data_1M12
# 
_entry.id   1M12 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1M12         
RCSB  RCSB016465   
WWPDB D_1000016465 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1NKL 
_pdbx_database_related.details        'Another protein with the Saposin fold' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1M12 
_pdbx_database_status.recvd_initial_deposition_date   2002-06-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'de Alba, E.' 1 
'Weiler, S.'  2 
'Tjandra, N.' 3 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of human saposin C: pH-dependent interaction with phospholipid vesicles.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            42 
_citation.page_first                14729 
_citation.page_last                 14740 
_citation.year                      2003 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14674747 
_citation.pdbx_database_id_DOI      10.1021/bi0301338 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'de Alba, E.' 1 
primary 'Weiler, S.'  2 
primary 'Tjandra, N.' 3 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'SAPOSIN C' 
_entity.formula_weight             9424.898 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSG
LVPR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSG
LVPR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  ASP n 
1 3  VAL n 
1 4  TYR n 
1 5  CYS n 
1 6  GLU n 
1 7  VAL n 
1 8  CYS n 
1 9  GLU n 
1 10 PHE n 
1 11 LEU n 
1 12 VAL n 
1 13 LYS n 
1 14 GLU n 
1 15 VAL n 
1 16 THR n 
1 17 LYS n 
1 18 LEU n 
1 19 ILE n 
1 20 ASP n 
1 21 ASN n 
1 22 ASN n 
1 23 LYS n 
1 24 THR n 
1 25 GLU n 
1 26 LYS n 
1 27 GLU n 
1 28 ILE n 
1 29 LEU n 
1 30 ASP n 
1 31 ALA n 
1 32 PHE n 
1 33 ASP n 
1 34 LYS n 
1 35 MET n 
1 36 CYS n 
1 37 SER n 
1 38 LYS n 
1 39 LEU n 
1 40 PRO n 
1 41 LYS n 
1 42 SER n 
1 43 LEU n 
1 44 SER n 
1 45 GLU n 
1 46 GLU n 
1 47 CYS n 
1 48 GLN n 
1 49 GLU n 
1 50 VAL n 
1 51 VAL n 
1 52 ASP n 
1 53 THR n 
1 54 TYR n 
1 55 GLY n 
1 56 SER n 
1 57 SER n 
1 58 ILE n 
1 59 LEU n 
1 60 SER n 
1 61 ILE n 
1 62 LEU n 
1 63 LEU n 
1 64 GLU n 
1 65 GLU n 
1 66 VAL n 
1 67 SER n 
1 68 PRO n 
1 69 GLU n 
1 70 LEU n 
1 71 VAL n 
1 72 CYS n 
1 73 SER n 
1 74 MET n 
1 75 LEU n 
1 76 HIS n 
1 77 LEU n 
1 78 CYS n 
1 79 SER n 
1 80 GLY n 
1 81 LEU n 
1 82 VAL n 
1 83 PRO n 
1 84 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          pET-30b 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SAP_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSG

;
_struct_ref.pdbx_align_begin           311 
_struct_ref.pdbx_db_accession          P07602 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1M12 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 80 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07602 
_struct_ref_seq.db_align_beg                  311 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  390 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       80 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1M12 LEU A 81 ? UNP P07602 ? ? 'CLONING ARTIFACT' 81 1 
1 1M12 VAL A 82 ? UNP P07602 ? ? 'CLONING ARTIFACT' 82 2 
1 1M12 PRO A 83 ? UNP P07602 ? ? 'CLONING ARTIFACT' 83 3 
1 1M12 ARG A 84 ? UNP P07602 ? ? 'CLONING ARTIFACT' 84 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY                                   
2 2 1 4D_13C/15N-separated_NOESY                               
3 3 1 4D_13C-separated_NOESY                                   
4 3 1 3D_13C-separated_TOCSY                                   
5 2 1 'CBCACONH, HNCACB'                                       
6 2 1 'experiments for residual dipolar coupling measurements' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '~10-20mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 U-15N          '90% H20, 10% D20' 
2 'U-15N, U-13C' '90% H20, 10% D20' 
3 'U-15N, U-13C' '100% D20'         
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DRX 600 
2 ? Bruker DMX 800 
# 
_pdbx_nmr_refine.entry_id           1M12 
_pdbx_nmr_refine.method             'distance geometry and simulated annealing' 
_pdbx_nmr_refine.details            
;structures were calculated with: 
1806 NOE-derived destance constriants (no intra-residue NOEs used), 
28 hydrogen bonds, 135 dihedral restraints, 276 residual dipolar couplings.  
Residues 1-3 and 79-84 are disordered.
Superimposition of structures is from residues 4-78.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1M12 
_pdbx_nmr_details.text       
;residual dipolar couplings measured in two different alignment media. 
Pf1 and fd phages
;
# 
_pdbx_nmr_ensemble.entry_id                                      1M12 
_pdbx_nmr_ensemble.conformers_calculated_total_number            163 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1M12 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XWINNMR 2.5   collection      Bruker  1 
NMRPipe 2.1   processing      Delagio 2 
PIPP    4.2.8 'data analysis' Garrett 3 
X-PLOR  3.840 refinement      Brunger 4 
# 
_exptl.entry_id          1M12 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.crystal_id             1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1M12 
_struct.title                     'NMR solution structure of human Saposin C' 
_struct.pdbx_descriptor           'SAPOSIN C' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1M12 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            'disulfide bridges, alpha-helices, MEMBRANE PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 2  ? ASN A 21 ? ASP A 2  ASN A 21 1 ? 20 
HELX_P HELX_P2 2 THR A 24 ? PHE A 32 ? THR A 24 PHE A 32 1 ? 9  
HELX_P HELX_P3 3 ASP A 33 ? LYS A 34 ? ASP A 33 LYS A 34 5 ? 2  
HELX_P HELX_P4 4 MET A 35 ? LEU A 39 ? MET A 35 LEU A 39 5 ? 5  
HELX_P HELX_P5 5 LEU A 43 ? LEU A 63 ? LEU A 43 LEU A 63 1 ? 21 
HELX_P HELX_P6 6 GLU A 69 ? LEU A 75 ? GLU A 69 LEU A 75 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 5  SG ? ? ? 1_555 A CYS 78 SG ? ? A CYS 5  A CYS 78 1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf2 disulf ? ? A CYS 8  SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 8  A CYS 72 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf3 disulf ? ? A CYS 36 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 36 A CYS 47 1_555 ? ? ? ? ? ? ? 2.013 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1M12 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1M12 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . SER A 1 1  ? 6.363   16.607  -1.466  1.00 0.00 ? 1  SER A N    1  
ATOM 2     C CA   . SER A 1 1  ? 5.305   16.429  -0.432  1.00 0.00 ? 1  SER A CA   1  
ATOM 3     C C    . SER A 1 1  ? 4.150   15.616  -1.019  1.00 0.00 ? 1  SER A C    1  
ATOM 4     O O    . SER A 1 1  ? 2.995   15.842  -0.717  1.00 0.00 ? 1  SER A O    1  
ATOM 5     C CB   . SER A 1 1  ? 4.788   17.798  0.010   1.00 0.00 ? 1  SER A CB   1  
ATOM 6     O OG   . SER A 1 1  ? 5.888   18.621  0.376   1.00 0.00 ? 1  SER A OG   1  
ATOM 7     H H1   . SER A 1 1  ? 6.542   15.699  -1.939  1.00 0.00 ? 1  SER A H1   1  
ATOM 8     H H2   . SER A 1 1  ? 7.238   16.941  -1.012  1.00 0.00 ? 1  SER A H2   1  
ATOM 9     H H3   . SER A 1 1  ? 6.048   17.305  -2.168  1.00 0.00 ? 1  SER A H3   1  
ATOM 10    H HA   . SER A 1 1  ? 5.717   15.907  0.420   1.00 0.00 ? 1  SER A HA   1  
ATOM 11    H HB2  . SER A 1 1  ? 4.254   18.262  -0.802  1.00 0.00 ? 1  SER A HB2  1  
ATOM 12    H HB3  . SER A 1 1  ? 4.121   17.675  0.853   1.00 0.00 ? 1  SER A HB3  1  
ATOM 13    H HG   . SER A 1 1  ? 5.598   19.536  0.343   1.00 0.00 ? 1  SER A HG   1  
ATOM 14    N N    . ASP A 1 2  ? 4.461   14.677  -1.871  1.00 0.00 ? 2  ASP A N    1  
ATOM 15    C CA   . ASP A 1 2  ? 3.398   13.846  -2.504  1.00 0.00 ? 2  ASP A CA   1  
ATOM 16    C C    . ASP A 1 2  ? 2.773   12.907  -1.469  1.00 0.00 ? 2  ASP A C    1  
ATOM 17    O O    . ASP A 1 2  ? 3.321   11.881  -1.119  1.00 0.00 ? 2  ASP A O    1  
ATOM 18    C CB   . ASP A 1 2  ? 4.014   13.028  -3.644  1.00 0.00 ? 2  ASP A CB   1  
ATOM 19    C CG   . ASP A 1 2  ? 2.989   12.021  -4.174  1.00 0.00 ? 2  ASP A CG   1  
ATOM 20    O OD1  . ASP A 1 2  ? 1.922   12.450  -4.581  1.00 0.00 ? 2  ASP A OD1  1  
ATOM 21    O OD2  . ASP A 1 2  ? 3.289   10.839  -4.162  1.00 0.00 ? 2  ASP A OD2  1  
ATOM 22    H H    . ASP A 1 2  ? 5.401   14.523  -2.104  1.00 0.00 ? 2  ASP A H    1  
ATOM 23    H HA   . ASP A 1 2  ? 2.633   14.489  -2.906  1.00 0.00 ? 2  ASP A HA   1  
ATOM 24    H HB2  . ASP A 1 2  ? 4.308   13.694  -4.443  1.00 0.00 ? 2  ASP A HB2  1  
ATOM 25    H HB3  . ASP A 1 2  ? 4.881   12.501  -3.281  1.00 0.00 ? 2  ASP A HB3  1  
ATOM 26    N N    . VAL A 1 3  ? 1.622   13.277  -0.976  1.00 0.00 ? 3  VAL A N    1  
ATOM 27    C CA   . VAL A 1 3  ? 0.919   12.452  0.045   1.00 0.00 ? 3  VAL A CA   1  
ATOM 28    C C    . VAL A 1 3  ? 0.595   11.059  -0.508  1.00 0.00 ? 3  VAL A C    1  
ATOM 29    O O    . VAL A 1 3  ? 0.187   10.191  0.237   1.00 0.00 ? 3  VAL A O    1  
ATOM 30    C CB   . VAL A 1 3  ? -0.398  13.168  0.440   1.00 0.00 ? 3  VAL A CB   1  
ATOM 31    C CG1  . VAL A 1 3  ? -0.170  14.681  0.460   1.00 0.00 ? 3  VAL A CG1  1  
ATOM 32    C CG2  . VAL A 1 3  ? -1.533  12.849  -0.549  1.00 0.00 ? 3  VAL A CG2  1  
ATOM 33    H H    . VAL A 1 3  ? 1.217   14.116  -1.280  1.00 0.00 ? 3  VAL A H    1  
ATOM 34    H HA   . VAL A 1 3  ? 1.524   12.374  0.939   1.00 0.00 ? 3  VAL A HA   1  
ATOM 35    H HB   . VAL A 1 3  ? -0.691  12.847  1.432   1.00 0.00 ? 3  VAL A HB   1  
ATOM 36    H HG11 . VAL A 1 3  ? -0.979  15.159  0.993   1.00 0.00 ? 3  VAL A HG11 1  
ATOM 37    H HG12 . VAL A 1 3  ? -0.137  15.054  -0.553  1.00 0.00 ? 3  VAL A HG12 1  
ATOM 38    H HG13 . VAL A 1 3  ? 0.765   14.897  0.955   1.00 0.00 ? 3  VAL A HG13 1  
ATOM 39    H HG21 . VAL A 1 3  ? -1.171  12.948  -1.560  1.00 0.00 ? 3  VAL A HG21 1  
ATOM 40    H HG22 . VAL A 1 3  ? -2.354  13.536  -0.390  1.00 0.00 ? 3  VAL A HG22 1  
ATOM 41    H HG23 . VAL A 1 3  ? -1.878  11.838  -0.385  1.00 0.00 ? 3  VAL A HG23 1  
ATOM 42    N N    . TYR A 1 4  ? 0.710   10.819  -1.796  1.00 0.00 ? 4  TYR A N    1  
ATOM 43    C CA   . TYR A 1 4  ? 0.320   9.458   -2.294  1.00 0.00 ? 4  TYR A CA   1  
ATOM 44    C C    . TYR A 1 4  ? 1.386   8.431   -1.894  1.00 0.00 ? 4  TYR A C    1  
ATOM 45    O O    . TYR A 1 4  ? 1.079   7.350   -1.432  1.00 0.00 ? 4  TYR A O    1  
ATOM 46    C CB   . TYR A 1 4  ? 0.110   9.471   -3.813  1.00 0.00 ? 4  TYR A CB   1  
ATOM 47    C CG   . TYR A 1 4  ? -1.298  9.897   -4.160  1.00 0.00 ? 4  TYR A CG   1  
ATOM 48    C CD1  . TYR A 1 4  ? -2.369  9.042   -3.889  1.00 0.00 ? 4  TYR A CD1  1  
ATOM 49    C CD2  . TYR A 1 4  ? -1.528  11.127  -4.791  1.00 0.00 ? 4  TYR A CD2  1  
ATOM 50    C CE1  . TYR A 1 4  ? -3.669  9.411   -4.244  1.00 0.00 ? 4  TYR A CE1  1  
ATOM 51    C CE2  . TYR A 1 4  ? -2.831  11.501  -5.140  1.00 0.00 ? 4  TYR A CE2  1  
ATOM 52    C CZ   . TYR A 1 4  ? -3.902  10.643  -4.868  1.00 0.00 ? 4  TYR A CZ   1  
ATOM 53    O OH   . TYR A 1 4  ? -5.186  11.008  -5.217  1.00 0.00 ? 4  TYR A OH   1  
ATOM 54    H H    . TYR A 1 4  ? 1.003   11.517  -2.418  1.00 0.00 ? 4  TYR A H    1  
ATOM 55    H HA   . TYR A 1 4  ? -0.579  9.201   -1.756  1.00 0.00 ? 4  TYR A HA   1  
ATOM 56    H HB2  . TYR A 1 4  ? 0.812   10.160  -4.260  1.00 0.00 ? 4  TYR A HB2  1  
ATOM 57    H HB3  . TYR A 1 4  ? 0.288   8.482   -4.212  1.00 0.00 ? 4  TYR A HB3  1  
ATOM 58    H HD1  . TYR A 1 4  ? -2.193  8.102   -3.395  1.00 0.00 ? 4  TYR A HD1  1  
ATOM 59    H HD2  . TYR A 1 4  ? -0.702  11.791  -5.000  1.00 0.00 ? 4  TYR A HD2  1  
ATOM 60    H HE1  . TYR A 1 4  ? -4.492  8.742   -4.042  1.00 0.00 ? 4  TYR A HE1  1  
ATOM 61    H HE2  . TYR A 1 4  ? -3.008  12.451  -5.621  1.00 0.00 ? 4  TYR A HE2  1  
ATOM 62    H HH   . TYR A 1 4  ? -5.205  11.159  -6.164  1.00 0.00 ? 4  TYR A HH   1  
ATOM 63    N N    . CYS A 1 5  ? 2.635   8.765   -2.067  1.00 0.00 ? 5  CYS A N    1  
ATOM 64    C CA   . CYS A 1 5  ? 3.716   7.813   -1.696  1.00 0.00 ? 5  CYS A CA   1  
ATOM 65    C C    . CYS A 1 5  ? 3.615   7.480   -0.201  1.00 0.00 ? 5  CYS A C    1  
ATOM 66    O O    . CYS A 1 5  ? 3.763   6.342   0.197   1.00 0.00 ? 5  CYS A O    1  
ATOM 67    C CB   . CYS A 1 5  ? 5.080   8.442   -1.996  1.00 0.00 ? 5  CYS A CB   1  
ATOM 68    S SG   . CYS A 1 5  ? 5.361   8.429   -3.779  1.00 0.00 ? 5  CYS A SG   1  
ATOM 69    H H    . CYS A 1 5  ? 2.860   9.642   -2.439  1.00 0.00 ? 5  CYS A H    1  
ATOM 70    H HA   . CYS A 1 5  ? 3.605   6.897   -2.256  1.00 0.00 ? 5  CYS A HA   1  
ATOM 71    H HB2  . CYS A 1 5  ? 5.098   9.461   -1.640  1.00 0.00 ? 5  CYS A HB2  1  
ATOM 72    H HB3  . CYS A 1 5  ? 5.857   7.874   -1.505  1.00 0.00 ? 5  CYS A HB3  1  
ATOM 73    N N    . GLU A 1 6  ? 3.377   8.455   0.630   1.00 0.00 ? 6  GLU A N    1  
ATOM 74    C CA   . GLU A 1 6  ? 3.283   8.177   2.091   1.00 0.00 ? 6  GLU A CA   1  
ATOM 75    C C    . GLU A 1 6  ? 2.192   7.135   2.360   1.00 0.00 ? 6  GLU A C    1  
ATOM 76    O O    . GLU A 1 6  ? 2.360   6.246   3.171   1.00 0.00 ? 6  GLU A O    1  
ATOM 77    C CB   . GLU A 1 6  ? 2.953   9.483   2.831   1.00 0.00 ? 6  GLU A CB   1  
ATOM 78    C CG   . GLU A 1 6  ? 2.547   9.191   4.288   1.00 0.00 ? 6  GLU A CG   1  
ATOM 79    C CD   . GLU A 1 6  ? 1.056   8.843   4.359   1.00 0.00 ? 6  GLU A CD   1  
ATOM 80    O OE1  . GLU A 1 6  ? 0.269   9.575   3.784   1.00 0.00 ? 6  GLU A OE1  1  
ATOM 81    O OE2  . GLU A 1 6  ? 0.730   7.850   4.988   1.00 0.00 ? 6  GLU A OE2  1  
ATOM 82    H H    . GLU A 1 6  ? 3.275   9.369   0.294   1.00 0.00 ? 6  GLU A H    1  
ATOM 83    H HA   . GLU A 1 6  ? 4.230   7.797   2.443   1.00 0.00 ? 6  GLU A HA   1  
ATOM 84    H HB2  . GLU A 1 6  ? 3.825   10.122  2.825   1.00 0.00 ? 6  GLU A HB2  1  
ATOM 85    H HB3  . GLU A 1 6  ? 2.142   9.986   2.324   1.00 0.00 ? 6  GLU A HB3  1  
ATOM 86    H HG2  . GLU A 1 6  ? 3.127   8.360   4.665   1.00 0.00 ? 6  GLU A HG2  1  
ATOM 87    H HG3  . GLU A 1 6  ? 2.737   10.063  4.894   1.00 0.00 ? 6  GLU A HG3  1  
ATOM 88    N N    . VAL A 1 7  ? 1.068   7.256   1.716   1.00 0.00 ? 7  VAL A N    1  
ATOM 89    C CA   . VAL A 1 7  ? -0.041  6.291   1.968   1.00 0.00 ? 7  VAL A CA   1  
ATOM 90    C C    . VAL A 1 7  ? 0.265   4.906   1.370   1.00 0.00 ? 7  VAL A C    1  
ATOM 91    O O    . VAL A 1 7  ? 0.000   3.895   1.989   1.00 0.00 ? 7  VAL A O    1  
ATOM 92    C CB   . VAL A 1 7  ? -1.348  6.858   1.403   1.00 0.00 ? 7  VAL A CB   1  
ATOM 93    C CG1  . VAL A 1 7  ? -2.469  5.827   1.560   1.00 0.00 ? 7  VAL A CG1  1  
ATOM 94    C CG2  . VAL A 1 7  ? -1.719  8.157   2.149   1.00 0.00 ? 7  VAL A CG2  1  
ATOM 95    H H    . VAL A 1 7  ? 0.939   7.997   1.088   1.00 0.00 ? 7  VAL A H    1  
ATOM 96    H HA   . VAL A 1 7  ? -0.140  6.135   3.038   1.00 0.00 ? 7  VAL A HA   1  
ATOM 97    H HB   . VAL A 1 7  ? -1.211  7.077   0.355   1.00 0.00 ? 7  VAL A HB   1  
ATOM 98    H HG11 . VAL A 1 7  ? -2.362  5.063   0.805   1.00 0.00 ? 7  VAL A HG11 1  
ATOM 99    H HG12 . VAL A 1 7  ? -3.426  6.315   1.445   1.00 0.00 ? 7  VAL A HG12 1  
ATOM 100   H HG13 . VAL A 1 7  ? -2.410  5.376   2.539   1.00 0.00 ? 7  VAL A HG13 1  
ATOM 101   H HG21 . VAL A 1 7  ? -1.155  8.982   1.739   1.00 0.00 ? 7  VAL A HG21 1  
ATOM 102   H HG22 . VAL A 1 7  ? -1.490  8.056   3.199   1.00 0.00 ? 7  VAL A HG22 1  
ATOM 103   H HG23 . VAL A 1 7  ? -2.775  8.357   2.031   1.00 0.00 ? 7  VAL A HG23 1  
ATOM 104   N N    . CYS A 1 8  ? 0.816   4.836   0.181   1.00 0.00 ? 8  CYS A N    1  
ATOM 105   C CA   . CYS A 1 8  ? 1.125   3.501   -0.426  1.00 0.00 ? 8  CYS A CA   1  
ATOM 106   C C    . CYS A 1 8  ? 2.090   2.740   0.473   1.00 0.00 ? 8  CYS A C    1  
ATOM 107   O O    . CYS A 1 8  ? 1.964   1.546   0.654   1.00 0.00 ? 8  CYS A O    1  
ATOM 108   C CB   . CYS A 1 8  ? 1.755   3.718   -1.802  1.00 0.00 ? 8  CYS A CB   1  
ATOM 109   S SG   . CYS A 1 8  ? 2.328   2.140   -2.490  1.00 0.00 ? 8  CYS A SG   1  
ATOM 110   H H    . CYS A 1 8  ? 1.040   5.643   -0.327  1.00 0.00 ? 8  CYS A H    1  
ATOM 111   H HA   . CYS A 1 8  ? 0.218   2.924   -0.541  1.00 0.00 ? 8  CYS A HA   1  
ATOM 112   H HB2  . CYS A 1 8  ? 1.014   4.141   -2.457  1.00 0.00 ? 8  CYS A HB2  1  
ATOM 113   H HB3  . CYS A 1 8  ? 2.583   4.399   -1.714  1.00 0.00 ? 8  CYS A HB3  1  
ATOM 114   N N    . GLU A 1 9  ? 3.050   3.408   1.051   1.00 0.00 ? 9  GLU A N    1  
ATOM 115   C CA   . GLU A 1 9  ? 3.996   2.692   1.939   1.00 0.00 ? 9  GLU A CA   1  
ATOM 116   C C    . GLU A 1 9  ? 3.278   2.377   3.253   1.00 0.00 ? 9  GLU A C    1  
ATOM 117   O O    . GLU A 1 9  ? 3.571   1.388   3.895   1.00 0.00 ? 9  GLU A O    1  
ATOM 118   C CB   . GLU A 1 9  ? 5.225   3.583   2.214   1.00 0.00 ? 9  GLU A CB   1  
ATOM 119   C CG   . GLU A 1 9  ? 6.305   3.341   1.151   1.00 0.00 ? 9  GLU A CG   1  
ATOM 120   C CD   . GLU A 1 9  ? 6.993   2.001   1.418   1.00 0.00 ? 9  GLU A CD   1  
ATOM 121   O OE1  . GLU A 1 9  ? 7.723   1.916   2.392   1.00 0.00 ? 9  GLU A OE1  1  
ATOM 122   O OE2  . GLU A 1 9  ? 6.778   1.082   0.645   1.00 0.00 ? 9  GLU A OE2  1  
ATOM 123   H H    . GLU A 1 9  ? 3.153   4.372   0.914   1.00 0.00 ? 9  GLU A H    1  
ATOM 124   H HA   . GLU A 1 9  ? 4.305   1.773   1.463   1.00 0.00 ? 9  GLU A HA   1  
ATOM 125   H HB2  . GLU A 1 9  ? 4.926   4.620   2.187   1.00 0.00 ? 9  GLU A HB2  1  
ATOM 126   H HB3  . GLU A 1 9  ? 5.633   3.355   3.190   1.00 0.00 ? 9  GLU A HB3  1  
ATOM 127   H HG2  . GLU A 1 9  ? 5.850   3.323   0.173   1.00 0.00 ? 9  GLU A HG2  1  
ATOM 128   H HG3  . GLU A 1 9  ? 7.037   4.133   1.194   1.00 0.00 ? 9  GLU A HG3  1  
ATOM 129   N N    . PHE A 1 10 ? 2.332   3.183   3.665   1.00 0.00 ? 10 PHE A N    1  
ATOM 130   C CA   . PHE A 1 10 ? 1.626   2.863   4.932   1.00 0.00 ? 10 PHE A CA   1  
ATOM 131   C C    . PHE A 1 10 ? 0.762   1.613   4.728   1.00 0.00 ? 10 PHE A C    1  
ATOM 132   O O    . PHE A 1 10 ? 0.793   0.695   5.522   1.00 0.00 ? 10 PHE A O    1  
ATOM 133   C CB   . PHE A 1 10 ? 0.733   4.027   5.360   1.00 0.00 ? 10 PHE A CB   1  
ATOM 134   C CG   . PHE A 1 10 ? 0.032   3.636   6.636   1.00 0.00 ? 10 PHE A CG   1  
ATOM 135   C CD1  . PHE A 1 10 ? 0.643   3.878   7.872   1.00 0.00 ? 10 PHE A CD1  1  
ATOM 136   C CD2  . PHE A 1 10 ? -1.215  3.005   6.582   1.00 0.00 ? 10 PHE A CD2  1  
ATOM 137   C CE1  . PHE A 1 10 ? 0.003   3.493   9.056   1.00 0.00 ? 10 PHE A CE1  1  
ATOM 138   C CE2  . PHE A 1 10 ? -1.855  2.616   7.766   1.00 0.00 ? 10 PHE A CE2  1  
ATOM 139   C CZ   . PHE A 1 10 ? -1.245  2.861   9.003   1.00 0.00 ? 10 PHE A CZ   1  
ATOM 140   H H    . PHE A 1 10 ? 2.079   3.986   3.161   1.00 0.00 ? 10 PHE A H    1  
ATOM 141   H HA   . PHE A 1 10 ? 2.353   2.673   5.701   1.00 0.00 ? 10 PHE A HA   1  
ATOM 142   H HB2  . PHE A 1 10 ? 1.337   4.907   5.528   1.00 0.00 ? 10 PHE A HB2  1  
ATOM 143   H HB3  . PHE A 1 10 ? 0.001   4.226   4.592   1.00 0.00 ? 10 PHE A HB3  1  
ATOM 144   H HD1  . PHE A 1 10 ? 1.605   4.366   7.911   1.00 0.00 ? 10 PHE A HD1  1  
ATOM 145   H HD2  . PHE A 1 10 ? -1.684  2.822   5.625   1.00 0.00 ? 10 PHE A HD2  1  
ATOM 146   H HE1  . PHE A 1 10 ? 0.476   3.680   10.011  1.00 0.00 ? 10 PHE A HE1  1  
ATOM 147   H HE2  . PHE A 1 10 ? -2.817  2.123   7.725   1.00 0.00 ? 10 PHE A HE2  1  
ATOM 148   H HZ   . PHE A 1 10 ? -1.738  2.563   9.916   1.00 0.00 ? 10 PHE A HZ   1  
ATOM 149   N N    . LEU A 1 11 ? 0.002   1.558   3.662   1.00 0.00 ? 11 LEU A N    1  
ATOM 150   C CA   . LEU A 1 11 ? -0.839  0.348   3.422   1.00 0.00 ? 11 LEU A CA   1  
ATOM 151   C C    . LEU A 1 11 ? 0.083   -0.856  3.263   1.00 0.00 ? 11 LEU A C    1  
ATOM 152   O O    . LEU A 1 11 ? -0.168  -1.911  3.811   1.00 0.00 ? 11 LEU A O    1  
ATOM 153   C CB   . LEU A 1 11 ? -1.681  0.509   2.143   1.00 0.00 ? 11 LEU A CB   1  
ATOM 154   C CG   . LEU A 1 11 ? -2.735  1.616   2.336   1.00 0.00 ? 11 LEU A CG   1  
ATOM 155   C CD1  . LEU A 1 11 ? -3.222  2.106   0.969   1.00 0.00 ? 11 LEU A CD1  1  
ATOM 156   C CD2  . LEU A 1 11 ? -3.939  1.082   3.129   1.00 0.00 ? 11 LEU A CD2  1  
ATOM 157   H H    . LEU A 1 11 ? -0.008  2.302   3.024   1.00 0.00 ? 11 LEU A H    1  
ATOM 158   H HA   . LEU A 1 11 ? -1.495  0.181   4.262   1.00 0.00 ? 11 LEU A HA   1  
ATOM 159   H HB2  . LEU A 1 11 ? -1.030  0.773   1.315   1.00 0.00 ? 11 LEU A HB2  1  
ATOM 160   H HB3  . LEU A 1 11 ? -2.178  -0.433  1.924   1.00 0.00 ? 11 LEU A HB3  1  
ATOM 161   H HG   . LEU A 1 11 ? -2.290  2.443   2.871   1.00 0.00 ? 11 LEU A HG   1  
ATOM 162   H HD11 . LEU A 1 11 ? -2.413  2.603   0.455   1.00 0.00 ? 11 LEU A HD11 1  
ATOM 163   H HD12 . LEU A 1 11 ? -4.041  2.797   1.105   1.00 0.00 ? 11 LEU A HD12 1  
ATOM 164   H HD13 . LEU A 1 11 ? -3.557  1.263   0.383   1.00 0.00 ? 11 LEU A HD13 1  
ATOM 165   H HD21 . LEU A 1 11 ? -3.666  0.957   4.165   1.00 0.00 ? 11 LEU A HD21 1  
ATOM 166   H HD22 . LEU A 1 11 ? -4.255  0.134   2.722   1.00 0.00 ? 11 LEU A HD22 1  
ATOM 167   H HD23 . LEU A 1 11 ? -4.754  1.789   3.059   1.00 0.00 ? 11 LEU A HD23 1  
ATOM 168   N N    . VAL A 1 12 ? 1.150   -0.721  2.524   1.00 0.00 ? 12 VAL A N    1  
ATOM 169   C CA   . VAL A 1 12 ? 2.074   -1.868  2.347   1.00 0.00 ? 12 VAL A CA   1  
ATOM 170   C C    . VAL A 1 12 ? 2.619   -2.302  3.721   1.00 0.00 ? 12 VAL A C    1  
ATOM 171   O O    . VAL A 1 12 ? 2.611   -3.467  4.058   1.00 0.00 ? 12 VAL A O    1  
ATOM 172   C CB   . VAL A 1 12 ? 3.226   -1.424  1.429   1.00 0.00 ? 12 VAL A CB   1  
ATOM 173   C CG1  . VAL A 1 12 ? 4.426   -2.365  1.566   1.00 0.00 ? 12 VAL A CG1  1  
ATOM 174   C CG2  . VAL A 1 12 ? 2.747   -1.432  -0.025  1.00 0.00 ? 12 VAL A CG2  1  
ATOM 175   H H    . VAL A 1 12 ? 1.357   0.123   2.071   1.00 0.00 ? 12 VAL A H    1  
ATOM 176   H HA   . VAL A 1 12 ? 1.541   -2.698  1.893   1.00 0.00 ? 12 VAL A HA   1  
ATOM 177   H HB   . VAL A 1 12 ? 3.528   -0.424  1.699   1.00 0.00 ? 12 VAL A HB   1  
ATOM 178   H HG11 . VAL A 1 12 ? 4.089   -3.389  1.507   1.00 0.00 ? 12 VAL A HG11 1  
ATOM 179   H HG12 . VAL A 1 12 ? 4.911   -2.199  2.517   1.00 0.00 ? 12 VAL A HG12 1  
ATOM 180   H HG13 . VAL A 1 12 ? 5.124   -2.165  0.770   1.00 0.00 ? 12 VAL A HG13 1  
ATOM 181   H HG21 . VAL A 1 12 ? 1.853   -0.833  -0.113  1.00 0.00 ? 12 VAL A HG21 1  
ATOM 182   H HG22 . VAL A 1 12 ? 2.532   -2.447  -0.329  1.00 0.00 ? 12 VAL A HG22 1  
ATOM 183   H HG23 . VAL A 1 12 ? 3.519   -1.022  -0.660  1.00 0.00 ? 12 VAL A HG23 1  
ATOM 184   N N    . LYS A 1 13 ? 3.086   -1.368  4.520   1.00 0.00 ? 13 LYS A N    1  
ATOM 185   C CA   . LYS A 1 13 ? 3.627   -1.734  5.867   1.00 0.00 ? 13 LYS A CA   1  
ATOM 186   C C    . LYS A 1 13 ? 2.525   -2.420  6.681   1.00 0.00 ? 13 LYS A C    1  
ATOM 187   O O    . LYS A 1 13 ? 2.747   -3.418  7.338   1.00 0.00 ? 13 LYS A O    1  
ATOM 188   C CB   . LYS A 1 13 ? 4.105   -0.464  6.588   1.00 0.00 ? 13 LYS A CB   1  
ATOM 189   C CG   . LYS A 1 13 ? 4.358   -0.758  8.077   1.00 0.00 ? 13 LYS A CG   1  
ATOM 190   C CD   . LYS A 1 13 ? 5.333   0.273   8.655   1.00 0.00 ? 13 LYS A CD   1  
ATOM 191   C CE   . LYS A 1 13 ? 4.821   1.685   8.364   1.00 0.00 ? 13 LYS A CE   1  
ATOM 192   N NZ   . LYS A 1 13 ? 3.378   1.774   8.725   1.00 0.00 ? 13 LYS A NZ   1  
ATOM 193   H H    . LYS A 1 13 ? 3.084   -0.431  4.232   1.00 0.00 ? 13 LYS A H    1  
ATOM 194   H HA   . LYS A 1 13 ? 4.459   -2.412  5.738   1.00 0.00 ? 13 LYS A HA   1  
ATOM 195   H HB2  . LYS A 1 13 ? 5.019   -0.119  6.126   1.00 0.00 ? 13 LYS A HB2  1  
ATOM 196   H HB3  . LYS A 1 13 ? 3.349   0.303   6.498   1.00 0.00 ? 13 LYS A HB3  1  
ATOM 197   H HG2  . LYS A 1 13 ? 3.421   -0.706  8.616   1.00 0.00 ? 13 LYS A HG2  1  
ATOM 198   H HG3  . LYS A 1 13 ? 4.780   -1.746  8.186   1.00 0.00 ? 13 LYS A HG3  1  
ATOM 199   H HD2  . LYS A 1 13 ? 5.413   0.132   9.724   1.00 0.00 ? 13 LYS A HD2  1  
ATOM 200   H HD3  . LYS A 1 13 ? 6.304   0.144   8.201   1.00 0.00 ? 13 LYS A HD3  1  
ATOM 201   H HE2  . LYS A 1 13 ? 5.384   2.399   8.947   1.00 0.00 ? 13 LYS A HE2  1  
ATOM 202   H HE3  . LYS A 1 13 ? 4.944   1.903   7.313   1.00 0.00 ? 13 LYS A HE3  1  
ATOM 203   H HZ1  . LYS A 1 13 ? 3.100   2.773   8.796   1.00 0.00 ? 13 LYS A HZ1  1  
ATOM 204   H HZ2  . LYS A 1 13 ? 3.221   1.303   9.639   1.00 0.00 ? 13 LYS A HZ2  1  
ATOM 205   H HZ3  . LYS A 1 13 ? 2.808   1.309   7.992   1.00 0.00 ? 13 LYS A HZ3  1  
ATOM 206   N N    . GLU A 1 14 ? 1.347   -1.866  6.661   1.00 0.00 ? 14 GLU A N    1  
ATOM 207   C CA   . GLU A 1 14 ? 0.229   -2.450  7.453   1.00 0.00 ? 14 GLU A CA   1  
ATOM 208   C C    . GLU A 1 14 ? -0.190  -3.782  6.836   1.00 0.00 ? 14 GLU A C    1  
ATOM 209   O O    . GLU A 1 14 ? -0.529  -4.718  7.533   1.00 0.00 ? 14 GLU A O    1  
ATOM 210   C CB   . GLU A 1 14 ? -0.955  -1.457  7.460   1.00 0.00 ? 14 GLU A CB   1  
ATOM 211   C CG   . GLU A 1 14 ? -1.629  -1.448  8.839   1.00 0.00 ? 14 GLU A CG   1  
ATOM 212   C CD   . GLU A 1 14 ? -2.170  -2.842  9.153   1.00 0.00 ? 14 GLU A CD   1  
ATOM 213   O OE1  . GLU A 1 14 ? -2.719  -3.456  8.255   1.00 0.00 ? 14 GLU A OE1  1  
ATOM 214   O OE2  . GLU A 1 14 ? -2.024  -3.272  10.285  1.00 0.00 ? 14 GLU A OE2  1  
ATOM 215   H H    . GLU A 1 14 ? 1.207   -1.057  6.127   1.00 0.00 ? 14 GLU A H    1  
ATOM 216   H HA   . GLU A 1 14 ? 0.563   -2.618  8.466   1.00 0.00 ? 14 GLU A HA   1  
ATOM 217   H HB2  . GLU A 1 14 ? -0.585  -0.466  7.241   1.00 0.00 ? 14 GLU A HB2  1  
ATOM 218   H HB3  . GLU A 1 14 ? -1.681  -1.738  6.709   1.00 0.00 ? 14 GLU A HB3  1  
ATOM 219   H HG2  . GLU A 1 14 ? -0.906  -1.166  9.590   1.00 0.00 ? 14 GLU A HG2  1  
ATOM 220   H HG3  . GLU A 1 14 ? -2.441  -0.740  8.838   1.00 0.00 ? 14 GLU A HG3  1  
ATOM 221   N N    . VAL A 1 15 ? -0.182  -3.877  5.543   1.00 0.00 ? 15 VAL A N    1  
ATOM 222   C CA   . VAL A 1 15 ? -0.596  -5.150  4.906   1.00 0.00 ? 15 VAL A CA   1  
ATOM 223   C C    . VAL A 1 15 ? 0.452   -6.241  5.161   1.00 0.00 ? 15 VAL A C    1  
ATOM 224   O O    . VAL A 1 15 ? 0.114   -7.357  5.472   1.00 0.00 ? 15 VAL A O    1  
ATOM 225   C CB   . VAL A 1 15 ? -0.797  -4.931  3.397   1.00 0.00 ? 15 VAL A CB   1  
ATOM 226   C CG1  . VAL A 1 15 ? -0.748  -6.279  2.655   1.00 0.00 ? 15 VAL A CG1  1  
ATOM 227   C CG2  . VAL A 1 15 ? -2.159  -4.261  3.160   1.00 0.00 ? 15 VAL A CG2  1  
ATOM 228   H H    . VAL A 1 15 ? 0.084   -3.111  4.993   1.00 0.00 ? 15 VAL A H    1  
ATOM 229   H HA   . VAL A 1 15 ? -1.532  -5.472  5.342   1.00 0.00 ? 15 VAL A HA   1  
ATOM 230   H HB   . VAL A 1 15 ? -0.016  -4.287  3.022   1.00 0.00 ? 15 VAL A HB   1  
ATOM 231   H HG11 . VAL A 1 15 ? 0.285   -6.530  2.438   1.00 0.00 ? 15 VAL A HG11 1  
ATOM 232   H HG12 . VAL A 1 15 ? -1.308  -6.208  1.735   1.00 0.00 ? 15 VAL A HG12 1  
ATOM 233   H HG13 . VAL A 1 15 ? -1.179  -7.052  3.275   1.00 0.00 ? 15 VAL A HG13 1  
ATOM 234   H HG21 . VAL A 1 15 ? -2.949  -4.932  3.466   1.00 0.00 ? 15 VAL A HG21 1  
ATOM 235   H HG22 . VAL A 1 15 ? -2.269  -4.029  2.111   1.00 0.00 ? 15 VAL A HG22 1  
ATOM 236   H HG23 . VAL A 1 15 ? -2.217  -3.350  3.738   1.00 0.00 ? 15 VAL A HG23 1  
ATOM 237   N N    . THR A 1 16 ? 1.716   -5.963  5.011   1.00 0.00 ? 16 THR A N    1  
ATOM 238   C CA   . THR A 1 16 ? 2.689   -7.067  5.232   1.00 0.00 ? 16 THR A CA   1  
ATOM 239   C C    . THR A 1 16 ? 2.594   -7.556  6.672   1.00 0.00 ? 16 THR A C    1  
ATOM 240   O O    . THR A 1 16 ? 2.704   -8.739  6.928   1.00 0.00 ? 16 THR A O    1  
ATOM 241   C CB   . THR A 1 16 ? 4.132   -6.654  4.945   1.00 0.00 ? 16 THR A CB   1  
ATOM 242   O OG1  . THR A 1 16 ? 4.674   -6.014  6.092   1.00 0.00 ? 16 THR A OG1  1  
ATOM 243   C CG2  . THR A 1 16 ? 4.230   -5.708  3.737   1.00 0.00 ? 16 THR A CG2  1  
ATOM 244   H H    . THR A 1 16 ? 2.004   -5.066  4.743   1.00 0.00 ? 16 THR A H    1  
ATOM 245   H HA   . THR A 1 16 ? 2.424   -7.872  4.568   1.00 0.00 ? 16 THR A HA   1  
ATOM 246   H HB   . THR A 1 16 ? 4.691   -7.554  4.738   1.00 0.00 ? 16 THR A HB   1  
ATOM 247   H HG1  . THR A 1 16 ? 5.362   -6.579  6.449   1.00 0.00 ? 16 THR A HG1  1  
ATOM 248   H HG21 . THR A 1 16 ? 4.548   -4.735  4.078   1.00 0.00 ? 16 THR A HG21 1  
ATOM 249   H HG22 . THR A 1 16 ? 3.274   -5.623  3.246   1.00 0.00 ? 16 THR A HG22 1  
ATOM 250   H HG23 . THR A 1 16 ? 4.957   -6.091  3.033   1.00 0.00 ? 16 THR A HG23 1  
ATOM 251   N N    . LYS A 1 17 ? 2.383   -6.692  7.624   1.00 0.00 ? 17 LYS A N    1  
ATOM 252   C CA   . LYS A 1 17 ? 2.285   -7.205  9.014   1.00 0.00 ? 17 LYS A CA   1  
ATOM 253   C C    . LYS A 1 17 ? 1.072   -8.128  9.062   1.00 0.00 ? 17 LYS A C    1  
ATOM 254   O O    . LYS A 1 17 ? 1.038   -9.110  9.777   1.00 0.00 ? 17 LYS A O    1  
ATOM 255   C CB   . LYS A 1 17 ? 2.113   -6.051  10.014  1.00 0.00 ? 17 LYS A CB   1  
ATOM 256   C CG   . LYS A 1 17 ? 1.551   -6.601  11.344  1.00 0.00 ? 17 LYS A CG   1  
ATOM 257   C CD   . LYS A 1 17 ? 1.940   -5.701  12.515  1.00 0.00 ? 17 LYS A CD   1  
ATOM 258   C CE   . LYS A 1 17 ? 1.469   -6.356  13.817  1.00 0.00 ? 17 LYS A CE   1  
ATOM 259   N NZ   . LYS A 1 17 ? 2.072   -5.646  14.979  1.00 0.00 ? 17 LYS A NZ   1  
ATOM 260   H H    . LYS A 1 17 ? 2.276   -5.739  7.426   1.00 0.00 ? 17 LYS A H    1  
ATOM 261   H HA   . LYS A 1 17 ? 3.192   -7.750  9.235   1.00 0.00 ? 17 LYS A HA   1  
ATOM 262   H HB2  . LYS A 1 17 ? 3.073   -5.583  10.186  1.00 0.00 ? 17 LYS A HB2  1  
ATOM 263   H HB3  . LYS A 1 17 ? 1.427   -5.323  9.606   1.00 0.00 ? 17 LYS A HB3  1  
ATOM 264   H HG2  . LYS A 1 17 ? 0.476   -6.653  11.281  1.00 0.00 ? 17 LYS A HG2  1  
ATOM 265   H HG3  . LYS A 1 17 ? 1.944   -7.594  11.517  1.00 0.00 ? 17 LYS A HG3  1  
ATOM 266   H HD2  . LYS A 1 17 ? 3.013   -5.577  12.537  1.00 0.00 ? 17 LYS A HD2  1  
ATOM 267   H HD3  . LYS A 1 17 ? 1.465   -4.737  12.406  1.00 0.00 ? 17 LYS A HD3  1  
ATOM 268   H HE2  . LYS A 1 17 ? 0.392   -6.299  13.878  1.00 0.00 ? 17 LYS A HE2  1  
ATOM 269   H HE3  . LYS A 1 17 ? 1.772   -7.396  13.830  1.00 0.00 ? 17 LYS A HE3  1  
ATOM 270   H HZ1  . LYS A 1 17 ? 3.097   -5.551  14.834  1.00 0.00 ? 17 LYS A HZ1  1  
ATOM 271   H HZ2  . LYS A 1 17 ? 1.893   -6.190  15.848  1.00 0.00 ? 17 LYS A HZ2  1  
ATOM 272   H HZ3  . LYS A 1 17 ? 1.648   -4.701  15.067  1.00 0.00 ? 17 LYS A HZ3  1  
ATOM 273   N N    . LEU A 1 18 ? 0.080   -7.805  8.283   1.00 0.00 ? 18 LEU A N    1  
ATOM 274   C CA   . LEU A 1 18 ? -1.148  -8.634  8.236   1.00 0.00 ? 18 LEU A CA   1  
ATOM 275   C C    . LEU A 1 18 ? -0.790  -9.946  7.525   1.00 0.00 ? 18 LEU A C    1  
ATOM 276   O O    . LEU A 1 18 ? -1.262  -11.009 7.878   1.00 0.00 ? 18 LEU A O    1  
ATOM 277   C CB   . LEU A 1 18 ? -2.251  -7.864  7.473   1.00 0.00 ? 18 LEU A CB   1  
ATOM 278   C CG   . LEU A 1 18 ? -2.851  -6.643  8.271   1.00 0.00 ? 18 LEU A CG   1  
ATOM 279   C CD1  . LEU A 1 18 ? -4.372  -6.788  8.394   1.00 0.00 ? 18 LEU A CD1  1  
ATOM 280   C CD2  . LEU A 1 18 ? -2.283  -6.489  9.697   1.00 0.00 ? 18 LEU A CD2  1  
ATOM 281   H H    . LEU A 1 18 ? 0.152   -7.013  7.711   1.00 0.00 ? 18 LEU A H    1  
ATOM 282   H HA   . LEU A 1 18 ? -1.477  -8.885  9.229   1.00 0.00 ? 18 LEU A HA   1  
ATOM 283   H HB2  . LEU A 1 18 ? -1.831  -7.498  6.555   1.00 0.00 ? 18 LEU A HB2  1  
ATOM 284   H HB3  . LEU A 1 18 ? -3.033  -8.545  7.223   1.00 0.00 ? 18 LEU A HB3  1  
ATOM 285   H HG   . LEU A 1 18 ? -2.646  -5.734  7.718   1.00 0.00 ? 18 LEU A HG   1  
ATOM 286   H HD11 . LEU A 1 18 ? -4.806  -6.890  7.408   1.00 0.00 ? 18 LEU A HD11 1  
ATOM 287   H HD12 . LEU A 1 18 ? -4.778  -5.917  8.882   1.00 0.00 ? 18 LEU A HD12 1  
ATOM 288   H HD13 . LEU A 1 18 ? -4.601  -7.660  8.981   1.00 0.00 ? 18 LEU A HD13 1  
ATOM 289   H HD21 . LEU A 1 18 ? -2.622  -5.549  10.108  1.00 0.00 ? 18 LEU A HD21 1  
ATOM 290   H HD22 . LEU A 1 18 ? -1.210  -6.490  9.673   1.00 0.00 ? 18 LEU A HD22 1  
ATOM 291   H HD23 . LEU A 1 18 ? -2.639  -7.293  10.323  1.00 0.00 ? 18 LEU A HD23 1  
ATOM 292   N N    . ILE A 1 19 ? 0.080   -9.879  6.554   1.00 0.00 ? 19 ILE A N    1  
ATOM 293   C CA   . ILE A 1 19 ? 0.521   -11.113 5.846   1.00 0.00 ? 19 ILE A CA   1  
ATOM 294   C C    . ILE A 1 19 ? 1.417   -11.888 6.806   1.00 0.00 ? 19 ILE A C    1  
ATOM 295   O O    . ILE A 1 19 ? 1.451   -13.102 6.811   1.00 0.00 ? 19 ILE A O    1  
ATOM 296   C CB   . ILE A 1 19 ? 1.314   -10.731 4.585   1.00 0.00 ? 19 ILE A CB   1  
ATOM 297   C CG1  . ILE A 1 19 ? 0.378   -10.008 3.606   1.00 0.00 ? 19 ILE A CG1  1  
ATOM 298   C CG2  . ILE A 1 19 ? 1.881   -11.988 3.914   1.00 0.00 ? 19 ILE A CG2  1  
ATOM 299   C CD1  . ILE A 1 19 ? 1.156   -9.560  2.366   1.00 0.00 ? 19 ILE A CD1  1  
ATOM 300   H H    . ILE A 1 19 ? 0.467   -9.018  6.318   1.00 0.00 ? 19 ILE A H    1  
ATOM 301   H HA   . ILE A 1 19 ? -0.339  -11.710 5.580   1.00 0.00 ? 19 ILE A HA   1  
ATOM 302   H HB   . ILE A 1 19 ? 2.133   -10.076 4.858   1.00 0.00 ? 19 ILE A HB   1  
ATOM 303   H HG12 . ILE A 1 19 ? -0.416  -10.674 3.310   1.00 0.00 ? 19 ILE A HG12 1  
ATOM 304   H HG13 . ILE A 1 19 ? -0.048  -9.148  4.086   1.00 0.00 ? 19 ILE A HG13 1  
ATOM 305   H HG21 . ILE A 1 19 ? 1.074   -12.659 3.663   1.00 0.00 ? 19 ILE A HG21 1  
ATOM 306   H HG22 . ILE A 1 19 ? 2.566   -12.482 4.587   1.00 0.00 ? 19 ILE A HG22 1  
ATOM 307   H HG23 . ILE A 1 19 ? 2.410   -11.709 3.015   1.00 0.00 ? 19 ILE A HG23 1  
ATOM 308   H HD11 . ILE A 1 19 ? 2.127   -9.190  2.660   1.00 0.00 ? 19 ILE A HD11 1  
ATOM 309   H HD12 . ILE A 1 19 ? 0.610   -8.777  1.865   1.00 0.00 ? 19 ILE A HD12 1  
ATOM 310   H HD13 . ILE A 1 19 ? 1.279   -10.398 1.696   1.00 0.00 ? 19 ILE A HD13 1  
ATOM 311   N N    . ASP A 1 20 ? 2.148   -11.177 7.617   1.00 0.00 ? 20 ASP A N    1  
ATOM 312   C CA   . ASP A 1 20 ? 3.061   -11.832 8.586   1.00 0.00 ? 20 ASP A CA   1  
ATOM 313   C C    . ASP A 1 20 ? 2.267   -12.419 9.754   1.00 0.00 ? 20 ASP A C    1  
ATOM 314   O O    . ASP A 1 20 ? 2.738   -13.317 10.425  1.00 0.00 ? 20 ASP A O    1  
ATOM 315   C CB   . ASP A 1 20 ? 4.054   -10.799 9.122   1.00 0.00 ? 20 ASP A CB   1  
ATOM 316   C CG   . ASP A 1 20 ? 4.757   -10.110 7.951   1.00 0.00 ? 20 ASP A CG   1  
ATOM 317   O OD1  . ASP A 1 20 ? 5.024   -10.781 6.968   1.00 0.00 ? 20 ASP A OD1  1  
ATOM 318   O OD2  . ASP A 1 20 ? 5.016   -8.922  8.057   1.00 0.00 ? 20 ASP A OD2  1  
ATOM 319   H H    . ASP A 1 20 ? 2.100   -10.198 7.586   1.00 0.00 ? 20 ASP A H    1  
ATOM 320   H HA   . ASP A 1 20 ? 3.607   -12.629 8.103   1.00 0.00 ? 20 ASP A HA   1  
ATOM 321   H HB2  . ASP A 1 20 ? 3.524   -10.062 9.709   1.00 0.00 ? 20 ASP A HB2  1  
ATOM 322   H HB3  . ASP A 1 20 ? 4.788   -11.291 9.741   1.00 0.00 ? 20 ASP A HB3  1  
ATOM 323   N N    . ASN A 1 21 ? 1.071   -11.931 10.020  1.00 0.00 ? 21 ASN A N    1  
ATOM 324   C CA   . ASN A 1 21 ? 0.289   -12.494 11.171  1.00 0.00 ? 21 ASN A CA   1  
ATOM 325   C C    . ASN A 1 21 ? -0.553  -13.684 10.685  1.00 0.00 ? 21 ASN A C    1  
ATOM 326   O O    . ASN A 1 21 ? -1.230  -14.321 11.465  1.00 0.00 ? 21 ASN A O    1  
ATOM 327   C CB   . ASN A 1 21 ? -0.585  -11.416 11.818  1.00 0.00 ? 21 ASN A CB   1  
ATOM 328   C CG   . ASN A 1 21 ? -1.348  -12.016 13.001  1.00 0.00 ? 21 ASN A CG   1  
ATOM 329   O OD1  . ASN A 1 21 ? -1.014  -13.084 13.474  1.00 0.00 ? 21 ASN A OD1  1  
ATOM 330   N ND2  . ASN A 1 21 ? -2.364  -11.369 13.502  1.00 0.00 ? 21 ASN A ND2  1  
ATOM 331   H H    . ASN A 1 21 ? 0.703   -11.208 9.470   1.00 0.00 ? 21 ASN A H    1  
ATOM 332   H HA   . ASN A 1 21 ? 1.001   -12.888 11.883  1.00 0.00 ? 21 ASN A HA   1  
ATOM 333   H HB2  . ASN A 1 21 ? 0.041   -10.604 12.168  1.00 0.00 ? 21 ASN A HB2  1  
ATOM 334   H HB3  . ASN A 1 21 ? -1.289  -11.039 11.092  1.00 0.00 ? 21 ASN A HB3  1  
ATOM 335   H HD21 . ASN A 1 21 ? -2.633  -10.507 13.121  1.00 0.00 ? 21 ASN A HD21 1  
ATOM 336   H HD22 . ASN A 1 21 ? -2.859  -11.746 14.259  1.00 0.00 ? 21 ASN A HD22 1  
ATOM 337   N N    . ASN A 1 22 ? -0.454  -14.027 9.419   1.00 0.00 ? 22 ASN A N    1  
ATOM 338   C CA   . ASN A 1 22 ? -1.177  -15.237 8.878   1.00 0.00 ? 22 ASN A CA   1  
ATOM 339   C C    . ASN A 1 22 ? -2.656  -14.966 8.555   1.00 0.00 ? 22 ASN A C    1  
ATOM 340   O O    . ASN A 1 22 ? -3.502  -15.794 8.829   1.00 0.00 ? 22 ASN A O    1  
ATOM 341   C CB   . ASN A 1 22 ? -1.089  -16.389 9.905   1.00 0.00 ? 22 ASN A CB   1  
ATOM 342   C CG   . ASN A 1 22 ? -1.114  -17.743 9.183   1.00 0.00 ? 22 ASN A CG   1  
ATOM 343   O OD1  . ASN A 1 22 ? -0.294  -18.001 8.324   1.00 0.00 ? 22 ASN A OD1  1  
ATOM 344   N ND2  . ASN A 1 22 ? -2.026  -18.621 9.499   1.00 0.00 ? 22 ASN A ND2  1  
ATOM 345   H H    . ASN A 1 22 ? 0.143   -13.517 8.822   1.00 0.00 ? 22 ASN A H    1  
ATOM 346   H HA   . ASN A 1 22 ? -0.661  -15.551 7.980   1.00 0.00 ? 22 ASN A HA   1  
ATOM 347   H HB2  . ASN A 1 22 ? -0.168  -16.300 10.462  1.00 0.00 ? 22 ASN A HB2  1  
ATOM 348   H HB3  . ASN A 1 22 ? -1.926  -16.340 10.588  1.00 0.00 ? 22 ASN A HB3  1  
ATOM 349   H HD21 . ASN A 1 22 ? -2.687  -18.413 10.192  1.00 0.00 ? 22 ASN A HD21 1  
ATOM 350   H HD22 . ASN A 1 22 ? -2.049  -19.488 9.043   1.00 0.00 ? 22 ASN A HD22 1  
ATOM 351   N N    . LYS A 1 23 ? -2.988  -13.847 7.973   1.00 0.00 ? 23 LYS A N    1  
ATOM 352   C CA   . LYS A 1 23 ? -4.427  -13.580 7.638   1.00 0.00 ? 23 LYS A CA   1  
ATOM 353   C C    . LYS A 1 23 ? -4.671  -13.951 6.162   1.00 0.00 ? 23 LYS A C    1  
ATOM 354   O O    . LYS A 1 23 ? -3.782  -13.879 5.337   1.00 0.00 ? 23 LYS A O    1  
ATOM 355   C CB   . LYS A 1 23 ? -4.728  -12.099 7.867   1.00 0.00 ? 23 LYS A CB   1  
ATOM 356   C CG   . LYS A 1 23 ? -4.091  -11.597 9.206   1.00 0.00 ? 23 LYS A CG   1  
ATOM 357   C CD   . LYS A 1 23 ? -5.149  -10.941 10.116  1.00 0.00 ? 23 LYS A CD   1  
ATOM 358   C CE   . LYS A 1 23 ? -4.548  -10.696 11.503  1.00 0.00 ? 23 LYS A CE   1  
ATOM 359   N NZ   . LYS A 1 23 ? -5.613  -10.209 12.425  1.00 0.00 ? 23 LYS A NZ   1  
ATOM 360   H H    . LYS A 1 23 ? -2.300  -13.187 7.747   1.00 0.00 ? 23 LYS A H    1  
ATOM 361   H HA   . LYS A 1 23 ? -5.066  -14.152 8.277   1.00 0.00 ? 23 LYS A HA   1  
ATOM 362   H HB2  . LYS A 1 23 ? -4.323  -11.554 7.041   1.00 0.00 ? 23 LYS A HB2  1  
ATOM 363   H HB3  . LYS A 1 23 ? -5.800  -11.961 7.898   1.00 0.00 ? 23 LYS A HB3  1  
ATOM 364   H HG2  . LYS A 1 23 ? -3.647  -12.425 9.741   1.00 0.00 ? 23 LYS A HG2  1  
ATOM 365   H HG3  . LYS A 1 23 ? -3.322  -10.872 8.988   1.00 0.00 ? 23 LYS A HG3  1  
ATOM 366   H HD2  . LYS A 1 23 ? -5.467  -9.995  9.694   1.00 0.00 ? 23 LYS A HD2  1  
ATOM 367   H HD3  . LYS A 1 23 ? -5.998  -11.597 10.212  1.00 0.00 ? 23 LYS A HD3  1  
ATOM 368   H HE2  . LYS A 1 23 ? -4.137  -11.619 11.885  1.00 0.00 ? 23 LYS A HE2  1  
ATOM 369   H HE3  . LYS A 1 23 ? -3.767  -9.955  11.432  1.00 0.00 ? 23 LYS A HE3  1  
ATOM 370   H HZ1  . LYS A 1 23 ? -6.516  -10.662 12.183  1.00 0.00 ? 23 LYS A HZ1  1  
ATOM 371   H HZ2  . LYS A 1 23 ? -5.705  -9.177  12.332  1.00 0.00 ? 23 LYS A HZ2  1  
ATOM 372   H HZ3  . LYS A 1 23 ? -5.359  -10.448 13.405  1.00 0.00 ? 23 LYS A HZ3  1  
ATOM 373   N N    . THR A 1 24 ? -5.882  -14.346 5.832   1.00 0.00 ? 24 THR A N    1  
ATOM 374   C CA   . THR A 1 24 ? -6.207  -14.724 4.418   1.00 0.00 ? 24 THR A CA   1  
ATOM 375   C C    . THR A 1 24 ? -6.440  -13.477 3.560   1.00 0.00 ? 24 THR A C    1  
ATOM 376   O O    . THR A 1 24 ? -6.557  -12.379 4.063   1.00 0.00 ? 24 THR A O    1  
ATOM 377   C CB   . THR A 1 24 ? -7.488  -15.568 4.378   1.00 0.00 ? 24 THR A CB   1  
ATOM 378   O OG1  . THR A 1 24 ? -8.617  -14.707 4.320   1.00 0.00 ? 24 THR A OG1  1  
ATOM 379   C CG2  . THR A 1 24 ? -7.587  -16.441 5.623   1.00 0.00 ? 24 THR A CG2  1  
ATOM 380   H H    . THR A 1 24 ? -6.578  -14.396 6.519   1.00 0.00 ? 24 THR A H    1  
ATOM 381   H HA   . THR A 1 24 ? -5.395  -15.288 3.984   1.00 0.00 ? 24 THR A HA   1  
ATOM 382   H HB   . THR A 1 24 ? -7.477  -16.200 3.502   1.00 0.00 ? 24 THR A HB   1  
ATOM 383   H HG1  . THR A 1 24 ? -8.691  -14.375 3.422   1.00 0.00 ? 24 THR A HG1  1  
ATOM 384   H HG21 . THR A 1 24 ? -6.691  -17.035 5.719   1.00 0.00 ? 24 THR A HG21 1  
ATOM 385   H HG22 . THR A 1 24 ? -8.444  -17.091 5.532   1.00 0.00 ? 24 THR A HG22 1  
ATOM 386   H HG23 . THR A 1 24 ? -7.701  -15.815 6.493   1.00 0.00 ? 24 THR A HG23 1  
ATOM 387   N N    . GLU A 1 25 ? -6.547  -13.656 2.269   1.00 0.00 ? 25 GLU A N    1  
ATOM 388   C CA   . GLU A 1 25 ? -6.810  -12.497 1.364   1.00 0.00 ? 25 GLU A CA   1  
ATOM 389   C C    . GLU A 1 25 ? -8.177  -11.903 1.732   1.00 0.00 ? 25 GLU A C    1  
ATOM 390   O O    . GLU A 1 25 ? -8.340  -10.703 1.830   1.00 0.00 ? 25 GLU A O    1  
ATOM 391   C CB   . GLU A 1 25 ? -6.823  -12.983 -0.091  1.00 0.00 ? 25 GLU A CB   1  
ATOM 392   C CG   . GLU A 1 25 ? -6.719  -11.788 -1.044  1.00 0.00 ? 25 GLU A CG   1  
ATOM 393   C CD   . GLU A 1 25 ? -7.180  -12.204 -2.444  1.00 0.00 ? 25 GLU A CD   1  
ATOM 394   O OE1  . GLU A 1 25 ? -6.552  -13.077 -3.018  1.00 0.00 ? 25 GLU A OE1  1  
ATOM 395   O OE2  . GLU A 1 25 ? -8.154  -11.641 -2.917  1.00 0.00 ? 25 GLU A OE2  1  
ATOM 396   H H    . GLU A 1 25 ? -6.476  -14.564 1.909   1.00 0.00 ? 25 GLU A H    1  
ATOM 397   H HA   . GLU A 1 25 ? -6.042  -11.747 1.502   1.00 0.00 ? 25 GLU A HA   1  
ATOM 398   H HB2  . GLU A 1 25 ? -5.983  -13.644 -0.254  1.00 0.00 ? 25 GLU A HB2  1  
ATOM 399   H HB3  . GLU A 1 25 ? -7.742  -13.516 -0.281  1.00 0.00 ? 25 GLU A HB3  1  
ATOM 400   H HG2  . GLU A 1 25 ? -7.343  -10.983 -0.685  1.00 0.00 ? 25 GLU A HG2  1  
ATOM 401   H HG3  . GLU A 1 25 ? -5.693  -11.457 -1.092  1.00 0.00 ? 25 GLU A HG3  1  
ATOM 402   N N    . LYS A 1 26 ? -9.159  -12.743 1.921   1.00 0.00 ? 26 LYS A N    1  
ATOM 403   C CA   . LYS A 1 26 ? -10.527 -12.256 2.268   1.00 0.00 ? 26 LYS A CA   1  
ATOM 404   C C    . LYS A 1 26 ? -10.498 -11.374 3.523   1.00 0.00 ? 26 LYS A C    1  
ATOM 405   O O    . LYS A 1 26 ? -11.276 -10.450 3.655   1.00 0.00 ? 26 LYS A O    1  
ATOM 406   C CB   . LYS A 1 26 ? -11.454 -13.457 2.496   1.00 0.00 ? 26 LYS A CB   1  
ATOM 407   C CG   . LYS A 1 26 ? -12.923 -12.993 2.558   1.00 0.00 ? 26 LYS A CG   1  
ATOM 408   C CD   . LYS A 1 26 ? -13.518 -12.924 1.145   1.00 0.00 ? 26 LYS A CD   1  
ATOM 409   C CE   . LYS A 1 26 ? -14.992 -12.522 1.231   1.00 0.00 ? 26 LYS A CE   1  
ATOM 410   N NZ   . LYS A 1 26 ? -15.696 -13.415 2.194   1.00 0.00 ? 26 LYS A NZ   1  
ATOM 411   H H    . LYS A 1 26 ? -8.999  -13.703 1.821   1.00 0.00 ? 26 LYS A H    1  
ATOM 412   H HA   . LYS A 1 26 ? -10.911 -11.668 1.461   1.00 0.00 ? 26 LYS A HA   1  
ATOM 413   H HB2  . LYS A 1 26 ? -11.329 -14.163 1.687   1.00 0.00 ? 26 LYS A HB2  1  
ATOM 414   H HB3  . LYS A 1 26 ? -11.192 -13.937 3.426   1.00 0.00 ? 26 LYS A HB3  1  
ATOM 415   H HG2  . LYS A 1 26 ? -13.494 -13.695 3.150   1.00 0.00 ? 26 LYS A HG2  1  
ATOM 416   H HG3  . LYS A 1 26 ? -12.978 -12.016 3.016   1.00 0.00 ? 26 LYS A HG3  1  
ATOM 417   H HD2  . LYS A 1 26 ? -12.981 -12.194 0.560   1.00 0.00 ? 26 LYS A HD2  1  
ATOM 418   H HD3  . LYS A 1 26 ? -13.439 -13.892 0.674   1.00 0.00 ? 26 LYS A HD3  1  
ATOM 419   H HE2  . LYS A 1 26 ? -15.067 -11.499 1.568   1.00 0.00 ? 26 LYS A HE2  1  
ATOM 420   H HE3  . LYS A 1 26 ? -15.447 -12.614 0.256   1.00 0.00 ? 26 LYS A HE3  1  
ATOM 421   H HZ1  . LYS A 1 26 ? -16.701 -13.152 2.240   1.00 0.00 ? 26 LYS A HZ1  1  
ATOM 422   H HZ2  . LYS A 1 26 ? -15.267 -13.315 3.136   1.00 0.00 ? 26 LYS A HZ2  1  
ATOM 423   H HZ3  . LYS A 1 26 ? -15.614 -14.402 1.877   1.00 0.00 ? 26 LYS A HZ3  1  
ATOM 424   N N    . GLU A 1 27 ? -9.623  -11.647 4.446   1.00 0.00 ? 27 GLU A N    1  
ATOM 425   C CA   . GLU A 1 27 ? -9.568  -10.818 5.688   1.00 0.00 ? 27 GLU A CA   1  
ATOM 426   C C    . GLU A 1 27 ? -8.877  -9.472  5.410   1.00 0.00 ? 27 GLU A C    1  
ATOM 427   O O    . GLU A 1 27 ? -9.253  -8.457  5.961   1.00 0.00 ? 27 GLU A O    1  
ATOM 428   C CB   . GLU A 1 27 ? -8.790  -11.571 6.771   1.00 0.00 ? 27 GLU A CB   1  
ATOM 429   C CG   . GLU A 1 27 ? -9.677  -12.652 7.399   1.00 0.00 ? 27 GLU A CG   1  
ATOM 430   C CD   . GLU A 1 27 ? -10.748 -11.993 8.271   1.00 0.00 ? 27 GLU A CD   1  
ATOM 431   O OE1  . GLU A 1 27 ? -10.380 -11.258 9.173   1.00 0.00 ? 27 GLU A OE1  1  
ATOM 432   O OE2  . GLU A 1 27 ? -11.918 -12.233 8.021   1.00 0.00 ? 27 GLU A OE2  1  
ATOM 433   H H    . GLU A 1 27 ? -9.004  -12.397 4.323   1.00 0.00 ? 27 GLU A H    1  
ATOM 434   H HA   . GLU A 1 27 ? -10.570 -10.633 6.048   1.00 0.00 ? 27 GLU A HA   1  
ATOM 435   H HB2  . GLU A 1 27 ? -7.917  -12.029 6.335   1.00 0.00 ? 27 GLU A HB2  1  
ATOM 436   H HB3  . GLU A 1 27 ? -8.488  -10.876 7.537   1.00 0.00 ? 27 GLU A HB3  1  
ATOM 437   H HG2  . GLU A 1 27 ? -10.151 -13.227 6.620   1.00 0.00 ? 27 GLU A HG2  1  
ATOM 438   H HG3  . GLU A 1 27 ? -9.073  -13.305 8.010   1.00 0.00 ? 27 GLU A HG3  1  
ATOM 439   N N    . ILE A 1 28 ? -7.875  -9.444  4.574   1.00 0.00 ? 28 ILE A N    1  
ATOM 440   C CA   . ILE A 1 28 ? -7.182  -8.149  4.294   1.00 0.00 ? 28 ILE A CA   1  
ATOM 441   C C    . ILE A 1 28 ? -8.173  -7.203  3.624   1.00 0.00 ? 28 ILE A C    1  
ATOM 442   O O    . ILE A 1 28 ? -8.202  -6.021  3.904   1.00 0.00 ? 28 ILE A O    1  
ATOM 443   C CB   . ILE A 1 28 ? -5.973  -8.420  3.379   1.00 0.00 ? 28 ILE A CB   1  
ATOM 444   C CG1  . ILE A 1 28 ? -5.222  -9.685  3.904   1.00 0.00 ? 28 ILE A CG1  1  
ATOM 445   C CG2  . ILE A 1 28 ? -5.061  -7.185  3.332   1.00 0.00 ? 28 ILE A CG2  1  
ATOM 446   C CD1  . ILE A 1 28 ? -3.695  -9.519  3.937   1.00 0.00 ? 28 ILE A CD1  1  
ATOM 447   H H    . ILE A 1 28 ? -7.576  -10.265 4.130   1.00 0.00 ? 28 ILE A H    1  
ATOM 448   H HA   . ILE A 1 28 ? -6.851  -7.717  5.227   1.00 0.00 ? 28 ILE A HA   1  
ATOM 449   H HB   . ILE A 1 28 ? -6.336  -8.610  2.381   1.00 0.00 ? 28 ILE A HB   1  
ATOM 450   H HG12 . ILE A 1 28 ? -5.557  -9.909  4.896   1.00 0.00 ? 28 ILE A HG12 1  
ATOM 451   H HG13 . ILE A 1 28 ? -5.458  -10.517 3.272   1.00 0.00 ? 28 ILE A HG13 1  
ATOM 452   H HG21 . ILE A 1 28 ? -4.268  -7.354  2.617   1.00 0.00 ? 28 ILE A HG21 1  
ATOM 453   H HG22 . ILE A 1 28 ? -4.636  -7.007  4.307   1.00 0.00 ? 28 ILE A HG22 1  
ATOM 454   H HG23 . ILE A 1 28 ? -5.637  -6.328  3.028   1.00 0.00 ? 28 ILE A HG23 1  
ATOM 455   H HD11 . ILE A 1 28 ? -3.333  -9.291  2.945   1.00 0.00 ? 28 ILE A HD11 1  
ATOM 456   H HD12 . ILE A 1 28 ? -3.248  -10.444 4.281   1.00 0.00 ? 28 ILE A HD12 1  
ATOM 457   H HD13 . ILE A 1 28 ? -3.430  -8.723  4.614   1.00 0.00 ? 28 ILE A HD13 1  
ATOM 458   N N    . LEU A 1 29 ? -8.996  -7.708  2.753   1.00 0.00 ? 29 LEU A N    1  
ATOM 459   C CA   . LEU A 1 29 ? -9.993  -6.834  2.082   1.00 0.00 ? 29 LEU A CA   1  
ATOM 460   C C    . LEU A 1 29 ? -11.111 -6.484  3.072   1.00 0.00 ? 29 LEU A C    1  
ATOM 461   O O    . LEU A 1 29 ? -11.724 -5.441  2.996   1.00 0.00 ? 29 LEU A O    1  
ATOM 462   C CB   . LEU A 1 29 ? -10.567 -7.576  0.875   1.00 0.00 ? 29 LEU A CB   1  
ATOM 463   C CG   . LEU A 1 29 ? -9.415  -8.070  -0.011  1.00 0.00 ? 29 LEU A CG   1  
ATOM 464   C CD1  . LEU A 1 29 ? -9.986  -8.894  -1.169  1.00 0.00 ? 29 LEU A CD1  1  
ATOM 465   C CD2  . LEU A 1 29 ? -8.636  -6.867  -0.572  1.00 0.00 ? 29 LEU A CD2  1  
ATOM 466   H H    . LEU A 1 29 ? -8.965  -8.662  2.531   1.00 0.00 ? 29 LEU A H    1  
ATOM 467   H HA   . LEU A 1 29 ? -9.513  -5.925  1.753   1.00 0.00 ? 29 LEU A HA   1  
ATOM 468   H HB2  . LEU A 1 29 ? -11.148 -8.422  1.215   1.00 0.00 ? 29 LEU A HB2  1  
ATOM 469   H HB3  . LEU A 1 29 ? -11.197 -6.909  0.306   1.00 0.00 ? 29 LEU A HB3  1  
ATOM 470   H HG   . LEU A 1 29 ? -8.748  -8.690  0.579   1.00 0.00 ? 29 LEU A HG   1  
ATOM 471   H HD11 . LEU A 1 29 ? -9.224  -9.032  -1.922  1.00 0.00 ? 29 LEU A HD11 1  
ATOM 472   H HD12 . LEU A 1 29 ? -10.828 -8.373  -1.601  1.00 0.00 ? 29 LEU A HD12 1  
ATOM 473   H HD13 . LEU A 1 29 ? -10.308 -9.857  -0.803  1.00 0.00 ? 29 LEU A HD13 1  
ATOM 474   H HD21 . LEU A 1 29 ? -7.936  -6.514  0.171   1.00 0.00 ? 29 LEU A HD21 1  
ATOM 475   H HD22 . LEU A 1 29 ? -9.323  -6.072  -0.825  1.00 0.00 ? 29 LEU A HD22 1  
ATOM 476   H HD23 . LEU A 1 29 ? -8.094  -7.165  -1.458  1.00 0.00 ? 29 LEU A HD23 1  
ATOM 477   N N    . ASP A 1 30 ? -11.363 -7.348  4.018   1.00 0.00 ? 30 ASP A N    1  
ATOM 478   C CA   . ASP A 1 30 ? -12.415 -7.055  5.036   1.00 0.00 ? 30 ASP A CA   1  
ATOM 479   C C    . ASP A 1 30 ? -11.918 -5.907  5.924   1.00 0.00 ? 30 ASP A C    1  
ATOM 480   O O    . ASP A 1 30 ? -12.651 -4.989  6.236   1.00 0.00 ? 30 ASP A O    1  
ATOM 481   C CB   . ASP A 1 30 ? -12.666 -8.300  5.890   1.00 0.00 ? 30 ASP A CB   1  
ATOM 482   C CG   . ASP A 1 30 ? -13.841 -8.042  6.836   1.00 0.00 ? 30 ASP A CG   1  
ATOM 483   O OD1  . ASP A 1 30 ? -13.604 -7.528  7.917   1.00 0.00 ? 30 ASP A OD1  1  
ATOM 484   O OD2  . ASP A 1 30 ? -14.957 -8.364  6.464   1.00 0.00 ? 30 ASP A OD2  1  
ATOM 485   H H    . ASP A 1 30 ? -10.849 -8.181  4.055   1.00 0.00 ? 30 ASP A H    1  
ATOM 486   H HA   . ASP A 1 30 ? -13.331 -6.751  4.550   1.00 0.00 ? 30 ASP A HA   1  
ATOM 487   H HB2  . ASP A 1 30 ? -12.898 -9.137  5.247   1.00 0.00 ? 30 ASP A HB2  1  
ATOM 488   H HB3  . ASP A 1 30 ? -11.783 -8.524  6.469   1.00 0.00 ? 30 ASP A HB3  1  
ATOM 489   N N    . ALA A 1 31 ? -10.686 -5.967  6.352   1.00 0.00 ? 31 ALA A N    1  
ATOM 490   C CA   . ALA A 1 31 ? -10.141 -4.900  7.244   1.00 0.00 ? 31 ALA A CA   1  
ATOM 491   C C    . ALA A 1 31 ? -10.014 -3.574  6.480   1.00 0.00 ? 31 ALA A C    1  
ATOM 492   O O    . ALA A 1 31 ? -10.063 -2.513  7.071   1.00 0.00 ? 31 ALA A O    1  
ATOM 493   C CB   . ALA A 1 31 ? -8.767  -5.343  7.755   1.00 0.00 ? 31 ALA A CB   1  
ATOM 494   H H    . ALA A 1 31 ? -10.121 -6.727  6.101   1.00 0.00 ? 31 ALA A H    1  
ATOM 495   H HA   . ALA A 1 31 ? -10.803 -4.765  8.083   1.00 0.00 ? 31 ALA A HA   1  
ATOM 496   H HB1  . ALA A 1 31 ? -8.039  -5.253  6.963   1.00 0.00 ? 31 ALA A HB1  1  
ATOM 497   H HB2  . ALA A 1 31 ? -8.821  -6.373  8.077   1.00 0.00 ? 31 ALA A HB2  1  
ATOM 498   H HB3  . ALA A 1 31 ? -8.474  -4.723  8.589   1.00 0.00 ? 31 ALA A HB3  1  
ATOM 499   N N    . PHE A 1 32 ? -9.885  -3.605  5.188   1.00 0.00 ? 32 PHE A N    1  
ATOM 500   C CA   . PHE A 1 32 ? -9.796  -2.327  4.417   1.00 0.00 ? 32 PHE A CA   1  
ATOM 501   C C    . PHE A 1 32 ? -10.989 -1.440  4.783   1.00 0.00 ? 32 PHE A C    1  
ATOM 502   O O    . PHE A 1 32 ? -11.065 -0.294  4.389   1.00 0.00 ? 32 PHE A O    1  
ATOM 503   C CB   . PHE A 1 32 ? -9.852  -2.672  2.920   1.00 0.00 ? 32 PHE A CB   1  
ATOM 504   C CG   . PHE A 1 32 ? -8.485  -3.084  2.378   1.00 0.00 ? 32 PHE A CG   1  
ATOM 505   C CD1  . PHE A 1 32 ? -7.413  -3.451  3.226   1.00 0.00 ? 32 PHE A CD1  1  
ATOM 506   C CD2  . PHE A 1 32 ? -8.291  -3.083  0.990   1.00 0.00 ? 32 PHE A CD2  1  
ATOM 507   C CE1  . PHE A 1 32 ? -6.177  -3.803  2.675   1.00 0.00 ? 32 PHE A CE1  1  
ATOM 508   C CE2  . PHE A 1 32 ? -7.050  -3.434  0.448   1.00 0.00 ? 32 PHE A CE2  1  
ATOM 509   C CZ   . PHE A 1 32 ? -5.993  -3.791  1.290   1.00 0.00 ? 32 PHE A CZ   1  
ATOM 510   H H    . PHE A 1 32 ? -9.870  -4.461  4.710   1.00 0.00 ? 32 PHE A H    1  
ATOM 511   H HA   . PHE A 1 32 ? -8.872  -1.810  4.632   1.00 0.00 ? 32 PHE A HA   1  
ATOM 512   H HB2  . PHE A 1 32 ? -10.543 -3.482  2.773   1.00 0.00 ? 32 PHE A HB2  1  
ATOM 513   H HB3  . PHE A 1 32 ? -10.202 -1.811  2.368   1.00 0.00 ? 32 PHE A HB3  1  
ATOM 514   H HD1  . PHE A 1 32 ? -7.535  -3.485  4.294   1.00 0.00 ? 32 PHE A HD1  1  
ATOM 515   H HD2  . PHE A 1 32 ? -9.106  -2.812  0.335   1.00 0.00 ? 32 PHE A HD2  1  
ATOM 516   H HE1  . PHE A 1 32 ? -5.357  -4.072  3.324   1.00 0.00 ? 32 PHE A HE1  1  
ATOM 517   H HE2  . PHE A 1 32 ? -6.909  -3.430  -0.623  1.00 0.00 ? 32 PHE A HE2  1  
ATOM 518   H HZ   . PHE A 1 32 ? -5.037  -4.063  0.870   1.00 0.00 ? 32 PHE A HZ   1  
ATOM 519   N N    . ASP A 1 33 ? -11.935 -1.969  5.509   1.00 0.00 ? 33 ASP A N    1  
ATOM 520   C CA   . ASP A 1 33 ? -13.138 -1.164  5.866   1.00 0.00 ? 33 ASP A CA   1  
ATOM 521   C C    . ASP A 1 33 ? -12.874 -0.326  7.117   1.00 0.00 ? 33 ASP A C    1  
ATOM 522   O O    . ASP A 1 33 ? -13.565 0.641   7.371   1.00 0.00 ? 33 ASP A O    1  
ATOM 523   C CB   . ASP A 1 33 ? -14.312 -2.108  6.129   1.00 0.00 ? 33 ASP A CB   1  
ATOM 524   C CG   . ASP A 1 33 ? -15.565 -1.291  6.448   1.00 0.00 ? 33 ASP A CG   1  
ATOM 525   O OD1  . ASP A 1 33 ? -15.741 -0.938  7.603   1.00 0.00 ? 33 ASP A OD1  1  
ATOM 526   O OD2  . ASP A 1 33 ? -16.328 -1.032  5.532   1.00 0.00 ? 33 ASP A OD2  1  
ATOM 527   H H    . ASP A 1 33 ? -11.865 -2.903  5.802   1.00 0.00 ? 33 ASP A H    1  
ATOM 528   H HA   . ASP A 1 33 ? -13.390 -0.508  5.046   1.00 0.00 ? 33 ASP A HA   1  
ATOM 529   H HB2  . ASP A 1 33 ? -14.490 -2.714  5.252   1.00 0.00 ? 33 ASP A HB2  1  
ATOM 530   H HB3  . ASP A 1 33 ? -14.079 -2.748  6.967   1.00 0.00 ? 33 ASP A HB3  1  
ATOM 531   N N    . LYS A 1 34 ? -11.878 -0.673  7.897   1.00 0.00 ? 34 LYS A N    1  
ATOM 532   C CA   . LYS A 1 34 ? -11.564 0.120   9.129   1.00 0.00 ? 34 LYS A CA   1  
ATOM 533   C C    . LYS A 1 34 ? -10.063 0.430   9.166   1.00 0.00 ? 34 LYS A C    1  
ATOM 534   O O    . LYS A 1 34 ? -9.540  0.879   10.165  1.00 0.00 ? 34 LYS A O    1  
ATOM 535   C CB   . LYS A 1 34 ? -11.968 -0.671  10.379  1.00 0.00 ? 34 LYS A CB   1  
ATOM 536   C CG   . LYS A 1 34 ? -11.147 -1.957  10.483  1.00 0.00 ? 34 LYS A CG   1  
ATOM 537   C CD   . LYS A 1 34 ? -11.665 -2.792  11.658  1.00 0.00 ? 34 LYS A CD   1  
ATOM 538   C CE   . LYS A 1 34 ? -10.654 -3.888  11.995  1.00 0.00 ? 34 LYS A CE   1  
ATOM 539   N NZ   . LYS A 1 34 ? -11.097 -4.610  13.221  1.00 0.00 ? 34 LYS A NZ   1  
ATOM 540   H H    . LYS A 1 34 ? -11.330 -1.456  7.679   1.00 0.00 ? 34 LYS A H    1  
ATOM 541   H HA   . LYS A 1 34 ? -12.108 1.055   9.114   1.00 0.00 ? 34 LYS A HA   1  
ATOM 542   H HB2  . LYS A 1 34 ? -11.796 -0.065  11.256  1.00 0.00 ? 34 LYS A HB2  1  
ATOM 543   H HB3  . LYS A 1 34 ? -13.017 -0.922  10.318  1.00 0.00 ? 34 LYS A HB3  1  
ATOM 544   H HG2  . LYS A 1 34 ? -11.244 -2.523  9.568   1.00 0.00 ? 34 LYS A HG2  1  
ATOM 545   H HG3  . LYS A 1 34 ? -10.109 -1.712  10.650  1.00 0.00 ? 34 LYS A HG3  1  
ATOM 546   H HD2  . LYS A 1 34 ? -11.805 -2.154  12.519  1.00 0.00 ? 34 LYS A HD2  1  
ATOM 547   H HD3  . LYS A 1 34 ? -12.607 -3.245  11.389  1.00 0.00 ? 34 LYS A HD3  1  
ATOM 548   H HE2  . LYS A 1 34 ? -10.590 -4.583  11.172  1.00 0.00 ? 34 LYS A HE2  1  
ATOM 549   H HE3  . LYS A 1 34 ? -9.685  -3.444  12.168  1.00 0.00 ? 34 LYS A HE3  1  
ATOM 550   H HZ1  . LYS A 1 34 ? -12.135 -4.638  13.252  1.00 0.00 ? 34 LYS A HZ1  1  
ATOM 551   H HZ2  . LYS A 1 34 ? -10.737 -4.114  14.063  1.00 0.00 ? 34 LYS A HZ2  1  
ATOM 552   H HZ3  . LYS A 1 34 ? -10.726 -5.581  13.206  1.00 0.00 ? 34 LYS A HZ3  1  
ATOM 553   N N    . MET A 1 35 ? -9.361  0.197   8.083   1.00 0.00 ? 35 MET A N    1  
ATOM 554   C CA   . MET A 1 35 ? -7.895  0.490   8.071   1.00 0.00 ? 35 MET A CA   1  
ATOM 555   C C    . MET A 1 35 ? -7.690  1.993   7.845   1.00 0.00 ? 35 MET A C    1  
ATOM 556   O O    . MET A 1 35 ? -6.871  2.601   8.505   1.00 0.00 ? 35 MET A O    1  
ATOM 557   C CB   . MET A 1 35 ? -7.212  -0.335  6.954   1.00 0.00 ? 35 MET A CB   1  
ATOM 558   C CG   . MET A 1 35 ? -5.966  -1.045  7.486   1.00 0.00 ? 35 MET A CG   1  
ATOM 559   S SD   . MET A 1 35 ? -4.965  -1.632  6.090   1.00 0.00 ? 35 MET A SD   1  
ATOM 560   C CE   . MET A 1 35 ? -5.192  -3.412  6.345   1.00 0.00 ? 35 MET A CE   1  
ATOM 561   H H    . MET A 1 35 ? -9.796  -0.162  7.281   1.00 0.00 ? 35 MET A H    1  
ATOM 562   H HA   . MET A 1 35 ? -7.478  0.222   9.034   1.00 0.00 ? 35 MET A HA   1  
ATOM 563   H HB2  . MET A 1 35 ? -7.903  -1.073  6.608   1.00 0.00 ? 35 MET A HB2  1  
ATOM 564   H HB3  . MET A 1 35 ? -6.927  0.303   6.128   1.00 0.00 ? 35 MET A HB3  1  
ATOM 565   H HG2  . MET A 1 35 ? -5.389  -0.354  8.080   1.00 0.00 ? 35 MET A HG2  1  
ATOM 566   H HG3  . MET A 1 35 ? -6.268  -1.880  8.096   1.00 0.00 ? 35 MET A HG3  1  
ATOM 567   H HE1  . MET A 1 35 ? -4.605  -3.958  5.618   1.00 0.00 ? 35 MET A HE1  1  
ATOM 568   H HE2  . MET A 1 35 ? -6.234  -3.666  6.227   1.00 0.00 ? 35 MET A HE2  1  
ATOM 569   H HE3  . MET A 1 35 ? -4.871  -3.672  7.342   1.00 0.00 ? 35 MET A HE3  1  
ATOM 570   N N    . CYS A 1 36 ? -8.409  2.622   6.946   1.00 0.00 ? 36 CYS A N    1  
ATOM 571   C CA   . CYS A 1 36 ? -8.176  4.079   6.782   1.00 0.00 ? 36 CYS A CA   1  
ATOM 572   C C    . CYS A 1 36 ? -8.589  4.741   8.090   1.00 0.00 ? 36 CYS A C    1  
ATOM 573   O O    . CYS A 1 36 ? -8.454  5.935   8.272   1.00 0.00 ? 36 CYS A O    1  
ATOM 574   C CB   . CYS A 1 36 ? -8.986  4.660   5.618   1.00 0.00 ? 36 CYS A CB   1  
ATOM 575   S SG   . CYS A 1 36 ? -8.152  6.137   5.001   1.00 0.00 ? 36 CYS A SG   1  
ATOM 576   H H    . CYS A 1 36 ? -9.086  2.156   6.410   1.00 0.00 ? 36 CYS A H    1  
ATOM 577   H HA   . CYS A 1 36 ? -7.120  4.239   6.628   1.00 0.00 ? 36 CYS A HA   1  
ATOM 578   H HB2  . CYS A 1 36 ? -9.057  3.936   4.827   1.00 0.00 ? 36 CYS A HB2  1  
ATOM 579   H HB3  . CYS A 1 36 ? -9.980  4.926   5.950   1.00 0.00 ? 36 CYS A HB3  1  
ATOM 580   N N    . SER A 1 37 ? -9.104  3.964   9.002   1.00 0.00 ? 37 SER A N    1  
ATOM 581   C CA   . SER A 1 37 ? -9.545  4.542   10.309  1.00 0.00 ? 37 SER A CA   1  
ATOM 582   C C    . SER A 1 37 ? -8.351  4.686   11.261  1.00 0.00 ? 37 SER A C    1  
ATOM 583   O O    . SER A 1 37 ? -8.526  4.919   12.441  1.00 0.00 ? 37 SER A O    1  
ATOM 584   C CB   . SER A 1 37 ? -10.594 3.627   10.944  1.00 0.00 ? 37 SER A CB   1  
ATOM 585   O OG   . SER A 1 37 ? -11.483 3.165   9.937   1.00 0.00 ? 37 SER A OG   1  
ATOM 586   H H    . SER A 1 37 ? -9.210  2.995   8.820   1.00 0.00 ? 37 SER A H    1  
ATOM 587   H HA   . SER A 1 37 ? -9.982  5.515   10.139  1.00 0.00 ? 37 SER A HA   1  
ATOM 588   H HB2  . SER A 1 37 ? -10.111 2.783   11.407  1.00 0.00 ? 37 SER A HB2  1  
ATOM 589   H HB3  . SER A 1 37 ? -11.142 4.180   11.696  1.00 0.00 ? 37 SER A HB3  1  
ATOM 590   H HG   . SER A 1 37 ? -11.161 3.479   9.089   1.00 0.00 ? 37 SER A HG   1  
ATOM 591   N N    . LYS A 1 38 ? -7.140  4.550   10.765  1.00 0.00 ? 38 LYS A N    1  
ATOM 592   C CA   . LYS A 1 38 ? -5.930  4.680   11.649  1.00 0.00 ? 38 LYS A CA   1  
ATOM 593   C C    . LYS A 1 38 ? -5.061  5.860   11.182  1.00 0.00 ? 38 LYS A C    1  
ATOM 594   O O    . LYS A 1 38 ? -3.980  6.079   11.693  1.00 0.00 ? 38 LYS A O    1  
ATOM 595   C CB   . LYS A 1 38 ? -5.118  3.375   11.601  1.00 0.00 ? 38 LYS A CB   1  
ATOM 596   C CG   . LYS A 1 38 ? -5.777  2.326   12.501  1.00 0.00 ? 38 LYS A CG   1  
ATOM 597   C CD   . LYS A 1 38 ? -4.934  1.049   12.499  1.00 0.00 ? 38 LYS A CD   1  
ATOM 598   C CE   . LYS A 1 38 ? -5.681  -0.056  13.250  1.00 0.00 ? 38 LYS A CE   1  
ATOM 599   N NZ   . LYS A 1 38 ? -5.862  0.347   14.673  1.00 0.00 ? 38 LYS A NZ   1  
ATOM 600   H H    . LYS A 1 38 ? -7.025  4.362   9.810   1.00 0.00 ? 38 LYS A H    1  
ATOM 601   H HA   . LYS A 1 38 ? -6.236  4.866   12.671  1.00 0.00 ? 38 LYS A HA   1  
ATOM 602   H HB2  . LYS A 1 38 ? -5.088  3.004   10.588  1.00 0.00 ? 38 LYS A HB2  1  
ATOM 603   H HB3  . LYS A 1 38 ? -4.112  3.560   11.948  1.00 0.00 ? 38 LYS A HB3  1  
ATOM 604   H HG2  . LYS A 1 38 ? -5.847  2.710   13.509  1.00 0.00 ? 38 LYS A HG2  1  
ATOM 605   H HG3  . LYS A 1 38 ? -6.766  2.103   12.130  1.00 0.00 ? 38 LYS A HG3  1  
ATOM 606   H HD2  . LYS A 1 38 ? -4.756  0.736   11.480  1.00 0.00 ? 38 LYS A HD2  1  
ATOM 607   H HD3  . LYS A 1 38 ? -3.991  1.239   12.988  1.00 0.00 ? 38 LYS A HD3  1  
ATOM 608   H HE2  . LYS A 1 38 ? -6.648  -0.211  12.794  1.00 0.00 ? 38 LYS A HE2  1  
ATOM 609   H HE3  . LYS A 1 38 ? -5.110  -0.971  13.205  1.00 0.00 ? 38 LYS A HE3  1  
ATOM 610   H HZ1  . LYS A 1 38 ? -6.766  0.849   14.780  1.00 0.00 ? 38 LYS A HZ1  1  
ATOM 611   H HZ2  . LYS A 1 38 ? -5.081  0.973   14.958  1.00 0.00 ? 38 LYS A HZ2  1  
ATOM 612   H HZ3  . LYS A 1 38 ? -5.866  -0.500  15.276  1.00 0.00 ? 38 LYS A HZ3  1  
ATOM 613   N N    . LEU A 1 39 ? -5.530  6.627   10.222  1.00 0.00 ? 39 LEU A N    1  
ATOM 614   C CA   . LEU A 1 39 ? -4.744  7.809   9.718   1.00 0.00 ? 39 LEU A CA   1  
ATOM 615   C C    . LEU A 1 39 ? -5.534  9.094   10.042  1.00 0.00 ? 39 LEU A C    1  
ATOM 616   O O    . LEU A 1 39 ? -6.745  9.081   9.951   1.00 0.00 ? 39 LEU A O    1  
ATOM 617   C CB   . LEU A 1 39 ? -4.599  7.706   8.191   1.00 0.00 ? 39 LEU A CB   1  
ATOM 618   C CG   . LEU A 1 39 ? -3.895  6.402   7.797   1.00 0.00 ? 39 LEU A CG   1  
ATOM 619   C CD1  . LEU A 1 39 ? -3.888  6.277   6.273   1.00 0.00 ? 39 LEU A CD1  1  
ATOM 620   C CD2  . LEU A 1 39 ? -2.445  6.405   8.306   1.00 0.00 ? 39 LEU A CD2  1  
ATOM 621   H H    . LEU A 1 39 ? -6.408  6.431   9.834   1.00 0.00 ? 39 LEU A H    1  
ATOM 622   H HA   . LEU A 1 39 ? -3.773  7.832   10.181  1.00 0.00 ? 39 LEU A HA   1  
ATOM 623   H HB2  . LEU A 1 39 ? -5.582  7.726   7.744   1.00 0.00 ? 39 LEU A HB2  1  
ATOM 624   H HB3  . LEU A 1 39 ? -4.028  8.542   7.822   1.00 0.00 ? 39 LEU A HB3  1  
ATOM 625   H HG   . LEU A 1 39 ? -4.427  5.567   8.219   1.00 0.00 ? 39 LEU A HG   1  
ATOM 626   H HD11 . LEU A 1 39 ? -3.640  5.264   5.997   1.00 0.00 ? 39 LEU A HD11 1  
ATOM 627   H HD12 . LEU A 1 39 ? -3.153  6.950   5.864   1.00 0.00 ? 39 LEU A HD12 1  
ATOM 628   H HD13 . LEU A 1 39 ? -4.863  6.529   5.885   1.00 0.00 ? 39 LEU A HD13 1  
ATOM 629   H HD21 . LEU A 1 39 ? -2.012  7.382   8.158   1.00 0.00 ? 39 LEU A HD21 1  
ATOM 630   H HD22 . LEU A 1 39 ? -1.868  5.675   7.758   1.00 0.00 ? 39 LEU A HD22 1  
ATOM 631   H HD23 . LEU A 1 39 ? -2.428  6.156   9.355   1.00 0.00 ? 39 LEU A HD23 1  
ATOM 632   N N    . PRO A 1 40 ? -4.862  10.181  10.396  1.00 0.00 ? 40 PRO A N    1  
ATOM 633   C CA   . PRO A 1 40 ? -5.571  11.435  10.696  1.00 0.00 ? 40 PRO A CA   1  
ATOM 634   C C    . PRO A 1 40 ? -6.644  11.711  9.623   1.00 0.00 ? 40 PRO A C    1  
ATOM 635   O O    . PRO A 1 40 ? -6.576  11.174  8.536   1.00 0.00 ? 40 PRO A O    1  
ATOM 636   C CB   . PRO A 1 40 ? -4.464  12.516  10.741  1.00 0.00 ? 40 PRO A CB   1  
ATOM 637   C CG   . PRO A 1 40 ? -3.097  11.771  10.735  1.00 0.00 ? 40 PRO A CG   1  
ATOM 638   C CD   . PRO A 1 40 ? -3.389  10.268  10.534  1.00 0.00 ? 40 PRO A CD   1  
ATOM 639   H HA   . PRO A 1 40 ? -6.044  11.350  11.659  1.00 0.00 ? 40 PRO A HA   1  
ATOM 640   H HB2  . PRO A 1 40 ? -4.535  13.164  9.875   1.00 0.00 ? 40 PRO A HB2  1  
ATOM 641   H HB3  . PRO A 1 40 ? -4.550  13.104  11.645  1.00 0.00 ? 40 PRO A HB3  1  
ATOM 642   H HG2  . PRO A 1 40 ? -2.478  12.142  9.925   1.00 0.00 ? 40 PRO A HG2  1  
ATOM 643   H HG3  . PRO A 1 40 ? -2.588  11.921  11.678  1.00 0.00 ? 40 PRO A HG3  1  
ATOM 644   H HD2  . PRO A 1 40 ? -2.898  9.913   9.648   1.00 0.00 ? 40 PRO A HD2  1  
ATOM 645   H HD3  . PRO A 1 40 ? -3.066  9.701   11.396  1.00 0.00 ? 40 PRO A HD3  1  
ATOM 646   N N    . LYS A 1 41 ? -7.636  12.511  9.901   1.00 0.00 ? 41 LYS A N    1  
ATOM 647   C CA   . LYS A 1 41 ? -8.687  12.758  8.867   1.00 0.00 ? 41 LYS A CA   1  
ATOM 648   C C    . LYS A 1 41 ? -8.109  13.470  7.643   1.00 0.00 ? 41 LYS A C    1  
ATOM 649   O O    . LYS A 1 41 ? -8.746  13.556  6.612   1.00 0.00 ? 41 LYS A O    1  
ATOM 650   C CB   . LYS A 1 41 ? -9.804  13.611  9.454   1.00 0.00 ? 41 LYS A CB   1  
ATOM 651   C CG   . LYS A 1 41 ? -10.981 13.670  8.471   1.00 0.00 ? 41 LYS A CG   1  
ATOM 652   C CD   . LYS A 1 41 ? -12.220 14.225  9.181   1.00 0.00 ? 41 LYS A CD   1  
ATOM 653   C CE   . LYS A 1 41 ? -11.955 15.659  9.652   1.00 0.00 ? 41 LYS A CE   1  
ATOM 654   N NZ   . LYS A 1 41 ? -11.180 15.627  10.925  1.00 0.00 ? 41 LYS A NZ   1  
ATOM 655   H H    . LYS A 1 41 ? -7.703  12.943  10.778  1.00 0.00 ? 41 LYS A H    1  
ATOM 656   H HA   . LYS A 1 41 ? -9.091  11.821  8.518   1.00 0.00 ? 41 LYS A HA   1  
ATOM 657   H HB2  . LYS A 1 41 ? -10.130 13.182  10.388  1.00 0.00 ? 41 LYS A HB2  1  
ATOM 658   H HB3  . LYS A 1 41 ? -9.430  14.607  9.623   1.00 0.00 ? 41 LYS A HB3  1  
ATOM 659   H HG2  . LYS A 1 41 ? -10.724 14.313  7.642   1.00 0.00 ? 41 LYS A HG2  1  
ATOM 660   H HG3  . LYS A 1 41 ? -11.197 12.679  8.102   1.00 0.00 ? 41 LYS A HG3  1  
ATOM 661   H HD2  . LYS A 1 41 ? -13.056 14.221  8.497   1.00 0.00 ? 41 LYS A HD2  1  
ATOM 662   H HD3  . LYS A 1 41 ? -12.451 13.606  10.035  1.00 0.00 ? 41 LYS A HD3  1  
ATOM 663   H HE2  . LYS A 1 41 ? -11.391 16.192  8.900   1.00 0.00 ? 41 LYS A HE2  1  
ATOM 664   H HE3  . LYS A 1 41 ? -12.896 16.161  9.818   1.00 0.00 ? 41 LYS A HE3  1  
ATOM 665   H HZ1  . LYS A 1 41 ? -11.737 16.072  11.681  1.00 0.00 ? 41 LYS A HZ1  1  
ATOM 666   H HZ2  . LYS A 1 41 ? -10.287 16.145  10.799  1.00 0.00 ? 41 LYS A HZ2  1  
ATOM 667   H HZ3  . LYS A 1 41 ? -10.977 14.640  11.182  1.00 0.00 ? 41 LYS A HZ3  1  
ATOM 668   N N    . SER A 1 42 ? -6.949  14.051  7.763   1.00 0.00 ? 42 SER A N    1  
ATOM 669   C CA   . SER A 1 42 ? -6.399  14.832  6.618   1.00 0.00 ? 42 SER A CA   1  
ATOM 670   C C    . SER A 1 42 ? -5.936  13.957  5.451   1.00 0.00 ? 42 SER A C    1  
ATOM 671   O O    . SER A 1 42 ? -5.727  14.438  4.354   1.00 0.00 ? 42 SER A O    1  
ATOM 672   C CB   . SER A 1 42 ? -5.262  15.738  7.088   1.00 0.00 ? 42 SER A CB   1  
ATOM 673   O OG   . SER A 1 42 ? -4.597  16.281  5.956   1.00 0.00 ? 42 SER A OG   1  
ATOM 674   H H    . SER A 1 42 ? -6.467  14.023  8.616   1.00 0.00 ? 42 SER A H    1  
ATOM 675   H HA   . SER A 1 42 ? -7.194  15.434  6.206   1.00 0.00 ? 42 SER A HA   1  
ATOM 676   H HB2  . SER A 1 42 ? -5.661  16.541  7.684   1.00 0.00 ? 42 SER A HB2  1  
ATOM 677   H HB3  . SER A 1 42 ? -4.567  15.161  7.685   1.00 0.00 ? 42 SER A HB3  1  
ATOM 678   H HG   . SER A 1 42 ? -4.084  17.038  6.248   1.00 0.00 ? 42 SER A HG   1  
ATOM 679   N N    . LEU A 1 43 ? -5.794  12.671  5.672   1.00 0.00 ? 43 LEU A N    1  
ATOM 680   C CA   . LEU A 1 43 ? -5.363  11.744  4.567   1.00 0.00 ? 43 LEU A CA   1  
ATOM 681   C C    . LEU A 1 43 ? -6.507  10.776  4.255   1.00 0.00 ? 43 LEU A C    1  
ATOM 682   O O    . LEU A 1 43 ? -6.381  9.928   3.394   1.00 0.00 ? 43 LEU A O    1  
ATOM 683   C CB   . LEU A 1 43 ? -4.136  10.920  4.986   1.00 0.00 ? 43 LEU A CB   1  
ATOM 684   C CG   . LEU A 1 43 ? -3.066  11.811  5.613   1.00 0.00 ? 43 LEU A CG   1  
ATOM 685   C CD1  . LEU A 1 43 ? -1.813  10.984  5.908   1.00 0.00 ? 43 LEU A CD1  1  
ATOM 686   C CD2  . LEU A 1 43 ? -2.705  12.957  4.662   1.00 0.00 ? 43 LEU A CD2  1  
ATOM 687   H H    . LEU A 1 43 ? -5.992  12.309  6.565   1.00 0.00 ? 43 LEU A H    1  
ATOM 688   H HA   . LEU A 1 43 ? -5.125  12.306  3.674   1.00 0.00 ? 43 LEU A HA   1  
ATOM 689   H HB2  . LEU A 1 43 ? -4.440  10.179  5.706   1.00 0.00 ? 43 LEU A HB2  1  
ATOM 690   H HB3  . LEU A 1 43 ? -3.725  10.430  4.116   1.00 0.00 ? 43 LEU A HB3  1  
ATOM 691   H HG   . LEU A 1 43 ? -3.443  12.203  6.532   1.00 0.00 ? 43 LEU A HG   1  
ATOM 692   H HD11 . LEU A 1 43 ? -1.987  10.370  6.778   1.00 0.00 ? 43 LEU A HD11 1  
ATOM 693   H HD12 . LEU A 1 43 ? -0.980  11.645  6.099   1.00 0.00 ? 43 LEU A HD12 1  
ATOM 694   H HD13 . LEU A 1 43 ? -1.585  10.354  5.062   1.00 0.00 ? 43 LEU A HD13 1  
ATOM 695   H HD21 . LEU A 1 43 ? -3.500  13.684  4.653   1.00 0.00 ? 43 LEU A HD21 1  
ATOM 696   H HD22 . LEU A 1 43 ? -2.562  12.567  3.667   1.00 0.00 ? 43 LEU A HD22 1  
ATOM 697   H HD23 . LEU A 1 43 ? -1.793  13.428  4.998   1.00 0.00 ? 43 LEU A HD23 1  
ATOM 698   N N    . SER A 1 44 ? -7.611  10.881  4.961   1.00 0.00 ? 44 SER A N    1  
ATOM 699   C CA   . SER A 1 44 ? -8.767  9.952   4.724   1.00 0.00 ? 44 SER A CA   1  
ATOM 700   C C    . SER A 1 44 ? -8.906  9.648   3.233   1.00 0.00 ? 44 SER A C    1  
ATOM 701   O O    . SER A 1 44 ? -8.778  8.533   2.774   1.00 0.00 ? 44 SER A O    1  
ATOM 702   C CB   . SER A 1 44 ? -10.054 10.601  5.234   1.00 0.00 ? 44 SER A CB   1  
ATOM 703   O OG   . SER A 1 44 ? -11.170 9.823   4.821   1.00 0.00 ? 44 SER A OG   1  
ATOM 704   H H    . SER A 1 44 ? -7.675  11.561  5.664   1.00 0.00 ? 44 SER A H    1  
ATOM 705   H HA   . SER A 1 44 ? -8.594  9.025   5.258   1.00 0.00 ? 44 SER A HA   1  
ATOM 706   H HB2  . SER A 1 44 ? -10.034 10.647  6.310   1.00 0.00 ? 44 SER A HB2  1  
ATOM 707   H HB3  . SER A 1 44 ? -10.133 11.603  4.834   1.00 0.00 ? 44 SER A HB3  1  
ATOM 708   H HG   . SER A 1 44 ? -11.767 9.740   5.568   1.00 0.00 ? 44 SER A HG   1  
ATOM 709   N N    . GLU A 1 45 ? -9.331  10.655  2.522   1.00 0.00 ? 45 GLU A N    1  
ATOM 710   C CA   . GLU A 1 45 ? -9.699  10.553  1.083   1.00 0.00 ? 45 GLU A CA   1  
ATOM 711   C C    . GLU A 1 45 ? -8.683  9.954   0.122   1.00 0.00 ? 45 GLU A C    1  
ATOM 712   O O    . GLU A 1 45 ? -8.974  9.031   -0.613  1.00 0.00 ? 45 GLU A O    1  
ATOM 713   C CB   . GLU A 1 45 ? -9.987  11.971  0.587   1.00 0.00 ? 45 GLU A CB   1  
ATOM 714   C CG   . GLU A 1 45 ? -11.133 12.583  1.397   1.00 0.00 ? 45 GLU A CG   1  
ATOM 715   C CD   . GLU A 1 45 ? -12.438 11.859  1.063   1.00 0.00 ? 45 GLU A CD   1  
ATOM 716   O OE1  . GLU A 1 45 ? -12.989 12.129  0.008   1.00 0.00 ? 45 GLU A OE1  1  
ATOM 717   O OE2  . GLU A 1 45 ? -12.865 11.047  1.867   1.00 0.00 ? 45 GLU A OE2  1  
ATOM 718   H H    . GLU A 1 45 ? -9.514  11.518  2.946   1.00 0.00 ? 45 GLU A H    1  
ATOM 719   H HA   . GLU A 1 45 ? -10.613 9.992   1.004   1.00 0.00 ? 45 GLU A HA   1  
ATOM 720   H HB2  . GLU A 1 45 ? -9.093  12.576  0.703   1.00 0.00 ? 45 GLU A HB2  1  
ATOM 721   H HB3  . GLU A 1 45 ? -10.262 11.939  -0.457  1.00 0.00 ? 45 GLU A HB3  1  
ATOM 722   H HG2  . GLU A 1 45 ? -10.924 12.483  2.451   1.00 0.00 ? 45 GLU A HG2  1  
ATOM 723   H HG3  . GLU A 1 45 ? -11.230 13.629  1.147   1.00 0.00 ? 45 GLU A HG3  1  
ATOM 724   N N    . GLU A 1 46 ? -7.494  10.463  0.127   1.00 0.00 ? 46 GLU A N    1  
ATOM 725   C CA   . GLU A 1 46 ? -6.459  9.920   -0.776  1.00 0.00 ? 46 GLU A CA   1  
ATOM 726   C C    . GLU A 1 46 ? -6.289  8.427   -0.513  1.00 0.00 ? 46 GLU A C    1  
ATOM 727   O O    . GLU A 1 46 ? -5.839  7.694   -1.364  1.00 0.00 ? 46 GLU A O    1  
ATOM 728   C CB   . GLU A 1 46 ? -5.137  10.649  -0.527  1.00 0.00 ? 46 GLU A CB   1  
ATOM 729   C CG   . GLU A 1 46 ? -5.377  12.173  -0.433  1.00 0.00 ? 46 GLU A CG   1  
ATOM 730   C CD   . GLU A 1 46 ? -5.624  12.585  1.023   1.00 0.00 ? 46 GLU A CD   1  
ATOM 731   O OE1  . GLU A 1 46 ? -6.638  12.186  1.571   1.00 0.00 ? 46 GLU A OE1  1  
ATOM 732   O OE2  . GLU A 1 46 ? -4.792  13.296  1.564   1.00 0.00 ? 46 GLU A OE2  1  
ATOM 733   H H    . GLU A 1 46 ? -7.278  11.208  0.727   1.00 0.00 ? 46 GLU A H    1  
ATOM 734   H HA   . GLU A 1 46 ? -6.760  10.057  -1.800  1.00 0.00 ? 46 GLU A HA   1  
ATOM 735   H HB2  . GLU A 1 46 ? -4.699  10.286  0.392   1.00 0.00 ? 46 GLU A HB2  1  
ATOM 736   H HB3  . GLU A 1 46 ? -4.464  10.444  -1.343  1.00 0.00 ? 46 GLU A HB3  1  
ATOM 737   H HG2  . GLU A 1 46 ? -4.508  12.696  -0.805  1.00 0.00 ? 46 GLU A HG2  1  
ATOM 738   H HG3  . GLU A 1 46 ? -6.236  12.448  -1.031  1.00 0.00 ? 46 GLU A HG3  1  
ATOM 739   N N    . CYS A 1 47 ? -6.659  7.957   0.645   1.00 0.00 ? 47 CYS A N    1  
ATOM 740   C CA   . CYS A 1 47 ? -6.523  6.503   0.914   1.00 0.00 ? 47 CYS A CA   1  
ATOM 741   C C    . CYS A 1 47 ? -7.687  5.784   0.232   1.00 0.00 ? 47 CYS A C    1  
ATOM 742   O O    . CYS A 1 47 ? -7.520  4.755   -0.392  1.00 0.00 ? 47 CYS A O    1  
ATOM 743   C CB   . CYS A 1 47 ? -6.549  6.261   2.437   1.00 0.00 ? 47 CYS A CB   1  
ATOM 744   S SG   . CYS A 1 47 ? -8.239  5.915   3.002   1.00 0.00 ? 47 CYS A SG   1  
ATOM 745   H H    . CYS A 1 47 ? -7.042  8.552   1.324   1.00 0.00 ? 47 CYS A H    1  
ATOM 746   H HA   . CYS A 1 47 ? -5.594  6.146   0.490   1.00 0.00 ? 47 CYS A HA   1  
ATOM 747   H HB2  . CYS A 1 47 ? -5.916  5.422   2.680   1.00 0.00 ? 47 CYS A HB2  1  
ATOM 748   H HB3  . CYS A 1 47 ? -6.185  7.145   2.942   1.00 0.00 ? 47 CYS A HB3  1  
ATOM 749   N N    . GLN A 1 48 ? -8.866  6.319   0.353   1.00 0.00 ? 48 GLN A N    1  
ATOM 750   C CA   . GLN A 1 48 ? -10.039 5.664   -0.280  1.00 0.00 ? 48 GLN A CA   1  
ATOM 751   C C    . GLN A 1 48 ? -9.746  5.434   -1.759  1.00 0.00 ? 48 GLN A C    1  
ATOM 752   O O    . GLN A 1 48 ? -10.021 4.383   -2.302  1.00 0.00 ? 48 GLN A O    1  
ATOM 753   C CB   . GLN A 1 48 ? -11.272 6.558   -0.132  1.00 0.00 ? 48 GLN A CB   1  
ATOM 754   C CG   . GLN A 1 48 ? -12.522 5.776   -0.541  1.00 0.00 ? 48 GLN A CG   1  
ATOM 755   C CD   . GLN A 1 48 ? -12.825 4.708   0.512   1.00 0.00 ? 48 GLN A CD   1  
ATOM 756   O OE1  . GLN A 1 48 ? -12.728 3.527   0.242   1.00 0.00 ? 48 GLN A OE1  1  
ATOM 757   N NE2  . GLN A 1 48 ? -13.189 5.075   1.710   1.00 0.00 ? 48 GLN A NE2  1  
ATOM 758   H H    . GLN A 1 48 ? -8.977  7.145   0.870   1.00 0.00 ? 48 GLN A H    1  
ATOM 759   H HA   . GLN A 1 48 ? -10.220 4.713   0.200   1.00 0.00 ? 48 GLN A HA   1  
ATOM 760   H HB2  . GLN A 1 48 ? -11.366 6.874   0.897   1.00 0.00 ? 48 GLN A HB2  1  
ATOM 761   H HB3  . GLN A 1 48 ? -11.168 7.424   -0.767  1.00 0.00 ? 48 GLN A HB3  1  
ATOM 762   H HG2  . GLN A 1 48 ? -13.361 6.453   -0.620  1.00 0.00 ? 48 GLN A HG2  1  
ATOM 763   H HG3  . GLN A 1 48 ? -12.353 5.300   -1.495  1.00 0.00 ? 48 GLN A HG3  1  
ATOM 764   H HE21 . GLN A 1 48 ? -13.266 6.027   1.928   1.00 0.00 ? 48 GLN A HE21 1  
ATOM 765   H HE22 . GLN A 1 48 ? -13.385 4.399   2.391   1.00 0.00 ? 48 GLN A HE22 1  
ATOM 766   N N    . GLU A 1 49 ? -9.197  6.417   -2.420  1.00 0.00 ? 49 GLU A N    1  
ATOM 767   C CA   . GLU A 1 49 ? -8.896  6.264   -3.867  1.00 0.00 ? 49 GLU A CA   1  
ATOM 768   C C    . GLU A 1 49 ? -7.780  5.238   -4.071  1.00 0.00 ? 49 GLU A C    1  
ATOM 769   O O    . GLU A 1 49 ? -7.828  4.430   -4.977  1.00 0.00 ? 49 GLU A O    1  
ATOM 770   C CB   . GLU A 1 49 ? -8.459  7.614   -4.440  1.00 0.00 ? 49 GLU A CB   1  
ATOM 771   C CG   . GLU A 1 49 ? -9.648  8.576   -4.447  1.00 0.00 ? 49 GLU A CG   1  
ATOM 772   C CD   . GLU A 1 49 ? -10.648 8.144   -5.521  1.00 0.00 ? 49 GLU A CD   1  
ATOM 773   O OE1  . GLU A 1 49 ? -10.220 7.907   -6.639  1.00 0.00 ? 49 GLU A OE1  1  
ATOM 774   O OE2  . GLU A 1 49 ? -11.823 8.057   -5.208  1.00 0.00 ? 49 GLU A OE2  1  
ATOM 775   H H    . GLU A 1 49 ? -8.991  7.264   -1.973  1.00 0.00 ? 49 GLU A H    1  
ATOM 776   H HA   . GLU A 1 49 ? -9.785  5.932   -4.382  1.00 0.00 ? 49 GLU A HA   1  
ATOM 777   H HB2  . GLU A 1 49 ? -7.667  8.024   -3.830  1.00 0.00 ? 49 GLU A HB2  1  
ATOM 778   H HB3  . GLU A 1 49 ? -8.102  7.478   -5.450  1.00 0.00 ? 49 GLU A HB3  1  
ATOM 779   H HG2  . GLU A 1 49 ? -10.129 8.560   -3.479  1.00 0.00 ? 49 GLU A HG2  1  
ATOM 780   H HG3  . GLU A 1 49 ? -9.301  9.575   -4.662  1.00 0.00 ? 49 GLU A HG3  1  
ATOM 781   N N    . VAL A 1 50 ? -6.778  5.250   -3.227  1.00 0.00 ? 50 VAL A N    1  
ATOM 782   C CA   . VAL A 1 50 ? -5.679  4.259   -3.380  1.00 0.00 ? 50 VAL A CA   1  
ATOM 783   C C    . VAL A 1 50 ? -6.212  2.871   -3.047  1.00 0.00 ? 50 VAL A C    1  
ATOM 784   O O    . VAL A 1 50 ? -6.048  1.933   -3.802  1.00 0.00 ? 50 VAL A O    1  
ATOM 785   C CB   . VAL A 1 50 ? -4.513  4.578   -2.432  1.00 0.00 ? 50 VAL A CB   1  
ATOM 786   C CG1  . VAL A 1 50 ? -3.405  3.536   -2.621  1.00 0.00 ? 50 VAL A CG1  1  
ATOM 787   C CG2  . VAL A 1 50 ? -3.958  5.984   -2.732  1.00 0.00 ? 50 VAL A CG2  1  
ATOM 788   H H    . VAL A 1 50 ? -6.757  5.899   -2.496  1.00 0.00 ? 50 VAL A H    1  
ATOM 789   H HA   . VAL A 1 50 ? -5.325  4.287   -4.393  1.00 0.00 ? 50 VAL A HA   1  
ATOM 790   H HB   . VAL A 1 50 ? -4.858  4.526   -1.413  1.00 0.00 ? 50 VAL A HB   1  
ATOM 791   H HG11 . VAL A 1 50 ? -3.747  2.575   -2.265  1.00 0.00 ? 50 VAL A HG11 1  
ATOM 792   H HG12 . VAL A 1 50 ? -2.532  3.835   -2.062  1.00 0.00 ? 50 VAL A HG12 1  
ATOM 793   H HG13 . VAL A 1 50 ? -3.154  3.465   -3.668  1.00 0.00 ? 50 VAL A HG13 1  
ATOM 794   H HG21 . VAL A 1 50 ? -3.189  5.922   -3.489  1.00 0.00 ? 50 VAL A HG21 1  
ATOM 795   H HG22 . VAL A 1 50 ? -3.538  6.406   -1.830  1.00 0.00 ? 50 VAL A HG22 1  
ATOM 796   H HG23 . VAL A 1 50 ? -4.752  6.622   -3.087  1.00 0.00 ? 50 VAL A HG23 1  
ATOM 797   N N    . VAL A 1 51 ? -6.824  2.720   -1.901  1.00 0.00 ? 51 VAL A N    1  
ATOM 798   C CA   . VAL A 1 51 ? -7.330  1.381   -1.507  1.00 0.00 ? 51 VAL A CA   1  
ATOM 799   C C    . VAL A 1 51 ? -8.365  0.885   -2.526  1.00 0.00 ? 51 VAL A C    1  
ATOM 800   O O    . VAL A 1 51 ? -8.290  -0.217  -3.027  1.00 0.00 ? 51 VAL A O    1  
ATOM 801   C CB   . VAL A 1 51 ? -7.890  1.449   -0.079  1.00 0.00 ? 51 VAL A CB   1  
ATOM 802   C CG1  . VAL A 1 51 ? -8.325  0.066   0.384   1.00 0.00 ? 51 VAL A CG1  1  
ATOM 803   C CG2  . VAL A 1 51 ? -6.806  1.977   0.869   1.00 0.00 ? 51 VAL A CG2  1  
ATOM 804   H H    . VAL A 1 51 ? -6.923  3.472   -1.281  1.00 0.00 ? 51 VAL A H    1  
ATOM 805   H HA   . VAL A 1 51 ? -6.500  0.696   -1.560  1.00 0.00 ? 51 VAL A HA   1  
ATOM 806   H HB   . VAL A 1 51 ? -8.735  2.117   -0.057  1.00 0.00 ? 51 VAL A HB   1  
ATOM 807   H HG11 . VAL A 1 51 ? -8.584  0.106   1.432   1.00 0.00 ? 51 VAL A HG11 1  
ATOM 808   H HG12 . VAL A 1 51 ? -7.513  -0.631  0.241   1.00 0.00 ? 51 VAL A HG12 1  
ATOM 809   H HG13 . VAL A 1 51 ? -9.182  -0.250  -0.188  1.00 0.00 ? 51 VAL A HG13 1  
ATOM 810   H HG21 . VAL A 1 51 ? -7.237  2.179   1.841   1.00 0.00 ? 51 VAL A HG21 1  
ATOM 811   H HG22 . VAL A 1 51 ? -6.387  2.886   0.468   1.00 0.00 ? 51 VAL A HG22 1  
ATOM 812   H HG23 . VAL A 1 51 ? -6.027  1.236   0.971   1.00 0.00 ? 51 VAL A HG23 1  
ATOM 813   N N    . ASP A 1 52 ? -9.369  1.686   -2.781  1.00 0.00 ? 52 ASP A N    1  
ATOM 814   C CA   . ASP A 1 52 ? -10.472 1.275   -3.703  1.00 0.00 ? 52 ASP A CA   1  
ATOM 815   C C    . ASP A 1 52 ? -9.981  1.044   -5.134  1.00 0.00 ? 52 ASP A C    1  
ATOM 816   O O    . ASP A 1 52 ? -10.382 0.103   -5.790  1.00 0.00 ? 52 ASP A O    1  
ATOM 817   C CB   . ASP A 1 52 ? -11.541 2.374   -3.713  1.00 0.00 ? 52 ASP A CB   1  
ATOM 818   C CG   . ASP A 1 52 ? -12.043 2.608   -2.287  1.00 0.00 ? 52 ASP A CG   1  
ATOM 819   O OD1  . ASP A 1 52 ? -11.244 2.491   -1.372  1.00 0.00 ? 52 ASP A OD1  1  
ATOM 820   O OD2  . ASP A 1 52 ? -13.217 2.900   -2.134  1.00 0.00 ? 52 ASP A OD2  1  
ATOM 821   H H    . ASP A 1 52 ? -9.419  2.558   -2.336  1.00 0.00 ? 52 ASP A H    1  
ATOM 822   H HA   . ASP A 1 52 ? -10.924 0.371   -3.325  1.00 0.00 ? 52 ASP A HA   1  
ATOM 823   H HB2  . ASP A 1 52 ? -11.120 3.290   -4.101  1.00 0.00 ? 52 ASP A HB2  1  
ATOM 824   H HB3  . ASP A 1 52 ? -12.367 2.066   -4.335  1.00 0.00 ? 52 ASP A HB3  1  
ATOM 825   N N    . THR A 1 53 ? -9.139  1.903   -5.633  1.00 0.00 ? 53 THR A N    1  
ATOM 826   C CA   . THR A 1 53 ? -8.647  1.746   -7.029  1.00 0.00 ? 53 THR A CA   1  
ATOM 827   C C    . THR A 1 53 ? -7.443  0.814   -7.076  1.00 0.00 ? 53 THR A C    1  
ATOM 828   O O    . THR A 1 53 ? -7.314  0.027   -7.993  1.00 0.00 ? 53 THR A O    1  
ATOM 829   C CB   . THR A 1 53 ? -8.252  3.118   -7.579  1.00 0.00 ? 53 THR A CB   1  
ATOM 830   O OG1  . THR A 1 53 ? -9.311  4.038   -7.355  1.00 0.00 ? 53 THR A OG1  1  
ATOM 831   C CG2  . THR A 1 53 ? -7.976  3.009   -9.079  1.00 0.00 ? 53 THR A CG2  1  
ATOM 832   H H    . THR A 1 53 ? -8.837  2.665   -5.096  1.00 0.00 ? 53 THR A H    1  
ATOM 833   H HA   . THR A 1 53 ? -9.416  1.329   -7.655  1.00 0.00 ? 53 THR A HA   1  
ATOM 834   H HB   . THR A 1 53 ? -7.363  3.465   -7.078  1.00 0.00 ? 53 THR A HB   1  
ATOM 835   H HG1  . THR A 1 53 ? -9.028  4.899   -7.673  1.00 0.00 ? 53 THR A HG1  1  
ATOM 836   H HG21 . THR A 1 53 ? -7.205  2.273   -9.252  1.00 0.00 ? 53 THR A HG21 1  
ATOM 837   H HG22 . THR A 1 53 ? -7.650  3.968   -9.456  1.00 0.00 ? 53 THR A HG22 1  
ATOM 838   H HG23 . THR A 1 53 ? -8.880  2.710   -9.590  1.00 0.00 ? 53 THR A HG23 1  
ATOM 839   N N    . TYR A 1 54 ? -6.542  0.906   -6.130  1.00 0.00 ? 54 TYR A N    1  
ATOM 840   C CA   . TYR A 1 54 ? -5.326  0.031   -6.168  1.00 0.00 ? 54 TYR A CA   1  
ATOM 841   C C    . TYR A 1 54 ? -5.330  -1.022  -5.055  1.00 0.00 ? 54 TYR A C    1  
ATOM 842   O O    . TYR A 1 54 ? -4.300  -1.393  -4.533  1.00 0.00 ? 54 TYR A O    1  
ATOM 843   C CB   . TYR A 1 54 ? -4.086  0.902   -6.039  1.00 0.00 ? 54 TYR A CB   1  
ATOM 844   C CG   . TYR A 1 54 ? -3.962  1.784   -7.260  1.00 0.00 ? 54 TYR A CG   1  
ATOM 845   C CD1  . TYR A 1 54 ? -4.574  3.038   -7.271  1.00 0.00 ? 54 TYR A CD1  1  
ATOM 846   C CD2  . TYR A 1 54 ? -3.236  1.352   -8.375  1.00 0.00 ? 54 TYR A CD2  1  
ATOM 847   C CE1  . TYR A 1 54 ? -4.466  3.866   -8.389  1.00 0.00 ? 54 TYR A CE1  1  
ATOM 848   C CE2  . TYR A 1 54 ? -3.124  2.180   -9.500  1.00 0.00 ? 54 TYR A CE2  1  
ATOM 849   C CZ   . TYR A 1 54 ? -3.739  3.439   -9.506  1.00 0.00 ? 54 TYR A CZ   1  
ATOM 850   O OH   . TYR A 1 54 ? -3.630  4.256   -10.613 1.00 0.00 ? 54 TYR A OH   1  
ATOM 851   H H    . TYR A 1 54 ? -6.651  1.564   -5.412  1.00 0.00 ? 54 TYR A H    1  
ATOM 852   H HA   . TYR A 1 54 ? -5.277  -0.490  -7.114  1.00 0.00 ? 54 TYR A HA   1  
ATOM 853   H HB2  . TYR A 1 54 ? -4.175  1.516   -5.160  1.00 0.00 ? 54 TYR A HB2  1  
ATOM 854   H HB3  . TYR A 1 54 ? -3.213  0.276   -5.957  1.00 0.00 ? 54 TYR A HB3  1  
ATOM 855   H HD1  . TYR A 1 54 ? -5.134  3.364   -6.418  1.00 0.00 ? 54 TYR A HD1  1  
ATOM 856   H HD2  . TYR A 1 54 ? -2.763  0.382   -8.370  1.00 0.00 ? 54 TYR A HD2  1  
ATOM 857   H HE1  . TYR A 1 54 ? -4.942  4.836   -8.385  1.00 0.00 ? 54 TYR A HE1  1  
ATOM 858   H HE2  . TYR A 1 54 ? -2.564  1.848   -10.361 1.00 0.00 ? 54 TYR A HE2  1  
ATOM 859   H HH   . TYR A 1 54 ? -4.403  4.113   -11.165 1.00 0.00 ? 54 TYR A HH   1  
ATOM 860   N N    . GLY A 1 55 ? -6.490  -1.471  -4.660  1.00 0.00 ? 55 GLY A N    1  
ATOM 861   C CA   . GLY A 1 55 ? -6.575  -2.459  -3.547  1.00 0.00 ? 55 GLY A CA   1  
ATOM 862   C C    . GLY A 1 55 ? -6.282  -3.877  -4.029  1.00 0.00 ? 55 GLY A C    1  
ATOM 863   O O    . GLY A 1 55 ? -5.413  -4.544  -3.502  1.00 0.00 ? 55 GLY A O    1  
ATOM 864   H H    . GLY A 1 55 ? -7.308  -1.150  -5.087  1.00 0.00 ? 55 GLY A H    1  
ATOM 865   H HA2  . GLY A 1 55 ? -5.856  -2.193  -2.786  1.00 0.00 ? 55 GLY A HA2  1  
ATOM 866   H HA3  . GLY A 1 55 ? -7.566  -2.431  -3.121  1.00 0.00 ? 55 GLY A HA3  1  
ATOM 867   N N    . SER A 1 56 ? -7.001  -4.369  -5.003  1.00 0.00 ? 56 SER A N    1  
ATOM 868   C CA   . SER A 1 56 ? -6.736  -5.758  -5.452  1.00 0.00 ? 56 SER A CA   1  
ATOM 869   C C    . SER A 1 56 ? -5.349  -5.834  -6.067  1.00 0.00 ? 56 SER A C    1  
ATOM 870   O O    . SER A 1 56 ? -4.717  -6.872  -6.088  1.00 0.00 ? 56 SER A O    1  
ATOM 871   C CB   . SER A 1 56 ? -7.770  -6.195  -6.488  1.00 0.00 ? 56 SER A CB   1  
ATOM 872   O OG   . SER A 1 56 ? -9.039  -5.653  -6.148  1.00 0.00 ? 56 SER A OG   1  
ATOM 873   H H    . SER A 1 56 ? -7.714  -3.842  -5.423  1.00 0.00 ? 56 SER A H    1  
ATOM 874   H HA   . SER A 1 56 ? -6.793  -6.404  -4.590  1.00 0.00 ? 56 SER A HA   1  
ATOM 875   H HB2  . SER A 1 56 ? -7.479  -5.840  -7.466  1.00 0.00 ? 56 SER A HB2  1  
ATOM 876   H HB3  . SER A 1 56 ? -7.817  -7.277  -6.500  1.00 0.00 ? 56 SER A HB3  1  
ATOM 877   H HG   . SER A 1 56 ? -8.928  -5.102  -5.369  1.00 0.00 ? 56 SER A HG   1  
ATOM 878   N N    . SER A 1 57 ? -4.902  -4.747  -6.641  1.00 0.00 ? 57 SER A N    1  
ATOM 879   C CA   . SER A 1 57 ? -3.591  -4.777  -7.334  1.00 0.00 ? 57 SER A CA   1  
ATOM 880   C C    . SER A 1 57 ? -2.436  -4.773  -6.336  1.00 0.00 ? 57 SER A C    1  
ATOM 881   O O    . SER A 1 57 ? -1.542  -5.586  -6.420  1.00 0.00 ? 57 SER A O    1  
ATOM 882   C CB   . SER A 1 57 ? -3.469  -3.610  -8.313  1.00 0.00 ? 57 SER A CB   1  
ATOM 883   O OG   . SER A 1 57 ? -3.602  -2.386  -7.602  1.00 0.00 ? 57 SER A OG   1  
ATOM 884   H H    . SER A 1 57 ? -5.450  -3.934  -6.636  1.00 0.00 ? 57 SER A H    1  
ATOM 885   H HA   . SER A 1 57 ? -3.543  -5.715  -7.865  1.00 0.00 ? 57 SER A HA   1  
ATOM 886   H HB2  . SER A 1 57 ? -2.504  -3.639  -8.792  1.00 0.00 ? 57 SER A HB2  1  
ATOM 887   H HB3  . SER A 1 57 ? -4.244  -3.688  -9.064  1.00 0.00 ? 57 SER A HB3  1  
ATOM 888   H HG   . SER A 1 57 ? -2.799  -2.249  -7.093  1.00 0.00 ? 57 SER A HG   1  
ATOM 889   N N    . ILE A 1 58 ? -2.471  -3.905  -5.357  1.00 0.00 ? 58 ILE A N    1  
ATOM 890   C CA   . ILE A 1 58 ? -1.390  -3.901  -4.332  1.00 0.00 ? 58 ILE A CA   1  
ATOM 891   C C    . ILE A 1 58 ? -1.340  -5.284  -3.687  1.00 0.00 ? 58 ILE A C    1  
ATOM 892   O O    . ILE A 1 58 ? -0.332  -5.961  -3.665  1.00 0.00 ? 58 ILE A O    1  
ATOM 893   C CB   . ILE A 1 58 ? -1.696  -2.848  -3.242  1.00 0.00 ? 58 ILE A CB   1  
ATOM 894   C CG1  . ILE A 1 58 ? -1.414  -1.437  -3.793  1.00 0.00 ? 58 ILE A CG1  1  
ATOM 895   C CG2  . ILE A 1 58 ? -0.806  -3.112  -2.009  1.00 0.00 ? 58 ILE A CG2  1  
ATOM 896   C CD1  . ILE A 1 58 ? -1.806  -0.363  -2.761  1.00 0.00 ? 58 ILE A CD1  1  
ATOM 897   H H    . ILE A 1 58 ? -3.227  -3.287  -5.263  1.00 0.00 ? 58 ILE A H    1  
ATOM 898   H HA   . ILE A 1 58 ? -0.431  -3.681  -4.775  1.00 0.00 ? 58 ILE A HA   1  
ATOM 899   H HB   . ILE A 1 58 ? -2.735  -2.924  -2.954  1.00 0.00 ? 58 ILE A HB   1  
ATOM 900   H HG12 . ILE A 1 58 ? -0.363  -1.348  -4.016  1.00 0.00 ? 58 ILE A HG12 1  
ATOM 901   H HG13 . ILE A 1 58 ? -1.981  -1.287  -4.698  1.00 0.00 ? 58 ILE A HG13 1  
ATOM 902   H HG21 . ILE A 1 58 ? -1.213  -3.940  -1.449  1.00 0.00 ? 58 ILE A HG21 1  
ATOM 903   H HG22 . ILE A 1 58 ? -0.772  -2.238  -1.375  1.00 0.00 ? 58 ILE A HG22 1  
ATOM 904   H HG23 . ILE A 1 58 ? 0.194   -3.359  -2.333  1.00 0.00 ? 58 ILE A HG23 1  
ATOM 905   H HD11 . ILE A 1 58 ? -2.642  -0.707  -2.168  1.00 0.00 ? 58 ILE A HD11 1  
ATOM 906   H HD12 . ILE A 1 58 ? -2.084  0.550   -3.270  1.00 0.00 ? 58 ILE A HD12 1  
ATOM 907   H HD13 . ILE A 1 58 ? -0.961  -0.170  -2.114  1.00 0.00 ? 58 ILE A HD13 1  
ATOM 908   N N    . LEU A 1 59 ? -2.460  -5.674  -3.154  1.00 0.00 ? 59 LEU A N    1  
ATOM 909   C CA   . LEU A 1 59 ? -2.588  -6.985  -2.474  1.00 0.00 ? 59 LEU A CA   1  
ATOM 910   C C    . LEU A 1 59 ? -2.233  -8.106  -3.450  1.00 0.00 ? 59 LEU A C    1  
ATOM 911   O O    . LEU A 1 59 ? -1.868  -9.187  -3.040  1.00 0.00 ? 59 LEU A O    1  
ATOM 912   C CB   . LEU A 1 59 ? -4.040  -7.128  -1.994  1.00 0.00 ? 59 LEU A CB   1  
ATOM 913   C CG   . LEU A 1 59 ? -4.297  -8.530  -1.423  1.00 0.00 ? 59 LEU A CG   1  
ATOM 914   C CD1  . LEU A 1 59 ? -3.265  -8.847  -0.330  1.00 0.00 ? 59 LEU A CD1  1  
ATOM 915   C CD2  . LEU A 1 59 ? -5.717  -8.590  -0.821  1.00 0.00 ? 59 LEU A CD2  1  
ATOM 916   H H    . LEU A 1 59 ? -3.237  -5.081  -3.217  1.00 0.00 ? 59 LEU A H    1  
ATOM 917   H HA   . LEU A 1 59 ? -1.921  -7.019  -1.626  1.00 0.00 ? 59 LEU A HA   1  
ATOM 918   H HB2  . LEU A 1 59 ? -4.229  -6.390  -1.229  1.00 0.00 ? 59 LEU A HB2  1  
ATOM 919   H HB3  . LEU A 1 59 ? -4.706  -6.955  -2.826  1.00 0.00 ? 59 LEU A HB3  1  
ATOM 920   H HG   . LEU A 1 59 ? -4.219  -9.256  -2.222  1.00 0.00 ? 59 LEU A HG   1  
ATOM 921   H HD11 . LEU A 1 59 ? -3.635  -9.649  0.293   1.00 0.00 ? 59 LEU A HD11 1  
ATOM 922   H HD12 . LEU A 1 59 ? -3.101  -7.969  0.277   1.00 0.00 ? 59 LEU A HD12 1  
ATOM 923   H HD13 . LEU A 1 59 ? -2.336  -9.149  -0.784  1.00 0.00 ? 59 LEU A HD13 1  
ATOM 924   H HD21 . LEU A 1 59 ? -5.963  -7.646  -0.359  1.00 0.00 ? 59 LEU A HD21 1  
ATOM 925   H HD22 . LEU A 1 59 ? -5.764  -9.370  -0.075  1.00 0.00 ? 59 LEU A HD22 1  
ATOM 926   H HD23 . LEU A 1 59 ? -6.428  -8.804  -1.604  1.00 0.00 ? 59 LEU A HD23 1  
ATOM 927   N N    . SER A 1 60 ? -2.356  -7.903  -4.734  1.00 0.00 ? 60 SER A N    1  
ATOM 928   C CA   . SER A 1 60 ? -2.042  -9.031  -5.663  1.00 0.00 ? 60 SER A CA   1  
ATOM 929   C C    . SER A 1 60 ? -0.524  -9.138  -5.878  1.00 0.00 ? 60 SER A C    1  
ATOM 930   O O    . SER A 1 60 ? 0.022   -10.213 -6.021  1.00 0.00 ? 60 SER A O    1  
ATOM 931   C CB   . SER A 1 60 ? -2.734  -8.782  -6.998  1.00 0.00 ? 60 SER A CB   1  
ATOM 932   O OG   . SER A 1 60 ? -4.122  -9.061  -6.869  1.00 0.00 ? 60 SER A OG   1  
ATOM 933   H H    . SER A 1 60 ? -2.673  -7.042  -5.078  1.00 0.00 ? 60 SER A H    1  
ATOM 934   H HA   . SER A 1 60 ? -2.447  -9.918  -5.198  1.00 0.00 ? 60 SER A HA   1  
ATOM 935   H HB2  . SER A 1 60 ? -2.603  -7.751  -7.276  1.00 0.00 ? 60 SER A HB2  1  
ATOM 936   H HB3  . SER A 1 60 ? -2.296  -9.417  -7.757  1.00 0.00 ? 60 SER A HB3  1  
ATOM 937   H HG   . SER A 1 60 ? -4.233  -10.014 -6.855  1.00 0.00 ? 60 SER A HG   1  
ATOM 938   N N    . ILE A 1 61 ? 0.152   -8.018  -5.906  1.00 0.00 ? 61 ILE A N    1  
ATOM 939   C CA   . ILE A 1 61 ? 1.633   -8.021  -6.117  1.00 0.00 ? 61 ILE A CA   1  
ATOM 940   C C    . ILE A 1 61 ? 2.340   -8.610  -4.892  1.00 0.00 ? 61 ILE A C    1  
ATOM 941   O O    . ILE A 1 61 ? 3.235   -9.424  -5.007  1.00 0.00 ? 61 ILE A O    1  
ATOM 942   C CB   . ILE A 1 61 ? 2.118   -6.575  -6.322  1.00 0.00 ? 61 ILE A CB   1  
ATOM 943   C CG1  . ILE A 1 61 ? 1.171   -5.819  -7.315  1.00 0.00 ? 61 ILE A CG1  1  
ATOM 944   C CG2  . ILE A 1 61 ? 3.566   -6.608  -6.823  1.00 0.00 ? 61 ILE A CG2  1  
ATOM 945   C CD1  . ILE A 1 61 ? 1.944   -5.149  -8.461  1.00 0.00 ? 61 ILE A CD1  1  
ATOM 946   H H    . ILE A 1 61 ? -0.318  -7.165  -5.796  1.00 0.00 ? 61 ILE A H    1  
ATOM 947   H HA   . ILE A 1 61 ? 1.878   -8.607  -6.991  1.00 0.00 ? 61 ILE A HA   1  
ATOM 948   H HB   . ILE A 1 61 ? 2.104   -6.070  -5.362  1.00 0.00 ? 61 ILE A HB   1  
ATOM 949   H HG12 . ILE A 1 61 ? 0.452   -6.506  -7.740  1.00 0.00 ? 61 ILE A HG12 1  
ATOM 950   H HG13 . ILE A 1 61 ? 0.639   -5.051  -6.773  1.00 0.00 ? 61 ILE A HG13 1  
ATOM 951   H HG21 . ILE A 1 61 ? 3.600   -7.055  -7.806  1.00 0.00 ? 61 ILE A HG21 1  
ATOM 952   H HG22 . ILE A 1 61 ? 4.163   -7.191  -6.143  1.00 0.00 ? 61 ILE A HG22 1  
ATOM 953   H HG23 . ILE A 1 61 ? 3.956   -5.601  -6.869  1.00 0.00 ? 61 ILE A HG23 1  
ATOM 954   H HD11 . ILE A 1 61 ? 2.459   -5.899  -9.043  1.00 0.00 ? 61 ILE A HD11 1  
ATOM 955   H HD12 . ILE A 1 61 ? 2.660   -4.453  -8.050  1.00 0.00 ? 61 ILE A HD12 1  
ATOM 956   H HD13 . ILE A 1 61 ? 1.251   -4.618  -9.094  1.00 0.00 ? 61 ILE A HD13 1  
ATOM 957   N N    . LEU A 1 62 ? 1.960   -8.181  -3.722  1.00 0.00 ? 62 LEU A N    1  
ATOM 958   C CA   . LEU A 1 62 ? 2.615   -8.679  -2.479  1.00 0.00 ? 62 LEU A CA   1  
ATOM 959   C C    . LEU A 1 62 ? 2.733   -10.207 -2.501  1.00 0.00 ? 62 LEU A C    1  
ATOM 960   O O    . LEU A 1 62 ? 3.675   -10.772 -1.982  1.00 0.00 ? 62 LEU A O    1  
ATOM 961   C CB   . LEU A 1 62 ? 1.764   -8.255  -1.275  1.00 0.00 ? 62 LEU A CB   1  
ATOM 962   C CG   . LEU A 1 62 ? 2.008   -6.758  -0.949  1.00 0.00 ? 62 LEU A CG   1  
ATOM 963   C CD1  . LEU A 1 62 ? 0.698   -6.103  -0.497  1.00 0.00 ? 62 LEU A CD1  1  
ATOM 964   C CD2  . LEU A 1 62 ? 3.050   -6.633  0.170   1.00 0.00 ? 62 LEU A CD2  1  
ATOM 965   H H    . LEU A 1 62 ? 1.248   -7.510  -3.656  1.00 0.00 ? 62 LEU A H    1  
ATOM 966   H HA   . LEU A 1 62 ? 3.594   -8.226  -2.398  1.00 0.00 ? 62 LEU A HA   1  
ATOM 967   H HB2  . LEU A 1 62 ? 0.720   -8.411  -1.514  1.00 0.00 ? 62 LEU A HB2  1  
ATOM 968   H HB3  . LEU A 1 62 ? 2.023   -8.863  -0.417  1.00 0.00 ? 62 LEU A HB3  1  
ATOM 969   H HG   . LEU A 1 62 ? 2.368   -6.244  -1.831  1.00 0.00 ? 62 LEU A HG   1  
ATOM 970   H HD11 . LEU A 1 62 ? 0.109   -5.850  -1.363  1.00 0.00 ? 62 LEU A HD11 1  
ATOM 971   H HD12 . LEU A 1 62 ? 0.909   -5.206  0.069   1.00 0.00 ? 62 LEU A HD12 1  
ATOM 972   H HD13 . LEU A 1 62 ? 0.149   -6.797  0.116   1.00 0.00 ? 62 LEU A HD13 1  
ATOM 973   H HD21 . LEU A 1 62 ? 3.988   -7.054  -0.160  1.00 0.00 ? 62 LEU A HD21 1  
ATOM 974   H HD22 . LEU A 1 62 ? 2.705   -7.166  1.043   1.00 0.00 ? 62 LEU A HD22 1  
ATOM 975   H HD23 . LEU A 1 62 ? 3.185   -5.593  0.415   1.00 0.00 ? 62 LEU A HD23 1  
ATOM 976   N N    . LEU A 1 63 ? 1.773   -10.880 -3.072  1.00 0.00 ? 63 LEU A N    1  
ATOM 977   C CA   . LEU A 1 63 ? 1.818   -12.367 -3.097  1.00 0.00 ? 63 LEU A CA   1  
ATOM 978   C C    . LEU A 1 63 ? 2.806   -12.863 -4.155  1.00 0.00 ? 63 LEU A C    1  
ATOM 979   O O    . LEU A 1 63 ? 3.186   -14.017 -4.158  1.00 0.00 ? 63 LEU A O    1  
ATOM 980   C CB   . LEU A 1 63 ? 0.415   -12.918 -3.369  1.00 0.00 ? 63 LEU A CB   1  
ATOM 981   C CG   . LEU A 1 63 ? -0.595  -12.220 -2.450  1.00 0.00 ? 63 LEU A CG   1  
ATOM 982   C CD1  . LEU A 1 63 ? -1.968  -12.879 -2.607  1.00 0.00 ? 63 LEU A CD1  1  
ATOM 983   C CD2  . LEU A 1 63 ? -0.136  -12.331 -0.990  1.00 0.00 ? 63 LEU A CD2  1  
ATOM 984   H H    . LEU A 1 63 ? 1.012   -10.410 -3.472  1.00 0.00 ? 63 LEU A H    1  
ATOM 985   H HA   . LEU A 1 63 ? 2.165   -12.741 -2.146  1.00 0.00 ? 63 LEU A HA   1  
ATOM 986   H HB2  . LEU A 1 63 ? 0.149   -12.737 -4.399  1.00 0.00 ? 63 LEU A HB2  1  
ATOM 987   H HB3  . LEU A 1 63 ? 0.401   -13.980 -3.174  1.00 0.00 ? 63 LEU A HB3  1  
ATOM 988   H HG   . LEU A 1 63 ? -0.665  -11.178 -2.725  1.00 0.00 ? 63 LEU A HG   1  
ATOM 989   H HD11 . LEU A 1 63 ? -1.860  -13.952 -2.552  1.00 0.00 ? 63 LEU A HD11 1  
ATOM 990   H HD12 . LEU A 1 63 ? -2.390  -12.607 -3.563  1.00 0.00 ? 63 LEU A HD12 1  
ATOM 991   H HD13 . LEU A 1 63 ? -2.622  -12.542 -1.815  1.00 0.00 ? 63 LEU A HD13 1  
ATOM 992   H HD21 . LEU A 1 63 ? -0.970  -12.135 -0.331  1.00 0.00 ? 63 LEU A HD21 1  
ATOM 993   H HD22 . LEU A 1 63 ? 0.645   -11.608 -0.804  1.00 0.00 ? 63 LEU A HD22 1  
ATOM 994   H HD23 . LEU A 1 63 ? 0.243   -13.326 -0.805  1.00 0.00 ? 63 LEU A HD23 1  
ATOM 995   N N    . GLU A 1 64 ? 3.233   -12.016 -5.058  1.00 0.00 ? 64 GLU A N    1  
ATOM 996   C CA   . GLU A 1 64 ? 4.198   -12.477 -6.101  1.00 0.00 ? 64 GLU A CA   1  
ATOM 997   C C    . GLU A 1 64 ? 5.621   -12.350 -5.548  1.00 0.00 ? 64 GLU A C    1  
ATOM 998   O O    . GLU A 1 64 ? 6.579   -12.184 -6.276  1.00 0.00 ? 64 GLU A O    1  
ATOM 999   C CB   . GLU A 1 64 ? 4.035   -11.646 -7.380  1.00 0.00 ? 64 GLU A CB   1  
ATOM 1000  C CG   . GLU A 1 64 ? 2.851   -12.169 -8.200  1.00 0.00 ? 64 GLU A CG   1  
ATOM 1001  C CD   . GLU A 1 64 ? 3.200   -13.538 -8.789  1.00 0.00 ? 64 GLU A CD   1  
ATOM 1002  O OE1  . GLU A 1 64 ? 3.939   -13.572 -9.759  1.00 0.00 ? 64 GLU A OE1  1  
ATOM 1003  O OE2  . GLU A 1 64 ? 2.721   -14.528 -8.260  1.00 0.00 ? 64 GLU A OE2  1  
ATOM 1004  H H    . GLU A 1 64 ? 2.926   -11.088 -5.050  1.00 0.00 ? 64 GLU A H    1  
ATOM 1005  H HA   . GLU A 1 64 ? 4.010   -13.522 -6.313  1.00 0.00 ? 64 GLU A HA   1  
ATOM 1006  H HB2  . GLU A 1 64 ? 3.857   -10.615 -7.117  1.00 0.00 ? 64 GLU A HB2  1  
ATOM 1007  H HB3  . GLU A 1 64 ? 4.933   -11.719 -7.973  1.00 0.00 ? 64 GLU A HB3  1  
ATOM 1008  H HG2  . GLU A 1 64 ? 1.985   -12.261 -7.565  1.00 0.00 ? 64 GLU A HG2  1  
ATOM 1009  H HG3  . GLU A 1 64 ? 2.637   -11.480 -9.003  1.00 0.00 ? 64 GLU A HG3  1  
ATOM 1010  N N    . GLU A 1 65 ? 5.749   -12.483 -4.255  1.00 0.00 ? 65 GLU A N    1  
ATOM 1011  C CA   . GLU A 1 65 ? 7.094   -12.438 -3.611  1.00 0.00 ? 65 GLU A CA   1  
ATOM 1012  C C    . GLU A 1 65 ? 7.919   -11.230 -4.074  1.00 0.00 ? 65 GLU A C    1  
ATOM 1013  O O    . GLU A 1 65 ? 9.133   -11.274 -4.119  1.00 0.00 ? 65 GLU A O    1  
ATOM 1014  C CB   . GLU A 1 65 ? 7.851   -13.700 -4.033  1.00 0.00 ? 65 GLU A CB   1  
ATOM 1015  C CG   . GLU A 1 65 ? 7.193   -14.928 -3.401  1.00 0.00 ? 65 GLU A CG   1  
ATOM 1016  C CD   . GLU A 1 65 ? 7.879   -16.194 -3.916  1.00 0.00 ? 65 GLU A CD   1  
ATOM 1017  O OE1  . GLU A 1 65 ? 8.312   -16.187 -5.057  1.00 0.00 ? 65 GLU A OE1  1  
ATOM 1018  O OE2  . GLU A 1 65 ? 7.959   -17.150 -3.162  1.00 0.00 ? 65 GLU A OE2  1  
ATOM 1019  H H    . GLU A 1 65 ? 4.948   -12.660 -3.724  1.00 0.00 ? 65 GLU A H    1  
ATOM 1020  H HA   . GLU A 1 65 ? 7.005   -12.459 -2.537  1.00 0.00 ? 65 GLU A HA   1  
ATOM 1021  H HB2  . GLU A 1 65 ? 7.826   -13.792 -5.109  1.00 0.00 ? 65 GLU A HB2  1  
ATOM 1022  H HB3  . GLU A 1 65 ? 8.875   -13.632 -3.701  1.00 0.00 ? 65 GLU A HB3  1  
ATOM 1023  H HG2  . GLU A 1 65 ? 7.291   -14.875 -2.326  1.00 0.00 ? 65 GLU A HG2  1  
ATOM 1024  H HG3  . GLU A 1 65 ? 6.147   -14.954 -3.667  1.00 0.00 ? 65 GLU A HG3  1  
ATOM 1025  N N    . VAL A 1 66 ? 7.267   -10.142 -4.387  1.00 0.00 ? 66 VAL A N    1  
ATOM 1026  C CA   . VAL A 1 66 ? 7.991   -8.904  -4.815  1.00 0.00 ? 66 VAL A CA   1  
ATOM 1027  C C    . VAL A 1 66 ? 8.254   -8.045  -3.563  1.00 0.00 ? 66 VAL A C    1  
ATOM 1028  O O    . VAL A 1 66 ? 7.459   -8.018  -2.645  1.00 0.00 ? 66 VAL A O    1  
ATOM 1029  C CB   . VAL A 1 66 ? 7.098   -8.148  -5.827  1.00 0.00 ? 66 VAL A CB   1  
ATOM 1030  C CG1  . VAL A 1 66 ? 7.334   -6.634  -5.759  1.00 0.00 ? 66 VAL A CG1  1  
ATOM 1031  C CG2  . VAL A 1 66 ? 7.404   -8.633  -7.251  1.00 0.00 ? 66 VAL A CG2  1  
ATOM 1032  H H    . VAL A 1 66 ? 6.286   -10.128 -4.333  1.00 0.00 ? 66 VAL A H    1  
ATOM 1033  H HA   . VAL A 1 66 ? 8.930   -9.169  -5.286  1.00 0.00 ? 66 VAL A HA   1  
ATOM 1034  H HB   . VAL A 1 66 ? 6.066   -8.356  -5.598  1.00 0.00 ? 66 VAL A HB   1  
ATOM 1035  H HG11 . VAL A 1 66 ? 6.881   -6.159  -6.617  1.00 0.00 ? 66 VAL A HG11 1  
ATOM 1036  H HG12 . VAL A 1 66 ? 8.395   -6.439  -5.756  1.00 0.00 ? 66 VAL A HG12 1  
ATOM 1037  H HG13 . VAL A 1 66 ? 6.892   -6.241  -4.855  1.00 0.00 ? 66 VAL A HG13 1  
ATOM 1038  H HG21 . VAL A 1 66 ? 8.320   -8.178  -7.599  1.00 0.00 ? 66 VAL A HG21 1  
ATOM 1039  H HG22 . VAL A 1 66 ? 6.593   -8.354  -7.908  1.00 0.00 ? 66 VAL A HG22 1  
ATOM 1040  H HG23 . VAL A 1 66 ? 7.515   -9.706  -7.249  1.00 0.00 ? 66 VAL A HG23 1  
ATOM 1041  N N    . SER A 1 67 ? 9.364   -7.348  -3.515  1.00 0.00 ? 67 SER A N    1  
ATOM 1042  C CA   . SER A 1 67 ? 9.662   -6.506  -2.315  1.00 0.00 ? 67 SER A CA   1  
ATOM 1043  C C    . SER A 1 67 ? 8.495   -5.517  -2.076  1.00 0.00 ? 67 SER A C    1  
ATOM 1044  O O    . SER A 1 67 ? 7.910   -5.044  -3.030  1.00 0.00 ? 67 SER A O    1  
