOM   9631  C  CG  . GLN F  3  40  ? 41.341  24.587  -36.790  1.00 79.75  ? 118 GLN F CG  1 
ATOM   9632  C  CD  . GLN F  3  40  ? 40.376  25.712  -36.452  1.00 85.80  ? 118 GLN F CD  1 
ATOM   9633  O  OE1 . GLN F  3  40  ? 39.243  25.464  -36.023  1.00 88.06  ? 118 GLN F OE1 1 
ATOM   9634  N  NE2 . GLN F  3  40  ? 40.821  26.956  -36.636  1.00 75.31  ? 118 GLN F NE2 1 
ATOM   9635  N  N   . PHE F  3  41  ? 45.794  25.289  -37.392  1.00 52.91  ? 119 PHE F N   1 
ATOM   9636  C  CA  . PHE F  3  41  ? 47.037  25.835  -37.932  1.00 44.05  ? 119 PHE F CA  1 
ATOM   9637  C  C   . PHE F  3  41  ? 47.906  24.656  -38.427  1.00 45.56  ? 119 PHE F C   1 
ATOM   9638  O  O   . PHE F  3  41  ? 48.504  24.707  -39.504  1.00 41.73  ? 119 PHE F O   1 
ATOM   9639  C  CB  . PHE F  3  41  ? 47.770  26.619  -36.826  1.00 30.37  ? 119 PHE F CB  1 
ATOM   9640  C  CG  . PHE F  3  41  ? 48.693  27.710  -37.334  1.00 17.61  ? 119 PHE F CG  1 
ATOM   9641  C  CD1 . PHE F  3  41  ? 49.393  27.570  -38.527  1.00 30.77  ? 119 PHE F CD1 1 
ATOM   9642  C  CD2 . PHE F  3  41  ? 48.882  28.865  -36.593  1.00 16.32  ? 119 PHE F CD2 1 
ATOM   9643  C  CE1 . PHE F  3  41  ? 50.268  28.565  -38.978  1.00 32.99  ? 119 PHE F CE1 1 
ATOM   9644  C  CE2 . PHE F  3  41  ? 49.754  29.867  -37.026  1.00 30.95  ? 119 PHE F CE2 1 
ATOM   9645  C  CZ  . PHE F  3  41  ? 50.449  29.718  -38.221  1.00 34.37  ? 119 PHE F CZ  1 
ATOM   9646  N  N   . VAL F  3  42  ? 47.967  23.589  -37.636  1.00 50.03  ? 120 VAL F N   1 
ATOM   9647  C  CA  . VAL F  3  42  ? 48.754  22.421  -37.999  1.00 52.96  ? 120 VAL F CA  1 
ATOM   9648  C  C   . VAL F  3  42  ? 48.236  21.831  -39.301  1.00 58.00  ? 120 VAL F C   1 
ATOM   9649  O  O   . VAL F  3  42  ? 49.007  21.346  -40.127  1.00 58.98  ? 120 VAL F O   1 
ATOM   9650  C  CB  . VAL F  3  42  ? 48.677  21.362  -36.913  1.00 59.32  ? 120 VAL F CB  1 
ATOM   9651  C  CG1 . VAL F  3  42  ? 49.620  20.221  -37.231  1.00 60.24  ? 120 VAL F CG1 1 
ATOM   9652  C  CG2 . VAL F  3  42  ? 49.019  21.984  -35.584  1.00 68.39  ? 120 VAL F CG2 1 
ATOM   9653  N  N   . THR F  3  43  ? 46.921  21.864  -39.477  1.00 59.87  ? 121 THR F N   1 
ATOM   9654  C  CA  . THR F  3  43  ? 46.312  21.354  -40.696  1.00 56.40  ? 121 THR F CA  1 
ATOM   9655  C  C   . THR F  3  43  ? 46.758  22.249  -41.851  1.00 55.93  ? 121 THR F C   1 
ATOM   9656  O  O   . THR F  3  43  ? 47.316  21.766  -42.830  1.00 56.77  ? 121 THR F O   1 
ATOM   9657  C  CB  . THR F  3  43  ? 44.769  21.363  -40.597  1.00 59.75  ? 121 THR F CB  1 
ATOM   9658  O  OG1 . THR F  3  43  ? 44.343  20.388  -39.631  1.00 39.56  ? 121 THR F OG1 1 
ATOM   9659  C  CG2 . THR F  3  43  ? 44.140  21.057  -41.962  1.00 58.57  ? 121 THR F CG2 1 
ATOM   9660  N  N   . ARG F  3  44  ? 46.520  23.551  -41.724  1.00 48.86  ? 122 ARG F N   1 
ATOM   9661  C  CA  . ARG F  3  44  ? 46.914  24.500  -42.757  1.00 44.36  ? 122 ARG F CA  1 
ATOM   9662  C  C   . ARG F  3  44  ? 48.389  24.301  -43.140  1.00 46.80  ? 122 ARG F C   1 
ATOM   9663  O  O   . ARG F  3  44  ? 48.743  24.387  -44.318  1.00 45.27  ? 122 ARG F O   1 
ATOM   9664  C  CB  . ARG F  3  44  ? 46.652  25.943  -42.277  1.00 53.13  ? 122 ARG F CB  1 
ATOM   9665  C  CG  . ARG F  3  44  ? 47.073  27.042  -43.266  1.00 58.17  ? 122 ARG F CG  1 
ATOM   9666  C  CD  . ARG F  3  44  ? 46.496  28.436  -42.944  1.00 51.34  ? 122 ARG F CD  1 
ATOM   9667  N  NE  . ARG F  3  44  ? 47.028  29.052  -41.725  1.00 63.98  ? 122 ARG F NE  1 
ATOM   9668  C  CZ  . ARG F  3  44  ? 46.576  28.818  -40.492  1.00 67.02  ? 122 ARG F CZ  1 
ATOM   9669  N  NH1 . ARG F  3  44  ? 45.569  27.968  -40.295  1.00 58.39  ? 122 ARG F NH1 1 
ATOM   9670  N  NH2 . ARG F  3  44  ? 47.126  29.442  -39.453  1.00 45.22  ? 122 ARG F NH2 1 
ATOM   9671  N  N   . LEU F  3  45  ? 49.254  24.029  -42.161  1.00 51.80  ? 123 LEU F N   1 
ATOM   9672  C  CA  . LEU F  3  45  ? 50.668  23.809  -42.475  1.00 41.82  ? 123 LEU F CA  1 
ATOM   9673  C  C   . LEU F  3  45  ? 50.822  22.432  -43.089  1.00 35.96  ? 123 LEU F C   1 
ATOM   9674  O  O   . LEU F  3  45  ? 51.673  22.225  -43.935  1.00 40.84  ? 123 LEU F O   1 
ATOM   9675  C  CB  . LEU F  3  45  ? 51.562  23.929  -41.236  1.00 38.72  ? 123 LEU F CB  1 
ATOM   9676  C  CG  . LEU F  3  45  ? 51.816  25.323  -40.626  1.00 51.11  ? 123 LEU F CG  1 
ATOM   9677  C  CD1 . LEU F  3  45  ? 52.843  25.213  -39.490  1.00 33.75  ? 123 LEU F CD1 1 
ATOM   9678  C  CD2 . LEU F  3  45  ? 52.330  26.288  -41.692  1.00 52.34  ? 123 LEU F CD2 1 
ATOM   9679  N  N   . GLN F  3  46  ? 49.996  21.481  -42.670  1.00 43.77  ? 124 GLN F N   1 
ATOM   9680  C  CA  . GLN F  3  46  ? 50.065  20.145  -43.248  1.00 48.16  ? 124 GLN F CA  1 
ATOM   9681  C  C   . GLN F  3  46  ? 49.946  20.293  -44.752  1.00 43.60  ? 124 GLN F C   1 
ATOM   9682  O  O   . GLN F  3  46  ? 50.784  19.792  -45.486  1.00 46.41  ? 124 GLN F O   1 
ATOM   9683  C  CB  . GLN F  3  46  ? 48.927  19.259  -42.732  1.00 63.14  ? 124 GLN F CB  1 
ATOM   9684  C  CG  . GLN F  3  46  ? 49.288  18.447  -41.508  1.00 80.65  ? 124 GLN F CG  1 
ATOM   9685  C  CD  . GLN F  3  46  ? 50.648  17.790  -41.653  1.00 94.25  ? 124 GLN F CD  1 
ATOM   9686  O  OE1 . GLN F  3  46  ? 50.973  17.231  -42.701  1.00 97.00  ? 124 GLN F OE1 1 
ATOM   9687  N  NE2 . GLN F  3  46  ? 51.449  17.854  -40.600  1.00 107.24 ? 124 GLN F NE2 1 
ATOM   9688  N  N   . GLN F  3  47  ? 48.899  20.998  -45.187  1.00 53.76  ? 125 GLN F N   1 
ATOM   9689  C  CA  . GLN F  3  47  ? 48.611  21.262  -46.602  1.00 56.67  ? 125 GLN F CA  1 
ATOM   9690  C  C   . GLN F  3  47  ? 49.767  22.002  -47.288  1.00 62.12  ? 125 GLN F C   1 
ATOM   9691  O  O   . GLN F  3  47  ? 50.195  21.621  -48.384  1.00 57.87  ? 125 GLN F O   1 
ATOM   9692  C  CB  . GLN F  3  47  ? 47.318  22.088  -46.723  1.00 64.85  ? 125 GLN F CB  1 
ATOM   9693  C  CG  . GLN F  3  47  ? 47.436  23.399  -47.537  1.00 81.85  ? 125 GLN F CG  1 
ATOM   9694  C  CD  . GLN F  3  47  ? 46.825  24.622  -46.834  1.00 83.98  ? 125 GLN F CD  1 
ATOM   9695  O  OE1 . GLN F  3  47  ? 45.668  24.589  -46.385  1.00 74.03  ? 125 GLN F OE1 1 
ATOM   9696  N  NE2 . GLN F  3  47  ? 47.601  25.712  -46.751  1.00 63.46  ? 125 GLN F NE2 1 
ATOM   9697  N  N   . GLN F  3  48  ? 50.266  23.059  -46.645  1.00 53.34  ? 126 GLN F N   1 
ATOM   9698  C  CA  . GLN F  3  48  ? 51.366  23.840  -47.204  1.00 43.43  ? 126 GLN F CA  1 
ATOM   9699  C  C   . GLN F  3  48  ? 52.605  22.983  -47.421  1.00 47.29  ? 126 GLN F C   1 
ATOM   9700  O  O   . GLN F  3  48  ? 53.339  23.185  -48.383  1.00 54.53  ? 126 GLN F O   1 
ATOM   9701  C  CB  . GLN F  3  48  ? 51.677  25.033  -46.294  1.00 35.87  ? 126 GLN F CB  1 
ATOM   9702  C  CG  . GLN F  3  48  ? 50.521  26.047  -46.268  1.00 57.03  ? 126 GLN F CG  1 
ATOM   9703  C  CD  . GLN F  3  48  ? 50.758  27.273  -45.398  1.00 56.96  ? 126 GLN F CD  1 
ATOM   9704  O  OE1 . GLN F  3  48  ? 51.810  27.928  -45.463  1.00 66.75  ? 126 GLN F OE1 1 
ATOM   9705  N  NE2 . GLN F  3  48  ? 49.761  27.605  -44.593  1.00 52.87  ? 126 GLN F NE2 1 
ATOM   9706  N  N   . LEU F  3  49  ? 52.821  22.011  -46.540  1.00 39.71  ? 127 LEU F N   1 
ATOM   9707  C  CA  . LEU F  3  49  ? 53.965  21.134  -46.660  1.00 29.74  ? 127 LEU F CA  1 
ATOM   9708  C  C   . LEU F  3  49  ? 53.879  20.274  -47.913  1.00 40.76  ? 127 LEU F C   1 
ATOM   9709  O  O   . LEU F  3  49  ? 54.858  20.143  -48.646  1.00 47.48  ? 127 LEU F O   1 
ATOM   9710  C  CB  . LEU F  3  49  ? 54.084  20.230  -45.441  1.00 37.48  ? 127 LEU F CB  1 
ATOM   9711  C  CG  . LEU F  3  49  ? 55.195  19.178  -45.606  1.00 42.33  ? 127 LEU F CG  1 
ATOM   9712  C  CD1 . LEU F  3  49  ? 56.527  19.881  -45.786  1.00 27.24  ? 127 LEU F CD1 1 
ATOM   9713  C  CD2 . LEU F  3  49  ? 55.224  18.241  -44.421  1.00 22.78  ? 127 LEU F CD2 1 
ATOM   9714  N  N   . VAL F  3  50  ? 52.728  19.664  -48.164  1.00 30.99  ? 128 VAL F N   1 
ATOM   9715  C  CA  . VAL F  3  50  ? 52.622  18.851  -49.363  1.00 47.35  ? 128 VAL F CA  1 
ATOM   9716  C  C   . VAL F  3  50  ? 52.730  19.779  -50.581  1.00 53.63  ? 128 VAL F C   1 
ATOM   9717  O  O   . VAL F  3  50  ? 53.375  19.446  -51.573  1.00 48.73  ? 128 VAL F O   1 
ATOM   9718  C  CB  . VAL F  3  50  ? 51.292  18.066  -49.402  1.00 53.12  ? 128 VAL F CB  1 
ATOM   9719  C  CG1 . VAL F  3  50  ? 51.004  17.492  -48.017  1.00 46.90  ? 128 VAL F CG1 1 
ATOM   9720  C  CG2 . VAL F  3  50  ? 50.148  18.958  -49.894  1.00 56.24  ? 128 VAL F CG2 1 
ATOM   9721  N  N   . ASP F  3  51  ? 52.118  20.957  -50.487  1.00 60.26  ? 129 ASP F N   1 
ATOM   9722  C  CA  . ASP F  3  51  ? 52.150  21.929  -51.571  1.00 55.88  ? 129 ASP F CA  1 
ATOM   9723  C  C   . ASP F  3  51  ? 53.569  22.324  -51.948  1.00 59.83  ? 129 ASP F C   1 
ATOM   9724  O  O   . ASP F  3  51  ? 53.913  22.371  -53.134  1.00 54.83  ? 129 ASP F O   1 
ATOM   9725  C  CB  . ASP F  3  51  ? 51.370  23.178  -51.179  1.00 71.96  ? 129 ASP F CB  1 
ATOM   9726  C  CG  . ASP F  3  51  ? 49.913  23.105  -51.586  1.00 86.91  ? 129 ASP F CG  1 
ATOM   9727  O  OD1 . ASP F  3  51  ? 49.254  22.083  -51.277  1.00 84.14  ? 129 ASP F OD1 1 
ATOM   9728  O  OD2 . ASP F  3  51  ? 49.432  24.078  -52.211  1.00 89.41  ? 129 ASP F OD2 1 
ATOM   9729  N  N   . ILE F  3  52  ? 54.391  22.615  -50.943  1.00 54.85  ? 130 ILE F N   1 
