data_1LY2
# 
_entry.id   1LY2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LY2         
RCSB  RCSB016398   
WWPDB D_1000016398 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LY2 
_pdbx_database_status.recvd_initial_deposition_date   2002-06-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Prota, A.E.'     1 
'Sage, D.R.'      2 
'Stehle, T.'      3 
'Fingeroth, J.D.' 4 
# 
_citation.id                        primary 
_citation.title                     'The crystal structure of human CD21: Implications for Epstein-Barr virus and C3d binding.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            99 
_citation.page_first                10641 
_citation.page_last                 10646 
_citation.year                      2002 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12122212 
_citation.pdbx_database_id_DOI      10.1073/pnas.162360499 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Prota, A.E.'     1 ? 
primary 'Sage, D.R.'      2 ? 
primary 'Stehle, T.'      3 ? 
primary 'Fingeroth, J.D.' 4 ? 
# 
_cell.entry_id           1LY2 
_cell.length_a           31.6 
_cell.length_b           33.27 
_cell.length_c           42.11 
_cell.angle_alpha        91.51 
_cell.angle_beta         111.44 
_cell.angle_gamma        117.81 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LY2 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                1 
_symmetry.cell_setting                     triclinic 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'complement receptor type 2'             14256.318 1   ? ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2   ? ? ? ? 
3 water       nat water                                    18.015    146 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CD21; Epstein-Barr virus receptor' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EASCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGG
YKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EASCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGG
YKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ALA n 
1 3   SER n 
1 4   CYS n 
1 5   GLY n 
1 6   SER n 
1 7   PRO n 
1 8   PRO n 
1 9   PRO n 
1 10  ILE n 
1 11  LEU n 
1 12  ASN n 
1 13  GLY n 
1 14  ARG n 
1 15  ILE n 
1 16  SER n 
1 17  TYR n 
1 18  TYR n 
1 19  SER n 
1 20  THR n 
1 21  PRO n 
1 22  ILE n 
1 23  ALA n 
1 24  VAL n 
1 25  GLY n 
1 26  THR n 
1 27  VAL n 
1 28  ILE n 
1 29  ARG n 
1 30  TYR n 
1 31  SER n 
1 32  CYS n 
1 33  SER n 
1 34  GLY n 
1 35  THR n 
1 36  PHE n 
1 37  ARG n 
1 38  LEU n 
1 39  ILE n 
1 40  GLY n 
1 41  GLU n 
1 42  LYS n 
1 43  SER n 
1 44  LEU n 
1 45  LEU n 
1 46  CYS n 
1 47  ILE n 
1 48  THR n 
1 49  LYS n 
1 50  ASP n 
1 51  LYS n 
1 52  VAL n 
1 53  ASP n 
1 54  GLY n 
1 55  THR n 
1 56  TRP n 
1 57  ASP n 
1 58  LYS n 
1 59  PRO n 
1 60  ALA n 
1 61  PRO n 
1 62  LYS n 
1 63  CYS n 
1 64  GLU n 
1 65  TYR n 
1 66  PHE n 
1 67  ASN n 
1 68  LYS n 
1 69  TYR n 
1 70  SER n 
1 71  SER n 
1 72  CYS n 
1 73  PRO n 
1 74  GLU n 
1 75  PRO n 
1 76  ILE n 
1 77  VAL n 
1 78  PRO n 
1 79  GLY n 
1 80  GLY n 
1 81  TYR n 
1 82  LYS n 
1 83  ILE n 
1 84  ARG n 
1 85  GLY n 
1 86  SER n 
1 87  THR n 
1 88  PRO n 
1 89  TYR n 
1 90  ARG n 
1 91  HIS n 
1 92  GLY n 
1 93  ASP n 
1 94  SER n 
1 95  VAL n 
1 96  THR n 
1 97  PHE n 
1 98  ALA n 
1 99  CYS n 
1 100 LYS n 
1 101 THR n 
1 102 ASN n 
1 103 PHE n 
1 104 SER n 
1 105 MET n 
1 106 ASN n 
1 107 GLY n 
1 108 ASN n 
1 109 LYS n 
1 110 SER n 
1 111 VAL n 
1 112 TRP n 
1 113 CYS n 
1 114 GLN n 
1 115 ALA n 
1 116 ASN n 
1 117 ASN n 
1 118 MET n 
1 119 TRP n 
1 120 GLY n 
1 121 PRO n 
1 122 THR n 
1 123 ARG n 
1 124 LEU n 
1 125 PRO n 
1 126 THR n 
1 127 CYS n 
1 128 VAL n 
1 129 SER n 
1 130 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CR2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Pichia pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     Pichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               X-33 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               'PicZa (Invitrogen) secreted protein' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CR2_HUMAN 
_struct_ref.pdbx_db_accession          P20023 
_struct_ref.pdbx_align_begin           20 
_struct_ref.pdbx_seq_one_letter_code   
;GISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGG
YKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSV
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1LY2 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 130 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P20023 
_struct_ref_seq.db_align_beg                  20 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  149 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       0 
_struct_ref_seq.pdbx_auth_seq_align_end       129 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1LY2 GLU A 1   ? UNP P20023 GLY 20  'cloning artifact' 0   1 
1 1LY2 ALA A 2   ? UNP P20023 ILE 21  'cloning artifact' 1   2 
1 1LY2 ILE A 130 ? UNP P20023 VAL 149 'cloning artifact' 129 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1LY2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   50.41 
_exptl_crystal.density_Matthews      2.48 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'PEG 4000, pH 7.5, VAPOR DIFFUSION, HANGING DROP at 298K, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   2001-02-01 
_diffrn_detector.details                wiggler 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    wiggler 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.05 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.05 
# 
_reflns.entry_id                     1LY2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.80 
_reflns.d_resolution_low             30 
_reflns.number_all                   12743 
_reflns.number_obs                   11265 
_reflns.percent_possible_obs         88.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.90 
_reflns_shell.percent_possible_all   55.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.1 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1LY2 
_refine.ls_d_res_high                            1.80 
_refine.ls_d_res_low                             20.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     12743 
_refine.ls_number_reflns_obs                     11265 
_refine.ls_number_reflns_R_free                  1127 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.179 
_refine.ls_R_factor_R_free                       0.234 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 10. 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'Crystal structure of liganded CD21 (complex with C3d)' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        996 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             146 
_refine_hist.number_atoms_total               1170 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d    0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg 1.34  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1LY2 
_struct.title                     'Crystal structure of unliganded human CD21 SCR1-SCR2 (Complement receptor type 2)' 
_struct.pdbx_descriptor           'complement receptor type 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LY2 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            
;Complement receptor; Epstein Barr virus; Regulator of complement activation; short consensus repeat; viral receptor; complement control protein, IMMUNE SYSTEM
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 4   SG  ? ? ? 1_555 A CYS 46  SG ? ? A CYS 3   A CYS 45   1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf2 disulf ?   ? A CYS 32  SG  ? ? ? 1_555 A CYS 63  SG ? ? A CYS 31  A CYS 62   1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf3 disulf ?   ? A CYS 72  SG  ? ? ? 1_555 A CYS 113 SG ? ? A CYS 71  A CYS 112  1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf4 disulf ?   ? A CYS 99  SG  ? ? ? 1_555 A CYS 127 SG ? ? A CYS 98  A CYS 126  1_555 ? ? ? ? ? ? ? 2.047 ? ?               
covale1 covale one ? A ASN 102 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 101 A NAG 1001 1_555 ? ? ? ? ? ? ? 1.455 ? N-Glycosylation 
covale2 covale one ? A ASN 108 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 107 A NAG 1002 1_555 ? ? ? ? ? ? ? 1.459 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 20  A . ? THR 19  A PRO 21  A ? PRO 20  A 1 -0.16 
2 THR 87  A . ? THR 86  A PRO 88  A ? PRO 87  A 1 -0.22 
3 GLY 120 A . ? GLY 119 A PRO 121 A ? PRO 120 A 1 0.15  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 2 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 3   ? CYS A 4   ? SER A 2   CYS A 3   
A 2 ILE A 22  ? ALA A 23  ? ILE A 21  ALA A 22  
B 1 GLY A 13  ? ILE A 15  ? GLY A 12  ILE A 14  
B 2 VAL A 27  ? CYS A 32  ? VAL A 26  CYS A 31  
B 3 SER A 43  ? ILE A 47  ? SER A 42  ILE A 46  
B 4 THR A 55  ? TRP A 56  ? THR A 54  TRP A 55  
C 1 PHE A 36  ? ILE A 39  ? PHE A 35  ILE A 38  
C 2 LYS A 62  ? TYR A 65  ? LYS A 61  TYR A 64  
D 1 SER A 71  ? CYS A 72  ? SER A 70  CYS A 71  
D 2 TYR A 89  ? ARG A 90  ? TYR A 88  ARG A 89  
E 1 GLY A 80  ? ARG A 84  ? GLY A 79  ARG A 83  
E 2 SER A 94  ? CYS A 99  ? SER A 93  CYS A 98  
E 3 SER A 110 ? CYS A 113 ? SER A 109 CYS A 112 
E 4 TRP A 119 ? GLY A 120 ? TRP A 118 GLY A 119 
F 1 PHE A 103 ? ASN A 106 ? PHE A 102 ASN A 105 
F 2 THR A 126 ? SER A 129 ? THR A 125 SER A 128 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 4   ? N CYS A 3   O ILE A 22  ? O ILE A 21  
B 1 2 N ARG A 14  ? N ARG A 13  O SER A 31  ? O SER A 30  
B 2 3 N ILE A 28  ? N ILE A 27  O LEU A 44  ? O LEU A 43  
B 3 4 N ILE A 47  ? N ILE A 46  O THR A 55  ? O THR A 54  
C 1 2 N ILE A 39  ? N ILE A 38  O LYS A 62  ? O LYS A 61  
D 1 2 N CYS A 72  ? N CYS A 71  O TYR A 89  ? O TYR A 88  
E 1 2 N TYR A 81  ? N TYR A 80  O ALA A 98  ? O ALA A 97  
E 2 3 N VAL A 95  ? N VAL A 94  O VAL A 111 ? O VAL A 110 
E 3 4 N TRP A 112 ? N TRP A 111 O GLY A 120 ? O GLY A 119 
F 1 2 N SER A 104 ? N SER A 103 O VAL A 128 ? O VAL A 127 
# 
_database_PDB_matrix.entry_id          1LY2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LY2 
_atom_sites.fract_transf_matrix[1][1]   0.031646 
_atom_sites.fract_transf_matrix[1][2]   0.016692 
_atom_sites.fract_transf_matrix[1][3]   0.016910 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.033982 
_atom_sites.fract_transf_matrix[2][3]   0.008369 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.026275 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? -22.258 10.956 8.616  1.00 30.63 ? 0    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? -21.209 11.651 9.356  1.00 28.28 ? 0    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? -20.576 10.762 10.421 1.00 24.07 ? 0    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? -21.188 9.803  10.878 1.00 22.40 ? 0    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? -21.758 12.919 10.021 1.00 30.64 ? 0    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? -22.184 14.013 9.050  1.00 29.63 ? 0    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? -21.122 14.326 8.008  1.00 36.05 ? 0    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? -19.926 14.423 8.365  1.00 40.95 ? 0    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? -21.491 14.470 6.823  1.00 34.80 ? 0    GLU A OE2 1 
ATOM   10   N N   . ALA A 1 2   ? -19.339 11.072 10.799 1.00 25.08 ? 1    ALA A N   1 
ATOM   11   C CA  . ALA A 1 2   ? -18.646 10.299 11.826 1.00 24.74 ? 1    ALA A CA  1 
ATOM   12   C C   . ALA A 1 2   ? -19.355 10.507 13.163 1.00 22.78 ? 1    ALA A C   1 
ATOM   13   O O   . ALA A 1 2   ? -20.000 11.541 13.385 1.00 23.07 ? 1    ALA A O   1 
ATOM   14   C CB  . ALA A 1 2   ? -17.188 10.737 11.928 1.00 20.65 ? 1    ALA A CB  1 
ATOM   15   N N   . SER A 1 3   ? -19.250 9.522  14.044 1.00 21.11 ? 2    SER A N   1 
ATOM   16   C CA  . SER A 1 3   ? -19.872 9.613  15.358 1.00 21.61 ? 2    SER A CA  1 
ATOM   17   C C   . SER A 1 3   ? -19.042 8.828  16.375 1.00 22.48 ? 2    SER A C   1 
ATOM   18   O O   . SER A 1 3   ? -18.192 8.014  15.997 1.00 17.43 ? 2    SER A O   1 
ATOM   19   C CB  . SER A 1 3   ? -21.308 9.084  15.303 1.00 19.98 ? 2    SER A CB  1 
ATOM   20   O OG  . SER A 1 3   ? -21.335 7.718  14.924 1.00 23.42 ? 2    SER A OG  1 
ATOM   21   N N   . CYS A 1 4   ? -19.262 9.107  17.655 1.00 17.09 ? 3    CYS A N   1 
ATOM   22   C CA  . CYS A 1 4   ? -18.543 8.432  18.729 1.00 19.87 ? 3    CYS A CA  1 
ATOM   23   C C   . CYS A 1 4   ? -19.385 7.353  19.390 1.00 20.51 ? 3    CYS A C   1 
ATOM   24   O O   . CYS A 1 4   ? -20.618 7.411  19.370 1.00 21.33 ? 3    CYS A O   1 
ATOM   25   C CB  . CYS A 1 4   ? -18.103 9.438  19.799 1.00 16.67 ? 3    CYS A CB  1 
ATOM   26   S SG  . CYS A 1 4   ? -16.680 10.465 19.322 1.00 32.71 ? 3    CYS A SG  1 
ATOM   27   N N   . GLY A 1 5   ? -18.709 6.360  19.959 1.00 15.81 ? 4    GLY A N   1 
ATOM   28   C CA  . GLY A 1 5   ? -19.405 5.304  20.664 1.00 15.32 ? 4    GLY A CA  1 
ATOM   29   C C   . GLY A 1 5   ? -19.694 5.796  22.072 1.00 19.07 ? 4    GLY A C   1 
ATOM   30   O O   . GLY A 1 5   ? -19.375 6.944  22.411 1.00 15.95 ? 4    GLY A O   1 
ATOM   31   N N   . SER A 1 6   ? -20.285 4.933  22.892 1.00 19.86 ? 5    SER A N   1 
ATOM   32   C CA  . SER A 1 6   ? -20.615 5.269  24.278 1.00 24.96 ? 5    SER A CA  1 
ATOM   33   C C   . SER A 1 6   ? -19.388 5.832  24.996 1.00 21.13 ? 5    SER A C   1 
ATOM   34   O O   . SER A 1 6   ? -18.265 5.362  24.785 1.00 24.38 ? 5    SER A O   1 
ATOM   35   C CB  . SER A 1 6   ? -21.096 4.017  25.027 1.00 24.82 ? 5    SER A CB  1 
ATOM   36   O OG  . SER A 1 6   ? -22.088 3.315  24.290 1.00 40.57 ? 5    SER A OG  1 
ATOM   37   N N   . PRO A 1 7   ? -19.587 6.854  25.845 1.00 14.68 ? 6    PRO A N   1 
ATOM   38   C CA  . PRO A 1 7   ? -18.506 7.492  26.604 1.00 17.21 ? 6    PRO A CA  1 
ATOM   39   C C   . PRO A 1 7   ? -17.934 6.488  27.589 1.00 19.24 ? 6    PRO A C   1 
ATOM   40   O O   . PRO A 1 7   ? -18.622 5.537  27.970 1.00 19.26 ? 6    PRO A O   1 
ATOM   41   C CB  . PRO A 1 7   ? -19.236 8.591  27.374 1.00 16.48 ? 6    PRO A CB  1 
ATOM   42   C CG  . PRO A 1 7   ? -20.448 8.863  26.559 1.00 20.62 ? 6    PRO A CG  1 
ATOM   43   C CD  . PRO A 1 7   ? -20.874 7.494  26.146 1.00 19.60 ? 6    PRO A CD  1 
ATOM   44   N N   . PRO A 1 8   ? -16.658 6.649  27.982 1.00 19.98 ? 7    PRO A N   1 
ATOM   45   C CA  . PRO A 1 8   ? -16.102 5.687  28.947 1.00 18.35 ? 7    PRO A CA  1 
ATOM   46   C C   . PRO A 1 8   ? -16.838 5.837  30.289 1.00 21.66 ? 7    PRO A C   1 
ATOM   47   O O   . PRO A 1 8   ? -17.003 6.959  30.795 1.00 12.43 ? 7    PRO A O   1 
ATOM   48   C CB  . PRO A 1 8   ? -14.629 6.118  29.061 1.00 11.53 ? 7    PRO A CB  1 
ATOM   49   C CG  . PRO A 1 8   ? -14.344 6.722  27.702 1.00 17.47 ? 7    PRO A CG  1 
ATOM   50   C CD  . PRO A 1 8   ? -15.603 7.530  27.441 1.00 17.74 ? 7    PRO A CD  1 
ATOM   51   N N   . PRO A 1 9   ? -17.366 4.727  30.837 1.00 17.91 ? 8    PRO A N   1 
ATOM   52   C CA  . PRO A 1 9   ? -18.078 4.816  32.117 1.00 18.10 ? 8    PRO A CA  1 
ATOM   53   C C   . PRO A 1 9   ? -17.178 5.249  33.285 1.00 20.24 ? 8    PRO A C   1 
ATOM   54   O O   . PRO A 1 9   ? -15.945 5.284  33.152 1.00 11.92 ? 8    PRO A O   1 
ATOM   55   C CB  . PRO A 1 9   ? -18.652 3.407  32.289 1.00 24.52 ? 8    PRO A CB  1 
ATOM   56   C CG  . PRO A 1 9   ? -17.732 2.543  31.468 1.00 26.48 ? 8    PRO A CG  1 
ATOM   57   C CD  . PRO A 1 9   ? -17.452 3.370  30.266 1.00 18.64 ? 8    PRO A CD  1 