ATOM 1045  C CB   . SER A 1 67 ? 10.964  -5.723  -2.543  1.00 0.00 ? 67 SER A CB   1  
ATOM 1046  O OG   . SER A 1 67 ? 11.856  -6.516  -3.316  1.00 0.00 ? 67 SER A OG   1  
ATOM 1047  H H    . SER A 1 67 ? 9.999   -7.383  -4.260  1.00 0.00 ? 67 SER A H    1  
ATOM 1048  H HA   . SER A 1 67 ? 9.784   -7.158  -1.473  1.00 0.00 ? 67 SER A HA   1  
ATOM 1049  H HB2  . SER A 1 67 ? 10.757  -4.806  -3.072  1.00 0.00 ? 67 SER A HB2  1  
ATOM 1050  H HB3  . SER A 1 67 ? 11.414  -5.488  -1.587  1.00 0.00 ? 67 SER A HB3  1  
ATOM 1051  H HG   . SER A 1 67 ? 11.375  -6.849  -4.077  1.00 0.00 ? 67 SER A HG   1  
ATOM 1052  N N    . PRO A 1 68 ? 8.176   -5.224  -0.823  1.00 0.00 ? 68 PRO A N    1  
ATOM 1053  C CA   . PRO A 1 68 ? 7.072   -4.290  -0.509  1.00 0.00 ? 68 PRO A CA   1  
ATOM 1054  C C    . PRO A 1 68 ? 7.331   -2.875  -1.069  1.00 0.00 ? 68 PRO A C    1  
ATOM 1055  O O    . PRO A 1 68 ? 6.414   -2.182  -1.452  1.00 0.00 ? 68 PRO A O    1  
ATOM 1056  C CB   . PRO A 1 68 ? 7.011   -4.251  1.039   1.00 0.00 ? 68 PRO A CB   1  
ATOM 1057  C CG   . PRO A 1 68 ? 8.178   -5.121  1.579   1.00 0.00 ? 68 PRO A CG   1  
ATOM 1058  C CD   . PRO A 1 68 ? 8.856   -5.791  0.367   1.00 0.00 ? 68 PRO A CD   1  
ATOM 1059  H HA   . PRO A 1 68 ? 6.146   -4.680  -0.904  1.00 0.00 ? 68 PRO A HA   1  
ATOM 1060  H HB2  . PRO A 1 68 ? 7.115   -3.234  1.397   1.00 0.00 ? 68 PRO A HB2  1  
ATOM 1061  H HB3  . PRO A 1 68 ? 6.075   -4.657  1.382   1.00 0.00 ? 68 PRO A HB3  1  
ATOM 1062  H HG2  . PRO A 1 68 ? 8.890   -4.497  2.107   1.00 0.00 ? 68 PRO A HG2  1  
ATOM 1063  H HG3  . PRO A 1 68 ? 7.791   -5.880  2.249   1.00 0.00 ? 68 PRO A HG3  1  
ATOM 1064  H HD2  . PRO A 1 68 ? 9.914   -5.563  0.345   1.00 0.00 ? 68 PRO A HD2  1  
ATOM 1065  H HD3  . PRO A 1 68 ? 8.700   -6.860  0.409   1.00 0.00 ? 68 PRO A HD3  1  
ATOM 1066  N N    . GLU A 1 69 ? 8.552   -2.423  -1.080  1.00 0.00 ? 69 GLU A N    1  
ATOM 1067  C CA   . GLU A 1 69 ? 8.827   -1.038  -1.577  1.00 0.00 ? 69 GLU A CA   1  
ATOM 1068  C C    . GLU A 1 69 ? 8.785   -0.999  -3.110  1.00 0.00 ? 69 GLU A C    1  
ATOM 1069  O O    . GLU A 1 69 ? 8.577   0.043   -3.721  1.00 0.00 ? 69 GLU A O    1  
ATOM 1070  C CB   . GLU A 1 69 ? 10.212  -0.605  -1.074  1.00 0.00 ? 69 GLU A CB   1  
ATOM 1071  C CG   . GLU A 1 69 ? 10.675  0.671   -1.789  1.00 0.00 ? 69 GLU A CG   1  
ATOM 1072  C CD   . GLU A 1 69 ? 9.560   1.721   -1.757  1.00 0.00 ? 69 GLU A CD   1  
ATOM 1073  O OE1  . GLU A 1 69 ? 9.098   2.033   -0.672  1.00 0.00 ? 69 GLU A OE1  1  
ATOM 1074  O OE2  . GLU A 1 69 ? 9.188   2.193   -2.819  1.00 0.00 ? 69 GLU A OE2  1  
ATOM 1075  H H    . GLU A 1 69 ? 9.285   -2.977  -0.739  1.00 0.00 ? 69 GLU A H    1  
ATOM 1076  H HA   . GLU A 1 69 ? 8.080   -0.364  -1.183  1.00 0.00 ? 69 GLU A HA   1  
ATOM 1077  H HB2  . GLU A 1 69 ? 10.159  -0.418  -0.011  1.00 0.00 ? 69 GLU A HB2  1  
ATOM 1078  H HB3  . GLU A 1 69 ? 10.922  -1.396  -1.261  1.00 0.00 ? 69 GLU A HB3  1  
ATOM 1079  H HG2  . GLU A 1 69 ? 11.550  1.062   -1.290  1.00 0.00 ? 69 GLU A HG2  1  
ATOM 1080  H HG3  . GLU A 1 69 ? 10.922  0.440   -2.814  1.00 0.00 ? 69 GLU A HG3  1  
ATOM 1081  N N    . LEU A 1 70 ? 8.955   -2.120  -3.743  1.00 0.00 ? 70 LEU A N    1  
ATOM 1082  C CA   . LEU A 1 70 ? 8.909   -2.117  -5.227  1.00 0.00 ? 70 LEU A CA   1  
ATOM 1083  C C    . LEU A 1 70 ? 7.454   -1.877  -5.652  1.00 0.00 ? 70 LEU A C    1  
ATOM 1084  O O    . LEU A 1 70 ? 7.167   -1.582  -6.795  1.00 0.00 ? 70 LEU A O    1  
ATOM 1085  C CB   . LEU A 1 70 ? 9.454   -3.443  -5.780  1.00 0.00 ? 70 LEU A CB   1  
ATOM 1086  C CG   . LEU A 1 70 ? 10.985  -3.473  -5.667  1.00 0.00 ? 70 LEU A CG   1  
ATOM 1087  C CD1  . LEU A 1 70 ? 11.491  -4.902  -5.914  1.00 0.00 ? 70 LEU A CD1  1  
ATOM 1088  C CD2  . LEU A 1 70 ? 11.640  -2.517  -6.685  1.00 0.00 ? 70 LEU A CD2  1  
ATOM 1089  H H    . LEU A 1 70 ? 9.083   -2.945  -3.232  1.00 0.00 ? 70 LEU A H    1  
ATOM 1090  H HA   . LEU A 1 70 ? 9.504   -1.289  -5.572  1.00 0.00 ? 70 LEU A HA   1  
ATOM 1091  H HB2  . LEU A 1 70 ? 9.043   -4.257  -5.206  1.00 0.00 ? 70 LEU A HB2  1  
ATOM 1092  H HB3  . LEU A 1 70 ? 9.172   -3.554  -6.804  1.00 0.00 ? 70 LEU A HB3  1  
ATOM 1093  H HG   . LEU A 1 70 ? 11.254  -3.169  -4.678  1.00 0.00 ? 70 LEU A HG   1  
ATOM 1094  H HD11 . LEU A 1 70 ? 12.538  -4.962  -5.654  1.00 0.00 ? 70 LEU A HD11 1  
ATOM 1095  H HD12 . LEU A 1 70 ? 11.366  -5.152  -6.956  1.00 0.00 ? 70 LEU A HD12 1  
ATOM 1096  H HD13 . LEU A 1 70 ? 10.931  -5.598  -5.308  1.00 0.00 ? 70 LEU A HD13 1  
ATOM 1097  H HD21 . LEU A 1 70 ? 12.651  -2.843  -6.892  1.00 0.00 ? 70 LEU A HD21 1  
ATOM 1098  H HD22 . LEU A 1 70 ? 11.673  -1.519  -6.275  1.00 0.00 ? 70 LEU A HD22 1  
ATOM 1099  H HD23 . LEU A 1 70 ? 11.075  -2.511  -7.599  1.00 0.00 ? 70 LEU A HD23 1  
ATOM 1100  N N    . VAL A 1 71 ? 6.533   -2.034  -4.732  1.00 0.00 ? 71 VAL A N    1  
ATOM 1101  C CA   . VAL A 1 71 ? 5.089   -1.852  -5.071  1.00 0.00 ? 71 VAL A CA   1  
ATOM 1102  C C    . VAL A 1 71 ? 4.790   -0.393  -5.435  1.00 0.00 ? 71 VAL A C    1  
ATOM 1103  O O    . VAL A 1 71 ? 4.255   -0.122  -6.488  1.00 0.00 ? 71 VAL A O    1  
ATOM 1104  C CB   . VAL A 1 71 ? 4.209   -2.305  -3.881  1.00 0.00 ? 71 VAL A CB   1  
ATOM 1105  C CG1  . VAL A 1 71 ? 2.811   -1.646  -3.919  1.00 0.00 ? 71 VAL A CG1  1  
ATOM 1106  C CG2  . VAL A 1 71 ? 4.056   -3.830  -3.914  1.00 0.00 ? 71 VAL A CG2  1  
ATOM 1107  H H    . VAL A 1 71 ? 6.801   -2.312  -3.830  1.00 0.00 ? 71 VAL A H    1  
ATOM 1108  H HA   . VAL A 1 71 ? 4.881   -2.448  -5.945  1.00 0.00 ? 71 VAL A HA   1  
ATOM 1109  H HB   . VAL A 1 71 ? 4.694   -2.022  -2.964  1.00 0.00 ? 71 VAL A HB   1  
ATOM 1110  H HG11 . VAL A 1 71 ? 2.445   -1.633  -4.934  1.00 0.00 ? 71 VAL A HG11 1  
ATOM 1111  H HG12 . VAL A 1 71 ? 2.869   -0.630  -3.546  1.00 0.00 ? 71 VAL A HG12 1  
ATOM 1112  H HG13 . VAL A 1 71 ? 2.130   -2.205  -3.295  1.00 0.00 ? 71 VAL A HG13 1  
ATOM 1113  H HG21 . VAL A 1 71 ? 3.387   -4.142  -3.126  1.00 0.00 ? 71 VAL A HG21 1  
ATOM 1114  H HG22 . VAL A 1 71 ? 5.022   -4.291  -3.768  1.00 0.00 ? 71 VAL A HG22 1  
ATOM 1115  H HG23 . VAL A 1 71 ? 3.655   -4.132  -4.869  1.00 0.00 ? 71 VAL A HG23 1  
ATOM 1116  N N    . CYS A 1 72 ? 5.082   0.553   -4.589  1.00 0.00 ? 72 CYS A N    1  
ATOM 1117  C CA   . CYS A 1 72 ? 4.732   1.951   -4.955  1.00 0.00 ? 72 CYS A CA   1  
ATOM 1118  C C    . CYS A 1 72 ? 5.546   2.383   -6.190  1.00 0.00 ? 72 CYS A C    1  
ATOM 1119  O O    . CYS A 1 72 ? 5.123   3.224   -6.958  1.00 0.00 ? 72 CYS A O    1  
ATOM 1120  C CB   . CYS A 1 72 ? 5.009   2.882   -3.761  1.00 0.00 ? 72 CYS A CB   1  
ATOM 1121  S SG   . CYS A 1 72 ? 4.337   2.158   -2.237  1.00 0.00 ? 72 CYS A SG   1  
ATOM 1122  H H    . CYS A 1 72 ? 5.489   0.352   -3.719  1.00 0.00 ? 72 CYS A H    1  
ATOM 1123  H HA   . CYS A 1 72 ? 3.672   1.955   -5.191  1.00 0.00 ? 72 CYS A HA   1  
ATOM 1124  H HB2  . CYS A 1 72 ? 6.074   3.015   -3.646  1.00 0.00 ? 72 CYS A HB2  1  
ATOM 1125  H HB3  . CYS A 1 72 ? 4.550   3.839   -3.933  1.00 0.00 ? 72 CYS A HB3  1  
ATOM 1126  N N    . SER A 1 73 ? 6.705   1.794   -6.395  1.00 0.00 ? 73 SER A N    1  
ATOM 1127  C CA   . SER A 1 73 ? 7.527   2.163   -7.598  1.00 0.00 ? 73 SER A CA   1  
ATOM 1128  C C    . SER A 1 73 ? 6.965   1.509   -8.883  1.00 0.00 ? 73 SER A C    1  
ATOM 1129  O O    . SER A 1 73 ? 6.950   2.125   -9.930  1.00 0.00 ? 73 SER A O    1  
ATOM 1130  C CB   . SER A 1 73 ? 8.980   1.735   -7.390  1.00 0.00 ? 73 SER A CB   1  
ATOM 1131  O OG   . SER A 1 73 ? 9.821   2.515   -8.229  1.00 0.00 ? 73 SER A OG   1  
ATOM 1132  H H    . SER A 1 73 ? 7.026   1.117   -5.743  1.00 0.00 ? 73 SER A H    1  
ATOM 1133  H HA   . SER A 1 73 ? 7.486   3.229   -7.738  1.00 0.00 ? 73 SER A HA   1  
ATOM 1134  H HB2  . SER A 1 73 ? 9.260   1.895   -6.362  1.00 0.00 ? 73 SER A HB2  1  
ATOM 1135  H HB3  . SER A 1 73 ? 9.085   0.687   -7.632  1.00 0.00 ? 73 SER A HB3  1  
ATOM 1136  H HG   . SER A 1 73 ? 10.186  1.936   -8.903  1.00 0.00 ? 73 SER A HG   1  
ATOM 1137  N N    . MET A 1 74 ? 6.511   0.283   -8.828  1.00 0.00 ? 74 MET A N    1  
ATOM 1138  C CA   . MET A 1 74 ? 5.964   -0.375  -10.067 1.00 0.00 ? 74 MET A CA   1  
ATOM 1139  C C    . MET A 1 74 ? 4.591   0.219   -10.442 1.00 0.00 ? 74 MET A C    1  
ATOM 1140  O O    . MET A 1 74 ? 4.302   0.418   -11.605 1.00 0.00 ? 74 MET A O    1  
ATOM 1141  C CB   . MET A 1 74 ? 5.816   -1.907  -9.826  1.00 0.00 ? 74 MET A CB   1  
ATOM 1142  C CG   . MET A 1 74 ? 7.005   -2.689  -10.416 1.00 0.00 ? 74 MET A CG   1  
ATOM 1143  S SD   . MET A 1 74 ? 6.554   -4.437  -10.613 1.00 0.00 ? 74 MET A SD   1  
ATOM 1144  C CE   . MET A 1 74 ? 5.729   -4.683  -9.019  1.00 0.00 ? 74 MET A CE   1  
ATOM 1145  H H    . MET A 1 74 ? 6.530   -0.209  -7.981  1.00 0.00 ? 74 MET A H    1  
ATOM 1146  H HA   . MET A 1 74 ? 6.620   -0.216  -10.907 1.00 0.00 ? 74 MET A HA   1  
ATOM 1147  H HB2  . MET A 1 74 ? 5.774   -2.093  -8.766  1.00 0.00 ? 74 MET A HB2  1  
ATOM 1148  H HB3  . MET A 1 74 ? 4.905   -2.265  -10.288 1.00 0.00 ? 74 MET A HB3  1  
ATOM 1149  H HG2  . MET A 1 74 ? 7.268   -2.289  -11.384 1.00 0.00 ? 74 MET A HG2  1  
ATOM 1150  H HG3  . MET A 1 74 ? 7.851   -2.609  -9.756  1.00 0.00 ? 74 MET A HG3  1  
ATOM 1151  H HE1  . MET A 1 74 ? 6.341   -4.273  -8.230  1.00 0.00 ? 74 MET A HE1  1  
ATOM 1152  H HE2  . MET A 1 74 ? 5.588   -5.738  -8.847  1.00 0.00 ? 74 MET A HE2  1  
ATOM 1153  H HE3  . MET A 1 74 ? 4.766   -4.192  -9.030  1.00 0.00 ? 74 MET A HE3  1  
ATOM 1154  N N    . LEU A 1 75 ? 3.735   0.484   -9.494  1.00 0.00 ? 75 LEU A N    1  
ATOM 1155  C CA   . LEU A 1 75 ? 2.391   1.037   -9.855  1.00 0.00 ? 75 LEU A CA   1  
ATOM 1156  C C    . LEU A 1 75 ? 2.517   2.496   -10.321 1.00 0.00 ? 75 LEU A C    1  
ATOM 1157  O O    . LEU A 1 75 ? 1.547   3.226   -10.367 1.00 0.00 ? 75 LEU A O    1  
ATOM 1158  C CB   . LEU A 1 75 ? 1.452   0.958   -8.641  1.00 0.00 ? 75 LEU A CB   1  
ATOM 1159  C CG   . LEU A 1 75 ? 1.408   -0.478  -8.089  1.00 0.00 ? 75 LEU A CG   1  
ATOM 1160  C CD1  . LEU A 1 75 ? 0.331   -0.582  -7.007  1.00 0.00 ? 75 LEU A CD1  1  
ATOM 1161  C CD2  . LEU A 1 75 ? 1.096   -1.476  -9.216  1.00 0.00 ? 75 LEU A CD2  1  
ATOM 1162  H H    . LEU A 1 75 ? 3.964   0.305   -8.558  1.00 0.00 ? 75 LEU A H    1  
ATOM 1163  H HA   . LEU A 1 75 ? 1.977   0.455   -10.663 1.00 0.00 ? 75 LEU A HA   1  
ATOM 1164  H HB2  . LEU A 1 75 ? 1.809   1.626   -7.871  1.00 0.00 ? 75 LEU A HB2  1  
ATOM 1165  H HB3  . LEU A 1 75 ? 0.459   1.256   -8.939  1.00 0.00 ? 75 LEU A HB3  1  
ATOM 1166  H HG   . LEU A 1 75 ? 2.360   -0.718  -7.653  1.00 0.00 ? 75 LEU A HG   1  
ATOM 1167  H HD11 . LEU A 1 75 ? 0.188   -1.620  -6.742  1.00 0.00 ? 75 LEU A HD11 1  
ATOM 1168  H HD12 . LEU A 1 75 ? -0.594  -0.177  -7.382  1.00 0.00 ? 75 LEU A HD12 1  
ATOM 1169  H HD13 . LEU A 1 75 ? 0.643   -0.029  -6.134  1.00 0.00 ? 75 LEU A HD13 1  
ATOM 1170  H HD21 . LEU A 1 75 ? 2.003   -1.698  -9.760  1.00 0.00 ? 75 LEU A HD21 1  
ATOM 1171  H HD22 . LEU A 1 75 ? 0.367   -1.048  -9.888  1.00 0.00 ? 75 LEU A HD22 1  
ATOM 1172  H HD23 . LEU A 1 75 ? 0.701   -2.388  -8.794  1.00 0.00 ? 75 LEU A HD23 1  
ATOM 1173  N N    . HIS A 1 76 ? 3.702   2.928   -10.661 1.00 0.00 ? 76 HIS A N    1  
ATOM 1174  C CA   . HIS A 1 76 ? 3.888   4.341   -11.119 1.00 0.00 ? 76 HIS A CA   1  
ATOM 1175  C C    . HIS A 1 76 ? 3.168   5.285   -10.145 1.00 0.00 ? 76 HIS A C    1  
ATOM 1176  O O    . HIS A 1 76 ? 2.873   6.415   -10.481 1.00 0.00 ? 76 HIS A O    1  
ATOM 1177  C CB   . HIS A 1 76 ? 3.338   4.510   -12.543 1.00 0.00 ? 76 HIS A CB   1  
ATOM 1178  C CG   . HIS A 1 76 ? 4.136   3.653   -13.488 1.00 0.00 ? 76 HIS A CG   1  
ATOM 1179  N ND1  . HIS A 1 76 ? 3.828   3.555   -14.836 1.00 0.00 ? 76 HIS A ND1  1  
ATOM 1180  C CD2  . HIS A 1 76 ? 5.230   2.847   -13.293 1.00 0.00 ? 76 HIS A CD2  1  
ATOM 1181  C CE1  . HIS A 1 76 ? 4.721   2.718   -15.395 1.00 0.00 ? 76 HIS A CE1  1  
ATOM 1182  N NE2  . HIS A 1 76 ? 5.598   2.258   -14.499 1.00 0.00 ? 76 HIS A NE2  1  
ATOM 1183  H H    . HIS A 1 76 ? 4.472   2.324   -10.602 1.00 0.00 ? 76 HIS A H    1  
ATOM 1184  H HA   . HIS A 1 76 ? 4.943   4.570   -11.115 1.00 0.00 ? 76 HIS A HA   1  
ATOM 1185  H HB2  . HIS A 1 76 ? 2.303   4.208   -12.576 1.00 0.00 ? 76 HIS A HB2  1  
ATOM 1186  H HB3  . HIS A 1 76 ? 3.423   5.545   -12.843 1.00 0.00 ? 76 HIS A HB3  1  
ATOM 1187  H HD1  . HIS A 1 76 ? 3.095   4.013   -15.297 1.00 0.00 ? 76 HIS A HD1  1  
ATOM 1188  H HD2  . HIS A 1 76 ? 5.730   2.693   -12.348 1.00 0.00 ? 76 HIS A HD2  1  
ATOM 1189  H HE1  . HIS A 1 76 ? 4.727   2.451   -16.442 1.00 0.00 ? 76 HIS A HE1  1  
ATOM 1190  N N    . LEU A 1 77 ? 2.878   4.850   -8.951  1.00 0.00 ? 77 LEU A N    1  
ATOM 1191  C CA   . LEU A 1 77 ? 2.177   5.741   -7.981  1.00 0.00 ? 77 LEU A CA   1  
ATOM 1192  C C    . LEU A 1 77 ? 3.230   6.644   -7.317  1.00 0.00 ? 77 LEU A C    1  
ATOM 1193  O O    . LEU A 1 77 ? 2.907   7.641   -6.702  1.00 0.00 ? 77 LEU A O    1  
ATOM 1194  C CB   . LEU A 1 77 ? 1.433   4.853   -6.945  1.00 0.00 ? 77 LEU A CB   1  
ATOM 1195  C CG   . LEU A 1 77 ? -0.069  5.198   -6.841  1.00 0.00 ? 77 LEU A CG   1  
ATOM 1196  C CD1  . LEU A 1 77 ? -0.748  5.285   -8.230  1.00 0.00 ? 77 LEU A CD1  1  
ATOM 1197  C CD2  . LEU A 1 77 ? -0.774  4.129   -5.991  1.00 0.00 ? 77 LEU A CD2  1  
ATOM 1198  H H    . LEU A 1 77 ? 3.121   3.944   -8.687  1.00 0.00 ? 77 LEU A H    1  
ATOM 1199  H HA   . LEU A 1 77 ? 1.482   6.370   -8.509  1.00 0.00 ? 77 LEU A HA   1  
ATOM 1200  H HB2  . LEU A 1 77 ? 1.527   3.824   -7.238  1.00 0.00 ? 77 LEU A HB2  1  
ATOM 1201  H HB3  . LEU A 1 77 ? 1.879   4.980   -5.972  1.00 0.00 ? 77 LEU A HB3  1  
ATOM 1202  H HG   . LEU A 1 77 ? -0.154  6.138   -6.348  1.00 0.00 ? 77 LEU A HG   1  
ATOM 1203  H HD11 . LEU A 1 77 ? -0.830  6.322   -8.522  1.00 0.00 ? 77 LEU A HD11 1  
ATOM 1204  H HD12 . LEU A 1 77 ? -1.741  4.854   -8.191  1.00 0.00 ? 77 LEU A HD12 1  
ATOM 1205  H HD13 . LEU A 1 77 ? -0.160  4.755   -8.960  1.00 0.00 ? 77 LEU A HD13 1  
ATOM 1206  H HD21 . LEU A 1 77 ? -1.708  4.523   -5.626  1.00 0.00 ? 77 LEU A HD21 1  
ATOM 1207  H HD22 . LEU A 1 77 ? -0.148  3.855   -5.158  1.00 0.00 ? 77 LEU A HD22 1  
ATOM 1208  H HD23 . LEU A 1 77 ? -0.969  3.262   -6.597  1.00 0.00 ? 77 LEU A HD23 1  
ATOM 1209  N N    . CYS A 1 78 ? 4.487   6.306   -7.466  1.00 0.00 ? 78 CYS A N    1  
ATOM 1210  C CA   . CYS A 1 78 ? 5.590   7.139   -6.885  1.00 0.00 ? 78 CYS A CA   1  
ATOM 1211  C C    . CYS A 1 78 ? 6.608   7.413   -7.996  1.00 0.00 ? 78 CYS A C    1  
ATOM 1212  O O    . CYS A 1 78 ? 7.605   6.728   -8.113  1.00 0.00 ? 78 CYS A O    1  
ATOM 1213  C CB   . CYS A 1 78 ? 6.281   6.372   -5.758  1.00 0.00 ? 78 CYS A CB   1  
ATOM 1214  S SG   . CYS A 1 78 ? 5.280   6.474   -4.266  1.00 0.00 ? 78 CYS A SG   1  
ATOM 1215  H H    . CYS A 1 78 ? 4.712   5.504   -7.982  1.00 0.00 ? 78 CYS A H    1  
ATOM 1216  H HA   . CYS A 1 78 ? 5.195   8.076   -6.508  1.00 0.00 ? 78 CYS A HA   1  
ATOM 1217  H HB2  . CYS A 1 78 ? 6.394   5.343   -6.044  1.00 0.00 ? 78 CYS A HB2  1  
ATOM 1218  H HB3  . CYS A 1 78 ? 7.254   6.803   -5.567  1.00 0.00 ? 78 CYS A HB3  1  
ATOM 1219  N N    . SER A 1 79 ? 6.335   8.357   -8.856  1.00 0.00 ? 79 SER A N    1  
ATOM 1220  C CA   . SER A 1 79 ? 7.262   8.597   -10.000 1.00 0.00 ? 79 SER A CA   1  
ATOM 1221  C C    . SER A 1 79 ? 8.710   8.755   -9.506  1.00 0.00 ? 79 SER A C    1  
ATOM 1222  O O    . SER A 1 79 ? 8.961   8.778   -8.318  1.00 0.00 ? 79 SER A O    1  
ATOM 1223  C CB   . SER A 1 79 ? 6.815   9.827   -10.792 1.00 0.00 ? 79 SER A CB   1  
ATOM 1224  O OG   . SER A 1 79 ? 7.860   10.229  -11.668 1.00 0.00 ? 79 SER A OG   1  
ATOM 1225  H H    . SER A 1 79 ? 5.501   8.867   -8.782  1.00 0.00 ? 79 SER A H    1  
ATOM 1226  H HA   . SER A 1 79 ? 7.208   7.713   -10.618 1.00 0.00 ? 79 SER A HA   1  
ATOM 1227  H HB2  . SER A 1 79 ? 5.938   9.585   -11.373 1.00 0.00 ? 79 SER A HB2  1  
ATOM 1228  H HB3  . SER A 1 79 ? 6.576   10.630  -10.105 1.00 0.00 ? 79 SER A HB3  1  
ATOM 1229  H HG   . SER A 1 79 ? 7.869   11.188  -11.699 1.00 0.00 ? 79 SER A HG   1  
ATOM 1230  N N    . GLY A 1 80 ? 9.664   8.878   -10.408 1.00 0.00 ? 80 GLY A N    1  
ATOM 1231  C CA   . GLY A 1 80 ? 11.095  9.051   -9.996  1.00 0.00 ? 80 GLY A CA   1  
ATOM 1232  C C    . GLY A 1 80 ? 11.577  10.434  -10.440 1.00 0.00 ? 80 GLY A C    1  
ATOM 1233  O O    . GLY A 1 80 ? 10.788  11.302  -10.755 1.00 0.00 ? 80 GLY A O    1  
ATOM 1234  H H    . GLY A 1 80 ? 9.441   8.866   -11.363 1.00 0.00 ? 80 GLY A H    1  
ATOM 1235  H HA2  . GLY A 1 80 ? 11.192  8.962   -8.922  1.00 0.00 ? 80 GLY A HA2  1  
ATOM 1236  H HA3  . GLY A 1 80 ? 11.700  8.296   -10.474 1.00 0.00 ? 80 GLY A HA3  1  
ATOM 1237  N N    . LEU A 1 81 ? 12.864  10.648  -10.472 1.00 0.00 ? 81 LEU A N    1  
ATOM 1238  C CA   . LEU A 1 81 ? 13.383  11.978  -10.902 1.00 0.00 ? 81 LEU A CA   1  
ATOM 1239  C C    . LEU A 1 81 ? 13.262  12.088  -12.428 1.00 0.00 ? 81 LEU A C    1  
ATOM 1240  O O    . LEU A 1 81 ? 14.228  12.356  -13.112 1.00 0.00 ? 81 LEU A O    1  
ATOM 1241  C CB   . LEU A 1 81 ? 14.858  12.114  -10.465 1.00 0.00 ? 81 LEU A CB   1  
ATOM 1242  C CG   . LEU A 1 81 ? 15.206  13.584  -10.179 1.00 0.00 ? 81 LEU A CG   1  
ATOM 1243  C CD1  . LEU A 1 81 ? 16.617  13.667  -9.596  1.00 0.00 ? 81 LEU A CD1  1  
ATOM 1244  C CD2  . LEU A 1 81 ? 15.149  14.395  -11.476 1.00 0.00 ? 81 LEU A CD2  1  
ATOM 1245  H H    . LEU A 1 81 ? 13.488  9.936   -10.218 1.00 0.00 ? 81 LEU A H    1  
ATOM 1246  H HA   . LEU A 1 81 ? 12.790  12.754  -10.440 1.00 0.00 ? 81 LEU A HA   1  
ATOM 1247  H HB2  . LEU A 1 81 ? 15.014  11.535  -9.567  1.00 0.00 ? 81 LEU A HB2  1  
ATOM 1248  H HB3  . LEU A 1 81 ? 15.509  11.740  -11.243 1.00 0.00 ? 81 LEU A HB3  1  
ATOM 1249  H HG   . LEU A 1 81 ? 14.501  13.989  -9.466  1.00 0.00 ? 81 LEU A HG   1  
ATOM 1250  H HD11 . LEU A 1 81 ? 16.857  14.698  -9.381  1.00 0.00 ? 81 LEU A HD11 1  
ATOM 1251  H HD12 . LEU A 1 81 ? 17.325  13.274  -10.310 1.00 0.00 ? 81 LEU A HD12 1  
ATOM 1252  H HD13 . LEU A 1 81 ? 16.665  13.089  -8.685  1.00 0.00 ? 81 LEU A HD13 1  
ATOM 1253  H HD21 . LEU A 1 81 ? 15.535  15.387  -11.296 1.00 0.00 ? 81 LEU A HD21 1  
ATOM 1254  H HD22 . LEU A 1 81 ? 14.126  14.464  -11.815 1.00 0.00 ? 81 LEU A HD22 1  
ATOM 1255  H HD23 . LEU A 1 81 ? 15.748  13.909  -12.232 1.00 0.00 ? 81 LEU A HD23 1  
ATOM 1256  N N    . VAL A 1 82 ? 12.071  11.873  -12.946 1.00 0.00 ? 82 VAL A N    1  
ATOM 1257  C CA   . VAL A 1 82 ? 11.818  11.944  -14.428 1.00 0.00 ? 82 VAL A CA   1  
ATOM 1258  C C    . VAL A 1 82 ? 12.788  12.938  -15.113 1.00 0.00 ? 82 VAL A C    1  
ATOM 1259  O O    . VAL A 1 82 ? 12.512  14.121  -15.144 1.00 0.00 ? 82 VAL A O    1  
ATOM 1260  C CB   . VAL A 1 82 ? 10.370  12.424  -14.645 1.00 0.00 ? 82 VAL A CB   1  
ATOM 1261  C CG1  . VAL A 1 82 ? 9.402   11.246  -14.495 1.00 0.00 ? 82 VAL A CG1  1  
ATOM 1262  C CG2  . VAL A 1 82 ? 10.024  13.490  -13.599 1.00 0.00 ? 82 VAL A CG2  1  
ATOM 1263  H H    . VAL A 1 82 ? 11.325  11.658  -12.347 1.00 0.00 ? 82 VAL A H    1  
ATOM 1264  H HA   . VAL A 1 82 ? 11.924  10.961  -14.855 1.00 0.00 ? 82 VAL A HA   1  
ATOM 1265  H HB   . VAL A 1 82 ? 10.269  12.844  -15.637 1.00 0.00 ? 82 VAL A HB   1  
ATOM 1266  H HG11 . VAL A 1 82 ? 9.537   10.790  -13.525 1.00 0.00 ? 82 VAL A HG11 1  
ATOM 1267  H HG12 . VAL A 1 82 ? 9.600   10.516  -15.266 1.00 0.00 ? 82 VAL A HG12 1  
ATOM 1268  H HG13 . VAL A 1 82 ? 8.386   11.600  -14.588 1.00 0.00 ? 82 VAL A HG13 1  
ATOM 1269  H HG21 . VAL A 1 82 ? 10.832  14.201  -13.524 1.00 0.00 ? 82 VAL A HG21 1  
ATOM 1270  H HG22 . VAL A 1 82 ? 9.872   13.018  -12.640 1.00 0.00 ? 82 VAL A HG22 1  
ATOM 1271  H HG23 . VAL A 1 82 ? 9.120   14.003  -13.895 1.00 0.00 ? 82 VAL A HG23 1  
ATOM 1272  N N    . PRO A 1 83 ? 13.902  12.452  -15.641 1.00 0.00 ? 83 PRO A N    1  
ATOM 1273  C CA   . PRO A 1 83 ? 14.878  13.340  -16.303 1.00 0.00 ? 83 PRO A CA   1  
ATOM 1274  C C    . PRO A 1 83 ? 14.294  13.857  -17.624 1.00 0.00 ? 83 PRO A C    1  
ATOM 1275  O O    . PRO A 1 83 ? 14.893  14.664  -18.307 1.00 0.00 ? 83 PRO A O    1  
ATOM 1276  C CB   . PRO A 1 83 ? 16.122  12.451  -16.547 1.00 0.00 ? 83 PRO A CB   1  
ATOM 1277  C CG   . PRO A 1 83 ? 15.744  10.997  -16.137 1.00 0.00 ? 83 PRO A CG   1  
ATOM 1278  C CD   . PRO A 1 83 ? 14.284  11.021  -15.631 1.00 0.00 ? 83 PRO A CD   1  
ATOM 1279  H HA   . PRO A 1 83 ? 15.129  14.165  -15.657 1.00 0.00 ? 83 PRO A HA   1  
ATOM 1280  H HB2  . PRO A 1 83 ? 16.410  12.481  -17.593 1.00 0.00 ? 83 PRO A HB2  1  
ATOM 1281  H HB3  . PRO A 1 83 ? 16.947  12.795  -15.937 1.00 0.00 ? 83 PRO A HB3  1  
ATOM 1282  H HG2  . PRO A 1 83 ? 15.831  10.338  -16.994 1.00 0.00 ? 83 PRO A HG2  1  
ATOM 1283  H HG3  . PRO A 1 83 ? 16.399  10.651  -15.348 1.00 0.00 ? 83 PRO A HG3  1  
ATOM 1284  H HD2  . PRO A 1 83 ? 13.648  10.457  -16.302 1.00 0.00 ? 83 PRO A HD2  1  
ATOM 1285  H HD3  . PRO A 1 83 ? 14.220  10.621  -14.631 1.00 0.00 ? 83 PRO A HD3  1  
ATOM 1286  N N    . ARG A 1 84 ? 13.130  13.396  -17.984 1.00 0.00 ? 84 ARG A N    1  
ATOM 1287  C CA   . ARG A 1 84 ? 12.504  13.856  -19.256 1.00 0.00 ? 84 ARG A CA   1  
ATOM 1288  C C    . ARG A 1 84 ? 11.044  13.401  -19.294 1.00 0.00 ? 84 ARG A C    1  
ATOM 1289  O O    . ARG A 1 84 ? 10.230  14.135  -19.829 1.00 0.00 ? 84 ARG A O    1  
ATOM 1290  C CB   . ARG A 1 84 ? 13.268  13.254  -20.446 1.00 0.00 ? 84 ARG A CB   1  
ATOM 1291  C CG   . ARG A 1 84 ? 12.720  13.811  -21.787 1.00 0.00 ? 84 ARG A CG   1  
ATOM 1292  C CD   . ARG A 1 84 ? 11.757  12.805  -22.436 1.00 0.00 ? 84 ARG A CD   1  
ATOM 1293  N NE   . ARG A 1 84 ? 12.505  11.568  -22.800 1.00 0.00 ? 84 ARG A NE   1  
ATOM 1294  C CZ   . ARG A 1 84 ? 11.855  10.474  -23.091 1.00 0.00 ? 84 ARG A CZ   1  
ATOM 1295  N NH1  . ARG A 1 84 ? 10.551  10.462  -23.060 1.00 0.00 ? 84 ARG A NH1  1  
ATOM 1296  N NH2  . ARG A 1 84 ? 12.511  9.393   -23.412 1.00 0.00 ? 84 ARG A NH2  1  
ATOM 1297  O OXT  . ARG A 1 84 ? 10.765  12.327  -18.788 1.00 0.00 ? 84 ARG A OXT  1  
ATOM 1298  H H    . ARG A 1 84 ? 12.667  12.746  -17.417 1.00 0.00 ? 84 ARG A H    1  
ATOM 1299  H HA   . ARG A 1 84 ? 12.547  14.934  -19.308 1.00 0.00 ? 84 ARG A HA   1  
ATOM 1300  H HB2  . ARG A 1 84 ? 14.316  13.510  -20.352 1.00 0.00 ? 84 ARG A HB2  1  
ATOM 1301  H HB3  . ARG A 1 84 ? 13.166  12.179  -20.427 1.00 0.00 ? 84 ARG A HB3  1  
ATOM 1302  H HG2  . ARG A 1 84 ? 12.197  14.742  -21.616 1.00 0.00 ? 84 ARG A HG2  1  
ATOM 1303  H HG3  . ARG A 1 84 ? 13.544  13.991  -22.464 1.00 0.00 ? 84 ARG A HG3  1  
ATOM 1304  H HD2  . ARG A 1 84 ? 10.969  12.557  -21.743 1.00 0.00 ? 84 ARG A HD2  1  
ATOM 1305  H HD3  . ARG A 1 84 ? 11.328  13.241  -23.326 1.00 0.00 ? 84 ARG A HD3  1  
ATOM 1306  H HE   . ARG A 1 84 ? 13.484  11.577  -22.823 1.00 0.00 ? 84 ARG A HE   1  
ATOM 1307  H HH11 . ARG A 1 84 ? 10.048  11.291  -22.814 1.00 0.00 ? 84 ARG A HH11 1  
ATOM 1308  H HH12 . ARG A 1 84 ? 10.053  9.623   -23.283 1.00 0.00 ? 84 ARG A HH12 1  
ATOM 1309  H HH21 . ARG A 1 84 ? 13.511  9.402   -23.435 1.00 0.00 ? 84 ARG A HH21 1  
ATOM 1310  H HH22 . ARG A 1 84 ? 12.014  8.554   -23.634 1.00 0.00 ? 84 ARG A HH22 1  
ATOM 1311  N N    . SER A 1 1  ? 5.740   17.610  -1.487  1.00 0.00 ? 1  SER A N    2  
ATOM 1312  C CA   . SER A 1 1  ? 4.784   17.195  -0.422  1.00 0.00 ? 1  SER A CA   2  
ATOM 1313  C C    . SER A 1 1  ? 3.896   16.062  -0.946  1.00 0.00 ? 1  SER A C    2  
ATOM 1314  O O    . SER A 1 1  ? 2.716   15.988  -0.664  1.00 0.00 ? 1  SER A O    2  
ATOM 1315  C CB   . SER A 1 1  ? 3.909   18.387  -0.030  1.00 0.00 ? 1  SER A CB   2  
ATOM 1316  O OG   . SER A 1 1  ? 2.889   17.950  0.859   1.00 0.00 ? 1  SER A OG   2  
ATOM 1317  H H1   . SER A 1 1  ? 5.268   18.268  -2.140  1.00 0.00 ? 1  SER A H1   2  
ATOM 1318  H H2   . SER A 1 1  ? 6.061   16.771  -2.011  1.00 0.00 ? 1  SER A H2   2  
ATOM 1319  H H3   . SER A 1 1  ? 6.558   18.083  -1.054  1.00 0.00 ? 1  SER A H3   2  
ATOM 1320  H HA   . SER A 1 1  ? 5.334   16.852  0.443   1.00 0.00 ? 1  SER A HA   2  
ATOM 1321  H HB2  . SER A 1 1  ? 4.512   19.132  0.461   1.00 0.00 ? 1  SER A HB2  2  
ATOM 1322  H HB3  . SER A 1 1  ? 3.466   18.814  -0.921  1.00 0.00 ? 1  SER A HB3  2  
ATOM 1323  H HG   . SER A 1 1  ? 2.803   16.997  0.768   1.00 0.00 ? 1  SER A HG   2  
ATOM 1324  N N    . ASP A 1 2  ? 4.470   15.202  -1.745  1.00 0.00 ? 2  ASP A N    2  
ATOM 1325  C CA   . ASP A 1 2  ? 3.704   14.080  -2.356  1.00 0.00 ? 2  ASP A CA   2  
ATOM 1326  C C    . ASP A 1 2  ? 3.141   13.137  -1.285  1.00 0.00 ? 2  ASP A C    2  
ATOM 1327  O O    . ASP A 1 2  ? 3.824   12.285  -0.752  1.00 0.00 ? 2  ASP A O    2  
ATOM 1328  C CB   . ASP A 1 2  ? 4.641   13.317  -3.296  1.00 0.00 ? 2  ASP A CB   2  
ATOM 1329  C CG   . ASP A 1 2  ? 5.352   14.313  -4.216  1.00 0.00 ? 2  ASP A CG   2  
ATOM 1330  O OD1  . ASP A 1 2  ? 4.701   15.243  -4.665  1.00 0.00 ? 2  ASP A OD1  2  
ATOM 1331  O OD2  . ASP A 1 2  ? 6.533   14.128  -4.456  1.00 0.00 ? 2  ASP A OD2  2  
ATOM 1332  H H    . ASP A 1 2  ? 5.420   15.313  -1.967  1.00 0.00 ? 2  ASP A H    2  
ATOM 1333  H HA   . ASP A 1 2  ? 2.885   14.480  -2.929  1.00 0.00 ? 2  ASP A HA   2  
ATOM 1334  H HB2  . ASP A 1 2  ? 5.374   12.781  -2.716  1.00 0.00 ? 2  ASP A HB2  2  
ATOM 1335  H HB3  . ASP A 1 2  ? 4.073   12.624  -3.896  1.00 0.00 ? 2  ASP A HB3  2  
ATOM 1336  N N    . VAL A 1 3  ? 1.883   13.316  -0.974  1.00 0.00 ? 3  VAL A N    2  
ATOM 1337  C CA   . VAL A 1 3  ? 1.201   12.483  0.059   1.00 0.00 ? 3  VAL A CA   2  
ATOM 1338  C C    . VAL A 1 3  ? 0.857   11.090  -0.489  1.00 0.00 ? 3  VAL A C    2  
ATOM 1339  O O    . VAL A 1 3  ? 0.482   10.219  0.270   1.00 0.00 ? 3  VAL A O    2  
ATOM 1340  C CB   . VAL A 1 3  ? -0.108  13.195  0.474   1.00 0.00 ? 3  VAL A CB   2  
ATOM 1341  C CG1  . VAL A 1 3  ? 0.152   14.696  0.617   1.00 0.00 ? 3  VAL A CG1  2  
ATOM 1342  C CG2  . VAL A 1 3  ? -1.219  12.978  -0.567  1.00 0.00 ? 3  VAL A CG2  2  
ATOM 1343  H H    . VAL A 1 3  ? 1.376   14.022  -1.427  1.00 0.00 ? 3  VAL A H    2  
ATOM 1344  H HA   . VAL A 1 3  ? 1.816   12.405  0.946   1.00 0.00 ? 3  VAL A HA   2  
ATOM 1345  H HB   . VAL A 1 3  ? -0.433  12.804  1.427   1.00 0.00 ? 3  VAL A HB   2  
ATOM 1346  H HG11 . VAL A 1 3  ? 0.978   14.855  1.294   1.00 0.00 ? 3  VAL A HG11 2  
ATOM 1347  H HG12 . VAL A 1 3  ? -0.733  15.177  1.006   1.00 0.00 ? 3  VAL A HG12 2  
ATOM 1348  H HG13 . VAL A 1 3  ? 0.393   15.113  -0.350  1.00 0.00 ? 3  VAL A HG13 2  
ATOM 1349  H HG21 . VAL A 1 3  ? -2.028  13.670  -0.378  1.00 0.00 ? 3  VAL A HG21 2  
ATOM 1350  H HG22 . VAL A 1 3  ? -1.591  11.964  -0.492  1.00 0.00 ? 3  VAL A HG22 2  
ATOM 1351  H HG23 . VAL A 1 3  ? -0.827  13.146  -1.559  1.00 0.00 ? 3  VAL A HG23 2  
ATOM 1352  N N    . TYR A 1 4  ? 0.911   10.852  -1.778  1.00 0.00 ? 4  TYR A N    2  
ATOM 1353  C CA   . TYR A 1 4  ? 0.499   9.495   -2.257  1.00 0.00 ? 4  TYR A CA   2  
ATOM 1354  C C    . TYR A 1 4  ? 1.547   8.452   -1.855  1.00 0.00 ? 4  TYR A C    2  
ATOM 1355  O O    . TYR A 1 4  ? 1.222   7.379   -1.389  1.00 0.00 ? 4  TYR A O    2  
ATOM 1356  C CB   . TYR A 1 4  ? 0.283   9.496   -3.771  1.00 0.00 ? 4  TYR A CB   2  
ATOM 1357  C CG   . TYR A 1 4  ? -1.078  10.048  -4.114  1.00 0.00 ? 4  TYR A CG   2  
ATOM 1358  C CD1  . TYR A 1 4  ? -2.202  9.226   -4.010  1.00 0.00 ? 4  TYR A CD1  2  
ATOM 1359  C CD2  . TYR A 1 4  ? -1.213  11.366  -4.565  1.00 0.00 ? 4  TYR A CD2  2  
ATOM 1360  C CE1  . TYR A 1 4  ? -3.462  9.716   -4.354  1.00 0.00 ? 4  TYR A CE1  2  
ATOM 1361  C CE2  . TYR A 1 4  ? -2.477  11.861  -4.905  1.00 0.00 ? 4  TYR A CE2  2  
ATOM 1362  C CZ   . TYR A 1 4  ? -3.603  11.035  -4.800  1.00 0.00 ? 4  TYR A CZ   2  
ATOM 1363  O OH   . TYR A 1 4  ? -4.849  11.521  -5.139  1.00 0.00 ? 4  TYR A OH   2  
ATOM 1364  H H    . TYR A 1 4  ? 1.172   11.548  -2.414  1.00 0.00 ? 4  TYR A H    2  
ATOM 1365  H HA   . TYR A 1 4  ? -0.404  9.255   -1.717  1.00 0.00 ? 4  TYR A HA   2  
ATOM 1366  H HB2  . TYR A 1 4  ? 1.042   10.107  -4.238  1.00 0.00 ? 4  TYR A HB2  2  
ATOM 1367  H HB3  . TYR A 1 4  ? 0.360   8.488   -4.147  1.00 0.00 ? 4  TYR A HB3  2  
ATOM 1368  H HD1  . TYR A 1 4  ? -2.096  8.218   -3.655  1.00 0.00 ? 4  TYR A HD1  2  
ATOM 1369  H HD2  . TYR A 1 4  ? -0.343  12.001  -4.645  1.00 0.00 ? 4  TYR A HD2  2  
ATOM 1370  H HE1  . TYR A 1 4  ? -4.325  9.073   -4.279  1.00 0.00 ? 4  TYR A HE1  2  
ATOM 1371  H HE2  . TYR A 1 4  ? -2.583  12.877  -5.250  1.00 0.00 ? 4  TYR A HE2  2  
ATOM 1372  H HH   . TYR A 1 4  ? -5.229  11.931  -4.358  1.00 0.00 ? 4  TYR A HH   2  
ATOM 1373  N N    . CYS A 1 5  ? 2.800   8.767   -2.022  1.00 0.00 ? 5  CYS A N    2  
ATOM 1374  C CA   . CYS A 1 5  ? 3.866   7.803   -1.639  1.00 0.00 ? 5  CYS A CA   2  
ATOM 1375  C C    . CYS A 1 5  ? 3.727   7.457   -0.148  1.00 0.00 ? 5  CYS A C    2  
ATOM 1376  O O    . CYS A 1 5  ? 3.857   6.314   0.243   1.00 0.00 ? 5  CYS A O    2  
ATOM 1377  C CB   . CYS A 1 5  ? 5.243   8.424   -1.900  1.00 0.00 ? 5  CYS A CB   2  
ATOM 1378  S SG   . CYS A 1 5  ? 5.541   8.492   -3.679  1.00 0.00 ? 5  CYS A SG   2  
ATOM 1379  H H    . CYS A 1 5  ? 3.040   9.641   -2.391  1.00 0.00 ? 5  CYS A H    2  
ATOM 1380  H HA   . CYS A 1 5  ? 3.761   6.888   -2.204  1.00 0.00 ? 5  CYS A HA   2  
ATOM 1381  H HB2  . CYS A 1 5  ? 5.275   9.425   -1.497  1.00 0.00 ? 5  CYS A HB2  2  
ATOM 1382  H HB3  . CYS A 1 5  ? 6.006   7.821   -1.430  1.00 0.00 ? 5  CYS A HB3  2  
ATOM 1383  N N    . GLU A 1 6  ? 3.478   8.427   0.686   1.00 0.00 ? 6  GLU A N    2  
ATOM 1384  C CA   . GLU A 1 6  ? 3.351   8.142   2.144   1.00 0.00 ? 6  GLU A CA   2  
ATOM 1385  C C    . GLU A 1 6  ? 2.206   7.152   2.400   1.00 0.00 ? 6  GLU A C    2  
ATOM 1386  O O    . GLU A 1 6  ? 2.336   6.237   3.189   1.00 0.00 ? 6  GLU A O    2  
ATOM 1387  C CB   . GLU A 1 6  ? 3.080   9.452   2.890   1.00 0.00 ? 6  GLU A CB   2  
ATOM 1388  C CG   . GLU A 1 6  ? 3.182   9.218   4.400   1.00 0.00 ? 6  GLU A CG   2  
ATOM 1389  C CD   . GLU A 1 6  ? 4.639   8.947   4.779   1.00 0.00 ? 6  GLU A CD   2  
ATOM 1390  O OE1  . GLU A 1 6  ? 5.364   9.905   4.994   1.00 0.00 ? 6  GLU A OE1  2  
ATOM 1391  O OE2  . GLU A 1 6  ? 5.007   7.785   4.848   1.00 0.00 ? 6  GLU A OE2  2  
ATOM 1392  H H    . GLU A 1 6  ? 3.392   9.345   0.355   1.00 0.00 ? 6  GLU A H    2  
ATOM 1393  H HA   . GLU A 1 6  ? 4.275   7.717   2.507   1.00 0.00 ? 6  GLU A HA   2  
ATOM 1394  H HB2  . GLU A 1 6  ? 3.809   10.191  2.592   1.00 0.00 ? 6  GLU A HB2  2  
ATOM 1395  H HB3  . GLU A 1 6  ? 2.092   9.807   2.650   1.00 0.00 ? 6  GLU A HB3  2  
ATOM 1396  H HG2  . GLU A 1 6  ? 2.831   10.095  4.924   1.00 0.00 ? 6  GLU A HG2  2  
ATOM 1397  H HG3  . GLU A 1 6  ? 2.576   8.368   4.676   1.00 0.00 ? 6  GLU A HG3  2  
ATOM 1398  N N    . VAL A 1 7  ? 1.080   7.334   1.762   1.00 0.00 ? 7  VAL A N    2  
ATOM 1399  C CA   . VAL A 1 7  ? -0.067  6.406   2.003   1.00 0.00 ? 7  VAL A CA   2  
ATOM 1400  C C    . VAL A 1 7  ? 0.206   5.020   1.401   1.00 0.00 ? 7  VAL A C    2  
ATOM 1401  O O    . VAL A 1 7  ? -0.101  4.011   2.003   1.00 0.00 ? 7  VAL A O    2  
ATOM 1402  C CB   . VAL A 1 7  ? -1.359  6.996   1.420   1.00 0.00 ? 7  VAL A CB   2  
ATOM 1403  C CG1  . VAL A 1 7  ? -2.501  5.989   1.594   1.00 0.00 ? 7  VAL A CG1  2  
ATOM 1404  C CG2  . VAL A 1 7  ? -1.709  8.318   2.134   1.00 0.00 ? 7  VAL A CG2  2  
ATOM 1405  H H    . VAL A 1 7  ? 0.982   8.087   1.144   1.00 0.00 ? 7  VAL A H    2  
ATOM 1406  H HA   . VAL A 1 7  ? -0.181  6.243   3.071   1.00 0.00 ? 7  VAL A HA   2  
ATOM 1407  H HB   . VAL A 1 7  ? -1.214  7.186   0.366   1.00 0.00 ? 7  VAL A HB   2  
ATOM 1408  H HG11 . VAL A 1 7  ? -2.412  5.213   0.848   1.00 0.00 ? 7  VAL A HG11 2  
ATOM 1409  H HG12 . VAL A 1 7  ? -3.446  6.496   1.475   1.00 0.00 ? 7  VAL A HG12 2  
ATOM 1410  H HG13 . VAL A 1 7  ? -2.448  5.549   2.578   1.00 0.00 ? 7  VAL A HG13 2  
ATOM 1411  H HG21 . VAL A 1 7  ? -2.769  8.514   2.041   1.00 0.00 ? 7  VAL A HG21 2  
ATOM 1412  H HG22 . VAL A 1 7  ? -1.159  9.130   1.680   1.00 0.00 ? 7  VAL A HG22 2  
ATOM 1413  H HG23 . VAL A 1 7  ? -1.449  8.251   3.182   1.00 0.00 ? 7  VAL A HG23 2  
ATOM 1414  N N    . CYS A 1 8  ? 0.775   4.949   0.222   1.00 0.00 ? 8  CYS A N    2  
ATOM 1415  C CA   . CYS A 1 8  ? 1.052   3.618   -0.394  1.00 0.00 ? 8  CYS A CA   2  
ATOM 1416  C C    . CYS A 1 8  ? 1.953   2.811   0.536   1.00 0.00 ? 8  CYS A C    2  
ATOM 1417  O O    . CYS A 1 8  ? 1.703   1.654   0.807   1.00 0.00 ? 8  CYS A O    2  
ATOM 1418  C CB   . CYS A 1 8  ? 1.740   3.836   -1.753  1.00 0.00 ? 8  CYS A CB   2  
ATOM 1419  S SG   . CYS A 1 8  ? 3.519   4.093   -1.546  1.00 0.00 ? 8  CYS A SG   2  
ATOM 1420  H H    . CYS A 1 8  ? 1.030   5.753   -0.272  1.00 0.00 ? 8  CYS A H    2  
ATOM 1421  H HA   . CYS A 1 8  ? 0.129   3.078   -0.549  1.00 0.00 ? 8  CYS A HA   2  
ATOM 1422  H HB2  . CYS A 1 8  ? 1.583   2.971   -2.375  1.00 0.00 ? 8  CYS A HB2  2  
ATOM 1423  H HB3  . CYS A 1 8  ? 1.309   4.703   -2.231  1.00 0.00 ? 8  CYS A HB3  2  
ATOM 1424  N N    . GLU A 1 9  ? 3.000   3.409   1.022   1.00 0.00 ? 9  GLU A N    2  
ATOM 1425  C CA   . GLU A 1 9  ? 3.911   2.672   1.922   1.00 0.00 ? 9  GLU A CA   2  
ATOM 1426  C C    . GLU A 1 9  ? 3.186   2.364   3.227   1.00 0.00 ? 9  GLU A C    2  
ATOM 1427  O O    . GLU A 1 9  ? 3.485   1.385   3.884   1.00 0.00 ? 9  GLU A O    2  
ATOM 1428  C CB   . GLU A 1 9  ? 5.147   3.525   2.220   1.00 0.00 ? 9  GLU A CB   2  
ATOM 1429  C CG   . GLU A 1 9  ? 5.975   3.701   0.946   1.00 0.00 ? 9  GLU A CG   2  
ATOM 1430  C CD   . GLU A 1 9  ? 7.350   4.267   1.305   1.00 0.00 ? 9  GLU A CD   2  
ATOM 1431  O OE1  . GLU A 1 9  ? 7.397   5.218   2.067   1.00 0.00 ? 9  GLU A OE1  2  
ATOM 1432  O OE2  . GLU A 1 9  ? 8.334   3.740   0.811   1.00 0.00 ? 9  GLU A OE2  2  
ATOM 1433  H H    . GLU A 1 9  ? 3.193   4.340   0.785   1.00 0.00 ? 9  GLU A H    2  
ATOM 1434  H HA   . GLU A 1 9  ? 4.213   1.752   1.443   1.00 0.00 ? 9  GLU A HA   2  
ATOM 1435  H HB2  . GLU A 1 9  ? 4.834   4.495   2.582   1.00 0.00 ? 9  GLU A HB2  2  
ATOM 1436  H HB3  . GLU A 1 9  ? 5.748   3.037   2.973   1.00 0.00 ? 9  GLU A HB3  2  
ATOM 1437  H HG2  . GLU A 1 9  ? 6.096   2.744   0.459   1.00 0.00 ? 9  GLU A HG2  2  
ATOM 1438  H HG3  . GLU A 1 9  ? 5.471   4.382   0.278   1.00 0.00 ? 9  GLU A HG3  2  
ATOM 1439  N N    . PHE A 1 10 ? 2.228   3.164   3.627   1.00 0.00 ? 10 PHE A N    2  
ATOM 1440  C CA   . PHE A 1 10 ? 1.527   2.843   4.895   1.00 0.00 ? 10 PHE A CA   2  
ATOM 1441  C C    . PHE A 1 10 ? 0.683   1.574   4.704   1.00 0.00 ? 10 PHE A C    2  
ATOM 1442  O O    . PHE A 1 10 ? 0.737   0.664   5.509   1.00 0.00 ? 10 PHE A O    2  
ATOM 1443  C CB   . PHE A 1 10 ? 0.625   4.002   5.320   1.00 0.00 ? 10 PHE A CB   2  
ATOM 1444  C CG   . PHE A 1 10 ? -0.082  3.605   6.590   1.00 0.00 ? 10 PHE A CG   2  
ATOM 1445  C CD1  . PHE A 1 10 ? 0.540   3.799   7.826   1.00 0.00 ? 10 PHE A CD1  2  
ATOM 1446  C CD2  . PHE A 1 10 ? -1.349  3.017   6.525   1.00 0.00 ? 10 PHE A CD2  2  
ATOM 1447  C CE1  . PHE A 1 10 ? -0.105  3.407   9.004   1.00 0.00 ? 10 PHE A CE1  2  
ATOM 1448  C CE2  . PHE A 1 10 ? -1.995  2.618   7.703   1.00 0.00 ? 10 PHE A CE2  2  
ATOM 1449  C CZ   . PHE A 1 10 ? -1.372  2.815   8.942   1.00 0.00 ? 10 PHE A CZ   2  
ATOM 1450  H H    . PHE A 1 10 ? 1.971   3.962   3.119   1.00 0.00 ? 10 PHE A H    2  
ATOM 1451  H HA   . PHE A 1 10 ? 2.265   2.664   5.655   1.00 0.00 ? 10 PHE A HA   2  
ATOM 1452  H HB2  . PHE A 1 10 ? 1.224   4.885   5.495   1.00 0.00 ? 10 PHE A HB2  2  
ATOM 1453  H HB3  . PHE A 1 10 ? -0.102  4.202   4.548   1.00 0.00 ? 10 PHE A HB3  2  
ATOM 1454  H HD1  . PHE A 1 10 ? 1.517   4.256   7.872   1.00 0.00 ? 10 PHE A HD1  2  
ATOM 1455  H HD2  . PHE A 1 10 ? -1.827  2.873   5.567   1.00 0.00 ? 10 PHE A HD2  2  
ATOM 1456  H HE1  . PHE A 1 10 ? 0.377   3.557   9.960   1.00 0.00 ? 10 PHE A HE1  2  
ATOM 1457  H HE2  . PHE A 1 10 ? -2.973  2.161   7.657   1.00 0.00 ? 10 PHE A HE2  2  
ATOM 1458  H HZ   . PHE A 1 10 ? -1.867  2.508   9.850   1.00 0.00 ? 10 PHE A HZ   2  
ATOM 1459  N N    . LEU A 1 11 ? -0.080  1.487   3.642   1.00 0.00 ? 11 LEU A N    2  
ATOM 1460  C CA   . LEU A 1 11 ? -0.893  0.253   3.423   1.00 0.00 ? 11 LEU A CA   2  
ATOM 1461  C C    . LEU A 1 11 ? 0.053   -0.934  3.254   1.00 0.00 ? 11 LEU A C    2  
ATOM 1462  O O    . LEU A 1 11 ? -0.159  -1.985  3.825   1.00 0.00 ? 11 LEU A O    2  
ATOM 1463  C CB   . LEU A 1 11 ? -1.769  0.379   2.163   1.00 0.00 ? 11 LEU A CB   2  
ATOM 1464  C CG   . LEU A 1 11 ? -2.787  1.521   2.335   1.00 0.00 ? 11 LEU A CG   2  
ATOM 1465  C CD1  . LEU A 1 11 ? -3.329  1.935   0.963   1.00 0.00 ? 11 LEU A CD1  2  
ATOM 1466  C CD2  . LEU A 1 11 ? -3.961  1.068   3.217   1.00 0.00 ? 11 LEU A CD2  2  
ATOM 1467  H H    . LEU A 1 11 ? -0.110  2.222   2.994   1.00 0.00 ? 11 LEU A H    2  
ATOM 1468  H HA   . LEU A 1 11 ? -1.530  0.068   4.274   1.00 0.00 ? 11 LEU A HA   2  
ATOM 1469  H HB2  . LEU A 1 11 ? -1.140  0.585   1.308   1.00 0.00 ? 11 LEU A HB2  2  
ATOM 1470  H HB3  . LEU A 1 11 ? -2.297  -0.556  2.001   1.00 0.00 ? 11 LEU A HB3  2  
ATOM 1471  H HG   . LEU A 1 11 ? -2.296  2.369   2.795   1.00 0.00 ? 11 LEU A HG   2  
ATOM 1472  H HD11 . LEU A 1 11 ? -2.550  2.433   0.404   1.00 0.00 ? 11 LEU A HD11 2  
ATOM 1473  H HD12 . LEU A 1 11 ? -4.164  2.609   1.094   1.00 0.00 ? 11 LEU A HD12 2  
ATOM 1474  H HD13 . LEU A 1 11 ? -3.655  1.058   0.425   1.00 0.00 ? 11 LEU A HD13 2  
ATOM 1475  H HD21 . LEU A 1 11 ? -4.767  1.785   3.133   1.00 0.00 ? 11 LEU A HD21 2  
ATOM 1476  H HD22 . LEU A 1 11 ? -3.643  1.011   4.247   1.00 0.00 ? 11 LEU A HD22 2  
ATOM 1477  H HD23 . LEU A 1 11 ? -4.312  0.100   2.893   1.00 0.00 ? 11 LEU A HD23 2  
ATOM 1478  N N    . VAL A 1 12 ? 1.098   -0.792  2.481   1.00 0.00 ? 12 VAL A N    2  
ATOM 1479  C CA   . VAL A 1 12 ? 2.037   -1.928  2.296   1.00 0.00 ? 12 VAL A CA   2  
ATOM 1480  C C    . VAL A 1 12 ? 2.603   -2.348  3.665   1.00 0.00 ? 12 VAL A C    2  
ATOM 1481  O O    . VAL A 1 12 ? 2.607   -3.511  4.008   1.00 0.00 ? 12 VAL A O    2  
ATOM 1482  C CB   . VAL A 1 12 ? 3.174   -1.469  1.362   1.00 0.00 ? 12 VAL A CB   2  
ATOM 1483  C CG1  . VAL A 1 12 ? 4.396   -2.383  1.496   1.00 0.00 ? 12 VAL A CG1  2  
ATOM 1484  C CG2  . VAL A 1 12 ? 2.685   -1.506  -0.090  1.00 0.00 ? 12 VAL A CG2  2  
ATOM 1485  H H    . VAL A 1 12 ? 1.278   0.046   2.003   1.00 0.00 ? 12 VAL A H    2  
ATOM 1486  H HA   . VAL A 1 12 ? 1.514   -2.766  1.846   1.00 0.00 ? 12 VAL A HA   2  
ATOM 1487  H HB   . VAL A 1 12 ? 3.457   -0.459  1.617   1.00 0.00 ? 12 VAL A HB   2  
ATOM 1488  H HG11 . VAL A 1 12 ? 4.883   -2.205  2.443   1.00 0.00 ? 12 VAL A HG11 2  
ATOM 1489  H HG12 . VAL A 1 12 ? 5.087   -2.169  0.696   1.00 0.00 ? 12 VAL A HG12 2  
ATOM 1490  H HG13 . VAL A 1 12 ? 4.080   -3.415  1.440   1.00 0.00 ? 12 VAL A HG13 2  
ATOM 1491  H HG21 . VAL A 1 12 ? 3.406   -1.015  -0.726  1.00 0.00 ? 12 VAL A HG21 2  
ATOM 1492  H HG22 . VAL A 1 12 ? 1.735   -0.999  -0.164  1.00 0.00 ? 12 VAL A HG22 2  
ATOM 1493  H HG23 . VAL A 1 12 ? 2.570   -2.534  -0.406  1.00 0.00 ? 12 VAL A HG23 2  
ATOM 1494  N N    . LYS A 1 13 ? 3.071   -1.405  4.450   1.00 0.00 ? 13 LYS A N    2  
ATOM 1495  C CA   . LYS A 1 13 ? 3.630   -1.753  5.794   1.00 0.00 ? 13 LYS A CA   2  
ATOM 1496  C C    . LYS A 1 13 ? 2.548   -2.456  6.619   1.00 0.00 ? 13 LYS A C    2  
ATOM 1497  O O    . LYS A 1 13 ? 2.797   -3.439  7.288   1.00 0.00 ? 13 LYS A O    2  
ATOM 1498  C CB   . LYS A 1 13 ? 4.088   -0.467  6.503   1.00 0.00 ? 13 LYS A CB   2  
ATOM 1499  C CG   . LYS A 1 13 ? 4.307   -0.729  8.005   1.00 0.00 ? 13 LYS A CG   2  
ATOM 1500  C CD   . LYS A 1 13 ? 5.284   0.303   8.580   1.00 0.00 ? 13 LYS A CD   2  
ATOM 1501  C CE   . LYS A 1 13 ? 4.793   1.714   8.254   1.00 0.00 ? 13 LYS A CE   2  
ATOM 1502  N NZ   . LYS A 1 13 ? 3.342   1.823   8.577   1.00 0.00 ? 13 LYS A NZ   2  
ATOM 1503  H H    . LYS A 1 13 ? 3.059   -0.470  4.154   1.00 0.00 ? 13 LYS A H    2  
ATOM 1504  H HA   . LYS A 1 13 ? 4.474   -2.415  5.666   1.00 0.00 ? 13 LYS A HA   2  
ATOM 1505  H HB2  . LYS A 1 13 ? 5.012   -0.129  6.055   1.00 0.00 ? 13 LYS A HB2  2  
ATOM 1506  H HB3  . LYS A 1 13 ? 3.333   0.295   6.380   1.00 0.00 ? 13 LYS A HB3  2  
ATOM 1507  H HG2  . LYS A 1 13 ? 3.360   -0.653  8.524   1.00 0.00 ? 13 LYS A HG2  2  
ATOM 1508  H HG3  . LYS A 1 13 ? 4.713   -1.720  8.145   1.00 0.00 ? 13 LYS A HG3  2  
ATOM 1509  H HD2  . LYS A 1 13 ? 5.344   0.181   9.652   1.00 0.00 ? 13 LYS A HD2  2  
ATOM 1510  H HD3  . LYS A 1 13 ? 6.261   0.154   8.145   1.00 0.00 ? 13 LYS A HD3  2  
ATOM 1511  H HE2  . LYS A 1 13 ? 5.347   2.431   8.841   1.00 0.00 ? 13 LYS A HE2  2  
ATOM 1512  H HE3  . LYS A 1 13 ? 4.944   1.914   7.204   1.00 0.00 ? 13 LYS A HE3  2  
ATOM 1513  H HZ1  . LYS A 1 13 ? 2.793   1.247   7.908   1.00 0.00 ? 13 LYS A HZ1  2  
ATOM 1514  H HZ2  . LYS A 1 13 ? 3.045   2.818   8.504   1.00 0.00 ? 13 LYS A HZ2  2  
ATOM 1515  H HZ3  . LYS A 1 13 ? 3.175   1.480   9.544   1.00 0.00 ? 13 LYS A HZ3  2  
ATOM 1516  N N    . GLU A 1 14 ? 1.354   -1.938  6.590   1.00 0.00 ? 14 GLU A N    2  
ATOM 1517  C CA   . GLU A 1 14 ? 0.254   -2.547  7.387   1.00 0.00 ? 14 GLU A CA   2  
ATOM 1518  C C    . GLU A 1 14 ? -0.136  -3.889  6.768   1.00 0.00 ? 14 GLU A C    2  
ATOM 1519  O O    . GLU A 1 14 ? -0.450  -4.831  7.469   1.00 0.00 ? 14 GLU A O    2  
ATOM 1520  C CB   . GLU A 1 14 ? -0.953  -1.579  7.399   1.00 0.00 ? 14 GLU A CB   2  
ATOM 1521  C CG   . GLU A 1 14 ? -1.592  -1.543  8.795   1.00 0.00 ? 14 GLU A CG   2  
ATOM 1522  C CD   . GLU A 1 14 ? -2.127  -2.931  9.149   1.00 0.00 ? 14 GLU A CD   2  
ATOM 1523  O OE1  . GLU A 1 14 ? -1.326  -3.776  9.517   1.00 0.00 ? 14 GLU A OE1  2  
ATOM 1524  O OE2  . GLU A 1 14 ? -3.326  -3.126  9.050   1.00 0.00 ? 14 GLU A OE2  2  
ATOM 1525  H H    . GLU A 1 14 ? 1.190   -1.143  6.042   1.00 0.00 ? 14 GLU A H    2  
ATOM 1526  H HA   . GLU A 1 14 ? 0.599   -2.710  8.398   1.00 0.00 ? 14 GLU A HA   2  
ATOM 1527  H HB2  . GLU A 1 14 ? -0.611  -0.588  7.142   1.00 0.00 ? 14 GLU A HB2  2  
ATOM 1528  H HB3  . GLU A 1 14 ? -1.692  -1.896  6.676   1.00 0.00 ? 14 GLU A HB3  2  
ATOM 1529  H HG2  . GLU A 1 14 ? -0.849  -1.246  9.521   1.00 0.00 ? 14 GLU A HG2  2  
ATOM 1530  H HG3  . GLU A 1 14 ? -2.403  -0.834  8.800   1.00 0.00 ? 14 GLU A HG3  2  
ATOM 1531  N N    . VAL A 1 15 ? -0.129  -3.995  5.472   1.00 0.00 ? 15 VAL A N    2  
ATOM 1532  C CA   . VAL A 1 15 ? -0.515  -5.289  4.855   1.00 0.00 ? 15 VAL A CA   2  
ATOM 1533  C C    . VAL A 1 15 ? 0.544   -6.352  5.172   1.00 0.00 ? 15 VAL A C    2  
ATOM 1534  O O    . VAL A 1 15 ? 0.216   -7.484  5.439   1.00 0.00 ? 15 VAL A O    2  
ATOM 1535  C CB   . VAL A 1 15 ? -0.686  -5.116  3.329   1.00 0.00 ? 15 VAL A CB   2  
ATOM 1536  C CG1  . VAL A 1 15 ? -0.568  -6.472  2.616   1.00 0.00 ? 15 VAL A CG1  2  
ATOM 1537  C CG2  . VAL A 1 15 ? -2.067  -4.520  3.036   1.00 0.00 ? 15 VAL A CG2  2  
ATOM 1538  H H    . VAL A 1 15 ? 0.121   -3.232  4.911   1.00 0.00 ? 15 VAL A H    2  
ATOM 1539  H HA   . VAL A 1 15 ? -1.454  -5.609  5.289   1.00 0.00 ? 15 VAL A HA   2  
ATOM 1540  H HB   . VAL A 1 15 ? 0.077   -4.449  2.955   1.00 0.00 ? 15 VAL A HB   2  
ATOM 1541  H HG11 . VAL A 1 15 ? 0.459   -6.813  2.651   1.00 0.00 ? 15 VAL A HG11 2  
ATOM 1542  H HG12 . VAL A 1 15 ? -0.876  -6.365  1.587   1.00 0.00 ? 15 VAL A HG12 2  
ATOM 1543  H HG13 . VAL A 1 15 ? -1.203  -7.193  3.109   1.00 0.00 ? 15 VAL A HG13 2  
ATOM 1544  H HG21 . VAL A 1 15 ? -2.157  -3.563  3.525   1.00 0.00 ? 15 VAL A HG21 2  
ATOM 1545  H HG22 . VAL A 1 15 ? -2.833  -5.188  3.404   1.00 0.00 ? 15 VAL A HG22 2  
ATOM 1546  H HG23 . VAL A 1 15 ? -2.184  -4.393  1.969   1.00 0.00 ? 15 VAL A HG23 2  
ATOM 1547  N N    . THR A 1 16 ? 1.809   -6.038  5.118   1.00 0.00 ? 16 THR A N    2  
ATOM 1548  C CA   . THR A 1 16 ? 2.794   -7.120  5.392   1.00 0.00 ? 16 THR A CA   2  
ATOM 1549  C C    . THR A 1 16 ? 2.661   -7.612  6.828   1.00 0.00 ? 16 THR A C    2  
ATOM 1550  O O    . THR A 1 16 ? 2.739   -8.797  7.083   1.00 0.00 ? 16 THR A O    2  
ATOM 1551  C CB   . THR A 1 16 ? 4.241   -6.693  5.142   1.00 0.00 ? 16 THR A CB   2  
ATOM 1552  O OG1  . THR A 1 16 ? 4.766   -6.102  6.323   1.00 0.00 ? 16 THR A OG1  2  
ATOM 1553  C CG2  . THR A 1 16 ? 4.349   -5.696  3.978   1.00 0.00 ? 16 THR A CG2  2  
ATOM 1554  H H    . THR A 1 16 ? 2.097   -5.132  4.878   1.00 0.00 ? 16 THR A H    2  
ATOM 1555  H HA   . THR A 1 16 ? 2.564   -7.933  4.734   1.00 0.00 ? 16 THR A HA   2  
ATOM 1556  H HB   . THR A 1 16 ? 4.806   -7.583  4.903   1.00 0.00 ? 16 THR A HB   2  
ATOM 1557  H HG1  . THR A 1 16 ? 4.064   -5.599  6.740   1.00 0.00 ? 16 THR A HG1  2  
ATOM 1558  H HG21 . THR A 1 16 ? 4.550   -4.713  4.375   1.00 0.00 ? 16 THR A HG21 2  
ATOM 1559  H HG22 . THR A 1 16 ? 3.431   -5.678  3.415   1.00 0.00 ? 16 THR A HG22 2  
ATOM 1560  H HG23 . THR A 1 16 ? 5.160   -5.986  3.325   1.00 0.00 ? 16 THR A HG23 2  
ATOM 1561  N N    . LYS A 1 17 ? 2.445   -6.745  7.775   1.00 0.00 ? 17 LYS A N    2  
ATOM 1562  C CA   . LYS A 1 17 ? 2.300   -7.254  9.162   1.00 0.00 ? 17 LYS A CA   2  
ATOM 1563  C C    . LYS A 1 17 ? 1.096   -8.190  9.171   1.00 0.00 ? 17 LYS A C    2  
ATOM 1564  O O    . LYS A 1 17 ? 1.042   -9.166  9.891   1.00 0.00 ? 17 LYS A O    2  
ATOM 1565  C CB   . LYS A 1 17 ? 2.064   -6.100  10.150  1.00 0.00 ? 17 LYS A CB   2  
ATOM 1566  C CG   . LYS A 1 17 ? 1.507   -6.670  11.470  1.00 0.00 ? 17 LYS A CG   2  
ATOM 1567  C CD   . LYS A 1 17 ? 1.796   -5.727  12.635  1.00 0.00 ? 17 LYS A CD   2  
ATOM 1568  C CE   . LYS A 1 17 ? 1.327   -6.393  13.934  1.00 0.00 ? 17 LYS A CE   2  
ATOM 1569  N NZ   . LYS A 1 17 ? 1.868   -5.645  15.103  1.00 0.00 ? 17 LYS A NZ   2  
ATOM 1570  H H    . LYS A 1 17 ? 2.359   -5.789  7.576   1.00 0.00 ? 17 LYS A H    2  
ATOM 1571  H HA   . LYS A 1 17 ? 3.202   -7.784  9.435   1.00 0.00 ? 17 LYS A HA   2  
ATOM 1572  H HB2  . LYS A 1 17 ? 2.999   -5.592  10.334  1.00 0.00 ? 17 LYS A HB2  2  
ATOM 1573  H HB3  . LYS A 1 17 ? 1.352   -5.406  9.728   1.00 0.00 ? 17 LYS A HB3  2  
ATOM 1574  H HG2  . LYS A 1 17 ? 0.440   -6.802  11.380  1.00 0.00 ? 17 LYS A HG2  2  
ATOM 1575  H HG3  . LYS A 1 17 ? 1.967   -7.629  11.670  1.00 0.00 ? 17 LYS A HG3  2  
ATOM 1576  H HD2  . LYS A 1 17 ? 2.858   -5.530  12.687  1.00 0.00 ? 17 LYS A HD2  2  
ATOM 1577  H HD3  . LYS A 1 17 ? 1.261   -4.800  12.491  1.00 0.00 ? 17 LYS A HD3  2  
ATOM 1578  H HE2  . LYS A 1 17 ? 0.248   -6.387  13.970  1.00 0.00 ? 17 LYS A HE2  2  
ATOM 1579  H HE3  . LYS A 1 17 ? 1.679   -7.418  13.965  1.00 0.00 ? 17 LYS A HE3  2  
ATOM 1580  H HZ1  . LYS A 1 17 ? 1.998   -4.646  14.846  1.00 0.00 ? 17 LYS A HZ1  2  
ATOM 1581  H HZ2  . LYS A 1 17 ? 2.783   -6.054  15.382  1.00 0.00 ? 17 LYS A HZ2  2  
ATOM 1582  H HZ3  . LYS A 1 17 ? 1.201   -5.712  15.896  1.00 0.00 ? 17 LYS A HZ3  2  
ATOM 1583  N N    . LEU A 1 18 ? 0.130   -7.876  8.356   1.00 0.00 ? 18 LEU A N    2  
ATOM 1584  C CA   . LEU A 1 18 ? -1.093  -8.710  8.272   1.00 0.00 ? 18 LEU A CA   2  
ATOM 1585  C C    . LEU A 1 18 ? -0.723  -10.016 7.556   1.00 0.00 ? 18 LEU A C    2  
ATOM 1586  O O    . LEU A 1 18 ? -1.179  -11.084 7.911   1.00 0.00 ? 18 LEU A O    2  
ATOM 1587  C CB   . LEU A 1 18 ? -2.177  -7.939  7.488   1.00 0.00 ? 18 LEU A CB   2  
ATOM 1588  C CG   . LEU A 1 18 ? -2.799  -6.721  8.276   1.00 0.00 ? 18 LEU A CG   2  
ATOM 1589  C CD1  . LEU A 1 18 ? -4.322  -6.862  8.344   1.00 0.00 ? 18 LEU A CD1  2  
ATOM 1590  C CD2  . LEU A 1 18 ? -2.281  -6.583  9.722   1.00 0.00 ? 18 LEU A CD2  2  
ATOM 1591  H H    . LEU A 1 18 ? 0.215   -7.084  7.786   1.00 0.00 ? 18 LEU A H    2  
ATOM 1592  H HA   . LEU A 1 18 ? -1.445  -8.960  9.256   1.00 0.00 ? 18 LEU A HA   2  
ATOM 1593  H HB2  . LEU A 1 18 ? -1.734  -7.569  6.582   1.00 0.00 ? 18 LEU A HB2  2  
ATOM 1594  H HB3  . LEU A 1 18 ? -2.951  -8.623  7.217   1.00 0.00 ? 18 LEU A HB3  2  
ATOM 1595  H HG   . LEU A 1 18 ? -2.571  -5.807  7.739   1.00 0.00 ? 18 LEU A HG   2  
ATOM 1596  H HD11 . LEU A 1 18 ? -4.722  -6.942  7.342   1.00 0.00 ? 18 LEU A HD11 2  
ATOM 1597  H HD12 . LEU A 1 18 ? -4.742  -5.999  8.836   1.00 0.00 ? 18 LEU A HD12 2  
ATOM 1598  H HD13 . LEU A 1 18 ? -4.574  -7.744  8.905   1.00 0.00 ? 18 LEU A HD13 2  
ATOM 1599  H HD21 . LEU A 1 18 ? -2.660  -7.392  10.327  1.00 0.00 ? 18 LEU A HD21 2  
ATOM 1600  H HD22 . LEU A 1 18 ? -2.630  -5.647  10.130  1.00 0.00 ? 18 LEU A HD22 2  
ATOM 1601  H HD23 . LEU A 1 18 ? -1.207  -6.588  9.735   1.00 0.00 ? 18 LEU A HD23 2  
ATOM 1602  N N    . ILE A 1 19 ? 0.137   -9.936  6.575   1.00 0.00 ? 19 ILE A N    2  
ATOM 1603  C CA   . ILE A 1 19 ? 0.583   -11.162 5.858   1.00 0.00 ? 19 ILE A CA   2  
ATOM 1604  C C    . ILE A 1 19 ? 1.499   -11.930 6.805   1.00 0.00 ? 19 ILE A C    2  
ATOM 1605  O O    . ILE A 1 19 ? 1.556   -13.143 6.795   1.00 0.00 ? 19 ILE A O    2  
ATOM 1606  C CB   . ILE A 1 19 ? 1.356   -10.765 4.589   1.00 0.00 ? 19 ILE A CB   2  
ATOM 1607  C CG1  . ILE A 1 19 ? 0.391   -10.093 3.602   1.00 0.00 ? 19 ILE A CG1  2  
ATOM 1608  C CG2  . ILE A 1 19 ? 1.970   -12.006 3.935   1.00 0.00 ? 19 ILE A CG2  2  
ATOM 1609  C CD1  . ILE A 1 19 ? 1.165   -9.550  2.398   1.00 0.00 ? 19 ILE A CD1  2  
ATOM 1610  H H    . ILE A 1 19 ? 0.514   -9.072  6.334   1.00 0.00 ? 19 ILE A H    2  
ATOM 1611  H HA   . ILE A 1 19 ? -0.273  -11.768 5.601   1.00 0.00 ? 19 ILE A HA   2  
ATOM 1612  H HB   . ILE A 1 19 ? 2.152   -10.079 4.850   1.00 0.00 ? 19 ILE A HB   2  
ATOM 1613  H HG12 . ILE A 1 19 ? -0.336  -10.813 3.264   1.00 0.00 ? 19 ILE A HG12 2  
ATOM 1614  H HG13 . ILE A 1 19 ? -0.119  -9.284  4.091   1.00 0.00 ? 19 ILE A HG13 2  
ATOM 1615  H HG21 . ILE A 1 19 ? 2.415   -11.730 2.990   1.00 0.00 ? 19 ILE A HG21 2  
ATOM 1616  H HG22 . ILE A 1 19 ? 1.201   -12.744 3.770   1.00 0.00 ? 19 ILE A HG22 2  
ATOM 1617  H HG23 . ILE A 1 19 ? 2.731   -12.415 4.581   1.00 0.00 ? 19 ILE A HG23 2  
ATOM 1618  H HD11 . ILE A 1 19 ? 1.597   -10.371 1.848   1.00 0.00 ? 19 ILE A HD11 2  
ATOM 1619  H HD12 . ILE A 1 19 ? 1.950   -8.897  2.739   1.00 0.00 ? 19 ILE A HD12 2  
ATOM 1620  H HD13 . ILE A 1 19 ? 0.493   -9.000  1.756   1.00 0.00 ? 19 ILE A HD13 2  
ATOM 1621  N N    . ASP A 1 20 ? 2.217   -11.215 7.624   1.00 0.00 ? 20 ASP A N    2  
ATOM 1622  C CA   . ASP A 1 20 ? 3.143   -11.866 8.584   1.00 0.00 ? 20 ASP A CA   2  
ATOM 1623  C C    . ASP A 1 20 ? 2.363   -12.455 9.760   1.00 0.00 ? 20 ASP A C    2  
ATOM 1624  O O    . ASP A 1 20 ? 2.846   -13.347 10.430  1.00 0.00 ? 20 ASP A O    2  
ATOM 1625  C CB   . ASP A 1 20 ? 4.137   -10.827 9.108   1.00 0.00 ? 20 ASP A CB   2  
ATOM 1626  C CG   . ASP A 1 20 ? 4.830   -10.143 7.928   1.00 0.00 ? 20 ASP A CG   2  
ATOM 1627  O OD1  . ASP A 1 20 ? 4.453   -10.423 6.803   1.00 0.00 ? 20 ASP A OD1  2  
ATOM 1628  O OD2  . ASP A 1 20 ? 5.725   -9.351  8.171   1.00 0.00 ? 20 ASP A OD2  2  
ATOM 1629  H H    . ASP A 1 20 ? 2.150   -10.238 7.609   1.00 0.00 ? 20 ASP A H    2  
ATOM 1630  H HA   . ASP A 1 20 ? 3.688   -12.661 8.097   1.00 0.00 ? 20 ASP A HA   2  
ATOM 1631  H HB2  . ASP A 1 20 ? 3.610   -10.089 9.696   1.00 0.00 ? 20 ASP A HB2  2  
ATOM 1632  H HB3  . ASP A 1 20 ? 4.878   -11.317 9.724   1.00 0.00 ? 20 ASP A HB3  2  
ATOM 1633  N N    . ASN A 1 21 ? 1.165   -11.976 10.035  1.00 0.00 ? 21 ASN A N    2  
ATOM 1634  C CA   . ASN A 1 21 ? 0.394   -12.544 11.193  1.00 0.00 ? 21 ASN A CA   2  
ATOM 1635  C C    . ASN A 1 21 ? -0.446  -13.738 10.712  1.00 0.00 ? 21 ASN A C    2  
ATOM 1636  O O    . ASN A 1 21 ? -1.116  -14.375 11.496  1.00 0.00 ? 21 ASN A O    2  
ATOM 1637  C CB   . ASN A 1 21 ? -0.480  -11.472 11.851  1.00 0.00 ? 21 ASN A CB   2  
ATOM 1638  C CG   . ASN A 1 21 ? -1.154  -12.056 13.095  1.00 0.00 ? 21 ASN A CG   2  
ATOM 1639  O OD1  . ASN A 1 21 ? -0.706  -11.837 14.202  1.00 0.00 ? 21 ASN A OD1  2  
ATOM 1640  N ND2  . ASN A 1 21 ? -2.222  -12.793 12.958  1.00 0.00 ? 21 ASN A ND2  2  
ATOM 1641  H H    . ASN A 1 21 ? 0.785   -11.259 9.484   1.00 0.00 ? 21 ASN A H    2  
ATOM 1642  H HA   . ASN A 1 21 ? 1.115   -12.937 11.898  1.00 0.00 ? 21 ASN A HA   2  
ATOM 1643  H HB2  . ASN A 1 21 ? 0.137   -10.629 12.138  1.00 0.00 ? 21 ASN A HB2  2  
ATOM 1644  H HB3  . ASN A 1 21 ? -1.234  -11.146 11.153  1.00 0.00 ? 21 ASN A HB3  2  
ATOM 1645  H HD21 . ASN A 1 21 ? -2.585  -12.969 12.064  1.00 0.00 ? 21 ASN A HD21 2  
ATOM 1646  H HD22 . ASN A 1 21 ? -2.662  -13.169 13.748  1.00 0.00 ? 21 ASN A HD22 2  
ATOM 1647  N N    . ASN A 1 22 ? -0.353  -14.083 9.445   1.00 0.00 ? 22 ASN A N    2  
ATOM 1648  C CA   . ASN A 1 22 ? -1.075  -15.298 8.911   1.00 0.00 ? 22 ASN A CA   2  
ATOM 1649  C C    . ASN A 1 22 ? -2.558  -15.035 8.595   1.00 0.00 ? 22 ASN A C    2  
ATOM 1650  O O    . ASN A 1 22 ? -3.398  -15.863 8.884   1.00 0.00 ? 22 ASN A O    2  
ATOM 1651  C CB   . ASN A 1 22 ? -0.978  -16.446 9.941   1.00 0.00 ? 22 ASN A CB   2  
ATOM 1652  C CG   . ASN A 1 22 ? -1.004  -17.803 9.224   1.00 0.00 ? 22 ASN A CG   2  
ATOM 1653  O OD1  . ASN A 1 22 ? -1.979  -18.147 8.586   1.00 0.00 ? 22 ASN A OD1  2  
ATOM 1654  N ND2  . ASN A 1 22 ? 0.033   -18.591 9.306   1.00 0.00 ? 22 ASN A ND2  2  
ATOM 1655  H H    . ASN A 1 22 ? 0.239   -13.574 8.843   1.00 0.00 ? 22 ASN A H    2  
ATOM 1656  H HA   . ASN A 1 22 ? -0.564  -15.614 8.012   1.00 0.00 ? 22 ASN A HA   2  
ATOM 1657  H HB2  . ASN A 1 22 ? -0.055  -16.353 10.493  1.00 0.00 ? 22 ASN A HB2  2  
ATOM 1658  H HB3  . ASN A 1 22 ? -1.812  -16.397 10.629  1.00 0.00 ? 22 ASN A HB3  2  
ATOM 1659  H HD21 . ASN A 1 22 ? 0.819   -18.313 9.822   1.00 0.00 ? 22 ASN A HD21 2  
ATOM 1660  H HD22 . ASN A 1 22 ? 0.026   -19.459 8.852   1.00 0.00 ? 22 ASN A HD22 2  
ATOM 1661  N N    . LYS A 1 23 ? -2.900  -13.925 7.999   1.00 0.00 ? 23 LYS A N    2  
ATOM 1662  C CA   . LYS A 1 23 ? -4.344  -13.673 7.671   1.00 0.00 ? 23 LYS A CA   2  
ATOM 1663  C C    . LYS A 1 23 ? -4.595  -14.056 6.200   1.00 0.00 ? 23 LYS A C    2  
ATOM 1664  O O    . LYS A 1 23 ? -3.722  -13.950 5.361   1.00 0.00 ? 23 LYS A O    2  
ATOM 1665  C CB   . LYS A 1 23 ? -4.663  -12.195 7.888   1.00 0.00 ? 23 LYS A CB   2  
ATOM 1666  C CG   . LYS A 1 23 ? -4.025  -11.674 9.220   1.00 0.00 ? 23 LYS A CG   2  
ATOM 1667  C CD   . LYS A 1 23 ? -5.084  -11.013 10.128  1.00 0.00 ? 23 LYS A CD   2  
ATOM 1668  C CE   . LYS A 1 23 ? -4.493  -10.780 11.520  1.00 0.00 ? 23 LYS A CE   2  
ATOM 1669  N NZ   . LYS A 1 23 ? -5.559  -10.281 12.434  1.00 0.00 ? 23 LYS A NZ   2  
ATOM 1670  H H    . LYS A 1 23 ? -2.219  -13.263 7.760   1.00 0.00 ? 23 LYS A H    2  
ATOM 1671  H HA   . LYS A 1 23 ? -4.975  -14.247 8.318   1.00 0.00 ? 23 LYS A HA   2  
ATOM 1672  H HB2  . LYS A 1 23 ? -4.270  -11.649 7.055   1.00 0.00 ? 23 LYS A HB2  2  
ATOM 1673  H HB3  . LYS A 1 23 ? -5.737  -12.070 7.922   1.00 0.00 ? 23 LYS A HB3  2  
ATOM 1674  H HG2  . LYS A 1 23 ? -3.576  -12.495 9.763   1.00 0.00 ? 23 LYS A HG2  2  
ATOM 1675  H HG3  . LYS A 1 23 ? -3.260  -10.947 8.992   1.00 0.00 ? 23 LYS A HG3  2  
ATOM 1676  H HD2  . LYS A 1 23 ? -5.390  -10.062 9.707   1.00 0.00 ? 23 LYS A HD2  2  
ATOM 1677  H HD3  . LYS A 1 23 ? -5.940  -11.661 10.215  1.00 0.00 ? 23 LYS A HD3  2  
ATOM 1678  H HE2  . LYS A 1 23 ? -4.097  -11.709 11.904  1.00 0.00 ? 23 LYS A HE2  2  
ATOM 1679  H HE3  . LYS A 1 23 ? -3.702  -10.049 11.459  1.00 0.00 ? 23 LYS A HE3  2  
ATOM 1680  H HZ1  . LYS A 1 23 ? -6.336  -9.878  11.874  1.00 0.00 ? 23 LYS A HZ1  2  
ATOM 1681  H HZ2  . LYS A 1 23 ? -5.163  -9.547  13.058  1.00 0.00 ? 23 LYS A HZ2  2  
ATOM 1682  H HZ3  . LYS A 1 23 ? -5.921  -11.068 13.009  1.00 0.00 ? 23 LYS A HZ3  2  
ATOM 1683  N N    . THR A 1 24 ? -5.795  -14.496 5.886   1.00 0.00 ? 24 THR A N    2  
ATOM 1684  C CA   . THR A 1 24 ? -6.125  -14.882 4.477   1.00 0.00 ? 24 THR A CA   2  
ATOM 1685  C C    . THR A 1 24 ? -6.344  -13.635 3.618   1.00 0.00 ? 24 THR A C    2  
ATOM 1686  O O    . THR A 1 24 ? -6.366  -12.528 4.110   1.00 0.00 ? 24 THR A O    2  
ATOM 1687  C CB   . THR A 1 24 ? -7.417  -15.712 4.439   1.00 0.00 ? 24 THR A CB   2  
ATOM 1688  O OG1  . THR A 1 24 ? -8.536  -14.839 4.365   1.00 0.00 ? 24 THR A OG1  2  
ATOM 1689  C CG2  . THR A 1 24 ? -7.534  -16.568 5.694   1.00 0.00 ? 24 THR A CG2  2  
ATOM 1690  H H    . THR A 1 24 ? -6.480  -14.569 6.582   1.00 0.00 ? 24 THR A H    2  
ATOM 1691  H HA   . THR A 1 24 ? -5.320  -15.455 4.039   1.00 0.00 ? 24 THR A HA   2  
ATOM 1692  H HB   . THR A 1 24 ? -7.409  -16.355 3.571   1.00 0.00 ? 24 THR A HB   2  
ATOM 1693  H HG1  . THR A 1 24 ? -8.506  -14.390 3.516   1.00 0.00 ? 24 THR A HG1  2  
ATOM 1694  H HG21 . THR A 1 24 ? -7.664  -15.931 6.553   1.00 0.00 ? 24 THR A HG21 2  
ATOM 1695  H HG22 . THR A 1 24 ? -6.639  -17.159 5.813   1.00 0.00 ? 24 THR A HG22 2  
ATOM 1696  H HG23 . THR A 1 24 ? -8.389  -17.221 5.599   1.00 0.00 ? 24 THR A HG23 2  
ATOM 1697  N N    . GLU A 1 25 ? -6.539  -13.821 2.338   1.00 0.00 ? 25 GLU A N    2  
ATOM 1698  C CA   . GLU A 1 25 ? -6.790  -12.660 1.435   1.00 0.00 ? 25 GLU A CA   2  
ATOM 1699  C C    . GLU A 1 25 ? -8.146  -12.044 1.805   1.00 0.00 ? 25 GLU A C    2  
ATOM 1700  O O    . GLU A 1 25 ? -8.291  -10.842 1.904   1.00 0.00 ? 25 GLU A O    2  
ATOM 1701  C CB   . GLU A 1 25 ? -6.814  -13.151 -0.018  1.00 0.00 ? 25 GLU A CB   2  
ATOM 1702  C CG   . GLU A 1 25 ? -6.657  -11.967 -0.972  1.00 0.00 ? 25 GLU A CG   2  
ATOM 1703  C CD   . GLU A 1 25 ? -7.076  -12.385 -2.383  1.00 0.00 ? 25 GLU A CD   2  
ATOM 1704  O OE1  . GLU A 1 25 ? -8.252  -12.274 -2.688  1.00 0.00 ? 25 GLU A OE1  2  
ATOM 1705  O OE2  . GLU A 1 25 ? -6.213  -12.809 -3.134  1.00 0.00 ? 25 GLU A OE2  2  
ATOM 1706  H H    . GLU A 1 25 ? -6.539  -14.734 1.980   1.00 0.00 ? 25 GLU A H    2  
ATOM 1707  H HA   . GLU A 1 25 ? -6.008  -11.922 1.569   1.00 0.00 ? 25 GLU A HA   2  
ATOM 1708  H HB2  . GLU A 1 25 ? -6.003  -13.847 -0.173  1.00 0.00 ? 25 GLU A HB2  2  
ATOM 1709  H HB3  . GLU A 1 25 ? -7.754  -13.646 -0.212  1.00 0.00 ? 25 GLU A HB3  2  
ATOM 1710  H HG2  . GLU A 1 25 ? -7.282  -11.152 -0.638  1.00 0.00 ? 25 GLU A HG2  2  
ATOM 1711  H HG3  . GLU A 1 25 ? -5.626  -11.651 -0.985  1.00 0.00 ? 25 GLU A HG3  2  
ATOM 1712  N N    . LYS A 1 26 ? -9.144  -12.868 1.990   1.00 0.00 ? 26 LYS A N    2  
ATOM 1713  C CA   . LYS A 1 26 ? -10.503 -12.354 2.332   1.00 0.00 ? 26 LYS A CA   2  
ATOM 1714  C C    . LYS A 1 26 ? -10.468 -11.481 3.592   1.00 0.00 ? 26 LYS A C    2  
ATOM 1715  O O    . LYS A 1 26 ? -11.235 -10.548 3.724   1.00 0.00 ? 26 LYS A O    2  
ATOM 1716  C CB   . LYS A 1 26 ? -11.463 -13.530 2.537   1.00 0.00 ? 26 LYS A CB   2  
ATOM 1717  C CG   . LYS A 1 26 ? -12.909 -13.021 2.463   1.00 0.00 ? 26 LYS A CG   2  
ATOM 1718  C CD   . LYS A 1 26 ? -13.897 -14.187 2.641   1.00 0.00 ? 26 LYS A CD   2  
ATOM 1719  C CE   . LYS A 1 26 ? -14.164 -14.870 1.293   1.00 0.00 ? 26 LYS A CE   2  
ATOM 1720  N NZ   . LYS A 1 26 ? -14.906 -13.935 0.400   1.00 0.00 ? 26 LYS A NZ   2  
ATOM 1721  H H    . LYS A 1 26 ? -9.002  -13.830 1.886   1.00 0.00 ? 26 LYS A H    2  
ATOM 1722  H HA   . LYS A 1 26 ? -10.864 -11.749 1.529   1.00 0.00 ? 26 LYS A HA   2  
ATOM 1723  H HB2  . LYS A 1 26 ? -11.295 -14.266 1.767   1.00 0.00 ? 26 LYS A HB2  2  
ATOM 1724  H HB3  . LYS A 1 26 ? -11.289 -13.975 3.503   1.00 0.00 ? 26 LYS A HB3  2  
ATOM 1725  H HG2  . LYS A 1 26 ? -13.068 -12.295 3.248   1.00 0.00 ? 26 LYS A HG2  2  
ATOM 1726  H HG3  . LYS A 1 26 ? -13.073 -12.549 1.505   1.00 0.00 ? 26 LYS A HG3  2  
ATOM 1727  H HD2  . LYS A 1 26 ? -13.488 -14.908 3.332   1.00 0.00 ? 26 LYS A HD2  2  
ATOM 1728  H HD3  . LYS A 1 26 ? -14.828 -13.806 3.033   1.00 0.00 ? 26 LYS A HD3  2  
ATOM 1729  H HE2  . LYS A 1 26 ? -13.228 -15.141 0.830   1.00 0.00 ? 26 LYS A HE2  2  
ATOM 1730  H HE3  . LYS A 1 26 ? -14.756 -15.759 1.452   1.00 0.00 ? 26 LYS A HE3  2  
ATOM 1731  H HZ1  . LYS A 1 26 ? -14.910 -14.311 -0.570  1.00 0.00 ? 26 LYS A HZ1  2  
ATOM 1732  H HZ2  . LYS A 1 26 ? -14.441 -13.004 0.410   1.00 0.00 ? 26 LYS A HZ2  2  
ATOM 1733  H HZ3  . LYS A 1 26 ? -15.885 -13.838 0.735   1.00 0.00 ? 26 LYS A HZ3  2  
ATOM 1734  N N    . GLU A 1 27 ? -9.604  -11.769 4.516   1.00 0.00 ? 27 GLU A N    2  
ATOM 1735  C CA   . GLU A 1 27 ? -9.548  -10.943 5.758   1.00 0.00 ? 27 GLU A CA   2  
ATOM 1736  C C    . GLU A 1 27 ? -8.862  -9.600  5.470   1.00 0.00 ? 27 GLU A C    2  
ATOM 1737  O O    . GLU A 1 27 ? -9.226  -8.584  6.028   1.00 0.00 ? 27 GLU A O    2  
ATOM 1738  C CB   . GLU A 1 27 ? -8.763  -11.691 6.838   1.00 0.00 ? 27 GLU A CB   2  
ATOM 1739  C CG   . GLU A 1 27 ? -9.638  -12.787 7.459   1.00 0.00 ? 27 GLU A CG   2  
ATOM 1740  C CD   . GLU A 1 27 ? -10.728 -12.145 8.319   1.00 0.00 ? 27 GLU A CD   2  
ATOM 1741  O OE1  . GLU A 1 27 ? -10.392 -11.311 9.143   1.00 0.00 ? 27 GLU A OE1  2  
ATOM 1742  O OE2  . GLU A 1 27 ? -11.882 -12.500 8.140   1.00 0.00 ? 27 GLU A OE2  2  
ATOM 1743  H H    . GLU A 1 27 ? -8.992  -12.525 4.391   1.00 0.00 ? 27 GLU A H    2  
ATOM 1744  H HA   . GLU A 1 27 ? -10.550 -10.760 6.120   1.00 0.00 ? 27 GLU A HA   2  
ATOM 1745  H HB2  . GLU A 1 27 ? -7.885  -12.137 6.402   1.00 0.00 ? 27 GLU A HB2  2  
ATOM 1746  H HB3  . GLU A 1 27 ? -8.472  -10.996 7.608   1.00 0.00 ? 27 GLU A HB3  2  
ATOM 1747  H HG2  . GLU A 1 27 ? -10.094 -13.371 6.676   1.00 0.00 ? 27 GLU A HG2  2  
ATOM 1748  H HG3  . GLU A 1 27 ? -9.027  -13.427 8.077   1.00 0.00 ? 27 GLU A HG3  2  
ATOM 1749  N N    . ILE A 1 28 ? -7.875  -9.574  4.617   1.00 0.00 ? 28 ILE A N    2  
ATOM 1750  C CA   . ILE A 1 28 ? -7.185  -8.280  4.324   1.00 0.00 ? 28 ILE A CA   2  
ATOM 1751  C C    . ILE A 1 28 ? -8.189  -7.336  3.668   1.00 0.00 ? 28 ILE A C    2  
ATOM 1752  O O    . ILE A 1 28 ? -8.218  -6.155  3.950   1.00 0.00 ? 28 ILE A O    2  
ATOM 1753  C CB   . ILE A 1 28 ? -5.994  -8.552  3.389   1.00 0.00 ? 28 ILE A CB   2  
ATOM 1754  C CG1  . ILE A 1 28 ? -5.211  -9.801  3.913   1.00 0.00 ? 28 ILE A CG1  2  
ATOM 1755  C CG2  . ILE A 1 28 ? -5.105  -7.305  3.294   1.00 0.00 ? 28 ILE A CG2  2  
ATOM 1756  C CD1  . ILE A 1 28 ? -3.697  -9.575  4.005   1.00 0.00 ? 28 ILE A CD1  2  
ATOM 1757  H H    . ILE A 1 28 ? -7.585  -10.396 4.169   1.00 0.00 ? 28 ILE A H    2  
ATOM 1758  H HA   . ILE A 1 28 ? -6.846  -7.847  5.254   1.00 0.00 ? 28 ILE A HA   2  
ATOM 1759  H HB   . ILE A 1 28 ? -6.381  -8.763  2.404   1.00 0.00 ? 28 ILE A HB   2  
ATOM 1760  H HG12 . ILE A 1 28 ? -5.570  -10.066 4.886   1.00 0.00 ? 28 ILE A HG12 2  
ATOM 1761  H HG13 . ILE A 1 28 ? -5.388  -10.624 3.253   1.00 0.00 ? 28 ILE A HG13 2  
ATOM 1762  H HG21 . ILE A 1 28 ? -4.690  -7.076  4.263   1.00 0.00 ? 28 ILE A HG21 2  
ATOM 1763  H HG22 . ILE A 1 28 ? -5.695  -6.475  2.947   1.00 0.00 ? 28 ILE A HG22 2  
ATOM 1764  H HG23 . ILE A 1 28 ? -4.305  -7.489  2.592   1.00 0.00 ? 28 ILE A HG23 2  
ATOM 1765  H HD11 . ILE A 1 28 ? -3.228  -10.480 4.373   1.00 0.00 ? 28 ILE A HD11 2  
ATOM 1766  H HD12 . ILE A 1 28 ? -3.490  -8.764  4.682   1.00 0.00 ? 28 ILE A HD12 2  
ATOM 1767  H HD13 . ILE A 1 28 ? -3.307  -9.341  3.026   1.00 0.00 ? 28 ILE A HD13 2  
ATOM 1768  N N    . LEU A 1 29 ? -9.018  -7.841  2.801   1.00 0.00 ? 29 LEU A N    2  
ATOM 1769  C CA   . LEU A 1 29 ? -10.022 -6.969  2.138   1.00 0.00 ? 29 LEU A CA   2  
ATOM 1770  C C    . LEU A 1 29 ? -11.119 -6.577  3.135   1.00 0.00 ? 29 LEU A C    2  
ATOM 1771  O O    . LEU A 1 29 ? -11.696 -5.514  3.062   1.00 0.00 ? 29 LEU A O    2  
ATOM 1772  C CB   . LEU A 1 29 ? -10.644 -7.731  0.970   1.00 0.00 ? 29 LEU A CB   2  
ATOM 1773  C CG   . LEU A 1 29 ? -9.535  -8.256  0.052   1.00 0.00 ? 29 LEU A CG   2  
ATOM 1774  C CD1  . LEU A 1 29 ? -10.168 -9.091  -1.067  1.00 0.00 ? 29 LEU A CD1  2  
ATOM 1775  C CD2  . LEU A 1 29 ? -8.758  -7.074  -0.557  1.00 0.00 ? 29 LEU A CD2  2  
ATOM 1776  H H    . LEU A 1 29 ? -8.982  -8.794  2.574   1.00 0.00 ? 29 LEU A H    2  
ATOM 1777  H HA   . LEU A 1 29 ? -9.538  -6.077  1.769   1.00 0.00 ? 29 LEU A HA   2  
ATOM 1778  H HB2  . LEU A 1 29 ? -11.220 -8.564  1.351   1.00 0.00 ? 29 LEU A HB2  2  
ATOM 1779  H HB3  . LEU A 1 29 ? -11.290 -7.071  0.411   1.00 0.00 ? 29 LEU A HB3  2  
ATOM 1780  H HG   . LEU A 1 29 ? -8.857  -8.878  0.630   1.00 0.00 ? 29 LEU A HG   2  
ATOM 1781  H HD11 . LEU A 1 29 ? -10.635 -8.434  -1.785  1.00 0.00 ? 29 LEU A HD11 2  
ATOM 1782  H HD12 . LEU A 1 29 ? -10.913 -9.754  -0.650  1.00 0.00 ? 29 LEU A HD12 2  
ATOM 1783  H HD13 . LEU A 1 29 ? -9.403  -9.673  -1.559  1.00 0.00 ? 29 LEU A HD13 2  
ATOM 1784  H HD21 . LEU A 1 29 ? -8.004  -6.738  0.143   1.00 0.00 ? 29 LEU A HD21 2  
ATOM 1785  H HD22 . LEU A 1 29 ? -9.436  -6.260  -0.770  1.00 0.00 ? 29 LEU A HD22 2  
ATOM 1786  H HD23 . LEU A 1 29 ? -8.278  -7.388  -1.473  1.00 0.00 ? 29 LEU A HD23 2  
ATOM 1787  N N    . ASP A 1 30 ? -11.396 -7.433  4.081   1.00 0.00 ? 30 ASP A N    2  
ATOM 1788  C CA   . ASP A 1 30 ? -12.434 -7.107  5.103   1.00 0.00 ? 30 ASP A CA   2  
ATOM 1789  C C    . ASP A 1 30 ? -11.906 -5.971  5.989   1.00 0.00 ? 30 ASP A C    2  
ATOM 1790  O O    . ASP A 1 30 ? -12.617 -5.040  6.311   1.00 0.00 ? 30 ASP A O    2  
ATOM 1791  C CB   . ASP A 1 30 ? -12.719 -8.342  5.961   1.00 0.00 ? 30 ASP A CB   2  
ATOM 1792  C CG   . ASP A 1 30 ? -13.867 -8.040  6.925   1.00 0.00 ? 30 ASP A CG   2  
ATOM 1793  O OD1  . ASP A 1 30 ? -14.940 -7.707  6.452   1.00 0.00 ? 30 ASP A OD1  2  
ATOM 1794  O OD2  . ASP A 1 30 ? -13.654 -8.147  8.122   1.00 0.00 ? 30 ASP A OD2  2  
ATOM 1795  H H    . ASP A 1 30 ? -10.915 -8.285  4.113   1.00 0.00 ? 30 ASP A H    2  
ATOM 1796  H HA   . ASP A 1 30 ? -13.343 -6.780  4.620   1.00 0.00 ? 30 ASP A HA   2  
ATOM 1797  H HB2  . ASP A 1 30 ? -12.993 -9.168  5.321   1.00 0.00 ? 30 ASP A HB2  2  
ATOM 1798  H HB3  . ASP A 1 30 ? -11.835 -8.600  6.525   1.00 0.00 ? 30 ASP A HB3  2  
ATOM 1799  N N    . ALA A 1 31 ? -10.671 -6.054  6.402   1.00 0.00 ? 31 ALA A N    2  
ATOM 1800  C CA   . ALA A 1 31 ? -10.097 -4.997  7.287   1.00 0.00 ? 31 ALA A CA   2  
ATOM 1801  C C    . ALA A 1 31 ? -9.966  -3.671  6.522   1.00 0.00 ? 31 ALA A C    2  
ATOM 1802  O O    . ALA A 1 31 ? -9.972  -2.612  7.117   1.00 0.00 ? 31 ALA A O    2  
ATOM 1803  C CB   . ALA A 1 31 ? -8.722  -5.458  7.778   1.00 0.00 ? 31 ALA A CB   2  
ATOM 1804  H H    . ALA A 1 31 ? -10.122 -6.823  6.142   1.00 0.00 ? 31 ALA A H    2  
ATOM 1805  H HA   . ALA A 1 31 ? -10.748 -4.857  8.135   1.00 0.00 ? 31 ALA A HA   2  
ATOM 1806  H HB1  . ALA A 1 31 ? -8.420  -4.858  8.623   1.00 0.00 ? 31 ALA A HB1  2  
ATOM 1807  H HB2  . ALA A 1 31 ? -7.999  -5.353  6.983   1.00 0.00 ? 31 ALA A HB2  2  
ATOM 1808  H HB3  . ALA A 1 31 ? -8.777  -6.495  8.077   1.00 0.00 ? 31 ALA A HB3  2  
ATOM 1809  N N    . PHE A 1 32 ? -9.876  -3.698  5.223   1.00 0.00 ? 32 PHE A N    2  
ATOM 1810  C CA   . PHE A 1 32 ? -9.779  -2.415  4.456   1.00 0.00 ? 32 PHE A CA   2  
ATOM 1811  C C    . PHE A 1 32 ? -10.954 -1.508  4.837   1.00 0.00 ? 32 PHE A C    2  
ATOM 1812  O O    . PHE A 1 32 ? -10.968 -0.333  4.529   1.00 0.00 ? 32 PHE A O    2  
ATOM 1813  C CB   . PHE A 1 32 ? -9.857  -2.744  2.956   1.00 0.00 ? 32 PHE A CB   2  
ATOM 1814  C CG   . PHE A 1 32 ? -8.504  -3.169  2.393   1.00 0.00 ? 32 PHE A CG   2  
ATOM 1815  C CD1  . PHE A 1 32 ? -7.432  -3.574  3.223   1.00 0.00 ? 32 PHE A CD1  2  
ATOM 1816  C CD2  . PHE A 1 32 ? -8.327  -3.148  1.003   1.00 0.00 ? 32 PHE A CD2  2  
ATOM 1817  C CE1  . PHE A 1 32 ? -6.210  -3.942  2.651   1.00 0.00 ? 32 PHE A CE1  2  
ATOM 1818  C CE2  . PHE A 1 32 ? -7.101  -3.518  0.440   1.00 0.00 ? 32 PHE A CE2  2  
ATOM 1819  C CZ   . PHE A 1 32 ? -6.043  -3.911  1.263   1.00 0.00 ? 32 PHE A CZ   2  
ATOM 1820  H H    . PHE A 1 32 ? -9.893  -4.551  4.741   1.00 0.00 ? 32 PHE A H    2  
ATOM 1821  H HA   . PHE A 1 32 ? -8.846  -1.915  4.663   1.00 0.00 ? 32 PHE A HA   2  
ATOM 1822  H HB2  . PHE A 1 32 ? -10.560 -3.541  2.808   1.00 0.00 ? 32 PHE A HB2  2  
ATOM 1823  H HB3  . PHE A 1 32 ? -10.199 -1.873  2.417   1.00 0.00 ? 32 PHE A HB3  2  
ATOM 1824  H HD1  . PHE A 1 32 ? -7.541  -3.620  4.292   1.00 0.00 ? 32 PHE A HD1  2  
ATOM 1825  H HD2  . PHE A 1 32 ? -9.142  -2.846  0.362   1.00 0.00 ? 32 PHE A HD2  2  
ATOM 1826  H HE1  . PHE A 1 32 ? -5.388  -4.237  3.285   1.00 0.00 ? 32 PHE A HE1  2  
ATOM 1827  H HE2  . PHE A 1 32 ? -6.972  -3.500  -0.632  1.00 0.00 ? 32 PHE A HE2  2  
ATOM 1828  H HZ   . PHE A 1 32 ? -5.101  -4.200  0.826   1.00 0.00 ? 32 PHE A HZ   2  
ATOM 1829  N N    . ASP A 1 33 ? -11.948 -2.052  5.480   1.00 0.00 ? 33 ASP A N    2  
ATOM 1830  C CA   . ASP A 1 33 ? -13.134 -1.231  5.852   1.00 0.00 ? 33 ASP A CA   2  
ATOM 1831  C C    . ASP A 1 33 ? -12.853 -0.407  7.112   1.00 0.00 ? 33 ASP A C    2  
ATOM 1832  O O    . ASP A 1 33 ? -13.523 0.573   7.369   1.00 0.00 ? 33 ASP A O    2  
ATOM 1833  C CB   . ASP A 1 33 ? -14.324 -2.156  6.113   1.00 0.00 ? 33 ASP A CB   2  
ATOM 1834  C CG   . ASP A 1 33 ? -14.589 -3.008  4.870   1.00 0.00 ? 33 ASP A CG   2  
ATOM 1835  O OD1  . ASP A 1 33 ? -14.525 -2.466  3.780   1.00 0.00 ? 33 ASP A OD1  2  
ATOM 1836  O OD2  . ASP A 1 33 ? -14.852 -4.189  5.032   1.00 0.00 ? 33 ASP A OD2  2  
ATOM 1837  H H    . ASP A 1 33 ? -11.924 -3.006  5.702   1.00 0.00 ? 33 ASP A H    2  
ATOM 1838  H HA   . ASP A 1 33 ? -13.377 -0.564  5.038   1.00 0.00 ? 33 ASP A HA   2  
ATOM 1839  H HB2  . ASP A 1 33 ? -14.102 -2.799  6.951   1.00 0.00 ? 33 ASP A HB2  2  
ATOM 1840  H HB3  . ASP A 1 33 ? -15.199 -1.565  6.334   1.00 0.00 ? 33 ASP A HB3  2  
ATOM 1841  N N    . LYS A 1 34 ? -11.867 -0.782  7.896   1.00 0.00 ? 34 LYS A N    2  
ATOM 1842  C CA   . LYS A 1 34 ? -11.543 -0.001  9.135   1.00 0.00 ? 34 LYS A CA   2  
ATOM 1843  C C    . LYS A 1 34 ? -10.043 0.318   9.165   1.00 0.00 ? 34 LYS A C    2  
ATOM 1844  O O    . LYS A 1 34 ? -9.520  0.768   10.164  1.00 0.00 ? 34 LYS A O    2  
ATOM 1845  C CB   . LYS A 1 34 ? -11.926 -0.807  10.384  1.00 0.00 ? 34 LYS A CB   2  
ATOM 1846  C CG   . LYS A 1 34 ? -11.400 -2.239  10.271  1.00 0.00 ? 34 LYS A CG   2  
ATOM 1847  C CD   . LYS A 1 34 ? -11.577 -2.958  11.613  1.00 0.00 ? 34 LYS A CD   2  
ATOM 1848  C CE   . LYS A 1 34 ? -13.067 -3.146  11.918  1.00 0.00 ? 34 LYS A CE   2  
ATOM 1849  N NZ   . LYS A 1 34 ? -13.231 -4.215  12.943  1.00 0.00 ? 34 LYS A NZ   2  
ATOM 1850  H H    . LYS A 1 34 ? -11.336 -1.575  7.675   1.00 0.00 ? 34 LYS A H    2  
ATOM 1851  H HA   . LYS A 1 34 ? -12.092 0.931   9.138   1.00 0.00 ? 34 LYS A HA   2  
ATOM 1852  H HB2  . LYS A 1 34 ? -11.500 -0.336  11.258  1.00 0.00 ? 34 LYS A HB2  2  
ATOM 1853  H HB3  . LYS A 1 34 ? -13.001 -0.827  10.478  1.00 0.00 ? 34 LYS A HB3  2  
ATOM 1854  H HG2  . LYS A 1 34 ? -11.950 -2.763  9.505   1.00 0.00 ? 34 LYS A HG2  2  
ATOM 1855  H HG3  . LYS A 1 34 ? -10.353 -2.218  10.015  1.00 0.00 ? 34 LYS A HG3  2  
ATOM 1856  H HD2  . LYS A 1 34 ? -11.096 -3.925  11.569  1.00 0.00 ? 34 LYS A HD2  2  
ATOM 1857  H HD3  . LYS A 1 34 ? -11.125 -2.369  12.398  1.00 0.00 ? 34 LYS A HD3  2  
ATOM 1858  H HE2  . LYS A 1 34 ? -13.478 -2.221  12.296  1.00 0.00 ? 34 LYS A HE2  2  
ATOM 1859  H HE3  . LYS A 1 34 ? -13.591 -3.431  11.017  1.00 0.00 ? 34 LYS A HE3  2  
ATOM 1860  H HZ1  . LYS A 1 34 ? -12.614 -4.015  13.755  1.00 0.00 ? 34 LYS A HZ1  2  
ATOM 1861  H HZ2  . LYS A 1 34 ? -12.974 -5.135  12.529  1.00 0.00 ? 34 LYS A HZ2  2  
ATOM 1862  H HZ3  . LYS A 1 34 ? -14.220 -4.242  13.262  1.00 0.00 ? 34 LYS A HZ3  2  
ATOM 1863  N N    . MET A 1 35 ? -9.341  0.100   8.079   1.00 0.00 ? 35 MET A N    2  
ATOM 1864  C CA   . MET A 1 35 ? -7.878  0.409   8.065   1.00 0.00 ? 35 MET A CA   2  
ATOM 1865  C C    . MET A 1 35 ? -7.697  1.908   7.801   1.00 0.00 ? 35 MET A C    2  
ATOM 1866  O O    . MET A 1 35 ? -6.892  2.553   8.445   1.00 0.00 ? 35 MET A O    2  
ATOM 1867  C CB   . MET A 1 35 ? -7.178  -0.436  6.973   1.00 0.00 ? 35 MET A CB   2  
ATOM 1868  C CG   . MET A 1 35 ? -5.936  -1.133  7.532   1.00 0.00 ? 35 MET A CG   2  
ATOM 1869  S SD   . MET A 1 35 ? -4.888  -1.688  6.158   1.00 0.00 ? 35 MET A SD   2  
ATOM 1870  C CE   . MET A 1 35 ? -5.150  -3.472  6.341   1.00 0.00 ? 35 MET A CE   2  
ATOM 1871  H H    . MET A 1 35 ? -9.775  -0.256  7.274   1.00 0.00 ? 35 MET A H    2  
ATOM 1872  H HA   . MET A 1 35 ? -7.462  0.173   9.038   1.00 0.00 ? 35 MET A HA   2  
ATOM 1873  H HB2  . MET A 1 35 ? -7.862  -1.183  6.632   1.00 0.00 ? 35 MET A HB2  2  
ATOM 1874  H HB3  . MET A 1 35 ? -6.884  0.186   6.138   1.00 0.00 ? 35 MET A HB3  2  
ATOM 1875  H HG2  . MET A 1 35 ? -5.385  -0.440  8.149   1.00 0.00 ? 35 MET A HG2  2  
ATOM 1876  H HG3  . MET A 1 35 ? -6.240  -1.980  8.124   1.00 0.00 ? 35 MET A HG3  2  
ATOM 1877  H HE1  . MET A 1 35 ? -6.212  -3.683  6.339   1.00 0.00 ? 35 MET A HE1  2  
ATOM 1878  H HE2  . MET A 1 35 ? -4.723  -3.802  7.273   1.00 0.00 ? 35 MET A HE2  2  
ATOM 1879  H HE3  . MET A 1 35 ? -4.671  -3.993  5.524   1.00 0.00 ? 35 MET A HE3  2  
ATOM 1880  N N    . CYS A 1 36 ? -8.434  2.490   6.886   1.00 0.00 ? 36 CYS A N    2  
ATOM 1881  C CA   . CYS A 1 36 ? -8.254  3.947   6.667   1.00 0.00 ? 36 CYS A CA   2  
ATOM 1882  C C    . CYS A 1 36 ? -8.687  4.635   7.957   1.00 0.00 ? 36 CYS A C    2  
ATOM 1883  O O    . CYS A 1 36 ? -8.600  5.839   8.092   1.00 0.00 ? 36 CYS A O    2  
ATOM 1884  C CB   . CYS A 1 36 ? -9.091  4.428   5.478   1.00 0.00 ? 36 CYS A CB   2  
ATOM 1885  S SG   . CYS A 1 36 ? -8.157  4.194   3.948   1.00 0.00 ? 36 CYS A SG   2  
ATOM 1886  H H    . CYS A 1 36 ? -9.099  1.986   6.371   1.00 0.00 ? 36 CYS A H    2  
ATOM 1887  H HA   . CYS A 1 36 ? -7.205  4.146   6.515   1.00 0.00 ? 36 CYS A HA   2  
ATOM 1888  H HB2  . CYS A 1 36 ? -10.008 3.861   5.429   1.00 0.00 ? 36 CYS A HB2  2  
ATOM 1889  H HB3  . CYS A 1 36 ? -9.323  5.479   5.597   1.00 0.00 ? 36 CYS A HB3  2  
ATOM 1890  N N    . SER A 1 37 ? -9.151  3.878   8.913   1.00 0.00 ? 37 SER A N    2  
ATOM 1891  C CA   . SER A 1 37 ? -9.591  4.497   10.202  1.00 0.00 ? 37 SER A CA   2  
ATOM 1892  C C    . SER A 1 37 ? -8.387  4.674   11.138  1.00 0.00 ? 37 SER A C    2  
ATOM 1893  O O    . SER A 1 37 ? -8.557  4.916   12.317  1.00 0.00 ? 37 SER A O    2  
ATOM 1894  C CB   . SER A 1 37 ? -10.625 3.597   10.876  1.00 0.00 ? 37 SER A CB   2  
ATOM 1895  O OG   . SER A 1 37 ? -11.288 4.328   11.899  1.00 0.00 ? 37 SER A OG   2  
ATOM 1896  H H    . SER A 1 37 ? -9.214  2.899   8.778   1.00 0.00 ? 37 SER A H    2  
ATOM 1897  H HA   . SER A 1 37 ? -10.034 5.464   10.006  1.00 0.00 ? 37 SER A HA   2  
ATOM 1898  H HB2  . SER A 1 37 ? -11.348 3.270   10.149  1.00 0.00 ? 37 SER A HB2  2  
ATOM 1899  H HB3  . SER A 1 37 ? -10.128 2.735   11.301  1.00 0.00 ? 37 SER A HB3  2  
ATOM 1900  H HG   . SER A 1 37 ? -11.238 5.261   11.676  1.00 0.00 ? 37 SER A HG   2  
ATOM 1901  N N    . LYS A 1 38 ? -7.177  4.555   10.634  1.00 0.00 ? 38 LYS A N    2  
ATOM 1902  C CA   . LYS A 1 38 ? -5.964  4.718   11.511  1.00 0.00 ? 38 LYS A CA   2  
ATOM 1903  C C    . LYS A 1 38 ? -5.091  5.885   11.015  1.00 0.00 ? 38 LYS A C    2  
ATOM 1904  O O    . LYS A 1 38 ? -3.940  6.000   11.386  1.00 0.00 ? 38 LYS A O    2  
ATOM 1905  C CB   . LYS A 1 38 ? -5.154  3.410   11.505  1.00 0.00 ? 38 LYS A CB   2  
ATOM 1906  C CG   . LYS A 1 38 ? -5.817  2.392   12.439  1.00 0.00 ? 38 LYS A CG   2  
ATOM 1907  C CD   . LYS A 1 38 ? -5.023  1.085   12.417  1.00 0.00 ? 38 LYS A CD   2  
ATOM 1908  C CE   . LYS A 1 38 ? -5.806  0.002   13.163  1.00 0.00 ? 38 LYS A CE   2  
ATOM 1909  N NZ   . LYS A 1 38 ? -6.139  0.483   14.533  1.00 0.00 ? 38 LYS A NZ   2  
ATOM 1910  H H    . LYS A 1 38 ? -7.065  4.359   9.681   1.00 0.00 ? 38 LYS A H    2  
ATOM 1911  H HA   . LYS A 1 38 ? -6.270  4.933   12.526  1.00 0.00 ? 38 LYS A HA   2  
ATOM 1912  H HB2  . LYS A 1 38 ? -5.121  3.007   10.505  1.00 0.00 ? 38 LYS A HB2  2  
ATOM 1913  H HB3  . LYS A 1 38 ? -4.148  3.605   11.850  1.00 0.00 ? 38 LYS A HB3  2  
ATOM 1914  H HG2  . LYS A 1 38 ? -5.836  2.787   13.445  1.00 0.00 ? 38 LYS A HG2  2  
ATOM 1915  H HG3  . LYS A 1 38 ? -6.827  2.204   12.106  1.00 0.00 ? 38 LYS A HG3  2  
ATOM 1916  H HD2  . LYS A 1 38 ? -4.865  0.776   11.395  1.00 0.00 ? 38 LYS A HD2  2  
ATOM 1917  H HD3  . LYS A 1 38 ? -4.069  1.234   12.901  1.00 0.00 ? 38 LYS A HD3  2  
ATOM 1918  H HE2  . LYS A 1 38 ? -6.718  -0.216  12.627  1.00 0.00 ? 38 LYS A HE2  2  
ATOM 1919  H HE3  . LYS A 1 38 ? -5.206  -0.894  13.231  1.00 0.00 ? 38 LYS A HE3  2  
ATOM 1920  H HZ1  . LYS A 1 38 ? -6.667  -0.254  15.041  1.00 0.00 ? 38 LYS A HZ1  2  
ATOM 1921  H HZ2  . LYS A 1 38 ? -6.720  1.345   14.466  1.00 0.00 ? 38 LYS A HZ2  2  
ATOM 1922  H HZ3  . LYS A 1 38 ? -5.262  0.695   15.050  1.00 0.00 ? 38 LYS A HZ3  2  
ATOM 1923  N N    . LEU A 1 39 ? -5.630  6.755   10.187  1.00 0.00 ? 39 LEU A N    2  
ATOM 1924  C CA   . LEU A 1 39 ? -4.837  7.929   9.669   1.00 0.00 ? 39 LEU A CA   2  
ATOM 1925  C C    . LEU A 1 39 ? -5.626  9.223   9.958   1.00 0.00 ? 39 LEU A C    2  
ATOM 1926  O O    . LEU A 1 39 ? -6.838  9.210   9.862   1.00 0.00 ? 39 LEU A O    2  
ATOM 1927  C CB   . LEU A 1 39 ? -4.668  7.796   8.146   1.00 0.00 ? 39 LEU A CB   2  
ATOM 1928  C CG   . LEU A 1 39 ? -3.947  6.492   7.790   1.00 0.00 ? 39 LEU A CG   2  
ATOM 1929  C CD1  . LEU A 1 39 ? -3.947  6.329   6.276   1.00 0.00 ? 39 LEU A CD1  2  
ATOM 1930  C CD2  . LEU A 1 39 ? -2.493  6.527   8.286   1.00 0.00 ? 39 LEU A CD2  2  
ATOM 1931  H H    . LEU A 1 39 ? -6.562  6.642   9.908   1.00 0.00 ? 39 LEU A H    2  
ATOM 1932  H HA   . LEU A 1 39 ? -3.873  7.960   10.144  1.00 0.00 ? 39 LEU A HA   2  
ATOM 1933  H HB2  . LEU A 1 39 ? -5.646  7.796   7.686   1.00 0.00 ? 39 LEU A HB2  2  
ATOM 1934  H HB3  . LEU A 1 39 ? -4.102  8.630   7.767   1.00 0.00 ? 39 LEU A HB3  2  
ATOM 1935  H HG   . LEU A 1 39 ? -4.465  5.662   8.237   1.00 0.00 ? 39 LEU A HG   2  
ATOM 1936  H HD11 . LEU A 1 39 ? -3.290  7.066   5.839   1.00 0.00 ? 39 LEU A HD11 2  
ATOM 1937  H HD12 . LEU A 1 39 ? -4.947  6.472   5.901   1.00 0.00 ? 39 LEU A HD12 2  
ATOM 1938  H HD13 . LEU A 1 39 ? -3.602  5.340   6.019   1.00 0.00 ? 39 LEU A HD13 2  
ATOM 1939  H HD21 . LEU A 1 39 ? -2.071  7.501   8.093   1.00 0.00 ? 39 LEU A HD21 2  
ATOM 1940  H HD22 . LEU A 1 39 ? -1.915  5.779   7.764   1.00 0.00 ? 39 LEU A HD22 2  
ATOM 1941  H HD23 . LEU A 1 39 ? -2.465  6.322   9.344   1.00 0.00 ? 39 LEU A HD23 2  
ATOM 1942  N N    . PRO A 1 40 ? -4.953  10.315  10.297  1.00 0.00 ? 40 PRO A N    2  
ATOM 1943  C CA   . PRO A 1 40 ? -5.658  11.577  10.574  1.00 0.00 ? 40 PRO A CA   2  
ATOM 1944  C C    . PRO A 1 40 ? -6.726  11.860  9.497   1.00 0.00 ? 40 PRO A C    2  
ATOM 1945  O O    . PRO A 1 40 ? -6.660  11.315  8.412   1.00 0.00 ? 40 PRO A O    2  
ATOM 1946  C CB   . PRO A 1 40 ? -4.546  12.654  10.619  1.00 0.00 ? 40 PRO A CB   2  
ATOM 1947  C CG   . PRO A 1 40 ? -3.183  11.905  10.628  1.00 0.00 ? 40 PRO A CG   2  
ATOM 1948  C CD   . PRO A 1 40 ? -3.479  10.401  10.442  1.00 0.00 ? 40 PRO A CD   2  
ATOM 1949  H HA   . PRO A 1 40 ? -6.140  11.505  11.535  1.00 0.00 ? 40 PRO A HA   2  
ATOM 1950  H HB2  . PRO A 1 40 ? -4.609  13.296  9.749   1.00 0.00 ? 40 PRO A HB2  2  
ATOM 1951  H HB3  . PRO A 1 40 ? -4.636  13.249  11.519  1.00 0.00 ? 40 PRO A HB3  2  
ATOM 1952  H HG2  . PRO A 1 40 ? -2.559  12.265  9.817   1.00 0.00 ? 40 PRO A HG2  2  
ATOM 1953  H HG3  . PRO A 1 40 ? -2.677  12.063  11.571  1.00 0.00 ? 40 PRO A HG3  2  
ATOM 1954  H HD2  . PRO A 1 40 ? -2.985  10.035  9.563   1.00 0.00 ? 40 PRO A HD2  2  
ATOM 1955  H HD3  . PRO A 1 40 ? -3.162  9.843   11.313  1.00 0.00 ? 40 PRO A HD3  2  
ATOM 1956  N N    . LYS A 1 41 ? -7.712  12.670  9.763   1.00 0.00 ? 41 LYS A N    2  
ATOM 1957  C CA   . LYS A 1 41 ? -8.755  12.918  8.720   1.00 0.00 ? 41 LYS A CA   2  
ATOM 1958  C C    . LYS A 1 41 ? -8.172  13.628  7.493   1.00 0.00 ? 41 LYS A C    2  
ATOM 1959  O O    . LYS A 1 41 ? -8.808  13.713  6.462   1.00 0.00 ? 41 LYS A O    2  
ATOM 1960  C CB   . LYS A 1 41 ? -9.876  13.773  9.302   1.00 0.00 ? 41 LYS A CB   2  
ATOM 1961  C CG   . LYS A 1 41 ? -11.119 13.677  8.406   1.00 0.00 ? 41 LYS A CG   2  
ATOM 1962  C CD   . LYS A 1 41 ? -12.276 14.445  9.048   1.00 0.00 ? 41 LYS A CD   2  
ATOM 1963  C CE   . LYS A 1 41 ? -13.510 14.358  8.146   1.00 0.00 ? 41 LYS A CE   2  
ATOM 1964  N NZ   . LYS A 1 41 ? -13.157 14.823  6.774   1.00 0.00 ? 41 LYS A NZ   2  
ATOM 1965  H H    . LYS A 1 41 ? -7.782  13.106  10.638  1.00 0.00 ? 41 LYS A H    2  
ATOM 1966  H HA   . LYS A 1 41 ? -9.160  11.983  8.367   1.00 0.00 ? 41 LYS A HA   2  
ATOM 1967  H HB2  . LYS A 1 41 ? -10.115 13.421  10.293  1.00 0.00 ? 41 LYS A HB2  2  
ATOM 1968  H HB3  . LYS A 1 41 ? -9.548  14.800  9.352   1.00 0.00 ? 41 LYS A HB3  2  
ATOM 1969  H HG2  . LYS A 1 41 ? -10.898 14.105  7.440   1.00 0.00 ? 41 LYS A HG2  2  
ATOM 1970  H HG3  . LYS A 1 41 ? -11.399 12.642  8.286   1.00 0.00 ? 41 LYS A HG3  2  
ATOM 1971  H HD2  . LYS A 1 41 ? -12.503 14.015  10.012  1.00 0.00 ? 41 LYS A HD2  2  
ATOM 1972  H HD3  . LYS A 1 41 ? -11.997 15.481  9.172   1.00 0.00 ? 41 LYS A HD3  2  
ATOM 1973  H HE2  . LYS A 1 41 ? -13.851 13.335  8.102   1.00 0.00 ? 41 LYS A HE2  2  
ATOM 1974  H HE3  . LYS A 1 41 ? -14.294 14.982  8.547   1.00 0.00 ? 41 LYS A HE3  2  
ATOM 1975  H HZ1  . LYS A 1 41 ? -12.310 15.423  6.818   1.00 0.00 ? 41 LYS A HZ1  2  
ATOM 1976  H HZ2  . LYS A 1 41 ? -13.951 15.369  6.380   1.00 0.00 ? 41 LYS A HZ2  2  
ATOM 1977  H HZ3  . LYS A 1 41 ? -12.967 14.001  6.167   1.00 0.00 ? 41 LYS A HZ3  2  
ATOM 1978  N N    . SER A 1 42 ? -7.009  14.205  7.605   1.00 0.00 ? 42 SER A N    2  
ATOM 1979  C CA   . SER A 1 42 ? -6.468  14.978  6.449   1.00 0.00 ? 42 SER A CA   2  
ATOM 1980  C C    . SER A 1 42 ? -6.049  14.095  5.271   1.00 0.00 ? 42 SER A C    2  
ATOM 1981  O O    . SER A 1 42 ? -5.914  14.563  4.158   1.00 0.00 ? 42 SER A O    2  
ATOM 1982  C CB   . SER A 1 42 ? -5.301  15.859  6.897   1.00 0.00 ? 42 SER A CB   2  
ATOM 1983  O OG   . SER A 1 42 ? -4.156  15.045  7.117   1.00 0.00 ? 42 SER A OG   2  
ATOM 1984  H H    . SER A 1 42 ? -6.520  14.178  8.453   1.00 0.00 ? 42 SER A H    2  
ATOM 1985  H HA   . SER A 1 42 ? -7.260  15.596  6.060   1.00 0.00 ? 42 SER A HA   2  
ATOM 1986  H HB2  . SER A 1 42 ? -5.079  16.583  6.131   1.00 0.00 ? 42 SER A HB2  2  
ATOM 1987  H HB3  . SER A 1 42 ? -5.570  16.374  7.809   1.00 0.00 ? 42 SER A HB3  2  
ATOM 1988  H HG   . SER A 1 42 ? -3.791  15.274  7.976   1.00 0.00 ? 42 SER A HG   2  
ATOM 1989  N N    . LEU A 1 43 ? -5.867  12.816  5.500   1.00 0.00 ? 43 LEU A N    2  
ATOM 1990  C CA   . LEU A 1 43 ? -5.480  11.882  4.382   1.00 0.00 ? 43 LEU A CA   2  
ATOM 1991  C C    . LEU A 1 43 ? -6.602  10.874  4.153   1.00 0.00 ? 43 LEU A C    2  
ATOM 1992  O O    . LEU A 1 43 ? -6.496  10.037  3.281   1.00 0.00 ? 43 LEU A O    2  
ATOM 1993  C CB   . LEU A 1 43 ? -4.181  11.110  4.710   1.00 0.00 ? 43 LEU A CB   2  
ATOM 1994  C CG   . LEU A 1 43 ? -3.198  11.976  5.496   1.00 0.00 ? 43 LEU A CG   2  
ATOM 1995  C CD1  . LEU A 1 43 ? -1.948  11.156  5.821   1.00 0.00 ? 43 LEU A CD1  2  
ATOM 1996  C CD2  . LEU A 1 43 ? -2.789  13.203  4.671   1.00 0.00 ? 43 LEU A CD2  2  
ATOM 1997  H H    . LEU A 1 43 ? -6.009  12.464  6.407   1.00 0.00 ? 43 LEU A H    2  
ATOM 1998  H HA   . LEU A 1 43 ? -5.342  12.432  3.453   1.00 0.00 ? 43 LEU A HA   2  
ATOM 1999  H HB2  . LEU A 1 43 ? -4.418  10.241  5.300   1.00 0.00 ? 43 LEU A HB2  2  
ATOM 2000  H HB3  . LEU A 1 43 ? -3.712  10.796  3.788   1.00 0.00 ? 43 LEU A HB3  2  
ATOM 2001  H HG   . LEU A 1 43 ? -3.662  12.282  6.411   1.00 0.00 ? 43 LEU A HG   2  
ATOM 2002  H HD11 . LEU A 1 43 ? -2.176  10.449  6.603   1.00 0.00 ? 43 LEU A HD11 2  
ATOM 2003  H HD12 . LEU A 1 43 ? -1.160  11.816  6.154   1.00 0.00 ? 43 LEU A HD12 2  
ATOM 2004  H HD13 . LEU A 1 43 ? -1.624  10.626  4.938   1.00 0.00 ? 43 LEU A HD13 2  
ATOM 2005  H HD21 . LEU A 1 43 ? -2.149  13.837  5.266   1.00 0.00 ? 43 LEU A HD21 2  
ATOM 2006  H HD22 . LEU A 1 43 ? -3.665  13.756  4.378   1.00 0.00 ? 43 LEU A HD22 2  
ATOM 2007  H HD23 . LEU A 1 43 ? -2.255  12.881  3.790   1.00 0.00 ? 43 LEU A HD23 2  
ATOM 2008  N N    . SER A 1 44 ? -7.670  10.937  4.926   1.00 0.00 ? 44 SER A N    2  
ATOM 2009  C CA   . SER A 1 44 ? -8.807  9.971   4.740   1.00 0.00 ? 44 SER A CA   2  
ATOM 2010  C C    . SER A 1 44 ? -8.969  9.688   3.252   1.00 0.00 ? 44 SER A C    2  
ATOM 2011  O O    . SER A 1 44 ? -9.102  8.567   2.799   1.00 0.00 ? 44 SER A O    2  
ATOM 2012  C CB   . SER A 1 44 ? -10.095 10.596  5.278   1.00 0.00 ? 44 SER A CB   2  
ATOM 2013  O OG   . SER A 1 44 ? -11.210 9.836   4.830   1.00 0.00 ? 44 SER A OG   2  
ATOM 2014  H H    . SER A 1 44 ? -7.723  11.617  5.631   1.00 0.00 ? 44 SER A H    2  
ATOM 2015  H HA   . SER A 1 44 ? -8.600  9.056   5.280   1.00 0.00 ? 44 SER A HA   2  
ATOM 2016  H HB2  . SER A 1 44 ? -10.075 10.596  6.355   1.00 0.00 ? 44 SER A HB2  2  
ATOM 2017  H HB3  . SER A 1 44 ? -10.174 11.616  4.924   1.00 0.00 ? 44 SER A HB3  2  
ATOM 2018  H HG   . SER A 1 44 ? -11.673 9.503   5.603   1.00 0.00 ? 44 SER A HG   2  
ATOM 2019  N N    . GLU A 1 45 ? -9.115  10.767  2.537   1.00 0.00 ? 45 GLU A N    2  
ATOM 2020  C CA   . GLU A 1 45 ? -9.455  10.759  1.096   1.00 0.00 ? 45 GLU A CA   2  
ATOM 2021  C C    . GLU A 1 45 ? -8.481  10.101  0.132   1.00 0.00 ? 45 GLU A C    2  
ATOM 2022  O O    . GLU A 1 45 ? -8.843  9.240   -0.645  1.00 0.00 ? 45 GLU A O    2  
ATOM 2023  C CB   . GLU A 1 45 ? -9.584  12.226  0.671   1.00 0.00 ? 45 GLU A CB   2  
ATOM 2024  C CG   . GLU A 1 45 ? -10.073 12.314  -0.778  1.00 0.00 ? 45 GLU A CG   2  
ATOM 2025  C CD   . GLU A 1 45 ? -10.662 13.703  -1.045  1.00 0.00 ? 45 GLU A CD   2  
ATOM 2026  O OE1  . GLU A 1 45 ? -9.889  14.613  -1.299  1.00 0.00 ? 45 GLU A OE1  2  
ATOM 2027  O OE2  . GLU A 1 45 ? -11.873 13.832  -0.991  1.00 0.00 ? 45 GLU A OE2  2  
ATOM 2028  H H    . GLU A 1 45 ? -9.100  11.649  2.964   1.00 0.00 ? 45 GLU A H    2  
ATOM 2029  H HA   . GLU A 1 45 ? -10.417 10.295  0.973   1.00 0.00 ? 45 GLU A HA   2  
ATOM 2030  H HB2  . GLU A 1 45 ? -10.283 12.728  1.323   1.00 0.00 ? 45 GLU A HB2  2  
ATOM 2031  H HB3  . GLU A 1 45 ? -8.613  12.704  0.747   1.00 0.00 ? 45 GLU A HB3  2  
ATOM 2032  H HG2  . GLU A 1 45 ? -9.241  12.147  -1.443  1.00 0.00 ? 45 GLU A HG2  2  
ATOM 2033  H HG3  . GLU A 1 45 ? -10.831 11.566  -0.950  1.00 0.00 ? 45 GLU A HG3  2  
ATOM 2034  N N    . GLU A 1 46 ? -7.245  10.496  0.175   1.00 0.00 ? 46 GLU A N    2  
ATOM 2035  C CA   . GLU A 1 46 ? -6.248  9.893   -0.735  1.00 0.00 ? 46 GLU A CA   2  
ATOM 2036  C C    . GLU A 1 46 ? -6.157  8.398   -0.467  1.00 0.00 ? 46 GLU A C    2  
ATOM 2037  O O    . GLU A 1 46 ? -5.768  7.635   -1.322  1.00 0.00 ? 46 GLU A O    2  
ATOM 2038  C CB   . GLU A 1 46 ? -4.892  10.556  -0.492  1.00 0.00 ? 46 GLU A CB   2  
ATOM 2039  C CG   . GLU A 1 46 ? -5.074  12.074  -0.385  1.00 0.00 ? 46 GLU A CG   2  
ATOM 2040  C CD   . GLU A 1 46 ? -5.833  12.590  -1.610  1.00 0.00 ? 46 GLU A CD   2  
ATOM 2041  O OE1  . GLU A 1 46 ? -5.416  12.282  -2.714  1.00 0.00 ? 46 GLU A OE1  2  
ATOM 2042  O OE2  . GLU A 1 46 ? -6.818  13.286  -1.423  1.00 0.00 ? 46 GLU A OE2  2  
ATOM 2043  H H    . GLU A 1 46 ? -6.961  11.200  0.797   1.00 0.00 ? 46 GLU A H    2  
ATOM 2044  H HA   . GLU A 1 46 ? -6.546  10.043  -1.759  1.00 0.00 ? 46 GLU A HA   2  
ATOM 2045  H HB2  . GLU A 1 46 ? -4.466  10.177  0.426   1.00 0.00 ? 46 GLU A HB2  2  
ATOM 2046  H HB3  . GLU A 1 46 ? -4.230  10.334  -1.311  1.00 0.00 ? 46 GLU A HB3  2  
ATOM 2047  H HG2  . GLU A 1 46 ? -5.628  12.310  0.510   1.00 0.00 ? 46 GLU A HG2  2  
ATOM 2048  H HG3  . GLU A 1 46 ? -4.109  12.548  -0.341  1.00 0.00 ? 46 GLU A HG3  2  
ATOM 2049  N N    . CYS A 1 47 ? -6.527  7.961   0.699   1.00 0.00 ? 47 CYS A N    2  
ATOM 2050  C CA   . CYS A 1 47 ? -6.465  6.503   0.979   1.00 0.00 ? 47 CYS A CA   2  
ATOM 2051  C C    . CYS A 1 47 ? -7.657  5.832   0.300   1.00 0.00 ? 47 CYS A C    2  
ATOM 2052  O O    . CYS A 1 47 ? -7.532  4.796   -0.323  1.00 0.00 ? 47 CYS A O    2  
ATOM 2053  C CB   . CYS A 1 47 ? -6.499  6.274   2.503   1.00 0.00 ? 47 CYS A CB   2  
ATOM 2054  S SG   . CYS A 1 47 ? -8.200  6.016   3.083   1.00 0.00 ? 47 CYS A SG   2  
ATOM 2055  H H    . CYS A 1 47 ? -6.855  8.583   1.382   1.00 0.00 ? 47 CYS A H    2  
ATOM 2056  H HA   . CYS A 1 47 ? -5.557  6.100   0.552   1.00 0.00 ? 47 CYS A HA   2  
ATOM 2057  H HB2  . CYS A 1 47 ? -5.908  5.408   2.750   1.00 0.00 ? 47 CYS A HB2  2  
ATOM 2058  H HB3  . CYS A 1 47 ? -6.093  7.143   2.999   1.00 0.00 ? 47 CYS A HB3  2  
ATOM 2059  N N    . GLN A 1 48 ? -8.813  6.412   0.423   1.00 0.00 ? 48 GLN A N    2  
ATOM 2060  C CA   . GLN A 1 48 ? -10.013 5.801   -0.208  1.00 0.00 ? 48 GLN A CA   2  
ATOM 2061  C C    . GLN A 1 48 ? -9.729  5.567   -1.692  1.00 0.00 ? 48 GLN A C    2  
ATOM 2062  O O    . GLN A 1 48 ? -10.048 4.531   -2.242  1.00 0.00 ? 48 GLN A O    2  
ATOM 2063  C CB   . GLN A 1 48 ? -11.219 6.746   -0.027  1.00 0.00 ? 48 GLN A CB   2  
ATOM 2064  C CG   . GLN A 1 48 ? -12.520 5.939   0.059   1.00 0.00 ? 48 GLN A CG   2  
ATOM 2065  C CD   . GLN A 1 48 ? -12.618 4.987   -1.133  1.00 0.00 ? 48 GLN A CD   2  
ATOM 2066  O OE1  . GLN A 1 48 ? -12.968 3.834   -0.976  1.00 0.00 ? 48 GLN A OE1  2  
ATOM 2067  N NE2  . GLN A 1 48 ? -12.324 5.423   -2.328  1.00 0.00 ? 48 GLN A NE2  2  
ATOM 2068  H H    . GLN A 1 48 ? -8.892  7.240   0.943   1.00 0.00 ? 48 GLN A H    2  
ATOM 2069  H HA   . GLN A 1 48 ? -10.214 4.849   0.268   1.00 0.00 ? 48 GLN A HA   2  
ATOM 2070  H HB2  . GLN A 1 48 ? -11.092 7.310   0.885   1.00 0.00 ? 48 GLN A HB2  2  
ATOM 2071  H HB3  . GLN A 1 48 ? -11.277 7.430   -0.862  1.00 0.00 ? 48 GLN A HB3  2  
ATOM 2072  H HG2  . GLN A 1 48 ? -12.529 5.369   0.977   1.00 0.00 ? 48 GLN A HG2  2  
ATOM 2073  H HG3  . GLN A 1 48 ? -13.363 6.614   0.048   1.00 0.00 ? 48 GLN A HG3  2  
ATOM 2074  H HE21 . GLN A 1 48 ? -12.044 6.353   -2.454  1.00 0.00 ? 48 GLN A HE21 2  
ATOM 2075  H HE22 . GLN A 1 48 ? -12.384 4.820   -3.098  1.00 0.00 ? 48 GLN A HE22 2  
ATOM 2076  N N    . GLU A 1 49 ? -9.140  6.530   -2.349  1.00 0.00 ? 49 GLU A N    2  
ATOM 2077  C CA   . GLU A 1 49 ? -8.844  6.375   -3.797  1.00 0.00 ? 49 GLU A CA   2  
ATOM 2078  C C    . GLU A 1 49 ? -7.754  5.320   -4.010  1.00 0.00 ? 49 GLU A C    2  
ATOM 2079  O O    . GLU A 1 49 ? -7.824  4.522   -4.923  1.00 0.00 ? 49 GLU A O    2  
ATOM 2080  C CB   . GLU A 1 49 ? -8.372  7.718   -4.363  1.00 0.00 ? 49 GLU A CB   2  
ATOM 2081  C CG   . GLU A 1 49 ? -7.956  7.541   -5.825  1.00 0.00 ? 49 GLU A CG   2  
ATOM 2082  C CD   . GLU A 1 49 ? -7.781  8.913   -6.476  1.00 0.00 ? 49 GLU A CD   2  
ATOM 2083  O OE1  . GLU A 1 49 ? -6.690  9.453   -6.389  1.00 0.00 ? 49 GLU A OE1  2  
ATOM 2084  O OE2  . GLU A 1 49 ? -8.740  9.402   -7.051  1.00 0.00 ? 49 GLU A OE2  2  
ATOM 2085  H H    . GLU A 1 49 ? -8.898  7.364   -1.897  1.00 0.00 ? 49 GLU A H    2  
ATOM 2086  H HA   . GLU A 1 49 ? -9.741  6.068   -4.315  1.00 0.00 ? 49 GLU A HA   2  
ATOM 2087  H HB2  . GLU A 1 49 ? -9.177  8.436   -4.301  1.00 0.00 ? 49 GLU A HB2  2  
ATOM 2088  H HB3  . GLU A 1 49 ? -7.528  8.073   -3.791  1.00 0.00 ? 49 GLU A HB3  2  
ATOM 2089  H HG2  . GLU A 1 49 ? -7.022  6.998   -5.870  1.00 0.00 ? 49 GLU A HG2  2  
ATOM 2090  H HG3  . GLU A 1 49 ? -8.719  6.989   -6.352  1.00 0.00 ? 49 GLU A HG3  2  
ATOM 2091  N N    . VAL A 1 50 ? -6.748  5.301   -3.171  1.00 0.00 ? 50 VAL A N    2  
ATOM 2092  C CA   . VAL A 1 50 ? -5.672  4.285   -3.339  1.00 0.00 ? 50 VAL A CA   2  
ATOM 2093  C C    . VAL A 1 50 ? -6.233  2.904   -3.012  1.00 0.00 ? 50 VAL A C    2  
ATOM 2094  O O    . VAL A 1 50 ? -6.073  1.966   -3.766  1.00 0.00 ? 50 VAL A O    2  
ATOM 2095  C CB   . VAL A 1 50 ? -4.488  4.579   -2.404  1.00 0.00 ? 50 VAL A CB   2  
ATOM 2096  C CG1  . VAL A 1 50 ? -3.381  3.543   -2.644  1.00 0.00 ? 50 VAL A CG1  2  
ATOM 2097  C CG2  . VAL A 1 50 ? -3.939  6.000   -2.670  1.00 0.00 ? 50 VAL A CG2  2  
ATOM 2098  H H    . VAL A 1 50 ? -6.705  5.943   -2.437  1.00 0.00 ? 50 VAL A H    2  
ATOM 2099  H HA   . VAL A 1 50 ? -5.330  4.312   -4.356  1.00 0.00 ? 50 VAL A HA   2  
ATOM 2100  H HB   . VAL A 1 50 ? -4.815  4.494   -1.380  1.00 0.00 ? 50 VAL A HB   2  
ATOM 2101  H HG11 . VAL A 1 50 ? -2.517  3.797   -2.047  1.00 0.00 ? 50 VAL A HG11 2  
ATOM 2102  H HG12 . VAL A 1 50 ? -3.107  3.545   -3.687  1.00 0.00 ? 50 VAL A HG12 2  
ATOM 2103  H HG13 . VAL A 1 50 ? -3.735  2.562   -2.364  1.00 0.00 ? 50 VAL A HG13 2  
ATOM 2104  H HG21 . VAL A 1 50 ? -3.104  5.952   -3.358  1.00 0.00 ? 50 VAL A HG21 2  
ATOM 2105  H HG22 . VAL A 1 50 ? -3.606  6.440   -1.741  1.00 0.00 ? 50 VAL A HG22 2  
ATOM 2106  H HG23 . VAL A 1 50 ? -4.712  6.621   -3.100  1.00 0.00 ? 50 VAL A HG23 2  
ATOM 2107  N N    . VAL A 1 51 ? -6.861  2.758   -1.872  1.00 0.00 ? 51 VAL A N    2  
ATOM 2108  C CA   . VAL A 1 51 ? -7.392  1.421   -1.490  1.00 0.00 ? 51 VAL A CA   2  
ATOM 2109  C C    . VAL A 1 51 ? -8.427  0.954   -2.522  1.00 0.00 ? 51 VAL A C    2  
ATOM 2110  O O    . VAL A 1 51 ? -8.373  -0.149  -3.023  1.00 0.00 ? 51 VAL A O    2  
ATOM 2111  C CB   . VAL A 1 51 ? -7.976  1.477   -0.069  1.00 0.00 ? 51 VAL A CB   2  
ATOM 2112  C CG1  . VAL A 1 51 ? -8.416  0.086   0.374   1.00 0.00 ? 51 VAL A CG1  2  
ATOM 2113  C CG2  . VAL A 1 51 ? -6.917  2.001   0.908   1.00 0.00 ? 51 VAL A CG2  2  
ATOM 2114  H H    . VAL A 1 51 ? -6.957  3.508   -1.248  1.00 0.00 ? 51 VAL A H    2  
ATOM 2115  H HA   . VAL A 1 51 ? -6.574  0.725   -1.544  1.00 0.00 ? 51 VAL A HA   2  
ATOM 2116  H HB   . VAL A 1 51 ? -8.824  2.140   -0.060  1.00 0.00 ? 51 VAL A HB   2  
ATOM 2117  H HG11 . VAL A 1 51 ? -8.798  0.138   1.382   1.00 0.00 ? 51 VAL A HG11 2  
ATOM 2118  H HG12 . VAL A 1 51 ? -7.571  -0.585  0.344   1.00 0.00 ? 51 VAL A HG12 2  
ATOM 2119  H HG13 . VAL A 1 51 ? -9.190  -0.273  -0.286  1.00 0.00 ? 51 VAL A HG13 2  
ATOM 2120  H HG21 . VAL A 1 51 ? -6.439  2.873   0.490   1.00 0.00 ? 51 VAL A HG21 2  
ATOM 2121  H HG22 . VAL A 1 51 ? -6.179  1.235   1.084   1.00 0.00 ? 51 VAL A HG22 2  
ATOM 2122  H HG23 . VAL A 1 51 ? -7.390  2.266   1.846   1.00 0.00 ? 51 VAL A HG23 2  
ATOM 2123  N N    . ASP A 1 52 ? -9.407  1.778   -2.785  1.00 0.00 ? 52 ASP A N    2  
ATOM 2124  C CA   . ASP A 1 52 ? -10.507 1.395   -3.719  1.00 0.00 ? 52 ASP A CA   2  
ATOM 2125  C C    . ASP A 1 52 ? -10.008 1.157   -5.146  1.00 0.00 ? 52 ASP A C    2  
ATOM 2126  O O    . ASP A 1 52 ? -10.430 0.232   -5.811  1.00 0.00 ? 52 ASP A O    2  
ATOM 2127  C CB   . ASP A 1 52 ? -11.552 2.515   -3.738  1.00 0.00 ? 52 ASP A CB   2  
ATOM 2128  C CG   . ASP A 1 52 ? -12.739 2.092   -4.604  1.00 0.00 ? 52 ASP A CG   2  
ATOM 2129  O OD1  . ASP A 1 52 ? -13.589 1.376   -4.098  1.00 0.00 ? 52 ASP A OD1  2  
ATOM 2130  O OD2  . ASP A 1 52 ? -12.780 2.490   -5.756  1.00 0.00 ? 52 ASP A OD2  2  
ATOM 2131  H H    . ASP A 1 52 ? -9.443  2.648   -2.337  1.00 0.00 ? 52 ASP A H    2  
ATOM 2132  H HA   . ASP A 1 52 ? -10.984 0.499   -3.350  1.00 0.00 ? 52 ASP A HA   2  
ATOM 2133  H HB2  . ASP A 1 52 ? -11.890 2.704   -2.730  1.00 0.00 ? 52 ASP A HB2  2  
ATOM 2134  H HB3  . ASP A 1 52 ? -11.115 3.414   -4.145  1.00 0.00 ? 52 ASP A HB3  2  
ATOM 2135  N N    . THR A 1 53 ? -9.137  1.995   -5.633  1.00 0.00 ? 53 THR A N    2  
ATOM 2136  C CA   . THR A 1 53 ? -8.639  1.831   -7.027  1.00 0.00 ? 53 THR A CA   2  
ATOM 2137  C C    . THR A 1 53 ? -7.444  0.884   -7.073  1.00 0.00 ? 53 THR A C    2  
ATOM 2138  O O    . THR A 1 53 ? -7.319  0.100   -7.992  1.00 0.00 ? 53 THR A O    2  
ATOM 2139  C CB   . THR A 1 53 ? -8.227  3.201   -7.574  1.00 0.00 ? 53 THR A CB   2  
ATOM 2140  O OG1  . THR A 1 53 ? -9.301  4.116   -7.405  1.00 0.00 ? 53 THR A OG1  2  
ATOM 2141  C CG2  . THR A 1 53 ? -7.887  3.083   -9.060  1.00 0.00 ? 53 THR A CG2  2  
ATOM 2142  H H    . THR A 1 53 ? -8.820  2.748   -5.092  1.00 0.00 ? 53 THR A H    2  
ATOM 2143  H HA   . THR A 1 53 ? -9.414  1.426   -7.654  1.00 0.00 ? 53 THR A HA   2  
ATOM 2144  H HB   . THR A 1 53 ? -7.365  3.558   -7.038  1.00 0.00 ? 53 THR A HB   2  
ATOM 2145  H HG1  . THR A 1 53 ? -9.784  3.864   -6.615  1.00 0.00 ? 53 THR A HG1  2  
ATOM 2146  H HG21 . THR A 1 53 ? -7.572  4.046   -9.434  1.00 0.00 ? 53 THR A HG21 2  
ATOM 2147  H HG22 . THR A 1 53 ? -8.759  2.754   -9.605  1.00 0.00 ? 53 THR A HG22 2  
ATOM 2148  H HG23 . THR A 1 53 ? -7.089  2.367   -9.192  1.00 0.00 ? 53 THR A HG23 2  
ATOM 2149  N N    . TYR A 1 54 ? -6.547  0.961   -6.121  1.00 0.00 ? 54 TYR A N    2  
ATOM 2150  C CA   . TYR A 1 54 ? -5.340  0.073   -6.156  1.00 0.00 ? 54 TYR A CA   2  
ATOM 2151  C C    . TYR A 1 54 ? -5.364  -0.986  -5.048  1.00 0.00 ? 54 TYR A C    2  
ATOM 2152  O O    . TYR A 1 54 ? -4.342  -1.378  -4.526  1.00 0.00 ? 54 TYR A O    2  
ATOM 2153  C CB   . TYR A 1 54 ? -4.089  0.927   -6.007  1.00 0.00 ? 54 TYR A CB   2  
ATOM 2154  C CG   . TYR A 1 54 ? -3.939  1.820   -7.215  1.00 0.00 ? 54 TYR A CG   2  
ATOM 2155  C CD1  . TYR A 1 54 ? -4.556  3.071   -7.231  1.00 0.00 ? 54 TYR A CD1  2  
ATOM 2156  C CD2  . TYR A 1 54 ? -3.182  1.402   -8.316  1.00 0.00 ? 54 TYR A CD2  2  
ATOM 2157  C CE1  . TYR A 1 54 ? -4.424  3.910   -8.337  1.00 0.00 ? 54 TYR A CE1  2  
ATOM 2158  C CE2  . TYR A 1 54 ? -3.045  2.242   -9.430  1.00 0.00 ? 54 TYR A CE2  2  
ATOM 2159  C CZ   . TYR A 1 54 ? -3.665  3.498   -9.439  1.00 0.00 ? 54 TYR A CZ   2  
ATOM 2160  O OH   . TYR A 1 54 ? -3.531  4.325   -10.535 1.00 0.00 ? 54 TYR A OH   2  
ATOM 2161  H H    . TYR A 1 54 ? -6.652  1.618   -5.401  1.00 0.00 ? 54 TYR A H    2  
ATOM 2162  H HA   . TYR A 1 54 ? -5.289  -0.445  -7.103  1.00 0.00 ? 54 TYR A HA   2  