ATOM   9730  C  CA  . ILE F  3  52  ? 55.769  23.008  -51.199  1.00 40.89  ? 130 ILE F CA  1 
ATOM   9731  C  C   . ILE F  3  52  ? 56.570  21.817  -51.708  1.00 37.72  ? 130 ILE F C   1 
ATOM   9732  O  O   . ILE F  3  52  ? 57.338  21.953  -52.668  1.00 44.02  ? 130 ILE F O   1 
ATOM   9733  C  CB  . ILE F  3  52  ? 56.436  23.623  -49.937  1.00 47.14  ? 130 ILE F CB  1 
ATOM   9734  C  CG1 . ILE F  3  52  ? 57.754  24.292  -50.317  1.00 44.56  ? 130 ILE F CG1 1 
ATOM   9735  C  CG2 . ILE F  3  52  ? 56.677  22.575  -48.891  1.00 47.21  ? 130 ILE F CG2 1 
ATOM   9736  C  CD1 . ILE F  3  52  ? 57.582  25.464  -51.271  1.00 41.43  ? 130 ILE F CD1 1 
ATOM   9737  N  N   . ARG F  3  53  ? 56.378  20.649  -51.096  1.00 23.79  ? 131 ARG F N   1 
ATOM   9738  C  CA  . ARG F  3  53  ? 57.081  19.441  -51.532  1.00 26.68  ? 131 ARG F CA  1 
ATOM   9739  C  C   . ARG F  3  53  ? 56.985  19.293  -53.052  1.00 36.31  ? 131 ARG F C   1 
ATOM   9740  O  O   . ARG F  3  53  ? 57.971  18.965  -53.711  1.00 47.15  ? 131 ARG F O   1 
ATOM   9741  C  CB  . ARG F  3  53  ? 56.485  18.191  -50.872  1.00 36.83  ? 131 ARG F CB  1 
ATOM   9742  C  CG  . ARG F  3  53  ? 57.072  17.813  -49.513  1.00 47.38  ? 131 ARG F CG  1 
ATOM   9743  C  CD  . ARG F  3  53  ? 56.211  16.763  -48.806  1.00 49.59  ? 131 ARG F CD  1 
ATOM   9744  N  NE  . ARG F  3  53  ? 56.766  16.359  -47.511  1.00 62.12  ? 131 ARG F NE  1 
ATOM   9745  C  CZ  . ARG F  3  53  ? 56.070  15.737  -46.560  1.00 61.96  ? 131 ARG F CZ  1 
ATOM   9746  N  NH1 . ARG F  3  53  ? 54.788  15.455  -46.761  1.00 68.26  ? 131 ARG F NH1 1 
ATOM   9747  N  NH2 . ARG F  3  53  ? 56.649  15.389  -45.412  1.00 44.56  ? 131 ARG F NH2 1 
ATOM   9748  N  N   . GLN F  3  54  ? 55.799  19.530  -53.611  1.00 42.55  ? 132 GLN F N   1 
ATOM   9749  C  CA  . GLN F  3  54  ? 55.614  19.418  -55.053  1.00 44.03  ? 132 GLN F CA  1 
ATOM   9750  C  C   . GLN F  3  54  ? 56.314  20.515  -55.825  1.00 47.70  ? 132 GLN F C   1 
ATOM   9751  O  O   . GLN F  3  54  ? 57.114  20.235  -56.716  1.00 54.88  ? 132 GLN F O   1 
ATOM   9752  C  CB  . GLN F  3  54  ? 54.130  19.420  -55.421  1.00 55.44  ? 132 GLN F CB  1 
ATOM   9753  C  CG  . GLN F  3  54  ? 53.432  18.120  -55.108  1.00 72.25  ? 132 GLN F CG  1 
ATOM   9754  C  CD  . GLN F  3  54  ? 54.355  16.929  -55.297  1.00 86.76  ? 132 GLN F CD  1 
ATOM   9755  O  OE1 . GLN F  3  54  ? 55.091  16.547  -54.383  1.00 87.74  ? 132 GLN F OE1 1 
ATOM   9756  N  NE2 . GLN F  3  54  ? 54.342  16.352  -56.495  1.00 89.39  ? 132 GLN F NE2 1 
ATOM   9757  N  N   . THR F  3  55  ? 56.031  21.766  -55.484  1.00 43.56  ? 133 THR F N   1 
ATOM   9758  C  CA  . THR F  3  55  ? 56.650  22.856  -56.207  1.00 34.50  ? 133 THR F CA  1 
ATOM   9759  C  C   . THR F  3  55  ? 58.164  22.723  -56.199  1.00 39.93  ? 133 THR F C   1 
ATOM   9760  O  O   . THR F  3  55  ? 58.807  22.991  -57.209  1.00 44.36  ? 133 THR F O   1 
ATOM   9761  C  CB  . THR F  3  55  ? 56.268  24.248  -55.637  1.00 30.36  ? 133 THR F CB  1 
ATOM   9762  O  OG1 . THR F  3  55  ? 57.243  24.657  -54.682  1.00 52.32  ? 133 THR F OG1 1 
ATOM   9763  C  CG2 . THR F  3  55  ? 54.916  24.214  -54.962  1.00 28.67  ? 133 THR F CG2 1 
ATOM   9764  N  N   . CYS F  3  56  ? 58.747  22.280  -55.087  1.00 37.26  ? 134 CYS F N   1 
ATOM   9765  C  CA  . CYS F  3  56  ? 60.203  22.183  -55.044  1.00 36.42  ? 134 CYS F CA  1 
ATOM   9766  C  C   . CYS F  3  56  ? 60.795  20.843  -55.438  1.00 42.20  ? 134 CYS F C   1 
ATOM   9767  O  O   . CYS F  3  56  ? 61.936  20.543  -55.076  1.00 48.77  ? 134 CYS F O   1 
ATOM   9768  C  CB  . CYS F  3  56  ? 60.732  22.614  -53.671  1.00 35.18  ? 134 CYS F CB  1 
ATOM   9769  S  SG  . CYS F  3  56  ? 60.367  24.365  -53.293  1.00 44.97  ? 134 CYS F SG  1 
ATOM   9770  N  N   . SER F  3  57  ? 60.042  20.051  -56.200  1.00 41.11  ? 135 SER F N   1 
ATOM   9771  C  CA  . SER F  3  57  ? 60.535  18.754  -56.668  1.00 41.17  ? 135 SER F CA  1 
ATOM   9772  C  C   . SER F  3  57  ? 61.256  18.788  -58.022  1.00 38.92  ? 135 SER F C   1 
ATOM   9773  O  O   . SER F  3  57  ? 61.995  17.872  -58.352  1.00 47.06  ? 135 SER F O   1 
ATOM   9774  C  CB  . SER F  3  57  ? 59.401  17.750  -56.739  1.00 49.02  ? 135 SER F CB  1 
ATOM   9775  O  OG  . SER F  3  57  ? 59.128  17.233  -55.453  1.00 58.12  ? 135 SER F OG  1 
ATOM   9776  N  N   . ARG F  3  58  ? 61.055  19.843  -58.800  1.00 38.81  ? 136 ARG F N   1 
ATOM   9777  C  CA  . ARG F  3  58  ? 61.703  19.961  -60.102  1.00 38.95  ? 136 ARG F CA  1 
ATOM   9778  C  C   . ARG F  3  58  ? 63.093  20.563  -59.940  1.00 36.66  ? 136 ARG F C   1 
ATOM   9779  O  O   . ARG F  3  58  ? 63.302  21.440  -59.100  1.00 38.90  ? 136 ARG F O   1 
ATOM   9780  C  CB  . ARG F  3  58  ? 60.862  20.848  -61.029  1.00 52.24  ? 136 ARG F CB  1 
ATOM   9781  C  CG  . ARG F  3  58  ? 59.354  20.634  -60.892  1.00 79.04  ? 136 ARG F CG  1 
ATOM   9782  C  CD  . ARG F  3  58  ? 58.553  21.389  -61.952  1.00 98.26  ? 136 ARG F CD  1 
ATOM   9783  N  NE  . ARG F  3  58  ? 58.387  20.634  -63.196  1.00 113.11 ? 136 ARG F NE  1 
ATOM   9784  C  CZ  . ARG F  3  58  ? 59.364  20.349  -64.055  1.00 120.59 ? 136 ARG F CZ  1 
ATOM   9785  N  NH1 . ARG F  3  58  ? 60.607  20.755  -63.822  1.00 123.85 ? 136 ARG F NH1 1 
ATOM   9786  N  NH2 . ARG F  3  58  ? 59.099  19.650  -65.155  1.00 120.46 ? 136 ARG F NH2 1 
ATOM   9787  N  N   . PRO F  3  59  ? 63.987  20.002  -60.706  1.00 30.06  ? 137 PRO F N   1 
ATOM   9788  C  CA  . PRO F  3  59  ? 65.403  20.485  -60.839  1.00 43.76  ? 137 PRO F CA  1 
ATOM   9789  C  C   . PRO F  3  59  ? 65.741  21.773  -61.673  1.00 41.05  ? 137 PRO F C   1 
ATOM   9790  O  O   . PRO F  3  59  ? 65.007  22.031  -62.620  1.00 37.11  ? 137 PRO F O   1 
ATOM   9791  C  CB  . PRO F  3  59  ? 66.079  19.276  -61.438  1.00 41.57  ? 137 PRO F CB  1 
ATOM   9792  C  CG  . PRO F  3  59  ? 65.342  18.136  -60.784  1.00 45.10  ? 137 PRO F CG  1 
ATOM   9793  C  CD  . PRO F  3  59  ? 64.033  18.622  -60.297  1.00 46.30  ? 137 PRO F CD  1 
ATOM   9794  N  N   . CYS F  3  60  ? 66.846  22.509  -61.382  1.00 33.83  ? 138 CYS F N   1 
ATOM   9795  C  CA  . CYS F  3  60  ? 67.269  23.637  -62.218  1.00 38.65  ? 138 CYS F CA  1 
ATOM   9796  C  C   . CYS F  3  60  ? 67.323  23.268  -63.692  1.00 47.50  ? 138 CYS F C   1 
ATOM   9797  O  O   . CYS F  3  60  ? 67.557  22.108  -64.059  1.00 31.48  ? 138 CYS F O   1 
ATOM   9798  C  CB  . CYS F  3  60  ? 68.662  24.148  -61.836  1.00 35.25  ? 138 CYS F CB  1 
ATOM   9799  S  SG  . CYS F  3  60  ? 68.849  24.530  -60.087  1.00 41.51  ? 138 CYS F SG  1 
ATOM   9800  N  N   . GLN F  3  61  ? 67.114  24.284  -64.523  1.00 54.35  ? 139 GLN F N   1 
ATOM   9801  C  CA  . GLN F  3  61  ? 67.158  24.144  -65.967  1.00 56.37  ? 139 GLN F CA  1 
ATOM   9802  C  C   . GLN F  3  61  ? 68.593  24.384  -66.381  1.00 52.36  ? 139 GLN F C   1 
ATOM   9803  O  O   . GLN F  3  61  ? 69.197  25.379  -65.975  1.00 53.11  ? 139 GLN F O   1 
ATOM   9804  C  CB  . GLN F  3  61  ? 66.263  25.193  -66.622  1.00 71.00  ? 139 GLN F CB  1 
ATOM   9805  C  CG  . GLN F  3  61  ? 64.785  24.901  -66.511  1.00 92.43  ? 139 GLN F CG  1 
ATOM   9806  C  CD  . GLN F  3  61  ? 64.396  23.654  -67.289  1.00 104.47 ? 139 GLN F CD  1 
ATOM   9807  O  OE1 . GLN F  3  61  ? 64.524  23.604  -68.518  1.00 103.23 ? 139 GLN F OE1 1 
ATOM   9808  N  NE2 . GLN F  3  61  ? 63.925  22.634  -66.575  1.00 111.26 ? 139 GLN F NE2 1 
ATOM   9809  N  N   . ASP F  3  62  ? 69.144  23.467  -67.165  1.00 44.68  ? 140 ASP F N   1 
ATOM   9810  C  CA  . ASP F  3  62  ? 70.513  23.603  -67.655  1.00 50.34  ? 140 ASP F CA  1 
ATOM   9811  C  C   . ASP F  3  62  ? 70.401  24.347  -68.987  1.00 51.62  ? 140 ASP F C   1 
ATOM   9812  O  O   . ASP F  3  62  ? 70.419  23.731  -70.056  1.00 54.40  ? 140 ASP F O   1 
ATOM   9813  C  CB  . ASP F  3  62  ? 71.127  22.219  -67.868  1.00 41.53  ? 140 ASP F CB  1 
ATOM   9814  C  CG  . ASP F  3  62  ? 72.595  22.278  -68.207  1.00 51.37  ? 140 ASP F CG  1 
ATOM   9815  O  OD1 . ASP F  3  62  ? 73.208  21.203  -68.317  1.00 59.66  ? 140 ASP F OD1 1 
ATOM   9816  O  OD2 . ASP F  3  62  ? 73.142  23.390  -68.361  1.00 67.44  ? 140 ASP F OD2 1 
ATOM   9817  N  N   . THR F  3  63  ? 70.284  25.672  -68.915  1.00 34.82  ? 141 THR F N   1 
ATOM   9818  C  CA  . THR F  3  63  ? 70.110  26.488  -70.104  1.00 42.41  ? 141 THR F CA  1 
ATOM   9819  C  C   . THR F  3  63  ? 71.132  26.212  -71.196  1.00 49.14  ? 141 THR F C   1 
ATOM   9820  O  O   . THR F  3  63  ? 70.776  26.068  -72.365  1.00 53.78  ? 141 THR F O   1 
ATOM   9821  C  CB  . THR F  3  63  ? 70.137  27.971  -69.743  1.00 44.78  ? 141 THR F CB  1 
ATOM   9822  O  OG1 . THR F  3  63  ? 71.450  28.342  -69.307  1.00 50.21  ? 141 THR F OG1 1 
ATOM   9823  C  CG2 . THR F  3  63  ? 69.145  28.245  -68.626  1.00 32.93  ? 141 THR F CG2 1 
ATOM   9824  N  N   . THR F  3  64  ? 72.402  26.144  -70.816  1.00 50.53  ? 142 THR F N   1 
ATOM   9825  C  CA  . THR F  3  64  ? 73.467  25.869  -71.771  1.00 53.03  ? 142 THR F CA  1 
ATOM   9826  C  C   . THR F  3  64  ? 73.109  24.607  -72.545  1.00 49.31  ? 142 THR F C   1 
ATOM   9827  O  O   . THR F  3  64  ? 73.092  24.599  -73.776  1.00 49.17  ? 142 THR F O   1 
ATOM   9828  C  CB  . THR F  3  64  ? 74.830  25.677  -71.045  1.00 41.67  ? 142 THR F CB  1 