ATOM   58   N N   . ILE A 1 10  ? -17.799 5.641  34.398 1.00 17.01 ? 9    ILE A N   1 
ATOM   59   C CA  . ILE A 1 10  ? -17.067 6.087  35.581 1.00 11.97 ? 9    ILE A CA  1 
ATOM   60   C C   . ILE A 1 10  ? -17.628 5.519  36.897 1.00 12.79 ? 9    ILE A C   1 
ATOM   61   O O   . ILE A 1 10  ? -18.779 5.764  37.267 1.00 10.55 ? 9    ILE A O   1 
ATOM   62   C CB  . ILE A 1 10  ? -16.999 7.648  35.657 1.00 15.82 ? 9    ILE A CB  1 
ATOM   63   C CG1 . ILE A 1 10  ? -16.149 8.086  36.847 1.00 12.62 ? 9    ILE A CG1 1 
ATOM   64   C CG2 . ILE A 1 10  ? -18.393 8.256  35.738 1.00 10.41 ? 9    ILE A CG2 1 
ATOM   65   C CD1 . ILE A 1 10  ? -15.805 9.564  36.842 1.00 13.67 ? 9    ILE A CD1 1 
ATOM   66   N N   . LEU A 1 11  ? -16.797 4.768  37.608 1.00 14.08 ? 10   LEU A N   1 
ATOM   67   C CA  . LEU A 1 11  ? -17.200 4.183  38.888 1.00 14.49 ? 10   LEU A CA  1 
ATOM   68   C C   . LEU A 1 11  ? -17.500 5.291  39.903 1.00 14.84 ? 10   LEU A C   1 
ATOM   69   O O   . LEU A 1 11  ? -16.703 6.223  40.061 1.00 11.67 ? 10   LEU A O   1 
ATOM   70   C CB  . LEU A 1 11  ? -16.076 3.294  39.431 1.00 11.45 ? 10   LEU A CB  1 
ATOM   71   C CG  . LEU A 1 11  ? -16.319 2.608  40.780 1.00 11.18 ? 10   LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 11  ? -17.473 1.620  40.673 1.00 15.91 ? 10   LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 11  ? -15.051 1.901  41.217 1.00 11.88 ? 10   LEU A CD2 1 
ATOM   74   N N   . ASN A 1 12  ? -18.655 5.198  40.563 1.00 13.94 ? 11   ASN A N   1 
ATOM   75   C CA  . ASN A 1 12  ? -19.070 6.168  41.576 1.00 10.74 ? 11   ASN A CA  1 
ATOM   76   C C   . ASN A 1 12  ? -19.174 7.607  41.070 1.00 12.37 ? 11   ASN A C   1 
ATOM   77   O O   . ASN A 1 12  ? -19.072 8.555  41.852 1.00 16.79 ? 11   ASN A O   1 
ATOM   78   C CB  . ASN A 1 12  ? -18.122 6.115  42.786 1.00 10.38 ? 11   ASN A CB  1 
ATOM   79   C CG  . ASN A 1 12  ? -18.219 4.807  43.550 1.00 15.15 ? 11   ASN A CG  1 
ATOM   80   O OD1 . ASN A 1 12  ? -17.220 4.116  43.744 1.00 16.88 ? 11   ASN A OD1 1 
ATOM   81   N ND2 . ASN A 1 12  ? -19.421 4.460  43.987 1.00 18.44 ? 11   ASN A ND2 1 
ATOM   82   N N   . GLY A 1 13  ? -19.376 7.769  39.767 1.00 13.92 ? 12   GLY A N   1 
ATOM   83   C CA  . GLY A 1 13  ? -19.486 9.105  39.201 1.00 10.32 ? 12   GLY A CA  1 
ATOM   84   C C   . GLY A 1 13  ? -20.700 9.214  38.301 1.00 10.43 ? 12   GLY A C   1 
ATOM   85   O O   . GLY A 1 13  ? -21.454 8.246  38.151 1.00 11.11 ? 12   GLY A O   1 
ATOM   86   N N   . ARG A 1 14  ? -20.885 10.382 37.691 1.00 11.47 ? 13   ARG A N   1 
ATOM   87   C CA  . ARG A 1 14  ? -22.017 10.630 36.798 1.00 12.53 ? 13   ARG A CA  1 
ATOM   88   C C   . ARG A 1 14  ? -21.535 11.328 35.528 1.00 7.22  ? 13   ARG A C   1 
ATOM   89   O O   . ARG A 1 14  ? -20.521 12.037 35.545 1.00 7.00  ? 13   ARG A O   1 
ATOM   90   C CB  . ARG A 1 14  ? -23.049 11.532 37.487 1.00 16.25 ? 13   ARG A CB  1 
ATOM   91   C CG  . ARG A 1 14  ? -23.595 11.005 38.813 1.00 27.89 ? 13   ARG A CG  1 
ATOM   92   C CD  . ARG A 1 14  ? -24.980 10.398 38.667 1.00 39.92 ? 13   ARG A CD  1 
ATOM   93   N NE  . ARG A 1 14  ? -24.991 9.139  37.922 1.00 46.44 ? 13   ARG A NE  1 
ATOM   94   C CZ  . ARG A 1 14  ? -25.829 8.859  36.923 1.00 50.67 ? 13   ARG A CZ  1 
ATOM   95   N NH1 . ARG A 1 14  ? -26.735 9.750  36.523 1.00 37.15 ? 13   ARG A NH1 1 
ATOM   96   N NH2 . ARG A 1 14  ? -25.784 7.668  36.339 1.00 49.00 ? 13   ARG A NH2 1 
ATOM   97   N N   . ILE A 1 15  ? -22.284 11.148 34.444 1.00 8.39  ? 14   ILE A N   1 
ATOM   98   C CA  . ILE A 1 15  ? -21.966 11.772 33.162 1.00 8.12  ? 14   ILE A CA  1 
ATOM   99   C C   . ILE A 1 15  ? -23.157 12.661 32.795 1.00 9.90  ? 14   ILE A C   1 
ATOM   100  O O   . ILE A 1 15  ? -24.307 12.306 33.089 1.00 9.09  ? 14   ILE A O   1 
ATOM   101  C CB  . ILE A 1 15  ? -21.740 10.697 32.059 1.00 10.48 ? 14   ILE A CB  1 
ATOM   102  C CG1 . ILE A 1 15  ? -20.574 9.782  32.447 1.00 11.67 ? 14   ILE A CG1 1 
ATOM   103  C CG2 . ILE A 1 15  ? -21.432 11.355 30.716 1.00 8.24  ? 14   ILE A CG2 1 
ATOM   104  C CD1 . ILE A 1 15  ? -20.308 8.661  31.448 1.00 9.27  ? 14   ILE A CD1 1 
ATOM   105  N N   . SER A 1 16  ? -22.881 13.839 32.237 1.00 7.51  ? 15   SER A N   1 
ATOM   106  C CA  . SER A 1 16  ? -23.939 14.764 31.830 1.00 7.35  ? 15   SER A CA  1 
ATOM   107  C C   . SER A 1 16  ? -24.640 14.230 30.580 1.00 7.11  ? 15   SER A C   1 
ATOM   108  O O   . SER A 1 16  ? -24.132 13.329 29.899 1.00 9.11  ? 15   SER A O   1 
ATOM   109  C CB  . SER A 1 16  ? -23.372 16.173 31.594 1.00 12.23 ? 15   SER A CB  1 
ATOM   110  O OG  . SER A 1 16  ? -22.445 16.205 30.521 1.00 9.85  ? 15   SER A OG  1 
ATOM   111  N N   . TYR A 1 17  ? -25.803 14.796 30.274 1.00 7.51  ? 16   TYR A N   1 
ATOM   112  C CA  . TYR A 1 17  ? -26.598 14.351 29.136 1.00 9.35  ? 16   TYR A CA  1 
ATOM   113  C C   . TYR A 1 17  ? -25.912 14.366 27.772 1.00 12.19 ? 16   TYR A C   1 
ATOM   114  O O   . TYR A 1 17  ? -25.209 15.316 27.426 1.00 8.17  ? 16   TYR A O   1 
ATOM   115  C CB  . TYR A 1 17  ? -27.898 15.165 29.040 1.00 6.24  ? 16   TYR A CB  1 
ATOM   116  C CG  . TYR A 1 17  ? -28.819 14.672 27.942 1.00 10.32 ? 16   TYR A CG  1 
ATOM   117  C CD1 . TYR A 1 17  ? -29.830 13.745 28.215 1.00 13.13 ? 16   TYR A CD1 1 
ATOM   118  C CD2 . TYR A 1 17  ? -28.650 15.094 26.617 1.00 16.36 ? 16   TYR A CD2 1 
ATOM   119  C CE1 . TYR A 1 17  ? -30.650 13.248 27.193 1.00 15.00 ? 16   TYR A CE1 1 
ATOM   120  C CE2 . TYR A 1 17  ? -29.461 14.602 25.590 1.00 16.52 ? 16   TYR A CE2 1 
ATOM   121  C CZ  . TYR A 1 17  ? -30.459 13.681 25.885 1.00 19.43 ? 16   TYR A CZ  1 
ATOM   122  O OH  . TYR A 1 17  ? -31.261 13.204 24.869 1.00 31.11 ? 16   TYR A OH  1 
ATOM   123  N N   . TYR A 1 18  ? -26.168 13.324 26.988 1.00 9.96  ? 17   TYR A N   1 
ATOM   124  C CA  . TYR A 1 18  ? -25.651 13.223 25.625 1.00 16.27 ? 17   TYR A CA  1 
ATOM   125  C C   . TYR A 1 18  ? -26.652 12.438 24.769 1.00 20.72 ? 17   TYR A C   1 
ATOM   126  O O   . TYR A 1 18  ? -27.259 11.473 25.239 1.00 13.73 ? 17   TYR A O   1 
ATOM   127  C CB  . TYR A 1 18  ? -24.254 12.580 25.573 1.00 17.73 ? 17   TYR A CB  1 
ATOM   128  C CG  . TYR A 1 18  ? -24.175 11.164 26.086 1.00 16.01 ? 17   TYR A CG  1 
ATOM   129  C CD1 . TYR A 1 18  ? -24.362 10.084 25.228 1.00 18.65 ? 17   TYR A CD1 1 
ATOM   130  C CD2 . TYR A 1 18  ? -23.926 10.905 27.432 1.00 20.95 ? 17   TYR A CD2 1 
ATOM   131  C CE1 . TYR A 1 18  ? -24.309 8.781  25.695 1.00 17.98 ? 17   TYR A CE1 1 
ATOM   132  C CE2 . TYR A 1 18  ? -23.872 9.610  27.911 1.00 25.88 ? 17   TYR A CE2 1 
ATOM   133  C CZ  . TYR A 1 18  ? -24.069 8.549  27.037 1.00 24.55 ? 17   TYR A CZ  1 
ATOM   134  O OH  . TYR A 1 18  ? -24.054 7.260  27.515 1.00 28.96 ? 17   TYR A OH  1 
ATOM   135  N N   . SER A 1 19  ? -26.880 12.903 23.545 1.00 20.07 ? 18   SER A N   1 
ATOM   136  C CA  . SER A 1 19  ? -27.811 12.230 22.648 1.00 26.16 ? 18   SER A CA  1 
ATOM   137  C C   . SER A 1 19  ? -27.076 11.273 21.709 1.00 28.72 ? 18   SER A C   1 
ATOM   138  O O   . SER A 1 19  ? -25.874 11.431 21.462 1.00 20.95 ? 18   SER A O   1 
ATOM   139  C CB  . SER A 1 19  ? -28.616 13.260 21.846 1.00 21.75 ? 18   SER A CB  1 
ATOM   140  O OG  . SER A 1 19  ? -27.771 14.237 21.260 1.00 29.91 ? 18   SER A OG  1 
ATOM   141  N N   . THR A 1 20  ? -27.799 10.280 21.202 1.00 28.15 ? 19   THR A N   1 
ATOM   142  C CA  . THR A 1 20  ? -27.234 9.306  20.279 1.00 28.49 ? 19   THR A CA  1 
ATOM   143  C C   . THR A 1 20  ? -27.966 9.395  18.930 1.00 29.69 ? 19   THR A C   1 
ATOM   144  O O   . THR A 1 20  ? -29.180 9.586  18.901 1.00 35.93 ? 19   THR A O   1 
ATOM   145  C CB  . THR A 1 20  ? -27.369 7.883  20.846 1.00 31.36 ? 19   THR A CB  1 
ATOM   146  O OG1 . THR A 1 20  ? -28.753 7.580  21.050 1.00 44.07 ? 19   THR A OG1 1 
ATOM   147  C CG2 . THR A 1 20  ? -26.646 7.774  22.182 1.00 26.87 ? 19   THR A CG2 1 
ATOM   148  N N   . PRO A 1 21  ? -27.239 9.291  17.798 1.00 33.43 ? 20   PRO A N   1 
ATOM   149  C CA  . PRO A 1 21  ? -25.786 9.100  17.678 1.00 26.28 ? 20   PRO A CA  1 
ATOM   150  C C   . PRO A 1 21  ? -25.006 10.316 18.182 1.00 17.98 ? 20   PRO A C   1 
ATOM   151  O O   . PRO A 1 21  ? -25.492 11.446 18.120 1.00 17.34 ? 20   PRO A O   1 
ATOM   152  C CB  . PRO A 1 21  ? -25.593 8.881  16.172 1.00 30.13 ? 20   PRO A CB  1 
ATOM   153  C CG  . PRO A 1 21  ? -26.709 9.675  15.566 1.00 32.19 ? 20   PRO A CG  1 
ATOM   154  C CD  . PRO A 1 21  ? -27.871 9.311  16.466 1.00 33.23 ? 20   PRO A CD  1 
ATOM   155  N N   . ILE A 1 22  ? -23.806 10.068 18.691 1.00 14.62 ? 21   ILE A N   1 
ATOM   156  C CA  . ILE A 1 22  ? -22.962 11.121 19.231 1.00 12.29 ? 21   ILE A CA  1 
ATOM   157  C C   . ILE A 1 22  ? -22.173 11.807 18.110 1.00 17.59 ? 21   ILE A C   1 
ATOM   158  O O   . ILE A 1 22  ? -21.220 11.243 17.568 1.00 18.53 ? 21   ILE A O   1 
ATOM   159  C CB  . ILE A 1 22  ? -22.019 10.539 20.302 1.00 10.63 ? 21   ILE A CB  1 
ATOM   160  C CG1 . ILE A 1 22  ? -22.846 9.811  21.369 1.00 16.02 ? 21   ILE A CG1 1 
ATOM   161  C CG2 . ILE A 1 22  ? -21.173 11.646 20.919 1.00 9.72  ? 21   ILE A CG2 1 
ATOM   162  C CD1 . ILE A 1 22  ? -22.036 9.149  22.462 1.00 16.30 ? 21   ILE A CD1 1 
ATOM   163  N N   . ALA A 1 23  ? -22.574 13.028 17.768 1.00 12.82 ? 22   ALA A N   1 
ATOM   164  C CA  . ALA A 1 23  ? -21.928 13.777 16.693 1.00 12.40 ? 22   ALA A CA  1 
ATOM   165  C C   . ALA A 1 23  ? -20.565 14.306 17.079 1.00 17.37 ? 22   ALA A C   1 
ATOM   166  O O   . ALA A 1 23  ? -20.260 14.477 18.257 1.00 14.51 ? 22   ALA A O   1 
ATOM   167  C CB  . ALA A 1 23  ? -22.813 14.924 16.254 1.00 14.88 ? 22   ALA A CB  1 
ATOM   168  N N   . VAL A 1 24  ? -19.736 14.542 16.070 1.00 16.10 ? 23   VAL A N   1 
ATOM   169  C CA  . VAL A 1 24  ? -18.405 15.094 16.282 1.00 14.63 ? 23   VAL A CA  1 
ATOM   170  C C   . VAL A 1 24  ? -18.626 16.526 16.764 1.00 13.66 ? 23   VAL A C   1 
ATOM   171  O O   . VAL A 1 24  ? -19.359 17.301 16.136 1.00 13.59 ? 23   VAL A O   1 
ATOM   172  C CB  . VAL A 1 24  ? -17.572 15.079 14.972 1.00 10.53 ? 23   VAL A CB  1 
ATOM   173  C CG1 . VAL A 1 24  ? -16.293 15.876 15.145 1.00 9.18  ? 23   VAL A CG1 1 
ATOM   174  C CG2 . VAL A 1 24  ? -17.243 13.646 14.590 1.00 13.65 ? 23   VAL A CG2 1 
ATOM   175  N N   . GLY A 1 25  ? -18.011 16.859 17.890 1.00 13.00 ? 24   GLY A N   1 
ATOM   176  C CA  . GLY A 1 25  ? -18.173 18.176 18.471 1.00 11.54 ? 24   GLY A CA  1 
ATOM   177  C C   . GLY A 1 25  ? -18.892 18.043 19.802 1.00 8.47  ? 24   GLY A C   1 
ATOM   178  O O   . GLY A 1 25  ? -18.898 18.971 20.604 1.00 12.41 ? 24   GLY A O   1 
ATOM   179  N N   . THR A 1 26  ? -19.513 16.890 20.032 1.00 7.61  ? 25   THR A N   1 
ATOM   180  C CA  . THR A 1 26  ? -20.223 16.641 21.287 1.00 10.17 ? 25   THR A CA  1 
ATOM   181  C C   . THR A 1 26  ? -19.258 16.690 22.471 1.00 10.20 ? 25   THR A C   1 
ATOM   182  O O   . THR A 1 26  ? -18.136 16.175 22.392 1.00 10.99 ? 25   THR A O   1 
ATOM   183  C CB  . THR A 1 26  ? -20.912 15.245 21.298 1.00 10.31 ? 25   THR A CB  1 
ATOM   184  O OG1 . THR A 1 26  ? -21.842 15.150 20.212 1.00 13.34 ? 25   THR A OG1 1 
ATOM   185  C CG2 . THR A 1 26  ? -21.667 15.022 22.616 1.00 16.92 ? 25   THR A CG2 1 
ATOM   186  N N   . VAL A 1 27  ? -19.715 17.300 23.562 1.00 10.43 ? 26   VAL A N   1 
ATOM   187  C CA  . VAL A 1 27  ? -18.947 17.402 24.800 1.00 5.39  ? 26   VAL A CA  1 
ATOM   188  C C   . VAL A 1 27  ? -19.814 16.807 25.911 1.00 10.86 ? 26   VAL A C   1 
ATOM   189  O O   . VAL A 1 27  ? -21.036 16.980 25.907 1.00 8.78  ? 26   VAL A O   1 
ATOM   190  C CB  . VAL A 1 27  ? -18.655 18.874 25.167 1.00 10.65 ? 26   VAL A CB  1 
ATOM   191  C CG1 . VAL A 1 27  ? -18.052 18.973 26.575 1.00 10.59 ? 26   VAL A CG1 1 
ATOM   192  C CG2 . VAL A 1 27  ? -17.735 19.503 24.136 1.00 6.43  ? 26   VAL A CG2 1 
ATOM   193  N N   . ILE A 1 28  ? -19.185 16.086 26.831 1.00 5.92  ? 27   ILE A N   1 
ATOM   194  C CA  . ILE A 1 28  ? -19.873 15.486 27.974 1.00 9.25  ? 27   ILE A CA  1 
ATOM   195  C C   . ILE A 1 28  ? -19.030 15.837 29.194 1.00 9.42  ? 27   ILE A C   1 
ATOM   196  O O   . ILE A 1 28  ? -17.806 15.992 29.069 1.00 10.71 ? 27   ILE A O   1 
ATOM   197  C CB  . ILE A 1 28  ? -19.977 13.945 27.854 1.00 15.32 ? 27   ILE A CB  1 
ATOM   198  C CG1 . ILE A 1 28  ? -18.598 13.346 27.549 1.00 16.78 ? 27   ILE A CG1 1 
ATOM   199  C CG2 . ILE A 1 28  ? -21.002 13.564 26.798 1.00 12.46 ? 27   ILE A CG2 1 
ATOM   200  C CD1 . ILE A 1 28  ? -18.549 11.859 27.597 1.00 11.51 ? 27   ILE A CD1 1 
ATOM   201  N N   . ARG A 1 29  ? -19.682 15.983 30.351 1.00 7.85  ? 28   ARG A N   1 
ATOM   202  C CA  . ARG A 1 29  ? -19.013 16.333 31.606 1.00 6.30  ? 28   ARG A CA  1 
ATOM   203  C C   . ARG A 1 29  ? -19.145 15.202 32.617 1.00 7.30  ? 28   ARG A C   1 
ATOM   204  O O   . ARG A 1 29  ? -20.199 14.574 32.722 1.00 7.11  ? 28   ARG A O   1 
ATOM   205  C CB  . ARG A 1 29  ? -19.635 17.578 32.245 1.00 8.98  ? 28   ARG A CB  1 
ATOM   206  C CG  . ARG A 1 29  ? -20.090 18.659 31.296 1.00 17.07 ? 28   ARG A CG  1 
ATOM   207  C CD  . ARG A 1 29  ? -18.940 19.504 30.818 1.00 16.12 ? 28   ARG A CD  1 
ATOM   208  N NE  . ARG A 1 29  ? -19.421 20.643 30.039 1.00 10.09 ? 28   ARG A NE  1 
ATOM   209  C CZ  . ARG A 1 29  ? -18.627 21.497 29.406 1.00 15.33 ? 28   ARG A CZ  1 
ATOM   210  N NH1 . ARG A 1 29  ? -17.306 21.348 29.468 1.00 7.26  ? 28   ARG A NH1 1 
ATOM   211  N NH2 . ARG A 1 29  ? -19.152 22.467 28.672 1.00 14.51 ? 28   ARG A NH2 1 
ATOM   212  N N   . TYR A 1 30  ? -18.074 14.977 33.374 1.00 7.82  ? 29   TYR A N   1 
ATOM   213  C CA  . TYR A 1 30  ? -18.024 13.951 34.410 1.00 6.50  ? 29   TYR A CA  1 
ATOM   214  C C   . TYR A 1 30  ? -18.031 14.659 35.770 1.00 8.66  ? 29   TYR A C   1 
ATOM   215  O O   . TYR A 1 30  ? -17.536 15.790 35.895 1.00 9.66  ? 29   TYR A O   1 
ATOM   216  C CB  . TYR A 1 30  ? -16.735 13.124 34.278 1.00 4.99  ? 29   TYR A CB  1 
ATOM   217  C CG  . TYR A 1 30  ? -16.723 12.159 33.116 1.00 9.04  ? 29   TYR A CG  1 
ATOM   218  C CD1 . TYR A 1 30  ? -16.549 12.612 31.804 1.00 8.38  ? 29   TYR A CD1 1 
ATOM   219  C CD2 . TYR A 1 30  ? -16.901 10.795 33.322 1.00 6.95  ? 29   TYR A CD2 1 
ATOM   220  C CE1 . TYR A 1 30  ? -16.557 11.729 30.733 1.00 8.09  ? 29   TYR A CE1 1 
ATOM   221  C CE2 . TYR A 1 30  ? -16.910 9.900  32.257 1.00 8.38  ? 29   TYR A CE2 1 
ATOM   222  C CZ  . TYR A 1 30  ? -16.739 10.375 30.966 1.00 10.54 ? 29   TYR A CZ  1 
ATOM   223  O OH  . TYR A 1 30  ? -16.758 9.497  29.908 1.00 11.23 ? 29   TYR A OH  1 
ATOM   224  N N   . SER A 1 31  ? -18.582 13.997 36.784 1.00 7.76  ? 30   SER A N   1 
ATOM   225  C CA  . SER A 1 31  ? -18.640 14.556 38.137 1.00 10.17 ? 30   SER A CA  1 
ATOM   226  C C   . SER A 1 31  ? -18.702 13.404 39.135 1.00 14.04 ? 30   SER A C   1 
ATOM   227  O O   . SER A 1 31  ? -19.065 12.283 38.762 1.00 8.07  ? 30   SER A O   1 
ATOM   228  C CB  . SER A 1 31  ? -19.865 15.465 38.296 1.00 8.35  ? 30   SER A CB  1 
ATOM   229  O OG  . SER A 1 31  ? -21.063 14.779 37.956 1.00 13.21 ? 30   SER A OG  1 
ATOM   230  N N   . CYS A 1 32  ? -18.361 13.683 40.391 1.00 13.90 ? 31   CYS A N   1 
ATOM   231  C CA  . CYS A 1 32  ? -18.360 12.672 41.448 1.00 17.44 ? 31   CYS A CA  1 
ATOM   232  C C   . CYS A 1 32  ? -19.257 13.102 42.583 1.00 14.54 ? 31   CYS A C   1 
ATOM   233  O O   . CYS A 1 32  ? -19.568 14.282 42.719 1.00 23.34 ? 31   CYS A O   1 
ATOM   234  C CB  . CYS A 1 32  ? -16.947 12.495 42.035 1.00 13.19 ? 31   CYS A CB  1 