ATOM 2163  H HB2  . TYR A 1 54 ? -4.181  1.533   -5.122  1.00 0.00 ? 54 TYR A HB2  2  
ATOM 2164  H HB3  . TYR A 1 54 ? -3.225  0.288   -5.921  1.00 0.00 ? 54 TYR A HB3  2  
ATOM 2165  H HD1  . TYR A 1 54 ? -5.140  3.387   -6.389  1.00 0.00 ? 54 TYR A HD1  2  
ATOM 2166  H HD2  . TYR A 1 54 ? -2.704  0.433   -8.307  1.00 0.00 ? 54 TYR A HD2  2  
ATOM 2167  H HE1  . TYR A 1 54 ? -4.903  4.879   -8.336  1.00 0.00 ? 54 TYR A HE1  2  
ATOM 2168  H HE2  . TYR A 1 54 ? -2.460  1.921   -10.278 1.00 0.00 ? 54 TYR A HE2  2  
ATOM 2169  H HH   . TYR A 1 54 ? -3.211  3.796   -11.270 1.00 0.00 ? 54 TYR A HH   2  
ATOM 2170  N N    . GLY A 1 55 ? -6.532  -1.418  -4.656  1.00 0.00 ? 55 GLY A N    2  
ATOM 2171  C CA   . GLY A 1 55 ? -6.634  -2.410  -3.548  1.00 0.00 ? 55 GLY A CA   2  
ATOM 2172  C C    . GLY A 1 55 ? -6.370  -3.832  -4.037  1.00 0.00 ? 55 GLY A C    2  
ATOM 2173  O O    . GLY A 1 55 ? -5.555  -4.540  -3.479  1.00 0.00 ? 55 GLY A O    2  
ATOM 2174  H H    . GLY A 1 55 ? -7.344  -1.081  -5.082  1.00 0.00 ? 55 GLY A H    2  
ATOM 2175  H HA2  . GLY A 1 55 ? -5.910  -2.162  -2.787  1.00 0.00 ? 55 GLY A HA2  2  
ATOM 2176  H HA3  . GLY A 1 55 ? -7.624  -2.364  -3.122  1.00 0.00 ? 55 GLY A HA3  2  
ATOM 2177  N N    . SER A 1 56 ? -7.062  -4.279  -5.049  1.00 0.00 ? 56 SER A N    2  
ATOM 2178  C CA   . SER A 1 56 ? -6.837  -5.672  -5.512  1.00 0.00 ? 56 SER A CA   2  
ATOM 2179  C C    . SER A 1 56 ? -5.449  -5.796  -6.122  1.00 0.00 ? 56 SER A C    2  
ATOM 2180  O O    . SER A 1 56 ? -4.859  -6.858  -6.149  1.00 0.00 ? 56 SER A O    2  
ATOM 2181  C CB   . SER A 1 56 ? -7.876  -6.054  -6.564  1.00 0.00 ? 56 SER A CB   2  
ATOM 2182  O OG   . SER A 1 56 ? -9.138  -5.509  -6.201  1.00 0.00 ? 56 SER A OG   2  
ATOM 2183  H H    . SER A 1 56 ? -7.732  -3.716  -5.488  1.00 0.00 ? 56 SER A H    2  
ATOM 2184  H HA   . SER A 1 56 ? -6.928  -6.328  -4.661  1.00 0.00 ? 56 SER A HA   2  
ATOM 2185  H HB2  . SER A 1 56 ? -7.580  -5.661  -7.527  1.00 0.00 ? 56 SER A HB2  2  
ATOM 2186  H HB3  . SER A 1 56 ? -7.937  -7.132  -6.621  1.00 0.00 ? 56 SER A HB3  2  
ATOM 2187  H HG   . SER A 1 56 ? -8.982  -4.698  -5.711  1.00 0.00 ? 56 SER A HG   2  
ATOM 2188  N N    . SER A 1 57 ? -4.955  -4.724  -6.683  1.00 0.00 ? 57 SER A N    2  
ATOM 2189  C CA   . SER A 1 57 ? -3.640  -4.800  -7.370  1.00 0.00 ? 57 SER A CA   2  
ATOM 2190  C C    . SER A 1 57 ? -2.479  -4.824  -6.376  1.00 0.00 ? 57 SER A C    2  
ATOM 2191  O O    . SER A 1 57 ? -1.607  -5.661  -6.464  1.00 0.00 ? 57 SER A O    2  
ATOM 2192  C CB   . SER A 1 57 ? -3.482  -3.638  -8.349  1.00 0.00 ? 57 SER A CB   2  
ATOM 2193  O OG   . SER A 1 57 ? -3.519  -2.411  -7.632  1.00 0.00 ? 57 SER A OG   2  
ATOM 2194  H H    . SER A 1 57 ? -5.468  -3.890  -6.673  1.00 0.00 ? 57 SER A H    2  
ATOM 2195  H HA   . SER A 1 57 ? -3.620  -5.737  -7.905  1.00 0.00 ? 57 SER A HA   2  
ATOM 2196  H HB2  . SER A 1 57 ? -2.537  -3.720  -8.861  1.00 0.00 ? 57 SER A HB2  2  
ATOM 2197  H HB3  . SER A 1 57 ? -4.284  -3.668  -9.075  1.00 0.00 ? 57 SER A HB3  2  
ATOM 2198  H HG   . SER A 1 57 ? -2.874  -2.463  -6.923  1.00 0.00 ? 57 SER A HG   2  
ATOM 2199  N N    . ILE A 1 58 ? -2.478  -3.949  -5.403  1.00 0.00 ? 58 ILE A N    2  
ATOM 2200  C CA   . ILE A 1 58 ? -1.383  -3.962  -4.389  1.00 0.00 ? 58 ILE A CA   2  
ATOM 2201  C C    . ILE A 1 58 ? -1.317  -5.344  -3.749  1.00 0.00 ? 58 ILE A C    2  
ATOM 2202  O O    . ILE A 1 58 ? -0.286  -5.985  -3.689  1.00 0.00 ? 58 ILE A O    2  
ATOM 2203  C CB   . ILE A 1 58 ? -1.682  -2.929  -3.282  1.00 0.00 ? 58 ILE A CB   2  
ATOM 2204  C CG1  . ILE A 1 58 ? -1.468  -1.507  -3.827  1.00 0.00 ? 58 ILE A CG1  2  
ATOM 2205  C CG2  . ILE A 1 58 ? -0.739  -3.168  -2.084  1.00 0.00 ? 58 ILE A CG2  2  
ATOM 2206  C CD1  . ILE A 1 58 ? -1.931  -0.471  -2.791  1.00 0.00 ? 58 ILE A CD1  2  
ATOM 2207  H H    . ILE A 1 58 ? -3.212  -3.307  -5.307  1.00 0.00 ? 58 ILE A H    2  
ATOM 2208  H HA   . ILE A 1 58 ? -0.427  -3.728  -4.837  1.00 0.00 ? 58 ILE A HA   2  
ATOM 2209  H HB   . ILE A 1 58 ? -2.706  -3.043  -2.957  1.00 0.00 ? 58 ILE A HB   2  
ATOM 2210  H HG12 . ILE A 1 58 ? -0.419  -1.359  -4.033  1.00 0.00 ? 58 ILE A HG12 2  
ATOM 2211  H HG13 . ILE A 1 58 ? -2.030  -1.382  -4.738  1.00 0.00 ? 58 ILE A HG13 2  
ATOM 2212  H HG21 . ILE A 1 58 ? 0.258   -3.366  -2.448  1.00 0.00 ? 58 ILE A HG21 2  
ATOM 2213  H HG22 . ILE A 1 58 ? -1.086  -4.021  -1.519  1.00 0.00 ? 58 ILE A HG22 2  
ATOM 2214  H HG23 . ILE A 1 58 ? -0.723  -2.299  -1.442  1.00 0.00 ? 58 ILE A HG23 2  
ATOM 2215  H HD11 . ILE A 1 58 ? -2.099  0.482   -3.275  1.00 0.00 ? 58 ILE A HD11 2  
ATOM 2216  H HD12 . ILE A 1 58 ? -1.168  -0.362  -2.034  1.00 0.00 ? 58 ILE A HD12 2  
ATOM 2217  H HD13 . ILE A 1 58 ? -2.850  -0.803  -2.328  1.00 0.00 ? 58 ILE A HD13 2  
ATOM 2218  N N    . LEU A 1 59 ? -2.434  -5.773  -3.247  1.00 0.00 ? 59 LEU A N    2  
ATOM 2219  C CA   . LEU A 1 59 ? -2.511  -7.083  -2.566  1.00 0.00 ? 59 LEU A CA   2  
ATOM 2220  C C    . LEU A 1 59 ? -2.160  -8.192  -3.554  1.00 0.00 ? 59 LEU A C    2  
ATOM 2221  O O    . LEU A 1 59 ? -1.768  -9.269  -3.169  1.00 0.00 ? 59 LEU A O    2  
ATOM 2222  C CB   . LEU A 1 59 ? -3.942  -7.261  -2.016  1.00 0.00 ? 59 LEU A CB   2  
ATOM 2223  C CG   . LEU A 1 59 ? -4.285  -8.740  -1.699  1.00 0.00 ? 59 LEU A CG   2  
ATOM 2224  C CD1  . LEU A 1 59 ? -3.297  -9.332  -0.671  1.00 0.00 ? 59 LEU A CD1  2  
ATOM 2225  C CD2  . LEU A 1 59 ? -5.727  -8.817  -1.125  1.00 0.00 ? 59 LEU A CD2  2  
ATOM 2226  H H    . LEU A 1 59 ? -3.231  -5.208  -3.321  1.00 0.00 ? 59 LEU A H    2  
ATOM 2227  H HA   . LEU A 1 59 ? -1.816  -7.080  -1.740  1.00 0.00 ? 59 LEU A HA   2  
ATOM 2228  H HB2  . LEU A 1 59 ? -4.043  -6.681  -1.113  1.00 0.00 ? 59 LEU A HB2  2  
ATOM 2229  H HB3  . LEU A 1 59 ? -4.644  -6.888  -2.749  1.00 0.00 ? 59 LEU A HB3  2  
ATOM 2230  H HG   . LEU A 1 59 ? -4.246  -9.319  -2.611  1.00 0.00 ? 59 LEU A HG   2  
ATOM 2231  H HD11 . LEU A 1 59 ? -3.489  -8.902  0.300   1.00 0.00 ? 59 LEU A HD11 2  
ATOM 2232  H HD12 . LEU A 1 59 ? -2.287  -9.122  -0.960  1.00 0.00 ? 59 LEU A HD12 2  
ATOM 2233  H HD13 . LEU A 1 59 ? -3.434  -10.404 -0.618  1.00 0.00 ? 59 LEU A HD13 2  
ATOM 2234  H HD21 . LEU A 1 59 ? -6.384  -9.229  -1.876  1.00 0.00 ? 59 LEU A HD21 2  
ATOM 2235  H HD22 . LEU A 1 59 ? -6.075  -7.830  -0.851  1.00 0.00 ? 59 LEU A HD22 2  
ATOM 2236  H HD23 . LEU A 1 59 ? -5.749  -9.449  -0.250  1.00 0.00 ? 59 LEU A HD23 2  
ATOM 2237  N N    . SER A 1 60 ? -2.324  -7.980  -4.833  1.00 0.00 ? 60 SER A N    2  
ATOM 2238  C CA   . SER A 1 60 ? -2.018  -9.093  -5.777  1.00 0.00 ? 60 SER A CA   2  
ATOM 2239  C C    . SER A 1 60 ? -0.501  -9.172  -5.994  1.00 0.00 ? 60 SER A C    2  
ATOM 2240  O O    . SER A 1 60 ? 0.069   -10.234 -6.152  1.00 0.00 ? 60 SER A O    2  
ATOM 2241  C CB   . SER A 1 60 ? -2.724  -8.830  -7.103  1.00 0.00 ? 60 SER A CB   2  
ATOM 2242  O OG   . SER A 1 60 ? -4.095  -9.185  -6.984  1.00 0.00 ? 60 SER A OG   2  
ATOM 2243  H H    . SER A 1 60 ? -2.664  -7.122  -5.162  1.00 0.00 ? 60 SER A H    2  
ATOM 2244  H HA   . SER A 1 60 ? -2.418  -9.979  -5.308  1.00 0.00 ? 60 SER A HA   2  
ATOM 2245  H HB2  . SER A 1 60 ? -2.648  -7.782  -7.343  1.00 0.00 ? 60 SER A HB2  2  
ATOM 2246  H HB3  . SER A 1 60 ? -2.255  -9.411  -7.886  1.00 0.00 ? 60 SER A HB3  2  
ATOM 2247  H HG   . SER A 1 60 ? -4.184  -10.111 -7.223  1.00 0.00 ? 60 SER A HG   2  
ATOM 2248  N N    . ILE A 1 61 ? 0.145   -8.034  -6.012  1.00 0.00 ? 61 ILE A N    2  
ATOM 2249  C CA   . ILE A 1 61 ? 1.621   -7.987  -6.228  1.00 0.00 ? 61 ILE A CA   2  
ATOM 2250  C C    . ILE A 1 61 ? 2.366   -8.547  -5.011  1.00 0.00 ? 61 ILE A C    2  
ATOM 2251  O O    . ILE A 1 61 ? 3.269   -9.350  -5.140  1.00 0.00 ? 61 ILE A O    2  
ATOM 2252  C CB   . ILE A 1 61 ? 2.046   -6.521  -6.430  1.00 0.00 ? 61 ILE A CB   2  
ATOM 2253  C CG1  . ILE A 1 61 ? 1.106   -5.821  -7.469  1.00 0.00 ? 61 ILE A CG1  2  
ATOM 2254  C CG2  . ILE A 1 61 ? 3.514   -6.480  -6.869  1.00 0.00 ? 61 ILE A CG2  2  
ATOM 2255  C CD1  . ILE A 1 61 ? 1.889   -5.147  -8.610  1.00 0.00 ? 61 ILE A CD1  2  
ATOM 2256  H H    . ILE A 1 61 ? -0.352  -7.197  -5.896  1.00 0.00 ? 61 ILE A H    2  
ATOM 2257  H HA   . ILE A 1 61 ? 1.878   -8.558  -7.106  1.00 0.00 ? 61 ILE A HA   2  
ATOM 2258  H HB   . ILE A 1 61 ? 1.965   -6.011  -5.477  1.00 0.00 ? 61 ILE A HB   2  
ATOM 2259  H HG12 . ILE A 1 61 ? 0.425   -6.543  -7.898  1.00 0.00 ? 61 ILE A HG12 2  
ATOM 2260  H HG13 . ILE A 1 61 ? 0.529   -5.060  -6.962  1.00 0.00 ? 61 ILE A HG13 2  
ATOM 2261  H HG21 . ILE A 1 61 ? 4.116   -7.008  -6.151  1.00 0.00 ? 61 ILE A HG21 2  
ATOM 2262  H HG22 . ILE A 1 61 ? 3.845   -5.454  -6.924  1.00 0.00 ? 61 ILE A HG22 2  
ATOM 2263  H HG23 . ILE A 1 61 ? 3.616   -6.945  -7.839  1.00 0.00 ? 61 ILE A HG23 2  
ATOM 2264  H HD11 . ILE A 1 61 ? 1.194   -4.671  -9.284  1.00 0.00 ? 61 ILE A HD11 2  
ATOM 2265  H HD12 . ILE A 1 61 ? 2.459   -5.888  -9.150  1.00 0.00 ? 61 ILE A HD12 2  
ATOM 2266  H HD13 . ILE A 1 61 ? 2.555   -4.403  -8.197  1.00 0.00 ? 61 ILE A HD13 2  
ATOM 2267  N N    . LEU A 1 62 ? 2.017   -8.104  -3.835  1.00 0.00 ? 62 LEU A N    2  
ATOM 2268  C CA   . LEU A 1 62 ? 2.728   -8.578  -2.614  1.00 0.00 ? 62 LEU A CA   2  
ATOM 2269  C C    . LEU A 1 62 ? 2.672   -10.115 -2.540  1.00 0.00 ? 62 LEU A C    2  
ATOM 2270  O O    . LEU A 1 62 ? 3.617   -10.763 -2.140  1.00 0.00 ? 62 LEU A O    2  
ATOM 2271  C CB   . LEU A 1 62 ? 2.062   -7.940  -1.373  1.00 0.00 ? 62 LEU A CB   2  
ATOM 2272  C CG   . LEU A 1 62 ? 3.079   -7.063  -0.616  1.00 0.00 ? 62 LEU A CG   2  
ATOM 2273  C CD1  . LEU A 1 62 ? 2.374   -6.292  0.515   1.00 0.00 ? 62 LEU A CD1  2  
ATOM 2274  C CD2  . LEU A 1 62 ? 4.209   -7.955  -0.042  1.00 0.00 ? 62 LEU A CD2  2  
ATOM 2275  H H    . LEU A 1 62 ? 1.303   -7.437  -3.759  1.00 0.00 ? 62 LEU A H    2  
ATOM 2276  H HA   . LEU A 1 62 ? 3.759   -8.263  -2.685  1.00 0.00 ? 62 LEU A HA   2  
ATOM 2277  H HB2  . LEU A 1 62 ? 1.237   -7.325  -1.699  1.00 0.00 ? 62 LEU A HB2  2  
ATOM 2278  H HB3  . LEU A 1 62 ? 1.689   -8.707  -0.707  1.00 0.00 ? 62 LEU A HB3  2  
ATOM 2279  H HG   . LEU A 1 62 ? 3.507   -6.351  -1.308  1.00 0.00 ? 62 LEU A HG   2  
ATOM 2280  H HD11 . LEU A 1 62 ? 2.884   -5.357  0.681   1.00 0.00 ? 62 LEU A HD11 2  
ATOM 2281  H HD12 . LEU A 1 62 ? 2.397   -6.877  1.418   1.00 0.00 ? 62 LEU A HD12 2  
ATOM 2282  H HD13 . LEU A 1 62 ? 1.345   -6.091  0.246   1.00 0.00 ? 62 LEU A HD13 2  
ATOM 2283  H HD21 . LEU A 1 62 ? 5.017   -8.016  -0.757  1.00 0.00 ? 62 LEU A HD21 2  
ATOM 2284  H HD22 . LEU A 1 62 ? 3.834   -8.949  0.157   1.00 0.00 ? 62 LEU A HD22 2  
ATOM 2285  H HD23 . LEU A 1 62 ? 4.581   -7.529  0.876   1.00 0.00 ? 62 LEU A HD23 2  
ATOM 2286  N N    . LEU A 1 63 ? 1.567   -10.689 -2.922  1.00 0.00 ? 63 LEU A N    2  
ATOM 2287  C CA   . LEU A 1 63 ? 1.426   -12.174 -2.879  1.00 0.00 ? 63 LEU A CA   2  
ATOM 2288  C C    . LEU A 1 63 ? 2.328   -12.824 -3.937  1.00 0.00 ? 63 LEU A C    2  
ATOM 2289  O O    . LEU A 1 63 ? 2.528   -14.022 -3.929  1.00 0.00 ? 63 LEU A O    2  
ATOM 2290  C CB   . LEU A 1 63 ? -0.046  -12.548 -3.123  1.00 0.00 ? 63 LEU A CB   2  
ATOM 2291  C CG   . LEU A 1 63 ? -0.867  -12.455 -1.819  1.00 0.00 ? 63 LEU A CG   2  
ATOM 2292  C CD1  . LEU A 1 63 ? -0.488  -11.213 -1.005  1.00 0.00 ? 63 LEU A CD1  2  
ATOM 2293  C CD2  . LEU A 1 63 ? -2.357  -12.397 -2.168  1.00 0.00 ? 63 LEU A CD2  2  
ATOM 2294  H H    . LEU A 1 63 ? 0.820   -10.140 -3.239  1.00 0.00 ? 63 LEU A H    2  
ATOM 2295  H HA   . LEU A 1 63 ? 1.753   -12.567 -1.930  1.00 0.00 ? 63 LEU A HA   2  
ATOM 2296  H HB2  . LEU A 1 63 ? -0.463  -11.872 -3.855  1.00 0.00 ? 63 LEU A HB2  2  
ATOM 2297  H HB3  . LEU A 1 63 ? -0.102  -13.559 -3.502  1.00 0.00 ? 63 LEU A HB3  2  
ATOM 2298  H HG   . LEU A 1 63 ? -0.683  -13.323 -1.217  1.00 0.00 ? 63 LEU A HG   2  
ATOM 2299  H HD11 . LEU A 1 63 ? 0.464   -11.369 -0.530  1.00 0.00 ? 63 LEU A HD11 2  
ATOM 2300  H HD12 . LEU A 1 63 ? -1.235  -11.043 -0.247  1.00 0.00 ? 63 LEU A HD12 2  
ATOM 2301  H HD13 . LEU A 1 63 ? -0.431  -10.357 -1.654  1.00 0.00 ? 63 LEU A HD13 2  
ATOM 2302  H HD21 . LEU A 1 63 ? -2.943  -12.590 -1.281  1.00 0.00 ? 63 LEU A HD21 2  
ATOM 2303  H HD22 . LEU A 1 63 ? -2.580  -13.145 -2.915  1.00 0.00 ? 63 LEU A HD22 2  
ATOM 2304  H HD23 . LEU A 1 63 ? -2.600  -11.419 -2.555  1.00 0.00 ? 63 LEU A HD23 2  
ATOM 2305  N N    . GLU A 1 64 ? 2.878   -12.061 -4.845  1.00 0.00 ? 64 GLU A N    2  
ATOM 2306  C CA   . GLU A 1 64 ? 3.763   -12.671 -5.886  1.00 0.00 ? 64 GLU A CA   2  
ATOM 2307  C C    . GLU A 1 64 ? 5.198   -12.717 -5.355  1.00 0.00 ? 64 GLU A C    2  
ATOM 2308  O O    . GLU A 1 64 ? 6.085   -13.192 -6.033  1.00 0.00 ? 64 GLU A O    2  
ATOM 2309  C CB   . GLU A 1 64 ? 3.702   -11.847 -7.175  1.00 0.00 ? 64 GLU A CB   2  
ATOM 2310  C CG   . GLU A 1 64 ? 2.386   -12.128 -7.903  1.00 0.00 ? 64 GLU A CG   2  
ATOM 2311  C CD   . GLU A 1 64 ? 2.409   -13.547 -8.475  1.00 0.00 ? 64 GLU A CD   2  
ATOM 2312  O OE1  . GLU A 1 64 ? 3.280   -13.826 -9.282  1.00 0.00 ? 64 GLU A OE1  2  
ATOM 2313  O OE2  . GLU A 1 64 ? 1.554   -14.330 -8.097  1.00 0.00 ? 64 GLU A OE2  2  
ATOM 2314  H H    . GLU A 1 64 ? 2.712   -11.100 -4.850  1.00 0.00 ? 64 GLU A H    2  
ATOM 2315  H HA   . GLU A 1 64 ? 3.435   -13.683 -6.080  1.00 0.00 ? 64 GLU A HA   2  
ATOM 2316  H HB2  . GLU A 1 64 ? 3.762   -10.797 -6.933  1.00 0.00 ? 64 GLU A HB2  2  
ATOM 2317  H HB3  . GLU A 1 64 ? 4.528   -12.118 -7.814  1.00 0.00 ? 64 GLU A HB3  2  
ATOM 2318  H HG2  . GLU A 1 64 ? 1.563   -12.031 -7.211  1.00 0.00 ? 64 GLU A HG2  2  
ATOM 2319  H HG3  . GLU A 1 64 ? 2.263   -11.420 -8.709  1.00 0.00 ? 64 GLU A HG3  2  
ATOM 2320  N N    . GLU A 1 65 ? 5.423   -12.251 -4.143  1.00 0.00 ? 65 GLU A N    2  
ATOM 2321  C CA   . GLU A 1 65 ? 6.806   -12.306 -3.546  1.00 0.00 ? 65 GLU A CA   2  
ATOM 2322  C C    . GLU A 1 65 ? 7.692   -11.153 -4.044  1.00 0.00 ? 65 GLU A C    2  
ATOM 2323  O O    . GLU A 1 65 ? 8.903   -11.254 -4.071  1.00 0.00 ? 65 GLU A O    2  
ATOM 2324  C CB   . GLU A 1 65 ? 7.476   -13.650 -3.945  1.00 0.00 ? 65 GLU A CB   2  
ATOM 2325  C CG   . GLU A 1 65 ? 8.406   -14.124 -2.827  1.00 0.00 ? 65 GLU A CG   2  
ATOM 2326  C CD   . GLU A 1 65 ? 9.217   -15.328 -3.308  1.00 0.00 ? 65 GLU A CD   2  
ATOM 2327  O OE1  . GLU A 1 65 ? 8.640   -16.185 -3.957  1.00 0.00 ? 65 GLU A OE1  2  
ATOM 2328  O OE2  . GLU A 1 65 ? 10.402  -15.372 -3.020  1.00 0.00 ? 65 GLU A OE2  2  
ATOM 2329  H H    . GLU A 1 65 ? 4.670   -11.882 -3.636  1.00 0.00 ? 65 GLU A H    2  
ATOM 2330  H HA   . GLU A 1 65 ? 6.753   -12.290 -2.464  1.00 0.00 ? 65 GLU A HA   2  
ATOM 2331  H HB2  . GLU A 1 65 ? 6.712   -14.397 -4.105  1.00 0.00 ? 65 GLU A HB2  2  
ATOM 2332  H HB3  . GLU A 1 65 ? 8.050   -13.527 -4.854  1.00 0.00 ? 65 GLU A HB3  2  
ATOM 2333  H HG2  . GLU A 1 65 ? 9.072   -13.321 -2.553  1.00 0.00 ? 65 GLU A HG2  2  
ATOM 2334  H HG3  . GLU A 1 65 ? 7.812   -14.408 -1.970  1.00 0.00 ? 65 GLU A HG3  2  
ATOM 2335  N N    . VAL A 1 66 ? 7.098   -10.048 -4.397  1.00 0.00 ? 66 VAL A N    2  
ATOM 2336  C CA   . VAL A 1 66 ? 7.888   -8.861  -4.846  1.00 0.00 ? 66 VAL A CA   2  
ATOM 2337  C C    . VAL A 1 66 ? 8.183   -8.008  -3.599  1.00 0.00 ? 66 VAL A C    2  
ATOM 2338  O O    . VAL A 1 66 ? 7.372   -7.917  -2.699  1.00 0.00 ? 66 VAL A O    2  
ATOM 2339  C CB   . VAL A 1 66 ? 7.036   -8.069  -5.858  1.00 0.00 ? 66 VAL A CB   2  
ATOM 2340  C CG1  . VAL A 1 66 ? 7.442   -6.591  -5.875  1.00 0.00 ? 66 VAL A CG1  2  
ATOM 2341  C CG2  . VAL A 1 66 ? 7.224   -8.659  -7.263  1.00 0.00 ? 66 VAL A CG2  2  
ATOM 2342  H H    . VAL A 1 66 ? 6.121   -9.981  -4.343  1.00 0.00 ? 66 VAL A H    2  
ATOM 2343  H HA   . VAL A 1 66 ? 8.809   -9.179  -5.318  1.00 0.00 ? 66 VAL A HA   2  
ATOM 2344  H HB   . VAL A 1 66 ? 6.000   -8.150  -5.574  1.00 0.00 ? 66 VAL A HB   2  
ATOM 2345  H HG11 . VAL A 1 66 ? 7.087   -6.124  -6.782  1.00 0.00 ? 66 VAL A HG11 2  
ATOM 2346  H HG12 . VAL A 1 66 ? 8.518   -6.517  -5.828  1.00 0.00 ? 66 VAL A HG12 2  
ATOM 2347  H HG13 . VAL A 1 66 ? 7.008   -6.090  -5.020  1.00 0.00 ? 66 VAL A HG13 2  
ATOM 2348  H HG21 . VAL A 1 66 ? 6.426   -8.320  -7.907  1.00 0.00 ? 66 VAL A HG21 2  
ATOM 2349  H HG22 . VAL A 1 66 ? 7.209   -9.737  -7.207  1.00 0.00 ? 66 VAL A HG22 2  
ATOM 2350  H HG23 . VAL A 1 66 ? 8.172   -8.335  -7.666  1.00 0.00 ? 66 VAL A HG23 2  
ATOM 2351  N N    . SER A 1 67 ? 9.333   -7.383  -3.534  1.00 0.00 ? 67 SER A N    2  
ATOM 2352  C CA   . SER A 1 67 ? 9.652   -6.546  -2.338  1.00 0.00 ? 67 SER A CA   2  
ATOM 2353  C C    . SER A 1 67 ? 8.479   -5.573  -2.085  1.00 0.00 ? 67 SER A C    2  
ATOM 2354  O O    . SER A 1 67 ? 7.817   -5.178  -3.022  1.00 0.00 ? 67 SER A O    2  
ATOM 2355  C CB   . SER A 1 67 ? 10.949  -5.757  -2.588  1.00 0.00 ? 67 SER A CB   2  
ATOM 2356  O OG   . SER A 1 67 ? 11.803  -6.518  -3.432  1.00 0.00 ? 67 SER A OG   2  
ATOM 2357  H H    . SER A 1 67 ? 9.980   -7.463  -4.267  1.00 0.00 ? 67 SER A H    2  
ATOM 2358  H HA   . SER A 1 67 ? 9.786   -7.201  -1.497  1.00 0.00 ? 67 SER A HA   2  
ATOM 2359  H HB2  . SER A 1 67 ? 10.725  -4.816  -3.067  1.00 0.00 ? 67 SER A HB2  2  
ATOM 2360  H HB3  . SER A 1 67 ? 11.441  -5.565  -1.645  1.00 0.00 ? 67 SER A HB3  2  
ATOM 2361  H HG   . SER A 1 67 ? 12.354  -5.907  -3.925  1.00 0.00 ? 67 SER A HG   2  
ATOM 2362  N N    . PRO A 1 68 ? 8.234   -5.212  -0.838  1.00 0.00 ? 68 PRO A N    2  
ATOM 2363  C CA   . PRO A 1 68 ? 7.122   -4.293  -0.512  1.00 0.00 ? 68 PRO A CA   2  
ATOM 2364  C C    . PRO A 1 68 ? 7.353   -2.892  -1.110  1.00 0.00 ? 68 PRO A C    2  
ATOM 2365  O O    . PRO A 1 68 ? 6.424   -2.216  -1.499  1.00 0.00 ? 68 PRO A O    2  
ATOM 2366  C CB   . PRO A 1 68 ? 7.123   -4.217  1.036   1.00 0.00 ? 68 PRO A CB   2  
ATOM 2367  C CG   . PRO A 1 68 ? 8.424   -4.903  1.532   1.00 0.00 ? 68 PRO A CG   2  
ATOM 2368  C CD   . PRO A 1 68 ? 9.014   -5.675  0.336   1.00 0.00 ? 68 PRO A CD   2  
ATOM 2369  H HA   . PRO A 1 68 ? 6.186   -4.706  -0.865  1.00 0.00 ? 68 PRO A HA   2  
ATOM 2370  H HB2  . PRO A 1 68 ? 7.099   -3.185  1.367   1.00 0.00 ? 68 PRO A HB2  2  
ATOM 2371  H HB3  . PRO A 1 68 ? 6.270   -4.740  1.431   1.00 0.00 ? 68 PRO A HB3  2  
ATOM 2372  H HG2  . PRO A 1 68 ? 9.127   -4.153  1.875   1.00 0.00 ? 68 PRO A HG2  2  
ATOM 2373  H HG3  . PRO A 1 68 ? 8.200   -5.589  2.338   1.00 0.00 ? 68 PRO A HG3  2  
ATOM 2374  H HD2  . PRO A 1 68 ? 10.064  -5.443  0.214   1.00 0.00 ? 68 PRO A HD2  2  
ATOM 2375  H HD3  . PRO A 1 68 ? 8.874   -6.737  0.480   1.00 0.00 ? 68 PRO A HD3  2  
ATOM 2376  N N    . GLU A 1 69 ? 8.572   -2.433  -1.139  1.00 0.00 ? 69 GLU A N    2  
ATOM 2377  C CA   . GLU A 1 69 ? 8.847   -1.058  -1.658  1.00 0.00 ? 69 GLU A CA   2  
ATOM 2378  C C    . GLU A 1 69 ? 8.804   -1.022  -3.194  1.00 0.00 ? 69 GLU A C    2  
ATOM 2379  O O    . GLU A 1 69 ? 8.631   0.029   -3.797  1.00 0.00 ? 69 GLU A O    2  
ATOM 2380  C CB   . GLU A 1 69 ? 10.229  -0.621  -1.155  1.00 0.00 ? 69 GLU A CB   2  
ATOM 2381  C CG   . GLU A 1 69 ? 10.697  0.646   -1.882  1.00 0.00 ? 69 GLU A CG   2  
ATOM 2382  C CD   . GLU A 1 69 ? 9.586   1.699   -1.861  1.00 0.00 ? 69 GLU A CD   2  
ATOM 2383  O OE1  . GLU A 1 69 ? 9.120   2.017   -0.779  1.00 0.00 ? 69 GLU A OE1  2  
ATOM 2384  O OE2  . GLU A 1 69 ? 9.220   2.167   -2.927  1.00 0.00 ? 69 GLU A OE2  2  
ATOM 2385  H H    . GLU A 1 69 ? 9.307   -2.978  -0.786  1.00 0.00 ? 69 GLU A H    2  
ATOM 2386  H HA   . GLU A 1 69 ? 8.102   -0.379  -1.270  1.00 0.00 ? 69 GLU A HA   2  
ATOM 2387  H HB2  . GLU A 1 69 ? 10.169  -0.422  -0.095  1.00 0.00 ? 69 GLU A HB2  2  
ATOM 2388  H HB3  . GLU A 1 69 ? 10.938  -1.415  -1.329  1.00 0.00 ? 69 GLU A HB3  2  
ATOM 2389  H HG2  . GLU A 1 69 ? 11.573  1.038   -1.385  1.00 0.00 ? 69 GLU A HG2  2  
ATOM 2390  H HG3  . GLU A 1 69 ? 10.945  0.404   -2.905  1.00 0.00 ? 69 GLU A HG3  2  
ATOM 2391  N N    . LEU A 1 70 ? 8.927   -2.143  -3.845  1.00 0.00 ? 70 LEU A N    2  
ATOM 2392  C CA   . LEU A 1 70 ? 8.863   -2.098  -5.331  1.00 0.00 ? 70 LEU A CA   2  
ATOM 2393  C C    . LEU A 1 70 ? 7.415   -1.812  -5.722  1.00 0.00 ? 70 LEU A C    2  
ATOM 2394  O O    . LEU A 1 70 ? 7.119   -1.487  -6.850  1.00 0.00 ? 70 LEU A O    2  
ATOM 2395  C CB   . LEU A 1 70 ? 9.334   -3.418  -5.963  1.00 0.00 ? 70 LEU A CB   2  
ATOM 2396  C CG   . LEU A 1 70 ? 10.868  -3.539  -5.883  1.00 0.00 ? 70 LEU A CG   2  
ATOM 2397  C CD1  . LEU A 1 70 ? 11.292  -5.012  -5.971  1.00 0.00 ? 70 LEU A CD1  2  
ATOM 2398  C CD2  . LEU A 1 70 ? 11.536  -2.780  -7.035  1.00 0.00 ? 70 LEU A CD2  2  
ATOM 2399  H H    . LEU A 1 70 ? 9.021   -2.984  -3.350  1.00 0.00 ? 70 LEU A H    2  
ATOM 2400  H HA   . LEU A 1 70 ? 9.478   -1.281  -5.665  1.00 0.00 ? 70 LEU A HA   2  
ATOM 2401  H HB2  . LEU A 1 70 ? 8.878   -4.237  -5.434  1.00 0.00 ? 70 LEU A HB2  2  
ATOM 2402  H HB3  . LEU A 1 70 ? 9.028   -3.448  -6.994  1.00 0.00 ? 70 LEU A HB3  2  
ATOM 2403  H HG   . LEU A 1 70 ? 11.200  -3.127  -4.954  1.00 0.00 ? 70 LEU A HG   2  
ATOM 2404  H HD11 . LEU A 1 70 ? 10.705  -5.605  -5.289  1.00 0.00 ? 70 LEU A HD11 2  
ATOM 2405  H HD12 . LEU A 1 70 ? 12.336  -5.101  -5.714  1.00 0.00 ? 70 LEU A HD12 2  
ATOM 2406  H HD13 . LEU A 1 70 ? 11.139  -5.369  -6.979  1.00 0.00 ? 70 LEU A HD13 2  
ATOM 2407  H HD21 . LEU A 1 70 ? 12.601  -2.953  -7.004  1.00 0.00 ? 70 LEU A HD21 2  
ATOM 2408  H HD22 . LEU A 1 70 ? 11.345  -1.724  -6.937  1.00 0.00 ? 70 LEU A HD22 2  
ATOM 2409  H HD23 . LEU A 1 70 ? 11.145  -3.134  -7.974  1.00 0.00 ? 70 LEU A HD23 2  
ATOM 2410  N N    . VAL A 1 71 ? 6.505   -1.961  -4.789  1.00 0.00 ? 71 VAL A N    2  
ATOM 2411  C CA   . VAL A 1 71 ? 5.069   -1.733  -5.109  1.00 0.00 ? 71 VAL A CA   2  
ATOM 2412  C C    . VAL A 1 71 ? 4.825   -0.265  -5.463  1.00 0.00 ? 71 VAL A C    2  
ATOM 2413  O O    . VAL A 1 71 ? 4.305   0.034   -6.513  1.00 0.00 ? 71 VAL A O    2  
ATOM 2414  C CB   . VAL A 1 71 ? 4.188   -2.161  -3.910  1.00 0.00 ? 71 VAL A CB   2  
ATOM 2415  C CG1  . VAL A 1 71 ? 2.800   -1.473  -3.943  1.00 0.00 ? 71 VAL A CG1  2  
ATOM 2416  C CG2  . VAL A 1 71 ? 4.006   -3.682  -3.925  1.00 0.00 ? 71 VAL A CG2  2  
ATOM 2417  H H    . VAL A 1 71 ? 6.772   -2.252  -3.892  1.00 0.00 ? 71 VAL A H    2  
ATOM 2418  H HA   . VAL A 1 71 ? 4.837   -2.313  -5.987  1.00 0.00 ? 71 VAL A HA   2  
ATOM 2419  H HB   . VAL A 1 71 ? 4.688   -1.880  -3.000  1.00 0.00 ? 71 VAL A HB   2  
ATOM 2420  H HG11 . VAL A 1 71 ? 2.108   -2.021  -3.319  1.00 0.00 ? 71 VAL A HG11 2  
ATOM 2421  H HG12 . VAL A 1 71 ? 2.431   -1.450  -4.956  1.00 0.00 ? 71 VAL A HG12 2  
ATOM 2422  H HG13 . VAL A 1 71 ? 2.881   -0.458  -3.569  1.00 0.00 ? 71 VAL A HG13 2  
ATOM 2423  H HG21 . VAL A 1 71 ? 4.955   -4.159  -3.721  1.00 0.00 ? 71 VAL A HG21 2  
ATOM 2424  H HG22 . VAL A 1 71 ? 3.643   -3.996  -4.892  1.00 0.00 ? 71 VAL A HG22 2  
ATOM 2425  H HG23 . VAL A 1 71 ? 3.293   -3.964  -3.164  1.00 0.00 ? 71 VAL A HG23 2  
ATOM 2426  N N    . CYS A 1 72 ? 5.152   0.662   -4.612  1.00 0.00 ? 72 CYS A N    2  
ATOM 2427  C CA   . CYS A 1 72 ? 4.854   2.072   -4.973  1.00 0.00 ? 72 CYS A CA   2  
ATOM 2428  C C    . CYS A 1 72 ? 5.675   2.482   -6.204  1.00 0.00 ? 72 CYS A C    2  
ATOM 2429  O O    . CYS A 1 72 ? 5.281   3.340   -6.969  1.00 0.00 ? 72 CYS A O    2  
ATOM 2430  C CB   . CYS A 1 72 ? 5.182   2.988   -3.787  1.00 0.00 ? 72 CYS A CB   2  
ATOM 2431  S SG   . CYS A 1 72 ? 4.330   2.407   -2.305  1.00 0.00 ? 72 CYS A SG   2  
ATOM 2432  H H    . CYS A 1 72 ? 5.549   0.442   -3.743  1.00 0.00 ? 72 CYS A H    2  
ATOM 2433  H HA   . CYS A 1 72 ? 3.794   2.113   -5.192  1.00 0.00 ? 72 CYS A HA   2  
ATOM 2434  H HB2  . CYS A 1 72 ? 6.245   2.989   -3.606  1.00 0.00 ? 72 CYS A HB2  2  
ATOM 2435  H HB3  . CYS A 1 72 ? 4.858   3.987   -4.008  1.00 0.00 ? 72 CYS A HB3  2  
ATOM 2436  N N    . SER A 1 73 ? 6.811   1.856   -6.407  1.00 0.00 ? 73 SER A N    2  
ATOM 2437  C CA   . SER A 1 73 ? 7.646   2.198   -7.602  1.00 0.00 ? 73 SER A CA   2  
ATOM 2438  C C    . SER A 1 73 ? 7.078   1.539   -8.877  1.00 0.00 ? 73 SER A C    2  
ATOM 2439  O O    . SER A 1 73 ? 7.043   2.149   -9.928  1.00 0.00 ? 73 SER A O    2  
ATOM 2440  C CB   . SER A 1 73 ? 9.077   1.725   -7.379  1.00 0.00 ? 73 SER A CB   2  
ATOM 2441  O OG   . SER A 1 73 ? 9.478   2.039   -6.052  1.00 0.00 ? 73 SER A OG   2  
ATOM 2442  H H    . SER A 1 73 ? 7.106   1.165   -5.760  1.00 0.00 ? 73 SER A H    2  
ATOM 2443  H HA   . SER A 1 73 ? 7.635   3.265   -7.749  1.00 0.00 ? 73 SER A HA   2  
ATOM 2444  H HB2  . SER A 1 73 ? 9.127   0.661   -7.523  1.00 0.00 ? 73 SER A HB2  2  
ATOM 2445  H HB3  . SER A 1 73 ? 9.732   2.213   -8.090  1.00 0.00 ? 73 SER A HB3  2  
ATOM 2446  H HG   . SER A 1 73 ? 10.375  1.720   -5.928  1.00 0.00 ? 73 SER A HG   2  
ATOM 2447  N N    . MET A 1 74 ? 6.644   0.307   -8.805  1.00 0.00 ? 74 MET A N    2  
ATOM 2448  C CA   . MET A 1 74 ? 6.092   -0.372  -10.026 1.00 0.00 ? 74 MET A CA   2  
ATOM 2449  C C    . MET A 1 74 ? 4.714   0.215   -10.399 1.00 0.00 ? 74 MET A C    2  
ATOM 2450  O O    . MET A 1 74 ? 4.418   0.409   -11.560 1.00 0.00 ? 74 MET A O    2  
ATOM 2451  C CB   . MET A 1 74 ? 5.959   -1.891  -9.749  1.00 0.00 ? 74 MET A CB   2  
ATOM 2452  C CG   . MET A 1 74 ? 7.212   -2.665  -10.220 1.00 0.00 ? 74 MET A CG   2  
ATOM 2453  S SD   . MET A 1 74 ? 7.536   -4.073  -9.120  1.00 0.00 ? 74 MET A SD   2  
ATOM 2454  C CE   . MET A 1 74 ? 5.837   -4.660  -8.916  1.00 0.00 ? 74 MET A CE   2  
ATOM 2455  H H    . MET A 1 74 ? 6.682   -0.177  -7.954  1.00 0.00 ? 74 MET A H    2  
ATOM 2456  H HA   . MET A 1 74 ? 6.751   -0.229  -10.870 1.00 0.00 ? 74 MET A HA   2  
ATOM 2457  H HB2  . MET A 1 74 ? 5.837   -2.039  -8.693  1.00 0.00 ? 74 MET A HB2  2  
ATOM 2458  H HB3  . MET A 1 74 ? 5.091   -2.276  -10.267 1.00 0.00 ? 74 MET A HB3  2  
ATOM 2459  H HG2  . MET A 1 74 ? 7.056   -3.032  -11.223 1.00 0.00 ? 74 MET A HG2  2  
ATOM 2460  H HG3  . MET A 1 74 ? 8.071   -2.014  -10.213 1.00 0.00 ? 74 MET A HG3  2  
ATOM 2461  H HE1  . MET A 1 74 ? 5.849   -5.720  -8.719  1.00 0.00 ? 74 MET A HE1  2  
ATOM 2462  H HE2  . MET A 1 74 ? 5.275   -4.475  -9.813  1.00 0.00 ? 74 MET A HE2  2  
ATOM 2463  H HE3  . MET A 1 74 ? 5.376   -4.143  -8.087  1.00 0.00 ? 74 MET A HE3  2  
ATOM 2464  N N    . LEU A 1 75 ? 3.865   0.486   -9.442  1.00 0.00 ? 75 LEU A N    2  
ATOM 2465  C CA   . LEU A 1 75 ? 2.517   1.038   -9.790  1.00 0.00 ? 75 LEU A CA   2  
ATOM 2466  C C    . LEU A 1 75 ? 2.639   2.504   -10.240 1.00 0.00 ? 75 LEU A C    2  
ATOM 2467  O O    . LEU A 1 75 ? 1.672   3.237   -10.241 1.00 0.00 ? 75 LEU A O    2  
ATOM 2468  C CB   . LEU A 1 75 ? 1.580   0.943   -8.573  1.00 0.00 ? 75 LEU A CB   2  
ATOM 2469  C CG   . LEU A 1 75 ? 1.525   -0.503  -8.036  1.00 0.00 ? 75 LEU A CG   2  
ATOM 2470  C CD1  . LEU A 1 75 ? 0.398   -0.628  -7.009  1.00 0.00 ? 75 LEU A CD1  2  
ATOM 2471  C CD2  . LEU A 1 75 ? 1.277   -1.498  -9.178  1.00 0.00 ? 75 LEU A CD2  2  
ATOM 2472  H H    . LEU A 1 75 ? 4.105   0.313   -8.508  1.00 0.00 ? 75 LEU A H    2  
ATOM 2473  H HA   . LEU A 1 75 ? 2.096   0.466   -10.601 1.00 0.00 ? 75 LEU A HA   2  
ATOM 2474  H HB2  . LEU A 1 75 ? 1.939   1.602   -7.794  1.00 0.00 ? 75 LEU A HB2  2  
ATOM 2475  H HB3  . LEU A 1 75 ? 0.588   1.247   -8.868  1.00 0.00 ? 75 LEU A HB3  2  
ATOM 2476  H HG   . LEU A 1 75 ? 2.455   -0.739  -7.557  1.00 0.00 ? 75 LEU A HG   2  
ATOM 2477  H HD11 . LEU A 1 75 ? 0.260   -1.670  -6.755  1.00 0.00 ? 75 LEU A HD11 2  
ATOM 2478  H HD12 . LEU A 1 75 ? -0.515  -0.236  -7.427  1.00 0.00 ? 75 LEU A HD12 2  
ATOM 2479  H HD13 . LEU A 1 75 ? 0.658   -0.075  -6.120  1.00 0.00 ? 75 LEU A HD13 2  
ATOM 2480  H HD21 . LEU A 1 75 ? 0.913   -2.431  -8.773  1.00 0.00 ? 75 LEU A HD21 2  
ATOM 2481  H HD22 . LEU A 1 75 ? 2.203   -1.680  -9.707  1.00 0.00 ? 75 LEU A HD22 2  
ATOM 2482  H HD23 . LEU A 1 75 ? 0.544   -1.094  -9.860  1.00 0.00 ? 75 LEU A HD23 2  
ATOM 2483  N N    . HIS A 1 76 ? 3.820   2.932   -10.603 1.00 0.00 ? 76 HIS A N    2  
ATOM 2484  C CA   . HIS A 1 76 ? 4.017   4.353   -11.046 1.00 0.00 ? 76 HIS A CA   2  
ATOM 2485  C C    . HIS A 1 76 ? 3.308   5.299   -10.068 1.00 0.00 ? 76 HIS A C    2  
ATOM 2486  O O    . HIS A 1 76 ? 3.050   6.442   -10.388 1.00 0.00 ? 76 HIS A O    2  
ATOM 2487  C CB   . HIS A 1 76 ? 3.475   4.548   -12.470 1.00 0.00 ? 76 HIS A CB   2  
ATOM 2488  C CG   . HIS A 1 76 ? 1.973   4.491   -12.470 1.00 0.00 ? 76 HIS A CG   2  
ATOM 2489  N ND1  . HIS A 1 76 ? 1.192   5.544   -12.023 1.00 0.00 ? 76 HIS A ND1  2  
ATOM 2490  C CD2  . HIS A 1 76 ? 1.093   3.510   -12.860 1.00 0.00 ? 76 HIS A CD2  2  
ATOM 2491  C CE1  . HIS A 1 76 ? -0.096  5.177   -12.152 1.00 0.00 ? 76 HIS A CE1  2  
ATOM 2492  N NE2  . HIS A 1 76 ? -0.212  3.946   -12.658 1.00 0.00 ? 76 HIS A NE2  2  
ATOM 2493  H H    . HIS A 1 76 ? 4.585   2.320   -10.560 1.00 0.00 ? 76 HIS A H    2  
ATOM 2494  H HA   . HIS A 1 76 ? 5.074   4.573   -11.037 1.00 0.00 ? 76 HIS A HA   2  
ATOM 2495  H HB2  . HIS A 1 76 ? 3.795   5.509   -12.845 1.00 0.00 ? 76 HIS A HB2  2  
ATOM 2496  H HB3  . HIS A 1 76 ? 3.864   3.768   -13.109 1.00 0.00 ? 76 HIS A HB3  2  
ATOM 2497  H HD1  . HIS A 1 76 ? 1.519   6.400   -11.676 1.00 0.00 ? 76 HIS A HD1  2  
ATOM 2498  H HD2  . HIS A 1 76 ? 1.373   2.548   -13.262 1.00 0.00 ? 76 HIS A HD2  2  
ATOM 2499  H HE1  . HIS A 1 76 ? -0.934  5.802   -11.881 1.00 0.00 ? 76 HIS A HE1  2  
ATOM 2500  N N    . LEU A 1 77 ? 2.988   4.852   -8.890  1.00 0.00 ? 77 LEU A N    2  
ATOM 2501  C CA   . LEU A 1 77 ? 2.297   5.748   -7.920  1.00 0.00 ? 77 LEU A CA   2  
ATOM 2502  C C    . LEU A 1 77 ? 3.342   6.671   -7.272  1.00 0.00 ? 77 LEU A C    2  
ATOM 2503  O O    . LEU A 1 77 ? 3.004   7.659   -6.650  1.00 0.00 ? 77 LEU A O    2  
ATOM 2504  C CB   . LEU A 1 77 ? 1.560   4.869   -6.871  1.00 0.00 ? 77 LEU A CB   2  
ATOM 2505  C CG   . LEU A 1 77 ? 0.043   5.154   -6.861  1.00 0.00 ? 77 LEU A CG   2  
ATOM 2506  C CD1  . LEU A 1 77 ? -0.563  5.082   -8.287  1.00 0.00 ? 77 LEU A CD1  2  
ATOM 2507  C CD2  . LEU A 1 77 ? -0.660  4.145   -5.939  1.00 0.00 ? 77 LEU A CD2  2  
ATOM 2508  H H    . LEU A 1 77 ? 3.201   3.937   -8.641  1.00 0.00 ? 77 LEU A H    2  
ATOM 2509  H HA   . LEU A 1 77 ? 1.591   6.372   -8.444  1.00 0.00 ? 77 LEU A HA   2  
ATOM 2510  H HB2  . LEU A 1 77 ? 1.715   3.831   -7.111  1.00 0.00 ? 77 LEU A HB2  2  
ATOM 2511  H HB3  . LEU A 1 77 ? 1.953   5.065   -5.886  1.00 0.00 ? 77 LEU A HB3  2  
ATOM 2512  H HG   . LEU A 1 77 ? -0.105  6.136   -6.472  1.00 0.00 ? 77 LEU A HG   2  
ATOM 2513  H HD11 . LEU A 1 77 ? -1.514  4.566   -8.268  1.00 0.00 ? 77 LEU A HD11 2  
ATOM 2514  H HD12 . LEU A 1 77 ? 0.111   4.562   -8.951  1.00 0.00 ? 77 LEU A HD12 2  
ATOM 2515  H HD13 . LEU A 1 77 ? -0.716  6.085   -8.656  1.00 0.00 ? 77 LEU A HD13 2  
ATOM 2516  H HD21 . LEU A 1 77 ? -0.079  4.010   -5.041  1.00 0.00 ? 77 LEU A HD21 2  
ATOM 2517  H HD22 . LEU A 1 77 ? -0.763  3.203   -6.448  1.00 0.00 ? 77 LEU A HD22 2  
ATOM 2518  H HD23 . LEU A 1 77 ? -1.639  4.516   -5.680  1.00 0.00 ? 77 LEU A HD23 2  
ATOM 2519  N N    . CYS A 1 78 ? 4.608   6.370   -7.440  1.00 0.00 ? 78 CYS A N    2  
ATOM 2520  C CA   . CYS A 1 78 ? 5.693   7.239   -6.870  1.00 0.00 ? 78 CYS A CA   2  
ATOM 2521  C C    . CYS A 1 78 ? 6.693   7.549   -7.988  1.00 0.00 ? 78 CYS A C    2  
ATOM 2522  O O    . CYS A 1 78 ? 7.274   8.613   -8.059  1.00 0.00 ? 78 CYS A O    2  
ATOM 2523  C CB   . CYS A 1 78 ? 6.423   6.500   -5.753  1.00 0.00 ? 78 CYS A CB   2  
ATOM 2524  S SG   . CYS A 1 78 ? 5.426   6.564   -4.254  1.00 0.00 ? 78 CYS A SG   2  
ATOM 2525  H H    . CYS A 1 78 ? 4.851   5.575   -7.959  1.00 0.00 ? 78 CYS A H    2  
ATOM 2526  H HA   . CYS A 1 78 ? 5.271   8.162   -6.488  1.00 0.00 ? 78 CYS A HA   2  
ATOM 2527  H HB2  . CYS A 1 78 ? 6.578   5.476   -6.042  1.00 0.00 ? 78 CYS A HB2  2  
ATOM 2528  H HB3  . CYS A 1 78 ? 7.378   6.972   -5.567  1.00 0.00 ? 78 CYS A HB3  2  
ATOM 2529  N N    . SER A 1 79 ? 6.874   6.598   -8.862  1.00 0.00 ? 79 SER A N    2  
ATOM 2530  C CA   . SER A 1 79 ? 7.810   6.749   -10.012 1.00 0.00 ? 79 SER A CA   2  
ATOM 2531  C C    . SER A 1 79 ? 9.258   6.794   -9.516  1.00 0.00 ? 79 SER A C    2  
ATOM 2532  O O    . SER A 1 79 ? 10.191  6.838   -10.295 1.00 0.00 ? 79 SER A O    2  
ATOM 2533  C CB   . SER A 1 79 ? 7.478   8.010   -10.811 1.00 0.00 ? 79 SER A CB   2  
ATOM 2534  O OG   . SER A 1 79 ? 8.016   7.890   -12.122 1.00 0.00 ? 79 SER A OG   2  
ATOM 2535  H H    . SER A 1 79 ? 6.376   5.760   -8.761  1.00 0.00 ? 79 SER A H    2  
ATOM 2536  H HA   . SER A 1 79 ? 7.690   5.875   -10.635 1.00 0.00 ? 79 SER A HA   2  
ATOM 2537  H HB2  . SER A 1 79 ? 6.409   8.125   -10.875 1.00 0.00 ? 79 SER A HB2  2  
ATOM 2538  H HB3  . SER A 1 79 ? 7.902   8.873   -10.314 1.00 0.00 ? 79 SER A HB3  2  
ATOM 2539  H HG   . SER A 1 79 ? 8.943   7.653   -12.042 1.00 0.00 ? 79 SER A HG   2  
ATOM 2540  N N    . GLY A 1 80 ? 9.455   6.790   -8.223  1.00 0.00 ? 80 GLY A N    2  
ATOM 2541  C CA   . GLY A 1 80 ? 10.842  6.837   -7.668  1.00 0.00 ? 80 GLY A CA   2  
ATOM 2542  C C    . GLY A 1 80 ? 11.225  8.291   -7.374  1.00 0.00 ? 80 GLY A C    2  
ATOM 2543  O O    . GLY A 1 80 ? 10.418  9.066   -6.905  1.00 0.00 ? 80 GLY A O    2  
ATOM 2544  H H    . GLY A 1 80 ? 8.687   6.757   -7.614  1.00 0.00 ? 80 GLY A H    2  
ATOM 2545  H HA2  . GLY A 1 80 ? 10.881  6.264   -6.753  1.00 0.00 ? 80 GLY A HA2  2  
ATOM 2546  H HA3  . GLY A 1 80 ? 11.539  6.423   -8.382  1.00 0.00 ? 80 GLY A HA3  2  
ATOM 2547  N N    . LEU A 1 81 ? 12.455  8.656   -7.639  1.00 0.00 ? 81 LEU A N    2  
ATOM 2548  C CA   . LEU A 1 81 ? 12.923  10.054  -7.375  1.00 0.00 ? 81 LEU A CA   2  
ATOM 2549  C C    . LEU A 1 81 ? 12.910  10.329  -5.866  1.00 0.00 ? 81 LEU A C    2  
ATOM 2550  O O    . LEU A 1 81 ? 13.352  11.362  -5.403  1.00 0.00 ? 81 LEU A O    2  
ATOM 2551  C CB   . LEU A 1 81 ? 12.002  11.067  -8.080  1.00 0.00 ? 81 LEU A CB   2  
ATOM 2552  C CG   . LEU A 1 81 ? 11.715  10.613  -9.518  1.00 0.00 ? 81 LEU A CG   2  
ATOM 2553  C CD1  . LEU A 1 81 ? 10.985  11.731  -10.264 1.00 0.00 ? 81 LEU A CD1  2  
ATOM 2554  C CD2  . LEU A 1 81 ? 13.034  10.297  -10.234 1.00 0.00 ? 81 LEU A CD2  2  
ATOM 2555  H H    . LEU A 1 81 ? 13.084  7.999   -8.005  1.00 0.00 ? 81 LEU A H    2  
ATOM 2556  H HA   . LEU A 1 81 ? 13.918  10.163  -7.784  1.00 0.00 ? 81 LEU A HA   2  
ATOM 2557  H HB2  . LEU A 1 81 ? 11.076  11.160  -7.538  1.00 0.00 ? 81 LEU A HB2  2  
ATOM 2558  H HB3  . LEU A 1 81 ? 12.493  12.028  -8.108  1.00 0.00 ? 81 LEU A HB3  2  
ATOM 2559  H HG   . LEU A 1 81 ? 11.090  9.732   -9.503  1.00 0.00 ? 81 LEU A HG   2  
ATOM 2560  H HD11 . LEU A 1 81 ? 11.535  12.655  -10.155 1.00 0.00 ? 81 LEU A HD11 2  
ATOM 2561  H HD12 . LEU A 1 81 ? 9.995   11.852  -9.852  1.00 0.00 ? 81 LEU A HD12 2  
ATOM 2562  H HD13 . LEU A 1 81 ? 10.912  11.478  -11.311 1.00 0.00 ? 81 LEU A HD13 2  
ATOM 2563  H HD21 . LEU A 1 81 ? 13.396  9.331   -9.912  1.00 0.00 ? 81 LEU A HD21 2  
ATOM 2564  H HD22 . LEU A 1 81 ? 13.766  11.054  -9.994  1.00 0.00 ? 81 LEU A HD22 2  
ATOM 2565  H HD23 . LEU A 1 81 ? 12.870  10.280  -11.303 1.00 0.00 ? 81 LEU A HD23 2  
ATOM 2566  N N    . VAL A 1 82 ? 12.370  9.408   -5.104  1.00 0.00 ? 82 VAL A N    2  
ATOM 2567  C CA   . VAL A 1 82 ? 12.275  9.594   -3.619  1.00 0.00 ? 82 VAL A CA   2  
ATOM 2568  C C    . VAL A 1 82 ? 13.381  8.780   -2.893  1.00 0.00 ? 82 VAL A C    2  
ATOM 2569  O O    . VAL A 1 82 ? 13.433  7.578   -3.053  1.00 0.00 ? 82 VAL A O    2  
ATOM 2570  C CB   . VAL A 1 82 ? 10.895  9.105   -3.131  1.00 0.00 ? 82 VAL A CB   2  
ATOM 2571  C CG1  . VAL A 1 82 ? 9.824   10.146  -3.471  1.00 0.00 ? 82 VAL A CG1  2  
ATOM 2572  C CG2  . VAL A 1 82 ? 10.527  7.776   -3.804  1.00 0.00 ? 82 VAL A CG2  2  
ATOM 2573  H H    . VAL A 1 82 ? 12.012  8.608   -5.534  1.00 0.00 ? 82 VAL A H    2  
ATOM 2574  H HA   . VAL A 1 82 ? 12.361  10.641  -3.397  1.00 0.00 ? 82 VAL A HA   2  
ATOM 2575  H HB   . VAL A 1 82 ? 10.925  8.968   -2.059  1.00 0.00 ? 82 VAL A HB   2  
ATOM 2576  H HG11 . VAL A 1 82 ? 8.872   9.825   -3.076  1.00 0.00 ? 82 VAL A HG11 2  
ATOM 2577  H HG12 . VAL A 1 82 ? 9.751   10.250  -4.544  1.00 0.00 ? 82 VAL A HG12 2  
ATOM 2578  H HG13 . VAL A 1 82 ? 10.093  11.097  -3.035  1.00 0.00 ? 82 VAL A HG13 2  
ATOM 2579  H HG21 . VAL A 1 82 ? 11.242  7.017   -3.530  1.00 0.00 ? 82 VAL A HG21 2  
ATOM 2580  H HG22 . VAL A 1 82 ? 10.524  7.897   -4.875  1.00 0.00 ? 82 VAL A HG22 2  
ATOM 2581  H HG23 . VAL A 1 82 ? 9.542   7.473   -3.478  1.00 0.00 ? 82 VAL A HG23 2  
ATOM 2582  N N    . PRO A 1 83 ? 14.227  9.420   -2.087  1.00 0.00 ? 83 PRO A N    2  
ATOM 2583  C CA   . PRO A 1 83 ? 15.269  8.673   -1.347  1.00 0.00 ? 83 PRO A CA   2  
ATOM 2584  C C    . PRO A 1 83 ? 14.563  7.726   -0.358  1.00 0.00 ? 83 PRO A C    2  
ATOM 2585  O O    . PRO A 1 83 ? 13.481  8.019   0.109   1.00 0.00 ? 83 PRO A O    2  
ATOM 2586  C CB   . PRO A 1 83 ? 16.095  9.764   -0.609  1.00 0.00 ? 83 PRO A CB   2  
ATOM 2587  C CG   . PRO A 1 83 ? 15.412  11.134  -0.881  1.00 0.00 ? 83 PRO A CG   2  
ATOM 2588  C CD   . PRO A 1 83 ? 14.236  10.886  -1.850  1.00 0.00 ? 83 PRO A CD   2  
ATOM 2589  H HA   . PRO A 1 83 ? 15.895  8.116   -2.028  1.00 0.00 ? 83 PRO A HA   2  
ATOM 2590  H HB2  . PRO A 1 83 ? 16.118  9.572   0.458   1.00 0.00 ? 83 PRO A HB2  2  
ATOM 2591  H HB3  . PRO A 1 83 ? 17.106  9.786   -0.995  1.00 0.00 ? 83 PRO A HB3  2  
ATOM 2592  H HG2  . PRO A 1 83 ? 15.045  11.554  0.050   1.00 0.00 ? 83 PRO A HG2  2  
ATOM 2593  H HG3  . PRO A 1 83 ? 16.119  11.820  -1.332  1.00 0.00 ? 83 PRO A HG3  2  
ATOM 2594  H HD2  . PRO A 1 83 ? 13.304  11.201  -1.395  1.00 0.00 ? 83 PRO A HD2  2  
ATOM 2595  H HD3  . PRO A 1 83 ? 14.401  11.411  -2.780  1.00 0.00 ? 83 PRO A HD3  2  
ATOM 2596  N N    . ARG A 1 84 ? 15.147  6.597   -0.030  1.00 0.00 ? 84 ARG A N    2  
ATOM 2597  C CA   . ARG A 1 84 ? 14.469  5.676   0.925   1.00 0.00 ? 84 ARG A CA   2  
ATOM 2598  C C    . ARG A 1 84 ? 14.657  6.192   2.352   1.00 0.00 ? 84 ARG A C    2  
ATOM 2599  O O    . ARG A 1 84 ? 13.964  5.708   3.232   1.00 0.00 ? 84 ARG A O    2  
ATOM 2600  C CB   . ARG A 1 84 ? 15.081  4.278   0.803   1.00 0.00 ? 84 ARG A CB   2  
ATOM 2601  C CG   . ARG A 1 84 ? 15.046  3.831   -0.660  1.00 0.00 ? 84 ARG A CG   2  
ATOM 2602  C CD   . ARG A 1 84 ? 15.776  2.494   -0.804  1.00 0.00 ? 84 ARG A CD   2  
ATOM 2603  N NE   . ARG A 1 84 ? 15.532  1.939   -2.165  1.00 0.00 ? 84 ARG A NE   2  
ATOM 2604  C CZ   . ARG A 1 84 ? 16.281  0.972   -2.619  1.00 0.00 ? 84 ARG A CZ   2  
ATOM 2605  N NH1  . ARG A 1 84 ? 17.243  0.491   -1.882  1.00 0.00 ? 84 ARG A NH1  2  
ATOM 2606  N NH2  . ARG A 1 84 ? 16.067  0.487   -3.811  1.00 0.00 ? 84 ARG A NH2  2  
ATOM 2607  O OXT  . ARG A 1 84 ? 15.490  7.064   2.542   1.00 0.00 ? 84 ARG A OXT  2  
ATOM 2608  H H    . ARG A 1 84 ? 16.026  6.352   -0.392  1.00 0.00 ? 84 ARG A H    2  
ATOM 2609  H HA   . ARG A 1 84 ? 13.415  5.628   0.694   1.00 0.00 ? 84 ARG A HA   2  
ATOM 2610  H HB2  . ARG A 1 84 ? 16.104  4.302   1.148   1.00 0.00 ? 84 ARG A HB2  2  
ATOM 2611  H HB3  . ARG A 1 84 ? 14.513  3.583   1.404   1.00 0.00 ? 84 ARG A HB3  2  
ATOM 2612  H HG2  . ARG A 1 84 ? 14.019  3.717   -0.977  1.00 0.00 ? 84 ARG A HG2  2  
ATOM 2613  H HG3  . ARG A 1 84 ? 15.532  4.572   -1.276  1.00 0.00 ? 84 ARG A HG3  2  
ATOM 2614  H HD2  . ARG A 1 84 ? 16.835  2.645   -0.660  1.00 0.00 ? 84 ARG A HD2  2  
ATOM 2615  H HD3  . ARG A 1 84 ? 15.407  1.801   -0.061  1.00 0.00 ? 84 ARG A HD3  2  
ATOM 2616  H HE   . ARG A 1 84 ? 14.809  2.302   -2.719  1.00 0.00 ? 84 ARG A HE   2  
ATOM 2617  H HH11 . ARG A 1 84 ? 17.407  0.862   -0.968  1.00 0.00 ? 84 ARG A HH11 2  
ATOM 2618  H HH12 . ARG A 1 84 ? 17.817  -0.252  -2.230  1.00 0.00 ? 84 ARG A HH12 2  
ATOM 2619  H HH21 . ARG A 1 84 ? 15.330  0.856   -4.377  1.00 0.00 ? 84 ARG A HH21 2  
ATOM 2620  H HH22 . ARG A 1 84 ? 16.641  -0.254  -4.159  1.00 0.00 ? 84 ARG A HH22 2  
ATOM 2621  N N    . SER A 1 1  ? 6.457   16.522  -1.469  1.00 0.00 ? 1  SER A N    3  
ATOM 2622  C CA   . SER A 1 1  ? 5.389   16.376  -0.442  1.00 0.00 ? 1  SER A CA   3  
ATOM 2623  C C    . SER A 1 1  ? 4.229   15.565  -1.023  1.00 0.00 ? 1  SER A C    3  
ATOM 2624  O O    . SER A 1 1  ? 3.074   15.814  -0.739  1.00 0.00 ? 1  SER A O    3  
ATOM 2625  C CB   . SER A 1 1  ? 4.884   17.760  -0.032  1.00 0.00 ? 1  SER A CB   3  
ATOM 2626  O OG   . SER A 1 1  ? 4.198   18.353  -1.126  1.00 0.00 ? 1  SER A OG   3  
ATOM 2627  H H1   . SER A 1 1  ? 6.632   17.531  -1.648  1.00 0.00 ? 1  SER A H1   3  
ATOM 2628  H H2   . SER A 1 1  ? 6.154   16.060  -2.352  1.00 0.00 ? 1  SER A H2   3  
ATOM 2629  H H3   . SER A 1 1  ? 7.331   16.077  -1.126  1.00 0.00 ? 1  SER A H3   3  
ATOM 2630  H HA   . SER A 1 1  ? 5.786   15.867  0.424   1.00 0.00 ? 1  SER A HA   3  
ATOM 2631  H HB2  . SER A 1 1  ? 4.208   17.667  0.802   1.00 0.00 ? 1  SER A HB2  3  
ATOM 2632  H HB3  . SER A 1 1  ? 5.726   18.378  0.257   1.00 0.00 ? 1  SER A HB3  3  
ATOM 2633  H HG   . SER A 1 1  ? 3.890   19.219  -0.849  1.00 0.00 ? 1  SER A HG   3  
ATOM 2634  N N    . ASP A 1 2  ? 4.536   14.602  -1.850  1.00 0.00 ? 2  ASP A N    3  
ATOM 2635  C CA   . ASP A 1 2  ? 3.466   13.772  -2.472  1.00 0.00 ? 2  ASP A CA   3  
ATOM 2636  C C    . ASP A 1 2  ? 2.851   12.834  -1.433  1.00 0.00 ? 2  ASP A C    3  
ATOM 2637  O O    . ASP A 1 2  ? 3.399   11.803  -1.095  1.00 0.00 ? 2  ASP A O    3  
ATOM 2638  C CB   . ASP A 1 2  ? 4.069   12.953  -3.619  1.00 0.00 ? 2  ASP A CB   3  
ATOM 2639  C CG   . ASP A 1 2  ? 3.031   11.959  -4.148  1.00 0.00 ? 2  ASP A CG   3  
ATOM 2640  O OD1  . ASP A 1 2  ? 1.995   12.406  -4.611  1.00 0.00 ? 2  ASP A OD1  3  
ATOM 2641  O OD2  . ASP A 1 2  ? 3.291   10.769  -4.080  1.00 0.00 ? 2  ASP A OD2  3  
ATOM 2642  H H    . ASP A 1 2  ? 5.475   14.429  -2.069  1.00 0.00 ? 2  ASP A H    3  
ATOM 2643  H HA   . ASP A 1 2  ? 2.697   14.414  -2.867  1.00 0.00 ? 2  ASP A HA   3  
ATOM 2644  H HB2  . ASP A 1 2  ? 4.367   13.618  -4.415  1.00 0.00 ? 2  ASP A HB2  3  
ATOM 2645  H HB3  . ASP A 1 2  ? 4.931   12.414  -3.260  1.00 0.00 ? 2  ASP A HB3  3  
ATOM 2646  N N    . VAL A 1 3  ? 1.708   13.205  -0.925  1.00 0.00 ? 3  VAL A N    3  
ATOM 2647  C CA   . VAL A 1 3  ? 1.016   12.376  0.099   1.00 0.00 ? 3  VAL A CA   3  
ATOM 2648  C C    . VAL A 1 3  ? 0.703   10.982  -0.453  1.00 0.00 ? 3  VAL A C    3  
ATOM 2649  O O    . VAL A 1 3  ? 0.306   10.113  0.293   1.00 0.00 ? 3  VAL A O    3  
ATOM 2650  C CB   . VAL A 1 3  ? -0.309  13.073  0.496   1.00 0.00 ? 3  VAL A CB   3  
ATOM 2651  C CG1  . VAL A 1 3  ? -0.081  14.580  0.610   1.00 0.00 ? 3  VAL A CG1  3  
ATOM 2652  C CG2  . VAL A 1 3  ? -1.410  12.816  -0.546  1.00 0.00 ? 3  VAL A CG2  3  
ATOM 2653  H H    . VAL A 1 3  ? 1.299   14.045  -1.221  1.00 0.00 ? 3  VAL A H    3  
ATOM 2654  H HA   . VAL A 1 3  ? 1.623   12.302  0.993   1.00 0.00 ? 3  VAL A HA   3  
ATOM 2655  H HB   . VAL A 1 3  ? -0.631  12.695  1.456   1.00 0.00 ? 3  VAL A HB   3  
ATOM 2656  H HG11 . VAL A 1 3  ? 0.818   14.768  1.178   1.00 0.00 ? 3  VAL A HG11 3  
ATOM 2657  H HG12 . VAL A 1 3  ? -0.925  15.033  1.110   1.00 0.00 ? 3  VAL A HG12 3  
ATOM 2658  H HG13 . VAL A 1 3  ? 0.022   15.005  -0.378  1.00 0.00 ? 3  VAL A HG13 3  
ATOM 2659  H HG21 . VAL A 1 3  ? -1.019  12.983  -1.538  1.00 0.00 ? 3  VAL A HG21 3  
ATOM 2660  H HG22 . VAL A 1 3  ? -2.241  13.486  -0.367  1.00 0.00 ? 3  VAL A HG22 3  
ATOM 2661  H HG23 . VAL A 1 3  ? -1.754  11.795  -0.460  1.00 0.00 ? 3  VAL A HG23 3  
ATOM 2662  N N    . TYR A 1 4  ? 0.817   10.739  -1.741  1.00 0.00 ? 4  TYR A N    3  
ATOM 2663  C CA   . TYR A 1 4  ? 0.436   9.374   -2.232  1.00 0.00 ? 4  TYR A CA   3  
ATOM 2664  C C    . TYR A 1 4  ? 1.507   8.355   -1.827  1.00 0.00 ? 4  TYR A C    3  
ATOM 2665  O O    . TYR A 1 4  ? 1.209   7.293   -1.318  1.00 0.00 ? 4  TYR A O    3  
ATOM 2666  C CB   . TYR A 1 4  ? 0.228   9.369   -3.752  1.00 0.00 ? 4  TYR A CB   3  
ATOM 2667  C CG   . TYR A 1 4  ? -1.185  9.771   -4.109  1.00 0.00 ? 4  TYR A CG   3  
ATOM 2668  C CD1  . TYR A 1 4  ? -2.261  8.993   -3.673  1.00 0.00 ? 4  TYR A CD1  3  
ATOM 2669  C CD2  . TYR A 1 4  ? -1.417  10.899  -4.908  1.00 0.00 ? 4  TYR A CD2  3  
ATOM 2670  C CE1  . TYR A 1 4  ? -3.566  9.339   -4.034  1.00 0.00 ? 4  TYR A CE1  3  
ATOM 2671  C CE2  . TYR A 1 4  ? -2.724  11.249  -5.262  1.00 0.00 ? 4  TYR A CE2  3  
ATOM 2672  C CZ   . TYR A 1 4  ? -3.799  10.468  -4.826  1.00 0.00 ? 4  TYR A CZ   3  
ATOM 2673  O OH   . TYR A 1 4  ? -5.089  10.808  -5.180  1.00 0.00 ? 4  TYR A OH   3  
ATOM 2674  H H    . TYR A 1 4  ? 1.103   11.436  -2.367  1.00 0.00 ? 4  TYR A H    3  
ATOM 2675  H HA   . TYR A 1 4  ? -0.463  9.117   -1.692  1.00 0.00 ? 4  TYR A HA   3  
ATOM 2676  H HB2  . TYR A 1 4  ? 0.923   10.064  -4.203  1.00 0.00 ? 4  TYR A HB2  3  
ATOM 2677  H HB3  . TYR A 1 4  ? 0.421   8.379   -4.141  1.00 0.00 ? 4  TYR A HB3  3  
ATOM 2678  H HD1  . TYR A 1 4  ? -2.087  8.129   -3.052  1.00 0.00 ? 4  TYR A HD1  3  
ATOM 2679  H HD2  . TYR A 1 4  ? -0.588  11.504  -5.245  1.00 0.00 ? 4  TYR A HD2  3  
ATOM 2680  H HE1  . TYR A 1 4  ? -4.392  8.733   -3.703  1.00 0.00 ? 4  TYR A HE1  3  
ATOM 2681  H HE2  . TYR A 1 4  ? -2.901  12.118  -5.876  1.00 0.00 ? 4  TYR A HE2  3  
ATOM 2682  H HH   . TYR A 1 4  ? -5.046  11.363  -5.962  1.00 0.00 ? 4  TYR A HH   3  
ATOM 2683  N N    . CYS A 1 5  ? 2.751   8.680   -2.042  1.00 0.00 ? 5  CYS A N    3  
ATOM 2684  C CA   . CYS A 1 5  ? 3.841   7.744   -1.661  1.00 0.00 ? 5  CYS A CA   3  
ATOM 2685  C C    . CYS A 1 5  ? 3.707   7.407   -0.171  1.00 0.00 ? 5  CYS A C    3  
ATOM 2686  O O    . CYS A 1 5  ? 3.883   6.274   0.235   1.00 0.00 ? 5  CYS A O    3  
ATOM 2687  C CB   . CYS A 1 5  ? 5.199   8.398   -1.928  1.00 0.00 ? 5  CYS A CB   3  
ATOM 2688  S SG   . CYS A 1 5  ? 5.498   8.437   -3.708  1.00 0.00 ? 5  CYS A SG   3  
ATOM 2689  H H    . CYS A 1 5  ? 2.965   9.548   -2.442  1.00 0.00 ? 5  CYS A H    3  
ATOM 2690  H HA   . CYS A 1 5  ? 3.756   6.824   -2.222  1.00 0.00 ? 5  CYS A HA   3  
ATOM 2691  H HB2  . CYS A 1 5  ? 5.198   9.409   -1.545  1.00 0.00 ? 5  CYS A HB2  3  
ATOM 2692  H HB3  . CYS A 1 5  ? 5.977   7.828   -1.443  1.00 0.00 ? 5  CYS A HB3  3  
ATOM 2693  N N    . GLU A 1 6  ? 3.406   8.375   0.648   1.00 0.00 ? 6  GLU A N    3  
ATOM 2694  C CA   . GLU A 1 6  ? 3.272   8.102   2.107   1.00 0.00 ? 6  GLU A CA   3  
ATOM 2695  C C    . GLU A 1 6  ? 2.174   7.058   2.349   1.00 0.00 ? 6  GLU A C    3  
ATOM 2696  O O    . GLU A 1 6  ? 2.333   6.159   3.151   1.00 0.00 ? 6  GLU A O    3  
ATOM 2697  C CB   . GLU A 1 6  ? 2.921   9.406   2.831   1.00 0.00 ? 6  GLU A CB   3  
ATOM 2698  C CG   . GLU A 1 6  ? 2.575   9.115   4.293   1.00 0.00 ? 6  GLU A CG   3  
ATOM 2699  C CD   . GLU A 1 6  ? 2.594   10.417  5.094   1.00 0.00 ? 6  GLU A CD   3  
ATOM 2700  O OE1  . GLU A 1 6  ? 1.572   11.082  5.131   1.00 0.00 ? 6  GLU A OE1  3  
ATOM 2701  O OE2  . GLU A 1 6  ? 3.631   10.729  5.657   1.00 0.00 ? 6  GLU A OE2  3  
ATOM 2702  H H    . GLU A 1 6  ? 3.284   9.282   0.301   1.00 0.00 ? 6  GLU A H    3  
ATOM 2703  H HA   . GLU A 1 6  ? 4.208   7.719   2.484   1.00 0.00 ? 6  GLU A HA   3  
ATOM 2704  H HB2  . GLU A 1 6  ? 3.767   10.079  2.788   1.00 0.00 ? 6  GLU A HB2  3  
ATOM 2705  H HB3  . GLU A 1 6  ? 2.072   9.868   2.349   1.00 0.00 ? 6  GLU A HB3  3  
ATOM 2706  H HG2  . GLU A 1 6  ? 1.591   8.674   4.346   1.00 0.00 ? 6  GLU A HG2  3  
ATOM 2707  H HG3  . GLU A 1 6  ? 3.301   8.430   4.705   1.00 0.00 ? 6  GLU A HG3  3  
ATOM 2708  N N    . VAL A 1 7  ? 1.060   7.174   1.682   1.00 0.00 ? 7  VAL A N    3  
ATOM 2709  C CA   . VAL A 1 7  ? -0.043  6.191   1.901   1.00 0.00 ? 7  VAL A CA   3  
ATOM 2710  C C    . VAL A 1 7  ? 0.305   4.821   1.310   1.00 0.00 ? 7  VAL A C    3  
ATOM 2711  O O    . VAL A 1 7  ? 0.014   3.802   1.903   1.00 0.00 ? 7  VAL A O    3  
ATOM 2712  C CB   . VAL A 1 7  ? -1.342  6.709   1.280   1.00 0.00 ? 7  VAL A CB   3  
ATOM 2713  C CG1  . VAL A 1 7  ? -2.444  5.656   1.448   1.00 0.00 ? 7  VAL A CG1  3  
ATOM 2714  C CG2  . VAL A 1 7  ? -1.761  8.022   1.962   1.00 0.00 ? 7  VAL A CG2  3  
ATOM 2715  H H    . VAL A 1 7  ? 0.938   7.916   1.053   1.00 0.00 ? 7  VAL A H    3  
ATOM 2716  H HA   . VAL A 1 7  ? -0.180  6.026   2.966   1.00 0.00 ? 7  VAL A HA   3  
ATOM 2717  H HB   . VAL A 1 7  ? -1.184  6.887   0.226   1.00 0.00 ? 7  VAL A HB   3  
ATOM 2718  H HG11 . VAL A 1 7  ? -2.303  4.870   0.721   1.00 0.00 ? 7  VAL A HG11 3  
ATOM 2719  H HG12 . VAL A 1 7  ? -3.408  6.115   1.297   1.00 0.00 ? 7  VAL A HG12 3  
ATOM 2720  H HG13 . VAL A 1 7  ? -2.397  5.238   2.443   1.00 0.00 ? 7  VAL A HG13 3  
ATOM 2721  H HG21 . VAL A 1 7  ? -1.545  7.970   3.018   1.00 0.00 ? 7  VAL A HG21 3  
ATOM 2722  H HG22 . VAL A 1 7  ? -2.820  8.182   1.819   1.00 0.00 ? 7  VAL A HG22 3  
ATOM 2723  H HG23 . VAL A 1 7  ? -1.216  8.843   1.524   1.00 0.00 ? 7  VAL A HG23 3  
ATOM 2724  N N    . CYS A 1 8  ? 0.910   4.768   0.152   1.00 0.00 ? 8  CYS A N    3  
ATOM 2725  C CA   . CYS A 1 8  ? 1.243   3.444   -0.444  1.00 0.00 ? 8  CYS A CA   3  
ATOM 2726  C C    . CYS A 1 8  ? 2.128   2.665   0.523   1.00 0.00 ? 8  CYS A C    3  
ATOM 2727  O O    . CYS A 1 8  ? 1.908   1.497   0.777   1.00 0.00 ? 8  CYS A O    3  
ATOM 2728  C CB   . CYS A 1 8  ? 1.968   3.670   -1.783  1.00 0.00 ? 8  CYS A CB   3  
ATOM 2729  S SG   . CYS A 1 8  ? 3.745   3.896   -1.532  1.00 0.00 ? 8  CYS A SG   3  
ATOM 2730  H H    . CYS A 1 8  ? 1.151   5.578   -0.345  1.00 0.00 ? 8  CYS A H    3  
ATOM 2731  H HA   . CYS A 1 8  ? 0.336   2.883   -0.622  1.00 0.00 ? 8  CYS A HA   3  
ATOM 2732  H HB2  . CYS A 1 8  ? 1.815   2.817   -2.422  1.00 0.00 ? 8  CYS A HB2  3  
ATOM 2733  H HB3  . CYS A 1 8  ? 1.562   4.550   -2.261  1.00 0.00 ? 8  CYS A HB3  3  
ATOM 2734  N N    . GLU A 1 9  ? 3.136   3.293   1.056   1.00 0.00 ? 9  GLU A N    3  
ATOM 2735  C CA   . GLU A 1 9  ? 4.030   2.573   1.989   1.00 0.00 ? 9  GLU A CA   3  
ATOM 2736  C C    . GLU A 1 9  ? 3.276   2.270   3.284   1.00 0.00 ? 9  GLU A C    3  
ATOM 2737  O O    . GLU A 1 9  ? 3.555   1.286   3.941   1.00 0.00 ? 9  GLU A O    3  
ATOM 2738  C CB   . GLU A 1 9  ? 5.255   3.444   2.304   1.00 0.00 ? 9  GLU A CB   3  
ATOM 2739  C CG   . GLU A 1 9  ? 6.259   3.370   1.149   1.00 0.00 ? 9  GLU A CG   3  
ATOM 2740  C CD   . GLU A 1 9  ? 6.945   2.002   1.154   1.00 0.00 ? 9  GLU A CD   3  
ATOM 2741  O OE1  . GLU A 1 9  ? 7.756   1.772   2.036   1.00 0.00 ? 9  GLU A OE1  3  
ATOM 2742  O OE2  . GLU A 1 9  ? 6.647   1.209   0.277   1.00 0.00 ? 9  GLU A OE2  3  
ATOM 2743  H H    . GLU A 1 9  ? 3.313   4.230   0.831   1.00 0.00 ? 9  GLU A H    3  
ATOM 2744  H HA   . GLU A 1 9  ? 4.350   1.656   1.517   1.00 0.00 ? 9  GLU A HA   3  
ATOM 2745  H HB2  . GLU A 1 9  ? 4.941   4.468   2.440   1.00 0.00 ? 9  GLU A HB2  3  
ATOM 2746  H HB3  . GLU A 1 9  ? 5.729   3.090   3.209   1.00 0.00 ? 9  GLU A HB3  3  
ATOM 2747  H HG2  . GLU A 1 9  ? 5.741   3.510   0.213   1.00 0.00 ? 9  GLU A HG2  3  
ATOM 2748  H HG3  . GLU A 1 9  ? 7.003   4.143   1.269   1.00 0.00 ? 9  GLU A HG3  3  
ATOM 2749  N N    . PHE A 1 10 ? 2.317   3.076   3.672   1.00 0.00 ? 10 PHE A N    3  
ATOM 2750  C CA   . PHE A 1 10 ? 1.586   2.754   4.927   1.00 0.00 ? 10 PHE A CA   3  
ATOM 2751  C C    . PHE A 1 10 ? 0.728   1.501   4.712   1.00 0.00 ? 10 PHE A C    3  
ATOM 2752  O O    . PHE A 1 10 ? 0.756   0.584   5.509   1.00 0.00 ? 10 PHE A O    3  
ATOM 2753  C CB   . PHE A 1 10 ? 0.695   3.923   5.346   1.00 0.00 ? 10 PHE A CB   3  
ATOM 2754  C CG   . PHE A 1 10 ? -0.004  3.552   6.629   1.00 0.00 ? 10 PHE A CG   3  
ATOM 2755  C CD1  . PHE A 1 10 ? 0.653   3.713   7.854   1.00 0.00 ? 10 PHE A CD1  3  
ATOM 2756  C CD2  . PHE A 1 10 ? -1.298  3.022   6.592   1.00 0.00 ? 10 PHE A CD2  3  
ATOM 2757  C CE1  . PHE A 1 10 ? 0.014   3.350   9.044   1.00 0.00 ? 10 PHE A CE1  3  
ATOM 2758  C CE2  . PHE A 1 10 ? -1.938  2.653   7.783   1.00 0.00 ? 10 PHE A CE2  3  
ATOM 2759  C CZ   . PHE A 1 10 ? -1.281  2.818   9.008   1.00 0.00 ? 10 PHE A CZ   3  
ATOM 2760  H H    . PHE A 1 10 ? 2.072   3.879   3.162   1.00 0.00 ? 10 PHE A H    3  
ATOM 2761  H HA   . PHE A 1 10 ? 2.305   2.557   5.699   1.00 0.00 ? 10 PHE A HA   3  
ATOM 2762  H HB2  . PHE A 1 10 ? 1.301   4.805   5.503   1.00 0.00 ? 10 PHE A HB2  3  
ATOM 2763  H HB3  . PHE A 1 10 ? -0.038  4.117   4.578   1.00 0.00 ? 10 PHE A HB3  3  
ATOM 2764  H HD1  . PHE A 1 10 ? 1.651   4.124   7.881   1.00 0.00 ? 10 PHE A HD1  3  
ATOM 2765  H HD2  . PHE A 1 10 ? -1.803  2.899   5.643   1.00 0.00 ? 10 PHE A HD2  3  
ATOM 2766  H HE1  . PHE A 1 10 ? 0.520   3.476   9.990   1.00 0.00 ? 10 PHE A HE1  3  
ATOM 2767  H HE2  . PHE A 1 10 ? -2.936  2.243   7.755   1.00 0.00 ? 10 PHE A HE2  3  
ATOM 2768  H HZ   . PHE A 1 10 ? -1.773  2.534   9.926   1.00 0.00 ? 10 PHE A HZ   3  
ATOM 2769  N N    . LEU A 1 11 ? -0.023  1.436   3.640   1.00 0.00 ? 11 LEU A N    3  
ATOM 2770  C CA   . LEU A 1 11 ? -0.849  0.214   3.403   1.00 0.00 ? 11 LEU A CA   3  
ATOM 2771  C C    . LEU A 1 11 ? 0.091   -0.978  3.237   1.00 0.00 ? 11 LEU A C    3  
ATOM 2772  O O    . LEU A 1 11 ? -0.128  -2.029  3.806   1.00 0.00 ? 11 LEU A O    3  
ATOM 2773  C CB   . LEU A 1 11 ? -1.711  0.362   2.138   1.00 0.00 ? 11 LEU A CB   3  
ATOM 2774  C CG   . LEU A 1 11 ? -2.713  1.516   2.310   1.00 0.00 ? 11 LEU A CG   3  
ATOM 2775  C CD1  . LEU A 1 11 ? -3.251  1.935   0.939   1.00 0.00 ? 11 LEU A CD1  3  
ATOM 2776  C CD2  . LEU A 1 11 ? -3.891  1.081   3.198   1.00 0.00 ? 11 LEU A CD2  3  
ATOM 2777  H H    . LEU A 1 11 ? -0.035  2.175   2.998   1.00 0.00 ? 11 LEU A H    3  
ATOM 2778  H HA   . LEU A 1 11 ? -1.493  0.032   4.251   1.00 0.00 ? 11 LEU A HA   3  
ATOM 2779  H HB2  . LEU A 1 11 ? -1.073  0.564   1.290   1.00 0.00 ? 11 LEU A HB2  3  
ATOM 2780  H HB3  . LEU A 1 11 ? -2.251  -0.564  1.966   1.00 0.00 ? 11 LEU A HB3  3  
ATOM 2781  H HG   . LEU A 1 11 ? -2.211  2.357   2.766   1.00 0.00 ? 11 LEU A HG   3  
ATOM 2782  H HD11 . LEU A 1 11 ? -3.618  1.065   0.415   1.00 0.00 ? 11 LEU A HD11 3  
ATOM 2783  H HD12 . LEU A 1 11 ? -2.458  2.392   0.366   1.00 0.00 ? 11 LEU A HD12 3  
ATOM 2784  H HD13 . LEU A 1 11 ? -4.057  2.643   1.068   1.00 0.00 ? 11 LEU A HD13 3  
ATOM 2785  H HD21 . LEU A 1 11 ? -4.243  0.107   2.890   1.00 0.00 ? 11 LEU A HD21 3  
ATOM 2786  H HD22 . LEU A 1 11 ? -4.696  1.796   3.101   1.00 0.00 ? 11 LEU A HD22 3  
ATOM 2787  H HD23 . LEU A 1 11 ? -3.574  1.040   4.228   1.00 0.00 ? 11 LEU A HD23 3  
ATOM 2788  N N    . VAL A 1 12 ? 1.142   -0.838  2.469   1.00 0.00 ? 12 VAL A N    3  
ATOM 2789  C CA   . VAL A 1 12 ? 2.079   -1.973  2.286   1.00 0.00 ? 12 VAL A CA   3  
ATOM 2790  C C    . VAL A 1 12 ? 2.642   -2.388  3.656   1.00 0.00 ? 12 VAL A C    3  
ATOM 2791  O O    . VAL A 1 12 ? 2.632   -3.547  4.012   1.00 0.00 ? 12 VAL A O    3  
ATOM 2792  C CB   . VAL A 1 12 ? 3.218   -1.517  1.363   1.00 0.00 ? 12 VAL A CB   3  
ATOM 2793  C CG1  . VAL A 1 12 ? 4.406   -2.476  1.458   1.00 0.00 ? 12 VAL A CG1  3  
ATOM 2794  C CG2  . VAL A 1 12 ? 2.714   -1.484  -0.082  1.00 0.00 ? 12 VAL A CG2  3  
ATOM 2795  H H    . VAL A 1 12 ? 1.325   0.001   1.996   1.00 0.00 ? 12 VAL A H    3  
ATOM 2796  H HA   . VAL A 1 12 ? 1.559   -2.814  1.836   1.00 0.00 ? 12 VAL A HA   3  
ATOM 2797  H HB   . VAL A 1 12 ? 3.535   -0.528  1.654   1.00 0.00 ? 12 VAL A HB   3  
ATOM 2798  H HG11 . VAL A 1 12 ? 4.054   -3.494  1.380   1.00 0.00 ? 12 VAL A HG11 3  
ATOM 2799  H HG12 . VAL A 1 12 ? 4.910   -2.338  2.404   1.00 0.00 ? 12 VAL A HG12 3  
ATOM 2800  H HG13 . VAL A 1 12 ? 5.094   -2.267  0.655   1.00 0.00 ? 12 VAL A HG13 3  
ATOM 2801  H HG21 . VAL A 1 12 ? 1.816   -0.888  -0.136  1.00 0.00 ? 12 VAL A HG21 3  
ATOM 2802  H HG22 . VAL A 1 12 ? 2.498   -2.490  -0.411  1.00 0.00 ? 12 VAL A HG22 3  
ATOM 2803  H HG23 . VAL A 1 12 ? 3.472   -1.051  -0.717  1.00 0.00 ? 12 VAL A HG23 3  
ATOM 2804  N N    . LYS A 1 13 ? 3.121   -1.445  4.434   1.00 0.00 ? 13 LYS A N    3  
ATOM 2805  C CA   . LYS A 1 13 ? 3.673   -1.795  5.778   1.00 0.00 ? 13 LYS A CA   3  
ATOM 2806  C C    . LYS A 1 13 ? 2.567   -2.471  6.594   1.00 0.00 ? 13 LYS A C    3  
ATOM 2807  O O    . LYS A 1 13 ? 2.782   -3.465  7.258   1.00 0.00 ? 13 LYS A O    3  
ATOM 2808  C CB   . LYS A 1 13 ? 4.156   -0.516  6.482   1.00 0.00 ? 13 LYS A CB   3  
ATOM 2809  C CG   . LYS A 1 13 ? 4.354   -0.772  7.989   1.00 0.00 ? 13 LYS A CG   3  
ATOM 2810  C CD   . LYS A 1 13 ? 5.365   0.229   8.561   1.00 0.00 ? 13 LYS A CD   3  
ATOM 2811  C CE   . LYS A 1 13 ? 4.935   1.654   8.210   1.00 0.00 ? 13 LYS A CE   3  
ATOM 2812  N NZ   . LYS A 1 13 ? 3.474   1.811   8.465   1.00 0.00 ? 13 LYS A NZ   3  
ATOM 2813  H H    . LYS A 1 13 ? 3.117   -0.511  4.133   1.00 0.00 ? 13 LYS A H    3  
ATOM 2814  H HA   . LYS A 1 13 ? 4.500   -2.478  5.651   1.00 0.00 ? 13 LYS A HA   3  
ATOM 2815  H HB2  . LYS A 1 13 ? 5.093   -0.207  6.040   1.00 0.00 ? 13 LYS A HB2  3  
ATOM 2816  H HB3  . LYS A 1 13 ? 3.422   0.265   6.346   1.00 0.00 ? 13 LYS A HB3  3  
ATOM 2817  H HG2  . LYS A 1 13 ? 3.408   -0.656  8.498   1.00 0.00 ? 13 LYS A HG2  3  
ATOM 2818  H HG3  . LYS A 1 13 ? 4.723   -1.776  8.141   1.00 0.00 ? 13 LYS A HG3  3  
ATOM 2819  H HD2  . LYS A 1 13 ? 5.409   0.120   9.635   1.00 0.00 ? 13 LYS A HD2  3  
ATOM 2820  H HD3  . LYS A 1 13 ? 6.340   0.035   8.140   1.00 0.00 ? 13 LYS A HD3  3  
ATOM 2821  H HE2  . LYS A 1 13 ? 5.484   2.356   8.820   1.00 0.00 ? 13 LYS A HE2  3  
ATOM 2822  H HE3  . LYS A 1 13 ? 5.141   1.846   7.167   1.00 0.00 ? 13 LYS A HE3  3  
ATOM 2823  H HZ1  . LYS A 1 13 ? 3.184   1.166   9.226   1.00 0.00 ? 13 LYS A HZ1  3  
ATOM 2824  H HZ2  . LYS A 1 13 ? 2.946   1.584   7.597   1.00 0.00 ? 13 LYS A HZ2  3  
ATOM 2825  H HZ3  . LYS A 1 13 ? 3.275   2.791   8.747   1.00 0.00 ? 13 LYS A HZ3  3  
ATOM 2826  N N    . GLU A 1 14 ? 1.393   -1.910  6.564   1.00 0.00 ? 14 GLU A N    3  
ATOM 2827  C CA   . GLU A 1 14 ? 0.266   -2.478  7.354   1.00 0.00 ? 14 GLU A CA   3  
ATOM 2828  C C    . GLU A 1 14 ? -0.161  -3.811  6.744   1.00 0.00 ? 14 GLU A C    3  
ATOM 2829  O O    . GLU A 1 14 ? -0.494  -4.745  7.447   1.00 0.00 ? 14 GLU A O    3  
ATOM 2830  C CB   . GLU A 1 14 ? -0.904  -1.480  7.339   1.00 0.00 ? 14 GLU A CB   3  
ATOM 2831  C CG   . GLU A 1 14 ? -1.711  -1.592  8.633   1.00 0.00 ? 14 GLU A CG   3  
ATOM 2832  C CD   . GLU A 1 14 ? -2.864  -0.590  8.601   1.00 0.00 ? 14 GLU A CD   3  
ATOM 2833  O OE1  . GLU A 1 14 ? -3.153  -0.087  7.528   1.00 0.00 ? 14 GLU A OE1  3  
ATOM 2834  O OE2  . GLU A 1 14 ? -3.437  -0.343  9.649   1.00 0.00 ? 14 GLU A OE2  3  
ATOM 2835  H H    . GLU A 1 14 ? 1.259   -1.103  6.026   1.00 0.00 ? 14 GLU A H    3  
ATOM 2836  H HA   . GLU A 1 14 ? 0.597   -2.645  8.369   1.00 0.00 ? 14 GLU A HA   3  
ATOM 2837  H HB2  . GLU A 1 14 ? -0.512  -0.477  7.252   1.00 0.00 ? 14 GLU A HB2  3  
ATOM 2838  H HB3  . GLU A 1 14 ? -1.550  -1.681  6.496   1.00 0.00 ? 14 GLU A HB3  3  
ATOM 2839  H HG2  . GLU A 1 14 ? -2.104  -2.594  8.725   1.00 0.00 ? 14 GLU A HG2  3  
ATOM 2840  H HG3  . GLU A 1 14 ? -1.071  -1.374  9.474   1.00 0.00 ? 14 GLU A HG3  3  
ATOM 2841  N N    . VAL A 1 15 ? -0.166  -3.914  5.452   1.00 0.00 ? 15 VAL A N    3  
ATOM 2842  C CA   . VAL A 1 15 ? -0.586  -5.193  4.828   1.00 0.00 ? 15 VAL A CA   3  
ATOM 2843  C C    . VAL A 1 15 ? 0.456   -6.285  5.105   1.00 0.00 ? 15 VAL A C    3  
ATOM 2844  O O    . VAL A 1 15 ? 0.111   -7.397  5.421   1.00 0.00 ? 15 VAL A O    3  
ATOM 2845  C CB   . VAL A 1 15 ? -0.774  -4.992  3.313   1.00 0.00 ? 15 VAL A CB   3  
ATOM 2846  C CG1  . VAL A 1 15 ? -0.696  -6.346  2.585   1.00 0.00 ? 15 VAL A CG1  3  
ATOM 2847  C CG2  . VAL A 1 15 ? -2.143  -4.346  3.052   1.00 0.00 ? 15 VAL A CG2  3  
ATOM 2848  H H    . VAL A 1 15 ? 0.097   -3.151  4.895   1.00 0.00 ? 15 VAL A H    3  
ATOM 2849  H HA   . VAL A 1 15 ? -1.527  -5.506  5.264   1.00 0.00 ? 15 VAL A HA   3  
ATOM 2850  H HB   . VAL A 1 15 ? 0.002   -4.341  2.941   1.00 0.00 ? 15 VAL A HB   3  
ATOM 2851  H HG11 . VAL A 1 15 ? -1.133  -7.118  3.204   1.00 0.00 ? 15 VAL A HG11 3  
ATOM 2852  H HG12 . VAL A 1 15 ? 0.343   -6.590  2.394   1.00 0.00 ? 15 VAL A HG12 3  
ATOM 2853  H HG13 . VAL A 1 15 ? -1.234  -6.289  1.651   1.00 0.00 ? 15 VAL A HG13 3  
ATOM 2854  H HG21 . VAL A 1 15 ? -2.926  -5.014  3.382   1.00 0.00 ? 15 VAL A HG21 3  
ATOM 2855  H HG22 . VAL A 1 15 ? -2.255  -4.154  1.995   1.00 0.00 ? 15 VAL A HG22 3  
ATOM 2856  H HG23 . VAL A 1 15 ? -2.211  -3.415  3.596   1.00 0.00 ? 15 VAL A HG23 3  
ATOM 2857  N N    . THR A 1 16 ? 1.722   -6.010  4.965   1.00 0.00 ? 16 THR A N    3  
ATOM 2858  C CA   . THR A 1 16 ? 2.694   -7.112  5.202   1.00 0.00 ? 16 THR A CA   3  
ATOM 2859  C C    . THR A 1 16 ? 2.590   -7.598  6.644   1.00 0.00 ? 16 THR A C    3  
ATOM 2860  O O    . THR A 1 16 ? 2.692   -8.782  6.903   1.00 0.00 ? 16 THR A O    3  
ATOM 2861  C CB   . THR A 1 16 ? 4.139   -6.701  4.926   1.00 0.00 ? 16 THR A CB   3  
ATOM 2862  O OG1  . THR A 1 16 ? 4.670   -6.051  6.071   1.00 0.00 ? 16 THR A OG1  3  
ATOM 2863  C CG2  . THR A 1 16 ? 4.250   -5.764  3.710   1.00 0.00 ? 16 THR A CG2  3  
ATOM 2864  H H    . THR A 1 16 ? 2.012   -5.115  4.693   1.00 0.00 ? 16 THR A H    3  
ATOM 2865  H HA   . THR A 1 16 ? 2.435   -7.919  4.540   1.00 0.00 ? 16 THR A HA   3  
ATOM 2866  H HB   . THR A 1 16 ? 4.701   -7.602  4.733   1.00 0.00 ? 16 THR A HB   3  
ATOM 2867  H HG1  . THR A 1 16 ? 5.135   -5.264  5.778   1.00 0.00 ? 16 THR A HG1  3  
ATOM 2868  H HG21 . THR A 1 16 ? 4.586   -4.794  4.044   1.00 0.00 ? 16 THR A HG21 3  
ATOM 2869  H HG22 . THR A 1 16 ? 3.295   -5.666  3.222   1.00 0.00 ? 16 THR A HG22 3  
ATOM 2870  H HG23 . THR A 1 16 ? 4.968   -6.163  3.007   1.00 0.00 ? 16 THR A HG23 3  
ATOM 2871  N N    . LYS A 1 17 ? 2.387   -6.730  7.593   1.00 0.00 ? 17 LYS A N    3  
ATOM 2872  C CA   . LYS A 1 17 ? 2.285   -7.235  8.986   1.00 0.00 ? 17 LYS A CA   3  
ATOM 2873  C C    . LYS A 1 17 ? 1.067   -8.152  9.042   1.00 0.00 ? 17 LYS A C    3  
ATOM 2874  O O    . LYS A 1 17 ? 1.028   -9.131  9.760   1.00 0.00 ? 17 LYS A O    3  
ATOM 2875  C CB   . LYS A 1 17 ? 2.118   -6.072  9.977   1.00 0.00 ? 17 LYS A CB   3  
ATOM 2876  C CG   . LYS A 1 17 ? 1.563   -6.610  11.312  1.00 0.00 ? 17 LYS A CG   3  
ATOM 2877  C CD   . LYS A 1 17 ? 1.909   -5.668  12.463  1.00 0.00 ? 17 LYS A CD   3  
ATOM 2878  C CE   . LYS A 1 17 ? 1.421   -6.293  13.773  1.00 0.00 ? 17 LYS A CE   3  
ATOM 2879  N NZ   . LYS A 1 17 ? 1.996   -5.545  14.926  1.00 0.00 ? 17 LYS A NZ   3  
ATOM 2880  H H    . LYS A 1 17 ? 2.290   -5.776  7.392   1.00 0.00 ? 17 LYS A H    3  
ATOM 2881  H HA   . LYS A 1 17 ? 3.188   -7.783  9.212   1.00 0.00 ? 17 LYS A HA   3  
ATOM 2882  H HB2  . LYS A 1 17 ? 3.079   -5.605  10.141  1.00 0.00 ? 17 LYS A HB2  3  
ATOM 2883  H HB3  . LYS A 1 17 ? 1.431   -5.348  9.567   1.00 0.00 ? 17 LYS A HB3  3  
ATOM 2884  H HG2  . LYS A 1 17 ? 0.491   -6.701  11.240  1.00 0.00 ? 17 LYS A HG2  3  
ATOM 2885  H HG3  . LYS A 1 17 ? 1.990   -7.583  11.513  1.00 0.00 ? 17 LYS A HG3  3  
ATOM 2886  H HD2  . LYS A 1 17 ? 2.979   -5.522  12.504  1.00 0.00 ? 17 LYS A HD2  3  
ATOM 2887  H HD3  . LYS A 1 17 ? 1.418   -4.717  12.314  1.00 0.00 ? 17 LYS A HD3  3  
ATOM 2888  H HE2  . LYS A 1 17 ? 0.343   -6.244  13.814  1.00 0.00 ? 17 LYS A HE2  3  
ATOM 2889  H HE3  . LYS A 1 17 ? 1.735   -7.328  13.819  1.00 0.00 ? 17 LYS A HE3  3  
ATOM 2890  H HZ1  . LYS A 1 17 ? 2.931   -5.934  15.161  1.00 0.00 ? 17 LYS A HZ1  3  
ATOM 2891  H HZ2  . LYS A 1 17 ? 1.365   -5.638  15.748  1.00 0.00 ? 17 LYS A HZ2  3  
ATOM 2892  H HZ3  . LYS A 1 17 ? 2.095   -4.540  14.675  1.00 0.00 ? 17 LYS A HZ3  3  
ATOM 2893  N N    . LEU A 1 18 ? 0.074   -7.826  8.264   1.00 0.00 ? 18 LEU A N    3  
ATOM 2894  C CA   . LEU A 1 18 ? -1.160  -8.647  8.224   1.00 0.00 ? 18 LEU A CA   3  
ATOM 2895  C C    . LEU A 1 18 ? -0.813  -9.962  7.518   1.00 0.00 ? 18 LEU A C    3  
ATOM 2896  O O    . LEU A 1 18 ? -1.294  -11.020 7.871   1.00 0.00 ? 18 LEU A O    3  
ATOM 2897  C CB   . LEU A 1 18 ? -2.259  -7.875  7.460   1.00 0.00 ? 18 LEU A CB   3  
ATOM 2898  C CG   . LEU A 1 18 ? -2.827  -6.629  8.246   1.00 0.00 ? 18 LEU A CG   3  
ATOM 2899  C CD1  . LEU A 1 18 ? -4.345  -6.749  8.401   1.00 0.00 ? 18 LEU A CD1  3  
ATOM 2900  C CD2  . LEU A 1 18 ? -2.233  -6.457  9.658   1.00 0.00 ? 18 LEU A CD2  3  
ATOM 2901  H H    . LEU A 1 18 ? 0.149   -7.035  7.690   1.00 0.00 ? 18 LEU A H    3  
ATOM 2902  H HA   . LEU A 1 18 ? -1.489  -8.895  9.219   1.00 0.00 ? 18 LEU A HA   3  
ATOM 2903  H HB2  . LEU A 1 18 ? -1.845  -7.533  6.529   1.00 0.00 ? 18 LEU A HB2  3  
ATOM 2904  H HB3  . LEU A 1 18 ? -3.056  -8.552  7.234   1.00 0.00 ? 18 LEU A HB3  3  
ATOM 2905  H HG   . LEU A 1 18 ? -2.620  -5.733  7.672   1.00 0.00 ? 18 LEU A HG   3  
ATOM 2906  H HD11 . LEU A 1 18 ? -4.576  -7.620  8.989   1.00 0.00 ? 18 LEU A HD11 3  
ATOM 2907  H HD12 . LEU A 1 18 ? -4.803  -6.837  7.427   1.00 0.00 ? 18 LEU A HD12 3  
ATOM 2908  H HD13 . LEU A 1 18 ? -4.725  -5.872  8.903   1.00 0.00 ? 18 LEU A HD13 3  
ATOM 2909  H HD21 . LEU A 1 18 ? -2.566  -5.514  10.065  1.00 0.00 ? 18 LEU A HD21 3  
ATOM 2910  H HD22 . LEU A 1 18 ? -1.160  -6.455  9.612   1.00 0.00 ? 18 LEU A HD22 3  
ATOM 2911  H HD23 . LEU A 1 18 ? -2.573  -7.254  10.300  1.00 0.00 ? 18 LEU A HD23 3  
ATOM 2912  N N    . ILE A 1 19 ? 0.061   -9.902  6.549   1.00 0.00 ? 19 ILE A N    3  
ATOM 2913  C CA   . ILE A 1 19 ? 0.494   -11.138 5.845   1.00 0.00 ? 19 ILE A CA   3  
ATOM 2914  C C    . ILE A 1 19 ? 1.382   -11.916 6.811   1.00 0.00 ? 19 ILE A C    3  
ATOM 2915  O O    . ILE A 1 19 ? 1.422   -13.130 6.807   1.00 0.00 ? 19 ILE A O    3  
ATOM 2916  C CB   . ILE A 1 19 ? 1.293   -10.765 4.585   1.00 0.00 ? 19 ILE A CB   3  
ATOM 2917  C CG1  . ILE A 1 19 ? 0.355   -10.062 3.593   1.00 0.00 ? 19 ILE A CG1  3  
ATOM 2918  C CG2  . ILE A 1 19 ? 1.876   -12.026 3.935   1.00 0.00 ? 19 ILE A CG2  3  
ATOM 2919  C CD1  . ILE A 1 19 ? 1.132   -9.620  2.350   1.00 0.00 ? 19 ILE A CD1  3  
ATOM 2920  H H    . ILE A 1 19 ? 0.455   -9.045  6.314   1.00 0.00 ? 19 ILE A H    3  
ATOM 2921  H HA   . ILE A 1 19 ? -0.369  -11.731 5.577   1.00 0.00 ? 19 ILE A HA   3  
ATOM 2922  H HB   . ILE A 1 19 ? 2.105   -10.100 4.856   1.00 0.00 ? 19 ILE A HB   3  
ATOM 2923  H HG12 . ILE A 1 19 ? -0.431  -10.739 3.302   1.00 0.00 ? 19 ILE A HG12 3  
ATOM 2924  H HG13 . ILE A 1 19 ? -0.082  -9.201  4.061   1.00 0.00 ? 19 ILE A HG13 3  
ATOM 2925  H HG21 . ILE A 1 19 ? 2.578   -12.491 4.609   1.00 0.00 ? 19 ILE A HG21 3  
ATOM 2926  H HG22 . ILE A 1 19 ? 2.388   -11.757 3.022   1.00 0.00 ? 19 ILE A HG22 3  
ATOM 2927  H HG23 . ILE A 1 19 ? 1.078   -12.717 3.710   1.00 0.00 ? 19 ILE A HG23 3  
ATOM 2928  H HD11 . ILE A 1 19 ? 1.261   -10.464 1.689   1.00 0.00 ? 19 ILE A HD11 3  
ATOM 2929  H HD12 . ILE A 1 19 ? 2.100   -9.240  2.642   1.00 0.00 ? 19 ILE A HD12 3  
ATOM 2930  H HD13 . ILE A 1 19 ? 0.581   -8.846  1.841   1.00 0.00 ? 19 ILE A HD13 3  
ATOM 2931  N N    . ASP A 1 20 ? 2.098   -11.206 7.638   1.00 0.00 ? 20 ASP A N    3  
ATOM 2932  C CA   . ASP A 1 20 ? 2.999   -11.866 8.616   1.00 0.00 ? 20 ASP A CA   3  
ATOM 2933  C C    . ASP A 1 20 ? 2.191   -12.436 9.783   1.00 0.00 ? 20 ASP A C    3  
ATOM 2934  O O    . ASP A 1 20 ? 2.631   -13.356 10.444  1.00 0.00 ? 20 ASP A O    3  
ATOM 2935  C CB   . ASP A 1 20 ? 4.003   -10.840 9.150   1.00 0.00 ? 20 ASP A CB   3  
ATOM 2936  C CG   . ASP A 1 20 ? 4.701   -10.152 7.976   1.00 0.00 ? 20 ASP A CG   3  
ATOM 2937  O OD1  . ASP A 1 20 ? 4.946   -10.818 6.984   1.00 0.00 ? 20 ASP A OD1  3  
ATOM 2938  O OD2  . ASP A 1 20 ? 4.981   -8.969  8.091   1.00 0.00 ? 20 ASP A OD2  3  
ATOM 2939  H H    . ASP A 1 20 ? 2.044   -10.228 7.614   1.00 0.00 ? 20 ASP A H    3  
ATOM 2940  H HA   . ASP A 1 20 ? 3.536   -12.669 8.135   1.00 0.00 ? 20 ASP A HA   3  
ATOM 2941  H HB2  . ASP A 1 20 ? 3.482   -10.103 9.744   1.00 0.00 ? 20 ASP A HB2  3  
ATOM 2942  H HB3  . ASP A 1 20 ? 4.738   -11.341 9.761   1.00 0.00 ? 20 ASP A HB3  3  
ATOM 2943  N N    . ASN A 1 21 ? 1.015   -11.904 10.061  1.00 0.00 ? 21 ASN A N    3  
ATOM 2944  C CA   . ASN A 1 21 ? 0.220   -12.447 11.213  1.00 0.00 ? 21 ASN A CA   3  
ATOM 2945  C C    . ASN A 1 21 ? -0.634  -13.628 10.732  1.00 0.00 ? 21 ASN A C    3  
ATOM 2946  O O    . ASN A 1 21 ? -1.343  -14.236 11.505  1.00 0.00 ? 21 ASN A O    3  
ATOM 2947  C CB   . ASN A 1 21 ? -0.643  -11.354 11.851  1.00 0.00 ? 21 ASN A CB   3  
ATOM 2948  C CG   . ASN A 1 21 ? -1.351  -11.918 13.085  1.00 0.00 ? 21 ASN A CG   3  
ATOM 2949  O OD1  . ASN A 1 21 ? -2.274  -11.317 13.598  1.00 0.00 ? 21 ASN A OD1  3  
ATOM 2950  N ND2  . ASN A 1 21 ? -0.953  -13.055 13.587  1.00 0.00 ? 21 ASN A ND2  3  
ATOM 2951  H H    . ASN A 1 21 ? 0.673   -11.163 9.518   1.00 0.00 ? 21 ASN A H    3  
ATOM 2952  H HA   . ASN A 1 21 ? 0.926   -12.847 11.928  1.00 0.00 ? 21 ASN A HA   3  
ATOM 2953  H HB2  . ASN A 1 21 ? -0.015  -10.522 12.144  1.00 0.00 ? 21 ASN A HB2  3  
ATOM 2954  H HB3  . ASN A 1 21 ? -1.380  -11.015 11.140  1.00 0.00 ? 21 ASN A HB3  3  
ATOM 2955  H HD21 . ASN A 1 21 ? -0.210  -13.540 13.173  1.00 0.00 ? 21 ASN A HD21 3  
ATOM 2956  H HD22 . ASN A 1 21 ? -1.400  -13.425 14.378  1.00 0.00 ? 21 ASN A HD22 3  
ATOM 2957  N N    . ASN A 1 22 ? -0.505  -13.998 9.479   1.00 0.00 ? 22 ASN A N    3  
ATOM 2958  C CA   . ASN A 1 22 ? -1.234  -15.205 8.939   1.00 0.00 ? 22 ASN A CA   3  
ATOM 2959  C C    . ASN A 1 22 ? -2.718  -14.937 8.639   1.00 0.00 ? 22 ASN A C    3  
ATOM 2960  O O    . ASN A 1 22 ? -3.552  -15.782 8.896   1.00 0.00 ? 22 ASN A O    3  
ATOM 2961  C CB   . ASN A 1 22 ? -1.139  -16.364 9.951   1.00 0.00 ? 22 ASN A CB   3  
ATOM 2962  C CG   . ASN A 1 22 ? 0.228   -16.339 10.640  1.00 0.00 ? 22 ASN A CG   3  
ATOM 2963  O OD1  . ASN A 1 22 ? 0.311   -16.365 11.853  1.00 0.00 ? 22 ASN A OD1  3  
ATOM 2964  N ND2  . ASN A 1 22 ? 1.311   -16.285 9.914   1.00 0.00 ? 22 ASN A ND2  3  
ATOM 2965  H H    . ASN A 1 22 ? 0.118   -13.509 8.891   1.00 0.00 ? 22 ASN A H    3  
ATOM 2966  H HA   . ASN A 1 22 ? -0.724  -15.521 8.039   1.00 0.00 ? 22 ASN A HA   3  
ATOM 2967  H HB2  . ASN A 1 22 ? -1.921  -16.279 10.691  1.00 0.00 ? 22 ASN A HB2  3  
ATOM 2968  H HB3  . ASN A 1 22 ? -1.250  -17.303 9.428   1.00 0.00 ? 22 ASN A HB3  3  
ATOM 2969  H HD21 . ASN A 1 22 ? 1.245   -16.263 8.936   1.00 0.00 ? 22 ASN A HD21 3  
ATOM 2970  H HD22 . ASN A 1 22 ? 2.191   -16.268 10.346  1.00 0.00 ? 22 ASN A HD22 3  
ATOM 2971  N N    . LYS A 1 23 ? -3.071  -13.808 8.089   1.00 0.00 ? 23 LYS A N    3  
ATOM 2972  C CA   . LYS A 1 23 ? -4.518  -13.558 7.775   1.00 0.00 ? 23 LYS A CA   3  
ATOM 2973  C C    . LYS A 1 23 ? -4.767  -13.938 6.307   1.00 0.00 ? 23 LYS A C    3  
ATOM 2974  O O    . LYS A 1 23 ? -3.887  -13.859 5.475   1.00 0.00 ? 23 LYS A O    3  
ATOM 2975  C CB   . LYS A 1 23 ? -4.846  -12.082 8.013   1.00 0.00 ? 23 LYS A CB   3  
ATOM 2976  C CG   . LYS A 1 23 ? -4.141  -11.563 9.305   1.00 0.00 ? 23 LYS A CG   3  
ATOM 2977  C CD   . LYS A 1 23 ? -5.120  -10.811 10.228  1.00 0.00 ? 23 LYS A CD   3  
ATOM 2978  C CE   . LYS A 1 23 ? -4.402  -10.443 11.527  1.00 0.00 ? 23 LYS A CE   3  
ATOM 2979  N NZ   . LYS A 1 23 ? -3.313  -9.467  11.236  1.00 0.00 ? 23 LYS A NZ   3  
ATOM 2980  H H    . LYS A 1 23 ? -2.395  -13.135 7.866   1.00 0.00 ? 23 LYS A H    3  
ATOM 2981  H HA   . LYS A 1 23 ? -5.137  -14.140 8.424   1.00 0.00 ? 23 LYS A HA   3  
ATOM 2982  H HB2  . LYS A 1 23 ? -4.508  -11.531 7.165   1.00 0.00 ? 23 LYS A HB2  3  
ATOM 2983  H HB3  . LYS A 1 23 ? -5.918  -11.970 8.113   1.00 0.00 ? 23 LYS A HB3  3  
ATOM 2984  H HG2  . LYS A 1 23 ? -3.733  -12.394 9.860   1.00 0.00 ? 23 LYS A HG2  3  
ATOM 2985  H HG3  . LYS A 1 23 ? -3.339  -10.896 9.030   1.00 0.00 ? 23 LYS A HG3  3  
ATOM 2986  H HD2  . LYS A 1 23 ? -5.469  -9.908  9.746   1.00 0.00 ? 23 LYS A HD2  3  
ATOM 2987  H HD3  . LYS A 1 23 ? -5.959  -11.447 10.461  1.00 0.00 ? 23 LYS A HD3  3  
ATOM 2988  H HE2  . LYS A 1 23 ? -5.107  -10.000 12.215  1.00 0.00 ? 23 LYS A HE2  3  
ATOM 2989  H HE3  . LYS A 1 23 ? -3.979  -11.333 11.968  1.00 0.00 ? 23 LYS A HE3  3  
ATOM 2990  H HZ1  . LYS A 1 23 ? -3.083  -9.497  10.222  1.00 0.00 ? 23 LYS A HZ1  3  
ATOM 2991  H HZ2  . LYS A 1 23 ? -2.470  -9.714  11.791  1.00 0.00 ? 23 LYS A HZ2  3  
ATOM 2992  H HZ3  . LYS A 1 23 ? -3.628  -8.509  11.489  1.00 0.00 ? 23 LYS A HZ3  3  
ATOM 2993  N N    . THR A 1 24 ? -5.971  -14.355 5.991   1.00 0.00 ? 24 THR A N    3  
ATOM 2994  C CA   . THR A 1 24 ? -6.297  -14.749 4.587   1.00 0.00 ? 24 THR A CA   3  
ATOM 2995  C C    . THR A 1 24 ? -6.545  -13.512 3.719   1.00 0.00 ? 24 THR A C    3  
ATOM 2996  O O    . THR A 1 24 ? -6.808  -12.435 4.214   1.00 0.00 ? 24 THR A O    3  
ATOM 2997  C CB   . THR A 1 24 ? -7.565  -15.618 4.571   1.00 0.00 ? 24 THR A CB   3  
ATOM 2998  O OG1  . THR A 1 24 ? -8.707  -14.784 4.428   1.00 0.00 ? 24 THR A OG1  3  
ATOM 2999  C CG2  . THR A 1 24 ? -7.678  -16.403 5.875   1.00 0.00 ? 24 THR A CG2  3  
ATOM 3000  H H    . THR A 1 24 ? -6.661  -14.416 6.683   1.00 0.00 ? 24 THR A H    3  
ATOM 3001  H HA   . THR A 1 24 ? -5.478  -15.307 4.155   1.00 0.00 ? 24 THR A HA   3  
ATOM 3002  H HB   . THR A 1 24 ? -7.522  -16.310 3.743   1.00 0.00 ? 24 THR A HB   3  
ATOM 3003  H HG1  . THR A 1 24 ? -9.413  -15.311 4.049   1.00 0.00 ? 24 THR A HG1  3  
ATOM 3004  H HG21 . THR A 1 24 ? -6.741  -16.899 6.079   1.00 0.00 ? 24 THR A HG21 3  
ATOM 3005  H HG22 . THR A 1 24 ? -8.463  -17.138 5.781   1.00 0.00 ? 24 THR A HG22 3  
ATOM 3006  H HG23 . THR A 1 24 ? -7.912  -15.727 6.681   1.00 0.00 ? 24 THR A HG23 3  
ATOM 3007  N N    . GLU A 1 25 ? -6.490  -13.673 2.424   1.00 0.00 ? 25 GLU A N    3  
ATOM 3008  C CA   . GLU A 1 25 ? -6.750  -12.518 1.515   1.00 0.00 ? 25 GLU A CA   3  
ATOM 3009  C C    . GLU A 1 25 ? -8.111  -11.915 1.887   1.00 0.00 ? 25 GLU A C    3  
ATOM 3010  O O    . GLU A 1 25 ? -8.270  -10.714 1.983   1.00 0.00 ? 25 GLU A O    3  
ATOM 3011  C CB   . GLU A 1 25 ? -6.769  -13.014 0.063   1.00 0.00 ? 25 GLU A CB   3  
ATOM 3012  C CG   . GLU A 1 25 ? -6.686  -11.827 -0.901  1.00 0.00 ? 25 GLU A CG   3  
ATOM 3013  C CD   . GLU A 1 25 ? -7.174  -12.253 -2.289  1.00 0.00 ? 25 GLU A CD   3  
ATOM 3014  O OE1  . GLU A 1 25 ? -8.329  -12.628 -2.399  1.00 0.00 ? 25 GLU A OE1  3  
ATOM 3015  O OE2  . GLU A 1 25 ? -6.383  -12.197 -3.216  1.00 0.00 ? 25 GLU A OE2  3  
ATOM 3016  H H    . GLU A 1 25 ? -6.295  -14.562 2.062   1.00 0.00 ? 25 GLU A H    3  
ATOM 3017  H HA   . GLU A 1 25 ? -5.975  -11.772 1.648   1.00 0.00 ? 25 GLU A HA   3  
ATOM 3018  H HB2  . GLU A 1 25 ? -5.924  -13.669 -0.102  1.00 0.00 ? 25 GLU A HB2  3  
ATOM 3019  H HB3  . GLU A 1 25 ? -7.685  -13.559 -0.114  1.00 0.00 ? 25 GLU A HB3  3  
ATOM 3020  H HG2  . GLU A 1 25 ? -7.304  -11.020 -0.535  1.00 0.00 ? 25 GLU A HG2  3  
ATOM 3021  H HG3  . GLU A 1 25 ? -5.661  -11.496 -0.972  1.00 0.00 ? 25 GLU A HG3  3  
ATOM 3022  N N    . LYS A 1 26 ? -9.095  -12.751 2.087   1.00 0.00 ? 26 LYS A N    3  
ATOM 3023  C CA   . LYS A 1 26 ? -10.460 -12.263 2.445   1.00 0.00 ? 26 LYS A CA   3  
ATOM 3024  C C    . LYS A 1 26 ? -10.421 -11.376 3.695   1.00 0.00 ? 26 LYS A C    3  
ATOM 3025  O O    . LYS A 1 26 ? -11.205 -10.457 3.830   1.00 0.00 ? 26 LYS A O    3  
ATOM 3026  C CB   . LYS A 1 26 ? -11.376 -13.463 2.703   1.00 0.00 ? 26 LYS A CB   3  
ATOM 3027  C CG   . LYS A 1 26 ? -12.778 -12.966 3.062   1.00 0.00 ? 26 LYS A CG   3  
ATOM 3028  C CD   . LYS A 1 26 ? -13.774 -14.123 2.970   1.00 0.00 ? 26 LYS A CD   3  
ATOM 3029  C CE   . LYS A 1 26 ? -15.192 -13.596 3.191   1.00 0.00 ? 26 LYS A CE   3  
ATOM 3030  N NZ   . LYS A 1 26 ? -15.199 -12.659 4.350   1.00 0.00 ? 26 LYS A NZ   3  
ATOM 3031  H H    . LYS A 1 26 ? -8.937  -13.712 1.988   1.00 0.00 ? 26 LYS A H    3  
ATOM 3032  H HA   . LYS A 1 26 ? -10.861 -11.687 1.635   1.00 0.00 ? 26 LYS A HA   3  
ATOM 3033  H HB2  . LYS A 1 26 ? -11.426 -14.074 1.813   1.00 0.00 ? 26 LYS A HB2  3  
ATOM 3034  H HB3  . LYS A 1 26 ? -10.983 -14.048 3.519   1.00 0.00 ? 26 LYS A HB3  3  
ATOM 3035  H HG2  . LYS A 1 26 ? -12.773 -12.573 4.068   1.00 0.00 ? 26 LYS A HG2  3  
ATOM 3036  H HG3  . LYS A 1 26 ? -13.070 -12.186 2.374   1.00 0.00 ? 26 LYS A HG3  3  
ATOM 3037  H HD2  . LYS A 1 26 ? -13.707 -14.580 1.992   1.00 0.00 ? 26 LYS A HD2  3  
ATOM 3038  H HD3  . LYS A 1 26 ? -13.543 -14.859 3.726   1.00 0.00 ? 26 LYS A HD3  3  
ATOM 3039  H HE2  . LYS A 1 26 ? -15.526 -13.075 2.305   1.00 0.00 ? 26 LYS A HE2  3  
ATOM 3040  H HE3  . LYS A 1 26 ? -15.857 -14.423 3.394   1.00 0.00 ? 26 LYS A HE3  3  
ATOM 3041  H HZ1  . LYS A 1 26 ? -16.062 -12.805 4.909   1.00 0.00 ? 26 LYS A HZ1  3  
ATOM 3042  H HZ2  . LYS A 1 26 ? -15.174 -11.678 4.001   1.00 0.00 ? 26 LYS A HZ2  3  
ATOM 3043  H HZ3  . LYS A 1 26 ? -14.367 -12.837 4.945   1.00 0.00 ? 26 LYS A HZ3  3  
ATOM 3044  N N    . GLU A 1 27 ? -9.536  -11.637 4.612   1.00 0.00 ? 27 GLU A N    3  
ATOM 3045  C CA   . GLU A 1 27 ? -9.482  -10.797 5.847   1.00 0.00 ? 27 GLU A CA   3  
ATOM 3046  C C    . GLU A 1 27 ? -8.822  -9.445  5.542   1.00 0.00 ? 27 GLU A C    3  
ATOM 3047  O O    . GLU A 1 27 ? -9.194  -8.432  6.100   1.00 0.00 ? 27 GLU A O    3  
ATOM 3048  C CB   . GLU A 1 27 ? -8.670  -11.512 6.929   1.00 0.00 ? 27 GLU A CB   3  
ATOM 3049  C CG   . GLU A 1 27 ? -9.474  -12.667 7.520   1.00 0.00 ? 27 GLU A CG   3  
ATOM 3050  C CD   . GLU A 1 27 ? -8.610  -13.428 8.529   1.00 0.00 ? 27 GLU A CD   3  
ATOM 3051  O OE1  . GLU A 1 27 ? -7.831  -12.786 9.215   1.00 0.00 ? 27 GLU A OE1  3  
ATOM 3052  O OE2  . GLU A 1 27 ? -8.743  -14.638 8.598   1.00 0.00 ? 27 GLU A OE2  3  
ATOM 3053  H H    . GLU A 1 27 ? -8.912  -12.384 4.492   1.00 0.00 ? 27 GLU A H    3  
ATOM 3054  H HA   . GLU A 1 27 ? -10.486 -10.631 6.207   1.00 0.00 ? 27 GLU A HA   3  
ATOM 3055  H HB2  . GLU A 1 27 ? -7.757  -11.894 6.502   1.00 0.00 ? 27 GLU A HB2  3  
ATOM 3056  H HB3  . GLU A 1 27 ? -8.438  -10.810 7.711   1.00 0.00 ? 27 GLU A HB3  3  
ATOM 3057  H HG2  . GLU A 1 27 ? -10.346 -12.277 8.020   1.00 0.00 ? 27 GLU A HG2  3  
ATOM 3058  H HG3  . GLU A 1 27 ? -9.774  -13.336 6.733   1.00 0.00 ? 27 GLU A HG3  3  
ATOM 3059  N N    . ILE A 1 28 ? -7.845  -9.411  4.680   1.00 0.00 ? 28 ILE A N    3  
ATOM 3060  C CA   . ILE A 1 28 ? -7.172  -8.116  4.373   1.00 0.00 ? 28 ILE A CA   3  
ATOM 3061  C C    . ILE A 1 28 ? -8.169  -7.185  3.693   1.00 0.00 ? 28 ILE A C    3  
ATOM 3062  O O    . ILE A 1 28 ? -8.212  -6.002  3.966   1.00 0.00 ? 28 ILE A O    3  
ATOM 3063  C CB   . ILE A 1 28 ? -5.961  -8.411  3.473   1.00 0.00 ? 28 ILE A CB   3  
ATOM 3064  C CG1  . ILE A 1 28 ? -5.261  -9.680  4.031   1.00 0.00 ? 28 ILE A CG1  3  
ATOM 3065  C CG2  . ILE A 1 28 ? -5.017  -7.205  3.447   1.00 0.00 ? 28 ILE A CG2  3  
ATOM 3066  C CD1  . ILE A 1 28 ? -3.732  -9.647  3.888   1.00 0.00 ? 28 ILE A CD1  3  
ATOM 3067  H H    . ILE A 1 28 ? -7.549  -10.233 4.237   1.00 0.00 ? 28 ILE A H    3  
ATOM 3068  H HA   . ILE A 1 28 ? -6.845  -7.666  5.299   1.00 0.00 ? 28 ILE A HA   3  
ATOM 3069  H HB   . ILE A 1 28 ? -6.308  -8.604  2.469   1.00 0.00 ? 28 ILE A HB   3  
ATOM 3070  H HG12 . ILE A 1 28 ? -5.497  -9.774  5.068   1.00 0.00 ? 28 ILE A HG12 3  
ATOM 3071  H HG13 . ILE A 1 28 ? -5.639  -10.544 3.518   1.00 0.00 ? 28 ILE A HG13 3  
ATOM 3072  H HG21 . ILE A 1 28 ? -4.235  -7.380  2.722   1.00 0.00 ? 28 ILE A HG21 3  
ATOM 3073  H HG22 . ILE A 1 28 ? -4.579  -7.064  4.422   1.00 0.00 ? 28 ILE A HG22 3  
ATOM 3074  H HG23 . ILE A 1 28 ? -5.569  -6.324  3.168   1.00 0.00 ? 28 ILE A HG23 3  
ATOM 3075  H HD11 . ILE A 1 28 ? -3.328  -10.598 4.217   1.00 0.00 ? 28 ILE A HD11 3  
ATOM 3076  H HD12 . ILE A 1 28 ? -3.326  -8.859  4.502   1.00 0.00 ? 28 ILE A HD12 3  
ATOM 3077  H HD13 . ILE A 1 28 ? -3.464  -9.481  2.856   1.00 0.00 ? 28 ILE A HD13 3  
ATOM 3078  N N    . LEU A 1 29 ? -8.981  -7.701  2.821   1.00 0.00 ? 29 LEU A N    3  
ATOM 3079  C CA   . LEU A 1 29 ? -9.980  -6.840  2.140   1.00 0.00 ? 29 LEU A CA   3  
ATOM 3080  C C    . LEU A 1 29 ? -11.093 -6.461  3.128   1.00 0.00 ? 29 LEU A C    3  
ATOM 3081  O O    . LEU A 1 29 ? -11.686 -5.408  3.041   1.00 0.00 ? 29 LEU A O    3  
ATOM 3082  C CB   . LEU A 1 29 ? -10.561 -7.610  0.955   1.00 0.00 ? 29 LEU A CB   3  
ATOM 3083  C CG   . LEU A 1 29 ? -9.413  -8.132  0.080   1.00 0.00 ? 29 LEU A CG   3  
ATOM 3084  C CD1  . LEU A 1 29 ? -9.992  -8.972  -1.062  1.00 0.00 ? 29 LEU A CD1  3  
ATOM 3085  C CD2  . LEU A 1 29 ? -8.623  -6.947  -0.504  1.00 0.00 ? 29 LEU A CD2  3  
ATOM 3086  H H    . LEU A 1 29 ? -8.938  -8.655  2.600   1.00 0.00 ? 29 LEU A H    3  
ATOM 3087  H HA   . LEU A 1 29 ? -9.500  -5.941  1.785   1.00 0.00 ? 29 LEU A HA   3  
ATOM 3088  H HB2  . LEU A 1 29 ? -11.144 -8.446  1.320   1.00 0.00 ? 29 LEU A HB2  3  
ATOM 3089  H HB3  . LEU A 1 29 ? -11.190 -6.957  0.370   1.00 0.00 ? 29 LEU A HB3  3  
ATOM 3090  H HG   . LEU A 1 29 ? -8.750  -8.747  0.684   1.00 0.00 ? 29 LEU A HG   3  
ATOM 3091  H HD11 . LEU A 1 29 ? -10.780 -8.421  -1.551  1.00 0.00 ? 29 LEU A HD11 3  
ATOM 3092  H HD12 . LEU A 1 29 ? -10.390 -9.894  -0.667  1.00 0.00 ? 29 LEU A HD12 3  
ATOM 3093  H HD13 . LEU A 1 29 ? -9.213  -9.195  -1.777  1.00 0.00 ? 29 LEU A HD13 3  
ATOM 3094  H HD21 . LEU A 1 29 ? -7.915  -6.589  0.230   1.00 0.00 ? 29 LEU A HD21 3  
ATOM 3095  H HD22 . LEU A 1 29 ? -9.303  -6.149  -0.766  1.00 0.00 ? 29 LEU A HD22 3  
ATOM 3096  H HD23 . LEU A 1 29 ? -8.089  -7.265  -1.388  1.00 0.00 ? 29 LEU A HD23 3  
ATOM 3097  N N    . ASP A 1 30 ? -11.366 -7.313  4.080   1.00 0.00 ? 30 ASP A N    3  
ATOM 3098  C CA   . ASP A 1 30 ? -12.417 -6.993  5.092   1.00 0.00 ? 30 ASP A CA   3  
ATOM 3099  C C    . ASP A 1 30 ? -11.915 -5.844  5.978   1.00 0.00 ? 30 ASP A C    3  
ATOM 3100  O O    . ASP A 1 30 ? -12.639 -4.914  6.273   1.00 0.00 ? 30 ASP A O    3  
ATOM 3101  C CB   . ASP A 1 30 ? -12.694 -8.226  5.956   1.00 0.00 ? 30 ASP A CB   3  
ATOM 3102  C CG   . ASP A 1 30 ? -13.876 -7.943  6.885   1.00 0.00 ? 30 ASP A CG   3  
ATOM 3103  O OD1  . ASP A 1 30 ? -14.786 -7.250  6.459   1.00 0.00 ? 30 ASP A OD1  3  
ATOM 3104  O OD2  . ASP A 1 30 ? -13.851 -8.424  8.006   1.00 0.00 ? 30 ASP A OD2  3  
ATOM 3105  H H    . ASP A 1 30 ? -10.869 -8.157  4.122   1.00 0.00 ? 30 ASP A H    3  
ATOM 3106  H HA   . ASP A 1 30 ? -13.326 -6.679  4.599   1.00 0.00 ? 30 ASP A HA   3  
ATOM 3107  H HB2  . ASP A 1 30 ? -12.929 -9.066  5.318   1.00 0.00 ? 30 ASP A HB2  3  
ATOM 3108  H HB3  . ASP A 1 30 ? -11.821 -8.455  6.548   1.00 0.00 ? 30 ASP A HB3  3  
ATOM 3109  N N    . ALA A 1 31 ? -10.691 -5.916  6.422   1.00 0.00 ? 31 ALA A N    3  
ATOM 3110  C CA   . ALA A 1 31 ? -10.143 -4.848  7.313   1.00 0.00 ? 31 ALA A CA   3  
ATOM 3111  C C    . ALA A 1 31 ? -10.012 -3.522  6.548   1.00 0.00 ? 31 ALA A C    3  
ATOM 3112  O O    . ALA A 1 31 ? -10.050 -2.462  7.140   1.00 0.00 ? 31 ALA A O    3  
ATOM 3113  C CB   . ALA A 1 31 ? -8.772  -5.295  7.829   1.00 0.00 ? 31 ALA A CB   3  
ATOM 3114  H H    . ALA A 1 31 ? -10.132 -6.686  6.186   1.00 0.00 ? 31 ALA A H    3  
ATOM 3115  H HA   . ALA A 1 31 ? -10.806 -4.709  8.152   1.00 0.00 ? 31 ALA A HA   3  
ATOM 3116  H HB1  . ALA A 1 31 ? -8.043  -5.215  7.036   1.00 0.00 ? 31 ALA A HB1  3  
ATOM 3117  H HB2  . ALA A 1 31 ? -8.831  -6.322  8.157   1.00 0.00 ? 31 ALA A HB2  3  
ATOM 3118  H HB3  . ALA A 1 31 ? -8.476  -4.671  8.658   1.00 0.00 ? 31 ALA A HB3  3  
ATOM 3119  N N    . PHE A 1 32 ? -9.891  -3.554  5.255   1.00 0.00 ? 32 PHE A N    3  
ATOM 3120  C CA   . PHE A 1 32 ? -9.799  -2.274  4.484   1.00 0.00 ? 32 PHE A CA   3  
ATOM 3121  C C    . PHE A 1 32 ? -10.990 -1.381  4.847   1.00 0.00 ? 32 PHE A C    3  
ATOM 3122  O O    . PHE A 1 32 ? -11.051 -0.230  4.465   1.00 0.00 ? 32 PHE A O    3  
ATOM 3123  C CB   . PHE A 1 32 ? -9.852  -2.620  2.987   1.00 0.00 ? 32 PHE A CB   3  
ATOM 3124  C CG   . PHE A 1 32 ? -8.490  -3.054  2.450   1.00 0.00 ? 32 PHE A CG   3  
ATOM 3125  C CD1  . PHE A 1 32 ? -7.419  -3.418  3.301   1.00 0.00 ? 32 PHE A CD1  3  
ATOM 3126  C CD2  . PHE A 1 32 ? -8.300  -3.079  1.061   1.00 0.00 ? 32 PHE A CD2  3  
ATOM 3127  C CE1  . PHE A 1 32 ? -6.187  -3.793  2.752   1.00 0.00 ? 32 PHE A CE1  3  
ATOM 3128  C CE2  . PHE A 1 32 ? -7.065  -3.453  0.522   1.00 0.00 ? 32 PHE A CE2  3  
ATOM 3129  C CZ   . PHE A 1 32 ? -6.009  -3.806  1.366   1.00 0.00 ? 32 PHE A CZ   3  
ATOM 3130  H H    . PHE A 1 32 ? -9.885  -4.409  4.777   1.00 0.00 ? 32 PHE A H    3  
ATOM 3131  H HA   . PHE A 1 32 ? -8.873  -1.759  4.699   1.00 0.00 ? 32 PHE A HA   3  
ATOM 3132  H HB2  . PHE A 1 32 ? -10.556 -3.417  2.838   1.00 0.00 ? 32 PHE A HB2  3  
ATOM 3133  H HB3  . PHE A 1 32 ? -10.187 -1.754  2.434   1.00 0.00 ? 32 PHE A HB3  3  
ATOM 3134  H HD1  . PHE A 1 32 ? -7.537  -3.430  4.371   1.00 0.00 ? 32 PHE A HD1  3  
ATOM 3135  H HD2  . PHE A 1 32 ? -9.113  -2.811  0.404   1.00 0.00 ? 32 PHE A HD2  3  
ATOM 3136  H HE1  . PHE A 1 32 ? -5.368  -4.057  3.404   1.00 0.00 ? 32 PHE A HE1  3  
ATOM 3137  H HE2  . PHE A 1 32 ? -6.926  -3.470  -0.549  1.00 0.00 ? 32 PHE A HE2  3  
ATOM 3138  H HZ   . PHE A 1 32 ? -5.057  -4.095  0.948   1.00 0.00 ? 32 PHE A HZ   3  
ATOM 3139  N N    . ASP A 1 33 ? -11.951 -1.910  5.552   1.00 0.00 ? 33 ASP A N    3  
ATOM 3140  C CA   . ASP A 1 33 ? -13.152 -1.097  5.903   1.00 0.00 ? 33 ASP A CA   3  
ATOM 3141  C C    . ASP A 1 33 ? -12.892 -0.253  7.151   1.00 0.00 ? 33 ASP A C    3  
ATOM 3142  O O    . ASP A 1 33 ? -13.584 0.714   7.397   1.00 0.00 ? 33 ASP A O    3  
ATOM 3143  C CB   . ASP A 1 33 ? -14.330 -2.036  6.168   1.00 0.00 ? 33 ASP A CB   3  
ATOM 3144  C CG   . ASP A 1 33 ? -14.625 -2.854  4.909   1.00 0.00 ? 33 ASP A CG   3  
ATOM 3145  O OD1  . ASP A 1 33 ? -13.744 -3.582  4.481   1.00 0.00 ? 33 ASP A OD1  3  
ATOM 3146  O OD2  . ASP A 1 33 ? -15.724 -2.737  4.395   1.00 0.00 ? 33 ASP A OD2  3  
ATOM 3147  H H    . ASP A 1 33 ? -11.894 -2.848  5.834   1.00 0.00 ? 33 ASP A H    3  
ATOM 3148  H HA   . ASP A 1 33 ? -13.398 -0.446  5.077   1.00 0.00 ? 33 ASP A HA   3  
ATOM 3149  H HB2  . ASP A 1 33 ? -14.084 -2.702  6.982   1.00 0.00 ? 33 ASP A HB2  3  
ATOM 3150  H HB3  . ASP A 1 33 ? -15.202 -1.455  6.429   1.00 0.00 ? 33 ASP A HB3  3  
ATOM 3151  N N    . LYS A 1 34 ? -11.895 -0.591  7.933   1.00 0.00 ? 34 LYS A N    3  
ATOM 3152  C CA   . LYS A 1 34 ? -11.584 0.213   9.160   1.00 0.00 ? 34 LYS A CA   3  
ATOM 3153  C C    . LYS A 1 34 ? -10.083 0.516   9.201   1.00 0.00 ? 34 LYS A C    3  
ATOM 3154  O O    . LYS A 1 34 ? -9.564  0.981   10.197  1.00 0.00 ? 34 LYS A O    3  
ATOM 3155  C CB   . LYS A 1 34 ? -12.002 -0.558  10.417  1.00 0.00 ? 34 LYS A CB   3  
ATOM 3156  C CG   . LYS A 1 34 ? -11.245 -1.885  10.508  1.00 0.00 ? 34 LYS A CG   3  
ATOM 3157  C CD   . LYS A 1 34 ? -11.711 -2.640  11.756  1.00 0.00 ? 34 LYS A CD   3  
ATOM 3158  C CE   . LYS A 1 34 ? -10.772 -3.816  12.035  1.00 0.00 ? 34 LYS A CE   3  
ATOM 3159  N NZ   . LYS A 1 34 ? -11.089 -4.398  13.370  1.00 0.00 ? 34 LYS A NZ   3  
ATOM 3160  H H    . LYS A 1 34 ? -11.343 -1.372  7.719   1.00 0.00 ? 34 LYS A H    3  
ATOM 3161  H HA   . LYS A 1 34 ? -12.121 1.153   9.129   1.00 0.00 ? 34 LYS A HA   3  
ATOM 3162  H HB2  . LYS A 1 34 ? -11.781 0.038   11.291  1.00 0.00 ? 34 LYS A HB2  3  
ATOM 3163  H HB3  . LYS A 1 34 ? -13.062 -0.754  10.379  1.00 0.00 ? 34 LYS A HB3  3  
ATOM 3164  H HG2  . LYS A 1 34 ? -11.449 -2.479  9.628   1.00 0.00 ? 34 LYS A HG2  3  
ATOM 3165  H HG3  . LYS A 1 34 ? -10.186 -1.694  10.579  1.00 0.00 ? 34 LYS A HG3  3  
ATOM 3166  H HD2  . LYS A 1 34 ? -11.708 -1.970  12.603  1.00 0.00 ? 34 LYS A HD2  3  
ATOM 3167  H HD3  . LYS A 1 34 ? -12.712 -3.013  11.598  1.00 0.00 ? 34 LYS A HD3  3  
ATOM 3168  H HE2  . LYS A 1 34 ? -10.904 -4.570  11.275  1.00 0.00 ? 34 LYS A HE2  3  
ATOM 3169  H HE3  . LYS A 1 34 ? -9.748  -3.472  12.027  1.00 0.00 ? 34 LYS A HE3  3  
ATOM 3170  H HZ1  . LYS A 1 34 ? -10.821 -5.402  13.384  1.00 0.00 ? 34 LYS A HZ1  3  
ATOM 3171  H HZ2  . LYS A 1 34 ? -12.110 -4.308  13.553  1.00 0.00 ? 34 LYS A HZ2  3  
ATOM 3172  H HZ3  . LYS A 1 34 ? -10.558 -3.890  14.105  1.00 0.00 ? 34 LYS A HZ3  3  
ATOM 3173  N N    . MET A 1 35 ? -9.375  0.261   8.128   1.00 0.00 ? 35 MET A N    3  
ATOM 3174  C CA   . MET A 1 35 ? -7.908  0.545   8.119   1.00 0.00 ? 35 MET A CA   3  
ATOM 3175  C C    . MET A 1 35 ? -7.694  2.043   7.876   1.00 0.00 ? 35 MET A C    3  
ATOM 3176  O O    . MET A 1 35 ? -6.869  2.655   8.526   1.00 0.00 ? 35 MET A O    3  
ATOM 3177  C CB   . MET A 1 35 ? -7.224  -0.296  7.017   1.00 0.00 ? 35 MET A CB   3  
ATOM 3178  C CG   . MET A 1 35 ? -5.973  -0.989  7.558   1.00 0.00 ? 35 MET A CG   3  
ATOM 3179  S SD   . MET A 1 35 ? -4.959  -1.570  6.171   1.00 0.00 ? 35 MET A SD   3  
ATOM 3180  C CE   . MET A 1 35 ? -5.195  -3.348  6.415   1.00 0.00 ? 35 MET A CE   3  
ATOM 3181  H H    . MET A 1 35 ? -9.808  -0.109  7.329   1.00 0.00 ? 35 MET A H    3  
ATOM 3182  H HA   . MET A 1 35 ? -7.498  0.288   9.088   1.00 0.00 ? 35 MET A HA   3  
ATOM 3183  H HB2  . MET A 1 35 ? -7.911  -1.044  6.687   1.00 0.00 ? 35 MET A HB2  3  
ATOM 3184  H HB3  . MET A 1 35 ? -6.944  0.328   6.178   1.00 0.00 ? 35 MET A HB3  3  
ATOM 3185  H HG2  . MET A 1 35 ? -5.408  -0.289  8.153   1.00 0.00 ? 35 MET A HG2  3  
ATOM 3186  H HG3  . MET A 1 35 ? -6.269  -1.825  8.171   1.00 0.00 ? 35 MET A HG3  3  
ATOM 3187  H HE1  . MET A 1 35 ? -4.843  -3.622  7.398   1.00 0.00 ? 35 MET A HE1  3  
ATOM 3188  H HE2  . MET A 1 35 ? -4.638  -3.895  5.670   1.00 0.00 ? 35 MET A HE2  3  
ATOM 3189  H HE3  . MET A 1 35 ? -6.247  -3.588  6.324   1.00 0.00 ? 35 MET A HE3  3  
ATOM 3190  N N    . CYS A 1 36 ? -8.411  2.666   6.970   1.00 0.00 ? 36 CYS A N    3  
ATOM 3191  C CA   . CYS A 1 36 ? -8.169  4.118   6.784   1.00 0.00 ? 36 CYS A CA   3  
ATOM 3192  C C    . CYS A 1 36 ? -8.564  4.805   8.087   1.00 0.00 ? 36 CYS A C    3  
ATOM 3193  O O    . CYS A 1 36 ? -8.455  6.007   8.230   1.00 0.00 ? 36 CYS A O    3  
ATOM 3194  C CB   . CYS A 1 36 ? -8.981  4.687   5.616   1.00 0.00 ? 36 CYS A CB   3  
ATOM 3195  S SG   . CYS A 1 36 ? -8.182  6.189   5.017   1.00 0.00 ? 36 CYS A SG   3  
ATOM 3196  H H    . CYS A 1 36 ? -9.088  2.196   6.438   1.00 0.00 ? 36 CYS A H    3  
ATOM 3197  H HA   . CYS A 1 36 ? -7.114  4.266   6.627   1.00 0.00 ? 36 CYS A HA   3  
ATOM 3198  H HB2  . CYS A 1 36 ? -9.024  3.966   4.820   1.00 0.00 ? 36 CYS A HB2  3  
ATOM 3199  H HB3  . CYS A 1 36 ? -9.984  4.921   5.942   1.00 0.00 ? 36 CYS A HB3  3  
ATOM 3200  N N    . SER A 1 37 ? -9.035  4.047   9.036   1.00 0.00 ? 37 SER A N    3  
ATOM 3201  C CA   . SER A 1 37 ? -9.453  4.658   10.334  1.00 0.00 ? 37 SER A CA   3  
ATOM 3202  C C    . SER A 1 37 ? -8.232  4.949   11.222  1.00 0.00 ? 37 SER A C    3  
ATOM 3203  O O    . SER A 1 37 ? -8.365  5.539   12.277  1.00 0.00 ? 37 SER A O    3  
ATOM 3204  C CB   . SER A 1 37 ? -10.392 3.698   11.067  1.00 0.00 ? 37 SER A CB   3  
ATOM 3205  O OG   . SER A 1 37 ? -11.105 4.413   12.067  1.00 0.00 ? 37 SER A OG   3  
ATOM 3206  H H    . SER A 1 37 ? -9.126  3.072   8.888   1.00 0.00 ? 37 SER A H    3  
ATOM 3207  H HA   . SER A 1 37 ? -9.977  5.583   10.138  1.00 0.00 ? 37 SER A HA   3  
ATOM 3208  H HB2  . SER A 1 37 ? -11.094 3.274   10.368  1.00 0.00 ? 37 SER A HB2  3  
ATOM 3209  H HB3  . SER A 1 37 ? -9.814  2.905   11.521  1.00 0.00 ? 37 SER A HB3  3  
ATOM 3210  H HG   . SER A 1 37 ? -10.464 4.816   12.658  1.00 0.00 ? 37 SER A HG   3  
ATOM 3211  N N    . LYS A 1 38 ? -7.049  4.535   10.827  1.00 0.00 ? 38 LYS A N    3  
ATOM 3212  C CA   . LYS A 1 38 ? -5.835  4.786   11.682  1.00 0.00 ? 38 LYS A CA   3  
ATOM 3213  C C    . LYS A 1 38 ? -5.052  6.012   11.171  1.00 0.00 ? 38 LYS A C    3  
ATOM 3214  O O    . LYS A 1 38 ? -4.061  6.403   11.754  1.00 0.00 ? 38 LYS A O    3  
ATOM 3215  C CB   . LYS A 1 38 ? -4.932  3.539   11.663  1.00 0.00 ? 38 LYS A CB   3  
ATOM 3216  C CG   . LYS A 1 38 ? -5.454  2.493   12.657  1.00 0.00 ? 38 LYS A CG   3  
ATOM 3217  C CD   . LYS A 1 38 ? -6.845  2.018   12.226  1.00 0.00 ? 38 LYS A CD   3  
ATOM 3218  C CE   . LYS A 1 38 ? -7.185  0.710   12.943  1.00 0.00 ? 38 LYS A CE   3  
ATOM 3219  N NZ   . LYS A 1 38 ? -6.879  0.846   14.396  1.00 0.00 ? 38 LYS A NZ   3  
ATOM 3220  H H    . LYS A 1 38 ? -6.958  4.051   9.980   1.00 0.00 ? 38 LYS A H    3  
ATOM 3221  H HA   . LYS A 1 38 ? -6.145  4.979   12.702  1.00 0.00 ? 38 LYS A HA   3  
ATOM 3222  H HB2  . LYS A 1 38 ? -4.927  3.112   10.673  1.00 0.00 ? 38 LYS A HB2  3  
ATOM 3223  H HB3  . LYS A 1 38 ? -3.925  3.815   11.942  1.00 0.00 ? 38 LYS A HB3  3  
ATOM 3224  H HG2  . LYS A 1 38 ? -4.776  1.653   12.680  1.00 0.00 ? 38 LYS A HG2  3  
ATOM 3225  H HG3  . LYS A 1 38 ? -5.515  2.931   13.642  1.00 0.00 ? 38 LYS A HG3  3  
ATOM 3226  H HD2  . LYS A 1 38 ? -7.576  2.770   12.484  1.00 0.00 ? 38 LYS A HD2  3  
ATOM 3227  H HD3  . LYS A 1 38 ? -6.857  1.854   11.159  1.00 0.00 ? 38 LYS A HD3  3  
ATOM 3228  H HE2  . LYS A 1 38 ? -8.235  0.492   12.816  1.00 0.00 ? 38 LYS A HE2  3  
ATOM 3229  H HE3  . LYS A 1 38 ? -6.597  -0.093  12.525  1.00 0.00 ? 38 LYS A HE3  3  
ATOM 3230  H HZ1  . LYS A 1 38 ? -6.615  1.830   14.604  1.00 0.00 ? 38 LYS A HZ1  3  
ATOM 3231  H HZ2  . LYS A 1 38 ? -6.090  0.214   14.644  1.00 0.00 ? 38 LYS A HZ2  3  
ATOM 3232  H HZ3  . LYS A 1 38 ? -7.718  0.589   14.953  1.00 0.00 ? 38 LYS A HZ3  3  
ATOM 3233  N N    . LEU A 1 39 ? -5.497  6.634   10.104  1.00 0.00 ? 39 LEU A N    3  
ATOM 3234  C CA   . LEU A 1 39 ? -4.789  7.852   9.571   1.00 0.00 ? 39 LEU A CA   3  
ATOM 3235  C C    . LEU A 1 39 ? -5.625  9.096   9.943   1.00 0.00 ? 39 LEU A C    3  
ATOM 3236  O O    . LEU A 1 39 ? -6.837  9.029   9.886   1.00 0.00 ? 39 LEU A O    3  
ATOM 3237  C CB   . LEU A 1 39 ? -4.690  7.743   8.046   1.00 0.00 ? 39 LEU A CB   3  
ATOM 3238  C CG   . LEU A 1 39 ? -3.980  6.438   7.658   1.00 0.00 ? 39 LEU A CG   3  
ATOM 3239  C CD1  . LEU A 1 39 ? -3.980  6.294   6.135   1.00 0.00 ? 39 LEU A CD1  3  
ATOM 3240  C CD2  . LEU A 1 39 ? -2.526  6.448   8.167   1.00 0.00 ? 39 LEU A CD2  3  
ATOM 3241  H H    . LEU A 1 39 ? -6.309  6.312   9.660   1.00 0.00 ? 39 LEU A H    3  
ATOM 3242  H HA   . LEU A 1 39 ? -3.801  7.919   9.988   1.00 0.00 ? 39 LEU A HA   3  
ATOM 3243  H HB2  . LEU A 1 39 ? -5.685  7.749   7.625   1.00 0.00 ? 39 LEU A HB2  3  
ATOM 3244  H HB3  . LEU A 1 39 ? -4.134  8.581   7.657   1.00 0.00 ? 39 LEU A HB3  3  
ATOM 3245  H HG   . LEU A 1 39 ? -4.508  5.604   8.091   1.00 0.00 ? 39 LEU A HG   3  
ATOM 3246  H HD11 . LEU A 1 39 ? -3.781  5.267   5.870   1.00 0.00 ? 39 LEU A HD11 3  
ATOM 3247  H HD12 . LEU A 1 39 ? -3.216  6.926   5.714   1.00 0.00 ? 39 LEU A HD12 3  
ATOM 3248  H HD13 . LEU A 1 39 ? -4.943  6.586   5.747   1.00 0.00 ? 39 LEU A HD13 3  
ATOM 3249  H HD21 . LEU A 1 39 ? -2.503  6.174   9.209   1.00 0.00 ? 39 LEU A HD21 3  
ATOM 3250  H HD22 . LEU A 1 39 ? -2.105  7.432   8.045   1.00 0.00 ? 39 LEU A HD22 3  
ATOM 3251  H HD23 . LEU A 1 39 ? -1.938  5.739   7.600   1.00 0.00 ? 39 LEU A HD23 3  
ATOM 3252  N N    . PRO A 1 40 ? -4.994  10.204  10.313  1.00 0.00 ? 40 PRO A N    3  
ATOM 3253  C CA   . PRO A 1 40 ? -5.748  11.423  10.678  1.00 0.00 ? 40 PRO A CA   3  
ATOM 3254  C C    . PRO A 1 40 ? -6.900  11.643  9.673   1.00 0.00 ? 40 PRO A C    3  
ATOM 3255  O O    . PRO A 1 40 ? -6.877  11.125  8.573   1.00 0.00 ? 40 PRO A O    3  
ATOM 3256  C CB   . PRO A 1 40 ? -4.687  12.549  10.662  1.00 0.00 ? 40 PRO A CB   3  
ATOM 3257  C CG   . PRO A 1 40 ? -3.290  11.862  10.626  1.00 0.00 ? 40 PRO A CG   3  
ATOM 3258  C CD   . PRO A 1 40 ? -3.521  10.352  10.400  1.00 0.00 ? 40 PRO A CD   3  
ATOM 3259  H HA   . PRO A 1 40 ? -6.154  11.302  11.670  1.00 0.00 ? 40 PRO A HA   3  
ATOM 3260  H HB2  . PRO A 1 40 ? -4.811  13.170  9.784   1.00 0.00 ? 40 PRO A HB2  3  
ATOM 3261  H HB3  . PRO A 1 40 ? -4.768  13.155  11.553  1.00 0.00 ? 40 PRO A HB3  3  
ATOM 3262  H HG2  . PRO A 1 40 ? -2.697  12.271  9.816   1.00 0.00 ? 40 PRO A HG2  3  
ATOM 3263  H HG3  . PRO A 1 40 ? -2.776  12.015  11.565  1.00 0.00 ? 40 PRO A HG3  3  
ATOM 3264  H HD2  . PRO A 1 40 ? -3.046  10.039  9.486   1.00 0.00 ? 40 PRO A HD2  3  
ATOM 3265  H HD3  . PRO A 1 40 ? -3.142  9.781   11.237  1.00 0.00 ? 40 PRO A HD3  3  
ATOM 3266  N N    . LYS A 1 41 ? -7.922  12.378  10.054  1.00 0.00 ? 41 LYS A N    3  
ATOM 3267  C CA   . LYS A 1 41 ? -9.079  12.589  9.131   1.00 0.00 ? 41 LYS A CA   3  
ATOM 3268  C C    . LYS A 1 41 ? -8.666  13.344  7.867   1.00 0.00 ? 41 LYS A C    3  
ATOM 3269  O O    . LYS A 1 41 ? -9.351  13.311  6.863   1.00 0.00 ? 41 LYS A O    3  
ATOM 3270  C CB   . LYS A 1 41 ? -10.206 13.340  9.837   1.00 0.00 ? 41 LYS A CB   3  
ATOM 3271  C CG   . LYS A 1 41 ? -11.459 13.314  8.953   1.00 0.00 ? 41 LYS A CG   3  
ATOM 3272  C CD   . LYS A 1 41 ? -12.655 13.847  9.744   1.00 0.00 ? 41 LYS A CD   3  
ATOM 3273  C CE   . LYS A 1 41 ? -13.921 13.739  8.891   1.00 0.00 ? 41 LYS A CE   3  
ATOM 3274  N NZ   . LYS A 1 41 ? -14.068 12.341  8.392   1.00 0.00 ? 41 LYS A NZ   3  
ATOM 3275  H H    . LYS A 1 41 ? -7.934  12.777  10.949  1.00 0.00 ? 41 LYS A H    3  
ATOM 3276  H HA   . LYS A 1 41 ? -9.447  11.635  8.785   1.00 0.00 ? 41 LYS A HA   3  
ATOM 3277  H HB2  . LYS A 1 41 ? -10.419 12.866  10.783  1.00 0.00 ? 41 LYS A HB2  3  
ATOM 3278  H HB3  . LYS A 1 41 ? -9.907  14.364  10.004  1.00 0.00 ? 41 LYS A HB3  3  
ATOM 3279  H HG2  . LYS A 1 41 ? -11.296 13.932  8.083   1.00 0.00 ? 41 LYS A HG2  3  