ATOM   9829  O  OG1 . THR F  3  64  ? 75.365  26.958  -70.697  1.00 54.19  ? 142 THR F OG1 1 
ATOM   9830  C  CG2 . THR F  3  64  ? 75.823  24.962  -71.921  1.00 28.83  ? 142 THR F CG2 1 
ATOM   9831  N  N   . ALA F  3  65  ? 72.804  23.548  -71.814  1.00 44.60  ? 143 ALA F N   1 
ATOM   9832  C  CA  . ALA F  3  65  ? 72.445  22.287  -72.438  1.00 51.50  ? 143 ALA F CA  1 
ATOM   9833  C  C   . ALA F  3  65  ? 71.183  22.453  -73.270  1.00 47.95  ? 143 ALA F C   1 
ATOM   9834  O  O   . ALA F  3  65  ? 70.976  21.751  -74.260  1.00 49.27  ? 143 ALA F O   1 
ATOM   9835  C  CB  . ALA F  3  65  ? 72.233  21.227  -71.376  1.00 54.11  ? 143 ALA F CB  1 
ATOM   9836  N  N   . ASN F  3  66  ? 70.339  23.390  -72.869  1.00 45.97  ? 144 ASN F N   1 
ATOM   9837  C  CA  . ASN F  3  66  ? 69.111  23.628  -73.597  1.00 50.27  ? 144 ASN F CA  1 
ATOM   9838  C  C   . ASN F  3  66  ? 69.360  24.373  -74.920  1.00 46.29  ? 144 ASN F C   1 
ATOM   9839  O  O   . ASN F  3  66  ? 68.482  24.448  -75.782  1.00 40.23  ? 144 ASN F O   1 
ATOM   9840  C  CB  . ASN F  3  66  ? 68.139  24.403  -72.716  1.00 70.50  ? 144 ASN F CB  1 
ATOM   9841  C  CG  . ASN F  3  66  ? 66.835  24.708  -73.422  1.00 95.84  ? 144 ASN F CG  1 
ATOM   9842  O  OD1 . ASN F  3  66  ? 66.160  23.803  -73.922  1.00 100.73 ? 144 ASN F OD1 1 
ATOM   9843  N  ND2 . ASN F  3  66  ? 66.469  25.989  -73.467  1.00 107.85 ? 144 ASN F ND2 1 
ATOM   9844  N  N   . LYS F  3  67  ? 70.560  24.914  -75.094  1.00 37.70  ? 145 LYS F N   1 
ATOM   9845  C  CA  . LYS F  3  67  ? 70.867  25.622  -76.325  1.00 38.36  ? 145 LYS F CA  1 
ATOM   9846  C  C   . LYS F  3  67  ? 71.732  24.827  -77.289  1.00 38.28  ? 145 LYS F C   1 
ATOM   9847  O  O   . LYS F  3  67  ? 72.402  25.391  -78.151  1.00 49.14  ? 145 LYS F O   1 
ATOM   9848  C  CB  . LYS F  3  67  ? 71.523  26.961  -76.016  1.00 43.43  ? 145 LYS F CB  1 
ATOM   9849  C  CG  . LYS F  3  67  ? 70.587  27.940  -75.336  1.00 46.44  ? 145 LYS F CG  1 
ATOM   9850  C  CD  . LYS F  3  67  ? 71.304  29.217  -74.975  1.00 53.73  ? 145 LYS F CD  1 
ATOM   9851  C  CE  . LYS F  3  67  ? 70.437  30.085  -74.086  1.00 61.04  ? 145 LYS F CE  1 
ATOM   9852  N  NZ  . LYS F  3  67  ? 71.207  31.239  -73.528  1.00 80.07  ? 145 LYS F NZ  1 
ATOM   9853  N  N   . ILE F  3  68  ? 71.715  23.511  -77.148  1.00 36.98  ? 146 ILE F N   1 
ATOM   9854  C  CA  . ILE F  3  68  ? 72.483  22.651  -78.033  1.00 43.27  ? 146 ILE F CA  1 
ATOM   9855  C  C   . ILE F  3  68  ? 71.488  22.106  -79.040  1.00 47.13  ? 146 ILE F C   1 
ATOM   9856  O  O   . ILE F  3  68  ? 70.661  21.266  -78.708  1.00 46.37  ? 146 ILE F O   1 
ATOM   9857  C  CB  . ILE F  3  68  ? 73.121  21.470  -77.273  1.00 50.02  ? 146 ILE F CB  1 
ATOM   9858  C  CG1 . ILE F  3  68  ? 74.060  21.995  -76.188  1.00 38.01  ? 146 ILE F CG1 1 
ATOM   9859  C  CG2 . ILE F  3  68  ? 73.864  20.560  -78.249  1.00 34.69  ? 146 ILE F CG2 1 
ATOM   9860  C  CD1 . ILE F  3  68  ? 74.873  20.928  -75.550  1.00 49.55  ? 146 ILE F CD1 1 
ATOM   9861  N  N   . SER F  3  69  ? 71.570  22.591  -80.272  1.00 55.44  ? 147 SER F N   1 
ATOM   9862  C  CA  . SER F  3  69  ? 70.648  22.169  -81.319  1.00 62.26  ? 147 SER F CA  1 
ATOM   9863  C  C   . SER F  3  69  ? 70.644  20.671  -81.596  1.00 60.71  ? 147 SER F C   1 
ATOM   9864  O  O   . SER F  3  69  ? 71.626  19.971  -81.353  1.00 61.12  ? 147 SER F O   1 
ATOM   9865  C  CB  . SER F  3  69  ? 70.948  22.919  -82.623  1.00 69.03  ? 147 SER F CB  1 
ATOM   9866  O  OG  . SER F  3  69  ? 69.996  22.621  -83.636  1.00 69.93  ? 147 SER F OG  1 
ATOM   9867  N  N   . PRO F  3  70  ? 69.511  20.162  -82.092  1.00 59.06  ? 148 PRO F N   1 
ATOM   9868  C  CA  . PRO F  3  70  ? 69.322  18.749  -82.427  1.00 57.16  ? 148 PRO F CA  1 
ATOM   9869  C  C   . PRO F  3  70  ? 69.804  18.450  -83.847  1.00 60.32  ? 148 PRO F C   1 
ATOM   9870  O  O   . PRO F  3  70  ? 69.831  17.297  -84.268  1.00 55.50  ? 148 PRO F O   1 
ATOM   9871  C  CB  . PRO F  3  70  ? 67.812  18.557  -82.291  1.00 59.66  ? 148 PRO F CB  1 
ATOM   9872  C  CG  . PRO F  3  70  ? 67.386  19.689  -81.385  1.00 63.26  ? 148 PRO F CG  1 
ATOM   9873  C  CD  . PRO F  3  70  ? 68.210  20.821  -81.904  1.00 57.54  ? 148 PRO F CD  1 
ATOM   9874  N  N   . ILE F  3  71  ? 70.175  19.498  -84.579  1.00 60.76  ? 149 ILE F N   1 
ATOM   9875  C  CA  . ILE F  3  71  ? 70.656  19.371  -85.955  1.00 58.75  ? 149 ILE F CA  1 
ATOM   9876  C  C   . ILE F  3  71  ? 72.111  18.893  -85.979  1.00 60.40  ? 149 ILE F C   1 
ATOM   9877  O  O   . ILE F  3  71  ? 72.874  19.201  -85.067  1.00 67.83  ? 149 ILE F O   1 
ATOM   9878  C  CB  . ILE F  3  71  ? 70.555  20.716  -86.669  1.00 58.25  ? 149 ILE F CB  1 
ATOM   9879  C  CG1 . ILE F  3  71  ? 69.134  21.257  -86.527  1.00 61.72  ? 149 ILE F CG1 1 
ATOM   9880  C  CG2 . ILE F  3  71  ? 70.910  20.558  -88.132  1.00 66.80  ? 149 ILE F CG2 1 
ATOM   9881  C  CD1 . ILE F  3  71  ? 68.970  22.681  -87.003  1.00 64.21  ? 149 ILE F CD1 1 
ATOM   9882  N  N   . THR F  3  72  ? 72.496  18.160  -87.026  1.00 64.17  ? 150 THR F N   1 
ATOM   9883  C  CA  . THR F  3  72  ? 73.856  17.615  -87.140  1.00 67.11  ? 150 THR F CA  1 
ATOM   9884  C  C   . THR F  3  72  ? 74.445  17.701  -88.548  1.00 66.51  ? 150 THR F C   1 
ATOM   9885  O  O   . THR F  3  72  ? 73.941  18.435  -89.393  1.00 79.14  ? 150 THR F O   1 
ATOM   9886  C  CB  . THR F  3  72  ? 73.869  16.138  -86.709  1.00 74.25  ? 150 THR F CB  1 
ATOM   9887  O  OG1 . THR F  3  72  ? 73.084  15.994  -85.522  1.00 94.96  ? 150 THR F OG1 1 
ATOM   9888  C  CG2 . THR F  3  72  ? 75.291  15.658  -86.410  1.00 70.61  ? 150 THR F CG2 1 
ATOM   9889  N  N   . GLY F  3  73  ? 75.521  16.952  -88.788  1.00 62.48  ? 151 GLY F N   1 
ATOM   9890  C  CA  . GLY F  3  73  ? 76.162  16.953  -90.092  1.00 65.75  ? 151 GLY F CA  1 
ATOM   9891  C  C   . GLY F  3  73  ? 77.651  16.639  -90.065  1.00 68.30  ? 151 GLY F C   1 
ATOM   9892  O  O   . GLY F  3  73  ? 78.261  16.617  -89.001  1.00 69.66  ? 151 GLY F O   1 
ATOM   9893  N  N   . LYS F  3  74  ? 78.227  16.393  -91.245  1.00 71.31  ? 152 LYS F N   1 
ATOM   9894  C  CA  . LYS F  3  74  ? 79.654  16.087  -91.404  1.00 66.46  ? 152 LYS F CA  1 
ATOM   9895  C  C   . LYS F  3  74  ? 80.472  17.135  -90.660  1.00 63.57  ? 152 LYS F C   1 
ATOM   9896  O  O   . LYS F  3  74  ? 81.497  16.838  -90.050  1.00 62.84  ? 152 LYS F O   1 
ATOM   9897  C  CB  . LYS F  3  74  ? 80.062  16.163  -92.884  1.00 74.14  ? 152 LYS F CB  1 
ATOM   9898  C  CG  . LYS F  3  74  ? 79.216  15.375  -93.860  1.00 83.09  ? 152 LYS F CG  1 
ATOM   9899  C  CD  . LYS F  3  74  ? 79.367  15.930  -95.274  1.00 90.10  ? 152 LYS F CD  1 
ATOM   9900  C  CE  . LYS F  3  74  ? 80.808  15.891  -95.773  1.00 97.11  ? 152 LYS F CE  1 
ATOM   9901  N  NZ  . LYS F  3  74  ? 81.324  14.502  -95.984  1.00 97.22  ? 152 LYS F NZ  1 
ATOM   9902  N  N   . ASP F  3  75  ? 80.010  18.376  -90.766  1.00 60.73  ? 153 ASP F N   1 
ATOM   9903  C  CA  . ASP F  3  75  ? 80.651  19.522  -90.149  1.00 50.81  ? 153 ASP F CA  1 
ATOM   9904  C  C   . ASP F  3  75  ? 79.585  20.591  -89.988  1.00 50.74  ? 153 ASP F C   1 
ATOM   9905  O  O   . ASP F  3  75  ? 78.406  20.365  -90.266  1.00 48.07  ? 153 ASP F O   1 
ATOM   9906  C  CB  . ASP F  3  75  ? 81.756  20.055  -91.042  1.00 57.13  ? 153 ASP F CB  1 
ATOM   9907  C  CG  . ASP F  3  75  ? 81.257  20.375  -92.433  1.00 64.79  ? 153 ASP F CG  1 
ATOM   9908  O  OD1 . ASP F  3  75  ? 80.121  20.883  -92.544  1.00 68.65  ? 153 ASP F OD1 1 
ATOM   9909  O  OD2 . ASP F  3  75  ? 81.989  20.123  -93.413  1.00 65.13  ? 153 ASP F OD2 1 
ATOM   9910  N  N   . CYS F  3  76  ? 80.009  21.769  -89.564  1.00 48.83  ? 154 CYS F N   1 
ATOM   9911  C  CA  . CYS F  3  76  ? 79.073  22.853  -89.344  1.00 58.70  ? 154 CYS F CA  1 
ATOM   9912  C  C   . CYS F  3  76  ? 78.332  23.292  -90.588  1.00 57.91  ? 154 CYS F C   1 
ATOM   9913  O  O   . CYS F  3  76  ? 77.210  23.789  -90.503  1.00 48.86  ? 154 CYS F O   1 
ATOM   9914  C  CB  . CYS F  3  76  ? 79.795  24.037  -88.721  1.00 60.40  ? 154 CYS F CB  1 
ATOM   9915  S  SG  . CYS F  3  76  ? 80.138  23.793  -86.961  1.00 63.71  ? 154 CYS F SG  1 
ATOM   9916  N  N   . GLN F  3  77  ? 78.962  23.124  -91.743  1.00 61.76  ? 155 GLN F N   1 
ATOM   9917  C  CA  . GLN F  3  77  ? 78.313  23.500  -92.989  1.00 63.22  ? 155 GLN F CA  1 
ATOM   9918  C  C   . GLN F  3  77  ? 77.101  22.598  -93.196  1.00 64.85  ? 155 GLN F C   1 
ATOM   9919  O  O   . GLN F  3  77  ? 75.977  23.090  -93.308  1.00 52.10  ? 155 GLN F O   1 
ATOM   9920  C  CB  . GLN F  3  77  ? 79.271  23.359  -94.172  1.00 64.81  ? 155 GLN F CB  1 
ATOM   9921  C  CG  . GLN F  3  77  ? 78.668  23.813  -95.484  1.00 63.75  ? 155 GLN F CG  1 
ATOM   9922  C  CD  . GLN F  3  77  ? 78.002  25.166  -95.362  1.00 68.58  ? 155 GLN F CD  1 
ATOM   9923  O  OE1 . GLN F  3  77  ? 78.615  26.131  -94.914  1.00 69.11  ? 155 GLN F OE1 1 
ATOM   9924  N  NE2 . GLN F  3  77  ? 76.739  25.244  -95.762  1.00 75.38  ? 155 GLN F NE2 1 
ATOM   9925  N  N   . GLN F  3  78  ? 77.322  21.282  -93.233  1.00 61.43  ? 156 GLN F N   1 
ATOM   9926  C  CA  . GLN F  3  78  ? 76.208  20.366  -93.425  1.00 59.41  ? 156 GLN F CA  1 
ATOM   9927  C  C   . GLN F  3  78  ? 75.098  20.747  -92.452  1.00 57.93  ? 156 GLN F C   1 