ATOM   235  S SG  . CYS A 1 32  ? -15.653 12.000 40.853 1.00 31.77 ? 31   CYS A SG  1 
ATOM   236  N N   . SER A 1 33  ? -19.639 12.140 43.421 1.00 26.88 ? 32   SER A N   1 
ATOM   237  C CA  . SER A 1 33  ? -20.458 12.431 44.589 1.00 31.60 ? 32   SER A CA  1 
ATOM   238  C C   . SER A 1 33  ? -19.562 13.142 45.615 1.00 33.75 ? 32   SER A C   1 
ATOM   239  O O   . SER A 1 33  ? -18.337 13.127 45.493 1.00 31.93 ? 32   SER A O   1 
ATOM   240  C CB  . SER A 1 33  ? -21.033 11.145 45.176 1.00 38.70 ? 32   SER A CB  1 
ATOM   241  O OG  . SER A 1 33  ? -21.961 11.449 46.199 1.00 55.47 ? 32   SER A OG  1 
ATOM   242  N N   . GLY A 1 34  ? -20.171 13.735 46.636 1.00 34.52 ? 33   GLY A N   1 
ATOM   243  C CA  . GLY A 1 34  ? -19.423 14.475 47.641 1.00 19.86 ? 33   GLY A CA  1 
ATOM   244  C C   . GLY A 1 34  ? -18.277 13.792 48.364 1.00 23.66 ? 33   GLY A C   1 
ATOM   245  O O   . GLY A 1 34  ? -17.299 14.449 48.703 1.00 31.45 ? 33   GLY A O   1 
ATOM   246  N N   . THR A 1 35  ? -18.385 12.493 48.623 1.00 20.87 ? 34   THR A N   1 
ATOM   247  C CA  . THR A 1 35  ? -17.321 11.783 49.339 1.00 26.52 ? 34   THR A CA  1 
ATOM   248  C C   . THR A 1 35  ? -16.185 11.264 48.438 1.00 23.78 ? 34   THR A C   1 
ATOM   249  O O   . THR A 1 35  ? -15.300 10.512 48.888 1.00 18.19 ? 34   THR A O   1 
ATOM   250  C CB  . THR A 1 35  ? -17.902 10.642 50.226 1.00 29.48 ? 34   THR A CB  1 
ATOM   251  O OG1 . THR A 1 35  ? -18.670 9.733  49.424 1.00 30.06 ? 34   THR A OG1 1 
ATOM   252  C CG2 . THR A 1 35  ? -18.802 11.225 51.314 1.00 29.23 ? 34   THR A CG2 1 
ATOM   253  N N   . PHE A 1 36  ? -16.213 11.674 47.170 1.00 12.51 ? 35   PHE A N   1 
ATOM   254  C CA  . PHE A 1 36  ? -15.200 11.275 46.191 1.00 13.93 ? 35   PHE A CA  1 
ATOM   255  C C   . PHE A 1 36  ? -14.618 12.538 45.578 1.00 12.89 ? 35   PHE A C   1 
ATOM   256  O O   . PHE A 1 36  ? -15.224 13.608 45.647 1.00 18.29 ? 35   PHE A O   1 
ATOM   257  C CB  . PHE A 1 36  ? -15.812 10.431 45.067 1.00 14.10 ? 35   PHE A CB  1 
ATOM   258  C CG  . PHE A 1 36  ? -16.287 9.080  45.502 1.00 18.23 ? 35   PHE A CG  1 
ATOM   259  C CD1 . PHE A 1 36  ? -17.586 8.901  45.965 1.00 18.90 ? 35   PHE A CD1 1 
ATOM   260  C CD2 . PHE A 1 36  ? -15.433 7.986  45.453 1.00 11.13 ? 35   PHE A CD2 1 
ATOM   261  C CE1 . PHE A 1 36  ? -18.020 7.650  46.376 1.00 18.07 ? 35   PHE A CE1 1 
ATOM   262  C CE2 . PHE A 1 36  ? -15.858 6.731  45.861 1.00 16.05 ? 35   PHE A CE2 1 
ATOM   263  C CZ  . PHE A 1 36  ? -17.152 6.562  46.325 1.00 14.82 ? 35   PHE A CZ  1 
ATOM   264  N N   . ARG A 1 37  ? -13.454 12.405 44.958 1.00 12.13 ? 36   ARG A N   1 
ATOM   265  C CA  . ARG A 1 37  ? -12.802 13.541 44.321 1.00 11.98 ? 36   ARG A CA  1 
ATOM   266  C C   . ARG A 1 37  ? -12.516 13.155 42.880 1.00 12.15 ? 36   ARG A C   1 
ATOM   267  O O   . ARG A 1 37  ? -12.000 12.066 42.617 1.00 10.05 ? 36   ARG A O   1 
ATOM   268  C CB  . ARG A 1 37  ? -11.495 13.885 45.048 1.00 11.09 ? 36   ARG A CB  1 
ATOM   269  C CG  . ARG A 1 37  ? -11.684 14.359 46.487 1.00 11.52 ? 36   ARG A CG  1 
ATOM   270  C CD  . ARG A 1 37  ? -12.508 15.648 46.520 1.00 14.44 ? 36   ARG A CD  1 
ATOM   271  N NE  . ARG A 1 37  ? -12.591 16.226 47.860 1.00 16.28 ? 36   ARG A NE  1 
ATOM   272  C CZ  . ARG A 1 37  ? -13.513 15.906 48.763 1.00 17.83 ? 36   ARG A CZ  1 
ATOM   273  N NH1 . ARG A 1 37  ? -14.447 14.999 48.486 1.00 12.57 ? 36   ARG A NH1 1 
ATOM   274  N NH2 . ARG A 1 37  ? -13.520 16.521 49.937 1.00 21.72 ? 36   ARG A NH2 1 
ATOM   275  N N   . LEU A 1 38  ? -12.905 14.020 41.949 1.00 10.29 ? 37   LEU A N   1 
ATOM   276  C CA  . LEU A 1 38  ? -12.679 13.774 40.528 1.00 9.12  ? 37   LEU A CA  1 
ATOM   277  C C   . LEU A 1 38  ? -11.202 14.019 40.205 1.00 7.39  ? 37   LEU A C   1 
ATOM   278  O O   . LEU A 1 38  ? -10.639 15.071 40.537 1.00 9.86  ? 37   LEU A O   1 
ATOM   279  C CB  . LEU A 1 38  ? -13.572 14.689 39.672 1.00 8.63  ? 37   LEU A CB  1 
ATOM   280  C CG  . LEU A 1 38  ? -13.661 14.315 38.196 1.00 10.54 ? 37   LEU A CG  1 
ATOM   281  C CD1 . LEU A 1 38  ? -14.332 12.953 38.052 1.00 14.87 ? 37   LEU A CD1 1 
ATOM   282  C CD2 . LEU A 1 38  ? -14.435 15.370 37.450 1.00 14.96 ? 37   LEU A CD2 1 
ATOM   283  N N   . ILE A 1 39  ? -10.578 13.030 39.579 1.00 8.14  ? 38   ILE A N   1 
ATOM   284  C CA  . ILE A 1 39  ? -9.174  13.103 39.205 1.00 9.14  ? 38   ILE A CA  1 
ATOM   285  C C   . ILE A 1 39  ? -9.079  13.074 37.683 1.00 8.38  ? 38   ILE A C   1 
ATOM   286  O O   . ILE A 1 39  ? -9.493  12.098 37.046 1.00 7.30  ? 38   ILE A O   1 
ATOM   287  C CB  . ILE A 1 39  ? -8.379  11.908 39.815 1.00 11.45 ? 38   ILE A CB  1 
ATOM   288  C CG1 . ILE A 1 39  ? -8.502  11.924 41.345 1.00 8.96  ? 38   ILE A CG1 1 
ATOM   289  C CG2 . ILE A 1 39  ? -6.910  11.941 39.375 1.00 8.50  ? 38   ILE A CG2 1 
ATOM   290  C CD1 . ILE A 1 39  ? -8.029  13.211 41.996 1.00 11.68 ? 38   ILE A CD1 1 
ATOM   291  N N   . GLY A 1 40  ? -8.551  14.152 37.108 1.00 8.07  ? 39   GLY A N   1 
ATOM   292  C CA  . GLY A 1 40  ? -8.410  14.236 35.662 1.00 6.08  ? 39   GLY A CA  1 
ATOM   293  C C   . GLY A 1 40  ? -9.391  15.218 35.041 1.00 9.47  ? 39   GLY A C   1 
ATOM   294  O O   . GLY A 1 40  ? -10.351 15.620 35.693 1.00 5.19  ? 39   GLY A O   1 
ATOM   295  N N   . GLU A 1 41  ? -9.142  15.633 33.799 1.00 9.73  ? 40   GLU A N   1 
ATOM   296  C CA  . GLU A 1 41  ? -10.034 16.576 33.110 1.00 10.39 ? 40   GLU A CA  1 
ATOM   297  C C   . GLU A 1 41  ? -11.477 16.058 33.087 1.00 8.40  ? 40   GLU A C   1 
ATOM   298  O O   . GLU A 1 41  ? -11.735 14.929 32.661 1.00 10.44 ? 40   GLU A O   1 
ATOM   299  C CB  . GLU A 1 41  ? -9.549  16.838 31.677 1.00 7.17  ? 40   GLU A CB  1 
ATOM   300  C CG  . GLU A 1 41  ? -8.232  17.614 31.566 1.00 15.71 ? 40   GLU A CG  1 
ATOM   301  C CD  . GLU A 1 41  ? -8.347  19.098 31.938 1.00 24.23 ? 40   GLU A CD  1 
ATOM   302  O OE1 . GLU A 1 41  ? -9.476  19.620 32.094 1.00 15.59 ? 40   GLU A OE1 1 
ATOM   303  O OE2 . GLU A 1 41  ? -7.292  19.756 32.058 1.00 18.39 ? 40   GLU A OE2 1 
ATOM   304  N N   . LYS A 1 42  ? -12.422 16.906 33.490 1.00 11.71 ? 41   LYS A N   1 
ATOM   305  C CA  . LYS A 1 42  ? -13.825 16.496 33.544 1.00 10.69 ? 41   LYS A CA  1 
ATOM   306  C C   . LYS A 1 42  ? -14.598 16.466 32.233 1.00 11.42 ? 41   LYS A C   1 
ATOM   307  O O   . LYS A 1 42  ? -15.616 15.786 32.150 1.00 8.93  ? 41   LYS A O   1 
ATOM   308  C CB  . LYS A 1 42  ? -14.613 17.329 34.571 1.00 14.13 ? 41   LYS A CB  1 
ATOM   309  C CG  . LYS A 1 42  ? -14.917 18.767 34.170 1.00 13.38 ? 41   LYS A CG  1 
ATOM   310  C CD  . LYS A 1 42  ? -15.916 19.394 35.128 1.00 17.07 ? 41   LYS A CD  1 
ATOM   311  C CE  . LYS A 1 42  ? -15.566 20.847 35.428 1.00 37.06 ? 41   LYS A CE  1 
ATOM   312  N NZ  . LYS A 1 42  ? -15.493 21.716 34.212 1.00 47.64 ? 41   LYS A NZ  1 
ATOM   313  N N   . SER A 1 43  ? -14.115 17.169 31.211 1.00 9.39  ? 42   SER A N   1 
ATOM   314  C CA  . SER A 1 43  ? -14.829 17.228 29.937 1.00 13.09 ? 42   SER A CA  1 
ATOM   315  C C   . SER A 1 43  ? -14.192 16.455 28.787 1.00 12.58 ? 42   SER A C   1 
ATOM   316  O O   . SER A 1 43  ? -12.989 16.578 28.529 1.00 8.53  ? 42   SER A O   1 
ATOM   317  C CB  . SER A 1 43  ? -15.028 18.691 29.533 1.00 3.83  ? 42   SER A CB  1 
ATOM   318  O OG  . SER A 1 43  ? -15.586 19.435 30.602 1.00 10.23 ? 42   SER A OG  1 
ATOM   319  N N   . LEU A 1 44  ? -15.010 15.655 28.110 1.00 9.72  ? 43   LEU A N   1 
ATOM   320  C CA  . LEU A 1 44  ? -14.574 14.864 26.962 1.00 8.90  ? 43   LEU A CA  1 
ATOM   321  C C   . LEU A 1 44  ? -15.244 15.400 25.698 1.00 13.36 ? 43   LEU A C   1 
ATOM   322  O O   . LEU A 1 44  ? -16.420 15.785 25.713 1.00 9.17  ? 43   LEU A O   1 
ATOM   323  C CB  . LEU A 1 44  ? -14.900 13.378 27.160 1.00 8.98  ? 43   LEU A CB  1 
ATOM   324  C CG  . LEU A 1 44  ? -13.764 12.484 27.676 1.00 15.33 ? 43   LEU A CG  1 
ATOM   325  C CD1 . LEU A 1 44  ? -13.244 12.950 29.044 1.00 9.20  ? 43   LEU A CD1 1 
ATOM   326  C CD2 . LEU A 1 44  ? -14.252 11.049 27.742 1.00 16.91 ? 43   LEU A CD2 1 
ATOM   327  N N   . LEU A 1 45  ? -14.483 15.418 24.612 1.00 11.55 ? 44   LEU A N   1 
ATOM   328  C CA  . LEU A 1 45  ? -14.948 15.929 23.327 1.00 9.33  ? 44   LEU A CA  1 
ATOM   329  C C   . LEU A 1 45  ? -14.854 14.857 22.250 1.00 11.76 ? 44   LEU A C   1 
ATOM   330  O O   . LEU A 1 45  ? -13.835 14.167 22.153 1.00 10.43 ? 44   LEU A O   1 
ATOM   331  C CB  . LEU A 1 45  ? -14.086 17.134 22.917 1.00 11.23 ? 44   LEU A CB  1 
ATOM   332  C CG  . LEU A 1 45  ? -14.261 17.677 21.499 1.00 10.05 ? 44   LEU A CG  1 
ATOM   333  C CD1 . LEU A 1 45  ? -15.586 18.402 21.390 1.00 11.97 ? 44   LEU A CD1 1 
ATOM   334  C CD2 . LEU A 1 45  ? -13.114 18.612 21.149 1.00 12.64 ? 44   LEU A CD2 1 
ATOM   335  N N   . CYS A 1 46  ? -15.920 14.703 21.462 1.00 10.32 ? 45   CYS A N   1 
ATOM   336  C CA  . CYS A 1 46  ? -15.942 13.736 20.367 1.00 15.09 ? 45   CYS A CA  1 
ATOM   337  C C   . CYS A 1 46  ? -15.265 14.377 19.144 1.00 17.91 ? 45   CYS A C   1 
ATOM   338  O O   . CYS A 1 46  ? -15.721 15.412 18.637 1.00 8.93  ? 45   CYS A O   1 
ATOM   339  C CB  . CYS A 1 46  ? -17.377 13.328 20.027 1.00 12.18 ? 45   CYS A CB  1 
ATOM   340  S SG  . CYS A 1 46  ? -17.494 12.188 18.609 1.00 18.00 ? 45   CYS A SG  1 
ATOM   341  N N   . ILE A 1 47  ? -14.157 13.784 18.708 1.00 15.85 ? 46   ILE A N   1 
ATOM   342  C CA  . ILE A 1 47  ? -13.396 14.299 17.574 1.00 21.55 ? 46   ILE A CA  1 
ATOM   343  C C   . ILE A 1 47  ? -13.214 13.213 16.524 1.00 20.30 ? 46   ILE A C   1 
ATOM   344  O O   . ILE A 1 47  ? -13.610 12.066 16.727 1.00 18.83 ? 46   ILE A O   1 
ATOM   345  C CB  . ILE A 1 47  ? -11.984 14.758 18.007 1.00 11.97 ? 46   ILE A CB  1 
ATOM   346  C CG1 . ILE A 1 47  ? -11.161 13.543 18.461 1.00 21.07 ? 46   ILE A CG1 1 
ATOM   347  C CG2 . ILE A 1 47  ? -12.082 15.810 19.114 1.00 13.07 ? 46   ILE A CG2 1 
ATOM   348  C CD1 . ILE A 1 47  ? -9.687  13.819 18.703 1.00 22.19 ? 46   ILE A CD1 1 
ATOM   349  N N   . THR A 1 48  ? -12.632 13.589 15.390 1.00 20.67 ? 47   THR A N   1 
ATOM   350  C CA  . THR A 1 48  ? -12.360 12.635 14.321 1.00 23.12 ? 47   THR A CA  1 
ATOM   351  C C   . THR A 1 48  ? -11.041 13.016 13.654 1.00 28.77 ? 47   THR A C   1 
ATOM   352  O O   . THR A 1 48  ? -10.800 14.186 13.348 1.00 30.15 ? 47   THR A O   1 
ATOM   353  C CB  . THR A 1 48  ? -13.509 12.558 13.276 1.00 25.96 ? 47   THR A CB  1 
ATOM   354  O OG1 . THR A 1 48  ? -13.217 11.528 12.321 1.00 22.33 ? 47   THR A OG1 1 
ATOM   355  C CG2 . THR A 1 48  ? -13.694 13.889 12.552 1.00 22.29 ? 47   THR A CG2 1 
ATOM   356  N N   . LYS A 1 49  ? -10.167 12.030 13.485 1.00 31.31 ? 48   LYS A N   1 
ATOM   357  C CA  . LYS A 1 49  ? -8.867  12.255 12.871 1.00 36.82 ? 48   LYS A CA  1 
ATOM   358  C C   . LYS A 1 49  ? -8.933  12.072 11.358 1.00 38.91 ? 48   LYS A C   1 
ATOM   359  O O   . LYS A 1 49  ? -8.251  12.777 10.615 1.00 42.25 ? 48   LYS A O   1 
ATOM   360  C CB  . LYS A 1 49  ? -7.844  11.287 13.461 1.00 39.74 ? 48   LYS A CB  1 
ATOM   361  C CG  . LYS A 1 49  ? -6.430  11.839 13.538 1.00 47.49 ? 48   LYS A CG  1 
ATOM   362  C CD  . LYS A 1 49  ? -5.503  10.879 14.282 1.00 49.74 ? 48   LYS A CD  1 
ATOM   363  C CE  . LYS A 1 49  ? -6.085  10.442 15.638 1.00 46.47 ? 48   LYS A CE  1 
ATOM   364  N NZ  . LYS A 1 49  ? -6.403  11.573 16.558 1.00 40.23 ? 48   LYS A NZ  1 
ATOM   365  N N   . ASP A 1 50  ? -9.789  11.153 10.915 1.00 34.31 ? 49   ASP A N   1 
ATOM   366  C CA  . ASP A 1 50  ? -9.947  10.836 9.493  1.00 33.10 ? 49   ASP A CA  1 
ATOM   367  C C   . ASP A 1 50  ? -11.324 11.167 8.893  1.00 34.33 ? 49   ASP A C   1 
ATOM   368  O O   . ASP A 1 50  ? -11.590 10.855 7.733  1.00 31.68 ? 49   ASP A O   1 
ATOM   369  C CB  . ASP A 1 50  ? -9.638  9.344  9.264  1.00 32.89 ? 49   ASP A CB  1 
ATOM   370  C CG  . ASP A 1 50  ? -10.517 8.404  10.121 1.00 42.70 ? 49   ASP A CG  1 
ATOM   371  O OD1 . ASP A 1 50  ? -11.497 8.862  10.756 1.00 43.88 ? 49   ASP A OD1 1 
ATOM   372  O OD2 . ASP A 1 50  ? -10.222 7.189  10.157 1.00 39.68 ? 49   ASP A OD2 1 
ATOM   373  N N   . LYS A 1 51  ? -12.208 11.756 9.692  1.00 31.98 ? 50   LYS A N   1 
ATOM   374  C CA  . LYS A 1 51  ? -13.559 12.102 9.244  1.00 31.91 ? 50   LYS A CA  1 
ATOM   375  C C   . LYS A 1 51  ? -14.460 10.892 8.948  1.00 29.23 ? 50   LYS A C   1 
ATOM   376  O O   . LYS A 1 51  ? -15.581 11.046 8.448  1.00 32.48 ? 50   LYS A O   1 
ATOM   377  C CB  . LYS A 1 51  ? -13.514 13.089 8.066  1.00 32.32 ? 50   LYS A CB  1 
ATOM   378  C CG  . LYS A 1 51  ? -13.238 14.510 8.527  1.00 38.65 ? 50   LYS A CG  1 
ATOM   379  C CD  . LYS A 1 51  ? -12.641 15.389 7.448  1.00 42.03 ? 50   LYS A CD  1 
ATOM   380  C CE  . LYS A 1 51  ? -12.214 16.718 8.058  1.00 45.32 ? 50   LYS A CE  1 
ATOM   381  N NZ  . LYS A 1 51  ? -11.347 17.530 7.162  1.00 47.84 ? 50   LYS A NZ  1 
ATOM   382  N N   . VAL A 1 52  ? -13.986 9.700  9.308  1.00 27.47 ? 51   VAL A N   1 
ATOM   383  C CA  . VAL A 1 52  ? -14.755 8.470  9.116  1.00 28.80 ? 51   VAL A CA  1 
ATOM   384  C C   . VAL A 1 52  ? -15.198 7.896  10.468 1.00 28.27 ? 51   VAL A C   1 
ATOM   385  O O   . VAL A 1 52  ? -16.375 7.587  10.659 1.00 25.31 ? 51   VAL A O   1 
ATOM   386  C CB  . VAL A 1 52  ? -13.954 7.394  8.338  1.00 31.35 ? 51   VAL A CB  1 
ATOM   387  C CG1 . VAL A 1 52  ? -14.796 6.134  8.158  1.00 25.68 ? 51   VAL A CG1 1 
ATOM   388  C CG2 . VAL A 1 52  ? -13.536 7.930  6.980  1.00 23.29 ? 51   VAL A CG2 1 
ATOM   389  N N   . ASP A 1 53  ? -14.254 7.761  11.400 1.00 23.51 ? 52   ASP A N   1 
ATOM   390  C CA  . ASP A 1 53  ? -14.552 7.230  12.734 1.00 28.36 ? 52   ASP A CA  1 
ATOM   391  C C   . ASP A 1 53  ? -14.450 8.327  13.790 1.00 27.05 ? 52   ASP A C   1 
ATOM   392  O O   . ASP A 1 53  ? -13.545 9.164  13.732 1.00 21.05 ? 52   ASP A O   1 
ATOM   393  C CB  . ASP A 1 53  ? -13.572 6.105  13.113 1.00 34.02 ? 52   ASP A CB  1 
ATOM   394  C CG  . ASP A 1 53  ? -13.680 4.889  12.207 1.00 40.18 ? 52   ASP A CG  1 
ATOM   395  O OD1 . ASP A 1 53  ? -14.808 4.391  11.997 1.00 41.60 ? 52   ASP A OD1 1 
ATOM   396  O OD2 . ASP A 1 53  ? -12.627 4.424  11.718 1.00 44.10 ? 52   ASP A OD2 1 
ATOM   397  N N   . GLY A 1 54  ? -15.374 8.317  14.749 1.00 19.09 ? 53   GLY A N   1 
ATOM   398  C CA  . GLY A 1 54  ? -15.341 9.301  15.815 1.00 17.89 ? 53   GLY A CA  1 
ATOM   399  C C   . GLY A 1 54  ? -14.703 8.685  17.047 1.00 19.78 ? 53   GLY A C   1 
ATOM   400  O O   . GLY A 1 54  ? -14.877 7.490  17.298 1.00 21.35 ? 53   GLY A O   1 
ATOM   401  N N   . THR A 1 55  ? -13.951 9.483  17.798 1.00 14.72 ? 54   THR A N   1 
ATOM   402  C CA  . THR A 1 55  ? -13.288 9.009  19.008 1.00 19.47 ? 54   THR A CA  1 
ATOM   403  C C   . THR A 1 55  ? -13.280 10.108 20.067 1.00 15.45 ? 54   THR A C   1 
ATOM   404  O O   . THR A 1 55  ? -13.324 11.298 19.736 1.00 14.21 ? 54   THR A O   1 
ATOM   405  C CB  . THR A 1 55  ? -11.821 8.548  18.711 1.00 27.83 ? 54   THR A CB  1 
ATOM   406  O OG1 . THR A 1 55  ? -11.244 7.970  19.891 1.00 36.05 ? 54   THR A OG1 1 
ATOM   407  C CG2 . THR A 1 55  ? -10.948 9.721  18.265 1.00 26.62 ? 54   THR A CG2 1 
ATOM   408  N N   . TRP A 1 56  ? -13.285 9.720  21.341 1.00 10.17 ? 55   TRP A N   1 
ATOM   409  C CA  . TRP A 1 56  ? -13.240 10.715 22.411 1.00 7.78  ? 55   TRP A CA  1 
ATOM   410  C C   . TRP A 1 56  ? -11.801 11.237 22.489 1.00 8.82  ? 55   TRP A C   1 
ATOM   411  O O   . TRP A 1 56  ? -10.848 10.473 22.319 1.00 14.79 ? 55   TRP A O   1 
ATOM   412  C CB  . TRP A 1 56  ? -13.727 10.131 23.742 1.00 9.64  ? 55   TRP A CB  1 