ATOM 3280  H HG3  . LYS A 1 41 ? -11.661 12.299  8.639   1.00 0.00 ? 41 LYS A HG3  3  
ATOM 3281  H HD2  . LYS A 1 41 ? -12.777 13.266  10.647  1.00 0.00 ? 41 LYS A HD2  3  
ATOM 3282  H HD3  . LYS A 1 41 ? -12.485 14.882  10.001  1.00 0.00 ? 41 LYS A HD3  3  
ATOM 3283  H HE2  . LYS A 1 41 ? -14.782 13.999  9.489   1.00 0.00 ? 41 LYS A HE2  3  
ATOM 3284  H HE3  . LYS A 1 41 ? -13.848 14.414  8.052   1.00 0.00 ? 41 LYS A HE3  3  
ATOM 3285  H HZ1  . LYS A 1 41 ? -15.075 12.087  8.362   1.00 0.00 ? 41 LYS A HZ1  3  
ATOM 3286  H HZ2  . LYS A 1 41 ? -13.565 11.691  9.030   1.00 0.00 ? 41 LYS A HZ2  3  
ATOM 3287  H HZ3  . LYS A 1 41 ? -13.667 12.270  7.436   1.00 0.00 ? 41 LYS A HZ3  3  
ATOM 3288  N N    . SER A 1 42 ? -7.609  14.103  7.936   1.00 0.00 ? 42 SER A N    3  
ATOM 3289  C CA   . SER A 1 42 ? -7.226  14.949  6.771   1.00 0.00 ? 42 SER A CA   3  
ATOM 3290  C C    . SER A 1 42 ? -6.609  14.149  5.631   1.00 0.00 ? 42 SER A C    3  
ATOM 3291  O O    . SER A 1 42 ? -6.314  14.654  4.566   1.00 0.00 ? 42 SER A O    3  
ATOM 3292  C CB   . SER A 1 42 ? -6.250  16.032  7.224   1.00 0.00 ? 42 SER A CB   3  
ATOM 3293  O OG   . SER A 1 42 ? -6.847  16.799  8.261   1.00 0.00 ? 42 SER A OG   3  
ATOM 3294  H H    . SER A 1 42 ? -7.095  14.161  8.768   1.00 0.00 ? 42 SER A H    3  
ATOM 3295  H HA   . SER A 1 42 ? -8.118  15.417  6.387   1.00 0.00 ? 42 SER A HA   3  
ATOM 3296  H HB2  . SER A 1 42 ? -5.349  15.575  7.596   1.00 0.00 ? 42 SER A HB2  3  
ATOM 3297  H HB3  . SER A 1 42 ? -6.006  16.671  6.384   1.00 0.00 ? 42 SER A HB3  3  
ATOM 3298  H HG   . SER A 1 42 ? -7.478  16.238  8.718   1.00 0.00 ? 42 SER A HG   3  
ATOM 3299  N N    . LEU A 1 43 ? -6.376  12.894  5.895   1.00 0.00 ? 43 LEU A N    3  
ATOM 3300  C CA   . LEU A 1 43 ? -5.730  11.978  4.915   1.00 0.00 ? 43 LEU A CA   3  
ATOM 3301  C C    . LEU A 1 43 ? -6.761  10.918  4.524   1.00 0.00 ? 43 LEU A C    3  
ATOM 3302  O O    . LEU A 1 43 ? -6.525  10.082  3.675   1.00 0.00 ? 43 LEU A O    3  
ATOM 3303  C CB   . LEU A 1 43 ? -4.526  11.336  5.660   1.00 0.00 ? 43 LEU A CB   3  
ATOM 3304  C CG   . LEU A 1 43 ? -3.211  11.558  4.916   1.00 0.00 ? 43 LEU A CG   3  
ATOM 3305  C CD1  . LEU A 1 43 ? -2.994  13.053  4.569   1.00 0.00 ? 43 LEU A CD1  3  
ATOM 3306  C CD2  . LEU A 1 43 ? -2.041  11.045  5.771   1.00 0.00 ? 43 LEU A CD2  3  
ATOM 3307  H H    . LEU A 1 43 ? -6.613  12.539  6.772   1.00 0.00 ? 43 LEU A H    3  
ATOM 3308  H HA   . LEU A 1 43 ? -5.413  12.536  4.049   1.00 0.00 ? 43 LEU A HA   3  
ATOM 3309  H HB2  . LEU A 1 43 ? -4.447  11.780  6.638   1.00 0.00 ? 43 LEU A HB2  3  
ATOM 3310  H HB3  . LEU A 1 43 ? -4.688  10.272  5.770   1.00 0.00 ? 43 LEU A HB3  3  
ATOM 3311  H HG   . LEU A 1 43 ? -3.263  10.987  4.026   1.00 0.00 ? 43 LEU A HG   3  
ATOM 3312  H HD11 . LEU A 1 43 ? -1.955  13.323  4.708   1.00 0.00 ? 43 LEU A HD11 3  
ATOM 3313  H HD12 . LEU A 1 43 ? -3.608  13.675  5.205   1.00 0.00 ? 43 LEU A HD12 3  
ATOM 3314  H HD13 . LEU A 1 43 ? -3.265  13.223  3.538   1.00 0.00 ? 43 LEU A HD13 3  
ATOM 3315  H HD21 . LEU A 1 43 ? -2.167  11.367  6.794   1.00 0.00 ? 43 LEU A HD21 3  
ATOM 3316  H HD22 . LEU A 1 43 ? -1.114  11.442  5.384   1.00 0.00 ? 43 LEU A HD22 3  
ATOM 3317  H HD23 . LEU A 1 43 ? -2.012  9.970   5.732   1.00 0.00 ? 43 LEU A HD23 3  
ATOM 3318  N N    . SER A 1 44 ? -7.888  10.951  5.159   1.00 0.00 ? 44 SER A N    3  
ATOM 3319  C CA   . SER A 1 44 ? -8.968  9.960   4.873   1.00 0.00 ? 44 SER A CA   3  
ATOM 3320  C C    . SER A 1 44 ? -9.062  9.673   3.371   1.00 0.00 ? 44 SER A C    3  
ATOM 3321  O O    . SER A 1 44 ? -8.953  8.557   2.908   1.00 0.00 ? 44 SER A O    3  
ATOM 3322  C CB   . SER A 1 44 ? -10.303 10.530  5.353   1.00 0.00 ? 44 SER A CB   3  
ATOM 3323  O OG   . SER A 1 44 ? -11.353 9.652   4.970   1.00 0.00 ? 44 SER A OG   3  
ATOM 3324  H H    . SER A 1 44 ? -8.020  11.626  5.849   1.00 0.00 ? 44 SER A H    3  
ATOM 3325  H HA   . SER A 1 44 ? -8.765  9.045   5.413   1.00 0.00 ? 44 SER A HA   3  
ATOM 3326  H HB2  . SER A 1 44 ? -10.292 10.624  6.426   1.00 0.00 ? 44 SER A HB2  3  
ATOM 3327  H HB3  . SER A 1 44 ? -10.456 11.506  4.909   1.00 0.00 ? 44 SER A HB3  3  
ATOM 3328  H HG   . SER A 1 44 ? -11.137 9.287   4.108   1.00 0.00 ? 44 SER A HG   3  
ATOM 3329  N N    . GLU A 1 45 ? -9.438  10.701  2.652   1.00 0.00 ? 45 GLU A N    3  
ATOM 3330  C CA   . GLU A 1 45 ? -9.767  10.631  1.196   1.00 0.00 ? 45 GLU A CA   3  
ATOM 3331  C C    . GLU A 1 45 ? -8.737  10.058  0.232   1.00 0.00 ? 45 GLU A C    3  
ATOM 3332  O O    . GLU A 1 45 ? -9.002  9.126   -0.501  1.00 0.00 ? 45 GLU A O    3  
ATOM 3333  C CB   . GLU A 1 45 ? -10.022 12.066  0.731   1.00 0.00 ? 45 GLU A CB   3  
ATOM 3334  C CG   . GLU A 1 45 ? -11.169 12.679  1.538   1.00 0.00 ? 45 GLU A CG   3  
ATOM 3335  C CD   . GLU A 1 45 ? -11.391 14.124  1.085   1.00 0.00 ? 45 GLU A CD   3  
ATOM 3336  O OE1  . GLU A 1 45 ? -10.414 14.779  0.762   1.00 0.00 ? 45 GLU A OE1  3  
ATOM 3337  O OE2  . GLU A 1 45 ? -12.534 14.551  1.071   1.00 0.00 ? 45 GLU A OE2  3  
ATOM 3338  H H    . GLU A 1 45 ? -9.614  11.565  3.077   1.00 0.00 ? 45 GLU A H    3  
ATOM 3339  H HA   . GLU A 1 45 ? -10.686 10.086  1.077   1.00 0.00 ? 45 GLU A HA   3  
ATOM 3340  H HB2  . GLU A 1 45 ? -9.118  12.652  0.877   1.00 0.00 ? 45 GLU A HB2  3  
ATOM 3341  H HB3  . GLU A 1 45 ? -10.279 12.066  -0.317  1.00 0.00 ? 45 GLU A HB3  3  
ATOM 3342  H HG2  . GLU A 1 45 ? -12.070 12.108  1.375   1.00 0.00 ? 45 GLU A HG2  3  
ATOM 3343  H HG3  . GLU A 1 45 ? -10.921 12.669  2.588   1.00 0.00 ? 45 GLU A HG3  3  
ATOM 3344  N N    . GLU A 1 46 ? -7.568  10.610  0.229   1.00 0.00 ? 46 GLU A N    3  
ATOM 3345  C CA   . GLU A 1 46 ? -6.519  10.108  -0.683  1.00 0.00 ? 46 GLU A CA   3  
ATOM 3346  C C    . GLU A 1 46 ? -6.313  8.620   -0.445  1.00 0.00 ? 46 GLU A C    3  
ATOM 3347  O O    . GLU A 1 46 ? -5.812  7.918   -1.294  1.00 0.00 ? 46 GLU A O    3  
ATOM 3348  C CB   . GLU A 1 46 ? -5.223  10.866  -0.418  1.00 0.00 ? 46 GLU A CB   3  
ATOM 3349  C CG   . GLU A 1 46 ? -4.804  10.659  1.034   1.00 0.00 ? 46 GLU A CG   3  
ATOM 3350  C CD   . GLU A 1 46 ? -3.605  11.552  1.355   1.00 0.00 ? 46 GLU A CD   3  
ATOM 3351  O OE1  . GLU A 1 46 ? -3.756  12.760  1.284   1.00 0.00 ? 46 GLU A OE1  3  
ATOM 3352  O OE2  . GLU A 1 46 ? -2.555  11.012  1.664   1.00 0.00 ? 46 GLU A OE2  3  
ATOM 3353  H H    . GLU A 1 46 ? -7.378  11.365  0.823   1.00 0.00 ? 46 GLU A H    3  
ATOM 3354  H HA   . GLU A 1 46 ? -6.816  10.248  -1.708  1.00 0.00 ? 46 GLU A HA   3  
ATOM 3355  H HB2  . GLU A 1 46 ? -4.452  10.498  -1.072  1.00 0.00 ? 46 GLU A HB2  3  
ATOM 3356  H HB3  . GLU A 1 46 ? -5.381  11.919  -0.599  1.00 0.00 ? 46 GLU A HB3  3  
ATOM 3357  H HG2  . GLU A 1 46 ? -5.628  10.914  1.682   1.00 0.00 ? 46 GLU A HG2  3  
ATOM 3358  H HG3  . GLU A 1 46 ? -4.533  9.627   1.182   1.00 0.00 ? 46 GLU A HG3  3  
ATOM 3359  N N    . CYS A 1 47 ? -6.706  8.120   0.689   1.00 0.00 ? 47 CYS A N    3  
ATOM 3360  C CA   . CYS A 1 47 ? -6.535  6.669   0.944   1.00 0.00 ? 47 CYS A CA   3  
ATOM 3361  C C    . CYS A 1 47 ? -7.678  5.921   0.260   1.00 0.00 ? 47 CYS A C    3  
ATOM 3362  O O    . CYS A 1 47 ? -7.480  4.895   -0.359  1.00 0.00 ? 47 CYS A O    3  
ATOM 3363  C CB   . CYS A 1 47 ? -6.564  6.427   2.467   1.00 0.00 ? 47 CYS A CB   3  
ATOM 3364  S SG   . CYS A 1 47 ? -8.232  5.967   3.016   1.00 0.00 ? 47 CYS A SG   3  
ATOM 3365  H H    . CYS A 1 47 ? -7.127  8.692   1.366   1.00 0.00 ? 47 CYS A H    3  
ATOM 3366  H HA   . CYS A 1 47 ? -5.597  6.337   0.526   1.00 0.00 ? 47 CYS A HA   3  
ATOM 3367  H HB2  . CYS A 1 47 ? -5.877  5.636   2.719   1.00 0.00 ? 47 CYS A HB2  3  
ATOM 3368  H HB3  . CYS A 1 47 ? -6.270  7.339   2.974   1.00 0.00 ? 47 CYS A HB3  3  
ATOM 3369  N N    . GLN A 1 48 ? -8.869  6.423   0.371   1.00 0.00 ? 48 GLN A N    3  
ATOM 3370  C CA   . GLN A 1 48 ? -10.017 5.731   -0.269  1.00 0.00 ? 48 GLN A CA   3  
ATOM 3371  C C    . GLN A 1 48 ? -9.708  5.499   -1.745  1.00 0.00 ? 48 GLN A C    3  
ATOM 3372  O O    . GLN A 1 48 ? -10.009 4.458   -2.295  1.00 0.00 ? 48 GLN A O    3  
ATOM 3373  C CB   . GLN A 1 48 ? -11.279 6.589   -0.135  1.00 0.00 ? 48 GLN A CB   3  
ATOM 3374  C CG   . GLN A 1 48 ? -12.455 5.871   -0.801  1.00 0.00 ? 48 GLN A CG   3  
ATOM 3375  C CD   . GLN A 1 48 ? -13.754 6.617   -0.487  1.00 0.00 ? 48 GLN A CD   3  
ATOM 3376  O OE1  . GLN A 1 48 ? -13.956 7.067   0.623   1.00 0.00 ? 48 GLN A OE1  3  
ATOM 3377  N NE2  . GLN A 1 48 ? -14.648 6.766   -1.425  1.00 0.00 ? 48 GLN A NE2  3  
ATOM 3378  H H    . GLN A 1 48 ? -9.007  7.246   0.887   1.00 0.00 ? 48 GLN A H    3  
ATOM 3379  H HA   . GLN A 1 48 ? -10.174 4.776   0.216   1.00 0.00 ? 48 GLN A HA   3  
ATOM 3380  H HB2  . GLN A 1 48 ? -11.496 6.747   0.912   1.00 0.00 ? 48 GLN A HB2  3  
ATOM 3381  H HB3  . GLN A 1 48 ? -11.119 7.540   -0.619  1.00 0.00 ? 48 GLN A HB3  3  
ATOM 3382  H HG2  . GLN A 1 48 ? -12.302 5.847   -1.870  1.00 0.00 ? 48 GLN A HG2  3  
ATOM 3383  H HG3  . GLN A 1 48 ? -12.522 4.862   -0.423  1.00 0.00 ? 48 GLN A HG3  3  
ATOM 3384  H HE21 . GLN A 1 48 ? -14.486 6.403   -2.321  1.00 0.00 ? 48 GLN A HE21 3  
ATOM 3385  H HE22 . GLN A 1 48 ? -15.484 7.242   -1.234  1.00 0.00 ? 48 GLN A HE22 3  
ATOM 3386  N N    . GLU A 1 49 ? -9.120  6.465   -2.397  1.00 0.00 ? 49 GLU A N    3  
ATOM 3387  C CA   . GLU A 1 49 ? -8.807  6.308   -3.841  1.00 0.00 ? 49 GLU A CA   3  
ATOM 3388  C C    . GLU A 1 49 ? -7.707  5.260   -4.044  1.00 0.00 ? 49 GLU A C    3  
ATOM 3389  O O    . GLU A 1 49 ? -7.766  4.457   -4.953  1.00 0.00 ? 49 GLU A O    3  
ATOM 3390  C CB   . GLU A 1 49 ? -8.339  7.652   -4.409  1.00 0.00 ? 49 GLU A CB   3  
ATOM 3391  C CG   . GLU A 1 49 ? -9.543  8.582   -4.587  1.00 0.00 ? 49 GLU A CG   3  
ATOM 3392  C CD   . GLU A 1 49 ? -10.285 8.717   -3.258  1.00 0.00 ? 49 GLU A CD   3  
ATOM 3393  O OE1  . GLU A 1 49 ? -11.088 7.848   -2.958  1.00 0.00 ? 49 GLU A OE1  3  
ATOM 3394  O OE2  . GLU A 1 49 ? -10.041 9.688   -2.560  1.00 0.00 ? 49 GLU A OE2  3  
ATOM 3395  H H    . GLU A 1 49 ? -8.894  7.306   -1.947  1.00 0.00 ? 49 GLU A H    3  
ATOM 3396  H HA   . GLU A 1 49 ? -9.696  5.992   -4.365  1.00 0.00 ? 49 GLU A HA   3  
ATOM 3397  H HB2  . GLU A 1 49 ? -7.634  8.104   -3.727  1.00 0.00 ? 49 GLU A HB2  3  
ATOM 3398  H HB3  . GLU A 1 49 ? -7.865  7.495   -5.366  1.00 0.00 ? 49 GLU A HB3  3  
ATOM 3399  H HG2  . GLU A 1 49 ? -9.201  9.554   -4.910  1.00 0.00 ? 49 GLU A HG2  3  
ATOM 3400  H HG3  . GLU A 1 49 ? -10.209 8.169   -5.329  1.00 0.00 ? 49 GLU A HG3  3  
ATOM 3401  N N    . VAL A 1 50 ? -6.704  5.252   -3.200  1.00 0.00 ? 50 VAL A N    3  
ATOM 3402  C CA   . VAL A 1 50 ? -5.621  4.242   -3.360  1.00 0.00 ? 50 VAL A CA   3  
ATOM 3403  C C    . VAL A 1 50 ? -6.173  2.860   -3.036  1.00 0.00 ? 50 VAL A C    3  
ATOM 3404  O O    . VAL A 1 50 ? -6.010  1.922   -3.790  1.00 0.00 ? 50 VAL A O    3  
ATOM 3405  C CB   . VAL A 1 50 ? -4.448  4.529   -2.413  1.00 0.00 ? 50 VAL A CB   3  
ATOM 3406  C CG1  . VAL A 1 50 ? -3.321  3.527   -2.681  1.00 0.00 ? 50 VAL A CG1  3  
ATOM 3407  C CG2  . VAL A 1 50 ? -3.928  5.956   -2.639  1.00 0.00 ? 50 VAL A CG2  3  
ATOM 3408  H H    . VAL A 1 50 ? -6.671  5.899   -2.468  1.00 0.00 ? 50 VAL A H    3  
ATOM 3409  H HA   . VAL A 1 50 ? -5.269  4.269   -4.374  1.00 0.00 ? 50 VAL A HA   3  
ATOM 3410  H HB   . VAL A 1 50 ? -4.774  4.413   -1.392  1.00 0.00 ? 50 VAL A HB   3  
ATOM 3411  H HG11 . VAL A 1 50 ? -3.043  3.568   -3.723  1.00 0.00 ? 50 VAL A HG11 3  
ATOM 3412  H HG12 . VAL A 1 50 ? -3.657  2.531   -2.436  1.00 0.00 ? 50 VAL A HG12 3  
ATOM 3413  H HG13 . VAL A 1 50 ? -2.464  3.777   -2.072  1.00 0.00 ? 50 VAL A HG13 3  
ATOM 3414  H HG21 . VAL A 1 50 ? -3.427  6.301   -1.746  1.00 0.00 ? 50 VAL A HG21 3  
ATOM 3415  H HG22 . VAL A 1 50 ? -4.753  6.609   -2.860  1.00 0.00 ? 50 VAL A HG22 3  
ATOM 3416  H HG23 . VAL A 1 50 ? -3.234  5.967   -3.467  1.00 0.00 ? 50 VAL A HG23 3  
ATOM 3417  N N    . VAL A 1 51 ? -6.797  2.715   -1.895  1.00 0.00 ? 51 VAL A N    3  
ATOM 3418  C CA   . VAL A 1 51 ? -7.319  1.380   -1.507  1.00 0.00 ? 51 VAL A CA   3  
ATOM 3419  C C    . VAL A 1 51 ? -8.352  0.901   -2.535  1.00 0.00 ? 51 VAL A C    3  
ATOM 3420  O O    . VAL A 1 51 ? -8.291  -0.205  -3.030  1.00 0.00 ? 51 VAL A O    3  
ATOM 3421  C CB   . VAL A 1 51 ? -7.889  1.449   -0.084  1.00 0.00 ? 51 VAL A CB   3  
ATOM 3422  C CG1  . VAL A 1 51 ? -8.318  0.063   0.376   1.00 0.00 ? 51 VAL A CG1  3  
ATOM 3423  C CG2  . VAL A 1 51 ? -6.816  1.986   0.871   1.00 0.00 ? 51 VAL A CG2  3  
ATOM 3424  H H    . VAL A 1 51 ? -6.892  3.468   -1.275  1.00 0.00 ? 51 VAL A H    3  
ATOM 3425  H HA   . VAL A 1 51 ? -6.498  0.687   -1.559  1.00 0.00 ? 51 VAL A HA   3  
ATOM 3426  H HB   . VAL A 1 51 ? -8.739  2.111   -0.070  1.00 0.00 ? 51 VAL A HB   3  
ATOM 3427  H HG11 . VAL A 1 51 ? -8.575  0.100   1.425   1.00 0.00 ? 51 VAL A HG11 3  
ATOM 3428  H HG12 . VAL A 1 51 ? -7.505  -0.632  0.230   1.00 0.00 ? 51 VAL A HG12 3  
ATOM 3429  H HG13 . VAL A 1 51 ? -9.177  -0.256  -0.195  1.00 0.00 ? 51 VAL A HG13 3  
ATOM 3430  H HG21 . VAL A 1 51 ? -6.485  2.957   0.533   1.00 0.00 ? 51 VAL A HG21 3  
ATOM 3431  H HG22 . VAL A 1 51 ? -5.978  1.306   0.889   1.00 0.00 ? 51 VAL A HG22 3  
ATOM 3432  H HG23 . VAL A 1 51 ? -7.227  2.074   1.869   1.00 0.00 ? 51 VAL A HG23 3  
ATOM 3433  N N    . ASP A 1 52 ? -9.339  1.715   -2.799  1.00 0.00 ? 52 ASP A N    3  
ATOM 3434  C CA   . ASP A 1 52 ? -10.439 1.317   -3.729  1.00 0.00 ? 52 ASP A CA   3  
ATOM 3435  C C    . ASP A 1 52 ? -9.941  1.082   -5.157  1.00 0.00 ? 52 ASP A C    3  
ATOM 3436  O O    . ASP A 1 52 ? -10.352 0.149   -5.819  1.00 0.00 ? 52 ASP A O    3  
ATOM 3437  C CB   . ASP A 1 52 ? -11.497 2.425   -3.744  1.00 0.00 ? 52 ASP A CB   3  
ATOM 3438  C CG   . ASP A 1 52 ? -12.010 2.658   -2.321  1.00 0.00 ? 52 ASP A CG   3  
ATOM 3439  O OD1  . ASP A 1 52 ? -11.218 2.538   -1.400  1.00 0.00 ? 52 ASP A OD1  3  
ATOM 3440  O OD2  . ASP A 1 52 ? -13.185 2.953   -2.177  1.00 0.00 ? 52 ASP A OD2  3  
ATOM 3441  H H    . ASP A 1 52 ? -9.382  2.587   -2.355  1.00 0.00 ? 52 ASP A H    3  
ATOM 3442  H HA   . ASP A 1 52 ? -10.902 0.416   -3.354  1.00 0.00 ? 52 ASP A HA   3  
ATOM 3443  H HB2  . ASP A 1 52 ? -11.063 3.339   -4.124  1.00 0.00 ? 52 ASP A HB2  3  
ATOM 3444  H HB3  . ASP A 1 52 ? -12.321 2.128   -4.375  1.00 0.00 ? 52 ASP A HB3  3  
ATOM 3445  N N    . THR A 1 53 ? -9.081  1.930   -5.649  1.00 0.00 ? 53 THR A N    3  
ATOM 3446  C CA   . THR A 1 53 ? -8.585  1.767   -7.044  1.00 0.00 ? 53 THR A CA   3  
ATOM 3447  C C    . THR A 1 53 ? -7.385  0.830   -7.089  1.00 0.00 ? 53 THR A C    3  
ATOM 3448  O O    . THR A 1 53 ? -7.259  0.040   -8.003  1.00 0.00 ? 53 THR A O    3  
ATOM 3449  C CB   . THR A 1 53 ? -8.181  3.138   -7.594  1.00 0.00 ? 53 THR A CB   3  
ATOM 3450  O OG1  . THR A 1 53 ? -9.254  4.052   -7.417  1.00 0.00 ? 53 THR A OG1  3  
ATOM 3451  C CG2  . THR A 1 53 ? -7.851  3.018   -9.083  1.00 0.00 ? 53 THR A CG2  3  
ATOM 3452  H H    . THR A 1 53 ? -8.772  2.687   -5.111  1.00 0.00 ? 53 THR A H    3  
ATOM 3453  H HA   . THR A 1 53 ? -9.355  1.355   -7.671  1.00 0.00 ? 53 THR A HA   3  
ATOM 3454  H HB   . THR A 1 53 ? -7.313  3.497   -7.065  1.00 0.00 ? 53 THR A HB   3  
ATOM 3455  H HG1  . THR A 1 53 ? -9.057  4.844   -7.922  1.00 0.00 ? 53 THR A HG1  3  
ATOM 3456  H HG21 . THR A 1 53 ? -7.542  3.982   -9.461  1.00 0.00 ? 53 THR A HG21 3  
ATOM 3457  H HG22 . THR A 1 53 ? -8.727  2.684   -9.620  1.00 0.00 ? 53 THR A HG22 3  
ATOM 3458  H HG23 . THR A 1 53 ? -7.052  2.305   -9.219  1.00 0.00 ? 53 THR A HG23 3  
ATOM 3459  N N    . TYR A 1 54 ? -6.483  0.918   -6.144  1.00 0.00 ? 54 TYR A N    3  
ATOM 3460  C CA   . TYR A 1 54 ? -5.271  0.038   -6.182  1.00 0.00 ? 54 TYR A CA   3  
ATOM 3461  C C    . TYR A 1 54 ? -5.281  -1.016  -5.069  1.00 0.00 ? 54 TYR A C    3  
ATOM 3462  O O    . TYR A 1 54 ? -4.256  -1.393  -4.543  1.00 0.00 ? 54 TYR A O    3  
ATOM 3463  C CB   . TYR A 1 54 ? -4.027  0.904   -6.050  1.00 0.00 ? 54 TYR A CB   3  
ATOM 3464  C CG   . TYR A 1 54 ? -3.906  1.795   -7.264  1.00 0.00 ? 54 TYR A CG   3  
ATOM 3465  C CD1  . TYR A 1 54 ? -4.522  3.047   -7.265  1.00 0.00 ? 54 TYR A CD1  3  
ATOM 3466  C CD2  . TYR A 1 54 ? -3.176  1.375   -8.382  1.00 0.00 ? 54 TYR A CD2  3  
ATOM 3467  C CE1  . TYR A 1 54 ? -4.416  3.884   -8.376  1.00 0.00 ? 54 TYR A CE1  3  
ATOM 3468  C CE2  . TYR A 1 54 ? -3.069  2.212   -9.501  1.00 0.00 ? 54 TYR A CE2  3  
ATOM 3469  C CZ   . TYR A 1 54 ? -3.689  3.468   -9.498  1.00 0.00 ? 54 TYR A CZ   3  
ATOM 3470  O OH   . TYR A 1 54 ? -3.583  4.293   -10.599 1.00 0.00 ? 54 TYR A OH   3  
ATOM 3471  H H    . TYR A 1 54 ? -6.588  1.578   -5.426  1.00 0.00 ? 54 TYR A H    3  
ATOM 3472  H HA   . TYR A 1 54 ? -5.222  -0.484  -7.127  1.00 0.00 ? 54 TYR A HA   3  
ATOM 3473  H HB2  . TYR A 1 54 ? -4.111  1.510   -5.164  1.00 0.00 ? 54 TYR A HB2  3  
ATOM 3474  H HB3  . TYR A 1 54 ? -3.155  0.274   -5.976  1.00 0.00 ? 54 TYR A HB3  3  
ATOM 3475  H HD1  . TYR A 1 54 ? -5.083  3.366   -6.410  1.00 0.00 ? 54 TYR A HD1  3  
ATOM 3476  H HD2  . TYR A 1 54 ? -2.702  0.406   -8.384  1.00 0.00 ? 54 TYR A HD2  3  
ATOM 3477  H HE1  . TYR A 1 54 ? -4.896  4.853   -8.366  1.00 0.00 ? 54 TYR A HE1  3  
ATOM 3478  H HE2  . TYR A 1 54 ? -2.508  1.888   -10.364 1.00 0.00 ? 54 TYR A HE2  3  
ATOM 3479  H HH   . TYR A 1 54 ? -3.631  3.746   -11.386 1.00 0.00 ? 54 TYR A HH   3  
ATOM 3480  N N    . GLY A 1 55 ? -6.447  -1.460  -4.677  1.00 0.00 ? 55 GLY A N    3  
ATOM 3481  C CA   . GLY A 1 55 ? -6.543  -2.449  -3.567  1.00 0.00 ? 55 GLY A CA   3  
ATOM 3482  C C    . GLY A 1 55 ? -6.263  -3.871  -4.049  1.00 0.00 ? 55 GLY A C    3  
ATOM 3483  O O    . GLY A 1 55 ? -5.433  -4.562  -3.493  1.00 0.00 ? 55 GLY A O    3  
ATOM 3484  H H    . GLY A 1 55 ? -7.261  -1.134  -5.108  1.00 0.00 ? 55 GLY A H    3  
ATOM 3485  H HA2  . GLY A 1 55 ? -5.824  -2.191  -2.804  1.00 0.00 ? 55 GLY A HA2  3  
ATOM 3486  H HA3  . GLY A 1 55 ? -7.535  -2.411  -3.144  1.00 0.00 ? 55 GLY A HA3  3  
ATOM 3487  N N    . SER A 1 56 ? -6.955  -4.337  -5.054  1.00 0.00 ? 56 SER A N    3  
ATOM 3488  C CA   . SER A 1 56 ? -6.706  -5.731  -5.505  1.00 0.00 ? 56 SER A CA   3  
ATOM 3489  C C    . SER A 1 56 ? -5.320  -5.830  -6.119  1.00 0.00 ? 56 SER A C    3  
ATOM 3490  O O    . SER A 1 56 ? -4.704  -6.877  -6.137  1.00 0.00 ? 56 SER A O    3  
ATOM 3491  C CB   . SER A 1 56 ? -7.744  -6.155  -6.542  1.00 0.00 ? 56 SER A CB   3  
ATOM 3492  O OG   . SER A 1 56 ? -9.009  -5.604  -6.198  1.00 0.00 ? 56 SER A OG   3  
ATOM 3493  H H    . SER A 1 56 ? -7.637  -3.790  -5.495  1.00 0.00 ? 56 SER A H    3  
ATOM 3494  H HA   . SER A 1 56 ? -6.773  -6.377  -4.645  1.00 0.00 ? 56 SER A HA   3  
ATOM 3495  H HB2  . SER A 1 56 ? -7.451  -5.798  -7.519  1.00 0.00 ? 56 SER A HB2  3  
ATOM 3496  H HB3  . SER A 1 56 ? -7.800  -7.236  -6.559  1.00 0.00 ? 56 SER A HB3  3  
ATOM 3497  H HG   . SER A 1 56 ? -8.951  -4.650  -6.281  1.00 0.00 ? 56 SER A HG   3  
ATOM 3498  N N    . SER A 1 57 ? -4.857  -4.754  -6.698  1.00 0.00 ? 57 SER A N    3  
ATOM 3499  C CA   . SER A 1 57 ? -3.547  -4.808  -7.393  1.00 0.00 ? 57 SER A CA   3  
ATOM 3500  C C    . SER A 1 57 ? -2.391  -4.817  -6.396  1.00 0.00 ? 57 SER A C    3  
ATOM 3501  O O    . SER A 1 57 ? -1.511  -5.646  -6.475  1.00 0.00 ? 57 SER A O    3  
ATOM 3502  C CB   . SER A 1 57 ? -3.407  -3.643  -8.373  1.00 0.00 ? 57 SER A CB   3  
ATOM 3503  O OG   . SER A 1 57 ? -3.444  -2.418  -7.653  1.00 0.00 ? 57 SER A OG   3  
ATOM 3504  H H    . SER A 1 57 ? -5.392  -3.932  -6.696  1.00 0.00 ? 57 SER A H    3  
ATOM 3505  H HA   . SER A 1 57 ? -3.513  -5.746  -7.923  1.00 0.00 ? 57 SER A HA   3  
ATOM 3506  H HB2  . SER A 1 57 ? -2.467  -3.719  -8.894  1.00 0.00 ? 57 SER A HB2  3  
ATOM 3507  H HB3  . SER A 1 57 ? -4.217  -3.677  -9.088  1.00 0.00 ? 57 SER A HB3  3  
ATOM 3508  H HG   . SER A 1 57 ? -3.819  -1.747  -8.229  1.00 0.00 ? 57 SER A HG   3  
ATOM 3509  N N    . ILE A 1 58 ? -2.410  -3.945  -5.421  1.00 0.00 ? 58 ILE A N    3  
ATOM 3510  C CA   . ILE A 1 58 ? -1.327  -3.954  -4.399  1.00 0.00 ? 58 ILE A CA   3  
ATOM 3511  C C    . ILE A 1 58 ? -1.285  -5.335  -3.758  1.00 0.00 ? 58 ILE A C    3  
ATOM 3512  O O    . ILE A 1 58 ? -0.278  -6.013  -3.723  1.00 0.00 ? 58 ILE A O    3  
ATOM 3513  C CB   . ILE A 1 58 ? -1.631  -2.913  -3.304  1.00 0.00 ? 58 ILE A CB   3  
ATOM 3514  C CG1  . ILE A 1 58 ? -1.380  -1.500  -3.854  1.00 0.00 ? 58 ILE A CG1  3  
ATOM 3515  C CG2  . ILE A 1 58 ? -0.722  -3.165  -2.084  1.00 0.00 ? 58 ILE A CG2  3  
ATOM 3516  C CD1  . ILE A 1 58 ? -1.829  -0.453  -2.826  1.00 0.00 ? 58 ILE A CD1  3  
ATOM 3517  H H    . ILE A 1 58 ? -3.154  -3.314  -5.329  1.00 0.00 ? 58 ILE A H    3  
ATOM 3518  H HA   . ILE A 1 58 ? -0.367  -3.734  -4.841  1.00 0.00 ? 58 ILE A HA   3  
ATOM 3519  H HB   . ILE A 1 58 ? -2.665  -3.006  -3.003  1.00 0.00 ? 58 ILE A HB   3  
ATOM 3520  H HG12 . ILE A 1 58 ? -0.329  -1.377  -4.055  1.00 0.00 ? 58 ILE A HG12 3  
ATOM 3521  H HG13 . ILE A 1 58 ? -1.936  -1.366  -4.769  1.00 0.00 ? 58 ILE A HG13 3  
ATOM 3522  H HG21 . ILE A 1 58 ? -1.120  -3.987  -1.509  1.00 0.00 ? 58 ILE A HG21 3  
ATOM 3523  H HG22 . ILE A 1 58 ? -0.676  -2.285  -1.461  1.00 0.00 ? 58 ILE A HG22 3  
ATOM 3524  H HG23 . ILE A 1 58 ? 0.273   -3.416  -2.422  1.00 0.00 ? 58 ILE A HG23 3  
ATOM 3525  H HD11 . ILE A 1 58 ? -1.076  -0.372  -2.055  1.00 0.00 ? 58 ILE A HD11 3  
ATOM 3526  H HD12 . ILE A 1 58 ? -2.766  -0.753  -2.382  1.00 0.00 ? 58 ILE A HD12 3  
ATOM 3527  H HD13 . ILE A 1 58 ? -1.953  0.505   -3.311  1.00 0.00 ? 58 ILE A HD13 3  
ATOM 3528  N N    . LEU A 1 59 ? -2.408  -5.721  -3.239  1.00 0.00 ? 59 LEU A N    3  
ATOM 3529  C CA   . LEU A 1 59 ? -2.547  -7.028  -2.560  1.00 0.00 ? 59 LEU A CA   3  
ATOM 3530  C C    . LEU A 1 59 ? -2.196  -8.149  -3.537  1.00 0.00 ? 59 LEU A C    3  
ATOM 3531  O O    . LEU A 1 59 ? -1.842  -9.234  -3.128  1.00 0.00 ? 59 LEU A O    3  
ATOM 3532  C CB   . LEU A 1 59 ? -4.000  -7.157  -2.083  1.00 0.00 ? 59 LEU A CB   3  
ATOM 3533  C CG   . LEU A 1 59 ? -4.271  -8.555  -1.508  1.00 0.00 ? 59 LEU A CG   3  
ATOM 3534  C CD1  . LEU A 1 59 ? -3.239  -8.879  -0.417  1.00 0.00 ? 59 LEU A CD1  3  
ATOM 3535  C CD2  . LEU A 1 59 ? -5.692  -8.601  -0.904  1.00 0.00 ? 59 LEU A CD2  3  
ATOM 3536  H H    . LEU A 1 59 ? -3.184  -5.125  -3.308  1.00 0.00 ? 59 LEU A H    3  
ATOM 3537  H HA   . LEU A 1 59 ? -1.881  -7.064  -1.711  1.00 0.00 ? 59 LEU A HA   3  
ATOM 3538  H HB2  . LEU A 1 59 ? -4.184  -6.414  -1.322  1.00 0.00 ? 59 LEU A HB2  3  
ATOM 3539  H HB3  . LEU A 1 59 ? -4.664  -6.981  -2.917  1.00 0.00 ? 59 LEU A HB3  3  
ATOM 3540  H HG   . LEU A 1 59 ? -4.200  -9.282  -2.307  1.00 0.00 ? 59 LEU A HG   3  
ATOM 3541  H HD11 . LEU A 1 59 ? -2.314  -9.193  -0.873  1.00 0.00 ? 59 LEU A HD11 3  
ATOM 3542  H HD12 . LEU A 1 59 ? -3.614  -9.676  0.209   1.00 0.00 ? 59 LEU A HD12 3  
ATOM 3543  H HD13 . LEU A 1 59 ? -3.063  -8.001  0.187   1.00 0.00 ? 59 LEU A HD13 3  
ATOM 3544  H HD21 . LEU A 1 59 ? -5.952  -7.638  -0.489  1.00 0.00 ? 59 LEU A HD21 3  
ATOM 3545  H HD22 . LEU A 1 59 ? -5.733  -9.343  -0.120  1.00 0.00 ? 59 LEU A HD22 3  
ATOM 3546  H HD23 . LEU A 1 59 ? -6.400  -8.861  -1.676  1.00 0.00 ? 59 LEU A HD23 3  
ATOM 3547  N N    . SER A 1 60 ? -2.309  -7.938  -4.821  1.00 0.00 ? 60 SER A N    3  
ATOM 3548  C CA   . SER A 1 60 ? -1.996  -9.063  -5.756  1.00 0.00 ? 60 SER A CA   3  
ATOM 3549  C C    . SER A 1 60 ? -0.479  -9.172  -5.969  1.00 0.00 ? 60 SER A C    3  
ATOM 3550  O O    . SER A 1 60 ? 0.066   -10.250 -6.111  1.00 0.00 ? 60 SER A O    3  
ATOM 3551  C CB   . SER A 1 60 ? -2.686  -8.806  -7.090  1.00 0.00 ? 60 SER A CB   3  
ATOM 3552  O OG   . SER A 1 60 ? -4.077  -9.063  -6.959  1.00 0.00 ? 60 SER A OG   3  
ATOM 3553  H H    . SER A 1 60 ? -2.615  -7.073  -5.163  1.00 0.00 ? 60 SER A H    3  
ATOM 3554  H HA   . SER A 1 60 ? -2.407  -9.947  -5.294  1.00 0.00 ? 60 SER A HA   3  
ATOM 3555  H HB2  . SER A 1 60 ? -2.539  -7.777  -7.372  1.00 0.00 ? 60 SER A HB2  3  
ATOM 3556  H HB3  . SER A 1 60 ? -2.258  -9.448  -7.848  1.00 0.00 ? 60 SER A HB3  3  
ATOM 3557  H HG   . SER A 1 60 ? -4.318  -9.734  -7.602  1.00 0.00 ? 60 SER A HG   3  
ATOM 3558  N N    . ILE A 1 61 ? 0.200   -8.053  -6.001  1.00 0.00 ? 61 ILE A N    3  
ATOM 3559  C CA   . ILE A 1 61 ? 1.681   -8.059  -6.211  1.00 0.00 ? 61 ILE A CA   3  
ATOM 3560  C C    . ILE A 1 61 ? 2.391   -8.645  -4.985  1.00 0.00 ? 61 ILE A C    3  
ATOM 3561  O O    . ILE A 1 61 ? 3.297   -9.445  -5.101  1.00 0.00 ? 61 ILE A O    3  
ATOM 3562  C CB   . ILE A 1 61 ? 2.169   -6.614  -6.423  1.00 0.00 ? 61 ILE A CB   3  
ATOM 3563  C CG1  . ILE A 1 61 ? 1.222   -5.862  -7.418  1.00 0.00 ? 61 ILE A CG1  3  
ATOM 3564  C CG2  . ILE A 1 61 ? 3.616   -6.651  -6.929  1.00 0.00 ? 61 ILE A CG2  3  
ATOM 3565  C CD1  . ILE A 1 61 ? 2.002   -5.153  -8.539  1.00 0.00 ? 61 ILE A CD1  3  
ATOM 3566  H H    . ILE A 1 61 ? -0.269  -7.199  -5.893  1.00 0.00 ? 61 ILE A H    3  
ATOM 3567  H HA   . ILE A 1 61 ? 1.922   -8.650  -7.083  1.00 0.00 ? 61 ILE A HA   3  
ATOM 3568  H HB   . ILE A 1 61 ? 2.158   -6.105  -5.466  1.00 0.00 ? 61 ILE A HB   3  
ATOM 3569  H HG12 . ILE A 1 61 ? 0.525   -6.561  -7.865  1.00 0.00 ? 61 ILE A HG12 3  
ATOM 3570  H HG13 . ILE A 1 61 ? 0.664   -5.117  -6.871  1.00 0.00 ? 61 ILE A HG13 3  
ATOM 3571  H HG21 . ILE A 1 61 ? 3.643   -7.079  -7.920  1.00 0.00 ? 61 ILE A HG21 3  
ATOM 3572  H HG22 . ILE A 1 61 ? 4.209   -7.250  -6.261  1.00 0.00 ? 61 ILE A HG22 3  
ATOM 3573  H HG23 . ILE A 1 61 ? 4.013   -5.645  -6.957  1.00 0.00 ? 61 ILE A HG23 3  
ATOM 3574  H HD11 . ILE A 1 61 ? 2.720   -4.474  -8.102  1.00 0.00 ? 61 ILE A HD11 3  
ATOM 3575  H HD12 . ILE A 1 61 ? 1.312   -4.599  -9.155  1.00 0.00 ? 61 ILE A HD12 3  
ATOM 3576  H HD13 . ILE A 1 61 ? 2.515   -5.884  -9.144  1.00 0.00 ? 61 ILE A HD13 3  
ATOM 3577  N N    . LEU A 1 62 ? 2.001   -8.224  -3.815  1.00 0.00 ? 62 LEU A N    3  
ATOM 3578  C CA   . LEU A 1 62 ? 2.664   -8.719  -2.574  1.00 0.00 ? 62 LEU A CA   3  
ATOM 3579  C C    . LEU A 1 62 ? 2.758   -10.251 -2.586  1.00 0.00 ? 62 LEU A C    3  
ATOM 3580  O O    . LEU A 1 62 ? 3.704   -10.825 -2.086  1.00 0.00 ? 62 LEU A O    3  
ATOM 3581  C CB   . LEU A 1 62 ? 1.841   -8.262  -1.360  1.00 0.00 ? 62 LEU A CB   3  
ATOM 3582  C CG   . LEU A 1 62 ? 2.191   -6.793  -0.996  1.00 0.00 ? 62 LEU A CG   3  
ATOM 3583  C CD1  . LEU A 1 62 ? 0.923   -6.044  -0.580  1.00 0.00 ? 62 LEU A CD1  3  
ATOM 3584  C CD2  . LEU A 1 62 ? 3.193   -6.766  0.166   1.00 0.00 ? 62 LEU A CD2  3  
ATOM 3585  H H    . LEU A 1 62 ? 1.282   -7.562  -3.750  1.00 0.00 ? 62 LEU A H    3  
ATOM 3586  H HA   . LEU A 1 62 ? 3.654   -8.288  -2.521  1.00 0.00 ? 62 LEU A HA   3  
ATOM 3587  H HB2  . LEU A 1 62 ? 0.789   -8.338  -1.606  1.00 0.00 ? 62 LEU A HB2  3  
ATOM 3588  H HB3  . LEU A 1 62 ? 2.050   -8.908  -0.517  1.00 0.00 ? 62 LEU A HB3  3  
ATOM 3589  H HG   . LEU A 1 62 ? 2.623   -6.293  -1.854  1.00 0.00 ? 62 LEU A HG   3  
ATOM 3590  H HD11 . LEU A 1 62 ? 0.330   -6.681  0.053   1.00 0.00 ? 62 LEU A HD11 3  
ATOM 3591  H HD12 . LEU A 1 62 ? 0.355   -5.786  -1.460  1.00 0.00 ? 62 LEU A HD12 3  
ATOM 3592  H HD13 . LEU A 1 62 ? 1.187   -5.144  -0.044  1.00 0.00 ? 62 LEU A HD13 3  
ATOM 3593  H HD21 . LEU A 1 62 ? 3.372   -5.744  0.454   1.00 0.00 ? 62 LEU A HD21 3  
ATOM 3594  H HD22 . LEU A 1 62 ? 4.119   -7.225  -0.145  1.00 0.00 ? 62 LEU A HD22 3  
ATOM 3595  H HD23 . LEU A 1 62 ? 2.786   -7.309  1.005   1.00 0.00 ? 62 LEU A HD23 3  
ATOM 3596  N N    . LEU A 1 63 ? 1.776   -10.915 -3.131  1.00 0.00 ? 63 LEU A N    3  
ATOM 3597  C CA   . LEU A 1 63 ? 1.808   -12.403 -3.146  1.00 0.00 ? 63 LEU A CA   3  
ATOM 3598  C C    . LEU A 1 63 ? 2.790   -12.912 -4.203  1.00 0.00 ? 63 LEU A C    3  
ATOM 3599  O O    . LEU A 1 63 ? 3.156   -14.071 -4.204  1.00 0.00 ? 63 LEU A O    3  
ATOM 3600  C CB   . LEU A 1 63 ? 0.400   -12.949 -3.413  1.00 0.00 ? 63 LEU A CB   3  
ATOM 3601  C CG   . LEU A 1 63 ? -0.603  -12.272 -2.470  1.00 0.00 ? 63 LEU A CG   3  
ATOM 3602  C CD1  . LEU A 1 63 ? -1.974  -12.937 -2.621  1.00 0.00 ? 63 LEU A CD1  3  
ATOM 3603  C CD2  . LEU A 1 63 ? -0.127  -12.405 -1.016  1.00 0.00 ? 63 LEU A CD2  3  
ATOM 3604  H H    . LEU A 1 63 ? 1.013   -10.438 -3.519  1.00 0.00 ? 63 LEU A H    3  
ATOM 3605  H HA   . LEU A 1 63 ? 2.156   -12.773 -2.195  1.00 0.00 ? 63 LEU A HA   3  
ATOM 3606  H HB2  . LEU A 1 63 ? 0.123   -12.747 -4.436  1.00 0.00 ? 63 LEU A HB2  3  
ATOM 3607  H HB3  . LEU A 1 63 ? 0.390   -14.014 -3.240  1.00 0.00 ? 63 LEU A HB3  3  
ATOM 3608  H HG   . LEU A 1 63 ? -0.683  -11.226 -2.726  1.00 0.00 ? 63 LEU A HG   3  
ATOM 3609  H HD11 . LEU A 1 63 ? -2.622  -12.613 -1.819  1.00 0.00 ? 63 LEU A HD11 3  
ATOM 3610  H HD12 . LEU A 1 63 ? -1.860  -14.010 -2.580  1.00 0.00 ? 63 LEU A HD12 3  
ATOM 3611  H HD13 . LEU A 1 63 ? -2.407  -12.657 -3.569  1.00 0.00 ? 63 LEU A HD13 3  
ATOM 3612  H HD21 . LEU A 1 63 ? 0.269   -13.397 -0.854  1.00 0.00 ? 63 LEU A HD21 3  
ATOM 3613  H HD22 . LEU A 1 63 ? -0.956  -12.234 -0.345  1.00 0.00 ? 63 LEU A HD22 3  
ATOM 3614  H HD23 . LEU A 1 63 ? 0.644   -11.673 -0.823  1.00 0.00 ? 63 LEU A HD23 3  
ATOM 3615  N N    . GLU A 1 64 ? 3.226   -12.070 -5.106  1.00 0.00 ? 64 GLU A N    3  
ATOM 3616  C CA   . GLU A 1 64 ? 4.186   -12.541 -6.149  1.00 0.00 ? 64 GLU A CA   3  
ATOM 3617  C C    . GLU A 1 64 ? 5.607   -12.429 -5.595  1.00 0.00 ? 64 GLU A C    3  
ATOM 3618  O O    . GLU A 1 64 ? 6.568   -12.270 -6.322  1.00 0.00 ? 64 GLU A O    3  
ATOM 3619  C CB   . GLU A 1 64 ? 4.039   -11.707 -7.426  1.00 0.00 ? 64 GLU A CB   3  
ATOM 3620  C CG   . GLU A 1 64 ? 2.806   -12.160 -8.210  1.00 0.00 ? 64 GLU A CG   3  
ATOM 3621  C CD   . GLU A 1 64 ? 2.783   -11.461 -9.571  1.00 0.00 ? 64 GLU A CD   3  
ATOM 3622  O OE1  . GLU A 1 64 ? 3.842   -11.324 -10.161 1.00 0.00 ? 64 GLU A OE1  3  
ATOM 3623  O OE2  . GLU A 1 64 ? 1.708   -11.077 -9.999  1.00 0.00 ? 64 GLU A OE2  3  
ATOM 3624  H H    . GLU A 1 64 ? 2.929   -11.139 -5.101  1.00 0.00 ? 64 GLU A H    3  
ATOM 3625  H HA   . GLU A 1 64 ? 3.986   -13.583 -6.361  1.00 0.00 ? 64 GLU A HA   3  
ATOM 3626  H HB2  . GLU A 1 64 ? 3.931   -10.667 -7.163  1.00 0.00 ? 64 GLU A HB2  3  
ATOM 3627  H HB3  . GLU A 1 64 ? 4.915   -11.838 -8.042  1.00 0.00 ? 64 GLU A HB3  3  
ATOM 3628  H HG2  . GLU A 1 64 ? 2.841   -13.229 -8.354  1.00 0.00 ? 64 GLU A HG2  3  
ATOM 3629  H HG3  . GLU A 1 64 ? 1.916   -11.897 -7.661  1.00 0.00 ? 64 GLU A HG3  3  
ATOM 3630  N N    . GLU A 1 65 ? 5.733   -12.566 -4.304  1.00 0.00 ? 65 GLU A N    3  
ATOM 3631  C CA   . GLU A 1 65 ? 7.078   -12.535 -3.664  1.00 0.00 ? 65 GLU A CA   3  
ATOM 3632  C C    . GLU A 1 65 ? 7.911   -11.335 -4.134  1.00 0.00 ? 65 GLU A C    3  
ATOM 3633  O O    . GLU A 1 65 ? 9.125   -11.384 -4.169  1.00 0.00 ? 65 GLU A O    3  
ATOM 3634  C CB   . GLU A 1 65 ? 7.817   -13.805 -4.087  1.00 0.00 ? 65 GLU A CB   3  
ATOM 3635  C CG   . GLU A 1 65 ? 7.083   -15.030 -3.536  1.00 0.00 ? 65 GLU A CG   3  
ATOM 3636  C CD   . GLU A 1 65 ? 7.267   -15.096 -2.019  1.00 0.00 ? 65 GLU A CD   3  
ATOM 3637  O OE1  . GLU A 1 65 ? 8.256   -15.665 -1.586  1.00 0.00 ? 65 GLU A OE1  3  
ATOM 3638  O OE2  . GLU A 1 65 ? 6.417   -14.575 -1.316  1.00 0.00 ? 65 GLU A OE2  3  
ATOM 3639  H H    . GLU A 1 65 ? 4.929   -12.740 -3.774  1.00 0.00 ? 65 GLU A H    3  
ATOM 3640  H HA   . GLU A 1 65 ? 6.992   -12.552 -2.589  1.00 0.00 ? 65 GLU A HA   3  
ATOM 3641  H HB2  . GLU A 1 65 ? 7.850   -13.860 -5.165  1.00 0.00 ? 65 GLU A HB2  3  
ATOM 3642  H HB3  . GLU A 1 65 ? 8.822   -13.784 -3.696  1.00 0.00 ? 65 GLU A HB3  3  
ATOM 3643  H HG2  . GLU A 1 65 ? 6.031   -14.954 -3.769  1.00 0.00 ? 65 GLU A HG2  3  
ATOM 3644  H HG3  . GLU A 1 65 ? 7.489   -15.924 -3.984  1.00 0.00 ? 65 GLU A HG3  3  
ATOM 3645  N N    . VAL A 1 66 ? 7.265   -10.247 -4.462  1.00 0.00 ? 66 VAL A N    3  
ATOM 3646  C CA   . VAL A 1 66 ? 7.999   -9.017  -4.894  1.00 0.00 ? 66 VAL A CA   3  
ATOM 3647  C C    . VAL A 1 66 ? 8.269   -8.161  -3.643  1.00 0.00 ? 66 VAL A C    3  
ATOM 3648  O O    . VAL A 1 66 ? 7.471   -8.124  -2.727  1.00 0.00 ? 66 VAL A O    3  
ATOM 3649  C CB   . VAL A 1 66 ? 7.117   -8.250  -5.906  1.00 0.00 ? 66 VAL A CB   3  
ATOM 3650  C CG1  . VAL A 1 66 ? 7.390   -6.739  -5.852  1.00 0.00 ? 66 VAL A CG1  3  
ATOM 3651  C CG2  . VAL A 1 66 ? 7.399   -8.755  -7.327  1.00 0.00 ? 66 VAL A CG2  3  
ATOM 3652  H H    . VAL A 1 66 ? 6.284   -10.229 -4.412  1.00 0.00 ? 66 VAL A H    3  
ATOM 3653  H HA   . VAL A 1 66 ? 8.937   -9.290  -5.364  1.00 0.00 ? 66 VAL A HA   3  
ATOM 3654  H HB   . VAL A 1 66 ? 6.082   -8.429  -5.665  1.00 0.00 ? 66 VAL A HB   3  
ATOM 3655  H HG11 . VAL A 1 66 ? 8.457   -6.567  -5.849  1.00 0.00 ? 66 VAL A HG11 3  
ATOM 3656  H HG12 . VAL A 1 66 ? 6.957   -6.326  -4.953  1.00 0.00 ? 66 VAL A HG12 3  
ATOM 3657  H HG13 . VAL A 1 66 ? 6.951   -6.262  -6.715  1.00 0.00 ? 66 VAL A HG13 3  
ATOM 3658  H HG21 . VAL A 1 66 ? 7.488   -9.830  -7.316  1.00 0.00 ? 66 VAL A HG21 3  
ATOM 3659  H HG22 . VAL A 1 66 ? 8.321   -8.323  -7.687  1.00 0.00 ? 66 VAL A HG22 3  
ATOM 3660  H HG23 . VAL A 1 66 ? 6.589   -8.465  -7.979  1.00 0.00 ? 66 VAL A HG23 3  
ATOM 3661  N N    . SER A 1 67 ? 9.386   -7.480  -3.596  1.00 0.00 ? 67 SER A N    3  
ATOM 3662  C CA   . SER A 1 67 ? 9.693   -6.640  -2.399  1.00 0.00 ? 67 SER A CA   3  
ATOM 3663  C C    . SER A 1 67 ? 8.534   -5.644  -2.157  1.00 0.00 ? 67 SER A C    3  
ATOM 3664  O O    . SER A 1 67 ? 7.908   -5.214  -3.106  1.00 0.00 ? 67 SER A O    3  
ATOM 3665  C CB   . SER A 1 67 ? 11.001  -5.875  -2.637  1.00 0.00 ? 67 SER A CB   3  
ATOM 3666  O OG   . SER A 1 67 ? 11.878  -6.680  -3.412  1.00 0.00 ? 67 SER A OG   3  
ATOM 3667  H H    . SER A 1 67 ? 10.019  -7.523  -4.341  1.00 0.00 ? 67 SER A H    3  
ATOM 3668  H HA   . SER A 1 67 ? 9.811   -7.293  -1.558  1.00 0.00 ? 67 SER A HA   3  
ATOM 3669  H HB2  . SER A 1 67 ? 10.800  -4.959  -3.168  1.00 0.00 ? 67 SER A HB2  3  
ATOM 3670  H HB3  . SER A 1 67 ? 11.459  -5.642  -1.685  1.00 0.00 ? 67 SER A HB3  3  
ATOM 3671  H HG   . SER A 1 67 ? 11.347  -7.182  -4.036  1.00 0.00 ? 67 SER A HG   3  
ATOM 3672  N N    . PRO A 1 68 ? 8.259   -5.302  -0.906  1.00 0.00 ? 68 PRO A N    3  
ATOM 3673  C CA   . PRO A 1 68 ? 7.158   -4.365  -0.585  1.00 0.00 ? 68 PRO A CA   3  
ATOM 3674  C C    . PRO A 1 68 ? 7.387   -2.954  -1.173  1.00 0.00 ? 68 PRO A C    3  
ATOM 3675  O O    . PRO A 1 68 ? 6.455   -2.315  -1.607  1.00 0.00 ? 68 PRO A O    3  
ATOM 3676  C CB   . PRO A 1 68 ? 7.125   -4.305  0.963   1.00 0.00 ? 68 PRO A CB   3  
ATOM 3677  C CG   . PRO A 1 68 ? 8.333   -5.123  1.490   1.00 0.00 ? 68 PRO A CG   3  
ATOM 3678  C CD   . PRO A 1 68 ? 8.989   -5.817  0.280   1.00 0.00 ? 68 PRO A CD   3  
ATOM 3679  H HA   . PRO A 1 68 ? 6.225   -4.765  -0.955  1.00 0.00 ? 68 PRO A HA   3  
ATOM 3680  H HB2  . PRO A 1 68 ? 7.192   -3.280  1.307   1.00 0.00 ? 68 PRO A HB2  3  
ATOM 3681  H HB3  . PRO A 1 68 ? 6.213   -4.743  1.328   1.00 0.00 ? 68 PRO A HB3  3  
ATOM 3682  H HG2  . PRO A 1 68 ? 9.043   -4.462  1.973   1.00 0.00 ? 68 PRO A HG2  3  
ATOM 3683  H HG3  . PRO A 1 68 ? 7.990   -5.869  2.198   1.00 0.00 ? 68 PRO A HG3  3  
ATOM 3684  H HD2  . PRO A 1 68 ? 10.041  -5.565  0.218   1.00 0.00 ? 68 PRO A HD2  3  
ATOM 3685  H HD3  . PRO A 1 68 ? 8.860   -6.885  0.361   1.00 0.00 ? 68 PRO A HD3  3  
ATOM 3686  N N    . GLU A 1 69 ? 8.588   -2.437  -1.154  1.00 0.00 ? 69 GLU A N    3  
ATOM 3687  C CA   . GLU A 1 69 ? 8.790   -1.046  -1.680  1.00 0.00 ? 69 GLU A CA   3  
ATOM 3688  C C    . GLU A 1 69 ? 8.810   -1.038  -3.213  1.00 0.00 ? 69 GLU A C    3  
ATOM 3689  O O    . GLU A 1 69 ? 8.624   -0.006  -3.845  1.00 0.00 ? 69 GLU A O    3  
ATOM 3690  C CB   . GLU A 1 69 ? 10.096  -0.450  -1.130  1.00 0.00 ? 69 GLU A CB   3  
ATOM 3691  C CG   . GLU A 1 69 ? 11.283  -1.393  -1.381  1.00 0.00 ? 69 GLU A CG   3  
ATOM 3692  C CD   . GLU A 1 69 ? 11.769  -1.263  -2.829  1.00 0.00 ? 69 GLU A CD   3  
ATOM 3693  O OE1  . GLU A 1 69 ? 11.313  -0.363  -3.514  1.00 0.00 ? 69 GLU A OE1  3  
ATOM 3694  O OE2  . GLU A 1 69 ? 12.599  -2.064  -3.224  1.00 0.00 ? 69 GLU A OE2  3  
ATOM 3695  H H    . GLU A 1 69 ? 9.340   -2.937  -0.772  1.00 0.00 ? 69 GLU A H    3  
ATOM 3696  H HA   . GLU A 1 69 ? 7.966   -0.430  -1.348  1.00 0.00 ? 69 GLU A HA   3  
ATOM 3697  H HB2  . GLU A 1 69 ? 10.285  0.499   -1.608  1.00 0.00 ? 69 GLU A HB2  3  
ATOM 3698  H HB3  . GLU A 1 69 ? 9.990   -0.294  -0.066  1.00 0.00 ? 69 GLU A HB3  3  
ATOM 3699  H HG2  . GLU A 1 69 ? 12.090  -1.131  -0.712  1.00 0.00 ? 69 GLU A HG2  3  
ATOM 3700  H HG3  . GLU A 1 69 ? 10.984  -2.410  -1.194  1.00 0.00 ? 69 GLU A HG3  3  
ATOM 3701  N N    . LEU A 1 70 ? 8.996   -2.170  -3.831  1.00 0.00 ? 70 LEU A N    3  
ATOM 3702  C CA   . LEU A 1 70 ? 8.990   -2.172  -5.318  1.00 0.00 ? 70 LEU A CA   3  
ATOM 3703  C C    . LEU A 1 70 ? 7.548   -1.906  -5.765  1.00 0.00 ? 70 LEU A C    3  
ATOM 3704  O O    . LEU A 1 70 ? 7.284   -1.588  -6.908  1.00 0.00 ? 70 LEU A O    3  
ATOM 3705  C CB   . LEU A 1 70 ? 9.516   -3.512  -5.860  1.00 0.00 ? 70 LEU A CB   3  
ATOM 3706  C CG   . LEU A 1 70 ? 11.043  -3.571  -5.741  1.00 0.00 ? 70 LEU A CG   3  
ATOM 3707  C CD1  . LEU A 1 70 ? 11.526  -5.000  -6.021  1.00 0.00 ? 70 LEU A CD1  3  
ATOM 3708  C CD2  . LEU A 1 70 ? 11.719  -2.595  -6.729  1.00 0.00 ? 70 LEU A CD2  3  
ATOM 3709  H H    . LEU A 1 70 ? 9.102   -2.997  -3.317  1.00 0.00 ? 70 LEU A H    3  
ATOM 3710  H HA   . LEU A 1 70 ? 9.607   -1.354  -5.652  1.00 0.00 ? 70 LEU A HA   3  
ATOM 3711  H HB2  . LEU A 1 70 ? 9.086   -4.319  -5.286  1.00 0.00 ? 70 LEU A HB2  3  
ATOM 3712  H HB3  . LEU A 1 70 ? 9.237   -3.624  -6.885  1.00 0.00 ? 70 LEU A HB3  3  
ATOM 3713  H HG   . LEU A 1 70 ? 11.311  -3.299  -4.744  1.00 0.00 ? 70 LEU A HG   3  
ATOM 3714  H HD11 . LEU A 1 70 ? 12.569  -5.085  -5.758  1.00 0.00 ? 70 LEU A HD11 3  
ATOM 3715  H HD12 . LEU A 1 70 ? 11.403  -5.223  -7.071  1.00 0.00 ? 70 LEU A HD12 3  
ATOM 3716  H HD13 . LEU A 1 70 ? 10.949  -5.702  -5.437  1.00 0.00 ? 70 LEU A HD13 3  
ATOM 3717  H HD21 . LEU A 1 70 ? 12.713  -2.950  -6.970  1.00 0.00 ? 70 LEU A HD21 3  
ATOM 3718  H HD22 . LEU A 1 70 ? 11.796  -1.619  -6.276  1.00 0.00 ? 70 LEU A HD22 3  
ATOM 3719  H HD23 . LEU A 1 70 ? 11.139  -2.526  -7.632  1.00 0.00 ? 70 LEU A HD23 3  
ATOM 3720  N N    . VAL A 1 71 ? 6.611   -2.061  -4.861  1.00 0.00 ? 71 VAL A N    3  
ATOM 3721  C CA   . VAL A 1 71 ? 5.177   -1.848  -5.215  1.00 0.00 ? 71 VAL A CA   3  
ATOM 3722  C C    . VAL A 1 71 ? 4.922   -0.382  -5.575  1.00 0.00 ? 71 VAL A C    3  
ATOM 3723  O O    . VAL A 1 71 ? 4.390   -0.088  -6.623  1.00 0.00 ? 71 VAL A O    3  
ATOM 3724  C CB   . VAL A 1 71 ? 4.274   -2.277  -4.032  1.00 0.00 ? 71 VAL A CB   3  
ATOM 3725  C CG1  . VAL A 1 71 ? 2.883   -1.606  -4.102  1.00 0.00 ? 71 VAL A CG1  3  
ATOM 3726  C CG2  . VAL A 1 71 ? 4.107   -3.799  -4.042  1.00 0.00 ? 71 VAL A CG2  3  
ATOM 3727  H H    . VAL A 1 71 ? 6.861   -2.352  -3.959  1.00 0.00 ? 71 VAL A H    3  
ATOM 3728  H HA   . VAL A 1 71 ? 4.963   -2.439  -6.091  1.00 0.00 ? 71 VAL A HA   3  
ATOM 3729  H HB   . VAL A 1 71 ? 4.749   -1.984  -3.113  1.00 0.00 ? 71 VAL A HB   3  
ATOM 3730  H HG11 . VAL A 1 71 ? 2.512   -1.646  -5.114  1.00 0.00 ? 71 VAL A HG11 3  
ATOM 3731  H HG12 . VAL A 1 71 ? 2.954   -0.573  -3.786  1.00 0.00 ? 71 VAL A HG12 3  
ATOM 3732  H HG13 . VAL A 1 71 ? 2.198   -2.123  -3.444  1.00 0.00 ? 71 VAL A HG13 3  
ATOM 3733  H HG21 . VAL A 1 71 ? 5.059   -4.267  -3.833  1.00 0.00 ? 71 VAL A HG21 3  
ATOM 3734  H HG22 . VAL A 1 71 ? 3.753   -4.119  -5.010  1.00 0.00 ? 71 VAL A HG22 3  
ATOM 3735  H HG23 . VAL A 1 71 ? 3.394   -4.087  -3.284  1.00 0.00 ? 71 VAL A HG23 3  
ATOM 3736  N N    . CYS A 1 72 ? 5.242   0.547   -4.720  1.00 0.00 ? 72 CYS A N    3  
ATOM 3737  C CA   . CYS A 1 72 ? 4.931   1.957   -5.064  1.00 0.00 ? 72 CYS A CA   3  
ATOM 3738  C C    . CYS A 1 72 ? 5.713   2.387   -6.313  1.00 0.00 ? 72 CYS A C    3  
ATOM 3739  O O    . CYS A 1 72 ? 5.289   3.243   -7.064  1.00 0.00 ? 72 CYS A O    3  
ATOM 3740  C CB   . CYS A 1 72 ? 5.307   2.866   -3.880  1.00 0.00 ? 72 CYS A CB   3  
ATOM 3741  S SG   . CYS A 1 72 ? 4.552   2.244   -2.362  1.00 0.00 ? 72 CYS A SG   3  
ATOM 3742  H H    . CYS A 1 72 ? 5.634   0.326   -3.848  1.00 0.00 ? 72 CYS A H    3  
ATOM 3743  H HA   . CYS A 1 72 ? 3.860   2.005   -5.227  1.00 0.00 ? 72 CYS A HA   3  
ATOM 3744  H HB2  . CYS A 1 72 ? 6.378   2.888   -3.756  1.00 0.00 ? 72 CYS A HB2  3  
ATOM 3745  H HB3  . CYS A 1 72 ? 4.950   3.864   -4.067  1.00 0.00 ? 72 CYS A HB3  3  
ATOM 3746  N N    . SER A 1 73 ? 6.858   1.781   -6.538  1.00 0.00 ? 73 SER A N    3  
ATOM 3747  C CA   . SER A 1 73 ? 7.671   2.141   -7.741  1.00 0.00 ? 73 SER A CA   3  
ATOM 3748  C C    . SER A 1 73 ? 7.100   1.486   -9.020  1.00 0.00 ? 73 SER A C    3  
ATOM 3749  O O    . SER A 1 73 ? 7.079   2.096   -10.070 1.00 0.00 ? 73 SER A O    3  
ATOM 3750  C CB   . SER A 1 73 ? 9.120   1.701   -7.538  1.00 0.00 ? 73 SER A CB   3  
ATOM 3751  O OG   . SER A 1 73 ? 9.959   2.428   -8.426  1.00 0.00 ? 73 SER A OG   3  
ATOM 3752  H H    . SER A 1 73 ? 7.175   1.101   -5.889  1.00 0.00 ? 73 SER A H    3  
ATOM 3753  H HA   . SER A 1 73 ? 7.635   3.211   -7.880  1.00 0.00 ? 73 SER A HA   3  
ATOM 3754  H HB2  . SER A 1 73 ? 9.421   1.902   -6.523  1.00 0.00 ? 73 SER A HB2  3  
ATOM 3755  H HB3  . SER A 1 73 ? 9.205   0.640   -7.735  1.00 0.00 ? 73 SER A HB3  3  
ATOM 3756  H HG   . SER A 1 73 ? 9.452   3.164   -8.778  1.00 0.00 ? 73 SER A HG   3  
ATOM 3757  N N    . MET A 1 74 ? 6.640   0.261   -8.952  1.00 0.00 ? 74 MET A N    3  
ATOM 3758  C CA   . MET A 1 74 ? 6.081   -0.402  -10.181 1.00 0.00 ? 74 MET A CA   3  
ATOM 3759  C C    . MET A 1 74 ? 4.714   0.209   -10.548 1.00 0.00 ? 74 MET A C    3  
ATOM 3760  O O    . MET A 1 74 ? 4.420   0.412   -11.710 1.00 0.00 ? 74 MET A O    3  
ATOM 3761  C CB   . MET A 1 74 ? 5.915   -1.929  -9.929  1.00 0.00 ? 74 MET A CB   3  
ATOM 3762  C CG   . MET A 1 74 ? 7.098   -2.730  -10.504 1.00 0.00 ? 74 MET A CG   3  
ATOM 3763  S SD   . MET A 1 74 ? 6.625   -4.472  -10.692 1.00 0.00 ? 74 MET A SD   3  
ATOM 3764  C CE   . MET A 1 74 ? 5.787   -4.697  -9.101  1.00 0.00 ? 74 MET A CE   3  
ATOM 3765  H H    . MET A 1 74 ? 6.663   -0.226  -8.102  1.00 0.00 ? 74 MET A H    3  
ATOM 3766  H HA   . MET A 1 74 ? 6.738   -0.252  -11.020 1.00 0.00 ? 74 MET A HA   3  
ATOM 3767  H HB2  . MET A 1 74 ? 5.864   -2.104  -8.868  1.00 0.00 ? 74 MET A HB2  3  
ATOM 3768  H HB3  . MET A 1 74 ? 5.002   -2.281  -10.394 1.00 0.00 ? 74 MET A HB3  3  
ATOM 3769  H HG2  . MET A 1 74 ? 7.373   -2.340  -11.473 1.00 0.00 ? 74 MET A HG2  3  
ATOM 3770  H HG3  . MET A 1 74 ? 7.940   -2.656  -9.838  1.00 0.00 ? 74 MET A HG3  3  
ATOM 3771  H HE1  . MET A 1 74 ? 5.630   -5.752  -8.926  1.00 0.00 ? 74 MET A HE1  3  
ATOM 3772  H HE2  . MET A 1 74 ? 4.832   -4.195  -9.116  1.00 0.00 ? 74 MET A HE2  3  
ATOM 3773  H HE3  . MET A 1 74 ? 6.396   -4.284  -8.311  1.00 0.00 ? 74 MET A HE3  3  
ATOM 3774  N N    . LEU A 1 75 ? 3.870   0.490   -9.593  1.00 0.00 ? 75 LEU A N    3  
ATOM 3775  C CA   . LEU A 1 75 ? 2.534   1.066   -9.944  1.00 0.00 ? 75 LEU A CA   3  
ATOM 3776  C C    . LEU A 1 75 ? 2.686   2.527   -10.391 1.00 0.00 ? 75 LEU A C    3  
ATOM 3777  O O    . LEU A 1 75 ? 1.724   3.267   -10.449 1.00 0.00 ? 75 LEU A O    3  
ATOM 3778  C CB   . LEU A 1 75 ? 1.596   0.992   -8.729  1.00 0.00 ? 75 LEU A CB   3  
ATOM 3779  C CG   . LEU A 1 75 ? 1.525   -0.447  -8.186  1.00 0.00 ? 75 LEU A CG   3  
ATOM 3780  C CD1  . LEU A 1 75 ? 0.432   -0.543  -7.118  1.00 0.00 ? 75 LEU A CD1  3  
ATOM 3781  C CD2  . LEU A 1 75 ? 1.210   -1.432  -9.324  1.00 0.00 ? 75 LEU A CD2  3  
ATOM 3782  H H    . LEU A 1 75 ? 4.102   0.312   -8.657  1.00 0.00 ? 75 LEU A H    3  
ATOM 3783  H HA   . LEU A 1 75 ? 2.109   0.501   -10.758 1.00 0.00 ? 75 LEU A HA   3  
ATOM 3784  H HB2  . LEU A 1 75 ? 1.967   1.647   -7.953  1.00 0.00 ? 75 LEU A HB2  3  
ATOM 3785  H HB3  . LEU A 1 75 ? 0.608   1.311   -9.022  1.00 0.00 ? 75 LEU A HB3  3  
ATOM 3786  H HG   . LEU A 1 75 ? 2.468   -0.704  -7.741  1.00 0.00 ? 75 LEU A HG   3  
ATOM 3787  H HD11 . LEU A 1 75 ? 0.754   -0.023  -6.228  1.00 0.00 ? 75 LEU A HD11 3  
ATOM 3788  H HD12 . LEU A 1 75 ? 0.251   -1.581  -6.882  1.00 0.00 ? 75 LEU A HD12 3  
ATOM 3789  H HD13 . LEU A 1 75 ? -0.476  -0.096  -7.491  1.00 0.00 ? 75 LEU A HD13 3  
ATOM 3790  H HD21 . LEU A 1 75 ? 0.486   -0.993  -9.994  1.00 0.00 ? 75 LEU A HD21 3  
ATOM 3791  H HD22 . LEU A 1 75 ? 0.809   -2.346  -8.912  1.00 0.00 ? 75 LEU A HD22 3  
ATOM 3792  H HD23 . LEU A 1 75 ? 2.117   -1.654  -9.868  1.00 0.00 ? 75 LEU A HD23 3  
ATOM 3793  N N    . HIS A 1 76 ? 3.881   2.949   -10.704 1.00 0.00 ? 76 HIS A N    3  
ATOM 3794  C CA   . HIS A 1 76 ? 4.087   4.364   -11.144 1.00 0.00 ? 76 HIS A CA   3  
ATOM 3795  C C    . HIS A 1 76 ? 3.369   5.305   -10.168 1.00 0.00 ? 76 HIS A C    3  
ATOM 3796  O O    . HIS A 1 76 ? 3.061   6.431   -10.503 1.00 0.00 ? 76 HIS A O    3  
ATOM 3797  C CB   . HIS A 1 76 ? 3.543   4.553   -12.567 1.00 0.00 ? 76 HIS A CB   3  
ATOM 3798  C CG   . HIS A 1 76 ? 4.260   3.619   -13.502 1.00 0.00 ? 76 HIS A CG   3  
ATOM 3799  N ND1  . HIS A 1 76 ? 5.632   3.422   -13.443 1.00 0.00 ? 76 HIS A ND1  3  
ATOM 3800  C CD2  . HIS A 1 76 ? 3.811   2.820   -14.524 1.00 0.00 ? 76 HIS A CD2  3  
ATOM 3801  C CE1  . HIS A 1 76 ? 5.956   2.536   -14.403 1.00 0.00 ? 76 HIS A CE1  3  
ATOM 3802  N NE2  . HIS A 1 76 ? 4.883   2.138   -15.091 1.00 0.00 ? 76 HIS A NE2  3  
ATOM 3803  H H    . HIS A 1 76 ? 4.645   2.338   -10.640 1.00 0.00 ? 76 HIS A H    3  
ATOM 3804  H HA   . HIS A 1 76 ? 5.144   4.585   -11.135 1.00 0.00 ? 76 HIS A HA   3  
ATOM 3805  H HB2  . HIS A 1 76 ? 2.486   4.336   -12.587 1.00 0.00 ? 76 HIS A HB2  3  
ATOM 3806  H HB3  . HIS A 1 76 ? 3.708   5.572   -12.885 1.00 0.00 ? 76 HIS A HB3  3  
ATOM 3807  H HD1  . HIS A 1 76 ? 6.251   3.849   -12.816 1.00 0.00 ? 76 HIS A HD1  3  
ATOM 3808  H HD2  . HIS A 1 76 ? 2.781   2.735   -14.839 1.00 0.00 ? 76 HIS A HD2  3  
ATOM 3809  H HE1  . HIS A 1 76 ? 6.961   2.190   -14.594 1.00 0.00 ? 76 HIS A HE1  3  
ATOM 3810  N N    . LEU A 1 77 ? 3.092   4.866   -8.971  1.00 0.00 ? 77 LEU A N    3  
ATOM 3811  C CA   . LEU A 1 77 ? 2.390   5.749   -7.996  1.00 0.00 ? 77 LEU A CA   3  
ATOM 3812  C C    . LEU A 1 77 ? 3.431   6.662   -7.328  1.00 0.00 ? 77 LEU A C    3  
ATOM 3813  O O    . LEU A 1 77 ? 3.082   7.646   -6.705  1.00 0.00 ? 77 LEU A O    3  
ATOM 3814  C CB   . LEU A 1 77 ? 1.650   4.860   -6.956  1.00 0.00 ? 77 LEU A CB   3  
ATOM 3815  C CG   . LEU A 1 77 ? 0.153   5.223   -6.837  1.00 0.00 ? 77 LEU A CG   3  
ATOM 3816  C CD1  . LEU A 1 77 ? -0.549  5.258   -8.217  1.00 0.00 ? 77 LEU A CD1  3  
ATOM 3817  C CD2  . LEU A 1 77 ? -0.545  4.201   -5.925  1.00 0.00 ? 77 LEU A CD2  3  
ATOM 3818  H H    . LEU A 1 77 ? 3.343   3.963   -8.710  1.00 0.00 ? 77 LEU A H    3  
ATOM 3819  H HA   . LEU A 1 77 ? 1.686   6.374   -8.523  1.00 0.00 ? 77 LEU A HA   3  
ATOM 3820  H HB2  . LEU A 1 77 ? 1.729   3.832   -7.256  1.00 0.00 ? 77 LEU A HB2  3  
ATOM 3821  H HB3  . LEU A 1 77 ? 2.107   4.977   -5.986  1.00 0.00 ? 77 LEU A HB3  3  
ATOM 3822  H HG   . LEU A 1 77 ? 0.084   6.187   -6.387  1.00 0.00 ? 77 LEU A HG   3  
ATOM 3823  H HD11 . LEU A 1 77 ? -0.631  6.283   -8.548  1.00 0.00 ? 77 LEU A HD11 3  
ATOM 3824  H HD12 . LEU A 1 77 ? -1.543  4.833   -8.144  1.00 0.00 ? 77 LEU A HD12 3  
ATOM 3825  H HD13 . LEU A 1 77 ? 0.025   4.697   -8.936  1.00 0.00 ? 77 LEU A HD13 3  
ATOM 3826  H HD21 . LEU A 1 77 ? 0.098   3.950   -5.096  1.00 0.00 ? 77 LEU A HD21 3  
ATOM 3827  H HD22 . LEU A 1 77 ? -0.768  3.311   -6.489  1.00 0.00 ? 77 LEU A HD22 3  
ATOM 3828  H HD23 . LEU A 1 77 ? -1.464  4.623   -5.553  1.00 0.00 ? 77 LEU A HD23 3  
ATOM 3829  N N    . CYS A 1 78 ? 4.705   6.354   -7.465  1.00 0.00 ? 78 CYS A N    3  
ATOM 3830  C CA   . CYS A 1 78 ? 5.770   7.219   -6.850  1.00 0.00 ? 78 CYS A CA   3  
ATOM 3831  C C    . CYS A 1 78 ? 6.788   7.619   -7.924  1.00 0.00 ? 78 CYS A C    3  
ATOM 3832  O O    . CYS A 1 78 ? 6.812   7.137   -9.039  1.00 0.00 ? 78 CYS A O    3  
ATOM 3833  C CB   . CYS A 1 78 ? 6.489   6.465   -5.734  1.00 0.00 ? 78 CYS A CB   3  
ATOM 3834  S SG   . CYS A 1 78 ? 5.473   6.493   -4.247  1.00 0.00 ? 78 CYS A SG   3  
ATOM 3835  H H    . CYS A 1 78 ? 4.961   5.559   -7.979  1.00 0.00 ? 78 CYS A H    3  
ATOM 3836  H HA   . CYS A 1 78 ? 5.321   8.128   -6.468  1.00 0.00 ? 78 CYS A HA   3  
ATOM 3837  H HB2  . CYS A 1 78 ? 6.657   5.445   -6.042  1.00 0.00 ? 78 CYS A HB2  3  
ATOM 3838  H HB3  . CYS A 1 78 ? 7.440   6.937   -5.526  1.00 0.00 ? 78 CYS A HB3  3  
ATOM 3839  N N    . SER A 1 79 ? 7.622   8.536   -7.516  1.00 0.00 ? 79 SER A N    3  
ATOM 3840  C CA   . SER A 1 79 ? 8.713   9.121   -8.346  1.00 0.00 ? 79 SER A CA   3  
ATOM 3841  C C    . SER A 1 79 ? 8.109   10.105  -9.351  1.00 0.00 ? 79 SER A C    3  
ATOM 3842  O O    . SER A 1 79 ? 8.561   10.219  -10.473 1.00 0.00 ? 79 SER A O    3  
ATOM 3843  C CB   . SER A 1 79 ? 9.531   8.035   -9.044  1.00 0.00 ? 79 SER A CB   3  
ATOM 3844  O OG   . SER A 1 79 ? 8.863   7.637   -10.234 1.00 0.00 ? 79 SER A OG   3  
ATOM 3845  H H    . SER A 1 79 ? 7.521   8.867   -6.600  1.00 0.00 ? 79 SER A H    3  
ATOM 3846  H HA   . SER A 1 79 ? 9.315   9.663   -7.632  1.00 0.00 ? 79 SER A HA   3  
ATOM 3847  H HB2  . SER A 1 79 ? 10.505  8.419   -9.296  1.00 0.00 ? 79 SER A HB2  3  
ATOM 3848  H HB3  . SER A 1 79 ? 9.641   7.188   -8.380  1.00 0.00 ? 79 SER A HB3  3  
ATOM 3849  H HG   . SER A 1 79 ? 7.953   7.936   -10.178 1.00 0.00 ? 79 SER A HG   3  
ATOM 3850  N N    . GLY A 1 80 ? 7.087   10.816  -8.958  1.00 0.00 ? 80 GLY A N    3  
ATOM 3851  C CA   . GLY A 1 80 ? 6.453   11.790  -9.890  1.00 0.00 ? 80 GLY A CA   3  
ATOM 3852  C C    . GLY A 1 80 ? 7.335   13.035  -10.013 1.00 0.00 ? 80 GLY A C    3  
ATOM 3853  O O    . GLY A 1 80 ? 8.545   12.945  -10.079 1.00 0.00 ? 80 GLY A O    3  
ATOM 3854  H H    . GLY A 1 80 ? 6.736   10.708  -8.049  1.00 0.00 ? 80 GLY A H    3  
ATOM 3855  H HA2  . GLY A 1 80 ? 6.335   11.333  -10.862 1.00 0.00 ? 80 GLY A HA2  3  
ATOM 3856  H HA3  . GLY A 1 80 ? 5.485   12.077  -9.507  1.00 0.00 ? 80 GLY A HA3  3  
ATOM 3857  N N    . LEU A 1 81 ? 6.738   14.196  -10.046 1.00 0.00 ? 81 LEU A N    3  
ATOM 3858  C CA   . LEU A 1 81 ? 7.542   15.445  -10.168 1.00 0.00 ? 81 LEU A CA   3  
ATOM 3859  C C    . LEU A 1 81 ? 8.194   15.764  -8.820  1.00 0.00 ? 81 LEU A C    3  
ATOM 3860  O O    . LEU A 1 81 ? 8.042   16.846  -8.289  1.00 0.00 ? 81 LEU A O    3  
ATOM 3861  C CB   . LEU A 1 81 ? 6.624   16.602  -10.581 1.00 0.00 ? 81 LEU A CB   3  
ATOM 3862  C CG   . LEU A 1 81 ? 6.323   16.516  -12.080 1.00 0.00 ? 81 LEU A CG   3  
ATOM 3863  C CD1  . LEU A 1 81 ? 5.593   15.204  -12.390 1.00 0.00 ? 81 LEU A CD1  3  
ATOM 3864  C CD2  . LEU A 1 81 ? 5.440   17.700  -12.486 1.00 0.00 ? 81 LEU A CD2  3  
ATOM 3865  H H    . LEU A 1 81 ? 5.761   14.245  -9.993  1.00 0.00 ? 81 LEU A H    3  
ATOM 3866  H HA   . LEU A 1 81 ? 8.311   15.308  -10.914 1.00 0.00 ? 81 LEU A HA   3  
ATOM 3867  H HB2  . LEU A 1 81 ? 5.700   16.543  -10.025 1.00 0.00 ? 81 LEU A HB2  3  
ATOM 3868  H HB3  . LEU A 1 81 ? 7.110   17.543  -10.369 1.00 0.00 ? 81 LEU A HB3  3  
ATOM 3869  H HG   . LEU A 1 81 ? 7.249   16.549  -12.634 1.00 0.00 ? 81 LEU A HG   3  
ATOM 3870  H HD11 . LEU A 1 81 ? 6.303   14.391  -12.399 1.00 0.00 ? 81 LEU A HD11 3  
ATOM 3871  H HD12 . LEU A 1 81 ? 5.117   15.274  -13.357 1.00 0.00 ? 81 LEU A HD12 3  
ATOM 3872  H HD13 . LEU A 1 81 ? 4.844   15.019  -11.633 1.00 0.00 ? 81 LEU A HD13 3  
ATOM 3873  H HD21 . LEU A 1 81 ? 5.966   18.623  -12.294 1.00 0.00 ? 81 LEU A HD21 3  
ATOM 3874  H HD22 . LEU A 1 81 ? 4.525   17.680  -11.912 1.00 0.00 ? 81 LEU A HD22 3  
ATOM 3875  H HD23 . LEU A 1 81 ? 5.207   17.631  -13.538 1.00 0.00 ? 81 LEU A HD23 3  
ATOM 3876  N N    . VAL A 1 82 ? 8.919   14.825  -8.263  1.00 0.00 ? 82 VAL A N    3  
ATOM 3877  C CA   . VAL A 1 82 ? 9.589   15.055  -6.942  1.00 0.00 ? 82 VAL A CA   3  
ATOM 3878  C C    . VAL A 1 82 ? 11.034  14.493  -7.004  1.00 0.00 ? 82 VAL A C    3  
ATOM 3879  O O    . VAL A 1 82 ? 11.218  13.301  -6.862  1.00 0.00 ? 82 VAL A O    3  
ATOM 3880  C CB   . VAL A 1 82 ? 8.773   14.328  -5.853  1.00 0.00 ? 82 VAL A CB   3  
ATOM 3881  C CG1  . VAL A 1 82 ? 8.259   12.987  -6.390  1.00 0.00 ? 82 VAL A CG1  3  
ATOM 3882  C CG2  . VAL A 1 82 ? 9.632   14.091  -4.598  1.00 0.00 ? 82 VAL A CG2  3  
ATOM 3883  H H    . VAL A 1 82 ? 9.018   13.958  -8.714  1.00 0.00 ? 82 VAL A H    3  
ATOM 3884  H HA   . VAL A 1 82 ? 9.602   16.109  -6.716  1.00 0.00 ? 82 VAL A HA   3  
ATOM 3885  H HB   . VAL A 1 82 ? 7.924   14.943  -5.587  1.00 0.00 ? 82 VAL A HB   3  
ATOM 3886  H HG11 . VAL A 1 82 ? 7.777   12.442  -5.593  1.00 0.00 ? 82 VAL A HG11 3  
ATOM 3887  H HG12 . VAL A 1 82 ? 9.085   12.407  -6.773  1.00 0.00 ? 82 VAL A HG12 3  
ATOM 3888  H HG13 . VAL A 1 82 ? 7.548   13.166  -7.183  1.00 0.00 ? 82 VAL A HG13 3  
ATOM 3889  H HG21 . VAL A 1 82 ? 8.988   13.950  -3.744  1.00 0.00 ? 82 VAL A HG21 3  
ATOM 3890  H HG22 . VAL A 1 82 ? 10.269  14.946  -4.430  1.00 0.00 ? 82 VAL A HG22 3  
ATOM 3891  H HG23 . VAL A 1 82 ? 10.244  13.210  -4.735  1.00 0.00 ? 82 VAL A HG23 3  
ATOM 3892  N N    . PRO A 1 83 ? 12.031  15.340  -7.223  1.00 0.00 ? 83 PRO A N    3  
ATOM 3893  C CA   . PRO A 1 83 ? 13.424  14.858  -7.301  1.00 0.00 ? 83 PRO A CA   3  
ATOM 3894  C C    . PRO A 1 83 ? 13.852  14.300  -5.930  1.00 0.00 ? 83 PRO A C    3  
ATOM 3895  O O    . PRO A 1 83 ? 14.743  14.811  -5.281  1.00 0.00 ? 83 PRO A O    3  
ATOM 3896  C CB   . PRO A 1 83 ? 14.257  16.099  -7.717  1.00 0.00 ? 83 PRO A CB   3  
ATOM 3897  C CG   . PRO A 1 83 ? 13.281  17.310  -7.797  1.00 0.00 ? 83 PRO A CG   3  
ATOM 3898  C CD   . PRO A 1 83 ? 11.874  16.802  -7.409  1.00 0.00 ? 83 PRO A CD   3  
ATOM 3899  H HA   . PRO A 1 83 ? 13.506  14.087  -8.054  1.00 0.00 ? 83 PRO A HA   3  
ATOM 3900  H HB2  . PRO A 1 83 ? 15.036  16.297  -6.992  1.00 0.00 ? 83 PRO A HB2  3  
ATOM 3901  H HB3  . PRO A 1 83 ? 14.704  15.933  -8.688  1.00 0.00 ? 83 PRO A HB3  3  
ATOM 3902  H HG2  . PRO A 1 83 ? 13.600  18.087  -7.111  1.00 0.00 ? 83 PRO A HG2  3  
ATOM 3903  H HG3  . PRO A 1 83 ? 13.261  17.704  -8.805  1.00 0.00 ? 83 PRO A HG3  3  
ATOM 3904  H HD2  . PRO A 1 83 ? 11.553  17.268  -6.484  1.00 0.00 ? 83 PRO A HD2  3  
ATOM 3905  H HD3  . PRO A 1 83 ? 11.165  17.005  -8.198  1.00 0.00 ? 83 PRO A HD3  3  
ATOM 3906  N N    . ARG A 1 84 ? 13.215  13.252  -5.487  1.00 0.00 ? 84 ARG A N    3  
ATOM 3907  C CA   . ARG A 1 84 ? 13.578  12.663  -4.168  1.00 0.00 ? 84 ARG A CA   3  
ATOM 3908  C C    . ARG A 1 84 ? 12.929  11.283  -4.034  1.00 0.00 ? 84 ARG A C    3  
ATOM 3909  O O    . ARG A 1 84 ? 11.713  11.213  -4.103  1.00 0.00 ? 84 ARG A O    3  
ATOM 3910  C CB   . ARG A 1 84 ? 13.077  13.582  -3.048  1.00 0.00 ? 84 ARG A CB   3  
ATOM 3911  C CG   . ARG A 1 84 ? 13.765  13.223  -1.720  1.00 0.00 ? 84 ARG A CG   3  
ATOM 3912  C CD   . ARG A 1 84 ? 13.292  11.845  -1.218  1.00 0.00 ? 84 ARG A CD   3  
ATOM 3913  N NE   . ARG A 1 84 ? 13.286  11.833  0.279   1.00 0.00 ? 84 ARG A NE   3  
ATOM 3914  C CZ   . ARG A 1 84 ? 14.323  12.238  0.966   1.00 0.00 ? 84 ARG A CZ   3  
ATOM 3915  N NH1  . ARG A 1 84 ? 15.460  12.475  0.372   1.00 0.00 ? 84 ARG A NH1  3  
ATOM 3916  N NH2  . ARG A 1 84 ? 14.236  12.349  2.264   1.00 0.00 ? 84 ARG A NH2  3  
ATOM 3917  O OXT  . ARG A 1 84 ? 13.659  10.321  -3.867  1.00 0.00 ? 84 ARG A OXT  3  
ATOM 3918  H H    . ARG A 1 84 ? 12.497  12.852  -6.022  1.00 0.00 ? 84 ARG A H    3  
ATOM 3919  H HA   . ARG A 1 84 ? 14.651  12.564  -4.102  1.00 0.00 ? 84 ARG A HA   3  
ATOM 3920  H HB2  . ARG A 1 84 ? 13.305  14.607  -3.301  1.00 0.00 ? 84 ARG A HB2  3  
ATOM 3921  H HB3  . ARG A 1 84 ? 12.008  13.473  -2.941  1.00 0.00 ? 84 ARG A HB3  3  
ATOM 3922  H HG2  . ARG A 1 84 ? 14.833  13.208  -1.873  1.00 0.00 ? 84 ARG A HG2  3  
ATOM 3923  H HG3  . ARG A 1 84 ? 13.523  13.972  -0.981  1.00 0.00 ? 84 ARG A HG3  3  
ATOM 3924  H HD2  . ARG A 1 84 ? 12.287  11.656  -1.548  1.00 0.00 ? 84 ARG A HD2  3  
ATOM 3925  H HD3  . ARG A 1 84 ? 13.946  11.072  -1.611  1.00 0.00 ? 84 ARG A HD3  3  
ATOM 3926  H HE   . ARG A 1 84 ? 12.470  11.569  0.753   1.00 0.00 ? 84 ARG A HE   3  
ATOM 3927  H HH11 . ARG A 1 84 ? 15.548  12.344  -0.611  1.00 0.00 ? 84 ARG A HH11 3  
ATOM 3928  H HH12 . ARG A 1 84 ? 16.245  12.790  0.905   1.00 0.00 ? 84 ARG A HH12 3  
ATOM 3929  H HH21 . ARG A 1 84 ? 13.380  12.125  2.728   1.00 0.00 ? 84 ARG A HH21 3  
ATOM 3930  H HH22 . ARG A 1 84 ? 15.026  12.658  2.793   1.00 0.00 ? 84 ARG A HH22 3  
ATOM 3931  N N    . SER A 1 1  ? 6.477   16.697  -1.106  1.00 0.00 ? 1  SER A N    4  
ATOM 3932  C CA   . SER A 1 1  ? 5.403   16.564  -0.082  1.00 0.00 ? 1  SER A CA   4  
ATOM 3933  C C    . SER A 1 1  ? 4.202   15.839  -0.693  1.00 0.00 ? 1  SER A C    4  
ATOM 3934  O O    . SER A 1 1  ? 3.063   16.119  -0.377  1.00 0.00 ? 1  SER A O    4  
ATOM 3935  C CB   . SER A 1 1  ? 4.974   17.954  0.390   1.00 0.00 ? 1  SER A CB   4  
ATOM 3936  O OG   . SER A 1 1  ? 4.302   18.622  -0.669  1.00 0.00 ? 1  SER A OG   4  
ATOM 3937  H H1   . SER A 1 1  ? 7.404   16.725  -0.637  1.00 0.00 ? 1  SER A H1   4  
ATOM 3938  H H2   . SER A 1 1  ? 6.333   17.576  -1.646  1.00 0.00 ? 1  SER A H2   4  
ATOM 3939  H H3   . SER A 1 1  ? 6.442   15.883  -1.752  1.00 0.00 ? 1  SER A H3   4  
ATOM 3940  H HA   . SER A 1 1  ? 5.776   15.997  0.759   1.00 0.00 ? 1  SER A HA   4  
ATOM 3941  H HB2  . SER A 1 1  ? 4.308   17.861  1.230   1.00 0.00 ? 1  SER A HB2  4  
ATOM 3942  H HB3  . SER A 1 1  ? 5.849   18.518  0.688   1.00 0.00 ? 1  SER A HB3  4  
ATOM 3943  H HG   . SER A 1 1  ? 4.471   19.564  -0.581  1.00 0.00 ? 1  SER A HG   4  
ATOM 3944  N N    . ASP A 1 2  ? 4.459   14.914  -1.577  1.00 0.00 ? 2  ASP A N    4  
ATOM 3945  C CA   . ASP A 1 2  ? 3.353   14.163  -2.232  1.00 0.00 ? 2  ASP A CA   4  
ATOM 3946  C C    . ASP A 1 2  ? 2.677   13.227  -1.213  1.00 0.00 ? 2  ASP A C    4  
ATOM 3947  O O    . ASP A 1 2  ? 3.265   12.285  -0.720  1.00 0.00 ? 2  ASP A O    4  
ATOM 3948  C CB   . ASP A 1 2  ? 3.933   13.379  -3.431  1.00 0.00 ? 2  ASP A CB   4  
ATOM 3949  C CG   . ASP A 1 2  ? 4.512   12.031  -2.987  1.00 0.00 ? 2  ASP A CG   4  
ATOM 3950  O OD1  . ASP A 1 2  ? 5.233   12.012  -2.003  1.00 0.00 ? 2  ASP A OD1  4  
ATOM 3951  O OD2  . ASP A 1 2  ? 4.226   11.045  -3.645  1.00 0.00 ? 2  ASP A OD2  4  
ATOM 3952  H H    . ASP A 1 2  ? 5.389   14.716  -1.816  1.00 0.00 ? 2  ASP A H    4  
ATOM 3953  H HA   . ASP A 1 2  ? 2.617   14.861  -2.602  1.00 0.00 ? 2  ASP A HA   4  
ATOM 3954  H HB2  . ASP A 1 2  ? 3.156   13.209  -4.162  1.00 0.00 ? 2  ASP A HB2  4  
ATOM 3955  H HB3  . ASP A 1 2  ? 4.718   13.965  -3.885  1.00 0.00 ? 2  ASP A HB3  4  
ATOM 3956  N N    . VAL A 1 3  ? 1.446   13.519  -0.875  1.00 0.00 ? 3  VAL A N    4  
ATOM 3957  C CA   . VAL A 1 3  ? 0.709   12.699  0.134   1.00 0.00 ? 3  VAL A CA   4  
ATOM 3958  C C    . VAL A 1 3  ? 0.355   11.312  -0.425  1.00 0.00 ? 3  VAL A C    4  
ATOM 3959  O O    . VAL A 1 3  ? -0.034  10.435  0.322   1.00 0.00 ? 3  VAL A O    4  
ATOM 3960  C CB   . VAL A 1 3  ? -0.593  13.447  0.534   1.00 0.00 ? 3  VAL A CB   4  
ATOM 3961  C CG1  . VAL A 1 3  ? -0.348  14.956  0.491   1.00 0.00 ? 3  VAL A CG1  4  
ATOM 3962  C CG2  . VAL A 1 3  ? -1.759  13.108  -0.414  1.00 0.00 ? 3  VAL A CG2  4  
ATOM 3963  H H    . VAL A 1 3  ? 1.010   14.301  -1.271  1.00 0.00 ? 3  VAL A H    4  
ATOM 3964  H HA   . VAL A 1 3  ? 1.307   12.597  1.026   1.00 0.00 ? 3  VAL A HA   4  
ATOM 3965  H HB   . VAL A 1 3  ? -0.866  13.167  1.544   1.00 0.00 ? 3  VAL A HB   4  
ATOM 3966  H HG11 . VAL A 1 3  ? -0.324  15.288  -0.536  1.00 0.00 ? 3  VAL A HG11 4  
ATOM 3967  H HG12 . VAL A 1 3  ? 0.595   15.181  0.966   1.00 0.00 ? 3  VAL A HG12 4  
ATOM 3968  H HG13 . VAL A 1 3  ? -1.146  15.464  1.014   1.00 0.00 ? 3  VAL A HG13 4  
ATOM 3969  H HG21 . VAL A 1 3  ? -2.568  13.808  -0.253  1.00 0.00 ? 3  VAL A HG21 4  
ATOM 3970  H HG22 . VAL A 1 3  ? -2.108  12.106  -0.208  1.00 0.00 ? 3  VAL A HG22 4  
ATOM 3971  H HG23 . VAL A 1 3  ? -1.425  13.172  -1.437  1.00 0.00 ? 3  VAL A HG23 4  
ATOM 3972  N N    . TYR A 1 4  ? 0.428   11.090  -1.714  1.00 0.00 ? 4  TYR A N    4  
ATOM 3973  C CA   . TYR A 1 4  ? 0.014   9.747   -2.227  1.00 0.00 ? 4  TYR A CA   4  
ATOM 3974  C C    . TYR A 1 4  ? 1.077   8.685   -1.885  1.00 0.00 ? 4  TYR A C    4  
ATOM 3975  O O    . TYR A 1 4  ? 0.769   7.627   -1.373  1.00 0.00 ? 4  TYR A O    4  
ATOM 3976  C CB   . TYR A 1 4  ? -0.257  9.827   -3.734  1.00 0.00 ? 4  TYR A CB   4  
ATOM 3977  C CG   . TYR A 1 4  ? -1.692  10.229  -4.003  1.00 0.00 ? 4  TYR A CG   4  
ATOM 3978  C CD1  . TYR A 1 4  ? -2.716  9.286   -3.866  1.00 0.00 ? 4  TYR A CD1  4  
ATOM 3979  C CD2  . TYR A 1 4  ? -1.992  11.533  -4.417  1.00 0.00 ? 4  TYR A CD2  4  
ATOM 3980  C CE1  . TYR A 1 4  ? -4.039  9.642   -4.141  1.00 0.00 ? 4  TYR A CE1  4  
ATOM 3981  C CE2  . TYR A 1 4  ? -3.317  11.893  -4.686  1.00 0.00 ? 4  TYR A CE2  4  
ATOM 3982  C CZ   . TYR A 1 4  ? -4.342  10.947  -4.550  1.00 0.00 ? 4  TYR A CZ   4  
ATOM 3983  O OH   . TYR A 1 4  ? -5.647  11.300  -4.822  1.00 0.00 ? 4  TYR A OH   4  
ATOM 3984  H H    . TYR A 1 4  ? 0.709   11.789  -2.336  1.00 0.00 ? 4  TYR A H    4  
ATOM 3985  H HA   . TYR A 1 4  ? -0.878  9.486   -1.675  1.00 0.00 ? 4  TYR A HA   4  
ATOM 3986  H HB2  . TYR A 1 4  ? 0.404   10.560  -4.173  1.00 0.00 ? 4  TYR A HB2  4  
ATOM 3987  H HB3  . TYR A 1 4  ? -0.071  8.872   -4.183  1.00 0.00 ? 4  TYR A HB3  4  
ATOM 3988  H HD1  . TYR A 1 4  ? -2.486  8.285   -3.541  1.00 0.00 ? 4  TYR A HD1  4  
ATOM 3989  H HD2  . TYR A 1 4  ? -1.202  12.262  -4.522  1.00 0.00 ? 4  TYR A HD2  4  
ATOM 3990  H HE1  . TYR A 1 4  ? -4.826  8.909   -4.041  1.00 0.00 ? 4  TYR A HE1  4  
ATOM 3991  H HE2  . TYR A 1 4  ? -3.550  12.898  -5.003  1.00 0.00 ? 4  TYR A HE2  4  
ATOM 3992  H HH   . TYR A 1 4  ? -5.958  11.860  -4.106  1.00 0.00 ? 4  TYR A HH   4  
ATOM 3993  N N    . CYS A 1 5  ? 2.327   8.965   -2.162  1.00 0.00 ? 5  CYS A N    4  
ATOM 3994  C CA   . CYS A 1 5  ? 3.408   7.977   -1.851  1.00 0.00 ? 5  CYS A CA   4  
ATOM 3995  C C    . CYS A 1 5  ? 3.359   7.631   -0.351  1.00 0.00 ? 5  CYS A C    4  
ATOM 3996  O O    . CYS A 1 5  ? 3.436   6.476   0.016   1.00 0.00 ? 5  CYS A O    4  
ATOM 3997  C CB   . CYS A 1 5  ? 4.779   8.583   -2.180  1.00 0.00 ? 5  CYS A CB   4  
ATOM 3998  S SG   . CYS A 1 5  ? 5.074   8.470   -3.950  1.00 0.00 ? 5  CYS A SG   4  
ATOM 3999  H H    . CYS A 1 5  ? 2.550   9.830   -2.566  1.00 0.00 ? 5  CYS A H    4  
ATOM 4000  H HA   . CYS A 1 5  ? 3.260   7.063   -2.425  1.00 0.00 ? 5  CYS A HA   4  
ATOM 4001  H HB2  . CYS A 1 5  ? 4.801   9.621   -1.883  1.00 0.00 ? 5  CYS A HB2  4  
ATOM 4002  H HB3  . CYS A 1 5  ? 5.554   8.043   -1.653  1.00 0.00 ? 5  CYS A HB3  4  
ATOM 4003  N N    . GLU A 1 6  ? 3.262   8.597   0.519   1.00 0.00 ? 6  GLU A N    4  
ATOM 4004  C CA   . GLU A 1 6  ? 3.245   8.270   1.975   1.00 0.00 ? 6  GLU A CA   4  
ATOM 4005  C C    . GLU A 1 6  ? 2.136   7.264   2.271   1.00 0.00 ? 6  GLU A C    4  
ATOM 4006  O O    . GLU A 1 6  ? 2.303   6.355   3.061   1.00 0.00 ? 6  GLU A O    4  
ATOM 4007  C CB   . GLU A 1 6  ? 3.010   9.546   2.781   1.00 0.00 ? 6  GLU A CB   4  
ATOM 4008  C CG   . GLU A 1 6  ? 4.029   10.600  2.357   1.00 0.00 ? 6  GLU A CG   4  
ATOM 4009  C CD   . GLU A 1 6  ? 5.441   10.107  2.676   1.00 0.00 ? 6  GLU A CD   4  
ATOM 4010  O OE1  . GLU A 1 6  ? 5.888   10.330  3.788   1.00 0.00 ? 6  GLU A OE1  4  
ATOM 4011  O OE2  . GLU A 1 6  ? 6.052   9.513   1.802   1.00 0.00 ? 6  GLU A OE2  4  
ATOM 4012  H H    . GLU A 1 6  ? 3.221   9.528   0.223   1.00 0.00 ? 6  GLU A H    4  
ATOM 4013  H HA   . GLU A 1 6  ? 4.198   7.846   2.254   1.00 0.00 ? 6  GLU A HA   4  
ATOM 4014  H HB2  . GLU A 1 6  ? 2.013   9.912   2.595   1.00 0.00 ? 6  GLU A HB2  4  
ATOM 4015  H HB3  . GLU A 1 6  ? 3.129   9.336   3.833   1.00 0.00 ? 6  GLU A HB3  4  
ATOM 4016  H HG2  . GLU A 1 6  ? 3.939   10.774  1.294   1.00 0.00 ? 6  GLU A HG2  4  
ATOM 4017  H HG3  . GLU A 1 6  ? 3.841   11.518  2.891   1.00 0.00 ? 6  GLU A HG3  4  
ATOM 4018  N N    . VAL A 1 7  ? 1.001   7.427   1.658   1.00 0.00 ? 7  VAL A N    4  
ATOM 4019  C CA   . VAL A 1 7  ? -0.125  6.490   1.920   1.00 0.00 ? 7  VAL A CA   4  
ATOM 4020  C C    . VAL A 1 7  ? 0.164   5.105   1.314   1.00 0.00 ? 7  VAL A C    4  
ATOM 4021  O O    . VAL A 1 7  ? -0.140  4.092   1.910   1.00 0.00 ? 7  VAL A O    4  
ATOM 4022  C CB   . VAL A 1 7  ? -1.417  7.089   1.346   1.00 0.00 ? 7  VAL A CB   4  
ATOM 4023  C CG1  . VAL A 1 7  ? -2.531  6.034   1.350   1.00 0.00 ? 7  VAL A CG1  4  
ATOM 4024  C CG2  . VAL A 1 7  ? -1.852  8.317   2.177   1.00 0.00 ? 7  VAL A CG2  4  
ATOM 4025  H H    . VAL A 1 7  ? 0.882   8.177   1.036   1.00 0.00 ? 7  VAL A H    4  
ATOM 4026  H HA   . VAL A 1 7  ? -0.225  6.328   2.990   1.00 0.00 ? 7  VAL A HA   4  
ATOM 4027  H HB   . VAL A 1 7  ? -1.227  7.402   0.330   1.00 0.00 ? 7  VAL A HB   4  
ATOM 4028  H HG11 . VAL A 1 7  ? -2.497  5.474   2.273   1.00 0.00 ? 7  VAL A HG11 4  
ATOM 4029  H HG12 . VAL A 1 7  ? -2.392  5.362   0.517   1.00 0.00 ? 7  VAL A HG12 4  
ATOM 4030  H HG13 . VAL A 1 7  ? -3.489  6.522   1.261   1.00 0.00 ? 7  VAL A HG13 4  
ATOM 4031  H HG21 . VAL A 1 7  ? -1.639  8.152   3.222   1.00 0.00 ? 7  VAL A HG21 4  
ATOM 4032  H HG22 . VAL A 1 7  ? -2.913  8.485   2.053   1.00 0.00 ? 7  VAL A HG22 4  
ATOM 4033  H HG23 . VAL A 1 7  ? -1.316  9.191   1.837   1.00 0.00 ? 7  VAL A HG23 4  
ATOM 4034  N N    . CYS A 1 8  ? 0.748   5.040   0.139   1.00 0.00 ? 8  CYS A N    4  
ATOM 4035  C CA   . CYS A 1 8  ? 1.046   3.712   -0.479  1.00 0.00 ? 8  CYS A CA   4  
ATOM 4036  C C    . CYS A 1 8  ? 1.957   2.917   0.450   1.00 0.00 ? 8  CYS A C    4  
ATOM 4037  O O    . CYS A 1 8  ? 1.721   1.757   0.725   1.00 0.00 ? 8  CYS A O    4  
ATOM 4038  C CB   . CYS A 1 8  ? 1.726   3.939   -1.844  1.00 0.00 ? 8  CYS A CB   4  
ATOM 4039  S SG   . CYS A 1 8  ? 3.514   4.159   -1.662  1.00 0.00 ? 8  CYS A SG   4  
ATOM 4040  H H    . CYS A 1 8  ? 1.004   5.847   -0.350  1.00 0.00 ? 8  CYS A H    4  
ATOM 4041  H HA   . CYS A 1 8  ? 0.130   3.156   -0.630  1.00 0.00 ? 8  CYS A HA   4  
ATOM 4042  H HB2  . CYS A 1 8  ? 1.545   3.088   -2.478  1.00 0.00 ? 8  CYS A HB2  4  
ATOM 4043  H HB3  . CYS A 1 8  ? 1.304   4.821   -2.303  1.00 0.00 ? 8  CYS A HB3  4  
ATOM 4044  N N    . GLU A 1 9  ? 3.001   3.525   0.931   1.00 0.00 ? 9  GLU A N    4  
ATOM 4045  C CA   . GLU A 1 9  ? 3.922   2.795   1.831   1.00 0.00 ? 9  GLU A CA   4  
ATOM 4046  C C    . GLU A 1 9  ? 3.208   2.483   3.142   1.00 0.00 ? 9  GLU A C    4  
ATOM 4047  O O    . GLU A 1 9  ? 3.524   1.510   3.797   1.00 0.00 ? 9  GLU A O    4  
ATOM 4048  C CB   . GLU A 1 9  ? 5.152   3.660   2.118   1.00 0.00 ? 9  GLU A CB   4  
ATOM 4049  C CG   . GLU A 1 9  ? 5.872   3.983   0.808   1.00 0.00 ? 9  GLU A CG   4  
ATOM 4050  C CD   . GLU A 1 9  ? 7.267   4.533   1.114   1.00 0.00 ? 9  GLU A CD   4  
ATOM 4051  O OE1  . GLU A 1 9  ? 7.361   5.701   1.454   1.00 0.00 ? 9  GLU A OE1  4  
ATOM 4052  O OE2  . GLU A 1 9  ? 8.218   3.776   1.003   1.00 0.00 ? 9  GLU A OE2  4  
ATOM 4053  H H    . GLU A 1 9  ? 3.186   4.458   0.692   1.00 0.00 ? 9  GLU A H    4  
ATOM 4054  H HA   . GLU A 1 9  ? 4.230   1.880   1.349   1.00 0.00 ? 9  GLU A HA   4  
ATOM 4055  H HB2  . GLU A 1 9  ? 4.841   4.579   2.595   1.00 0.00 ? 9  GLU A HB2  4  
ATOM 4056  H HB3  . GLU A 1 9  ? 5.823   3.125   2.773   1.00 0.00 ? 9  GLU A HB3  4  
ATOM 4057  H HG2  . GLU A 1 9  ? 5.960   3.084   0.216   1.00 0.00 ? 9  GLU A HG2  4  
ATOM 4058  H HG3  . GLU A 1 9  ? 5.308   4.724   0.261   1.00 0.00 ? 9  GLU A HG3  4  
ATOM 4059  N N    . PHE A 1 10 ? 2.248   3.275   3.550   1.00 0.00 ? 10 PHE A N    4  
ATOM 4060  C CA   . PHE A 1 10 ? 1.560   2.951   4.825   1.00 0.00 ? 10 PHE A CA   4  
ATOM 4061  C C    . PHE A 1 10 ? 0.721   1.676   4.650   1.00 0.00 ? 10 PHE A C    4  
ATOM 4062  O O    . PHE A 1 10 ? 0.786   0.772   5.458   1.00 0.00 ? 10 PHE A O    4  
ATOM 4063  C CB   . PHE A 1 10 ? 0.657   4.103   5.261   1.00 0.00 ? 10 PHE A CB   4  
ATOM 4064  C CG   . PHE A 1 10 ? -0.010  3.706   6.552   1.00 0.00 ? 10 PHE A CG   4  
ATOM 4065  C CD1  . PHE A 1 10 ? 0.650   3.907   7.768   1.00 0.00 ? 10 PHE A CD1  4  
ATOM 4066  C CD2  . PHE A 1 10 ? -1.273  3.108   6.528   1.00 0.00 ? 10 PHE A CD2  4  
ATOM 4067  C CE1  . PHE A 1 10 ? 0.045   3.512   8.966   1.00 0.00 ? 10 PHE A CE1  4  
ATOM 4068  C CE2  . PHE A 1 10 ? -1.879  2.707   7.726   1.00 0.00 ? 10 PHE A CE2  4  
ATOM 4069  C CZ   . PHE A 1 10 ? -1.219  2.911   8.947   1.00 0.00 ? 10 PHE A CZ   4  
ATOM 4070  H H    . PHE A 1 10 ? 1.979   4.071   3.041   1.00 0.00 ? 10 PHE A H    4  
ATOM 4071  H HA   . PHE A 1 10 ? 2.305   2.776   5.578   1.00 0.00 ? 10 PHE A HA   4  
ATOM 4072  H HB2  . PHE A 1 10 ? 1.250   4.994   5.414   1.00 0.00 ? 10 PHE A HB2  4  
ATOM 4073  H HB3  . PHE A 1 10 ? -0.093  4.289   4.506   1.00 0.00 ? 10 PHE A HB3  4  
ATOM 4074  H HD1  . PHE A 1 10 ? 1.624   4.372   7.781   1.00 0.00 ? 10 PHE A HD1  4  
ATOM 4075  H HD2  . PHE A 1 10 ? -1.779  2.960   5.585   1.00 0.00 ? 10 PHE A HD2  4  
ATOM 4076  H HE1  . PHE A 1 10 ? 0.556   3.667   9.907   1.00 0.00 ? 10 PHE A HE1  4  
ATOM 4077  H HE2  . PHE A 1 10 ? -2.854  2.238   7.712   1.00 0.00 ? 10 PHE A HE2  4  
ATOM 4078  H HZ   . PHE A 1 10 ? -1.683  2.602   9.870   1.00 0.00 ? 10 PHE A HZ   4  
ATOM 4079  N N    . LEU A 1 11 ? -0.054  1.583   3.597   1.00 0.00 ? 11 LEU A N    4  
ATOM 4080  C CA   . LEU A 1 11 ? -0.868  0.347   3.391   1.00 0.00 ? 11 LEU A CA   4  
ATOM 4081  C C    . LEU A 1 11 ? 0.072   -0.844  3.225   1.00 0.00 ? 11 LEU A C    4  
ATOM 4082  O O    . LEU A 1 11 ? -0.158  -1.899  3.782   1.00 0.00 ? 11 LEU A O    4  
ATOM 4083  C CB   . LEU A 1 11 ? -1.739  0.470   2.128   1.00 0.00 ? 11 LEU A CB   4  
ATOM 4084  C CG   . LEU A 1 11 ? -2.747  1.623   2.286   1.00 0.00 ? 11 LEU A CG   4  
ATOM 4085  C CD1  . LEU A 1 11 ? -3.253  2.056   0.907   1.00 0.00 ? 11 LEU A CD1  4  
ATOM 4086  C CD2  . LEU A 1 11 ? -3.945  1.176   3.136   1.00 0.00 ? 11 LEU A CD2  4  
ATOM 4087  H H    . LEU A 1 11 ? -0.094  2.316   2.948   1.00 0.00 ? 11 LEU A H    4  
ATOM 4088  H HA   . LEU A 1 11 ? -1.508  0.171   4.241   1.00 0.00 ? 11 LEU A HA   4  
ATOM 4089  H HB2  . LEU A 1 11 ? -1.104  0.661   1.273   1.00 0.00 ? 11 LEU A HB2  4  
ATOM 4090  H HB3  . LEU A 1 11 ? -2.276  -0.463  1.975   1.00 0.00 ? 11 LEU A HB3  4  
ATOM 4091  H HG   . LEU A 1 11 ? -2.260  2.461   2.764   1.00 0.00 ? 11 LEU A HG   4  
ATOM 4092  H HD11 . LEU A 1 11 ? -3.614  1.192   0.368   1.00 0.00 ? 11 LEU A HD11 4  
ATOM 4093  H HD12 . LEU A 1 11 ? -2.446  2.512   0.354   1.00 0.00 ? 11 LEU A HD12 4  
ATOM 4094  H HD13 . LEU A 1 11 ? -4.056  2.769   1.025   1.00 0.00 ? 11 LEU A HD13 4  
ATOM 4095  H HD21 . LEU A 1 11 ? -3.641  1.068   4.165   1.00 0.00 ? 11 LEU A HD21 4  
ATOM 4096  H HD22 . LEU A 1 11 ? -4.322  0.233   2.771   1.00 0.00 ? 11 LEU A HD22 4  
ATOM 4097  H HD23 . LEU A 1 11 ? -4.726  1.920   3.071   1.00 0.00 ? 11 LEU A HD23 4  
ATOM 4098  N N    . VAL A 1 12 ? 1.127   -0.703  2.468   1.00 0.00 ? 12 VAL A N    4  
ATOM 4099  C CA   . VAL A 1 12 ? 2.058   -1.846  2.285   1.00 0.00 ? 12 VAL A CA   4  
ATOM 4100  C C    . VAL A 1 12 ? 2.613   -2.285  3.654   1.00 0.00 ? 12 VAL A C    4  
ATOM 4101  O O    . VAL A 1 12 ? 2.607   -3.452  3.983   1.00 0.00 ? 12 VAL A O    4  
ATOM 4102  C CB   . VAL A 1 12 ? 3.203   -1.394  1.359   1.00 0.00 ? 12 VAL A CB   4  
ATOM 4103  C CG1  . VAL A 1 12 ? 4.412   -2.323  1.492   1.00 0.00 ? 12 VAL A CG1  4  
ATOM 4104  C CG2  . VAL A 1 12 ? 2.718   -1.412  -0.093  1.00 0.00 ? 12 VAL A CG2  4  
ATOM 4105  H H    . VAL A 1 12 ? 1.318   0.136   2.001   1.00 0.00 ? 12 VAL A H    4  
ATOM 4106  H HA   . VAL A 1 12 ? 1.529   -2.679  1.834   1.00 0.00 ? 12 VAL A HA   4  
ATOM 4107  H HB   . VAL A 1 12 ? 3.496   -0.389  1.624   1.00 0.00 ? 12 VAL A HB   4  
ATOM 4108  H HG11 . VAL A 1 12 ? 5.105   -2.121  0.690   1.00 0.00 ? 12 VAL A HG11 4  
ATOM 4109  H HG12 . VAL A 1 12 ? 4.084   -3.351  1.440   1.00 0.00 ? 12 VAL A HG12 4  
ATOM 4110  H HG13 . VAL A 1 12 ? 4.902   -2.150  2.439   1.00 0.00 ? 12 VAL A HG13 4  
ATOM 4111  H HG21 . VAL A 1 12 ? 2.545   -2.433  -0.404  1.00 0.00 ? 12 VAL A HG21 4  
ATOM 4112  H HG22 . VAL A 1 12 ? 3.468   -0.964  -0.729  1.00 0.00 ? 12 VAL A HG22 4  
ATOM 4113  H HG23 . VAL A 1 12 ? 1.797   -0.851  -0.172  1.00 0.00 ? 12 VAL A HG23 4  
ATOM 4114  N N    . LYS A 1 13 ? 3.083   -1.357  4.455   1.00 0.00 ? 13 LYS A N    4  
ATOM 4115  C CA   . LYS A 1 13 ? 3.631   -1.731  5.797   1.00 0.00 ? 13 LYS A CA   4  
ATOM 4116  C C    . LYS A 1 13 ? 2.539   -2.428  6.617   1.00 0.00 ? 13 LYS A C    4  
ATOM 4117  O O    . LYS A 1 13 ? 2.778   -3.417  7.280   1.00 0.00 ? 13 LYS A O    4  
ATOM 4118  C CB   . LYS A 1 13 ? 4.107   -0.463  6.523   1.00 0.00 ? 13 LYS A CB   4  
ATOM 4119  C CG   . LYS A 1 13 ? 4.372   -0.766  8.009   1.00 0.00 ? 13 LYS A CG   4  
ATOM 4120  C CD   . LYS A 1 13 ? 5.349   0.263   8.588   1.00 0.00 ? 13 LYS A CD   4  
ATOM 4121  C CE   . LYS A 1 13 ? 4.830   1.675   8.311   1.00 0.00 ? 13 LYS A CE   4  
ATOM 4122  N NZ   . LYS A 1 13 ? 3.389   1.756   8.682   1.00 0.00 ? 13 LYS A NZ   4  
ATOM 4123  H H    . LYS A 1 13 ? 3.080   -0.418  4.172   1.00 0.00 ? 13 LYS A H    4  
ATOM 4124  H HA   . LYS A 1 13 ? 4.465   -2.403  5.661   1.00 0.00 ? 13 LYS A HA   4  
ATOM 4125  H HB2  . LYS A 1 13 ? 5.017   -0.111  6.058   1.00 0.00 ? 13 LYS A HB2  4  
ATOM 4126  H HB3  . LYS A 1 13 ? 3.348   0.300   6.444   1.00 0.00 ? 13 LYS A HB3  4  
ATOM 4127  H HG2  . LYS A 1 13 ? 3.439   -0.719  8.555   1.00 0.00 ? 13 LYS A HG2  4  
ATOM 4128  H HG3  . LYS A 1 13 ? 4.796   -1.754  8.108   1.00 0.00 ? 13 LYS A HG3  4  
ATOM 4129  H HD2  . LYS A 1 13 ? 5.439   0.114   9.653   1.00 0.00 ? 13 LYS A HD2  4  
ATOM 4130  H HD3  . LYS A 1 13 ? 6.316   0.141   8.124   1.00 0.00 ? 13 LYS A HD3  4  
ATOM 4131  H HE2  . LYS A 1 13 ? 5.394   2.386   8.897   1.00 0.00 ? 13 LYS A HE2  4  
ATOM 4132  H HE3  . LYS A 1 13 ? 4.945   1.902   7.262   1.00 0.00 ? 13 LYS A HE3  4  
ATOM 4133  H HZ1  . LYS A 1 13 ? 3.134   2.747   8.869   1.00 0.00 ? 13 LYS A HZ1  4  
ATOM 4134  H HZ2  . LYS A 1 13 ? 3.218   1.187   9.537   1.00 0.00 ? 13 LYS A HZ2  4  
ATOM 4135  H HZ3  . LYS A 1 13 ? 2.808   1.393   7.901   1.00 0.00 ? 13 LYS A HZ3  4  
ATOM 4136  N N    . GLU A 1 14 ? 1.351   -1.896  6.593   1.00 0.00 ? 14 GLU A N    4  
ATOM 4137  C CA   . GLU A 1 14 ? 0.242   -2.496  7.391   1.00 0.00 ? 14 GLU A CA   4  
ATOM 4138  C C    . GLU A 1 14 ? -0.160  -3.839  6.774   1.00 0.00 ? 14 GLU A C    4  
ATOM 4139  O O    . GLU A 1 14 ? -0.485  -4.775  7.476   1.00 0.00 ? 14 GLU A O    4  
ATOM 4140  C CB   . GLU A 1 14 ? -0.958  -1.514  7.396   1.00 0.00 ? 14 GLU A CB   4  
ATOM 4141  C CG   . GLU A 1 14 ? -1.310  -1.098  8.830   1.00 0.00 ? 14 GLU A CG   4  
ATOM 4142  C CD   . GLU A 1 14 ? -0.185  -0.232  9.401   1.00 0.00 ? 14 GLU A CD   4  
ATOM 4143  O OE1  . GLU A 1 14 ? 0.380   0.542   8.646   1.00 0.00 ? 14 GLU A OE1  4  
ATOM 4144  O OE2  . GLU A 1 14 ? 0.092   -0.356  10.582  1.00 0.00 ? 14 GLU A OE2  4  
ATOM 4145  H H    . GLU A 1 14 ? 1.195   -1.094  6.053   1.00 0.00 ? 14 GLU A H    4  
ATOM 4146  H HA   . GLU A 1 14 ? 0.587   -2.666  8.402   1.00 0.00 ? 14 GLU A HA   4  
ATOM 4147  H HB2  . GLU A 1 14 ? -0.693  -0.634  6.830   1.00 0.00 ? 14 GLU A HB2  4  
ATOM 4148  H HB3  . GLU A 1 14 ? -1.825  -1.976  6.941   1.00 0.00 ? 14 GLU A HB3  4  
ATOM 4149  H HG2  . GLU A 1 14 ? -2.231  -0.537  8.825   1.00 0.00 ? 14 GLU A HG2  4  
ATOM 4150  H HG3  . GLU A 1 14 ? -1.428  -1.979  9.443   1.00 0.00 ? 14 GLU A HG3  4  
ATOM 4151  N N    . VAL A 1 15 ? -0.162  -3.943  5.481   1.00 0.00 ? 15 VAL A N    4  
ATOM 4152  C CA   . VAL A 1 15 ? -0.569  -5.230  4.862   1.00 0.00 ? 15 VAL A CA   4  
ATOM 4153  C C    . VAL A 1 15 ? 0.474   -6.320  5.140   1.00 0.00 ? 15 VAL A C    4  
ATOM 4154  O O    . VAL A 1 15 ? 0.127   -7.438  5.435   1.00 0.00 ? 15 VAL A O    4  
ATOM 4155  C CB   . VAL A 1 15 ? -0.763  -5.038  3.346   1.00 0.00 ? 15 VAL A CB   4  
ATOM 4156  C CG1  . VAL A 1 15 ? -0.699  -6.399  2.625   1.00 0.00 ? 15 VAL A CG1  4  
ATOM 4157  C CG2  . VAL A 1 15 ? -2.127  -4.382  3.088   1.00 0.00 ? 15 VAL A CG2  4  
ATOM 4158  H H    . VAL A 1 15 ? 0.089   -3.179  4.921   1.00 0.00 ? 15 VAL A H    4  
ATOM 4159  H HA   . VAL A 1 15 ? -1.508  -5.545  5.302   1.00 0.00 ? 15 VAL A HA   4  
ATOM 4160  H HB   . VAL A 1 15 ? 0.017   -4.396  2.966   1.00 0.00 ? 15 VAL A HB   4  
ATOM 4161  H HG11 . VAL A 1 15 ? 0.337   -6.641  2.411   1.00 0.00 ? 15 VAL A HG11 4  
ATOM 4162  H HG12 . VAL A 1 15 ? -1.258  -6.352  1.704   1.00 0.00 ? 15 VAL A HG12 4  
ATOM 4163  H HG13 . VAL A 1 15 ? -1.120  -7.168  3.257   1.00 0.00 ? 15 VAL A HG13 4  
ATOM 4164  H HG21 . VAL A 1 15 ? -2.915  -5.066  3.368   1.00 0.00 ? 15 VAL A HG21 4  
ATOM 4165  H HG22 . VAL A 1 15 ? -2.217  -4.139  2.040   1.00 0.00 ? 15 VAL A HG22 4  
ATOM 4166  H HG23 . VAL A 1 15 ? -2.208  -3.480  3.676   1.00 0.00 ? 15 VAL A HG23 4  
ATOM 4167  N N    . THR A 1 16 ? 1.742   -6.043  5.026   1.00 0.00 ? 16 THR A N    4  
ATOM 4168  C CA   . THR A 1 16 ? 2.706   -7.152  5.265   1.00 0.00 ? 16 THR A CA   4  
ATOM 4169  C C    . THR A 1 16 ? 2.597   -7.645  6.703   1.00 0.00 ? 16 THR A C    4  
ATOM 4170  O O    . THR A 1 16 ? 2.684   -8.831  6.956   1.00 0.00 ? 16 THR A O    4  
ATOM 4171  C CB   . THR A 1 16 ? 4.154   -6.752  4.988   1.00 0.00 ? 16 THR A CB   4  
ATOM 4172  O OG1  . THR A 1 16 ? 4.708   -6.154  6.151   1.00 0.00 ? 16 THR A OG1  4  
ATOM 4173  C CG2  . THR A 1 16 ? 4.256   -5.771  3.810   1.00 0.00 ? 16 THR A CG2  4  
ATOM 4174  H H    . THR A 1 16 ? 2.041   -5.146  4.768   1.00 0.00 ? 16 THR A H    4  
ATOM 4175  H HA   . THR A 1 16 ? 2.441   -7.956  4.601   1.00 0.00 ? 16 THR A HA   4  
ATOM 4176  H HB   . THR A 1 16 ? 4.703   -7.652  4.749   1.00 0.00 ? 16 THR A HB   4  
ATOM 4177  H HG1  . THR A 1 16 ? 4.415   -6.658  6.912   1.00 0.00 ? 16 THR A HG1  4  
ATOM 4178  H HG21 . THR A 1 16 ? 4.483   -4.788  4.190   1.00 0.00 ? 16 THR A HG21 4  
ATOM 4179  H HG22 . THR A 1 16 ? 3.326   -5.742  3.265   1.00 0.00 ? 16 THR A HG22 4  
ATOM 4180  H HG23 . THR A 1 16 ? 5.048   -6.084  3.144   1.00 0.00 ? 16 THR A HG23 4  
ATOM 4181  N N    . LYS A 1 17 ? 2.399   -6.780  7.656   1.00 0.00 ? 17 LYS A N    4  
ATOM 4182  C CA   . LYS A 1 17 ? 2.284   -7.292  9.045   1.00 0.00 ? 17 LYS A CA   4  
ATOM 4183  C C    . LYS A 1 17 ? 1.066   -8.210  9.082   1.00 0.00 ? 17 LYS A C    4  
ATOM 4184  O O    . LYS A 1 17 ? 1.018   -9.191  9.799   1.00 0.00 ? 17 LYS A O    4  
ATOM 4185  C CB   . LYS A 1 17 ? 2.102   -6.138  10.042  1.00 0.00 ? 17 LYS A CB   4  
ATOM 4186  C CG   . LYS A 1 17 ? 1.548   -6.692  11.371  1.00 0.00 ? 17 LYS A CG   4  
ATOM 4187  C CD   . LYS A 1 17 ? 1.892   -5.764  12.533  1.00 0.00 ? 17 LYS A CD   4  
ATOM 4188  C CE   . LYS A 1 17 ? 1.420   -6.415  13.837  1.00 0.00 ? 17 LYS A CE   4  
ATOM 4189  N NZ   . LYS A 1 17 ? 2.002   -5.684  14.998  1.00 0.00 ? 17 LYS A NZ   4  
ATOM 4190  H H    . LYS A 1 17 ? 2.310   -5.824  7.460   1.00 0.00 ? 17 LYS A H    4  
ATOM 4191  H HA   . LYS A 1 17 ? 3.187   -7.840  9.280   1.00 0.00 ? 17 LYS A HA   4  
ATOM 4192  H HB2  . LYS A 1 17 ? 3.058   -5.662  10.214  1.00 0.00 ? 17 LYS A HB2  4  
ATOM 4193  H HB3  . LYS A 1 17 ? 1.410   -5.416  9.634   1.00 0.00 ? 17 LYS A HB3  4  
ATOM 4194  H HG2  . LYS A 1 17 ? 0.475   -6.781  11.298  1.00 0.00 ? 17 LYS A HG2  4  
ATOM 4195  H HG3  . LYS A 1 17 ? 1.972   -7.668  11.559  1.00 0.00 ? 17 LYS A HG3  4  
ATOM 4196  H HD2  . LYS A 1 17 ? 2.962   -5.610  12.568  1.00 0.00 ? 17 LYS A HD2  4  
ATOM 4197  H HD3  . LYS A 1 17 ? 1.393   -4.817  12.402  1.00 0.00 ? 17 LYS A HD3  4  
ATOM 4198  H HE2  . LYS A 1 17 ? 0.343   -6.374  13.888  1.00 0.00 ? 17 LYS A HE2  4  
ATOM 4199  H HE3  . LYS A 1 17 ? 1.741   -7.450  13.863  1.00 0.00 ? 17 LYS A HE3  4  
ATOM 4200  H HZ1  . LYS A 1 17 ? 1.282   -5.054  15.406  1.00 0.00 ? 17 LYS A HZ1  4  
ATOM 4201  H HZ2  . LYS A 1 17 ? 2.817   -5.122  14.680  1.00 0.00 ? 17 LYS A HZ2  4  
ATOM 4202  H HZ3  . LYS A 1 17 ? 2.310   -6.366  15.719  1.00 0.00 ? 17 LYS A HZ3  4  
ATOM 4203  N N    . LEU A 1 18 ? 0.083   -7.881  8.295   1.00 0.00 ? 18 LEU A N    4  
ATOM 4204  C CA   . LEU A 1 18 ? -1.152  -8.701  8.241   1.00 0.00 ? 18 LEU A CA   4  
ATOM 4205  C C    . LEU A 1 18 ? -0.807  -10.012 7.525   1.00 0.00 ? 18 LEU A C    4  
ATOM 4206  O O    . LEU A 1 18 ? -1.297  -11.069 7.868   1.00 0.00 ? 18 LEU A O    4  
ATOM 4207  C CB   . LEU A 1 18 ? -2.248  -7.922  7.478   1.00 0.00 ? 18 LEU A CB   4  
ATOM 4208  C CG   . LEU A 1 18 ? -2.820  -6.682  8.271   1.00 0.00 ? 18 LEU A CG   4  
ATOM 4209  C CD1  . LEU A 1 18 ? -4.342  -6.793  8.399   1.00 0.00 ? 18 LEU A CD1  4  
ATOM 4210  C CD2  . LEU A 1 18 ? -2.249  -6.534  9.696   1.00 0.00 ? 18 LEU A CD2  4  
ATOM 4211  H H    . LEU A 1 18 ? 0.163   -7.089  7.725   1.00 0.00 ? 18 LEU A H    4  
ATOM 4212  H HA   . LEU A 1 18 ? -1.484  -8.951  9.232   1.00 0.00 ? 18 LEU A HA   4  
ATOM 4213  H HB2  . LEU A 1 18 ? -1.831  -7.573  6.551   1.00 0.00 ? 18 LEU A HB2  4  
ATOM 4214  H HB3  . LEU A 1 18 ? -3.044  -8.596  7.245   1.00 0.00 ? 18 LEU A HB3  4  
ATOM 4215  H HG   . LEU A 1 18 ? -2.597  -5.780  7.714   1.00 0.00 ? 18 LEU A HG   4  
ATOM 4216  H HD11 . LEU A 1 18 ? -4.727  -5.912  8.888   1.00 0.00 ? 18 LEU A HD11 4  
ATOM 4217  H HD12 . LEU A 1 18 ? -4.589  -7.659  8.989   1.00 0.00 ? 18 LEU A HD12 4  
ATOM 4218  H HD13 . LEU A 1 18 ? -4.782  -6.885  7.416   1.00 0.00 ? 18 LEU A HD13 4  
ATOM 4219  H HD21 . LEU A 1 18 ? -1.176  -6.540  9.667   1.00 0.00 ? 18 LEU A HD21 4  
ATOM 4220  H HD22 . LEU A 1 18 ? -2.606  -7.337  10.321  1.00 0.00 ? 18 LEU A HD22 4  
ATOM 4221  H HD23 . LEU A 1 18 ? -2.585  -5.594  10.110  1.00 0.00 ? 18 LEU A HD23 4  
ATOM 4222  N N    . ILE A 1 19 ? 0.070   -9.950  6.559   1.00 0.00 ? 19 ILE A N    4  
ATOM 4223  C CA   . ILE A 1 19 ? 0.497   -11.185 5.845   1.00 0.00 ? 19 ILE A CA   4  
ATOM 4224  C C    . ILE A 1 19 ? 1.384   -11.978 6.800   1.00 0.00 ? 19 ILE A C    4  
ATOM 4225  O O    . ILE A 1 19 ? 1.408   -13.192 6.792   1.00 0.00 ? 19 ILE A O    4  
ATOM 4226  C CB   . ILE A 1 19 ? 1.295   -10.806 4.585   1.00 0.00 ? 19 ILE A CB   4  
ATOM 4227  C CG1  . ILE A 1 19 ? 0.360   -10.096 3.596   1.00 0.00 ? 19 ILE A CG1  4  
ATOM 4228  C CG2  . ILE A 1 19 ? 1.875   -12.065 3.928   1.00 0.00 ? 19 ILE A CG2  4  
ATOM 4229  C CD1  . ILE A 1 19 ? 1.147   -9.641  2.365   1.00 0.00 ? 19 ILE A CD1  4  
ATOM 4230  H H    . ILE A 1 19 ? 0.471   -9.094  6.330   1.00 0.00 ? 19 ILE A H    4  
ATOM 4231  H HA   . ILE A 1 19 ? -0.371  -11.771 5.576   1.00 0.00 ? 19 ILE A HA   4  
ATOM 4232  H HB   . ILE A 1 19 ? 2.107   -10.146 4.858   1.00 0.00 ? 19 ILE A HB   4  
ATOM 4233  H HG12 . ILE A 1 19 ? -0.423  -10.772 3.290   1.00 0.00 ? 19 ILE A HG12 4  
ATOM 4234  H HG13 . ILE A 1 19 ? -0.081  -9.241  4.070   1.00 0.00 ? 19 ILE A HG13 4  
ATOM 4235  H HG21 . ILE A 1 19 ? 2.384   -11.791 3.014   1.00 0.00 ? 19 ILE A HG21 4  
ATOM 4236  H HG22 . ILE A 1 19 ? 1.079   -12.755 3.703   1.00 0.00 ? 19 ILE A HG22 4  
ATOM 4237  H HG23 . ILE A 1 19 ? 2.580   -12.533 4.597   1.00 0.00 ? 19 ILE A HG23 4  
ATOM 4238  H HD11 . ILE A 1 19 ? 2.096   -9.227  2.673   1.00 0.00 ? 19 ILE A HD11 4  
ATOM 4239  H HD12 . ILE A 1 19 ? 0.583   -8.889  1.836   1.00 0.00 ? 19 ILE A HD12 4  
ATOM 4240  H HD13 . ILE A 1 19 ? 1.319   -10.485 1.714   1.00 0.00 ? 19 ILE A HD13 4  
ATOM 4241  N N    . ASP A 1 20 ? 2.119   -11.279 7.620   1.00 0.00 ? 20 ASP A N    4  
ATOM 4242  C CA   . ASP A 1 20 ? 3.024   -11.952 8.585   1.00 0.00 ? 20 ASP A CA   4  
ATOM 4243  C C    . ASP A 1 20 ? 2.224   -12.528 9.755   1.00 0.00 ? 20 ASP A C    4  
ATOM 4244  O O    . ASP A 1 20 ? 2.671   -13.446 10.411  1.00 0.00 ? 20 ASP A O    4  
ATOM 4245  C CB   . ASP A 1 20 ? 4.037   -10.936 9.118   1.00 0.00 ? 20 ASP A CB   4  
ATOM 4246  C CG   . ASP A 1 20 ? 5.078   -11.655 9.978   1.00 0.00 ? 20 ASP A CG   4  
ATOM 4247  O OD1  . ASP A 1 20 ? 6.041   -12.150 9.417   1.00 0.00 ? 20 ASP A OD1  4  
ATOM 4248  O OD2  . ASP A 1 20 ? 4.894   -11.698 11.183  1.00 0.00 ? 20 ASP A OD2  4  
ATOM 4249  H H    . ASP A 1 20 ? 2.079   -10.300 7.597   1.00 0.00 ? 20 ASP A H    4  
ATOM 4250  H HA   . ASP A 1 20 ? 3.554   -12.755 8.096   1.00 0.00 ? 20 ASP A HA   4  
ATOM 4251  H HB2  . ASP A 1 20 ? 4.527   -10.449 8.288   1.00 0.00 ? 20 ASP A HB2  4  
ATOM 4252  H HB3  . ASP A 1 20 ? 3.524   -10.198 9.718   1.00 0.00 ? 20 ASP A HB3  4  
ATOM 4253  N N    . ASN A 1 21 ? 1.049   -12.000 10.039  1.00 0.00 ? 21 ASN A N    4  
ATOM 4254  C CA   . ASN A 1 21 ? 0.260   -12.549 11.193  1.00 0.00 ? 21 ASN A CA   4  
ATOM 4255  C C    . ASN A 1 21 ? -0.610  -13.719 10.709  1.00 0.00 ? 21 ASN A C    4  
ATOM 4256  O O    . ASN A 1 21 ? -1.310  -14.331 11.485  1.00 0.00 ? 21 ASN A O    4  
ATOM 4257  C CB   . ASN A 1 21 ? -0.585  -11.454 11.848  1.00 0.00 ? 21 ASN A CB   4  
ATOM 4258  C CG   . ASN A 1 21 ? -1.242  -12.004 13.116  1.00 0.00 ? 21 ASN A CG   4  
ATOM 4259  O OD1  . ASN A 1 21 ? -0.777  -11.756 14.211  1.00 0.00 ? 21 ASN A OD1  4  
ATOM 4260  N ND2  . ASN A 1 21 ? -2.310  -12.745 13.015  1.00 0.00 ? 21 ASN A ND2  4  
ATOM 4261  H H    . ASN A 1 21 ? 0.701   -11.260 9.499   1.00 0.00 ? 21 ASN A H    4  
ATOM 4262  H HA   . ASN A 1 21 ? 0.968   -12.960 11.900  1.00 0.00 ? 21 ASN A HA   4  
ATOM 4263  H HB2  . ASN A 1 21 ? 0.048   -10.614 12.105  1.00 0.00 ? 21 ASN A HB2  4  
ATOM 4264  H HB3  . ASN A 1 21 ? -1.349  -11.130 11.159  1.00 0.00 ? 21 ASN A HB3  4  
ATOM 4265  H HD21 . ASN A 1 21 ? -2.686  -12.946 12.132  1.00 0.00 ? 21 ASN A HD21 4  
ATOM 4266  H HD22 . ASN A 1 21 ? -2.737  -13.102 13.821  1.00 0.00 ? 21 ASN A HD22 4  
ATOM 4267  N N    . ASN A 1 22 ? -0.505  -14.074 9.448   1.00 0.00 ? 22 ASN A N    4  
ATOM 4268  C CA   . ASN A 1 22 ? -1.251  -15.269 8.906   1.00 0.00 ? 22 ASN A CA   4  
ATOM 4269  C C    . ASN A 1 22 ? -2.733  -14.987 8.611   1.00 0.00 ? 22 ASN A C    4  
ATOM 4270  O O    . ASN A 1 22 ? -3.575  -15.822 8.877   1.00 0.00 ? 22 ASN A O    4  
ATOM 4271  C CB   . ASN A 1 22 ? -1.164  -16.439 9.907   1.00 0.00 ? 22 ASN A CB   4  
ATOM 4272  C CG   . ASN A 1 22 ? 0.208   -16.441 10.585  1.00 0.00 ? 22 ASN A CG   4  
ATOM 4273  O OD1  . ASN A 1 22 ? 1.219   -16.249 9.937   1.00 0.00 ? 22 ASN A OD1  4  
ATOM 4274  N ND2  . ASN A 1 22 ? 0.289   -16.651 11.870  1.00 0.00 ? 22 ASN A ND2  4  
ATOM 4275  H H    . ASN A 1 22 ? 0.113   -13.583 8.857   1.00 0.00 ? 22 ASN A H    4  
ATOM 4276  H HA   . ASN A 1 22 ? -0.750  -15.585 8.001   1.00 0.00 ? 22 ASN A HA   4  
ATOM 4277  H HB2  . ASN A 1 22 ? -1.939  -16.346 10.654  1.00 0.00 ? 22 ASN A HB2  4  
ATOM 4278  H HB3  . ASN A 1 22 ? -1.297  -17.371 9.378   1.00 0.00 ? 22 ASN A HB3  4  
ATOM 4279  H HD21 . ASN A 1 22 ? -0.525  -16.805 12.393  1.00 0.00 ? 22 ASN A HD21 4  
ATOM 4280  H HD22 . ASN A 1 22 ? 1.163   -16.654 12.312  1.00 0.00 ? 22 ASN A HD22 4  
ATOM 4281  N N    . LYS A 1 23 ? -3.078  -13.857 8.053   1.00 0.00 ? 23 LYS A N    4  
ATOM 4282  C CA   . LYS A 1 23 ? -4.525  -13.597 7.743   1.00 0.00 ? 23 LYS A CA   4  
ATOM 4283  C C    . LYS A 1 23 ? -4.785  -13.967 6.273   1.00 0.00 ? 23 LYS A C    4  
ATOM 4284  O O    . LYS A 1 23 ? -3.908  -13.882 5.435   1.00 0.00 ? 23 LYS A O    4  
ATOM 4285  C CB   . LYS A 1 23 ? -4.842  -12.120 7.987   1.00 0.00 ? 23 LYS A CB   4  
ATOM 4286  C CG   . LYS A 1 23 ? -4.170  -11.621 9.307   1.00 0.00 ? 23 LYS A CG   4  
ATOM 4287  C CD   . LYS A 1 23 ? -5.181  -10.898 10.222  1.00 0.00 ? 23 LYS A CD   4  
ATOM 4288  C CE   . LYS A 1 23 ? -4.545  -10.641 11.589  1.00 0.00 ? 23 LYS A CE   4  
ATOM 4289  N NZ   . LYS A 1 23 ? -5.582  -10.129 12.529  1.00 0.00 ? 23 LYS A NZ   4  
ATOM 4290  H H    . LYS A 1 23 ? -2.397  -13.193 7.823   1.00 0.00 ? 23 LYS A H    4  
ATOM 4291  H HA   . LYS A 1 23 ? -5.147  -14.174 8.392   1.00 0.00 ? 23 LYS A HA   4  
ATOM 4292  H HB2  . LYS A 1 23 ? -4.473  -11.565 7.154   1.00 0.00 ? 23 LYS A HB2  4  
ATOM 4293  H HB3  . LYS A 1 23 ? -5.915  -11.997 8.056   1.00 0.00 ? 23 LYS A HB3  4  
ATOM 4294  H HG2  . LYS A 1 23 ? -3.762  -12.460 9.849   1.00 0.00 ? 23 LYS A HG2  4  
ATOM 4295  H HG3  . LYS A 1 23 ? -3.370  -10.937 9.063   1.00 0.00 ? 23 LYS A HG3  4  
ATOM 4296  H HD2  . LYS A 1 23 ? -5.470  -9.952  9.783   1.00 0.00 ? 23 LYS A HD2  4  
ATOM 4297  H HD3  . LYS A 1 23 ? -6.052  -11.519 10.355  1.00 0.00 ? 23 LYS A HD3  4  
ATOM 4298  H HE2  . LYS A 1 23 ? -4.134  -11.560 11.976  1.00 0.00 ? 23 LYS A HE2  4  
ATOM 4299  H HE3  . LYS A 1 23 ? -3.759  -9.907  11.489  1.00 0.00 ? 23 LYS A HE3  4  
ATOM 4300  H HZ1  . LYS A 1 23 ? -5.497  -9.097  12.613  1.00 0.00 ? 23 LYS A HZ1  4  
ATOM 4301  H HZ2  . LYS A 1 23 ? -5.448  -10.566 13.464  1.00 0.00 ? 23 LYS A HZ2  4  
ATOM 4302  H HZ3  . LYS A 1 23 ? -6.527  -10.369 12.166  1.00 0.00 ? 23 LYS A HZ3  4  
ATOM 4303  N N    . THR A 1 24 ? -5.991  -14.379 5.959   1.00 0.00 ? 24 THR A N    4  
ATOM 4304  C CA   . THR A 1 24 ? -6.325  -14.762 4.551   1.00 0.00 ? 24 THR A CA   4  
ATOM 4305  C C    . THR A 1 24 ? -6.572  -13.519 3.687   1.00 0.00 ? 24 THR A C    4  
ATOM 4306  O O    . THR A 1 24 ? -6.812  -12.439 4.189   1.00 0.00 ? 24 THR A O    4  
ATOM 4307  C CB   . THR A 1 24 ? -7.599  -15.626 4.531   1.00 0.00 ? 24 THR A CB   4  
ATOM 4308  O OG1  . THR A 1 24 ? -8.736  -14.788 4.378   1.00 0.00 ? 24 THR A OG1  4  
ATOM 4309  C CG2  . THR A 1 24 ? -7.726  -16.409 5.836   1.00 0.00 ? 24 THR A CG2  4  
ATOM 4310  H H    . THR A 1 24 ? -6.677  -14.443 6.655   1.00 0.00 ? 24 THR A H    4  
ATOM 4311  H HA   . THR A 1 24 ? -5.512  -15.319 4.110   1.00 0.00 ? 24 THR A HA   4  
ATOM 4312  H HB   . THR A 1 24 ? -7.554  -16.321 3.705   1.00 0.00 ? 24 THR A HB   4  
ATOM 4313  H HG1  . THR A 1 24 ? -9.414  -15.289 3.919   1.00 0.00 ? 24 THR A HG1  4  
ATOM 4314  H HG21 . THR A 1 24 ? -8.108  -15.759 6.607   1.00 0.00 ? 24 THR A HG21 4  
ATOM 4315  H HG22 . THR A 1 24 ? -6.757  -16.788 6.128   1.00 0.00 ? 24 THR A HG22 4  
ATOM 4316  H HG23 . THR A 1 24 ? -8.408  -17.233 5.692   1.00 0.00 ? 24 THR A HG23 4  
ATOM 4317  N N    . GLU A 1 25 ? -6.542  -13.677 2.389   1.00 0.00 ? 25 GLU A N    4  
ATOM 4318  C CA   . GLU A 1 25 ? -6.802  -12.518 1.485   1.00 0.00 ? 25 GLU A CA   4  
ATOM 4319  C C    . GLU A 1 25 ? -8.161  -11.916 1.864   1.00 0.00 ? 25 GLU A C    4  
ATOM 4320  O O    . GLU A 1 25 ? -8.315  -10.715 1.975   1.00 0.00 ? 25 GLU A O    4  
ATOM 4321  C CB   . GLU A 1 25 ? -6.827  -13.006 0.031   1.00 0.00 ? 25 GLU A CB   4  
ATOM 4322  C CG   . GLU A 1 25 ? -6.685  -11.818 -0.924  1.00 0.00 ? 25 GLU A CG   4  
ATOM 4323  C CD   . GLU A 1 25 ? -7.143  -12.227 -2.327  1.00 0.00 ? 25 GLU A CD   4  
ATOM 4324  O OE1  . GLU A 1 25 ? -6.818  -13.329 -2.736  1.00 0.00 ? 25 GLU A OE1  4  
ATOM 4325  O OE2  . GLU A 1 25 ? -7.808  -11.430 -2.967  1.00 0.00 ? 25 GLU A OE2  4  
ATOM 4326  H H    . GLU A 1 25 ? -6.366  -14.569 2.022   1.00 0.00 ? 25 GLU A H    4  
ATOM 4327  H HA   . GLU A 1 25 ? -6.026  -11.774 1.619   1.00 0.00 ? 25 GLU A HA   4  
ATOM 4328  H HB2  . GLU A 1 25 ? -6.009  -13.694 -0.129  1.00 0.00 ? 25 GLU A HB2  4  
ATOM 4329  H HB3  . GLU A 1 25 ? -7.763  -13.512 -0.160  1.00 0.00 ? 25 GLU A HB3  4  
ATOM 4330  H HG2  . GLU A 1 25 ? -7.293  -10.997 -0.572  1.00 0.00 ? 25 GLU A HG2  4  
ATOM 4331  H HG3  . GLU A 1 25 ? -5.651  -11.513 -0.962  1.00 0.00 ? 25 GLU A HG3  4  
ATOM 4332  N N    . LYS A 1 26 ? -9.146  -12.751 2.055   1.00 0.00 ? 26 LYS A N    4  
ATOM 4333  C CA   . LYS A 1 26 ? -10.507 -12.262 2.420   1.00 0.00 ? 26 LYS A CA   4  
ATOM 4334  C C    . LYS A 1 26 ? -10.454 -11.381 3.673   1.00 0.00 ? 26 LYS A C    4  
ATOM 4335  O O    . LYS A 1 26 ? -11.231 -10.459 3.820   1.00 0.00 ? 26 LYS A O    4  
ATOM 4336  C CB   . LYS A 1 26 ? -11.430 -13.466 2.665   1.00 0.00 ? 26 LYS A CB   4  
ATOM 4337  C CG   . LYS A 1 26 ? -12.879 -12.996 2.956   1.00 0.00 ? 26 LYS A CG   4  
ATOM 4338  C CD   . LYS A 1 26 ? -13.157 -12.999 4.467   1.00 0.00 ? 26 LYS A CD   4  
ATOM 4339  C CE   . LYS A 1 26 ? -14.608 -12.586 4.719   1.00 0.00 ? 26 LYS A CE   4  
ATOM 4340  N NZ   . LYS A 1 26 ? -14.770 -11.136 4.419   1.00 0.00 ? 26 LYS A NZ   4  
ATOM 4341  H H    . LYS A 1 26 ? -8.991  -13.711 1.948   1.00 0.00 ? 26 LYS A H    4  
ATOM 4342  H HA   . LYS A 1 26 ? -10.908 -11.675 1.615   1.00 0.00 ? 26 LYS A HA   4  
ATOM 4343  H HB2  . LYS A 1 26 ? -11.426 -14.092 1.782   1.00 0.00 ? 26 LYS A HB2  4  
ATOM 4344  H HB3  . LYS A 1 26 ? -11.055 -14.039 3.501   1.00 0.00 ? 26 LYS A HB3  4  
ATOM 4345  H HG2  . LYS A 1 26 ? -13.027 -11.997 2.570   1.00 0.00 ? 26 LYS A HG2  4  
ATOM 4346  H HG3  . LYS A 1 26 ? -13.577 -13.666 2.472   1.00 0.00 ? 26 LYS A HG3  4  
ATOM 4347  H HD2  . LYS A 1 26 ? -12.989 -13.990 4.860   1.00 0.00 ? 26 LYS A HD2  4  
ATOM 4348  H HD3  . LYS A 1 26 ? -12.497 -12.301 4.959   1.00 0.00 ? 26 LYS A HD3  4  
ATOM 4349  H HE2  . LYS A 1 26 ? -15.262 -13.162 4.080   1.00 0.00 ? 26 LYS A HE2  4  
ATOM 4350  H HE3  . LYS A 1 26 ? -14.859 -12.770 5.752   1.00 0.00 ? 26 LYS A HE3  4  
ATOM 4351  H HZ1  . LYS A 1 26 ? -15.772 -10.873 4.507   1.00 0.00 ? 26 LYS A HZ1  4  
ATOM 4352  H HZ2  . LYS A 1 26 ? -14.445 -10.944 3.449   1.00 0.00 ? 26 LYS A HZ2  4  
ATOM 4353  H HZ3  . LYS A 1 26 ? -14.207 -10.577 5.090   1.00 0.00 ? 26 LYS A HZ3  4  
ATOM 4354  N N    . GLU A 1 27 ? -9.562  -11.653 4.581   1.00 0.00 ? 27 GLU A N    4  
ATOM 4355  C CA   . GLU A 1 27 ? -9.492  -10.820 5.818   1.00 0.00 ? 27 GLU A CA   4  
ATOM 4356  C C    . GLU A 1 27 ? -8.820  -9.471  5.518   1.00 0.00 ? 27 GLU A C    4  
ATOM 4357  O O    . GLU A 1 27 ? -9.184  -8.458  6.081   1.00 0.00 ? 27 GLU A O    4  
ATOM 4358  C CB   . GLU A 1 27 ? -8.679  -11.547 6.890   1.00 0.00 ? 27 GLU A CB   4  
ATOM 4359  C CG   . GLU A 1 27 ? -9.484  -12.699 7.485   1.00 0.00 ? 27 GLU A CG   4  
ATOM 4360  C CD   . GLU A 1 27 ? -8.568  -13.570 8.348   1.00 0.00 ? 27 GLU A CD   4  
ATOM 4361  O OE1  . GLU A 1 27 ? -7.480  -13.881 7.892   1.00 0.00 ? 27 GLU A OE1  4  
ATOM 4362  O OE2  . GLU A 1 27 ? -8.970  -13.908 9.448   1.00 0.00 ? 27 GLU A OE2  4  
ATOM 4363  H H    . GLU A 1 27 ? -8.943  -12.402 4.451   1.00 0.00 ? 27 GLU A H    4  
ATOM 4364  H HA   . GLU A 1 27 ? -10.492 -10.646 6.187   1.00 0.00 ? 27 GLU A HA   4  
ATOM 4365  H HB2  . GLU A 1 27 ? -7.772  -11.935 6.454   1.00 0.00 ? 27 GLU A HB2  4  
ATOM 4366  H HB3  . GLU A 1 27 ? -8.435  -10.851 7.672   1.00 0.00 ? 27 GLU A HB3  4  
ATOM 4367  H HG2  . GLU A 1 27 ? -10.279 -12.301 8.096   1.00 0.00 ? 27 GLU A HG2  4  
ATOM 4368  H HG3  . GLU A 1 27 ? -9.900  -13.296 6.692   1.00 0.00 ? 27 GLU A HG3  4  
ATOM 4369  N N    . ILE A 1 28 ? -7.843  -9.441  4.656   1.00 0.00 ? 28 ILE A N    4  
ATOM 4370  C CA   . ILE A 1 28 ? -7.162  -8.147  4.354   1.00 0.00 ? 28 ILE A CA   4  
ATOM 4371  C C    . ILE A 1 28 ? -8.156  -7.207  3.684   1.00 0.00 ? 28 ILE A C    4  
ATOM 4372  O O    . ILE A 1 28 ? -8.200  -6.028  3.973   1.00 0.00 ? 28 ILE A O    4  
ATOM 4373  C CB   . ILE A 1 28 ? -5.955  -8.442  3.448   1.00 0.00 ? 28 ILE A CB   4  
ATOM 4374  C CG1  . ILE A 1 28 ? -5.243  -9.706  4.011   1.00 0.00 ? 28 ILE A CG1  4  
ATOM 4375  C CG2  . ILE A 1 28 ? -5.017  -7.228  3.406   1.00 0.00 ? 28 ILE A CG2  4  
ATOM 4376  C CD1  . ILE A 1 28 ? -3.713  -9.648  3.894   1.00 0.00 ? 28 ILE A CD1  4  
ATOM 4377  H H    . ILE A 1 28 ? -7.553  -10.261 4.206   1.00 0.00 ? 28 ILE A H    4  
ATOM 4378  H HA   . ILE A 1 28 ? -6.826  -7.705  5.281   1.00 0.00 ? 28 ILE A HA   4  
ATOM 4379  H HB   . ILE A 1 28 ? -6.308  -8.644  2.448   1.00 0.00 ? 28 ILE A HB   4  
ATOM 4380  H HG12 . ILE A 1 28 ? -5.494  -9.812  5.043   1.00 0.00 ? 28 ILE A HG12 4  
ATOM 4381  H HG13 . ILE A 1 28 ? -5.598  -10.573 3.485   1.00 0.00 ? 28 ILE A HG13 4  
ATOM 4382  H HG21 . ILE A 1 28 ? -4.583  -7.068  4.380   1.00 0.00 ? 28 ILE A HG21 4  
ATOM 4383  H HG22 . ILE A 1 28 ? -5.576  -6.355  3.113   1.00 0.00 ? 28 ILE A HG22 4  
ATOM 4384  H HG23 . ILE A 1 28 ? -4.233  -7.406  2.685   1.00 0.00 ? 28 ILE A HG23 4  
ATOM 4385  H HD11 . ILE A 1 28 ? -3.432  -9.474  2.866   1.00 0.00 ? 28 ILE A HD11 4  
ATOM 4386  H HD12 . ILE A 1 28 ? -3.299  -10.593 4.228   1.00 0.00 ? 28 ILE A HD12 4  
ATOM 4387  H HD13 . ILE A 1 28 ? -3.332  -8.854  4.515   1.00 0.00 ? 28 ILE A HD13 4  
ATOM 4388  N N    . LEU A 1 29 ? -8.966  -7.714  2.804   1.00 0.00 ? 29 LEU A N    4  
ATOM 4389  C CA   . LEU A 1 29 ? -9.967  -6.847  2.135   1.00 0.00 ? 29 LEU A CA   4  
ATOM 4390  C C    . LEU A 1 29 ? -11.073 -6.482  3.134   1.00 0.00 ? 29 LEU A C    4  
ATOM 4391  O O    . LEU A 1 29 ? -11.680 -5.436  3.058   1.00 0.00 ? 29 LEU A O    4  
ATOM 4392  C CB   . LEU A 1 29 ? -10.554 -7.605  0.945   1.00 0.00 ? 29 LEU A CB   4  
ATOM 4393  C CG   . LEU A 1 29 ? -9.411  -8.137  0.069   1.00 0.00 ? 29 LEU A CG   4  
ATOM 4394  C CD1  . LEU A 1 29 ? -9.999  -8.968  -1.076  1.00 0.00 ? 29 LEU A CD1  4  
ATOM 4395  C CD2  . LEU A 1 29 ? -8.609  -6.959  -0.510  1.00 0.00 ? 29 LEU A CD2  4  
ATOM 4396  H H    . LEU A 1 29 ? -8.924  -8.666  2.576   1.00 0.00 ? 29 LEU A H    4  
ATOM 4397  H HA   . LEU A 1 29 ? -9.489  -5.943  1.788   1.00 0.00 ? 29 LEU A HA   4  