ATOM   9928  O  O   . GLN F  3  78  ? 73.913  20.667  -92.775  1.00 55.30  ? 156 GLN F O   1 
ATOM   9929  C  CB  . GLN F  3  78  ? 76.626  18.904  -93.210  1.00 50.52  ? 156 GLN F CB  1 
ATOM   9930  C  CG  . GLN F  3  78  ? 75.436  17.953  -93.354  1.00 51.22  ? 156 GLN F CG  1 
ATOM   9931  C  CD  . GLN F  3  78  ? 75.812  16.518  -93.689  1.00 61.43  ? 156 GLN F CD  1 
ATOM   9932  O  OE1 . GLN F  3  78  ? 76.512  16.252  -94.669  1.00 52.61  ? 156 GLN F OE1 1 
ATOM   9933  N  NE2 . GLN F  3  78  ? 75.326  15.579  -92.879  1.00 75.10  ? 156 GLN F NE2 1 
ATOM   9934  N  N   . VAL F  3  79  ? 75.496  21.182  -91.264  1.00 59.05  ? 157 VAL F N   1 
ATOM   9935  C  CA  . VAL F  3  79  ? 74.540  21.592  -90.242  1.00 65.66  ? 157 VAL F CA  1 
ATOM   9936  C  C   . VAL F  3  79  ? 73.642  22.711  -90.774  1.00 69.02  ? 157 VAL F C   1 
ATOM   9937  O  O   . VAL F  3  79  ? 72.421  22.679  -90.612  1.00 63.42  ? 157 VAL F O   1 
ATOM   9938  C  CB  . VAL F  3  79  ? 75.278  22.072  -88.971  1.00 49.84  ? 157 VAL F CB  1 
ATOM   9939  C  CG1 . VAL F  3  79  ? 74.310  22.712  -88.005  1.00 32.73  ? 157 VAL F CG1 1 
ATOM   9940  C  CG2 . VAL F  3  79  ? 75.965  20.902  -88.319  1.00 49.53  ? 157 VAL F CG2 1 
ATOM   9941  N  N   . VAL F  3  80  ? 74.252  23.705  -91.407  1.00 74.58  ? 158 VAL F N   1 
ATOM   9942  C  CA  . VAL F  3  80  ? 73.487  24.811  -91.969  1.00 79.89  ? 158 VAL F CA  1 
ATOM   9943  C  C   . VAL F  3  80  ? 72.623  24.240  -93.087  1.00 78.82  ? 158 VAL F C   1 
ATOM   9944  O  O   . VAL F  3  80  ? 71.473  24.638  -93.269  1.00 76.07  ? 158 VAL F O   1 
ATOM   9945  C  CB  . VAL F  3  80  ? 74.416  25.904  -92.552  1.00 79.01  ? 158 VAL F CB  1 
ATOM   9946  C  CG1 . VAL F  3  80  ? 73.593  26.940  -93.288  1.00 67.83  ? 158 VAL F CG1 1 
ATOM   9947  C  CG2 . VAL F  3  80  ? 75.209  26.567  -91.435  1.00 75.90  ? 158 VAL F CG2 1 
ATOM   9948  N  N   . ASP F  3  81  ? 73.199  23.294  -93.822  1.00 74.67  ? 159 ASP F N   1 
ATOM   9949  C  CA  . ASP F  3  81  ? 72.520  22.631  -94.924  1.00 71.60  ? 159 ASP F CA  1 
ATOM   9950  C  C   . ASP F  3  81  ? 71.385  21.764  -94.408  1.00 70.64  ? 159 ASP F C   1 
ATOM   9951  O  O   . ASP F  3  81  ? 70.617  21.208  -95.193  1.00 79.25  ? 159 ASP F O   1 
ATOM   9952  C  CB  . ASP F  3  81  ? 73.496  21.742  -95.697  1.00 71.91  ? 159 ASP F CB  1 
ATOM   9953  C  CG  . ASP F  3  81  ? 74.610  22.528  -96.347  1.00 74.42  ? 159 ASP F CG  1 
ATOM   9954  O  OD1 . ASP F  3  81  ? 75.550  21.893  -96.876  1.00 77.14  ? 159 ASP F OD1 1 
ATOM   9955  O  OD2 . ASP F  3  81  ? 74.542  23.778  -96.333  1.00 79.00  ? 159 ASP F OD2 1 
ATOM   9956  N  N   . ASN F  3  82  ? 71.281  21.640  -93.092  1.00 62.05  ? 160 ASN F N   1 
ATOM   9957  C  CA  . ASN F  3  82  ? 70.230  20.822  -92.514  1.00 61.78  ? 160 ASN F CA  1 
ATOM   9958  C  C   . ASN F  3  82  ? 69.247  21.625  -91.690  1.00 67.32  ? 160 ASN F C   1 
ATOM   9959  O  O   . ASN F  3  82  ? 68.378  21.059  -91.022  1.00 71.67  ? 160 ASN F O   1 
ATOM   9960  C  CB  . ASN F  3  82  ? 70.840  19.704  -91.669  1.00 63.19  ? 160 ASN F CB  1 
ATOM   9961  C  CG  . ASN F  3  82  ? 71.351  18.549  -92.517  1.00 76.09  ? 160 ASN F CG  1 
ATOM   9962  O  OD1 . ASN F  3  82  ? 72.106  17.692  -92.043  1.00 80.73  ? 160 ASN F OD1 1 
ATOM   9963  N  ND2 . ASN F  3  82  ? 70.929  18.513  -93.779  1.00 77.93  ? 160 ASN F ND2 1 
ATOM   9964  N  N   . GLY F  3  83  ? 69.376  22.945  -91.737  1.00 70.21  ? 161 GLY F N   1 
ATOM   9965  C  CA  . GLY F  3  83  ? 68.459  23.783  -90.986  1.00 75.11  ? 161 GLY F CA  1 
ATOM   9966  C  C   . GLY F  3  83  ? 69.132  24.694  -89.981  1.00 82.18  ? 161 GLY F C   1 
ATOM   9967  O  O   . GLY F  3  83  ? 68.518  25.645  -89.492  1.00 89.33  ? 161 GLY F O   1 
ATOM   9968  N  N   . GLY F  3  84  ? 70.391  24.410  -89.665  1.00 80.83  ? 162 GLY F N   1 
ATOM   9969  C  CA  . GLY F  3  84  ? 71.100  25.242  -88.714  1.00 80.13  ? 162 GLY F CA  1 
ATOM   9970  C  C   . GLY F  3  84  ? 70.979  26.701  -89.106  1.00 79.83  ? 162 GLY F C   1 
ATOM   9971  O  O   . GLY F  3  84  ? 71.406  27.085  -90.195  1.00 78.36  ? 162 GLY F O   1 
ATOM   9972  N  N   . LYS F  3  85  ? 70.395  27.513  -88.229  1.00 75.23  ? 163 LYS F N   1 
ATOM   9973  C  CA  . LYS F  3  85  ? 70.228  28.928  -88.519  1.00 75.87  ? 163 LYS F CA  1 
ATOM   9974  C  C   . LYS F  3  85  ? 71.131  29.827  -87.686  1.00 70.55  ? 163 LYS F C   1 
ATOM   9975  O  O   . LYS F  3  85  ? 71.858  30.641  -88.234  1.00 76.54  ? 163 LYS F O   1 
ATOM   9976  C  CB  . LYS F  3  85  ? 68.770  29.347  -88.310  1.00 88.23  ? 163 LYS F CB  1 
ATOM   9977  C  CG  . LYS F  3  85  ? 68.536  30.838  -88.523  1.00 98.96  ? 163 LYS F CG  1 
ATOM   9978  C  CD  . LYS F  3  85  ? 67.190  31.300  -87.972  1.00 102.12 ? 163 LYS F CD  1 
ATOM   9979  C  CE  . LYS F  3  85  ? 67.069  32.823  -88.031  1.00 101.68 ? 163 LYS F CE  1 
ATOM   9980  N  NZ  . LYS F  3  85  ? 65.838  33.324  -87.353  1.00 97.52  ? 163 LYS F NZ  1 
ATOM   9981  N  N   . ASP F  3  86  ? 71.090  29.680  -86.366  1.00 72.38  ? 164 ASP F N   1 
ATOM   9982  C  CA  . ASP F  3  86  ? 71.907  30.514  -85.483  1.00 71.15  ? 164 ASP F CA  1 
ATOM   9983  C  C   . ASP F  3  86  ? 73.221  29.881  -84.998  1.00 68.88  ? 164 ASP F C   1 
ATOM   9984  O  O   . ASP F  3  86  ? 73.345  28.666  -84.897  1.00 67.39  ? 164 ASP F O   1 
ATOM   9985  C  CB  . ASP F  3  86  ? 71.073  30.933  -84.275  1.00 73.25  ? 164 ASP F CB  1 
ATOM   9986  C  CG  . ASP F  3  86  ? 69.744  31.534  -84.676  1.00 81.03  ? 164 ASP F CG  1 
ATOM   9987  O  OD1 . ASP F  3  86  ? 69.741  32.517  -85.446  1.00 91.07  ? 164 ASP F OD1 1 
ATOM   9988  O  OD2 . ASP F  3  86  ? 68.700  31.025  -84.224  1.00 77.91  ? 164 ASP F OD2 1 
ATOM   9989  N  N   . SER F  3  87  ? 74.203  30.721  -84.696  1.00 66.83  ? 165 SER F N   1 
ATOM   9990  C  CA  . SER F  3  87  ? 75.490  30.238  -84.214  1.00 65.37  ? 165 SER F CA  1 
ATOM   9991  C  C   . SER F  3  87  ? 75.348  29.650  -82.811  1.00 67.96  ? 165 SER F C   1 
ATOM   9992  O  O   . SER F  3  87  ? 74.684  30.223  -81.948  1.00 77.63  ? 165 SER F O   1 
ATOM   9993  C  CB  . SER F  3  87  ? 76.510  31.379  -84.190  1.00 62.78  ? 165 SER F CB  1 
ATOM   9994  O  OG  . SER F  3  87  ? 76.891  31.757  -85.498  1.00 58.90  ? 165 SER F OG  1 
ATOM   9995  N  N   . GLY F  3  88  ? 75.975  28.503  -82.584  1.00 66.36  ? 166 GLY F N   1 
ATOM   9996  C  CA  . GLY F  3  88  ? 75.895  27.877  -81.278  1.00 62.66  ? 166 GLY F CA  1 
ATOM   9997  C  C   . GLY F  3  88  ? 76.558  26.515  -81.227  1.00 58.56  ? 166 GLY F C   1 
ATOM   9998  O  O   . GLY F  3  88  ? 77.412  26.195  -82.061  1.00 56.77  ? 166 GLY F O   1 
ATOM   9999  N  N   . LEU F  3  89  ? 76.161  25.709  -80.248  1.00 39.91  ? 167 LEU F N   1 
ATOM   10000 C  CA  . LEU F  3  89  ? 76.726  24.387  -80.103  1.00 38.28  ? 167 LEU F CA  1 
ATOM   10001 C  C   . LEU F  3  89  ? 75.915  23.392  -80.896  1.00 39.66  ? 167 LEU F C   1 
ATOM   10002 O  O   . LEU F  3  89  ? 74.685  23.461  -80.926  1.00 53.24  ? 167 LEU F O   1 
ATOM   10003 C  CB  . LEU F  3  89  ? 76.732  23.970  -78.634  1.00 46.63  ? 167 LEU F CB  1 
ATOM   10004 C  CG  . LEU F  3  89  ? 77.457  24.919  -77.686  1.00 42.11  ? 167 LEU F CG  1 
ATOM   10005 C  CD1 . LEU F  3  89  ? 77.300  24.451  -76.272  1.00 24.52  ? 167 LEU F CD1 1 
ATOM   10006 C  CD2 . LEU F  3  89  ? 78.918  24.999  -78.072  1.00 49.29  ? 167 LEU F CD2 1 
ATOM   10007 N  N   . TYR F  3  90  ? 76.608  22.471  -81.547  1.00 34.79  ? 168 TYR F N   1 
ATOM   10008 C  CA  . TYR F  3  90  ? 75.941  21.427  -82.320  1.00 45.88  ? 168 TYR F CA  1 
ATOM   10009 C  C   . TYR F  3  90  ? 76.821  20.205  -82.275  1.00 46.87  ? 168 TYR F C   1 
ATOM   10010 O  O   . TYR F  3  90  ? 78.021  20.299  -82.022  1.00 55.15  ? 168 TYR F O   1 
ATOM   10011 C  CB  . TYR F  3  90  ? 75.783  21.801  -83.797  1.00 52.29  ? 168 TYR F CB  1 
ATOM   10012 C  CG  . TYR F  3  90  ? 74.920  22.996  -84.090  1.00 60.25  ? 168 TYR F CG  1 
ATOM   10013 C  CD1 . TYR F  3  90  ? 75.369  24.288  -83.829  1.00 57.45  ? 168 TYR F CD1 1 
ATOM   10014 C  CD2 . TYR F  3  90  ? 73.666  22.837  -84.660  1.00 64.44  ? 168 TYR F CD2 1 
ATOM   10015 C  CE1 . TYR F  3  90  ? 74.598  25.383  -84.128  1.00 52.91  ? 168 TYR F CE1 1 
ATOM   10016 C  CE2 . TYR F  3  90  ? 72.885  23.931  -84.967  1.00 68.79  ? 168 TYR F CE2 1 
ATOM   10017 C  CZ  . TYR F  3  90  ? 73.357  25.202  -84.699  1.00 66.27  ? 168 TYR F CZ  1 
ATOM   10018 O  OH  . TYR F  3  90  ? 72.583  26.295  -85.008  1.00 82.39  ? 168 TYR F OH  1 
ATOM   10019 N  N   . TYR F  3  91  ? 76.224  19.054  -82.518  1.00 44.36  ? 169 TYR F N   1 
ATOM   10020 C  CA  . TYR F  3  91  ? 77.004  17.842  -82.565  1.00 51.79  ? 169 TYR F CA  1 
ATOM   10021 C  C   . TYR F  3  91  ? 77.258  17.588  -84.046  1.00 48.74  ? 169 TYR F C   1 
ATOM   10022 O  O   . TYR F  3  91  ? 76.354  17.711  -84.862  1.00 55.18  ? 169 TYR F O   1 
ATOM   10023 C  CB  . TYR F  3  91  ? 76.236  16.671  -81.961  1.00 55.60  ? 169 TYR F CB  1 
ATOM   10024 C  CG  . TYR F  3  91  ? 76.348  16.555  -80.462  1.00 53.26  ? 169 TYR F CG  1 
ATOM   10025 C  CD1 . TYR F  3  91  ? 75.445  17.205  -79.616  1.00 48.23  ? 169 TYR F CD1 1 
ATOM   10026 C  CD2 . TYR F  3  91  ? 77.344  15.769  -79.887  1.00 50.43  ? 169 TYR F CD2 1 