ATOM   413  C CG  . TRP A 1 56  ? -15.200 9.788  23.713 1.00 10.15 ? 55   TRP A CG  1 
ATOM   414  C CD1 . TRP A 1 56  ? -15.747 8.544  23.580 1.00 12.19 ? 55   TRP A CD1 1 
ATOM   415  C CD2 . TRP A 1 56  ? -16.304 10.706 23.750 1.00 13.08 ? 55   TRP A CD2 1 
ATOM   416  N NE1 . TRP A 1 56  ? -17.113 8.631  23.524 1.00 18.48 ? 55   TRP A NE1 1 
ATOM   417  C CE2 . TRP A 1 56  ? -17.485 9.945  23.624 1.00 17.61 ? 55   TRP A CE2 1 
ATOM   418  C CE3 . TRP A 1 56  ? -16.407 12.097 23.867 1.00 7.79  ? 55   TRP A CE3 1 
ATOM   419  C CZ2 . TRP A 1 56  ? -18.757 10.527 23.611 1.00 12.60 ? 55   TRP A CZ2 1 
ATOM   420  C CZ3 . TRP A 1 56  ? -17.668 12.677 23.852 1.00 10.29 ? 55   TRP A CZ3 1 
ATOM   421  C CH2 . TRP A 1 56  ? -18.827 11.891 23.725 1.00 11.37 ? 55   TRP A CH2 1 
ATOM   422  N N   . ASP A 1 57  ? -11.644 12.535 22.725 1.00 9.80  ? 56   ASP A N   1 
ATOM   423  C CA  . ASP A 1 57  ? -10.320 13.150 22.735 1.00 10.39 ? 56   ASP A CA  1 
ATOM   424  C C   . ASP A 1 57  ? -9.367  12.774 23.869 1.00 17.39 ? 56   ASP A C   1 
ATOM   425  O O   . ASP A 1 57  ? -8.171  13.057 23.791 1.00 12.68 ? 56   ASP A O   1 
ATOM   426  C CB  . ASP A 1 57  ? -10.440 14.678 22.619 1.00 12.85 ? 56   ASP A CB  1 
ATOM   427  C CG  . ASP A 1 57  ? -10.941 15.338 23.900 1.00 22.38 ? 56   ASP A CG  1 
ATOM   428  O OD1 . ASP A 1 57  ? -11.732 14.716 24.637 1.00 16.80 ? 56   ASP A OD1 1 
ATOM   429  O OD2 . ASP A 1 57  ? -10.542 16.491 24.169 1.00 24.36 ? 56   ASP A OD2 1 
ATOM   430  N N   . LYS A 1 58  ? -9.880  12.131 24.912 1.00 11.74 ? 57   LYS A N   1 
ATOM   431  C CA  . LYS A 1 58  ? -9.032  11.763 26.036 1.00 13.85 ? 57   LYS A CA  1 
ATOM   432  C C   . LYS A 1 58  ? -9.707  10.698 26.895 1.00 10.73 ? 57   LYS A C   1 
ATOM   433  O O   . LYS A 1 58  ? -10.893 10.404 26.710 1.00 9.46  ? 57   LYS A O   1 
ATOM   434  C CB  . LYS A 1 58  ? -8.737  13.011 26.886 1.00 15.26 ? 57   LYS A CB  1 
ATOM   435  C CG  . LYS A 1 58  ? -9.953  13.612 27.585 1.00 15.14 ? 57   LYS A CG  1 
ATOM   436  C CD  . LYS A 1 58  ? -9.561  14.743 28.525 1.00 20.17 ? 57   LYS A CD  1 
ATOM   437  C CE  . LYS A 1 58  ? -9.205  16.007 27.780 1.00 17.80 ? 57   LYS A CE  1 
ATOM   438  N NZ  . LYS A 1 58  ? -10.414 16.654 27.186 1.00 19.62 ? 57   LYS A NZ  1 
ATOM   439  N N   . PRO A 1 59  ? -8.930  10.030 27.767 1.00 13.94 ? 58   PRO A N   1 
ATOM   440  C CA  . PRO A 1 59  ? -9.512  9.004  28.636 1.00 9.31  ? 58   PRO A CA  1 
ATOM   441  C C   . PRO A 1 59  ? -10.477 9.705  29.579 1.00 6.92  ? 58   PRO A C   1 
ATOM   442  O O   . PRO A 1 59  ? -10.370 10.913 29.806 1.00 8.93  ? 58   PRO A O   1 
ATOM   443  C CB  . PRO A 1 59  ? -8.302  8.494  29.427 1.00 7.30  ? 58   PRO A CB  1 
ATOM   444  C CG  . PRO A 1 59  ? -7.166  8.686  28.476 1.00 17.26 ? 58   PRO A CG  1 
ATOM   445  C CD  . PRO A 1 59  ? -7.460  10.056 27.902 1.00 15.17 ? 58   PRO A CD  1 
ATOM   446  N N   . ALA A 1 60  ? -11.406 8.948  30.144 1.00 10.85 ? 59   ALA A N   1 
ATOM   447  C CA  . ALA A 1 60  ? -12.345 9.513  31.094 1.00 9.05  ? 59   ALA A CA  1 
ATOM   448  C C   . ALA A 1 60  ? -11.618 9.680  32.421 1.00 10.62 ? 59   ALA A C   1 
ATOM   449  O O   . ALA A 1 60  ? -10.635 8.985  32.689 1.00 9.39  ? 59   ALA A O   1 
ATOM   450  C CB  . ALA A 1 60  ? -13.518 8.574  31.276 1.00 10.91 ? 59   ALA A CB  1 
ATOM   451  N N   . PRO A 1 61  ? -12.049 10.650 33.239 1.00 7.04  ? 60   PRO A N   1 
ATOM   452  C CA  . PRO A 1 61  ? -11.421 10.871 34.546 1.00 7.45  ? 60   PRO A CA  1 
ATOM   453  C C   . PRO A 1 61  ? -11.960 9.779  35.486 1.00 12.45 ? 60   PRO A C   1 
ATOM   454  O O   . PRO A 1 61  ? -12.777 8.950  35.065 1.00 11.49 ? 60   PRO A O   1 
ATOM   455  C CB  . PRO A 1 61  ? -11.948 12.254 34.939 1.00 7.08  ? 60   PRO A CB  1 
ATOM   456  C CG  . PRO A 1 61  ? -13.328 12.267 34.329 1.00 6.19  ? 60   PRO A CG  1 
ATOM   457  C CD  . PRO A 1 61  ? -13.095 11.657 32.964 1.00 5.71  ? 60   PRO A CD  1 
ATOM   458  N N   . LYS A 1 62  ? -11.545 9.790  36.748 1.00 9.55  ? 61   LYS A N   1 
ATOM   459  C CA  . LYS A 1 62  ? -12.020 8.785  37.700 1.00 14.20 ? 61   LYS A CA  1 
ATOM   460  C C   . LYS A 1 62  ? -12.352 9.441  39.031 1.00 11.82 ? 61   LYS A C   1 
ATOM   461  O O   . LYS A 1 62  ? -11.898 10.551 39.309 1.00 9.74  ? 61   LYS A O   1 
ATOM   462  C CB  . LYS A 1 62  ? -10.970 7.685  37.896 1.00 15.53 ? 61   LYS A CB  1 
ATOM   463  C CG  . LYS A 1 62  ? -9.644  8.176  38.450 1.00 28.62 ? 61   LYS A CG  1 
ATOM   464  C CD  . LYS A 1 62  ? -8.608  7.065  38.455 1.00 34.16 ? 61   LYS A CD  1 
ATOM   465  C CE  . LYS A 1 62  ? -7.232  7.596  38.825 1.00 44.40 ? 61   LYS A CE  1 
ATOM   466  N NZ  . LYS A 1 62  ? -6.211  6.509  38.816 1.00 50.88 ? 61   LYS A NZ  1 
ATOM   467  N N   . CYS A 1 63  ? -13.161 8.763  39.835 1.00 9.17  ? 62   CYS A N   1 
ATOM   468  C CA  . CYS A 1 63  ? -13.560 9.255  41.153 1.00 7.40  ? 62   CYS A CA  1 
ATOM   469  C C   . CYS A 1 63  ? -12.826 8.462  42.230 1.00 10.56 ? 62   CYS A C   1 
ATOM   470  O O   . CYS A 1 63  ? -13.015 7.253  42.346 1.00 16.62 ? 62   CYS A O   1 
ATOM   471  C CB  . CYS A 1 63  ? -15.065 9.069  41.370 1.00 9.03  ? 62   CYS A CB  1 
ATOM   472  S SG  . CYS A 1 63  ? -16.115 10.088 40.303 1.00 20.38 ? 62   CYS A SG  1 
ATOM   473  N N   . GLU A 1 64  ? -11.987 9.134  43.008 1.00 12.53 ? 63   GLU A N   1 
ATOM   474  C CA  . GLU A 1 64  ? -11.253 8.472  44.079 1.00 12.42 ? 63   GLU A CA  1 
ATOM   475  C C   . GLU A 1 64  ? -11.892 8.791  45.430 1.00 8.46  ? 63   GLU A C   1 
ATOM   476  O O   . GLU A 1 64  ? -12.203 9.954  45.713 1.00 9.73  ? 63   GLU A O   1 
ATOM   477  C CB  . GLU A 1 64  ? -9.791  8.938  44.089 1.00 8.99  ? 63   GLU A CB  1 
ATOM   478  C CG  . GLU A 1 64  ? -8.941  8.427  42.928 1.00 10.62 ? 63   GLU A CG  1 
ATOM   479  C CD  . GLU A 1 64  ? -7.466  8.770  43.088 1.00 13.50 ? 63   GLU A CD  1 
ATOM   480  O OE1 . GLU A 1 64  ? -6.632  8.160  42.392 1.00 14.72 ? 63   GLU A OE1 1 
ATOM   481  O OE2 . GLU A 1 64  ? -7.135  9.655  43.907 1.00 12.49 ? 63   GLU A OE2 1 
ATOM   482  N N   . TYR A 1 65  ? -12.072 7.773  46.271 1.00 11.56 ? 64   TYR A N   1 
ATOM   483  C CA  . TYR A 1 65  ? -12.658 7.990  47.592 1.00 10.35 ? 64   TYR A CA  1 
ATOM   484  C C   . TYR A 1 65  ? -11.753 8.982  48.328 1.00 8.57  ? 64   TYR A C   1 
ATOM   485  O O   . TYR A 1 65  ? -10.536 8.807  48.359 1.00 13.09 ? 64   TYR A O   1 
ATOM   486  C CB  . TYR A 1 65  ? -12.762 6.671  48.373 1.00 15.05 ? 64   TYR A CB  1 
ATOM   487  C CG  . TYR A 1 65  ? -13.571 6.793  49.650 1.00 27.18 ? 64   TYR A CG  1 
ATOM   488  C CD1 . TYR A 1 65  ? -14.948 7.049  49.607 1.00 30.08 ? 64   TYR A CD1 1 
ATOM   489  C CD2 . TYR A 1 65  ? -12.961 6.682  50.904 1.00 30.11 ? 64   TYR A CD2 1 
ATOM   490  C CE1 . TYR A 1 65  ? -15.700 7.194  50.783 1.00 34.29 ? 64   TYR A CE1 1 
ATOM   491  C CE2 . TYR A 1 65  ? -13.701 6.825  52.087 1.00 35.34 ? 64   TYR A CE2 1 
ATOM   492  C CZ  . TYR A 1 65  ? -15.070 7.080  52.019 1.00 38.85 ? 64   TYR A CZ  1 
ATOM   493  O OH  . TYR A 1 65  ? -15.804 7.223  53.182 1.00 35.63 ? 64   TYR A OH  1 
ATOM   494  N N   . PHE A 1 66  ? -12.336 10.043 48.875 1.00 9.48  ? 65   PHE A N   1 
ATOM   495  C CA  . PHE A 1 66  ? -11.566 11.069 49.561 1.00 8.34  ? 65   PHE A CA  1 
ATOM   496  C C   . PHE A 1 66  ? -10.653 10.538 50.662 1.00 15.40 ? 65   PHE A C   1 
ATOM   497  O O   . PHE A 1 66  ? -11.090 9.786  51.535 1.00 16.72 ? 65   PHE A O   1 
ATOM   498  C CB  . PHE A 1 66  ? -12.498 12.132 50.144 1.00 8.58  ? 65   PHE A CB  1 
ATOM   499  C CG  . PHE A 1 66  ? -11.780 13.313 50.764 1.00 13.61 ? 65   PHE A CG  1 
ATOM   500  C CD1 . PHE A 1 66  ? -10.793 14.002 50.060 1.00 13.44 ? 65   PHE A CD1 1 
ATOM   501  C CD2 . PHE A 1 66  ? -12.109 13.749 52.049 1.00 11.87 ? 65   PHE A CD2 1 
ATOM   502  C CE1 . PHE A 1 66  ? -10.147 15.109 50.627 1.00 16.46 ? 65   PHE A CE1 1 
ATOM   503  C CE2 . PHE A 1 66  ? -11.468 14.854 52.622 1.00 9.44  ? 65   PHE A CE2 1 
ATOM   504  C CZ  . PHE A 1 66  ? -10.487 15.534 51.910 1.00 12.27 ? 65   PHE A CZ  1 
ATOM   505  N N   . ASN A 1 67  ? -9.375  10.901 50.577 1.00 12.20 ? 66   ASN A N   1 
ATOM   506  C CA  . ASN A 1 67  ? -8.390  10.544 51.591 1.00 11.78 ? 66   ASN A CA  1 
ATOM   507  C C   . ASN A 1 67  ? -7.939  11.900 52.136 1.00 14.47 ? 66   ASN A C   1 
ATOM   508  O O   . ASN A 1 67  ? -7.158  12.612 51.495 1.00 12.20 ? 66   ASN A O   1 
ATOM   509  C CB  . ASN A 1 67  ? -7.213  9.766  50.991 1.00 8.81  ? 66   ASN A CB  1 
ATOM   510  C CG  . ASN A 1 67  ? -6.172  9.390  52.035 1.00 12.45 ? 66   ASN A CG  1 
ATOM   511  O OD1 . ASN A 1 67  ? -5.873  10.174 52.933 1.00 9.69  ? 66   ASN A OD1 1 
ATOM   512  N ND2 . ASN A 1 67  ? -5.601  8.201  51.908 1.00 14.28 ? 66   ASN A ND2 1 
ATOM   513  N N   . LYS A 1 68  ? -8.454  12.263 53.308 1.00 10.64 ? 67   LYS A N   1 
ATOM   514  C CA  . LYS A 1 68  ? -8.143  13.549 53.918 1.00 11.75 ? 67   LYS A CA  1 
ATOM   515  C C   . LYS A 1 68  ? -6.703  13.794 54.351 1.00 8.20  ? 67   LYS A C   1 
ATOM   516  O O   . LYS A 1 68  ? -6.343  14.925 54.677 1.00 15.80 ? 67   LYS A O   1 
ATOM   517  C CB  . LYS A 1 68  ? -9.079  13.815 55.099 1.00 13.38 ? 67   LYS A CB  1 
ATOM   518  C CG  . LYS A 1 68  ? -8.933  12.849 56.258 1.00 11.43 ? 67   LYS A CG  1 
ATOM   519  C CD  . LYS A 1 68  ? -9.989  13.148 57.310 1.00 15.92 ? 67   LYS A CD  1 
ATOM   520  C CE  . LYS A 1 68  ? -9.955  12.153 58.452 1.00 16.51 ? 67   LYS A CE  1 
ATOM   521  N NZ  . LYS A 1 68  ? -11.069 12.408 59.407 1.00 10.27 ? 67   LYS A NZ  1 
ATOM   522  N N   . TYR A 1 69  ? -5.887  12.748 54.388 1.00 7.50  ? 68   TYR A N   1 
ATOM   523  C CA  . TYR A 1 69  ? -4.495  12.898 54.816 1.00 9.63  ? 68   TYR A CA  1 
ATOM   524  C C   . TYR A 1 69  ? -3.550  13.166 53.648 1.00 7.13  ? 68   TYR A C   1 
ATOM   525  O O   . TYR A 1 69  ? -2.442  13.655 53.837 1.00 13.43 ? 68   TYR A O   1 
ATOM   526  C CB  . TYR A 1 69  ? -4.020  11.631 55.526 1.00 9.38  ? 68   TYR A CB  1 
ATOM   527  C CG  . TYR A 1 69  ? -5.003  11.063 56.523 1.00 12.39 ? 68   TYR A CG  1 
ATOM   528  C CD1 . TYR A 1 69  ? -5.612  9.824  56.298 1.00 13.86 ? 68   TYR A CD1 1 
ATOM   529  C CD2 . TYR A 1 69  ? -5.304  11.744 57.707 1.00 15.39 ? 68   TYR A CD2 1 
ATOM   530  C CE1 . TYR A 1 69  ? -6.494  9.274  57.231 1.00 11.73 ? 68   TYR A CE1 1 
ATOM   531  C CE2 . TYR A 1 69  ? -6.181  11.204 58.643 1.00 18.11 ? 68   TYR A CE2 1 
ATOM   532  C CZ  . TYR A 1 69  ? -6.768  9.970  58.400 1.00 18.43 ? 68   TYR A CZ  1 
ATOM   533  O OH  . TYR A 1 69  ? -7.616  9.422  59.334 1.00 16.30 ? 68   TYR A OH  1 
ATOM   534  N N   . SER A 1 70  ? -3.992  12.835 52.446 1.00 8.02  ? 69   SER A N   1 
ATOM   535  C CA  . SER A 1 70  ? -3.160  12.999 51.260 1.00 12.20 ? 69   SER A CA  1 
ATOM   536  C C   . SER A 1 70  ? -2.794  14.444 50.943 1.00 11.79 ? 69   SER A C   1 
ATOM   537  O O   . SER A 1 70  ? -3.570  15.367 51.212 1.00 16.29 ? 69   SER A O   1 
ATOM   538  C CB  . SER A 1 70  ? -3.834  12.338 50.053 1.00 9.11  ? 69   SER A CB  1 
ATOM   539  O OG  . SER A 1 70  ? -3.966  10.935 50.257 1.00 12.68 ? 69   SER A OG  1 
ATOM   540  N N   . SER A 1 71  ? -1.588  14.627 50.412 1.00 15.60 ? 70   SER A N   1 
ATOM   541  C CA  . SER A 1 71  ? -1.094  15.942 50.012 1.00 13.54 ? 70   SER A CA  1 
ATOM   542  C C   . SER A 1 71  ? 0.020   15.725 48.989 1.00 15.76 ? 70   SER A C   1 
ATOM   543  O O   . SER A 1 71  ? 0.706   14.698 49.009 1.00 14.38 ? 70   SER A O   1 
ATOM   544  C CB  . SER A 1 71  ? -0.601  16.763 51.215 1.00 21.47 ? 70   SER A CB  1 
ATOM   545  O OG  . SER A 1 71  ? 0.557   16.208 51.807 1.00 23.25 ? 70   SER A OG  1 
ATOM   546  N N   . CYS A 1 72  ? 0.187   16.683 48.088 1.00 14.86 ? 71   CYS A N   1 
ATOM   547  C CA  . CYS A 1 72  ? 1.187   16.569 47.041 1.00 13.03 ? 71   CYS A CA  1 
ATOM   548  C C   . CYS A 1 72  ? 2.214   17.684 47.130 1.00 13.30 ? 71   CYS A C   1 
ATOM   549  O O   . CYS A 1 72  ? 1.899   18.779 47.589 1.00 15.18 ? 71   CYS A O   1 
ATOM   550  C CB  . CYS A 1 72  ? 0.489   16.621 45.679 1.00 15.95 ? 71   CYS A CB  1 
ATOM   551  S SG  . CYS A 1 72  ? -0.654  15.234 45.374 1.00 30.47 ? 71   CYS A SG  1 
ATOM   552  N N   . PRO A 1 73  ? 3.474   17.399 46.755 1.00 12.05 ? 72   PRO A N   1 
ATOM   553  C CA  . PRO A 1 73  ? 4.522   18.424 46.798 1.00 17.91 ? 72   PRO A CA  1 
ATOM   554  C C   . PRO A 1 73  ? 4.307   19.423 45.646 1.00 14.70 ? 72   PRO A C   1 
ATOM   555  O O   . PRO A 1 73  ? 3.535   19.160 44.728 1.00 12.18 ? 72   PRO A O   1 
ATOM   556  C CB  . PRO A 1 73  ? 5.800   17.603 46.597 1.00 12.29 ? 72   PRO A CB  1 
ATOM   557  C CG  . PRO A 1 73  ? 5.350   16.504 45.694 1.00 20.39 ? 72   PRO A CG  1 
ATOM   558  C CD  . PRO A 1 73  ? 4.029   16.101 46.332 1.00 20.05 ? 72   PRO A CD  1 
ATOM   559  N N   . GLU A 1 74  ? 4.982   20.564 45.699 1.00 16.90 ? 73   GLU A N   1 
ATOM   560  C CA  . GLU A 1 74  ? 4.865   21.581 44.651 1.00 18.69 ? 73   GLU A CA  1 
ATOM   561  C C   . GLU A 1 74  ? 5.280   20.994 43.296 1.00 13.08 ? 73   GLU A C   1 
ATOM   562  O O   . GLU A 1 74  ? 6.404   20.520 43.143 1.00 18.76 ? 73   GLU A O   1 
ATOM   563  C CB  . GLU A 1 74  ? 5.778   22.767 44.986 1.00 25.61 ? 73   GLU A CB  1 
ATOM   564  C CG  . GLU A 1 74  ? 5.688   23.946 44.022 1.00 25.85 ? 73   GLU A CG  1 
ATOM   565  C CD  . GLU A 1 74  ? 4.425   24.772 44.220 1.00 35.22 ? 73   GLU A CD  1 
ATOM   566  O OE1 . GLU A 1 74  ? 3.862   25.244 43.210 1.00 35.89 ? 73   GLU A OE1 1 
ATOM   567  O OE2 . GLU A 1 74  ? 4.000   24.966 45.384 1.00 34.19 ? 73   GLU A OE2 1 
ATOM   568  N N   . PRO A 1 75  ? 4.361   20.958 42.314 1.00 13.29 ? 74   PRO A N   1 
ATOM   569  C CA  . PRO A 1 75  ? 4.755   20.401 41.014 1.00 12.80 ? 74   PRO A CA  1 
ATOM   570  C C   . PRO A 1 75  ? 5.555   21.461 40.251 1.00 12.96 ? 74   PRO A C   1 
ATOM   571  O O   . PRO A 1 75  ? 5.212   22.643 40.279 1.00 12.98 ? 74   PRO A O   1 
ATOM   572  C CB  . PRO A 1 75  ? 3.409   20.093 40.358 1.00 8.83  ? 74   PRO A CB  1 
ATOM   573  C CG  . PRO A 1 75  ? 2.538   21.207 40.874 1.00 9.14  ? 74   PRO A CG  1 
ATOM   574  C CD  . PRO A 1 75  ? 2.931   21.329 42.329 1.00 13.39 ? 74   PRO A CD  1 
ATOM   575  N N   . ILE A 1 76  ? 6.623   21.041 39.589 1.00 13.95 ? 75   ILE A N   1 
ATOM   576  C CA  . ILE A 1 76  ? 7.475   21.970 38.858 1.00 13.82 ? 75   ILE A CA  1 
ATOM   577  C C   . ILE A 1 76  ? 7.633   21.550 37.398 1.00 11.60 ? 75   ILE A C   1 
ATOM   578  O O   . ILE A 1 76  ? 7.869   20.376 37.102 1.00 9.82  ? 75   ILE A O   1 
ATOM   579  C CB  . ILE A 1 76  ? 8.869   22.061 39.536 1.00 19.04 ? 75   ILE A CB  1 
ATOM   580  C CG1 . ILE A 1 76  ? 8.741   22.741 40.900 1.00 17.10 ? 75   ILE A CG1 1 
ATOM   581  C CG2 . ILE A 1 76  ? 9.861   22.798 38.663 1.00 18.37 ? 75   ILE A CG2 1 
ATOM   582  C CD1 . ILE A 1 76  ? 9.975   22.616 41.752 1.00 32.02 ? 75   ILE A CD1 1 
ATOM   583  N N   . VAL A 1 77  ? 7.458   22.514 36.495 1.00 8.45  ? 76   VAL A N   1 
ATOM   584  C CA  . VAL A 1 77  ? 7.594   22.281 35.062 1.00 7.46  ? 76   VAL A CA  1 
ATOM   585  C C   . VAL A 1 77  ? 8.629   23.282 34.521 1.00 8.97  ? 76   VAL A C   1 
ATOM   586  O O   . VAL A 1 77  ? 8.366   24.485 34.478 1.00 11.64 ? 76   VAL A O   1 
ATOM   587  C CB  . VAL A 1 77  ? 6.241   22.496 34.318 1.00 7.35  ? 76   VAL A CB  1 
ATOM   588  C CG1 . VAL A 1 77  ? 6.456   22.488 32.810 1.00 16.02 ? 76   VAL A CG1 1 
ATOM   589  C CG2 . VAL A 1 77  ? 5.222   21.417 34.709 1.00 7.74  ? 76   VAL A CG2 1 
ATOM   590  N N   . PRO A 1 78  ? 9.852   22.816 34.212 1.00 10.39 ? 77   PRO A N   1 