ATOM 4398  H HB2  . LEU A 1 29 ? -11.148 -8.434  1.305   1.00 0.00 ? 29 LEU A HB2  4  
ATOM 4399  H HB3  . LEU A 1 29 ? -11.174 -6.941  0.362   1.00 0.00 ? 29 LEU A HB3  4  
ATOM 4400  H HG   . LEU A 1 29 ? -8.756  -8.762  0.671   1.00 0.00 ? 29 LEU A HG   4  
ATOM 4401  H HD11 . LEU A 1 29 ? -10.782 -8.405  -1.563  1.00 0.00 ? 29 LEU A HD11 4  
ATOM 4402  H HD12 . LEU A 1 29 ? -10.407 -9.886  -0.684  1.00 0.00 ? 29 LEU A HD12 4  
ATOM 4403  H HD13 . LEU A 1 29 ? -9.222  -9.195  -1.791  1.00 0.00 ? 29 LEU A HD13 4  
ATOM 4404  H HD21 . LEU A 1 29 ? -7.909  -6.601  0.231   1.00 0.00 ? 29 LEU A HD21 4  
ATOM 4405  H HD22 . LEU A 1 29 ? -9.282  -6.160  -0.785  1.00 0.00 ? 29 LEU A HD22 4  
ATOM 4406  H HD23 . LEU A 1 29 ? -8.065  -7.285  -1.384  1.00 0.00 ? 29 LEU A HD23 4  
ATOM 4407  N N    . ASP A 1 30 ? -11.320 -7.341  4.086   1.00 0.00 ? 30 ASP A N    4  
ATOM 4408  C CA   . ASP A 1 30 ? -12.358 -7.038  5.114   1.00 0.00 ? 30 ASP A CA   4  
ATOM 4409  C C    . ASP A 1 30 ? -11.842 -5.899  6.002   1.00 0.00 ? 30 ASP A C    4  
ATOM 4410  O O    . ASP A 1 30 ? -12.564 -4.977  6.326   1.00 0.00 ? 30 ASP A O    4  
ATOM 4411  C CB   . ASP A 1 30 ? -12.621 -8.283  5.966   1.00 0.00 ? 30 ASP A CB   4  
ATOM 4412  C CG   . ASP A 1 30 ? -13.828 -8.036  6.873   1.00 0.00 ? 30 ASP A CG   4  
ATOM 4413  O OD1  . ASP A 1 30 ? -13.945 -6.933  7.381   1.00 0.00 ? 30 ASP A OD1  4  
ATOM 4414  O OD2  . ASP A 1 30 ? -14.614 -8.953  7.041   1.00 0.00 ? 30 ASP A OD2  4  
ATOM 4415  H H    . ASP A 1 30 ? -10.810 -8.177  4.119   1.00 0.00 ? 30 ASP A H    4  
ATOM 4416  H HA   . ASP A 1 30 ? -13.274 -6.721  4.637   1.00 0.00 ? 30 ASP A HA   4  
ATOM 4417  H HB2  . ASP A 1 30 ? -12.821 -9.126  5.320   1.00 0.00 ? 30 ASP A HB2  4  
ATOM 4418  H HB3  . ASP A 1 30 ? -11.753 -8.494  6.574   1.00 0.00 ? 30 ASP A HB3  4  
ATOM 4419  N N    . ALA A 1 31 ? -10.605 -5.967  6.414   1.00 0.00 ? 31 ALA A N    4  
ATOM 4420  C CA   . ALA A 1 31 ? -10.044 -4.904  7.302   1.00 0.00 ? 31 ALA A CA   4  
ATOM 4421  C C    . ALA A 1 31 ? -9.920  -3.577  6.535   1.00 0.00 ? 31 ALA A C    4  
ATOM 4422  O O    . ALA A 1 31 ? -9.942  -2.517  7.129   1.00 0.00 ? 31 ALA A O    4  
ATOM 4423  C CB   . ALA A 1 31 ? -8.668  -5.350  7.800   1.00 0.00 ? 31 ALA A CB   4  
ATOM 4424  H H    . ALA A 1 31 ? -10.046 -6.729  6.153   1.00 0.00 ? 31 ALA A H    4  
ATOM 4425  H HA   . ALA A 1 31 ? -10.699 -4.769  8.148   1.00 0.00 ? 31 ALA A HA   4  
ATOM 4426  H HB1  . ALA A 1 31 ? -8.716  -6.385  8.108   1.00 0.00 ? 31 ALA A HB1  4  
ATOM 4427  H HB2  . ALA A 1 31 ? -8.371  -4.741  8.641   1.00 0.00 ? 31 ALA A HB2  4  
ATOM 4428  H HB3  . ALA A 1 31 ? -7.944  -5.248  7.006   1.00 0.00 ? 31 ALA A HB3  4  
ATOM 4429  N N    . PHE A 1 32 ? -9.821  -3.607  5.238   1.00 0.00 ? 32 PHE A N    4  
ATOM 4430  C CA   . PHE A 1 32 ? -9.731  -2.328  4.466   1.00 0.00 ? 32 PHE A CA   4  
ATOM 4431  C C    . PHE A 1 32 ? -10.906 -1.422  4.845   1.00 0.00 ? 32 PHE A C    4  
ATOM 4432  O O    . PHE A 1 32 ? -10.914 -0.244  4.546   1.00 0.00 ? 32 PHE A O    4  
ATOM 4433  C CB   . PHE A 1 32 ? -9.806  -2.673  2.969   1.00 0.00 ? 32 PHE A CB   4  
ATOM 4434  C CG   . PHE A 1 32 ? -8.448  -3.099  2.412   1.00 0.00 ? 32 PHE A CG   4  
ATOM 4435  C CD1  . PHE A 1 32 ? -7.365  -3.465  3.248   1.00 0.00 ? 32 PHE A CD1  4  
ATOM 4436  C CD2  . PHE A 1 32 ? -8.275  -3.111  1.021   1.00 0.00 ? 32 PHE A CD2  4  
ATOM 4437  C CE1  . PHE A 1 32 ? -6.138  -3.829  2.682   1.00 0.00 ? 32 PHE A CE1  4  
ATOM 4438  C CE2  . PHE A 1 32 ? -7.042  -3.474  0.465   1.00 0.00 ? 32 PHE A CE2  4  
ATOM 4439  C CZ   . PHE A 1 32 ? -5.976  -3.829  1.294   1.00 0.00 ? 32 PHE A CZ   4  
ATOM 4440  H H    . PHE A 1 32 ? -9.826  -4.461  4.758   1.00 0.00 ? 32 PHE A H    4  
ATOM 4441  H HA   . PHE A 1 32 ? -8.802  -1.821  4.667   1.00 0.00 ? 32 PHE A HA   4  
ATOM 4442  H HB2  . PHE A 1 32 ? -10.506 -3.476  2.829   1.00 0.00 ? 32 PHE A HB2  4  
ATOM 4443  H HB3  . PHE A 1 32 ? -10.153 -1.810  2.421   1.00 0.00 ? 32 PHE A HB3  4  
ATOM 4444  H HD1  . PHE A 1 32 ? -7.471  -3.489  4.319   1.00 0.00 ? 32 PHE A HD1  4  
ATOM 4445  H HD2  . PHE A 1 32 ? -9.096  -2.841  0.376   1.00 0.00 ? 32 PHE A HD2  4  
ATOM 4446  H HE1  . PHE A 1 32 ? -5.311  -4.095  3.322   1.00 0.00 ? 32 PHE A HE1  4  
ATOM 4447  H HE2  . PHE A 1 32 ? -6.917  -3.481  -0.608  1.00 0.00 ? 32 PHE A HE2  4  
ATOM 4448  H HZ   . PHE A 1 32 ? -5.027  -4.110  0.864   1.00 0.00 ? 32 PHE A HZ   4  
ATOM 4449  N N    . ASP A 1 33 ? -11.910 -1.965  5.473   1.00 0.00 ? 33 ASP A N    4  
ATOM 4450  C CA   . ASP A 1 33 ? -13.093 -1.138  5.837   1.00 0.00 ? 33 ASP A CA   4  
ATOM 4451  C C    . ASP A 1 33 ? -12.814 -0.310  7.094   1.00 0.00 ? 33 ASP A C    4  
ATOM 4452  O O    . ASP A 1 33 ? -13.496 0.660   7.358   1.00 0.00 ? 33 ASP A O    4  
ATOM 4453  C CB   . ASP A 1 33 ? -14.287 -2.059  6.094   1.00 0.00 ? 33 ASP A CB   4  
ATOM 4454  C CG   . ASP A 1 33 ? -14.599 -2.854  4.825   1.00 0.00 ? 33 ASP A CG   4  
ATOM 4455  O OD1  . ASP A 1 33 ? -15.014 -2.242  3.854   1.00 0.00 ? 33 ASP A OD1  4  
ATOM 4456  O OD2  . ASP A 1 33 ? -14.418 -4.059  4.844   1.00 0.00 ? 33 ASP A OD2  4  
ATOM 4457  H H    . ASP A 1 33 ? -11.894 -2.921  5.686   1.00 0.00 ? 33 ASP A H    4  
ATOM 4458  H HA   . ASP A 1 33 ? -13.330 -0.475  5.020   1.00 0.00 ? 33 ASP A HA   4  
ATOM 4459  H HB2  . ASP A 1 33 ? -14.049 -2.741  6.898   1.00 0.00 ? 33 ASP A HB2  4  
ATOM 4460  H HB3  . ASP A 1 33 ? -15.148 -1.467  6.367   1.00 0.00 ? 33 ASP A HB3  4  
ATOM 4461  N N    . LYS A 1 34 ? -11.816 -0.670  7.868   1.00 0.00 ? 34 LYS A N    4  
ATOM 4462  C CA   . LYS A 1 34 ? -11.492 0.116   9.106   1.00 0.00 ? 34 LYS A CA   4  
ATOM 4463  C C    . LYS A 1 34 ? -9.990  0.421   9.143   1.00 0.00 ? 34 LYS A C    4  
ATOM 4464  O O    . LYS A 1 34 ? -9.469  0.865   10.146  1.00 0.00 ? 34 LYS A O    4  
ATOM 4465  C CB   . LYS A 1 34 ? -11.890 -0.681  10.353  1.00 0.00 ? 34 LYS A CB   4  
ATOM 4466  C CG   . LYS A 1 34 ? -11.381 -2.118  10.240  1.00 0.00 ? 34 LYS A CG   4  
ATOM 4467  C CD   . LYS A 1 34 ? -11.669 -2.874  11.544  1.00 0.00 ? 34 LYS A CD   4  
ATOM 4468  C CE   . LYS A 1 34 ? -13.162 -3.213  11.646  1.00 0.00 ? 34 LYS A CE   4  
ATOM 4469  N NZ   . LYS A 1 34 ? -13.358 -4.267  12.681  1.00 0.00 ? 34 LYS A NZ   4  
ATOM 4470  H H    . LYS A 1 34 ? -11.275 -1.455  7.644   1.00 0.00 ? 34 LYS A H    4  
ATOM 4471  H HA   . LYS A 1 34 ? -12.033 1.053   9.100   1.00 0.00 ? 34 LYS A HA   4  
ATOM 4472  H HB2  . LYS A 1 34 ? -11.460 -0.215  11.228  1.00 0.00 ? 34 LYS A HB2  4  
ATOM 4473  H HB3  . LYS A 1 34 ? -12.965 -0.689  10.444  1.00 0.00 ? 34 LYS A HB3  4  
ATOM 4474  H HG2  . LYS A 1 34 ? -11.873 -2.608  9.416   1.00 0.00 ? 34 LYS A HG2  4  
ATOM 4475  H HG3  . LYS A 1 34 ? -10.315 -2.106  10.067  1.00 0.00 ? 34 LYS A HG3  4  
ATOM 4476  H HD2  . LYS A 1 34 ? -11.094 -3.787  11.563  1.00 0.00 ? 34 LYS A HD2  4  
ATOM 4477  H HD3  . LYS A 1 34 ? -11.387 -2.257  12.384  1.00 0.00 ? 34 LYS A HD3  4  
ATOM 4478  H HE2  . LYS A 1 34 ? -13.715 -2.329  11.925  1.00 0.00 ? 34 LYS A HE2  4  
ATOM 4479  H HE3  . LYS A 1 34 ? -13.521 -3.575  10.693  1.00 0.00 ? 34 LYS A HE3  4  
ATOM 4480  H HZ1  . LYS A 1 34 ? -13.450 -5.194  12.219  1.00 0.00 ? 34 LYS A HZ1  4  
ATOM 4481  H HZ2  . LYS A 1 34 ? -14.221 -4.061  13.224  1.00 0.00 ? 34 LYS A HZ2  4  
ATOM 4482  H HZ3  . LYS A 1 34 ? -12.539 -4.282  13.320  1.00 0.00 ? 34 LYS A HZ3  4  
ATOM 4483  N N    . MET A 1 35 ? -9.283  0.192   8.063   1.00 0.00 ? 35 MET A N    4  
ATOM 4484  C CA   . MET A 1 35 ? -7.817  0.485   8.063   1.00 0.00 ? 35 MET A CA   4  
ATOM 4485  C C    . MET A 1 35 ? -7.614  1.985   7.831   1.00 0.00 ? 35 MET A C    4  
ATOM 4486  O O    . MET A 1 35 ? -6.789  2.598   8.479   1.00 0.00 ? 35 MET A O    4  
ATOM 4487  C CB   . MET A 1 35 ? -7.121  -0.345  6.959   1.00 0.00 ? 35 MET A CB   4  
ATOM 4488  C CG   . MET A 1 35 ? -5.869  -1.040  7.501   1.00 0.00 ? 35 MET A CG   4  
ATOM 4489  S SD   . MET A 1 35 ? -4.870  -1.648  6.113   1.00 0.00 ? 35 MET A SD   4  
ATOM 4490  C CE   . MET A 1 35 ? -5.150  -3.422  6.360   1.00 0.00 ? 35 MET A CE   4  
ATOM 4491  H H    . MET A 1 35 ? -9.714  -0.162  7.257   1.00 0.00 ? 35 MET A H    4  
ATOM 4492  H HA   . MET A 1 35 ? -7.408  0.224   9.032   1.00 0.00 ? 35 MET A HA   4  
ATOM 4493  H HB2  . MET A 1 35 ? -7.802  -1.093  6.620   1.00 0.00 ? 35 MET A HB2  4  
ATOM 4494  H HB3  . MET A 1 35 ? -6.840  0.286   6.126   1.00 0.00 ? 35 MET A HB3  4  
ATOM 4495  H HG2  . MET A 1 35 ? -5.291  -0.335  8.081   1.00 0.00 ? 35 MET A HG2  4  
ATOM 4496  H HG3  . MET A 1 35 ? -6.166  -1.865  8.127   1.00 0.00 ? 35 MET A HG3  4  
ATOM 4497  H HE1  . MET A 1 35 ? -6.213  -3.626  6.339   1.00 0.00 ? 35 MET A HE1  4  
ATOM 4498  H HE2  . MET A 1 35 ? -4.749  -3.718  7.315   1.00 0.00 ? 35 MET A HE2  4  
ATOM 4499  H HE3  . MET A 1 35 ? -4.654  -3.977  5.576   1.00 0.00 ? 35 MET A HE3  4  
ATOM 4500  N N    . CYS A 1 36 ? -8.347  2.608   6.938   1.00 0.00 ? 36 CYS A N    4  
ATOM 4501  C CA   . CYS A 1 36 ? -8.125  4.065   6.764   1.00 0.00 ? 36 CYS A CA   4  
ATOM 4502  C C    . CYS A 1 36 ? -8.519  4.729   8.078   1.00 0.00 ? 36 CYS A C    4  
ATOM 4503  O O    . CYS A 1 36 ? -8.393  5.925   8.250   1.00 0.00 ? 36 CYS A O    4  
ATOM 4504  C CB   . CYS A 1 36 ? -8.956  4.636   5.609   1.00 0.00 ? 36 CYS A CB   4  
ATOM 4505  S SG   . CYS A 1 36 ? -8.153  6.125   4.983   1.00 0.00 ? 36 CYS A SG   4  
ATOM 4506  H H    . CYS A 1 36 ? -9.029  2.136   6.412   1.00 0.00 ? 36 CYS A H    4  
ATOM 4507  H HA   . CYS A 1 36 ? -7.072  4.229   6.601   1.00 0.00 ? 36 CYS A HA   4  
ATOM 4508  H HB2  . CYS A 1 36 ? -9.027  3.910   4.820   1.00 0.00 ? 36 CYS A HB2  4  
ATOM 4509  H HB3  . CYS A 1 36 ? -9.949  4.886   5.955   1.00 0.00 ? 36 CYS A HB3  4  
ATOM 4510  N N    . SER A 1 37 ? -9.001  3.951   9.009   1.00 0.00 ? 37 SER A N    4  
ATOM 4511  C CA   . SER A 1 37 ? -9.412  4.531   10.322  1.00 0.00 ? 37 SER A CA   4  
ATOM 4512  C C    . SER A 1 37 ? -8.192  4.688   11.241  1.00 0.00 ? 37 SER A C    4  
ATOM 4513  O O    . SER A 1 37 ? -8.333  4.990   12.410  1.00 0.00 ? 37 SER A O    4  
ATOM 4514  C CB   . SER A 1 37 ? -10.435 3.609   10.991  1.00 0.00 ? 37 SER A CB   4  
ATOM 4515  O OG   . SER A 1 37 ? -11.136 4.335   11.991  1.00 0.00 ? 37 SER A OG   4  
ATOM 4516  H H    . SER A 1 37 ? -9.097  2.981   8.837   1.00 0.00 ? 37 SER A H    4  
ATOM 4517  H HA   . SER A 1 37 ? -9.862  5.500   10.161  1.00 0.00 ? 37 SER A HA   4  
ATOM 4518  H HB2  . SER A 1 37 ? -11.136 3.254   10.255  1.00 0.00 ? 37 SER A HB2  4  
ATOM 4519  H HB3  . SER A 1 37 ? -9.924  2.764   11.435  1.00 0.00 ? 37 SER A HB3  4  
ATOM 4520  H HG   . SER A 1 37 ? -11.801 3.753   12.368  1.00 0.00 ? 37 SER A HG   4  
ATOM 4521  N N    . LYS A 1 38 ? -6.999  4.482   10.729  1.00 0.00 ? 38 LYS A N    4  
ATOM 4522  C CA   . LYS A 1 38 ? -5.765  4.617   11.578  1.00 0.00 ? 38 LYS A CA   4  
ATOM 4523  C C    . LYS A 1 38 ? -4.914  5.799   11.086  1.00 0.00 ? 38 LYS A C    4  
ATOM 4524  O O    . LYS A 1 38 ? -3.783  5.966   11.497  1.00 0.00 ? 38 LYS A O    4  
ATOM 4525  C CB   . LYS A 1 38 ? -4.950  3.315   11.506  1.00 0.00 ? 38 LYS A CB   4  
ATOM 4526  C CG   . LYS A 1 38 ? -5.581  2.259   12.418  1.00 0.00 ? 38 LYS A CG   4  
ATOM 4527  C CD   . LYS A 1 38 ? -4.726  0.990   12.397  1.00 0.00 ? 38 LYS A CD   4  
ATOM 4528  C CE   . LYS A 1 38 ? -5.494  -0.156  13.059  1.00 0.00 ? 38 LYS A CE   4  
ATOM 4529  N NZ   . LYS A 1 38 ? -4.625  -1.365  13.124  1.00 0.00 ? 38 LYS A NZ   4  
ATOM 4530  H H    . LYS A 1 38 ? -6.912  4.237   9.784   1.00 0.00 ? 38 LYS A H    4  
ATOM 4531  H HA   . LYS A 1 38 ? -6.044  4.800   12.608  1.00 0.00 ? 38 LYS A HA   4  
ATOM 4532  H HB2  . LYS A 1 38 ? -4.942  2.948   10.491  1.00 0.00 ? 38 LYS A HB2  4  
ATOM 4533  H HB3  . LYS A 1 38 ? -3.936  3.504   11.830  1.00 0.00 ? 38 LYS A HB3  4  
ATOM 4534  H HG2  . LYS A 1 38 ? -5.636  2.640   13.427  1.00 0.00 ? 38 LYS A HG2  4  
ATOM 4535  H HG3  . LYS A 1 38 ? -6.574  2.026   12.066  1.00 0.00 ? 38 LYS A HG3  4  
ATOM 4536  H HD2  . LYS A 1 38 ? -4.497  0.728   11.375  1.00 0.00 ? 38 LYS A HD2  4  
ATOM 4537  H HD3  . LYS A 1 38 ? -3.809  1.165   12.938  1.00 0.00 ? 38 LYS A HD3  4  
ATOM 4538  H HE2  . LYS A 1 38 ? -5.783  0.134   14.059  1.00 0.00 ? 38 LYS A HE2  4  
ATOM 4539  H HE3  . LYS A 1 38 ? -6.378  -0.379  12.479  1.00 0.00 ? 38 LYS A HE3  4  
ATOM 4540  H HZ1  . LYS A 1 38 ? -4.006  -1.303  13.957  1.00 0.00 ? 38 LYS A HZ1  4  
ATOM 4541  H HZ2  . LYS A 1 38 ? -4.043  -1.420  12.262  1.00 0.00 ? 38 LYS A HZ2  4  
ATOM 4542  H HZ3  . LYS A 1 38 ? -5.218  -2.216  13.197  1.00 0.00 ? 38 LYS A HZ3  4  
ATOM 4543  N N    . LEU A 1 39 ? -5.455  6.625   10.220  1.00 0.00 ? 39 LEU A N    4  
ATOM 4544  C CA   . LEU A 1 39 ? -4.695  7.816   9.700   1.00 0.00 ? 39 LEU A CA   4  
ATOM 4545  C C    . LEU A 1 39 ? -5.495  9.088   10.047  1.00 0.00 ? 39 LEU A C    4  
ATOM 4546  O O    . LEU A 1 39 ? -6.708  9.057   9.985   1.00 0.00 ? 39 LEU A O    4  
ATOM 4547  C CB   . LEU A 1 39 ? -4.588  7.723   8.169   1.00 0.00 ? 39 LEU A CB   4  
ATOM 4548  C CG   . LEU A 1 39 ? -3.871  6.436   7.746   1.00 0.00 ? 39 LEU A CG   4  
ATOM 4549  C CD1  . LEU A 1 39 ? -3.896  6.330   6.220   1.00 0.00 ? 39 LEU A CD1  4  
ATOM 4550  C CD2  . LEU A 1 39 ? -2.409  6.460   8.223   1.00 0.00 ? 39 LEU A CD2  4  
ATOM 4551  H H    . LEU A 1 39 ? -6.373  6.470   9.916   1.00 0.00 ? 39 LEU A H    4  
ATOM 4552  H HA   . LEU A 1 39 ? -3.713  7.852   10.139  1.00 0.00 ? 39 LEU A HA   4  
ATOM 4553  H HB2  . LEU A 1 39 ? -5.584  7.727   7.749   1.00 0.00 ? 39 LEU A HB2  4  
ATOM 4554  H HB3  . LEU A 1 39 ? -4.045  8.574   7.790   1.00 0.00 ? 39 LEU A HB3  4  
ATOM 4555  H HG   . LEU A 1 39 ? -4.379  5.587   8.170   1.00 0.00 ? 39 LEU A HG   4  
ATOM 4556  H HD11 . LEU A 1 39 ? -4.883  6.569   5.857   1.00 0.00 ? 39 LEU A HD11 4  
ATOM 4557  H HD12 . LEU A 1 39 ? -3.636  5.325   5.925   1.00 0.00 ? 39 LEU A HD12 4  
ATOM 4558  H HD13 . LEU A 1 39 ? -3.182  7.022   5.804   1.00 0.00 ? 39 LEU A HD13 4  
ATOM 4559  H HD21 . LEU A 1 39 ? -1.999  7.446   8.079   1.00 0.00 ? 39 LEU A HD21 4  
ATOM 4560  H HD22 . LEU A 1 39 ? -1.831  5.749   7.652   1.00 0.00 ? 39 LEU A HD22 4  
ATOM 4561  H HD23 . LEU A 1 39 ? -2.365  6.198   9.268   1.00 0.00 ? 39 LEU A HD23 4  
ATOM 4562  N N    . PRO A 1 40 ? -4.832  10.184  10.388  1.00 0.00 ? 40 PRO A N    4  
ATOM 4563  C CA   . PRO A 1 40 ? -5.554  11.424  10.708  1.00 0.00 ? 40 PRO A CA   4  
ATOM 4564  C C    . PRO A 1 40 ? -6.654  11.680  9.658   1.00 0.00 ? 40 PRO A C    4  
ATOM 4565  O O    . PRO A 1 40 ? -6.599  11.139  8.573   1.00 0.00 ? 40 PRO A O    4  
ATOM 4566  C CB   . PRO A 1 40 ? -4.465  12.523  10.730  1.00 0.00 ? 40 PRO A CB   4  
ATOM 4567  C CG   . PRO A 1 40 ? -3.087  11.801  10.696  1.00 0.00 ? 40 PRO A CG   4  
ATOM 4568  C CD   . PRO A 1 40 ? -3.358  10.295  10.491  1.00 0.00 ? 40 PRO A CD   4  
ATOM 4569  H HA   . PRO A 1 40 ? -6.006  11.330  11.681  1.00 0.00 ? 40 PRO A HA   4  
ATOM 4570  H HB2  . PRO A 1 40 ? -4.565  13.170  9.865   1.00 0.00 ? 40 PRO A HB2  4  
ATOM 4571  H HB3  . PRO A 1 40 ? -4.542  13.111  11.636  1.00 0.00 ? 40 PRO A HB3  4  
ATOM 4572  H HG2  . PRO A 1 40 ? -2.487  12.187  9.878   1.00 0.00 ? 40 PRO A HG2  4  
ATOM 4573  H HG3  . PRO A 1 40 ? -2.563  11.953  11.631  1.00 0.00 ? 40 PRO A HG3  4  
ATOM 4574  H HD2  . PRO A 1 40 ? -2.884  9.954   9.590   1.00 0.00 ? 40 PRO A HD2  4  
ATOM 4575  H HD3  . PRO A 1 40 ? -3.005  9.727   11.341  1.00 0.00 ? 40 PRO A HD3  4  
ATOM 4576  N N    . LYS A 1 41 ? -7.657  12.460  9.951   1.00 0.00 ? 41 LYS A N    4  
ATOM 4577  C CA   . LYS A 1 41 ? -8.728  12.671  8.932   1.00 0.00 ? 41 LYS A CA   4  
ATOM 4578  C C    . LYS A 1 41 ? -8.196  13.402  7.694   1.00 0.00 ? 41 LYS A C    4  
ATOM 4579  O O    . LYS A 1 41 ? -8.855  13.464  6.675   1.00 0.00 ? 41 LYS A O    4  
ATOM 4580  C CB   . LYS A 1 41 ? -9.889  13.462  9.537   1.00 0.00 ? 41 LYS A CB   4  
ATOM 4581  C CG   . LYS A 1 41 ? -11.182 13.203  8.730   1.00 0.00 ? 41 LYS A CG   4  
ATOM 4582  C CD   . LYS A 1 41 ? -11.879 11.915  9.225   1.00 0.00 ? 41 LYS A CD   4  
ATOM 4583  C CE   . LYS A 1 41 ? -12.885 12.247  10.335  1.00 0.00 ? 41 LYS A CE   4  
ATOM 4584  N NZ   . LYS A 1 41 ? -12.332 13.317  11.212  1.00 0.00 ? 41 LYS A NZ   4  
ATOM 4585  H H    . LYS A 1 41 ? -7.720  12.893  10.828  1.00 0.00 ? 41 LYS A H    4  
ATOM 4586  H HA   . LYS A 1 41 ? -9.091  11.716  8.579   1.00 0.00 ? 41 LYS A HA   4  
ATOM 4587  H HB2  . LYS A 1 41 ? -10.031 13.155  10.562  1.00 0.00 ? 41 LYS A HB2  4  
ATOM 4588  H HB3  . LYS A 1 41 ? -9.655  14.516  9.508   1.00 0.00 ? 41 LYS A HB3  4  
ATOM 4589  H HG2  . LYS A 1 41 ? -11.849 14.047  8.843   1.00 0.00 ? 41 LYS A HG2  4  
ATOM 4590  H HG3  . LYS A 1 41 ? -10.934 13.090  7.682   1.00 0.00 ? 41 LYS A HG3  4  
ATOM 4591  H HD2  . LYS A 1 41 ? -12.402 11.452  8.401   1.00 0.00 ? 41 LYS A HD2  4  
ATOM 4592  H HD3  . LYS A 1 41 ? -11.141 11.224  9.609   1.00 0.00 ? 41 LYS A HD3  4  
ATOM 4593  H HE2  . LYS A 1 41 ? -13.810 12.588  9.892   1.00 0.00 ? 41 LYS A HE2  4  
ATOM 4594  H HE3  . LYS A 1 41 ? -13.075 11.362  10.924  1.00 0.00 ? 41 LYS A HE3  4  
ATOM 4595  H HZ1  . LYS A 1 41 ? -13.027 13.556  11.947  1.00 0.00 ? 41 LYS A HZ1  4  
ATOM 4596  H HZ2  . LYS A 1 41 ? -12.127 14.162  10.640  1.00 0.00 ? 41 LYS A HZ2  4  
ATOM 4597  H HZ3  . LYS A 1 41 ? -11.458 12.981  11.661  1.00 0.00 ? 41 LYS A HZ3  4  
ATOM 4598  N N    . SER A 1 42 ? -7.056  14.031  7.789   1.00 0.00 ? 42 SER A N    4  
ATOM 4599  C CA   . SER A 1 42 ? -6.566  14.835  6.631   1.00 0.00 ? 42 SER A CA   4  
ATOM 4600  C C    . SER A 1 42 ? -6.093  13.976  5.454   1.00 0.00 ? 42 SER A C    4  
ATOM 4601  O O    . SER A 1 42 ? -5.915  14.463  4.355   1.00 0.00 ? 42 SER A O    4  
ATOM 4602  C CB   . SER A 1 42 ? -5.460  15.789  7.081   1.00 0.00 ? 42 SER A CB   4  
ATOM 4603  O OG   . SER A 1 42 ? -5.979  16.677  8.063   1.00 0.00 ? 42 SER A OG   4  
ATOM 4604  H H    . SER A 1 42 ? -6.554  14.024  8.631   1.00 0.00 ? 42 SER A H    4  
ATOM 4605  H HA   . SER A 1 42 ? -7.400  15.405  6.250   1.00 0.00 ? 42 SER A HA   4  
ATOM 4606  H HB2  . SER A 1 42 ? -4.646  15.227  7.508   1.00 0.00 ? 42 SER A HB2  4  
ATOM 4607  H HB3  . SER A 1 42 ? -5.100  16.352  6.229   1.00 0.00 ? 42 SER A HB3  4  
ATOM 4608  H HG   . SER A 1 42 ? -5.850  17.575  7.750   1.00 0.00 ? 42 SER A HG   4  
ATOM 4609  N N    . LEU A 1 43 ? -5.915  12.696  5.675   1.00 0.00 ? 43 LEU A N    4  
ATOM 4610  C CA   . LEU A 1 43 ? -5.478  11.776  4.568   1.00 0.00 ? 43 LEU A CA   4  
ATOM 4611  C C    . LEU A 1 43 ? -6.610  10.790  4.271   1.00 0.00 ? 43 LEU A C    4  
ATOM 4612  O O    . LEU A 1 43 ? -6.483  9.944   3.409   1.00 0.00 ? 43 LEU A O    4  
ATOM 4613  C CB   . LEU A 1 43 ? -4.236  10.973  4.981   1.00 0.00 ? 43 LEU A CB   4  
ATOM 4614  C CG   . LEU A 1 43 ? -3.173  11.884  5.594   1.00 0.00 ? 43 LEU A CG   4  
ATOM 4615  C CD1  . LEU A 1 43 ? -1.904  11.077  5.879   1.00 0.00 ? 43 LEU A CD1  4  
ATOM 4616  C CD2  . LEU A 1 43 ? -2.838  13.029  4.632   1.00 0.00 ? 43 LEU A CD2  4  
ATOM 4617  H H    . LEU A 1 43 ? -6.093  12.335  6.571   1.00 0.00 ? 43 LEU A H    4  
ATOM 4618  H HA   . LEU A 1 43 ? -5.259  12.337  3.670   1.00 0.00 ? 43 LEU A HA   4  
ATOM 4619  H HB2  . LEU A 1 43 ? -4.521  10.232  5.708   1.00 0.00 ? 43 LEU A HB2  4  
ATOM 4620  H HB3  . LEU A 1 43 ? -3.825  10.486  4.111   1.00 0.00 ? 43 LEU A HB3  4  
ATOM 4621  H HG   . LEU A 1 43 ? -3.546  12.278  6.515   1.00 0.00 ? 43 LEU A HG   4  
ATOM 4622  H HD11 . LEU A 1 43 ? -1.081  11.753  6.064   1.00 0.00 ? 43 LEU A HD11 4  
ATOM 4623  H HD12 . LEU A 1 43 ? -1.673  10.454  5.029   1.00 0.00 ? 43 LEU A HD12 4  
ATOM 4624  H HD13 . LEU A 1 43 ? -2.061  10.459  6.749   1.00 0.00 ? 43 LEU A HD13 4  
ATOM 4625  H HD21 . LEU A 1 43 ? -1.937  13.523  4.963   1.00 0.00 ? 43 LEU A HD21 4  
ATOM 4626  H HD22 . LEU A 1 43 ? -3.649  13.737  4.613   1.00 0.00 ? 43 LEU A HD22 4  
ATOM 4627  H HD23 . LEU A 1 43 ? -2.683  12.632  3.641   1.00 0.00 ? 43 LEU A HD23 4  
ATOM 4628  N N    . SER A 1 44 ? -7.705  10.878  4.994   1.00 0.00 ? 44 SER A N    4  
ATOM 4629  C CA   . SER A 1 44 ? -8.853  9.936   4.774   1.00 0.00 ? 44 SER A CA   4  
ATOM 4630  C C    . SER A 1 44 ? -9.004  9.622   3.285   1.00 0.00 ? 44 SER A C    4  
ATOM 4631  O O    . SER A 1 44 ? -8.840  8.511   2.828   1.00 0.00 ? 44 SER A O    4  
ATOM 4632  C CB   . SER A 1 44 ? -10.141 10.576  5.292   1.00 0.00 ? 44 SER A CB   4  
ATOM 4633  O OG   . SER A 1 44 ? -11.253 9.786   4.891   1.00 0.00 ? 44 SER A OG   4  
ATOM 4634  H H    . SER A 1 44 ? -7.768  11.557  5.698   1.00 0.00 ? 44 SER A H    4  
ATOM 4635  H HA   . SER A 1 44 ? -8.666  9.017   5.314   1.00 0.00 ? 44 SER A HA   4  
ATOM 4636  H HB2  . SER A 1 44 ? -10.112 10.627  6.367   1.00 0.00 ? 44 SER A HB2  4  
ATOM 4637  H HB3  . SER A 1 44 ? -10.230 11.576  4.889   1.00 0.00 ? 44 SER A HB3  4  
ATOM 4638  H HG   . SER A 1 44 ? -11.372 9.900   3.946   1.00 0.00 ? 44 SER A HG   4  
ATOM 4639  N N    . GLU A 1 45 ? -9.472  10.613  2.579   1.00 0.00 ? 45 GLU A N    4  
ATOM 4640  C CA   . GLU A 1 45 ? -9.853  10.502  1.143   1.00 0.00 ? 45 GLU A CA   4  
ATOM 4641  C C    . GLU A 1 45 ? -8.825  9.942   0.172   1.00 0.00 ? 45 GLU A C    4  
ATOM 4642  O O    . GLU A 1 45 ? -9.087  9.013   -0.566  1.00 0.00 ? 45 GLU A O    4  
ATOM 4643  C CB   . GLU A 1 45 ? -10.179 11.912  0.655   1.00 0.00 ? 45 GLU A CB   4  
ATOM 4644  C CG   . GLU A 1 45 ? -11.304 12.510  1.504   1.00 0.00 ? 45 GLU A CG   4  
ATOM 4645  C CD   . GLU A 1 45 ? -11.652 13.904  0.979   1.00 0.00 ? 45 GLU A CD   4  
ATOM 4646  O OE1  . GLU A 1 45 ? -12.275 13.985  -0.067  1.00 0.00 ? 45 GLU A OE1  4  
ATOM 4647  O OE2  . GLU A 1 45 ? -11.288 14.868  1.633   1.00 0.00 ? 45 GLU A OE2  4  
ATOM 4648  H H    . GLU A 1 45 ? -9.675  11.470  3.007   1.00 0.00 ? 45 GLU A H    4  
ATOM 4649  H HA   . GLU A 1 45 ? -10.751 9.916   1.070   1.00 0.00 ? 45 GLU A HA   4  
ATOM 4650  H HB2  . GLU A 1 45 ? -9.292  12.533  0.739   1.00 0.00 ? 45 GLU A HB2  4  
ATOM 4651  H HB3  . GLU A 1 45 ? -10.490 11.873  -0.378  1.00 0.00 ? 45 GLU A HB3  4  
ATOM 4652  H HG2  . GLU A 1 45 ? -12.176 11.874  1.445   1.00 0.00 ? 45 GLU A HG2  4  
ATOM 4653  H HG3  . GLU A 1 45 ? -10.982 12.586  2.531   1.00 0.00 ? 45 GLU A HG3  4  
ATOM 4654  N N    . GLU A 1 46 ? -7.657  10.498  0.170   1.00 0.00 ? 46 GLU A N    4  
ATOM 4655  C CA   . GLU A 1 46 ? -6.603  10.005  -0.744  1.00 0.00 ? 46 GLU A CA   4  
ATOM 4656  C C    . GLU A 1 46 ? -6.389  8.511   -0.514  1.00 0.00 ? 46 GLU A C    4  
ATOM 4657  O O    . GLU A 1 46 ? -5.907  7.810   -1.374  1.00 0.00 ? 46 GLU A O    4  
ATOM 4658  C CB   . GLU A 1 46 ? -5.303  10.773  -0.475  1.00 0.00 ? 46 GLU A CB   4  
ATOM 4659  C CG   . GLU A 1 46 ? -5.619  12.239  -0.144  1.00 0.00 ? 46 GLU A CG   4  
ATOM 4660  C CD   . GLU A 1 46 ? -6.577  12.817  -1.189  1.00 0.00 ? 46 GLU A CD   4  
ATOM 4661  O OE1  . GLU A 1 46 ? -7.767  12.578  -1.069  1.00 0.00 ? 46 GLU A OE1  4  
ATOM 4662  O OE2  . GLU A 1 46 ? -6.104  13.490  -2.090  1.00 0.00 ? 46 GLU A OE2  4  
ATOM 4663  H H    . GLU A 1 46 ? -7.469  11.250  0.768   1.00 0.00 ? 46 GLU A H    4  
ATOM 4664  H HA   . GLU A 1 46 ? -6.907  10.153  -1.766  1.00 0.00 ? 46 GLU A HA   4  
ATOM 4665  H HB2  . GLU A 1 46 ? -4.784  10.322  0.357   1.00 0.00 ? 46 GLU A HB2  4  
ATOM 4666  H HB3  . GLU A 1 46 ? -4.678  10.734  -1.350  1.00 0.00 ? 46 GLU A HB3  4  
ATOM 4667  H HG2  . GLU A 1 46 ? -6.070  12.301  0.834   1.00 0.00 ? 46 GLU A HG2  4  
ATOM 4668  H HG3  . GLU A 1 46 ? -4.704  12.809  -0.149  1.00 0.00 ? 46 GLU A HG3  4  
ATOM 4669  N N    . CYS A 1 47 ? -6.758  8.010   0.630   1.00 0.00 ? 47 CYS A N    4  
ATOM 4670  C CA   . CYS A 1 47 ? -6.581  6.558   0.881   1.00 0.00 ? 47 CYS A CA   4  
ATOM 4671  C C    . CYS A 1 47 ? -7.734  5.815   0.210   1.00 0.00 ? 47 CYS A C    4  
ATOM 4672  O O    . CYS A 1 47 ? -7.549  4.791   -0.418  1.00 0.00 ? 47 CYS A O    4  
ATOM 4673  C CB   . CYS A 1 47 ? -6.587  6.308   2.404   1.00 0.00 ? 47 CYS A CB   4  
ATOM 4674  S SG   . CYS A 1 47 ? -8.255  5.895   2.985   1.00 0.00 ? 47 CYS A SG   4  
ATOM 4675  H H    . CYS A 1 47 ? -7.164  8.584   1.314   1.00 0.00 ? 47 CYS A H    4  
ATOM 4676  H HA   . CYS A 1 47 ? -5.648  6.226   0.452   1.00 0.00 ? 47 CYS A HA   4  
ATOM 4677  H HB2  . CYS A 1 47 ? -5.919  5.494   2.639   1.00 0.00 ? 47 CYS A HB2  4  
ATOM 4678  H HB3  . CYS A 1 47 ? -6.252  7.204   2.911   1.00 0.00 ? 47 CYS A HB3  4  
ATOM 4679  N N    . GLN A 1 48 ? -8.923  6.321   0.342   1.00 0.00 ? 48 GLN A N    4  
ATOM 4680  C CA   . GLN A 1 48 ? -10.083 5.638   -0.285  1.00 0.00 ? 48 GLN A CA   4  
ATOM 4681  C C    . GLN A 1 48 ? -9.794  5.412   -1.767  1.00 0.00 ? 48 GLN A C    4  
ATOM 4682  O O    . GLN A 1 48 ? -10.086 4.369   -2.316  1.00 0.00 ? 48 GLN A O    4  
ATOM 4683  C CB   . GLN A 1 48 ? -11.338 6.499   -0.130  1.00 0.00 ? 48 GLN A CB   4  
ATOM 4684  C CG   . GLN A 1 48 ? -12.545 5.746   -0.691  1.00 0.00 ? 48 GLN A CG   4  
ATOM 4685  C CD   . GLN A 1 48 ? -13.819 6.553   -0.434  1.00 0.00 ? 48 GLN A CD   4  
ATOM 4686  O OE1  . GLN A 1 48 ? -13.755 7.713   -0.080  1.00 0.00 ? 48 GLN A OE1  4  
ATOM 4687  N NE2  . GLN A 1 48 ? -14.982 5.984   -0.597  1.00 0.00 ? 48 GLN A NE2  4  
ATOM 4688  H H    . GLN A 1 48 ? -9.051  7.142   0.863   1.00 0.00 ? 48 GLN A H    4  
ATOM 4689  H HA   . GLN A 1 48 ? -10.237 4.681   0.196   1.00 0.00 ? 48 GLN A HA   4  
ATOM 4690  H HB2  . GLN A 1 48 ? -11.501 6.713   0.917   1.00 0.00 ? 48 GLN A HB2  4  
ATOM 4691  H HB3  . GLN A 1 48 ? -11.210 7.424   -0.671  1.00 0.00 ? 48 GLN A HB3  4  
ATOM 4692  H HG2  . GLN A 1 48 ? -12.417 5.603   -1.755  1.00 0.00 ? 48 GLN A HG2  4  
ATOM 4693  H HG3  . GLN A 1 48 ? -12.627 4.784   -0.207  1.00 0.00 ? 48 GLN A HG3  4  
ATOM 4694  H HE21 . GLN A 1 48 ? -15.033 5.049   -0.884  1.00 0.00 ? 48 GLN A HE21 4  
ATOM 4695  H HE22 . GLN A 1 48 ? -15.803 6.494   -0.436  1.00 0.00 ? 48 GLN A HE22 4  
ATOM 4696  N N    . GLU A 1 49 ? -9.236  6.392   -2.426  1.00 0.00 ? 49 GLU A N    4  
ATOM 4697  C CA   . GLU A 1 49 ? -8.945  6.242   -3.876  1.00 0.00 ? 49 GLU A CA   4  
ATOM 4698  C C    . GLU A 1 49 ? -7.827  5.217   -4.092  1.00 0.00 ? 49 GLU A C    4  
ATOM 4699  O O    . GLU A 1 49 ? -7.883  4.411   -4.999  1.00 0.00 ? 49 GLU A O    4  
ATOM 4700  C CB   . GLU A 1 49 ? -8.516  7.595   -4.450  1.00 0.00 ? 49 GLU A CB   4  
ATOM 4701  C CG   . GLU A 1 49 ? -9.734  8.515   -4.554  1.00 0.00 ? 49 GLU A CG   4  
ATOM 4702  C CD   . GLU A 1 49 ? -9.276  9.923   -4.939  1.00 0.00 ? 49 GLU A CD   4  
ATOM 4703  O OE1  . GLU A 1 49 ? -8.396  10.031  -5.776  1.00 0.00 ? 49 GLU A OE1  4  
ATOM 4704  O OE2  . GLU A 1 49 ? -9.816  10.870  -4.391  1.00 0.00 ? 49 GLU A OE2  4  
ATOM 4705  H H    . GLU A 1 49 ? -9.018  7.235   -1.976  1.00 0.00 ? 49 GLU A H    4  
ATOM 4706  H HA   . GLU A 1 49 ? -9.839  5.911   -4.380  1.00 0.00 ? 49 GLU A HA   4  
ATOM 4707  H HB2  . GLU A 1 49 ? -7.780  8.044   -3.800  1.00 0.00 ? 49 GLU A HB2  4  
ATOM 4708  H HB3  . GLU A 1 49 ? -8.090  7.451   -5.431  1.00 0.00 ? 49 GLU A HB3  4  
ATOM 4709  H HG2  . GLU A 1 49 ? -10.408 8.135   -5.308  1.00 0.00 ? 49 GLU A HG2  4  
ATOM 4710  H HG3  . GLU A 1 49 ? -10.240 8.551   -3.602  1.00 0.00 ? 49 GLU A HG3  4  
ATOM 4711  N N    . VAL A 1 50 ? -6.814  5.230   -3.260  1.00 0.00 ? 50 VAL A N    4  
ATOM 4712  C CA   . VAL A 1 50 ? -5.714  4.242   -3.429  1.00 0.00 ? 50 VAL A CA   4  
ATOM 4713  C C    . VAL A 1 50 ? -6.238  2.853   -3.088  1.00 0.00 ? 50 VAL A C    4  
ATOM 4714  O O    . VAL A 1 50 ? -6.083  1.917   -3.847  1.00 0.00 ? 50 VAL A O    4  
ATOM 4715  C CB   . VAL A 1 50 ? -4.537  4.566   -2.497  1.00 0.00 ? 50 VAL A CB   4  
ATOM 4716  C CG1  . VAL A 1 50 ? -3.399  3.567   -2.745  1.00 0.00 ? 50 VAL A CG1  4  
ATOM 4717  C CG2  . VAL A 1 50 ? -4.032  5.996   -2.763  1.00 0.00 ? 50 VAL A CG2  4  
ATOM 4718  H H    . VAL A 1 50 ? -6.786  5.876   -2.529  1.00 0.00 ? 50 VAL A H    4  
ATOM 4719  H HA   . VAL A 1 50 ? -5.374  4.270   -4.447  1.00 0.00 ? 50 VAL A HA   4  
ATOM 4720  H HB   . VAL A 1 50 ? -4.856  4.472   -1.471  1.00 0.00 ? 50 VAL A HB   4  
ATOM 4721  H HG11 . VAL A 1 50 ? -3.125  3.587   -3.788  1.00 0.00 ? 50 VAL A HG11 4  
ATOM 4722  H HG12 . VAL A 1 50 ? -3.724  2.574   -2.474  1.00 0.00 ? 50 VAL A HG12 4  
ATOM 4723  H HG13 . VAL A 1 50 ? -2.544  3.840   -2.144  1.00 0.00 ? 50 VAL A HG13 4  
ATOM 4724  H HG21 . VAL A 1 50 ? -3.575  6.388   -1.867  1.00 0.00 ? 50 VAL A HG21 4  
ATOM 4725  H HG22 . VAL A 1 50 ? -4.857  6.626   -3.050  1.00 0.00 ? 50 VAL A HG22 4  
ATOM 4726  H HG23 . VAL A 1 50 ? -3.303  5.984   -3.561  1.00 0.00 ? 50 VAL A HG23 4  
ATOM 4727  N N    . VAL A 1 51 ? -6.831  2.697   -1.932  1.00 0.00 ? 51 VAL A N    4  
ATOM 4728  C CA   . VAL A 1 51 ? -7.325  1.355   -1.532  1.00 0.00 ? 51 VAL A CA   4  
ATOM 4729  C C    . VAL A 1 51 ? -8.365  0.856   -2.543  1.00 0.00 ? 51 VAL A C    4  
ATOM 4730  O O    . VAL A 1 51 ? -8.289  -0.247  -3.044  1.00 0.00 ? 51 VAL A O    4  
ATOM 4731  C CB   . VAL A 1 51 ? -7.882  1.422   -0.103  1.00 0.00 ? 51 VAL A CB   4  
ATOM 4732  C CG1  . VAL A 1 51 ? -8.290  0.032   0.370   1.00 0.00 ? 51 VAL A CG1  4  
ATOM 4733  C CG2  . VAL A 1 51 ? -6.804  1.976   0.838   1.00 0.00 ? 51 VAL A CG2  4  
ATOM 4734  H H    . VAL A 1 51 ? -6.921  3.447   -1.308  1.00 0.00 ? 51 VAL A H    4  
ATOM 4735  H HA   . VAL A 1 51 ? -6.492  0.676   -1.589  1.00 0.00 ? 51 VAL A HA   4  
ATOM 4736  H HB   . VAL A 1 51 ? -8.739  2.073   -0.084  1.00 0.00 ? 51 VAL A HB   4  
ATOM 4737  H HG11 . VAL A 1 51 ? -8.551  0.075   1.417   1.00 0.00 ? 51 VAL A HG11 4  
ATOM 4738  H HG12 . VAL A 1 51 ? -7.466  -0.649  0.231   1.00 0.00 ? 51 VAL A HG12 4  
ATOM 4739  H HG13 . VAL A 1 51 ? -9.141  -0.303  -0.200  1.00 0.00 ? 51 VAL A HG13 4  
ATOM 4740  H HG21 . VAL A 1 51 ? -5.993  1.269   0.912   1.00 0.00 ? 51 VAL A HG21 4  
ATOM 4741  H HG22 . VAL A 1 51 ? -7.228  2.138   1.820   1.00 0.00 ? 51 VAL A HG22 4  
ATOM 4742  H HG23 . VAL A 1 51 ? -6.433  2.912   0.450   1.00 0.00 ? 51 VAL A HG23 4  
ATOM 4743  N N    . ASP A 1 52 ? -9.373  1.653   -2.790  1.00 0.00 ? 52 ASP A N    4  
ATOM 4744  C CA   . ASP A 1 52 ? -10.480 1.238   -3.706  1.00 0.00 ? 52 ASP A CA   4  
ATOM 4745  C C    . ASP A 1 52 ? -9.996  0.996   -5.137  1.00 0.00 ? 52 ASP A C    4  
ATOM 4746  O O    . ASP A 1 52 ? -10.417 0.063   -5.792  1.00 0.00 ? 52 ASP A O    4  
ATOM 4747  C CB   . ASP A 1 52 ? -11.544 2.340   -3.721  1.00 0.00 ? 52 ASP A CB   4  
ATOM 4748  C CG   . ASP A 1 52 ? -12.041 2.592   -2.296  1.00 0.00 ? 52 ASP A CG   4  
ATOM 4749  O OD1  . ASP A 1 52 ? -11.237 2.491   -1.383  1.00 0.00 ? 52 ASP A OD1  4  
ATOM 4750  O OD2  . ASP A 1 52 ? -13.215 2.882   -2.141  1.00 0.00 ? 52 ASP A OD2  4  
ATOM 4751  H H    . ASP A 1 52 ? -9.425  2.522   -2.342  1.00 0.00 ? 52 ASP A H    4  
ATOM 4752  H HA   . ASP A 1 52 ? -10.934 0.338   -3.318  1.00 0.00 ? 52 ASP A HA   4  
ATOM 4753  H HB2  . ASP A 1 52 ? -11.120 3.250   -4.119  1.00 0.00 ? 52 ASP A HB2  4  
ATOM 4754  H HB3  . ASP A 1 52 ? -12.374 2.029   -4.338  1.00 0.00 ? 52 ASP A HB3  4  
ATOM 4755  N N    . THR A 1 53 ? -9.138  1.838   -5.641  1.00 0.00 ? 53 THR A N    4  
ATOM 4756  C CA   . THR A 1 53 ? -8.656  1.670   -7.042  1.00 0.00 ? 53 THR A CA   4  
ATOM 4757  C C    . THR A 1 53 ? -7.433  0.760   -7.091  1.00 0.00 ? 53 THR A C    4  
ATOM 4758  O O    . THR A 1 53 ? -7.293  -0.027  -8.006  1.00 0.00 ? 53 THR A O    4  
ATOM 4759  C CB   . THR A 1 53 ? -8.296  3.042   -7.617  1.00 0.00 ? 53 THR A CB   4  
ATOM 4760  O OG1  . THR A 1 53 ? -9.397  3.925   -7.449  1.00 0.00 ? 53 THR A OG1  4  
ATOM 4761  C CG2  . THR A 1 53 ? -7.970  2.907   -9.106  1.00 0.00 ? 53 THR A CG2  4  
ATOM 4762  H H    . THR A 1 53 ? -8.821  2.595   -5.104  1.00 0.00 ? 53 THR A H    4  
ATOM 4763  H HA   . THR A 1 53 ? -9.427  1.231   -7.650  1.00 0.00 ? 53 THR A HA   4  
ATOM 4764  H HB   . THR A 1 53 ? -7.438  3.437   -7.099  1.00 0.00 ? 53 THR A HB   4  
ATOM 4765  H HG1  . THR A 1 53 ? -10.017 3.514   -6.842  1.00 0.00 ? 53 THR A HG1  4  
ATOM 4766  H HG21 . THR A 1 53 ? -8.836  2.533   -9.631  1.00 0.00 ? 53 THR A HG21 4  
ATOM 4767  H HG22 . THR A 1 53 ? -7.146  2.221   -9.234  1.00 0.00 ? 53 THR A HG22 4  
ATOM 4768  H HG23 . THR A 1 53 ? -7.698  3.874   -9.503  1.00 0.00 ? 53 THR A HG23 4  
ATOM 4769  N N    . TYR A 1 54 ? -6.533  0.867   -6.146  1.00 0.00 ? 54 TYR A N    4  
ATOM 4770  C CA   . TYR A 1 54 ? -5.301  0.011   -6.185  1.00 0.00 ? 54 TYR A CA   4  
ATOM 4771  C C    . TYR A 1 54 ? -5.299  -1.046  -5.076  1.00 0.00 ? 54 TYR A C    4  
ATOM 4772  O O    . TYR A 1 54 ? -4.267  -1.421  -4.561  1.00 0.00 ? 54 TYR A O    4  
ATOM 4773  C CB   . TYR A 1 54 ? -4.072  0.896   -6.045  1.00 0.00 ? 54 TYR A CB   4  
ATOM 4774  C CG   . TYR A 1 54 ? -3.943  1.780   -7.263  1.00 0.00 ? 54 TYR A CG   4  
ATOM 4775  C CD1  . TYR A 1 54 ? -4.607  3.006   -7.300  1.00 0.00 ? 54 TYR A CD1  4  
ATOM 4776  C CD2  . TYR A 1 54 ? -3.160  1.376   -8.351  1.00 0.00 ? 54 TYR A CD2  4  
ATOM 4777  C CE1  . TYR A 1 54 ? -4.494  3.836   -8.417  1.00 0.00 ? 54 TYR A CE1  4  
ATOM 4778  C CE2  . TYR A 1 54 ? -3.042  2.207   -9.473  1.00 0.00 ? 54 TYR A CE2  4  
ATOM 4779  C CZ   . TYR A 1 54 ? -3.711  3.438   -9.506  1.00 0.00 ? 54 TYR A CZ   4  
ATOM 4780  O OH   . TYR A 1 54 ? -3.596  4.257   -10.611 1.00 0.00 ? 54 TYR A OH   4  
ATOM 4781  H H    . TYR A 1 54 ? -6.652  1.522   -5.427  1.00 0.00 ? 54 TYR A H    4  
ATOM 4782  H HA   . TYR A 1 54 ? -5.242  -0.510  -7.132  1.00 0.00 ? 54 TYR A HA   4  
ATOM 4783  H HB2  . TYR A 1 54 ? -4.178  1.507   -5.167  1.00 0.00 ? 54 TYR A HB2  4  
ATOM 4784  H HB3  . TYR A 1 54 ? -3.192  0.279   -5.953  1.00 0.00 ? 54 TYR A HB3  4  
ATOM 4785  H HD1  . TYR A 1 54 ? -5.209  3.311   -6.468  1.00 0.00 ? 54 TYR A HD1  4  
ATOM 4786  H HD2  . TYR A 1 54 ? -2.646  0.427   -8.325  1.00 0.00 ? 54 TYR A HD2  4  
ATOM 4787  H HE1  . TYR A 1 54 ? -5.010  4.786   -8.434  1.00 0.00 ? 54 TYR A HE1  4  
ATOM 4788  H HE2  . TYR A 1 54 ? -2.439  1.897   -10.313 1.00 0.00 ? 54 TYR A HE2  4  
ATOM 4789  H HH   . TYR A 1 54 ? -4.480  4.514   -10.883 1.00 0.00 ? 54 TYR A HH   4  
ATOM 4790  N N    . GLY A 1 55 ? -6.458  -1.494  -4.674  1.00 0.00 ? 55 GLY A N    4  
ATOM 4791  C CA   . GLY A 1 55 ? -6.541  -2.486  -3.565  1.00 0.00 ? 55 GLY A CA   4  
ATOM 4792  C C    . GLY A 1 55 ? -6.249  -3.903  -4.055  1.00 0.00 ? 55 GLY A C    4  
ATOM 4793  O O    . GLY A 1 55 ? -5.381  -4.572  -3.533  1.00 0.00 ? 55 GLY A O    4  
ATOM 4794  H H    . GLY A 1 55 ? -7.278  -1.168  -5.094  1.00 0.00 ? 55 GLY A H    4  
ATOM 4795  H HA2  . GLY A 1 55 ? -5.819  -2.224  -2.806  1.00 0.00 ? 55 GLY A HA2  4  
ATOM 4796  H HA3  . GLY A 1 55 ? -7.530  -2.459  -3.136  1.00 0.00 ? 55 GLY A HA3  4  
ATOM 4797  N N    . SER A 1 56 ? -6.971  -4.389  -5.030  1.00 0.00 ? 56 SER A N    4  
ATOM 4798  C CA   . SER A 1 56 ? -6.706  -5.778  -5.484  1.00 0.00 ? 56 SER A CA   4  
ATOM 4799  C C    . SER A 1 56 ? -5.322  -5.854  -6.105  1.00 0.00 ? 56 SER A C    4  
ATOM 4800  O O    . SER A 1 56 ? -4.693  -6.893  -6.134  1.00 0.00 ? 56 SER A O    4  
ATOM 4801  C CB   . SER A 1 56 ? -7.743  -6.212  -6.518  1.00 0.00 ? 56 SER A CB   4  
ATOM 4802  O OG   . SER A 1 56 ? -9.013  -5.673  -6.173  1.00 0.00 ? 56 SER A OG   4  
ATOM 4803  H H    . SER A 1 56 ? -7.685  -3.860  -5.444  1.00 0.00 ? 56 SER A H    4  
ATOM 4804  H HA   . SER A 1 56 ? -6.761  -6.424  -4.624  1.00 0.00 ? 56 SER A HA   4  
ATOM 4805  H HB2  . SER A 1 56 ? -7.455  -5.854  -7.496  1.00 0.00 ? 56 SER A HB2  4  
ATOM 4806  H HB3  . SER A 1 56 ? -7.789  -7.294  -6.534  1.00 0.00 ? 56 SER A HB3  4  
ATOM 4807  H HG   . SER A 1 56 ? -8.881  -5.031  -5.472  1.00 0.00 ? 56 SER A HG   4  
ATOM 4808  N N    . SER A 1 57 ? -4.874  -4.765  -6.673  1.00 0.00 ? 57 SER A N    4  
ATOM 4809  C CA   . SER A 1 57 ? -3.565  -4.795  -7.373  1.00 0.00 ? 57 SER A CA   4  
ATOM 4810  C C    . SER A 1 57 ? -2.401  -4.794  -6.384  1.00 0.00 ? 57 SER A C    4  
ATOM 4811  O O    . SER A 1 57 ? -1.505  -5.605  -6.477  1.00 0.00 ? 57 SER A O    4  
ATOM 4812  C CB   . SER A 1 57 ? -3.448  -3.625  -8.348  1.00 0.00 ? 57 SER A CB   4  
ATOM 4813  O OG   . SER A 1 57 ? -3.526  -2.403  -7.627  1.00 0.00 ? 57 SER A OG   4  
ATOM 4814  H H    . SER A 1 57 ? -5.419  -3.951  -6.661  1.00 0.00 ? 57 SER A H    4  
ATOM 4815  H HA   . SER A 1 57 ? -3.521  -5.731  -7.909  1.00 0.00 ? 57 SER A HA   4  
ATOM 4816  H HB2  . SER A 1 57 ? -2.501  -3.674  -8.860  1.00 0.00 ? 57 SER A HB2  4  
ATOM 4817  H HB3  . SER A 1 57 ? -4.250  -3.679  -9.073  1.00 0.00 ? 57 SER A HB3  4  
ATOM 4818  H HG   . SER A 1 57 ? -4.339  -2.410  -7.116  1.00 0.00 ? 57 SER A HG   4  
ATOM 4819  N N    . ILE A 1 58 ? -2.433  -3.927  -5.403  1.00 0.00 ? 58 ILE A N    4  
ATOM 4820  C CA   . ILE A 1 58 ? -1.349  -3.918  -4.381  1.00 0.00 ? 58 ILE A CA   4  
ATOM 4821  C C    . ILE A 1 58 ? -1.297  -5.298  -3.739  1.00 0.00 ? 58 ILE A C    4  
ATOM 4822  O O    . ILE A 1 58 ? -0.286  -5.972  -3.707  1.00 0.00 ? 58 ILE A O    4  
ATOM 4823  C CB   . ILE A 1 58 ? -1.667  -2.877  -3.288  1.00 0.00 ? 58 ILE A CB   4  
ATOM 4824  C CG1  . ILE A 1 58 ? -1.410  -1.463  -3.830  1.00 0.00 ? 58 ILE A CG1  4  
ATOM 4825  C CG2  . ILE A 1 58 ? -0.778  -3.128  -2.051  1.00 0.00 ? 58 ILE A CG2  4  
ATOM 4826  C CD1  . ILE A 1 58 ? -1.885  -0.414  -2.813  1.00 0.00 ? 58 ILE A CD1  4  
ATOM 4827  H H    . ILE A 1 58 ? -3.190  -3.314  -5.305  1.00 0.00 ? 58 ILE A H    4  
ATOM 4828  H HA   . ILE A 1 58 ? -0.392  -3.691  -4.829  1.00 0.00 ? 58 ILE A HA   4  
ATOM 4829  H HB   . ILE A 1 58 ? -2.705  -2.971  -3.003  1.00 0.00 ? 58 ILE A HB   4  
ATOM 4830  H HG12 . ILE A 1 58 ? -0.353  -1.335  -4.006  1.00 0.00 ? 58 ILE A HG12 4  
ATOM 4831  H HG13 . ILE A 1 58 ? -1.944  -1.330  -4.758  1.00 0.00 ? 58 ILE A HG13 4  
ATOM 4832  H HG21 . ILE A 1 58 ? 0.217   -3.399  -2.372  1.00 0.00 ? 58 ILE A HG21 4  
ATOM 4833  H HG22 . ILE A 1 58 ? -1.197  -3.935  -1.470  1.00 0.00 ? 58 ILE A HG22 4  
ATOM 4834  H HG23 . ILE A 1 58 ? -0.727  -2.240  -1.439  1.00 0.00 ? 58 ILE A HG23 4  
ATOM 4835  H HD11 . ILE A 1 58 ? -1.128  -0.296  -2.050  1.00 0.00 ? 58 ILE A HD11 4  
ATOM 4836  H HD12 . ILE A 1 58 ? -2.809  -0.737  -2.355  1.00 0.00 ? 58 ILE A HD12 4  
ATOM 4837  H HD13 . ILE A 1 58 ? -2.047  0.531   -3.310  1.00 0.00 ? 58 ILE A HD13 4  
ATOM 4838  N N    . LEU A 1 59 ? -2.420  -5.690  -3.217  1.00 0.00 ? 59 LEU A N    4  
ATOM 4839  C CA   . LEU A 1 59 ? -2.548  -6.998  -2.539  1.00 0.00 ? 59 LEU A CA   4  
ATOM 4840  C C    . LEU A 1 59 ? -2.198  -8.114  -3.519  1.00 0.00 ? 59 LEU A C    4  
ATOM 4841  O O    . LEU A 1 59 ? -1.813  -9.186  -3.109  1.00 0.00 ? 59 LEU A O    4  
ATOM 4842  C CB   . LEU A 1 59 ? -3.997  -7.141  -2.049  1.00 0.00 ? 59 LEU A CB   4  
ATOM 4843  C CG   . LEU A 1 59 ? -4.250  -8.545  -1.480  1.00 0.00 ? 59 LEU A CG   4  
ATOM 4844  C CD1  . LEU A 1 59 ? -3.213  -8.863  -0.393  1.00 0.00 ? 59 LEU A CD1  4  
ATOM 4845  C CD2  . LEU A 1 59 ? -5.670  -8.613  -0.875  1.00 0.00 ? 59 LEU A CD2  4  
ATOM 4846  H H    . LEU A 1 59 ? -3.199  -5.098  -3.284  1.00 0.00 ? 59 LEU A H    4  
ATOM 4847  H HA   . LEU A 1 59 ? -1.873  -7.036  -1.699  1.00 0.00 ? 59 LEU A HA   4  
ATOM 4848  H HB2  . LEU A 1 59 ? -4.180  -6.406  -1.279  1.00 0.00 ? 59 LEU A HB2  4  
ATOM 4849  H HB3  . LEU A 1 59 ? -4.670  -6.965  -2.875  1.00 0.00 ? 59 LEU A HB3  4  
ATOM 4850  H HG   . LEU A 1 59 ? -4.171  -9.268  -2.281  1.00 0.00 ? 59 LEU A HG   4  
ATOM 4851  H HD11 . LEU A 1 59 ? -2.287  -9.164  -0.851  1.00 0.00 ? 59 LEU A HD11 4  
ATOM 4852  H HD12 . LEU A 1 59 ? -3.578  -9.666  0.229   1.00 0.00 ? 59 LEU A HD12 4  
ATOM 4853  H HD13 . LEU A 1 59 ? -3.046  -7.985  0.215   1.00 0.00 ? 59 LEU A HD13 4  
ATOM 4854  H HD21 . LEU A 1 59 ? -6.376  -8.879  -1.647  1.00 0.00 ? 59 LEU A HD21 4  
ATOM 4855  H HD22 . LEU A 1 59 ? -5.941  -7.656  -0.455  1.00 0.00 ? 59 LEU A HD22 4  
ATOM 4856  H HD23 . LEU A 1 59 ? -5.700  -9.359  -0.095  1.00 0.00 ? 59 LEU A HD23 4  
ATOM 4857  N N    . SER A 1 60 ? -2.338  -7.921  -4.805  1.00 0.00 ? 60 SER A N    4  
ATOM 4858  C CA   . SER A 1 60 ? -2.013  -9.054  -5.725  1.00 0.00 ? 60 SER A CA   4  
ATOM 4859  C C    . SER A 1 60 ? -0.498  -9.125  -5.946  1.00 0.00 ? 60 SER A C    4  
ATOM 4860  O O    . SER A 1 60 ? 0.075   -10.186 -6.096  1.00 0.00 ? 60 SER A O    4  
ATOM 4861  C CB   . SER A 1 60 ? -2.722  -8.848  -7.057  1.00 0.00 ? 60 SER A CB   4  
ATOM 4862  O OG   . SER A 1 60 ? -2.142  -9.698  -8.038  1.00 0.00 ? 60 SER A OG   4  
ATOM 4863  H H    . SER A 1 60 ? -2.665  -7.065  -5.155  1.00 0.00 ? 60 SER A H    4  
ATOM 4864  H HA   . SER A 1 60 ? -2.394  -9.939  -5.237  1.00 0.00 ? 60 SER A HA   4  
ATOM 4865  H HB2  . SER A 1 60 ? -3.765  -9.087  -6.950  1.00 0.00 ? 60 SER A HB2  4  
ATOM 4866  H HB3  . SER A 1 60 ? -2.619  -7.813  -7.355  1.00 0.00 ? 60 SER A HB3  4  
ATOM 4867  H HG   . SER A 1 60 ? -2.208  -10.602 -7.722  1.00 0.00 ? 60 SER A HG   4  
ATOM 4868  N N    . ILE A 1 61 ? 0.151   -7.987  -5.969  1.00 0.00 ? 61 ILE A N    4  
ATOM 4869  C CA   . ILE A 1 61 ? 1.629   -7.954  -6.181  1.00 0.00 ? 61 ILE A CA   4  
ATOM 4870  C C    . ILE A 1 61 ? 2.343   -8.547  -4.963  1.00 0.00 ? 61 ILE A C    4  
ATOM 4871  O O    . ILE A 1 61 ? 3.239   -9.359  -5.085  1.00 0.00 ? 61 ILE A O    4  
ATOM 4872  C CB   . ILE A 1 61 ? 2.093   -6.495  -6.363  1.00 0.00 ? 61 ILE A CB   4  
ATOM 4873  C CG1  . ILE A 1 61 ? 1.149   -5.738  -7.360  1.00 0.00 ? 61 ILE A CG1  4  
ATOM 4874  C CG2  . ILE A 1 61 ? 3.551   -6.499  -6.843  1.00 0.00 ? 61 ILE A CG2  4  
ATOM 4875  C CD1  . ILE A 1 61 ? 1.920   -5.122  -8.538  1.00 0.00 ? 61 ILE A CD1  4  
ATOM 4876  H H    . ILE A 1 61 ? -0.340  -7.146  -5.852  1.00 0.00 ? 61 ILE A H    4  
ATOM 4877  H HA   . ILE A 1 61 ? 1.883   -8.524  -7.062  1.00 0.00 ? 61 ILE A HA   4  
ATOM 4878  H HB   . ILE A 1 61 ? 2.060   -6.004  -5.399  1.00 0.00 ? 61 ILE A HB   4  
ATOM 4879  H HG12 . ILE A 1 61 ? 0.402   -6.414  -7.751  1.00 0.00 ? 61 ILE A HG12 4  
ATOM 4880  H HG13 . ILE A 1 61 ? 0.650   -4.939  -6.829  1.00 0.00 ? 61 ILE A HG13 4  
ATOM 4881  H HG21 . ILE A 1 61 ? 3.913   -5.483  -6.906  1.00 0.00 ? 61 ILE A HG21 4  
ATOM 4882  H HG22 . ILE A 1 61 ? 3.612   -6.966  -7.815  1.00 0.00 ? 61 ILE A HG22 4  
ATOM 4883  H HG23 . ILE A 1 61 ? 4.155   -7.051  -6.141  1.00 0.00 ? 61 ILE A HG23 4  
ATOM 4884  H HD11 . ILE A 1 61 ? 2.651   -4.422  -8.162  1.00 0.00 ? 61 ILE A HD11 4  
ATOM 4885  H HD12 . ILE A 1 61 ? 1.229   -4.605  -9.185  1.00 0.00 ? 61 ILE A HD12 4  
ATOM 4886  H HD13 . ILE A 1 61 ? 2.418   -5.901  -9.096  1.00 0.00 ? 61 ILE A HD13 4  
ATOM 4887  N N    . LEU A 1 62 ? 1.961   -8.124  -3.789  1.00 0.00 ? 62 LEU A N    4  
ATOM 4888  C CA   . LEU A 1 62 ? 2.617   -8.629  -2.550  1.00 0.00 ? 62 LEU A CA   4  
ATOM 4889  C C    . LEU A 1 62 ? 2.679   -10.160 -2.576  1.00 0.00 ? 62 LEU A C    4  
ATOM 4890  O O    . LEU A 1 62 ? 3.601   -10.763 -2.063  1.00 0.00 ? 62 LEU A O    4  
ATOM 4891  C CB   . LEU A 1 62 ? 1.791   -8.168  -1.337  1.00 0.00 ? 62 LEU A CB   4  
ATOM 4892  C CG   . LEU A 1 62 ? 2.185   -6.722  -0.928  1.00 0.00 ? 62 LEU A CG   4  
ATOM 4893  C CD1  . LEU A 1 62 ? 0.935   -5.931  -0.527  1.00 0.00 ? 62 LEU A CD1  4  
ATOM 4894  C CD2  . LEU A 1 62 ? 3.154   -6.760  0.260   1.00 0.00 ? 62 LEU A CD2  4  
ATOM 4895  H H    . LEU A 1 62 ? 1.246   -7.457  -3.718  1.00 0.00 ? 62 LEU A H    4  
ATOM 4896  H HA   . LEU A 1 62 ? 3.613   -8.211  -2.493  1.00 0.00 ? 62 LEU A HA   4  
ATOM 4897  H HB2  . LEU A 1 62 ? 0.741   -8.199  -1.603  1.00 0.00 ? 62 LEU A HB2  4  
ATOM 4898  H HB3  . LEU A 1 62 ? 1.959   -8.842  -0.507  1.00 0.00 ? 62 LEU A HB3  4  
ATOM 4899  H HG   . LEU A 1 62 ? 2.660   -6.218  -1.762  1.00 0.00 ? 62 LEU A HG   4  
ATOM 4900  H HD11 . LEU A 1 62 ? 0.295   -6.561  0.065   1.00 0.00 ? 62 LEU A HD11 4  
ATOM 4901  H HD12 . LEU A 1 62 ? 0.408   -5.620  -1.415  1.00 0.00 ? 62 LEU A HD12 4  
ATOM 4902  H HD13 . LEU A 1 62 ? 1.219   -5.060  0.048   1.00 0.00 ? 62 LEU A HD13 4  
ATOM 4903  H HD21 . LEU A 1 62 ? 3.362   -5.753  0.579   1.00 0.00 ? 62 LEU A HD21 4  
ATOM 4904  H HD22 . LEU A 1 62 ? 4.073   -7.246  -0.036  1.00 0.00 ? 62 LEU A HD22 4  
ATOM 4905  H HD23 . LEU A 1 62 ? 2.704   -7.308  1.074   1.00 0.00 ? 62 LEU A HD23 4  
ATOM 4906  N N    . LEU A 1 63 ? 1.692   -10.790 -3.149  1.00 0.00 ? 63 LEU A N    4  
ATOM 4907  C CA   . LEU A 1 63 ? 1.674   -12.276 -3.184  1.00 0.00 ? 63 LEU A CA   4  
ATOM 4908  C C    . LEU A 1 63 ? 2.637   -12.803 -4.248  1.00 0.00 ? 63 LEU A C    4  
ATOM 4909  O O    . LEU A 1 63 ? 2.987   -13.967 -4.248  1.00 0.00 ? 63 LEU A O    4  
ATOM 4910  C CB   . LEU A 1 63 ? 0.249   -12.764 -3.459  1.00 0.00 ? 63 LEU A CB   4  
ATOM 4911  C CG   . LEU A 1 63 ? -0.704  -12.194 -2.400  1.00 0.00 ? 63 LEU A CG   4  
ATOM 4912  C CD1  . LEU A 1 63 ? -2.121  -12.710 -2.665  1.00 0.00 ? 63 LEU A CD1  4  
ATOM 4913  C CD2  . LEU A 1 63 ? -0.251  -12.619 -0.991  1.00 0.00 ? 63 LEU A CD2  4  
ATOM 4914  H H    . LEU A 1 63 ? 0.950   -10.285 -3.543  1.00 0.00 ? 63 LEU A H    4  
ATOM 4915  H HA   . LEU A 1 63 ? 2.010   -12.670 -2.238  1.00 0.00 ? 63 LEU A HA   4  
ATOM 4916  H HB2  . LEU A 1 63 ? -0.065  -12.428 -4.438  1.00 0.00 ? 63 LEU A HB2  4  
ATOM 4917  H HB3  . LEU A 1 63 ? 0.221   -13.842 -3.422  1.00 0.00 ? 63 LEU A HB3  4  
ATOM 4918  H HG   . LEU A 1 63 ? -0.700  -11.117 -2.466  1.00 0.00 ? 63 LEU A HG   4  
ATOM 4919  H HD11 . LEU A 1 63 ? -2.534  -12.202 -3.524  1.00 0.00 ? 63 LEU A HD11 4  
ATOM 4920  H HD12 . LEU A 1 63 ? -2.742  -12.519 -1.801  1.00 0.00 ? 63 LEU A HD12 4  
ATOM 4921  H HD13 . LEU A 1 63 ? -2.088  -13.772 -2.855  1.00 0.00 ? 63 LEU A HD13 4  
ATOM 4922  H HD21 . LEU A 1 63 ? -1.092  -12.589 -0.311  1.00 0.00 ? 63 LEU A HD21 4  
ATOM 4923  H HD22 . LEU A 1 63 ? 0.512   -11.939 -0.639  1.00 0.00 ? 63 LEU A HD22 4  
ATOM 4924  H HD23 . LEU A 1 63 ? 0.149   -13.622 -1.023  1.00 0.00 ? 63 LEU A HD23 4  
ATOM 4925  N N    . GLU A 1 64 ? 3.081   -11.970 -5.154  1.00 0.00 ? 64 GLU A N    4  
ATOM 4926  C CA   . GLU A 1 64 ? 4.027   -12.462 -6.198  1.00 0.00 ? 64 GLU A CA   4  
ATOM 4927  C C    . GLU A 1 64 ? 5.449   -12.386 -5.636  1.00 0.00 ? 64 GLU A C    4  
ATOM 4928  O O    . GLU A 1 64 ? 6.417   -12.256 -6.358  1.00 0.00 ? 64 GLU A O    4  
ATOM 4929  C CB   . GLU A 1 64 ? 3.899   -11.620 -7.474  1.00 0.00 ? 64 GLU A CB   4  
ATOM 4930  C CG   . GLU A 1 64 ? 2.689   -12.088 -8.289  1.00 0.00 ? 64 GLU A CG   4  
ATOM 4931  C CD   . GLU A 1 64 ? 2.974   -13.469 -8.883  1.00 0.00 ? 64 GLU A CD   4  
ATOM 4932  O OE1  . GLU A 1 64 ? 3.731   -13.537 -9.839  1.00 0.00 ? 64 GLU A OE1  4  
ATOM 4933  O OE2  . GLU A 1 64 ? 2.431   -14.436 -8.374  1.00 0.00 ? 64 GLU A OE2  4  
ATOM 4934  H H    . GLU A 1 64 ? 2.803   -11.034 -5.146  1.00 0.00 ? 64 GLU A H    4  
ATOM 4935  H HA   . GLU A 1 64 ? 3.802   -13.499 -6.412  1.00 0.00 ? 64 GLU A HA   4  
ATOM 4936  H HB2  . GLU A 1 64 ? 3.768   -10.583 -7.207  1.00 0.00 ? 64 GLU A HB2  4  
ATOM 4937  H HB3  . GLU A 1 64 ? 4.791   -11.732 -8.070  1.00 0.00 ? 64 GLU A HB3  4  
ATOM 4938  H HG2  . GLU A 1 64 ? 1.822   -12.143 -7.649  1.00 0.00 ? 64 GLU A HG2  4  
ATOM 4939  H HG3  . GLU A 1 64 ? 2.502   -11.388 -9.089  1.00 0.00 ? 64 GLU A HG3  4  
ATOM 4940  N N    . GLU A 1 65 ? 5.561   -12.517 -4.341  1.00 0.00 ? 65 GLU A N    4  
ATOM 4941  C CA   . GLU A 1 65 ? 6.900   -12.515 -3.684  1.00 0.00 ? 65 GLU A CA   4  
ATOM 4942  C C    . GLU A 1 65 ? 7.755   -11.321 -4.120  1.00 0.00 ? 65 GLU A C    4  
ATOM 4943  O O    . GLU A 1 65 ? 8.967   -11.399 -4.180  1.00 0.00 ? 65 GLU A O    4  
ATOM 4944  C CB   . GLU A 1 65 ? 7.629   -13.790 -4.114  1.00 0.00 ? 65 GLU A CB   4  
ATOM 4945  C CG   . GLU A 1 65 ? 6.863   -15.013 -3.608  1.00 0.00 ? 65 GLU A CG   4  
ATOM 4946  C CD   . GLU A 1 65 ? 7.013   -15.119 -2.089  1.00 0.00 ? 65 GLU A CD   4  
ATOM 4947  O OE1  . GLU A 1 65 ? 8.140   -15.099 -1.622  1.00 0.00 ? 65 GLU A OE1  4  
ATOM 4948  O OE2  . GLU A 1 65 ? 5.998   -15.219 -1.419  1.00 0.00 ? 65 GLU A OE2  4  
ATOM 4949  H H    . GLU A 1 65 ? 4.750   -12.658 -3.812  1.00 0.00 ? 65 GLU A H    4  
ATOM 4950  H HA   . GLU A 1 65 ? 6.798   -12.549 -2.611  1.00 0.00 ? 65 GLU A HA   4  
ATOM 4951  H HB2  . GLU A 1 65 ? 7.691   -13.824 -5.191  1.00 0.00 ? 65 GLU A HB2  4  
ATOM 4952  H HB3  . GLU A 1 65 ? 8.624   -13.793 -3.696  1.00 0.00 ? 65 GLU A HB3  4  
ATOM 4953  H HG2  . GLU A 1 65 ? 5.817   -14.912 -3.861  1.00 0.00 ? 65 GLU A HG2  4  
ATOM 4954  H HG3  . GLU A 1 65 ? 7.261   -15.904 -4.070  1.00 0.00 ? 65 GLU A HG3  4  
ATOM 4955  N N    . VAL A 1 66 ? 7.130   -10.206 -4.398  1.00 0.00 ? 66 VAL A N    4  
ATOM 4956  C CA   . VAL A 1 66 ? 7.889   -8.979  -4.804  1.00 0.00 ? 66 VAL A CA   4  
ATOM 4957  C C    . VAL A 1 66 ? 8.178   -8.147  -3.538  1.00 0.00 ? 66 VAL A C    4  
ATOM 4958  O O    . VAL A 1 66 ? 7.378   -8.106  -2.624  1.00 0.00 ? 66 VAL A O    4  
ATOM 4959  C CB   . VAL A 1 66 ? 7.022   -8.177  -5.806  1.00 0.00 ? 66 VAL A CB   4  
ATOM 4960  C CG1  . VAL A 1 66 ? 7.294   -6.671  -5.698  1.00 0.00 ? 66 VAL A CG1  4  
ATOM 4961  C CG2  . VAL A 1 66 ? 7.333   -8.634  -7.237  1.00 0.00 ? 66 VAL A CG2  4  
ATOM 4962  H H    . VAL A 1 66 ? 6.149   -10.166 -4.335  1.00 0.00 ? 66 VAL A H    4  
ATOM 4963  H HA   . VAL A 1 66 ? 8.820   -9.262  -5.280  1.00 0.00 ? 66 VAL A HA   4  
ATOM 4964  H HB   . VAL A 1 66 ? 5.981   -8.365  -5.593  1.00 0.00 ? 66 VAL A HB   4  
ATOM 4965  H HG11 . VAL A 1 66 ? 6.870   -6.165  -6.554  1.00 0.00 ? 66 VAL A HG11 4  
ATOM 4966  H HG12 . VAL A 1 66 ? 8.358   -6.501  -5.670  1.00 0.00 ? 66 VAL A HG12 4  
ATOM 4967  H HG13 . VAL A 1 66 ? 6.842   -6.287  -4.794  1.00 0.00 ? 66 VAL A HG13 4  
ATOM 4968  H HG21 . VAL A 1 66 ? 6.543   -8.312  -7.898  1.00 0.00 ? 66 VAL A HG21 4  
ATOM 4969  H HG22 . VAL A 1 66 ? 7.412   -9.710  -7.262  1.00 0.00 ? 66 VAL A HG22 4  
ATOM 4970  H HG23 . VAL A 1 66 ? 8.269   -8.200  -7.559  1.00 0.00 ? 66 VAL A HG23 4  
ATOM 4971  N N    . SER A 1 67 ? 9.310   -7.488  -3.471  1.00 0.00 ? 67 SER A N    4  
ATOM 4972  C CA   . SER A 1 67 ? 9.619   -6.678  -2.253  1.00 0.00 ? 67 SER A CA   4  
ATOM 4973  C C    . SER A 1 67 ? 8.476   -5.671  -2.006  1.00 0.00 ? 67 SER A C    4  
ATOM 4974  O O    . SER A 1 67 ? 7.856   -5.227  -2.952  1.00 0.00 ? 67 SER A O    4  
ATOM 4975  C CB   . SER A 1 67 ? 10.929  -5.911  -2.453  1.00 0.00 ? 67 SER A CB   4  
ATOM 4976  O OG   . SER A 1 67 ? 10.649  -4.661  -3.063  1.00 0.00 ? 67 SER A OG   4  
ATOM 4977  H H    . SER A 1 67 ? 9.950   -7.531  -4.212  1.00 0.00 ? 67 SER A H    4  
ATOM 4978  H HA   . SER A 1 67 ? 9.719   -7.350  -1.422  1.00 0.00 ? 67 SER A HA   4  
ATOM 4979  H HB2  . SER A 1 67 ? 11.399  -5.739  -1.499  1.00 0.00 ? 67 SER A HB2  4  
ATOM 4980  H HB3  . SER A 1 67 ? 11.594  -6.490  -3.079  1.00 0.00 ? 67 SER A HB3  4  
ATOM 4981  H HG   . SER A 1 67 ? 9.837   -4.752  -3.567  1.00 0.00 ? 67 SER A HG   4  
ATOM 4982  N N    . PRO A 1 68 ? 8.210   -5.333  -0.755  1.00 0.00 ? 68 PRO A N    4  
ATOM 4983  C CA   . PRO A 1 68 ? 7.126   -4.380  -0.428  1.00 0.00 ? 68 PRO A CA   4  
ATOM 4984  C C    . PRO A 1 68 ? 7.384   -2.969  -0.999  1.00 0.00 ? 68 PRO A C    4  
ATOM 4985  O O    . PRO A 1 68 ? 6.464   -2.287  -1.392  1.00 0.00 ? 68 PRO A O    4  
ATOM 4986  C CB   . PRO A 1 68 ? 7.091   -4.330  1.119   1.00 0.00 ? 68 PRO A CB   4  
ATOM 4987  C CG   . PRO A 1 68 ? 8.283   -5.175  1.644   1.00 0.00 ? 68 PRO A CG   4  
ATOM 4988  C CD   . PRO A 1 68 ? 8.933   -5.865  0.428   1.00 0.00 ? 68 PRO A CD   4  
ATOM 4989  H HA   . PRO A 1 68 ? 6.188   -4.761  -0.805  1.00 0.00 ? 68 PRO A HA   4  
ATOM 4990  H HB2  . PRO A 1 68 ? 7.180   -3.309  1.469   1.00 0.00 ? 68 PRO A HB2  4  
ATOM 4991  H HB3  . PRO A 1 68 ? 6.171   -4.751  1.480   1.00 0.00 ? 68 PRO A HB3  4  
ATOM 4992  H HG2  . PRO A 1 68 ? 9.002   -4.531  2.137   1.00 0.00 ? 68 PRO A HG2  4  
ATOM 4993  H HG3  . PRO A 1 68 ? 7.924   -5.922  2.341   1.00 0.00 ? 68 PRO A HG3  4  
ATOM 4994  H HD2  . PRO A 1 68 ? 9.988   -5.626  0.369   1.00 0.00 ? 68 PRO A HD2  4  
ATOM 4995  H HD3  . PRO A 1 68 ? 8.790   -6.934  0.500   1.00 0.00 ? 68 PRO A HD3  4  
ATOM 4996  N N    . GLU A 1 69 ? 8.603   -2.500  -1.006  1.00 0.00 ? 69 GLU A N    4  
ATOM 4997  C CA   . GLU A 1 69 ? 8.849   -1.109  -1.509  1.00 0.00 ? 69 GLU A CA   4  
ATOM 4998  C C    . GLU A 1 69 ? 8.862   -1.078  -3.046  1.00 0.00 ? 69 GLU A C    4  
ATOM 4999  O O    . GLU A 1 69 ? 8.712   -0.029  -3.661  1.00 0.00 ? 69 GLU A O    4  
ATOM 5000  C CB   . GLU A 1 69 ? 10.184  -0.573  -0.939  1.00 0.00 ? 69 GLU A CB   4  
ATOM 5001  C CG   . GLU A 1 69 ? 11.120  -1.733  -0.580  1.00 0.00 ? 69 GLU A CG   4  
ATOM 5002  C CD   . GLU A 1 69 ? 12.479  -1.174  -0.153  1.00 0.00 ? 69 GLU A CD   4  
ATOM 5003  O OE1  . GLU A 1 69 ? 13.192  -0.683  -1.011  1.00 0.00 ? 69 GLU A OE1  4  
ATOM 5004  O OE2  . GLU A 1 69 ? 12.780  -1.245  1.027   1.00 0.00 ? 69 GLU A OE2  4  
ATOM 5005  H H    . GLU A 1 69 ? 9.342   -3.038  -0.655  1.00 0.00 ? 69 GLU A H    4  
ATOM 5006  H HA   . GLU A 1 69 ? 8.043   -0.471  -1.166  1.00 0.00 ? 69 GLU A HA   4  
ATOM 5007  H HB2  . GLU A 1 69 ? 10.667  0.065   -1.666  1.00 0.00 ? 69 GLU A HB2  4  
ATOM 5008  H HB3  . GLU A 1 69 ? 9.983   0.004   -0.045  1.00 0.00 ? 69 GLU A HB3  4  
ATOM 5009  H HG2  . GLU A 1 69 ? 10.695  -2.301  0.233   1.00 0.00 ? 69 GLU A HG2  4  
ATOM 5010  H HG3  . GLU A 1 69 ? 11.254  -2.371  -1.437  1.00 0.00 ? 69 GLU A HG3  4  
ATOM 5011  N N    . LEU A 1 70 ? 8.993   -2.205  -3.687  1.00 0.00 ? 70 LEU A N    4  
ATOM 5012  C CA   . LEU A 1 70 ? 8.974   -2.177  -5.173  1.00 0.00 ? 70 LEU A CA   4  
ATOM 5013  C C    . LEU A 1 70 ? 7.527   -1.908  -5.598  1.00 0.00 ? 70 LEU A C    4  
ATOM 5014  O O    . LEU A 1 70 ? 7.248   -1.581  -6.735  1.00 0.00 ? 70 LEU A O    4  
ATOM 5015  C CB   . LEU A 1 70 ? 9.494   -3.507  -5.749  1.00 0.00 ? 70 LEU A CB   4  
ATOM 5016  C CG   . LEU A 1 70 ? 11.032  -3.566  -5.665  1.00 0.00 ? 70 LEU A CG   4  
ATOM 5017  C CD1  . LEU A 1 70 ? 11.510  -5.019  -5.795  1.00 0.00 ? 70 LEU A CD1  4  
ATOM 5018  C CD2  . LEU A 1 70 ? 11.683  -2.741  -6.786  1.00 0.00 ? 70 LEU A CD2  4  
ATOM 5019  H H    . LEU A 1 70 ? 9.064   -3.047  -3.192  1.00 0.00 ? 70 LEU A H    4  
ATOM 5020  H HA   . LEU A 1 70 ? 9.587   -1.357  -5.503  1.00 0.00 ? 70 LEU A HA   4  
ATOM 5021  H HB2  . LEU A 1 70 ? 9.074   -4.322  -5.182  1.00 0.00 ? 70 LEU A HB2  4  
ATOM 5022  H HB3  . LEU A 1 70 ? 9.193   -3.598  -6.772  1.00 0.00 ? 70 LEU A HB3  4  
ATOM 5023  H HG   . LEU A 1 70 ? 11.338  -3.175  -4.719  1.00 0.00 ? 70 LEU A HG   4  
ATOM 5024  H HD11 . LEU A 1 70 ? 10.916  -5.662  -5.167  1.00 0.00 ? 70 LEU A HD11 4  
ATOM 5025  H HD12 . LEU A 1 70 ? 12.545  -5.082  -5.495  1.00 0.00 ? 70 LEU A HD12 4  
ATOM 5026  H HD13 . LEU A 1 70 ? 11.418  -5.337  -6.824  1.00 0.00 ? 70 LEU A HD13 4  
ATOM 5027  H HD21 . LEU A 1 70 ? 11.567  -1.689  -6.581  1.00 0.00 ? 70 LEU A HD21 4  
ATOM 5028  H HD22 . LEU A 1 70 ? 11.223  -2.979  -7.728  1.00 0.00 ? 70 LEU A HD22 4  
ATOM 5029  H HD23 . LEU A 1 70 ? 12.736  -2.979  -6.837  1.00 0.00 ? 70 LEU A HD23 4  
ATOM 5030  N N    . VAL A 1 71 ? 6.598   -2.072  -4.683  1.00 0.00 ? 71 VAL A N    4  
ATOM 5031  C CA   . VAL A 1 71 ? 5.161   -1.855  -5.023  1.00 0.00 ? 71 VAL A CA   4  
ATOM 5032  C C    . VAL A 1 71 ? 4.920   -0.394  -5.394  1.00 0.00 ? 71 VAL A C    4  
ATOM 5033  O O    . VAL A 1 71 ? 4.374   -0.108  -6.438  1.00 0.00 ? 71 VAL A O    4  
ATOM 5034  C CB   . VAL A 1 71 ? 4.256   -2.261  -3.828  1.00 0.00 ? 71 VAL A CB   4  
ATOM 5035  C CG1  . VAL A 1 71 ? 2.886   -1.536  -3.867  1.00 0.00 ? 71 VAL A CG1  4  
ATOM 5036  C CG2  . VAL A 1 71 ? 4.035   -3.778  -3.848  1.00 0.00 ? 71 VAL A CG2  4  
ATOM 5037  H H    . VAL A 1 71 ? 6.856   -2.370  -3.785  1.00 0.00 ? 71 VAL A H    4  
ATOM 5038  H HA   . VAL A 1 71 ? 4.937   -2.447  -5.896  1.00 0.00 ? 71 VAL A HA   4  
ATOM 5039  H HB   . VAL A 1 71 ? 4.756   -1.995  -2.913  1.00 0.00 ? 71 VAL A HB   4  
ATOM 5040  H HG11 . VAL A 1 71 ? 2.169   -2.076  -3.261  1.00 0.00 ? 71 VAL A HG11 4  
ATOM 5041  H HG12 . VAL A 1 71 ? 2.530   -1.485  -4.883  1.00 0.00 ? 71 VAL A HG12 4  
ATOM 5042  H HG13 . VAL A 1 71 ? 2.987   -0.530  -3.473  1.00 0.00 ? 71 VAL A HG13 4  
ATOM 5043  H HG21 . VAL A 1 71 ? 3.660   -4.075  -4.816  1.00 0.00 ? 71 VAL A HG21 4  
ATOM 5044  H HG22 . VAL A 1 71 ? 3.316   -4.045  -3.086  1.00 0.00 ? 71 VAL A HG22 4  
ATOM 5045  H HG23 . VAL A 1 71 ? 4.970   -4.280  -3.652  1.00 0.00 ? 71 VAL A HG23 4  
ATOM 5046  N N    . CYS A 1 72 ? 5.272   0.542   -4.562  1.00 0.00 ? 72 CYS A N    4  
ATOM 5047  C CA   . CYS A 1 72 ? 4.974   1.949   -4.930  1.00 0.00 ? 72 CYS A CA   4  
ATOM 5048  C C    . CYS A 1 72 ? 5.796   2.358   -6.160  1.00 0.00 ? 72 CYS A C    4  
ATOM 5049  O O    . CYS A 1 72 ? 5.401   3.218   -6.924  1.00 0.00 ? 72 CYS A O    4  
ATOM 5050  C CB   . CYS A 1 72 ? 5.285   2.878   -3.747  1.00 0.00 ? 72 CYS A CB   4  
ATOM 5051  S SG   . CYS A 1 72 ? 4.278   2.409   -2.321  1.00 0.00 ? 72 CYS A SG   4  
ATOM 5052  H H    . CYS A 1 72 ? 5.681   0.330   -3.696  1.00 0.00 ? 72 CYS A H    4  
ATOM 5053  H HA   . CYS A 1 72 ? 3.920   1.979   -5.163  1.00 0.00 ? 72 CYS A HA   4  
ATOM 5054  H HB2  . CYS A 1 72 ? 6.329   2.798   -3.486  1.00 0.00 ? 72 CYS A HB2  4  
ATOM 5055  H HB3  . CYS A 1 72 ? 5.064   3.895   -4.020  1.00 0.00 ? 72 CYS A HB3  4  
ATOM 5056  N N    . SER A 1 73 ? 6.933   1.738   -6.366  1.00 0.00 ? 73 SER A N    4  
ATOM 5057  C CA   . SER A 1 73 ? 7.759   2.091   -7.562  1.00 0.00 ? 73 SER A CA   4  
ATOM 5058  C C    . SER A 1 73 ? 7.173   1.459   -8.847  1.00 0.00 ? 73 SER A C    4  
ATOM 5059  O O    . SER A 1 73 ? 7.172   2.077   -9.894  1.00 0.00 ? 73 SER A O    4  
ATOM 5060  C CB   . SER A 1 73 ? 9.196   1.614   -7.361  1.00 0.00 ? 73 SER A CB   4  
ATOM 5061  O OG   . SER A 1 73 ? 9.593   1.871   -6.020  1.00 0.00 ? 73 SER A OG   4  
ATOM 5062  H H    . SER A 1 73 ? 7.235   1.048   -5.719  1.00 0.00 ? 73 SER A H    4  
ATOM 5063  H HA   . SER A 1 73 ? 7.746   3.163   -7.696  1.00 0.00 ? 73 SER A HA   4  
ATOM 5064  H HB2  . SER A 1 73 ? 9.253   0.556   -7.551  1.00 0.00 ? 73 SER A HB2  4  
ATOM 5065  H HB3  . SER A 1 73 ? 9.848   2.137   -8.048  1.00 0.00 ? 73 SER A HB3  4  
ATOM 5066  H HG   . SER A 1 73 ? 10.466  1.493   -5.891  1.00 0.00 ? 73 SER A HG   4  
ATOM 5067  N N    . MET A 1 74 ? 6.679   0.245   -8.791  1.00 0.00 ? 74 MET A N    4  
ATOM 5068  C CA   . MET A 1 74 ? 6.106   -0.395  -10.028 1.00 0.00 ? 74 MET A CA   4  
ATOM 5069  C C    . MET A 1 74 ? 4.737   0.221   -10.385 1.00 0.00 ? 74 MET A C    4  
ATOM 5070  O O    . MET A 1 74 ? 4.440   0.431   -11.545 1.00 0.00 ? 74 MET A O    4  
ATOM 5071  C CB   . MET A 1 74 ? 5.933   -1.926  -9.793  1.00 0.00 ? 74 MET A CB   4  
ATOM 5072  C CG   . MET A 1 74 ? 7.081   -2.733  -10.427 1.00 0.00 ? 74 MET A CG   4  
ATOM 5073  S SD   . MET A 1 74 ? 6.567   -4.461  -10.641 1.00 0.00 ? 74 MET A SD   4  
ATOM 5074  C CE   . MET A 1 74 ? 5.787   -4.709  -9.024  1.00 0.00 ? 74 MET A CE   4  
ATOM 5075  H H    . MET A 1 74 ? 6.689   -0.251  -7.946  1.00 0.00 ? 74 MET A H    4  
ATOM 5076  H HA   . MET A 1 74 ? 6.758   -0.243  -10.872 1.00 0.00 ? 74 MET A HA   4  
ATOM 5077  H HB2  . MET A 1 74 ? 5.921   -2.119  -8.734  1.00 0.00 ? 74 MET A HB2  4  
ATOM 5078  H HB3  . MET A 1 74 ? 4.999   -2.261  -10.228 1.00 0.00 ? 74 MET A HB3  4  
ATOM 5079  H HG2  . MET A 1 74 ? 7.332   -2.324  -11.394 1.00 0.00 ? 74 MET A HG2  4  
ATOM 5080  H HG3  . MET A 1 74 ? 7.944   -2.692  -9.787  1.00 0.00 ? 74 MET A HG3  4  
ATOM 5081  H HE1  . MET A 1 74 ? 6.431   -4.320  -8.250  1.00 0.00 ? 74 MET A HE1  4  
ATOM 5082  H HE2  . MET A 1 74 ? 5.632   -5.763  -8.858  1.00 0.00 ? 74 MET A HE2  4  
ATOM 5083  H HE3  . MET A 1 74 ? 4.833   -4.200  -8.997  1.00 0.00 ? 74 MET A HE3  4  
ATOM 5084  N N    . LEU A 1 75 ? 3.894   0.491   -9.429  1.00 0.00 ? 75 LEU A N    4  
ATOM 5085  C CA   . LEU A 1 75 ? 2.554   1.061   -9.773  1.00 0.00 ? 75 LEU A CA   4  
ATOM 5086  C C    . LEU A 1 75 ? 2.693   2.522   -10.225 1.00 0.00 ? 75 LEU A C    4  
ATOM 5087  O O    . LEU A 1 75 ? 1.737   3.270   -10.224 1.00 0.00 ? 75 LEU A O    4  
ATOM 5088  C CB   . LEU A 1 75 ? 1.622   0.976   -8.556  1.00 0.00 ? 75 LEU A CB   4  
ATOM 5089  C CG   . LEU A 1 75 ? 1.538   -0.470  -8.031  1.00 0.00 ? 75 LEU A CG   4  
ATOM 5090  C CD1  . LEU A 1 75 ? 0.446   -0.566  -6.961  1.00 0.00 ? 75 LEU A CD1  4  
ATOM 5091  C CD2  . LEU A 1 75 ? 1.211   -1.442  -9.175  1.00 0.00 ? 75 LEU A CD2  4  
ATOM 5092  H H    . LEU A 1 75 ? 4.127   0.304   -8.495  1.00 0.00 ? 75 LEU A H    4  
ATOM 5093  H HA   . LEU A 1 75 ? 2.127   0.492   -10.584 1.00 0.00 ? 75 LEU A HA   4  
ATOM 5094  H HB2  . LEU A 1 75 ? 2.004   1.614   -7.774  1.00 0.00 ? 75 LEU A HB2  4  
ATOM 5095  H HB3  . LEU A 1 75 ? 0.637   1.310   -8.842  1.00 0.00 ? 75 LEU A HB3  4  
ATOM 5096  H HG   . LEU A 1 75 ? 2.479   -0.742  -7.589  1.00 0.00 ? 75 LEU A HG   4  
ATOM 5097  H HD11 . LEU A 1 75 ? 0.235   -1.605  -6.757  1.00 0.00 ? 75 LEU A HD11 4  
ATOM 5098  H HD12 . LEU A 1 75 ? -0.451  -0.081  -7.314  1.00 0.00 ? 75 LEU A HD12 4  
ATOM 5099  H HD13 . LEU A 1 75 ? 0.786   -0.086  -6.057  1.00 0.00 ? 75 LEU A HD13 4  
ATOM 5100  H HD21 . LEU A 1 75 ? 2.115   -1.669  -9.723  1.00 0.00 ? 75 LEU A HD21 4  
ATOM 5101  H HD22 . LEU A 1 75 ? 0.489   -0.992  -9.839  1.00 0.00 ? 75 LEU A HD22 4  
ATOM 5102  H HD23 . LEU A 1 75 ? 0.802   -2.356  -8.770  1.00 0.00 ? 75 LEU A HD23 4  
ATOM 5103  N N    . HIS A 1 76 ? 3.878   2.929   -10.599 1.00 0.00 ? 76 HIS A N    4  
ATOM 5104  C CA   . HIS A 1 76 ? 4.100   4.341   -11.050 1.00 0.00 ? 76 HIS A CA   4  
ATOM 5105  C C    . HIS A 1 76 ? 3.433   5.315   -10.069 1.00 0.00 ? 76 HIS A C    4  
ATOM 5106  O O    . HIS A 1 76 ? 3.176   6.452   -10.413 1.00 0.00 ? 76 HIS A O    4  
ATOM 5107  C CB   . HIS A 1 76 ? 3.541   4.541   -12.468 1.00 0.00 ? 76 HIS A CB   4  
ATOM 5108  C CG   . HIS A 1 76 ? 2.037   4.539   -12.442 1.00 0.00 ? 76 HIS A CG   4  
ATOM 5109  N ND1  . HIS A 1 76 ? 1.304   5.617   -11.972 1.00 0.00 ? 76 HIS A ND1  4  
ATOM 5110  C CD2  . HIS A 1 76 ? 1.116   3.595   -12.823 1.00 0.00 ? 76 HIS A CD2  4  
ATOM 5111  C CE1  . HIS A 1 76 ? 0.000   5.298   -12.080 1.00 0.00 ? 76 HIS A CE1  4  
ATOM 5112  N NE2  . HIS A 1 76 ? -0.170  4.076   -12.593 1.00 0.00 ? 76 HIS A NE2  4  
ATOM 5113  H H    . HIS A 1 76 ? 4.630   2.302   -10.561 1.00 0.00 ? 76 HIS A H    4  
ATOM 5114  H HA   . HIS A 1 76 ? 5.163   4.535   -11.062 1.00 0.00 ? 76 HIS A HA   4  
ATOM 5115  H HB2  . HIS A 1 76 ? 3.889   5.485   -12.859 1.00 0.00 ? 76 HIS A HB2  4  
ATOM 5116  H HB3  . HIS A 1 76 ? 3.890   3.741   -13.104 1.00 0.00 ? 76 HIS A HB3  4  
ATOM 5117  H HD1  . HIS A 1 76 ? 1.668   6.457   -11.624 1.00 0.00 ? 76 HIS A HD1  4  
ATOM 5118  H HD2  . HIS A 1 76 ? 1.353   2.627   -13.238 1.00 0.00 ? 76 HIS A HD2  4  
ATOM 5119  H HE1  . HIS A 1 76 ? -0.808  5.949   -11.786 1.00 0.00 ? 76 HIS A HE1  4  
ATOM 5120  N N    . LEU A 1 77 ? 3.145   4.912   -8.867  1.00 0.00 ? 77 LEU A N    4  
ATOM 5121  C CA   . LEU A 1 77 ? 2.497   5.864   -7.917  1.00 0.00 ? 77 LEU A CA   4  
ATOM 5122  C C    . LEU A 1 77 ? 3.564   6.754   -7.281  1.00 0.00 ? 77 LEU A C    4  
ATOM 5123  O O    . LEU A 1 77 ? 3.245   7.733   -6.636  1.00 0.00 ? 77 LEU A O    4  
ATOM 5124  C CB   . LEU A 1 77 ? 1.752   5.100   -6.804  1.00 0.00 ? 77 LEU A CB   4  
ATOM 5125  C CG   . LEU A 1 77 ? 0.449   4.433   -7.296  1.00 0.00 ? 77 LEU A CG   4  
ATOM 5126  C CD1  . LEU A 1 77 ? -0.377  4.018   -6.074  1.00 0.00 ? 77 LEU A CD1  4  
ATOM 5127  C CD2  . LEU A 1 77 ? -0.404  5.384   -8.160  1.00 0.00 ? 77 LEU A CD2  4  
ATOM 5128  H H    . LEU A 1 77 ? 3.356   4.002   -8.588  1.00 0.00 ? 77 LEU A H    4  
ATOM 5129  H HA   . LEU A 1 77 ? 1.816   6.505   -8.443  1.00 0.00 ? 77 LEU A HA   4  
ATOM 5130  H HB2  . LEU A 1 77 ? 2.402   4.331   -6.420  1.00 0.00 ? 77 LEU A HB2  4  
ATOM 5131  H HB3  . LEU A 1 77 ? 1.518   5.782   -6.008  1.00 0.00 ? 77 LEU A HB3  4  
ATOM 5132  H HG   . LEU A 1 77 ? 0.703   3.555   -7.862  1.00 0.00 ? 77 LEU A HG   4  
ATOM 5133  H HD11 . LEU A 1 77 ? 0.177   3.302   -5.488  1.00 0.00 ? 77 LEU A HD11 4  
ATOM 5134  H HD12 . LEU A 1 77 ? -1.309  3.579   -6.399  1.00 0.00 ? 77 LEU A HD12 4  
ATOM 5135  H HD13 . LEU A 1 77 ? -0.585  4.889   -5.472  1.00 0.00 ? 77 LEU A HD13 4  
ATOM 5136  H HD21 . LEU A 1 77 ? -1.431  5.040   -8.175  1.00 0.00 ? 77 LEU A HD21 4  
ATOM 5137  H HD22 . LEU A 1 77 ? -0.026  5.395   -9.172  1.00 0.00 ? 77 LEU A HD22 4  
ATOM 5138  H HD23 . LEU A 1 77 ? -0.368  6.381   -7.747  1.00 0.00 ? 77 LEU A HD23 4  
ATOM 5139  N N    . CYS A 1 78 ? 4.826   6.433   -7.454  1.00 0.00 ? 78 CYS A N    4  
ATOM 5140  C CA   . CYS A 1 78 ? 5.908   7.280   -6.855  1.00 0.00 ? 78 CYS A CA   4  
ATOM 5141  C C    . CYS A 1 78 ? 6.944   7.642   -7.922  1.00 0.00 ? 78 CYS A C    4  
ATOM 5142  O O    . CYS A 1 78 ? 6.978   7.131   -9.024  1.00 0.00 ? 78 CYS A O    4  
ATOM 5143  C CB   . CYS A 1 78 ? 6.588   6.520   -5.714  1.00 0.00 ? 78 CYS A CB   4  
ATOM 5144  S SG   . CYS A 1 78 ? 5.511   6.522   -4.258  1.00 0.00 ? 78 CYS A SG   4  
ATOM 5145  H H    . CYS A 1 78 ? 5.061   5.637   -7.975  1.00 0.00 ? 78 CYS A H    4  
ATOM 5146  H HA   . CYS A 1 78 ? 5.483   8.194   -6.473  1.00 0.00 ? 78 CYS A HA   4  
ATOM 5147  H HB2  . CYS A 1 78 ? 6.777   5.504   -6.022  1.00 0.00 ? 78 CYS A HB2  4  
ATOM 5148  H HB3  . CYS A 1 78 ? 7.525   7.000   -5.469  1.00 0.00 ? 78 CYS A HB3  4  
ATOM 5149  N N    . SER A 1 79 ? 7.785   8.559   -7.527  1.00 0.00 ? 79 SER A N    4  
ATOM 5150  C CA   . SER A 1 79 ? 8.896   9.107   -8.359  1.00 0.00 ? 79 SER A CA   4  
ATOM 5151  C C    . SER A 1 79 ? 8.323   10.115  -9.360  1.00 0.00 ? 79 SER A C    4  
ATOM 5152  O O    . SER A 1 79 ? 8.712   10.145  -10.510 1.00 0.00 ? 79 SER A O    4  
ATOM 5153  C CB   . SER A 1 79 ? 9.674   7.994   -9.061  1.00 0.00 ? 79 SER A CB   4  
ATOM 5154  O OG   . SER A 1 79 ? 9.895   6.928   -8.148  1.00 0.00 ? 79 SER A OG   4  
ATOM 5155  H H    . SER A 1 79 ? 7.677   8.914   -6.620  1.00 0.00 ? 79 SER A H    4  
ATOM 5156  H HA   . SER A 1 79 ? 9.514   9.625   -7.642  1.00 0.00 ? 79 SER A HA   4  
ATOM 5157  H HB2  . SER A 1 79 ? 9.107   7.630   -9.901  1.00 0.00 ? 79 SER A HB2  4  
ATOM 5158  H HB3  . SER A 1 79 ? 10.621  8.385   -9.411  1.00 0.00 ? 79 SER A HB3  4  
ATOM 5159  H HG   . SER A 1 79 ? 9.319   6.201   -8.395  1.00 0.00 ? 79 SER A HG   4  
ATOM 5160  N N    . GLY A 1 80 ? 7.394   10.929  -8.939  1.00 0.00 ? 80 GLY A N    4  
ATOM 5161  C CA   . GLY A 1 80 ? 6.796   11.920  -9.872  1.00 0.00 ? 80 GLY A CA   4  
ATOM 5162  C C    . GLY A 1 80 ? 7.839   12.959  -10.290 1.00 0.00 ? 80 GLY A C    4  
ATOM 5163  O O    . GLY A 1 80 ? 7.593   14.147  -10.231 1.00 0.00 ? 80 GLY A O    4  
ATOM 5164  H H    . GLY A 1 80 ? 7.082   10.884  -8.014  1.00 0.00 ? 80 GLY A H    4  
ATOM 5165  H HA2  . GLY A 1 80 ? 6.430   11.407  -10.749 1.00 0.00 ? 80 GLY A HA2  4  
ATOM 5166  H HA3  . GLY A 1 80 ? 5.973   12.420  -9.382  1.00 0.00 ? 80 GLY A HA3  4  
ATOM 5167  N N    . LEU A 1 81 ? 8.990   12.531  -10.748 1.00 0.00 ? 81 LEU A N    4  
ATOM 5168  C CA   . LEU A 1 81 ? 10.018  13.502  -11.206 1.00 0.00 ? 81 LEU A CA   4  
ATOM 5169  C C    . LEU A 1 81 ? 9.840   13.633  -12.707 1.00 0.00 ? 81 LEU A C    4  
ATOM 5170  O O    . LEU A 1 81 ? 10.568  14.336  -13.376 1.00 0.00 ? 81 LEU A O    4  
ATOM 5171  C CB   . LEU A 1 81 ? 11.420  12.967  -10.898 1.00 0.00 ? 81 LEU A CB   4  
ATOM 5172  C CG   . LEU A 1 81 ? 11.532  12.621  -9.407  1.00 0.00 ? 81 LEU A CG   4  
ATOM 5173  C CD1  . LEU A 1 81 ? 12.827  11.844  -9.164  1.00 0.00 ? 81 LEU A CD1  4  
ATOM 5174  C CD2  . LEU A 1 81 ? 11.544  13.907  -8.568  1.00 0.00 ? 81 LEU A CD2  4  
ATOM 5175  H H    . LEU A 1 81 ? 9.168   11.571  -10.827 1.00 0.00 ? 81 LEU A H    4  
ATOM 5176  H HA   . LEU A 1 81 ? 9.873   14.463  -10.732 1.00 0.00 ? 81 LEU A HA   4  
ATOM 5177  H HB2  . LEU A 1 81 ? 11.598  12.078  -11.485 1.00 0.00 ? 81 LEU A HB2  4  
ATOM 5178  H HB3  . LEU A 1 81 ? 12.155  13.715  -11.150 1.00 0.00 ? 81 LEU A HB3  4  
ATOM 5179  H HG   . LEU A 1 81 ? 10.688  12.009  -9.119  1.00 0.00 ? 81 LEU A HG   4  
ATOM 5180  H HD11 . LEU A 1 81 ? 12.728  10.845  -9.559  1.00 0.00 ? 81 LEU A HD11 4  
ATOM 5181  H HD12 . LEU A 1 81 ? 13.022  11.794  -8.103  1.00 0.00 ? 81 LEU A HD12 4  
ATOM 5182  H HD13 . LEU A 1 81 ? 13.646  12.348  -9.657  1.00 0.00 ? 81 LEU A HD13 4  
ATOM 5183  H HD21 . LEU A 1 81 ? 11.898  13.682  -7.572  1.00 0.00 ? 81 LEU A HD21 4  
ATOM 5184  H HD22 . LEU A 1 81 ? 10.544  14.309  -8.509  1.00 0.00 ? 81 LEU A HD22 4  
ATOM 5185  H HD23 . LEU A 1 81 ? 12.198  14.634  -9.025  1.00 0.00 ? 81 LEU A HD23 4  
ATOM 5186  N N    . VAL A 1 82 ? 8.850   12.931  -13.217 1.00 0.00 ? 82 VAL A N    4  
ATOM 5187  C CA   . VAL A 1 82 ? 8.536   12.940  -14.688 1.00 0.00 ? 82 VAL A CA   4  
ATOM 5188  C C    . VAL A 1 82 ? 8.943   14.288  -15.334 1.00 0.00 ? 82 VAL A C    4  
ATOM 5189  O O    . VAL A 1 82 ? 8.172   15.225  -15.301 1.00 0.00 ? 82 VAL A O    4  
ATOM 5190  C CB   . VAL A 1 82 ? 7.019   12.739  -14.858 1.00 0.00 ? 82 VAL A CB   4  
ATOM 5191  C CG1  . VAL A 1 82 ? 6.676   11.248  -14.760 1.00 0.00 ? 82 VAL A CG1  4  
ATOM 5192  C CG2  . VAL A 1 82 ? 6.276   13.495  -13.753 1.00 0.00 ? 82 VAL A CG2  4  
ATOM 5193  H H    . VAL A 1 82 ? 8.297   12.378  -12.605 1.00 0.00 ? 82 VAL A H    4  
ATOM 5194  H HA   . VAL A 1 82 ? 9.050   12.124  -15.167 1.00 0.00 ? 82 VAL A HA   4  
ATOM 5195  H HB   . VAL A 1 82 ? 6.706   13.112  -15.825 1.00 0.00 ? 82 VAL A HB   4  
ATOM 5196  H HG11 . VAL A 1 82 ? 7.160   10.713  -15.565 1.00 0.00 ? 82 VAL A HG11 4  
ATOM 5197  H HG12 . VAL A 1 82 ? 5.607   11.118  -14.835 1.00 0.00 ? 82 VAL A HG12 4  
ATOM 5198  H HG13 . VAL A 1 82 ? 7.020   10.860  -13.813 1.00 0.00 ? 82 VAL A HG13 4  
ATOM 5199  H HG21 . VAL A 1 82 ? 6.382   12.962  -12.819 1.00 0.00 ? 82 VAL A HG21 4  
ATOM 5200  H HG22 . VAL A 1 82 ? 5.230   13.568  -14.008 1.00 0.00 ? 82 VAL A HG22 4  
ATOM 5201  H HG23 . VAL A 1 82 ? 6.691   14.486  -13.650 1.00 0.00 ? 82 VAL A HG23 4  
ATOM 5202  N N    . PRO A 1 83 ? 10.140  14.369  -15.899 1.00 0.00 ? 83 PRO A N    4  
ATOM 5203  C CA   . PRO A 1 83 ? 10.600  15.623  -16.525 1.00 0.00 ? 83 PRO A CA   4  
ATOM 5204  C C    . PRO A 1 83 ? 9.785   15.898  -17.796 1.00 0.00 ? 83 PRO A C    4  
ATOM 5205  O O    . PRO A 1 83 ? 9.936   16.927  -18.422 1.00 0.00 ? 83 PRO A O    4  
ATOM 5206  C CB   . PRO A 1 83 ? 12.095  15.379  -16.853 1.00 0.00 ? 83 PRO A CB   4  
ATOM 5207  C CG   . PRO A 1 83 ? 12.414  13.898  -16.498 1.00 0.00 ? 83 PRO A CG   4  
ATOM 5208  C CD   . PRO A 1 83 ? 11.115  13.255  -15.966 1.00 0.00 ? 83 PRO A CD   4  
ATOM 5209  H HA   . PRO A 1 83 ? 10.498  16.443  -15.832 1.00 0.00 ? 83 PRO A HA   4  
ATOM 5210  H HB2  . PRO A 1 83 ? 12.285  15.560  -17.905 1.00 0.00 ? 83 PRO A HB2  4  
ATOM 5211  H HB3  . PRO A 1 83 ? 12.714  16.037  -16.257 1.00 0.00 ? 83 PRO A HB3  4  
ATOM 5212  H HG2  . PRO A 1 83 ? 12.756  13.372  -17.383 1.00 0.00 ? 83 PRO A HG2  4  
ATOM 5213  H HG3  . PRO A 1 83 ? 13.182  13.855  -15.735 1.00 0.00 ? 83 PRO A HG3  4  
ATOM 5214  H HD2  . PRO A 1 83 ? 10.768  12.492  -16.652 1.00 0.00 ? 83 PRO A HD2  4  
ATOM 5215  H HD3  . PRO A 1 83 ? 11.271  12.832  -14.985 1.00 0.00 ? 83 PRO A HD3  4  
ATOM 5216  N N    . ARG A 1 84 ? 8.925   14.976  -18.163 1.00 0.00 ? 84 ARG A N    4  
ATOM 5217  C CA   . ARG A 1 84 ? 8.071   15.133  -19.390 1.00 0.00 ? 84 ARG A CA   4  
ATOM 5218  C C    . ARG A 1 84 ? 8.810   15.925  -20.475 1.00 0.00 ? 84 ARG A C    4  
ATOM 5219  O O    . ARG A 1 84 ? 8.172   16.733  -21.130 1.00 0.00 ? 84 ARG A O    4  
ATOM 5220  C CB   . ARG A 1 84 ? 6.761   15.849  -19.033 1.00 0.00 ? 84 ARG A CB   4  
ATOM 5221  C CG   . ARG A 1 84 ? 7.055   17.149  -18.273 1.00 0.00 ? 84 ARG A CG   4  
ATOM 5222  C CD   . ARG A 1 84 ? 5.762   17.952  -18.092 1.00 0.00 ? 84 ARG A CD   4  
ATOM 5223  N NE   . ARG A 1 84 ? 5.022   18.054  -19.395 1.00 0.00 ? 84 ARG A NE   4  
ATOM 5224  C CZ   . ARG A 1 84 ? 5.582   18.551  -20.467 1.00 0.00 ? 84 ARG A CZ   4  
ATOM 5225  N NH1  . ARG A 1 84 ? 6.738   19.150  -20.395 1.00 0.00 ? 84 ARG A NH1  4  
ATOM 5226  N NH2  . ARG A 1 84 ? 4.953   18.497  -21.610 1.00 0.00 ? 84 ARG A NH2  4  
ATOM 5227  O OXT  . ARG A 1 84 ? 10.002  15.710  -20.631 1.00 0.00 ? 84 ARG A OXT  4  
ATOM 5228  H H    . ARG A 1 84 ? 8.839   14.165  -17.622 1.00 0.00 ? 84 ARG A H    4  
ATOM 5229  H HA   . ARG A 1 84 ? 7.838   14.153  -19.777 1.00 0.00 ? 84 ARG A HA   4  
ATOM 5230  H HB2  . ARG A 1 84 ? 6.223   16.074  -19.941 1.00 0.00 ? 84 ARG A HB2  4  
ATOM 5231  H HB3  . ARG A 1 84 ? 6.159   15.202  -18.412 1.00 0.00 ? 84 ARG A HB3  4  
ATOM 5232  H HG2  . ARG A 1 84 ? 7.458   16.907  -17.301 1.00 0.00 ? 84 ARG A HG2  4  
ATOM 5233  H HG3  . ARG A 1 84 ? 7.774   17.732  -18.820 1.00 0.00 ? 84 ARG A HG3  4  
ATOM 5234  H HD2  . ARG A 1 84 ? 5.123   17.439  -17.399 1.00 0.00 ? 84 ARG A HD2  4  
ATOM 5235  H HD3  . ARG A 1 84 ? 6.004   18.934  -17.689 1.00 0.00 ? 84 ARG A HD3  4  
ATOM 5236  H HE   . ARG A 1 84 ? 4.114   17.690  -19.456 1.00 0.00 ? 84 ARG A HE   4  
ATOM 5237  H HH11 . ARG A 1 84 ? 7.202   19.237  -19.515 1.00 0.00 ? 84 ARG A HH11 4  
ATOM 5238  H HH12 . ARG A 1 84 ? 7.160   19.524  -21.221 1.00 0.00 ? 84 ARG A HH12 4  
ATOM 5239  H HH21 . ARG A 1 84 ? 4.047   18.077  -21.661 1.00 0.00 ? 84 ARG A HH21 4  
ATOM 5240  H HH22 . ARG A 1 84 ? 5.377   18.875  -22.432 1.00 0.00 ? 84 ARG A HH22 4  
ATOM 5241  N N    . SER A 1 1  ? 6.662   16.485  -1.373  1.00 0.00 ? 1  SER A N    5  
ATOM 5242  C CA   . SER A 1 1  ? 5.600   16.313  -0.342  1.00 0.00 ? 1  SER A CA   5  
ATOM 5243  C C    . SER A 1 1  ? 4.429   15.531  -0.943  1.00 0.00 ? 1  SER A C    5  
ATOM 5244  O O    . SER A 1 1  ? 3.280   15.764  -0.627  1.00 0.00 ? 1  SER A O    5  
ATOM 5245  C CB   . SER A 1 1  ? 5.112   17.686  0.121   1.00 0.00 ? 1  SER A CB   5  
ATOM 5246  O OG   . SER A 1 1  ? 4.087   17.518  1.091   1.00 0.00 ? 1  SER A OG   5  
ATOM 5247  H H1   . SER A 1 1  ? 6.966   15.552  -1.717  1.00 0.00 ? 1  SER A H1   5  
ATOM 5248  H H2   . SER A 1 1  ? 7.474   16.982  -0.953  1.00 0.00 ? 1  SER A H2   5  
ATOM 5249  H H3   . SER A 1 1  ? 6.288   17.040  -2.168  1.00 0.00 ? 1  SER A H3   5  
ATOM 5250  H HA   . SER A 1 1  ? 6.000   15.770  0.501   1.00 0.00 ? 1  SER A HA   5  
ATOM 5251  H HB2  . SER A 1 1  ? 5.930   18.232  0.560   1.00 0.00 ? 1  SER A HB2  5  
ATOM 5252  H HB3  . SER A 1 1  ? 4.731   18.236  -0.730  1.00 0.00 ? 1  SER A HB3  5  
ATOM 5253  H HG   . SER A 1 1  ? 3.597   16.722  0.870   1.00 0.00 ? 1  SER A HG   5  
ATOM 5254  N N    . ASP A 1 2  ? 4.724   14.609  -1.819  1.00 0.00 ? 2  ASP A N    5  
ATOM 5255  C CA   . ASP A 1 2  ? 3.649   13.804  -2.464  1.00 0.00 ? 2  ASP A CA   5  
ATOM 5256  C C    . ASP A 1 2  ? 2.999   12.872  -1.439  1.00 0.00 ? 2  ASP A C    5  
ATOM 5257  O O    . ASP A 1 2  ? 3.550   11.858  -1.055  1.00 0.00 ? 2  ASP A O    5  
ATOM 5258  C CB   . ASP A 1 2  ? 4.260   12.981  -3.604  1.00 0.00 ? 2  ASP A CB   5  
ATOM 5259  C CG   . ASP A 1 2  ? 3.228   11.990  -4.145  1.00 0.00 ? 2  ASP A CG   5  
ATOM 5260  O OD1  . ASP A 1 2  ? 2.240   12.439  -4.704  1.00 0.00 ? 2  ASP A OD1  5  
ATOM 5261  O OD2  . ASP A 1 2  ? 3.441   10.798  -3.990  1.00 0.00 ? 2  ASP A OD2  5  
ATOM 5262  H H    . ASP A 1 2  ? 5.661   14.449  -2.058  1.00 0.00 ? 2  ASP A H    5  
ATOM 5263  H HA   . ASP A 1 2  ? 2.899   14.461  -2.871  1.00 0.00 ? 2  ASP A HA   5  
ATOM 5264  H HB2  . ASP A 1 2  ? 4.569   13.646  -4.398  1.00 0.00 ? 2  ASP A HB2  5  
ATOM 5265  H HB3  . ASP A 1 2  ? 5.118   12.442  -3.237  1.00 0.00 ? 2  ASP A HB3  5  
ATOM 5266  N N    . VAL A 1 3  ? 1.827   13.230  -0.991  1.00 0.00 ? 3  VAL A N    5  
ATOM 5267  C CA   . VAL A 1 3  ? 1.105   12.408  0.020   1.00 0.00 ? 3  VAL A CA   5  
ATOM 5268  C C    . VAL A 1 3  ? 0.787   11.014  -0.536  1.00 0.00 ? 3  VAL A C    5  
ATOM 5269  O O    . VAL A 1 3  ? 0.372   10.150  0.207   1.00 0.00 ? 3  VAL A O    5  
ATOM 5270  C CB   . VAL A 1 3  ? -0.216  13.122  0.398   1.00 0.00 ? 3  VAL A CB   5  
ATOM 5271  C CG1  . VAL A 1 3  ? 0.023   14.631  0.473   1.00 0.00 ? 3  VAL A CG1  5  
ATOM 5272  C CG2  . VAL A 1 3  ? -1.321  12.846  -0.637  1.00 0.00 ? 3  VAL A CG2  5  
ATOM 5273  H H    . VAL A 1 3  ? 1.419   14.059  -1.318  1.00 0.00 ? 3  VAL A H    5  
ATOM 5274  H HA   . VAL A 1 3  ? 1.700   12.324  0.920   1.00 0.00 ? 3  VAL A HA   5  
ATOM 5275  H HB   . VAL A 1 3  ? -0.541  12.771  1.368   1.00 0.00 ? 3  VAL A HB   5  
ATOM 5276  H HG11 . VAL A 1 3  ? -0.810  15.101  0.975   1.00 0.00 ? 3  VAL A HG11 5  
ATOM 5277  H HG12 . VAL A 1 3  ? 0.114   15.031  -0.524  1.00 0.00 ? 3  VAL A HG12 5  
ATOM 5278  H HG13 . VAL A 1 3  ? 0.931   14.825  1.025   1.00 0.00 ? 3  VAL A HG13 5  
ATOM 5279  H HG21 . VAL A 1 3  ? -0.925  12.967  -1.632  1.00 0.00 ? 3  VAL A HG21 5  
ATOM 5280  H HG22 . VAL A 1 3  ? -2.140  13.539  -0.486  1.00 0.00 ? 3  VAL A HG22 5  
ATOM 5281  H HG23 . VAL A 1 3  ? -1.684  11.835  -0.512  1.00 0.00 ? 3  VAL A HG23 5  
ATOM 5282  N N    . TYR A 1 4  ? 0.917   10.769  -1.822  1.00 0.00 ? 4  TYR A N    5  
ATOM 5283  C CA   . TYR A 1 4  ? 0.536   9.404   -2.316  1.00 0.00 ? 4  TYR A CA   5  
ATOM 5284  C C    . TYR A 1 4  ? 1.607   8.383   -1.911  1.00 0.00 ? 4  TYR A C    5  
ATOM 5285  O O    . TYR A 1 4  ? 1.308   7.325   -1.395  1.00 0.00 ? 4  TYR A O    5  
ATOM 5286  C CB   . TYR A 1 4  ? 0.326   9.404   -3.835  1.00 0.00 ? 4  TYR A CB   5  
ATOM 5287  C CG   . TYR A 1 4  ? -1.084  9.821   -4.186  1.00 0.00 ? 4  TYR A CG   5  
ATOM 5288  C CD1  . TYR A 1 4  ? -2.165  9.045   -3.759  1.00 0.00 ? 4  TYR A CD1  5  
ATOM 5289  C CD2  . TYR A 1 4  ? -1.308  10.965  -4.965  1.00 0.00 ? 4  TYR A CD2  5  
ATOM 5290  C CE1  . TYR A 1 4  ? -3.467  9.409   -4.107  1.00 0.00 ? 4  TYR A CE1  5  
ATOM 5291  C CE2  . TYR A 1 4  ? -2.612  11.326  -5.315  1.00 0.00 ? 4  TYR A CE2  5  
ATOM 5292  C CZ   . TYR A 1 4  ? -3.693  10.548  -4.888  1.00 0.00 ? 4  TYR A CZ   5  
ATOM 5293  O OH   . TYR A 1 4  ? -4.980  10.905  -5.234  1.00 0.00 ? 4  TYR A OH   5  
ATOM 5294  H H    . TYR A 1 4  ? 1.219   11.464  -2.443  1.00 0.00 ? 4  TYR A H    5  
ATOM 5295  H HA   . TYR A 1 4  ? -0.365  9.145   -1.779  1.00 0.00 ? 4  TYR A HA   5  
ATOM 5296  H HB2  . TYR A 1 4  ? 1.027   10.089  -4.288  1.00 0.00 ? 4  TYR A HB2  5  
ATOM 5297  H HB3  . TYR A 1 4  ? 0.504   8.411   -4.223  1.00 0.00 ? 4  TYR A HB3  5  
ATOM 5298  H HD1  . TYR A 1 4  ? -1.995  8.171   -3.150  1.00 0.00 ? 4  TYR A HD1  5  
ATOM 5299  H HD2  . TYR A 1 4  ? -0.474  11.567  -5.295  1.00 0.00 ? 4  TYR A HD2  5  
ATOM 5300  H HE1  . TYR A 1 4  ? -4.298  8.802   -3.786  1.00 0.00 ? 4  TYR A HE1  5  
ATOM 5301  H HE2  . TYR A 1 4  ? -2.783  12.205  -5.916  1.00 0.00 ? 4  TYR A HE2  5  
ATOM 5302  H HH   . TYR A 1 4  ? -5.558  10.164  -5.034  1.00 0.00 ? 4  TYR A HH   5  
ATOM 5303  N N    . CYS A 1 5  ? 2.853   8.705   -2.129  1.00 0.00 ? 5  CYS A N    5  
ATOM 5304  C CA   . CYS A 1 5  ? 3.941   7.764   -1.743  1.00 0.00 ? 5  CYS A CA   5  
ATOM 5305  C C    . CYS A 1 5  ? 3.790   7.423   -0.254  1.00 0.00 ? 5  CYS A C    5  
ATOM 5306  O O    . CYS A 1 5  ? 3.992   6.299   0.156   1.00 0.00 ? 5  CYS A O    5  
ATOM 5307  C CB   . CYS A 1 5  ? 5.308   8.415   -1.986  1.00 0.00 ? 5  CYS A CB   5  
ATOM 5308  S SG   . CYS A 1 5  ? 5.629   8.493   -3.761  1.00 0.00 ? 5  CYS A SG   5  
ATOM 5309  H H    . CYS A 1 5  ? 3.070   9.572   -2.531  1.00 0.00 ? 5  CYS A H    5  
ATOM 5310  H HA   . CYS A 1 5  ? 3.861   6.844   -2.305  1.00 0.00 ? 5  CYS A HA   5  
ATOM 5311  H HB2  . CYS A 1 5  ? 5.315   9.414   -1.577  1.00 0.00 ? 5  CYS A HB2  5  
ATOM 5312  H HB3  . CYS A 1 5  ? 6.076   7.823   -1.510  1.00 0.00 ? 5  CYS A HB3  5  
ATOM 5313  N N    . GLU A 1 6  ? 3.449   8.386   0.555   1.00 0.00 ? 6  GLU A N    5  
ATOM 5314  C CA   . GLU A 1 6  ? 3.300   8.117   2.014   1.00 0.00 ? 6  GLU A CA   5  
ATOM 5315  C C    . GLU A 1 6  ? 2.191   7.087   2.265   1.00 0.00 ? 6  GLU A C    5  
ATOM 5316  O O    . GLU A 1 6  ? 2.344   6.193   3.074   1.00 0.00 ? 6  GLU A O    5  
ATOM 5317  C CB   . GLU A 1 6  ? 2.964   9.428   2.733   1.00 0.00 ? 6  GLU A CB   5  
ATOM 5318  C CG   . GLU A 1 6  ? 2.647   9.146   4.203   1.00 0.00 ? 6  GLU A CG   5  
ATOM 5319  C CD   . GLU A 1 6  ? 2.680   10.455  4.995   1.00 0.00 ? 6  GLU A CD   5  
ATOM 5320  O OE1  . GLU A 1 6  ? 1.709   11.190  4.929   1.00 0.00 ? 6  GLU A OE1  5  
ATOM 5321  O OE2  . GLU A 1 6  ? 3.678   10.700  5.655   1.00 0.00 ? 6  GLU A OE2  5  
ATOM 5322  H H    . GLU A 1 6  ? 3.312   9.288   0.199   1.00 0.00 ? 6  GLU A H    5  
ATOM 5323  H HA   . GLU A 1 6  ? 4.230   7.728   2.399   1.00 0.00 ? 6  GLU A HA   5  
ATOM 5324  H HB2  . GLU A 1 6  ? 3.810   10.099  2.669   1.00 0.00 ? 6  GLU A HB2  5  
ATOM 5325  H HB3  . GLU A 1 6  ? 2.107   9.886   2.263   1.00 0.00 ? 6  GLU A HB3  5  
ATOM 5326  H HG2  . GLU A 1 6  ? 1.663   8.705   4.279   1.00 0.00 ? 6  GLU A HG2  5  
ATOM 5327  H HG3  . GLU A 1 6  ? 3.380   8.465   4.606   1.00 0.00 ? 6  GLU A HG3  5  
ATOM 5328  N N    . VAL A 1 7  ? 1.070   7.210   1.609   1.00 0.00 ? 7  VAL A N    5  
ATOM 5329  C CA   . VAL A 1 7  ? -0.039  6.239   1.853   1.00 0.00 ? 7  VAL A CA   5  
ATOM 5330  C C    . VAL A 1 7  ? 0.280   4.861   1.266   1.00 0.00 ? 7  VAL A C    5  
ATOM 5331  O O    . VAL A 1 7  ? 0.046   3.849   1.897   1.00 0.00 ? 7  VAL A O    5  
ATOM 5332  C CB   . VAL A 1 7  ? -1.349  6.765   1.263   1.00 0.00 ? 7  VAL A CB   5  
ATOM 5333  C CG1  . VAL A 1 7  ? -2.463  5.740   1.498   1.00 0.00 ? 7  VAL A CG1  5  
ATOM 5334  C CG2  . VAL A 1 7  ? -1.719  8.101   1.926   1.00 0.00 ? 7  VAL A CG2  5  
ATOM 5335  H H    . VAL A 1 7  ? 0.947   7.949   0.977   1.00 0.00 ? 7  VAL A H    5  
ATOM 5336  H HA   . VAL A 1 7  ? -0.152  6.085   2.922   1.00 0.00 ? 7  VAL A HA   5  
ATOM 5337  H HB   . VAL A 1 7  ? -1.225  6.915   0.202   1.00 0.00 ? 7  VAL A HB   5  
ATOM 5338  H HG11 . VAL A 1 7  ? -2.365  4.934   0.785   1.00 0.00 ? 7  VAL A HG11 5  
ATOM 5339  H HG12 . VAL A 1 7  ? -3.423  6.215   1.373   1.00 0.00 ? 7  VAL A HG12 5  
ATOM 5340  H HG13 . VAL A 1 7  ? -2.386  5.343   2.499   1.00 0.00 ? 7  VAL A HG13 5  
ATOM 5341  H HG21 . VAL A 1 7  ? -2.770  8.301   1.774   1.00 0.00 ? 7  VAL A HG21 5  
ATOM 5342  H HG22 . VAL A 1 7  ? -1.139  8.895   1.482   1.00 0.00 ? 7  VAL A HG22 5  
ATOM 5343  H HG23 . VAL A 1 7  ? -1.513  8.051   2.984   1.00 0.00 ? 7  VAL A HG23 5  
ATOM 5344  N N    . CYS A 1 8  ? 0.801   4.792   0.068   1.00 0.00 ? 8  CYS A N    5  
ATOM 5345  C CA   . CYS A 1 8  ? 1.112   3.465   -0.534  1.00 0.00 ? 8  CYS A CA   5  
ATOM 5346  C C    . CYS A 1 8  ? 2.102   2.715   0.343   1.00 0.00 ? 8  CYS A C    5  
ATOM 5347  O O    . CYS A 1 8  ? 2.060   1.505   0.439   1.00 0.00 ? 8  CYS A O    5  
ATOM 5348  C CB   . CYS A 1 8  ? 1.685   3.682   -1.932  1.00 0.00 ? 8  CYS A CB   5  
ATOM 5349  S SG   . CYS A 1 8  ? 3.418   4.160   -1.866  1.00 0.00 ? 8  CYS A SG   5  
ATOM 5350  H H    . CYS A 1 8  ? 0.997   5.595   -0.457  1.00 0.00 ? 8  CYS A H    5  
ATOM 5351  H HA   . CYS A 1 8  ? 0.208   2.877   -0.618  1.00 0.00 ? 8  CYS A HA   5  
ATOM 5352  H HB2  . CYS A 1 8  ? 1.604   2.773   -2.497  1.00 0.00 ? 8  CYS A HB2  5  
ATOM 5353  H HB3  . CYS A 1 8  ? 1.127   4.463   -2.422  1.00 0.00 ? 8  CYS A HB3  5  
ATOM 5354  N N    . GLU A 1 9  ? 2.976   3.411   1.011   1.00 0.00 ? 9  GLU A N    5  
ATOM 5355  C CA   . GLU A 1 9  ? 3.932   2.711   1.901   1.00 0.00 ? 9  GLU A CA   5  
ATOM 5356  C C    . GLU A 1 9  ? 3.219   2.378   3.208   1.00 0.00 ? 9  GLU A C    5  
ATOM 5357  O O    . GLU A 1 9  ? 3.542   1.405   3.860   1.00 0.00 ? 9  GLU A O    5  
ATOM 5358  C CB   . GLU A 1 9  ? 5.124   3.626   2.201   1.00 0.00 ? 9  GLU A CB   5  
ATOM 5359  C CG   . GLU A 1 9  ? 5.937   3.850   0.927   1.00 0.00 ? 9  GLU A CG   5  
ATOM 5360  C CD   . GLU A 1 9  ? 7.065   4.844   1.209   1.00 0.00 ? 9  GLU A CD   5  
ATOM 5361  O OE1  . GLU A 1 9  ? 7.932   4.517   2.004   1.00 0.00 ? 9  GLU A OE1  5  
ATOM 5362  O OE2  . GLU A 1 9  ? 7.045   5.915   0.625   1.00 0.00 ? 9  GLU A OE2  5  
ATOM 5363  H H    . GLU A 1 9  ? 2.995   4.390   0.961   1.00 0.00 ? 9  GLU A H    5  
ATOM 5364  H HA   . GLU A 1 9  ? 4.279   1.803   1.428   1.00 0.00 ? 9  GLU A HA   5  
ATOM 5365  H HB2  . GLU A 1 9  ? 4.763   4.575   2.571   1.00 0.00 ? 9  GLU A HB2  5  
ATOM 5366  H HB3  . GLU A 1 9  ? 5.751   3.164   2.949   1.00 0.00 ? 9  GLU A HB3  5  
ATOM 5367  H HG2  . GLU A 1 9  ? 6.357   2.911   0.599   1.00 0.00 ? 9  GLU A HG2  5  
ATOM 5368  H HG3  . GLU A 1 9  ? 5.294   4.247   0.157   1.00 0.00 ? 9  GLU A HG3  5  
ATOM 5369  N N    . PHE A 1 10 ? 2.237   3.151   3.603   1.00 0.00 ? 10 PHE A N    5  
ATOM 5370  C CA   . PHE A 1 10 ? 1.527   2.815   4.866   1.00 0.00 ? 10 PHE A CA   5  
ATOM 5371  C C    . PHE A 1 10 ? 0.672   1.556   4.660   1.00 0.00 ? 10 PHE A C    5  
ATOM 5372  O O    . PHE A 1 10 ? 0.716   0.640   5.458   1.00 0.00 ? 10 PHE A O    5  
ATOM 5373  C CB   . PHE A 1 10 ? 0.626   3.971   5.299   1.00 0.00 ? 10 PHE A CB   5  
ATOM 5374  C CG   . PHE A 1 10 ? -0.057  3.570   6.582   1.00 0.00 ? 10 PHE A CG   5  
ATOM 5375  C CD1  . PHE A 1 10 ? 0.641   3.647   7.792   1.00 0.00 ? 10 PHE A CD1  5  
ATOM 5376  C CD2  . PHE A 1 10 ? -1.372  3.097   6.558   1.00 0.00 ? 10 PHE A CD2  5  
ATOM 5377  C CE1  . PHE A 1 10 ? 0.021   3.254   8.983   1.00 0.00 ? 10 PHE A CE1  5  
ATOM 5378  C CE2  . PHE A 1 10 ? -1.994  2.699   7.749   1.00 0.00 ? 10 PHE A CE2  5  
ATOM 5379  C CZ   . PHE A 1 10 ? -1.297  2.778   8.962   1.00 0.00 ? 10 PHE A CZ   5  
ATOM 5380  H H    . PHE A 1 10 ? 1.962   3.941   3.087   1.00 0.00 ? 10 PHE A H    5  
ATOM 5381  H HA   . PHE A 1 10 ? 2.252   2.628   5.638   1.00 0.00 ? 10 PHE A HA   5  
ATOM 5382  H HB2  . PHE A 1 10 ? 1.223   4.857   5.461   1.00 0.00 ? 10 PHE A HB2  5  
ATOM 5383  H HB3  . PHE A 1 10 ? -0.115  4.164   4.538   1.00 0.00 ? 10 PHE A HB3  5  
ATOM 5384  H HD1  . PHE A 1 10 ? 1.657   4.013   7.807   1.00 0.00 ? 10 PHE A HD1  5  
ATOM 5385  H HD2  . PHE A 1 10 ? -1.908  3.042   5.621   1.00 0.00 ? 10 PHE A HD2  5  
ATOM 5386  H HE1  . PHE A 1 10 ? 0.560   3.313   9.917   1.00 0.00 ? 10 PHE A HE1  5  
ATOM 5387  H HE2  . PHE A 1 10 ? -3.009  2.328   7.734   1.00 0.00 ? 10 PHE A HE2  5  
ATOM 5388  H HZ   . PHE A 1 10 ? -1.774  2.472   9.879   1.00 0.00 ? 10 PHE A HZ   5  
ATOM 5389  N N    . LEU A 1 11 ? -0.093  1.482   3.595   1.00 0.00 ? 11 LEU A N    5  
ATOM 5390  C CA   . LEU A 1 11 ? -0.916  0.253   3.370   1.00 0.00 ? 11 LEU A CA   5  
ATOM 5391  C C    . LEU A 1 11 ? 0.030   -0.938  3.226   1.00 0.00 ? 11 LEU A C    5  
ATOM 5392  O O    . LEU A 1 11 ? -0.201  -1.989  3.790   1.00 0.00 ? 11 LEU A O    5  
ATOM 5393  C CB   . LEU A 1 11 ? -1.763  0.366   2.087   1.00 0.00 ? 11 LEU A CB   5  
ATOM 5394  C CG   . LEU A 1 11 ? -2.664  1.611   2.133   1.00 0.00 ? 11 LEU A CG   5  
ATOM 5395  C CD1  . LEU A 1 11 ? -3.190  1.914   0.726   1.00 0.00 ? 11 LEU A CD1  5  
ATOM 5396  C CD2  . LEU A 1 11 ? -3.859  1.367   3.063   1.00 0.00 ? 11 LEU A CD2  5  
ATOM 5397  H H    . LEU A 1 11 ? -0.114  2.219   2.949   1.00 0.00 ? 11 LEU A H    5  
ATOM 5398  H HA   . LEU A 1 11 ? -1.571  0.082   4.212   1.00 0.00 ? 11 LEU A HA   5  
ATOM 5399  H HB2  . LEU A 1 11 ? -1.110  0.434   1.229   1.00 0.00 ? 11 LEU A HB2  5  
ATOM 5400  H HB3  . LEU A 1 11 ? -2.381  -0.522  1.993   1.00 0.00 ? 11 LEU A HB3  5  
ATOM 5401  H HG   . LEU A 1 11 ? -2.093  2.455   2.491   1.00 0.00 ? 11 LEU A HG   5  
ATOM 5402  H HD11 . LEU A 1 11 ? -2.394  2.324   0.124   1.00 0.00 ? 11 LEU A HD11 5  
ATOM 5403  H HD12 . LEU A 1 11 ? -4.000  2.629   0.788   1.00 0.00 ? 11 LEU A HD12 5  
ATOM 5404  H HD13 . LEU A 1 11 ? -3.552  1.003   0.273   1.00 0.00 ? 11 LEU A HD13 5  
ATOM 5405  H HD21 . LEU A 1 11 ? -4.580  2.162   2.934   1.00 0.00 ? 11 LEU A HD21 5  
ATOM 5406  H HD22 . LEU A 1 11 ? -3.522  1.354   4.087   1.00 0.00 ? 11 LEU A HD22 5  
ATOM 5407  H HD23 . LEU A 1 11 ? -4.323  0.423   2.820   1.00 0.00 ? 11 LEU A HD23 5  
ATOM 5408  N N    . VAL A 1 12 ? 1.096   -0.797  2.482   1.00 0.00 ? 12 VAL A N    5  
ATOM 5409  C CA   . VAL A 1 12 ? 2.040   -1.930  2.317   1.00 0.00 ? 12 VAL A CA   5  
ATOM 5410  C C    . VAL A 1 12 ? 2.600   -2.337  3.693   1.00 0.00 ? 12 VAL A C    5  
ATOM 5411  O O    . VAL A 1 12 ? 2.611   -3.497  4.047   1.00 0.00 ? 12 VAL A O    5  
ATOM 5412  C CB   . VAL A 1 12 ? 3.181   -1.473  1.391   1.00 0.00 ? 12 VAL A CB   5  
ATOM 5413  C CG1  . VAL A 1 12 ? 4.392   -2.401  1.518   1.00 0.00 ? 12 VAL A CG1  5  
ATOM 5414  C CG2  . VAL A 1 12 ? 2.692   -1.489  -0.061  1.00 0.00 ? 12 VAL A CG2  5  
ATOM 5415  H H    . VAL A 1 12 ? 1.288   0.043   2.014   1.00 0.00 ? 12 VAL A H    5  
ATOM 5416  H HA   . VAL A 1 12 ? 1.527   -2.774  1.868   1.00 0.00 ? 12 VAL A HA   5  
ATOM 5417  H HB   . VAL A 1 12 ? 3.474   -0.468  1.657   1.00 0.00 ? 12 VAL A HB   5  
ATOM 5418  H HG11 . VAL A 1 12 ? 4.879   -2.237  2.467   1.00 0.00 ? 12 VAL A HG11 5  
ATOM 5419  H HG12 . VAL A 1 12 ? 5.086   -2.187  0.721   1.00 0.00 ? 12 VAL A HG12 5  
ATOM 5420  H HG13 . VAL A 1 12 ? 4.065   -3.428  1.452   1.00 0.00 ? 12 VAL A HG13 5  
ATOM 5421  H HG21 . VAL A 1 12 ? 3.422   -1.004  -0.693  1.00 0.00 ? 12 VAL A HG21 5  
ATOM 5422  H HG22 . VAL A 1 12 ? 1.751   -0.965  -0.130  1.00 0.00 ? 12 VAL A HG22 5  
ATOM 5423  H HG23 . VAL A 1 12 ? 2.559   -2.512  -0.386  1.00 0.00 ? 12 VAL A HG23 5  
ATOM 5424  N N    . LYS A 1 13 ? 3.058   -1.384  4.470   1.00 0.00 ? 13 LYS A N    5  
ATOM 5425  C CA   . LYS A 1 13 ? 3.618   -1.704  5.823   1.00 0.00 ? 13 LYS A CA   5  
ATOM 5426  C C    . LYS A 1 13 ? 2.555   -2.433  6.650   1.00 0.00 ? 13 LYS A C    5  
ATOM 5427  O O    . LYS A 1 13 ? 2.825   -3.408  7.326   1.00 0.00 ? 13 LYS A O    5  
ATOM 5428  C CB   . LYS A 1 13 ? 4.014   -0.391  6.516   1.00 0.00 ? 13 LYS A CB   5  
ATOM 5429  C CG   . LYS A 1 13 ? 4.288   -0.630  8.010   1.00 0.00 ? 13 LYS A CG   5  
ATOM 5430  C CD   . LYS A 1 13 ? 4.938   0.620   8.638   1.00 0.00 ? 13 LYS A CD   5  
ATOM 5431  C CE   . LYS A 1 13 ? 6.458   0.594   8.434   1.00 0.00 ? 13 LYS A CE   5  
ATOM 5432  N NZ   . LYS A 1 13 ? 7.020   -0.657  9.017   1.00 0.00 ? 13 LYS A NZ   5  
ATOM 5433  H H    . LYS A 1 13 ? 3.041   -0.453  4.160   1.00 0.00 ? 13 LYS A H    5  
ATOM 5434  H HA   . LYS A 1 13 ? 4.490   -2.333  5.709   1.00 0.00 ? 13 LYS A HA   5  
ATOM 5435  H HB2  . LYS A 1 13 ? 4.900   0.004   6.046   1.00 0.00 ? 13 LYS A HB2  5  
ATOM 5436  H HB3  . LYS A 1 13 ? 3.209   0.322   6.412   1.00 0.00 ? 13 LYS A HB3  5  
ATOM 5437  H HG2  . LYS A 1 13 ? 3.352   -0.831  8.515   1.00 0.00 ? 13 LYS A HG2  5  
ATOM 5438  H HG3  . LYS A 1 13 ? 4.946   -1.478  8.125   1.00 0.00 ? 13 LYS A HG3  5  
ATOM 5439  H HD2  . LYS A 1 13 ? 4.531   1.510   8.178   1.00 0.00 ? 13 LYS A HD2  5  
ATOM 5440  H HD3  . LYS A 1 13 ? 4.724   0.639   9.697   1.00 0.00 ? 13 LYS A HD3  5  
ATOM 5441  H HE2  . LYS A 1 13 ? 6.684   0.633   7.379   1.00 0.00 ? 13 LYS A HE2  5  
ATOM 5442  H HE3  . LYS A 1 13 ? 6.898   1.449   8.926   1.00 0.00 ? 13 LYS A HE3  5  
ATOM 5443  H HZ1  . LYS A 1 13 ? 6.379   -1.017  9.752   1.00 0.00 ? 13 LYS A HZ1  5  
ATOM 5444  H HZ2  . LYS A 1 13 ? 7.951   -0.455  9.437   1.00 0.00 ? 13 LYS A HZ2  5  
ATOM 5445  H HZ3  . LYS A 1 13 ? 7.123   -1.373  8.270   1.00 0.00 ? 13 LYS A HZ3  5  
ATOM 5446  N N    . GLU A 1 14 ? 1.355   -1.936  6.616   1.00 0.00 ? 14 GLU A N    5  
ATOM 5447  C CA   . GLU A 1 14 ? 0.256   -2.548  7.414   1.00 0.00 ? 14 GLU A CA   5  
ATOM 5448  C C    . GLU A 1 14 ? -0.133  -3.898  6.804   1.00 0.00 ? 14 GLU A C    5  
ATOM 5449  O O    . GLU A 1 14 ? -0.437  -4.837  7.514   1.00 0.00 ? 14 GLU A O    5  
ATOM 5450  C CB   . GLU A 1 14 ? -0.949  -1.576  7.406   1.00 0.00 ? 14 GLU A CB   5  
ATOM 5451  C CG   . GLU A 1 14 ? -1.420  -1.284  8.839   1.00 0.00 ? 14 GLU A CG   5  
ATOM 5452  C CD   . GLU A 1 14 ? -0.311  -0.558  9.603   1.00 0.00 ? 14 GLU A CD   5  
ATOM 5453  O OE1  . GLU A 1 14 ? 0.293   0.333   9.027   1.00 0.00 ? 14 GLU A OE1  5  
ATOM 5454  O OE2  . GLU A 1 14 ? -0.083  -0.905  10.749  1.00 0.00 ? 14 GLU A OE2  5  
ATOM 5455  H H    . GLU A 1 14 ? 1.182   -1.146  6.063   1.00 0.00 ? 14 GLU A H    5  
ATOM 5456  H HA   . GLU A 1 14 ? 0.596   -2.703  8.429   1.00 0.00 ? 14 GLU A HA   5  
ATOM 5457  H HB2  . GLU A 1 14 ? -0.648  -0.649  6.941   1.00 0.00 ? 14 GLU A HB2  5  
ATOM 5458  H HB3  . GLU A 1 14 ? -1.766  -2.003  6.844   1.00 0.00 ? 14 GLU A HB3  5  
ATOM 5459  H HG2  . GLU A 1 14 ? -2.300  -0.661  8.806   1.00 0.00 ? 14 GLU A HG2  5  
ATOM 5460  H HG3  . GLU A 1 14 ? -1.651  -2.212  9.338   1.00 0.00 ? 14 GLU A HG3  5  
ATOM 5461  N N    . VAL A 1 15 ? -0.144  -4.009  5.512   1.00 0.00 ? 15 VAL A N    5  
ATOM 5462  C CA   . VAL A 1 15 ? -0.536  -5.306  4.906   1.00 0.00 ? 15 VAL A CA   5  
ATOM 5463  C C    . VAL A 1 15 ? 0.515   -6.379  5.220   1.00 0.00 ? 15 VAL A C    5  
ATOM 5464  O O    . VAL A 1 15 ? 0.176   -7.500  5.518   1.00 0.00 ? 15 VAL A O    5  
ATOM 5465  C CB   . VAL A 1 15 ? -0.704  -5.144  3.383   1.00 0.00 ? 15 VAL A CB   5  
ATOM 5466  C CG1  . VAL A 1 15 ? -0.667  -6.519  2.704   1.00 0.00 ? 15 VAL A CG1  5  
ATOM 5467  C CG2  . VAL A 1 15 ? -2.051  -4.476  3.087   1.00 0.00 ? 15 VAL A CG2  5  
ATOM 5468  H H    . VAL A 1 15 ? 0.091   -3.247  4.944   1.00 0.00 ? 15 VAL A H    5  
ATOM 5469  H HA   . VAL A 1 15 ? -1.479  -5.619  5.335   1.00 0.00 ? 15 VAL A HA   5  
ATOM 5470  H HB   . VAL A 1 15 ? 0.093   -4.529  2.994   1.00 0.00 ? 15 VAL A HB   5  
ATOM 5471  H HG11 . VAL A 1 15 ? -1.016  -6.428  1.687   1.00 0.00 ? 15 VAL A HG11 5  
ATOM 5472  H HG12 . VAL A 1 15 ? -1.305  -7.203  3.243   1.00 0.00 ? 15 VAL A HG12 5  
ATOM 5473  H HG13 . VAL A 1 15 ? 0.350   -6.897  2.709   1.00 0.00 ? 15 VAL A HG13 5  
ATOM 5474  H HG21 . VAL A 1 15 ? -2.100  -4.217  2.040   1.00 0.00 ? 15 VAL A HG21 5  
ATOM 5475  H HG22 . VAL A 1 15 ? -2.147  -3.580  3.685   1.00 0.00 ? 15 VAL A HG22 5  
ATOM 5476  H HG23 . VAL A 1 15 ? -2.853  -5.158  3.329   1.00 0.00 ? 15 VAL A HG23 5  
ATOM 5477  N N    . THR A 1 16 ? 1.783   -6.086  5.126   1.00 0.00 ? 16 THR A N    5  
ATOM 5478  C CA   . THR A 1 16 ? 2.756   -7.178  5.394   1.00 0.00 ? 16 THR A CA   5  
ATOM 5479  C C    . THR A 1 16 ? 2.624   -7.661  6.833   1.00 0.00 ? 16 THR A C    5  
ATOM 5480  O O    . THR A 1 16 ? 2.719   -8.843  7.097   1.00 0.00 ? 16 THR A O    5  
ATOM 5481  C CB   . THR A 1 16 ? 4.205   -6.767  5.141   1.00 0.00 ? 16 THR A CB   5  
ATOM 5482  O OG1  . THR A 1 16 ? 4.736   -6.166  6.313   1.00 0.00 ? 16 THR A OG1  5  
ATOM 5483  C CG2  . THR A 1 16 ? 4.319   -5.786  3.966   1.00 0.00 ? 16 THR A CG2  5  
ATOM 5484  H H    . THR A 1 16 ? 2.073   -5.187  4.864   1.00 0.00 ? 16 THR A H    5  
ATOM 5485  H HA   . THR A 1 16 ? 2.512   -7.989  4.734   1.00 0.00 ? 16 THR A HA   5  
ATOM 5486  H HB   . THR A 1 16 ? 4.762   -7.664  4.912   1.00 0.00 ? 16 THR A HB   5  
ATOM 5487  H HG1  . THR A 1 16 ? 4.133   -5.473  6.591   1.00 0.00 ? 16 THR A HG1  5  
ATOM 5488  H HG21 . THR A 1 16 ? 4.490   -4.794  4.352   1.00 0.00 ? 16 THR A HG21 5  
ATOM 5489  H HG22 . THR A 1 16 ? 3.414   -5.798  3.382   1.00 0.00 ? 16 THR A HG22 5  
ATOM 5490  H HG23 . THR A 1 16 ? 5.152   -6.069  3.336   1.00 0.00 ? 16 THR A HG23 5  
ATOM 5491  N N    . LYS A 1 17 ? 2.397   -6.790  7.776   1.00 0.00 ? 17 LYS A N    5  
ATOM 5492  C CA   . LYS A 1 17 ? 2.260   -7.293  9.165   1.00 0.00 ? 17 LYS A CA   5  
ATOM 5493  C C    . LYS A 1 17 ? 1.044   -8.216  9.187   1.00 0.00 ? 17 LYS A C    5  
ATOM 5494  O O    . LYS A 1 17 ? 0.990   -9.194  9.907   1.00 0.00 ? 17 LYS A O    5  
ATOM 5495  C CB   . LYS A 1 17 ? 2.061   -6.128  10.150  1.00 0.00 ? 17 LYS A CB   5  
ATOM 5496  C CG   . LYS A 1 17 ? 1.435   -6.656  11.458  1.00 0.00 ? 17 LYS A CG   5  
ATOM 5497  C CD   . LYS A 1 17 ? 1.773   -5.739  12.632  1.00 0.00 ? 17 LYS A CD   5  
ATOM 5498  C CE   . LYS A 1 17 ? 1.256   -6.381  13.923  1.00 0.00 ? 17 LYS A CE   5  
ATOM 5499  N NZ   . LYS A 1 17 ? 1.795   -5.643  15.098  1.00 0.00 ? 17 LYS A NZ   5  
ATOM 5500  H H    . LYS A 1 17 ? 2.301   -5.837  7.569   1.00 0.00 ? 17 LYS A H    5  
ATOM 5501  H HA   . LYS A 1 17 ? 3.162   -7.834  9.420   1.00 0.00 ? 17 LYS A HA   5  
ATOM 5502  H HB2  . LYS A 1 17 ? 3.021   -5.675  10.360  1.00 0.00 ? 17 LYS A HB2  5  
ATOM 5503  H HB3  . LYS A 1 17 ? 1.407   -5.392  9.708   1.00 0.00 ? 17 LYS A HB3  5  
ATOM 5504  H HG2  . LYS A 1 17 ? 0.363   -6.704  11.345  1.00 0.00 ? 17 LYS A HG2  5  
ATOM 5505  H HG3  . LYS A 1 17 ? 1.814   -7.648  11.664  1.00 0.00 ? 17 LYS A HG3  5  
ATOM 5506  H HD2  . LYS A 1 17 ? 2.844   -5.609  12.695  1.00 0.00 ? 17 LYS A HD2  5  
ATOM 5507  H HD3  . LYS A 1 17 ? 1.298   -4.781  12.492  1.00 0.00 ? 17 LYS A HD3  5  
ATOM 5508  H HE2  . LYS A 1 17 ? 0.177   -6.342  13.936  1.00 0.00 ? 17 LYS A HE2  5  
ATOM 5509  H HE3  . LYS A 1 17 ? 1.576   -7.416  13.967  1.00 0.00 ? 17 LYS A HE3  5  
ATOM 5510  H HZ1  . LYS A 1 17 ? 2.219   -4.748  14.781  1.00 0.00 ? 17 LYS A HZ1  5  
ATOM 5511  H HZ2  . LYS A 1 17 ? 2.519   -6.223  15.570  1.00 0.00 ? 17 LYS A HZ2  5  
ATOM 5512  H HZ3  . LYS A 1 17 ? 1.024   -5.441  15.765  1.00 0.00 ? 17 LYS A HZ3  5  
ATOM 5513  N N    . LEU A 1 18 ? 0.070   -7.896  8.382   1.00 0.00 ? 18 LEU A N    5  
ATOM 5514  C CA   . LEU A 1 18 ? -1.162  -8.720  8.311   1.00 0.00 ? 18 LEU A CA   5  
ATOM 5515  C C    . LEU A 1 18 ? -0.798  -10.033 7.607   1.00 0.00 ? 18 LEU A C    5  