ATOM   10027 C  CE1 . TYR F  3  91  ? 75.531  17.065  -78.226  1.00 42.83  ? 169 TYR F CE1 1 
ATOM   10028 C  CE2 . TYR F  3  91  ? 77.441  15.624  -78.500  1.00 50.78  ? 169 TYR F CE2 1 
ATOM   10029 C  CZ  . TYR F  3  91  ? 76.532  16.272  -77.678  1.00 45.54  ? 169 TYR F CZ  1 
ATOM   10030 O  OH  . TYR F  3  91  ? 76.629  16.109  -76.319  1.00 50.87  ? 169 TYR F OH  1 
ATOM   10031 N  N   . ILE F  3  92  ? 78.492  17.267  -84.396  1.00 39.53  ? 170 ILE F N   1 
ATOM   10032 C  CA  . ILE F  3  92  ? 78.825  16.999  -85.777  1.00 40.91  ? 170 ILE F CA  1 
ATOM   10033 C  C   . ILE F  3  92  ? 79.563  15.683  -85.756  1.00 52.80  ? 170 ILE F C   1 
ATOM   10034 O  O   . ILE F  3  92  ? 80.184  15.340  -84.753  1.00 60.69  ? 170 ILE F O   1 
ATOM   10035 C  CB  . ILE F  3  92  ? 79.742  18.104  -86.360  1.00 47.21  ? 170 ILE F CB  1 
ATOM   10036 C  CG1 . ILE F  3  92  ? 81.135  18.025  -85.736  1.00 47.51  ? 170 ILE F CG1 1 
ATOM   10037 C  CG2 . ILE F  3  92  ? 79.144  19.492  -86.078  1.00 46.82  ? 170 ILE F CG2 1 
ATOM   10038 C  CD1 . ILE F  3  92  ? 82.055  19.154  -86.146  1.00 42.03  ? 170 ILE F CD1 1 
ATOM   10039 N  N   . LYS F  3  93  ? 79.486  14.929  -86.843  1.00 56.92  ? 171 LYS F N   1 
ATOM   10040 C  CA  . LYS F  3  93  ? 80.185  13.652  -86.903  1.00 57.45  ? 171 LYS F CA  1 
ATOM   10041 C  C   . LYS F  3  93  ? 80.984  13.473  -88.190  1.00 55.94  ? 171 LYS F C   1 
ATOM   10042 O  O   . LYS F  3  93  ? 80.446  13.057  -89.212  1.00 64.30  ? 171 LYS F O   1 
ATOM   10043 C  CB  . LYS F  3  93  ? 79.204  12.487  -86.746  1.00 51.00  ? 171 LYS F CB  1 
ATOM   10044 C  CG  . LYS F  3  93  ? 79.863  11.112  -86.887  1.00 53.98  ? 171 LYS F CG  1 
ATOM   10045 C  CD  . LYS F  3  93  ? 78.862  9.998   -86.659  1.00 62.61  ? 171 LYS F CD  1 
ATOM   10046 C  CE  . LYS F  3  93  ? 79.549  8.645   -86.496  1.00 67.72  ? 171 LYS F CE  1 
ATOM   10047 N  NZ  . LYS F  3  93  ? 78.582  7.599   -86.027  1.00 69.68  ? 171 LYS F NZ  1 
ATOM   10048 N  N   . PRO F  3  94  ? 82.283  13.804  -88.156  1.00 58.00  ? 172 PRO F N   1 
ATOM   10049 C  CA  . PRO F  3  94  ? 83.106  13.649  -89.353  1.00 56.16  ? 172 PRO F CA  1 
ATOM   10050 C  C   . PRO F  3  94  ? 83.032  12.210  -89.809  1.00 56.96  ? 172 PRO F C   1 
ATOM   10051 O  O   . PRO F  3  94  ? 82.579  11.348  -89.067  1.00 55.52  ? 172 PRO F O   1 
ATOM   10052 C  CB  . PRO F  3  94  ? 84.484  14.038  -88.863  1.00 60.72  ? 172 PRO F CB  1 
ATOM   10053 C  CG  . PRO F  3  94  ? 84.163  15.122  -87.880  1.00 66.21  ? 172 PRO F CG  1 
ATOM   10054 C  CD  . PRO F  3  94  ? 83.027  14.516  -87.104  1.00 56.43  ? 172 PRO F CD  1 
ATOM   10055 N  N   . LEU F  3  95  ? 83.471  11.961  -91.034  1.00 72.38  ? 173 LEU F N   1 
ATOM   10056 C  CA  . LEU F  3  95  ? 83.424  10.632  -91.611  1.00 72.91  ? 173 LEU F CA  1 
ATOM   10057 C  C   . LEU F  3  95  ? 83.911  9.551   -90.669  1.00 75.52  ? 173 LEU F C   1 
ATOM   10058 O  O   . LEU F  3  95  ? 83.103  8.890   -90.015  1.00 87.90  ? 173 LEU F O   1 
ATOM   10059 C  CB  . LEU F  3  95  ? 84.232  10.591  -92.907  1.00 79.73  ? 173 LEU F CB  1 
ATOM   10060 C  CG  . LEU F  3  95  ? 84.268  9.245   -93.641  1.00 90.69  ? 173 LEU F CG  1 
ATOM   10061 C  CD1 . LEU F  3  95  ? 82.844  8.780   -93.956  1.00 85.26  ? 173 LEU F CD1 1 
ATOM   10062 C  CD2 . LEU F  3  95  ? 85.103  9.388   -94.916  1.00 84.64  ? 173 LEU F CD2 1 
ATOM   10063 N  N   . LYS F  3  96  ? 85.225  9.377   -90.587  1.00 67.91  ? 174 LYS F N   1 
ATOM   10064 C  CA  . LYS F  3  96  ? 85.794  8.333   -89.742  1.00 69.53  ? 174 LYS F CA  1 
ATOM   10065 C  C   . LYS F  3  96  ? 85.575  8.530   -88.254  1.00 62.08  ? 174 LYS F C   1 
ATOM   10066 O  O   . LYS F  3  96  ? 85.975  7.685   -87.461  1.00 62.69  ? 174 LYS F O   1 
ATOM   10067 C  CB  . LYS F  3  96  ? 87.287  8.193   -90.014  1.00 80.89  ? 174 LYS F CB  1 
ATOM   10068 C  CG  . LYS F  3  96  ? 87.639  7.997   -91.481  1.00 83.45  ? 174 LYS F CG  1 
ATOM   10069 C  CD  . LYS F  3  96  ? 87.120  6.685   -92.035  1.00 83.93  ? 174 LYS F CD  1 
ATOM   10070 C  CE  . LYS F  3  96  ? 87.622  6.488   -93.454  1.00 91.16  ? 174 LYS F CE  1 
ATOM   10071 N  NZ  . LYS F  3  96  ? 89.109  6.588   -93.507  1.00 88.44  ? 174 LYS F NZ  1 
ATOM   10072 N  N   . ALA F  3  97  ? 84.954  9.644   -87.876  1.00 63.89  ? 175 ALA F N   1 
ATOM   10073 C  CA  . ALA F  3  97  ? 84.672  9.925   -86.470  1.00 60.90  ? 175 ALA F CA  1 
ATOM   10074 C  C   . ALA F  3  97  ? 83.812  8.802   -85.892  1.00 67.74  ? 175 ALA F C   1 
ATOM   10075 O  O   . ALA F  3  97  ? 82.729  8.502   -86.406  1.00 72.12  ? 175 ALA F O   1 
ATOM   10076 C  CB  . ALA F  3  97  ? 83.948  11.249  -86.336  1.00 48.53  ? 175 ALA F CB  1 
ATOM   10077 N  N   . LYS F  3  98  ? 84.294  8.190   -84.816  1.00 66.39  ? 176 LYS F N   1 
ATOM   10078 C  CA  . LYS F  3  98  ? 83.582  7.088   -84.189  1.00 63.68  ? 176 LYS F CA  1 
ATOM   10079 C  C   . LYS F  3  98  ? 82.437  7.509   -83.281  1.00 60.49  ? 176 LYS F C   1 
ATOM   10080 O  O   . LYS F  3  98  ? 81.470  6.773   -83.103  1.00 66.04  ? 176 LYS F O   1 
ATOM   10081 C  CB  . LYS F  3  98  ? 84.577  6.226   -83.417  1.00 61.06  ? 176 LYS F CB  1 
ATOM   10082 C  CG  . LYS F  3  98  ? 85.507  7.023   -82.533  1.00 75.13  ? 176 LYS F CG  1 
ATOM   10083 C  CD  . LYS F  3  98  ? 86.760  6.226   -82.177  1.00 85.16  ? 176 LYS F CD  1 
ATOM   10084 C  CE  . LYS F  3  98  ? 87.712  7.030   -81.291  1.00 86.46  ? 176 LYS F CE  1 
ATOM   10085 N  NZ  . LYS F  3  98  ? 87.110  7.358   -79.964  1.00 94.74  ? 176 LYS F NZ  1 
ATOM   10086 N  N   . GLN F  3  99  ? 82.531  8.710   -82.732  1.00 68.37  ? 177 GLN F N   1 
ATOM   10087 C  CA  . GLN F  3  99  ? 81.520  9.212   -81.808  1.00 73.34  ? 177 GLN F CA  1 
ATOM   10088 C  C   . GLN F  3  99  ? 81.305  10.715  -82.060  1.00 66.58  ? 177 GLN F C   1 
ATOM   10089 O  O   . GLN F  3  99  ? 82.177  11.531  -81.761  1.00 69.96  ? 177 GLN F O   1 
ATOM   10090 C  CB  . GLN F  3  99  ? 82.024  8.960   -80.380  1.00 69.68  ? 177 GLN F CB  1 
ATOM   10091 C  CG  . GLN F  3  99  ? 80.989  9.040   -79.291  1.00 99.99  ? 177 GLN F CG  1 
ATOM   10092 C  CD  . GLN F  3  99  ? 81.550  8.631   -77.930  1.00 117.67 ? 177 GLN F CD  1 
ATOM   10093 O  OE1 . GLN F  3  99  ? 82.080  7.528   -77.771  1.00 124.87 ? 177 GLN F OE1 1 
ATOM   10094 N  NE2 . GLN F  3  99  ? 81.432  9.520   -76.942  1.00 119.38 ? 177 GLN F NE2 1 
ATOM   10095 N  N   . PRO F  3  100 ? 80.134  11.100  -82.594  1.00 57.09  ? 178 PRO F N   1 
ATOM   10096 C  CA  . PRO F  3  100 ? 79.888  12.526  -82.856  1.00 49.03  ? 178 PRO F CA  1 
ATOM   10097 C  C   . PRO F  3  100 ? 80.264  13.380  -81.653  1.00 46.60  ? 178 PRO F C   1 
ATOM   10098 O  O   . PRO F  3  100 ? 80.118  12.937  -80.520  1.00 46.15  ? 178 PRO F O   1 
ATOM   10099 C  CB  . PRO F  3  100 ? 78.389  12.571  -83.143  1.00 44.27  ? 178 PRO F CB  1 
ATOM   10100 C  CG  . PRO F  3  100 ? 77.860  11.458  -82.285  1.00 45.66  ? 178 PRO F CG  1 
ATOM   10101 C  CD  . PRO F  3  100 ? 78.864  10.353  -82.532  1.00 47.62  ? 178 PRO F CD  1 
ATOM   10102 N  N   . PHE F  3  101 ? 80.748  14.597  -81.901  1.00 47.44  ? 179 PHE F N   1 
ATOM   10103 C  CA  . PHE F  3  101 ? 81.141  15.501  -80.822  1.00 42.33  ? 179 PHE F CA  1 
ATOM   10104 C  C   . PHE F  3  101 ? 80.543  16.890  -80.892  1.00 38.73  ? 179 PHE F C   1 
ATOM   10105 O  O   . PHE F  3  101 ? 80.080  17.337  -81.932  1.00 40.08  ? 179 PHE F O   1 
ATOM   10106 C  CB  . PHE F  3  101 ? 82.661  15.631  -80.747  1.00 38.70  ? 179 PHE F CB  1 
ATOM   10107 C  CG  . PHE F  3  101 ? 83.310  15.924  -82.057  1.00 48.09  ? 179 PHE F CG  1 
ATOM   10108 C  CD1 . PHE F  3  101 ? 83.777  14.893  -82.863  1.00 43.17  ? 179 PHE F CD1 1 
ATOM   10109 C  CD2 . PHE F  3  101 ? 83.469  17.237  -82.494  1.00 54.59  ? 179 PHE F CD2 1 
ATOM   10110 C  CE1 . PHE F  3  101 ? 84.396  15.168  -84.086  1.00 35.94  ? 179 PHE F CE1 1 
ATOM   10111 C  CE2 . PHE F  3  101 ? 84.092  17.519  -83.723  1.00 33.97  ? 179 PHE F CE2 1 
ATOM   10112 C  CZ  . PHE F  3  101 ? 84.553  16.481  -84.513  1.00 34.03  ? 179 PHE F CZ  1 
ATOM   10113 N  N   . LEU F  3  102 ? 80.574  17.572  -79.755  1.00 49.09  ? 180 LEU F N   1 
ATOM   10114 C  CA  . LEU F  3  102 ? 80.041  18.919  -79.635  1.00 51.20  ? 180 LEU F CA  1 
ATOM   10115 C  C   . LEU F  3  102 ? 81.081  19.912  -80.162  1.00 50.72  ? 180 LEU F C   1 
ATOM   10116 O  O   . LEU F  3  102 ? 82.281  19.761  -79.915  1.00 52.42  ? 180 LEU F O   1 
ATOM   10117 C  CB  . LEU F  3  102 ? 79.719  19.202  -78.167  1.00 46.39  ? 180 LEU F CB  1 
ATOM   10118 C  CG  . LEU F  3  102 ? 78.852  20.409  -77.826  1.00 54.03  ? 180 LEU F CG  1 
ATOM   10119 C  CD1 . LEU F  3  102 ? 77.453  20.175  -78.348  1.00 41.52  ? 180 LEU F CD1 1 
ATOM   10120 C  CD2 . LEU F  3  102 ? 78.844  20.624  -76.310  1.00 37.75  ? 180 LEU F CD2 1 
ATOM   10121 N  N   . VAL F  3  103 ? 80.613  20.912  -80.900  1.00 44.44  ? 181 VAL F N   1 
ATOM   10122 C  CA  . VAL F  3  103 ? 81.481  21.934  -81.476  1.00 47.12  ? 181 VAL F CA  1 
ATOM   10123 C  C   . VAL F  3  103 ? 80.683  23.211  -81.598  1.00 47.89  ? 181 VAL F C   1 
ATOM   10124 O  O   . VAL F  3  103 ? 79.449  23.164  -81.645  1.00 45.10  ? 181 VAL F O   1 
ATOM   10125 C  CB  . VAL F  3  103 ? 81.918  21.566  -82.883  1.00 47.59  ? 181 VAL F CB  1 