ATOM   591  C CA  . PRO A 1 78  ? 10.887  23.717 33.684 1.00 12.67 ? 77   PRO A CA  1 
ATOM   592  C C   . PRO A 1 78  ? 10.374  24.385 32.400 1.00 12.06 ? 77   PRO A C   1 
ATOM   593  O O   . PRO A 1 78  ? 9.753   23.723 31.553 1.00 10.57 ? 77   PRO A O   1 
ATOM   594  C CB  . PRO A 1 78  ? 12.052  22.761 33.397 1.00 10.39 ? 77   PRO A CB  1 
ATOM   595  C CG  . PRO A 1 78  ? 11.891  21.719 34.462 1.00 9.82  ? 77   PRO A CG  1 
ATOM   596  C CD  . PRO A 1 78  ? 10.394  21.462 34.421 1.00 11.60 ? 77   PRO A CD  1 
ATOM   597  N N   . GLY A 1 79  ? 10.619  25.688 32.271 1.00 8.69  ? 78   GLY A N   1 
ATOM   598  C CA  . GLY A 1 79  ? 10.157  26.427 31.106 1.00 8.60  ? 78   GLY A CA  1 
ATOM   599  C C   . GLY A 1 79  ? 8.691   26.843 31.190 1.00 9.82  ? 78   GLY A C   1 
ATOM   600  O O   . GLY A 1 79  ? 8.164   27.494 30.278 1.00 14.20 ? 78   GLY A O   1 
ATOM   601  N N   . GLY A 1 80  ? 8.023   26.473 32.280 1.00 9.99  ? 79   GLY A N   1 
ATOM   602  C CA  . GLY A 1 80  ? 6.629   26.826 32.453 1.00 6.80  ? 79   GLY A CA  1 
ATOM   603  C C   . GLY A 1 80  ? 6.396   27.402 33.830 1.00 9.57  ? 79   GLY A C   1 
ATOM   604  O O   . GLY A 1 80  ? 7.312   27.464 34.653 1.00 8.44  ? 79   GLY A O   1 
ATOM   605  N N   . TYR A 1 81  ? 5.161   27.799 34.098 1.00 7.11  ? 80   TYR A N   1 
ATOM   606  C CA  . TYR A 1 81  ? 4.813   28.379 35.380 1.00 10.16 ? 80   TYR A CA  1 
ATOM   607  C C   . TYR A 1 81  ? 3.354   28.106 35.743 1.00 14.93 ? 80   TYR A C   1 
ATOM   608  O O   . TYR A 1 81  ? 2.488   27.961 34.872 1.00 11.73 ? 80   TYR A O   1 
ATOM   609  C CB  . TYR A 1 81  ? 5.122   29.896 35.395 1.00 12.78 ? 80   TYR A CB  1 
ATOM   610  C CG  . TYR A 1 81  ? 4.320   30.755 34.423 1.00 14.56 ? 80   TYR A CG  1 
ATOM   611  C CD1 . TYR A 1 81  ? 3.281   31.569 34.881 1.00 11.93 ? 80   TYR A CD1 1 
ATOM   612  C CD2 . TYR A 1 81  ? 4.591   30.746 33.050 1.00 9.00  ? 80   TYR A CD2 1 
ATOM   613  C CE1 . TYR A 1 81  ? 2.533   32.344 34.001 1.00 9.42  ? 80   TYR A CE1 1 
ATOM   614  C CE2 . TYR A 1 81  ? 3.843   31.521 32.161 1.00 11.84 ? 80   TYR A CE2 1 
ATOM   615  C CZ  . TYR A 1 81  ? 2.817   32.312 32.643 1.00 8.15  ? 80   TYR A CZ  1 
ATOM   616  O OH  . TYR A 1 81  ? 2.041   33.047 31.774 1.00 10.49 ? 80   TYR A OH  1 
ATOM   617  N N   . LYS A 1 82  ? 3.105   27.994 37.041 1.00 9.55  ? 81   LYS A N   1 
ATOM   618  C CA  . LYS A 1 82  ? 1.774   27.743 37.560 1.00 11.49 ? 81   LYS A CA  1 
ATOM   619  C C   . LYS A 1 82  ? 0.886   28.976 37.386 1.00 14.25 ? 81   LYS A C   1 
ATOM   620  O O   . LYS A 1 82  ? 1.284   30.086 37.734 1.00 19.35 ? 81   LYS A O   1 
ATOM   621  C CB  . LYS A 1 82  ? 1.882   27.378 39.045 1.00 14.24 ? 81   LYS A CB  1 
ATOM   622  C CG  . LYS A 1 82  ? 0.586   26.952 39.697 1.00 27.22 ? 81   LYS A CG  1 
ATOM   623  C CD  . LYS A 1 82  ? 0.801   26.580 41.167 1.00 22.13 ? 81   LYS A CD  1 
ATOM   624  C CE  . LYS A 1 82  ? 1.297   27.779 41.961 1.00 28.03 ? 81   LYS A CE  1 
ATOM   625  N NZ  . LYS A 1 82  ? 1.366   27.514 43.417 1.00 23.46 ? 81   LYS A NZ  1 
ATOM   626  N N   . ILE A 1 83  ? -0.300  28.788 36.811 1.00 12.75 ? 82   ILE A N   1 
ATOM   627  C CA  . ILE A 1 83  ? -1.240  29.892 36.619 1.00 16.71 ? 82   ILE A CA  1 
ATOM   628  C C   . ILE A 1 83  ? -2.496  29.737 37.484 1.00 19.01 ? 82   ILE A C   1 
ATOM   629  O O   . ILE A 1 83  ? -3.350  30.632 37.533 1.00 13.10 ? 82   ILE A O   1 
ATOM   630  C CB  . ILE A 1 83  ? -1.669  30.043 35.145 1.00 9.30  ? 82   ILE A CB  1 
ATOM   631  C CG1 . ILE A 1 83  ? -2.402  28.787 34.663 1.00 12.71 ? 82   ILE A CG1 1 
ATOM   632  C CG2 . ILE A 1 83  ? -0.450  30.315 34.286 1.00 23.43 ? 82   ILE A CG2 1 
ATOM   633  C CD1 . ILE A 1 83  ? -2.965  28.890 33.254 1.00 17.67 ? 82   ILE A CD1 1 
ATOM   634  N N   . ARG A 1 84  ? -2.584  28.619 38.194 1.00 13.91 ? 83   ARG A N   1 
ATOM   635  C CA  . ARG A 1 84  ? -3.731  28.353 39.042 1.00 13.50 ? 83   ARG A CA  1 
ATOM   636  C C   . ARG A 1 84  ? -3.333  27.245 40.014 1.00 16.93 ? 83   ARG A C   1 
ATOM   637  O O   . ARG A 1 84  ? -2.622  26.311 39.634 1.00 13.00 ? 83   ARG A O   1 
ATOM   638  C CB  . ARG A 1 84  ? -4.899  27.896 38.160 1.00 20.12 ? 83   ARG A CB  1 
ATOM   639  C CG  . ARG A 1 84  ? -6.281  28.361 38.604 1.00 39.68 ? 83   ARG A CG  1 
ATOM   640  C CD  . ARG A 1 84  ? -7.075  27.217 39.196 1.00 41.89 ? 83   ARG A CD  1 
ATOM   641  N NE  . ARG A 1 84  ? -6.867  26.000 38.422 1.00 47.57 ? 83   ARG A NE  1 
ATOM   642  C CZ  . ARG A 1 84  ? -6.591  24.818 38.960 1.00 41.39 ? 83   ARG A CZ  1 
ATOM   643  N NH1 . ARG A 1 84  ? -6.510  24.687 40.278 1.00 40.16 ? 83   ARG A NH1 1 
ATOM   644  N NH2 . ARG A 1 84  ? -6.308  23.790 38.177 1.00 23.92 ? 83   ARG A NH2 1 
ATOM   645  N N   . GLY A 1 85  ? -3.755  27.369 41.268 1.00 15.31 ? 84   GLY A N   1 
ATOM   646  C CA  . GLY A 1 85  ? -3.434  26.357 42.256 1.00 20.56 ? 84   GLY A CA  1 
ATOM   647  C C   . GLY A 1 85  ? -2.703  26.977 43.421 1.00 25.96 ? 84   GLY A C   1 
ATOM   648  O O   . GLY A 1 85  ? -1.779  27.770 43.226 1.00 31.86 ? 84   GLY A O   1 
ATOM   649  N N   . SER A 1 86  ? -3.102  26.602 44.631 1.00 28.65 ? 85   SER A N   1 
ATOM   650  C CA  . SER A 1 86  ? -2.495  27.140 45.842 1.00 29.49 ? 85   SER A CA  1 
ATOM   651  C C   . SER A 1 86  ? -2.191  26.047 46.857 1.00 25.81 ? 85   SER A C   1 
ATOM   652  O O   . SER A 1 86  ? -2.948  25.095 47.005 1.00 26.95 ? 85   SER A O   1 
ATOM   653  C CB  . SER A 1 86  ? -3.423  28.178 46.477 1.00 29.55 ? 85   SER A CB  1 
ATOM   654  O OG  . SER A 1 86  ? -2.811  28.787 47.601 1.00 42.29 ? 85   SER A OG  1 
ATOM   655  N N   . THR A 1 87  ? -1.061  26.193 47.533 1.00 28.93 ? 86   THR A N   1 
ATOM   656  C CA  . THR A 1 87  ? -0.623  25.249 48.547 1.00 28.71 ? 86   THR A CA  1 
ATOM   657  C C   . THR A 1 87  ? -1.417  25.503 49.841 1.00 26.66 ? 86   THR A C   1 
ATOM   658  O O   . THR A 1 87  ? -1.843  26.632 50.092 1.00 27.03 ? 86   THR A O   1 
ATOM   659  C CB  . THR A 1 87  ? 0.893   25.423 48.801 1.00 34.21 ? 86   THR A CB  1 
ATOM   660  O OG1 . THR A 1 87  ? 1.349   24.436 49.730 1.00 40.85 ? 86   THR A OG1 1 
ATOM   661  C CG2 . THR A 1 87  ? 1.196   26.821 49.345 1.00 32.73 ? 86   THR A CG2 1 
ATOM   662  N N   . PRO A 1 88  ? -1.690  24.448 50.639 1.00 28.18 ? 87   PRO A N   1 
ATOM   663  C CA  . PRO A 1 88  ? -1.327  23.036 50.439 1.00 20.89 ? 87   PRO A CA  1 
ATOM   664  C C   . PRO A 1 88  ? -2.203  22.334 49.394 1.00 15.97 ? 87   PRO A C   1 
ATOM   665  O O   . PRO A 1 88  ? -3.372  22.676 49.207 1.00 17.89 ? 87   PRO A O   1 
ATOM   666  C CB  . PRO A 1 88  ? -1.536  22.437 51.831 1.00 25.01 ? 87   PRO A CB  1 
ATOM   667  C CG  . PRO A 1 88  ? -2.707  23.222 52.351 1.00 24.65 ? 87   PRO A CG  1 
ATOM   668  C CD  . PRO A 1 88  ? -2.320  24.636 51.962 1.00 27.32 ? 87   PRO A CD  1 
ATOM   669  N N   . TYR A 1 89  ? -1.627  21.348 48.718 1.00 15.28 ? 88   TYR A N   1 
ATOM   670  C CA  . TYR A 1 89  ? -2.341  20.597 47.699 1.00 12.22 ? 88   TYR A CA  1 
ATOM   671  C C   . TYR A 1 89  ? -2.884  19.317 48.324 1.00 21.63 ? 88   TYR A C   1 
ATOM   672  O O   . TYR A 1 89  ? -2.125  18.401 48.655 1.00 25.14 ? 88   TYR A O   1 
ATOM   673  C CB  . TYR A 1 89  ? -1.405  20.272 46.536 1.00 14.56 ? 88   TYR A CB  1 
ATOM   674  C CG  . TYR A 1 89  ? -0.715  21.495 45.969 1.00 10.80 ? 88   TYR A CG  1 
ATOM   675  C CD1 . TYR A 1 89  ? 0.640   21.722 46.204 1.00 17.26 ? 88   TYR A CD1 1 
ATOM   676  C CD2 . TYR A 1 89  ? -1.418  22.432 45.215 1.00 16.41 ? 88   TYR A CD2 1 
ATOM   677  C CE1 . TYR A 1 89  ? 1.281   22.851 45.705 1.00 20.29 ? 88   TYR A CE1 1 
ATOM   678  C CE2 . TYR A 1 89  ? -0.787  23.567 44.709 1.00 21.85 ? 88   TYR A CE2 1 
ATOM   679  C CZ  . TYR A 1 89  ? 0.561   23.770 44.960 1.00 23.57 ? 88   TYR A CZ  1 
ATOM   680  O OH  . TYR A 1 89  ? 1.190   24.897 44.483 1.00 21.36 ? 88   TYR A OH  1 
ATOM   681  N N   . ARG A 1 90  ? -4.191  19.298 48.556 1.00 16.03 ? 89   ARG A N   1 
ATOM   682  C CA  . ARG A 1 90  ? -4.858  18.146 49.149 1.00 17.19 ? 89   ARG A CA  1 
ATOM   683  C C   . ARG A 1 90  ? -5.451  17.287 48.040 1.00 16.61 ? 89   ARG A C   1 
ATOM   684  O O   . ARG A 1 90  ? -5.418  17.666 46.869 1.00 9.76  ? 89   ARG A O   1 
ATOM   685  C CB  . ARG A 1 90  ? -5.966  18.594 50.116 1.00 15.27 ? 89   ARG A CB  1 
ATOM   686  C CG  . ARG A 1 90  ? -5.538  19.623 51.169 1.00 27.58 ? 89   ARG A CG  1 
ATOM   687  C CD  . ARG A 1 90  ? -4.347  19.159 51.998 1.00 35.05 ? 89   ARG A CD  1 
ATOM   688  N NE  . ARG A 1 90  ? -4.682  18.067 52.912 1.00 43.62 ? 89   ARG A NE  1 
ATOM   689  C CZ  . ARG A 1 90  ? -3.796  17.416 53.664 1.00 40.57 ? 89   ARG A CZ  1 
ATOM   690  N NH1 . ARG A 1 90  ? -2.508  17.737 53.617 1.00 40.34 ? 89   ARG A NH1 1 
ATOM   691  N NH2 . ARG A 1 90  ? -4.196  16.450 54.476 1.00 28.51 ? 89   ARG A NH2 1 
ATOM   692  N N   . HIS A 1 91  ? -6.021  16.149 48.426 1.00 14.16 ? 90   HIS A N   1 
ATOM   693  C CA  . HIS A 1 91  ? -6.622  15.206 47.491 1.00 8.20  ? 90   HIS A CA  1 
ATOM   694  C C   . HIS A 1 91  ? -7.740  15.852 46.676 1.00 10.89 ? 90   HIS A C   1 
ATOM   695  O O   . HIS A 1 91  ? -8.693  16.395 47.232 1.00 9.73  ? 90   HIS A O   1 
ATOM   696  C CB  . HIS A 1 91  ? -7.150  13.987 48.264 1.00 18.64 ? 90   HIS A CB  1 
ATOM   697  C CG  . HIS A 1 91  ? -7.674  12.884 47.393 1.00 14.77 ? 90   HIS A CG  1 
ATOM   698  N ND1 . HIS A 1 91  ? -8.695  12.046 47.791 1.00 9.35  ? 90   HIS A ND1 1 
ATOM   699  C CD2 . HIS A 1 91  ? -7.319  12.477 46.149 1.00 10.28 ? 90   HIS A CD2 1 
ATOM   700  C CE1 . HIS A 1 91  ? -8.946  11.171 46.835 1.00 11.98 ? 90   HIS A CE1 1 
ATOM   701  N NE2 . HIS A 1 91  ? -8.127  11.413 45.827 1.00 12.36 ? 90   HIS A NE2 1 
ATOM   702  N N   . GLY A 1 92  ? -7.615  15.789 45.354 1.00 11.26 ? 91   GLY A N   1 
ATOM   703  C CA  . GLY A 1 92  ? -8.621  16.378 44.487 1.00 8.18  ? 91   GLY A CA  1 
ATOM   704  C C   . GLY A 1 92  ? -8.243  17.765 43.984 1.00 7.99  ? 91   GLY A C   1 
ATOM   705  O O   . GLY A 1 92  ? -8.826  18.243 43.009 1.00 8.32  ? 91   GLY A O   1 
ATOM   706  N N   . ASP A 1 93  ? -7.278  18.418 44.635 1.00 5.57  ? 92   ASP A N   1 
ATOM   707  C CA  . ASP A 1 93  ? -6.850  19.753 44.211 1.00 10.15 ? 92   ASP A CA  1 
ATOM   708  C C   . ASP A 1 93  ? -6.073  19.663 42.901 1.00 7.89  ? 92   ASP A C   1 
ATOM   709  O O   . ASP A 1 93  ? -5.391  18.668 42.636 1.00 9.31  ? 92   ASP A O   1 
ATOM   710  C CB  . ASP A 1 93  ? -5.958  20.424 45.263 1.00 11.32 ? 92   ASP A CB  1 
ATOM   711  C CG  . ASP A 1 93  ? -6.721  20.842 46.520 1.00 17.54 ? 92   ASP A CG  1 
ATOM   712  O OD1 . ASP A 1 93  ? -7.972  20.829 46.527 1.00 17.30 ? 92   ASP A OD1 1 
ATOM   713  O OD2 . ASP A 1 93  ? -6.051  21.185 47.512 1.00 14.49 ? 92   ASP A OD2 1 
ATOM   714  N N   . SER A 1 94  ? -6.163  20.708 42.091 1.00 12.00 ? 93   SER A N   1 
ATOM   715  C CA  . SER A 1 94  ? -5.445  20.720 40.831 1.00 12.05 ? 93   SER A CA  1 
ATOM   716  C C   . SER A 1 94  ? -4.563  21.959 40.680 1.00 14.06 ? 93   SER A C   1 
ATOM   717  O O   . SER A 1 94  ? -4.683  22.931 41.439 1.00 8.85  ? 93   SER A O   1 
ATOM   718  C CB  . SER A 1 94  ? -6.418  20.613 39.657 1.00 13.59 ? 93   SER A CB  1 
ATOM   719  O OG  . SER A 1 94  ? -7.374  21.654 39.697 1.00 17.02 ? 93   SER A OG  1 
ATOM   720  N N   . VAL A 1 95  ? -3.635  21.875 39.735 1.00 10.16 ? 94   VAL A N   1 
ATOM   721  C CA  . VAL A 1 95  ? -2.721  22.957 39.415 1.00 10.36 ? 94   VAL A CA  1 
ATOM   722  C C   . VAL A 1 95  ? -2.754  23.027 37.891 1.00 15.21 ? 94   VAL A C   1 
ATOM   723  O O   . VAL A 1 95  ? -2.912  21.992 37.235 1.00 11.54 ? 94   VAL A O   1 
ATOM   724  C CB  . VAL A 1 95  ? -1.269  22.631 39.871 1.00 15.02 ? 94   VAL A CB  1 
ATOM   725  C CG1 . VAL A 1 95  ? -0.271  23.574 39.210 1.00 20.31 ? 94   VAL A CG1 1 
ATOM   726  C CG2 . VAL A 1 95  ? -1.153  22.752 41.385 1.00 16.01 ? 94   VAL A CG2 1 
ATOM   727  N N   . THR A 1 96  ? -2.672  24.238 37.343 1.00 9.35  ? 95   THR A N   1 
ATOM   728  C CA  . THR A 1 96  ? -2.663  24.446 35.894 1.00 8.13  ? 95   THR A CA  1 
ATOM   729  C C   . THR A 1 96  ? -1.382  25.220 35.567 1.00 5.84  ? 95   THR A C   1 
ATOM   730  O O   . THR A 1 96  ? -0.972  26.103 36.329 1.00 5.07  ? 95   THR A O   1 
ATOM   731  C CB  . THR A 1 96  ? -3.903  25.236 35.415 1.00 8.55  ? 95   THR A CB  1 
ATOM   732  O OG1 . THR A 1 96  ? -5.092  24.561 35.852 1.00 14.10 ? 95   THR A OG1 1 
ATOM   733  C CG2 . THR A 1 96  ? -3.929  25.325 33.888 1.00 9.53  ? 95   THR A CG2 1 
ATOM   734  N N   . PHE A 1 97  ? -0.748  24.862 34.455 1.00 8.35  ? 96   PHE A N   1 
ATOM   735  C CA  . PHE A 1 97  ? 0.494   25.501 34.019 1.00 7.25  ? 96   PHE A CA  1 
ATOM   736  C C   . PHE A 1 97  ? 0.330   26.183 32.668 1.00 10.59 ? 96   PHE A C   1 
ATOM   737  O O   . PHE A 1 97  ? -0.569  25.844 31.894 1.00 10.18 ? 96   PHE A O   1 
ATOM   738  C CB  . PHE A 1 97  ? 1.600   24.454 33.845 1.00 6.43  ? 96   PHE A CB  1 
ATOM   739  C CG  . PHE A 1 97  ? 2.039   23.803 35.120 1.00 7.90  ? 96   PHE A CG  1 
ATOM   740  C CD1 . PHE A 1 97  ? 1.413   22.635 35.573 1.00 11.53 ? 96   PHE A CD1 1 
ATOM   741  C CD2 . PHE A 1 97  ? 3.084   24.346 35.867 1.00 11.97 ? 96   PHE A CD2 1 
ATOM   742  C CE1 . PHE A 1 97  ? 1.828   22.021 36.754 1.00 11.50 ? 96   PHE A CE1 1 
ATOM   743  C CE2 . PHE A 1 97  ? 3.507   23.741 37.051 1.00 16.65 ? 96   PHE A CE2 1 
ATOM   744  C CZ  . PHE A 1 97  ? 2.878   22.576 37.494 1.00 13.46 ? 96   PHE A CZ  1 
ATOM   745  N N   . ALA A 1 98  ? 1.232   27.122 32.394 1.00 12.32 ? 97   ALA A N   1 
ATOM   746  C CA  . ALA A 1 98  ? 1.308   27.831 31.116 1.00 8.94  ? 97   ALA A CA  1 
ATOM   747  C C   . ALA A 1 98  ? 2.799   27.855 30.817 1.00 13.53 ? 97   ALA A C   1 
ATOM   748  O O   . ALA A 1 98  ? 3.616   27.831 31.744 1.00 11.31 ? 97   ALA A O   1 
ATOM   749  C CB  . ALA A 1 98  ? 0.789   29.248 31.241 1.00 10.88 ? 97   ALA A CB  1 
ATOM   750  N N   . CYS A 1 99  ? 3.171   27.825 29.544 1.00 13.26 ? 98   CYS A N   1 
ATOM   751  C CA  . CYS A 1 99  ? 4.587   27.878 29.235 1.00 14.56 ? 98   CYS A CA  1 
ATOM   752  C C   . CYS A 1 99  ? 5.055   29.331 29.162 1.00 12.03 ? 98   CYS A C   1 
ATOM   753  O O   . CYS A 1 99  ? 4.268   30.239 28.879 1.00 11.05 ? 98   CYS A O   1 
ATOM   754  C CB  . CYS A 1 99  ? 4.914   27.114 27.948 1.00 17.69 ? 98   CYS A CB  1 
ATOM   755  S SG  . CYS A 1 99  ? 4.656   25.306 28.052 1.00 20.57 ? 98   CYS A SG  1 
ATOM   756  N N   . LYS A 1 100 ? 6.319   29.557 29.499 1.00 6.98  ? 99   LYS A N   1 
ATOM   757  C CA  . LYS A 1 100 ? 6.882   30.897 29.458 1.00 6.23  ? 99   LYS A CA  1 
ATOM   758  C C   . LYS A 1 100 ? 6.955   31.358 28.012 1.00 12.44 ? 99   LYS A C   1 
ATOM   759  O O   . LYS A 1 100 ? 6.721   30.573 27.079 1.00 12.06 ? 99   LYS A O   1 
ATOM   760  C CB  . LYS A 1 100 ? 8.280   30.919 30.086 1.00 13.62 ? 99   LYS A CB  1 
ATOM   761  C CG  . LYS A 1 100 ? 8.270   30.639 31.576 1.00 9.54  ? 99   LYS A CG  1 
ATOM   762  C CD  . LYS A 1 100 ? 9.651   30.632 32.173 1.00 18.50 ? 99   LYS A CD  1 
ATOM   763  C CE  . LYS A 1 100 ? 9.567   30.295 33.651 1.00 31.57 ? 99   LYS A CE  1 
ATOM   764  N NZ  . LYS A 1 100 ? 10.904  30.273 34.305 1.00 40.27 ? 99   LYS A NZ  1 
ATOM   765  N N   . THR A 1 101 ? 7.242   32.642 27.834 1.00 9.95  ? 100  THR A N   1 
ATOM   766  C CA  . THR A 1 101 ? 7.359   33.229 26.506 1.00 11.22 ? 100  THR A CA  1 
ATOM   767  C C   . THR A 1 101 ? 8.442   32.471 25.729 1.00 9.29  ? 100  THR A C   1 
ATOM   768  O O   . THR A 1 101 ? 9.518   32.186 26.267 1.00 13.60 ? 100  THR A O   1 