ATOM 5516  O O    . LEU A 1 18 ? -1.265  -11.095 7.966   1.00 0.00 ? 18 LEU A O    5  
ATOM 5517  C CB   . LEU A 1 18 ? -2.247  -7.956  7.518   1.00 0.00 ? 18 LEU A CB   5  
ATOM 5518  C CG   . LEU A 1 18 ? -2.861  -6.726  8.292   1.00 0.00 ? 18 LEU A CG   5  
ATOM 5519  C CD1  . LEU A 1 18 ? -4.368  -6.919  8.484   1.00 0.00 ? 18 LEU A CD1  5  
ATOM 5520  C CD2  . LEU A 1 18 ? -2.244  -6.496  9.684   1.00 0.00 ? 18 LEU A CD2  5  
ATOM 5521  H H    . LEU A 1 18 ? 0.156   -7.103  7.811   1.00 0.00 ? 18 LEU A H    5  
ATOM 5522  H HA   . LEU A 1 18 ? -1.516  -8.965  9.297   1.00 0.00 ? 18 LEU A HA   5  
ATOM 5523  H HB2  . LEU A 1 18 ? -1.807  -7.602  6.604   1.00 0.00 ? 18 LEU A HB2  5  
ATOM 5524  H HB3  . LEU A 1 18 ? -3.027  -8.643  7.261   1.00 0.00 ? 18 LEU A HB3  5  
ATOM 5525  H HG   . LEU A 1 18 ? -2.711  -5.833  7.696   1.00 0.00 ? 18 LEU A HG   5  
ATOM 5526  H HD11 . LEU A 1 18 ? -4.823  -7.158  7.534   1.00 0.00 ? 18 LEU A HD11 5  
ATOM 5527  H HD12 . LEU A 1 18 ? -4.797  -6.008  8.874   1.00 0.00 ? 18 LEU A HD12 5  
ATOM 5528  H HD13 . LEU A 1 18 ? -4.540  -7.720  9.182   1.00 0.00 ? 18 LEU A HD13 5  
ATOM 5529  H HD21 . LEU A 1 18 ? -2.600  -5.552  10.070  1.00 0.00 ? 18 LEU A HD21 5  
ATOM 5530  H HD22 . LEU A 1 18 ? -1.176  -6.461  9.614   1.00 0.00 ? 18 LEU A HD22 5  
ATOM 5531  H HD23 . LEU A 1 18 ? -2.545  -7.283  10.356  1.00 0.00 ? 18 LEU A HD23 5  
ATOM 5532  N N    . ILE A 1 19 ? 0.072   -9.965  6.635   1.00 0.00 ? 19 ILE A N    5  
ATOM 5533  C CA   . ILE A 1 19 ? 0.519   -11.198 5.930   1.00 0.00 ? 19 ILE A CA   5  
ATOM 5534  C C    . ILE A 1 19 ? 1.417   -11.964 6.895   1.00 0.00 ? 19 ILE A C    5  
ATOM 5535  O O    . ILE A 1 19 ? 1.466   -13.178 6.898   1.00 0.00 ? 19 ILE A O    5  
ATOM 5536  C CB   . ILE A 1 19 ? 1.312   -10.819 4.665   1.00 0.00 ? 19 ILE A CB   5  
ATOM 5537  C CG1  . ILE A 1 19 ? 0.364   -10.142 3.662   1.00 0.00 ? 19 ILE A CG1  5  
ATOM 5538  C CG2  . ILE A 1 19 ? 1.920   -12.072 4.028   1.00 0.00 ? 19 ILE A CG2  5  
ATOM 5539  C CD1  . ILE A 1 19 ? 1.144   -9.674  2.429   1.00 0.00 ? 19 ILE A CD1  5  
ATOM 5540  H H    . ILE A 1 19 ? 0.455   -9.104  6.393   1.00 0.00 ? 19 ILE A H    5  
ATOM 5541  H HA   . ILE A 1 19 ? -0.338  -11.801 5.666   1.00 0.00 ? 19 ILE A HA   5  
ATOM 5542  H HB   . ILE A 1 19 ? 2.110   -10.139 4.932   1.00 0.00 ? 19 ILE A HB   5  
ATOM 5543  H HG12 . ILE A 1 19 ? -0.398  -10.841 3.359   1.00 0.00 ? 19 ILE A HG12 5  
ATOM 5544  H HG13 . ILE A 1 19 ? -0.105  -9.294  4.127   1.00 0.00 ? 19 ILE A HG13 5  
ATOM 5545  H HG21 . ILE A 1 19 ? 1.140   -12.789 3.824   1.00 0.00 ? 19 ILE A HG21 5  
ATOM 5546  H HG22 . ILE A 1 19 ? 2.644   -12.507 4.700   1.00 0.00 ? 19 ILE A HG22 5  
ATOM 5547  H HG23 . ILE A 1 19 ? 2.412   -11.804 3.105   1.00 0.00 ? 19 ILE A HG23 5  
ATOM 5548  H HD11 . ILE A 1 19 ? 0.508   -9.059  1.810   1.00 0.00 ? 19 ILE A HD11 5  
ATOM 5549  H HD12 . ILE A 1 19 ? 1.473   -10.533 1.862   1.00 0.00 ? 19 ILE A HD12 5  
ATOM 5550  H HD13 . ILE A 1 19 ? 2.003   -9.102  2.743   1.00 0.00 ? 19 ILE A HD13 5  
ATOM 5551  N N    . ASP A 1 20 ? 2.134   -11.245 7.713   1.00 0.00 ? 20 ASP A N    5  
ATOM 5552  C CA   . ASP A 1 20 ? 3.046   -11.892 8.690   1.00 0.00 ? 20 ASP A CA   5  
ATOM 5553  C C    . ASP A 1 20 ? 2.251   -12.476 9.858   1.00 0.00 ? 20 ASP A C    5  
ATOM 5554  O O    . ASP A 1 20 ? 2.722   -13.371 10.533  1.00 0.00 ? 20 ASP A O    5  
ATOM 5555  C CB   . ASP A 1 20 ? 4.033   -10.850 9.223   1.00 0.00 ? 20 ASP A CB   5  
ATOM 5556  C CG   . ASP A 1 20 ? 5.131   -11.551 10.026  1.00 0.00 ? 20 ASP A CG   5  
ATOM 5557  O OD1  . ASP A 1 20 ? 6.084   -12.006 9.416   1.00 0.00 ? 20 ASP A OD1  5  
ATOM 5558  O OD2  . ASP A 1 20 ? 5.000   -11.619 11.237  1.00 0.00 ? 20 ASP A OD2  5  
ATOM 5559  H H    . ASP A 1 20 ? 2.073   -10.267 7.685   1.00 0.00 ? 20 ASP A H    5  
ATOM 5560  H HA   . ASP A 1 20 ? 3.597   -12.687 8.213   1.00 0.00 ? 20 ASP A HA   5  
ATOM 5561  H HB2  . ASP A 1 20 ? 4.475   -10.316 8.395   1.00 0.00 ? 20 ASP A HB2  5  
ATOM 5562  H HB3  . ASP A 1 20 ? 3.511   -10.154 9.862   1.00 0.00 ? 20 ASP A HB3  5  
ATOM 5563  N N    . ASN A 1 21 ? 1.055   -11.987 10.123  1.00 0.00 ? 21 ASN A N    5  
ATOM 5564  C CA   . ASN A 1 21 ? 0.272   -12.548 11.276  1.00 0.00 ? 21 ASN A CA   5  
ATOM 5565  C C    . ASN A 1 21 ? -0.561  -13.745 10.793  1.00 0.00 ? 21 ASN A C    5  
ATOM 5566  O O    . ASN A 1 21 ? -1.238  -14.379 11.574  1.00 0.00 ? 21 ASN A O    5  
ATOM 5567  C CB   . ASN A 1 21 ? -0.610  -11.474 11.915  1.00 0.00 ? 21 ASN A CB   5  
ATOM 5568  C CG   . ASN A 1 21 ? -1.321  -12.058 13.138  1.00 0.00 ? 21 ASN A CG   5  
ATOM 5569  O OD1  . ASN A 1 21 ? -2.273  -11.487 13.633  1.00 0.00 ? 21 ASN A OD1  5  
ATOM 5570  N ND2  . ASN A 1 21 ? -0.895  -13.179 13.651  1.00 0.00 ? 21 ASN A ND2  5  
ATOM 5571  H H    . ASN A 1 21 ? 0.687   -11.267 9.569   1.00 0.00 ? 21 ASN A H    5  
ATOM 5572  H HA   . ASN A 1 21 ? 0.985   -12.935 11.991  1.00 0.00 ? 21 ASN A HA   5  
ATOM 5573  H HB2  . ASN A 1 21 ? 0.004   -10.636 12.221  1.00 0.00 ? 21 ASN A HB2  5  
ATOM 5574  H HB3  . ASN A 1 21 ? -1.346  -11.139 11.200  1.00 0.00 ? 21 ASN A HB3  5  
ATOM 5575  H HD21 . ASN A 1 21 ? -0.127  -13.639 13.253  1.00 0.00 ? 21 ASN A HD21 5  
ATOM 5576  H HD22 . ASN A 1 21 ? -1.343  -13.562 14.434  1.00 0.00 ? 21 ASN A HD22 5  
ATOM 5577  N N    . ASN A 1 22 ? -0.455  -14.096 9.530   1.00 0.00 ? 22 ASN A N    5  
ATOM 5578  C CA   . ASN A 1 22 ? -1.172  -15.312 8.996   1.00 0.00 ? 22 ASN A CA   5  
ATOM 5579  C C    . ASN A 1 22 ? -2.652  -15.049 8.676   1.00 0.00 ? 22 ASN A C    5  
ATOM 5580  O O    . ASN A 1 22 ? -3.492  -15.884 8.947   1.00 0.00 ? 22 ASN A O    5  
ATOM 5581  C CB   . ASN A 1 22 ? -1.078  -16.456 10.032  1.00 0.00 ? 22 ASN A CB   5  
ATOM 5582  C CG   . ASN A 1 22 ? -1.088  -17.816 9.321   1.00 0.00 ? 22 ASN A CG   5  
ATOM 5583  O OD1  . ASN A 1 22 ? -1.906  -18.664 9.618   1.00 0.00 ? 22 ASN A OD1  5  
ATOM 5584  N ND2  . ASN A 1 22 ? -0.208  -18.058 8.389   1.00 0.00 ? 22 ASN A ND2  5  
ATOM 5585  H H    . ASN A 1 22 ? 0.140   -13.586 8.932   1.00 0.00 ? 22 ASN A H    5  
ATOM 5586  H HA   . ASN A 1 22 ? -0.654  -15.630 8.102   1.00 0.00 ? 22 ASN A HA   5  
ATOM 5587  H HB2  . ASN A 1 22 ? -0.160  -16.355 10.592  1.00 0.00 ? 22 ASN A HB2  5  
ATOM 5588  H HB3  . ASN A 1 22 ? -1.917  -16.409 10.712  1.00 0.00 ? 22 ASN A HB3  5  
ATOM 5589  H HD21 . ASN A 1 22 ? 0.452   -17.373 8.149   1.00 0.00 ? 22 ASN A HD21 5  
ATOM 5590  H HD22 . ASN A 1 22 ? -0.206  -18.922 7.929   1.00 0.00 ? 22 ASN A HD22 5  
ATOM 5591  N N    . LYS A 1 23 ? -2.995  -13.930 8.100   1.00 0.00 ? 23 LYS A N    5  
ATOM 5592  C CA   . LYS A 1 23 ? -4.439  -13.676 7.772   1.00 0.00 ? 23 LYS A CA   5  
ATOM 5593  C C    . LYS A 1 23 ? -4.682  -14.062 6.307   1.00 0.00 ? 23 LYS A C    5  
ATOM 5594  O O    . LYS A 1 23 ? -3.792  -14.011 5.481   1.00 0.00 ? 23 LYS A O    5  
ATOM 5595  C CB   . LYS A 1 23 ? -4.759  -12.198 7.992   1.00 0.00 ? 23 LYS A CB   5  
ATOM 5596  C CG   . LYS A 1 23 ? -4.105  -11.684 9.313   1.00 0.00 ? 23 LYS A CG   5  
ATOM 5597  C CD   . LYS A 1 23 ? -5.147  -11.039 10.247  1.00 0.00 ? 23 LYS A CD   5  
ATOM 5598  C CE   . LYS A 1 23 ? -4.533  -10.845 11.633  1.00 0.00 ? 23 LYS A CE   5  
ATOM 5599  N NZ   . LYS A 1 23 ? -4.087  -12.160 12.172  1.00 0.00 ? 23 LYS A NZ   5  
ATOM 5600  H H    . LYS A 1 23 ? -2.314  -13.262 7.875   1.00 0.00 ? 23 LYS A H    5  
ATOM 5601  H HA   . LYS A 1 23 ? -5.069  -14.252 8.415   1.00 0.00 ? 23 LYS A HA   5  
ATOM 5602  H HB2  . LYS A 1 23 ? -4.377  -11.653 7.154   1.00 0.00 ? 23 LYS A HB2  5  
ATOM 5603  H HB3  . LYS A 1 23 ? -5.833  -12.073 8.041   1.00 0.00 ? 23 LYS A HB3  5  
ATOM 5604  H HG2  . LYS A 1 23 ? -3.644  -12.504 9.839   1.00 0.00 ? 23 LYS A HG2  5  
ATOM 5605  H HG3  . LYS A 1 23 ? -3.351  -10.951 9.076   1.00 0.00 ? 23 LYS A HG3  5  
ATOM 5606  H HD2  . LYS A 1 23 ? -5.449  -10.077 9.854   1.00 0.00 ? 23 LYS A HD2  5  
ATOM 5607  H HD3  . LYS A 1 23 ? -6.005  -11.686 10.335  1.00 0.00 ? 23 LYS A HD3  5  
ATOM 5608  H HE2  . LYS A 1 23 ? -3.689  -10.179 11.560  1.00 0.00 ? 23 LYS A HE2  5  
ATOM 5609  H HE3  . LYS A 1 23 ? -5.274  -10.419 12.292  1.00 0.00 ? 23 LYS A HE3  5  
ATOM 5610  H HZ1  . LYS A 1 23 ? -3.122  -12.362 11.840  1.00 0.00 ? 23 LYS A HZ1  5  
ATOM 5611  H HZ2  . LYS A 1 23 ? -4.731  -12.907 11.842  1.00 0.00 ? 23 LYS A HZ2  5  
ATOM 5612  H HZ3  . LYS A 1 23 ? -4.092  -12.129 13.211  1.00 0.00 ? 23 LYS A HZ3  5  
ATOM 5613  N N    . THR A 1 24 ? -5.890  -14.456 5.989   1.00 0.00 ? 24 THR A N    5  
ATOM 5614  C CA   . THR A 1 24 ? -6.221  -14.857 4.591   1.00 0.00 ? 24 THR A CA   5  
ATOM 5615  C C    . THR A 1 24 ? -6.472  -13.622 3.720   1.00 0.00 ? 24 THR A C    5  
ATOM 5616  O O    . THR A 1 24 ? -6.692  -12.536 4.215   1.00 0.00 ? 24 THR A O    5  
ATOM 5617  C CB   . THR A 1 24 ? -7.488  -15.731 4.592   1.00 0.00 ? 24 THR A CB   5  
ATOM 5618  O OG1  . THR A 1 24 ? -8.630  -14.911 4.376   1.00 0.00 ? 24 THR A OG1  5  
ATOM 5619  C CG2  . THR A 1 24 ? -7.629  -16.444 5.936   1.00 0.00 ? 24 THR A CG2  5  
ATOM 5620  H H    . THR A 1 24 ? -6.587  -14.497 6.676   1.00 0.00 ? 24 THR A H    5  
ATOM 5621  H HA   . THR A 1 24 ? -5.401  -15.416 4.163   1.00 0.00 ? 24 THR A HA   5  
ATOM 5622  H HB   . THR A 1 24 ? -7.424  -16.468 3.805   1.00 0.00 ? 24 THR A HB   5  
ATOM 5623  H HG1  . THR A 1 24 ? -8.525  -14.113 4.899   1.00 0.00 ? 24 THR A HG1  5  
ATOM 5624  H HG21 . THR A 1 24 ? -6.691  -16.905 6.201   1.00 0.00 ? 24 THR A HG21 5  
ATOM 5625  H HG22 . THR A 1 24 ? -8.395  -17.201 5.861   1.00 0.00 ? 24 THR A HG22 5  
ATOM 5626  H HG23 . THR A 1 24 ? -7.905  -15.729 6.696   1.00 0.00 ? 24 THR A HG23 5  
ATOM 5627  N N    . GLU A 1 25 ? -6.467  -13.792 2.427   1.00 0.00 ? 25 GLU A N    5  
ATOM 5628  C CA   . GLU A 1 25 ? -6.729  -12.636 1.515   1.00 0.00 ? 25 GLU A CA   5  
ATOM 5629  C C    . GLU A 1 25 ? -8.088  -12.023 1.882   1.00 0.00 ? 25 GLU A C    5  
ATOM 5630  O O    . GLU A 1 25 ? -8.239  -10.821 1.970   1.00 0.00 ? 25 GLU A O    5  
ATOM 5631  C CB   . GLU A 1 25 ? -6.753  -13.138 0.066   1.00 0.00 ? 25 GLU A CB   5  
ATOM 5632  C CG   . GLU A 1 25 ? -6.664  -11.956 -0.900  1.00 0.00 ? 25 GLU A CG   5  
ATOM 5633  C CD   . GLU A 1 25 ? -7.114  -12.397 -2.296  1.00 0.00 ? 25 GLU A CD   5  
ATOM 5634  O OE1  . GLU A 1 25 ? -6.594  -13.389 -2.779  1.00 0.00 ? 25 GLU A OE1  5  
ATOM 5635  O OE2  . GLU A 1 25 ? -7.972  -11.734 -2.856  1.00 0.00 ? 25 GLU A OE2  5  
ATOM 5636  H H    . GLU A 1 25 ? -6.305  -14.689 2.066   1.00 0.00 ? 25 GLU A H    5  
ATOM 5637  H HA   . GLU A 1 25 ? -5.952  -11.893 1.643   1.00 0.00 ? 25 GLU A HA   5  
ATOM 5638  H HB2  . GLU A 1 25 ? -5.913  -13.798 -0.096  1.00 0.00 ? 25 GLU A HB2  5  
ATOM 5639  H HB3  . GLU A 1 25 ? -7.672  -13.677 -0.108  1.00 0.00 ? 25 GLU A HB3  5  
ATOM 5640  H HG2  . GLU A 1 25 ? -7.302  -11.157 -0.553  1.00 0.00 ? 25 GLU A HG2  5  
ATOM 5641  H HG3  . GLU A 1 25 ? -5.643  -11.611 -0.949  1.00 0.00 ? 25 GLU A HG3  5  
ATOM 5642  N N    . LYS A 1 26 ? -9.079  -12.852 2.081   1.00 0.00 ? 26 LYS A N    5  
ATOM 5643  C CA   . LYS A 1 26 ? -10.444 -12.351 2.428   1.00 0.00 ? 26 LYS A CA   5  
ATOM 5644  C C    . LYS A 1 26 ? -10.404 -11.459 3.684   1.00 0.00 ? 26 LYS A C    5  
ATOM 5645  O O    . LYS A 1 26 ? -11.177 -10.531 3.813   1.00 0.00 ? 26 LYS A O    5  
ATOM 5646  C CB   . LYS A 1 26 ? -11.377 -13.562 2.654   1.00 0.00 ? 26 LYS A CB   5  
ATOM 5647  C CG   . LYS A 1 26 ? -12.802 -13.249 2.173   1.00 0.00 ? 26 LYS A CG   5  
ATOM 5648  C CD   . LYS A 1 26 ? -13.331 -11.989 2.873   1.00 0.00 ? 26 LYS A CD   5  
ATOM 5649  C CE   . LYS A 1 26 ? -14.860 -11.955 2.795   1.00 0.00 ? 26 LYS A CE   5  
ATOM 5650  N NZ   . LYS A 1 26 ? -15.422 -13.082 3.592   1.00 0.00 ? 26 LYS A NZ   5  
ATOM 5651  H H    . LYS A 1 26 ? -8.929  -13.813 1.987   1.00 0.00 ? 26 LYS A H    5  
ATOM 5652  H HA   . LYS A 1 26 ? -10.819 -11.759 1.615   1.00 0.00 ? 26 LYS A HA   5  
ATOM 5653  H HB2  . LYS A 1 26 ? -10.996 -14.406 2.100   1.00 0.00 ? 26 LYS A HB2  5  
ATOM 5654  H HB3  . LYS A 1 26 ? -11.403 -13.813 3.704   1.00 0.00 ? 26 LYS A HB3  5  
ATOM 5655  H HG2  . LYS A 1 26 ? -12.791 -13.087 1.105   1.00 0.00 ? 26 LYS A HG2  5  
ATOM 5656  H HG3  . LYS A 1 26 ? -13.447 -14.084 2.403   1.00 0.00 ? 26 LYS A HG3  5  
ATOM 5657  H HD2  . LYS A 1 26 ? -13.024 -11.992 3.909   1.00 0.00 ? 26 LYS A HD2  5  
ATOM 5658  H HD3  . LYS A 1 26 ? -12.932 -11.113 2.382   1.00 0.00 ? 26 LYS A HD3  5  
ATOM 5659  H HE2  . LYS A 1 26 ? -15.220 -11.018 3.193   1.00 0.00 ? 26 LYS A HE2  5  
ATOM 5660  H HE3  . LYS A 1 26 ? -15.170 -12.052 1.765   1.00 0.00 ? 26 LYS A HE3  5  
ATOM 5661  H HZ1  . LYS A 1 26 ? -15.634 -13.881 2.961   1.00 0.00 ? 26 LYS A HZ1  5  
ATOM 5662  H HZ2  . LYS A 1 26 ? -16.296 -12.770 4.063   1.00 0.00 ? 26 LYS A HZ2  5  
ATOM 5663  H HZ3  . LYS A 1 26 ? -14.730 -13.382 4.307   1.00 0.00 ? 26 LYS A HZ3  5  
ATOM 5664  N N    . GLU A 1 27 ? -9.526  -11.722 4.608   1.00 0.00 ? 27 GLU A N    5  
ATOM 5665  C CA   . GLU A 1 27 ? -9.477  -10.871 5.837   1.00 0.00 ? 27 GLU A CA   5  
ATOM 5666  C C    . GLU A 1 27 ? -8.811  -9.522  5.526   1.00 0.00 ? 27 GLU A C    5  
ATOM 5667  O O    . GLU A 1 27 ? -9.178  -8.505  6.080   1.00 0.00 ? 27 GLU A O    5  
ATOM 5668  C CB   . GLU A 1 27 ? -8.665  -11.567 6.933   1.00 0.00 ? 27 GLU A CB   5  
ATOM 5669  C CG   . GLU A 1 27 ? -9.469  -12.706 7.555   1.00 0.00 ? 27 GLU A CG   5  
ATOM 5670  C CD   . GLU A 1 27 ? -8.584  -13.473 8.541   1.00 0.00 ? 27 GLU A CD   5  
ATOM 5671  O OE1  . GLU A 1 27 ? -7.764  -12.840 9.186   1.00 0.00 ? 27 GLU A OE1  5  
ATOM 5672  O OE2  . GLU A 1 27 ? -8.743  -14.679 8.634   1.00 0.00 ? 27 GLU A OE2  5  
ATOM 5673  H H    . GLU A 1 27 ? -8.904  -12.471 4.493   1.00 0.00 ? 27 GLU A H    5  
ATOM 5674  H HA   . GLU A 1 27 ? -10.482 -10.699 6.193   1.00 0.00 ? 27 GLU A HA   5  
ATOM 5675  H HB2  . GLU A 1 27 ? -7.756  -11.961 6.511   1.00 0.00 ? 27 GLU A HB2  5  
ATOM 5676  H HB3  . GLU A 1 27 ? -8.428  -10.849 7.698   1.00 0.00 ? 27 GLU A HB3  5  
ATOM 5677  H HG2  . GLU A 1 27 ? -10.318 -12.300 8.079   1.00 0.00 ? 27 GLU A HG2  5  
ATOM 5678  H HG3  . GLU A 1 27 ? -9.803  -13.375 6.784   1.00 0.00 ? 27 GLU A HG3  5  
ATOM 5679  N N    . ILE A 1 28 ? -7.831  -9.497  4.667   1.00 0.00 ? 28 ILE A N    5  
ATOM 5680  C CA   . ILE A 1 28 ? -7.150  -8.207  4.360   1.00 0.00 ? 28 ILE A CA   5  
ATOM 5681  C C    . ILE A 1 28 ? -8.137  -7.270  3.674   1.00 0.00 ? 28 ILE A C    5  
ATOM 5682  O O    . ILE A 1 28 ? -8.169  -6.085  3.942   1.00 0.00 ? 28 ILE A O    5  
ATOM 5683  C CB   . ILE A 1 28 ? -5.936  -8.510  3.464   1.00 0.00 ? 28 ILE A CB   5  
ATOM 5684  C CG1  . ILE A 1 28 ? -5.225  -9.771  4.036   1.00 0.00 ? 28 ILE A CG1  5  
ATOM 5685  C CG2  . ILE A 1 28 ? -5.000  -7.297  3.412   1.00 0.00 ? 28 ILE A CG2  5  
ATOM 5686  C CD1  . ILE A 1 28 ? -3.695  -9.700  3.944   1.00 0.00 ? 28 ILE A CD1  5  
ATOM 5687  H H    . ILE A 1 28 ? -7.537  -10.322 4.227   1.00 0.00 ? 28 ILE A H    5  
ATOM 5688  H HA   . ILE A 1 28 ? -6.825  -7.759  5.288   1.00 0.00 ? 28 ILE A HA   5  
ATOM 5689  H HB   . ILE A 1 28 ? -6.286  -8.718  2.465   1.00 0.00 ? 28 ILE A HB   5  
ATOM 5690  H HG12 . ILE A 1 28 ? -5.493  -9.885  5.064   1.00 0.00 ? 28 ILE A HG12 5  
ATOM 5691  H HG13 . ILE A 1 28 ? -5.563  -10.637 3.499   1.00 0.00 ? 28 ILE A HG13 5  
ATOM 5692  H HG21 . ILE A 1 28 ? -5.558  -6.430  3.100   1.00 0.00 ? 28 ILE A HG21 5  
ATOM 5693  H HG22 . ILE A 1 28 ? -4.210  -7.486  2.700   1.00 0.00 ? 28 ILE A HG22 5  
ATOM 5694  H HG23 . ILE A 1 28 ? -4.574  -7.122  4.388   1.00 0.00 ? 28 ILE A HG23 5  
ATOM 5695  H HD11 . ILE A 1 28 ? -3.400  -9.520  2.921   1.00 0.00 ? 28 ILE A HD11 5  
ATOM 5696  H HD12 . ILE A 1 28 ? -3.278  -10.643 4.284   1.00 0.00 ? 28 ILE A HD12 5  
ATOM 5697  H HD13 . ILE A 1 28 ? -3.331  -8.904  4.575   1.00 0.00 ? 28 ILE A HD13 5  
ATOM 5698  N N    . LEU A 1 29 ? -8.952  -7.782  2.804   1.00 0.00 ? 29 LEU A N    5  
ATOM 5699  C CA   . LEU A 1 29 ? -9.941  -6.914  2.117   1.00 0.00 ? 29 LEU A CA   5  
ATOM 5700  C C    . LEU A 1 29 ? -11.064 -6.540  3.095   1.00 0.00 ? 29 LEU A C    5  
ATOM 5701  O O    . LEU A 1 29 ? -11.645 -5.480  3.015   1.00 0.00 ? 29 LEU A O    5  
ATOM 5702  C CB   . LEU A 1 29 ? -10.505 -7.677  0.920   1.00 0.00 ? 29 LEU A CB   5  
ATOM 5703  C CG   . LEU A 1 29 ? -9.343  -8.158  0.038   1.00 0.00 ? 29 LEU A CG   5  
ATOM 5704  C CD1  . LEU A 1 29 ? -9.895  -9.036  -1.090  1.00 0.00 ? 29 LEU A CD1  5  
ATOM 5705  C CD2  . LEU A 1 29 ? -8.606  -6.947  -0.566  1.00 0.00 ? 29 LEU A CD2  5  
ATOM 5706  H H    . LEU A 1 29 ? -8.917  -8.737  2.586   1.00 0.00 ? 29 LEU A H    5  
ATOM 5707  H HA   . LEU A 1 29 ? -9.455  -6.014  1.775   1.00 0.00 ? 29 LEU A HA   5  
ATOM 5708  H HB2  . LEU A 1 29 ? -11.068 -8.532  1.271   1.00 0.00 ? 29 LEU A HB2  5  
ATOM 5709  H HB3  . LEU A 1 29 ? -11.149 -7.029  0.345   1.00 0.00 ? 29 LEU A HB3  5  
ATOM 5710  H HG   . LEU A 1 29 ? -8.651  -8.740  0.642   1.00 0.00 ? 29 LEU A HG   5  
ATOM 5711  H HD11 . LEU A 1 29 ? -10.760 -8.559  -1.528  1.00 0.00 ? 29 LEU A HD11 5  
ATOM 5712  H HD12 . LEU A 1 29 ? -10.180 -9.998  -0.690  1.00 0.00 ? 29 LEU A HD12 5  
ATOM 5713  H HD13 . LEU A 1 29 ? -9.137  -9.171  -1.846  1.00 0.00 ? 29 LEU A HD13 5  
ATOM 5714  H HD21 . LEU A 1 29 ? -9.318  -6.176  -0.821  1.00 0.00 ? 29 LEU A HD21 5  
ATOM 5715  H HD22 . LEU A 1 29 ? -8.074  -7.250  -1.455  1.00 0.00 ? 29 LEU A HD22 5  
ATOM 5716  H HD23 . LEU A 1 29 ? -7.900  -6.559  0.155   1.00 0.00 ? 29 LEU A HD23 5  
ATOM 5717  N N    . ASP A 1 30 ? -11.359 -7.400  4.031   1.00 0.00 ? 30 ASP A N    5  
ATOM 5718  C CA   . ASP A 1 30 ? -12.423 -7.078  5.030   1.00 0.00 ? 30 ASP A CA   5  
ATOM 5719  C C    . ASP A 1 30 ? -11.926 -5.930  5.918   1.00 0.00 ? 30 ASP A C    5  
ATOM 5720  O O    . ASP A 1 30 ? -12.653 -5.001  6.212   1.00 0.00 ? 30 ASP A O    5  
ATOM 5721  C CB   . ASP A 1 30 ? -12.711 -8.311  5.890   1.00 0.00 ? 30 ASP A CB   5  
ATOM 5722  C CG   . ASP A 1 30 ? -13.908 -8.029  6.800   1.00 0.00 ? 30 ASP A CG   5  
ATOM 5723  O OD1  . ASP A 1 30 ? -15.026 -8.105  6.316   1.00 0.00 ? 30 ASP A OD1  5  
ATOM 5724  O OD2  . ASP A 1 30 ? -13.687 -7.742  7.965   1.00 0.00 ? 30 ASP A OD2  5  
ATOM 5725  H H    . ASP A 1 30 ? -10.875 -8.250  4.072   1.00 0.00 ? 30 ASP A H    5  
ATOM 5726  H HA   . ASP A 1 30 ? -13.326 -6.762  4.527   1.00 0.00 ? 30 ASP A HA   5  
ATOM 5727  H HB2  . ASP A 1 30 ? -12.936 -9.151  5.249   1.00 0.00 ? 30 ASP A HB2  5  
ATOM 5728  H HB3  . ASP A 1 30 ? -11.847 -8.539  6.495   1.00 0.00 ? 30 ASP A HB3  5  
ATOM 5729  N N    . ALA A 1 31 ? -10.704 -6.002  6.367   1.00 0.00 ? 31 ALA A N    5  
ATOM 5730  C CA   . ALA A 1 31 ? -10.159 -4.937  7.262   1.00 0.00 ? 31 ALA A CA   5  
ATOM 5731  C C    . ALA A 1 31 ? -10.019 -3.605  6.500   1.00 0.00 ? 31 ALA A C    5  
ATOM 5732  O O    . ALA A 1 31 ? -10.048 -2.547  7.097   1.00 0.00 ? 31 ALA A O    5  
ATOM 5733  C CB   . ALA A 1 31 ? -8.793  -5.395  7.786   1.00 0.00 ? 31 ALA A CB   5  
ATOM 5734  H H    . ALA A 1 31 ? -10.145 -6.772  6.131   1.00 0.00 ? 31 ALA A H    5  
ATOM 5735  H HA   . ALA A 1 31 ? -10.826 -4.801  8.097   1.00 0.00 ? 31 ALA A HA   5  
ATOM 5736  H HB1  . ALA A 1 31 ? -8.870  -6.417  8.131   1.00 0.00 ? 31 ALA A HB1  5  
ATOM 5737  H HB2  . ALA A 1 31 ? -8.490  -4.764  8.607   1.00 0.00 ? 31 ALA A HB2  5  
ATOM 5738  H HB3  . ALA A 1 31 ? -8.064  -5.340  6.994   1.00 0.00 ? 31 ALA A HB3  5  
ATOM 5739  N N    . PHE A 1 32 ? -9.901  -3.629  5.204   1.00 0.00 ? 32 PHE A N    5  
ATOM 5740  C CA   . PHE A 1 32 ? -9.799  -2.345  4.433   1.00 0.00 ? 32 PHE A CA   5  
ATOM 5741  C C    . PHE A 1 32 ? -10.984 -1.444  4.792   1.00 0.00 ? 32 PHE A C    5  
ATOM 5742  O O    . PHE A 1 32 ? -10.974 -0.257  4.532   1.00 0.00 ? 32 PHE A O    5  
ATOM 5743  C CB   . PHE A 1 32 ? -9.840  -2.687  2.936   1.00 0.00 ? 32 PHE A CB   5  
ATOM 5744  C CG   . PHE A 1 32 ? -8.467  -3.113  2.421   1.00 0.00 ? 32 PHE A CG   5  
ATOM 5745  C CD1  . PHE A 1 32 ? -7.432  -3.524  3.294   1.00 0.00 ? 32 PHE A CD1  5  
ATOM 5746  C CD2  . PHE A 1 32 ? -8.229  -3.082  1.041   1.00 0.00 ? 32 PHE A CD2  5  
ATOM 5747  C CE1  . PHE A 1 32 ? -6.186  -3.889  2.776   1.00 0.00 ? 32 PHE A CE1  5  
ATOM 5748  C CE2  . PHE A 1 32 ? -6.979  -3.448  0.531   1.00 0.00 ? 32 PHE A CE2  5  
ATOM 5749  C CZ   . PHE A 1 32 ? -5.957  -3.847  1.399   1.00 0.00 ? 32 PHE A CZ   5  
ATOM 5750  H H    . PHE A 1 32 ? -9.901  -4.485  4.725   1.00 0.00 ? 32 PHE A H    5  
ATOM 5751  H HA   . PHE A 1 32 ? -8.873  -1.834  4.654   1.00 0.00 ? 32 PHE A HA   5  
ATOM 5752  H HB2  . PHE A 1 32 ? -10.539 -3.487  2.775   1.00 0.00 ? 32 PHE A HB2  5  
ATOM 5753  H HB3  . PHE A 1 32 ? -10.168 -1.819  2.381   1.00 0.00 ? 32 PHE A HB3  5  
ATOM 5754  H HD1  . PHE A 1 32 ? -7.589  -3.580  4.358   1.00 0.00 ? 32 PHE A HD1  5  
ATOM 5755  H HD2  . PHE A 1 32 ? -9.015  -2.777  0.367   1.00 0.00 ? 32 PHE A HD2  5  
ATOM 5756  H HE1  . PHE A 1 32 ? -5.394  -4.187  3.445   1.00 0.00 ? 32 PHE A HE1  5  
ATOM 5757  H HE2  . PHE A 1 32 ? -6.801  -3.422  -0.534  1.00 0.00 ? 32 PHE A HE2  5  
ATOM 5758  H HZ   . PHE A 1 32 ? -4.995  -4.131  1.005   1.00 0.00 ? 32 PHE A HZ   5  
ATOM 5759  N N    . ASP A 1 33 ? -12.014 -2.002  5.361   1.00 0.00 ? 33 ASP A N    5  
ATOM 5760  C CA   . ASP A 1 33 ? -13.209 -1.182  5.705   1.00 0.00 ? 33 ASP A CA   5  
ATOM 5761  C C    . ASP A 1 33 ? -12.953 -0.348  6.965   1.00 0.00 ? 33 ASP A C    5  
ATOM 5762  O O    . ASP A 1 33 ? -13.634 0.628   7.209   1.00 0.00 ? 33 ASP A O    5  
ATOM 5763  C CB   . ASP A 1 33 ? -14.401 -2.108  5.949   1.00 0.00 ? 33 ASP A CB   5  
ATOM 5764  C CG   . ASP A 1 33 ? -15.628 -1.276  6.326   1.00 0.00 ? 33 ASP A CG   5  
ATOM 5765  O OD1  . ASP A 1 33 ? -16.103 -0.539  5.479   1.00 0.00 ? 33 ASP A OD1  5  
ATOM 5766  O OD2  . ASP A 1 33 ? -16.073 -1.390  7.457   1.00 0.00 ? 33 ASP A OD2  5  
ATOM 5767  H H    . ASP A 1 33 ? -12.011 -2.964  5.545   1.00 0.00 ? 33 ASP A H    5  
ATOM 5768  H HA   . ASP A 1 33 ? -13.437 -0.521  4.883   1.00 0.00 ? 33 ASP A HA   5  
ATOM 5769  H HB2  . ASP A 1 33 ? -14.609 -2.671  5.051   1.00 0.00 ? 33 ASP A HB2  5  
ATOM 5770  H HB3  . ASP A 1 33 ? -14.170 -2.789  6.755   1.00 0.00 ? 33 ASP A HB3  5  
ATOM 5771  N N    . LYS A 1 34 ? -11.976 -0.712  7.764   1.00 0.00 ? 34 LYS A N    5  
ATOM 5772  C CA   . LYS A 1 34 ? -11.676 0.074   9.005   1.00 0.00 ? 34 LYS A CA   5  
ATOM 5773  C C    . LYS A 1 34 ? -10.173 0.361   9.086   1.00 0.00 ? 34 LYS A C    5  
ATOM 5774  O O    . LYS A 1 34 ? -9.676  0.804   10.103  1.00 0.00 ? 34 LYS A O    5  
ATOM 5775  C CB   . LYS A 1 34 ? -12.121 -0.714  10.244  1.00 0.00 ? 34 LYS A CB   5  
ATOM 5776  C CG   . LYS A 1 34 ? -11.608 -2.152  10.166  1.00 0.00 ? 34 LYS A CG   5  
ATOM 5777  C CD   . LYS A 1 34 ? -11.880 -2.870  11.493  1.00 0.00 ? 34 LYS A CD   5  
ATOM 5778  C CE   . LYS A 1 34 ? -13.388 -3.080  11.682  1.00 0.00 ? 34 LYS A CE   5  
ATOM 5779  N NZ   . LYS A 1 34 ? -13.613 -4.144  12.699  1.00 0.00 ? 34 LYS A NZ   5  
ATOM 5780  H H    . LYS A 1 34 ? -11.437 -1.502  7.553   1.00 0.00 ? 34 LYS A H    5  
ATOM 5781  H HA   . LYS A 1 34 ? -12.205 1.018   8.981   1.00 0.00 ? 34 LYS A HA   5  
ATOM 5782  H HB2  . LYS A 1 34 ? -11.725 -0.239  11.131  1.00 0.00 ? 34 LYS A HB2  5  
ATOM 5783  H HB3  . LYS A 1 34 ? -13.200 -0.722  10.293  1.00 0.00 ? 34 LYS A HB3  5  
ATOM 5784  H HG2  . LYS A 1 34 ? -12.113 -2.670  9.363   1.00 0.00 ? 34 LYS A HG2  5  
ATOM 5785  H HG3  . LYS A 1 34 ? -10.546 -2.145  9.978   1.00 0.00 ? 34 LYS A HG3  5  
ATOM 5786  H HD2  . LYS A 1 34 ? -11.383 -3.828  11.491  1.00 0.00 ? 34 LYS A HD2  5  
ATOM 5787  H HD3  . LYS A 1 34 ? -11.500 -2.271  12.308  1.00 0.00 ? 34 LYS A HD3  5  
ATOM 5788  H HE2  . LYS A 1 34 ? -13.840 -2.160  12.019  1.00 0.00 ? 34 LYS A HE2  5  
ATOM 5789  H HE3  . LYS A 1 34 ? -13.834 -3.380  10.745  1.00 0.00 ? 34 LYS A HE3  5  
ATOM 5790  H HZ1  . LYS A 1 34 ? -13.842 -5.039  12.222  1.00 0.00 ? 34 LYS A HZ1  5  
ATOM 5791  H HZ2  . LYS A 1 34 ? -14.403 -3.869  13.319  1.00 0.00 ? 34 LYS A HZ2  5  
ATOM 5792  H HZ3  . LYS A 1 34 ? -12.752 -4.269  13.269  1.00 0.00 ? 34 LYS A HZ3  5  
ATOM 5793  N N    . MET A 1 35 ? -9.436  0.118   8.028   1.00 0.00 ? 35 MET A N    5  
ATOM 5794  C CA   . MET A 1 35 ? -7.968  0.392   8.072   1.00 0.00 ? 35 MET A CA   5  
ATOM 5795  C C    . MET A 1 35 ? -7.741  1.892   7.840   1.00 0.00 ? 35 MET A C    5  
ATOM 5796  O O    . MET A 1 35 ? -6.922  2.498   8.502   1.00 0.00 ? 35 MET A O    5  
ATOM 5797  C CB   . MET A 1 35 ? -7.248  -0.442  6.984   1.00 0.00 ? 35 MET A CB   5  
ATOM 5798  C CG   . MET A 1 35 ? -5.921  -1.036  7.502   1.00 0.00 ? 35 MET A CG   5  
ATOM 5799  S SD   . MET A 1 35 ? -6.187  -2.737  8.080   1.00 0.00 ? 35 MET A SD   5  
ATOM 5800  C CE   . MET A 1 35 ? -5.485  -3.602  6.647   1.00 0.00 ? 35 MET A CE   5  
ATOM 5801  H H    . MET A 1 35 ? -9.847  -0.234  7.210   1.00 0.00 ? 35 MET A H    5  
ATOM 5802  H HA   . MET A 1 35 ? -7.595  0.127   9.052   1.00 0.00 ? 35 MET A HA   5  
ATOM 5803  H HB2  . MET A 1 35 ? -7.895  -1.242  6.692   1.00 0.00 ? 35 MET A HB2  5  
ATOM 5804  H HB3  . MET A 1 35 ? -7.043  0.174   6.116   1.00 0.00 ? 35 MET A HB3  5  
ATOM 5805  H HG2  . MET A 1 35 ? -5.203  -1.044  6.702   1.00 0.00 ? 35 MET A HG2  5  
ATOM 5806  H HG3  . MET A 1 35 ? -5.536  -0.436  8.314   1.00 0.00 ? 35 MET A HG3  5  
ATOM 5807  H HE1  . MET A 1 35 ? -4.405  -3.621  6.730   1.00 0.00 ? 35 MET A HE1  5  
ATOM 5808  H HE2  . MET A 1 35 ? -5.763  -3.090  5.740   1.00 0.00 ? 35 MET A HE2  5  
ATOM 5809  H HE3  . MET A 1 35 ? -5.868  -4.613  6.615   1.00 0.00 ? 35 MET A HE3  5  
ATOM 5810  N N    . CYS A 1 36 ? -8.448  2.515   6.929   1.00 0.00 ? 36 CYS A N    5  
ATOM 5811  C CA   . CYS A 1 36 ? -8.216  3.968   6.738   1.00 0.00 ? 36 CYS A CA   5  
ATOM 5812  C C    . CYS A 1 36 ? -8.643  4.656   8.033   1.00 0.00 ? 36 CYS A C    5  
ATOM 5813  O O    . CYS A 1 36 ? -8.562  5.862   8.167   1.00 0.00 ? 36 CYS A O    5  
ATOM 5814  C CB   . CYS A 1 36 ? -9.020  4.495   5.544   1.00 0.00 ? 36 CYS A CB   5  
ATOM 5815  S SG   . CYS A 1 36 ? -8.051  4.293   4.030   1.00 0.00 ? 36 CYS A SG   5  
ATOM 5816  H H    . CYS A 1 36 ? -9.121  2.043   6.394   1.00 0.00 ? 36 CYS A H    5  
ATOM 5817  H HA   . CYS A 1 36 ? -7.159  4.134   6.594   1.00 0.00 ? 36 CYS A HA   5  
ATOM 5818  H HB2  . CYS A 1 36 ? -9.941  3.938   5.457   1.00 0.00 ? 36 CYS A HB2  5  
ATOM 5819  H HB3  . CYS A 1 36 ? -9.245  5.542   5.687   1.00 0.00 ? 36 CYS A HB3  5  
ATOM 5820  N N    . SER A 1 37 ? -9.105  3.895   8.987   1.00 0.00 ? 37 SER A N    5  
ATOM 5821  C CA   . SER A 1 37 ? -9.549  4.504   10.279  1.00 0.00 ? 37 SER A CA   5  
ATOM 5822  C C    . SER A 1 37 ? -8.353  4.704   11.224  1.00 0.00 ? 37 SER A C    5  
ATOM 5823  O O    . SER A 1 37 ? -8.537  4.912   12.408  1.00 0.00 ? 37 SER A O    5  
ATOM 5824  C CB   . SER A 1 37 ? -10.569 3.581   10.948  1.00 0.00 ? 37 SER A CB   5  
ATOM 5825  O OG   . SER A 1 37 ? -11.265 4.303   11.956  1.00 0.00 ? 37 SER A OG   5  
ATOM 5826  H H    . SER A 1 37 ? -9.170  2.919   8.848   1.00 0.00 ? 37 SER A H    5  
ATOM 5827  H HA   . SER A 1 37 ? -10.012 5.461   10.085  1.00 0.00 ? 37 SER A HA   5  
ATOM 5828  H HB2  . SER A 1 37 ? -11.276 3.229   10.214  1.00 0.00 ? 37 SER A HB2  5  
ATOM 5829  H HB3  . SER A 1 37 ? -10.057 2.735   11.386  1.00 0.00 ? 37 SER A HB3  5  
ATOM 5830  H HG   . SER A 1 37 ? -12.171 3.990   11.975  1.00 0.00 ? 37 SER A HG   5  
ATOM 5831  N N    . LYS A 1 38 ? -7.135  4.649   10.726  1.00 0.00 ? 38 LYS A N    5  
ATOM 5832  C CA   . LYS A 1 38 ? -5.934  4.842   11.616  1.00 0.00 ? 38 LYS A CA   5  
ATOM 5833  C C    . LYS A 1 38 ? -5.112  6.057   11.146  1.00 0.00 ? 38 LYS A C    5  
ATOM 5834  O O    . LYS A 1 38 ? -4.121  6.414   11.752  1.00 0.00 ? 38 LYS A O    5  
ATOM 5835  C CB   . LYS A 1 38 ? -5.067  3.573   11.592  1.00 0.00 ? 38 LYS A CB   5  
ATOM 5836  C CG   . LYS A 1 38 ? -5.686  2.509   12.503  1.00 0.00 ? 38 LYS A CG   5  
ATOM 5837  C CD   . LYS A 1 38 ? -4.824  1.245   12.470  1.00 0.00 ? 38 LYS A CD   5  
ATOM 5838  C CE   . LYS A 1 38 ? -5.570  0.101   13.157  1.00 0.00 ? 38 LYS A CE   5  
ATOM 5839  N NZ   . LYS A 1 38 ? -5.929  0.505   14.547  1.00 0.00 ? 38 LYS A NZ   5  
ATOM 5840  H H    . LYS A 1 38 ? -7.009  4.482   9.768   1.00 0.00 ? 38 LYS A H    5  
ATOM 5841  H HA   . LYS A 1 38 ? -6.256  5.026   12.633  1.00 0.00 ? 38 LYS A HA   5  
ATOM 5842  H HB2  . LYS A 1 38 ? -5.013  3.188   10.586  1.00 0.00 ? 38 LYS A HB2  5  
ATOM 5843  H HB3  . LYS A 1 38 ? -4.073  3.806   11.945  1.00 0.00 ? 38 LYS A HB3  5  
ATOM 5844  H HG2  . LYS A 1 38 ? -5.735  2.887   13.515  1.00 0.00 ? 38 LYS A HG2  5  
ATOM 5845  H HG3  . LYS A 1 38 ? -6.680  2.273   12.157  1.00 0.00 ? 38 LYS A HG3  5  
ATOM 5846  H HD2  . LYS A 1 38 ? -4.618  0.978   11.444  1.00 0.00 ? 38 LYS A HD2  5  
ATOM 5847  H HD3  . LYS A 1 38 ? -3.894  1.429   12.988  1.00 0.00 ? 38 LYS A HD3  5  
ATOM 5848  H HE2  . LYS A 1 38 ? -6.470  -0.127  12.605  1.00 0.00 ? 38 LYS A HE2  5  
ATOM 5849  H HE3  . LYS A 1 38 ? -4.937  -0.774  13.190  1.00 0.00 ? 38 LYS A HE3  5  
ATOM 5850  H HZ1  . LYS A 1 38 ? -5.095  0.912   15.016  1.00 0.00 ? 38 LYS A HZ1  5  
ATOM 5851  H HZ2  . LYS A 1 38 ? -6.253  -0.330  15.077  1.00 0.00 ? 38 LYS A HZ2  5  
ATOM 5852  H HZ3  . LYS A 1 38 ? -6.688  1.214   14.516  1.00 0.00 ? 38 LYS A HZ3  5  
ATOM 5853  N N    . LEU A 1 39 ? -5.527  6.708   10.086  1.00 0.00 ? 39 LEU A N    5  
ATOM 5854  C CA   . LEU A 1 39 ? -4.789  7.918   9.581   1.00 0.00 ? 39 LEU A CA   5  
ATOM 5855  C C    . LEU A 1 39 ? -5.615  9.169   9.952   1.00 0.00 ? 39 LEU A C    5  
ATOM 5856  O O    . LEU A 1 39 ? -6.827  9.118   9.876   1.00 0.00 ? 39 LEU A O    5  
ATOM 5857  C CB   . LEU A 1 39 ? -4.665  7.820   8.057   1.00 0.00 ? 39 LEU A CB   5  
ATOM 5858  C CG   . LEU A 1 39 ? -3.977  6.500   7.679   1.00 0.00 ? 39 LEU A CG   5  
ATOM 5859  C CD1  . LEU A 1 39 ? -4.002  6.329   6.162   1.00 0.00 ? 39 LEU A CD1  5  
ATOM 5860  C CD2  . LEU A 1 39 ? -2.518  6.499   8.167   1.00 0.00 ? 39 LEU A CD2  5  
ATOM 5861  H H    . LEU A 1 39 ? -6.338  6.410   9.623   1.00 0.00 ? 39 LEU A H    5  
ATOM 5862  H HA   . LEU A 1 39 ? -3.808  7.966   10.017  1.00 0.00 ? 39 LEU A HA   5  
ATOM 5863  H HB2  . LEU A 1 39 ? -5.653  7.850   7.618   1.00 0.00 ? 39 LEU A HB2  5  
ATOM 5864  H HB3  . LEU A 1 39 ? -4.083  8.646   7.681   1.00 0.00 ? 39 LEU A HB3  5  
ATOM 5865  H HG   . LEU A 1 39 ? -4.510  5.682   8.131   1.00 0.00 ? 39 LEU A HG   5  
ATOM 5866  H HD11 . LEU A 1 39 ? -3.775  5.303   5.913   1.00 0.00 ? 39 LEU A HD11 5  
ATOM 5867  H HD12 . LEU A 1 39 ? -3.265  6.977   5.714   1.00 0.00 ? 39 LEU A HD12 5  
ATOM 5868  H HD13 . LEU A 1 39 ? -4.981  6.581   5.789   1.00 0.00 ? 39 LEU A HD13 5  
ATOM 5869  H HD21 . LEU A 1 39 ? -2.487  6.247   9.216   1.00 0.00 ? 39 LEU A HD21 5  
ATOM 5870  H HD22 . LEU A 1 39 ? -2.084  7.473   8.020   1.00 0.00 ? 39 LEU A HD22 5  
ATOM 5871  H HD23 . LEU A 1 39 ? -1.948  5.767   7.611   1.00 0.00 ? 39 LEU A HD23 5  
ATOM 5872  N N    . PRO A 1 40 ? -4.974  10.266  10.343  1.00 0.00 ? 40 PRO A N    5  
ATOM 5873  C CA   . PRO A 1 40 ? -5.719  11.491  10.708  1.00 0.00 ? 40 PRO A CA   5  
ATOM 5874  C C    . PRO A 1 40 ? -6.851  11.730  9.687   1.00 0.00 ? 40 PRO A C    5  
ATOM 5875  O O    . PRO A 1 40 ? -6.822  11.205  8.591   1.00 0.00 ? 40 PRO A O    5  
ATOM 5876  C CB   . PRO A 1 40 ? -4.645  12.606  10.719  1.00 0.00 ? 40 PRO A CB   5  
ATOM 5877  C CG   . PRO A 1 40 ? -3.254  11.902  10.673  1.00 0.00 ? 40 PRO A CG   5  
ATOM 5878  C CD   . PRO A 1 40 ? -3.502  10.395  10.451  1.00 0.00 ? 40 PRO A CD   5  
ATOM 5879  H HA   . PRO A 1 40 ? -6.141  11.371  11.695  1.00 0.00 ? 40 PRO A HA   5  
ATOM 5880  H HB2  . PRO A 1 40 ? -4.759  13.248  9.857   1.00 0.00 ? 40 PRO A HB2  5  
ATOM 5881  H HB3  . PRO A 1 40 ? -4.721  13.192  11.624  1.00 0.00 ? 40 PRO A HB3  5  
ATOM 5882  H HG2  . PRO A 1 40 ? -2.664  12.304  9.857   1.00 0.00 ? 40 PRO A HG2  5  
ATOM 5883  H HG3  . PRO A 1 40 ? -2.730  12.052  11.607  1.00 0.00 ? 40 PRO A HG3  5  
ATOM 5884  H HD2  . PRO A 1 40 ? -3.017  10.070  9.547   1.00 0.00 ? 40 PRO A HD2  5  
ATOM 5885  H HD3  . PRO A 1 40 ? -3.144  9.823   11.296  1.00 0.00 ? 40 PRO A HD3  5  
ATOM 5886  N N    . LYS A 1 41 ? -7.868  12.480  10.044  1.00 0.00 ? 41 LYS A N    5  
ATOM 5887  C CA   . LYS A 1 41 ? -9.002  12.694  9.094   1.00 0.00 ? 41 LYS A CA   5  
ATOM 5888  C C    . LYS A 1 41 ? -8.557  13.449  7.840   1.00 0.00 ? 41 LYS A C    5  
ATOM 5889  O O    . LYS A 1 41 ? -9.224  13.431  6.825   1.00 0.00 ? 41 LYS A O    5  
ATOM 5890  C CB   . LYS A 1 41 ? -10.154 13.445  9.771   1.00 0.00 ? 41 LYS A CB   5  
ATOM 5891  C CG   . LYS A 1 41 ? -11.469 13.190  8.997   1.00 0.00 ? 41 LYS A CG   5  
ATOM 5892  C CD   . LYS A 1 41 ? -12.167 11.938  9.541   1.00 0.00 ? 41 LYS A CD   5  
ATOM 5893  C CE   . LYS A 1 41 ? -13.410 11.643  8.699   1.00 0.00 ? 41 LYS A CE   5  
ATOM 5894  N NZ   . LYS A 1 41 ? -14.234 10.601  9.375   1.00 0.00 ? 41 LYS A NZ   5  
ATOM 5895  H H    . LYS A 1 41 ? -7.897  12.886  10.937  1.00 0.00 ? 41 LYS A H    5  
ATOM 5896  H HA   . LYS A 1 41 ? -9.360  11.736  8.743   1.00 0.00 ? 41 LYS A HA   5  
ATOM 5897  H HB2  . LYS A 1 41 ? -10.255 13.101  10.792  1.00 0.00 ? 41 LYS A HB2  5  
ATOM 5898  H HB3  . LYS A 1 41 ? -9.940  14.504  9.772   1.00 0.00 ? 41 LYS A HB3  5  
ATOM 5899  H HG2  . LYS A 1 41 ? -12.124 14.041  9.112   1.00 0.00 ? 41 LYS A HG2  5  
ATOM 5900  H HG3  . LYS A 1 41 ? -11.253 13.044  7.945   1.00 0.00 ? 41 LYS A HG3  5  
ATOM 5901  H HD2  . LYS A 1 41 ? -11.490 11.097  9.492   1.00 0.00 ? 41 LYS A HD2  5  
ATOM 5902  H HD3  . LYS A 1 41 ? -12.460 12.105  10.566  1.00 0.00 ? 41 LYS A HD3  5  
ATOM 5903  H HE2  . LYS A 1 41 ? -13.993 12.546  8.588   1.00 0.00 ? 41 LYS A HE2  5  
ATOM 5904  H HE3  . LYS A 1 41 ? -13.109 11.287  7.725   1.00 0.00 ? 41 LYS A HE3  5  
ATOM 5905  H HZ1  . LYS A 1 41 ? -13.782 9.671   9.259   1.00 0.00 ? 41 LYS A HZ1  5  
ATOM 5906  H HZ2  . LYS A 1 41 ? -15.184 10.582  8.951   1.00 0.00 ? 41 LYS A HZ2  5  
ATOM 5907  H HZ3  . LYS A 1 41 ? -14.310 10.822  10.388  1.00 0.00 ? 41 LYS A HZ3  5  
ATOM 5908  N N    . SER A 1 42 ? -7.489  14.193  7.932   1.00 0.00 ? 42 SER A N    5  
ATOM 5909  C CA   . SER A 1 42 ? -7.074  15.040  6.778   1.00 0.00 ? 42 SER A CA   5  
ATOM 5910  C C    . SER A 1 42 ? -6.451  14.237  5.645   1.00 0.00 ? 42 SER A C    5  
ATOM 5911  O O    . SER A 1 42 ? -6.139  14.741  4.584   1.00 0.00 ? 42 SER A O    5  
ATOM 5912  C CB   . SER A 1 42 ? -6.092  16.111  7.252   1.00 0.00 ? 42 SER A CB   5  
ATOM 5913  O OG   . SER A 1 42 ? -5.660  16.877  6.135   1.00 0.00 ? 42 SER A OG   5  
ATOM 5914  H H    . SER A 1 42 ? -6.987  14.238  8.771   1.00 0.00 ? 42 SER A H    5  
ATOM 5915  H HA   . SER A 1 42 ? -7.954  15.520  6.379   1.00 0.00 ? 42 SER A HA   5  
ATOM 5916  H HB2  . SER A 1 42 ? -6.577  16.761  7.961   1.00 0.00 ? 42 SER A HB2  5  
ATOM 5917  H HB3  . SER A 1 42 ? -5.242  15.635  7.725   1.00 0.00 ? 42 SER A HB3  5  
ATOM 5918  H HG   . SER A 1 42 ? -6.202  16.632  5.381   1.00 0.00 ? 42 SER A HG   5  
ATOM 5919  N N    . LEU A 1 43 ? -6.234  12.981  5.910   1.00 0.00 ? 43 LEU A N    5  
ATOM 5920  C CA   . LEU A 1 43 ? -5.589  12.058  4.937   1.00 0.00 ? 43 LEU A CA   5  
ATOM 5921  C C    . LEU A 1 43 ? -6.637  11.022  4.531   1.00 0.00 ? 43 LEU A C    5  
ATOM 5922  O O    . LEU A 1 43 ? -6.413  10.192  3.671   1.00 0.00 ? 43 LEU A O    5  
ATOM 5923  C CB   . LEU A 1 43 ? -4.419  11.383  5.704   1.00 0.00 ? 43 LEU A CB   5  
ATOM 5924  C CG   . LEU A 1 43 ? -3.072  11.667  5.044   1.00 0.00 ? 43 LEU A CG   5  
ATOM 5925  C CD1  . LEU A 1 43 ? -2.859  13.186  4.820   1.00 0.00 ? 43 LEU A CD1  5  
ATOM 5926  C CD2  . LEU A 1 43 ? -1.937  11.098  5.914   1.00 0.00 ? 43 LEU A CD2  5  
ATOM 5927  H H    . LEU A 1 43 ? -6.485  12.626  6.783   1.00 0.00 ? 43 LEU A H    5  
ATOM 5928  H HA   . LEU A 1 43 ? -5.240  12.614  4.083   1.00 0.00 ? 43 LEU A HA   5  
ATOM 5929  H HB2  . LEU A 1 43 ? -4.397  11.764  6.710   1.00 0.00 ? 43 LEU A HB2  5  
ATOM 5930  H HB3  . LEU A 1 43 ? -4.571  10.313  5.738   1.00 0.00 ? 43 LEU A HB3  5  
ATOM 5931  H HG   . LEU A 1 43 ? -3.076  11.165  4.113   1.00 0.00 ? 43 LEU A HG   5  
ATOM 5932  H HD11 . LEU A 1 43 ? -3.499  13.752  5.482   1.00 0.00 ? 43 LEU A HD11 5  
ATOM 5933  H HD12 . LEU A 1 43 ? -3.097  13.434  3.798   1.00 0.00 ? 43 LEU A HD12 5  
ATOM 5934  H HD13 . LEU A 1 43 ? -1.827  13.450  5.011   1.00 0.00 ? 43 LEU A HD13 5  
ATOM 5935  H HD21 . LEU A 1 43 ? -1.876  10.032  5.771   1.00 0.00 ? 43 LEU A HD21 5  
ATOM 5936  H HD22 . LEU A 1 43 ? -2.130  11.312  6.953   1.00 0.00 ? 43 LEU A HD22 5  
ATOM 5937  H HD23 . LEU A 1 43 ? -1.000  11.552  5.623   1.00 0.00 ? 43 LEU A HD23 5  
ATOM 5938  N N    . SER A 1 44 ? -7.764  11.071  5.166   1.00 0.00 ? 44 SER A N    5  
ATOM 5939  C CA   . SER A 1 44 ? -8.867  10.108  4.873   1.00 0.00 ? 44 SER A CA   5  
ATOM 5940  C C    . SER A 1 44 ? -8.954  9.817   3.372   1.00 0.00 ? 44 SER A C    5  
ATOM 5941  O O    . SER A 1 44 ? -8.852  8.697   2.914   1.00 0.00 ? 44 SER A O    5  
ATOM 5942  C CB   . SER A 1 44 ? -10.193 10.708  5.342   1.00 0.00 ? 44 SER A CB   5  
ATOM 5943  O OG   . SER A 1 44 ? -11.265 9.891   4.888   1.00 0.00 ? 44 SER A OG   5  
ATOM 5944  H H    . SER A 1 44 ? -7.883  11.747  5.858   1.00 0.00 ? 44 SER A H    5  
ATOM 5945  H HA   . SER A 1 44 ? -8.686  9.190   5.411   1.00 0.00 ? 44 SER A HA   5  
ATOM 5946  H HB2  . SER A 1 44 ? -10.211 10.750  6.418   1.00 0.00 ? 44 SER A HB2  5  
ATOM 5947  H HB3  . SER A 1 44 ? -10.295 11.708  4.943   1.00 0.00 ? 44 SER A HB3  5  
ATOM 5948  H HG   . SER A 1 44 ? -11.916 9.838   5.593   1.00 0.00 ? 44 SER A HG   5  
ATOM 5949  N N    . GLU A 1 45 ? -9.309  10.845  2.647   1.00 0.00 ? 45 GLU A N    5  
ATOM 5950  C CA   . GLU A 1 45 ? -9.626  10.772  1.190   1.00 0.00 ? 45 GLU A CA   5  
ATOM 5951  C C    . GLU A 1 45 ? -8.603  10.165  0.235   1.00 0.00 ? 45 GLU A C    5  
ATOM 5952  O O    . GLU A 1 45 ? -8.897  9.247   -0.504  1.00 0.00 ? 45 GLU A O    5  
ATOM 5953  C CB   . GLU A 1 45 ? -9.855  12.206  0.710   1.00 0.00 ? 45 GLU A CB   5  
ATOM 5954  C CG   . GLU A 1 45 ? -11.000 12.844  1.503   1.00 0.00 ? 45 GLU A CG   5  
ATOM 5955  C CD   . GLU A 1 45 ? -11.198 14.287  1.034   1.00 0.00 ? 45 GLU A CD   5  
ATOM 5956  O OE1  . GLU A 1 45 ? -10.455 15.142  1.486   1.00 0.00 ? 45 GLU A OE1  5  
ATOM 5957  O OE2  . GLU A 1 45 ? -12.090 14.511  0.233   1.00 0.00 ? 45 GLU A OE2  5  
ATOM 5958  H H    . GLU A 1 45 ? -9.479  11.712  3.069   1.00 0.00 ? 45 GLU A H    5  
ATOM 5959  H HA   . GLU A 1 45 ? -10.554 10.242  1.070   1.00 0.00 ? 45 GLU A HA   5  
ATOM 5960  H HB2  . GLU A 1 45 ? -8.946  12.780  0.858   1.00 0.00 ? 45 GLU A HB2  5  
ATOM 5961  H HB3  . GLU A 1 45 ? -10.106 12.200  -0.340  1.00 0.00 ? 45 GLU A HB3  5  
ATOM 5962  H HG2  . GLU A 1 45 ? -11.909 12.282  1.338   1.00 0.00 ? 45 GLU A HG2  5  
ATOM 5963  H HG3  . GLU A 1 45 ? -10.759 12.839  2.554   1.00 0.00 ? 45 GLU A HG3  5  
ATOM 5964  N N    . GLU A 1 46 ? -7.408  10.666  0.248   1.00 0.00 ? 46 GLU A N    5  
ATOM 5965  C CA   . GLU A 1 46 ? -6.371  10.116  -0.654  1.00 0.00 ? 46 GLU A CA   5  
ATOM 5966  C C    . GLU A 1 46 ? -6.234  8.622   -0.409  1.00 0.00 ? 46 GLU A C    5  
ATOM 5967  O O    . GLU A 1 46 ? -5.776  7.889   -1.257  1.00 0.00 ? 46 GLU A O    5  
ATOM 5968  C CB   . GLU A 1 46 ? -5.038  10.804  -0.366  1.00 0.00 ? 46 GLU A CB   5  
ATOM 5969  C CG   . GLU A 1 46 ? -5.182  12.311  -0.584  1.00 0.00 ? 46 GLU A CG   5  
ATOM 5970  C CD   . GLU A 1 46 ? -5.224  12.611  -2.083  1.00 0.00 ? 46 GLU A CD   5  
ATOM 5971  O OE1  . GLU A 1 46 ? -4.298  12.216  -2.772  1.00 0.00 ? 46 GLU A OE1  5  
ATOM 5972  O OE2  . GLU A 1 46 ? -6.181  13.231  -2.518  1.00 0.00 ? 46 GLU A OE2  5  
ATOM 5973  H H    . GLU A 1 46 ? -7.191  11.409  0.847   1.00 0.00 ? 46 GLU A H    5  
ATOM 5974  H HA   . GLU A 1 46 ? -6.646  10.272  -1.681  1.00 0.00 ? 46 GLU A HA   5  
ATOM 5975  H HB2  . GLU A 1 46 ? -4.753  10.612  0.657   1.00 0.00 ? 46 GLU A HB2  5  
ATOM 5976  H HB3  . GLU A 1 46 ? -4.283  10.416  -1.029  1.00 0.00 ? 46 GLU A HB3  5  
ATOM 5977  H HG2  . GLU A 1 46 ? -6.095  12.657  -0.121  1.00 0.00 ? 46 GLU A HG2  5  
ATOM 5978  H HG3  . GLU A 1 46 ? -4.340  12.820  -0.141  1.00 0.00 ? 46 GLU A HG3  5  
ATOM 5979  N N    . CYS A 1 47 ? -6.635  8.155   0.734   1.00 0.00 ? 47 CYS A N    5  
ATOM 5980  C CA   . CYS A 1 47 ? -6.530  6.699   1.005   1.00 0.00 ? 47 CYS A CA   5  
ATOM 5981  C C    . CYS A 1 47 ? -7.692  5.987   0.312   1.00 0.00 ? 47 CYS A C    5  
ATOM 5982  O O    . CYS A 1 47 ? -7.522  4.951   -0.299  1.00 0.00 ? 47 CYS A O    5  
ATOM 5983  C CB   . CYS A 1 47 ? -6.567  6.468   2.528   1.00 0.00 ? 47 CYS A CB   5  
ATOM 5984  S SG   . CYS A 1 47 ? -8.247  6.071   3.093   1.00 0.00 ? 47 CYS A SG   5  
ATOM 5985  H H    . CYS A 1 47 ? -7.015  8.757   1.409   1.00 0.00 ? 47 CYS A H    5  
ATOM 5986  H HA   . CYS A 1 47 ? -5.605  6.328   0.587   1.00 0.00 ? 47 CYS A HA   5  
ATOM 5987  H HB2  . CYS A 1 47 ? -5.908  5.654   2.783   1.00 0.00 ? 47 CYS A HB2  5  
ATOM 5988  H HB3  . CYS A 1 47 ? -6.236  7.371   3.027   1.00 0.00 ? 47 CYS A HB3  5  
ATOM 5989  N N    . GLN A 1 48 ? -8.868  6.526   0.409   1.00 0.00 ? 48 GLN A N    5  
ATOM 5990  C CA   . GLN A 1 48 ? -10.031 5.865   -0.240  1.00 0.00 ? 48 GLN A CA   5  
ATOM 5991  C C    . GLN A 1 48 ? -9.722  5.627   -1.716  1.00 0.00 ? 48 GLN A C    5  
ATOM 5992  O O    . GLN A 1 48 ? -10.027 4.587   -2.265  1.00 0.00 ? 48 GLN A O    5  
ATOM 5993  C CB   . GLN A 1 48 ? -11.271 6.754   -0.110  1.00 0.00 ? 48 GLN A CB   5  
ATOM 5994  C CG   . GLN A 1 48 ? -12.481 6.034   -0.707  1.00 0.00 ? 48 GLN A CG   5  
ATOM 5995  C CD   . GLN A 1 48 ? -13.736 6.883   -0.498  1.00 0.00 ? 48 GLN A CD   5  
ATOM 5996  O OE1  . GLN A 1 48 ? -13.652 8.085   -0.337  1.00 0.00 ? 48 GLN A OE1  5  
ATOM 5997  N NE2  . GLN A 1 48 ? -14.907 6.306   -0.496  1.00 0.00 ? 48 GLN A NE2  5  
ATOM 5998  H H    . GLN A 1 48 ? -8.985  7.355   0.921   1.00 0.00 ? 48 GLN A H    5  
ATOM 5999  H HA   . GLN A 1 48 ? -10.214 4.913   0.241   1.00 0.00 ? 48 GLN A HA   5  
ATOM 6000  H HB2  . GLN A 1 48 ? -11.454 6.965   0.934   1.00 0.00 ? 48 GLN A HB2  5  
ATOM 6001  H HB3  . GLN A 1 48 ? -11.107 7.680   -0.640  1.00 0.00 ? 48 GLN A HB3  5  
ATOM 6002  H HG2  . GLN A 1 48 ? -12.322 5.880   -1.765  1.00 0.00 ? 48 GLN A HG2  5  
ATOM 6003  H HG3  . GLN A 1 48 ? -12.609 5.080   -0.219  1.00 0.00 ? 48 GLN A HG3  5  
ATOM 6004  H HE21 . GLN A 1 48 ? -14.975 5.338   -0.626  1.00 0.00 ? 48 GLN A HE21 5  
ATOM 6005  H HE22 . GLN A 1 48 ? -15.717 6.841   -0.363  1.00 0.00 ? 48 GLN A HE22 5  
ATOM 6006  N N    . GLU A 1 49 ? -9.129  6.590   -2.369  1.00 0.00 ? 49 GLU A N    5  
ATOM 6007  C CA   . GLU A 1 49 ? -8.813  6.428   -3.813  1.00 0.00 ? 49 GLU A CA   5  
ATOM 6008  C C    . GLU A 1 49 ? -7.723  5.370   -4.013  1.00 0.00 ? 49 GLU A C    5  
ATOM 6009  O O    . GLU A 1 49 ? -7.788  4.572   -4.926  1.00 0.00 ? 49 GLU A O    5  
ATOM 6010  C CB   . GLU A 1 49 ? -8.334  7.768   -4.378  1.00 0.00 ? 49 GLU A CB   5  
ATOM 6011  C CG   . GLU A 1 49 ? -7.894  7.585   -5.833  1.00 0.00 ? 49 GLU A CG   5  
ATOM 6012  C CD   . GLU A 1 49 ? -7.717  8.955   -6.489  1.00 0.00 ? 49 GLU A CD   5  
ATOM 6013  O OE1  . GLU A 1 49 ? -7.128  9.819   -5.861  1.00 0.00 ? 49 GLU A OE1  5  
ATOM 6014  O OE2  . GLU A 1 49 ? -8.174  9.118   -7.608  1.00 0.00 ? 49 GLU A OE2  5  
ATOM 6015  H H    . GLU A 1 49 ? -8.900  7.429   -1.919  1.00 0.00 ? 49 GLU A H    5  
ATOM 6016  H HA   . GLU A 1 49 ? -9.702  6.120   -4.342  1.00 0.00 ? 49 GLU A HA   5  
ATOM 6017  H HB2  . GLU A 1 49 ? -9.141  8.485   -4.334  1.00 0.00 ? 49 GLU A HB2  5  
ATOM 6018  H HB3  . GLU A 1 49 ? -7.501  8.128   -3.795  1.00 0.00 ? 49 GLU A HB3  5  
ATOM 6019  H HG2  . GLU A 1 49 ? -6.957  7.048   -5.860  1.00 0.00 ? 49 GLU A HG2  5  
ATOM 6020  H HG3  . GLU A 1 49 ? -8.647  7.027   -6.369  1.00 0.00 ? 49 GLU A HG3  5  
ATOM 6021  N N    . VAL A 1 50 ? -6.723  5.347   -3.168  1.00 0.00 ? 50 VAL A N    5  
ATOM 6022  C CA   . VAL A 1 50 ? -5.651  4.326   -3.335  1.00 0.00 ? 50 VAL A CA   5  
ATOM 6023  C C    . VAL A 1 50 ? -6.212  2.947   -3.007  1.00 0.00 ? 50 VAL A C    5  
ATOM 6024  O O    . VAL A 1 50 ? -6.047  2.005   -3.757  1.00 0.00 ? 50 VAL A O    5  
ATOM 6025  C CB   . VAL A 1 50 ? -4.465  4.607   -2.398  1.00 0.00 ? 50 VAL A CB   5  
ATOM 6026  C CG1  . VAL A 1 50 ? -3.347  3.599   -2.681  1.00 0.00 ? 50 VAL A CG1  5  
ATOM 6027  C CG2  . VAL A 1 50 ? -3.937  6.038   -2.623  1.00 0.00 ? 50 VAL A CG2  5  
ATOM 6028  H H    . VAL A 1 50 ? -6.681  5.991   -2.435  1.00 0.00 ? 50 VAL A H    5  
ATOM 6029  H HA   . VAL A 1 50 ? -5.308  4.354   -4.350  1.00 0.00 ? 50 VAL A HA   5  
ATOM 6030  H HB   . VAL A 1 50 ? -4.782  4.485   -1.376  1.00 0.00 ? 50 VAL A HB   5  
ATOM 6031  H HG11 . VAL A 1 50 ? -3.060  3.661   -3.720  1.00 0.00 ? 50 VAL A HG11 5  
ATOM 6032  H HG12 . VAL A 1 50 ? -3.695  2.600   -2.460  1.00 0.00 ? 50 VAL A HG12 5  
ATOM 6033  H HG13 . VAL A 1 50 ? -2.496  3.826   -2.058  1.00 0.00 ? 50 VAL A HG13 5  
ATOM 6034  H HG21 . VAL A 1 50 ? -3.180  6.035   -3.396  1.00 0.00 ? 50 VAL A HG21 5  
ATOM 6035  H HG22 . VAL A 1 50 ? -3.507  6.412   -1.705  1.00 0.00 ? 50 VAL A HG22 5  
ATOM 6036  H HG23 . VAL A 1 50 ? -4.746  6.683   -2.924  1.00 0.00 ? 50 VAL A HG23 5  
ATOM 6037  N N    . VAL A 1 51 ? -6.841  2.807   -1.868  1.00 0.00 ? 51 VAL A N    5  
ATOM 6038  C CA   . VAL A 1 51 ? -7.369  1.473   -1.477  1.00 0.00 ? 51 VAL A CA   5  
ATOM 6039  C C    . VAL A 1 51 ? -8.396  0.989   -2.508  1.00 0.00 ? 51 VAL A C    5  
ATOM 6040  O O    . VAL A 1 51 ? -8.328  -0.116  -3.005  1.00 0.00 ? 51 VAL A O    5  
ATOM 6041  C CB   . VAL A 1 51 ? -7.951  1.542   -0.059  1.00 0.00 ? 51 VAL A CB   5  
ATOM 6042  C CG1  . VAL A 1 51 ? -8.376  0.153   0.403   1.00 0.00 ? 51 VAL A CG1  5  
ATOM 6043  C CG2  . VAL A 1 51 ? -6.895  2.091   0.909   1.00 0.00 ? 51 VAL A CG2  5  
ATOM 6044  H H    . VAL A 1 51 ? -6.937  3.560   -1.249  1.00 0.00 ? 51 VAL A H    5  
ATOM 6045  H HA   . VAL A 1 51 ? -6.549  0.779   -1.524  1.00 0.00 ? 51 VAL A HA   5  
ATOM 6046  H HB   . VAL A 1 51 ? -8.805  2.196   -0.055  1.00 0.00 ? 51 VAL A HB   5  
ATOM 6047  H HG11 . VAL A 1 51 ? -8.687  0.200   1.436   1.00 0.00 ? 51 VAL A HG11 5  
ATOM 6048  H HG12 . VAL A 1 51 ? -7.544  -0.526  0.308   1.00 0.00 ? 51 VAL A HG12 5  
ATOM 6049  H HG13 . VAL A 1 51 ? -9.198  -0.192  -0.206  1.00 0.00 ? 51 VAL A HG13 5  
ATOM 6050  H HG21 . VAL A 1 51 ? -6.467  2.994   0.501   1.00 0.00 ? 51 VAL A HG21 5  
ATOM 6051  H HG22 . VAL A 1 51 ? -6.118  1.355   1.050   1.00 0.00 ? 51 VAL A HG22 5  
ATOM 6052  H HG23 . VAL A 1 51 ? -7.357  2.313   1.864   1.00 0.00 ? 51 VAL A HG23 5  
ATOM 6053  N N    . ASP A 1 52 ? -9.387  1.801   -2.772  1.00 0.00 ? 52 ASP A N    5  
ATOM 6054  C CA   . ASP A 1 52 ? -10.483 1.401   -3.705  1.00 0.00 ? 52 ASP A CA   5  
ATOM 6055  C C    . ASP A 1 52 ? -9.978  1.169   -5.130  1.00 0.00 ? 52 ASP A C    5  
ATOM 6056  O O    . ASP A 1 52 ? -10.370 0.226   -5.790  1.00 0.00 ? 52 ASP A O    5  
ATOM 6057  C CB   . ASP A 1 52 ? -11.544 2.508   -3.722  1.00 0.00 ? 52 ASP A CB   5  
ATOM 6058  C CG   . ASP A 1 52 ? -12.714 2.078   -4.607  1.00 0.00 ? 52 ASP A CG   5  
ATOM 6059  O OD1  . ASP A 1 52 ? -13.219 0.989   -4.399  1.00 0.00 ? 52 ASP A OD1  5  
ATOM 6060  O OD2  . ASP A 1 52 ? -13.086 2.848   -5.478  1.00 0.00 ? 52 ASP A OD2  5  
ATOM 6061  H H    . ASP A 1 52 ? -9.433  2.672   -2.329  1.00 0.00 ? 52 ASP A H    5  
ATOM 6062  H HA   . ASP A 1 52 ? -10.946 0.499   -3.334  1.00 0.00 ? 52 ASP A HA   5  
ATOM 6063  H HB2  . ASP A 1 52 ? -11.898 2.678   -2.715  1.00 0.00 ? 52 ASP A HB2  5  
ATOM 6064  H HB3  . ASP A 1 52 ? -11.116 3.418   -4.110  1.00 0.00 ? 52 ASP A HB3  5  
ATOM 6065  N N    . THR A 1 53 ? -9.132  2.030   -5.621  1.00 0.00 ? 53 THR A N    5  
ATOM 6066  C CA   . THR A 1 53 ? -8.626  1.873   -7.012  1.00 0.00 ? 53 THR A CA   5  
ATOM 6067  C C    . THR A 1 53 ? -7.435  0.923   -7.052  1.00 0.00 ? 53 THR A C    5  
ATOM 6068  O O    . THR A 1 53 ? -7.314  0.135   -7.968  1.00 0.00 ? 53 THR A O    5  
ATOM 6069  C CB   . THR A 1 53 ? -8.199  3.244   -7.545  1.00 0.00 ? 53 THR A CB   5  
ATOM 6070  O OG1  . THR A 1 53 ? -9.248  4.179   -7.330  1.00 0.00 ? 53 THR A OG1  5  
ATOM 6071  C CG2  . THR A 1 53 ? -7.901  3.145   -9.041  1.00 0.00 ? 53 THR A CG2  5  
ATOM 6072  H H    . THR A 1 53 ? -8.837  2.794   -5.084  1.00 0.00 ? 53 THR A H    5  
ATOM 6073  H HA   . THR A 1 53 ? -9.394  1.475   -7.650  1.00 0.00 ? 53 THR A HA   5  
ATOM 6074  H HB   . THR A 1 53 ? -7.313  3.573   -7.026  1.00 0.00 ? 53 THR A HB   5  
ATOM 6075  H HG1  . THR A 1 53 ? -9.860  3.798   -6.697  1.00 0.00 ? 53 THR A HG1  5  
ATOM 6076  H HG21 . THR A 1 53 ? -8.811  2.911   -9.575  1.00 0.00 ? 53 THR A HG21 5  
ATOM 6077  H HG22 . THR A 1 53 ? -7.172  2.366   -9.213  1.00 0.00 ? 53 THR A HG22 5  
ATOM 6078  H HG23 . THR A 1 53 ? -7.510  4.088   -9.393  1.00 0.00 ? 53 THR A HG23 5  
ATOM 6079  N N    . TYR A 1 54 ? -6.537  1.003   -6.102  1.00 0.00 ? 54 TYR A N    5  
ATOM 6080  C CA   . TYR A 1 54 ? -5.333  0.111   -6.136  1.00 0.00 ? 54 TYR A CA   5  
ATOM 6081  C C    . TYR A 1 54 ? -5.352  -0.944  -5.024  1.00 0.00 ? 54 TYR A C    5  
ATOM 6082  O O    . TYR A 1 54 ? -4.330  -1.318  -4.488  1.00 0.00 ? 54 TYR A O    5  
ATOM 6083  C CB   . TYR A 1 54 ? -4.082  0.968   -6.004  1.00 0.00 ? 54 TYR A CB   5  
ATOM 6084  C CG   . TYR A 1 54 ? -3.949  1.849   -7.225  1.00 0.00 ? 54 TYR A CG   5  
ATOM 6085  C CD1  . TYR A 1 54 ? -3.242  1.403   -8.347  1.00 0.00 ? 54 TYR A CD1  5  
ATOM 6086  C CD2  . TYR A 1 54 ? -4.532  3.117   -7.228  1.00 0.00 ? 54 TYR A CD2  5  
ATOM 6087  C CE1  . TYR A 1 54 ? -3.120  2.232   -9.470  1.00 0.00 ? 54 TYR A CE1  5  
ATOM 6088  C CE2  . TYR A 1 54 ? -4.415  3.945   -8.344  1.00 0.00 ? 54 TYR A CE2  5  
ATOM 6089  C CZ   . TYR A 1 54 ? -3.706  3.505   -9.468  1.00 0.00 ? 54 TYR A CZ   5  
ATOM 6090  O OH   . TYR A 1 54 ? -3.587  4.321   -10.574 1.00 0.00 ? 54 TYR A OH   5  
ATOM 6091  H H    . TYR A 1 54 ? -6.639  1.663   -5.384  1.00 0.00 ? 54 TYR A H    5  
ATOM 6092  H HA   . TYR A 1 54 ? -5.289  -0.409  -7.081  1.00 0.00 ? 54 TYR A HA   5  
ATOM 6093  H HB2  . TYR A 1 54 ? -4.167  1.581   -5.124  1.00 0.00 ? 54 TYR A HB2  5  
ATOM 6094  H HB3  . TYR A 1 54 ? -3.216  0.331   -5.922  1.00 0.00 ? 54 TYR A HB3  5  
ATOM 6095  H HD1  . TYR A 1 54 ? -2.792  0.422   -8.347  1.00 0.00 ? 54 TYR A HD1  5  
ATOM 6096  H HD2  . TYR A 1 54 ? -5.079  3.453   -6.371  1.00 0.00 ? 54 TYR A HD2  5  
ATOM 6097  H HE1  . TYR A 1 54 ? -2.574  1.889   -10.336 1.00 0.00 ? 54 TYR A HE1  5  
ATOM 6098  H HE2  . TYR A 1 54 ? -4.868  4.926   -8.333  1.00 0.00 ? 54 TYR A HE2  5  
ATOM 6099  H HH   . TYR A 1 54 ? -4.470  4.499   -10.907 1.00 0.00 ? 54 TYR A HH   5  
ATOM 6100  N N    . GLY A 1 55 ? -6.518  -1.392  -4.642  1.00 0.00 ? 55 GLY A N    5  
ATOM 6101  C CA   . GLY A 1 55 ? -6.621  -2.382  -3.533  1.00 0.00 ? 55 GLY A CA   5  
ATOM 6102  C C    . GLY A 1 55 ? -6.333  -3.806  -4.011  1.00 0.00 ? 55 GLY A C    5  
ATOM 6103  O O    . GLY A 1 55 ? -5.520  -4.502  -3.434  1.00 0.00 ? 55 GLY A O    5  
ATOM 6104  H H    . GLY A 1 55 ? -7.330  -1.068  -5.078  1.00 0.00 ? 55 GLY A H    5  
ATOM 6105  H HA2  . GLY A 1 55 ? -5.910  -2.122  -2.763  1.00 0.00 ? 55 GLY A HA2  5  
ATOM 6106  H HA3  . GLY A 1 55 ? -7.617  -2.347  -3.118  1.00 0.00 ? 55 GLY A HA3  5  
ATOM 6107  N N    . SER A 1 56 ? -7.002  -4.271  -5.032  1.00 0.00 ? 56 SER A N    5  
ATOM 6108  C CA   . SER A 1 56 ? -6.754  -5.668  -5.478  1.00 0.00 ? 56 SER A CA   5  
ATOM 6109  C C    . SER A 1 56 ? -5.367  -5.790  -6.090  1.00 0.00 ? 56 SER A C    5  
ATOM 6110  O O    . SER A 1 56 ? -4.766  -6.846  -6.097  1.00 0.00 ? 56 SER A O    5  
ATOM 6111  C CB   . SER A 1 56 ? -7.791  -6.094  -6.514  1.00 0.00 ? 56 SER A CB   5  
ATOM 6112  O OG   . SER A 1 56 ? -9.056  -5.541  -6.175  1.00 0.00 ? 56 SER A OG   5  
ATOM 6113  H H    . SER A 1 56 ? -7.673  -3.719  -5.486  1.00 0.00 ? 56 SER A H    5  
ATOM 6114  H HA   . SER A 1 56 ? -6.826  -6.314  -4.618  1.00 0.00 ? 56 SER A HA   5  
ATOM 6115  H HB2  . SER A 1 56 ? -7.497  -5.741  -7.493  1.00 0.00 ? 56 SER A HB2  5  
ATOM 6116  H HB3  . SER A 1 56 ? -7.848  -7.176  -6.528  1.00 0.00 ? 56 SER A HB3  5  
ATOM 6117  H HG   . SER A 1 56 ? -9.251  -5.786  -5.267  1.00 0.00 ? 56 SER A HG   5  
ATOM 6118  N N    . SER A 1 57 ? -4.882  -4.726  -6.676  1.00 0.00 ? 57 SER A N    5  
ATOM 6119  C CA   . SER A 1 57 ? -3.570  -4.813  -7.364  1.00 0.00 ? 57 SER A CA   5  
ATOM 6120  C C    . SER A 1 57 ? -2.418  -4.843  -6.354  1.00 0.00 ? 57 SER A C    5  
ATOM 6121  O O    . SER A 1 57 ? -1.551  -5.683  -6.435  1.00 0.00 ? 57 SER A O    5  
ATOM 6122  C CB   . SER A 1 57 ? -3.412  -3.664  -8.376  1.00 0.00 ? 57 SER A CB   5  
ATOM 6123  O OG   . SER A 1 57 ? -3.838  -4.114  -9.656  1.00 0.00 ? 57 SER A OG   5  
ATOM 6124  H H    . SER A 1 57 ? -5.401  -3.895  -6.682  1.00 0.00 ? 57 SER A H    5  
ATOM 6125  H HA   . SER A 1 57 ? -3.555  -5.755  -7.892  1.00 0.00 ? 57 SER A HA   5  
ATOM 6126  H HB2  . SER A 1 57 ? -4.023  -2.829  -8.082  1.00 0.00 ? 57 SER A HB2  5  
ATOM 6127  H HB3  . SER A 1 57 ? -2.375  -3.350  -8.427  1.00 0.00 ? 57 SER A HB3  5  
ATOM 6128  H HG   . SER A 1 57 ? -3.371  -3.603  -10.321 1.00 0.00 ? 57 SER A HG   5  
ATOM 6129  N N    . ILE A 1 58 ? -2.422  -3.975  -5.373  1.00 0.00 ? 58 ILE A N    5  
ATOM 6130  C CA   . ILE A 1 58 ? -1.339  -4.010  -4.352  1.00 0.00 ? 58 ILE A CA   5  
ATOM 6131  C C    . ILE A 1 58 ? -1.305  -5.394  -3.726  1.00 0.00 ? 58 ILE A C    5  
ATOM 6132  O O    . ILE A 1 58 ? -0.297  -6.070  -3.679  1.00 0.00 ? 58 ILE A O    5  
ATOM 6133  C CB   . ILE A 1 58 ? -1.637  -2.985  -3.246  1.00 0.00 ? 58 ILE A CB   5  
ATOM 6134  C CG1  . ILE A 1 58 ? -1.459  -1.566  -3.800  1.00 0.00 ? 58 ILE A CG1  5  
ATOM 6135  C CG2  . ILE A 1 58 ? -0.671  -3.206  -2.067  1.00 0.00 ? 58 ILE A CG2  5  
ATOM 6136  C CD1  . ILE A 1 58 ? -1.956  -0.543  -2.771  1.00 0.00 ? 58 ILE A CD1  5  
ATOM 6137  H H    . ILE A 1 58 ? -3.153  -3.330  -5.278  1.00 0.00 ? 58 ILE A H    5  
ATOM 6138  H HA   . ILE A 1 58 ? -0.379  -3.788  -4.789  1.00 0.00 ? 58 ILE A HA   5  
ATOM 6139  H HB   . ILE A 1 58 ? -2.654  -3.118  -2.905  1.00 0.00 ? 58 ILE A HB   5  
ATOM 6140  H HG12 . ILE A 1 58 ? -0.414  -1.390  -4.003  1.00 0.00 ? 58 ILE A HG12 5  
ATOM 6141  H HG13 . ILE A 1 58 ? -2.022  -1.461  -4.712  1.00 0.00 ? 58 ILE A HG13 5  
ATOM 6142  H HG21 . ILE A 1 58 ? -0.669  -2.339  -1.422  1.00 0.00 ? 58 ILE A HG21 5  
ATOM 6143  H HG22 . ILE A 1 58 ? 0.325   -3.373  -2.447  1.00 0.00 ? 58 ILE A HG22 5  
ATOM 6144  H HG23 . ILE A 1 58 ? -0.987  -4.072  -1.501  1.00 0.00 ? 58 ILE A HG23 5  
ATOM 6145  H HD11 . ILE A 1 58 ? -2.106  0.414   -3.251  1.00 0.00 ? 58 ILE A HD11 5  
ATOM 6146  H HD12 . ILE A 1 58 ? -1.217  -0.446  -1.989  1.00 0.00 ? 58 ILE A HD12 5  
ATOM 6147  H HD13 . ILE A 1 58 ? -2.889  -0.878  -2.343  1.00 0.00 ? 58 ILE A HD13 5  
ATOM 6148  N N    . LEU A 1 59 ? -2.435  -5.783  -3.231  1.00 0.00 ? 59 LEU A N    5  
ATOM 6149  C CA   . LEU A 1 59 ? -2.578  -7.093  -2.566  1.00 0.00 ? 59 LEU A CA   5  
ATOM 6150  C C    . LEU A 1 59 ? -2.215  -8.206  -3.545  1.00 0.00 ? 59 LEU A C    5  
ATOM 6151  O O    . LEU A 1 59 ? -1.876  -9.296  -3.140  1.00 0.00 ? 59 LEU A O    5  
ATOM 6152  C CB   . LEU A 1 59 ? -4.035  -7.225  -2.105  1.00 0.00 ? 59 LEU A CB   5  
ATOM 6153  C CG   . LEU A 1 59 ? -4.307  -8.624  -1.534  1.00 0.00 ? 59 LEU A CG   5  
ATOM 6154  C CD1  . LEU A 1 59 ? -3.284  -8.949  -0.433  1.00 0.00 ? 59 LEU A CD1  5  
ATOM 6155  C CD2  . LEU A 1 59 ? -5.732  -8.670  -0.941  1.00 0.00 ? 59 LEU A CD2  5  
ATOM 6156  H H    . LEU A 1 59 ? -3.209  -5.190  -3.306  1.00 0.00 ? 59 LEU A H    5  
ATOM 6157  H HA   . LEU A 1 59 ? -1.922  -7.135  -1.711  1.00 0.00 ? 59 LEU A HA   5  
ATOM 6158  H HB2  . LEU A 1 59 ? -4.229  -6.484  -1.345  1.00 0.00 ? 59 LEU A HB2  5  
ATOM 6159  H HB3  . LEU A 1 59 ? -4.689  -7.051  -2.946  1.00 0.00 ? 59 LEU A HB3  5  
ATOM 6160  H HG   . LEU A 1 59 ? -4.230  -9.350  -2.332  1.00 0.00 ? 59 LEU A HG   5  
ATOM 6161  H HD11 . LEU A 1 59 ? -2.358  -9.270  -0.880  1.00 0.00 ? 59 LEU A HD11 5  
ATOM 6162  H HD12 . LEU A 1 59 ? -3.667  -9.740  0.196   1.00 0.00 ? 59 LEU A HD12 5  
ATOM 6163  H HD13 . LEU A 1 59 ? -3.107  -8.069  0.168   1.00 0.00 ? 59 LEU A HD13 5  
ATOM 6164  H HD21 . LEU A 1 59 ? -6.437  -8.903  -1.724  1.00 0.00 ? 59 LEU A HD21 5  
ATOM 6165  H HD22 . LEU A 1 59 ? -5.983  -7.717  -0.503  1.00 0.00 ? 59 LEU A HD22 5  
ATOM 6166  H HD23 . LEU A 1 59 ? -5.785  -9.432  -0.178  1.00 0.00 ? 59 LEU A HD23 5  
ATOM 6167  N N    . SER A 1 60 ? -2.306  -7.978  -4.830  1.00 0.00 ? 60 SER A N    5  
ATOM 6168  C CA   . SER A 1 60 ? -1.983  -9.089  -5.777  1.00 0.00 ? 60 SER A CA   5  
ATOM 6169  C C    . SER A 1 60 ? -0.465  -9.191  -5.983  1.00 0.00 ? 60 SER A C    5  
ATOM 6170  O O    . SER A 1 60 ? 0.089   -10.264 -6.122  1.00 0.00 ? 60 SER A O    5  
ATOM 6171  C CB   . SER A 1 60 ? -2.666  -8.817  -7.112  1.00 0.00 ? 60 SER A CB   5  
ATOM 6172  O OG   . SER A 1 60 ? -4.053  -9.108  -7.000  1.00 0.00 ? 60 SER A OG   5  
ATOM 6173  H H    . SER A 1 60 ? -2.602  -7.106  -5.165  1.00 0.00 ? 60 SER A H    5  
ATOM 6174  H HA   . SER A 1 60 ? -2.397  -9.975  -5.325  1.00 0.00 ? 60 SER A HA   5  
ATOM 6175  H HB2  . SER A 1 60 ? -2.541  -7.778  -7.368  1.00 0.00 ? 60 SER A HB2  5  
ATOM 6176  H HB3  . SER A 1 60 ? -2.218  -9.432  -7.881  1.00 0.00 ? 60 SER A HB3  5  
ATOM 6177  H HG   . SER A 1 60 ? -4.268  -9.174  -6.066  1.00 0.00 ? 60 SER A HG   5  
ATOM 6178  N N    . ILE A 1 61 ? 0.204   -8.065  -6.012  1.00 0.00 ? 61 ILE A N    5  
ATOM 6179  C CA   . ILE A 1 61 ? 1.685   -8.052  -6.221  1.00 0.00 ? 61 ILE A CA   5  
ATOM 6180  C C    . ILE A 1 61 ? 2.406   -8.613  -4.994  1.00 0.00 ? 61 ILE A C    5  
ATOM 6181  O O    . ILE A 1 61 ? 3.329   -9.397  -5.106  1.00 0.00 ? 61 ILE A O    5  
ATOM 6182  C CB   . ILE A 1 61 ? 2.150   -6.600  -6.438  1.00 0.00 ? 61 ILE A CB   5  
ATOM 6183  C CG1  . ILE A 1 61 ? 1.212   -5.883  -7.462  1.00 0.00 ? 61 ILE A CG1  5  
ATOM 6184  C CG2  . ILE A 1 61 ? 3.612   -6.609  -6.912  1.00 0.00 ? 61 ILE A CG2  5  
ATOM 6185  C CD1  . ILE A 1 61 ? 2.006   -5.116  -8.533  1.00 0.00 ? 61 ILE A CD1  5  
ATOM 6186  H H    . ILE A 1 61 ? -0.276  -7.217  -5.909  1.00 0.00 ? 61 ILE A H    5  
ATOM 6187  H HA   . ILE A 1 61 ? 1.936   -8.642  -7.089  1.00 0.00 ? 61 ILE A HA   5  
ATOM 6188  H HB   . ILE A 1 61 ? 2.106   -6.081  -5.488  1.00 0.00 ? 61 ILE A HB   5  
ATOM 6189  H HG12 . ILE A 1 61 ? 0.573   -6.609  -7.951  1.00 0.00 ? 61 ILE A HG12 5  
ATOM 6190  H HG13 . ILE A 1 61 ? 0.593   -5.177  -6.931  1.00 0.00 ? 61 ILE A HG13 5  
ATOM 6191  H HG21 . ILE A 1 61 ? 4.204   -7.203  -6.235  1.00 0.00 ? 61 ILE A HG21 5  
ATOM 6192  H HG22 . ILE A 1 61 ? 3.993   -5.598  -6.923  1.00 0.00 ? 61 ILE A HG22 5  
ATOM 6193  H HG23 . ILE A 1 61 ? 3.668   -7.029  -7.905  1.00 0.00 ? 61 ILE A HG23 5  
ATOM 6194  H HD11 . ILE A 1 61 ? 1.320   -4.557  -9.151  1.00 0.00 ? 61 ILE A HD11 5  
ATOM 6195  H HD12 . ILE A 1 61 ? 2.556   -5.811  -9.147  1.00 0.00 ? 61 ILE A HD12 5  
ATOM 6196  H HD13 . ILE A 1 61 ? 2.691   -4.434  -8.051  1.00 0.00 ? 61 ILE A HD13 5  
ATOM 6197  N N    . LEU A 1 62 ? 2.018   -8.184  -3.829  1.00 0.00 ? 62 LEU A N    5  
ATOM 6198  C CA   . LEU A 1 62 ? 2.700   -8.648  -2.593  1.00 0.00 ? 62 LEU A CA   5  
ATOM 6199  C C    . LEU A 1 62 ? 2.756   -10.183 -2.565  1.00 0.00 ? 62 LEU A C    5  
ATOM 6200  O O    . LEU A 1 62 ? 3.703   -10.766 -2.077  1.00 0.00 ? 62 LEU A O    5  
ATOM 6201  C CB   . LEU A 1 62 ? 1.924   -8.097  -1.377  1.00 0.00 ? 62 LEU A CB   5  
ATOM 6202  C CG   . LEU A 1 62 ? 2.707   -6.946  -0.714  1.00 0.00 ? 62 LEU A CG   5  
ATOM 6203  C CD1  . LEU A 1 62 ? 1.751   -6.057  0.095   1.00 0.00 ? 62 LEU A CD1  5  
ATOM 6204  C CD2  . LEU A 1 62 ? 3.791   -7.533  0.200   1.00 0.00 ? 62 LEU A CD2  5  
ATOM 6205  H H    . LEU A 1 62 ? 1.290   -7.530  -3.766  1.00 0.00 ? 62 LEU A H    5  
ATOM 6206  H HA   . LEU A 1 62 ? 3.708   -8.257  -2.604  1.00 0.00 ? 62 LEU A HA   5  
ATOM 6207  H HB2  . LEU A 1 62 ? 0.967   -7.725  -1.717  1.00 0.00 ? 62 LEU A HB2  5  
ATOM 6208  H HB3  . LEU A 1 62 ? 1.757   -8.884  -0.653  1.00 0.00 ? 62 LEU A HB3  5  
ATOM 6209  H HG   . LEU A 1 62 ? 3.174   -6.340  -1.480  1.00 0.00 ? 62 LEU A HG   5  
ATOM 6210  H HD11 . LEU A 1 62 ? 2.292   -5.559  0.887   1.00 0.00 ? 62 LEU A HD11 5  
ATOM 6211  H HD12 . LEU A 1 62 ? 0.970   -6.661  0.519   1.00 0.00 ? 62 LEU A HD12 5  
ATOM 6212  H HD13 . LEU A 1 62 ? 1.315   -5.316  -0.559  1.00 0.00 ? 62 LEU A HD13 5  
ATOM 6213  H HD21 . LEU A 1 62 ? 4.242   -6.743  0.770   1.00 0.00 ? 62 LEU A HD21 5  
ATOM 6214  H HD22 . LEU A 1 62 ? 4.545   -8.019  -0.400  1.00 0.00 ? 62 LEU A HD22 5  
ATOM 6215  H HD23 . LEU A 1 62 ? 3.351   -8.252  0.872   1.00 0.00 ? 62 LEU A HD23 5  
ATOM 6216  N N    . LEU A 1 63 ? 1.755   -10.838 -3.077  1.00 0.00 ? 63 LEU A N    5  
ATOM 6217  C CA   . LEU A 1 63 ? 1.765   -12.328 -3.066  1.00 0.00 ? 63 LEU A CA   5  
ATOM 6218  C C    . LEU A 1 63 ? 2.739   -12.861 -4.118  1.00 0.00 ? 63 LEU A C    5  
ATOM 6219  O O    . LEU A 1 63 ? 3.094   -14.023 -4.106  1.00 0.00 ? 63 LEU A O    5  
ATOM 6220  C CB   . LEU A 1 63 ? 0.354   -12.864 -3.323  1.00 0.00 ? 63 LEU A CB   5  
ATOM 6221  C CG   . LEU A 1 63 ? -0.624  -12.230 -2.329  1.00 0.00 ? 63 LEU A CG   5  
ATOM 6222  C CD1  . LEU A 1 63 ? -2.018  -12.826 -2.543  1.00 0.00 ? 63 LEU A CD1  5  
ATOM 6223  C CD2  . LEU A 1 63 ? -0.160  -12.498 -0.889  1.00 0.00 ? 63 LEU A CD2  5  
ATOM 6224  H H    . LEU A 1 63 ? 0.996   -10.354 -3.465  1.00 0.00 ? 63 LEU A H    5  
ATOM 6225  H HA   . LEU A 1 63 ? 2.117   -12.689 -2.111  1.00 0.00 ? 63 LEU A HA   5  
ATOM 6226  H HB2  . LEU A 1 63 ? 0.053   -12.621 -4.329  1.00 0.00 ? 63 LEU A HB2  5  
ATOM 6227  H HB3  . LEU A 1 63 ? 0.349   -13.937 -3.193  1.00 0.00 ? 63 LEU A HB3  5  
ATOM 6228  H HG   . LEU A 1 63 ? -0.661  -11.166 -2.501  1.00 0.00 ? 63 LEU A HG   5  
ATOM 6229  H HD11 . LEU A 1 63 ? -1.942  -13.900 -2.618  1.00 0.00 ? 63 LEU A HD11 5  
ATOM 6230  H HD12 . LEU A 1 63 ? -2.443  -12.429 -3.453  1.00 0.00 ? 63 LEU A HD12 5  
ATOM 6231  H HD13 . LEU A 1 63 ? -2.652  -12.567 -1.707  1.00 0.00 ? 63 LEU A HD13 5  
ATOM 6232  H HD21 . LEU A 1 63 ? -0.996  -12.402 -0.211  1.00 0.00 ? 63 LEU A HD21 5  
ATOM 6233  H HD22 . LEU A 1 63 ? 0.600   -11.779 -0.618  1.00 0.00 ? 63 LEU A HD22 5  
ATOM 6234  H HD23 . LEU A 1 63 ? 0.249   -13.496 -0.817  1.00 0.00 ? 63 LEU A HD23 5  
ATOM 6235  N N    . GLU A 1 64 ? 3.182   -12.032 -5.029  1.00 0.00 ? 64 GLU A N    5  
ATOM 6236  C CA   . GLU A 1 64 ? 4.137   -12.520 -6.068  1.00 0.00 ? 64 GLU A CA   5  
ATOM 6237  C C    . GLU A 1 64 ? 5.559   -12.412 -5.510  1.00 0.00 ? 64 GLU A C    5  
ATOM 6238  O O    . GLU A 1 64 ? 6.523   -12.264 -6.234  1.00 0.00 ? 64 GLU A O    5  
ATOM 6239  C CB   . GLU A 1 64 ? 3.994   -11.692 -7.351  1.00 0.00 ? 64 GLU A CB   5  
ATOM 6240  C CG   . GLU A 1 64 ? 2.779   -12.174 -8.150  1.00 0.00 ? 64 GLU A CG   5  
ATOM 6241  C CD   . GLU A 1 64 ? 3.064   -13.560 -8.733  1.00 0.00 ? 64 GLU A CD   5  
ATOM 6242  O OE1  . GLU A 1 64 ? 4.122   -13.729 -9.317  1.00 0.00 ? 64 GLU A OE1  5  
ATOM 6243  O OE2  . GLU A 1 64 ? 2.220   -14.427 -8.586  1.00 0.00 ? 64 GLU A OE2  5  
ATOM 6244  H H    . GLU A 1 64 ? 2.894   -11.099 -5.030  1.00 0.00 ? 64 GLU A H    5  
ATOM 6245  H HA   . GLU A 1 64 ? 3.929   -13.561 -6.276  1.00 0.00 ? 64 GLU A HA   5  
ATOM 6246  H HB2  . GLU A 1 64 ? 3.862   -10.653 -7.093  1.00 0.00 ? 64 GLU A HB2  5  
ATOM 6247  H HB3  . GLU A 1 64 ? 4.882   -11.808 -7.953  1.00 0.00 ? 64 GLU A HB3  5  
ATOM 6248  H HG2  . GLU A 1 64 ? 1.919   -12.225 -7.504  1.00 0.00 ? 64 GLU A HG2  5  
ATOM 6249  H HG3  . GLU A 1 64 ? 2.583   -11.482 -8.956  1.00 0.00 ? 64 GLU A HG3  5  
ATOM 6250  N N    . GLU A 1 65 ? 5.677   -12.542 -4.216  1.00 0.00 ? 65 GLU A N    5  
ATOM 6251  C CA   . GLU A 1 65 ? 7.018   -12.514 -3.567  1.00 0.00 ? 65 GLU A CA   5  
ATOM 6252  C C    . GLU A 1 65 ? 7.859   -11.318 -4.032  1.00 0.00 ? 65 GLU A C    5  
ATOM 6253  O O    . GLU A 1 65 ? 9.072   -11.377 -4.074  1.00 0.00 ? 65 GLU A O    5  
ATOM 6254  C CB   . GLU A 1 65 ? 7.753   -13.789 -3.984  1.00 0.00 ? 65 GLU A CB   5  
ATOM 6255  C CG   . GLU A 1 65 ? 6.996   -15.009 -3.453  1.00 0.00 ? 65 GLU A CG   5  
ATOM 6256  C CD   . GLU A 1 65 ? 7.148   -15.084 -1.934  1.00 0.00 ? 65 GLU A CD   5  
ATOM 6257  O OE1  . GLU A 1 65 ? 8.274   -15.006 -1.467  1.00 0.00 ? 65 GLU A OE1  5  
ATOM 6258  O OE2  . GLU A 1 65 ? 6.139   -15.218 -1.262  1.00 0.00 ? 65 GLU A OE2  5  
ATOM 6259  H H    . GLU A 1 65 ? 4.868   -12.706 -3.691  1.00 0.00 ? 65 GLU A H    5  
ATOM 6260  H HA   . GLU A 1 65 ? 6.926   -12.530 -2.493  1.00 0.00 ? 65 GLU A HA   5  
ATOM 6261  H HB2  . GLU A 1 65 ? 7.807   -13.839 -5.060  1.00 0.00 ? 65 GLU A HB2  5  
ATOM 6262  H HB3  . GLU A 1 65 ? 8.751   -13.781 -3.572  1.00 0.00 ? 65 GLU A HB3  5  
ATOM 6263  H HG2  . GLU A 1 65 ? 5.949   -14.921 -3.707  1.00 0.00 ? 65 GLU A HG2  5  
ATOM 6264  H HG3  . GLU A 1 65 ? 7.401   -15.905 -3.898  1.00 0.00 ? 65 GLU A HG3  5  
ATOM 6265  N N    . VAL A 1 66 ? 7.219   -10.224 -4.352  1.00 0.00 ? 66 VAL A N    5  
ATOM 6266  C CA   . VAL A 1 66 ? 7.961   -8.997  -4.783  1.00 0.00 ? 66 VAL A CA   5  
ATOM 6267  C C    . VAL A 1 66 ? 8.224   -8.132  -3.535  1.00 0.00 ? 66 VAL A C    5  
ATOM 6268  O O    . VAL A 1 66 ? 7.414   -8.073  -2.631  1.00 0.00 ? 66 VAL A O    5  
ATOM 6269  C CB   . VAL A 1 66 ? 7.086   -8.236  -5.808  1.00 0.00 ? 66 VAL A CB   5  
ATOM 6270  C CG1  . VAL A 1 66 ? 7.329   -6.722  -5.735  1.00 0.00 ? 66 VAL A CG1  5  
ATOM 6271  C CG2  . VAL A 1 66 ? 7.411   -8.725  -7.227  1.00 0.00 ? 66 VAL A CG2  5  
ATOM 6272  H H    . VAL A 1 66 ? 6.238   -10.198 -4.302  1.00 0.00 ? 66 VAL A H    5  
ATOM 6273  H HA   . VAL A 1 66 ? 8.900   -9.275  -5.246  1.00 0.00 ? 66 VAL A HA   5  
ATOM 6274  H HB   . VAL A 1 66 ? 6.048   -8.437  -5.595  1.00 0.00 ? 66 VAL A HB   5  
ATOM 6275  H HG11 . VAL A 1 66 ? 8.390   -6.533  -5.664  1.00 0.00 ? 66 VAL A HG11 5  
ATOM 6276  H HG12 . VAL A 1 66 ? 6.833   -6.320  -4.865  1.00 0.00 ? 66 VAL A HG12 5  
ATOM 6277  H HG13 . VAL A 1 66 ? 6.936   -6.247  -6.623  1.00 0.00 ? 66 VAL A HG13 5  
ATOM 6278  H HG21 . VAL A 1 66 ? 7.507   -9.800  -7.223  1.00 0.00 ? 66 VAL A HG21 5  
ATOM 6279  H HG22 . VAL A 1 66 ? 8.341   -8.284  -7.555  1.00 0.00 ? 66 VAL A HG22 5  
ATOM 6280  H HG23 . VAL A 1 66 ? 6.618   -8.433  -7.899  1.00 0.00 ? 66 VAL A HG23 5  
ATOM 6281  N N    . SER A 1 67 ? 9.349   -7.461  -3.481  1.00 0.00 ? 67 SER A N    5  
ATOM 6282  C CA   . SER A 1 67 ? 9.653   -6.604  -2.293  1.00 0.00 ? 67 SER A CA   5  
ATOM 6283  C C    . SER A 1 67 ? 8.480   -5.628  -2.062  1.00 0.00 ? 67 SER A C    5  
ATOM 6284  O O    . SER A 1 67 ? 7.806   -5.270  -3.006  1.00 0.00 ? 67 SER A O    5  
ATOM 6285  C CB   . SER A 1 67 ? 10.938  -5.809  -2.552  1.00 0.00 ? 67 SER A CB   5  
ATOM 6286  O OG   . SER A 1 67 ? 10.606  -4.585  -3.191  1.00 0.00 ? 67 SER A OG   5  
ATOM 6287  H H    . SER A 1 67 ? 9.990   -7.518  -4.220  1.00 0.00 ? 67 SER A H    5  
ATOM 6288  H HA   . SER A 1 67 ? 9.788   -7.243  -1.441  1.00 0.00 ? 67 SER A HA   5  
ATOM 6289  H HB2  . SER A 1 67 ? 11.433  -5.598  -1.621  1.00 0.00 ? 67 SER A HB2  5  
ATOM 6290  H HB3  . SER A 1 67 ? 11.598  -6.389  -3.181  1.00 0.00 ? 67 SER A HB3  5  
ATOM 6291  H HG   . SER A 1 67 ? 9.762   -4.699  -3.630  1.00 0.00 ? 67 SER A HG   5  
ATOM 6292  N N    . PRO A 1 68 ? 8.248   -5.223  -0.823  1.00 0.00 ? 68 PRO A N    5  
ATOM 6293  C CA   . PRO A 1 68 ? 7.134   -4.300  -0.513  1.00 0.00 ? 68 PRO A CA   5  
ATOM 6294  C C    . PRO A 1 68 ? 7.329   -2.905  -1.148  1.00 0.00 ? 68 PRO A C    5  
ATOM 6295  O O    . PRO A 1 68 ? 6.380   -2.285  -1.576  1.00 0.00 ? 68 PRO A O    5  
ATOM 6296  C CB   . PRO A 1 68 ? 7.144   -4.181  1.034   1.00 0.00 ? 68 PRO A CB   5  
ATOM 6297  C CG   . PRO A 1 68 ? 8.433   -4.875  1.545   1.00 0.00 ? 68 PRO A CG   5  
ATOM 6298  C CD   . PRO A 1 68 ? 9.041   -5.647  0.358   1.00 0.00 ? 68 PRO A CD   5  
ATOM 6299  H HA   . PRO A 1 68 ? 6.198   -4.730  -0.846  1.00 0.00 ? 68 PRO A HA   5  
ATOM 6300  H HB2  . PRO A 1 68 ? 7.137   -3.141  1.338   1.00 0.00 ? 68 PRO A HB2  5  
ATOM 6301  H HB3  . PRO A 1 68 ? 6.285   -4.677  1.447   1.00 0.00 ? 68 PRO A HB3  5  
ATOM 6302  H HG2  . PRO A 1 68 ? 9.135   -4.129  1.903   1.00 0.00 ? 68 PRO A HG2  5  
ATOM 6303  H HG3  . PRO A 1 68 ? 8.194   -5.562  2.347   1.00 0.00 ? 68 PRO A HG3  5  
ATOM 6304  H HD2  . PRO A 1 68 ? 10.084  -5.391  0.232   1.00 0.00 ? 68 PRO A HD2  5  
ATOM 6305  H HD3  . PRO A 1 68 ? 8.930   -6.709  0.519   1.00 0.00 ? 68 PRO A HD3  5  
ATOM 6306  N N    . GLU A 1 69 ? 8.527   -2.380  -1.163  1.00 0.00 ? 69 GLU A N    5  
ATOM 6307  C CA   . GLU A 1 69 ? 8.719   -1.001  -1.718  1.00 0.00 ? 69 GLU A CA   5  
ATOM 6308  C C    . GLU A 1 69 ? 8.751   -1.017  -3.255  1.00 0.00 ? 69 GLU A C    5  
ATOM 6309  O O    . GLU A 1 69 ? 8.581   0.011   -3.897  1.00 0.00 ? 69 GLU A O    5  
ATOM 6310  C CB   . GLU A 1 69 ? 10.020  -0.388  -1.153  1.00 0.00 ? 69 GLU A CB   5  
ATOM 6311  C CG   . GLU A 1 69 ? 11.026  -1.492  -0.805  1.00 0.00 ? 69 GLU A CG   5  
ATOM 6312  C CD   . GLU A 1 69 ? 12.362  -0.856  -0.419  1.00 0.00 ? 69 GLU A CD   5  
ATOM 6313  O OE1  . GLU A 1 69 ? 12.340  0.155   0.262   1.00 0.00 ? 69 GLU A OE1  5  
ATOM 6314  O OE2  . GLU A 1 69 ? 13.386  -1.392  -0.812  1.00 0.00 ? 69 GLU A OE2  5  
ATOM 6315  H H    . GLU A 1 69 ? 9.284   -2.868  -0.778  1.00 0.00 ? 69 GLU A H    5  
ATOM 6316  H HA   . GLU A 1 69 ? 7.884   -0.388  -1.405  1.00 0.00 ? 69 GLU A HA   5  
ATOM 6317  H HB2  . GLU A 1 69 ? 10.460  0.279   -1.881  1.00 0.00 ? 69 GLU A HB2  5  
ATOM 6318  H HB3  . GLU A 1 69 ? 9.791   0.171   -0.256  1.00 0.00 ? 69 GLU A HB3  5  
ATOM 6319  H HG2  . GLU A 1 69 ? 10.652  -2.072  0.027   1.00 0.00 ? 69 GLU A HG2  5  
ATOM 6320  H HG3  . GLU A 1 69 ? 11.172  -2.135  -1.657  1.00 0.00 ? 69 GLU A HG3  5  
ATOM 6321  N N    . LEU A 1 70 ? 8.925   -2.155  -3.869  1.00 0.00 ? 70 LEU A N    5  
ATOM 6322  C CA   . LEU A 1 70 ? 8.925   -2.154  -5.354  1.00 0.00 ? 70 LEU A CA   5  
ATOM 6323  C C    . LEU A 1 70 ? 7.482   -1.897  -5.800  1.00 0.00 ? 70 LEU A C    5  
ATOM 6324  O O    . LEU A 1 70 ? 7.212   -1.596  -6.946  1.00 0.00 ? 70 LEU A O    5  
ATOM 6325  C CB   . LEU A 1 70 ? 9.460   -3.489  -5.905  1.00 0.00 ? 70 LEU A CB   5  
ATOM 6326  C CG   . LEU A 1 70 ? 10.997  -3.531  -5.816  1.00 0.00 ? 70 LEU A CG   5  
ATOM 6327  C CD1  . LEU A 1 70 ? 11.491  -4.981  -5.919  1.00 0.00 ? 70 LEU A CD1  5  
ATOM 6328  C CD2  . LEU A 1 70 ? 11.642  -2.722  -6.952  1.00 0.00 ? 70 LEU A CD2  5  
ATOM 6329  H H    . LEU A 1 70 ? 9.016   -2.984  -3.356  1.00 0.00 ? 70 LEU A H    5  
ATOM 6330  H HA   . LEU A 1 70 ? 9.537   -1.332  -5.686  1.00 0.00 ? 70 LEU A HA   5  
ATOM 6331  H HB2  . LEU A 1 70 ? 9.044   -4.297  -5.325  1.00 0.00 ? 70 LEU A HB2  5  
ATOM 6332  H HB3  . LEU A 1 70 ? 9.164   -3.601  -6.927  1.00 0.00 ? 70 LEU A HB3  5  
ATOM 6333  H HG   . LEU A 1 70 ? 11.298  -3.118  -4.875  1.00 0.00 ? 70 LEU A HG   5  
ATOM 6334  H HD11 . LEU A 1 70 ? 11.402  -5.319  -6.941  1.00 0.00 ? 70 LEU A HD11 5  
ATOM 6335  H HD12 . LEU A 1 70 ? 10.901  -5.618  -5.280  1.00 0.00 ? 70 LEU A HD12 5  
ATOM 6336  H HD13 . LEU A 1 70 ? 12.526  -5.029  -5.615  1.00 0.00 ? 70 LEU A HD13 5  
ATOM 6337  H HD21 . LEU A 1 70 ? 12.701  -2.934  -6.982  1.00 0.00 ? 70 LEU A HD21 5  
ATOM 6338  H HD22 . LEU A 1 70 ? 11.500  -1.667  -6.780  1.00 0.00 ? 70 LEU A HD22 5  
ATOM 6339  H HD23 . LEU A 1 70 ? 11.199  -3.000  -7.891  1.00 0.00 ? 70 LEU A HD23 5  
ATOM 6340  N N    . VAL A 1 71 ? 6.551   -2.046  -4.887  1.00 0.00 ? 71 VAL A N    5  
ATOM 6341  C CA   . VAL A 1 71 ? 5.114   -1.846  -5.235  1.00 0.00 ? 71 VAL A CA   5  
ATOM 6342  C C    . VAL A 1 71 ? 4.852   -0.387  -5.617  1.00 0.00 ? 71 VAL A C    5  
ATOM 6343  O O    . VAL A 1 71 ? 4.318   -0.115  -6.669  1.00 0.00 ? 71 VAL A O    5  
ATOM 6344  C CB   . VAL A 1 71 ? 4.219   -2.261  -4.041  1.00 0.00 ? 71 VAL A CB   5  
ATOM 6345  C CG1  . VAL A 1 71 ? 2.809   -1.631  -4.135  1.00 0.00 ? 71 VAL A CG1  5  
ATOM 6346  C CG2  . VAL A 1 71 ? 4.094   -3.787  -4.000  1.00 0.00 ? 71 VAL A CG2  5  
ATOM 6347  H H    . VAL A 1 71 ? 6.808   -2.327  -3.984  1.00 0.00 ? 71 VAL A H    5  
ATOM 6348  H HA   . VAL A 1 71 ? 4.905   -2.443  -6.106  1.00 0.00 ? 71 VAL A HA   5  
ATOM 6349  H HB   . VAL A 1 71 ? 4.683   -1.924  -3.129  1.00 0.00 ? 71 VAL A HB   5  
ATOM 6350  H HG11 . VAL A 1 71 ? 2.137   -2.144  -3.459  1.00 0.00 ? 71 VAL A HG11 5  
ATOM 6351  H HG12 . VAL A 1 71 ? 2.440   -1.716  -5.144  1.00 0.00 ? 71 VAL A HG12 5  
ATOM 6352  H HG13 . VAL A 1 71 ? 2.851   -0.586  -3.856  1.00 0.00 ? 71 VAL A HG13 5  
ATOM 6353  H HG21 . VAL A 1 71 ? 3.354   -4.066  -3.264  1.00 0.00 ? 71 VAL A HG21 5  
ATOM 6354  H HG22 . VAL A 1 71 ? 5.048   -4.219  -3.729  1.00 0.00 ? 71 VAL A HG22 5  
ATOM 6355  H HG23 . VAL A 1 71 ? 3.795   -4.154  -4.970  1.00 0.00 ? 71 VAL A HG23 5  
ATOM 6356  N N    . CYS A 1 72 ? 5.172   0.558   -4.783  1.00 0.00 ? 72 CYS A N    5  
ATOM 6357  C CA   . CYS A 1 72 ? 4.855   1.962   -5.157  1.00 0.00 ? 72 CYS A CA   5  
ATOM 6358  C C    . CYS A 1 72 ? 5.662   2.383   -6.397  1.00 0.00 ? 72 CYS A C    5  
ATOM 6359  O O    . CYS A 1 72 ? 5.243   3.225   -7.167  1.00 0.00 ? 72 CYS A O    5  
ATOM 6360  C CB   . CYS A 1 72 ? 5.171   2.889   -3.966  1.00 0.00 ? 72 CYS A CB   5  
ATOM 6361  S SG   . CYS A 1 72 ? 3.902   4.163   -3.825  1.00 0.00 ? 72 CYS A SG   5  
ATOM 6362  H H    . CYS A 1 72 ? 5.571   0.354   -3.911  1.00 0.00 ? 72 CYS A H    5  
ATOM 6363  H HA   . CYS A 1 72 ? 3.794   1.983   -5.369  1.00 0.00 ? 72 CYS A HA   5  
ATOM 6364  H HB2  . CYS A 1 72 ? 5.188   2.310   -3.059  1.00 0.00 ? 72 CYS A HB2  5  
ATOM 6365  H HB3  . CYS A 1 72 ? 6.134   3.362   -4.101  1.00 0.00 ? 72 CYS A HB3  5  
ATOM 6366  N N    . SER A 1 73 ? 6.814   1.790   -6.595  1.00 0.00 ? 73 SER A N    5  
ATOM 6367  C CA   . SER A 1 73 ? 7.637   2.153   -7.793  1.00 0.00 ? 73 SER A CA   5  
ATOM 6368  C C    . SER A 1 73 ? 7.074   1.500   -9.075  1.00 0.00 ? 73 SER A C    5  
ATOM 6369  O O    . SER A 1 73 ? 7.065   2.110   -10.125 1.00 0.00 ? 73 SER A O    5  
ATOM 6370  C CB   . SER A 1 73 ? 9.085   1.712   -7.581  1.00 0.00 ? 73 SER A CB   5  
ATOM 6371  O OG   . SER A 1 73 ? 9.932   2.454   -8.448  1.00 0.00 ? 73 SER A OG   5  
ATOM 6372  H H    . SER A 1 73 ? 7.133   1.119   -5.939  1.00 0.00 ? 73 SER A H    5  
ATOM 6373  H HA   . SER A 1 73 ? 7.603   3.223   -7.932  1.00 0.00 ? 73 SER A HA   5  
ATOM 6374  H HB2  . SER A 1 73 ? 9.374   1.897   -6.560  1.00 0.00 ? 73 SER A HB2  5  
ATOM 6375  H HB3  . SER A 1 73 ? 9.173   0.654   -7.792  1.00 0.00 ? 73 SER A HB3  5  
ATOM 6376  H HG   . SER A 1 73 ? 10.841  2.205   -8.260  1.00 0.00 ? 73 SER A HG   5  
ATOM 6377  N N    . MET A 1 74 ? 6.606   0.278   -9.012  1.00 0.00 ? 74 MET A N    5  
ATOM 6378  C CA   . MET A 1 74 ? 6.052   -0.379  -10.247 1.00 0.00 ? 74 MET A CA   5  
ATOM 6379  C C    . MET A 1 74 ? 4.692   0.242   -10.623 1.00 0.00 ? 74 MET A C    5  
ATOM 6380  O O    . MET A 1 74 ? 4.411   0.451   -11.787 1.00 0.00 ? 74 MET A O    5  
ATOM 6381  C CB   . MET A 1 74 ? 5.875   -1.904  -9.997  1.00 0.00 ? 74 MET A CB   5  
ATOM 6382  C CG   . MET A 1 74 ? 7.050   -2.712  -10.576 1.00 0.00 ? 74 MET A CG   5  
ATOM 6383  S SD   . MET A 1 74 ? 6.570   -4.453  -10.758 1.00 0.00 ? 74 MET A SD   5  
ATOM 6384  C CE   . MET A 1 74 ? 5.729   -4.671  -9.167  1.00 0.00 ? 74 MET A CE   5  
ATOM 6385  H H    . MET A 1 74 ? 6.618   -0.209  -8.161  1.00 0.00 ? 74 MET A H    5  
ATOM 6386  H HA   . MET A 1 74 ? 6.716   -0.232  -11.081 1.00 0.00 ? 74 MET A HA   5  
ATOM 6387  H HB2  . MET A 1 74 ? 5.825   -2.081  -8.936  1.00 0.00 ? 74 MET A HB2  5  
ATOM 6388  H HB3  . MET A 1 74 ? 4.959   -2.249  -10.461 1.00 0.00 ? 74 MET A HB3  5  
ATOM 6389  H HG2  . MET A 1 74 ? 7.321   -2.324  -11.547 1.00 0.00 ? 74 MET A HG2  5  
ATOM 6390  H HG3  . MET A 1 74 ? 7.895   -2.638  -9.914  1.00 0.00 ? 74 MET A HG3  5  
ATOM 6391  H HE1  . MET A 1 74 ? 5.566   -5.725  -8.991  1.00 0.00 ? 74 MET A HE1  5  
ATOM 6392  H HE2  . MET A 1 74 ? 4.779   -4.164  -9.183  1.00 0.00 ? 74 MET A HE2  5  
ATOM 6393  H HE3  . MET A 1 74 ? 6.341   -4.263  -8.376  1.00 0.00 ? 74 MET A HE3  5  
ATOM 6394  N N    . LEU A 1 75 ? 3.841   0.525   -9.676  1.00 0.00 ? 75 LEU A N    5  
ATOM 6395  C CA   . LEU A 1 75 ? 2.515   1.112   -10.037 1.00 0.00 ? 75 LEU A CA   5  
ATOM 6396  C C    . LEU A 1 75 ? 2.683   2.574   -10.477 1.00 0.00 ? 75 LEU A C    5  
ATOM 6397  O O    . LEU A 1 75 ? 1.730   3.324   -10.543 1.00 0.00 ? 75 LEU A O    5  
ATOM 6398  C CB   . LEU A 1 75 ? 1.564   1.042   -8.832  1.00 0.00 ? 75 LEU A CB   5  
ATOM 6399  C CG   . LEU A 1 75 ? 1.482   -0.401  -8.295  1.00 0.00 ? 75 LEU A CG   5  
ATOM 6400  C CD1  . LEU A 1 75 ? 0.381   -0.496  -7.235  1.00 0.00 ? 75 LEU A CD1  5  
ATOM 6401  C CD2  . LEU A 1 75 ? 1.172   -1.381  -9.437  1.00 0.00 ? 75 LEU A CD2  5  
ATOM 6402  H H    . LEU A 1 75 ? 4.064   0.345   -8.738  1.00 0.00 ? 75 LEU A H    5  
ATOM 6403  H HA   . LEU A 1 75 ? 2.091   0.553   -10.857 1.00 0.00 ? 75 LEU A HA   5  
ATOM 6404  H HB2  . LEU A 1 75 ? 1.929   1.695   -8.050  1.00 0.00 ? 75 LEU A HB2  5  
ATOM 6405  H HB3  . LEU A 1 75 ? 0.581   1.364   -9.136  1.00 0.00 ? 75 LEU A HB3  5  
ATOM 6406  H HG   . LEU A 1 75 ? 2.420   -0.663  -7.843  1.00 0.00 ? 75 LEU A HG   5  
ATOM 6407  H HD11 . LEU A 1 75 ? 0.706   0.000   -6.333  1.00 0.00 ? 75 LEU A HD11 5  
ATOM 6408  H HD12 . LEU A 1 75 ? 0.181   -1.536  -7.020  1.00 0.00 ? 75 LEU A HD12 5  
ATOM 6409  H HD13 . LEU A 1 75 ? -0.516  -0.026  -7.603  1.00 0.00 ? 75 LEU A HD13 5  
ATOM 6410  H HD21 . LEU A 1 75 ? 0.766   -2.296  -9.032  1.00 0.00 ? 75 LEU A HD21 5  
ATOM 6411  H HD22 . LEU A 1 75 ? 2.082   -1.604  -9.976  1.00 0.00 ? 75 LEU A HD22 5  
ATOM 6412  H HD23 . LEU A 1 75 ? 0.453   -0.938  -10.110 1.00 0.00 ? 75 LEU A HD23 5  
ATOM 6413  N N    . HIS A 1 76 ? 3.887   2.983   -10.781 1.00 0.00 ? 76 HIS A N    5  
ATOM 6414  C CA   . HIS A 1 76 ? 4.115   4.395   -11.218 1.00 0.00 ? 76 HIS A CA   5  
ATOM 6415  C C    . HIS A 1 76 ? 3.408   5.347   -10.244 1.00 0.00 ? 76 HIS A C    5  
ATOM 6416  O O    . HIS A 1 76 ? 3.074   6.461   -10.595 1.00 0.00 ? 76 HIS A O    5  
ATOM 6417  C CB   . HIS A 1 76 ? 3.574   4.590   -12.642 1.00 0.00 ? 76 HIS A CB   5  
ATOM 6418  C CG   . HIS A 1 76 ? 4.247   3.615   -13.568 1.00 0.00 ? 76 HIS A CG   5  
ATOM 6419  N ND1  . HIS A 1 76 ? 5.596   3.698   -13.875 1.00 0.00 ? 76 HIS A ND1  5  
ATOM 6420  C CD2  . HIS A 1 76 ? 3.771   2.530   -14.261 1.00 0.00 ? 76 HIS A CD2  5  
ATOM 6421  C CE1  . HIS A 1 76 ? 5.882   2.690   -14.720 1.00 0.00 ? 76 HIS A CE1  5  
ATOM 6422  N NE2  . HIS A 1 76 ? 4.805   1.947   -14.987 1.00 0.00 ? 76 HIS A NE2  5  
ATOM 6423  H H    . HIS A 1 76 ? 4.643   2.362   -10.714 1.00 0.00 ? 76 HIS A H    5  
ATOM 6424  H HA   . HIS A 1 76 ? 5.175   4.601   -11.210 1.00 0.00 ? 76 HIS A HA   5  
ATOM 6425  H HB2  . HIS A 1 76 ? 2.509   4.419   -12.655 1.00 0.00 ? 76 HIS A HB2  5  
ATOM 6426  H HB3  . HIS A 1 76 ? 3.782   5.598   -12.971 1.00 0.00 ? 76 HIS A HB3  5  
ATOM 6427  H HD1  . HIS A 1 76 ? 6.227   4.369   -13.539 1.00 0.00 ? 76 HIS A HD1  5  
ATOM 6428  H HD2  . HIS A 1 76 ? 2.749   2.181   -14.244 1.00 0.00 ? 76 HIS A HD2  5  
ATOM 6429  H HE1  . HIS A 1 76 ? 6.864   2.504   -15.130 1.00 0.00 ? 76 HIS A HE1  5  
ATOM 6430  N N    . LEU A 1 77 ? 3.168   4.927   -9.032  1.00 0.00 ? 77 LEU A N    5  
ATOM 6431  C CA   . LEU A 1 77 ? 2.476   5.815   -8.052  1.00 0.00 ? 77 LEU A CA   5  
ATOM 6432  C C    . LEU A 1 77 ? 3.524   6.723   -7.387  1.00 0.00 ? 77 LEU A C    5  
ATOM 6433  O O    . LEU A 1 77 ? 3.189   7.721   -6.779  1.00 0.00 ? 77 LEU A O    5  
ATOM 6434  C CB   . LEU A 1 77 ? 1.740   4.921   -7.013  1.00 0.00 ? 77 LEU A CB   5  
ATOM 6435  C CG   . LEU A 1 77 ? 0.235   5.267   -6.891  1.00 0.00 ? 77 LEU A CG   5  
ATOM 6436  C CD1  . LEU A 1 77 ? -0.456  5.359   -8.275  1.00 0.00 ? 77 LEU A CD1  5  
ATOM 6437  C CD2  . LEU A 1 77 ? -0.466  4.196   -6.029  1.00 0.00 ? 77 LEU A CD2  5  
ATOM 6438  H H    . LEU A 1 77 ? 3.439   4.031   -8.764  1.00 0.00 ? 77 LEU A H    5  
ATOM 6439  H HA   . LEU A 1 77 ? 1.774   6.439   -8.577  1.00 0.00 ? 77 LEU A HA   5  
ATOM 6440  H HB2  . LEU A 1 77 ? 1.830   3.893   -7.314  1.00 0.00 ? 77 LEU A HB2  5  
ATOM 6441  H HB3  . LEU A 1 77 ? 2.201   5.039   -6.041  1.00 0.00 ? 77 LEU A HB3  5  
ATOM 6442  H HG   . LEU A 1 77 ? 0.149   6.212   -6.399  1.00 0.00 ? 77 LEU A HG   5  
ATOM 6443  H HD11 . LEU A 1 77 ? -1.448  4.927   -8.228  1.00 0.00 ? 77 LEU A HD11 5  
ATOM 6444  H HD12 . LEU A 1 77 ? 0.126   4.833   -9.012  1.00 0.00 ? 77 LEU A HD12 5  
ATOM 6445  H HD13 . LEU A 1 77 ? -0.539  6.397   -8.564  1.00 0.00 ? 77 LEU A HD13 5  
ATOM 6446  H HD21 . LEU A 1 77 ? -0.816  3.394   -6.658  1.00 0.00 ? 77 LEU A HD21 5  
ATOM 6447  H HD22 . LEU A 1 77 ? -1.308  4.638   -5.523  1.00 0.00 ? 77 LEU A HD22 5  
ATOM 6448  H HD23 . LEU A 1 77 ? 0.224   3.802   -5.299  1.00 0.00 ? 77 LEU A HD23 5  
ATOM 6449  N N    . CYS A 1 78 ? 4.790   6.396   -7.523  1.00 0.00 ? 78 CYS A N    5  
ATOM 6450  C CA   . CYS A 1 78 ? 5.875   7.250   -6.929  1.00 0.00 ? 78 CYS A CA   5  
ATOM 6451  C C    . CYS A 1 78 ? 6.887   7.579   -8.032  1.00 0.00 ? 78 CYS A C    5  
ATOM 6452  O O    . CYS A 1 78 ? 6.870   6.992   -9.096  1.00 0.00 ? 78 CYS A O    5  
ATOM 6453  C CB   . CYS A 1 78 ? 6.593   6.498   -5.810  1.00 0.00 ? 78 CYS A CB   5  
ATOM 6454  S SG   . CYS A 1 78 ? 5.596   6.558   -4.315  1.00 0.00 ? 78 CYS A SG   5  
ATOM 6455  H H    . CYS A 1 78 ? 5.031   5.595   -8.035  1.00 0.00 ? 78 CYS A H    5  
ATOM 6456  H HA   . CYS A 1 78 ? 5.453   8.174   -6.554  1.00 0.00 ? 78 CYS A HA   5  
ATOM 6457  H HB2  . CYS A 1 78 ? 6.741   5.471   -6.103  1.00 0.00 ? 78 CYS A HB2  5  
ATOM 6458  H HB3  . CYS A 1 78 ? 7.553   6.959   -5.618  1.00 0.00 ? 78 CYS A HB3  5  
ATOM 6459  N N    . SER A 1 79 ? 7.771   8.507   -7.788  1.00 0.00 ? 79 SER A N    5  
ATOM 6460  C CA   . SER A 1 79 ? 8.780   8.856   -8.825  1.00 0.00 ? 79 SER A CA   5  
ATOM 6461  C C    . SER A 1 79 ? 9.828   7.743   -8.903  1.00 0.00 ? 79 SER A C    5  
ATOM 6462  O O    . SER A 1 79 ? 10.129  7.235   -9.965  1.00 0.00 ? 79 SER A O    5  
ATOM 6463  C CB   . SER A 1 79 ? 9.458   10.180  -8.460  1.00 0.00 ? 79 SER A CB   5  
ATOM 6464  O OG   . SER A 1 79 ? 10.350  9.967   -7.374  1.00 0.00 ? 79 SER A OG   5  
ATOM 6465  H H    . SER A 1 79 ? 7.775   8.967   -6.922  1.00 0.00 ? 79 SER A H    5  
ATOM 6466  H HA   . SER A 1 79 ? 8.289   8.956   -9.783  1.00 0.00 ? 79 SER A HA   5  
ATOM 6467  H HB2  . SER A 1 79 ? 10.011  10.550  -9.307  1.00 0.00 ? 79 SER A HB2  5  
ATOM 6468  H HB3  . SER A 1 79 ? 8.702   10.905  -8.182  1.00 0.00 ? 79 SER A HB3  5  
ATOM 6469  H HG   . SER A 1 79 ? 9.875   9.492   -6.688  1.00 0.00 ? 79 SER A HG   5  
ATOM 6470  N N    . GLY A 1 80 ? 10.387  7.356   -7.782  1.00 0.00 ? 80 GLY A N    5  
ATOM 6471  C CA   . GLY A 1 80 ? 11.415  6.276   -7.775  1.00 0.00 ? 80 GLY A CA   5  
ATOM 6472  C C    . GLY A 1 80 ? 12.523  6.656   -6.793  1.00 0.00 ? 80 GLY A C    5  
ATOM 6473  O O    . GLY A 1 80 ? 13.085  7.731   -6.872  1.00 0.00 ? 80 GLY A O    5  
ATOM 6474  H H    . GLY A 1 80 ? 10.130  7.780   -6.938  1.00 0.00 ? 80 GLY A H    5  
ATOM 6475  H HA2  . GLY A 1 80 ? 10.958  5.346   -7.467  1.00 0.00 ? 80 GLY A HA2  5  
ATOM 6476  H HA3  . GLY A 1 80 ? 11.840  6.160   -8.762  1.00 0.00 ? 80 GLY A HA3  5  
ATOM 6477  N N    . LEU A 1 81 ? 12.834  5.793   -5.859  1.00 0.00 ? 81 LEU A N    5  
ATOM 6478  C CA   . LEU A 1 81 ? 13.901  6.116   -4.864  1.00 0.00 ? 81 LEU A CA   5  
ATOM 6479  C C    . LEU A 1 81 ? 15.100  6.724   -5.587  1.00 0.00 ? 81 LEU A C    5  
ATOM 6480  O O    . LEU A 1 81 ? 15.924  7.357   -4.957  1.00 0.00 ? 81 LEU A O    5  
ATOM 6481  C CB   . LEU A 1 81 ? 14.336  4.838   -4.136  1.00 0.00 ? 81 LEU A CB   5  
ATOM 6482  C CG   . LEU A 1 81 ? 13.104  4.018   -3.739  1.00 0.00 ? 81 LEU A CG   5  
ATOM 6483  C CD1  . LEU A 1 81 ? 13.538  2.849   -2.852  1.00 0.00 ? 81 LEU A CD1  5  
ATOM 6484  C CD2  . LEU A 1 81 ? 12.120  4.903   -2.968  1.00 0.00 ? 81 LEU A CD2  5  
ATOM 6485  H H    . LEU A 1 81 ? 12.361  4.936   -5.808  1.00 0.00 ? 81 LEU A H    5  
ATOM 6486  H HA   . LEU A 1 81 ? 13.520  6.825   -4.151  1.00 0.00 ? 81 LEU A HA   5  
ATOM 6487  H HB2  . LEU A 1 81 ? 14.964  4.249   -4.788  1.00 0.00 ? 81 LEU A HB2  5  
ATOM 6488  H HB3  . LEU A 1 81 ? 14.890  5.103   -3.248  1.00 0.00 ? 81 LEU A HB3  5  
ATOM 6489  H HG   . LEU A 1 81 ? 12.626  3.632   -4.627  1.00 0.00 ? 81 LEU A HG   5  
ATOM 6490  H HD11 . LEU A 1 81 ? 14.084  3.226   -2.000  1.00 0.00 ? 81 LEU A HD11 5  
ATOM 6491  H HD12 . LEU A 1 81 ? 14.171  2.182   -3.419  1.00 0.00 ? 81 LEU A HD12 5  
ATOM 6492  H HD13 . LEU A 1 81 ? 12.665  2.312   -2.510  1.00 0.00 ? 81 LEU A HD13 5  
ATOM 6493  H HD21 . LEU A 1 81 ? 11.396  4.283   -2.461  1.00 0.00 ? 81 LEU A HD21 5  
ATOM 6494  H HD22 . LEU A 1 81 ? 11.611  5.559   -3.658  1.00 0.00 ? 81 LEU A HD22 5  
ATOM 6495  H HD23 . LEU A 1 81 ? 12.660  5.493   -2.242  1.00 0.00 ? 81 LEU A HD23 5  
ATOM 6496  N N    . VAL A 1 82 ? 15.231  6.555   -6.878  1.00 0.00 ? 82 VAL A N    5  
ATOM 6497  C CA   . VAL A 1 82 ? 16.417  7.154   -7.591  1.00 0.00 ? 82 VAL A CA   5  
ATOM 6498  C C    . VAL A 1 82 ? 15.958  7.899   -8.862  1.00 0.00 ? 82 VAL A C    5  
ATOM 6499  O O    . VAL A 1 82 ? 15.863  7.300   -9.913  1.00 0.00 ? 82 VAL A O    5  
ATOM 6500  C CB   . VAL A 1 82 ? 17.391  6.030   -7.975  1.00 0.00 ? 82 VAL A CB   5  
ATOM 6501  C CG1  . VAL A 1 82 ? 16.672  4.910   -8.758  1.00 0.00 ? 82 VAL A CG1  5  
ATOM 6502  C CG2  . VAL A 1 82 ? 18.526  6.613   -8.827  1.00 0.00 ? 82 VAL A CG2  5  
ATOM 6503  H H    . VAL A 1 82 ? 14.575  6.029   -7.397  1.00 0.00 ? 82 VAL A H    5  
ATOM 6504  H HA   . VAL A 1 82 ? 16.937  7.839   -6.941  1.00 0.00 ? 82 VAL A HA   5  
ATOM 6505  H HB   . VAL A 1 82 ? 17.809  5.618   -7.070  1.00 0.00 ? 82 VAL A HB   5  
ATOM 6506  H HG11 . VAL A 1 82 ? 17.191  3.976   -8.600  1.00 0.00 ? 82 VAL A HG11 5  
ATOM 6507  H HG12 . VAL A 1 82 ? 16.670  5.139   -9.813  1.00 0.00 ? 82 VAL A HG12 5  
ATOM 6508  H HG13 . VAL A 1 82 ? 15.655  4.814   -8.411  1.00 0.00 ? 82 VAL A HG13 5  
ATOM 6509  H HG21 . VAL A 1 82 ? 18.872  7.535   -8.385  1.00 0.00 ? 82 VAL A HG21 5  
ATOM 6510  H HG22 . VAL A 1 82 ? 18.164  6.806   -9.826  1.00 0.00 ? 82 VAL A HG22 5  
ATOM 6511  H HG23 . VAL A 1 82 ? 19.342  5.906   -8.871  1.00 0.00 ? 82 VAL A HG23 5  
ATOM 6512  N N    . PRO A 1 83 ? 15.686  9.191   -8.752  1.00 0.00 ? 83 PRO A N    5  
ATOM 6513  C CA   . PRO A 1 83 ? 15.248  9.981   -9.917  1.00 0.00 ? 83 PRO A CA   5  
ATOM 6514  C C    . PRO A 1 83 ? 16.469  10.313  -10.788 1.00 0.00 ? 83 PRO A C    5  
ATOM 6515  O O    . PRO A 1 83 ? 17.333  11.073  -10.400 1.00 0.00 ? 83 PRO A O    5  
ATOM 6516  C CB   . PRO A 1 83 ? 14.636  11.261  -9.310  1.00 0.00 ? 83 PRO A CB   5  
ATOM 6517  C CG   . PRO A 1 83 ? 15.077  11.312  -7.816  1.00 0.00 ? 83 PRO A CG   5  
ATOM 6518  C CD   . PRO A 1 83 ? 15.774  9.969   -7.493  1.00 0.00 ? 83 PRO A CD   5  
ATOM 6519  H HA   . PRO A 1 83 ? 14.520  9.443   -10.503 1.00 0.00 ? 83 PRO A HA   5  
ATOM 6520  H HB2  . PRO A 1 83 ? 14.989  12.139  -9.838  1.00 0.00 ? 83 PRO A HB2  5  
ATOM 6521  H HB3  . PRO A 1 83 ? 13.557  11.214  -9.366  1.00 0.00 ? 83 PRO A HB3  5  
ATOM 6522  H HG2  . PRO A 1 83 ? 15.765  12.136  -7.664  1.00 0.00 ? 83 PRO A HG2  5  
ATOM 6523  H HG3  . PRO A 1 83 ? 14.213  11.439  -7.177  1.00 0.00 ? 83 PRO A HG3  5  
ATOM 6524  H HD2  . PRO A 1 83 ? 16.812  10.138  -7.229  1.00 0.00 ? 83 PRO A HD2  5  
ATOM 6525  H HD3  . PRO A 1 83 ? 15.264  9.457   -6.695  1.00 0.00 ? 83 PRO A HD3  5  
ATOM 6526  N N    . ARG A 1 84 ? 16.542  9.746   -11.960 1.00 0.00 ? 84 ARG A N    5  
ATOM 6527  C CA   . ARG A 1 84 ? 17.702  10.026  -12.854 1.00 0.00 ? 84 ARG A CA   5  
ATOM 6528  C C    . ARG A 1 84 ? 17.580  11.443  -13.417 1.00 0.00 ? 84 ARG A C    5  
ATOM 6529  O O    . ARG A 1 84 ? 18.526  11.892  -14.044 1.00 0.00 ? 84 ARG A O    5  
ATOM 6530  C CB   . ARG A 1 84 ? 17.717  9.007   -14.004 1.00 0.00 ? 84 ARG A CB   5  
ATOM 6531  C CG   . ARG A 1 84 ? 16.370  9.032   -14.775 1.00 0.00 ? 84 ARG A CG   5  
ATOM 6532  C CD   . ARG A 1 84 ? 16.502  9.857   -16.064 1.00 0.00 ? 84 ARG A CD   5  
ATOM 6533  N NE   . ARG A 1 84 ? 15.145  10.203  -16.573 1.00 0.00 ? 84 ARG A NE   5  
ATOM 6534  C CZ   . ARG A 1 84 ? 15.004  11.132  -17.479 1.00 0.00 ? 84 ARG A CZ   5  
ATOM 6535  N NH1  . ARG A 1 84 ? 16.053  11.760  -17.937 1.00 0.00 ? 84 ARG A NH1  5  
ATOM 6536  N NH2  . ARG A 1 84 ? 13.817  11.433  -17.926 1.00 0.00 ? 84 ARG A NH2  5  
ATOM 6537  O OXT  . ARG A 1 84 ? 16.546  12.055  -13.211 1.00 0.00 ? 84 ARG A OXT  5  
ATOM 6538  H H    . ARG A 1 84 ? 15.834  9.135   -12.255 1.00 0.00 ? 84 ARG A H    5  
ATOM 6539  H HA   . ARG A 1 84 ? 18.617  9.942   -12.288 1.00 0.00 ? 84 ARG A HA   5  
ATOM 6540  H HB2  . ARG A 1 84 ? 18.532  9.244   -14.675 1.00 0.00 ? 84 ARG A HB2  5  
ATOM 6541  H HB3  . ARG A 1 84 ? 17.875  8.019   -13.593 1.00 0.00 ? 84 ARG A HB3  5  
ATOM 6542  H HG2  . ARG A 1 84 ? 16.087  8.021   -15.036 1.00 0.00 ? 84 ARG A HG2  5  
ATOM 6543  H HG3  . ARG A 1 84 ? 15.597  9.464   -14.157 1.00 0.00 ? 84 ARG A HG3  5  
ATOM 6544  H HD2  . ARG A 1 84 ? 17.051  10.763  -15.862 1.00 0.00 ? 84 ARG A HD2  5  
ATOM 6545  H HD3  . ARG A 1 84 ? 17.027  9.278   -16.809 1.00 0.00 ? 84 ARG A HD3  5  
ATOM 6546  H HE   . ARG A 1 84 ? 14.357  9.732   -16.227 1.00 0.00 ? 84 ARG A HE   5  
ATOM 6547  H HH11 . ARG A 1 84 ? 16.963  11.529  -17.594 1.00 0.00 ? 84 ARG A HH11 5  
ATOM 6548  H HH12 . ARG A 1 84 ? 15.945  12.471  -18.631 1.00 0.00 ? 84 ARG A HH12 5  
ATOM 6549  H HH21 . ARG A 1 84 ? 13.012  10.952  -17.574 1.00 0.00 ? 84 ARG A HH21 5  
ATOM 6550  H HH22 . ARG A 1 84 ? 13.709  12.145  -18.620 1.00 0.00 ? 84 ARG A HH22 5  
ATOM 6551  N N    . SER A 1 1  ? 6.209   16.982  -1.066  1.00 0.00 ? 1  SER A N    6  
ATOM 6552  C CA   . SER A 1 1  ? 5.169   16.728  -0.030  1.00 0.00 ? 1  SER A CA   6  
ATOM 6553  C C    . SER A 1 1  ? 4.022   15.921  -0.642  1.00 0.00 ? 1  SER A C    6  
ATOM 6554  O O    . SER A 1 1  ? 2.865   16.117  -0.326  1.00 0.00 ? 1  SER A O    6  
ATOM 6555  C CB   . SER A 1 1  ? 4.630   18.062  0.489   1.00 0.00 ? 1  SER A CB   6  
ATOM 6556  O OG   . SER A 1 1  ? 3.951   18.735  -0.564  1.00 0.00 ? 1  SER A OG   6  
ATOM 6557  H H1   . SER A 1 1  ? 7.149   16.975  -0.623  1.00 0.00 ? 1  SER A H1   6  
ATOM 6558  H H2   . SER A 1 1  ? 6.039   17.909  -1.506  1.00 0.00 ? 1  SER A H2   6  
ATOM 6559  H H3   . SER A 1 1  ? 6.165   16.239  -1.791  1.00 0.00 ? 1  SER A H3   6  
ATOM 6560  H HA   . SER A 1 1  ? 5.603   16.173  0.790   1.00 0.00 ? 1  SER A HA   6  
ATOM 6561  H HB2  . SER A 1 1  ? 3.942   17.885  1.298   1.00 0.00 ? 1  SER A HB2  6  
ATOM 6562  H HB3  . SER A 1 1  ? 5.453   18.667  0.845   1.00 0.00 ? 1  SER A HB3  6  
ATOM 6563  H HG   . SER A 1 1  ? 3.030   18.465  -0.544  1.00 0.00 ? 1  SER A HG   6  
ATOM 6564  N N    . ASP A 1 2  ? 4.346   15.021  -1.533  1.00 0.00 ? 2  ASP A N    6  
ATOM 6565  C CA   . ASP A 1 2  ? 3.297   14.196  -2.197  1.00 0.00 ? 2  ASP A CA   6  
ATOM 6566  C C    . ASP A 1 2  ? 2.641   13.255  -1.183  1.00 0.00 ? 2  ASP A C    6  
ATOM 6567  O O    . ASP A 1 2  ? 3.253   12.338  -0.670  1.00 0.00 ? 2  ASP A O    6  
ATOM 6568  C CB   . ASP A 1 2  ? 3.941   13.381  -3.323  1.00 0.00 ? 2  ASP A CB   6  
ATOM 6569  C CG   . ASP A 1 2  ? 2.930   12.377  -3.884  1.00 0.00 ? 2  ASP A CG   6  
ATOM 6570  O OD1  . ASP A 1 2  ? 2.045   12.800  -4.611  1.00 0.00 ? 2  ASP A OD1  6  
ATOM 6571  O OD2  . ASP A 1 2  ? 3.056   11.204  -3.577  1.00 0.00 ? 2  ASP A OD2  6  
ATOM 6572  H H    . ASP A 1 2  ? 5.288   14.892  -1.774  1.00 0.00 ? 2  ASP A H    6  
ATOM 6573  H HA   . ASP A 1 2  ? 2.545   14.844  -2.616  1.00 0.00 ? 2  ASP A HA   6  
ATOM 6574  H HB2  . ASP A 1 2  ? 4.259   14.049  -4.111  1.00 0.00 ? 2  ASP A HB2  6  
ATOM 6575  H HB3  . ASP A 1 2  ? 4.797   12.850  -2.937  1.00 0.00 ? 2  ASP A HB3  6  
ATOM 6576  N N    . VAL A 1 3  ? 1.396   13.507  -0.882  1.00 0.00 ? 3  VAL A N    6  
ATOM 6577  C CA   . VAL A 1 3  ? 0.660   12.675  0.110   1.00 0.00 ? 3  VAL A CA   6  
ATOM 6578  C C    . VAL A 1 3  ? 0.314   11.296  -0.472  1.00 0.00 ? 3  VAL A C    6  
ATOM 6579  O O    . VAL A 1 3  ? -0.110  10.413  0.252   1.00 0.00 ? 3  VAL A O    6  
ATOM 6580  C CB   . VAL A 1 3  ? -0.648  13.416  0.504   1.00 0.00 ? 3  VAL A CB   6  
ATOM 6581  C CG1  . VAL A 1 3  ? -0.405  14.925  0.485   1.00 0.00 ? 3  VAL A CG1  6  
ATOM 6582  C CG2  . VAL A 1 3  ? -1.799  13.087  -0.464  1.00 0.00 ? 3  VAL A CG2  6  
ATOM 6583  H H    . VAL A 1 3  ? 0.943   14.265  -1.305  1.00 0.00 ? 3  VAL A H    6  
ATOM 6584  H HA   . VAL A 1 3  ? 1.248   12.569  1.010   1.00 0.00 ? 3  VAL A HA   6  
ATOM 6585  H HB   . VAL A 1 3  ? -0.934  13.122  1.506   1.00 0.00 ? 3  VAL A HB   6  
ATOM 6586  H HG11 . VAL A 1 3  ? -1.216  15.426  0.993   1.00 0.00 ? 3  VAL A HG11 6  
ATOM 6587  H HG12 . VAL A 1 3  ? -0.357  15.269  -0.538  1.00 0.00 ? 3  VAL A HG12 6  
ATOM 6588  H HG13 . VAL A 1 3  ? 0.525   15.148  0.984   1.00 0.00 ? 3  VAL A HG13 6  
ATOM 6589  H HG21 . VAL A 1 3  ? -2.149  12.082  -0.274  1.00 0.00 ? 3  VAL A HG21 6  
ATOM 6590  H HG22 . VAL A 1 3  ? -1.449  13.163  -1.481  1.00 0.00 ? 3  VAL A HG22 6  
ATOM 6591  H HG23 . VAL A 1 3  ? -2.611  13.785  -0.308  1.00 0.00 ? 3  VAL A HG23 6  
ATOM 6592  N N    . TYR A 1 4  ? 0.425   11.091  -1.766  1.00 0.00 ? 4  TYR A N    6  
ATOM 6593  C CA   . TYR A 1 4  ? 0.007   9.761   -2.315  1.00 0.00 ? 4  TYR A CA   6  
ATOM 6594  C C    . TYR A 1 4  ? 1.056   8.680   -1.994  1.00 0.00 ? 4  TYR A C    6  
ATOM 6595  O O    . TYR A 1 4  ? 0.734   7.616   -1.504  1.00 0.00 ? 4  TYR A O    6  
ATOM 6596  C CB   . TYR A 1 4  ? -0.254  9.878   -3.821  1.00 0.00 ? 4  TYR A CB   6  
ATOM 6597  C CG   . TYR A 1 4  ? -1.680  10.305  -4.090  1.00 0.00 ? 4  TYR A CG   6  
ATOM 6598  C CD1  . TYR A 1 4  ? -2.715  9.372   -3.983  1.00 0.00 ? 4  TYR A CD1  6  
ATOM 6599  C CD2  . TYR A 1 4  ? -1.962  11.622  -4.476  1.00 0.00 ? 4  TYR A CD2  6  
ATOM 6600  C CE1  . TYR A 1 4  ? -4.032  9.750   -4.259  1.00 0.00 ? 4  TYR A CE1  6  
ATOM 6601  C CE2  . TYR A 1 4  ? -3.281  12.003  -4.746  1.00 0.00 ? 4  TYR A CE2  6  
ATOM 6602  C CZ   . TYR A 1 4  ? -4.317  11.067  -4.638  1.00 0.00 ? 4  TYR A CZ   6  
ATOM 6603  O OH   . TYR A 1 4  ? -5.617  11.441  -4.910  1.00 0.00 ? 4  TYR A OH   6  
ATOM 6604  H H    . TYR A 1 4  ? 0.732   11.799  -2.370  1.00 0.00 ? 4  TYR A H    6  
ATOM 6605  H HA   . TYR A 1 4  ? -0.891  9.495   -1.775  1.00 0.00 ? 4  TYR A HA   6  
ATOM 6606  H HB2  . TYR A 1 4  ? 0.421   10.611  -4.241  1.00 0.00 ? 4  TYR A HB2  6  
ATOM 6607  H HB3  . TYR A 1 4  ? -0.079  8.931   -4.290  1.00 0.00 ? 4  TYR A HB3  6  
ATOM 6608  H HD1  . TYR A 1 4  ? -2.500  8.361   -3.681  1.00 0.00 ? 4  TYR A HD1  6  
ATOM 6609  H HD2  . TYR A 1 4  ? -1.162  12.344  -4.559  1.00 0.00 ? 4  TYR A HD2  6  
ATOM 6610  H HE1  . TYR A 1 4  ? -4.827  9.024   -4.181  1.00 0.00 ? 4  TYR A HE1  6  
ATOM 6611  H HE2  . TYR A 1 4  ? -3.499  13.019  -5.040  1.00 0.00 ? 4  TYR A HE2  6  
ATOM 6612  H HH   . TYR A 1 4  ? -5.703  11.551  -5.859  1.00 0.00 ? 4  TYR A HH   6  
ATOM 6613  N N    . CYS A 1 5  ? 2.307   8.944   -2.280  1.00 0.00 ? 5  CYS A N    6  
ATOM 6614  C CA   . CYS A 1 5  ? 3.366   7.927   -2.003  1.00 0.00 ? 5  CYS A CA   6  
ATOM 6615  C C    . CYS A 1 5  ? 3.345   7.584   -0.501  1.00 0.00 ? 5  CYS A C    6  
ATOM 6616  O O    . CYS A 1 5  ? 3.454   6.432   -0.130  1.00 0.00 ? 5  CYS A O    6  
ATOM 6617  C CB   . CYS A 1 5  ? 4.742   8.484   -2.405  1.00 0.00 ? 5  CYS A CB   6  
ATOM 6618  S SG   . CYS A 1 5  ? 5.807   7.116   -2.935  1.00 0.00 ? 5  CYS A SG   6  
ATOM 6619  H H    . CYS A 1 5  ? 2.539   9.811   -2.672  1.00 0.00 ? 5  CYS A H    6  
ATOM 6620  H HA   . CYS A 1 5  ? 3.161   7.031   -2.579  1.00 0.00 ? 5  CYS A HA   6  
ATOM 6621  H HB2  . CYS A 1 5  ? 4.618   9.184   -3.217  1.00 0.00 ? 5  CYS A HB2  6  
ATOM 6622  H HB3  . CYS A 1 5  ? 5.200   8.989   -1.567  1.00 0.00 ? 5  CYS A HB3  6  
ATOM 6623  N N    . GLU A 1 6  ? 3.237   8.552   0.363   1.00 0.00 ? 6  GLU A N    6  
ATOM 6624  C CA   . GLU A 1 6  ? 3.247   8.239   1.824   1.00 0.00 ? 6  GLU A CA   6  
ATOM 6625  C C    . GLU A 1 6  ? 2.138   7.242   2.160   1.00 0.00 ? 6  GLU A C    6  
ATOM 6626  O O    . GLU A 1 6  ? 2.323   6.337   2.949   1.00 0.00 ? 6  GLU A O    6  
ATOM 6627  C CB   . GLU A 1 6  ? 3.044   9.524   2.623   1.00 0.00 ? 6  GLU A CB   6  
ATOM 6628  C CG   . GLU A 1 6  ? 4.044   10.574  2.145   1.00 0.00 ? 6  GLU A CG   6  
ATOM 6629  C CD   . GLU A 1 6  ? 5.469   10.076  2.388   1.00 0.00 ? 6  GLU A CD   6  
ATOM 6630  O OE1  . GLU A 1 6  ? 5.978   10.303  3.474   1.00 0.00 ? 6  GLU A OE1  6  
ATOM 6631  O OE2  . GLU A 1 6  ? 6.029   9.476   1.485   1.00 0.00 ? 6  GLU A OE2  6  
ATOM 6632  H H    . GLU A 1 6  ? 3.172   9.481   0.058   1.00 0.00 ? 6  GLU A H    6  