ATOM   10126 C  CG1 . VAL F  3  103 ? 82.722  20.298  -82.859  1.00 48.04  ? 181 VAL F CG1 1 
ATOM   10127 C  CG2 . VAL F  3  103 ? 80.692  21.396  -83.768  1.00 50.05  ? 181 VAL F CG2 1 
ATOM   10128 N  N   . PHE F  3  104 ? 81.371  24.346  -81.646  1.00 45.35  ? 182 PHE F N   1 
ATOM   10129 C  CA  . PHE F  3  104 ? 80.668  25.614  -81.789  1.00 52.81  ? 182 PHE F CA  1 
ATOM   10130 C  C   . PHE F  3  104 ? 80.640  26.033  -83.254  1.00 56.71  ? 182 PHE F C   1 
ATOM   10131 O  O   . PHE F  3  104 ? 81.678  26.305  -83.855  1.00 58.05  ? 182 PHE F O   1 
ATOM   10132 C  CB  . PHE F  3  104 ? 81.331  26.711  -80.974  1.00 50.55  ? 182 PHE F CB  1 
ATOM   10133 C  CG  . PHE F  3  104 ? 80.662  28.055  -81.118  1.00 61.17  ? 182 PHE F CG  1 
ATOM   10134 C  CD1 . PHE F  3  104 ? 80.704  28.748  -82.320  1.00 50.35  ? 182 PHE F CD1 1 
ATOM   10135 C  CD2 . PHE F  3  104 ? 79.976  28.621  -80.049  1.00 53.92  ? 182 PHE F CD2 1 
ATOM   10136 C  CE1 . PHE F  3  104 ? 80.073  29.985  -82.451  1.00 59.22  ? 182 PHE F CE1 1 
ATOM   10137 C  CE2 . PHE F  3  104 ? 79.345  29.850  -80.174  1.00 60.22  ? 182 PHE F CE2 1 
ATOM   10138 C  CZ  . PHE F  3  104 ? 79.393  30.537  -81.379  1.00 56.90  ? 182 PHE F CZ  1 
ATOM   10139 N  N   . CYS F  3  105 ? 79.441  26.102  -83.819  1.00 57.57  ? 183 CYS F N   1 
ATOM   10140 C  CA  . CYS F  3  105 ? 79.279  26.480  -85.213  1.00 46.87  ? 183 CYS F CA  1 
ATOM   10141 C  C   . CYS F  3  105 ? 79.028  27.966  -85.359  1.00 53.04  ? 183 CYS F C   1 
ATOM   10142 O  O   . CYS F  3  105 ? 78.155  28.513  -84.693  1.00 58.48  ? 183 CYS F O   1 
ATOM   10143 C  CB  . CYS F  3  105 ? 78.101  25.747  -85.828  1.00 45.87  ? 183 CYS F CB  1 
ATOM   10144 S  SG  . CYS F  3  105 ? 78.305  23.959  -86.110  1.00 50.19  ? 183 CYS F SG  1 
ATOM   10145 N  N   . GLU F  3  106 ? 79.804  28.625  -86.210  1.00 53.01  ? 184 GLU F N   1 
ATOM   10146 C  CA  . GLU F  3  106 ? 79.596  30.046  -86.462  1.00 56.38  ? 184 GLU F CA  1 
ATOM   10147 C  C   . GLU F  3  106 ? 78.885  30.092  -87.803  1.00 67.96  ? 184 GLU F C   1 
ATOM   10148 O  O   . GLU F  3  106 ? 79.400  29.600  -88.817  1.00 60.54  ? 184 GLU F O   1 
ATOM   10149 C  CB  . GLU F  3  106 ? 80.908  30.809  -86.577  1.00 65.07  ? 184 GLU F CB  1 
ATOM   10150 C  CG  . GLU F  3  106 ? 80.689  32.291  -86.816  1.00 69.22  ? 184 GLU F CG  1 
ATOM   10151 C  CD  . GLU F  3  106 ? 81.983  33.060  -86.992  1.00 86.96  ? 184 GLU F CD  1 
ATOM   10152 O  OE1 . GLU F  3  106 ? 82.877  32.939  -86.127  1.00 93.75  ? 184 GLU F OE1 1 
ATOM   10153 O  OE2 . GLU F  3  106 ? 82.105  33.795  -87.993  1.00 89.50  ? 184 GLU F OE2 1 
ATOM   10154 N  N   . ILE F  3  107 ? 77.696  30.675  -87.814  1.00 70.61  ? 185 ILE F N   1 
ATOM   10155 C  CA  . ILE F  3  107 ? 76.924  30.740  -89.041  1.00 68.39  ? 185 ILE F CA  1 
ATOM   10156 C  C   . ILE F  3  107 ? 76.749  32.157  -89.549  1.00 72.77  ? 185 ILE F C   1 
ATOM   10157 O  O   . ILE F  3  107 ? 76.111  32.985  -88.897  1.00 73.10  ? 185 ILE F O   1 
ATOM   10158 C  CB  . ILE F  3  107 ? 75.554  30.093  -88.838  1.00 63.67  ? 185 ILE F CB  1 
ATOM   10159 C  CG1 . ILE F  3  107 ? 75.751  28.637  -88.404  1.00 56.47  ? 185 ILE F CG1 1 
ATOM   10160 C  CG2 . ILE F  3  107 ? 74.752  30.166  -90.121  1.00 66.36  ? 185 ILE F CG2 1 
ATOM   10161 C  CD1 . ILE F  3  107 ? 74.486  27.927  -87.994  1.00 57.37  ? 185 ILE F CD1 1 
ATOM   10162 N  N   . GLU F  3  108 ? 77.342  32.419  -90.715  1.00 79.39  ? 186 GLU F N   1 
ATOM   10163 C  CA  . GLU F  3  108 ? 77.281  33.720  -91.361  1.00 77.67  ? 186 GLU F CA  1 
ATOM   10164 C  C   . GLU F  3  108 ? 76.194  33.739  -92.415  1.00 85.25  ? 186 GLU F C   1 
ATOM   10165 O  O   . GLU F  3  108 ? 75.069  33.296  -92.194  1.00 94.80  ? 186 GLU F O   1 
ATOM   10166 C  CB  . GLU F  3  108 ? 78.608  34.060  -92.037  1.00 70.61  ? 186 GLU F CB  1 
ATOM   10167 C  CG  . GLU F  3  108 ? 79.716  34.425  -91.098  1.00 81.90  ? 186 GLU F CG  1 
ATOM   10168 C  CD  . GLU F  3  108 ? 80.952  34.881  -91.840  1.00 94.38  ? 186 GLU F CD  1 
ATOM   10169 O  OE1 . GLU F  3  108 ? 81.355  34.174  -92.783  1.00 91.80  ? 186 GLU F OE1 1 
ATOM   10170 O  OE2 . GLU F  3  108 ? 81.524  35.936  -91.483  1.00 102.37 ? 186 GLU F OE2 1 
ATOM   10171 N  N   . ASN F  3  109 ? 76.559  34.249  -93.578  1.00 88.37  ? 187 ASN F N   1 
ATOM   10172 C  CA  . ASN F  3  109 ? 75.647  34.364  -94.696  1.00 87.09  ? 187 ASN F CA  1 
ATOM   10173 C  C   . ASN F  3  109 ? 75.408  32.993  -95.305  1.00 84.06  ? 187 ASN F C   1 
ATOM   10174 O  O   . ASN F  3  109 ? 75.613  32.792  -96.500  1.00 91.18  ? 187 ASN F O   1 
ATOM   10175 C  CB  . ASN F  3  109 ? 76.266  35.312  -95.716  1.00 91.31  ? 187 ASN F CB  1 
ATOM   10176 C  CG  . ASN F  3  109 ? 76.964  36.481  -95.050  1.00 95.38  ? 187 ASN F CG  1 
ATOM   10177 O  OD1 . ASN F  3  109 ? 76.322  37.443  -94.630  1.00 98.38  ? 187 ASN F OD1 1 
ATOM   10178 N  ND2 . ASN F  3  109 ? 78.286  36.388  -94.919  1.00 91.94  ? 187 ASN F ND2 1 
ATOM   10179 N  N   . GLY F  3  110 ? 74.980  32.049  -94.474  1.00 73.69  ? 188 GLY F N   1 
ATOM   10180 C  CA  . GLY F  3  110 ? 74.719  30.711  -94.966  1.00 77.15  ? 188 GLY F CA  1 
ATOM   10181 C  C   . GLY F  3  110 ? 75.915  29.778  -94.913  1.00 77.97  ? 188 GLY F C   1 
ATOM   10182 O  O   . GLY F  3  110 ? 75.919  28.732  -95.563  1.00 80.95  ? 188 GLY F O   1 
ATOM   10183 N  N   . ASN F  3  111 ? 76.931  30.146  -94.141  1.00 78.90  ? 189 ASN F N   1 
ATOM   10184 C  CA  . ASN F  3  111 ? 78.116  29.309  -94.016  1.00 83.51  ? 189 ASN F CA  1 
ATOM   10185 C  C   . ASN F  3  111 ? 78.273  28.704  -92.623  1.00 88.43  ? 189 ASN F C   1 
ATOM   10186 O  O   . ASN F  3  111 ? 78.070  29.378  -91.609  1.00 87.10  ? 189 ASN F O   1 
ATOM   10187 C  CB  . ASN F  3  111 ? 79.367  30.109  -94.347  1.00 88.54  ? 189 ASN F CB  1 
ATOM   10188 C  CG  . ASN F  3  111 ? 79.238  30.858  -95.638  1.00 94.23  ? 189 ASN F CG  1 
ATOM   10189 O  OD1 . ASN F  3  111 ? 78.786  32.006  -95.658  1.00 102.58 ? 189 ASN F OD1 1 
ATOM   10190 N  ND2 . ASN F  3  111 ? 79.616  30.212  -96.736  1.00 87.82  ? 189 ASN F ND2 1 
ATOM   10191 N  N   . GLY F  3  112 ? 78.647  27.426  -92.589  1.00 87.45  ? 190 GLY F N   1 
ATOM   10192 C  CA  . GLY F  3  112 ? 78.842  26.733  -91.329  1.00 68.28  ? 190 GLY F CA  1 
ATOM   10193 C  C   . GLY F  3  112 ? 80.301  26.678  -90.917  1.00 61.25  ? 190 GLY F C   1 
ATOM   10194 O  O   . GLY F  3  112 ? 81.006  25.703  -91.193  1.00 62.13  ? 190 GLY F O   1 
ATOM   10195 N  N   . TRP F  3  113 ? 80.766  27.738  -90.268  1.00 55.93  ? 191 TRP F N   1 
ATOM   10196 C  CA  . TRP F  3  113 ? 82.145  27.782  -89.799  1.00 56.83  ? 191 TRP F CA  1 
ATOM   10197 C  C   . TRP F  3  113 ? 82.249  26.910  -88.558  1.00 59.75  ? 191 TRP F C   1 
ATOM   10198 O  O   . TRP F  3  113 ? 81.655  27.224  -87.521  1.00 62.56  ? 191 TRP F O   1 
ATOM   10199 C  CB  . TRP F  3  113 ? 82.553  29.201  -89.416  1.00 60.18  ? 191 TRP F CB  1 
ATOM   10200 C  CG  . TRP F  3  113 ? 82.810  30.109  -90.554  1.00 68.08  ? 191 TRP F CG  1 
ATOM   10201 C  CD1 . TRP F  3  113 ? 82.000  31.109  -91.012  1.00 69.74  ? 191 TRP F CD1 1 
ATOM   10202 C  CD2 . TRP F  3  113 ? 83.993  30.154  -91.345  1.00 65.33  ? 191 TRP F CD2 1 
ATOM   10203 N  NE1 . TRP F  3  113 ? 82.614  31.781  -92.035  1.00 61.80  ? 191 TRP F NE1 1 
ATOM   10204 C  CE2 . TRP F  3  113 ? 83.841  31.217  -92.261  1.00 63.18  ? 191 TRP F CE2 1 
ATOM   10205 C  CE3 . TRP F  3  113 ? 85.173  29.400  -91.367  1.00 69.30  ? 191 TRP F CE3 1 
ATOM   10206 C  CZ2 . TRP F  3  113 ? 84.828  31.550  -93.194  1.00 58.24  ? 191 TRP F CZ2 1 
ATOM   10207 C  CZ3 . TRP F  3  113 ? 86.153  29.729  -92.293  1.00 75.40  ? 191 TRP F CZ3 1 
ATOM   10208 C  CH2 . TRP F  3  113 ? 85.973  30.798  -93.195  1.00 69.91  ? 191 TRP F CH2 1 
ATOM   10209 N  N   . THR F  3  114 ? 82.992  25.816  -88.648  1.00 49.97  ? 192 THR F N   1 
ATOM   10210 C  CA  . THR F  3  114 ? 83.147  24.962  -87.486  1.00 49.91  ? 192 THR F CA  1 
ATOM   10211 C  C   . THR F  3  114 ? 84.461  25.320  -86.756  1.00 52.73  ? 192 THR F C   1 
ATOM   10212 O  O   . THR F  3  114 ? 85.566  25.012  -87.205  1.00 52.03  ? 192 THR F O   1 
ATOM   10213 C  CB  . THR F  3  114 ? 83.055  23.465  -87.896  1.00 44.67  ? 192 THR F CB  1 
ATOM   10214 O  OG1 . THR F  3  114 ? 84.121  22.721  -87.299  1.00 63.50  ? 192 THR F OG1 1 
ATOM   10215 C  CG2 . THR F  3  114 ? 83.090  23.327  -89.412  1.00 68.51  ? 192 THR F CG2 1 
ATOM   10216 N  N   . VAL F  3  115 ? 84.309  26.011  -85.628  1.00 45.96  ? 193 VAL F N   1 
ATOM   10217 C  CA  . VAL F  3  115 ? 85.426  26.469  -84.807  1.00 41.55  ? 193 VAL F CA  1 
ATOM   10218 C  C   . VAL F  3  115 ? 86.339  25.398  -84.229  1.00 43.95  ? 193 VAL F C   1 
ATOM   10219 O  O   . VAL F  3  115 ? 85.903  24.465  -83.556  1.00 46.26  ? 193 VAL F O   1 
ATOM   10220 C  CB  . VAL F  3  115 ? 84.924  27.312  -83.649  1.00 25.76  ? 193 VAL F CB  1 
ATOM   10221 C  CG1 . VAL F  3  115 ? 86.100  27.880  -82.894  1.00 34.37  ? 193 VAL F CG1 1 
ATOM   10222 C  CG2 . VAL F  3  115 ? 84.018  28.411  -84.163  1.00 32.51  ? 193 VAL F CG2 1 
ATOM   10223 N  N   . ILE F  3  116 ? 87.625  25.577  -84.469  1.00 50.60  ? 194 ILE F N   1 
ATOM   10224 C  CA  . ILE F  3  116 ? 88.651  24.655  -84.011  1.00 60.56  ? 194 ILE F CA  1 