ATOM   769  C CB  . THR A 1 101 ? 7.703   34.739 26.621 1.00 13.97 ? 100  THR A CB  1 
ATOM   770  O OG1 . THR A 1 101 ? 6.586   35.439 27.198 1.00 14.90 ? 100  THR A OG1 1 
ATOM   771  C CG2 . THR A 1 101 ? 8.039   35.335 25.259 1.00 12.64 ? 100  THR A CG2 1 
ATOM   772  N N   . ASN A 1 102 ? 8.108   32.076 24.502 1.00 7.63  ? 101  ASN A N   1 
ATOM   773  C CA  . ASN A 1 102 ? 9.014   31.341 23.615 1.00 19.92 ? 101  ASN A CA  1 
ATOM   774  C C   . ASN A 1 102 ? 9.148   29.846 23.917 1.00 18.10 ? 101  ASN A C   1 
ATOM   775  O O   . ASN A 1 102 ? 10.073  29.182 23.438 1.00 13.82 ? 101  ASN A O   1 
ATOM   776  C CB  . ASN A 1 102 ? 10.398  32.010 23.541 1.00 19.38 ? 101  ASN A CB  1 
ATOM   777  C CG  . ASN A 1 102 ? 10.404  33.242 22.640 1.00 27.01 ? 101  ASN A CG  1 
ATOM   778  O OD1 . ASN A 1 102 ? 11.004  34.262 22.983 1.00 35.35 ? 101  ASN A OD1 1 
ATOM   779  N ND2 . ASN A 1 102 ? 9.765   33.134 21.475 1.00 35.30 ? 101  ASN A ND2 1 
ATOM   780  N N   . PHE A 1 103 ? 8.221   29.333 24.718 1.00 12.78 ? 102  PHE A N   1 
ATOM   781  C CA  . PHE A 1 103 ? 8.177   27.919 25.064 1.00 9.35  ? 102  PHE A CA  1 
ATOM   782  C C   . PHE A 1 103 ? 6.818   27.419 24.610 1.00 9.08  ? 102  PHE A C   1 
ATOM   783  O O   . PHE A 1 103 ? 5.849   28.178 24.610 1.00 11.64 ? 102  PHE A O   1 
ATOM   784  C CB  . PHE A 1 103 ? 8.341   27.708 26.577 1.00 10.56 ? 102  PHE A CB  1 
ATOM   785  C CG  . PHE A 1 103 ? 9.770   27.728 27.041 1.00 11.04 ? 102  PHE A CG  1 
ATOM   786  C CD1 . PHE A 1 103 ? 10.437  28.931 27.235 1.00 13.94 ? 102  PHE A CD1 1 
ATOM   787  C CD2 . PHE A 1 103 ? 10.449  26.540 27.285 1.00 11.60 ? 102  PHE A CD2 1 
ATOM   788  C CE1 . PHE A 1 103 ? 11.765  28.953 27.667 1.00 15.42 ? 102  PHE A CE1 1 
ATOM   789  C CE2 . PHE A 1 103 ? 11.771  26.550 27.717 1.00 11.39 ? 102  PHE A CE2 1 
ATOM   790  C CZ  . PHE A 1 103 ? 12.433  27.762 27.908 1.00 11.33 ? 102  PHE A CZ  1 
ATOM   791  N N   . SER A 1 104 ? 6.754   26.152 24.215 1.00 8.35  ? 103  SER A N   1 
ATOM   792  C CA  . SER A 1 104 ? 5.520   25.532 23.744 1.00 10.30 ? 103  SER A CA  1 
ATOM   793  C C   . SER A 1 104 ? 5.277   24.265 24.566 1.00 11.42 ? 103  SER A C   1 
ATOM   794  O O   . SER A 1 104 ? 6.207   23.513 24.850 1.00 9.08  ? 103  SER A O   1 
ATOM   795  C CB  . SER A 1 104 ? 5.638   25.186 22.259 1.00 7.47  ? 103  SER A CB  1 
ATOM   796  O OG  . SER A 1 104 ? 4.459   24.563 21.787 1.00 13.07 ? 103  SER A OG  1 
ATOM   797  N N   . MET A 1 105 ? 4.024   24.039 24.939 1.00 10.36 ? 104  MET A N   1 
ATOM   798  C CA  . MET A 1 105 ? 3.664   22.899 25.765 1.00 6.80  ? 104  MET A CA  1 
ATOM   799  C C   . MET A 1 105 ? 3.302   21.617 25.035 1.00 9.25  ? 104  MET A C   1 
ATOM   800  O O   . MET A 1 105 ? 2.722   21.640 23.950 1.00 10.67 ? 104  MET A O   1 
ATOM   801  C CB  . MET A 1 105 ? 2.498   23.289 26.681 1.00 9.37  ? 104  MET A CB  1 
ATOM   802  C CG  . MET A 1 105 ? 2.125   22.229 27.714 1.00 8.17  ? 104  MET A CG  1 
ATOM   803  S SD  . MET A 1 105 ? 0.709   22.733 28.735 1.00 14.13 ? 104  MET A SD  1 
ATOM   804  C CE  . MET A 1 105 ? 1.497   23.955 29.782 1.00 12.40 ? 104  MET A CE  1 
ATOM   805  N N   . ASN A 1 106 ? 3.661   20.500 25.659 1.00 10.84 ? 105  ASN A N   1 
ATOM   806  C CA  . ASN A 1 106 ? 3.330   19.159 25.186 1.00 10.65 ? 105  ASN A CA  1 
ATOM   807  C C   . ASN A 1 106 ? 2.646   18.520 26.394 1.00 7.07  ? 105  ASN A C   1 
ATOM   808  O O   . ASN A 1 106 ? 3.209   18.494 27.490 1.00 5.91  ? 105  ASN A O   1 
ATOM   809  C CB  . ASN A 1 106 ? 4.575   18.330 24.851 1.00 10.79 ? 105  ASN A CB  1 
ATOM   810  C CG  . ASN A 1 106 ? 5.320   18.858 23.656 1.00 13.33 ? 105  ASN A CG  1 
ATOM   811  O OD1 . ASN A 1 106 ? 4.717   19.286 22.677 1.00 11.50 ? 105  ASN A OD1 1 
ATOM   812  N ND2 . ASN A 1 106 ? 6.641   18.819 23.721 1.00 12.48 ? 105  ASN A ND2 1 
ATOM   813  N N   . GLY A 1 107 ? 1.427   18.043 26.212 1.00 8.14  ? 106  GLY A N   1 
ATOM   814  C CA  . GLY A 1 107 ? 0.730   17.417 27.317 1.00 8.00  ? 106  GLY A CA  1 
ATOM   815  C C   . GLY A 1 107 ? -0.382  18.250 27.908 1.00 13.84 ? 106  GLY A C   1 
ATOM   816  O O   . GLY A 1 107 ? -0.669  19.361 27.462 1.00 13.08 ? 106  GLY A O   1 
ATOM   817  N N   . ASN A 1 108 ? -1.016  17.682 28.920 1.00 15.72 ? 107  ASN A N   1 
ATOM   818  C CA  . ASN A 1 108 ? -2.126  18.308 29.610 1.00 16.38 ? 107  ASN A CA  1 
ATOM   819  C C   . ASN A 1 108 ? -1.626  19.399 30.516 1.00 9.79  ? 107  ASN A C   1 
ATOM   820  O O   . ASN A 1 108 ? -0.701  19.185 31.298 1.00 13.94 ? 107  ASN A O   1 
ATOM   821  C CB  . ASN A 1 108 ? -2.874  17.262 30.431 1.00 15.78 ? 107  ASN A CB  1 
ATOM   822  C CG  . ASN A 1 108 ? -3.820  16.440 29.590 1.00 34.25 ? 107  ASN A CG  1 
ATOM   823  O OD1 . ASN A 1 108 ? -4.933  16.884 29.298 1.00 47.05 ? 107  ASN A OD1 1 
ATOM   824  N ND2 . ASN A 1 108 ? -3.404  15.214 29.272 1.00 33.28 ? 107  ASN A ND2 1 
ATOM   825  N N   . LYS A 1 109 ? -2.266  20.561 30.434 1.00 9.05  ? 108  LYS A N   1 
ATOM   826  C CA  . LYS A 1 109 ? -1.879  21.701 31.240 1.00 11.19 ? 108  LYS A CA  1 
ATOM   827  C C   . LYS A 1 109 ? -2.207  21.577 32.727 1.00 9.46  ? 108  LYS A C   1 
ATOM   828  O O   . LYS A 1 109 ? -1.615  22.281 33.546 1.00 10.12 ? 108  LYS A O   1 
ATOM   829  C CB  . LYS A 1 109 ? -2.489  22.983 30.677 1.00 14.70 ? 108  LYS A CB  1 
ATOM   830  C CG  . LYS A 1 109 ? -4.004  23.003 30.676 1.00 15.49 ? 108  LYS A CG  1 
ATOM   831  C CD  . LYS A 1 109 ? -4.518  24.392 30.349 1.00 24.74 ? 108  LYS A CD  1 
ATOM   832  C CE  . LYS A 1 109 ? -6.033  24.404 30.246 1.00 28.06 ? 108  LYS A CE  1 
ATOM   833  N NZ  . LYS A 1 109 ? -6.546  25.799 30.115 1.00 47.82 ? 108  LYS A NZ  1 
ATOM   834  N N   . SER A 1 110 ? -3.136  20.689 33.076 1.00 12.57 ? 109  SER A N   1 
ATOM   835  C CA  . SER A 1 110 ? -3.523  20.518 34.478 1.00 12.11 ? 109  SER A CA  1 
ATOM   836  C C   . SER A 1 110 ? -3.304  19.113 35.013 1.00 8.48  ? 109  SER A C   1 
ATOM   837  O O   . SER A 1 110 ? -3.497  18.129 34.294 1.00 8.38  ? 109  SER A O   1 
ATOM   838  C CB  . SER A 1 110 ? -4.994  20.874 34.671 1.00 8.09  ? 109  SER A CB  1 
ATOM   839  O OG  . SER A 1 110 ? -5.260  22.211 34.288 1.00 12.44 ? 109  SER A OG  1 
ATOM   840  N N   . VAL A 1 111 ? -2.907  19.036 36.282 1.00 9.30  ? 110  VAL A N   1 
ATOM   841  C CA  . VAL A 1 111 ? -2.697  17.771 36.979 1.00 8.38  ? 110  VAL A CA  1 
ATOM   842  C C   . VAL A 1 111 ? -3.418  17.852 38.324 1.00 7.21  ? 110  VAL A C   1 
ATOM   843  O O   . VAL A 1 111 ? -3.674  18.949 38.838 1.00 6.53  ? 110  VAL A O   1 
ATOM   844  C CB  . VAL A 1 111 ? -1.201  17.441 37.200 1.00 6.39  ? 110  VAL A CB  1 
ATOM   845  C CG1 . VAL A 1 111 ? -0.573  16.983 35.889 1.00 14.26 ? 110  VAL A CG1 1 
ATOM   846  C CG2 . VAL A 1 111 ? -0.467  18.645 37.773 1.00 10.43 ? 110  VAL A CG2 1 
ATOM   847  N N   . TRP A 1 112 ? -3.761  16.689 38.867 1.00 11.38 ? 111  TRP A N   1 
ATOM   848  C CA  . TRP A 1 112 ? -4.498  16.585 40.127 1.00 10.21 ? 111  TRP A CA  1 
ATOM   849  C C   . TRP A 1 112 ? -3.720  15.834 41.192 1.00 10.39 ? 111  TRP A C   1 
ATOM   850  O O   . TRP A 1 112 ? -2.930  14.938 40.888 1.00 9.51  ? 111  TRP A O   1 
ATOM   851  C CB  . TRP A 1 112 ? -5.828  15.847 39.908 1.00 6.95  ? 111  TRP A CB  1 
ATOM   852  C CG  . TRP A 1 112 ? -6.890  16.675 39.269 1.00 8.61  ? 111  TRP A CG  1 
ATOM   853  C CD1 . TRP A 1 112 ? -7.944  17.280 39.896 1.00 7.24  ? 111  TRP A CD1 1 
ATOM   854  C CD2 . TRP A 1 112 ? -6.961  17.063 37.894 1.00 6.29  ? 111  TRP A CD2 1 
ATOM   855  N NE1 . TRP A 1 112 ? -8.657  18.036 38.996 1.00 7.03  ? 111  TRP A NE1 1 
ATOM   856  C CE2 . TRP A 1 112 ? -8.075  17.923 37.762 1.00 6.21  ? 111  TRP A CE2 1 
ATOM   857  C CE3 . TRP A 1 112 ? -6.186  16.775 36.764 1.00 7.67  ? 111  TRP A CE3 1 
ATOM   858  C CZ2 . TRP A 1 112 ? -8.430  18.505 36.540 1.00 6.97  ? 111  TRP A CZ2 1 
ATOM   859  C CZ3 . TRP A 1 112 ? -6.538  17.354 35.548 1.00 9.35  ? 111  TRP A CZ3 1 
ATOM   860  C CH2 . TRP A 1 112 ? -7.650  18.210 35.449 1.00 11.76 ? 111  TRP A CH2 1 
ATOM   861  N N   . CYS A 1 113 ? -3.944  16.224 42.439 1.00 8.18  ? 112  CYS A N   1 
ATOM   862  C CA  . CYS A 1 113 ? -3.310  15.577 43.572 1.00 10.91 ? 112  CYS A CA  1 
ATOM   863  C C   . CYS A 1 113 ? -4.111  14.300 43.859 1.00 9.46  ? 112  CYS A C   1 
ATOM   864  O O   . CYS A 1 113 ? -5.290  14.365 44.221 1.00 12.43 ? 112  CYS A O   1 
ATOM   865  C CB  . CYS A 1 113 ? -3.331  16.503 44.781 1.00 8.08  ? 112  CYS A CB  1 
ATOM   866  S SG  . CYS A 1 113 ? -2.457  15.775 46.197 1.00 14.69 ? 112  CYS A SG  1 
ATOM   867  N N   . GLN A 1 114 ? -3.482  13.147 43.657 1.00 9.97  ? 113  GLN A N   1 
ATOM   868  C CA  . GLN A 1 114 ? -4.138  11.856 43.860 1.00 12.11 ? 113  GLN A CA  1 
ATOM   869  C C   . GLN A 1 114 ? -4.034  11.341 45.299 1.00 12.35 ? 113  GLN A C   1 
ATOM   870  O O   . GLN A 1 114 ? -3.244  11.843 46.094 1.00 11.26 ? 113  GLN A O   1 
ATOM   871  C CB  . GLN A 1 114 ? -3.553  10.826 42.887 1.00 10.85 ? 113  GLN A CB  1 
ATOM   872  C CG  . GLN A 1 114 ? -3.653  11.242 41.423 1.00 10.25 ? 113  GLN A CG  1 
ATOM   873  C CD  . GLN A 1 114 ? -2.924  10.297 40.504 1.00 13.21 ? 113  GLN A CD  1 
ATOM   874  O OE1 . GLN A 1 114 ? -1.809  9.866  40.794 1.00 21.45 ? 113  GLN A OE1 1 
ATOM   875  N NE2 . GLN A 1 114 ? -3.543  9.968  39.390 1.00 12.15 ? 113  GLN A NE2 1 
ATOM   876  N N   . ALA A 1 115 ? -4.823  10.320 45.625 1.00 13.14 ? 114  ALA A N   1 
ATOM   877  C CA  . ALA A 1 115 ? -4.804  9.736  46.967 1.00 12.03 ? 114  ALA A CA  1 
ATOM   878  C C   . ALA A 1 115 ? -3.435  9.136  47.307 1.00 12.91 ? 114  ALA A C   1 
ATOM   879  O O   . ALA A 1 115 ? -3.047  9.073  48.472 1.00 16.46 ? 114  ALA A O   1 
ATOM   880  C CB  . ALA A 1 115 ? -5.879  8.677  47.085 1.00 12.27 ? 114  ALA A CB  1 
ATOM   881  N N   . ASN A 1 116 ? -2.705  8.695  46.288 1.00 11.27 ? 115  ASN A N   1 
ATOM   882  C CA  . ASN A 1 116 ? -1.380  8.110  46.496 1.00 13.22 ? 115  ASN A CA  1 
ATOM   883  C C   . ASN A 1 116 ? -0.302  9.185  46.668 1.00 11.62 ? 115  ASN A C   1 
ATOM   884  O O   . ASN A 1 116 ? 0.892   8.898  46.594 1.00 14.69 ? 115  ASN A O   1 
ATOM   885  C CB  . ASN A 1 116 ? -1.010  7.148  45.354 1.00 7.69  ? 115  ASN A CB  1 
ATOM   886  C CG  . ASN A 1 116 ? -0.818  7.859  44.015 1.00 14.77 ? 115  ASN A CG  1 
ATOM   887  O OD1 . ASN A 1 116 ? -1.032  9.067  43.895 1.00 12.04 ? 115  ASN A OD1 1 
ATOM   888  N ND2 . ASN A 1 116 ? -0.417  7.104  43.002 1.00 18.08 ? 115  ASN A ND2 1 
ATOM   889  N N   . ASN A 1 117 ? -0.737  10.424 46.867 1.00 7.90  ? 116  ASN A N   1 
ATOM   890  C CA  . ASN A 1 117 ? 0.161   11.552 47.085 1.00 11.27 ? 116  ASN A CA  1 
ATOM   891  C C   . ASN A 1 117 ? 1.069   11.900 45.911 1.00 18.01 ? 116  ASN A C   1 
ATOM   892  O O   . ASN A 1 117 ? 2.175   12.420 46.092 1.00 15.18 ? 116  ASN A O   1 
ATOM   893  C CB  . ASN A 1 117 ? 0.986   11.326 48.354 1.00 16.62 ? 116  ASN A CB  1 
ATOM   894  C CG  . ASN A 1 117 ? 0.112   11.092 49.573 1.00 19.66 ? 116  ASN A CG  1 
ATOM   895  O OD1 . ASN A 1 117 ? -0.496  12.022 50.090 1.00 18.54 ? 116  ASN A OD1 1 
ATOM   896  N ND2 . ASN A 1 117 ? 0.016   9.841  50.012 1.00 17.19 ? 116  ASN A ND2 1 
ATOM   897  N N   . MET A 1 118 ? 0.597   11.624 44.705 1.00 9.22  ? 117  MET A N   1 
ATOM   898  C CA  . MET A 1 118 ? 1.350   11.930 43.502 1.00 16.10 ? 117  MET A CA  1 
ATOM   899  C C   . MET A 1 118 ? 0.448   12.688 42.555 1.00 19.54 ? 117  MET A C   1 
ATOM   900  O O   . MET A 1 118 ? -0.775  12.599 42.654 1.00 12.47 ? 117  MET A O   1 
ATOM   901  C CB  . MET A 1 118 ? 1.826   10.649 42.820 1.00 19.09 ? 117  MET A CB  1 
ATOM   902  C CG  . MET A 1 118 ? 3.101   10.072 43.404 1.00 32.82 ? 117  MET A CG  1 
ATOM   903  S SD  . MET A 1 118 ? 3.601   8.603  42.503 1.00 45.54 ? 117  MET A SD  1 
ATOM   904  C CE  . MET A 1 118 ? 4.114   9.324  40.909 1.00 44.35 ? 117  MET A CE  1 
ATOM   905  N N   . TRP A 1 119 ? 1.055   13.465 41.665 1.00 15.30 ? 118  TRP A N   1 
ATOM   906  C CA  . TRP A 1 119 ? 0.310   14.225 40.669 1.00 11.21 ? 118  TRP A CA  1 
ATOM   907  C C   . TRP A 1 119 ? -0.072  13.292 39.514 1.00 8.21  ? 118  TRP A C   1 
ATOM   908  O O   . TRP A 1 119 ? 0.713   12.428 39.110 1.00 10.34 ? 118  TRP A O   1 
ATOM   909  C CB  . TRP A 1 119 ? 1.161   15.397 40.161 1.00 7.09  ? 118  TRP A CB  1 
ATOM   910  C CG  . TRP A 1 119 ? 1.355   16.448 41.194 1.00 8.84  ? 118  TRP A CG  1 
ATOM   911  C CD1 . TRP A 1 119 ? 2.471   16.654 41.961 1.00 9.74  ? 118  TRP A CD1 1 
ATOM   912  C CD2 . TRP A 1 119 ? 0.384   17.407 41.632 1.00 11.66 ? 118  TRP A CD2 1 
ATOM   913  N NE1 . TRP A 1 119 ? 2.248   17.670 42.852 1.00 10.13 ? 118  TRP A NE1 1 
ATOM   914  C CE2 . TRP A 1 119 ? 0.978   18.153 42.675 1.00 10.58 ? 118  TRP A CE2 1 
ATOM   915  C CE3 . TRP A 1 119 ? -0.931  17.706 41.250 1.00 10.72 ? 118  TRP A CE3 1 
ATOM   916  C CZ2 . TRP A 1 119 ? 0.299   19.183 43.345 1.00 7.42  ? 118  TRP A CZ2 1 
ATOM   917  C CZ3 . TRP A 1 119 ? -1.609  18.736 41.919 1.00 9.34  ? 118  TRP A CZ3 1 
ATOM   918  C CH2 . TRP A 1 119 ? -0.990  19.457 42.953 1.00 6.73  ? 118  TRP A CH2 1 
ATOM   919  N N   . GLY A 1 120 ? -1.289  13.444 39.007 1.00 6.84  ? 119  GLY A N   1 
ATOM   920  C CA  . GLY A 1 120 ? -1.740  12.605 37.911 1.00 6.97  ? 119  GLY A CA  1 
ATOM   921  C C   . GLY A 1 120 ? -3.037  13.129 37.313 1.00 7.18  ? 119  GLY A C   1 
ATOM   922  O O   . GLY A 1 120 ? -3.435  14.252 37.623 1.00 9.14  ? 119  GLY A O   1 
ATOM   923  N N   . PRO A 1 121 ? -3.749  12.327 36.503 1.00 8.68  ? 120  PRO A N   1 
ATOM   924  C CA  . PRO A 1 121 ? -3.391  10.952 36.128 1.00 10.72 ? 120  PRO A CA  1 
ATOM   925  C C   . PRO A 1 121 ? -2.313  10.849 35.037 1.00 12.84 ? 120  PRO A C   1 
ATOM   926  O O   . PRO A 1 121 ? -1.846  9.754  34.714 1.00 12.11 ? 120  PRO A O   1 
ATOM   927  C CB  . PRO A 1 121 ? -4.724  10.384 35.648 1.00 13.79 ? 120  PRO A CB  1 
ATOM   928  C CG  . PRO A 1 121 ? -5.345  11.566 34.954 1.00 13.20 ? 120  PRO A CG  1 
ATOM   929  C CD  . PRO A 1 121 ? -5.049  12.715 35.912 1.00 8.92  ? 120  PRO A CD  1 
ATOM   930  N N   . THR A 1 122 ? -1.929  11.988 34.469 1.00 11.73 ? 121  THR A N   1 
ATOM   931  C CA  . THR A 1 122 ? -0.918  12.012 33.417 1.00 8.94  ? 121  THR A CA  1 
ATOM   932  C C   . THR A 1 122 ? 0.399   12.545 33.960 1.00 9.72  ? 121  THR A C   1 
ATOM   933  O O   . THR A 1 122 ? 0.473   13.024 35.092 1.00 10.27 ? 121  THR A O   1 
ATOM   934  C CB  . THR A 1 122 ? -1.336  12.960 32.277 1.00 8.42  ? 121  THR A CB  1 
ATOM   935  O OG1 . THR A 1 122 ? -1.436  14.305 32.779 1.00 11.12 ? 121  THR A OG1 1 
ATOM   936  C CG2 . THR A 1 122 ? -2.675  12.542 31.686 1.00 8.24  ? 121  THR A CG2 1 
ATOM   937  N N   . ARG A 1 123 ? 1.434   12.476 33.134 1.00 9.82  ? 122  ARG A N   1 
ATOM   938  C CA  . ARG A 1 123 ? 2.730   13.031 33.494 1.00 10.21 ? 122  ARG A CA  1 
ATOM   939  C C   . ARG A 1 123 ? 2.536   14.551 33.485 1.00 7.62  ? 122  ARG A C   1 
ATOM   940  O O   . ARG A 1 123 ? 1.571   15.048 32.885 1.00 10.13 ? 122  ARG A O   1 
ATOM   941  C CB  . ARG A 1 123 ? 3.758   12.669 32.421 1.00 6.21  ? 122  ARG A CB  1 
ATOM   942  C CG  . ARG A 1 123 ? 4.091   11.203 32.366 1.00 8.89  ? 122  ARG A CG  1 
ATOM   943  C CD  . ARG A 1 123 ? 5.100   10.923 31.290 1.00 12.04 ? 122  ARG A CD  1 
ATOM   944  N NE  . ARG A 1 123 ? 5.846   9.705  31.574 1.00 16.81 ? 122  ARG A NE  1 
ATOM   945  C CZ  . ARG A 1 123 ? 5.770   8.597  30.848 1.00 21.17 ? 122  ARG A CZ  1 
ATOM   946  N NH1 . ARG A 1 123 ? 4.971   8.546  29.795 1.00 22.46 ? 122  ARG A NH1 1 