ATOM 6633  H HA   . GLU A 1 6  ? 4.205   7.811   2.083   1.00 0.00 ? 6  GLU A HA   6  
ATOM 6634  H HB2  . GLU A 1 6  ? 2.038   9.888   2.474   1.00 0.00 ? 6  GLU A HB2  6  
ATOM 6635  H HB3  . GLU A 1 6  ? 3.206   9.327   3.672   1.00 0.00 ? 6  GLU A HB3  6  
ATOM 6636  H HG2  . GLU A 1 6  ? 3.899   10.749  1.089   1.00 0.00 ? 6  GLU A HG2  6  
ATOM 6637  H HG3  . GLU A 1 6  ? 3.888   11.493  2.688   1.00 0.00 ? 6  GLU A HG3  6  
ATOM 6638  N N    . VAL A 1 7  ? 0.979   7.411   1.590   1.00 0.00 ? 7  VAL A N    6  
ATOM 6639  C CA   . VAL A 1 7  ? -0.145  6.481   1.904   1.00 0.00 ? 7  VAL A CA   6  
ATOM 6640  C C    . VAL A 1 7  ? 0.118   5.088   1.302   1.00 0.00 ? 7  VAL A C    6  
ATOM 6641  O O    . VAL A 1 7  ? -0.189  4.082   1.910   1.00 0.00 ? 7  VAL A O    6  
ATOM 6642  C CB   . VAL A 1 7  ? -1.453  7.081   1.367   1.00 0.00 ? 7  VAL A CB   6  
ATOM 6643  C CG1  . VAL A 1 7  ? -2.571  6.031   1.421   1.00 0.00 ? 7  VAL A CG1  6  
ATOM 6644  C CG2  . VAL A 1 7  ? -1.855  8.322   2.199   1.00 0.00 ? 7  VAL A CG2  6  
ATOM 6645  H H    . VAL A 1 7  ? 0.842   8.157   0.966   1.00 0.00 ? 7  VAL A H    6  
ATOM 6646  H HA   . VAL A 1 7  ? -0.205  6.335   2.980   1.00 0.00 ? 7  VAL A HA   6  
ATOM 6647  H HB   . VAL A 1 7  ? -1.296  7.383   0.341   1.00 0.00 ? 7  VAL A HB   6  
ATOM 6648  H HG11 . VAL A 1 7  ? -2.464  5.352   0.588   1.00 0.00 ? 7  VAL A HG11 6  
ATOM 6649  H HG12 . VAL A 1 7  ? -3.530  6.523   1.363   1.00 0.00 ? 7  VAL A HG12 6  
ATOM 6650  H HG13 . VAL A 1 7  ? -2.504  5.479   2.346   1.00 0.00 ? 7  VAL A HG13 6  
ATOM 6651  H HG21 . VAL A 1 7  ? -1.331  9.191   1.827   1.00 0.00 ? 7  VAL A HG21 6  
ATOM 6652  H HG22 . VAL A 1 7  ? -1.598  8.171   3.237   1.00 0.00 ? 7  VAL A HG22 6  
ATOM 6653  H HG23 . VAL A 1 7  ? -2.920  8.489   2.116   1.00 0.00 ? 7  VAL A HG23 6  
ATOM 6654  N N    . CYS A 1 8  ? 0.691   5.009   0.127   1.00 0.00 ? 8  CYS A N    6  
ATOM 6655  C CA   . CYS A 1 8  ? 0.974   3.672   -0.481  1.00 0.00 ? 8  CYS A CA   6  
ATOM 6656  C C    . CYS A 1 8  ? 1.887   2.881   0.454   1.00 0.00 ? 8  CYS A C    6  
ATOM 6657  O O    . CYS A 1 8  ? 1.655   1.721   0.732   1.00 0.00 ? 8  CYS A O    6  
ATOM 6658  C CB   . CYS A 1 8  ? 1.652   3.879   -1.846  1.00 0.00 ? 8  CYS A CB   6  
ATOM 6659  S SG   . CYS A 1 8  ? 3.435   4.113   -1.654  1.00 0.00 ? 8  CYS A SG   6  
ATOM 6660  H H    . CYS A 1 8  ? 0.953   5.815   -0.361  1.00 0.00 ? 8  CYS A H    6  
ATOM 6661  H HA   . CYS A 1 8  ? 0.055   3.118   -0.624  1.00 0.00 ? 8  CYS A HA   6  
ATOM 6662  H HB2  . CYS A 1 8  ? 1.480   3.015   -2.465  1.00 0.00 ? 8  CYS A HB2  6  
ATOM 6663  H HB3  . CYS A 1 8  ? 1.228   4.750   -2.323  1.00 0.00 ? 8  CYS A HB3  6  
ATOM 6664  N N    . GLU A 1 9  ? 2.932   3.496   0.929   1.00 0.00 ? 9  GLU A N    6  
ATOM 6665  C CA   . GLU A 1 9  ? 3.862   2.778   1.831   1.00 0.00 ? 9  GLU A CA   6  
ATOM 6666  C C    . GLU A 1 9  ? 3.153   2.456   3.139   1.00 0.00 ? 9  GLU A C    6  
ATOM 6667  O O    . GLU A 1 9  ? 3.450   1.465   3.777   1.00 0.00 ? 9  GLU A O    6  
ATOM 6668  C CB   . GLU A 1 9  ? 5.077   3.662   2.128   1.00 0.00 ? 9  GLU A CB   6  
ATOM 6669  C CG   . GLU A 1 9  ? 5.916   3.830   0.862   1.00 0.00 ? 9  GLU A CG   6  
ATOM 6670  C CD   . GLU A 1 9  ? 7.255   4.480   1.219   1.00 0.00 ? 9  GLU A CD   6  
ATOM 6671  O OE1  . GLU A 1 9  ? 7.277   5.688   1.390   1.00 0.00 ? 9  GLU A OE1  6  
ATOM 6672  O OE2  . GLU A 1 9  ? 8.235   3.760   1.316   1.00 0.00 ? 9  GLU A OE2  6  
ATOM 6673  H H    . GLU A 1 9  ? 3.111   4.427   0.683   1.00 0.00 ? 9  GLU A H    6  
ATOM 6674  H HA   . GLU A 1 9  ? 4.187   1.868   1.349   1.00 0.00 ? 9  GLU A HA   6  
ATOM 6675  H HB2  . GLU A 1 9  ? 4.741   4.630   2.468   1.00 0.00 ? 9  GLU A HB2  6  
ATOM 6676  H HB3  . GLU A 1 9  ? 5.678   3.199   2.896   1.00 0.00 ? 9  GLU A HB3  6  
ATOM 6677  H HG2  . GLU A 1 9  ? 6.094   2.862   0.417   1.00 0.00 ? 9  GLU A HG2  6  
ATOM 6678  H HG3  . GLU A 1 9  ? 5.390   4.460   0.162   1.00 0.00 ? 9  GLU A HG3  6  
ATOM 6679  N N    . PHE A 1 10 ? 2.219   3.267   3.565   1.00 0.00 ? 10 PHE A N    6  
ATOM 6680  C CA   . PHE A 1 10 ? 1.534   2.950   4.842   1.00 0.00 ? 10 PHE A CA   6  
ATOM 6681  C C    . PHE A 1 10 ? 0.724   1.653   4.684   1.00 0.00 ? 10 PHE A C    6  
ATOM 6682  O O    . PHE A 1 10 ? 0.805   0.761   5.505   1.00 0.00 ? 10 PHE A O    6  
ATOM 6683  C CB   . PHE A 1 10 ? 0.613   4.102   5.247   1.00 0.00 ? 10 PHE A CB   6  
ATOM 6684  C CG   . PHE A 1 10 ? -0.048  3.746   6.550   1.00 0.00 ? 10 PHE A CG   6  
ATOM 6685  C CD1  . PHE A 1 10 ? 0.608   4.004   7.756   1.00 0.00 ? 10 PHE A CD1  6  
ATOM 6686  C CD2  . PHE A 1 10 ? -1.302  3.132   6.549   1.00 0.00 ? 10 PHE A CD2  6  
ATOM 6687  C CE1  . PHE A 1 10 ? 0.007   3.650   8.969   1.00 0.00 ? 10 PHE A CE1  6  
ATOM 6688  C CE2  . PHE A 1 10 ? -1.906  2.773   7.761   1.00 0.00 ? 10 PHE A CE2  6  
ATOM 6689  C CZ   . PHE A 1 10 ? -1.250  3.032   8.972   1.00 0.00 ? 10 PHE A CZ   6  
ATOM 6690  H H    . PHE A 1 10 ? 1.973   4.078   3.069   1.00 0.00 ? 10 PHE A H    6  
ATOM 6691  H HA   . PHE A 1 10 ? 2.285   2.803   5.596   1.00 0.00 ? 10 PHE A HA   6  
ATOM 6692  H HB2  . PHE A 1 10 ? 1.194   5.005   5.367   1.00 0.00 ? 10 PHE A HB2  6  
ATOM 6693  H HB3  . PHE A 1 10 ? -0.140  4.251   4.488   1.00 0.00 ? 10 PHE A HB3  6  
ATOM 6694  H HD1  . PHE A 1 10 ? 1.574   4.484   7.750   1.00 0.00 ? 10 PHE A HD1  6  
ATOM 6695  H HD2  . PHE A 1 10 ? -1.805  2.940   5.611   1.00 0.00 ? 10 PHE A HD2  6  
ATOM 6696  H HE1  . PHE A 1 10 ? 0.516   3.848   9.903   1.00 0.00 ? 10 PHE A HE1  6  
ATOM 6697  H HE2  . PHE A 1 10 ? -2.876  2.295   7.763   1.00 0.00 ? 10 PHE A HE2  6  
ATOM 6698  H HZ   . PHE A 1 10 ? -1.711  2.756   9.907   1.00 0.00 ? 10 PHE A HZ   6  
ATOM 6699  N N    . LEU A 1 11 ? -0.048  1.532   3.633   1.00 0.00 ? 11 LEU A N    6  
ATOM 6700  C CA   . LEU A 1 11 ? -0.843  0.280   3.431   1.00 0.00 ? 11 LEU A CA   6  
ATOM 6701  C C    . LEU A 1 11 ? 0.103   -0.912  3.267   1.00 0.00 ? 11 LEU A C    6  
ATOM 6702  O O    . LEU A 1 11 ? -0.127  -1.966  3.827   1.00 0.00 ? 11 LEU A O    6  
ATOM 6703  C CB   . LEU A 1 11 ? -1.710  0.394   2.163   1.00 0.00 ? 11 LEU A CB   6  
ATOM 6704  C CG   . LEU A 1 11 ? -2.764  1.506   2.334   1.00 0.00 ? 11 LEU A CG   6  
ATOM 6705  C CD1  . LEU A 1 11 ? -3.238  1.982   0.957   1.00 0.00 ? 11 LEU A CD1  6  
ATOM 6706  C CD2  . LEU A 1 11 ? -3.975  0.982   3.120   1.00 0.00 ? 11 LEU A CD2  6  
ATOM 6707  H H    . LEU A 1 11 ? -0.101  2.261   2.981   1.00 0.00 ? 11 LEU A H    6  
ATOM 6708  H HA   . LEU A 1 11 ? -1.491  0.098   4.274   1.00 0.00 ? 11 LEU A HA   6  
ATOM 6709  H HB2  . LEU A 1 11 ? -1.075  0.624   1.318   1.00 0.00 ? 11 LEU A HB2  6  
ATOM 6710  H HB3  . LEU A 1 11 ? -2.209  -0.554  1.989   1.00 0.00 ? 11 LEU A HB3  6  
ATOM 6711  H HG   . LEU A 1 11 ? -2.324  2.339   2.864   1.00 0.00 ? 11 LEU A HG   6  
ATOM 6712  H HD11 . LEU A 1 11 ? -4.011  2.727   1.079   1.00 0.00 ? 11 LEU A HD11 6  
ATOM 6713  H HD12 . LEU A 1 11 ? -3.633  1.143   0.403   1.00 0.00 ? 11 LEU A HD12 6  
ATOM 6714  H HD13 . LEU A 1 11 ? -2.407  2.410   0.418   1.00 0.00 ? 11 LEU A HD13 6  
ATOM 6715  H HD21 . LEU A 1 11 ? -3.692  0.800   4.145   1.00 0.00 ? 11 LEU A HD21 6  
ATOM 6716  H HD22 . LEU A 1 11 ? -4.327  0.063   2.675   1.00 0.00 ? 11 LEU A HD22 6  
ATOM 6717  H HD23 . LEU A 1 11 ? -4.764  1.717   3.091   1.00 0.00 ? 11 LEU A HD23 6  
ATOM 6718  N N    . VAL A 1 12 ? 1.160   -0.778  2.510   1.00 0.00 ? 12 VAL A N    6  
ATOM 6719  C CA   . VAL A 1 12 ? 2.090   -1.927  2.331   1.00 0.00 ? 12 VAL A CA   6  
ATOM 6720  C C    . VAL A 1 12 ? 2.639   -2.367  3.701   1.00 0.00 ? 12 VAL A C    6  
ATOM 6721  O O    . VAL A 1 12 ? 2.641   -3.535  4.025   1.00 0.00 ? 12 VAL A O    6  
ATOM 6722  C CB   . VAL A 1 12 ? 3.240   -1.484  1.405   1.00 0.00 ? 12 VAL A CB   6  
ATOM 6723  C CG1  . VAL A 1 12 ? 4.452   -2.410  1.559   1.00 0.00 ? 12 VAL A CG1  6  
ATOM 6724  C CG2  . VAL A 1 12 ? 2.767   -1.528  -0.052  1.00 0.00 ? 12 VAL A CG2  6  
ATOM 6725  H H    . VAL A 1 12 ? 1.348   0.062   2.042   1.00 0.00 ? 12 VAL A H    6  
ATOM 6726  H HA   . VAL A 1 12 ? 1.559   -2.757  1.871   1.00 0.00 ? 12 VAL A HA   6  
ATOM 6727  H HB   . VAL A 1 12 ? 3.530   -0.474  1.657   1.00 0.00 ? 12 VAL A HB   6  
ATOM 6728  H HG11 . VAL A 1 12 ? 4.125   -3.439  1.517   1.00 0.00 ? 12 VAL A HG11 6  
ATOM 6729  H HG12 . VAL A 1 12 ? 4.935   -2.223  2.507   1.00 0.00 ? 12 VAL A HG12 6  
ATOM 6730  H HG13 . VAL A 1 12 ? 5.150   -2.217  0.760   1.00 0.00 ? 12 VAL A HG13 6  
ATOM 6731  H HG21 . VAL A 1 12 ? 1.810   -1.037  -0.135  1.00 0.00 ? 12 VAL A HG21 6  
ATOM 6732  H HG22 . VAL A 1 12 ? 2.673   -2.558  -0.370  1.00 0.00 ? 12 VAL A HG22 6  
ATOM 6733  H HG23 . VAL A 1 12 ? 3.487   -1.023  -0.679  1.00 0.00 ? 12 VAL A HG23 6  
ATOM 6734  N N    . LYS A 1 13 ? 3.099   -1.440  4.509   1.00 0.00 ? 13 LYS A N    6  
ATOM 6735  C CA   . LYS A 1 13 ? 3.650   -1.815  5.850   1.00 0.00 ? 13 LYS A CA   6  
ATOM 6736  C C    . LYS A 1 13 ? 2.577   -2.550  6.661   1.00 0.00 ? 13 LYS A C    6  
ATOM 6737  O O    . LYS A 1 13 ? 2.853   -3.520  7.340   1.00 0.00 ? 13 LYS A O    6  
ATOM 6738  C CB   . LYS A 1 13 ? 4.095   -0.544  6.597   1.00 0.00 ? 13 LYS A CB   6  
ATOM 6739  C CG   . LYS A 1 13 ? 4.328   -0.847  8.099   1.00 0.00 ? 13 LYS A CG   6  
ATOM 6740  C CD   . LYS A 1 13 ? 5.499   -0.012  8.637   1.00 0.00 ? 13 LYS A CD   6  
ATOM 6741  C CE   . LYS A 1 13 ? 5.155   1.474   8.543   1.00 0.00 ? 13 LYS A CE   6  
ATOM 6742  N NZ   . LYS A 1 13 ? 6.240   2.277   9.177   1.00 0.00 ? 13 LYS A NZ   6  
ATOM 6743  H H    . LYS A 1 13 ? 3.093   -0.500  4.229   1.00 0.00 ? 13 LYS A H    6  
ATOM 6744  H HA   . LYS A 1 13 ? 4.500   -2.467  5.720   1.00 0.00 ? 13 LYS A HA   6  
ATOM 6745  H HB2  . LYS A 1 13 ? 5.011   -0.181  6.149   1.00 0.00 ? 13 LYS A HB2  6  
ATOM 6746  H HB3  . LYS A 1 13 ? 3.329   0.212   6.497   1.00 0.00 ? 13 LYS A HB3  6  
ATOM 6747  H HG2  . LYS A 1 13 ? 3.433   -0.604  8.659   1.00 0.00 ? 13 LYS A HG2  6  
ATOM 6748  H HG3  . LYS A 1 13 ? 4.555   -1.895  8.233   1.00 0.00 ? 13 LYS A HG3  6  
ATOM 6749  H HD2  . LYS A 1 13 ? 5.683   -0.274  9.669   1.00 0.00 ? 13 LYS A HD2  6  
ATOM 6750  H HD3  . LYS A 1 13 ? 6.383   -0.213  8.051   1.00 0.00 ? 13 LYS A HD3  6  
ATOM 6751  H HE2  . LYS A 1 13 ? 5.060   1.756   7.504   1.00 0.00 ? 13 LYS A HE2  6  
ATOM 6752  H HE3  . LYS A 1 13 ? 4.224   1.659   9.054   1.00 0.00 ? 13 LYS A HE3  6  
ATOM 6753  H HZ1  . LYS A 1 13 ? 6.214   3.247   8.807   1.00 0.00 ? 13 LYS A HZ1  6  
ATOM 6754  H HZ2  . LYS A 1 13 ? 7.161   1.845   8.960   1.00 0.00 ? 13 LYS A HZ2  6  
ATOM 6755  H HZ3  . LYS A 1 13 ? 6.099   2.297   10.207  1.00 0.00 ? 13 LYS A HZ3  6  
ATOM 6756  N N    . GLU A 1 14 ? 1.365   -2.083  6.616   1.00 0.00 ? 14 GLU A N    6  
ATOM 6757  C CA   . GLU A 1 14 ? 0.287   -2.741  7.405   1.00 0.00 ? 14 GLU A CA   6  
ATOM 6758  C C    . GLU A 1 14 ? -0.075  -4.079  6.775   1.00 0.00 ? 14 GLU A C    6  
ATOM 6759  O O    . GLU A 1 14 ? -0.335  -5.039  7.468   1.00 0.00 ? 14 GLU A O    6  
ATOM 6760  C CB   . GLU A 1 14 ? -0.960  -1.846  7.425   1.00 0.00 ? 14 GLU A CB   6  
ATOM 6761  C CG   . GLU A 1 14 ? -0.753  -0.664  8.380   1.00 0.00 ? 14 GLU A CG   6  
ATOM 6762  C CD   . GLU A 1 14 ? -2.107  -0.023  8.691   1.00 0.00 ? 14 GLU A CD   6  
ATOM 6763  O OE1  . GLU A 1 14 ? -2.965  -0.050  7.824   1.00 0.00 ? 14 GLU A OE1  6  
ATOM 6764  O OE2  . GLU A 1 14 ? -2.265  0.478   9.792   1.00 0.00 ? 14 GLU A OE2  6  
ATOM 6765  H H    . GLU A 1 14 ? 1.170   -1.298  6.061   1.00 0.00 ? 14 GLU A H    6  
ATOM 6766  H HA   . GLU A 1 14 ? 0.626   -2.908  8.418   1.00 0.00 ? 14 GLU A HA   6  
ATOM 6767  H HB2  . GLU A 1 14 ? -1.146  -1.472  6.429   1.00 0.00 ? 14 GLU A HB2  6  
ATOM 6768  H HB3  . GLU A 1 14 ? -1.812  -2.425  7.754   1.00 0.00 ? 14 GLU A HB3  6  
ATOM 6769  H HG2  . GLU A 1 14 ? -0.303  -1.009  9.299   1.00 0.00 ? 14 GLU A HG2  6  
ATOM 6770  H HG3  . GLU A 1 14 ? -0.109  0.067   7.916   1.00 0.00 ? 14 GLU A HG3  6  
ATOM 6771  N N    . VAL A 1 15 ? -0.107  -4.168  5.479   1.00 0.00 ? 15 VAL A N    6  
ATOM 6772  C CA   . VAL A 1 15 ? -0.481  -5.463  4.860   1.00 0.00 ? 15 VAL A CA   6  
ATOM 6773  C C    . VAL A 1 15 ? 0.578   -6.525  5.174   1.00 0.00 ? 15 VAL A C    6  
ATOM 6774  O O    . VAL A 1 15 ? 0.248   -7.649  5.486   1.00 0.00 ? 15 VAL A O    6  
ATOM 6775  C CB   . VAL A 1 15 ? -0.638  -5.290  3.335   1.00 0.00 ? 15 VAL A CB   6  
ATOM 6776  C CG1  . VAL A 1 15 ? -0.546  -6.651  2.630   1.00 0.00 ? 15 VAL A CG1  6  
ATOM 6777  C CG2  . VAL A 1 15 ? -2.001  -4.660  3.031   1.00 0.00 ? 15 VAL A CG2  6  
ATOM 6778  H H    . VAL A 1 15 ? 0.103   -3.395  4.915   1.00 0.00 ? 15 VAL A H    6  
ATOM 6779  H HA   . VAL A 1 15 ? -1.422  -5.784  5.284   1.00 0.00 ? 15 VAL A HA   6  
ATOM 6780  H HB   . VAL A 1 15 ? 0.142   -4.641  2.964   1.00 0.00 ? 15 VAL A HB   6  
ATOM 6781  H HG11 . VAL A 1 15 ? -0.854  -6.545  1.601   1.00 0.00 ? 15 VAL A HG11 6  
ATOM 6782  H HG12 . VAL A 1 15 ? -1.194  -7.357  3.128   1.00 0.00 ? 15 VAL A HG12 6  
ATOM 6783  H HG13 . VAL A 1 15 ? 0.476   -7.012  2.668   1.00 0.00 ? 15 VAL A HG13 6  
ATOM 6784  H HG21 . VAL A 1 15 ? -2.786  -5.342  3.326   1.00 0.00 ? 15 VAL A HG21 6  
ATOM 6785  H HG22 . VAL A 1 15 ? -2.078  -4.460  1.973   1.00 0.00 ? 15 VAL A HG22 6  
ATOM 6786  H HG23 . VAL A 1 15 ? -2.103  -3.736  3.581   1.00 0.00 ? 15 VAL A HG23 6  
ATOM 6787  N N    . THR A 1 16 ? 1.841   -6.218  5.067   1.00 0.00 ? 16 THR A N    6  
ATOM 6788  C CA   . THR A 1 16 ? 2.830   -7.291  5.335   1.00 0.00 ? 16 THR A CA   6  
ATOM 6789  C C    . THR A 1 16 ? 2.705   -7.777  6.770   1.00 0.00 ? 16 THR A C    6  
ATOM 6790  O O    . THR A 1 16 ? 2.784   -8.960  7.038   1.00 0.00 ? 16 THR A O    6  
ATOM 6791  C CB   . THR A 1 16 ? 4.271   -6.852  5.085   1.00 0.00 ? 16 THR A CB   6  
ATOM 6792  O OG1  . THR A 1 16 ? 4.780   -6.220  6.251   1.00 0.00 ? 16 THR A OG1  6  
ATOM 6793  C CG2  . THR A 1 16 ? 4.370   -5.890  3.893   1.00 0.00 ? 16 THR A CG2  6  
ATOM 6794  H H    . THR A 1 16 ? 2.117   -5.317  4.795   1.00 0.00 ? 16 THR A H    6  
ATOM 6795  H HA   . THR A 1 16 ? 2.605   -8.102  4.670   1.00 0.00 ? 16 THR A HA   6  
ATOM 6796  H HB   . THR A 1 16 ? 4.848   -7.742  4.875   1.00 0.00 ? 16 THR A HB   6  
ATOM 6797  H HG1  . THR A 1 16 ? 4.086   -5.665  6.615   1.00 0.00 ? 16 THR A HG1  6  
ATOM 6798  H HG21 . THR A 1 16 ? 5.220   -6.158  3.281   1.00 0.00 ? 16 THR A HG21 6  
ATOM 6799  H HG22 . THR A 1 16 ? 4.501   -4.885  4.260   1.00 0.00 ? 16 THR A HG22 6  
ATOM 6800  H HG23 . THR A 1 16 ? 3.471   -5.944  3.298   1.00 0.00 ? 16 THR A HG23 6  
ATOM 6801  N N    . LYS A 1 17 ? 2.492   -6.892  7.704   1.00 0.00 ? 17 LYS A N    6  
ATOM 6802  C CA   . LYS A 1 17 ? 2.348   -7.358  9.102   1.00 0.00 ? 17 LYS A CA   6  
ATOM 6803  C C    . LYS A 1 17 ? 1.150   -8.301  9.137   1.00 0.00 ? 17 LYS A C    6  
ATOM 6804  O O    . LYS A 1 17 ? 1.122   -9.280  9.858   1.00 0.00 ? 17 LYS A O    6  
ATOM 6805  C CB   . LYS A 1 17 ? 2.101   -6.167  10.042  1.00 0.00 ? 17 LYS A CB   6  
ATOM 6806  C CG   . LYS A 1 17 ? 2.044   -6.669  11.503  1.00 0.00 ? 17 LYS A CG   6  
ATOM 6807  C CD   . LYS A 1 17 ? 1.153   -5.767  12.362  1.00 0.00 ? 17 LYS A CD   6  
ATOM 6808  C CE   . LYS A 1 17 ? 0.984   -6.403  13.749  1.00 0.00 ? 17 LYS A CE   6  
ATOM 6809  N NZ   . LYS A 1 17 ? 2.233   -6.212  14.538  1.00 0.00 ? 17 LYS A NZ   6  
ATOM 6810  H H    . LYS A 1 17 ? 2.406   -5.941  7.481   1.00 0.00 ? 17 LYS A H    6  
ATOM 6811  H HA   . LYS A 1 17 ? 3.253   -7.870  9.401   1.00 0.00 ? 17 LYS A HA   6  
ATOM 6812  H HB2  . LYS A 1 17 ? 2.911   -5.458  9.934   1.00 0.00 ? 17 LYS A HB2  6  
ATOM 6813  H HB3  . LYS A 1 17 ? 1.173   -5.688  9.781   1.00 0.00 ? 17 LYS A HB3  6  
ATOM 6814  H HG2  . LYS A 1 17 ? 1.645   -7.670  11.529  1.00 0.00 ? 17 LYS A HG2  6  
ATOM 6815  H HG3  . LYS A 1 17 ? 3.041   -6.674  11.914  1.00 0.00 ? 17 LYS A HG3  6  
ATOM 6816  H HD2  . LYS A 1 17 ? 1.613   -4.795  12.463  1.00 0.00 ? 17 LYS A HD2  6  
ATOM 6817  H HD3  . LYS A 1 17 ? 0.185   -5.663  11.897  1.00 0.00 ? 17 LYS A HD3  6  
ATOM 6818  H HE2  . LYS A 1 17 ? 0.159   -5.932  14.263  1.00 0.00 ? 17 LYS A HE2  6  
ATOM 6819  H HE3  . LYS A 1 17 ? 0.783   -7.466  13.647  1.00 0.00 ? 17 LYS A HE3  6  
ATOM 6820  H HZ1  . LYS A 1 17 ? 2.030   -6.344  15.549  1.00 0.00 ? 17 LYS A HZ1  6  
ATOM 6821  H HZ2  . LYS A 1 17 ? 2.599   -5.251  14.379  1.00 0.00 ? 17 LYS A HZ2  6  
ATOM 6822  H HZ3  . LYS A 1 17 ? 2.945   -6.908  14.236  1.00 0.00 ? 17 LYS A HZ3  6  
ATOM 6823  N N    . LEU A 1 18 ? 0.162   -7.999  8.345   1.00 0.00 ? 18 LEU A N    6  
ATOM 6824  C CA   . LEU A 1 18 ? -1.053  -8.848  8.289   1.00 0.00 ? 18 LEU A CA   6  
ATOM 6825  C C    . LEU A 1 18 ? -0.698  -10.148 7.559   1.00 0.00 ? 18 LEU A C    6  
ATOM 6826  O O    . LEU A 1 18 ? -1.118  -11.222 7.942   1.00 0.00 ? 18 LEU A O    6  
ATOM 6827  C CB   . LEU A 1 18 ? -2.165  -8.066  7.560   1.00 0.00 ? 18 LEU A CB   6  
ATOM 6828  C CG   . LEU A 1 18 ? -2.725  -6.847  8.397   1.00 0.00 ? 18 LEU A CG   6  
ATOM 6829  C CD1  . LEU A 1 18 ? -4.254  -6.860  8.391   1.00 0.00 ? 18 LEU A CD1  6  
ATOM 6830  C CD2  . LEU A 1 18 ? -2.276  -6.839  9.874   1.00 0.00 ? 18 LEU A CD2  6  
ATOM 6831  H H    . LEU A 1 18 ? 0.226   -7.207  7.773   1.00 0.00 ? 18 LEU A H    6  
ATOM 6832  H HA   . LEU A 1 18 ? -1.370  -9.113  9.282   1.00 0.00 ? 18 LEU A HA   6  
ATOM 6833  H HB2  . LEU A 1 18 ? -1.760  -7.693  6.634   1.00 0.00 ? 18 LEU A HB2  6  
ATOM 6834  H HB3  . LEU A 1 18 ? -2.960  -8.737  7.324   1.00 0.00 ? 18 LEU A HB3  6  
ATOM 6835  H HG   . LEU A 1 18 ? -2.401  -5.928  7.931   1.00 0.00 ? 18 LEU A HG   6  
ATOM 6836  H HD11 . LEU A 1 18 ? -4.620  -5.980  8.896   1.00 0.00 ? 18 LEU A HD11 6  
ATOM 6837  H HD12 . LEU A 1 18 ? -4.607  -7.734  8.908   1.00 0.00 ? 18 LEU A HD12 6  
ATOM 6838  H HD13 . LEU A 1 18 ? -4.611  -6.868  7.375   1.00 0.00 ? 18 LEU A HD13 6  
ATOM 6839  H HD21 . LEU A 1 18 ? -2.726  -7.670  10.396  1.00 0.00 ? 18 LEU A HD21 6  
ATOM 6840  H HD22 . LEU A 1 18 ? -2.602  -5.918  10.335  1.00 0.00 ? 18 LEU A HD22 6  
ATOM 6841  H HD23 . LEU A 1 18 ? -1.203  -6.903  9.942   1.00 0.00 ? 18 LEU A HD23 6  
ATOM 6842  N N    . ILE A 1 19 ? 0.112   -10.058 6.537   1.00 0.00 ? 19 ILE A N    6  
ATOM 6843  C CA   . ILE A 1 19 ? 0.543   -11.283 5.810   1.00 0.00 ? 19 ILE A CA   6  
ATOM 6844  C C    . ILE A 1 19 ? 1.434   -12.065 6.767   1.00 0.00 ? 19 ILE A C    6  
ATOM 6845  O O    . ILE A 1 19 ? 1.491   -13.278 6.744   1.00 0.00 ? 19 ILE A O    6  
ATOM 6846  C CB   . ILE A 1 19 ? 1.339   -10.896 4.547   1.00 0.00 ? 19 ILE A CB   6  
ATOM 6847  C CG1  . ILE A 1 19 ? 0.391   -10.222 3.537   1.00 0.00 ? 19 ILE A CG1  6  
ATOM 6848  C CG2  . ILE A 1 19 ? 1.952   -12.150 3.915   1.00 0.00 ? 19 ILE A CG2  6  
ATOM 6849  C CD1  . ILE A 1 19 ? 1.176   -9.715  2.318   1.00 0.00 ? 19 ILE A CD1  6  
ATOM 6850  H H    . ILE A 1 19 ? 0.462   -9.189  6.273   1.00 0.00 ? 19 ILE A H    6  
ATOM 6851  H HA   . ILE A 1 19 ? -0.319  -11.876 5.540   1.00 0.00 ? 19 ILE A HA   6  
ATOM 6852  H HB   . ILE A 1 19 ? 2.137   -10.216 4.816   1.00 0.00 ? 19 ILE A HB   6  
ATOM 6853  H HG12 . ILE A 1 19 ? -0.350  -10.936 3.212   1.00 0.00 ? 19 ILE A HG12 6  
ATOM 6854  H HG13 . ILE A 1 19 ? -0.104  -9.392  4.011   1.00 0.00 ? 19 ILE A HG13 6  
ATOM 6855  H HG21 . ILE A 1 19 ? 2.400   -11.892 2.967   1.00 0.00 ? 19 ILE A HG21 6  
ATOM 6856  H HG22 . ILE A 1 19 ? 1.182   -12.891 3.761   1.00 0.00 ? 19 ILE A HG22 6  
ATOM 6857  H HG23 . ILE A 1 19 ? 2.712   -12.550 4.570   1.00 0.00 ? 19 ILE A HG23 6  
ATOM 6858  H HD11 . ILE A 1 19 ? 1.740   -10.528 1.885   1.00 0.00 ? 19 ILE A HD11 6  
ATOM 6859  H HD12 . ILE A 1 19 ? 1.851   -8.933  2.624   1.00 0.00 ? 19 ILE A HD12 6  
ATOM 6860  H HD13 . ILE A 1 19 ? 0.487   -9.327  1.580   1.00 0.00 ? 19 ILE A HD13 6  
ATOM 6861  N N    . ASP A 1 20 ? 2.133   -11.357 7.611   1.00 0.00 ? 20 ASP A N    6  
ATOM 6862  C CA   . ASP A 1 20 ? 3.035   -12.015 8.587   1.00 0.00 ? 20 ASP A CA   6  
ATOM 6863  C C    . ASP A 1 20 ? 2.228   -12.601 9.749   1.00 0.00 ? 20 ASP A C    6  
ATOM 6864  O O    . ASP A 1 20 ? 2.676   -13.522 10.405  1.00 0.00 ? 20 ASP A O    6  
ATOM 6865  C CB   . ASP A 1 20 ? 4.026   -10.984 9.132   1.00 0.00 ? 20 ASP A CB   6  
ATOM 6866  C CG   . ASP A 1 20 ? 4.804   -10.361 7.972   1.00 0.00 ? 20 ASP A CG   6  
ATOM 6867  O OD1  . ASP A 1 20 ? 5.230   -11.103 7.103   1.00 0.00 ? 20 ASP A OD1  6  
ATOM 6868  O OD2  . ASP A 1 20 ? 4.960   -9.150  7.971   1.00 0.00 ? 20 ASP A OD2  6  
ATOM 6869  H H    . ASP A 1 20 ? 2.062   -10.379 7.602   1.00 0.00 ? 20 ASP A H    6  
ATOM 6870  H HA   . ASP A 1 20 ? 3.582   -12.808 8.101   1.00 0.00 ? 20 ASP A HA   6  
ATOM 6871  H HB2  . ASP A 1 20 ? 3.487   -10.212 9.661   1.00 0.00 ? 20 ASP A HB2  6  
ATOM 6872  H HB3  . ASP A 1 20 ? 4.716   -11.468 9.806   1.00 0.00 ? 20 ASP A HB3  6  
ATOM 6873  N N    . ASN A 1 21 ? 1.046   -12.081 10.029  1.00 0.00 ? 21 ASN A N    6  
ATOM 6874  C CA   . ASN A 1 21 ? 0.253   -12.638 11.179  1.00 0.00 ? 21 ASN A CA   6  
ATOM 6875  C C    . ASN A 1 21 ? -0.599  -13.819 10.692  1.00 0.00 ? 21 ASN A C    6  
ATOM 6876  O O    . ASN A 1 21 ? -1.264  -14.462 11.476  1.00 0.00 ? 21 ASN A O    6  
ATOM 6877  C CB   . ASN A 1 21 ? -0.615  -11.556 11.823  1.00 0.00 ? 21 ASN A CB   6  
ATOM 6878  C CG   . ASN A 1 21 ? -1.352  -12.144 13.028  1.00 0.00 ? 21 ASN A CG   6  
ATOM 6879  O OD1  . ASN A 1 21 ? -2.319  -11.577 13.499  1.00 0.00 ? 21 ASN A OD1  6  
ATOM 6880  N ND2  . ASN A 1 21 ? -0.932  -13.263 13.552  1.00 0.00 ? 21 ASN A ND2  6  
ATOM 6881  H H    . ASN A 1 21 ? 0.700   -11.339 9.492   1.00 0.00 ? 21 ASN A H    6  
ATOM 6882  H HA   . ASN A 1 21 ? 0.963   -13.035 11.891  1.00 0.00 ? 21 ASN A HA   6  
ATOM 6883  H HB2  . ASN A 1 21 ? 0.013   -10.739 12.147  1.00 0.00 ? 21 ASN A HB2  6  
ATOM 6884  H HB3  . ASN A 1 21 ? -1.332  -11.196 11.104  1.00 0.00 ? 21 ASN A HB3  6  
ATOM 6885  H HD21 . ASN A 1 21 ? -0.152  -13.718 13.173  1.00 0.00 ? 21 ASN A HD21 6  
ATOM 6886  H HD22 . ASN A 1 21 ? -1.398  -13.648 14.323  1.00 0.00 ? 21 ASN A HD22 6  
ATOM 6887  N N    . ASN A 1 22 ? -0.525  -14.148 9.421   1.00 0.00 ? 22 ASN A N    6  
ATOM 6888  C CA   . ASN A 1 22 ? -1.262  -15.350 8.882   1.00 0.00 ? 22 ASN A CA   6  
ATOM 6889  C C    . ASN A 1 22 ? -2.746  -15.071 8.583   1.00 0.00 ? 22 ASN A C    6  
ATOM 6890  O O    . ASN A 1 22 ? -3.582  -15.921 8.815   1.00 0.00 ? 22 ASN A O    6  
ATOM 6891  C CB   . ASN A 1 22 ? -1.171  -16.508 9.904   1.00 0.00 ? 22 ASN A CB   6  
ATOM 6892  C CG   . ASN A 1 22 ? -1.205  -17.859 9.177   1.00 0.00 ? 22 ASN A CG   6  
ATOM 6893  O OD1  . ASN A 1 22 ? -2.031  -18.077 8.313   1.00 0.00 ? 22 ASN A OD1  6  
ATOM 6894  N ND2  . ASN A 1 22 ? -0.337  -18.780 9.496   1.00 0.00 ? 22 ASN A ND2  6  
ATOM 6895  H H    . ASN A 1 22 ? 0.062   -13.631 8.822   1.00 0.00 ? 22 ASN A H    6  
ATOM 6896  H HA   . ASN A 1 22 ? -0.753  -15.667 7.981   1.00 0.00 ? 22 ASN A HA   6  
ATOM 6897  H HB2  . ASN A 1 22 ? -0.245  -16.424 10.454  1.00 0.00 ? 22 ASN A HB2  6  
ATOM 6898  H HB3  . ASN A 1 22 ? -2.001  -16.458 10.594  1.00 0.00 ? 22 ASN A HB3  6  
ATOM 6899  H HD21 . ASN A 1 22 ? 0.329   -18.606 10.193  1.00 0.00 ? 22 ASN A HD21 6  
ATOM 6900  H HD22 . ASN A 1 22 ? -0.351  -19.647 9.038   1.00 0.00 ? 22 ASN A HD22 6  
ATOM 6901  N N    . LYS A 1 23 ? -3.099  -13.927 8.060   1.00 0.00 ? 23 LYS A N    6  
ATOM 6902  C CA   . LYS A 1 23 ? -4.545  -13.671 7.748   1.00 0.00 ? 23 LYS A CA   6  
ATOM 6903  C C    . LYS A 1 23 ? -4.793  -14.022 6.272   1.00 0.00 ? 23 LYS A C    6  
ATOM 6904  O O    . LYS A 1 23 ? -3.906  -13.939 5.445   1.00 0.00 ? 23 LYS A O    6  
ATOM 6905  C CB   . LYS A 1 23 ? -4.875  -12.201 8.014   1.00 0.00 ? 23 LYS A CB   6  
ATOM 6906  C CG   . LYS A 1 23 ? -4.189  -11.714 9.331   1.00 0.00 ? 23 LYS A CG   6  
ATOM 6907  C CD   . LYS A 1 23 ? -5.182  -10.967 10.247  1.00 0.00 ? 23 LYS A CD   6  
ATOM 6908  C CE   . LYS A 1 23 ? -4.530  -10.715 11.609  1.00 0.00 ? 23 LYS A CE   6  
ATOM 6909  N NZ   . LYS A 1 23 ? -5.551  -10.183 12.555  1.00 0.00 ? 23 LYS A NZ   6  
ATOM 6910  H H    . LYS A 1 23 ? -2.420  -13.249 7.855   1.00 0.00 ? 23 LYS A H    6  
ATOM 6911  H HA   . LYS A 1 23 ? -5.165  -14.262 8.387   1.00 0.00 ? 23 LYS A HA   6  
ATOM 6912  H HB2  . LYS A 1 23 ? -4.526  -11.630 7.183   1.00 0.00 ? 23 LYS A HB2  6  
ATOM 6913  H HB3  . LYS A 1 23 ? -5.948  -12.088 8.101   1.00 0.00 ? 23 LYS A HB3  6  
ATOM 6914  H HG2  . LYS A 1 23 ? -3.800  -12.562 9.874   1.00 0.00 ? 23 LYS A HG2  6  
ATOM 6915  H HG3  . LYS A 1 23 ? -3.374  -11.051 9.085   1.00 0.00 ? 23 LYS A HG3  6  
ATOM 6916  H HD2  . LYS A 1 23 ? -5.458  -10.018 9.805   1.00 0.00 ? 23 LYS A HD2  6  
ATOM 6917  H HD3  . LYS A 1 23 ? -6.063  -11.570 10.390  1.00 0.00 ? 23 LYS A HD3  6  
ATOM 6918  H HE2  . LYS A 1 23 ? -4.131  -11.641 11.995  1.00 0.00 ? 23 LYS A HE2  6  
ATOM 6919  H HE3  . LYS A 1 23 ? -3.734  -9.995  11.499  1.00 0.00 ? 23 LYS A HE3  6  
ATOM 6920  H HZ1  . LYS A 1 23 ? -5.753  -9.189  12.326  1.00 0.00 ? 23 LYS A HZ1  6  
ATOM 6921  H HZ2  . LYS A 1 23 ? -5.188  -10.247 13.528  1.00 0.00 ? 23 LYS A HZ2  6  
ATOM 6922  H HZ3  . LYS A 1 23 ? -6.425  -10.740 12.473  1.00 0.00 ? 23 LYS A HZ3  6  
ATOM 6923  N N    . THR A 1 24 ? -6.000  -14.417 5.942   1.00 0.00 ? 24 THR A N    6  
ATOM 6924  C CA   . THR A 1 24 ? -6.324  -14.778 4.528   1.00 0.00 ? 24 THR A CA   6  
ATOM 6925  C C    . THR A 1 24 ? -6.549  -13.519 3.684   1.00 0.00 ? 24 THR A C    6  
ATOM 6926  O O    . THR A 1 24 ? -6.831  -12.456 4.199   1.00 0.00 ? 24 THR A O    6  
ATOM 6927  C CB   . THR A 1 24 ? -7.605  -15.631 4.487   1.00 0.00 ? 24 THR A CB   6  
ATOM 6928  O OG1  . THR A 1 24 ? -8.732  -14.783 4.313   1.00 0.00 ? 24 THR A OG1  6  
ATOM 6929  C CG2  . THR A 1 24 ? -7.761  -16.412 5.791   1.00 0.00 ? 24 THR A CG2  6  
ATOM 6930  H H    . THR A 1 24 ? -6.696  -14.480 6.629   1.00 0.00 ? 24 THR A H    6  
ATOM 6931  H HA   . THR A 1 24 ? -5.509  -15.338 4.092   1.00 0.00 ? 24 THR A HA   6  
ATOM 6932  H HB   . THR A 1 24 ? -7.552  -16.326 3.661   1.00 0.00 ? 24 THR A HB   6  
ATOM 6933  H HG1  . THR A 1 24 ? -8.680  -14.082 4.968   1.00 0.00 ? 24 THR A HG1  6  
ATOM 6934  H HG21 . THR A 1 24 ? -6.802  -16.799 6.099   1.00 0.00 ? 24 THR A HG21 6  
ATOM 6935  H HG22 . THR A 1 24 ? -8.449  -17.230 5.636   1.00 0.00 ? 24 THR A HG22 6  
ATOM 6936  H HG23 . THR A 1 24 ? -8.150  -15.757 6.556   1.00 0.00 ? 24 THR A HG23 6  
ATOM 6937  N N    . GLU A 1 25 ? -6.453  -13.642 2.388   1.00 0.00 ? 25 GLU A N    6  
ATOM 6938  C CA   . GLU A 1 25 ? -6.687  -12.459 1.509   1.00 0.00 ? 25 GLU A CA   6  
ATOM 6939  C C    . GLU A 1 25 ? -8.054  -11.863 1.871   1.00 0.00 ? 25 GLU A C    6  
ATOM 6940  O O    . GLU A 1 25 ? -8.210  -10.665 1.999   1.00 0.00 ? 25 GLU A O    6  
ATOM 6941  C CB   . GLU A 1 25 ? -6.673  -12.894 0.040   1.00 0.00 ? 25 GLU A CB   6  
ATOM 6942  C CG   . GLU A 1 25 ? -6.455  -11.674 -0.857  1.00 0.00 ? 25 GLU A CG   6  
ATOM 6943  C CD   . GLU A 1 25 ? -6.784  -12.038 -2.306  1.00 0.00 ? 25 GLU A CD   6  
ATOM 6944  O OE1  . GLU A 1 25 ? -6.001  -12.757 -2.907  1.00 0.00 ? 25 GLU A OE1  6  
ATOM 6945  O OE2  . GLU A 1 25 ? -7.810  -11.592 -2.791  1.00 0.00 ? 25 GLU A OE2  6  
ATOM 6946  H H    . GLU A 1 25 ? -6.241  -14.523 2.013   1.00 0.00 ? 25 GLU A H    6  
ATOM 6947  H HA   . GLU A 1 25 ? -5.916  -11.720 1.685   1.00 0.00 ? 25 GLU A HA   6  
ATOM 6948  H HB2  . GLU A 1 25 ? -5.871  -13.603 -0.116  1.00 0.00 ? 25 GLU A HB2  6  
ATOM 6949  H HB3  . GLU A 1 25 ? -7.616  -13.358 -0.210  1.00 0.00 ? 25 GLU A HB3  6  
ATOM 6950  H HG2  . GLU A 1 25 ? -7.099  -10.870 -0.533  1.00 0.00 ? 25 GLU A HG2  6  
ATOM 6951  H HG3  . GLU A 1 25 ? -5.425  -11.358 -0.793  1.00 0.00 ? 25 GLU A HG3  6  
ATOM 6952  N N    . LYS A 1 26 ? -9.045  -12.699 2.031   1.00 0.00 ? 26 LYS A N    6  
ATOM 6953  C CA   . LYS A 1 26 ? -10.413 -12.210 2.376   1.00 0.00 ? 26 LYS A CA   6  
ATOM 6954  C C    . LYS A 1 26 ? -10.383 -11.338 3.638   1.00 0.00 ? 26 LYS A C    6  
ATOM 6955  O O    . LYS A 1 26 ? -11.162 -10.416 3.777   1.00 0.00 ? 26 LYS A O    6  
ATOM 6956  C CB   . LYS A 1 26 ? -11.337 -13.408 2.603   1.00 0.00 ? 26 LYS A CB   6  
ATOM 6957  C CG   . LYS A 1 26 ? -12.724 -12.912 3.019   1.00 0.00 ? 26 LYS A CG   6  
ATOM 6958  C CD   . LYS A 1 26 ? -13.737 -14.051 2.879   1.00 0.00 ? 26 LYS A CD   6  
ATOM 6959  C CE   . LYS A 1 26 ? -15.130 -13.546 3.260   1.00 0.00 ? 26 LYS A CE   6  
ATOM 6960  N NZ   . LYS A 1 26 ? -16.084 -14.692 3.281   1.00 0.00 ? 26 LYS A NZ   6  
ATOM 6961  H H    . LYS A 1 26 ? -8.890  -13.657 1.918   1.00 0.00 ? 26 LYS A H    6  
ATOM 6962  H HA   . LYS A 1 26 ? -10.802 -11.616 1.569   1.00 0.00 ? 26 LYS A HA   6  
ATOM 6963  H HB2  . LYS A 1 26 ? -11.417 -13.978 1.688   1.00 0.00 ? 26 LYS A HB2  6  
ATOM 6964  H HB3  . LYS A 1 26 ? -10.932 -14.035 3.382   1.00 0.00 ? 26 LYS A HB3  6  
ATOM 6965  H HG2  . LYS A 1 26 ? -12.695 -12.580 4.046   1.00 0.00 ? 26 LYS A HG2  6  
ATOM 6966  H HG3  . LYS A 1 26 ? -13.020 -12.091 2.383   1.00 0.00 ? 26 LYS A HG3  6  
ATOM 6967  H HD2  . LYS A 1 26 ? -13.747 -14.400 1.856   1.00 0.00 ? 26 LYS A HD2  6  
ATOM 6968  H HD3  . LYS A 1 26 ? -13.459 -14.863 3.534   1.00 0.00 ? 26 LYS A HD3  6  
ATOM 6969  H HE2  . LYS A 1 26 ? -15.093 -13.090 4.237   1.00 0.00 ? 26 LYS A HE2  6  
ATOM 6970  H HE3  . LYS A 1 26 ? -15.460 -12.817 2.535   1.00 0.00 ? 26 LYS A HE3  6  
ATOM 6971  H HZ1  . LYS A 1 26 ? -16.166 -15.056 4.250   1.00 0.00 ? 26 LYS A HZ1  6  
ATOM 6972  H HZ2  . LYS A 1 26 ? -15.734 -15.445 2.654   1.00 0.00 ? 26 LYS A HZ2  6  
ATOM 6973  H HZ3  . LYS A 1 26 ? -17.017 -14.371 2.953   1.00 0.00 ? 26 LYS A HZ3  6  
ATOM 6974  N N    . GLU A 1 27 ? -9.510  -11.621 4.558   1.00 0.00 ? 27 GLU A N    6  
ATOM 6975  C CA   . GLU A 1 27 ? -9.461  -10.803 5.806   1.00 0.00 ? 27 GLU A CA   6  
ATOM 6976  C C    . GLU A 1 27 ? -8.788  -9.450  5.530   1.00 0.00 ? 27 GLU A C    6  
ATOM 6977  O O    . GLU A 1 27 ? -9.160  -8.442  6.098   1.00 0.00 ? 27 GLU A O    6  
ATOM 6978  C CB   . GLU A 1 27 ? -8.661  -11.543 6.879   1.00 0.00 ? 27 GLU A CB   6  
ATOM 6979  C CG   . GLU A 1 27 ? -9.473  -12.710 7.436   1.00 0.00 ? 27 GLU A CG   6  
ATOM 6980  C CD   . GLU A 1 27 ? -8.558  -13.632 8.246   1.00 0.00 ? 27 GLU A CD   6  
ATOM 6981  O OE1  . GLU A 1 27 ? -7.451  -13.876 7.797   1.00 0.00 ? 27 GLU A OE1  6  
ATOM 6982  O OE2  . GLU A 1 27 ? -8.980  -14.076 9.300   1.00 0.00 ? 27 GLU A OE2  6  
ATOM 6983  H H    . GLU A 1 27 ? -8.892  -12.371 4.432   1.00 0.00 ? 27 GLU A H    6  
ATOM 6984  H HA   . GLU A 1 27 ? -10.465 -10.635 6.165   1.00 0.00 ? 27 GLU A HA   6  
ATOM 6985  H HB2  . GLU A 1 27 ? -7.743  -11.916 6.452   1.00 0.00 ? 27 GLU A HB2  6  
ATOM 6986  H HB3  . GLU A 1 27 ? -8.437  -10.859 7.677   1.00 0.00 ? 27 GLU A HB3  6  
ATOM 6987  H HG2  . GLU A 1 27 ? -10.253 -12.329 8.077   1.00 0.00 ? 27 GLU A HG2  6  
ATOM 6988  H HG3  . GLU A 1 27 ? -9.910  -13.266 6.624   1.00 0.00 ? 27 GLU A HG3  6  
ATOM 6989  N N    . ILE A 1 28 ? -7.801  -9.411  4.680   1.00 0.00 ? 28 ILE A N    6  
ATOM 6990  C CA   . ILE A 1 28 ? -7.112  -8.119  4.395   1.00 0.00 ? 28 ILE A CA   6  
ATOM 6991  C C    . ILE A 1 28 ? -8.090  -7.174  3.713   1.00 0.00 ? 28 ILE A C    6  
ATOM 6992  O O    . ILE A 1 28 ? -8.135  -5.995  4.004   1.00 0.00 ? 28 ILE A O    6  
ATOM 6993  C CB   . ILE A 1 28 ? -5.892  -8.421  3.509   1.00 0.00 ? 28 ILE A CB   6  
ATOM 6994  C CG1  . ILE A 1 28 ? -5.207  -9.687  4.091   1.00 0.00 ? 28 ILE A CG1  6  
ATOM 6995  C CG2  . ILE A 1 28 ? -4.940  -7.217  3.488   1.00 0.00 ? 28 ILE A CG2  6  
ATOM 6996  C CD1  . ILE A 1 28 ? -3.684  -9.693  3.907   1.00 0.00 ? 28 ILE A CD1  6  
ATOM 6997  H H    . ILE A 1 28 ? -7.506  -10.230 4.229   1.00 0.00 ? 28 ILE A H    6  
ATOM 6998  H HA   . ILE A 1 28 ? -6.789  -7.681  5.330   1.00 0.00 ? 28 ILE A HA   6  
ATOM 6999  H HB   . ILE A 1 28 ? -6.227  -8.623  2.501   1.00 0.00 ? 28 ILE A HB   6  
ATOM 7000  H HG12 . ILE A 1 28 ? -5.418  -9.741  5.137   1.00 0.00 ? 28 ILE A HG12 6  
ATOM 7001  H HG13 . ILE A 1 28 ? -5.618  -10.557 3.614   1.00 0.00 ? 28 ILE A HG13 6  
ATOM 7002  H HG21 . ILE A 1 28 ? -5.486  -6.330  3.206   1.00 0.00 ? 28 ILE A HG21 6  
ATOM 7003  H HG22 . ILE A 1 28 ? -4.155  -7.396  2.767   1.00 0.00 ? 28 ILE A HG22 6  
ATOM 7004  H HG23 . ILE A 1 28 ? -4.505  -7.079  4.464   1.00 0.00 ? 28 ILE A HG23 6  
ATOM 7005  H HD11 . ILE A 1 28 ? -3.245  -8.900  4.492   1.00 0.00 ? 28 ILE A HD11 6  
ATOM 7006  H HD12 . ILE A 1 28 ? -3.440  -9.554  2.865   1.00 0.00 ? 28 ILE A HD12 6  
ATOM 7007  H HD13 . ILE A 1 28 ? -3.295  -10.647 4.248   1.00 0.00 ? 28 ILE A HD13 6  
ATOM 7008  N N    . LEU A 1 29 ? -8.888  -7.675  2.822   1.00 0.00 ? 29 LEU A N    6  
ATOM 7009  C CA   . LEU A 1 29 ? -9.875  -6.804  2.142   1.00 0.00 ? 29 LEU A CA   6  
ATOM 7010  C C    . LEU A 1 29 ? -10.999 -6.455  3.129   1.00 0.00 ? 29 LEU A C    6  
ATOM 7011  O O    . LEU A 1 29 ? -11.629 -5.423  3.039   1.00 0.00 ? 29 LEU A O    6  
ATOM 7012  C CB   . LEU A 1 29 ? -10.432 -7.552  0.931   1.00 0.00 ? 29 LEU A CB   6  
ATOM 7013  C CG   . LEU A 1 29 ? -9.264  -8.104  0.100   1.00 0.00 ? 29 LEU A CG   6  
ATOM 7014  C CD1  . LEU A 1 29 ? -9.820  -8.897  -1.087  1.00 0.00 ? 29 LEU A CD1  6  
ATOM 7015  C CD2  . LEU A 1 29 ? -8.399  -6.944  -0.417  1.00 0.00 ? 29 LEU A CD2  6  
ATOM 7016  H H    . LEU A 1 29 ? -8.847  -8.627  2.593   1.00 0.00 ? 29 LEU A H    6  
ATOM 7017  H HA   . LEU A 1 29 ? -9.393  -5.895  1.815   1.00 0.00 ? 29 LEU A HA   6  
ATOM 7018  H HB2  . LEU A 1 29 ? -11.053 -8.371  1.268   1.00 0.00 ? 29 LEU A HB2  6  
ATOM 7019  H HB3  . LEU A 1 29 ? -11.017 -6.879  0.325   1.00 0.00 ? 29 LEU A HB3  6  
ATOM 7020  H HG   . LEU A 1 29 ? -8.658  -8.759  0.720   1.00 0.00 ? 29 LEU A HG   6  
ATOM 7021  H HD11 . LEU A 1 29 ? -9.033  -9.066  -1.808  1.00 0.00 ? 29 LEU A HD11 6  
ATOM 7022  H HD12 . LEU A 1 29 ? -10.618 -8.338  -1.552  1.00 0.00 ? 29 LEU A HD12 6  
ATOM 7023  H HD13 . LEU A 1 29 ? -10.201 -9.846  -0.741  1.00 0.00 ? 29 LEU A HD13 6  
ATOM 7024  H HD21 . LEU A 1 29 ? -9.035  -6.121  -0.715  1.00 0.00 ? 29 LEU A HD21 6  
ATOM 7025  H HD22 . LEU A 1 29 ? -7.819  -7.274  -1.267  1.00 0.00 ? 29 LEU A HD22 6  
ATOM 7026  H HD23 . LEU A 1 29 ? -7.730  -6.617  0.364   1.00 0.00 ? 29 LEU A HD23 6  
ATOM 7027  N N    . ASP A 1 30 ? -11.234 -7.312  4.087   1.00 0.00 ? 30 ASP A N    6  
ATOM 7028  C CA   . ASP A 1 30 ? -12.288 -7.030  5.107   1.00 0.00 ? 30 ASP A CA   6  
ATOM 7029  C C    . ASP A 1 30 ? -11.804 -5.884  6.006   1.00 0.00 ? 30 ASP A C    6  
ATOM 7030  O O    . ASP A 1 30 ? -12.541 -4.967  6.308   1.00 0.00 ? 30 ASP A O    6  
ATOM 7031  C CB   . ASP A 1 30 ? -12.534 -8.280  5.957   1.00 0.00 ? 30 ASP A CB   6  
ATOM 7032  C CG   . ASP A 1 30 ? -13.781 -8.074  6.820   1.00 0.00 ? 30 ASP A CG   6  
ATOM 7033  O OD1  . ASP A 1 30 ? -14.869 -8.107  6.270   1.00 0.00 ? 30 ASP A OD1  6  
ATOM 7034  O OD2  . ASP A 1 30 ? -13.624 -7.889  8.015   1.00 0.00 ? 30 ASP A OD2  6  
ATOM 7035  H H    . ASP A 1 30 ? -10.705 -8.136  4.127   1.00 0.00 ? 30 ASP A H    6  
ATOM 7036  H HA   . ASP A 1 30 ? -13.207 -6.728  4.625   1.00 0.00 ? 30 ASP A HA   6  
ATOM 7037  H HB2  . ASP A 1 30 ? -12.680 -9.132  5.309   1.00 0.00 ? 30 ASP A HB2  6  
ATOM 7038  H HB3  . ASP A 1 30 ? -11.681 -8.455  6.595   1.00 0.00 ? 30 ASP A HB3  6  
ATOM 7039  N N    . ALA A 1 31 ? -10.579 -5.942  6.453   1.00 0.00 ? 31 ALA A N    6  
ATOM 7040  C CA   . ALA A 1 31 ? -10.052 -4.874  7.356   1.00 0.00 ? 31 ALA A CA   6  
ATOM 7041  C C    . ALA A 1 31 ? -9.938  -3.540  6.602   1.00 0.00 ? 31 ALA A C    6  
ATOM 7042  O O    . ALA A 1 31 ? -9.962  -2.485  7.205   1.00 0.00 ? 31 ALA A O    6  
ATOM 7043  C CB   . ALA A 1 31 ? -8.678  -5.291  7.877   1.00 0.00 ? 31 ALA A CB   6  
ATOM 7044  H H    . ALA A 1 31 ? -10.008 -6.701  6.211   1.00 0.00 ? 31 ALA A H    6  
ATOM 7045  H HA   . ALA A 1 31 ? -10.716 -4.759  8.192   1.00 0.00 ? 31 ALA A HA   6  
ATOM 7046  H HB1  . ALA A 1 31 ? -7.950  -5.211  7.085   1.00 0.00 ? 31 ALA A HB1  6  
ATOM 7047  H HB2  . ALA A 1 31 ? -8.724  -6.314  8.222   1.00 0.00 ? 31 ALA A HB2  6  
ATOM 7048  H HB3  . ALA A 1 31 ? -8.397  -4.650  8.697   1.00 0.00 ? 31 ALA A HB3  6  
ATOM 7049  N N    . PHE A 1 32 ? -9.833  -3.559  5.308   1.00 0.00 ? 32 PHE A N    6  
ATOM 7050  C CA   . PHE A 1 32 ? -9.741  -2.277  4.541   1.00 0.00 ? 32 PHE A CA   6  
ATOM 7051  C C    . PHE A 1 32 ? -10.914 -1.362  4.910   1.00 0.00 ? 32 PHE A C    6  
ATOM 7052  O O    . PHE A 1 32 ? -10.956 -0.213  4.518   1.00 0.00 ? 32 PHE A O    6  
ATOM 7053  C CB   . PHE A 1 32 ? -9.794  -2.623  3.045   1.00 0.00 ? 32 PHE A CB   6  
ATOM 7054  C CG   . PHE A 1 32 ? -8.423  -3.035  2.511   1.00 0.00 ? 32 PHE A CG   6  
ATOM 7055  C CD1  . PHE A 1 32 ? -7.361  -3.414  3.368   1.00 0.00 ? 32 PHE A CD1  6  
ATOM 7056  C CD2  . PHE A 1 32 ? -8.211  -3.010  1.127   1.00 0.00 ? 32 PHE A CD2  6  
ATOM 7057  C CE1  . PHE A 1 32 ? -6.118  -3.756  2.828   1.00 0.00 ? 32 PHE A CE1  6  
ATOM 7058  C CE2  . PHE A 1 32 ? -6.962  -3.346  0.597   1.00 0.00 ? 32 PHE A CE2  6  
ATOM 7059  C CZ   . PHE A 1 32 ? -5.917  -3.716  1.447   1.00 0.00 ? 32 PHE A CZ   6  
ATOM 7060  H H    . PHE A 1 32 ? -9.828  -4.410  4.822   1.00 0.00 ? 32 PHE A H    6  
ATOM 7061  H HA   . PHE A 1 32 ? -8.814  -1.770  4.755   1.00 0.00 ? 32 PHE A HA   6  
ATOM 7062  H HB2  . PHE A 1 32 ? -10.485 -3.434  2.897   1.00 0.00 ? 32 PHE A HB2  6  
ATOM 7063  H HB3  . PHE A 1 32 ? -10.141 -1.763  2.491   1.00 0.00 ? 32 PHE A HB3  6  
ATOM 7064  H HD1  . PHE A 1 32 ? -7.497  -3.469  4.435   1.00 0.00 ? 32 PHE A HD1  6  
ATOM 7065  H HD2  . PHE A 1 32 ? -9.019  -2.733  0.467   1.00 0.00 ? 32 PHE A HD2  6  
ATOM 7066  H HE1  . PHE A 1 32 ? -5.306  -4.037  3.482   1.00 0.00 ? 32 PHE A HE1  6  
ATOM 7067  H HE2  . PHE A 1 32 ? -6.805  -3.324  -0.472  1.00 0.00 ? 32 PHE A HE2  6  
ATOM 7068  H HZ   . PHE A 1 32 ? -4.953  -3.971  1.038   1.00 0.00 ? 32 PHE A HZ   6  
ATOM 7069  N N    . ASP A 1 33 ? -11.878 -1.856  5.637   1.00 0.00 ? 33 ASP A N    6  
ATOM 7070  C CA   . ASP A 1 33 ? -13.050 -1.002  5.992   1.00 0.00 ? 33 ASP A CA   6  
ATOM 7071  C C    . ASP A 1 33 ? -12.765 -0.195  7.264   1.00 0.00 ? 33 ASP A C    6  
ATOM 7072  O O    . ASP A 1 33 ? -13.412 0.800   7.523   1.00 0.00 ? 33 ASP A O    6  
ATOM 7073  C CB   . ASP A 1 33 ? -14.273 -1.899  6.219   1.00 0.00 ? 33 ASP A CB   6  
ATOM 7074  C CG   . ASP A 1 33 ? -14.830 -2.362  4.871   1.00 0.00 ? 33 ASP A CG   6  
ATOM 7075  O OD1  . ASP A 1 33 ? -14.177 -3.169  4.229   1.00 0.00 ? 33 ASP A OD1  6  
ATOM 7076  O OD2  . ASP A 1 33 ? -15.898 -1.903  4.504   1.00 0.00 ? 33 ASP A OD2  6  
ATOM 7077  H H    . ASP A 1 33 ? -11.842 -2.790  5.932   1.00 0.00 ? 33 ASP A H    6  
ATOM 7078  H HA   . ASP A 1 33 ? -13.259 -0.319  5.180   1.00 0.00 ? 33 ASP A HA   6  
ATOM 7079  H HB2  . ASP A 1 33 ? -13.982 -2.760  6.799   1.00 0.00 ? 33 ASP A HB2  6  
ATOM 7080  H HB3  . ASP A 1 33 ? -15.035 -1.346  6.749   1.00 0.00 ? 33 ASP A HB3  6  
ATOM 7081  N N    . LYS A 1 34 ? -11.796 -0.600  8.053   1.00 0.00 ? 34 LYS A N    6  
ATOM 7082  C CA   . LYS A 1 34 ? -11.455 0.157   9.306   1.00 0.00 ? 34 LYS A CA   6  
ATOM 7083  C C    . LYS A 1 34 ? -9.954  0.500   9.298   1.00 0.00 ? 34 LYS A C    6  
ATOM 7084  O O    . LYS A 1 34 ? -9.415  0.961   10.283  1.00 0.00 ? 34 LYS A O    6  
ATOM 7085  C CB   . LYS A 1 34 ? -11.794 -0.685  10.574  1.00 0.00 ? 34 LYS A CB   6  
ATOM 7086  C CG   . LYS A 1 34 ? -12.064 -2.164  10.209  1.00 0.00 ? 34 LYS A CG   6  
ATOM 7087  C CD   . LYS A 1 34 ? -13.569 -2.386  9.891   1.00 0.00 ? 34 LYS A CD   6  
ATOM 7088  C CE   . LYS A 1 34 ? -14.285 -2.958  11.120  1.00 0.00 ? 34 LYS A CE   6  
ATOM 7089  N NZ   . LYS A 1 34 ? -15.753 -2.735  10.991  1.00 0.00 ? 34 LYS A NZ   6  
ATOM 7090  H H    . LYS A 1 34 ? -11.283 -1.405  7.829   1.00 0.00 ? 34 LYS A H    6  
ATOM 7091  H HA   . LYS A 1 34 ? -12.015 1.083   9.335   1.00 0.00 ? 34 LYS A HA   6  
ATOM 7092  H HB2  . LYS A 1 34 ? -10.968 -0.641  11.275  1.00 0.00 ? 34 LYS A HB2  6  
ATOM 7093  H HB3  . LYS A 1 34 ? -12.671 -0.271  11.055  1.00 0.00 ? 34 LYS A HB3  6  
ATOM 7094  H HG2  . LYS A 1 34 ? -11.465 -2.443  9.357   1.00 0.00 ? 34 LYS A HG2  6  
ATOM 7095  H HG3  . LYS A 1 34 ? -11.778 -2.790  11.045  1.00 0.00 ? 34 LYS A HG3  6  
ATOM 7096  H HD2  . LYS A 1 34 ? -14.033 -1.450  9.611   1.00 0.00 ? 34 LYS A HD2  6  
ATOM 7097  H HD3  . LYS A 1 34 ? -13.669 -3.083  9.075   1.00 0.00 ? 34 LYS A HD3  6  
ATOM 7098  H HE2  . LYS A 1 34 ? -14.084 -4.018  11.185  1.00 0.00 ? 34 LYS A HE2  6  
ATOM 7099  H HE3  . LYS A 1 34 ? -13.920 -2.468  12.010  1.00 0.00 ? 34 LYS A HE3  6  
ATOM 7100  H HZ1  . LYS A 1 34 ? -15.964 -2.347  10.050  1.00 0.00 ? 34 LYS A HZ1  6  
ATOM 7101  H HZ2  . LYS A 1 34 ? -16.066 -2.063  11.723  1.00 0.00 ? 34 LYS A HZ2  6  
ATOM 7102  H HZ3  . LYS A 1 34 ? -16.254 -3.638  11.112  1.00 0.00 ? 34 LYS A HZ3  6  
ATOM 7103  N N    . MET A 1 35 ? -9.274  0.284   8.200   1.00 0.00 ? 35 MET A N    6  
ATOM 7104  C CA   . MET A 1 35 ? -7.814  0.610   8.156   1.00 0.00 ? 35 MET A CA   6  
ATOM 7105  C C    . MET A 1 35 ? -7.646  2.116   7.905   1.00 0.00 ? 35 MET A C    6  
ATOM 7106  O O    . MET A 1 35 ? -6.844  2.755   8.559   1.00 0.00 ? 35 MET A O    6  
ATOM 7107  C CB   . MET A 1 35 ? -7.127  -0.221  7.044   1.00 0.00 ? 35 MET A CB   6  
ATOM 7108  C CG   . MET A 1 35 ? -5.907  -0.970  7.589   1.00 0.00 ? 35 MET A CG   6  
ATOM 7109  S SD   . MET A 1 35 ? -4.941  -1.632  6.201   1.00 0.00 ? 35 MET A SD   6  
ATOM 7110  C CE   . MET A 1 35 ? -5.206  -3.397  6.521   1.00 0.00 ? 35 MET A CE   6  
ATOM 7111  H H    . MET A 1 35 ? -9.719  -0.087  7.410   1.00 0.00 ? 35 MET A H    6  
ATOM 7112  H HA   . MET A 1 35 ? -7.376  0.369   9.117   1.00 0.00 ? 35 MET A HA   6  
ATOM 7113  H HB2  . MET A 1 35 ? -7.829  -0.940  6.678   1.00 0.00 ? 35 MET A HB2  6  
ATOM 7114  H HB3  . MET A 1 35 ? -6.812  0.418   6.229   1.00 0.00 ? 35 MET A HB3  6  
ATOM 7115  H HG2  . MET A 1 35 ? -5.295  -0.292  8.164   1.00 0.00 ? 35 MET A HG2  6  
ATOM 7116  H HG3  . MET A 1 35 ? -6.240  -1.778  8.220   1.00 0.00 ? 35 MET A HG3  6  
ATOM 7117  H HE1  . MET A 1 35 ? -6.258  -3.628  6.423   1.00 0.00 ? 35 MET A HE1  6  
ATOM 7118  H HE2  . MET A 1 35 ? -4.880  -3.633  7.520   1.00 0.00 ? 35 MET A HE2  6  
ATOM 7119  H HE3  . MET A 1 35 ? -4.635  -3.980  5.810   1.00 0.00 ? 35 MET A HE3  6  
ATOM 7120  N N    . CYS A 1 36 ? -8.379  2.714   6.994   1.00 0.00 ? 36 CYS A N    6  
ATOM 7121  C CA   . CYS A 1 36 ? -8.183  4.175   6.807   1.00 0.00 ? 36 CYS A CA   6  
ATOM 7122  C C    . CYS A 1 36 ? -8.616  4.845   8.108   1.00 0.00 ? 36 CYS A C    6  
ATOM 7123  O O    . CYS A 1 36 ? -8.456  6.036   8.291   1.00 0.00 ? 36 CYS A O    6  
ATOM 7124  C CB   . CYS A 1 36 ? -9.003  4.719   5.631   1.00 0.00 ? 36 CYS A CB   6  
ATOM 7125  S SG   . CYS A 1 36 ? -8.211  6.214   4.998   1.00 0.00 ? 36 CYS A SG   6  
ATOM 7126  H H    . CYS A 1 36 ? -9.043  2.223   6.464   1.00 0.00 ? 36 CYS A H    6  
ATOM 7127  H HA   . CYS A 1 36 ? -7.131  4.359   6.659   1.00 0.00 ? 36 CYS A HA   6  
ATOM 7128  H HB2  . CYS A 1 36 ? -9.048  3.984   4.850   1.00 0.00 ? 36 CYS A HB2  6  
ATOM 7129  H HB3  . CYS A 1 36 ? -10.005 4.960   5.957   1.00 0.00 ? 36 CYS A HB3  6  
ATOM 7130  N N    . SER A 1 37 ? -9.174  4.087   9.009   1.00 0.00 ? 37 SER A N    6  
ATOM 7131  C CA   . SER A 1 37 ? -9.631  4.691   10.301  1.00 0.00 ? 37 SER A CA   6  
ATOM 7132  C C    . SER A 1 37 ? -8.449  4.838   11.265  1.00 0.00 ? 37 SER A C    6  
ATOM 7133  O O    . SER A 1 37 ? -8.641  5.051   12.446  1.00 0.00 ? 37 SER A O    6  
ATOM 7134  C CB   . SER A 1 37 ? -10.696 3.801   10.939  1.00 0.00 ? 37 SER A CB   6  
ATOM 7135  O OG   . SER A 1 37 ? -11.323 4.510   12.000  1.00 0.00 ? 37 SER A OG   6  
ATOM 7136  H H    . SER A 1 37 ? -9.302  3.119   8.831   1.00 0.00 ? 37 SER A H    6  
ATOM 7137  H HA   . SER A 1 37 ? -10.054 5.667   10.108  1.00 0.00 ? 37 SER A HA   6  
ATOM 7138  H HB2  . SER A 1 37 ? -11.436 3.539   10.204  1.00 0.00 ? 37 SER A HB2  6  
ATOM 7139  H HB3  . SER A 1 37 ? -10.231 2.902   11.319  1.00 0.00 ? 37 SER A HB3  6  
ATOM 7140  H HG   . SER A 1 37 ? -11.274 5.449   11.800  1.00 0.00 ? 37 SER A HG   6  
ATOM 7141  N N    . LYS A 1 38 ? -7.232  4.733   10.781  1.00 0.00 ? 38 LYS A N    6  
ATOM 7142  C CA   . LYS A 1 38 ? -6.035  4.874   11.680  1.00 0.00 ? 38 LYS A CA   6  
ATOM 7143  C C    . LYS A 1 38 ? -5.185  6.072   11.229  1.00 0.00 ? 38 LYS A C    6  
ATOM 7144  O O    . LYS A 1 38 ? -4.189  6.398   11.844  1.00 0.00 ? 38 LYS A O    6  
ATOM 7145  C CB   . LYS A 1 38 ? -5.202  3.585   11.631  1.00 0.00 ? 38 LYS A CB   6  
ATOM 7146  C CG   . LYS A 1 38 ? -5.862  2.514   12.504  1.00 0.00 ? 38 LYS A CG   6  
ATOM 7147  C CD   . LYS A 1 38 ? -5.010  1.243   12.488  1.00 0.00 ? 38 LYS A CD   6  
ATOM 7148  C CE   . LYS A 1 38 ? -5.820  0.079   13.062  1.00 0.00 ? 38 LYS A CE   6  
ATOM 7149  N NZ   . LYS A 1 38 ? -4.991  -1.158  13.046  1.00 0.00 ? 38 LYS A NZ   6  
ATOM 7150  H H    . LYS A 1 38 ? -7.104  4.565   9.823   1.00 0.00 ? 38 LYS A H    6  
ATOM 7151  H HA   . LYS A 1 38 ? -6.357  5.048   12.699  1.00 0.00 ? 38 LYS A HA   6  
ATOM 7152  H HB2  . LYS A 1 38 ? -5.144  3.229   10.614  1.00 0.00 ? 38 LYS A HB2  6  
ATOM 7153  H HB3  . LYS A 1 38 ? -4.207  3.783   12.002  1.00 0.00 ? 38 LYS A HB3  6  
ATOM 7154  H HG2  . LYS A 1 38 ? -5.947  2.879   13.517  1.00 0.00 ? 38 LYS A HG2  6  
ATOM 7155  H HG3  . LYS A 1 38 ? -6.845  2.291   12.117  1.00 0.00 ? 38 LYS A HG3  6  
ATOM 7156  H HD2  . LYS A 1 38 ? -4.721  1.017   11.472  1.00 0.00 ? 38 LYS A HD2  6  
ATOM 7157  H HD3  . LYS A 1 38 ? -4.126  1.395   13.089  1.00 0.00 ? 38 LYS A HD3  6  
ATOM 7158  H HE2  . LYS A 1 38 ? -6.108  0.307   14.077  1.00 0.00 ? 38 LYS A HE2  6  
ATOM 7159  H HE3  . LYS A 1 38 ? -6.706  -0.073  12.461  1.00 0.00 ? 38 LYS A HE3  6  
ATOM 7160  H HZ1  . LYS A 1 38 ? -4.770  -1.440  14.021  1.00 0.00 ? 38 LYS A HZ1  6  
ATOM 7161  H HZ2  . LYS A 1 38 ? -4.107  -0.976  12.527  1.00 0.00 ? 38 LYS A HZ2  6  
ATOM 7162  H HZ3  . LYS A 1 38 ? -5.517  -1.923  12.577  1.00 0.00 ? 38 LYS A HZ3  6  
ATOM 7163  N N    . LEU A 1 39 ? -5.579  6.738   10.168  1.00 0.00 ? 39 LEU A N    6  
ATOM 7164  C CA   . LEU A 1 39 ? -4.807  7.932   9.676   1.00 0.00 ? 39 LEU A CA   6  
ATOM 7165  C C    . LEU A 1 39 ? -5.612  9.204   10.011  1.00 0.00 ? 39 LEU A C    6  
ATOM 7166  O O    . LEU A 1 39 ? -6.824  9.176   9.920   1.00 0.00 ? 39 LEU A O    6  
ATOM 7167  C CB   . LEU A 1 39 ? -4.658  7.842   8.150   1.00 0.00 ? 39 LEU A CB   6  
ATOM 7168  C CG   . LEU A 1 39 ? -3.950  6.543   7.751   1.00 0.00 ? 39 LEU A CG   6  
ATOM 7169  C CD1  . LEU A 1 39 ? -3.941  6.428   6.227   1.00 0.00 ? 39 LEU A CD1  6  
ATOM 7170  C CD2  . LEU A 1 39 ? -2.501  6.548   8.263   1.00 0.00 ? 39 LEU A CD2  6  
ATOM 7171  H H    . LEU A 1 39 ? -6.391  6.461   9.698   1.00 0.00 ? 39 LEU A H    6  
ATOM 7172  H HA   . LEU A 1 39 ? -3.836  7.960   10.141  1.00 0.00 ? 39 LEU A HA   6  
ATOM 7173  H HB2  . LEU A 1 39 ? -5.641  7.863   7.701   1.00 0.00 ? 39 LEU A HB2  6  
ATOM 7174  H HB3  . LEU A 1 39 ? -4.089  8.682   7.788   1.00 0.00 ? 39 LEU A HB3  6  
ATOM 7175  H HG   . LEU A 1 39 ? -4.481  5.704   8.166   1.00 0.00 ? 39 LEU A HG   6  
ATOM 7176  H HD11 . LEU A 1 39 ? -4.918  6.673   5.840   1.00 0.00 ? 39 LEU A HD11 6  
ATOM 7177  H HD12 . LEU A 1 39 ? -3.683  5.419   5.944   1.00 0.00 ? 39 LEU A HD12 6  
ATOM 7178  H HD13 . LEU A 1 39 ? -3.212  7.112   5.823   1.00 0.00 ? 39 LEU A HD13 6  
ATOM 7179  H HD21 . LEU A 1 39 ? -2.486  6.291   9.311   1.00 0.00 ? 39 LEU A HD21 6  
ATOM 7180  H HD22 . LEU A 1 39 ? -2.073  7.528   8.124   1.00 0.00 ? 39 LEU A HD22 6  
ATOM 7181  H HD23 . LEU A 1 39 ? -1.919  5.827   7.710   1.00 0.00 ? 39 LEU A HD23 6  
ATOM 7182  N N    . PRO A 1 40 ? -4.954  10.295  10.374  1.00 0.00 ? 40 PRO A N    6  
ATOM 7183  C CA   . PRO A 1 40 ? -5.679  11.537  10.686  1.00 0.00 ? 40 PRO A CA   6  
ATOM 7184  C C    . PRO A 1 40 ? -6.759  11.809  9.621   1.00 0.00 ? 40 PRO A C    6  
ATOM 7185  O O    . PRO A 1 40 ? -6.687  11.285  8.526   1.00 0.00 ? 40 PRO A O    6  
ATOM 7186  C CB   . PRO A 1 40 ? -4.586  12.632  10.737  1.00 0.00 ? 40 PRO A CB   6  
ATOM 7187  C CG   . PRO A 1 40 ? -3.209  11.904  10.725  1.00 0.00 ? 40 PRO A CG   6  
ATOM 7188  C CD   . PRO A 1 40 ? -3.483  10.400  10.512  1.00 0.00 ? 40 PRO A CD   6  
ATOM 7189  H HA   . PRO A 1 40 ? -6.148  11.439  11.652  1.00 0.00 ? 40 PRO A HA   6  
ATOM 7190  H HB2  . PRO A 1 40 ? -4.667  13.285  9.875   1.00 0.00 ? 40 PRO A HB2  6  
ATOM 7191  H HB3  . PRO A 1 40 ? -4.678  13.214  11.645  1.00 0.00 ? 40 PRO A HB3  6  
ATOM 7192  H HG2  . PRO A 1 40 ? -2.595  12.290  9.918   1.00 0.00 ? 40 PRO A HG2  6  
ATOM 7193  H HG3  . PRO A 1 40 ? -2.702  12.053  11.668  1.00 0.00 ? 40 PRO A HG3  6  
ATOM 7194  H HD2  . PRO A 1 40 ? -2.988  10.059  9.623   1.00 0.00 ? 40 PRO A HD2  6  
ATOM 7195  H HD3  . PRO A 1 40 ? -3.151  9.830   11.368  1.00 0.00 ? 40 PRO A HD3  6  
ATOM 7196  N N    . LYS A 1 41 ? -7.762  12.591  9.911   1.00 0.00 ? 41 LYS A N    6  
ATOM 7197  C CA   . LYS A 1 41 ? -8.821  12.836  8.885   1.00 0.00 ? 41 LYS A CA   6  
ATOM 7198  C C    . LYS A 1 41 ? -8.255  13.561  7.662   1.00 0.00 ? 41 LYS A C    6  
ATOM 7199  O O    . LYS A 1 41 ? -8.893  13.636  6.630   1.00 0.00 ? 41 LYS A O    6  
ATOM 7200  C CB   . LYS A 1 41 ? -9.945  13.672  9.486   1.00 0.00 ? 41 LYS A CB   6  
ATOM 7201  C CG   . LYS A 1 41 ? -11.176 13.615  8.573   1.00 0.00 ? 41 LYS A CG   6  
ATOM 7202  C CD   . LYS A 1 41 ? -12.353 14.322  9.249   1.00 0.00 ? 41 LYS A CD   6  
ATOM 7203  C CE   . LYS A 1 41 ? -13.582 14.242  8.340   1.00 0.00 ? 41 LYS A CE   6  
ATOM 7204  N NZ   . LYS A 1 41 ? -14.709 14.998  8.959   1.00 0.00 ? 41 LYS A NZ   6  
ATOM 7205  H H    . LYS A 1 41 ? -7.831  13.012  10.793  1.00 0.00 ? 41 LYS A H    6  
ATOM 7206  H HA   . LYS A 1 41 ? -9.218  11.899  8.527   1.00 0.00 ? 41 LYS A HA   6  
ATOM 7207  H HB2  . LYS A 1 41 ? -10.197 13.286  10.461  1.00 0.00 ? 41 LYS A HB2  6  
ATOM 7208  H HB3  . LYS A 1 41 ? -9.614  14.695  9.576   1.00 0.00 ? 41 LYS A HB3  6  
ATOM 7209  H HG2  . LYS A 1 41 ? -10.953 14.107  7.637   1.00 0.00 ? 41 LYS A HG2  6  
ATOM 7210  H HG3  . LYS A 1 41 ? -11.439 12.584  8.383   1.00 0.00 ? 41 LYS A HG3  6  
ATOM 7211  H HD2  . LYS A 1 41 ? -12.568 13.840  10.192  1.00 0.00 ? 41 LYS A HD2  6  
ATOM 7212  H HD3  . LYS A 1 41 ? -12.101 15.357  9.421   1.00 0.00 ? 41 LYS A HD3  6  
ATOM 7213  H HE2  . LYS A 1 41 ? -13.347 14.671  7.378   1.00 0.00 ? 41 LYS A HE2  6  
ATOM 7214  H HE3  . LYS A 1 41 ? -13.870 13.209  8.213   1.00 0.00 ? 41 LYS A HE3  6  
ATOM 7215  H HZ1  . LYS A 1 41 ? -14.957 14.566  9.871   1.00 0.00 ? 41 LYS A HZ1  6  
ATOM 7216  H HZ2  . LYS A 1 41 ? -15.533 14.970  8.324   1.00 0.00 ? 41 LYS A HZ2  6  
ATOM 7217  H HZ3  . LYS A 1 41 ? -14.422 15.985  9.111   1.00 0.00 ? 41 LYS A HZ3  6  
ATOM 7218  N N    . SER A 1 42 ? -7.107  14.161  7.780   1.00 0.00 ? 42 SER A N    6  
ATOM 7219  C CA   . SER A 1 42 ? -6.576  14.952  6.632   1.00 0.00 ? 42 SER A CA   6  
ATOM 7220  C C    . SER A 1 42 ? -6.117  14.084  5.457   1.00 0.00 ? 42 SER A C    6  
ATOM 7221  O O    . SER A 1 42 ? -5.925  14.570  4.360   1.00 0.00 ? 42 SER A O    6  
ATOM 7222  C CB   . SER A 1 42 ? -5.442  15.866  7.094   1.00 0.00 ? 42 SER A CB   6  
ATOM 7223  O OG   . SER A 1 42 ? -4.418  15.078  7.689   1.00 0.00 ? 42 SER A OG   6  
ATOM 7224  H H    . SER A 1 42 ? -6.619  14.140  8.630   1.00 0.00 ? 42 SER A H    6  
ATOM 7225  H HA   . SER A 1 42 ? -7.383  15.548  6.235   1.00 0.00 ? 42 SER A HA   6  
ATOM 7226  H HB2  . SER A 1 42 ? -5.035  16.394  6.248   1.00 0.00 ? 42 SER A HB2  6  
ATOM 7227  H HB3  . SER A 1 42 ? -5.825  16.579  7.813   1.00 0.00 ? 42 SER A HB3  6  
ATOM 7228  H HG   . SER A 1 42 ? -3.755  14.897  7.019   1.00 0.00 ? 42 SER A HG   6  
ATOM 7229  N N    . LEU A 1 43 ? -5.958  12.798  5.672   1.00 0.00 ? 43 LEU A N    6  
ATOM 7230  C CA   . LEU A 1 43 ? -5.527  11.879  4.561   1.00 0.00 ? 43 LEU A CA   6  
ATOM 7231  C C    . LEU A 1 43 ? -6.658  10.893  4.252   1.00 0.00 ? 43 LEU A C    6  
ATOM 7232  O O    . LEU A 1 43 ? -6.523  10.052  3.386   1.00 0.00 ? 43 LEU A O    6  
ATOM 7233  C CB   . LEU A 1 43 ? -4.285  11.071  4.967   1.00 0.00 ? 43 LEU A CB   6  
ATOM 7234  C CG   . LEU A 1 43 ? -3.224  11.973  5.595   1.00 0.00 ? 43 LEU A CG   6  
ATOM 7235  C CD1  . LEU A 1 43 ? -1.960  11.161  5.883   1.00 0.00 ? 43 LEU A CD1  6  
ATOM 7236  C CD2  . LEU A 1 43 ? -2.881  13.127  4.648   1.00 0.00 ? 43 LEU A CD2  6  
ATOM 7237  H H    . LEU A 1 43 ? -6.140  12.433  6.566   1.00 0.00 ? 43 LEU A H    6  
ATOM 7238  H HA   . LEU A 1 43 ? -5.303  12.447  3.667   1.00 0.00 ? 43 LEU A HA   6  
ATOM 7239  H HB2  . LEU A 1 43 ? -4.573  10.320  5.683   1.00 0.00 ? 43 LEU A HB2  6  
ATOM 7240  H HB3  . LEU A 1 43 ? -3.871  10.594  4.092   1.00 0.00 ? 43 LEU A HB3  6  
ATOM 7241  H HG   . LEU A 1 43 ? -3.604  12.358  6.517   1.00 0.00 ? 43 LEU A HG   6  
ATOM 7242  H HD11 . LEU A 1 43 ? -1.726  10.541  5.030   1.00 0.00 ? 43 LEU A HD11 6  
ATOM 7243  H HD12 . LEU A 1 43 ? -2.123  10.539  6.748   1.00 0.00 ? 43 LEU A HD12 6  
ATOM 7244  H HD13 . LEU A 1 43 ? -1.135  11.833  6.075   1.00 0.00 ? 43 LEU A HD13 6  
ATOM 7245  H HD21 . LEU A 1 43 ? -2.731  12.741  3.651   1.00 0.00 ? 43 LEU A HD21 6  
ATOM 7246  H HD22 . LEU A 1 43 ? -1.977  13.611  4.984   1.00 0.00 ? 43 LEU A HD22 6  
ATOM 7247  H HD23 . LEU A 1 43 ? -3.687  13.842  4.638   1.00 0.00 ? 43 LEU A HD23 6  
ATOM 7248  N N    . SER A 1 44 ? -7.759  10.974  4.967   1.00 0.00 ? 44 SER A N    6  
ATOM 7249  C CA   . SER A 1 44 ? -8.902  10.025  4.732   1.00 0.00 ? 44 SER A CA   6  
ATOM 7250  C C    . SER A 1 44 ? -9.041  9.719   3.241   1.00 0.00 ? 44 SER A C    6  
ATOM 7251  O O    . SER A 1 44 ? -8.874  8.609   2.778   1.00 0.00 ? 44 SER A O    6  
ATOM 7252  C CB   . SER A 1 44 ? -10.196 10.655  5.246   1.00 0.00 ? 44 SER A CB   6  
ATOM 7253  O OG   . SER A 1 44 ? -11.306 9.885   4.798   1.00 0.00 ? 44 SER A OG   6  
ATOM 7254  H H    . SER A 1 44 ? -7.830  11.648  5.675   1.00 0.00 ? 44 SER A H    6  
ATOM 7255  H HA   . SER A 1 44 ? -8.714  9.101   5.269   1.00 0.00 ? 44 SER A HA   6  
ATOM 7256  H HB2  . SER A 1 44 ? -10.189 10.671  6.323   1.00 0.00 ? 44 SER A HB2  6  
ATOM 7257  H HB3  . SER A 1 44 ? -10.275 11.668  4.875   1.00 0.00 ? 44 SER A HB3  6  
ATOM 7258  H HG   . SER A 1 44 ? -11.446 10.079  3.869   1.00 0.00 ? 44 SER A HG   6  
ATOM 7259  N N    . GLU A 1 45 ? -9.507  10.713  2.535   1.00 0.00 ? 45 GLU A N    6  
ATOM 7260  C CA   . GLU A 1 45 ? -9.880  10.607  1.098   1.00 0.00 ? 45 GLU A CA   6  
ATOM 7261  C C    . GLU A 1 45 ? -8.855  10.032  0.132   1.00 0.00 ? 45 GLU A C    6  
ATOM 7262  O O    . GLU A 1 45 ? -9.131  9.110   -0.609  1.00 0.00 ? 45 GLU A O    6  
ATOM 7263  C CB   . GLU A 1 45 ? -10.195 12.020  0.608   1.00 0.00 ? 45 GLU A CB   6  
ATOM 7264  C CG   . GLU A 1 45 ? -11.325 12.624  1.446   1.00 0.00 ? 45 GLU A CG   6  
ATOM 7265  C CD   . GLU A 1 45 ? -11.652 14.024  0.927   1.00 0.00 ? 45 GLU A CD   6  
ATOM 7266  O OE1  . GLU A 1 45 ? -12.349 14.119  -0.069  1.00 0.00 ? 45 GLU A OE1  6  
ATOM 7267  O OE2  . GLU A 1 45 ? -11.198 14.980  1.535   1.00 0.00 ? 45 GLU A OE2  6  
ATOM 7268  H H    . GLU A 1 45 ? -9.716  11.567  2.965   1.00 0.00 ? 45 GLU A H    6  
ATOM 7269  H HA   . GLU A 1 45 ? -10.784 10.028  1.021   1.00 0.00 ? 45 GLU A HA   6  
ATOM 7270  H HB2  . GLU A 1 45 ? -9.306  12.636  0.699   1.00 0.00 ? 45 GLU A HB2  6  
ATOM 7271  H HB3  . GLU A 1 45 ? -10.497 11.982  -0.428  1.00 0.00 ? 45 GLU A HB3  6  
ATOM 7272  H HG2  . GLU A 1 45 ? -12.202 11.997  1.371   1.00 0.00 ? 45 GLU A HG2  6  
ATOM 7273  H HG3  . GLU A 1 45 ? -11.015 12.688  2.477   1.00 0.00 ? 45 GLU A HG3  6  
ATOM 7274  N N    . GLU A 1 46 ? -7.674  10.562  0.137   1.00 0.00 ? 46 GLU A N    6  
ATOM 7275  C CA   . GLU A 1 46 ? -6.634  10.041  -0.773  1.00 0.00 ? 46 GLU A CA   6  
ATOM 7276  C C    . GLU A 1 46 ? -6.434  8.551   -0.520  1.00 0.00 ? 46 GLU A C    6  
ATOM 7277  O O    . GLU A 1 46 ? -5.977  7.832   -1.378  1.00 0.00 ? 46 GLU A O    6  
ATOM 7278  C CB   . GLU A 1 46 ? -5.323  10.791  -0.528  1.00 0.00 ? 46 GLU A CB   6  
ATOM 7279  C CG   . GLU A 1 46 ? -5.589  12.309  -0.411  1.00 0.00 ? 46 GLU A CG   6  
ATOM 7280  C CD   . GLU A 1 46 ? -5.818  12.699  1.055   1.00 0.00 ? 46 GLU A CD   6  
ATOM 7281  O OE1  . GLU A 1 46 ? -6.771  12.210  1.639   1.00 0.00 ? 46 GLU A OE1  6  
ATOM 7282  O OE2  . GLU A 1 46 ? -5.035  13.482  1.567   1.00 0.00 ? 46 GLU A OE2  6  
ATOM 7283  H H    . GLU A 1 46 ? -7.470  11.305  0.741   1.00 0.00 ? 46 GLU A H    6  
ATOM 7284  H HA   . GLU A 1 46 ? -6.940  10.176  -1.797  1.00 0.00 ? 46 GLU A HA   6  
ATOM 7285  H HB2  . GLU A 1 46 ? -4.870  10.424  0.382   1.00 0.00 ? 46 GLU A HB2  6  
ATOM 7286  H HB3  . GLU A 1 46 ? -4.657  10.608  -1.353  1.00 0.00 ? 46 GLU A HB3  6  
ATOM 7287  H HG2  . GLU A 1 46 ? -4.735  12.852  -0.790  1.00 0.00 ? 46 GLU A HG2  6  
ATOM 7288  H HG3  . GLU A 1 46 ? -6.462  12.577  -0.991  1.00 0.00 ? 46 GLU A HG3  6  
ATOM 7289  N N    . CYS A 1 47 ? -6.784  8.070   0.639   1.00 0.00 ? 47 CYS A N    6  
ATOM 7290  C CA   . CYS A 1 47 ? -6.615  6.619   0.902   1.00 0.00 ? 47 CYS A CA   6  
ATOM 7291  C C    . CYS A 1 47 ? -7.760  5.876   0.216   1.00 0.00 ? 47 CYS A C    6  
ATOM 7292  O O    . CYS A 1 47 ? -7.562  4.859   -0.416  1.00 0.00 ? 47 CYS A O    6  
ATOM 7293  C CB   . CYS A 1 47 ? -6.635  6.374   2.424   1.00 0.00 ? 47 CYS A CB   6  
ATOM 7294  S SG   . CYS A 1 47 ? -8.313  5.990   2.998   1.00 0.00 ? 47 CYS A SG   6  
ATOM 7295  H H    . CYS A 1 47 ? -7.172  8.657   1.323   1.00 0.00 ? 47 CYS A H    6  
ATOM 7296  H HA   . CYS A 1 47 ? -5.678  6.285   0.481   1.00 0.00 ? 47 CYS A HA   6  
ATOM 7297  H HB2  . CYS A 1 47 ? -5.982  5.550   2.665   1.00 0.00 ? 47 CYS A HB2  6  
ATOM 7298  H HB3  . CYS A 1 47 ? -6.288  7.266   2.931   1.00 0.00 ? 47 CYS A HB3  6  
ATOM 7299  N N    . GLN A 1 48 ? -8.951  6.378   0.334   1.00 0.00 ? 48 GLN A N    6  
ATOM 7300  C CA   . GLN A 1 48 ? -10.101 5.696   -0.314  1.00 0.00 ? 48 GLN A CA   6  
ATOM 7301  C C    . GLN A 1 48 ? -9.781  5.472   -1.788  1.00 0.00 ? 48 GLN A C    6  
ATOM 7302  O O    . GLN A 1 48 ? -10.070 4.432   -2.347  1.00 0.00 ? 48 GLN A O    6  
ATOM 7303  C CB   . GLN A 1 48 ? -11.355 6.564   -0.196  1.00 0.00 ? 48 GLN A CB   6  
ATOM 7304  C CG   . GLN A 1 48 ? -11.812 6.609   1.260   1.00 0.00 ? 48 GLN A CG   6  
ATOM 7305  C CD   . GLN A 1 48 ? -13.046 7.505   1.381   1.00 0.00 ? 48 GLN A CD   6  
ATOM 7306  O OE1  . GLN A 1 48 ? -14.050 7.105   1.936   1.00 0.00 ? 48 GLN A OE1  6  
ATOM 7307  N NE2  . GLN A 1 48 ? -13.012 8.711   0.882   1.00 0.00 ? 48 GLN A NE2  6  
ATOM 7308  H H    . GLN A 1 48 ? -9.089  7.197   0.856   1.00 0.00 ? 48 GLN A H    6  
ATOM 7309  H HA   . GLN A 1 48 ? -10.269 4.740   0.165   1.00 0.00 ? 48 GLN A HA   6  
ATOM 7310  H HB2  . GLN A 1 48 ? -11.133 7.565   -0.536  1.00 0.00 ? 48 GLN A HB2  6  
ATOM 7311  H HB3  . GLN A 1 48 ? -12.142 6.144   -0.805  1.00 0.00 ? 48 GLN A HB3  6  
ATOM 7312  H HG2  . GLN A 1 48 ? -12.057 5.610   1.589   1.00 0.00 ? 48 GLN A HG2  6  
ATOM 7313  H HG3  . GLN A 1 48 ? -11.019 7.007   1.873   1.00 0.00 ? 48 GLN A HG3  6  
ATOM 7314  H HE21 . GLN A 1 48 ? -12.202 9.034   0.435   1.00 0.00 ? 48 GLN A HE21 6  
ATOM 7315  H HE22 . GLN A 1 48 ? -13.797 9.293   0.955   1.00 0.00 ? 48 GLN A HE22 6  
ATOM 7316  N N    . GLU A 1 49 ? -9.202  6.451   -2.428  1.00 0.00 ? 49 GLU A N    6  
ATOM 7317  C CA   . GLU A 1 49 ? -8.881  6.307   -3.869  1.00 0.00 ? 49 GLU A CA   6  
ATOM 7318  C C    . GLU A 1 49 ? -7.768  5.274   -4.074  1.00 0.00 ? 49 GLU A C    6  
ATOM 7319  O O    . GLU A 1 49 ? -7.813  4.475   -4.987  1.00 0.00 ? 49 GLU A O    6  
ATOM 7320  C CB   . GLU A 1 49 ? -8.434  7.663   -4.427  1.00 0.00 ? 49 GLU A CB   6  
ATOM 7321  C CG   . GLU A 1 49 ? -9.654  8.570   -4.614  1.00 0.00 ? 49 GLU A CG   6  
ATOM 7322  C CD   . GLU A 1 49 ? -10.365 8.756   -3.273  1.00 0.00 ? 49 GLU A CD   6  
ATOM 7323  O OE1  . GLU A 1 49 ? -11.112 7.870   -2.892  1.00 0.00 ? 49 GLU A OE1  6  
ATOM 7324  O OE2  . GLU A 1 49 ? -10.150 9.782   -2.648  1.00 0.00 ? 49 GLU A OE2  6  
ATOM 7325  H H    . GLU A 1 49 ? -8.989  7.290   -1.971  1.00 0.00 ? 49 GLU A H    6  
ATOM 7326  H HA   . GLU A 1 49 ? -9.768  5.983   -4.393  1.00 0.00 ? 49 GLU A HA   6  
ATOM 7327  H HB2  . GLU A 1 49 ? -7.745  8.126   -3.736  1.00 0.00 ? 49 GLU A HB2  6  
ATOM 7328  H HB3  . GLU A 1 49 ? -7.947  7.520   -5.380  1.00 0.00 ? 49 GLU A HB3  6  
ATOM 7329  H HG2  . GLU A 1 49 ? -9.333  9.531   -4.989  1.00 0.00 ? 49 GLU A HG2  6  
ATOM 7330  H HG3  . GLU A 1 49 ? -10.334 8.118   -5.320  1.00 0.00 ? 49 GLU A HG3  6  
ATOM 7331  N N    . VAL A 1 50 ? -6.769  5.275   -3.224  1.00 0.00 ? 50 VAL A N    6  
ATOM 7332  C CA   . VAL A 1 50 ? -5.674  4.277   -3.382  1.00 0.00 ? 50 VAL A CA   6  
ATOM 7333  C C    . VAL A 1 50 ? -6.215  2.894   -3.046  1.00 0.00 ? 50 VAL A C    6  
ATOM 7334  O O    . VAL A 1 50 ? -6.065  1.956   -3.802  1.00 0.00 ? 50 VAL A O    6  
ATOM 7335  C CB   . VAL A 1 50 ? -4.498  4.579   -2.438  1.00 0.00 ? 50 VAL A CB   6  
ATOM 7336  C CG1  . VAL A 1 50 ? -3.354  3.602   -2.732  1.00 0.00 ? 50 VAL A CG1  6  
ATOM 7337  C CG2  . VAL A 1 50 ? -4.006  6.028   -2.640  1.00 0.00 ? 50 VAL A CG2  6  
ATOM 7338  H H    . VAL A 1 50 ? -6.747  5.915   -2.489  1.00 0.00 ? 50 VAL A H    6  
ATOM 7339  H HA   . VAL A 1 50 ? -5.325  4.308   -4.394  1.00 0.00 ? 50 VAL A HA   6  
ATOM 7340  H HB   . VAL A 1 50 ? -4.813  4.432   -1.418  1.00 0.00 ? 50 VAL A HB   6  
ATOM 7341  H HG11 . VAL A 1 50 ? -3.069  3.685   -3.770  1.00 0.00 ? 50 VAL A HG11 6  
ATOM 7342  H HG12 . VAL A 1 50 ? -3.678  2.594   -2.525  1.00 0.00 ? 50 VAL A HG12 6  
ATOM 7343  H HG13 . VAL A 1 50 ? -2.508  3.842   -2.106  1.00 0.00 ? 50 VAL A HG13 6  
ATOM 7344  H HG21 . VAL A 1 50 ? -3.221  6.050   -3.384  1.00 0.00 ? 50 VAL A HG21 6  
ATOM 7345  H HG22 . VAL A 1 50 ? -3.621  6.412   -1.707  1.00 0.00 ? 50 VAL A HG22 6  
ATOM 7346  H HG23 . VAL A 1 50 ? -4.821  6.651   -2.970  1.00 0.00 ? 50 VAL A HG23 6  
ATOM 7347  N N    . VAL A 1 51 ? -6.813  2.747   -1.891  1.00 0.00 ? 51 VAL A N    6  
ATOM 7348  C CA   . VAL A 1 51 ? -7.318  1.411   -1.488  1.00 0.00 ? 51 VAL A CA   6  
ATOM 7349  C C    . VAL A 1 51 ? -8.349  0.908   -2.509  1.00 0.00 ? 51 VAL A C    6  
ATOM 7350  O O    . VAL A 1 51 ? -8.257  -0.188  -3.019  1.00 0.00 ? 51 VAL A O    6  
ATOM 7351  C CB   . VAL A 1 51 ? -7.883  1.489   -0.063  1.00 0.00 ? 51 VAL A CB   6  
ATOM 7352  C CG1  . VAL A 1 51 ? -8.290  0.105   0.418   1.00 0.00 ? 51 VAL A CG1  6  
ATOM 7353  C CG2  . VAL A 1 51 ? -6.814  2.055   0.881   1.00 0.00 ? 51 VAL A CG2  6  
ATOM 7354  H H    . VAL A 1 51 ? -6.896  3.496   -1.265  1.00 0.00 ? 51 VAL A H    6  
ATOM 7355  H HA   . VAL A 1 51 ? -6.487  0.728   -1.539  1.00 0.00 ? 51 VAL A HA   6  
ATOM 7356  H HB   . VAL A 1 51 ? -8.743  2.139   -0.055  1.00 0.00 ? 51 VAL A HB   6  
ATOM 7357  H HG11 . VAL A 1 51 ? -9.135  -0.238  -0.158  1.00 0.00 ? 51 VAL A HG11 6  
ATOM 7358  H HG12 . VAL A 1 51 ? -8.561  0.155   1.462   1.00 0.00 ? 51 VAL A HG12 6  
ATOM 7359  H HG13 . VAL A 1 51 ? -7.462  -0.575  0.292   1.00 0.00 ? 51 VAL A HG13 6  
ATOM 7360  H HG21 . VAL A 1 51 ? -7.241  2.210   1.863   1.00 0.00 ? 51 VAL A HG21 6  
ATOM 7361  H HG22 . VAL A 1 51 ? -6.454  2.996   0.494   1.00 0.00 ? 51 VAL A HG22 6  
ATOM 7362  H HG23 . VAL A 1 51 ? -5.995  1.358   0.952   1.00 0.00 ? 51 VAL A HG23 6  
ATOM 7363  N N    . ASP A 1 52 ? -9.366  1.694   -2.752  1.00 0.00 ? 52 ASP A N    6  
ATOM 7364  C CA   . ASP A 1 52 ? -10.463 1.272   -3.675  1.00 0.00 ? 52 ASP A CA   6  
ATOM 7365  C C    . ASP A 1 52 ? -9.963  1.043   -5.102  1.00 0.00 ? 52 ASP A C    6  
ATOM 7366  O O    . ASP A 1 52 ? -10.368 0.112   -5.768  1.00 0.00 ? 52 ASP A O    6  
ATOM 7367  C CB   . ASP A 1 52 ? -11.539 2.362   -3.692  1.00 0.00 ? 52 ASP A CB   6  
ATOM 7368  C CG   . ASP A 1 52 ? -12.013 2.631   -2.263  1.00 0.00 ? 52 ASP A CG   6  
ATOM 7369  O OD1  . ASP A 1 52 ? -11.188 2.576   -1.366  1.00 0.00 ? 52 ASP A OD1  6  
ATOM 7370  O OD2  . ASP A 1 52 ? -13.193 2.889   -2.089  1.00 0.00 ? 52 ASP A OD2  6  
ATOM 7371  H H    . ASP A 1 52 ? -9.431  2.561   -2.300  1.00 0.00 ? 52 ASP A H    6  
ATOM 7372  H HA   . ASP A 1 52 ? -10.908 0.365   -3.297  1.00 0.00 ? 52 ASP A HA   6  
ATOM 7373  H HB2  . ASP A 1 52 ? -11.132 3.269   -4.113  1.00 0.00 ? 52 ASP A HB2  6  
ATOM 7374  H HB3  . ASP A 1 52 ? -12.376 2.032   -4.289  1.00 0.00 ? 52 ASP A HB3  6  
ATOM 7375  N N    . THR A 1 53 ? -9.107  1.897   -5.587  1.00 0.00 ? 53 THR A N    6  
ATOM 7376  C CA   . THR A 1 53 ? -8.605  1.744   -6.980  1.00 0.00 ? 53 THR A CA   6  
ATOM 7377  C C    . THR A 1 53 ? -7.402  0.809   -7.024  1.00 0.00 ? 53 THR A C    6  
ATOM 7378  O O    . THR A 1 53 ? -7.266  0.029   -7.945  1.00 0.00 ? 53 THR A O    6  
ATOM 7379  C CB   . THR A 1 53 ? -8.201  3.116   -7.524  1.00 0.00 ? 53 THR A CB   6  
ATOM 7380  O OG1  . THR A 1 53 ? -9.239  4.050   -7.261  1.00 0.00 ? 53 THR A OG1  6  
ATOM 7381  C CG2  . THR A 1 53 ? -7.968  3.021   -9.032  1.00 0.00 ? 53 THR A CG2  6  
ATOM 7382  H H    . THR A 1 53 ? -8.802  2.652   -5.043  1.00 0.00 ? 53 THR A H    6  
ATOM 7383  H HA   . THR A 1 53 ? -9.371  1.331   -7.613  1.00 0.00 ? 53 THR A HA   6  
ATOM 7384  H HB   . THR A 1 53 ? -7.295  3.441   -7.043  1.00 0.00 ? 53 THR A HB   6  
ATOM 7385  H HG1  . THR A 1 53 ? -9.088  4.823   -7.810  1.00 0.00 ? 53 THR A HG1  6  
ATOM 7386  H HG21 . THR A 1 53 ? -8.898  2.782   -9.527  1.00 0.00 ? 53 THR A HG21 6  
ATOM 7387  H HG22 . THR A 1 53 ? -7.242  2.247   -9.236  1.00 0.00 ? 53 THR A HG22 6  
ATOM 7388  H HG23 . THR A 1 53 ? -7.597  3.967   -9.400  1.00 0.00 ? 53 THR A HG23 6  
ATOM 7389  N N    . TYR A 1 54 ? -6.511  0.891   -6.066  1.00 0.00 ? 54 TYR A N    6  
ATOM 7390  C CA   . TYR A 1 54 ? -5.297  0.012   -6.098  1.00 0.00 ? 54 TYR A CA   6  
ATOM 7391  C C    . TYR A 1 54 ? -5.317  -1.050  -4.992  1.00 0.00 ? 54 TYR A C    6  
ATOM 7392  O O    . TYR A 1 54 ? -4.296  -1.437  -4.467  1.00 0.00 ? 54 TYR A O    6  
ATOM 7393  C CB   . TYR A 1 54 ? -4.052  0.875   -5.950  1.00 0.00 ? 54 TYR A CB   6  
ATOM 7394  C CG   . TYR A 1 54 ? -3.890  1.740   -7.177  1.00 0.00 ? 54 TYR A CG   6  
ATOM 7395  C CD1  . TYR A 1 54 ? -4.489  3.000   -7.217  1.00 0.00 ? 54 TYR A CD1  6  
ATOM 7396  C CD2  . TYR A 1 54 ? -3.140  1.289   -8.269  1.00 0.00 ? 54 TYR A CD2  6  
ATOM 7397  C CE1  . TYR A 1 54 ? -4.345  3.815   -8.339  1.00 0.00 ? 54 TYR A CE1  6  
ATOM 7398  C CE2  . TYR A 1 54 ? -2.993  2.103   -9.400  1.00 0.00 ? 54 TYR A CE2  6  
ATOM 7399  C CZ   . TYR A 1 54 ? -3.596  3.369   -9.435  1.00 0.00 ? 54 TYR A CZ   6  
ATOM 7400  O OH   . TYR A 1 54 ? -3.452  4.172   -10.548 1.00 0.00 ? 54 TYR A OH   6  
ATOM 7401  H H    . TYR A 1 54 ? -6.626  1.542   -5.343  1.00 0.00 ? 54 TYR A H    6  
ATOM 7402  H HA   . TYR A 1 54 ? -5.240  -0.503  -7.047  1.00 0.00 ? 54 TYR A HA   6  
ATOM 7403  H HB2  . TYR A 1 54 ? -4.157  1.500   -5.081  1.00 0.00 ? 54 TYR A HB2  6  
ATOM 7404  H HB3  . TYR A 1 54 ? -3.186  0.242   -5.839  1.00 0.00 ? 54 TYR A HB3  6  
ATOM 7405  H HD1  . TYR A 1 54 ? -5.066  3.340   -6.383  1.00 0.00 ? 54 TYR A HD1  6  
ATOM 7406  H HD2  . TYR A 1 54 ? -2.677  0.315   -8.241  1.00 0.00 ? 54 TYR A HD2  6  
ATOM 7407  H HE1  . TYR A 1 54 ? -4.813  4.790   -8.359  1.00 0.00 ? 54 TYR A HE1  6  
ATOM 7408  H HE2  . TYR A 1 54 ? -2.415  1.758   -10.244 1.00 0.00 ? 54 TYR A HE2  6  
ATOM 7409  H HH   . TYR A 1 54 ? -4.004  3.813   -11.246 1.00 0.00 ? 54 TYR A HH   6  
ATOM 7410  N N    . GLY A 1 55 ? -6.485  -1.485  -4.603  1.00 0.00 ? 55 GLY A N    6  
ATOM 7411  C CA   . GLY A 1 55 ? -6.592  -2.477  -3.495  1.00 0.00 ? 55 GLY A CA   6  
ATOM 7412  C C    . GLY A 1 55 ? -6.331  -3.899  -3.983  1.00 0.00 ? 55 GLY A C    6  
ATOM 7413  O O    . GLY A 1 55 ? -5.503  -4.600  -3.437  1.00 0.00 ? 55 GLY A O    6  
ATOM 7414  H H    . GLY A 1 55 ? -7.297  -1.149  -5.033  1.00 0.00 ? 55 GLY A H    6  
ATOM 7415  H HA2  . GLY A 1 55 ? -5.868  -2.230  -2.733  1.00 0.00 ? 55 GLY A HA2  6  
ATOM 7416  H HA3  . GLY A 1 55 ? -7.583  -2.428  -3.069  1.00 0.00 ? 55 GLY A HA3  6  
ATOM 7417  N N    . SER A 1 56 ? -7.036  -4.356  -4.981  1.00 0.00 ? 56 SER A N    6  
ATOM 7418  C CA   . SER A 1 56 ? -6.808  -5.749  -5.437  1.00 0.00 ? 56 SER A CA   6  
ATOM 7419  C C    . SER A 1 56 ? -5.422  -5.869  -6.061  1.00 0.00 ? 56 SER A C    6  
ATOM 7420  O O    . SER A 1 56 ? -4.821  -6.924  -6.079  1.00 0.00 ? 56 SER A O    6  
ATOM 7421  C CB   . SER A 1 56 ? -7.874  -6.157  -6.457  1.00 0.00 ? 56 SER A CB   6  
ATOM 7422  O OG   . SER A 1 56 ? -9.034  -5.356  -6.271  1.00 0.00 ? 56 SER A OG   6  
ATOM 7423  H H    . SER A 1 56 ? -7.718  -3.801  -5.415  1.00 0.00 ? 56 SER A H    6  
ATOM 7424  H HA   . SER A 1 56 ? -6.870  -6.401  -4.578  1.00 0.00 ? 56 SER A HA   6  
ATOM 7425  H HB2  . SER A 1 56 ? -7.499  -6.015  -7.460  1.00 0.00 ? 56 SER A HB2  6  
ATOM 7426  H HB3  . SER A 1 56 ? -8.118  -7.203  -6.311  1.00 0.00 ? 56 SER A HB3  6  
ATOM 7427  H HG   . SER A 1 56 ? -8.928  -4.866  -5.453  1.00 0.00 ? 56 SER A HG   6  
ATOM 7428  N N    . SER A 1 57 ? -4.945  -4.799  -6.645  1.00 0.00 ? 57 SER A N    6  
ATOM 7429  C CA   . SER A 1 57 ? -3.638  -4.875  -7.349  1.00 0.00 ? 57 SER A CA   6  
ATOM 7430  C C    . SER A 1 57 ? -2.482  -4.905  -6.355  1.00 0.00 ? 57 SER A C    6  
ATOM 7431  O O    . SER A 1 57 ? -1.631  -5.764  -6.426  1.00 0.00 ? 57 SER A O    6  
ATOM 7432  C CB   . SER A 1 57 ? -3.482  -3.705  -8.320  1.00 0.00 ? 57 SER A CB   6  
ATOM 7433  O OG   . SER A 1 57 ? -3.338  -2.498  -7.582  1.00 0.00 ? 57 SER A OG   6  
ATOM 7434  H H    . SER A 1 57 ? -5.467  -3.970  -6.640  1.00 0.00 ? 57 SER A H    6  
ATOM 7435  H HA   . SER A 1 57 ? -3.622  -5.811  -7.888  1.00 0.00 ? 57 SER A HA   6  
ATOM 7436  H HB2  . SER A 1 57 ? -2.606  -3.854  -8.929  1.00 0.00 ? 57 SER A HB2  6  
ATOM 7437  H HB3  . SER A 1 57 ? -4.355  -3.648  -8.957  1.00 0.00 ? 57 SER A HB3  6  
ATOM 7438  H HG   . SER A 1 57 ? -3.836  -1.813  -8.033  1.00 0.00 ? 57 SER A HG   6  
ATOM 7439  N N    . ILE A 1 58 ? -2.464  -4.028  -5.388  1.00 0.00 ? 58 ILE A N    6  
ATOM 7440  C CA   . ILE A 1 58 ? -1.372  -4.083  -4.377  1.00 0.00 ? 58 ILE A CA   6  
ATOM 7441  C C    . ILE A 1 58 ? -1.339  -5.499  -3.808  1.00 0.00 ? 58 ILE A C    6  
ATOM 7442  O O    . ILE A 1 58 ? -0.306  -6.123  -3.670  1.00 0.00 ? 58 ILE A O    6  
ATOM 7443  C CB   . ILE A 1 58 ? -1.665  -3.085  -3.241  1.00 0.00 ? 58 ILE A CB   6  
ATOM 7444  C CG1  . ILE A 1 58 ? -1.432  -1.650  -3.751  1.00 0.00 ? 58 ILE A CG1  6  
ATOM 7445  C CG2  . ILE A 1 58 ? -0.726  -3.370  -2.056  1.00 0.00 ? 58 ILE A CG2  6  
ATOM 7446  C CD1  . ILE A 1 58 ? -1.886  -0.621  -2.701  1.00 0.00 ? 58 ILE A CD1  6  
ATOM 7447  H H    . ILE A 1 58 ? -3.184  -3.372  -5.288  1.00 0.00 ? 58 ILE A H    6  
ATOM 7448  H HA   . ILE A 1 58 ? -0.413  -3.848  -4.815  1.00 0.00 ? 58 ILE A HA   6  
ATOM 7449  H HB   . ILE A 1 58 ? -2.692  -3.196  -2.922  1.00 0.00 ? 58 ILE A HB   6  
ATOM 7450  H HG12 . ILE A 1 58 ? -0.381  -1.512  -3.950  1.00 0.00 ? 58 ILE A HG12 6  
ATOM 7451  H HG13 . ILE A 1 58 ? -1.987  -1.500  -4.663  1.00 0.00 ? 58 ILE A HG13 6  
ATOM 7452  H HG21 . ILE A 1 58 ? -1.069  -4.253  -1.534  1.00 0.00 ? 58 ILE A HG21 6  
ATOM 7453  H HG22 . ILE A 1 58 ? -0.721  -2.530  -1.375  1.00 0.00 ? 58 ILE A HG22 6  
ATOM 7454  H HG23 . ILE A 1 58 ? 0.274   -3.541  -2.425  1.00 0.00 ? 58 ILE A HG23 6  
ATOM 7455  H HD11 . ILE A 1 58 ? -2.136  0.315   -3.189  1.00 0.00 ? 58 ILE A HD11 6  
ATOM 7456  H HD12 . ILE A 1 58 ? -1.083  -0.455  -1.999  1.00 0.00 ? 58 ILE A HD12 6  
ATOM 7457  H HD13 . ILE A 1 58 ? -2.754  -0.989  -2.173  1.00 0.00 ? 58 ILE A HD13 6  
ATOM 7458  N N    . LEU A 1 59 ? -2.497  -5.982  -3.473  1.00 0.00 ? 59 LEU A N    6  
ATOM 7459  C CA   . LEU A 1 59 ? -2.639  -7.343  -2.895  1.00 0.00 ? 59 LEU A CA   6  
ATOM 7460  C C    . LEU A 1 59 ? -2.166  -8.403  -3.891  1.00 0.00 ? 59 LEU A C    6  
ATOM 7461  O O    . LEU A 1 59 ? -1.795  -9.485  -3.490  1.00 0.00 ? 59 LEU A O    6  
ATOM 7462  C CB   . LEU A 1 59 ? -4.137  -7.581  -2.572  1.00 0.00 ? 59 LEU A CB   6  
ATOM 7463  C CG   . LEU A 1 59 ? -4.421  -7.604  -1.068  1.00 0.00 ? 59 LEU A CG   6  
ATOM 7464  C CD1  . LEU A 1 59 ? -3.688  -8.778  -0.395  1.00 0.00 ? 59 LEU A CD1  6  
ATOM 7465  C CD2  . LEU A 1 59 ? -4.002  -6.276  -0.429  1.00 0.00 ? 59 LEU A CD2  6  
ATOM 7466  H H    . LEU A 1 59 ? -3.298  -5.432  -3.601  1.00 0.00 ? 59 LEU A H    6  
ATOM 7467  H HA   . LEU A 1 59 ? -2.024  -7.446  -2.023  1.00 0.00 ? 59 LEU A HA   6  
ATOM 7468  H HB2  . LEU A 1 59 ? -4.712  -6.784  -3.011  1.00 0.00 ? 59 LEU A HB2  6  
ATOM 7469  H HB3  . LEU A 1 59 ? -4.466  -8.520  -3.000  1.00 0.00 ? 59 LEU A HB3  6  
ATOM 7470  H HG   . LEU A 1 59 ? -5.489  -7.736  -0.936  1.00 0.00 ? 59 LEU A HG   6  
ATOM 7471  H HD11 . LEU A 1 59 ? -3.592  -9.599  -1.092  1.00 0.00 ? 59 LEU A HD11 6  
ATOM 7472  H HD12 . LEU A 1 59 ? -4.257  -9.106  0.461   1.00 0.00 ? 59 LEU A HD12 6  
ATOM 7473  H HD13 . LEU A 1 59 ? -2.707  -8.465  -0.070  1.00 0.00 ? 59 LEU A HD13 6  
ATOM 7474  H HD21 . LEU A 1 59 ? -4.498  -6.172  0.522   1.00 0.00 ? 59 LEU A HD21 6  
ATOM 7475  H HD22 . LEU A 1 59 ? -4.285  -5.457  -1.075  1.00 0.00 ? 59 LEU A HD22 6  
ATOM 7476  H HD23 . LEU A 1 59 ? -2.933  -6.263  -0.278  1.00 0.00 ? 59 LEU A HD23 6  
ATOM 7477  N N    . SER A 1 60 ? -2.216  -8.158  -5.175  1.00 0.00 ? 60 SER A N    6  
ATOM 7478  C CA   . SER A 1 60 ? -1.808  -9.247  -6.116  1.00 0.00 ? 60 SER A CA   6  
ATOM 7479  C C    . SER A 1 60 ? -0.288  -9.277  -6.274  1.00 0.00 ? 60 SER A C    6  
ATOM 7480  O O    . SER A 1 60 ? 0.318   -10.316 -6.454  1.00 0.00 ? 60 SER A O    6  
ATOM 7481  C CB   . SER A 1 60 ? -2.463  -8.996  -7.466  1.00 0.00 ? 60 SER A CB   6  
ATOM 7482  O OG   . SER A 1 60 ? -1.830  -9.794  -8.457  1.00 0.00 ? 60 SER A OG   6  
ATOM 7483  H H    . SER A 1 60 ? -2.552  -7.303  -5.513  1.00 0.00 ? 60 SER A H    6  
ATOM 7484  H HA   . SER A 1 60 ? -2.201  -10.145 -5.674  1.00 0.00 ? 60 SER A HA   6  
ATOM 7485  H HB2  . SER A 1 60 ? -3.507  -9.253  -7.410  1.00 0.00 ? 60 SER A HB2  6  
ATOM 7486  H HB3  . SER A 1 60 ? -2.364  -7.945  -7.712  1.00 0.00 ? 60 SER A HB3  6  
ATOM 7487  H HG   . SER A 1 60 ? -0.883  -9.659  -8.387  1.00 0.00 ? 60 SER A HG   6  
ATOM 7488  N N    . ILE A 1 61 ? 0.322   -8.125  -6.228  1.00 0.00 ? 61 ILE A N    6  
ATOM 7489  C CA   . ILE A 1 61 ? 1.799   -8.032  -6.393  1.00 0.00 ? 61 ILE A CA   6  
ATOM 7490  C C    . ILE A 1 61 ? 2.532   -8.574  -5.163  1.00 0.00 ? 61 ILE A C    6  
ATOM 7491  O O    . ILE A 1 61 ? 3.484   -9.321  -5.270  1.00 0.00 ? 61 ILE A O    6  
ATOM 7492  C CB   . ILE A 1 61 ? 2.172   -6.559  -6.611  1.00 0.00 ? 61 ILE A CB   6  
ATOM 7493  C CG1  . ILE A 1 61 ? 1.261   -5.970  -7.733  1.00 0.00 ? 61 ILE A CG1  6  
ATOM 7494  C CG2  . ILE A 1 61 ? 3.666   -6.458  -6.968  1.00 0.00 ? 61 ILE A CG2  6  
ATOM 7495  C CD1  . ILE A 1 61 ? 2.027   -5.010  -8.655  1.00 0.00 ? 61 ILE A CD1  6  
ATOM 7496  H H    . ILE A 1 61 ? -0.202  -7.306  -6.109  1.00 0.00 ? 61 ILE A H    6  
ATOM 7497  H HA   . ILE A 1 61 ? 2.096   -8.603  -7.262  1.00 0.00 ? 61 ILE A HA   6  
ATOM 7498  H HB   . ILE A 1 61 ? 2.003   -6.019  -5.689  1.00 0.00 ? 61 ILE A HB   6  
ATOM 7499  H HG12 . ILE A 1 61 ? 0.841   -6.773  -8.329  1.00 0.00 ? 61 ILE A HG12 6  
ATOM 7500  H HG13 . ILE A 1 61 ? 0.452   -5.426  -7.274  1.00 0.00 ? 61 ILE A HG13 6  
ATOM 7501  H HG21 . ILE A 1 61 ? 3.962   -5.419  -6.992  1.00 0.00 ? 61 ILE A HG21 6  
ATOM 7502  H HG22 . ILE A 1 61 ? 3.839   -6.903  -7.936  1.00 0.00 ? 61 ILE A HG22 6  
ATOM 7503  H HG23 . ILE A 1 61 ? 4.252   -6.975  -6.226  1.00 0.00 ? 61 ILE A HG23 6  
ATOM 7504  H HD11 . ILE A 1 61 ? 2.508   -4.249  -8.058  1.00 0.00 ? 61 ILE A HD11 6  
ATOM 7505  H HD12 . ILE A 1 61 ? 1.333   -4.545  -9.339  1.00 0.00 ? 61 ILE A HD12 6  
ATOM 7506  H HD13 . ILE A 1 61 ? 2.769   -5.556  -9.216  1.00 0.00 ? 61 ILE A HD13 6  
ATOM 7507  N N    . LEU A 1 62 ? 2.106   -8.172  -3.995  1.00 0.00 ? 62 LEU A N    6  
ATOM 7508  C CA   . LEU A 1 62 ? 2.780   -8.622  -2.750  1.00 0.00 ? 62 LEU A CA   6  
ATOM 7509  C C    . LEU A 1 62 ? 2.793   -10.155 -2.708  1.00 0.00 ? 62 LEU A C    6  
ATOM 7510  O O    . LEU A 1 62 ? 3.750   -10.769 -2.282  1.00 0.00 ? 62 LEU A O    6  
ATOM 7511  C CB   . LEU A 1 62 ? 2.012   -8.036  -1.543  1.00 0.00 ? 62 LEU A CB   6  
ATOM 7512  C CG   . LEU A 1 62 ? 2.888   -7.026  -0.782  1.00 0.00 ? 62 LEU A CG   6  
ATOM 7513  C CD1  . LEU A 1 62 ? 2.004   -6.136  0.099   1.00 0.00 ? 62 LEU A CD1  6  
ATOM 7514  C CD2  . LEU A 1 62 ? 3.902   -7.791  0.080   1.00 0.00 ? 62 LEU A CD2  6  
ATOM 7515  H H    . LEU A 1 62 ? 1.347   -7.554  -3.934  1.00 0.00 ? 62 LEU A H    6  
ATOM 7516  H HA   . LEU A 1 62 ? 3.795   -8.254  -2.769  1.00 0.00 ? 62 LEU A HA   6  
ATOM 7517  H HB2  . LEU A 1 62 ? 1.127   -7.530  -1.905  1.00 0.00 ? 62 LEU A HB2  6  
ATOM 7518  H HB3  . LEU A 1 62 ? 1.710   -8.827  -0.870  1.00 0.00 ? 62 LEU A HB3  6  
ATOM 7519  H HG   . LEU A 1 62 ? 3.415   -6.401  -1.489  1.00 0.00 ? 62 LEU A HG   6  
ATOM 7520  H HD11 . LEU A 1 62 ? 1.205   -6.724  0.518   1.00 0.00 ? 62 LEU A HD11 6  
ATOM 7521  H HD12 . LEU A 1 62 ? 1.585   -5.343  -0.502  1.00 0.00 ? 62 LEU A HD12 6  
ATOM 7522  H HD13 . LEU A 1 62 ? 2.593   -5.709  0.893   1.00 0.00 ? 62 LEU A HD13 6  
ATOM 7523  H HD21 . LEU A 1 62 ? 4.402   -7.104  0.739   1.00 0.00 ? 62 LEU A HD21 6  
ATOM 7524  H HD22 . LEU A 1 62 ? 4.630   -8.268  -0.559  1.00 0.00 ? 62 LEU A HD22 6  
ATOM 7525  H HD23 . LEU A 1 62 ? 3.394   -8.540  0.665   1.00 0.00 ? 62 LEU A HD23 6  
ATOM 7526  N N    . LEU A 1 63 ? 1.736   -10.773 -3.152  1.00 0.00 ? 63 LEU A N    6  
ATOM 7527  C CA   . LEU A 1 63 ? 1.681   -12.258 -3.146  1.00 0.00 ? 63 LEU A CA   6  
ATOM 7528  C C    . LEU A 1 63 ? 2.628   -12.814 -4.203  1.00 0.00 ? 63 LEU A C    6  
ATOM 7529  O O    . LEU A 1 63 ? 2.978   -13.977 -4.188  1.00 0.00 ? 63 LEU A O    6  
ATOM 7530  C CB   . LEU A 1 63 ? 0.250   -12.723 -3.412  1.00 0.00 ? 63 LEU A CB   6  
ATOM 7531  C CG   . LEU A 1 63 ? -0.674  -12.174 -2.318  1.00 0.00 ? 63 LEU A CG   6  
ATOM 7532  C CD1  . LEU A 1 63 ? -2.117  -12.584 -2.625  1.00 0.00 ? 63 LEU A CD1  6  
ATOM 7533  C CD2  . LEU A 1 63 ? -0.252  -12.725 -0.943  1.00 0.00 ? 63 LEU A CD2  6  
ATOM 7534  H H    . LEU A 1 63 ? 0.975   -10.257 -3.495  1.00 0.00 ? 63 LEU A H    6  
ATOM 7535  H HA   . LEU A 1 63 ? 2.018   -12.643 -2.196  1.00 0.00 ? 63 LEU A HA   6  
ATOM 7536  H HB2  . LEU A 1 63 ? -0.075  -12.357 -4.376  1.00 0.00 ? 63 LEU A HB2  6  
ATOM 7537  H HB3  . LEU A 1 63 ? 0.213   -13.802 -3.403  1.00 0.00 ? 63 LEU A HB3  6  
ATOM 7538  H HG   . LEU A 1 63 ? -0.606  -11.097 -2.307  1.00 0.00 ? 63 LEU A HG   6  
ATOM 7539  H HD11 . LEU A 1 63 ? -2.432  -12.123 -3.550  1.00 0.00 ? 63 LEU A HD11 6  
ATOM 7540  H HD12 . LEU A 1 63 ? -2.762  -12.258 -1.821  1.00 0.00 ? 63 LEU A HD12 6  
ATOM 7541  H HD13 . LEU A 1 63 ? -2.173  -13.658 -2.719  1.00 0.00 ? 63 LEU A HD13 6  
ATOM 7542  H HD21 . LEU A 1 63 ? 0.526   -12.099 -0.531  1.00 0.00 ? 63 LEU A HD21 6  
ATOM 7543  H HD22 . LEU A 1 63 ? 0.118   -13.734 -1.050  1.00 0.00 ? 63 LEU A HD22 6  
ATOM 7544  H HD23 . LEU A 1 63 ? -1.100  -12.724 -0.273  1.00 0.00 ? 63 LEU A HD23 6  
ATOM 7545  N N    . GLU A 1 64 ? 3.048   -11.991 -5.125  1.00 0.00 ? 64 GLU A N    6  
ATOM 7546  C CA   . GLU A 1 64 ? 3.976   -12.472 -6.184  1.00 0.00 ? 64 GLU A CA   6  
ATOM 7547  C C    . GLU A 1 64 ? 5.407   -12.378 -5.643  1.00 0.00 ? 64 GLU A C    6  
ATOM 7548  O O    . GLU A 1 64 ? 6.365   -12.200 -6.369  1.00 0.00 ? 64 GLU A O    6  
ATOM 7549  C CB   . GLU A 1 64 ? 3.790   -11.622 -7.444  1.00 0.00 ? 64 GLU A CB   6  
ATOM 7550  C CG   . GLU A 1 64 ? 4.385   -12.341 -8.656  1.00 0.00 ? 64 GLU A CG   6  
ATOM 7551  C CD   . GLU A 1 64 ? 3.505   -13.538 -9.022  1.00 0.00 ? 64 GLU A CD   6  
ATOM 7552  O OE1  . GLU A 1 64 ? 2.498   -13.328 -9.679  1.00 0.00 ? 64 GLU A OE1  6  
ATOM 7553  O OE2  . GLU A 1 64 ? 3.853   -14.642 -8.641  1.00 0.00 ? 64 GLU A OE2  6  
ATOM 7554  H H    . GLU A 1 64 ? 2.758   -11.058 -5.119  1.00 0.00 ? 64 GLU A H    6  
ATOM 7555  H HA   . GLU A 1 64 ? 3.756   -13.509 -6.401  1.00 0.00 ? 64 GLU A HA   6  
ATOM 7556  H HB2  . GLU A 1 64 ? 2.734   -11.461 -7.609  1.00 0.00 ? 64 GLU A HB2  6  
ATOM 7557  H HB3  . GLU A 1 64 ? 4.276   -10.674 -7.313  1.00 0.00 ? 64 GLU A HB3  6  
ATOM 7558  H HG2  . GLU A 1 64 ? 4.428   -11.655 -9.492  1.00 0.00 ? 64 GLU A HG2  6  
ATOM 7559  H HG3  . GLU A 1 64 ? 5.379   -12.686 -8.423  1.00 0.00 ? 64 GLU A HG3  6  
ATOM 7560  N N    . GLU A 1 65 ? 5.536   -12.559 -4.357  1.00 0.00 ? 65 GLU A N    6  
ATOM 7561  C CA   . GLU A 1 65 ? 6.880   -12.559 -3.714  1.00 0.00 ? 65 GLU A CA   6  
ATOM 7562  C C    . GLU A 1 65 ? 7.735   -11.364 -4.148  1.00 0.00 ? 65 GLU A C    6  
ATOM 7563  O O    . GLU A 1 65 ? 8.947   -11.444 -4.203  1.00 0.00 ? 65 GLU A O    6  
ATOM 7564  C CB   . GLU A 1 65 ? 7.603   -13.830 -4.157  1.00 0.00 ? 65 GLU A CB   6  
ATOM 7565  C CG   . GLU A 1 65 ? 6.877   -15.055 -3.599  1.00 0.00 ? 65 GLU A CG   6  
ATOM 7566  C CD   . GLU A 1 65 ? 7.120   -15.152 -2.092  1.00 0.00 ? 65 GLU A CD   6  
ATOM 7567  O OE1  . GLU A 1 65 ? 8.219   -15.523 -1.712  1.00 0.00 ? 65 GLU A OE1  6  
ATOM 7568  O OE2  . GLU A 1 65 ? 6.205   -14.852 -1.344  1.00 0.00 ? 65 GLU A OE2  6  
ATOM 7569  H H    . GLU A 1 65 ? 4.734   -12.748 -3.831  1.00 0.00 ? 65 GLU A H    6  
ATOM 7570  H HA   . GLU A 1 65 ? 6.787   -12.594 -2.639  1.00 0.00 ? 65 GLU A HA   6  
ATOM 7571  H HB2  . GLU A 1 65 ? 7.613   -13.878 -5.237  1.00 0.00 ? 65 GLU A HB2  6  
ATOM 7572  H HB3  . GLU A 1 65 ? 8.618   -13.816 -3.789  1.00 0.00 ? 65 GLU A HB3  6  
ATOM 7573  H HG2  . GLU A 1 65 ? 5.818   -14.962 -3.789  1.00 0.00 ? 65 GLU A HG2  6  
ATOM 7574  H HG3  . GLU A 1 65 ? 7.252   -15.946 -4.079  1.00 0.00 ? 65 GLU A HG3  6  
ATOM 7575  N N    . VAL A 1 66 ? 7.116   -10.248 -4.428  1.00 0.00 ? 66 VAL A N    6  
ATOM 7576  C CA   . VAL A 1 66 ? 7.890   -9.028  -4.826  1.00 0.00 ? 66 VAL A CA   6  
ATOM 7577  C C    . VAL A 1 66 ? 8.171   -8.199  -3.558  1.00 0.00 ? 66 VAL A C    6  
ATOM 7578  O O    . VAL A 1 66 ? 7.360   -8.143  -2.654  1.00 0.00 ? 66 VAL A O    6  
ATOM 7579  C CB   . VAL A 1 66 ? 7.046   -8.218  -5.839  1.00 0.00 ? 66 VAL A CB   6  
ATOM 7580  C CG1  . VAL A 1 66 ? 7.360   -6.718  -5.748  1.00 0.00 ? 66 VAL A CG1  6  
ATOM 7581  C CG2  . VAL A 1 66 ? 7.353   -8.704  -7.263  1.00 0.00 ? 66 VAL A CG2  6  
ATOM 7582  H H    . VAL A 1 66 ? 6.134   -10.201 -4.368  1.00 0.00 ? 66 VAL A H    6  
ATOM 7583  H HA   . VAL A 1 66 ? 8.823   -9.318  -5.295  1.00 0.00 ? 66 VAL A HA   6  
ATOM 7584  H HB   . VAL A 1 66 ? 6.000   -8.374  -5.628  1.00 0.00 ? 66 VAL A HB   6  
ATOM 7585  H HG11 . VAL A 1 66 ? 6.877   -6.302  -4.876  1.00 0.00 ? 66 VAL A HG11 6  
ATOM 7586  H HG12 . VAL A 1 66 ? 6.996   -6.215  -6.634  1.00 0.00 ? 66 VAL A HG12 6  
ATOM 7587  H HG13 . VAL A 1 66 ? 8.428   -6.580  -5.669  1.00 0.00 ? 66 VAL A HG13 6  
ATOM 7588  H HG21 . VAL A 1 66 ? 8.313   -8.317  -7.574  1.00 0.00 ? 66 VAL A HG21 6  
ATOM 7589  H HG22 . VAL A 1 66 ? 6.590   -8.353  -7.939  1.00 0.00 ? 66 VAL A HG22 6  
ATOM 7590  H HG23 . VAL A 1 66 ? 7.383   -9.783  -7.275  1.00 0.00 ? 66 VAL A HG23 6  
ATOM 7591  N N    . SER A 1 67 ? 9.312   -7.562  -3.482  1.00 0.00 ? 67 SER A N    6  
ATOM 7592  C CA   . SER A 1 67 ? 9.634   -6.749  -2.268  1.00 0.00 ? 67 SER A CA   6  
ATOM 7593  C C    . SER A 1 67 ? 8.476   -5.754  -2.000  1.00 0.00 ? 67 SER A C    6  
ATOM 7594  O O    . SER A 1 67 ? 7.788   -5.374  -2.925  1.00 0.00 ? 67 SER A O    6  
ATOM 7595  C CB   . SER A 1 67 ? 10.957  -5.998  -2.499  1.00 0.00 ? 67 SER A CB   6  
ATOM 7596  O OG   . SER A 1 67 ? 11.747  -6.062  -1.319  1.00 0.00 ? 67 SER A OG   6  
ATOM 7597  H H    . SER A 1 67 ? 9.957   -7.620  -4.218  1.00 0.00 ? 67 SER A H    6  
ATOM 7598  H HA   . SER A 1 67 ? 9.745   -7.420  -1.438  1.00 0.00 ? 67 SER A HA   6  
ATOM 7599  H HB2  . SER A 1 67 ? 11.497  -6.466  -3.303  1.00 0.00 ? 67 SER A HB2  6  
ATOM 7600  H HB3  . SER A 1 67 ? 10.761  -4.963  -2.758  1.00 0.00 ? 67 SER A HB3  6  
ATOM 7601  H HG   . SER A 1 67 ? 12.419  -6.734  -1.449  1.00 0.00 ? 67 SER A HG   6  
ATOM 7602  N N    . PRO A 1 68 ? 8.274   -5.366  -0.752  1.00 0.00 ? 68 PRO A N    6  
ATOM 7603  C CA   . PRO A 1 68 ? 7.178   -4.432  -0.403  1.00 0.00 ? 68 PRO A CA   6  
ATOM 7604  C C    . PRO A 1 68 ? 7.402   -3.017  -0.978  1.00 0.00 ? 68 PRO A C    6  
ATOM 7605  O O    . PRO A 1 68 ? 6.471   -2.373  -1.408  1.00 0.00 ? 68 PRO A O    6  
ATOM 7606  C CB   . PRO A 1 68 ? 7.189   -4.379  1.145   1.00 0.00 ? 68 PRO A CB   6  
ATOM 7607  C CG   . PRO A 1 68 ? 8.492   -5.074  1.622   1.00 0.00 ? 68 PRO A CG   6  
ATOM 7608  C CD   . PRO A 1 68 ? 9.086   -5.816  0.407   1.00 0.00 ? 68 PRO A CD   6  
ATOM 7609  H HA   . PRO A 1 68 ? 6.233   -4.830  -0.753  1.00 0.00 ? 68 PRO A HA   6  
ATOM 7610  H HB2  . PRO A 1 68 ? 7.165   -3.352  1.495   1.00 0.00 ? 68 PRO A HB2  6  
ATOM 7611  H HB3  . PRO A 1 68 ? 6.338   -4.907  1.539   1.00 0.00 ? 68 PRO A HB3  6  
ATOM 7612  H HG2  . PRO A 1 68 ? 9.192   -4.332  1.986   1.00 0.00 ? 68 PRO A HG2  6  
ATOM 7613  H HG3  . PRO A 1 68 ? 8.268   -5.781  2.411   1.00 0.00 ? 68 PRO A HG3  6  
ATOM 7614  H HD2  . PRO A 1 68 ? 10.125  -5.550  0.271   1.00 0.00 ? 68 PRO A HD2  6  
ATOM 7615  H HD3  . PRO A 1 68 ? 8.980   -6.881  0.544   1.00 0.00 ? 68 PRO A HD3  6  
ATOM 7616  N N    . GLU A 1 69 ? 8.603   -2.503  -0.946  1.00 0.00 ? 69 GLU A N    6  
ATOM 7617  C CA   . GLU A 1 69 ? 8.818   -1.108  -1.452  1.00 0.00 ? 69 GLU A CA   6  
ATOM 7618  C C    . GLU A 1 69 ? 8.822   -1.082  -2.988  1.00 0.00 ? 69 GLU A C    6  
ATOM 7619  O O    . GLU A 1 69 ? 8.655   -0.037  -3.605  1.00 0.00 ? 69 GLU A O    6  
ATOM 7620  C CB   . GLU A 1 69 ? 10.146  -0.543  -0.891  1.00 0.00 ? 69 GLU A CB   6  
ATOM 7621  C CG   . GLU A 1 69 ? 11.092  -1.684  -0.497  1.00 0.00 ? 69 GLU A CG   6  
ATOM 7622  C CD   . GLU A 1 69 ? 12.446  -1.103  -0.091  1.00 0.00 ? 69 GLU A CD   6  
ATOM 7623  O OE1  . GLU A 1 69 ? 12.931  -0.233  -0.796  1.00 0.00 ? 69 GLU A OE1  6  
ATOM 7624  O OE2  . GLU A 1 69 ? 12.977  -1.537  0.918   1.00 0.00 ? 69 GLU A OE2  6  
ATOM 7625  H H    . GLU A 1 69 ? 9.349   -3.011  -0.566  1.00 0.00 ? 69 GLU A H    6  
ATOM 7626  H HA   . GLU A 1 69 ? 8.001   -0.489  -1.105  1.00 0.00 ? 69 GLU A HA   6  
ATOM 7627  H HB2  . GLU A 1 69 ? 10.628  0.076   -1.635  1.00 0.00 ? 69 GLU A HB2  6  
ATOM 7628  H HB3  . GLU A 1 69 ? 9.937   0.056   -0.015  1.00 0.00 ? 69 GLU A HB3  6  
ATOM 7629  H HG2  . GLU A 1 69 ? 10.672  -2.228  0.336   1.00 0.00 ? 69 GLU A HG2  6  
ATOM 7630  H HG3  . GLU A 1 69 ? 11.227  -2.351  -1.333  1.00 0.00 ? 69 GLU A HG3  6  
ATOM 7631  N N    . LEU A 1 70 ? 8.973   -2.208  -3.624  1.00 0.00 ? 70 LEU A N    6  
ATOM 7632  C CA   . LEU A 1 70 ? 8.953   -2.189  -5.108  1.00 0.00 ? 70 LEU A CA   6  
ATOM 7633  C C    . LEU A 1 70 ? 7.504   -1.937  -5.538  1.00 0.00 ? 70 LEU A C    6  
ATOM 7634  O O    . LEU A 1 70 ? 7.225   -1.614  -6.675  1.00 0.00 ? 70 LEU A O    6  
ATOM 7635  C CB   . LEU A 1 70 ? 9.487   -3.515  -5.675  1.00 0.00 ? 70 LEU A CB   6  
ATOM 7636  C CG   . LEU A 1 70 ? 11.013  -3.591  -5.529  1.00 0.00 ? 70 LEU A CG   6  
ATOM 7637  C CD1  . LEU A 1 70 ? 11.505  -4.967  -6.005  1.00 0.00 ? 70 LEU A CD1  6  
ATOM 7638  C CD2  . LEU A 1 70 ? 11.708  -2.482  -6.351  1.00 0.00 ? 70 LEU A CD2  6  
ATOM 7639  H H    . LEU A 1 70 ? 9.063   -3.046  -3.125  1.00 0.00 ? 70 LEU A H    6  
ATOM 7640  H HA   . LEU A 1 70 ? 9.555   -1.359  -5.442  1.00 0.00 ? 70 LEU A HA   6  
ATOM 7641  H HB2  . LEU A 1 70 ? 9.044   -4.337  -5.133  1.00 0.00 ? 70 LEU A HB2  6  
ATOM 7642  H HB3  . LEU A 1 70 ? 9.232   -3.596  -6.707  1.00 0.00 ? 70 LEU A HB3  6  
ATOM 7643  H HG   . LEU A 1 70 ? 11.257  -3.467  -4.498  1.00 0.00 ? 70 LEU A HG   6  
ATOM 7644  H HD11 . LEU A 1 70 ? 11.537  -4.983  -7.085  1.00 0.00 ? 70 LEU A HD11 6  
ATOM 7645  H HD12 . LEU A 1 70 ? 10.835  -5.737  -5.655  1.00 0.00 ? 70 LEU A HD12 6  
ATOM 7646  H HD13 . LEU A 1 70 ? 12.496  -5.148  -5.616  1.00 0.00 ? 70 LEU A HD13 6  
ATOM 7647  H HD21 . LEU A 1 70 ? 11.112  -2.238  -7.215  1.00 0.00 ? 70 LEU A HD21 6  
ATOM 7648  H HD22 . LEU A 1 70 ? 12.684  -2.819  -6.674  1.00 0.00 ? 70 LEU A HD22 6  
ATOM 7649  H HD23 . LEU A 1 70 ? 11.827  -1.603  -5.737  1.00 0.00 ? 70 LEU A HD23 6  
ATOM 7650  N N    . VAL A 1 71 ? 6.577   -2.107  -4.625  1.00 0.00 ? 71 VAL A N    6  
ATOM 7651  C CA   . VAL A 1 71 ? 5.140   -1.903  -4.973  1.00 0.00 ? 71 VAL A CA   6  
ATOM 7652  C C    . VAL A 1 71 ? 4.890   -0.443  -5.341  1.00 0.00 ? 71 VAL A C    6  
ATOM 7653  O O    . VAL A 1 71 ? 4.338   -0.157  -6.380  1.00 0.00 ? 71 VAL A O    6  
ATOM 7654  C CB   . VAL A 1 71 ? 4.233   -2.323  -3.786  1.00 0.00 ? 71 VAL A CB   6  
ATOM 7655  C CG1  . VAL A 1 71 ? 2.853   -1.619  -3.839  1.00 0.00 ? 71 VAL A CG1  6  
ATOM 7656  C CG2  . VAL A 1 71 ? 4.037   -3.843  -3.805  1.00 0.00 ? 71 VAL A CG2  6  
ATOM 7657  H H    . VAL A 1 71 ? 6.835   -2.399  -3.726  1.00 0.00 ? 71 VAL A H    6  
ATOM 7658  H HA   . VAL A 1 71 ? 4.932   -2.492  -5.851  1.00 0.00 ? 71 VAL A HA   6  
ATOM 7659  H HB   . VAL A 1 71 ? 4.720   -2.046  -2.867  1.00 0.00 ? 71 VAL A HB   6  
ATOM 7660  H HG11 . VAL A 1 71 ? 2.508   -1.573  -4.861  1.00 0.00 ? 71 VAL A HG11 6  
ATOM 7661  H HG12 . VAL A 1 71 ? 2.934   -0.612  -3.443  1.00 0.00 ? 71 VAL A HG12 6  
ATOM 7662  H HG13 . VAL A 1 71 ? 2.139   -2.169  -3.242  1.00 0.00 ? 71 VAL A HG13 6  
ATOM 7663  H HG21 . VAL A 1 71 ? 4.975   -4.329  -3.579  1.00 0.00 ? 71 VAL A HG21 6  
ATOM 7664  H HG22 . VAL A 1 71 ? 3.695   -4.153  -4.781  1.00 0.00 ? 71 VAL A HG22 6  
ATOM 7665  H HG23 . VAL A 1 71 ? 3.303   -4.118  -3.061  1.00 0.00 ? 71 VAL A HG23 6  
ATOM 7666  N N    . CYS A 1 72 ? 5.230   0.491   -4.502  1.00 0.00 ? 72 CYS A N    6  
ATOM 7667  C CA   . CYS A 1 72 ? 4.913   1.897   -4.856  1.00 0.00 ? 72 CYS A CA   6  
ATOM 7668  C C    . CYS A 1 72 ? 5.715   2.346   -6.091  1.00 0.00 ? 72 CYS A C    6  
ATOM 7669  O O    . CYS A 1 72 ? 5.282   3.193   -6.847  1.00 0.00 ? 72 CYS A O    6  
ATOM 7670  C CB   . CYS A 1 72 ? 5.225   2.810   -3.663  1.00 0.00 ? 72 CYS A CB   6  
ATOM 7671  S SG   . CYS A 1 72 ? 4.209   2.347   -2.248  1.00 0.00 ? 72 CYS A SG   6  
ATOM 7672  H H    . CYS A 1 72 ? 5.633   0.279   -3.633  1.00 0.00 ? 72 CYS A H    6  
ATOM 7673  H HA   . CYS A 1 72 ? 3.853   1.919   -5.063  1.00 0.00 ? 72 CYS A HA   6  
ATOM 7674  H HB2  . CYS A 1 72 ? 6.265   2.724   -3.394  1.00 0.00 ? 72 CYS A HB2  6  
ATOM 7675  H HB3  . CYS A 1 72 ? 5.007   3.829   -3.923  1.00 0.00 ? 72 CYS A HB3  6  
ATOM 7676  N N    . SER A 1 73 ? 6.882   1.782   -6.301  1.00 0.00 ? 73 SER A N    6  
ATOM 7677  C CA   . SER A 1 73 ? 7.697   2.186   -7.494  1.00 0.00 ? 73 SER A CA   6  
ATOM 7678  C C    . SER A 1 73 ? 7.144   1.553   -8.793  1.00 0.00 ? 73 SER A C    6  
ATOM 7679  O O    . SER A 1 73 ? 7.141   2.183   -9.831  1.00 0.00 ? 73 SER A O    6  
ATOM 7680  C CB   . SER A 1 73 ? 9.150   1.763   -7.294  1.00 0.00 ? 73 SER A CB   6  
ATOM 7681  O OG   . SER A 1 73 ? 9.980   2.498   -8.184  1.00 0.00 ? 73 SER A OG   6  
ATOM 7682  H H    . SER A 1 73 ? 7.218   1.109   -5.653  1.00 0.00 ? 73 SER A H    6  
ATOM 7683  H HA   . SER A 1 73 ? 7.645   3.259   -7.608  1.00 0.00 ? 73 SER A HA   6  
ATOM 7684  H HB2  . SER A 1 73 ? 9.449   1.968   -6.279  1.00 0.00 ? 73 SER A HB2  6  
ATOM 7685  H HB3  . SER A 1 73 ? 9.243   0.704   -7.488  1.00 0.00 ? 73 SER A HB3  6  
ATOM 7686  H HG   . SER A 1 73 ? 10.895  2.293   -7.974  1.00 0.00 ? 73 SER A HG   6  
ATOM 7687  N N    . MET A 1 74 ? 6.684   0.330   -8.758  1.00 0.00 ? 74 MET A N    6  
ATOM 7688  C CA   . MET A 1 74 ? 6.145   -0.311  -10.010 1.00 0.00 ? 74 MET A CA   6  
ATOM 7689  C C    . MET A 1 74 ? 4.772   0.285   -10.386 1.00 0.00 ? 74 MET A C    6  
ATOM 7690  O O    . MET A 1 74 ? 4.489   0.492   -11.549 1.00 0.00 ? 74 MET A O    6  
ATOM 7691  C CB   . MET A 1 74 ? 5.995   -1.844  -9.790  1.00 0.00 ? 74 MET A CB   6  
ATOM 7692  C CG   . MET A 1 74 ? 7.203   -2.620  -10.350 1.00 0.00 ? 74 MET A CG   6  
ATOM 7693  S SD   . MET A 1 74 ? 6.753   -4.363  -10.585 1.00 0.00 ? 74 MET A SD   6  
ATOM 7694  C CE   . MET A 1 74 ? 5.866   -4.628  -9.026  1.00 0.00 ? 74 MET A CE   6  
ATOM 7695  H H    . MET A 1 74 ? 6.693   -0.173  -7.916  1.00 0.00 ? 74 MET A H    6  
ATOM 7696  H HA   . MET A 1 74 ? 6.806   -0.143  -10.846 1.00 0.00 ? 74 MET A HA   6  
ATOM 7697  H HB2  . MET A 1 74 ? 5.918   -2.041  -8.734  1.00 0.00 ? 74 MET A HB2  6  
ATOM 7698  H HB3  . MET A 1 74 ? 5.100   -2.200  -10.286 1.00 0.00 ? 74 MET A HB3  6  
ATOM 7699  H HG2  . MET A 1 74 ? 7.501   -2.208  -11.300 1.00 0.00 ? 74 MET A HG2  6  
ATOM 7700  H HG3  . MET A 1 74 ? 8.026   -2.552  -9.659  1.00 0.00 ? 74 MET A HG3  6  
ATOM 7701  H HE1  . MET A 1 74 ? 6.444   -4.223  -8.209  1.00 0.00 ? 74 MET A HE1  6  
ATOM 7702  H HE2  . MET A 1 74 ? 5.723   -5.685  -8.869  1.00 0.00 ? 74 MET A HE2  6  
ATOM 7703  H HE3  . MET A 1 74 ? 4.902   -4.141  -9.069  1.00 0.00 ? 74 MET A HE3  6  
ATOM 7704  N N    . LEU A 1 75 ? 3.912   0.541   -9.440  1.00 0.00 ? 75 LEU A N    6  
ATOM 7705  C CA   . LEU A 1 75 ? 2.570   1.092   -9.801  1.00 0.00 ? 75 LEU A CA   6  
ATOM 7706  C C    . LEU A 1 75 ? 2.693   2.555   -10.253 1.00 0.00 ? 75 LEU A C    6  
ATOM 7707  O O    . LEU A 1 75 ? 1.729   3.292   -10.257 1.00 0.00 ? 75 LEU A O    6  
ATOM 7708  C CB   . LEU A 1 75 ? 1.623   0.990   -8.597  1.00 0.00 ? 75 LEU A CB   6  
ATOM 7709  C CG   . LEU A 1 75 ? 1.555   -0.462  -8.082  1.00 0.00 ? 75 LEU A CG   6  
ATOM 7710  C CD1  . LEU A 1 75 ? 0.478   -0.577  -6.999  1.00 0.00 ? 75 LEU A CD1  6  
ATOM 7711  C CD2  . LEU A 1 75 ? 1.225   -1.426  -9.234  1.00 0.00 ? 75 LEU A CD2  6  
ATOM 7712  H H    . LEU A 1 75 ? 4.137   0.356   -8.505  1.00 0.00 ? 75 LEU A H    6  
ATOM 7713  H HA   . LEU A 1 75 ? 2.162   0.517   -10.618 1.00 0.00 ? 75 LEU A HA   6  
ATOM 7714  H HB2  . LEU A 1 75 ? 1.986   1.630   -7.809  1.00 0.00 ? 75 LEU A HB2  6  
ATOM 7715  H HB3  . LEU A 1 75 ? 0.636   1.308   -8.895  1.00 0.00 ? 75 LEU A HB3  6  
ATOM 7716  H HG   . LEU A 1 75 ? 2.502   -0.728  -7.654  1.00 0.00 ? 75 LEU A HG   6  
ATOM 7717  H HD11 . LEU A 1 75 ? 0.836   -0.129  -6.086  1.00 0.00 ? 75 LEU A HD11 6  
ATOM 7718  H HD12 . LEU A 1 75 ? 0.255   -1.620  -6.823  1.00 0.00 ? 75 LEU A HD12 6  
ATOM 7719  H HD13 . LEU A 1 75 ? -0.418  -0.071  -7.325  1.00 0.00 ? 75 LEU A HD13 6  
ATOM 7720  H HD21 . LEU A 1 75 ? 2.130   -1.658  -9.780  1.00 0.00 ? 75 LEU A HD21 6  
ATOM 7721  H HD22 . LEU A 1 75 ? 0.509   -0.967  -9.899  1.00 0.00 ? 75 LEU A HD22 6  
ATOM 7722  H HD23 . LEU A 1 75 ? 0.807   -2.339  -8.835  1.00 0.00 ? 75 LEU A HD23 6  
ATOM 7723  N N    . HIS A 1 76 ? 3.878   2.977   -10.620 1.00 0.00 ? 76 HIS A N    6  
ATOM 7724  C CA   . HIS A 1 76 ? 4.088   4.393   -11.071 1.00 0.00 ? 76 HIS A CA   6  
ATOM 7725  C C    . HIS A 1 76 ? 3.402   5.359   -10.096 1.00 0.00 ? 76 HIS A C    6  
ATOM 7726  O O    . HIS A 1 76 ? 3.089   6.475   -10.459 1.00 0.00 ? 76 HIS A O    6  
ATOM 7727  C CB   . HIS A 1 76 ? 3.537   4.585   -12.492 1.00 0.00 ? 76 HIS A CB   6  
ATOM 7728  C CG   . HIS A 1 76 ? 2.034   4.558   -12.479 1.00 0.00 ? 76 HIS A CG   6  
ATOM 7729  N ND1  . HIS A 1 76 ? 1.279   5.612   -11.989 1.00 0.00 ? 76 HIS A ND1  6  
ATOM 7730  C CD2  . HIS A 1 76 ? 1.131   3.608   -12.890 1.00 0.00 ? 76 HIS A CD2  6  
ATOM 7731  C CE1  . HIS A 1 76 ? -0.019  5.274   -12.115 1.00 0.00 ? 76 HIS A CE1  6  
ATOM 7732  N NE2  . HIS A 1 76 ? -0.165  4.062   -12.658 1.00 0.00 ? 76 HIS A NE2  6  
ATOM 7733  H H    . HIS A 1 76 ? 4.637   2.359   -10.577 1.00 0.00 ? 76 HIS A H    6  
ATOM 7734  H HA   . HIS A 1 76 ? 5.148   4.597   -11.074 1.00 0.00 ? 76 HIS A HA   6  
ATOM 7735  H HB2  . HIS A 1 76 ? 3.873   5.536   -12.880 1.00 0.00 ? 76 HIS A HB2  6  
ATOM 7736  H HB3  . HIS A 1 76 ? 3.903   3.793   -13.128 1.00 0.00 ? 76 HIS A HB3  6  
ATOM 7737  H HD1  . HIS A 1 76 ? 1.626   6.449   -11.618 1.00 0.00 ? 76 HIS A HD1  6  
ATOM 7738  H HD2  . HIS A 1 76 ? 1.386   2.654   -13.325 1.00 0.00 ? 76 HIS A HD2  6  
ATOM 7739  H HE1  . HIS A 1 76 ? -0.840  5.906   -11.812 1.00 0.00 ? 76 HIS A HE1  6  
ATOM 7740  N N    . LEU A 1 77 ? 3.158   4.972   -8.880  1.00 0.00 ? 77 LEU A N    6  
ATOM 7741  C CA   . LEU A 1 77 ? 2.487   5.916   -7.937  1.00 0.00 ? 77 LEU A CA   6  
ATOM 7742  C C    . LEU A 1 77 ? 3.526   6.855   -7.313  1.00 0.00 ? 77 LEU A C    6  
ATOM 7743  O O    . LEU A 1 77 ? 3.180   7.836   -6.685  1.00 0.00 ? 77 LEU A O    6  
ATOM 7744  C CB   . LEU A 1 77 ? 1.759   5.129   -6.828  1.00 0.00 ? 77 LEU A CB   6  
ATOM 7745  C CG   . LEU A 1 77 ? 0.453   4.461   -7.328  1.00 0.00 ? 77 LEU A CG   6  
ATOM 7746  C CD1  . LEU A 1 77 ? -0.333  3.969   -6.108  1.00 0.00 ? 77 LEU A CD1  6  
ATOM 7747  C CD2  . LEU A 1 77 ? -0.437  5.446   -8.115  1.00 0.00 ? 77 LEU A CD2  6  
ATOM 7748  H H    . LEU A 1 77 ? 3.409   4.077   -8.587  1.00 0.00 ? 77 LEU A H    6  
ATOM 7749  H HA   . LEU A 1 77 ? 1.785   6.531   -8.466  1.00 0.00 ? 77 LEU A HA   6  
ATOM 7750  H HB2  . LEU A 1 77 ? 2.418   4.360   -6.460  1.00 0.00 ? 77 LEU A HB2  6  