ATOM   10225 C  C   . ILE F  3  116 ? 89.268  25.117  -82.702  1.00 59.24  ? 194 ILE F C   1 
ATOM   10226 O  O   . ILE F  3  116 ? 89.516  24.312  -81.812  1.00 61.04  ? 194 ILE F O   1 
ATOM   10227 C  CB  . ILE F  3  116 ? 89.775  24.528  -85.078  1.00 70.06  ? 194 ILE F CB  1 
ATOM   10228 C  CG1 . ILE F  3  116 ? 89.306  23.623  -86.208  1.00 74.08  ? 194 ILE F CG1 1 
ATOM   10229 C  CG2 . ILE F  3  116 ? 91.055  24.019  -84.459  1.00 70.87  ? 194 ILE F CG2 1 
ATOM   10230 C  CD1 . ILE F  3  116 ? 88.825  22.286  -85.728  1.00 84.62  ? 194 ILE F CD1 1 
ATOM   10231 N  N   . GLN F  3  117 ? 89.520  26.419  -82.596  1.00 60.40  ? 195 GLN F N   1 
ATOM   10232 C  CA  . GLN F  3  117 ? 90.140  26.997  -81.407  1.00 58.50  ? 195 GLN F CA  1 
ATOM   10233 C  C   . GLN F  3  117 ? 89.671  28.421  -81.173  1.00 55.46  ? 195 GLN F C   1 
ATOM   10234 O  O   . GLN F  3  117 ? 89.169  29.075  -82.075  1.00 64.25  ? 195 GLN F O   1 
ATOM   10235 C  CB  . GLN F  3  117 ? 91.670  26.997  -81.559  1.00 56.97  ? 195 GLN F CB  1 
ATOM   10236 C  CG  . GLN F  3  117 ? 92.434  27.534  -80.344  1.00 62.02  ? 195 GLN F CG  1 
ATOM   10237 C  CD  . GLN F  3  117 ? 93.035  28.921  -80.558  1.00 57.60  ? 195 GLN F CD  1 
ATOM   10238 O  OE1 . GLN F  3  117 ? 92.364  29.842  -81.023  1.00 55.15  ? 195 GLN F OE1 1 
ATOM   10239 N  NE2 . GLN F  3  117 ? 94.305  29.074  -80.200  1.00 47.63  ? 195 GLN F NE2 1 
ATOM   10240 N  N   . HIS F  3  118 ? 89.830  28.897  -79.946  1.00 57.65  ? 196 HIS F N   1 
ATOM   10241 C  CA  . HIS F  3  118 ? 89.461  30.260  -79.613  1.00 51.74  ? 196 HIS F CA  1 
ATOM   10242 C  C   . HIS F  3  118 ? 90.098  30.697  -78.304  1.00 55.08  ? 196 HIS F C   1 
ATOM   10243 O  O   . HIS F  3  118 ? 90.108  29.963  -77.310  1.00 59.63  ? 196 HIS F O   1 
ATOM   10244 C  CB  . HIS F  3  118 ? 87.946  30.413  -79.547  1.00 52.00  ? 196 HIS F CB  1 
ATOM   10245 C  CG  . HIS F  3  118 ? 87.491  31.816  -79.283  1.00 53.11  ? 196 HIS F CG  1 
ATOM   10246 N  ND1 . HIS F  3  118 ? 87.353  32.327  -78.010  1.00 58.34  ? 196 HIS F ND1 1 
ATOM   10247 C  CD2 . HIS F  3  118 ? 87.145  32.815  -80.128  1.00 50.19  ? 196 HIS F CD2 1 
ATOM   10248 C  CE1 . HIS F  3  118 ? 86.938  33.579  -78.081  1.00 52.42  ? 196 HIS F CE1 1 
ATOM   10249 N  NE2 . HIS F  3  118 ? 86.804  33.899  -79.356  1.00 60.15  ? 196 HIS F NE2 1 
ATOM   10250 N  N   . ARG F  3  119 ? 90.653  31.899  -78.334  1.00 54.50  ? 197 ARG F N   1 
ATOM   10251 C  CA  . ARG F  3  119 ? 91.312  32.496  -77.187  1.00 51.45  ? 197 ARG F CA  1 
ATOM   10252 C  C   . ARG F  3  119 ? 90.399  33.649  -76.800  1.00 56.81  ? 197 ARG F C   1 
ATOM   10253 O  O   . ARG F  3  119 ? 89.830  34.288  -77.682  1.00 56.87  ? 197 ARG F O   1 
ATOM   10254 C  CB  . ARG F  3  119 ? 92.677  32.985  -77.629  1.00 62.40  ? 197 ARG F CB  1 
ATOM   10255 C  CG  . ARG F  3  119 ? 93.775  32.568  -76.717  1.00 61.44  ? 197 ARG F CG  1 
ATOM   10256 C  CD  . ARG F  3  119 ? 93.743  31.085  -76.421  1.00 56.77  ? 197 ARG F CD  1 
ATOM   10257 N  NE  . ARG F  3  119 ? 94.437  30.844  -75.160  1.00 67.51  ? 197 ARG F NE  1 
ATOM   10258 C  CZ  . ARG F  3  119 ? 95.753  30.917  -75.004  1.00 52.75  ? 197 ARG F CZ  1 
ATOM   10259 N  NH1 . ARG F  3  119 ? 96.532  31.205  -76.033  1.00 76.98  ? 197 ARG F NH1 1 
ATOM   10260 N  NH2 . ARG F  3  119 ? 96.284  30.750  -73.808  1.00 64.81  ? 197 ARG F NH2 1 
ATOM   10261 N  N   . HIS F  3  120 ? 90.257  33.948  -75.512  1.00 57.81  ? 198 HIS F N   1 
ATOM   10262 C  CA  . HIS F  3  120 ? 89.305  34.992  -75.138  1.00 54.47  ? 198 HIS F CA  1 
ATOM   10263 C  C   . HIS F  3  120 ? 89.606  35.804  -73.889  1.00 51.23  ? 198 HIS F C   1 
ATOM   10264 O  O   . HIS F  3  120 ? 89.171  36.948  -73.772  1.00 57.63  ? 198 HIS F O   1 
ATOM   10265 C  CB  . HIS F  3  120 ? 87.931  34.329  -74.977  1.00 62.21  ? 198 HIS F CB  1 
ATOM   10266 C  CG  . HIS F  3  120 ? 86.775  35.272  -75.050  1.00 52.75  ? 198 HIS F CG  1 
ATOM   10267 N  ND1 . HIS F  3  120 ? 86.234  35.688  -76.244  1.00 48.81  ? 198 HIS F ND1 1 
ATOM   10268 C  CD2 . HIS F  3  120 ? 86.040  35.858  -74.078  1.00 46.13  ? 198 HIS F CD2 1 
ATOM   10269 C  CE1 . HIS F  3  120 ? 85.211  36.489  -76.006  1.00 48.38  ? 198 HIS F CE1 1 
ATOM   10270 N  NE2 . HIS F  3  120 ? 85.072  36.607  -74.699  1.00 59.16  ? 198 HIS F NE2 1 
ATOM   10271 N  N   . ASP F  3  121 ? 90.328  35.217  -72.943  1.00 58.32  ? 199 ASP F N   1 
ATOM   10272 C  CA  . ASP F  3  121 ? 90.629  35.919  -71.699  1.00 59.46  ? 199 ASP F CA  1 
ATOM   10273 C  C   . ASP F  3  121 ? 91.621  35.186  -70.804  1.00 57.29  ? 199 ASP F C   1 
ATOM   10274 O  O   . ASP F  3  121 ? 91.591  35.340  -69.582  1.00 47.74  ? 199 ASP F O   1 
ATOM   10275 C  CB  . ASP F  3  121 ? 89.340  36.137  -70.925  1.00 60.24  ? 199 ASP F CB  1 
ATOM   10276 C  CG  . ASP F  3  121 ? 88.459  34.913  -70.939  1.00 65.59  ? 199 ASP F CG  1 
ATOM   10277 O  OD1 . ASP F  3  121 ? 89.020  33.797  -70.926  1.00 62.98  ? 199 ASP F OD1 1 
ATOM   10278 O  OD2 . ASP F  3  121 ? 87.218  35.064  -70.959  1.00 74.07  ? 199 ASP F OD2 1 
ATOM   10279 N  N   . GLY F  3  122 ? 92.493  34.395  -71.421  1.00 52.22  ? 200 GLY F N   1 
ATOM   10280 C  CA  . GLY F  3  122 ? 93.498  33.659  -70.676  1.00 63.33  ? 200 GLY F CA  1 
ATOM   10281 C  C   . GLY F  3  122 ? 93.006  33.038  -69.387  1.00 62.22  ? 200 GLY F C   1 
ATOM   10282 O  O   . GLY F  3  122 ? 93.678  33.105  -68.358  1.00 68.42  ? 200 GLY F O   1 
ATOM   10283 N  N   . SER F  3  123 ? 91.827  32.433  -69.444  1.00 62.88  ? 201 SER F N   1 
ATOM   10284 C  CA  . SER F  3  123 ? 91.244  31.783  -68.282  1.00 58.40  ? 201 SER F CA  1 
ATOM   10285 C  C   . SER F  3  123 ? 91.407  30.270  -68.368  1.00 53.94  ? 201 SER F C   1 
ATOM   10286 O  O   . SER F  3  123 ? 91.015  29.547  -67.466  1.00 64.74  ? 201 SER F O   1 
ATOM   10287 C  CB  . SER F  3  123 ? 89.763  32.121  -68.192  1.00 60.45  ? 201 SER F CB  1 
ATOM   10288 O  OG  . SER F  3  123 ? 89.078  31.652  -69.339  1.00 66.23  ? 201 SER F OG  1 
ATOM   10289 N  N   . VAL F  3  124 ? 91.984  29.793  -69.461  1.00 49.82  ? 202 VAL F N   1 
ATOM   10290 C  CA  . VAL F  3  124 ? 92.180  28.367  -69.650  1.00 51.96  ? 202 VAL F CA  1 
ATOM   10291 C  C   . VAL F  3  124 ? 93.661  28.117  -69.873  1.00 53.15  ? 202 VAL F C   1 
ATOM   10292 O  O   . VAL F  3  124 ? 94.218  28.573  -70.863  1.00 53.99  ? 202 VAL F O   1 
ATOM   10293 C  CB  . VAL F  3  124 ? 91.388  27.869  -70.883  1.00 56.44  ? 202 VAL F CB  1 
ATOM   10294 C  CG1 . VAL F  3  124 ? 91.586  26.367  -71.077  1.00 41.73  ? 202 VAL F CG1 1 
ATOM   10295 C  CG2 . VAL F  3  124 ? 89.916  28.203  -70.715  1.00 52.63  ? 202 VAL F CG2 1 
ATOM   10296 N  N   . ASN F  3  125 ? 94.299  27.400  -68.954  1.00 49.59  ? 203 ASN F N   1 
ATOM   10297 C  CA  . ASN F  3  125 ? 95.725  27.113  -69.077  1.00 53.07  ? 203 ASN F CA  1 
ATOM   10298 C  C   . ASN F  3  125 ? 95.917  26.254  -70.324  1.00 62.59  ? 203 ASN F C   1 
ATOM   10299 O  O   . ASN F  3  125 ? 95.390  25.139  -70.394  1.00 64.46  ? 203 ASN F O   1 
ATOM   10300 C  CB  . ASN F  3  125 ? 96.219  26.355  -67.832  1.00 58.71  ? 203 ASN F CB  1 
ATOM   10301 C  CG  . ASN F  3  125 ? 97.737  26.335  -67.711  1.00 46.12  ? 203 ASN F CG  1 
ATOM   10302 O  OD1 . ASN F  3  125 ? 98.446  26.241  -68.707  1.00 67.97  ? 203 ASN F OD1 1 
ATOM   10303 N  ND2 . ASN F  3  125 ? 98.238  26.402  -66.481  1.00 50.18  ? 203 ASN F ND2 1 
ATOM   10304 N  N   . PHE F  3  126 ? 96.659  26.769  -71.308  1.00 60.59  ? 204 PHE F N   1 
ATOM   10305 C  CA  . PHE F  3  126 ? 96.898  26.022  -72.542  1.00 55.63  ? 204 PHE F CA  1 
ATOM   10306 C  C   . PHE F  3  126 ? 98.149  25.167  -72.518  1.00 55.14  ? 204 PHE F C   1 
ATOM   10307 O  O   . PHE F  3  126 ? 98.526  24.562  -73.517  1.00 65.75  ? 204 PHE F O   1 
ATOM   10308 C  CB  . PHE F  3  126 ? 96.949  26.957  -73.750  1.00 44.44  ? 204 PHE F CB  1 
ATOM   10309 C  CG  . PHE F  3  126 ? 95.627  27.134  -74.417  1.00 43.39  ? 204 PHE F CG  1 
ATOM   10310 C  CD1 . PHE F  3  126 ? 94.641  27.927  -73.843  1.00 43.06  ? 204 PHE F CD1 1 
ATOM   10311 C  CD2 . PHE F  3  126 ? 95.343  26.473  -75.603  1.00 55.20  ? 204 PHE F CD2 1 
ATOM   10312 C  CE1 . PHE F  3  126 ? 93.380  28.060  -74.443  1.00 46.42  ? 204 PHE F CE1 1 
ATOM   10313 C  CE2 . PHE F  3  126 ? 94.085  26.598  -76.211  1.00 59.20  ? 204 PHE F CE2 1 
ATOM   10314 C  CZ  . PHE F  3  126 ? 93.102  27.396  -75.625  1.00 45.84  ? 204 PHE F CZ  1 
ATOM   10315 N  N   . THR F  3  127 ? 98.798  25.114  -71.372  1.00 59.20  ? 205 THR F N   1 
ATOM   10316 C  CA  . THR F  3  127 ? 99.989  24.303  -71.237  1.00 64.61  ? 205 THR F CA  1 
ATOM   10317 C  C   . THR F  3  127 ? 99.479  22.899  -70.950  1.00 59.92  ? 205 THR F C   1 
ATOM   10318 O  O   . THR F  3  127 ? 99.367  22.502  -69.801  1.00 53.73  ? 205 THR F O   1 
ATOM   10319 C  CB  . THR F  3  127 ? 100.857 24.783  -70.060  1.00 68.93  ? 205 THR F CB  1 
ATOM   10320 O  OG1 . THR F  3  127 ? 101.019 26.208  -70.131  1.00 77.83  ? 205 THR F OG1 1 
ATOM   10321 C  CG2 . THR F  3  127 ? 102.223 24.123  -70.112  1.00 73.93  ? 205 THR F CG2 1 
ATOM   10322 N  N   . ARG F  3  128 ? 99.147  22.156  -71.999  1.00 61.42  ? 206 ARG F N   1 
ATOM   10323 C  CA  . ARG F  3  128 ? 98.637  20.809  -71.815  1.00 57.33  ? 206 ARG F CA  1 