ATOM   947  N NH2 . ARG A 1 123 ? 6.540   7.561  31.143 1.00 23.63 ? 122  ARG A NH2 1 
ATOM   948  N N   . LEU A 1 124 ? 3.403   15.285 34.177 1.00 5.35  ? 123  LEU A N   1 
ATOM   949  C CA  . LEU A 1 124 ? 3.327   16.746 34.166 1.00 5.60  ? 123  LEU A CA  1 
ATOM   950  C C   . LEU A 1 124 ? 3.664   17.166 32.720 1.00 7.82  ? 123  LEU A C   1 
ATOM   951  O O   . LEU A 1 124 ? 4.405   16.471 32.019 1.00 9.96  ? 123  LEU A O   1 
ATOM   952  C CB  . LEU A 1 124 ? 4.353   17.366 35.128 1.00 7.77  ? 123  LEU A CB  1 
ATOM   953  C CG  . LEU A 1 124 ? 4.322   17.038 36.626 1.00 9.22  ? 123  LEU A CG  1 
ATOM   954  C CD1 . LEU A 1 124 ? 5.226   18.019 37.364 1.00 12.32 ? 123  LEU A CD1 1 
ATOM   955  C CD2 . LEU A 1 124 ? 2.922   17.127 37.172 1.00 20.61 ? 123  LEU A CD2 1 
ATOM   956  N N   . PRO A 1 125 ? 3.110   18.293 32.254 1.00 9.30  ? 124  PRO A N   1 
ATOM   957  C CA  . PRO A 1 125 ? 3.397   18.735 30.882 1.00 9.28  ? 124  PRO A CA  1 
ATOM   958  C C   . PRO A 1 125 ? 4.861   19.160 30.680 1.00 8.78  ? 124  PRO A C   1 
ATOM   959  O O   . PRO A 1 125 ? 5.574   19.438 31.645 1.00 5.65  ? 124  PRO A O   1 
ATOM   960  C CB  . PRO A 1 125 ? 2.447   19.924 30.711 1.00 11.95 ? 124  PRO A CB  1 
ATOM   961  C CG  . PRO A 1 125 ? 2.387   20.505 32.104 1.00 12.92 ? 124  PRO A CG  1 
ATOM   962  C CD  . PRO A 1 125 ? 2.242   19.259 32.957 1.00 5.16  ? 124  PRO A CD  1 
ATOM   963  N N   . THR A 1 126 ? 5.309   19.165 29.427 1.00 10.13 ? 125  THR A N   1 
ATOM   964  C CA  . THR A 1 126 ? 6.669   19.596 29.112 1.00 13.49 ? 125  THR A CA  1 
ATOM   965  C C   . THR A 1 126 ? 6.588   20.908 28.336 1.00 11.77 ? 125  THR A C   1 
ATOM   966  O O   . THR A 1 126 ? 5.748   21.046 27.443 1.00 12.85 ? 125  THR A O   1 
ATOM   967  C CB  . THR A 1 126 ? 7.435   18.578 28.226 1.00 7.45  ? 125  THR A CB  1 
ATOM   968  O OG1 . THR A 1 126 ? 7.422   17.285 28.849 1.00 9.98  ? 125  THR A OG1 1 
ATOM   969  C CG2 . THR A 1 126 ? 8.908   19.039 28.009 1.00 6.50  ? 125  THR A CG2 1 
ATOM   970  N N   . CYS A 1 127 ? 7.402   21.883 28.728 1.00 8.41  ? 126  CYS A N   1 
ATOM   971  C CA  . CYS A 1 127 ? 7.463   23.163 28.024 1.00 7.43  ? 126  CYS A CA  1 
ATOM   972  C C   . CYS A 1 127 ? 8.797   23.158 27.283 1.00 11.30 ? 126  CYS A C   1 
ATOM   973  O O   . CYS A 1 127 ? 9.847   22.998 27.898 1.00 11.04 ? 126  CYS A O   1 
ATOM   974  C CB  . CYS A 1 127 ? 7.388   24.328 29.008 1.00 10.79 ? 126  CYS A CB  1 
ATOM   975  S SG  . CYS A 1 127 ? 5.712   24.625 29.668 1.00 10.97 ? 126  CYS A SG  1 
ATOM   976  N N   . VAL A 1 128 ? 8.751   23.261 25.956 1.00 11.92 ? 127  VAL A N   1 
ATOM   977  C CA  . VAL A 1 128 ? 9.964   23.226 25.139 1.00 13.23 ? 127  VAL A CA  1 
ATOM   978  C C   . VAL A 1 128 ? 10.234  24.559 24.442 1.00 10.76 ? 127  VAL A C   1 
ATOM   979  O O   . VAL A 1 128 ? 9.331   25.154 23.857 1.00 9.91  ? 127  VAL A O   1 
ATOM   980  C CB  . VAL A 1 128 ? 9.874   22.102 24.058 1.00 10.47 ? 127  VAL A CB  1 
ATOM   981  C CG1 . VAL A 1 128 ? 11.202  21.962 23.304 1.00 10.06 ? 127  VAL A CG1 1 
ATOM   982  C CG2 . VAL A 1 128 ? 9.489   20.768 24.703 1.00 12.13 ? 127  VAL A CG2 1 
ATOM   983  N N   . SER A 1 129 ? 11.478  25.023 24.527 1.00 14.86 ? 128  SER A N   1 
ATOM   984  C CA  . SER A 1 129 ? 11.896  26.276 23.892 1.00 13.82 ? 128  SER A CA  1 
ATOM   985  C C   . SER A 1 129 ? 11.778  26.134 22.372 1.00 16.40 ? 128  SER A C   1 
ATOM   986  O O   . SER A 1 129 ? 12.270  25.152 21.797 1.00 16.47 ? 128  SER A O   1 
ATOM   987  C CB  . SER A 1 129 ? 13.345  26.583 24.277 1.00 17.77 ? 128  SER A CB  1 
ATOM   988  O OG  . SER A 1 129 ? 13.791  27.798 23.710 1.00 20.43 ? 128  SER A OG  1 
ATOM   989  N N   . ILE A 1 130 ? 11.097  27.085 21.730 1.00 16.86 ? 129  ILE A N   1 
ATOM   990  C CA  . ILE A 1 130 ? 10.917  27.054 20.270 1.00 28.10 ? 129  ILE A CA  1 
ATOM   991  C C   . ILE A 1 130 ? 11.587  28.221 19.549 1.00 25.22 ? 129  ILE A C   1 
ATOM   992  O O   . ILE A 1 130 ? 12.195  29.085 20.178 1.00 30.17 ? 129  ILE A O   1 
ATOM   993  C CB  . ILE A 1 130 ? 9.422   27.008 19.860 1.00 27.86 ? 129  ILE A CB  1 
ATOM   994  C CG1 . ILE A 1 130 ? 8.629   28.095 20.599 1.00 36.95 ? 129  ILE A CG1 1 
ATOM   995  C CG2 . ILE A 1 130 ? 8.855   25.603 20.078 1.00 26.69 ? 129  ILE A CG2 1 
ATOM   996  C CD1 . ILE A 1 130 ? 7.131   28.082 20.331 1.00 39.46 ? 129  ILE A CD1 1 
HETATM 997  C C1  . NAG B 2 .   ? 10.363  32.364 20.395 1.00 45.67 ? 1001 NAG A C1  1 
HETATM 998  C C2  . NAG B 2 .   ? 9.410   32.245 19.199 1.00 48.64 ? 1001 NAG A C2  1 
HETATM 999  C C3  . NAG B 2 .   ? 10.069  31.358 18.136 1.00 53.47 ? 1001 NAG A C3  1 
HETATM 1000 C C4  . NAG B 2 .   ? 11.463  31.885 17.772 1.00 55.32 ? 1001 NAG A C4  1 
HETATM 1001 C C5  . NAG B 2 .   ? 12.320  32.156 19.024 1.00 53.50 ? 1001 NAG A C5  1 
HETATM 1002 C C6  . NAG B 2 .   ? 13.598  32.912 18.694 1.00 51.46 ? 1001 NAG A C6  1 
HETATM 1003 C C7  . NAG B 2 .   ? 7.002   32.351 19.486 1.00 52.44 ? 1001 NAG A C7  1 
HETATM 1004 C C8  . NAG B 2 .   ? 5.734   31.637 19.943 1.00 50.88 ? 1001 NAG A C8  1 
HETATM 1005 N N2  . NAG B 2 .   ? 8.139   31.666 19.606 1.00 51.26 ? 1001 NAG A N2  1 
HETATM 1006 O O3  . NAG B 2 .   ? 9.257   31.307 16.967 1.00 55.58 ? 1001 NAG A O3  1 
HETATM 1007 O O4  . NAG B 2 .   ? 12.122  30.927 16.952 1.00 61.03 ? 1001 NAG A O4  1 
HETATM 1008 O O5  . NAG B 2 .   ? 11.595  32.965 19.977 1.00 50.39 ? 1001 NAG A O5  1 
HETATM 1009 O O6  . NAG B 2 .   ? 13.309  34.212 18.192 1.00 46.60 ? 1001 NAG A O6  1 
HETATM 1010 O O7  . NAG B 2 .   ? 6.955   33.506 19.043 1.00 49.14 ? 1001 NAG A O7  1 
HETATM 1011 C C1  . NAG C 2 .   ? -3.317  14.734 27.897 1.00 36.34 ? 1002 NAG A C1  1 
HETATM 1012 C C2  . NAG C 2 .   ? -4.642  14.107 27.440 1.00 36.19 ? 1002 NAG A C2  1 
HETATM 1013 C C3  . NAG C 2 .   ? -4.458  13.520 26.034 1.00 40.59 ? 1002 NAG A C3  1 
HETATM 1014 C C4  . NAG C 2 .   ? -3.952  14.607 25.091 1.00 41.58 ? 1002 NAG A C4  1 
HETATM 1015 C C5  . NAG C 2 .   ? -2.642  15.189 25.646 1.00 42.47 ? 1002 NAG A C5  1 
HETATM 1016 C C6  . NAG C 2 .   ? -2.037  16.286 24.776 1.00 39.46 ? 1002 NAG A C6  1 
HETATM 1017 C C7  . NAG C 2 .   ? -5.781  13.318 29.427 1.00 36.83 ? 1002 NAG A C7  1 
HETATM 1018 C C8  . NAG C 2 .   ? -6.118  12.148 30.338 1.00 29.66 ? 1002 NAG A C8  1 
HETATM 1019 N N2  . NAG C 2 .   ? -5.022  13.053 28.366 1.00 38.29 ? 1002 NAG A N2  1 
HETATM 1020 O O3  . NAG C 2 .   ? -5.683  12.992 25.545 1.00 39.28 ? 1002 NAG A O3  1 
HETATM 1021 O O4  . NAG C 2 .   ? -3.747  14.054 23.796 1.00 35.79 ? 1002 NAG A O4  1 
HETATM 1022 O O5  . NAG C 2 .   ? -2.871  15.741 26.970 1.00 41.36 ? 1002 NAG A O5  1 
HETATM 1023 O O6  . NAG C 2 .   ? -2.856  17.446 24.755 1.00 39.19 ? 1002 NAG A O6  1 
HETATM 1024 O O7  . NAG C 2 .   ? -6.217  14.443 29.669 1.00 38.01 ? 1002 NAG A O7  1 
HETATM 1025 O O   . HOH D 3 .   ? -12.582 16.770 15.143 1.00 21.90 ? 1003 HOH A O   1 
HETATM 1026 O O   . HOH D 3 .   ? -13.158 6.104  24.323 1.00 26.91 ? 1004 HOH A O   1 
HETATM 1027 O O   . HOH D 3 .   ? -14.962 16.698 11.189 1.00 21.97 ? 1005 HOH A O   1 
HETATM 1028 O O   . HOH D 3 .   ? -16.744 14.680 10.797 1.00 24.45 ? 1006 HOH A O   1 
HETATM 1029 O O   . HOH D 3 .   ? -19.140 15.810 11.483 1.00 26.49 ? 1007 HOH A O   1 
HETATM 1030 O O   . HOH D 3 .   ? -13.268 6.706  21.642 1.00 15.19 ? 1008 HOH A O   1 
HETATM 1031 O O   . HOH D 3 .   ? -21.168 5.410  28.865 1.00 31.55 ? 1009 HOH A O   1 
HETATM 1032 O O   . HOH D 3 .   ? -13.413 6.353  34.565 1.00 14.21 ? 1010 HOH A O   1 
HETATM 1033 O O   . HOH D 3 .   ? -22.477 9.740  42.146 1.00 48.32 ? 1011 HOH A O   1 
HETATM 1034 O O   . HOH D 3 .   ? -13.995 6.202  39.155 1.00 12.96 ? 1012 HOH A O   1 
HETATM 1035 O O   . HOH D 3 .   ? -13.687 4.979  36.856 1.00 10.82 ? 1013 HOH A O   1 
HETATM 1036 O O   . HOH D 3 .   ? -25.785 13.744 35.001 1.00 6.45  ? 1014 HOH A O   1 
HETATM 1037 O O   . HOH D 3 .   ? -25.212 15.444 23.231 1.00 30.12 ? 1015 HOH A O   1 
HETATM 1038 O O   . HOH D 3 .   ? -23.815 16.560 25.359 1.00 6.25  ? 1016 HOH A O   1 
HETATM 1039 O O   . HOH D 3 .   ? -15.182 16.057 42.507 1.00 22.38 ? 1017 HOH A O   1 
HETATM 1040 O O   . HOH D 3 .   ? -17.239 16.430 40.610 1.00 19.30 ? 1018 HOH A O   1 
HETATM 1041 O O   . HOH D 3 .   ? -17.326 17.658 37.960 1.00 20.18 ? 1019 HOH A O   1 
HETATM 1042 O O   . HOH D 3 .   ? -17.046 15.357 44.348 1.00 25.11 ? 1020 HOH A O   1 
HETATM 1043 O O   . HOH D 3 .   ? -11.222 17.193 42.118 1.00 16.22 ? 1021 HOH A O   1 
HETATM 1044 O O   . HOH D 3 .   ? -9.867  13.227 31.457 1.00 11.22 ? 1022 HOH A O   1 
HETATM 1045 O O   . HOH D 3 .   ? -7.687  12.354 32.745 1.00 18.25 ? 1023 HOH A O   1 
HETATM 1046 O O   . HOH D 3 .   ? -6.439  14.772 32.801 1.00 14.00 ? 1024 HOH A O   1 
HETATM 1047 O O   . HOH D 3 .   ? -3.744  15.495 33.628 1.00 12.56 ? 1025 HOH A O   1 
HETATM 1048 O O   . HOH D 3 .   ? -7.952  9.799  33.382 1.00 14.66 ? 1026 HOH A O   1 
HETATM 1049 O O   . HOH D 3 .   ? -9.755  8.501  23.877 1.00 24.70 ? 1027 HOH A O   1 
HETATM 1050 O O   . HOH D 3 .   ? -11.271 7.596  25.800 1.00 15.61 ? 1028 HOH A O   1 
HETATM 1051 O O   . HOH D 3 .   ? -11.225 6.050  29.621 1.00 12.54 ? 1029 HOH A O   1 
HETATM 1052 O O   . HOH D 3 .   ? -8.066  9.977  36.102 1.00 23.46 ? 1030 HOH A O   1 
HETATM 1053 O O   . HOH D 3 .   ? -8.830  4.846  30.272 1.00 15.76 ? 1031 HOH A O   1 
HETATM 1054 O O   . HOH D 3 .   ? -8.860  4.133  33.180 1.00 39.73 ? 1032 HOH A O   1 
HETATM 1055 O O   . HOH D 3 .   ? -10.403 5.998  32.243 1.00 35.97 ? 1033 HOH A O   1 
HETATM 1056 O O   . HOH D 3 .   ? -8.691  6.736  47.845 1.00 16.54 ? 1034 HOH A O   1 
HETATM 1057 O O   . HOH D 3 .   ? -6.756  6.274  50.078 1.00 16.63 ? 1035 HOH A O   1 
HETATM 1058 O O   . HOH D 3 .   ? -9.688  7.201  52.689 1.00 35.22 ? 1036 HOH A O   1 
HETATM 1059 O O   . HOH D 3 .   ? -6.264  15.369 51.341 1.00 7.39  ? 1037 HOH A O   1 
HETATM 1060 O O   . HOH D 3 .   ? 0.848   20.432 49.708 1.00 20.20 ? 1038 HOH A O   1 
HETATM 1061 O O   . HOH D 3 .   ? 4.224   13.419 41.821 1.00 11.93 ? 1039 HOH A O   1 
HETATM 1062 O O   . HOH D 3 .   ? -0.904  14.616 29.635 1.00 46.91 ? 1040 HOH A O   1 
HETATM 1063 O O   . HOH D 3 .   ? 0.898   16.293 30.550 1.00 16.08 ? 1041 HOH A O   1 
HETATM 1064 O O   . HOH D 3 .   ? 1.010   10.770 30.303 1.00 5.97  ? 1042 HOH A O   1 
HETATM 1065 O O   . HOH D 3 .   ? 8.377   18.475 35.134 1.00 14.13 ? 1043 HOH A O   1 
HETATM 1066 O O   . HOH D 3 .   ? 8.115   19.449 32.557 1.00 7.43  ? 1044 HOH A O   1 
HETATM 1067 O O   . HOH D 3 .   ? 9.206   21.139 30.841 1.00 8.09  ? 1045 HOH A O   1 
HETATM 1068 O O   . HOH D 3 .   ? 4.740   25.362 40.544 1.00 27.69 ? 1046 HOH A O   1 
HETATM 1069 O O   . HOH D 3 .   ? 5.779   27.216 38.665 1.00 23.40 ? 1047 HOH A O   1 
HETATM 1070 O O   . HOH D 3 .   ? 7.275   25.418 36.928 1.00 16.12 ? 1048 HOH A O   1 
HETATM 1071 O O   . HOH D 3 .   ? -4.210  18.911 26.266 1.00 33.03 ? 1049 HOH A O   1 
HETATM 1072 O O   . HOH D 3 .   ? -4.969  18.732 31.686 1.00 15.61 ? 1050 HOH A O   1 
HETATM 1073 O O   . HOH D 3 .   ? -3.835  20.891 28.029 1.00 17.68 ? 1051 HOH A O   1 
HETATM 1074 O O   . HOH D 3 .   ? -2.172  10.910 25.422 1.00 59.55 ? 1052 HOH A O   1 
HETATM 1075 O O   . HOH D 3 .   ? 0.314   18.200 23.601 1.00 22.05 ? 1053 HOH A O   1 
HETATM 1076 O O   . HOH D 3 .   ? -7.196  22.302 32.567 1.00 24.09 ? 1054 HOH A O   1 
HETATM 1077 O O   . HOH D 3 .   ? -11.483 16.854 37.578 1.00 27.01 ? 1055 HOH A O   1 
HETATM 1078 O O   . HOH D 3 .   ? -11.514 19.573 34.335 1.00 23.84 ? 1056 HOH A O   1 
HETATM 1079 O O   . HOH D 3 .   ? -12.054 19.123 31.111 1.00 21.23 ? 1057 HOH A O   1 
HETATM 1080 O O   . HOH D 3 .   ? -13.802 21.229 31.641 1.00 13.52 ? 1058 HOH A O   1 
HETATM 1081 O O   . HOH D 3 .   ? 11.646  27.037 34.590 1.00 34.15 ? 1059 HOH A O   1 
HETATM 1082 O O   . HOH D 3 .   ? -20.441 17.969 35.399 1.00 21.27 ? 1060 HOH A O   1 
HETATM 1083 O O   . HOH D 3 .   ? -9.247  18.103 22.122 1.00 35.52 ? 1061 HOH A O   1 
HETATM 1084 O O   . HOH D 3 .   ? -21.341 15.289 35.279 1.00 10.15 ? 1062 HOH A O   1 
HETATM 1085 O O   . HOH D 3 .   ? -24.252 8.630  34.407 1.00 2.74  ? 1063 HOH A O   1 
HETATM 1086 O O   . HOH D 3 .   ? -20.564 5.259  34.084 1.00 26.97 ? 1064 HOH A O   1 
HETATM 1087 O O   . HOH D 3 .   ? -22.057 6.785  35.547 1.00 24.14 ? 1065 HOH A O   1 
HETATM 1088 O O   . HOH D 3 .   ? -22.003 5.747  39.386 1.00 36.50 ? 1066 HOH A O   1 
HETATM 1089 O O   . HOH D 3 .   ? -21.069 3.192  35.780 1.00 37.73 ? 1067 HOH A O   1 
HETATM 1090 O O   . HOH D 3 .   ? -15.605 6.227  20.104 1.00 28.13 ? 1068 HOH A O   1 
HETATM 1091 O O   . HOH D 3 .   ? -11.265 19.373 38.762 1.00 43.98 ? 1069 HOH A O   1 
HETATM 1092 O O   . HOH D 3 .   ? -9.985  16.794 11.566 1.00 45.87 ? 1070 HOH A O   1 
HETATM 1093 O O   . HOH D 3 .   ? -14.329 18.283 17.202 1.00 26.74 ? 1071 HOH A O   1 
HETATM 1094 O O   . HOH D 3 .   ? 3.833   10.879 28.183 1.00 18.21 ? 1072 HOH A O   1 
HETATM 1095 O O   . HOH D 3 .   ? 3.894   7.260  33.774 1.00 49.49 ? 1073 HOH A O   1 
HETATM 1096 O O   . HOH D 3 .   ? 2.454   13.160 37.081 1.00 22.25 ? 1074 HOH A O   1 
HETATM 1097 O O   . HOH D 3 .   ? 5.017   12.780 37.411 1.00 20.04 ? 1075 HOH A O   1 
HETATM 1098 O O   . HOH D 3 .   ? -8.146  22.808 42.719 1.00 24.91 ? 1076 HOH A O   1 
HETATM 1099 O O   . HOH D 3 .   ? -11.319 5.020  45.297 1.00 27.32 ? 1077 HOH A O   1 
HETATM 1100 O O   . HOH D 3 .   ? -12.369 1.361  39.052 1.00 20.92 ? 1078 HOH A O   1 
HETATM 1101 O O   . HOH D 3 .   ? -11.878 4.710  40.232 1.00 36.08 ? 1079 HOH A O   1 
HETATM 1102 O O   . HOH D 3 .   ? -22.262 6.995  42.537 1.00 43.50 ? 1080 HOH A O   1 
HETATM 1103 O O   . HOH D 3 .   ? -11.418 3.621  37.761 1.00 24.84 ? 1081 HOH A O   1 
HETATM 1104 O O   . HOH D 3 .   ? -28.523 8.764  24.980 1.00 38.97 ? 1082 HOH A O   1 
HETATM 1105 O O   . HOH D 3 .   ? -25.009 13.933 19.881 1.00 35.59 ? 1083 HOH A O   1 
HETATM 1106 O O   . HOH D 3 .   ? -20.794 14.182 13.299 1.00 18.31 ? 1084 HOH A O   1 
HETATM 1107 O O   . HOH D 3 .   ? -14.036 4.878  43.218 1.00 29.74 ? 1085 HOH A O   1 
HETATM 1108 O O   . HOH D 3 .   ? -7.201  16.054 24.442 1.00 29.87 ? 1086 HOH A O   1 
HETATM 1109 O O   . HOH D 3 .   ? -0.686  21.009 25.112 1.00 32.08 ? 1087 HOH A O   1 
HETATM 1110 O O   . HOH D 3 .   ? -4.317  7.570  43.719 1.00 14.28 ? 1088 HOH A O   1 
HETATM 1111 O O   . HOH D 3 .   ? -1.135  5.943  39.342 1.00 53.09 ? 1089 HOH A O   1 
HETATM 1112 O O   . HOH D 3 .   ? -6.895  5.637  41.567 1.00 35.78 ? 1090 HOH A O   1 
HETATM 1113 O O   . HOH D 3 .   ? -3.168  6.440  41.306 1.00 35.83 ? 1091 HOH A O   1 
HETATM 1114 O O   . HOH D 3 .   ? 0.608   7.913  40.232 1.00 36.28 ? 1092 HOH A O   1 
HETATM 1115 O O   . HOH D 3 .   ? -9.597  4.320  35.815 1.00 43.36 ? 1093 HOH A O   1 
HETATM 1116 O O   . HOH D 3 .   ? -20.814 3.281  39.832 1.00 30.13 ? 1094 HOH A O   1 
HETATM 1117 O O   . HOH D 3 .   ? 4.551   13.217 44.652 1.00 31.44 ? 1095 HOH A O   1 
HETATM 1118 O O   . HOH D 3 .   ? 0.857   9.347  37.258 1.00 35.85 ? 1096 HOH A O   1 
HETATM 1119 O O   . HOH D 3 .   ? 4.501   13.375 48.135 1.00 51.87 ? 1097 HOH A O   1 
HETATM 1120 O O   . HOH D 3 .   ? 4.524   10.774 47.061 1.00 52.38 ? 1098 HOH A O   1 
HETATM 1121 O O   . HOH D 3 .   ? 7.141   10.052 46.491 1.00 31.38 ? 1099 HOH A O   1 
HETATM 1122 O O   . HOH D 3 .   ? 4.493   9.613  49.465 1.00 30.94 ? 1100 HOH A O   1 
HETATM 1123 O O   . HOH D 3 .   ? 1.854   32.014 28.699 1.00 45.35 ? 1101 HOH A O   1 
HETATM 1124 O O   . HOH D 3 .   ? 3.150   15.147 50.454 1.00 46.19 ? 1102 HOH A O   1 
HETATM 1125 O O   . HOH D 3 .   ? 14.554  23.059 22.769 1.00 33.61 ? 1103 HOH A O   1 
HETATM 1126 O O   . HOH D 3 .   ? -8.838  7.134  58.745 1.00 25.39 ? 1104 HOH A O   1 
HETATM 1127 O O   . HOH D 3 .   ? -12.913 8.124  59.900 1.00 44.32 ? 1105 HOH A O   1 
HETATM 1128 O O   . HOH D 3 .   ? -13.255 10.577 58.060 1.00 25.38 ? 1106 HOH A O   1 
HETATM 1129 O O   . HOH D 3 .   ? -12.802 11.588 55.505 1.00 41.19 ? 1107 HOH A O   1 
HETATM 1130 O O   . HOH D 3 .   ? -9.509  4.819  41.482 1.00 43.52 ? 1108 HOH A O   1 
HETATM 1131 O O   . HOH D 3 .   ? -11.861 0.492  41.634 1.00 38.61 ? 1109 HOH A O   1 
HETATM 1132 O O   . HOH D 3 .   ? -24.048 18.277 40.009 1.00 25.04 ? 1110 HOH A O   1 
HETATM 1133 O O   . HOH D 3 .   ? -4.946  24.074 43.958 1.00 23.99 ? 1111 HOH A O   1 
HETATM 1134 O O   . HOH D 3 .   ? -8.534  23.704 45.180 1.00 41.00 ? 1112 HOH A O   1 
HETATM 1135 O O   . HOH D 3 .   ? -15.751 25.535 26.807 1.00 38.43 ? 1113 HOH A O   1 
HETATM 1136 O O   . HOH D 3 .   ? -23.989 15.855 35.640 1.00 14.82 ? 1114 HOH A O   1 
HETATM 1137 O O   . HOH D 3 .   ? -23.573 15.976 38.351 1.00 31.18 ? 1115 HOH A O   1 
HETATM 1138 O O   . HOH D 3 .   ? -26.877 14.250 17.704 1.00 53.23 ? 1116 HOH A O   1 
HETATM 1139 O O   . HOH D 3 .   ? -22.197 13.768 40.488 1.00 37.31 ? 1117 HOH A O   1 
HETATM 1140 O O   . HOH D 3 .   ? -8.273  8.952  20.769 1.00 54.41 ? 1118 HOH A O   1 
HETATM 1141 O O   . HOH D 3 .   ? -3.403  8.890  31.659 1.00 33.75 ? 1119 HOH A O   1 
HETATM 1142 O O   . HOH D 3 .   ? -0.822  8.959  31.182 1.00 34.37 ? 1120 HOH A O   1 
HETATM 1143 O O   . HOH D 3 .   ? -3.197  6.724  29.913 1.00 40.54 ? 1121 HOH A O   1 
HETATM 1144 O O   . HOH D 3 .   ? -6.302  5.354  30.919 1.00 28.00 ? 1122 HOH A O   1 
HETATM 1145 O O   . HOH D 3 .   ? -4.011  4.478  32.068 1.00 42.59 ? 1123 HOH A O   1 
HETATM 1146 O O   . HOH D 3 .   ? -4.411  6.551  33.805 1.00 49.09 ? 1124 HOH A O   1 
HETATM 1147 O O   . HOH D 3 .   ? -10.486 10.481 54.440 1.00 15.80 ? 1125 HOH A O   1 
HETATM 1148 O O   . HOH D 3 .   ? -10.674 7.667  55.303 1.00 47.86 ? 1126 HOH A O   1 
HETATM 1149 O O   . HOH D 3 .   ? 9.144   20.536 44.104 1.00 34.51 ? 1127 HOH A O   1 
HETATM 1150 O O   . HOH D 3 .   ? -5.925  8.535  32.404 1.00 27.00 ? 1128 HOH A O   1 
HETATM 1151 O O   . HOH D 3 .   ? -2.688  7.378  35.675 1.00 35.52 ? 1129 HOH A O   1 
HETATM 1152 O O   . HOH D 3 .   ? 15.117  36.236 27.785 1.00 38.79 ? 1130 HOH A O   1 
HETATM 1153 O O   . HOH D 3 .   ? -1.217  30.743 44.631 1.00 29.79 ? 1131 HOH A O   1 
HETATM 1154 O O   . HOH D 3 .   ? -7.112  8.887  23.458 1.00 38.27 ? 1132 HOH A O   1 
HETATM 1155 O O   . HOH D 3 .   ? -3.810  10.545 28.568 1.00 25.61 ? 1133 HOH A O   1 
HETATM 1156 O O   . HOH D 3 .   ? -10.955 9.656  14.837 1.00 47.17 ? 1134 HOH A O   1 
HETATM 1157 O O   . HOH D 3 .   ? -9.600  7.284  14.607 1.00 37.33 ? 1135 HOH A O   1 
HETATM 1158 O O   . HOH D 3 .   ? -1.277  11.815 28.727 1.00 28.73 ? 1136 HOH A O   1 
HETATM 1159 O O   . HOH D 3 .   ? 13.971  23.296 25.766 1.00 5.15  ? 1137 HOH A O   1 
HETATM 1160 O O   . HOH D 3 .   ? 16.488  22.340 27.229 1.00 22.48 ? 1138 HOH A O   1 
HETATM 1161 O O   . HOH D 3 .   ? 13.898  21.339 20.344 1.00 10.51 ? 1139 HOH A O   1 
HETATM 1162 O O   . HOH D 3 .   ? 15.377  19.815 15.659 1.00 21.80 ? 1140 HOH A O   1 
HETATM 1163 O O   . HOH D 3 .   ? 13.035  19.103 14.264 1.00 13.84 ? 1141 HOH A O   1 
HETATM 1164 O O   . HOH D 3 .   ? 12.657  23.657 19.421 1.00 18.28 ? 1142 HOH A O   1 
HETATM 1165 O O   . HOH D 3 .   ? -7.365  17.257 53.660 1.00 21.89 ? 1143 HOH A O   1 
HETATM 1166 O O   . HOH D 3 .   ? 5.520   32.875 23.250 1.00 28.46 ? 1144 HOH A O   1 
HETATM 1167 O O   . HOH D 3 .   ? 2.108   26.458 24.471 1.00 24.49 ? 1145 HOH A O   1 
HETATM 1168 O O   . HOH D 3 .   ? 0.992   27.520 27.662 1.00 27.71 ? 1146 HOH A O   1 
HETATM 1169 O O   . HOH D 3 .   ? -1.695  26.736 29.522 1.00 25.29 ? 1147 HOH A O   1 
HETATM 1170 O O   . HOH D 3 .   ? 4.468   31.252 25.240 1.00 36.00 ? 1148 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   0   0   GLU GLU A . n 
A 1 2   ALA 2   1   1   ALA ALA A . n 
A 1 3   SER 3   2   2   SER SER A . n 
A 1 4   CYS 4   3   3   CYS CYS A . n 
A 1 5   GLY 5   4   4   GLY GLY A . n 
A 1 6   SER 6   5   5   SER SER A . n 
A 1 7   PRO 7   6   6   PRO PRO A . n 
A 1 8   PRO 8   7   7   PRO PRO A . n 
A 1 9   PRO 9   8   8   PRO PRO A . n 
A 1 10  ILE 10  9   9   ILE ILE A . n 
A 1 11  LEU 11  10  10  LEU LEU A . n 
A 1 12  ASN 12  11  11  ASN ASN A . n 
A 1 13  GLY 13  12  12  GLY GLY A . n 
A 1 14  ARG 14  13  13  ARG ARG A . n 
A 1 15  ILE 15  14  14  ILE ILE A . n 
A 1 16  SER 16  15  15  SER SER A . n 
A 1 17  TYR 17  16  16  TYR TYR A . n 
A 1 18  TYR 18  17  17  TYR TYR A . n 
A 1 19  SER 19  18  18  SER SER A . n 
A 1 20  THR 20  19  19  THR THR A . n 
A 1 21  PRO 21  20  20  PRO PRO A . n 
A 1 22  ILE 22  21  21  ILE ILE A . n 
A 1 23  ALA 23  22  22  ALA ALA A . n 
A 1 24  VAL 24  23  23  VAL VAL A . n 
A 1 25  GLY 25  24  24  GLY GLY A . n 
A 1 26  THR 26  25  25  THR THR A . n 
A 1 27  VAL 27  26  26  VAL VAL A . n 
A 1 28  ILE 28  27  27  ILE ILE A . n 
A 1 29  ARG 29  28  28  ARG ARG A . n 
A 1 30  TYR 30  29  29  TYR TYR A . n 
A 1 31  SER 31  30  30  SER SER A . n 
A 1 32  CYS 32  31  31  CYS CYS A . n 
A 1 33  SER 33  32  32  SER SER A . n 
A 1 34  GLY 34  33  33  GLY GLY A . n 
A 1 35  THR 35  34  34  THR THR A . n 
A 1 36  PHE 36  35  35  PHE PHE A . n 
A 1 37  ARG 37  36  36  ARG ARG A . n 
A 1 38  LEU 38  37  37  LEU LEU A . n 
A 1 39  ILE 39  38  38  ILE ILE A . n 
A 1 40  GLY 40  39  39  GLY GLY A . n 
A 1 41  GLU 41  40  40  GLU GLU A . n 
A 1 42  LYS 42  41  41  LYS LYS A . n 
A 1 43  SER 43  42  42  SER SER A . n 
A 1 44  LEU 44  43  43  LEU LEU A . n 
A 1 45  LEU 45  44  44  LEU LEU A . n 
A 1 46  CYS 46  45  45  CYS CYS A . n 
A 1 47  ILE 47  46  46  ILE ILE A . n 
A 1 48  THR 48  47  47  THR THR A . n 
A 1 49  LYS 49  48  48  LYS LYS A . n 
A 1 50  ASP 50  49  49  ASP ASP A . n 
A 1 51  LYS 51  50  50  LYS LYS A . n 
A 1 52  VAL 52  51  51  VAL VAL A . n 
A 1 53  ASP 53  52  52  ASP ASP A . n 
A 1 54  GLY 54  53  53  GLY GLY A . n 
A 1 55  THR 55  54  54  THR THR A . n 
A 1 56  TRP 56  55  55  TRP TRP A . n 
A 1 57  ASP 57  56  56  ASP ASP A . n 
A 1 58  LYS 58  57  57  LYS LYS A . n 
A 1 59  PRO 59  58  58  PRO PRO A . n 
A 1 60  ALA 60  59  59  ALA ALA A . n 
A 1 61  PRO 61  60  60  PRO PRO A . n 
A 1 62  LYS 62  61  61  LYS LYS A . n 
A 1 63  CYS 63  62  62  CYS CYS A . n 
A 1 64  GLU 64  63  63  GLU GLU A . n 
A 1 65  TYR 65  64  64  TYR TYR A . n 
A 1 66  PHE 66  65  65  PHE PHE A . n 
A 1 67  ASN 67  66  66  ASN ASN A . n 
A 1 68  LYS 68  67  67  LYS LYS A . n 
A 1 69  TYR 69  68  68  TYR TYR A . n 
A 1 70  SER 70  69  69  SER SER A . n 
A 1 71  SER 71  70  70  SER SER A . n 
A 1 72  CYS 72  71  71  CYS CYS A . n 
A 1 73  PRO 73  72  72  PRO PRO A . n 
A 1 74  GLU 74  73  73  GLU GLU A . n 
A 1 75  PRO 75  74  74  PRO PRO A . n 
A 1 76  ILE 76  75  75  ILE ILE A . n 
A 1 77  VAL 77  76  76  VAL VAL A . n 
A 1 78  PRO 78  77  77  PRO PRO A . n 
A 1 79  GLY 79  78  78  GLY GLY A . n 
A 1 80  GLY 80  79  79  GLY GLY A . n 
A 1 81  TYR 81  80  80  TYR TYR A . n 
A 1 82  LYS 82  81  81  LYS LYS A . n 
A 1 83  ILE 83  82  82  ILE ILE A . n 
A 1 84  ARG 84  83  83  ARG ARG A . n 
A 1 85  GLY 85  84  84  GLY GLY A . n 
A 1 86  SER 86  85  85  SER SER A . n 
A 1 87  THR 87  86  86  THR THR A . n 
A 1 88  PRO 88  87  87  PRO PRO A . n 
A 1 89  TYR 89  88  88  TYR TYR A . n 
A 1 90  ARG 90  89  89  ARG ARG A . n 
A 1 91  HIS 91  90  90  HIS HIS A . n 
A 1 92  GLY 92  91  91  GLY GLY A . n 
A 1 93  ASP 93  92  92  ASP ASP A . n 
A 1 94  SER 94  93  93  SER SER A . n 
A 1 95  VAL 95  94  94  VAL VAL A . n 
A 1 96  THR 96  95  95  THR THR A . n 
A 1 97  PHE 97  96  96  PHE PHE A . n 
A 1 98  ALA 98  97  97  ALA ALA A . n 
A 1 99  CYS 99  98  98  CYS CYS A . n 
A 1 100 LYS 100 99  99  LYS LYS A . n 
A 1 101 THR 101 100 100 THR THR A . n 
A 1 102 ASN 102 101 101 ASN ASN A . n 
A 1 103 PHE 103 102 102 PHE PHE A . n 
A 1 104 SER 104 103 103 SER SER A . n 
A 1 105 MET 105 104 104 MET MET A . n 
A 1 106 ASN 106 105 105 ASN ASN A . n 
A 1 107 GLY 107 106 106 GLY GLY A . n 
A 1 108 ASN 108 107 107 ASN ASN A . n 
A 1 109 LYS 109 108 108 LYS LYS A . n 
A 1 110 SER 110 109 109 SER SER A . n 
A 1 111 VAL 111 110 110 VAL VAL A . n 
A 1 112 TRP 112 111 111 TRP TRP A . n 
A 1 113 CYS 113 112 112 CYS CYS A . n 
A 1 114 GLN 114 113 113 GLN GLN A . n 
A 1 115 ALA 115 114 114 ALA ALA A . n 
A 1 116 ASN 116 115 115 ASN ASN A . n 
A 1 117 ASN 117 116 116 ASN ASN A . n 
A 1 118 MET 118 117 117 MET MET A . n 
A 1 119 TRP 119 118 118 TRP TRP A . n 
A 1 120 GLY 120 119 119 GLY GLY A . n 
A 1 121 PRO 121 120 120 PRO PRO A . n 
A 1 122 THR 122 121 121 THR THR A . n 
A 1 123 ARG 123 122 122 ARG ARG A . n 
A 1 124 LEU 124 123 123 LEU LEU A . n 
A 1 125 PRO 125 124 124 PRO PRO A . n 
A 1 126 THR 126 125 125 THR THR A . n 
A 1 127 CYS 127 126 126 CYS CYS A . n 
A 1 128 VAL 128 127 127 VAL VAL A . n 
A 1 129 SER 129 128 128 SER SER A . n 
A 1 130 ILE 130 129 129 ILE ILE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   1001 1001 NAG NAG A . 
C 2 NAG 1   1002 1002 NAG NAG A . 
D 3 HOH 1   1003 1    HOH HOH A . 
D 3 HOH 2   1004 2    HOH HOH A . 
D 3 HOH 3   1005 3    HOH HOH A . 
D 3 HOH 4   1006 4    HOH HOH A . 
D 3 HOH 5   1007 5    HOH HOH A . 
D 3 HOH 6   1008 6    HOH HOH A . 
D 3 HOH 7   1009 7    HOH HOH A . 
D 3 HOH 8   1010 8    HOH HOH A . 
D 3 HOH 9   1011 9    HOH HOH A . 
D 3 HOH 10  1012 10   HOH HOH A . 
D 3 HOH 11  1013 11   HOH HOH A . 
D 3 HOH 12  1014 12   HOH HOH A . 
D 3 HOH 13  1015 13   HOH HOH A . 
D 3 HOH 14  1016 14   HOH HOH A . 
D 3 HOH 15  1017 15   HOH HOH A . 
D 3 HOH 16  1018 16   HOH HOH A . 
D 3 HOH 17  1019 17   HOH HOH A . 
D 3 HOH 18  1020 18   HOH HOH A . 
D 3 HOH 19  1021 19   HOH HOH A . 
D 3 HOH 20  1022 20   HOH HOH A . 
D 3 HOH 21  1023 21   HOH HOH A . 
D 3 HOH 22  1024 22   HOH HOH A . 
D 3 HOH 23  1025 23   HOH HOH A . 
D 3 HOH 24  1026 24   HOH HOH A . 
D 3 HOH 25  1027 25   HOH HOH A . 
D 3 HOH 26  1028 26   HOH HOH A . 
D 3 HOH 27  1029 27   HOH HOH A . 
D 3 HOH 28  1030 28   HOH HOH A . 
D 3 HOH 29  1031 29   HOH HOH A . 
D 3 HOH 30  1032 30   HOH HOH A . 
D 3 HOH 31  1033 31   HOH HOH A . 
D 3 HOH 32  1034 32   HOH HOH A . 
D 3 HOH 33  1035 33   HOH HOH A . 
D 3 HOH 34  1036 34   HOH HOH A . 
D 3 HOH 35  1037 35   HOH HOH A . 
D 3 HOH 36  1038 36   HOH HOH A . 
D 3 HOH 37  1039 37   HOH HOH A . 
D 3 HOH 38  1040 38   HOH HOH A . 
D 3 HOH 39  1041 39   HOH HOH A . 
D 3 HOH 40  1042 40   HOH HOH A . 
D 3 HOH 41  1043 41   HOH HOH A . 
D 3 HOH 42  1044 42   HOH HOH A . 
D 3 HOH 43  1045 43   HOH HOH A . 
D 3 HOH 44  1046 44   HOH HOH A . 
D 3 HOH 45  1047 45   HOH HOH A . 
D 3 HOH 46  1048 46   HOH HOH A . 
D 3 HOH 47  1049 47   HOH HOH A . 
D 3 HOH 48  1050 48   HOH HOH A . 
D 3 HOH 49  1051 49   HOH HOH A . 
D 3 HOH 50  1052 50   HOH HOH A . 
D 3 HOH 51  1053 51   HOH HOH A . 
D 3 HOH 52  1054 52   HOH HOH A . 
D 3 HOH 53  1055 53   HOH HOH A . 
D 3 HOH 54  1056 54   HOH HOH A . 
D 3 HOH 55  1057 55   HOH HOH A . 
D 3 HOH 56  1058 56   HOH HOH A . 
D 3 HOH 57  1059 57   HOH HOH A . 
D 3 HOH 58  1060 58   HOH HOH A . 
D 3 HOH 59  1061 59   HOH HOH A . 
D 3 HOH 60  1062 60   HOH HOH A . 
D 3 HOH 61  1063 61   HOH HOH A . 
D 3 HOH 62  1064 62   HOH HOH A . 
D 3 HOH 63  1065 63   HOH HOH A . 
D 3 HOH 64  1066 64   HOH HOH A . 
D 3 HOH 65  1067 65   HOH HOH A . 
D 3 HOH 66  1068 66   HOH HOH A . 
D 3 HOH 67  1069 67   HOH HOH A . 
D 3 HOH 68  1070 68   HOH HOH A . 
D 3 HOH 69  1071 69   HOH HOH A . 
D 3 HOH 70  1072 70   HOH HOH A . 
D 3 HOH 71  1073 71   HOH HOH A . 
D 3 HOH 72  1074 72   HOH HOH A . 
D 3 HOH 73  1075 73   HOH HOH A . 
D 3 HOH 74  1076 74   HOH HOH A . 
D 3 HOH 75  1077 75   HOH HOH A . 
D 3 HOH 76  1078 76   HOH HOH A . 
D 3 HOH 77  1079 77   HOH HOH A . 
D 3 HOH 78  1080 78   HOH HOH A . 
D 3 HOH 79  1081 79   HOH HOH A . 
D 3 HOH 80  1082 80   HOH HOH A . 
D 3 HOH 81  1083 81   HOH HOH A . 
D 3 HOH 82  1084 82   HOH HOH A . 
D 3 HOH 83  1085 83   HOH HOH A . 
D 3 HOH 84  1086 84   HOH HOH A . 
D 3 HOH 85  1087 85   HOH HOH A . 
D 3 HOH 86  1088 86   HOH HOH A . 
D 3 HOH 87  1089 87   HOH HOH A . 
D 3 HOH 88  1090 88   HOH HOH A . 
D 3 HOH 89  1091 89   HOH HOH A . 
D 3 HOH 90  1092 90   HOH HOH A . 
D 3 HOH 91  1093 91   HOH HOH A . 
D 3 HOH 92  1094 92   HOH HOH A . 
D 3 HOH 93  1095 93   HOH HOH A . 
D 3 HOH 94  1096 94   HOH HOH A . 
D 3 HOH 95  1097 95   HOH HOH A . 
D 3 HOH 96  1098 96   HOH HOH A . 
D 3 HOH 97  1099 97   HOH HOH A . 
D 3 HOH 98  1100 98   HOH HOH A . 
D 3 HOH 99  1101 99   HOH HOH A . 
D 3 HOH 100 1102 100  HOH HOH A . 
D 3 HOH 101 1103 101  HOH HOH A . 
D 3 HOH 102 1104 102  HOH HOH A . 
D 3 HOH 103 1105 103  HOH HOH A . 
D 3 HOH 104 1106 104  HOH HOH A . 
D 3 HOH 105 1107 105  HOH HOH A . 
D 3 HOH 106 1108 106  HOH HOH A . 
D 3 HOH 107 1109 107  HOH HOH A . 
D 3 HOH 108 1110 109  HOH HOH A . 
D 3 HOH 109 1111 111  HOH HOH A . 
D 3 HOH 110 1112 112  HOH HOH A . 
D 3 HOH 111 1113 113  HOH HOH A . 
D 3 HOH 112 1114 114  HOH HOH A . 
D 3 HOH 113 1115 115  HOH HOH A . 
D 3 HOH 114 1116 116  HOH HOH A . 
D 3 HOH 115 1117 117  HOH HOH A . 
D 3 HOH 116 1118 118  HOH HOH A . 
D 3 HOH 117 1119 119  HOH HOH A . 
D 3 HOH 118 1120 120  HOH HOH A . 
D 3 HOH 119 1121 121  HOH HOH A . 
D 3 HOH 120 1122 122  HOH HOH A . 
D 3 HOH 121 1123 123  HOH HOH A . 
D 3 HOH 122 1124 124  HOH HOH A . 
D 3 HOH 123 1125 125  HOH HOH A . 
D 3 HOH 124 1126 126  HOH HOH A . 
D 3 HOH 125 1127 127  HOH HOH A . 
D 3 HOH 126 1128 129  HOH HOH A . 
D 3 HOH 127 1129 130  HOH HOH A . 
D 3 HOH 128 1130 131  HOH HOH A . 
D 3 HOH 129 1131 132  HOH HOH A . 
D 3 HOH 130 1132 133  HOH HOH A . 
D 3 HOH 131 1133 134  HOH HOH A . 
D 3 HOH 132 1134 135  HOH HOH A . 
D 3 HOH 133 1135 136  HOH HOH A . 
D 3 HOH 134 1136 137  HOH HOH A . 
D 3 HOH 135 1137 138  HOH HOH A . 
D 3 HOH 136 1138 139  HOH HOH A . 
D 3 HOH 137 1139 140  HOH HOH A . 
D 3 HOH 138 1140 141  HOH HOH A . 
D 3 HOH 139 1141 142  HOH HOH A . 
D 3 HOH 140 1142 143  HOH HOH A . 
D 3 HOH 141 1143 144  HOH HOH A . 
D 3 HOH 142 1144 145  HOH HOH A . 
D 3 HOH 143 1145 146  HOH HOH A . 
D 3 HOH 144 1146 147  HOH HOH A . 
D 3 HOH 145 1147 148  HOH HOH A . 
D 3 HOH 146 1148 149  HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 102 A ASN 101 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 108 A ASN 107 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-07-05 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Database references'       
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp                 
2 4 'Structure model' entity                    
3 4 'Structure model' pdbx_chem_comp_identifier 
4 4 'Structure model' pdbx_entity_nonpoly       
5 4 'Structure model' struct_conn               
6 4 'Structure model' struct_ref_seq_dif        
7 4 'Structure model' struct_site               
8 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_chem_comp.name'                     
2 4 'Structure model' '_chem_comp.type'                     
3 4 'Structure model' '_entity.pdbx_description'            
4 4 'Structure model' '_pdbx_entity_nonpoly.name'           
5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6 4 'Structure model' '_struct_conn.pdbx_role'              
7 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
X-PLOR    refinement       . ? 4 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
3 water                                    HOH 
#