ATOM   10324 C  C   . ARG F  3  128 ? 99.484  19.791  -72.519  1.00 50.71  ? 206 ARG F C   1 
ATOM   10325 O  O   . ARG F  3  128 ? 100.202 20.110  -73.450  1.00 54.49  ? 206 ARG F O   1 
ATOM   10326 C  CB  . ARG F  3  128 ? 97.215  20.691  -72.343  1.00 62.93  ? 206 ARG F CB  1 
ATOM   10327 C  CG  . ARG F  3  128 ? 96.262  21.728  -71.816  1.00 51.33  ? 206 ARG F CG  1 
ATOM   10328 C  CD  . ARG F  3  128 ? 96.351  21.857  -70.329  1.00 64.34  ? 206 ARG F CD  1 
ATOM   10329 N  NE  . ARG F  3  128 ? 95.177  22.556  -69.825  1.00 73.43  ? 206 ARG F NE  1 
ATOM   10330 C  CZ  . ARG F  3  128 ? 93.977  21.995  -69.696  1.00 70.80  ? 206 ARG F CZ  1 
ATOM   10331 N  NH1 . ARG F  3  128 ? 93.792  20.710  -70.028  1.00 35.77  ? 206 ARG F NH1 1 
ATOM   10332 N  NH2 . ARG F  3  128 ? 92.963  22.731  -69.244  1.00 52.38  ? 206 ARG F NH2 1 
ATOM   10333 N  N   . ASP F  3  129 ? 99.369  18.548  -72.078  1.00 58.34  ? 207 ASP F N   1 
ATOM   10334 C  CA  . ASP F  3  129 ? 100.134 17.469  -72.667  1.00 66.01  ? 207 ASP F CA  1 
ATOM   10335 C  C   . ASP F  3  129 ? 99.594  17.082  -74.036  1.00 67.19  ? 207 ASP F C   1 
ATOM   10336 O  O   . ASP F  3  129 ? 98.621  17.654  -74.533  1.00 60.15  ? 207 ASP F O   1 
ATOM   10337 C  CB  . ASP F  3  129 ? 100.114 16.247  -71.758  1.00 66.93  ? 207 ASP F CB  1 
ATOM   10338 C  CG  . ASP F  3  129 ? 98.735  15.694  -71.583  1.00 68.01  ? 207 ASP F CG  1 
ATOM   10339 O  OD1 . ASP F  3  129 ? 97.965  16.272  -70.795  1.00 69.32  ? 207 ASP F OD1 1 
ATOM   10340 O  OD2 . ASP F  3  129 ? 98.415  14.692  -72.252  1.00 73.24  ? 207 ASP F OD2 1 
ATOM   10341 N  N   . TRP F  3  130 ? 100.243 16.090  -74.631  1.00 68.82  ? 208 TRP F N   1 
ATOM   10342 C  CA  . TRP F  3  130 ? 99.877  15.598  -75.944  1.00 68.75  ? 208 TRP F CA  1 
ATOM   10343 C  C   . TRP F  3  130 ? 98.458  15.063  -75.955  1.00 70.68  ? 208 TRP F C   1 
ATOM   10344 O  O   . TRP F  3  130 ? 97.583  15.604  -76.632  1.00 77.17  ? 208 TRP F O   1 
ATOM   10345 C  CB  . TRP F  3  130 ? 100.859 14.503  -76.364  1.00 69.13  ? 208 TRP F CB  1 
ATOM   10346 C  CG  . TRP F  3  130 ? 100.588 13.928  -77.708  1.00 62.73  ? 208 TRP F CG  1 
ATOM   10347 C  CD1 . TRP F  3  130 ? 99.946  12.762  -77.984  1.00 60.30  ? 208 TRP F CD1 1 
ATOM   10348 C  CD2 . TRP F  3  130 ? 100.950 14.496  -78.966  1.00 64.67  ? 208 TRP F CD2 1 
ATOM   10349 N  NE1 . TRP F  3  130 ? 99.885  12.561  -79.339  1.00 56.82  ? 208 TRP F NE1 1 
ATOM   10350 C  CE2 . TRP F  3  130 ? 100.495 13.614  -79.966  1.00 65.49  ? 208 TRP F CE2 1 
ATOM   10351 C  CE3 . TRP F  3  130 ? 101.616 15.671  -79.347  1.00 69.69  ? 208 TRP F CE3 1 
ATOM   10352 C  CZ2 . TRP F  3  130 ? 100.685 13.867  -81.326  1.00 67.60  ? 208 TRP F CZ2 1 
ATOM   10353 C  CZ3 . TRP F  3  130 ? 101.803 15.923  -80.698  1.00 64.84  ? 208 TRP F CZ3 1 
ATOM   10354 C  CH2 . TRP F  3  130 ? 101.339 15.024  -81.671  1.00 64.90  ? 208 TRP F CH2 1 
ATOM   10355 N  N   . VAL F  3  131 ? 98.240  13.995  -75.198  1.00 64.70  ? 209 VAL F N   1 
ATOM   10356 C  CA  . VAL F  3  131 ? 96.933  13.373  -75.127  1.00 56.96  ? 209 VAL F CA  1 
ATOM   10357 C  C   . VAL F  3  131 ? 95.878  14.439  -74.873  1.00 53.64  ? 209 VAL F C   1 
ATOM   10358 O  O   . VAL F  3  131 ? 94.775  14.393  -75.421  1.00 61.18  ? 209 VAL F O   1 
ATOM   10359 C  CB  . VAL F  3  131 ? 96.891  12.273  -74.006  1.00 52.63  ? 209 VAL F CB  1 
ATOM   10360 C  CG1 . VAL F  3  131 ? 98.242  12.182  -73.312  1.00 37.11  ? 209 VAL F CG1 1 
ATOM   10361 C  CG2 . VAL F  3  131 ? 95.783  12.559  -73.001  1.00 36.54  ? 209 VAL F CG2 1 
ATOM   10362 N  N   . SER F  3  132 ? 96.220  15.412  -74.049  1.00 39.31  ? 210 SER F N   1 
ATOM   10363 C  CA  . SER F  3  132 ? 95.275  16.470  -73.755  1.00 50.15  ? 210 SER F CA  1 
ATOM   10364 C  C   . SER F  3  132 ? 94.960  17.280  -75.017  1.00 45.66  ? 210 SER F C   1 
ATOM   10365 O  O   . SER F  3  132 ? 93.819  17.661  -75.254  1.00 45.54  ? 210 SER F O   1 
ATOM   10366 C  CB  . SER F  3  132 ? 95.838  17.378  -72.663  1.00 48.79  ? 210 SER F CB  1 
ATOM   10367 O  OG  . SER F  3  132 ? 94.864  18.293  -72.209  1.00 47.90  ? 210 SER F OG  1 
ATOM   10368 N  N   . TYR F  3  133 ? 95.975  17.529  -75.834  1.00 47.42  ? 211 TYR F N   1 
ATOM   10369 C  CA  . TYR F  3  133 ? 95.781  18.299  -77.050  1.00 48.38  ? 211 TYR F CA  1 
ATOM   10370 C  C   . TYR F  3  133 ? 95.060  17.520  -78.138  1.00 58.59  ? 211 TYR F C   1 
ATOM   10371 O  O   . TYR F  3  133 ? 94.370  18.101  -78.984  1.00 60.93  ? 211 TYR F O   1 
ATOM   10372 C  CB  . TYR F  3  133 ? 97.130  18.802  -77.564  1.00 40.20  ? 211 TYR F CB  1 
ATOM   10373 C  CG  . TYR F  3  133 ? 97.376  20.250  -77.225  1.00 46.68  ? 211 TYR F CG  1 
ATOM   10374 C  CD1 . TYR F  3  133 ? 96.874  21.269  -78.036  1.00 50.53  ? 211 TYR F CD1 1 
ATOM   10375 C  CD2 . TYR F  3  133 ? 98.064  20.607  -76.064  1.00 46.26  ? 211 TYR F CD2 1 
ATOM   10376 C  CE1 . TYR F  3  133 ? 97.049  22.611  -77.700  1.00 46.85  ? 211 TYR F CE1 1 
ATOM   10377 C  CE2 . TYR F  3  133 ? 98.245  21.938  -75.717  1.00 47.58  ? 211 TYR F CE2 1 
ATOM   10378 C  CZ  . TYR F  3  133 ? 97.736  22.936  -76.542  1.00 55.38  ? 211 TYR F CZ  1 
ATOM   10379 O  OH  . TYR F  3  133 ? 97.925  24.259  -76.225  1.00 56.07  ? 211 TYR F OH  1 
ATOM   10380 N  N   . ARG F  3  134 ? 95.206  16.202  -78.119  1.00 62.80  ? 212 ARG F N   1 
ATOM   10381 C  CA  . ARG F  3  134 ? 94.561  15.384  -79.128  1.00 61.75  ? 212 ARG F CA  1 
ATOM   10382 C  C   . ARG F  3  134 ? 93.107  15.101  -78.784  1.00 59.85  ? 212 ARG F C   1 
ATOM   10383 O  O   . ARG F  3  134 ? 92.281  14.876  -79.668  1.00 68.53  ? 212 ARG F O   1 
ATOM   10384 C  CB  . ARG F  3  134 ? 95.343  14.082  -79.332  1.00 63.29  ? 212 ARG F CB  1 
ATOM   10385 C  CG  . ARG F  3  134 ? 94.849  12.851  -78.610  1.00 55.80  ? 212 ARG F CG  1 
ATOM   10386 C  CD  . ARG F  3  134 ? 95.589  11.643  -79.175  1.00 53.27  ? 212 ARG F CD  1 
ATOM   10387 N  NE  . ARG F  3  134 ? 95.178  10.376  -78.587  1.00 64.58  ? 212 ARG F NE  1 
ATOM   10388 C  CZ  . ARG F  3  134 ? 95.436  10.007  -77.338  1.00 63.76  ? 212 ARG F CZ  1 
ATOM   10389 N  NH1 . ARG F  3  134 ? 96.108  10.808  -76.531  1.00 51.34  ? 212 ARG F NH1 1 
ATOM   10390 N  NH2 . ARG F  3  134 ? 95.024  8.829   -76.896  1.00 79.98  ? 212 ARG F NH2 1 
ATOM   10391 N  N   . GLU F  3  135 ? 92.793  15.139  -77.497  1.00 54.26  ? 213 GLU F N   1 
ATOM   10392 C  CA  . GLU F  3  135 ? 91.437  14.892  -77.042  1.00 55.12  ? 213 GLU F CA  1 
ATOM   10393 C  C   . GLU F  3  135 ? 90.638  16.179  -77.021  1.00 48.75  ? 213 GLU F C   1 
ATOM   10394 O  O   . GLU F  3  135 ? 89.446  16.197  -77.334  1.00 44.18  ? 213 GLU F O   1 
ATOM   10395 C  CB  . GLU F  3  135 ? 91.460  14.284  -75.644  1.00 60.33  ? 213 GLU F CB  1 
ATOM   10396 C  CG  . GLU F  3  135 ? 92.073  12.909  -75.602  1.00 61.01  ? 213 GLU F CG  1 
ATOM   10397 C  CD  . GLU F  3  135 ? 91.492  12.006  -76.670  1.00 71.57  ? 213 GLU F CD  1 
ATOM   10398 O  OE1 . GLU F  3  135 ? 90.242  11.961  -76.798  1.00 56.92  ? 213 GLU F OE1 1 
ATOM   10399 O  OE2 . GLU F  3  135 ? 92.286  11.345  -77.377  1.00 76.16  ? 213 GLU F OE2 1 
ATOM   10400 N  N   . GLY F  3  136 ? 91.314  17.257  -76.652  1.00 47.60  ? 214 GLY F N   1 
ATOM   10401 C  CA  . GLY F  3  136 ? 90.661  18.546  -76.577  1.00 45.80  ? 214 GLY F CA  1 
ATOM   10402 C  C   . GLY F  3  136 ? 90.540  18.988  -75.140  1.00 43.56  ? 214 GLY F C   1 
ATOM   10403 O  O   . GLY F  3  136 ? 90.656  18.190  -74.212  1.00 55.65  ? 214 GLY F O   1 
ATOM   10404 N  N   . PHE F  3  137 ? 90.305  20.270  -74.950  1.00 40.32  ? 215 PHE F N   1 
ATOM   10405 C  CA  . PHE F  3  137 ? 90.161  20.816  -73.613  1.00 45.63  ? 215 PHE F CA  1 
ATOM   10406 C  C   . PHE F  3  137 ? 89.598  22.227  -73.744  1.00 48.06  ? 215 PHE F C   1 
ATOM   10407 O  O   . PHE F  3  137 ? 89.446  22.741  -74.848  1.00 40.47  ? 215 PHE F O   1 
ATOM   10408 C  CB  . PHE F  3  137 ? 91.518  20.803  -72.863  1.00 36.33  ? 215 PHE F CB  1 
ATOM   10409 C  CG  . PHE F  3  137 ? 92.623  21.512  -73.579  1.00 43.99  ? 215 PHE F CG  1 
ATOM   10410 C  CD1 . PHE F  3  137 ? 92.729  22.904  -73.530  1.00 44.68  ? 215 PHE F CD1 1 
ATOM   10411 C  CD2 . PHE F  3  137 ? 93.517  20.799  -74.368  1.00 44.21  ? 215 PHE F CD2 1 
ATOM   10412 C  CE1 . PHE F  3  137 ? 93.710  23.583  -74.268  1.00 41.95  ? 215 PHE F CE1 1 
ATOM   10413 C  CE2 . PHE F  3  137 ? 94.504  21.468  -75.112  1.00 60.80  ? 215 PHE F CE2 1 
ATOM   10414 C  CZ  . PHE F  3  137 ? 94.596  22.867  -75.060  1.00 48.71  ? 215 PHE F CZ  1 
ATOM   10415 N  N   . GLY F  3  138 ? 89.289  22.857  -72.621  1.00 53.71  ? 216 GLY F N   1 
ATOM   10416 C  CA  . GLY F  3  138 ? 88.715  24.179  -72.688  1.00 49.81  ? 216 GLY F CA  1 
ATOM   10417 C  C   . GLY F  3  138 ? 87.214  24.024  -72.556  1.00 55.17  ? 216 GLY F C   1 
ATOM   10418 O  O   . GLY F  3  138 ? 86.713  22.926  -72.288  1.00 53.45  ? 216 GLY F O   1 
ATOM   10419 N  N   . TYR F  3  139 ? 86.484  25.109  -72.768  1.00 45.88  ? 217 TYR F N   1 
ATOM   10420 C  CA  . TYR F  3  139 ? 85.051  25.062  -72.623  1.00 38.07  ? 217 TYR F CA  1 
ATOM   10421 C  C   . TYR F  3  139 ? 84.315  25.562  -73.843  1.00 41.79  ? 217 TYR F C   1 
ATOM   10422 O  O   . TYR F  3  139 ? 84.789  26.450  -74.538  1