ATOM 7751  H HB3  . LEU A 1 77 ? 1.523   5.797   -6.020  1.00 0.00 ? 77 LEU A HB3  6  
ATOM 7752  H HG   . LEU A 1 77 ? 0.705   3.616   -7.953  1.00 0.00 ? 77 LEU A HG   6  
ATOM 7753  H HD11 . LEU A 1 77 ? -1.226  3.456   -6.436  1.00 0.00 ? 77 LEU A HD11 6  
ATOM 7754  H HD12 . LEU A 1 77 ? -0.612  4.815   -5.499  1.00 0.00 ? 77 LEU A HD12 6  
ATOM 7755  H HD13 . LEU A 1 77 ? 0.278   3.299   -5.527  1.00 0.00 ? 77 LEU A HD13 6  
ATOM 7756  H HD21 . LEU A 1 77 ? -0.368  6.430   -7.676  1.00 0.00 ? 77 LEU A HD21 6  
ATOM 7757  H HD22 . LEU A 1 77 ? -1.466  5.114   -8.086  1.00 0.00 ? 77 LEU A HD22 6  
ATOM 7758  H HD23 . LEU A 1 77 ? -0.112  5.485   -9.145  1.00 0.00 ? 77 LEU A HD23 6  
ATOM 7759  N N    . CYS A 1 78 ? 4.796   6.582   -7.506  1.00 0.00 ? 78 CYS A N    6  
ATOM 7760  C CA   . CYS A 1 78 ? 5.868   7.478   -6.953  1.00 0.00 ? 78 CYS A CA   6  
ATOM 7761  C C    . CYS A 1 78 ? 6.845   7.816   -8.093  1.00 0.00 ? 78 CYS A C    6  
ATOM 7762  O O    . CYS A 1 78 ? 7.679   7.005   -8.445  1.00 0.00 ? 78 CYS A O    6  
ATOM 7763  C CB   . CYS A 1 78 ? 6.626   6.751   -5.829  1.00 0.00 ? 78 CYS A CB   6  
ATOM 7764  S SG   . CYS A 1 78 ? 6.907   7.885   -4.441  1.00 0.00 ? 78 CYS A SG   6  
ATOM 7765  H H    . CYS A 1 78 ? 5.047   5.793   -8.028  1.00 0.00 ? 78 CYS A H    6  
ATOM 7766  H HA   . CYS A 1 78 ? 5.422   8.392   -6.570  1.00 0.00 ? 78 CYS A HA   6  
ATOM 7767  H HB2  . CYS A 1 78 ? 6.039   5.919   -5.502  1.00 0.00 ? 78 CYS A HB2  6  
ATOM 7768  H HB3  . CYS A 1 78 ? 7.581   6.384   -6.189  1.00 0.00 ? 78 CYS A HB3  6  
ATOM 7769  N N    . SER A 1 79 ? 6.730   8.954   -8.727  1.00 0.00 ? 79 SER A N    6  
ATOM 7770  C CA   . SER A 1 79 ? 7.648   9.213   -9.878  1.00 0.00 ? 79 SER A CA   6  
ATOM 7771  C C    . SER A 1 79 ? 9.099   9.343   -9.385  1.00 0.00 ? 79 SER A C    6  
ATOM 7772  O O    . SER A 1 79 ? 9.352   9.368   -8.198  1.00 0.00 ? 79 SER A O    6  
ATOM 7773  C CB   . SER A 1 79 ? 7.212   10.462  -10.644 1.00 0.00 ? 79 SER A CB   6  
ATOM 7774  O OG   . SER A 1 79 ? 8.249   10.852  -11.536 1.00 0.00 ? 79 SER A OG   6  
ATOM 7775  H H    . SER A 1 79 ? 6.030   9.596   -8.487  1.00 0.00 ? 79 SER A H    6  
ATOM 7776  H HA   . SER A 1 79 ? 7.580   8.336   -10.508 1.00 0.00 ? 79 SER A HA   6  
ATOM 7777  H HB2  . SER A 1 79 ? 6.319   10.249  -11.209 1.00 0.00 ? 79 SER A HB2  6  
ATOM 7778  H HB3  . SER A 1 79 ? 7.008   11.261  -9.942  1.00 0.00 ? 79 SER A HB3  6  
ATOM 7779  H HG   . SER A 1 79 ? 8.720   11.589  -11.141 1.00 0.00 ? 79 SER A HG   6  
ATOM 7780  N N    . GLY A 1 80 ? 10.056  9.435   -10.281 1.00 0.00 ? 80 GLY A N    6  
ATOM 7781  C CA   . GLY A 1 80 ? 11.482  9.571   -9.849  1.00 0.00 ? 80 GLY A CA   6  
ATOM 7782  C C    . GLY A 1 80 ? 11.874  11.049  -9.857  1.00 0.00 ? 80 GLY A C    6  
ATOM 7783  O O    . GLY A 1 80 ? 11.065  11.914  -10.132 1.00 0.00 ? 80 GLY A O    6  
ATOM 7784  H H    . GLY A 1 80 ? 9.841   9.420   -11.238 1.00 0.00 ? 80 GLY A H    6  
ATOM 7785  H HA2  . GLY A 1 80 ? 11.606  9.168   -8.852  1.00 0.00 ? 80 GLY A HA2  6  
ATOM 7786  H HA3  . GLY A 1 80 ? 12.117  9.032   -10.535 1.00 0.00 ? 80 GLY A HA3  6  
ATOM 7787  N N    . LEU A 1 81 ? 13.110  11.348  -9.561  1.00 0.00 ? 81 LEU A N    6  
ATOM 7788  C CA   . LEU A 1 81 ? 13.550  12.772  -9.556  1.00 0.00 ? 81 LEU A CA   6  
ATOM 7789  C C    . LEU A 1 81 ? 13.780  13.236  -10.995 1.00 0.00 ? 81 LEU A C    6  
ATOM 7790  O O    . LEU A 1 81 ? 14.902  13.332  -11.451 1.00 0.00 ? 81 LEU A O    6  
ATOM 7791  C CB   . LEU A 1 81 ? 14.853  12.904  -8.763  1.00 0.00 ? 81 LEU A CB   6  
ATOM 7792  C CG   . LEU A 1 81 ? 14.752  12.091  -7.472  1.00 0.00 ? 81 LEU A CG   6  
ATOM 7793  C CD1  . LEU A 1 81 ? 16.030  12.280  -6.654  1.00 0.00 ? 81 LEU A CD1  6  
ATOM 7794  C CD2  . LEU A 1 81 ? 13.545  12.569  -6.658  1.00 0.00 ? 81 LEU A CD2  6  
ATOM 7795  H H    . LEU A 1 81 ? 13.748  10.637  -9.345  1.00 0.00 ? 81 LEU A H    6  
ATOM 7796  H HA   . LEU A 1 81 ? 12.786  13.384  -9.099  1.00 0.00 ? 81 LEU A HA   6  
ATOM 7797  H HB2  . LEU A 1 81 ? 15.677  12.534  -9.358  1.00 0.00 ? 81 LEU A HB2  6  
ATOM 7798  H HB3  . LEU A 1 81 ? 15.021  13.942  -8.520  1.00 0.00 ? 81 LEU A HB3  6  
ATOM 7799  H HG   . LEU A 1 81 ? 14.634  11.044  -7.716  1.00 0.00 ? 81 LEU A HG   6  
ATOM 7800  H HD11 . LEU A 1 81 ? 15.936  11.759  -5.712  1.00 0.00 ? 81 LEU A HD11 6  
ATOM 7801  H HD12 . LEU A 1 81 ? 16.187  13.333  -6.469  1.00 0.00 ? 81 LEU A HD12 6  
ATOM 7802  H HD13 . LEU A 1 81 ? 16.871  11.883  -7.202  1.00 0.00 ? 81 LEU A HD13 6  
ATOM 7803  H HD21 . LEU A 1 81 ? 13.636  12.224  -5.638  1.00 0.00 ? 81 LEU A HD21 6  
ATOM 7804  H HD22 . LEU A 1 81 ? 12.639  12.171  -7.091  1.00 0.00 ? 81 LEU A HD22 6  
ATOM 7805  H HD23 . LEU A 1 81 ? 13.505  13.649  -6.670  1.00 0.00 ? 81 LEU A HD23 6  
ATOM 7806  N N    . VAL A 1 82 ? 12.722  13.516  -11.714 1.00 0.00 ? 82 VAL A N    6  
ATOM 7807  C CA   . VAL A 1 82 ? 12.853  13.971  -13.137 1.00 0.00 ? 82 VAL A CA   6  
ATOM 7808  C C    . VAL A 1 82 ? 12.334  15.423  -13.263 1.00 0.00 ? 82 VAL A C    6  
ATOM 7809  O O    . VAL A 1 82 ? 11.155  15.618  -13.479 1.00 0.00 ? 82 VAL A O    6  
ATOM 7810  C CB   . VAL A 1 82 ? 11.995  13.048  -14.021 1.00 0.00 ? 82 VAL A CB   6  
ATOM 7811  C CG1  . VAL A 1 82 ? 12.779  11.774  -14.356 1.00 0.00 ? 82 VAL A CG1  6  
ATOM 7812  C CG2  . VAL A 1 82 ? 10.715  12.666  -13.270 1.00 0.00 ? 82 VAL A CG2  6  
ATOM 7813  H H    . VAL A 1 82 ? 11.827  13.419  -11.317 1.00 0.00 ? 82 VAL A H    6  
ATOM 7814  H HA   . VAL A 1 82 ? 13.880  13.909  -13.458 1.00 0.00 ? 82 VAL A HA   6  
ATOM 7815  H HB   . VAL A 1 82 ? 11.736  13.559  -14.940 1.00 0.00 ? 82 VAL A HB   6  
ATOM 7816  H HG11 . VAL A 1 82 ? 12.148  11.099  -14.916 1.00 0.00 ? 82 VAL A HG11 6  
ATOM 7817  H HG12 . VAL A 1 82 ? 13.095  11.295  -13.440 1.00 0.00 ? 82 VAL A HG12 6  
ATOM 7818  H HG13 . VAL A 1 82 ? 13.646  12.029  -14.947 1.00 0.00 ? 82 VAL A HG13 6  
ATOM 7819  H HG21 . VAL A 1 82 ? 10.004  12.243  -13.962 1.00 0.00 ? 82 VAL A HG21 6  
ATOM 7820  H HG22 . VAL A 1 82 ? 10.290  13.545  -12.810 1.00 0.00 ? 82 VAL A HG22 6  
ATOM 7821  H HG23 . VAL A 1 82 ? 10.950  11.940  -12.506 1.00 0.00 ? 82 VAL A HG23 6  
ATOM 7822  N N    . PRO A 1 83 ? 13.205  16.411  -13.121 1.00 0.00 ? 83 PRO A N    6  
ATOM 7823  C CA   . PRO A 1 83 ? 12.774  17.820  -13.222 1.00 0.00 ? 83 PRO A CA   6  
ATOM 7824  C C    . PRO A 1 83 ? 12.252  18.104  -14.639 1.00 0.00 ? 83 PRO A C    6  
ATOM 7825  O O    . PRO A 1 83 ? 11.896  19.219  -14.967 1.00 0.00 ? 83 PRO A O    6  
ATOM 7826  C CB   . PRO A 1 83 ? 14.039  18.653  -12.901 1.00 0.00 ? 83 PRO A CB   6  
ATOM 7827  C CG   . PRO A 1 83 ? 15.198  17.652  -12.620 1.00 0.00 ? 83 PRO A CG   6  
ATOM 7828  C CD   . PRO A 1 83 ? 14.652  16.228  -12.857 1.00 0.00 ? 83 PRO A CD   6  
ATOM 7829  H HA   . PRO A 1 83 ? 12.001  18.024  -12.495 1.00 0.00 ? 83 PRO A HA   6  
ATOM 7830  H HB2  . PRO A 1 83 ? 14.294  19.291  -13.741 1.00 0.00 ? 83 PRO A HB2  6  
ATOM 7831  H HB3  . PRO A 1 83 ? 13.868  19.264  -12.025 1.00 0.00 ? 83 PRO A HB3  6  
ATOM 7832  H HG2  . PRO A 1 83 ? 16.027  17.851  -13.291 1.00 0.00 ? 83 PRO A HG2  6  
ATOM 7833  H HG3  . PRO A 1 83 ? 15.532  17.750  -11.596 1.00 0.00 ? 83 PRO A HG3  6  
ATOM 7834  H HD2  . PRO A 1 83 ? 15.139  15.782  -13.716 1.00 0.00 ? 83 PRO A HD2  6  
ATOM 7835  H HD3  . PRO A 1 83 ? 14.797  15.614  -11.982 1.00 0.00 ? 83 PRO A HD3  6  
ATOM 7836  N N    . ARG A 1 84 ? 12.207  17.104  -15.475 1.00 0.00 ? 84 ARG A N    6  
ATOM 7837  C CA   . ARG A 1 84 ? 11.709  17.316  -16.864 1.00 0.00 ? 84 ARG A CA   6  
ATOM 7838  C C    . ARG A 1 84 ? 11.409  15.961  -17.509 1.00 0.00 ? 84 ARG A C    6  
ATOM 7839  O O    . ARG A 1 84 ? 12.351  15.289  -17.895 1.00 0.00 ? 84 ARG A O    6  
ATOM 7840  C CB   . ARG A 1 84 ? 12.776  18.045  -17.685 1.00 0.00 ? 84 ARG A CB   6  
ATOM 7841  C CG   . ARG A 1 84 ? 12.191  18.444  -19.042 1.00 0.00 ? 84 ARG A CG   6  
ATOM 7842  C CD   . ARG A 1 84 ? 13.256  19.174  -19.861 1.00 0.00 ? 84 ARG A CD   6  
ATOM 7843  N NE   . ARG A 1 84 ? 13.777  20.330  -19.078 1.00 0.00 ? 84 ARG A NE   6  
ATOM 7844  C CZ   . ARG A 1 84 ? 14.889  20.912  -19.435 1.00 0.00 ? 84 ARG A CZ   6  
ATOM 7845  N NH1  . ARG A 1 84 ? 15.538  20.492  -20.486 1.00 0.00 ? 84 ARG A NH1  6  
ATOM 7846  N NH2  . ARG A 1 84 ? 15.350  21.916  -18.740 1.00 0.00 ? 84 ARG A NH2  6  
ATOM 7847  O OXT  . ARG A 1 84 ? 10.242  15.619  -17.605 1.00 0.00 ? 84 ARG A OXT  6  
ATOM 7848  H H    . ARG A 1 84 ? 12.498  16.213  -15.190 1.00 0.00 ? 84 ARG A H    6  
ATOM 7849  H HA   . ARG A 1 84 ? 10.808  17.909  -16.837 1.00 0.00 ? 84 ARG A HA   6  
ATOM 7850  H HB2  . ARG A 1 84 ? 13.094  18.932  -17.155 1.00 0.00 ? 84 ARG A HB2  6  
ATOM 7851  H HB3  . ARG A 1 84 ? 13.622  17.393  -17.838 1.00 0.00 ? 84 ARG A HB3  6  
ATOM 7852  H HG2  . ARG A 1 84 ? 11.873  17.558  -19.572 1.00 0.00 ? 84 ARG A HG2  6  
ATOM 7853  H HG3  . ARG A 1 84 ? 11.345  19.097  -18.892 1.00 0.00 ? 84 ARG A HG3  6  
ATOM 7854  H HD2  . ARG A 1 84 ? 14.067  18.496  -20.084 1.00 0.00 ? 84 ARG A HD2  6  
ATOM 7855  H HD3  . ARG A 1 84 ? 12.821  19.532  -20.782 1.00 0.00 ? 84 ARG A HD3  6  
ATOM 7856  H HE   . ARG A 1 84 ? 13.287  20.649  -18.291 1.00 0.00 ? 84 ARG A HE   6  
ATOM 7857  H HH11 . ARG A 1 84 ? 15.182  19.725  -21.019 1.00 0.00 ? 84 ARG A HH11 6  
ATOM 7858  H HH12 . ARG A 1 84 ? 16.389  20.939  -20.759 1.00 0.00 ? 84 ARG A HH12 6  
ATOM 7859  H HH21 . ARG A 1 84 ? 14.851  22.238  -17.935 1.00 0.00 ? 84 ARG A HH21 6  
ATOM 7860  H HH22 . ARG A 1 84 ? 16.203  22.362  -19.013 1.00 0.00 ? 84 ARG A HH22 6  
ATOM 7861  N N    . SER A 1 1  ? 6.180   16.897  -1.364  1.00 0.00 ? 1  SER A N    7  
ATOM 7862  C CA   . SER A 1 1  ? 5.128   16.699  -0.327  1.00 0.00 ? 1  SER A CA   7  
ATOM 7863  C C    . SER A 1 1  ? 3.984   15.869  -0.914  1.00 0.00 ? 1  SER A C    7  
ATOM 7864  O O    . SER A 1 1  ? 2.827   16.079  -0.612  1.00 0.00 ? 1  SER A O    7  
ATOM 7865  C CB   . SER A 1 1  ? 4.592   18.059  0.121   1.00 0.00 ? 1  SER A CB   7  
ATOM 7866  O OG   . SER A 1 1  ? 3.846   18.642  -0.939  1.00 0.00 ? 1  SER A OG   7  
ATOM 7867  H H1   . SER A 1 1  ? 6.832   16.088  -1.357  1.00 0.00 ? 1  SER A H1   7  
ATOM 7868  H H2   . SER A 1 1  ? 6.708   17.771  -1.159  1.00 0.00 ? 1  SER A H2   7  
ATOM 7869  H H3   . SER A 1 1  ? 5.735   16.973  -2.301  1.00 0.00 ? 1  SER A H3   7  
ATOM 7870  H HA   . SER A 1 1  ? 5.551   16.181  0.521   1.00 0.00 ? 1  SER A HA   7  
ATOM 7871  H HB2  . SER A 1 1  ? 3.952   17.931  0.977   1.00 0.00 ? 1  SER A HB2  7  
ATOM 7872  H HB3  . SER A 1 1  ? 5.421   18.702  0.387   1.00 0.00 ? 1  SER A HB3  7  
ATOM 7873  H HG   . SER A 1 1  ? 4.390   19.316  -1.349  1.00 0.00 ? 1  SER A HG   7  
ATOM 7874  N N    . ASP A 1 2  ? 4.309   14.935  -1.768  1.00 0.00 ? 2  ASP A N    7  
ATOM 7875  C CA   . ASP A 1 2  ? 3.259   14.089  -2.402  1.00 0.00 ? 2  ASP A CA   7  
ATOM 7876  C C    . ASP A 1 2  ? 2.641   13.142  -1.367  1.00 0.00 ? 2  ASP A C    7  
ATOM 7877  O O    . ASP A 1 2  ? 3.215   12.140  -0.992  1.00 0.00 ? 2  ASP A O    7  
ATOM 7878  C CB   . ASP A 1 2  ? 3.890   13.282  -3.543  1.00 0.00 ? 2  ASP A CB   7  
ATOM 7879  C CG   . ASP A 1 2  ? 2.895   12.238  -4.058  1.00 0.00 ? 2  ASP A CG   7  
ATOM 7880  O OD1  . ASP A 1 2  ? 2.037   12.602  -4.844  1.00 0.00 ? 2  ASP A OD1  7  
ATOM 7881  O OD2  . ASP A 1 2  ? 3.009   11.091  -3.657  1.00 0.00 ? 2  ASP A OD2  7  
ATOM 7882  H H    . ASP A 1 2  ? 5.250   14.795  -2.001  1.00 0.00 ? 2  ASP A H    7  
ATOM 7883  H HA   . ASP A 1 2  ? 2.486   14.722  -2.805  1.00 0.00 ? 2  ASP A HA   7  
ATOM 7884  H HB2  . ASP A 1 2  ? 4.155   13.951  -4.348  1.00 0.00 ? 2  ASP A HB2  7  
ATOM 7885  H HB3  . ASP A 1 2  ? 4.777   12.786  -3.183  1.00 0.00 ? 2  ASP A HB3  7  
ATOM 7886  N N    . VAL A 1 3  ? 1.468   13.480  -0.907  1.00 0.00 ? 3  VAL A N    7  
ATOM 7887  C CA   . VAL A 1 3  ? 0.764   12.651  0.109   1.00 0.00 ? 3  VAL A CA   7  
ATOM 7888  C C    . VAL A 1 3  ? 0.412   11.268  -0.454  1.00 0.00 ? 3  VAL A C    7  
ATOM 7889  O O    . VAL A 1 3  ? 0.021   10.389  0.287   1.00 0.00 ? 3  VAL A O    7  
ATOM 7890  C CB   . VAL A 1 3  ? -0.545  13.375  0.515   1.00 0.00 ? 3  VAL A CB   7  
ATOM 7891  C CG1  . VAL A 1 3  ? -0.284  14.877  0.628   1.00 0.00 ? 3  VAL A CG1  7  
ATOM 7892  C CG2  . VAL A 1 3  ? -1.664  13.144  -0.517  1.00 0.00 ? 3  VAL A CG2  7  
ATOM 7893  H H    . VAL A 1 3  ? 1.044   14.301  -1.233  1.00 0.00 ? 3  VAL A H    7  
ATOM 7894  H HA   . VAL A 1 3  ? 1.365   12.561  1.006   1.00 0.00 ? 3  VAL A HA   7  
ATOM 7895  H HB   . VAL A 1 3  ? -0.869  13.004  1.478   1.00 0.00 ? 3  VAL A HB   7  
ATOM 7896  H HG11 . VAL A 1 3  ? 0.625   15.044  1.183   1.00 0.00 ? 3  VAL A HG11 7  
ATOM 7897  H HG12 . VAL A 1 3  ? -1.111  15.346  1.140   1.00 0.00 ? 3  VAL A HG12 7  
ATOM 7898  H HG13 . VAL A 1 3  ? -0.187  15.301  -0.361  1.00 0.00 ? 3  VAL A HG13 7  
ATOM 7899  H HG21 . VAL A 1 3  ? -1.999  12.119  -0.461  1.00 0.00 ? 3  VAL A HG21 7  
ATOM 7900  H HG22 . VAL A 1 3  ? -1.292  13.349  -1.508  1.00 0.00 ? 3  VAL A HG22 7  
ATOM 7901  H HG23 . VAL A 1 3  ? -2.494  13.804  -0.299  1.00 0.00 ? 3  VAL A HG23 7  
ATOM 7902  N N    . TYR A 1 4  ? 0.475   11.058  -1.748  1.00 0.00 ? 4  TYR A N    7  
ATOM 7903  C CA   . TYR A 1 4  ? 0.049   9.724   -2.274  1.00 0.00 ? 4  TYR A CA   7  
ATOM 7904  C C    . TYR A 1 4  ? 1.103   8.654   -1.952  1.00 0.00 ? 4  TYR A C    7  
ATOM 7905  O O    . TYR A 1 4  ? 0.796   7.601   -1.429  1.00 0.00 ? 4  TYR A O    7  
ATOM 7906  C CB   . TYR A 1 4  ? -0.239  9.827   -3.777  1.00 0.00 ? 4  TYR A CB   7  
ATOM 7907  C CG   . TYR A 1 4  ? -1.688  10.202  -4.010  1.00 0.00 ? 4  TYR A CG   7  
ATOM 7908  C CD1  . TYR A 1 4  ? -2.697  9.271   -3.742  1.00 0.00 ? 4  TYR A CD1  7  
ATOM 7909  C CD2  . TYR A 1 4  ? -2.020  11.470  -4.505  1.00 0.00 ? 4  TYR A CD2  7  
ATOM 7910  C CE1  . TYR A 1 4  ? -4.036  9.605   -3.965  1.00 0.00 ? 4  TYR A CE1  7  
ATOM 7911  C CE2  . TYR A 1 4  ? -3.361  11.805  -4.726  1.00 0.00 ? 4  TYR A CE2  7  
ATOM 7912  C CZ   . TYR A 1 4  ? -4.369  10.872  -4.457  1.00 0.00 ? 4  TYR A CZ   7  
ATOM 7913  O OH   . TYR A 1 4  ? -5.691  11.201  -4.678  1.00 0.00 ? 4  TYR A OH   7  
ATOM 7914  H H    . TYR A 1 4  ? 0.754   11.765  -2.367  1.00 0.00 ? 4  TYR A H    7  
ATOM 7915  H HA   . TYR A 1 4  ? -0.844  9.459   -1.723  1.00 0.00 ? 4  TYR A HA   7  
ATOM 7916  H HB2  . TYR A 1 4  ? 0.401   10.582  -4.211  1.00 0.00 ? 4  TYR A HB2  7  
ATOM 7917  H HB3  . TYR A 1 4  ? -0.042  8.885   -4.247  1.00 0.00 ? 4  TYR A HB3  7  
ATOM 7918  H HD1  . TYR A 1 4  ? -2.441  8.296   -3.357  1.00 0.00 ? 4  TYR A HD1  7  
ATOM 7919  H HD2  . TYR A 1 4  ? -1.242  12.190  -4.713  1.00 0.00 ? 4  TYR A HD2  7  
ATOM 7920  H HE1  . TYR A 1 4  ? -4.813  8.882   -3.759  1.00 0.00 ? 4  TYR A HE1  7  
ATOM 7921  H HE2  . TYR A 1 4  ? -3.617  12.781  -5.106  1.00 0.00 ? 4  TYR A HE2  7  
ATOM 7922  H HH   . TYR A 1 4  ? -6.217  10.404  -4.575  1.00 0.00 ? 4  TYR A HH   7  
ATOM 7923  N N    . CYS A 1 5  ? 2.344   8.923   -2.261  1.00 0.00 ? 5  CYS A N    7  
ATOM 7924  C CA   . CYS A 1 5  ? 3.418   7.929   -1.970  1.00 0.00 ? 5  CYS A CA   7  
ATOM 7925  C C    . CYS A 1 5  ? 3.369   7.589   -0.474  1.00 0.00 ? 5  CYS A C    7  
ATOM 7926  O O    . CYS A 1 5  ? 3.493   6.441   -0.094  1.00 0.00 ? 5  CYS A O    7  
ATOM 7927  C CB   . CYS A 1 5  ? 4.783   8.525   -2.314  1.00 0.00 ? 5  CYS A CB   7  
ATOM 7928  S SG   . CYS A 1 5  ? 4.998   8.497   -4.102  1.00 0.00 ? 5  CYS A SG   7  
ATOM 7929  H H    . CYS A 1 5  ? 2.562   9.788   -2.668  1.00 0.00 ? 5  CYS A H    7  
ATOM 7930  H HA   . CYS A 1 5  ? 3.254   7.018   -2.544  1.00 0.00 ? 5  CYS A HA   7  
ATOM 7931  H HB2  . CYS A 1 5  ? 4.834   9.546   -1.966  1.00 0.00 ? 5  CYS A HB2  7  
ATOM 7932  H HB3  . CYS A 1 5  ? 5.564   7.944   -1.847  1.00 0.00 ? 5  CYS A HB3  7  
ATOM 7933  N N    . GLU A 1 6  ? 3.207   8.558   0.381   1.00 0.00 ? 6  GLU A N    7  
ATOM 7934  C CA   . GLU A 1 6  ? 3.176   8.256   1.840   1.00 0.00 ? 6  GLU A CA   7  
ATOM 7935  C C    . GLU A 1 6  ? 2.091   7.217   2.147   1.00 0.00 ? 6  GLU A C    7  
ATOM 7936  O O    . GLU A 1 6  ? 2.285   6.333   2.957   1.00 0.00 ? 6  GLU A O    7  
ATOM 7937  C CB   . GLU A 1 6  ? 2.893   9.542   2.619   1.00 0.00 ? 6  GLU A CB   7  
ATOM 7938  C CG   . GLU A 1 6  ? 3.135   9.301   4.110   1.00 0.00 ? 6  GLU A CG   7  
ATOM 7939  C CD   . GLU A 1 6  ? 4.636   9.153   4.366   1.00 0.00 ? 6  GLU A CD   7  
ATOM 7940  O OE1  . GLU A 1 6  ? 5.293   10.170  4.519   1.00 0.00 ? 6  GLU A OE1  7  
ATOM 7941  O OE2  . GLU A 1 6  ? 5.103   8.026   4.404   1.00 0.00 ? 6  GLU A OE2  7  
ATOM 7942  H H    . GLU A 1 6  ? 3.126   9.482   0.067   1.00 0.00 ? 6  GLU A H    7  
ATOM 7943  H HA   . GLU A 1 6  ? 4.135   7.864   2.142   1.00 0.00 ? 6  GLU A HA   7  
ATOM 7944  H HB2  . GLU A 1 6  ? 3.552   10.325  2.270   1.00 0.00 ? 6  GLU A HB2  7  
ATOM 7945  H HB3  . GLU A 1 6  ? 1.870   9.841   2.466   1.00 0.00 ? 6  GLU A HB3  7  
ATOM 7946  H HG2  . GLU A 1 6  ? 2.753   10.137  4.677   1.00 0.00 ? 6  GLU A HG2  7  
ATOM 7947  H HG3  . GLU A 1 6  ? 2.629   8.397   4.416   1.00 0.00 ? 6  GLU A HG3  7  
ATOM 7948  N N    . VAL A 1 7  ? 0.945   7.325   1.534   1.00 0.00 ? 7  VAL A N    7  
ATOM 7949  C CA   . VAL A 1 7  ? -0.146  6.348   1.830   1.00 0.00 ? 7  VAL A CA   7  
ATOM 7950  C C    . VAL A 1 7  ? 0.166   4.958   1.240   1.00 0.00 ? 7  VAL A C    7  
ATOM 7951  O O    . VAL A 1 7  ? -0.093  3.953   1.870   1.00 0.00 ? 7  VAL A O    7  
ATOM 7952  C CB   . VAL A 1 7  ? -1.482  6.876   1.285   1.00 0.00 ? 7  VAL A CB   7  
ATOM 7953  C CG1  . VAL A 1 7  ? -2.568  5.816   1.489   1.00 0.00 ? 7  VAL A CG1  7  
ATOM 7954  C CG2  . VAL A 1 7  ? -1.877  8.186   2.010   1.00 0.00 ? 7  VAL A CG2  7  
ATOM 7955  H H    . VAL A 1 7  ? 0.791   8.057   0.900   1.00 0.00 ? 7  VAL A H    7  
ATOM 7956  H HA   . VAL A 1 7  ? -0.213  6.202   2.903   1.00 0.00 ? 7  VAL A HA   7  
ATOM 7957  H HB   . VAL A 1 7  ? -1.376  7.071   0.227   1.00 0.00 ? 7  VAL A HB   7  
ATOM 7958  H HG11 . VAL A 1 7  ? -2.453  5.037   0.750   1.00 0.00 ? 7  VAL A HG11 7  
ATOM 7959  H HG12 . VAL A 1 7  ? -3.539  6.274   1.381   1.00 0.00 ? 7  VAL A HG12 7  
ATOM 7960  H HG13 . VAL A 1 7  ? -2.477  5.391   2.477   1.00 0.00 ? 7  VAL A HG13 7  
ATOM 7961  H HG21 . VAL A 1 7  ? -1.542  8.157   3.038   1.00 0.00 ? 7  VAL A HG21 7  
ATOM 7962  H HG22 . VAL A 1 7  ? -2.951  8.309   1.991   1.00 0.00 ? 7  VAL A HG22 7  
ATOM 7963  H HG23 . VAL A 1 7  ? -1.419  9.027   1.510   1.00 0.00 ? 7  VAL A HG23 7  
ATOM 7964  N N    . CYS A 1 8  ? 0.718   4.873   0.053   1.00 0.00 ? 8  CYS A N    7  
ATOM 7965  C CA   . CYS A 1 8  ? 1.027   3.523   -0.521  1.00 0.00 ? 8  CYS A CA   7  
ATOM 7966  C C    . CYS A 1 8  ? 1.993   2.786   0.401   1.00 0.00 ? 8  CYS A C    7  
ATOM 7967  O O    . CYS A 1 8  ? 1.822   1.614   0.672   1.00 0.00 ? 8  CYS A O    7  
ATOM 7968  C CB   . CYS A 1 8  ? 1.649   3.690   -1.909  1.00 0.00 ? 8  CYS A CB   7  
ATOM 7969  S SG   . CYS A 1 8  ? 2.240   2.088   -2.525  1.00 0.00 ? 8  CYS A SG   7  
ATOM 7970  H H    . CYS A 1 8  ? 0.937   5.675   -0.464  1.00 0.00 ? 8  CYS A H    7  
ATOM 7971  H HA   . CYS A 1 8  ? 0.120   2.941   -0.613  1.00 0.00 ? 8  CYS A HA   7  
ATOM 7972  H HB2  . CYS A 1 8  ? 0.900   4.071   -2.579  1.00 0.00 ? 8  CYS A HB2  7  
ATOM 7973  H HB3  . CYS A 1 8  ? 2.468   4.384   -1.858  1.00 0.00 ? 8  CYS A HB3  7  
ATOM 7974  N N    . GLU A 1 9  ? 3.004   3.447   0.895   1.00 0.00 ? 9  GLU A N    7  
ATOM 7975  C CA   . GLU A 1 9  ? 3.951   2.749   1.797   1.00 0.00 ? 9  GLU A CA   7  
ATOM 7976  C C    . GLU A 1 9  ? 3.231   2.423   3.104   1.00 0.00 ? 9  GLU A C    7  
ATOM 7977  O O    . GLU A 1 9  ? 3.535   1.439   3.749   1.00 0.00 ? 9  GLU A O    7  
ATOM 7978  C CB   . GLU A 1 9  ? 5.159   3.664   2.089   1.00 0.00 ? 9  GLU A CB   7  
ATOM 7979  C CG   . GLU A 1 9  ? 6.242   3.471   1.023   1.00 0.00 ? 9  GLU A CG   7  
ATOM 7980  C CD   . GLU A 1 9  ? 7.347   4.510   1.225   1.00 0.00 ? 9  GLU A CD   7  
ATOM 7981  O OE1  . GLU A 1 9  ? 7.016   5.657   1.474   1.00 0.00 ? 9  GLU A OE1  7  
ATOM 7982  O OE2  . GLU A 1 9  ? 8.506   4.139   1.128   1.00 0.00 ? 9  GLU A OE2  7  
ATOM 7983  H H    . GLU A 1 9  ? 3.146   4.391   0.677   1.00 0.00 ? 9  GLU A H    7  
ATOM 7984  H HA   . GLU A 1 9  ? 4.284   1.839   1.319   1.00 0.00 ? 9  GLU A HA   7  
ATOM 7985  H HB2  . GLU A 1 9  ? 4.835   4.694   2.085   1.00 0.00 ? 9  GLU A HB2  7  
ATOM 7986  H HB3  . GLU A 1 9  ? 5.574   3.424   3.059   1.00 0.00 ? 9  GLU A HB3  7  
ATOM 7987  H HG2  . GLU A 1 9  ? 6.659   2.478   1.110   1.00 0.00 ? 9  GLU A HG2  7  
ATOM 7988  H HG3  . GLU A 1 9  ? 5.809   3.596   0.045   1.00 0.00 ? 9  GLU A HG3  7  
ATOM 7989  N N    . PHE A 1 10 ? 2.275   3.218   3.515   1.00 0.00 ? 10 PHE A N    7  
ATOM 7990  C CA   . PHE A 1 10 ? 1.576   2.890   4.784   1.00 0.00 ? 10 PHE A CA   7  
ATOM 7991  C C    . PHE A 1 10 ? 0.733   1.619   4.600   1.00 0.00 ? 10 PHE A C    7  
ATOM 7992  O O    . PHE A 1 10 ? 0.789   0.710   5.404   1.00 0.00 ? 10 PHE A O    7  
ATOM 7993  C CB   . PHE A 1 10 ? 0.669   4.042   5.209   1.00 0.00 ? 10 PHE A CB   7  
ATOM 7994  C CG   . PHE A 1 10 ? 0.000   3.659   6.501   1.00 0.00 ? 10 PHE A CG   7  
ATOM 7995  C CD1  . PHE A 1 10 ? 0.683   3.814   7.712   1.00 0.00 ? 10 PHE A CD1  7  
ATOM 7996  C CD2  . PHE A 1 10 ? -1.291  3.121   6.487   1.00 0.00 ? 10 PHE A CD2  7  
ATOM 7997  C CE1  . PHE A 1 10 ? 0.073   3.436   8.912   1.00 0.00 ? 10 PHE A CE1  7  
ATOM 7998  C CE2  . PHE A 1 10 ? -1.902  2.739   7.688   1.00 0.00 ? 10 PHE A CE2  7  
ATOM 7999  C CZ   . PHE A 1 10 ? -1.219  2.897   8.900   1.00 0.00 ? 10 PHE A CZ   7  
ATOM 8000  H H    . PHE A 1 10 ? 2.018   4.022   3.013   1.00 0.00 ? 10 PHE A H    7  
ATOM 8001  H HA   . PHE A 1 10 ? 2.312   2.717   5.547   1.00 0.00 ? 10 PHE A HA   7  
ATOM 8002  H HB2  . PHE A 1 10 ? 1.259   4.937   5.353   1.00 0.00 ? 10 PHE A HB2  7  
ATOM 8003  H HB3  . PHE A 1 10 ? -0.080  4.216   4.450   1.00 0.00 ? 10 PHE A HB3  7  
ATOM 8004  H HD1  . PHE A 1 10 ? 1.679   4.230   7.720   1.00 0.00 ? 10 PHE A HD1  7  
ATOM 8005  H HD2  . PHE A 1 10 ? -1.816  3.005   5.550   1.00 0.00 ? 10 PHE A HD2  7  
ATOM 8006  H HE1  . PHE A 1 10 ? 0.601   3.556   9.848   1.00 0.00 ? 10 PHE A HE1  7  
ATOM 8007  H HE2  . PHE A 1 10 ? -2.898  2.319   7.680   1.00 0.00 ? 10 PHE A HE2  7  
ATOM 8008  H HZ   . PHE A 1 10 ? -1.687  2.603   9.824   1.00 0.00 ? 10 PHE A HZ   7  
ATOM 8009  N N    . LEU A 1 11 ? -0.040  1.536   3.544   1.00 0.00 ? 11 LEU A N    7  
ATOM 8010  C CA   . LEU A 1 11 ? -0.863  0.307   3.325   1.00 0.00 ? 11 LEU A CA   7  
ATOM 8011  C C    . LEU A 1 11 ? 0.067   -0.893  3.166   1.00 0.00 ? 11 LEU A C    7  
ATOM 8012  O O    . LEU A 1 11 ? -0.173  -1.946  3.723   1.00 0.00 ? 11 LEU A O    7  
ATOM 8013  C CB   . LEU A 1 11 ? -1.717  0.445   2.052   1.00 0.00 ? 11 LEU A CB   7  
ATOM 8014  C CG   . LEU A 1 11 ? -2.811  1.512   2.256   1.00 0.00 ? 11 LEU A CG   7  
ATOM 8015  C CD1  . LEU A 1 11 ? -3.308  2.008   0.894   1.00 0.00 ? 11 LEU A CD1  7  
ATOM 8016  C CD2  . LEU A 1 11 ? -4.002  0.924   3.029   1.00 0.00 ? 11 LEU A CD2  7  
ATOM 8017  H H    . LEU A 1 11 ? -0.073  2.273   2.900   1.00 0.00 ? 11 LEU A H    7  
ATOM 8018  H HA   . LEU A 1 11 ? -1.515  0.135   4.168   1.00 0.00 ? 11 LEU A HA   7  
ATOM 8019  H HB2  . LEU A 1 11 ? -1.081  0.734   1.222   1.00 0.00 ? 11 LEU A HB2  7  
ATOM 8020  H HB3  . LEU A 1 11 ? -2.182  -0.515  1.831   1.00 0.00 ? 11 LEU A HB3  7  
ATOM 8021  H HG   . LEU A 1 11 ? -2.399  2.345   2.808   1.00 0.00 ? 11 LEU A HG   7  
ATOM 8022  H HD11 . LEU A 1 11 ? -4.100  2.728   1.039   1.00 0.00 ? 11 LEU A HD11 7  
ATOM 8023  H HD12 . LEU A 1 11 ? -3.683  1.172   0.321   1.00 0.00 ? 11 LEU A HD12 7  
ATOM 8024  H HD13 . LEU A 1 11 ? -2.492  2.472   0.360   1.00 0.00 ? 11 LEU A HD13 7  
ATOM 8025  H HD21 . LEU A 1 11 ? -3.726  0.768   4.061   1.00 0.00 ? 11 LEU A HD21 7  
ATOM 8026  H HD22 . LEU A 1 11 ? -4.297  -0.016  2.588   1.00 0.00 ? 11 LEU A HD22 7  
ATOM 8027  H HD23 . LEU A 1 11 ? -4.832  1.614   2.982   1.00 0.00 ? 11 LEU A HD23 7  
ATOM 8028  N N    . VAL A 1 12 ? 1.128   -0.757  2.421   1.00 0.00 ? 12 VAL A N    7  
ATOM 8029  C CA   . VAL A 1 12 ? 2.058   -1.902  2.244   1.00 0.00 ? 12 VAL A CA   7  
ATOM 8030  C C    . VAL A 1 12 ? 2.599   -2.335  3.619   1.00 0.00 ? 12 VAL A C    7  
ATOM 8031  O O    . VAL A 1 12 ? 2.629   -3.502  3.943   1.00 0.00 ? 12 VAL A O    7  
ATOM 8032  C CB   . VAL A 1 12 ? 3.212   -1.449  1.329   1.00 0.00 ? 12 VAL A CB   7  
ATOM 8033  C CG1  . VAL A 1 12 ? 4.436   -2.352  1.503   1.00 0.00 ? 12 VAL A CG1  7  
ATOM 8034  C CG2  . VAL A 1 12 ? 2.754   -1.506  -0.132  1.00 0.00 ? 12 VAL A CG2  7  
ATOM 8035  H H    . VAL A 1 12 ? 1.325   0.085   1.961   1.00 0.00 ? 12 VAL A H    7  
ATOM 8036  H HA   . VAL A 1 12 ? 1.535   -2.735  1.790   1.00 0.00 ? 12 VAL A HA   7  
ATOM 8037  H HB   . VAL A 1 12 ? 3.483   -0.433  1.577   1.00 0.00 ? 12 VAL A HB   7  
ATOM 8038  H HG11 . VAL A 1 12 ? 5.134   -2.162  0.702   1.00 0.00 ? 12 VAL A HG11 7  
ATOM 8039  H HG12 . VAL A 1 12 ? 4.125   -3.386  1.480   1.00 0.00 ? 12 VAL A HG12 7  
ATOM 8040  H HG13 . VAL A 1 12 ? 4.912   -2.139  2.450   1.00 0.00 ? 12 VAL A HG13 7  
ATOM 8041  H HG21 . VAL A 1 12 ? 2.582   -2.534  -0.417  1.00 0.00 ? 12 VAL A HG21 7  
ATOM 8042  H HG22 . VAL A 1 12 ? 3.518   -1.079  -0.766  1.00 0.00 ? 12 VAL A HG22 7  
ATOM 8043  H HG23 . VAL A 1 12 ? 1.840   -0.943  -0.244  1.00 0.00 ? 12 VAL A HG23 7  
ATOM 8044  N N    . LYS A 1 13 ? 3.021   -1.391  4.423   1.00 0.00 ? 13 LYS A N    7  
ATOM 8045  C CA   . LYS A 1 13 ? 3.566   -1.723  5.777   1.00 0.00 ? 13 LYS A CA   7  
ATOM 8046  C C    . LYS A 1 13 ? 2.511   -2.487  6.587   1.00 0.00 ? 13 LYS A C    7  
ATOM 8047  O O    . LYS A 1 13 ? 2.808   -3.452  7.268   1.00 0.00 ? 13 LYS A O    7  
ATOM 8048  C CB   . LYS A 1 13 ? 3.917   -0.405  6.493   1.00 0.00 ? 13 LYS A CB   7  
ATOM 8049  C CG   . LYS A 1 13 ? 4.508   -0.665  7.896   1.00 0.00 ? 13 LYS A CG   7  
ATOM 8050  C CD   . LYS A 1 13 ? 6.025   -0.932  7.800   1.00 0.00 ? 13 LYS A CD   7  
ATOM 8051  C CE   . LYS A 1 13 ? 6.798   0.393   7.812   1.00 0.00 ? 13 LYS A CE   7  
ATOM 8052  N NZ   . LYS A 1 13 ? 8.261   0.112   7.807   1.00 0.00 ? 13 LYS A NZ   7  
ATOM 8053  H H    . LYS A 1 13 ? 2.990   -0.455  4.131   1.00 0.00 ? 13 LYS A H    7  
ATOM 8054  H HA   . LYS A 1 13 ? 4.454   -2.326  5.661   1.00 0.00 ? 13 LYS A HA   7  
ATOM 8055  H HB2  . LYS A 1 13 ? 4.634   0.138   5.896   1.00 0.00 ? 13 LYS A HB2  7  
ATOM 8056  H HB3  . LYS A 1 13 ? 3.021   0.189   6.591   1.00 0.00 ? 13 LYS A HB3  7  
ATOM 8057  H HG2  . LYS A 1 13 ? 4.331   0.202   8.519   1.00 0.00 ? 13 LYS A HG2  7  
ATOM 8058  H HG3  . LYS A 1 13 ? 4.026   -1.518  8.347   1.00 0.00 ? 13 LYS A HG3  7  
ATOM 8059  H HD2  . LYS A 1 13 ? 6.336   -1.532  8.644   1.00 0.00 ? 13 LYS A HD2  7  
ATOM 8060  H HD3  . LYS A 1 13 ? 6.244   -1.464  6.886   1.00 0.00 ? 13 LYS A HD3  7  
ATOM 8061  H HE2  . LYS A 1 13 ? 6.542   0.970   6.937   1.00 0.00 ? 13 LYS A HE2  7  
ATOM 8062  H HE3  . LYS A 1 13 ? 6.542   0.952   8.700   1.00 0.00 ? 13 LYS A HE3  7  
ATOM 8063  H HZ1  . LYS A 1 13 ? 8.756   0.855   7.276   1.00 0.00 ? 13 LYS A HZ1  7  
ATOM 8064  H HZ2  . LYS A 1 13 ? 8.435   -0.811  7.358   1.00 0.00 ? 13 LYS A HZ2  7  
ATOM 8065  H HZ3  . LYS A 1 13 ? 8.615   0.092   8.785   1.00 0.00 ? 13 LYS A HZ3  7  
ATOM 8066  N N    . GLU A 1 14 ? 1.289   -2.047  6.533   1.00 0.00 ? 14 GLU A N    7  
ATOM 8067  C CA   . GLU A 1 14 ? 0.218   -2.722  7.317   1.00 0.00 ? 14 GLU A CA   7  
ATOM 8068  C C    . GLU A 1 14 ? -0.124  -4.068  6.695   1.00 0.00 ? 14 GLU A C    7  
ATOM 8069  O O    . GLU A 1 14 ? -0.386  -5.026  7.394   1.00 0.00 ? 14 GLU A O    7  
ATOM 8070  C CB   . GLU A 1 14 ? -1.039  -1.852  7.332   1.00 0.00 ? 14 GLU A CB   7  
ATOM 8071  C CG   . GLU A 1 14 ? -0.841  -0.641  8.250   1.00 0.00 ? 14 GLU A CG   7  
ATOM 8072  C CD   . GLU A 1 14 ? -2.205  -0.043  8.596   1.00 0.00 ? 14 GLU A CD   7  
ATOM 8073  O OE1  . GLU A 1 14 ? -3.057  -0.016  7.722   1.00 0.00 ? 14 GLU A OE1  7  
ATOM 8074  O OE2  . GLU A 1 14 ? -2.380  0.366   9.729   1.00 0.00 ? 14 GLU A OE2  7  
ATOM 8075  H H    . GLU A 1 14 ? 1.081   -1.268  5.974   1.00 0.00 ? 14 GLU A H    7  
ATOM 8076  H HA   . GLU A 1 14 ? 0.558   -2.882  8.328   1.00 0.00 ? 14 GLU A HA   7  
ATOM 8077  H HB2  . GLU A 1 14 ? -1.246  -1.510  6.328   1.00 0.00 ? 14 GLU A HB2  7  
ATOM 8078  H HB3  . GLU A 1 14 ? -1.870  -2.440  7.689   1.00 0.00 ? 14 GLU A HB3  7  
ATOM 8079  H HG2  . GLU A 1 14 ? -0.344  -0.946  9.159   1.00 0.00 ? 14 GLU A HG2  7  
ATOM 8080  H HG3  . GLU A 1 14 ? -0.243  0.102   7.743   1.00 0.00 ? 14 GLU A HG3  7  
ATOM 8081  N N    . VAL A 1 15 ? -0.144  -4.166  5.401   1.00 0.00 ? 15 VAL A N    7  
ATOM 8082  C CA   . VAL A 1 15 ? -0.500  -5.467  4.790   1.00 0.00 ? 15 VAL A CA   7  
ATOM 8083  C C    . VAL A 1 15 ? 0.570   -6.512  5.120   1.00 0.00 ? 15 VAL A C    7  
ATOM 8084  O O    . VAL A 1 15 ? 0.254   -7.647  5.390   1.00 0.00 ? 15 VAL A O    7  
ATOM 8085  C CB   . VAL A 1 15 ? -0.658  -5.306  3.266   1.00 0.00 ? 15 VAL A CB   7  
ATOM 8086  C CG1  . VAL A 1 15 ? -0.605  -6.677  2.575   1.00 0.00 ? 15 VAL A CG1  7  
ATOM 8087  C CG2  . VAL A 1 15 ? -2.007  -4.648  2.964   1.00 0.00 ? 15 VAL A CG2  7  
ATOM 8088  H H    . VAL A 1 15 ? 0.061   -3.396  4.832   1.00 0.00 ? 15 VAL A H    7  
ATOM 8089  H HA   . VAL A 1 15 ? -1.436  -5.796  5.219   1.00 0.00 ? 15 VAL A HA   7  
ATOM 8090  H HB   . VAL A 1 15 ? 0.135   -4.682  2.885   1.00 0.00 ? 15 VAL A HB   7  
ATOM 8091  H HG11 . VAL A 1 15 ? -0.878  -6.566  1.537   1.00 0.00 ? 15 VAL A HG11 7  
ATOM 8092  H HG12 . VAL A 1 15 ? -1.294  -7.351  3.060   1.00 0.00 ? 15 VAL A HG12 7  
ATOM 8093  H HG13 . VAL A 1 15 ? 0.397   -7.078  2.642   1.00 0.00 ? 15 VAL A HG13 7  
ATOM 8094  H HG21 . VAL A 1 15 ? -2.806  -5.275  3.330   1.00 0.00 ? 15 VAL A HG21 7  
ATOM 8095  H HG22 . VAL A 1 15 ? -2.113  -4.516  1.898   1.00 0.00 ? 15 VAL A HG22 7  
ATOM 8096  H HG23 . VAL A 1 15 ? -2.054  -3.684  3.451   1.00 0.00 ? 15 VAL A HG23 7  
ATOM 8097  N N    . THR A 1 16 ? 1.833   -6.179  5.076   1.00 0.00 ? 16 THR A N    7  
ATOM 8098  C CA   . THR A 1 16 ? 2.830   -7.247  5.362   1.00 0.00 ? 16 THR A CA   7  
ATOM 8099  C C    . THR A 1 16 ? 2.700   -7.736  6.800   1.00 0.00 ? 16 THR A C    7  
ATOM 8100  O O    . THR A 1 16 ? 2.795   -8.920  7.057   1.00 0.00 ? 16 THR A O    7  
ATOM 8101  C CB   . THR A 1 16 ? 4.275   -6.812  5.118   1.00 0.00 ? 16 THR A CB   7  
ATOM 8102  O OG1  . THR A 1 16 ? 4.819   -6.280  6.318   1.00 0.00 ? 16 THR A OG1  7  
ATOM 8103  C CG2  . THR A 1 16 ? 4.375   -5.764  4.005   1.00 0.00 ? 16 THR A CG2  7  
ATOM 8104  H H    . THR A 1 16 ? 2.109   -5.270  4.836   1.00 0.00 ? 16 THR A H    7  
ATOM 8105  H HA   . THR A 1 16 ? 2.610   -8.065  4.703   1.00 0.00 ? 16 THR A HA   7  
ATOM 8106  H HB   . THR A 1 16 ? 4.835   -7.691  4.828   1.00 0.00 ? 16 THR A HB   7  
ATOM 8107  H HG1  . THR A 1 16 ? 4.815   -6.976  6.979   1.00 0.00 ? 16 THR A HG1  7  
ATOM 8108  H HG21 . THR A 1 16 ? 5.242   -5.969  3.392   1.00 0.00 ? 16 THR A HG21 7  
ATOM 8109  H HG22 . THR A 1 16 ? 4.480   -4.787  4.448   1.00 0.00 ? 16 THR A HG22 7  
ATOM 8110  H HG23 . THR A 1 16 ? 3.492   -5.792  3.392   1.00 0.00 ? 16 THR A HG23 7  
ATOM 8111  N N    . LYS A 1 17 ? 2.476   -6.868  7.748   1.00 0.00 ? 17 LYS A N    7  
ATOM 8112  C CA   . LYS A 1 17 ? 2.342   -7.384  9.134   1.00 0.00 ? 17 LYS A CA   7  
ATOM 8113  C C    . LYS A 1 17 ? 1.132   -8.313  9.148   1.00 0.00 ? 17 LYS A C    7  
ATOM 8114  O O    . LYS A 1 17 ? 1.079   -9.295  9.862   1.00 0.00 ? 17 LYS A O    7  
ATOM 8115  C CB   . LYS A 1 17 ? 2.133   -6.236  10.137  1.00 0.00 ? 17 LYS A CB   7  
ATOM 8116  C CG   . LYS A 1 17 ? 1.553   -6.804  11.445  1.00 0.00 ? 17 LYS A CG   7  
ATOM 8117  C CD   . LYS A 1 17 ? 1.794   -5.844  12.605  1.00 0.00 ? 17 LYS A CD   7  
ATOM 8118  C CE   . LYS A 1 17 ? 1.273   -6.491  13.894  1.00 0.00 ? 17 LYS A CE   7  
ATOM 8119  N NZ   . LYS A 1 17 ? 1.780   -5.734  15.073  1.00 0.00 ? 17 LYS A NZ   7  
ATOM 8120  H H    . LYS A 1 17 ? 2.378   -5.913  7.549   1.00 0.00 ? 17 LYS A H    7  
ATOM 8121  H HA   . LYS A 1 17 ? 3.246   -7.923  9.383   1.00 0.00 ? 17 LYS A HA   7  
ATOM 8122  H HB2  . LYS A 1 17 ? 3.081   -5.758  10.338  1.00 0.00 ? 17 LYS A HB2  7  
ATOM 8123  H HB3  . LYS A 1 17 ? 1.447   -5.514  9.722   1.00 0.00 ? 17 LYS A HB3  7  
ATOM 8124  H HG2  . LYS A 1 17 ? 0.491   -6.957  11.326  1.00 0.00 ? 17 LYS A HG2  7  
ATOM 8125  H HG3  . LYS A 1 17 ? 2.025   -7.750  11.665  1.00 0.00 ? 17 LYS A HG3  7  
ATOM 8126  H HD2  . LYS A 1 17 ? 2.852   -5.645  12.698  1.00 0.00 ? 17 LYS A HD2  7  
ATOM 8127  H HD3  . LYS A 1 17 ? 1.264   -4.919  12.427  1.00 0.00 ? 17 LYS A HD3  7  
ATOM 8128  H HE2  . LYS A 1 17 ? 0.193   -6.474  13.892  1.00 0.00 ? 17 LYS A HE2  7  
ATOM 8129  H HE3  . LYS A 1 17 ? 1.614   -7.518  13.948  1.00 0.00 ? 17 LYS A HE3  7  
ATOM 8130  H HZ1  . LYS A 1 17 ? 2.680   -5.274  14.829  1.00 0.00 ? 17 LYS A HZ1  7  
ATOM 8131  H HZ2  . LYS A 1 17 ? 1.928   -6.390  15.867  1.00 0.00 ? 17 LYS A HZ2  7  
ATOM 8132  H HZ3  . LYS A 1 17 ? 1.085   -5.009  15.345  1.00 0.00 ? 17 LYS A HZ3  7  
ATOM 8133  N N    . LEU A 1 18 ? 0.159   -7.989  8.344   1.00 0.00 ? 18 LEU A N    7  
ATOM 8134  C CA   . LEU A 1 18 ? -1.071  -8.815  8.266   1.00 0.00 ? 18 LEU A CA   7  
ATOM 8135  C C    . LEU A 1 18 ? -0.709  -10.123 7.552   1.00 0.00 ? 18 LEU A C    7  
ATOM 8136  O O    . LEU A 1 18 ? -1.179  -11.188 7.903   1.00 0.00 ? 18 LEU A O    7  
ATOM 8137  C CB   . LEU A 1 18 ? -2.152  -8.043  7.483   1.00 0.00 ? 18 LEU A CB   7  
ATOM 8138  C CG   . LEU A 1 18 ? -2.743  -6.801  8.260   1.00 0.00 ? 18 LEU A CG   7  
ATOM 8139  C CD1  . LEU A 1 18 ? -4.263  -6.926  8.386   1.00 0.00 ? 18 LEU A CD1  7  
ATOM 8140  C CD2  . LEU A 1 18 ? -2.179  -6.630  9.684   1.00 0.00 ? 18 LEU A CD2  7  
ATOM 8141  H H    . LEU A 1 18 ? 0.243   -7.192  7.780   1.00 0.00 ? 18 LEU A H    7  
ATOM 8142  H HA   . LEU A 1 18 ? -1.424  -9.067  9.250   1.00 0.00 ? 18 LEU A HA   7  
ATOM 8143  H HB2  . LEU A 1 18 ? -1.716  -7.698  6.563   1.00 0.00 ? 18 LEU A HB2  7  
ATOM 8144  H HB3  . LEU A 1 18 ? -2.942  -8.719  7.236   1.00 0.00 ? 18 LEU A HB3  7  
ATOM 8145  H HG   . LEU A 1 18 ? -2.530  -5.902  7.693   1.00 0.00 ? 18 LEU A HG   7  
ATOM 8146  H HD11 . LEU A 1 18 ? -4.670  -5.997  8.752   1.00 0.00 ? 18 LEU A HD11 7  
ATOM 8147  H HD12 . LEU A 1 18 ? -4.501  -7.714  9.082   1.00 0.00 ? 18 LEU A HD12 7  
ATOM 8148  H HD13 . LEU A 1 18 ? -4.686  -7.153  7.419   1.00 0.00 ? 18 LEU A HD13 7  
ATOM 8149  H HD21 . LEU A 1 18 ? -1.107  -6.626  9.660   1.00 0.00 ? 18 LEU A HD21 7  
ATOM 8150  H HD22 . LEU A 1 18 ? -2.531  -7.427  10.318  1.00 0.00 ? 18 LEU A HD22 7  
ATOM 8151  H HD23 . LEU A 1 18 ? -2.524  -5.687  10.085  1.00 0.00 ? 18 LEU A HD23 7  
ATOM 8152  N N    . ILE A 1 19 ? 0.155   -10.048 6.576   1.00 0.00 ? 19 ILE A N    7  
ATOM 8153  C CA   . ILE A 1 19 ? 0.593   -11.278 5.859   1.00 0.00 ? 19 ILE A CA   7  
ATOM 8154  C C    . ILE A 1 19 ? 1.473   -12.066 6.822   1.00 0.00 ? 19 ILE A C    7  
ATOM 8155  O O    . ILE A 1 19 ? 1.506   -13.280 6.812   1.00 0.00 ? 19 ILE A O    7  
ATOM 8156  C CB   . ILE A 1 19 ? 1.402   -10.891 4.607   1.00 0.00 ? 19 ILE A CB   7  
ATOM 8157  C CG1  . ILE A 1 19 ? 0.456   -10.266 3.567   1.00 0.00 ? 19 ILE A CG1  7  
ATOM 8158  C CG2  . ILE A 1 19 ? 2.075   -12.129 4.009   1.00 0.00 ? 19 ILE A CG2  7  
ATOM 8159  C CD1  . ILE A 1 19 ? 1.255   -9.761  2.360   1.00 0.00 ? 19 ILE A CD1  7  
ATOM 8160  H H    . ILE A 1 19 ? 0.535   -9.185  6.337   1.00 0.00 ? 19 ILE A H    7  
ATOM 8161  H HA   . ILE A 1 19 ? -0.270  -11.866 5.580   1.00 0.00 ? 19 ILE A HA   7  
ATOM 8162  H HB   . ILE A 1 19 ? 2.167   -10.178 4.880   1.00 0.00 ? 19 ILE A HB   7  
ATOM 8163  H HG12 . ILE A 1 19 ? -0.257  -11.005 3.241   1.00 0.00 ? 19 ILE A HG12 7  
ATOM 8164  H HG13 . ILE A 1 19 ? -0.072  -9.442  4.012   1.00 0.00 ? 19 ILE A HG13 7  
ATOM 8165  H HG21 . ILE A 1 19 ? 2.840   -12.485 4.680   1.00 0.00 ? 19 ILE A HG21 7  
ATOM 8166  H HG22 . ILE A 1 19 ? 2.530   -11.871 3.063   1.00 0.00 ? 19 ILE A HG22 7  
ATOM 8167  H HG23 . ILE A 1 19 ? 1.338   -12.902 3.855   1.00 0.00 ? 19 ILE A HG23 7  
ATOM 8168  H HD11 . ILE A 1 19 ? 2.052   -9.120  2.698   1.00 0.00 ? 19 ILE A HD11 7  
ATOM 8169  H HD12 . ILE A 1 19 ? 0.603   -9.209  1.701   1.00 0.00 ? 19 ILE A HD12 7  
ATOM 8170  H HD13 . ILE A 1 19 ? 1.673   -10.603 1.828   1.00 0.00 ? 19 ILE A HD13 7  
ATOM 8171  N N    . ASP A 1 20 ? 2.190   -11.364 7.654   1.00 0.00 ? 20 ASP A N    7  
ATOM 8172  C CA   . ASP A 1 20 ? 3.084   -12.031 8.631   1.00 0.00 ? 20 ASP A CA   7  
ATOM 8173  C C    . ASP A 1 20 ? 2.268   -12.611 9.789   1.00 0.00 ? 20 ASP A C    7  
ATOM 8174  O O    . ASP A 1 20 ? 2.707   -13.530 10.450  1.00 0.00 ? 20 ASP A O    7  
ATOM 8175  C CB   . ASP A 1 20 ? 4.084   -11.011 9.178   1.00 0.00 ? 20 ASP A CB   7  
ATOM 8176  C CG   . ASP A 1 20 ? 4.798   -10.322 8.014   1.00 0.00 ? 20 ASP A CG   7  
ATOM 8177  O OD1  . ASP A 1 20 ? 5.095   -10.997 7.043   1.00 0.00 ? 20 ASP A OD1  7  
ATOM 8178  O OD2  . ASP A 1 20 ? 5.036   -9.129  8.114   1.00 0.00 ? 20 ASP A OD2  7  
ATOM 8179  H H    . ASP A 1 20 ? 2.140   -10.385 7.631   1.00 0.00 ? 20 ASP A H    7  
ATOM 8180  H HA   . ASP A 1 20 ? 3.624   -12.831 8.146   1.00 0.00 ? 20 ASP A HA   7  
ATOM 8181  H HB2  . ASP A 1 20 ? 3.558   -10.273 9.768   1.00 0.00 ? 20 ASP A HB2  7  
ATOM 8182  H HB3  . ASP A 1 20 ? 4.812   -11.515 9.796   1.00 0.00 ? 20 ASP A HB3  7  
ATOM 8183  N N    . ASN A 1 21 ? 1.088   -12.085 10.058  1.00 0.00 ? 21 ASN A N    7  
ATOM 8184  C CA   . ASN A 1 21 ? 0.285   -12.636 11.202  1.00 0.00 ? 21 ASN A CA   7  
ATOM 8185  C C    . ASN A 1 21 ? -0.579  -13.808 10.709  1.00 0.00 ? 21 ASN A C    7  
ATOM 8186  O O    . ASN A 1 21 ? -1.275  -14.430 11.481  1.00 0.00 ? 21 ASN A O    7  
ATOM 8187  C CB   . ASN A 1 21 ? -0.572  -11.543 11.847  1.00 0.00 ? 21 ASN A CB   7  
ATOM 8188  C CG   . ASN A 1 21 ? -1.244  -12.093 13.106  1.00 0.00 ? 21 ASN A CG   7  
ATOM 8189  O OD1  . ASN A 1 21 ? -0.798  -11.838 14.207  1.00 0.00 ? 21 ASN A OD1  7  
ATOM 8190  N ND2  . ASN A 1 21 ? -2.304  -12.845 12.991  1.00 0.00 ? 21 ASN A ND2  7  
ATOM 8191  H H    . ASN A 1 21 ? 0.746   -11.342 9.518   1.00 0.00 ? 21 ASN A H    7  
ATOM 8192  H HA   . ASN A 1 21 ? 0.985   -13.043 11.918  1.00 0.00 ? 21 ASN A HA   7  
ATOM 8193  H HB2  . ASN A 1 21 ? 0.056   -10.702 12.110  1.00 0.00 ? 21 ASN A HB2  7  
ATOM 8194  H HB3  . ASN A 1 21 ? -1.328  -11.221 11.148  1.00 0.00 ? 21 ASN A HB3  7  
ATOM 8195  H HD21 . ASN A 1 21 ? -2.664  -13.051 12.103  1.00 0.00 ? 21 ASN A HD21 7  
ATOM 8196  H HD22 . ASN A 1 21 ? -2.741  -13.202 13.792  1.00 0.00 ? 21 ASN A HD22 7  
ATOM 8197  N N    . ASN A 1 22 ? -0.471  -14.154 9.446   1.00 0.00 ? 22 ASN A N    7  
ATOM 8198  C CA   . ASN A 1 22 ? -1.208  -15.349 8.891   1.00 0.00 ? 22 ASN A CA   7  
ATOM 8199  C C    . ASN A 1 22 ? -2.690  -15.074 8.585   1.00 0.00 ? 22 ASN A C    7  
ATOM 8200  O O    . ASN A 1 22 ? -3.530  -15.916 8.839   1.00 0.00 ? 22 ASN A O    7  
ATOM 8201  C CB   . ASN A 1 22 ? -1.125  -16.524 9.888   1.00 0.00 ? 22 ASN A CB   7  
ATOM 8202  C CG   . ASN A 1 22 ? 0.243   -16.529 10.573  1.00 0.00 ? 22 ASN A CG   7  
ATOM 8203  O OD1  . ASN A 1 22 ? 1.260   -16.379 9.924   1.00 0.00 ? 22 ASN A OD1  7  
ATOM 8204  N ND2  . ASN A 1 22 ? 0.313   -16.695 11.865  1.00 0.00 ? 22 ASN A ND2  7  
ATOM 8205  H H    . ASN A 1 22 ? 0.146   -13.655 8.859   1.00 0.00 ? 22 ASN A H    7  
ATOM 8206  H HA   . ASN A 1 22 ? -0.696  -15.659 7.990   1.00 0.00 ? 22 ASN A HA   7  
ATOM 8207  H HB2  . ASN A 1 22 ? -1.905  -16.436 10.631  1.00 0.00 ? 22 ASN A HB2  7  
ATOM 8208  H HB3  . ASN A 1 22 ? -1.255  -17.453 9.353   1.00 0.00 ? 22 ASN A HB3  7  
ATOM 8209  H HD21 . ASN A 1 22 ? -0.507  -16.815 12.389  1.00 0.00 ? 22 ASN A HD21 7  
ATOM 8210  H HD22 . ASN A 1 22 ? 1.185   -16.700 12.313  1.00 0.00 ? 22 ASN A HD22 7  
ATOM 8211  N N    . LYS A 1 23 ? -3.037  -13.944 8.030   1.00 0.00 ? 23 LYS A N    7  
ATOM 8212  C CA   . LYS A 1 23 ? -4.483  -13.688 7.709   1.00 0.00 ? 23 LYS A CA   7  
ATOM 8213  C C    . LYS A 1 23 ? -4.729  -14.049 6.235   1.00 0.00 ? 23 LYS A C    7  
ATOM 8214  O O    . LYS A 1 23 ? -3.841  -13.973 5.408   1.00 0.00 ? 23 LYS A O    7  
ATOM 8215  C CB   . LYS A 1 23 ? -4.810  -12.215 7.962   1.00 0.00 ? 23 LYS A CB   7  
ATOM 8216  C CG   . LYS A 1 23 ? -4.144  -11.722 9.285   1.00 0.00 ? 23 LYS A CG   7  
ATOM 8217  C CD   . LYS A 1 23 ? -5.158  -10.997 10.193  1.00 0.00 ? 23 LYS A CD   7  
ATOM 8218  C CE   . LYS A 1 23 ? -4.529  -10.742 11.565  1.00 0.00 ? 23 LYS A CE   7  
ATOM 8219  N NZ   . LYS A 1 23 ? -5.569  -10.221 12.497  1.00 0.00 ? 23 LYS A NZ   7  
ATOM 8220  H H    . LYS A 1 23 ? -2.357  -13.273 7.811   1.00 0.00 ? 23 LYS A H    7  
ATOM 8221  H HA   . LYS A 1 23 ? -5.108  -14.273 8.350   1.00 0.00 ? 23 LYS A HA   7  
ATOM 8222  H HB2  . LYS A 1 23 ? -4.443  -11.652 7.132   1.00 0.00 ? 23 LYS A HB2  7  
ATOM 8223  H HB3  . LYS A 1 23 ? -5.884  -12.098 8.027   1.00 0.00 ? 23 LYS A HB3  7  
ATOM 8224  H HG2  . LYS A 1 23 ? -3.744  -12.564 9.830   1.00 0.00 ? 23 LYS A HG2  7  
ATOM 8225  H HG3  . LYS A 1 23 ? -3.339  -11.043 9.048   1.00 0.00 ? 23 LYS A HG3  7  
ATOM 8226  H HD2  . LYS A 1 23 ? -5.441  -10.052 9.752   1.00 0.00 ? 23 LYS A HD2  7  
ATOM 8227  H HD3  . LYS A 1 23 ? -6.032  -11.615 10.320  1.00 0.00 ? 23 LYS A HD3  7  
ATOM 8228  H HE2  . LYS A 1 23 ? -4.130  -11.665 11.955  1.00 0.00 ? 23 LYS A HE2  7  
ATOM 8229  H HE3  . LYS A 1 23 ? -3.737  -10.017 11.469  1.00 0.00 ? 23 LYS A HE3  7  
ATOM 8230  H HZ1  . LYS A 1 23 ? -6.509  -10.527 12.175  1.00 0.00 ? 23 LYS A HZ1  7  
ATOM 8231  H HZ2  . LYS A 1 23 ? -5.529  -9.181  12.513  1.00 0.00 ? 23 LYS A HZ2  7  
ATOM 8232  H HZ3  . LYS A 1 23 ? -5.395  -10.590 13.452  1.00 0.00 ? 23 LYS A HZ3  7  
ATOM 8233  N N    . THR A 1 24 ? -5.937  -14.446 5.904   1.00 0.00 ? 24 THR A N    7  
ATOM 8234  C CA   . THR A 1 24 ? -6.260  -14.819 4.492   1.00 0.00 ? 24 THR A CA   7  
ATOM 8235  C C    . THR A 1 24 ? -6.501  -13.571 3.636   1.00 0.00 ? 24 THR A C    7  
ATOM 8236  O O    . THR A 1 24 ? -6.731  -12.492 4.142   1.00 0.00 ? 24 THR A O    7  
ATOM 8237  C CB   . THR A 1 24 ? -7.532  -15.676 4.459   1.00 0.00 ? 24 THR A CB   7  
ATOM 8238  O OG1  . THR A 1 24 ? -8.669  -14.829 4.368   1.00 0.00 ? 24 THR A OG1  7  
ATOM 8239  C CG2  . THR A 1 24 ? -7.631  -16.517 5.728   1.00 0.00 ? 24 THR A CG2  7  
ATOM 8240  H H    . THR A 1 24 ? -6.631  -14.503 6.593   1.00 0.00 ? 24 THR A H    7  
ATOM 8241  H HA   . THR A 1 24 ? -5.444  -15.377 4.057   1.00 0.00 ? 24 THR A HA   7  
ATOM 8242  H HB   . THR A 1 24 ? -7.506  -16.332 3.601   1.00 0.00 ? 24 THR A HB   7  
ATOM 8243  H HG1  . THR A 1 24 ? -8.434  -13.976 4.742   1.00 0.00 ? 24 THR A HG1  7  
ATOM 8244  H HG21 . THR A 1 24 ? -6.710  -17.058 5.875   1.00 0.00 ? 24 THR A HG21 7  
ATOM 8245  H HG22 . THR A 1 24 ? -8.449  -17.213 5.630   1.00 0.00 ? 24 THR A HG22 7  
ATOM 8246  H HG23 . THR A 1 24 ? -7.809  -15.870 6.573   1.00 0.00 ? 24 THR A HG23 7  
ATOM 8247  N N    . GLU A 1 25 ? -6.479  -13.727 2.339   1.00 0.00 ? 25 GLU A N    7  
ATOM 8248  C CA   . GLU A 1 25 ? -6.736  -12.564 1.438   1.00 0.00 ? 25 GLU A CA   7  
ATOM 8249  C C    . GLU A 1 25 ? -8.103  -11.973 1.808   1.00 0.00 ? 25 GLU A C    7  
ATOM 8250  O O    . GLU A 1 25 ? -8.268  -10.774 1.908   1.00 0.00 ? 25 GLU A O    7  
ATOM 8251  C CB   . GLU A 1 25 ? -6.723  -13.046 -0.024  1.00 0.00 ? 25 GLU A CB   7  
ATOM 8252  C CG   . GLU A 1 25 ? -7.374  -11.999 -0.955  1.00 0.00 ? 25 GLU A CG   7  
ATOM 8253  C CD   . GLU A 1 25 ? -8.867  -12.300 -1.145  1.00 0.00 ? 25 GLU A CD   7  
ATOM 8254  O OE1  . GLU A 1 25 ? -9.402  -13.075 -0.370  1.00 0.00 ? 25 GLU A OE1  7  
ATOM 8255  O OE2  . GLU A 1 25 ? -9.449  -11.750 -2.066  1.00 0.00 ? 25 GLU A OE2  7  
ATOM 8256  H H    . GLU A 1 25 ? -6.312  -14.621 1.973   1.00 0.00 ? 25 GLU A H    7  
ATOM 8257  H HA   . GLU A 1 25 ? -5.969  -11.815 1.589   1.00 0.00 ? 25 GLU A HA   7  
ATOM 8258  H HB2  . GLU A 1 25 ? -5.698  -13.204 -0.328  1.00 0.00 ? 25 GLU A HB2  7  
ATOM 8259  H HB3  . GLU A 1 25 ? -7.260  -13.981 -0.095  1.00 0.00 ? 25 GLU A HB3  7  
ATOM 8260  H HG2  . GLU A 1 25 ? -7.263  -11.015 -0.529  1.00 0.00 ? 25 GLU A HG2  7  
ATOM 8261  H HG3  . GLU A 1 25 ? -6.884  -12.024 -1.920  1.00 0.00 ? 25 GLU A HG3  7  
ATOM 8262  N N    . LYS A 1 26 ? -9.082  -12.813 2.004   1.00 0.00 ? 26 LYS A N    7  
ATOM 8263  C CA   . LYS A 1 26 ? -10.447 -12.326 2.359   1.00 0.00 ? 26 LYS A CA   7  
ATOM 8264  C C    . LYS A 1 26 ? -10.405 -11.445 3.613   1.00 0.00 ? 26 LYS A C    7  
ATOM 8265  O O    . LYS A 1 26 ? -11.185 -10.525 3.756   1.00 0.00 ? 26 LYS A O    7  
ATOM 8266  C CB   . LYS A 1 26 ? -11.369 -13.528 2.605   1.00 0.00 ? 26 LYS A CB   7  
ATOM 8267  C CG   . LYS A 1 26 ? -12.838 -13.066 2.684   1.00 0.00 ? 26 LYS A CG   7  
ATOM 8268  C CD   . LYS A 1 26 ? -13.459 -13.023 1.281   1.00 0.00 ? 26 LYS A CD   7  
ATOM 8269  C CE   . LYS A 1 26 ? -14.894 -12.500 1.374   1.00 0.00 ? 26 LYS A CE   7  
ATOM 8270  N NZ   . LYS A 1 26 ? -14.871 -11.036 1.648   1.00 0.00 ? 26 LYS A NZ   7  
ATOM 8271  H H    . LYS A 1 26 ? -8.923  -13.774 1.904   1.00 0.00 ? 26 LYS A H    7  
ATOM 8272  H HA   . LYS A 1 26 ? -10.840 -11.741 1.552   1.00 0.00 ? 26 LYS A HA   7  
ATOM 8273  H HB2  . LYS A 1 26 ? -11.253 -14.239 1.799   1.00 0.00 ? 26 LYS A HB2  7  
ATOM 8274  H HB3  . LYS A 1 26 ? -11.094 -14.001 3.536   1.00 0.00 ? 26 LYS A HB3  7  
ATOM 8275  H HG2  . LYS A 1 26 ? -13.398 -13.759 3.297   1.00 0.00 ? 26 LYS A HG2  7  
ATOM 8276  H HG3  . LYS A 1 26 ? -12.890 -12.082 3.126   1.00 0.00 ? 26 LYS A HG3  7  
ATOM 8277  H HD2  . LYS A 1 26 ? -12.879 -12.371 0.647   1.00 0.00 ? 26 LYS A HD2  7  
ATOM 8278  H HD3  . LYS A 1 26 ? -13.468 -14.018 0.862   1.00 0.00 ? 26 LYS A HD3  7  
ATOM 8279  H HE2  . LYS A 1 26 ? -15.405 -12.684 0.440   1.00 0.00 ? 26 LYS A HE2  7  
ATOM 8280  H HE3  . LYS A 1 26 ? -15.412 -13.009 2.173   1.00 0.00 ? 26 LYS A HE3  7  
ATOM 8281  H HZ1  . LYS A 1 26 ? -15.533 -10.552 1.008   1.00 0.00 ? 26 LYS A HZ1  7  
ATOM 8282  H HZ2  . LYS A 1 26 ? -13.909 -10.670 1.495   1.00 0.00 ? 26 LYS A HZ2  7  
ATOM 8283  H HZ3  . LYS A 1 26 ? -15.156 -10.862 2.633   1.00 0.00 ? 26 LYS A HZ3  7  
ATOM 8284  N N    . GLU A 1 27 ? -9.517  -11.715 4.526   1.00 0.00 ? 27 GLU A N    7  
ATOM 8285  C CA   . GLU A 1 27 ? -9.456  -10.884 5.765   1.00 0.00 ? 27 GLU A CA   7  
ATOM 8286  C C    . GLU A 1 27 ? -8.783  -9.533  5.473   1.00 0.00 ? 27 GLU A C    7  
ATOM 8287  O O    . GLU A 1 27 ? -9.153  -8.521  6.033   1.00 0.00 ? 27 GLU A O    7  
ATOM 8288  C CB   . GLU A 1 27 ? -8.649  -11.614 6.840   1.00 0.00 ? 27 GLU A CB   7  
ATOM 8289  C CG   . GLU A 1 27 ? -9.478  -12.738 7.457   1.00 0.00 ? 27 GLU A CG   7  
ATOM 8290  C CD   . GLU A 1 27 ? -8.705  -13.360 8.622   1.00 0.00 ? 27 GLU A CD   7  
ATOM 8291  O OE1  . GLU A 1 27 ? -8.131  -12.609 9.392   1.00 0.00 ? 27 GLU A OE1  7  
ATOM 8292  O OE2  . GLU A 1 27 ? -8.702  -14.575 8.723   1.00 0.00 ? 27 GLU A OE2  7  
ATOM 8293  H H    . GLU A 1 27 ? -8.896  -12.463 4.399   1.00 0.00 ? 27 GLU A H    7  
ATOM 8294  H HA   . GLU A 1 27 ? -10.457 -10.711 6.129   1.00 0.00 ? 27 GLU A HA   7  
ATOM 8295  H HB2  . GLU A 1 27 ? -7.756  -12.030 6.402   1.00 0.00 ? 27 GLU A HB2  7  
ATOM 8296  H HB3  . GLU A 1 27 ? -8.383  -10.914 7.611   1.00 0.00 ? 27 GLU A HB3  7  
ATOM 8297  H HG2  . GLU A 1 27 ? -10.413 -12.339 7.818   1.00 0.00 ? 27 GLU A HG2  7  
ATOM 8298  H HG3  . GLU A 1 27 ? -9.667  -13.493 6.714   1.00 0.00 ? 27 GLU A HG3  7  
ATOM 8299  N N    . ILE A 1 28 ? -7.795  -9.501  4.621   1.00 0.00 ? 28 ILE A N    7  
ATOM 8300  C CA   . ILE A 1 28 ? -7.111  -8.207  4.329   1.00 0.00 ? 28 ILE A CA   7  
ATOM 8301  C C    . ILE A 1 28 ? -8.099  -7.265  3.652   1.00 0.00 ? 28 ILE A C    7  
ATOM 8302  O O    . ILE A 1 28 ? -8.132  -6.083  3.931   1.00 0.00 ? 28 ILE A O    7  
ATOM 8303  C CB   . ILE A 1 28 ? -5.895  -8.496  3.432   1.00 0.00 ? 28 ILE A CB   7  
ATOM 8304  C CG1  . ILE A 1 28 ? -5.180  -9.758  3.997   1.00 0.00 ? 28 ILE A CG1  7  
ATOM 8305  C CG2  . ILE A 1 28 ? -4.964  -7.276  3.394   1.00 0.00 ? 28 ILE A CG2  7  
ATOM 8306  C CD1  . ILE A 1 28 ? -3.649  -9.685  3.907   1.00 0.00 ? 28 ILE A CD1  7  
ATOM 8307  H H    . ILE A 1 28 ? -7.498  -10.321 4.174   1.00 0.00 ? 28 ILE A H    7  
ATOM 8308  H HA   . ILE A 1 28 ? -6.784  -7.767  5.261   1.00 0.00 ? 28 ILE A HA   7  
ATOM 8309  H HB   . ILE A 1 28 ? -6.242  -8.699  2.428   1.00 0.00 ? 28 ILE A HB   7  
ATOM 8310  H HG12 . ILE A 1 28 ? -5.449  -9.878  5.024   1.00 0.00 ? 28 ILE A HG12 7  
ATOM 8311  H HG13 . ILE A 1 28 ? -5.516  -10.623 3.457   1.00 0.00 ? 28 ILE A HG13 7  
ATOM 8312  H HG21 . ILE A 1 28 ? -4.536  -7.112  4.371   1.00 0.00 ? 28 ILE A HG21 7  
ATOM 8313  H HG22 . ILE A 1 28 ? -5.525  -6.406  3.097   1.00 0.00 ? 28 ILE A HG22 7  
ATOM 8314  H HG23 . ILE A 1 28 ? -4.173  -7.451  2.680   1.00 0.00 ? 28 ILE A HG23 7  
ATOM 8315  H HD11 . ILE A 1 28 ? -3.231  -10.626 4.250   1.00 0.00 ? 28 ILE A HD11 7  
ATOM 8316  H HD12 . ILE A 1 28 ? -3.287  -8.885  4.535   1.00 0.00 ? 28 ILE A HD12 7  
ATOM 8317  H HD13 . ILE A 1 28 ? -3.350  -9.509  2.885   1.00 0.00 ? 28 ILE A HD13 7  
ATOM 8318  N N    . LEU A 1 29 ? -8.914  -7.773  2.780   1.00 0.00 ? 29 LEU A N    7  
ATOM 8319  C CA   . LEU A 1 29 ? -9.907  -6.902  2.105   1.00 0.00 ? 29 LEU A CA   7  
ATOM 8320  C C    . LEU A 1 29 ? -11.023 -6.542  3.095   1.00 0.00 ? 29 LEU A C    7  
ATOM 8321  O O    . LEU A 1 29 ? -11.619 -5.488  3.023   1.00 0.00 ? 29 LEU A O    7  
ATOM 8322  C CB   . LEU A 1 29 ? -10.483 -7.654  0.908   1.00 0.00 ? 29 LEU A CB   7  
ATOM 8323  C CG   . LEU A 1 29 ? -9.332  -8.174  0.037   1.00 0.00 ? 29 LEU A CG   7  
ATOM 8324  C CD1  . LEU A 1 29 ? -9.908  -8.997  -1.119  1.00 0.00 ? 29 LEU A CD1  7  
ATOM 8325  C CD2  . LEU A 1 29 ? -8.528  -6.988  -0.526  1.00 0.00 ? 29 LEU A CD2  7  
ATOM 8326  H H    . LEU A 1 29 ? -8.880  -8.726  2.558   1.00 0.00 ? 29 LEU A H    7  
ATOM 8327  H HA   . LEU A 1 29 ? -9.426  -5.997  1.767   1.00 0.00 ? 29 LEU A HA   7  
ATOM 8328  H HB2  . LEU A 1 29 ? -11.076 -8.489  1.258   1.00 0.00 ? 29 LEU A HB2  7  
ATOM 8329  H HB3  . LEU A 1 29 ? -11.102 -6.990  0.325   1.00 0.00 ? 29 LEU A HB3  7  
ATOM 8330  H HG   . LEU A 1 29 ? -8.679  -8.802  0.638   1.00 0.00 ? 29 LEU A HG   7  
ATOM 8331  H HD11 . LEU A 1 29 ? -10.228 -9.960  -0.751  1.00 0.00 ? 29 LEU A HD11 7  
ATOM 8332  H HD12 . LEU A 1 29 ? -9.152  -9.134  -1.877  1.00 0.00 ? 29 LEU A HD12 7  
ATOM 8333  H HD13 . LEU A 1 29 ? -10.754 -8.478  -1.547  1.00 0.00 ? 29 LEU A HD13 7  
ATOM 8334  H HD21 . LEU A 1 29 ? -7.828  -6.641  0.221   1.00 0.00 ? 29 LEU A HD21 7  
ATOM 8335  H HD22 . LEU A 1 29 ? -9.200  -6.185  -0.789  1.00 0.00 ? 29 LEU A HD22 7  
ATOM 8336  H HD23 . LEU A 1 29 ? -7.984  -7.302  -1.405  1.00 0.00 ? 29 LEU A HD23 7  
ATOM 8337  N N    . ASP A 1 30 ? -11.290 -7.409  4.034   1.00 0.00 ? 30 ASP A N    7  
ATOM 8338  C CA   . ASP A 1 30 ? -12.342 -7.107  5.050   1.00 0.00 ? 30 ASP A CA   7  
ATOM 8339  C C    . ASP A 1 30 ? -11.832 -5.972  5.946   1.00 0.00 ? 30 ASP A C    7  
ATOM 8340  O O    . ASP A 1 30 ? -12.549 -5.041  6.256   1.00 0.00 ? 30 ASP A O    7  
ATOM 8341  C CB   . ASP A 1 30 ? -12.613 -8.351  5.898   1.00 0.00 ? 30 ASP A CB   7  
ATOM 8342  C CG   . ASP A 1 30 ? -13.790 -8.083  6.836   1.00 0.00 ? 30 ASP A CG   7  
ATOM 8343  O OD1  . ASP A 1 30 ? -14.918 -8.256  6.405   1.00 0.00 ? 30 ASP A OD1  7  
ATOM 8344  O OD2  . ASP A 1 30 ? -13.544 -7.708  7.971   1.00 0.00 ? 30 ASP A OD2  7  
ATOM 8345  H H    . ASP A 1 30 ? -10.791 -8.251  4.068   1.00 0.00 ? 30 ASP A H    7  
ATOM 8346  H HA   . ASP A 1 30 ? -13.251 -6.791  4.560   1.00 0.00 ? 30 ASP A HA   7  
ATOM 8347  H HB2  . ASP A 1 30 ? -12.848 -9.183  5.251   1.00 0.00 ? 30 ASP A HB2  7  
ATOM 8348  H HB3  . ASP A 1 30 ? -11.736 -8.587  6.482   1.00 0.00 ? 30 ASP A HB3  7  
ATOM 8349  N N    . ALA A 1 31 ? -10.606 -6.059  6.387   1.00 0.00 ? 31 ALA A N    7  
ATOM 8350  C CA   . ALA A 1 31 ? -10.049 -5.009  7.290   1.00 0.00 ? 31 ALA A CA   7  
ATOM 8351  C C    . ALA A 1 31 ? -9.902  -3.677  6.543   1.00 0.00 ? 31 ALA A C    7  
ATOM 8352  O O    . ALA A 1 31 ? -9.962  -2.621  7.141   1.00 0.00 ? 31 ALA A O    7  
ATOM 8353  C CB   . ALA A 1 31 ? -8.682  -5.468  7.799   1.00 0.00 ? 31 ALA A CB   7  
ATOM 8354  H H    . ALA A 1 31 ? -10.054 -6.831  6.139   1.00 0.00 ? 31 ALA A H    7  
ATOM 8355  H HA   . ALA A 1 31 ? -10.712 -4.879  8.130   1.00 0.00 ? 31 ALA A HA   7  
ATOM 8356  H HB1  . ALA A 1 31 ? -7.993  -5.539  6.969   1.00 0.00 ? 31 ALA A HB1  7  
ATOM 8357  H HB2  . ALA A 1 31 ? -8.780  -6.437  8.266   1.00 0.00 ? 31 ALA A HB2  7  
ATOM 8358  H HB3  . ALA A 1 31 ? -8.308  -4.758  8.520   1.00 0.00 ? 31 ALA A HB3  7  
ATOM 8359  N N    . PHE A 1 32 ? -9.734  -3.700  5.254   1.00 0.00 ? 32 PHE A N    7  
ATOM 8360  C CA   . PHE A 1 32 ? -9.613  -2.416  4.496   1.00 0.00 ? 32 PHE A CA   7  
ATOM 8361  C C    . PHE A 1 32 ? -10.780 -1.498  4.878   1.00 0.00 ? 32 PHE A C    7  
ATOM 8362  O O    . PHE A 1 32 ? -10.801 -0.331  4.537   1.00 0.00 ? 32 PHE A O    7  
ATOM 8363  C CB   . PHE A 1 32 ? -9.690  -2.740  2.992   1.00 0.00 ? 32 PHE A CB   7  
ATOM 8364  C CG   . PHE A 1 32 ? -8.338  -3.141  2.409   1.00 0.00 ? 32 PHE A CG   7  
ATOM 8365  C CD1  . PHE A 1 32 ? -7.246  -3.527  3.220   1.00 0.00 ? 32 PHE A CD1  7  
ATOM 8366  C CD2  . PHE A 1 32 ? -8.180  -3.104  1.017   1.00 0.00 ? 32 PHE A CD2  7  
ATOM 8367  C CE1  . PHE A 1 32 ? -6.023  -3.866  2.628   1.00 0.00 ? 32 PHE A CE1  7  
ATOM 8368  C CE2  . PHE A 1 32 ? -6.956  -3.449  0.434   1.00 0.00 ? 32 PHE A CE2  7  
ATOM 8369  C CZ   . PHE A 1 32 ? -5.879  -3.827  1.238   1.00 0.00 ? 32 PHE A CZ   7  
ATOM 8370  H H    . PHE A 1 32 ? -9.703  -4.553  4.773   1.00 0.00 ? 32 PHE A H    7  
ATOM 8371  H HA   . PHE A 1 32 ? -8.675  -1.928  4.719   1.00 0.00 ? 32 PHE A HA   7  
ATOM 8372  H HB2  . PHE A 1 32 ? -10.383 -3.548  2.846   1.00 0.00 ? 32 PHE A HB2  7  
ATOM 8373  H HB3  . PHE A 1 32 ? -10.055 -1.873  2.459   1.00 0.00 ? 32 PHE A HB3  7  
ATOM 8374  H HD1  . PHE A 1 32 ? -7.341  -3.581  4.289   1.00 0.00 ? 32 PHE A HD1  7  
ATOM 8375  H HD2  . PHE A 1 32 ? -9.010  -2.820  0.391   1.00 0.00 ? 32 PHE A HD2  7  
ATOM 8376  H HE1  . PHE A 1 32 ? -5.189  -4.151  3.249   1.00 0.00 ? 32 PHE A HE1  7  
ATOM 8377  H HE2  . PHE A 1 32 ? -6.843  -3.420  -0.640  1.00 0.00 ? 32 PHE A HE2  7  
ATOM 8378  H HZ   . PHE A 1 32 ? -4.935  -4.091  0.787   1.00 0.00 ? 32 PHE A HZ   7  
ATOM 8379  N N    . ASP A 1 33 ? -11.761 -2.022  5.557   1.00 0.00 ? 33 ASP A N    7  
ATOM 8380  C CA   . ASP A 1 33 ? -12.940 -1.189  5.930   1.00 0.00 ? 33 ASP A CA   7  
ATOM 8381  C C    . ASP A 1 33 ? -12.659 -0.379  7.199   1.00 0.00 ? 33 ASP A C    7  
ATOM 8382  O O    . ASP A 1 33 ? -13.322 0.606   7.458   1.00 0.00 ? 33 ASP A O    7  
ATOM 8383  C CB   . ASP A 1 33 ? -14.142 -2.103  6.172   1.00 0.00 ? 33 ASP A CB   7  
ATOM 8384  C CG   . ASP A 1 33 ? -15.351 -1.259  6.581   1.00 0.00 ? 33 ASP A CG   7  
ATOM 8385  O OD1  . ASP A 1 33 ? -15.559 -0.224  5.970   1.00 0.00 ? 33 ASP A OD1  7  
ATOM 8386  O OD2  . ASP A 1 33 ? -16.047 -1.662  7.498   1.00 0.00 ? 33 ASP A OD2  7  
ATOM 8387  H H    . ASP A 1 33 ? -11.734 -2.969  5.804   1.00 0.00 ? 33 ASP A H    7  
ATOM 8388  H HA   . ASP A 1 33 ? -13.169 -0.512  5.121   1.00 0.00 ? 33 ASP A HA   7  
ATOM 8389  H HB2  . ASP A 1 33 ? -14.370 -2.645  5.266   1.00 0.00 ? 33 ASP A HB2  7  
ATOM 8390  H HB3  . ASP A 1 33 ? -13.910 -2.801  6.962   1.00 0.00 ? 33 ASP A HB3  7  
ATOM 8391  N N    . LYS A 1 34 ? -11.687 -0.771  7.993   1.00 0.00 ? 34 LYS A N    7  
ATOM 8392  C CA   . LYS A 1 34 ? -11.373 -0.003  9.245   1.00 0.00 ? 34 LYS A CA   7  
ATOM 8393  C C    . LYS A 1 34 ? -9.884  0.365   9.276   1.00 0.00 ? 34 LYS A C    7  
ATOM 8394  O O    . LYS A 1 34 ? -9.378  0.825   10.280  1.00 0.00 ? 34 LYS A O    7  
ATOM 8395  C CB   . LYS A 1 34 ? -11.719 -0.843  10.481  1.00 0.00 ? 34 LYS A CB   7  
ATOM 8396  C CG   . LYS A 1 34 ? -11.161 -2.259  10.332  1.00 0.00 ? 34 LYS A CG   7  
ATOM 8397  C CD   . LYS A 1 34 ? -11.306 -3.012  11.659  1.00 0.00 ? 34 LYS A CD   7  
ATOM 8398  C CE   . LYS A 1 34 ? -12.788 -3.236  11.978  1.00 0.00 ? 34 LYS A CE   7  
ATOM 8399  N NZ   . LYS A 1 34 ? -12.916 -4.335  12.976  1.00 0.00 ? 34 LYS A NZ   7  
ATOM 8400  H H    . LYS A 1 34 ? -11.162 -1.569  7.774   1.00 0.00 ? 34 LYS A H    7  
ATOM 8401  H HA   . LYS A 1 34 ? -11.951 0.910   9.272   1.00 0.00 ? 34 LYS A HA   7  
ATOM 8402  H HB2  . LYS A 1 34 ? -11.292 -0.381  11.360  1.00 0.00 ? 34 LYS A HB2  7  
ATOM 8403  H HB3  . LYS A 1 34 ? -12.792 -0.893  10.590  1.00 0.00 ? 34 LYS A HB3  7  
ATOM 8404  H HG2  . LYS A 1 34 ? -11.708 -2.777  9.559   1.00 0.00 ? 34 LYS A HG2  7  
ATOM 8405  H HG3  . LYS A 1 34 ? -10.117 -2.208  10.064  1.00 0.00 ? 34 LYS A HG3  7  
ATOM 8406  H HD2  . LYS A 1 34 ? -10.806 -3.967  11.585  1.00 0.00 ? 34 LYS A HD2  7  
ATOM 8407  H HD3  . LYS A 1 34 ? -10.854 -2.434  12.451  1.00 0.00 ? 34 LYS A HD3  7  
ATOM 8408  H HE2  . LYS A 1 34 ? -13.209 -2.331  12.387  1.00 0.00 ? 34 LYS A HE2  7  
ATOM 8409  H HE3  . LYS A 1 34 ? -13.319 -3.507  11.078  1.00 0.00 ? 34 LYS A HE3  7  
ATOM 8410  H HZ1  . LYS A 1 34 ? -11.976 -4.584  13.343  1.00 0.00 ? 34 LYS A HZ1  7  
ATOM 8411  H HZ2  . LYS A 1 34 ? -13.342 -5.169  12.520  1.00 0.00 ? 34 LYS A HZ2  7  
ATOM 8412  H HZ3  . LYS A 1 34 ? -13.522 -4.023  13.761  1.00 0.00 ? 34 LYS A HZ3  7  
ATOM 8413  N N    . MET A 1 35 ? -9.171  0.186   8.188   1.00 0.00 ? 35 MET A N    7  
ATOM 8414  C CA   . MET A 1 35 ? -7.721  0.553   8.186   1.00 0.00 ? 35 MET A CA   7  
ATOM 8415  C C    . MET A 1 35 ? -7.592  2.050   7.887   1.00 0.00 ? 35 MET A C    7  
ATOM 8416  O O    . MET A 1 35 ? -6.836  2.742   8.539   1.00 0.00 ? 35 MET A O    7  
ATOM 8417  C CB   . MET A 1 35 ? -6.955  -0.273  7.123   1.00 0.00 ? 35 MET A CB   7  
ATOM 8418  C CG   . MET A 1 35 ? -6.346  -1.572  7.724   1.00 0.00 ? 35 MET A CG   7  
ATOM 8419  S SD   . MET A 1 35 ? -7.042  -3.031  6.893   1.00 0.00 ? 35 MET A SD   7  
ATOM 8420  C CE   . MET A 1 35 ? -5.502  -3.742  6.251   1.00 0.00 ? 35 MET A CE   7  
ATOM 8421  H H    . MET A 1 35 ? -9.590  -0.173  7.377   1.00 0.00 ? 35 MET A H    7  
ATOM 8422  H HA   . MET A 1 35 ? -7.305  0.371   9.166   1.00 0.00 ? 35 MET A HA   7  
ATOM 8423  H HB2  . MET A 1 35 ? -7.634  -0.533  6.333   1.00 0.00 ? 35 MET A HB2  7  
ATOM 8424  H HB3  . MET A 1 35 ? -6.156  0.330   6.708   1.00 0.00 ? 35 MET A HB3  7  
ATOM 8425  H HG2  . MET A 1 35 ? -5.279  -1.557  7.583   1.00 0.00 ? 35 MET A HG2  7  
ATOM 8426  H HG3  . MET A 1 35 ? -6.555  -1.641  8.780   1.00 0.00 ? 35 MET A HG3  7  
ATOM 8427  H HE1  . MET A 1 35 ? -4.745  -3.733  7.025   1.00 0.00 ? 35 MET A HE1  7  
ATOM 8428  H HE2  . MET A 1 35 ? -5.159  -3.160  5.412   1.00 0.00 ? 35 MET A HE2  7  
ATOM 8429  H HE3  . MET A 1 35 ? -5.685  -4.759  5.932   1.00 0.00 ? 35 MET A HE3  7  
ATOM 8430  N N    . CYS A 1 36 ? -8.317  2.583   6.934   1.00 0.00 ? 36 CYS A N    7  
ATOM 8431  C CA   . CYS A 1 36 ? -8.174  4.038   6.693   1.00 0.00 ? 36 CYS A CA   7  
ATOM 8432  C C    . CYS A 1 36 ? -8.632  4.726   7.976   1.00 0.00 ? 36 CYS A C    7  
ATOM 8433  O O    . CYS A 1 36 ? -8.518  5.926   8.126   1.00 0.00 ? 36 CYS A O    7  
ATOM 8434  C CB   . CYS A 1 36 ? -9.017  4.483   5.495   1.00 0.00 ? 36 CYS A CB   7  
ATOM 8435  S SG   . CYS A 1 36 ? -8.063  4.270   3.972   1.00 0.00 ? 36 CYS A SG   7  
ATOM 8436  H H    . CYS A 1 36 ? -8.946  2.048   6.409   1.00 0.00 ? 36 CYS A H    7  
ATOM 8437  H HA   . CYS A 1 36 ? -7.128  4.261   6.541   1.00 0.00 ? 36 CYS A HA   7  
ATOM 8438  H HB2  . CYS A 1 36 ? -9.913  3.883   5.444   1.00 0.00 ? 36 CYS A HB2  7  
ATOM 8439  H HB3  . CYS A 1 36 ? -9.286  5.523   5.605   1.00 0.00 ? 36 CYS A HB3  7  
ATOM 8440  N N    . SER A 1 37 ? -9.154  3.971   8.902   1.00 0.00 ? 37 SER A N    7  
ATOM 8441  C CA   . SER A 1 37 ? -9.623  4.589   10.183  1.00 0.00 ? 37 SER A CA   7  
ATOM 8442  C C    . SER A 1 37 ? -8.447  4.748   11.154  1.00 0.00 ? 37 SER A C    7  
ATOM 8443  O O    . SER A 1 37 ? -8.650  4.955   12.334  1.00 0.00 ? 37 SER A O    7  
ATOM 8444  C CB   . SER A 1 37 ? -10.689 3.700   10.822  1.00 0.00 ? 37 SER A CB   7  
ATOM 8445  O OG   . SER A 1 37 ? -11.332 4.416   11.868  1.00 0.00 ? 37 SER A OG   7  
ATOM 8446  H H    . SER A 1 37 ? -9.237  2.994   8.751   1.00 0.00 ? 37 SER A H    7  
ATOM 8447  H HA   . SER A 1 37 ? -10.049 5.562   9.978   1.00 0.00 ? 37 SER A HA   7  
ATOM 8448  H HB2  . SER A 1 37 ? -11.419 3.423   10.082  1.00 0.00 ? 37 SER A HB2  7  
ATOM 8449  H HB3  . SER A 1 37 ? -10.222 2.808   11.217  1.00 0.00 ? 37 SER A HB3  7  
ATOM 8450  H HG   . SER A 1 37 ? -10.892 5.265   11.961  1.00 0.00 ? 37 SER A HG   7  
ATOM 8451  N N    . LYS A 1 38 ? -7.224  4.657   10.682  1.00 0.00 ? 38 LYS A N    7  
ATOM 8452  C CA   . LYS A 1 38 ? -6.038  4.809   11.599  1.00 0.00 ? 38 LYS A CA   7  
ATOM 8453  C C    . LYS A 1 38 ? -5.170  5.998   11.150  1.00 0.00 ? 38 LYS A C    7  
ATOM 8454  O O    . LYS A 1 38 ? -4.148  6.280   11.742  1.00 0.00 ? 38 LYS A O    7  
ATOM 8455  C CB   . LYS A 1 38 ? -5.210  3.514   11.583  1.00 0.00 ? 38 LYS A CB   7  
ATOM 8456  C CG   . LYS A 1 38 ? -5.873  2.469   12.494  1.00 0.00 ? 38 LYS A CG   7  
ATOM 8457  C CD   . LYS A 1 38 ? -5.346  1.074   12.152  1.00 0.00 ? 38 LYS A CD   7  
ATOM 8458  C CE   . LYS A 1 38 ? -3.823  1.053   12.286  1.00 0.00 ? 38 LYS A CE   7  
ATOM 8459  N NZ   . LYS A 1 38 ? -3.428  1.705   13.566  1.00 0.00 ? 38 LYS A NZ   7  
ATOM 8460  H H    . LYS A 1 38 ? -7.082  4.491   9.727   1.00 0.00 ? 38 LYS A H    7  
ATOM 8461  H HA   . LYS A 1 38 ? -6.375  4.998   12.610  1.00 0.00 ? 38 LYS A HA   7  
ATOM 8462  H HB2  . LYS A 1 38 ? -5.159  3.130   10.576  1.00 0.00 ? 38 LYS A HB2  7  
ATOM 8463  H HB3  . LYS A 1 38 ? -4.213  3.718   11.944  1.00 0.00 ? 38 LYS A HB3  7  
ATOM 8464  H HG2  . LYS A 1 38 ? -5.645  2.697   13.525  1.00 0.00 ? 38 LYS A HG2  7  
ATOM 8465  H HG3  . LYS A 1 38 ? -6.944  2.492   12.350  1.00 0.00 ? 38 LYS A HG3  7  
ATOM 8466  H HD2  . LYS A 1 38 ? -5.778  0.351   12.829  1.00 0.00 ? 38 LYS A HD2  7  
ATOM 8467  H HD3  . LYS A 1 38 ? -5.620  0.825   11.139  1.00 0.00 ? 38 LYS A HD3  7  
ATOM 8468  H HE2  . LYS A 1 38 ? -3.476  0.030   12.280  1.00 0.00 ? 38 LYS A HE2  7  
ATOM 8469  H HE3  . LYS A 1 38 ? -3.383  1.587   11.458  1.00 0.00 ? 38 LYS A HE3  7  
ATOM 8470  H HZ1  . LYS A 1 38 ? -3.518  2.736   13.472  1.00 0.00 ? 38 LYS A HZ1  7  
ATOM 8471  H HZ2  . LYS A 1 38 ? -2.442  1.460   13.790  1.00 0.00 ? 38 LYS A HZ2  7  
ATOM 8472  H HZ3  . LYS A 1 38 ? -4.051  1.375   14.331  1.00 0.00 ? 38 LYS A HZ3  7  
ATOM 8473  N N    . LEU A 1 39 ? -5.576  6.702   10.119  1.00 0.00 ? 39 LEU A N    7  
ATOM 8474  C CA   . LEU A 1 39 ? -4.784  7.886   9.632   1.00 0.00 ? 39 LEU A CA   7  
ATOM 8475  C C    . LEU A 1 39 ? -5.565  9.172   9.968   1.00 0.00 ? 39 LEU A C    7  
ATOM 8476  O O    . LEU A 1 39 ? -6.777  9.166   9.880   1.00 0.00 ? 39 LEU A O    7  
ATOM 8477  C CB   . LEU A 1 39 ? -4.636  7.793   8.106   1.00 0.00 ? 39 LEU A CB   7  
ATOM 8478  C CG   . LEU A 1 39 ? -3.946  6.484   7.708   1.00 0.00 ? 39 LEU A CG   7  
ATOM 8479  C CD1  . LEU A 1 39 ? -3.947  6.363   6.183   1.00 0.00 ? 39 LEU A CD1  7  
ATOM 8480  C CD2  . LEU A 1 39 ? -2.496  6.470   8.213   1.00 0.00 ? 39 LEU A CD2  7  
ATOM 8481  H H    . LEU A 1 39 ? -6.409  6.458   9.664   1.00 0.00 ? 39 LEU A H    7  
ATOM 8482  H HA   . LEU A 1 39 ? -3.813  7.896   10.096  1.00 0.00 ? 39 LEU A HA   7  
ATOM 8483  H HB2  . LEU A 1 39 ? -5.618  7.829   7.658   1.00 0.00 ? 39 LEU A HB2  7  
ATOM 8484  H HB3  . LEU A 1 39 ? -4.055  8.625   7.744   1.00 0.00 ? 39 LEU A HB3  7  
ATOM 8485  H HG   . LEU A 1 39 ? -4.487  5.652   8.129   1.00 0.00 ? 39 LEU A HG   7  
ATOM 8486  H HD11 . LEU A 1 39 ? -3.709  5.350   5.903   1.00 0.00 ? 39 LEU A HD11 7  
ATOM 8487  H HD12 . LEU A 1 39 ? -3.206  7.032   5.774   1.00 0.00 ? 39 LEU A HD12 7  
ATOM 8488  H HD13 . LEU A 1 39 ? -4.920  6.627   5.799   1.00 0.00 ? 39 LEU A HD13 7  
ATOM 8489  H HD21 . LEU A 1 39 ? -1.925  5.740   7.659   1.00 0.00 ? 39 LEU A HD21 7  
ATOM 8490  H HD22 . LEU A 1 39 ? -2.478  6.212   9.261   1.00 0.00 ? 39 LEU A HD22 7  
ATOM 8491  H HD23 . LEU A 1 39 ? -2.054  7.445   8.073   1.00 0.00 ? 39 LEU A HD23 7  
ATOM 8492  N N    . PRO A 1 40 ? -4.886  10.252  10.329  1.00 0.00 ? 40 PRO A N    7  
ATOM 8493  C CA   . PRO A 1 40 ? -5.587  11.508  10.642  1.00 0.00 ? 40 PRO A CA   7  
ATOM 8494  C C    . PRO A 1 40 ? -6.659  11.798  9.573   1.00 0.00 ? 40 PRO A C    7  
ATOM 8495  O O    . PRO A 1 40 ? -6.597  11.274  8.478   1.00 0.00 ? 40 PRO A O    7  
ATOM 8496  C CB   . PRO A 1 40 ? -4.472  12.581  10.694  1.00 0.00 ? 40 PRO A CB   7  
ATOM 8497  C CG   . PRO A 1 40 ? -3.110  11.829  10.679  1.00 0.00 ? 40 PRO A CG   7  
ATOM 8498  C CD   . PRO A 1 40 ? -3.412  10.330  10.463  1.00 0.00 ? 40 PRO A CD   7  
ATOM 8499  H HA   . PRO A 1 40 ? -6.058  11.418  11.604  1.00 0.00 ? 40 PRO A HA   7  
ATOM 8500  H HB2  . PRO A 1 40 ? -4.542  13.238  9.836   1.00 0.00 ? 40 PRO A HB2  7  
ATOM 8501  H HB3  . PRO A 1 40 ? -4.552  13.162  11.604  1.00 0.00 ? 40 PRO A HB3  7  
ATOM 8502  H HG2  . PRO A 1 40 ? -2.491  12.204  9.871   1.00 0.00 ? 40 PRO A HG2  7  
ATOM 8503  H HG3  . PRO A 1 40 ? -2.599  11.965  11.622  1.00 0.00 ? 40 PRO A HG3  7  
ATOM 8504  H HD2  . PRO A 1 40 ? -2.926  9.982   9.570   1.00 0.00 ? 40 PRO A HD2  7  
ATOM 8505  H HD3  . PRO A 1 40 ? -3.089  9.751   11.317  1.00 0.00 ? 40 PRO A HD3  7  
ATOM 8506  N N    . LYS A 1 41 ? -7.647  12.601  9.866   1.00 0.00 ? 41 LYS A N    7  
ATOM 8507  C CA   . LYS A 1 41 ? -8.703  12.871  8.845   1.00 0.00 ? 41 LYS A CA   7  
ATOM 8508  C C    . LYS A 1 41 ? -8.121  13.584  7.625   1.00 0.00 ? 41 LYS A C    7  
ATOM 8509  O O    . LYS A 1 41 ? -8.754  13.674  6.593   1.00 0.00 ? 41 LYS A O    7  
ATOM 8510  C CB   . LYS A 1 41 ? -9.799  13.741  9.450   1.00 0.00 ? 41 LYS A CB   7  
ATOM 8511  C CG   . LYS A 1 41 ? -11.013 13.771  8.513   1.00 0.00 ? 41 LYS A CG   7  
ATOM 8512  C CD   . LYS A 1 41 ? -12.206 14.411  9.232   1.00 0.00 ? 41 LYS A CD   7  
ATOM 8513  C CE   . LYS A 1 41 ? -11.849 15.832  9.677   1.00 0.00 ? 41 LYS A CE   7  
ATOM 8514  N NZ   . LYS A 1 41 ? -11.083 16.519  8.599   1.00 0.00 ? 41 LYS A NZ   7  
ATOM 8515  H H    . LYS A 1 41 ? -7.705  13.022  10.750  1.00 0.00 ? 41 LYS A H    7  
ATOM 8516  H HA   . LYS A 1 41 ? -9.127  11.944  8.493   1.00 0.00 ? 41 LYS A HA   7  
ATOM 8517  H HB2  . LYS A 1 41 ? -10.089 13.339  10.408  1.00 0.00 ? 41 LYS A HB2  7  
ATOM 8518  H HB3  . LYS A 1 41 ? -9.420  14.742  9.576   1.00 0.00 ? 41 LYS A HB3  7  
ATOM 8519  H HG2  . LYS A 1 41 ? -10.771 14.347  7.632   1.00 0.00 ? 41 LYS A HG2  7  
ATOM 8520  H HG3  . LYS A 1 41 ? -11.272 12.764  8.222   1.00 0.00 ? 41 LYS A HG3  7  
ATOM 8521  H HD2  . LYS A 1 41 ? -13.051 14.445  8.561   1.00 0.00 ? 41 LYS A HD2  7  
ATOM 8522  H HD3  . LYS A 1 41 ? -12.460 13.818  10.098  1.00 0.00 ? 41 LYS A HD3  7  
ATOM 8523  H HE2  . LYS A 1 41 ? -12.757 16.382  9.878   1.00 0.00 ? 41 LYS A HE2  7  
ATOM 8524  H HE3  . LYS A 1 41 ? -11.251 15.789  10.575  1.00 0.00 ? 41 LYS A HE3  7  
ATOM 8525  H HZ1  . LYS A 1 41 ? -11.588 16.417  7.696   1.00 0.00 ? 41 LYS A HZ1  7  
ATOM 8526  H HZ2  . LYS A 1 41 ? -10.138 16.093  8.520   1.00 0.00 ? 41 LYS A HZ2  7  
ATOM 8527  H HZ3  . LYS A 1 41 ? -10.990 17.530  8.829   1.00 0.00 ? 41 LYS A HZ3  7  
ATOM 8528  N N    . SER A 1 42 ? -6.959  14.157  7.750   1.00 0.00 ? 42 SER A N    7  
ATOM 8529  C CA   . SER A 1 42 ? -6.400  14.935  6.608   1.00 0.00 ? 42 SER A CA   7  
ATOM 8530  C C    . SER A 1 42 ? -5.961  14.053  5.436   1.00 0.00 ? 42 SER A C    7  
ATOM 8531  O O    . SER A 1 42 ? -5.758  14.533  4.339   1.00 0.00 ? 42 SER A O    7  
ATOM 8532  C CB   . SER A 1 42 ? -5.240  15.813  7.077   1.00 0.00 ? 42 SER A CB   7  
ATOM 8533  O OG   . SER A 1 42 ? -4.480  16.227  5.949   1.00 0.00 ? 42 SER A OG   7  
ATOM 8534  H H    . SER A 1 42 ? -6.479  14.123  8.603   1.00 0.00 ? 42 SER A H    7  
ATOM 8535  H HA   . SER A 1 42 ? -7.182  15.552  6.200   1.00 0.00 ? 42 SER A HA   7  
ATOM 8536  H HB2  . SER A 1 42 ? -5.626  16.682  7.584   1.00 0.00 ? 42 SER A HB2  7  
ATOM 8537  H HB3  . SER A 1 42 ? -4.615  15.249  7.757   1.00 0.00 ? 42 SER A HB3  7  
ATOM 8538  H HG   . SER A 1 42 ? -3.675  15.706  5.926   1.00 0.00 ? 42 SER A HG   7  
ATOM 8539  N N    . LEU A 1 43 ? -5.838  12.764  5.653   1.00 0.00 ? 43 LEU A N    7  
ATOM 8540  C CA   . LEU A 1 43 ? -5.437  11.832  4.541   1.00 0.00 ? 43 LEU A CA   7  
ATOM 8541  C C    . LEU A 1 43 ? -6.597  10.878  4.243   1.00 0.00 ? 43 LEU A C    7  
ATOM 8542  O O    . LEU A 1 43 ? -6.484  10.019  3.393   1.00 0.00 ? 43 LEU A O    7  
ATOM 8543  C CB   . LEU A 1 43 ? -4.215  10.995  4.941   1.00 0.00 ? 43 LEU A CB   7  
ATOM 8544  C CG   . LEU A 1 43 ? -3.110  11.877  5.514   1.00 0.00 ? 43 LEU A CG   7  
ATOM 8545  C CD1  . LEU A 1 43 ? -1.859  11.035  5.777   1.00 0.00 ? 43 LEU A CD1  7  
ATOM 8546  C CD2  . LEU A 1 43 ? -2.773  13.004  4.531   1.00 0.00 ? 43 LEU A CD2  7  
ATOM 8547  H H    . LEU A 1 43 ? -6.032  12.401  6.544   1.00 0.00 ? 43 LEU A H    7  
ATOM 8548  H HA   . LEU A 1 43 ? -5.207  12.397  3.647   1.00 0.00 ? 43 LEU A HA   7  
ATOM 8549  H HB2  . LEU A 1 43 ? -4.511  10.277  5.687   1.00 0.00 ? 43 LEU A HB2  7  
ATOM 8550  H HB3  . LEU A 1 43 ? -3.840  10.479  4.071   1.00 0.00 ? 43 LEU A HB3  7  
ATOM 8551  H HG   . LEU A 1 43 ? -3.447  12.288  6.439   1.00 0.00 ? 43 LEU A HG   7  
ATOM 8552  H HD11 . LEU A 1 43 ? -1.673  10.388  4.932   1.00 0.00 ? 43 LEU A HD11 7  
ATOM 8553  H HD12 . LEU A 1 43 ? -2.011  10.439  6.664   1.00 0.00 ? 43 LEU A HD12 7  
ATOM 8554  H HD13 . LEU A 1 43 ? -1.011  11.687  5.925   1.00 0.00 ? 43 LEU A HD13 7  
ATOM 8555  H HD21 . LEU A 1 43 ? -2.716  12.603  3.530   1.00 0.00 ? 43 LEU A HD21 7  
ATOM 8556  H HD22 . LEU A 1 43 ? -1.823  13.444  4.796   1.00 0.00 ? 43 LEU A HD22 7  
ATOM 8557  H HD23 . LEU A 1 43 ? -3.540  13.760  4.571   1.00 0.00 ? 43 LEU A HD23 7  
ATOM 8558  N N    . SER A 1 44 ? -7.694  10.997  4.957   1.00 0.00 ? 44 SER A N    7  
ATOM 8559  C CA   . SER A 1 44 ? -8.859  10.074  4.733   1.00 0.00 ? 44 SER A CA   7  
ATOM 8560  C C    . SER A 1 44 ? -9.009  9.764   3.243   1.00 0.00 ? 44 SER A C    7  
ATOM 8561  O O    . SER A 1 44 ? -8.843  8.652   2.783   1.00 0.00 ? 44 SER A O    7  
ATOM 8562  C CB   . SER A 1 44 ? -10.140 10.730  5.251   1.00 0.00 ? 44 SER A CB   7  
ATOM 8563  O OG   . SER A 1 44 ? -11.265 9.987   4.796   1.00 0.00 ? 44 SER A OG   7  
ATOM 8564  H H    . SER A 1 44 ? -7.747  11.677  5.662   1.00 0.00 ? 44 SER A H    7  
ATOM 8565  H HA   . SER A 1 44 ? -8.682  9.150   5.267   1.00 0.00 ? 44 SER A HA   7  
ATOM 8566  H HB2  . SER A 1 44 ? -10.133 10.738  6.327   1.00 0.00 ? 44 SER A HB2  7  
ATOM 8567  H HB3  . SER A 1 44 ? -10.195 11.747  4.886   1.00 0.00 ? 44 SER A HB3  7  
ATOM 8568  H HG   . SER A 1 44 ? -10.984 9.082   4.647   1.00 0.00 ? 44 SER A HG   7  
ATOM 8569  N N    . GLU A 1 45 ? -9.480  10.756  2.537   1.00 0.00 ? 45 GLU A N    7  
ATOM 8570  C CA   . GLU A 1 45 ? -9.860  10.647  1.101   1.00 0.00 ? 45 GLU A CA   7  
ATOM 8571  C C    . GLU A 1 45 ? -8.833  10.081  0.137   1.00 0.00 ? 45 GLU A C    7  
ATOM 8572  O O    . GLU A 1 45 ? -9.092  9.145   -0.595  1.00 0.00 ? 45 GLU A O    7  
ATOM 8573  C CB   . GLU A 1 45 ? -10.172 12.062  0.611   1.00 0.00 ? 45 GLU A CB   7  
ATOM 8574  C CG   . GLU A 1 45 ? -11.313 12.662  1.439   1.00 0.00 ? 45 GLU A CG   7  
ATOM 8575  C CD   . GLU A 1 45 ? -12.611 11.907  1.148   1.00 0.00 ? 45 GLU A CD   7  
ATOM 8576  O OE1  . GLU A 1 45 ? -13.108 12.030  0.040   1.00 0.00 ? 45 GLU A OE1  7  
ATOM 8577  O OE2  . GLU A 1 45 ? -13.085 11.219  2.036   1.00 0.00 ? 45 GLU A OE2  7  
ATOM 8578  H H    . GLU A 1 45 ? -9.683  11.613  2.964   1.00 0.00 ? 45 GLU A H    7  
ATOM 8579  H HA   . GLU A 1 45 ? -10.763 10.067  1.025   1.00 0.00 ? 45 GLU A HA   7  
ATOM 8580  H HB2  . GLU A 1 45 ? -9.283  12.678  0.715   1.00 0.00 ? 45 GLU A HB2  7  
ATOM 8581  H HB3  . GLU A 1 45 ? -10.462 12.028  -0.428  1.00 0.00 ? 45 GLU A HB3  7  
ATOM 8582  H HG2  . GLU A 1 45 ? -11.077 12.584  2.490   1.00 0.00 ? 45 GLU A HG2  7  
ATOM 8583  H HG3  . GLU A 1 45 ? -11.438 13.702  1.176   1.00 0.00 ? 45 GLU A HG3  7  
ATOM 8584  N N    . GLU A 1 46 ? -7.669  10.638  0.138   1.00 0.00 ? 46 GLU A N    7  
ATOM 8585  C CA   . GLU A 1 46 ? -6.611  10.142  -0.763  1.00 0.00 ? 46 GLU A CA   7  
ATOM 8586  C C    . GLU A 1 46 ? -6.410  8.649   -0.525  1.00 0.00 ? 46 GLU A C    7  
ATOM 8587  O O    . GLU A 1 46 ? -5.935  7.940   -1.382  1.00 0.00 ? 46 GLU A O    7  
ATOM 8588  C CB   . GLU A 1 46 ? -5.323  10.902  -0.463  1.00 0.00 ? 46 GLU A CB   7  
ATOM 8589  C CG   . GLU A 1 46 ? -5.055  10.862  1.038   1.00 0.00 ? 46 GLU A CG   7  
ATOM 8590  C CD   . GLU A 1 46 ? -3.766  11.617  1.356   1.00 0.00 ? 46 GLU A CD   7  
ATOM 8591  O OE1  . GLU A 1 46 ? -3.818  12.834  1.424   1.00 0.00 ? 46 GLU A OE1  7  
ATOM 8592  O OE2  . GLU A 1 46 ? -2.748  10.967  1.525   1.00 0.00 ? 46 GLU A OE2  7  
ATOM 8593  H H    . GLU A 1 46 ? -7.485  11.392  0.736   1.00 0.00 ? 46 GLU A H    7  
ATOM 8594  H HA   . GLU A 1 46 ? -6.897  10.296  -1.788  1.00 0.00 ? 46 GLU A HA   7  
ATOM 8595  H HB2  . GLU A 1 46 ? -4.504  10.443  -0.983  1.00 0.00 ? 46 GLU A HB2  7  
ATOM 8596  H HB3  . GLU A 1 46 ? -5.431  11.928  -0.780  1.00 0.00 ? 46 GLU A HB3  7  
ATOM 8597  H HG2  . GLU A 1 46 ? -5.877  11.324  1.561   1.00 0.00 ? 46 GLU A HG2  7  
ATOM 8598  H HG3  . GLU A 1 46 ? -4.956  9.834   1.353   1.00 0.00 ? 46 GLU A HG3  7  
ATOM 8599  N N    . CYS A 1 47 ? -6.784  8.157   0.623   1.00 0.00 ? 47 CYS A N    7  
ATOM 8600  C CA   . CYS A 1 47 ? -6.625  6.699   0.883   1.00 0.00 ? 47 CYS A CA   7  
ATOM 8601  C C    . CYS A 1 47 ? -7.774  5.960   0.200   1.00 0.00 ? 47 CYS A C    7  
ATOM 8602  O O    . CYS A 1 47 ? -7.585  4.933   -0.420  1.00 0.00 ? 47 CYS A O    7  
ATOM 8603  C CB   . CYS A 1 47 ? -6.640  6.441   2.407   1.00 0.00 ? 47 CYS A CB   7  
ATOM 8604  S SG   . CYS A 1 47 ? -8.309  6.018   2.991   1.00 0.00 ? 47 CYS A SG   7  
ATOM 8605  H H    . CYS A 1 47 ? -7.183  8.742   1.301   1.00 0.00 ? 47 CYS A H    7  
ATOM 8606  H HA   . CYS A 1 47 ? -5.690  6.362   0.458   1.00 0.00 ? 47 CYS A HA   7  
ATOM 8607  H HB2  . CYS A 1 47 ? -5.973  5.628   2.640   1.00 0.00 ? 47 CYS A HB2  7  
ATOM 8608  H HB3  . CYS A 1 47 ? -6.310  7.333   2.917   1.00 0.00 ? 47 CYS A HB3  7  
ATOM 8609  N N    . GLN A 1 48 ? -8.964  6.471   0.316   1.00 0.00 ? 48 GLN A N    7  
ATOM 8610  C CA   . GLN A 1 48 ? -10.121 5.788   -0.322  1.00 0.00 ? 48 GLN A CA   7  
ATOM 8611  C C    . GLN A 1 48 ? -9.812  5.549   -1.794  1.00 0.00 ? 48 GLN A C    7  
ATOM 8612  O O    . GLN A 1 48 ? -10.102 4.503   -2.340  1.00 0.00 ? 48 GLN A O    7  
ATOM 8613  C CB   . GLN A 1 48 ? -11.370 6.665   -0.205  1.00 0.00 ? 48 GLN A CB   7  
ATOM 8614  C CG   . GLN A 1 48 ? -11.852 6.680   1.245   1.00 0.00 ? 48 GLN A CG   7  
ATOM 8615  C CD   . GLN A 1 48 ? -13.074 7.592   1.368   1.00 0.00 ? 48 GLN A CD   7  
ATOM 8616  O OE1  . GLN A 1 48 ? -13.049 8.723   0.925   1.00 0.00 ? 48 GLN A OE1  7  
ATOM 8617  N NE2  . GLN A 1 48 ? -14.150 7.145   1.956   1.00 0.00 ? 48 GLN A NE2  7  
ATOM 8618  H H    . GLN A 1 48 ? -9.094  7.294   0.833   1.00 0.00 ? 48 GLN A H    7  
ATOM 8619  H HA   . GLN A 1 48 ? -10.292 4.839   0.166   1.00 0.00 ? 48 GLN A HA   7  
ATOM 8620  H HB2  . GLN A 1 48 ? -11.133 7.671   -0.517  1.00 0.00 ? 48 GLN A HB2  7  
ATOM 8621  H HB3  . GLN A 1 48 ? -12.149 6.265   -0.836  1.00 0.00 ? 48 GLN A HB3  7  
ATOM 8622  H HG2  . GLN A 1 48 ? -12.117 5.676   1.543   1.00 0.00 ? 48 GLN A HG2  7  
ATOM 8623  H HG3  . GLN A 1 48 ? -11.063 7.050   1.880   1.00 0.00 ? 48 GLN A HG3  7  
ATOM 8624  H HE21 . GLN A 1 48 ? -14.170 6.233   2.314   1.00 0.00 ? 48 GLN A HE21 7  
ATOM 8625  H HE22 . GLN A 1 48 ? -14.937 7.722   2.041   1.00 0.00 ? 48 GLN A HE22 7  
ATOM 8626  N N    . GLU A 1 49 ? -9.240  6.520   -2.448  1.00 0.00 ? 49 GLU A N    7  
ATOM 8627  C CA   . GLU A 1 49 ? -8.929  6.361   -3.890  1.00 0.00 ? 49 GLU A CA   7  
ATOM 8628  C C    . GLU A 1 49 ? -7.824  5.321   -4.091  1.00 0.00 ? 49 GLU A C    7  
ATOM 8629  O O    . GLU A 1 49 ? -7.871  4.523   -5.007  1.00 0.00 ? 49 GLU A O    7  
ATOM 8630  C CB   . GLU A 1 49 ? -8.476  7.706   -4.463  1.00 0.00 ? 49 GLU A CB   7  
ATOM 8631  C CG   . GLU A 1 49 ? -9.681  8.640   -4.592  1.00 0.00 ? 49 GLU A CG   7  
ATOM 8632  C CD   . GLU A 1 49 ? -9.208  10.029  -5.022  1.00 0.00 ? 49 GLU A CD   7  
ATOM 8633  O OE1  . GLU A 1 49 ? -9.001  10.221  -6.209  1.00 0.00 ? 49 GLU A OE1  7  
ATOM 8634  O OE2  . GLU A 1 49 ? -9.060  10.877  -4.158  1.00 0.00 ? 49 GLU A OE2  7  
ATOM 8635  H H    . GLU A 1 49 ? -9.026  7.364   -1.999  1.00 0.00 ? 49 GLU A H    7  
ATOM 8636  H HA   . GLU A 1 49 ? -9.817  6.037   -4.410  1.00 0.00 ? 49 GLU A HA   7  
ATOM 8637  H HB2  . GLU A 1 49 ? -7.746  8.151   -3.804  1.00 0.00 ? 49 GLU A HB2  7  
ATOM 8638  H HB3  . GLU A 1 49 ? -8.037  7.554   -5.437  1.00 0.00 ? 49 GLU A HB3  7  
ATOM 8639  H HG2  . GLU A 1 49 ? -10.365 8.246   -5.330  1.00 0.00 ? 49 GLU A HG2  7  
ATOM 8640  H HG3  . GLU A 1 49 ? -10.184 8.713   -3.639  1.00 0.00 ? 49 GLU A HG3  7  
ATOM 8641  N N    . VAL A 1 50 ? -6.831  5.314   -3.236  1.00 0.00 ? 50 VAL A N    7  
ATOM 8642  C CA   . VAL A 1 50 ? -5.740  4.312   -3.386  1.00 0.00 ? 50 VAL A CA   7  
ATOM 8643  C C    . VAL A 1 50 ? -6.278  2.925   -3.051  1.00 0.00 ? 50 VAL A C    7  
ATOM 8644  O O    . VAL A 1 50 ? -6.107  1.985   -3.802  1.00 0.00 ? 50 VAL A O    7  
ATOM 8645  C CB   . VAL A 1 50 ? -4.571  4.620   -2.437  1.00 0.00 ? 50 VAL A CB   7  
ATOM 8646  C CG1  . VAL A 1 50 ? -3.439  3.615   -2.678  1.00 0.00 ? 50 VAL A CG1  7  
ATOM 8647  C CG2  . VAL A 1 50 ? -4.051  6.049   -2.688  1.00 0.00 ? 50 VAL A CG2  7  
ATOM 8648  H H    . VAL A 1 50 ? -6.809  5.958   -2.502  1.00 0.00 ? 50 VAL A H    7  
ATOM 8649  H HA   . VAL A 1 50 ? -5.383  4.338   -4.398  1.00 0.00 ? 50 VAL A HA   7  
ATOM 8650  H HB   . VAL A 1 50 ? -4.903  4.523   -1.417  1.00 0.00 ? 50 VAL A HB   7  
ATOM 8651  H HG11 . VAL A 1 50 ? -3.146  3.644   -3.716  1.00 0.00 ? 50 VAL A HG11 7  
ATOM 8652  H HG12 . VAL A 1 50 ? -3.776  2.622   -2.424  1.00 0.00 ? 50 VAL A HG12 7  
ATOM 8653  H HG13 . VAL A 1 50 ? -2.594  3.875   -2.058  1.00 0.00 ? 50 VAL A HG13 7  
ATOM 8654  H HG21 . VAL A 1 50 ? -3.611  6.436   -1.780  1.00 0.00 ? 50 VAL A HG21 7  
ATOM 8655  H HG22 . VAL A 1 50 ? -4.867  6.685   -2.988  1.00 0.00 ? 50 VAL A HG22 7  
ATOM 8656  H HG23 . VAL A 1 50 ? -3.306  6.037   -3.471  1.00 0.00 ? 50 VAL A HG23 7  
ATOM 8657  N N    . VAL A 1 51 ? -6.894  2.775   -1.904  1.00 0.00 ? 51 VAL A N    7  
ATOM 8658  C CA   . VAL A 1 51 ? -7.395  1.432   -1.507  1.00 0.00 ? 51 VAL A CA   7  
ATOM 8659  C C    . VAL A 1 51 ? -8.419  0.927   -2.530  1.00 0.00 ? 51 VAL A C    7  
ATOM 8660  O O    . VAL A 1 51 ? -8.328  -0.175  -3.031  1.00 0.00 ? 51 VAL A O    7  
ATOM 8661  C CB   . VAL A 1 51 ? -7.975  1.493   -0.086  1.00 0.00 ? 51 VAL A CB   7  
ATOM 8662  C CG1  . VAL A 1 51 ? -8.348  0.094   0.387   1.00 0.00 ? 51 VAL A CG1  7  
ATOM 8663  C CG2  . VAL A 1 51 ? -6.940  2.090   0.876   1.00 0.00 ? 51 VAL A CG2  7  
ATOM 8664  H H    . VAL A 1 51 ? -6.992  3.525   -1.282  1.00 0.00 ? 51 VAL A H    7  
ATOM 8665  H HA   . VAL A 1 51 ? -6.560  0.755   -1.557  1.00 0.00 ? 51 VAL A HA   7  
ATOM 8666  H HB   . VAL A 1 51 ? -8.855  2.114   -0.088  1.00 0.00 ? 51 VAL A HB   7  
ATOM 8667  H HG11 . VAL A 1 51 ? -7.497  -0.560  0.277   1.00 0.00 ? 51 VAL A HG11 7  
ATOM 8668  H HG12 . VAL A 1 51 ? -9.172  -0.277  -0.204  1.00 0.00 ? 51 VAL A HG12 7  
ATOM 8669  H HG13 . VAL A 1 51 ? -8.639  0.136   1.427   1.00 0.00 ? 51 VAL A HG13 7  
ATOM 8670  H HG21 . VAL A 1 51 ? -6.550  3.008   0.465   1.00 0.00 ? 51 VAL A HG21 7  
ATOM 8671  H HG22 . VAL A 1 51 ? -6.135  1.387   1.017   1.00 0.00 ? 51 VAL A HG22 7  
ATOM 8672  H HG23 . VAL A 1 51 ? -7.408  2.296   1.832   1.00 0.00 ? 51 VAL A HG23 7  
ATOM 8673  N N    . ASP A 1 52 ? -9.430  1.714   -2.789  1.00 0.00 ? 52 ASP A N    7  
ATOM 8674  C CA   . ASP A 1 52 ? -10.522 1.287   -3.714  1.00 0.00 ? 52 ASP A CA   7  
ATOM 8675  C C    . ASP A 1 52 ? -10.021 1.053   -5.140  1.00 0.00 ? 52 ASP A C    7  
ATOM 8676  O O    . ASP A 1 52 ? -10.429 0.118   -5.803  1.00 0.00 ? 52 ASP A O    7  
ATOM 8677  C CB   . ASP A 1 52 ? -11.600 2.375   -3.738  1.00 0.00 ? 52 ASP A CB   7  
ATOM 8678  C CG   . ASP A 1 52 ? -12.103 2.627   -2.315  1.00 0.00 ? 52 ASP A CG   7  
ATOM 8679  O OD1  . ASP A 1 52 ? -11.293 2.579   -1.405  1.00 0.00 ? 52 ASP A OD1  7  
ATOM 8680  O OD2  . ASP A 1 52 ? -13.289 2.865   -2.161  1.00 0.00 ? 52 ASP A OD2  7  
ATOM 8681  H H    . ASP A 1 52 ? -9.495  2.583   -2.342  1.00 0.00 ? 52 ASP A H    7  
ATOM 8682  H HA   . ASP A 1 52 ? -10.967 0.380   -3.333  1.00 0.00 ? 52 ASP A HA   7  
ATOM 8683  H HB2  . ASP A 1 52 ? -11.187 3.288   -4.140  1.00 0.00 ? 52 ASP A HB2  7  
ATOM 8684  H HB3  . ASP A 1 52 ? -12.425 2.051   -4.355  1.00 0.00 ? 52 ASP A HB3  7  
ATOM 8685  N N    . THR A 1 53 ? -9.165  1.903   -5.632  1.00 0.00 ? 53 THR A N    7  
ATOM 8686  C CA   . THR A 1 53 ? -8.667  1.744   -7.027  1.00 0.00 ? 53 THR A CA   7  
ATOM 8687  C C    . THR A 1 53 ? -7.445  0.832   -7.072  1.00 0.00 ? 53 THR A C    7  
ATOM 8688  O O    . THR A 1 53 ? -7.303  0.044   -7.986  1.00 0.00 ? 53 THR A O    7  
ATOM 8689  C CB   . THR A 1 53 ? -8.296  3.119   -7.586  1.00 0.00 ? 53 THR A CB   7  
ATOM 8690  O OG1  . THR A 1 53 ? -9.379  4.016   -7.384  1.00 0.00 ? 53 THR A OG1  7  
ATOM 8691  C CG2  . THR A 1 53 ? -7.999  3.005   -9.082  1.00 0.00 ? 53 THR A CG2  7  
ATOM 8692  H H    . THR A 1 53 ? -8.860  2.663   -5.092  1.00 0.00 ? 53 THR A H    7  
ATOM 8693  H HA   . THR A 1 53 ? -9.430  1.312   -7.649  1.00 0.00 ? 53 THR A HA   7  
ATOM 8694  H HB   . THR A 1 53 ? -7.423  3.491   -7.077  1.00 0.00 ? 53 THR A HB   7  
ATOM 8695  H HG1  . THR A 1 53 ? -9.195  4.820   -7.875  1.00 0.00 ? 53 THR A HG1  7  
ATOM 8696  H HG21 . THR A 1 53 ? -7.223  2.271   -9.240  1.00 0.00 ? 53 THR A HG21 7  
ATOM 8697  H HG22 . THR A 1 53 ? -7.670  3.963   -9.457  1.00 0.00 ? 53 THR A HG22 7  
ATOM 8698  H HG23 . THR A 1 53 ? -8.893  2.702   -9.605  1.00 0.00 ? 53 THR A HG23 7  
ATOM 8699  N N    . TYR A 1 54 ? -6.545  0.938   -6.126  1.00 0.00 ? 54 TYR A N    7  
ATOM 8700  C CA   . TYR A 1 54 ? -5.315  0.082   -6.164  1.00 0.00 ? 54 TYR A CA   7  
ATOM 8701  C C    . TYR A 1 54 ? -5.306  -0.971  -5.052  1.00 0.00 ? 54 TYR A C    7  
ATOM 8702  O O    . TYR A 1 54 ? -4.270  -1.337  -4.535  1.00 0.00 ? 54 TYR A O    7  
ATOM 8703  C CB   . TYR A 1 54 ? -4.087  0.971   -6.028  1.00 0.00 ? 54 TYR A CB   7  
ATOM 8704  C CG   . TYR A 1 54 ? -3.966  1.854   -7.248  1.00 0.00 ? 54 TYR A CG   7  
ATOM 8705  C CD1  . TYR A 1 54 ? -4.612  3.091   -7.270  1.00 0.00 ? 54 TYR A CD1  7  
ATOM 8706  C CD2  . TYR A 1 54 ? -3.208  1.442   -8.351  1.00 0.00 ? 54 TYR A CD2  7  
ATOM 8707  C CE1  . TYR A 1 54 ? -4.506  3.922   -8.386  1.00 0.00 ? 54 TYR A CE1  7  
ATOM 8708  C CE2  . TYR A 1 54 ? -3.100  2.273   -9.474  1.00 0.00 ? 54 TYR A CE2  7  
ATOM 8709  C CZ   . TYR A 1 54 ? -3.749  3.515   -9.491  1.00 0.00 ? 54 TYR A CZ   7  
ATOM 8710  O OH   . TYR A 1 54 ? -3.643  4.334   -10.596 1.00 0.00 ? 54 TYR A OH   7  
ATOM 8711  H H    . TYR A 1 54 ? -6.663  1.595   -5.407  1.00 0.00 ? 54 TYR A H    7  
ATOM 8712  H HA   . TYR A 1 54 ? -5.255  -0.438  -7.110  1.00 0.00 ? 54 TYR A HA   7  
ATOM 8713  H HB2  . TYR A 1 54 ? -4.191  1.582   -5.150  1.00 0.00 ? 54 TYR A HB2  7  
ATOM 8714  H HB3  . TYR A 1 54 ? -3.205  0.356   -5.940  1.00 0.00 ? 54 TYR A HB3  7  
ATOM 8715  H HD1  . TYR A 1 54 ? -5.195  3.402   -6.428  1.00 0.00 ? 54 TYR A HD1  7  
ATOM 8716  H HD2  . TYR A 1 54 ? -2.710  0.485   -8.336  1.00 0.00 ? 54 TYR A HD2  7  
ATOM 8717  H HE1  . TYR A 1 54 ? -5.008  4.879   -8.392  1.00 0.00 ? 54 TYR A HE1  7  
ATOM 8718  H HE2  . TYR A 1 54 ? -2.516  1.956   -10.325 1.00 0.00 ? 54 TYR A HE2  7  
ATOM 8719  H HH   . TYR A 1 54 ? -2.840  4.853   -10.506 1.00 0.00 ? 54 TYR A HH   7  
ATOM 8720  N N    . GLY A 1 55 ? -6.464  -1.425  -4.651  1.00 0.00 ? 55 GLY A N    7  
ATOM 8721  C CA   . GLY A 1 55 ? -6.546  -2.413  -3.540  1.00 0.00 ? 55 GLY A CA   7  
ATOM 8722  C C    . GLY A 1 55 ? -6.254  -3.833  -4.023  1.00 0.00 ? 55 GLY A C    7  
ATOM 8723  O O    . GLY A 1 55 ? -5.381  -4.498  -3.501  1.00 0.00 ? 55 GLY A O    7  
ATOM 8724  H H    . GLY A 1 55 ? -7.284  -1.106  -5.077  1.00 0.00 ? 55 GLY A H    7  
ATOM 8725  H HA2  . GLY A 1 55 ? -5.822  -2.147  -2.781  1.00 0.00 ? 55 GLY A HA2  7  
ATOM 8726  H HA3  . GLY A 1 55 ? -7.535  -2.382  -3.109  1.00 0.00 ? 55 GLY A HA3  7  
ATOM 8727  N N    . SER A 1 56 ? -6.980  -4.330  -4.990  1.00 0.00 ? 56 SER A N    7  
ATOM 8728  C CA   . SER A 1 56 ? -6.715  -5.721  -5.437  1.00 0.00 ? 56 SER A CA   7  
ATOM 8729  C C    . SER A 1 56 ? -5.330  -5.803  -6.057  1.00 0.00 ? 56 SER A C    7  
ATOM 8730  O O    . SER A 1 56 ? -4.698  -6.841  -6.073  1.00 0.00 ? 56 SER A O    7  
ATOM 8731  C CB   . SER A 1 56 ? -7.751  -6.162  -6.468  1.00 0.00 ? 56 SER A CB   7  
ATOM 8732  O OG   . SER A 1 56 ? -9.022  -5.630  -6.119  1.00 0.00 ? 56 SER A OG   7  
ATOM 8733  H H    . SER A 1 56 ? -7.697  -3.807  -5.405  1.00 0.00 ? 56 SER A H    7  
ATOM 8734  H HA   . SER A 1 56 ? -6.767  -6.369  -4.576  1.00 0.00 ? 56 SER A HA   7  
ATOM 8735  H HB2  . SER A 1 56 ? -7.468  -5.801  -7.446  1.00 0.00 ? 56 SER A HB2  7  
ATOM 8736  H HB3  . SER A 1 56 ? -7.791  -7.244  -6.484  1.00 0.00 ? 56 SER A HB3  7  
ATOM 8737  H HG   . SER A 1 56 ? -9.620  -5.784  -6.855  1.00 0.00 ? 56 SER A HG   7  
ATOM 8738  N N    . SER A 1 57 ? -4.886  -4.721  -6.640  1.00 0.00 ? 57 SER A N    7  
ATOM 8739  C CA   . SER A 1 57 ? -3.578  -4.755  -7.340  1.00 0.00 ? 57 SER A CA   7  
ATOM 8740  C C    . SER A 1 57 ? -2.419  -4.741  -6.349  1.00 0.00 ? 57 SER A C    7  
ATOM 8741  O O    . SER A 1 57 ? -1.528  -5.558  -6.426  1.00 0.00 ? 57 SER A O    7  
ATOM 8742  C CB   . SER A 1 57 ? -3.464  -3.588  -8.320  1.00 0.00 ? 57 SER A CB   7  
ATOM 8743  O OG   . SER A 1 57 ? -3.475  -2.365  -7.596  1.00 0.00 ? 57 SER A OG   7  
ATOM 8744  H H    . SER A 1 57 ? -5.434  -3.909  -6.636  1.00 0.00 ? 57 SER A H    7  
ATOM 8745  H HA   . SER A 1 57 ? -3.530  -5.693  -7.873  1.00 0.00 ? 57 SER A HA   7  
ATOM 8746  H HB2  . SER A 1 57 ? -2.540  -3.667  -8.869  1.00 0.00 ? 57 SER A HB2  7  
ATOM 8747  H HB3  . SER A 1 57 ? -4.295  -3.618  -9.012  1.00 0.00 ? 57 SER A HB3  7  
ATOM 8748  H HG   . SER A 1 57 ? -4.217  -2.388  -6.986  1.00 0.00 ? 57 SER A HG   7  
ATOM 8749  N N    . ILE A 1 58 ? -2.449  -3.862  -5.381  1.00 0.00 ? 58 ILE A N    7  
ATOM 8750  C CA   . ILE A 1 58 ? -1.365  -3.851  -4.362  1.00 0.00 ? 58 ILE A CA   7  
ATOM 8751  C C    . ILE A 1 58 ? -1.299  -5.234  -3.726  1.00 0.00 ? 58 ILE A C    7  
ATOM 8752  O O    . ILE A 1 58 ? -0.271  -5.877  -3.661  1.00 0.00 ? 58 ILE A O    7  
ATOM 8753  C CB   . ILE A 1 58 ? -1.680  -2.804  -3.269  1.00 0.00 ? 58 ILE A CB   7  
ATOM 8754  C CG1  . ILE A 1 58 ? -1.384  -1.395  -3.814  1.00 0.00 ? 58 ILE A CG1  7  
ATOM 8755  C CG2  . ILE A 1 58 ? -0.809  -3.073  -2.024  1.00 0.00 ? 58 ILE A CG2  7  
ATOM 8756  C CD1  . ILE A 1 58 ? -1.787  -0.315  -2.793  1.00 0.00 ? 58 ILE A CD1  7  
ATOM 8757  H H    . ILE A 1 58 ? -3.203  -3.243  -5.288  1.00 0.00 ? 58 ILE A H    7  
ATOM 8758  H HA   . ILE A 1 58 ? -0.408  -3.617  -4.807  1.00 0.00 ? 58 ILE A HA   7  
ATOM 8759  H HB   . ILE A 1 58 ? -2.724  -2.875  -2.996  1.00 0.00 ? 58 ILE A HB   7  
ATOM 8760  H HG12 . ILE A 1 58 ? -0.328  -1.311  -4.017  1.00 0.00 ? 58 ILE A HG12 7  
ATOM 8761  H HG13 . ILE A 1 58 ? -1.935  -1.243  -4.730  1.00 0.00 ? 58 ILE A HG13 7  
ATOM 8762  H HG21 . ILE A 1 58 ? 0.201   -3.296  -2.335  1.00 0.00 ? 58 ILE A HG21 7  
ATOM 8763  H HG22 . ILE A 1 58 ? -1.208  -3.919  -1.482  1.00 0.00 ? 58 ILE A HG22 7  
ATOM 8764  H HG23 . ILE A 1 58 ? -0.802  -2.210  -1.378  1.00 0.00 ? 58 ILE A HG23 7  
ATOM 8765  H HD11 . ILE A 1 58 ? -2.064  0.594   -3.312  1.00 0.00 ? 58 ILE A HD11 7  
ATOM 8766  H HD12 . ILE A 1 58 ? -0.949  -0.113  -2.143  1.00 0.00 ? 58 ILE A HD12 7  
ATOM 8767  H HD13 . ILE A 1 58 ? -2.626  -0.658  -2.204  1.00 0.00 ? 58 ILE A HD13 7  
ATOM 8768  N N    . LEU A 1 59 ? -2.424  -5.663  -3.239  1.00 0.00 ? 59 LEU A N    7  
ATOM 8769  C CA   . LEU A 1 59 ? -2.526  -6.978  -2.568  1.00 0.00 ? 59 LEU A CA   7  
ATOM 8770  C C    . LEU A 1 59 ? -2.158  -8.089  -3.550  1.00 0.00 ? 59 LEU A C    7  
ATOM 8771  O O    . LEU A 1 59 ? -1.764  -9.161  -3.145  1.00 0.00 ? 59 LEU A O    7  
ATOM 8772  C CB   . LEU A 1 59 ? -3.971  -7.157  -2.081  1.00 0.00 ? 59 LEU A CB   7  
ATOM 8773  C CG   . LEU A 1 59 ? -4.186  -8.568  -1.511  1.00 0.00 ? 59 LEU A CG   7  
ATOM 8774  C CD1  . LEU A 1 59 ? -3.138  -8.862  -0.425  1.00 0.00 ? 59 LEU A CD1  7  
ATOM 8775  C CD2  . LEU A 1 59 ? -5.597  -8.671  -0.900  1.00 0.00 ? 59 LEU A CD2  7  
ATOM 8776  H H    . LEU A 1 59 ? -3.219  -5.095  -3.319  1.00 0.00 ? 59 LEU A H    7  
ATOM 8777  H HA   . LEU A 1 59 ? -1.856  -7.003  -1.724  1.00 0.00 ? 59 LEU A HA   7  
ATOM 8778  H HB2  . LEU A 1 59 ? -4.173  -6.427  -1.312  1.00 0.00 ? 59 LEU A HB2  7  
ATOM 8779  H HB3  . LEU A 1 59 ? -4.647  -7.000  -2.907  1.00 0.00 ? 59 LEU A HB3  7  
ATOM 8780  H HG   . LEU A 1 59 ? -4.094  -9.289  -2.313  1.00 0.00 ? 59 LEU A HG   7  
ATOM 8781  H HD11 . LEU A 1 59 ? -3.487  -9.669  0.205   1.00 0.00 ? 59 LEU A HD11 7  
ATOM 8782  H HD12 . LEU A 1 59 ? -2.985  -7.979  0.176   1.00 0.00 ? 59 LEU A HD12 7  
ATOM 8783  H HD13 . LEU A 1 59 ? -2.208  -9.148  -0.887  1.00 0.00 ? 59 LEU A HD13 7  
ATOM 8784  H HD21 . LEU A 1 59 ? -5.612  -9.453  -0.154  1.00 0.00 ? 59 LEU A HD21 7  
ATOM 8785  H HD22 . LEU A 1 59 ? -6.307  -8.908  -1.677  1.00 0.00 ? 59 LEU A HD22 7  
ATOM 8786  H HD23 . LEU A 1 59 ? -5.869  -7.735  -0.437  1.00 0.00 ? 59 LEU A HD23 7  
ATOM 8787  N N    . SER A 1 60 ? -2.303  -7.891  -4.832  1.00 0.00 ? 60 SER A N    7  
ATOM 8788  C CA   . SER A 1 60 ? -1.972  -9.015  -5.760  1.00 0.00 ? 60 SER A CA   7  
ATOM 8789  C C    . SER A 1 60 ? -0.456  -9.083  -5.975  1.00 0.00 ? 60 SER A C    7  
ATOM 8790  O O    . SER A 1 60 ? 0.121   -10.141 -6.131  1.00 0.00 ? 60 SER A O    7  
ATOM 8791  C CB   . SER A 1 60 ? -2.674  -8.787  -7.095  1.00 0.00 ? 60 SER A CB   7  
ATOM 8792  O OG   . SER A 1 60 ? -2.165  -9.701  -8.058  1.00 0.00 ? 60 SER A OG   7  
ATOM 8793  H H    . SER A 1 60 ? -2.642  -7.038  -5.177  1.00 0.00 ? 60 SER A H    7  
ATOM 8794  H HA   . SER A 1 60 ? -2.357  -9.905  -5.287  1.00 0.00 ? 60 SER A HA   7  
ATOM 8795  H HB2  . SER A 1 60 ? -3.732  -8.945  -6.979  1.00 0.00 ? 60 SER A HB2  7  
ATOM 8796  H HB3  . SER A 1 60 ? -2.497  -7.768  -7.418  1.00 0.00 ? 60 SER A HB3  7  
ATOM 8797  H HG   . SER A 1 60 ? -2.348  -9.345  -8.931  1.00 0.00 ? 60 SER A HG   7  
ATOM 8798  N N    . ILE A 1 61 ? 0.186   -7.943  -5.989  1.00 0.00 ? 61 ILE A N    7  
ATOM 8799  C CA   . ILE A 1 61 ? 1.663   -7.892  -6.201  1.00 0.00 ? 61 ILE A CA   7  
ATOM 8800  C C    . ILE A 1 61 ? 2.402   -8.457  -4.985  1.00 0.00 ? 61 ILE A C    7  
ATOM 8801  O O    . ILE A 1 61 ? 3.307   -9.257  -5.113  1.00 0.00 ? 61 ILE A O    7  
ATOM 8802  C CB   . ILE A 1 61 ? 2.088   -6.423  -6.375  1.00 0.00 ? 61 ILE A CB   7  
ATOM 8803  C CG1  . ILE A 1 61 ? 1.150   -5.706  -7.405  1.00 0.00 ? 61 ILE A CG1  7  
ATOM 8804  C CG2  . ILE A 1 61 ? 3.564   -6.375  -6.804  1.00 0.00 ? 61 ILE A CG2  7  
ATOM 8805  C CD1  . ILE A 1 61 ? 1.936   -5.062  -8.553  1.00 0.00 ? 61 ILE A CD1  7  
ATOM 8806  H H    . ILE A 1 61 ? -0.313  -7.107  -5.875  1.00 0.00 ? 61 ILE A H    7  
ATOM 8807  H HA   . ILE A 1 61 ? 1.930   -8.453  -7.085  1.00 0.00 ? 61 ILE A HA   7  
ATOM 8808  H HB   . ILE A 1 61 ? 2.002   -5.930  -5.413  1.00 0.00 ? 61 ILE A HB   7  
ATOM 8809  H HG12 . ILE A 1 61 ? 0.444   -6.412  -7.820  1.00 0.00 ? 61 ILE A HG12 7  
ATOM 8810  H HG13 . ILE A 1 61 ? 0.603   -4.928  -6.894  1.00 0.00 ? 61 ILE A HG13 7  
ATOM 8811  H HG21 . ILE A 1 61 ? 3.886   -5.345  -6.871  1.00 0.00 ? 61 ILE A HG21 7  
ATOM 8812  H HG22 . ILE A 1 61 ? 3.679   -6.854  -7.764  1.00 0.00 ? 61 ILE A HG22 7  
ATOM 8813  H HG23 . ILE A 1 61 ? 4.166   -6.887  -6.070  1.00 0.00 ? 61 ILE A HG23 7  
ATOM 8814  H HD11 . ILE A 1 61 ? 2.491   -5.820  -9.085  1.00 0.00 ? 61 ILE A HD11 7  
ATOM 8815  H HD12 . ILE A 1 61 ? 2.614   -4.328  -8.149  1.00 0.00 ? 61 ILE A HD12 7  
ATOM 8816  H HD13 . ILE A 1 61 ? 1.246   -4.581  -9.229  1.00 0.00 ? 61 ILE A HD13 7  
ATOM 8817  N N    . LEU A 1 62 ? 2.049   -8.016  -3.811  1.00 0.00 ? 62 LEU A N    7  
ATOM 8818  C CA   . LEU A 1 62 ? 2.761   -8.494  -2.597  1.00 0.00 ? 62 LEU A CA   7  
ATOM 8819  C C    . LEU A 1 62 ? 2.728   -10.026 -2.550  1.00 0.00 ? 62 LEU A C    7  
ATOM 8820  O O    . LEU A 1 62 ? 3.666   -10.663 -2.113  1.00 0.00 ? 62 LEU A O    7  
ATOM 8821  C CB   . LEU A 1 62 ? 2.093   -7.876  -1.349  1.00 0.00 ? 62 LEU A CB   7  
ATOM 8822  C CG   . LEU A 1 62 ? 3.120   -7.051  -0.548  1.00 0.00 ? 62 LEU A CG   7  
ATOM 8823  C CD1  . LEU A 1 62 ? 2.411   -6.255  0.560   1.00 0.00 ? 62 LEU A CD1  7  
ATOM 8824  C CD2  . LEU A 1 62 ? 4.177   -7.996  0.066   1.00 0.00 ? 62 LEU A CD2  7  
ATOM 8825  H H    . LEU A 1 62 ? 1.336   -7.349  -3.733  1.00 0.00 ? 62 LEU A H    7  
ATOM 8826  H HA   . LEU A 1 62 ? 3.788   -8.167  -2.671  1.00 0.00 ? 62 LEU A HA   7  
ATOM 8827  H HB2  . LEU A 1 62 ? 1.290   -7.230  -1.670  1.00 0.00 ? 62 LEU A HB2  7  
ATOM 8828  H HB3  . LEU A 1 62 ? 1.686   -8.653  -0.715  1.00 0.00 ? 62 LEU A HB3  7  
ATOM 8829  H HG   . LEU A 1 62 ? 3.609   -6.356  -1.216  1.00 0.00 ? 62 LEU A HG   7  
ATOM 8830  H HD11 . LEU A 1 62 ? 1.424   -5.958  0.235   1.00 0.00 ? 62 LEU A HD11 7  
ATOM 8831  H HD12 . LEU A 1 62 ? 2.987   -5.373  0.788   1.00 0.00 ? 62 LEU A HD12 7  
ATOM 8832  H HD13 . LEU A 1 62 ? 2.327   -6.866  1.443   1.00 0.00 ? 62 LEU A HD13 7  
ATOM 8833  H HD21 . LEU A 1 62 ? 4.942   -8.207  -0.667  1.00 0.00 ? 62 LEU A HD21 7  
ATOM 8834  H HD22 . LEU A 1 62 ? 3.711   -8.921  0.372   1.00 0.00 ? 62 LEU A HD22 7  
ATOM 8835  H HD23 . LEU A 1 62 ? 4.628   -7.528  0.926   1.00 0.00 ? 62 LEU A HD23 7  
ATOM 8836  N N    . LEU A 1 63 ? 1.663   -10.620 -3.005  1.00 0.00 ? 63 LEU A N    7  
ATOM 8837  C CA   . LEU A 1 63 ? 1.584   -12.105 -2.994  1.00 0.00 ? 63 LEU A CA   7  
ATOM 8838  C C    . LEU A 1 63 ? 2.521   -12.674 -4.053  1.00 0.00 ? 63 LEU A C    7  
ATOM 8839  O O    . LEU A 1 63 ? 2.861   -13.840 -4.036  1.00 0.00 ? 63 LEU A O    7  
ATOM 8840  C CB   . LEU A 1 63 ? 0.147   -12.553 -3.258  1.00 0.00 ? 63 LEU A CB   7  
ATOM 8841  C CG   . LEU A 1 63 ? -0.767  -12.019 -2.151  1.00 0.00 ? 63 LEU A CG   7  
ATOM 8842  C CD1  . LEU A 1 63 ? -2.215  -12.413 -2.459  1.00 0.00 ? 63 LEU A CD1  7  
ATOM 8843  C CD2  . LEU A 1 63 ? -0.342  -12.600 -0.789  1.00 0.00 ? 63 LEU A CD2  7  
ATOM 8844  H H    . LEU A 1 63 ? 0.919   -10.091 -3.362  1.00 0.00 ? 63 LEU A H    7  
ATOM 8845  H HA   . LEU A 1 63 ? 1.919   -12.490 -2.044  1.00 0.00 ? 63 LEU A HA   7  
ATOM 8846  H HB2  . LEU A 1 63 ? -0.179  -12.167 -4.214  1.00 0.00 ? 63 LEU A HB2  7  
ATOM 8847  H HB3  . LEU A 1 63 ? 0.102   -13.632 -3.271  1.00 0.00 ? 63 LEU A HB3  7  
ATOM 8848  H HG   . LEU A 1 63 ? -0.690  -10.943 -2.119  1.00 0.00 ? 63 LEU A HG   7  
ATOM 8849  H HD11 . LEU A 1 63 ? -2.487  -12.044 -3.437  1.00 0.00 ? 63 LEU A HD11 7  
ATOM 8850  H HD12 . LEU A 1 63 ? -2.872  -11.983 -1.717  1.00 0.00 ? 63 LEU A HD12 7  
ATOM 8851  H HD13 . LEU A 1 63 ? -2.307  -13.488 -2.441  1.00 0.00 ? 63 LEU A HD13 7  
ATOM 8852  H HD21 . LEU A 1 63 ? 0.434   -11.979 -0.364  1.00 0.00 ? 63 LEU A HD21 7  
ATOM 8853  H HD22 . LEU A 1 63 ? 0.034   -13.605 -0.918  1.00 0.00 ? 63 LEU A HD22 7  
ATOM 8854  H HD23 . LEU A 1 63 ? -1.189  -12.618 -0.117  1.00 0.00 ? 63 LEU A HD23 7  
ATOM 8855  N N    . GLU A 1 64 ? 2.940   -11.857 -4.981  1.00 0.00 ? 64 GLU A N    7  
ATOM 8856  C CA   . GLU A 1 64 ? 3.853   -12.342 -6.049  1.00 0.00 ? 64 GLU A CA   7  
ATOM 8857  C C    . GLU A 1 64 ? 5.291   -12.243 -5.530  1.00 0.00 ? 64 GLU A C    7  
ATOM 8858  O O    . GLU A 1 64 ? 6.233   -12.022 -6.264  1.00 0.00 ? 64 GLU A O    7  
ATOM 8859  C CB   . GLU A 1 64 ? 3.643   -11.494 -7.308  1.00 0.00 ? 64 GLU A CB   7  
ATOM 8860  C CG   . GLU A 1 64 ? 4.235   -12.201 -8.528  1.00 0.00 ? 64 GLU A CG   7  
ATOM 8861  C CD   . GLU A 1 64 ? 3.394   -13.436 -8.860  1.00 0.00 ? 64 GLU A CD   7  
ATOM 8862  O OE1  . GLU A 1 64 ? 2.313   -13.264 -9.399  1.00 0.00 ? 64 GLU A OE1  7  
ATOM 8863  O OE2  . GLU A 1 64 ? 3.844   -14.531 -8.569  1.00 0.00 ? 64 GLU A OE2  7  
ATOM 8864  H H    . GLU A 1 64 ? 2.655   -10.924 -4.977  1.00 0.00 ? 64 GLU A H    7  
ATOM 8865  H HA   . GLU A 1 64 ? 3.631   -13.380 -6.257  1.00 0.00 ? 64 GLU A HA   7  
ATOM 8866  H HB2  . GLU A 1 64 ? 2.583   -11.348 -7.461  1.00 0.00 ? 64 GLU A HB2  7  
ATOM 8867  H HB3  . GLU A 1 64 ? 4.116   -10.539 -7.179  1.00 0.00 ? 64 GLU A HB3  7  
ATOM 8868  H HG2  . GLU A 1 64 ? 4.227   -11.523 -9.369  1.00 0.00 ? 64 GLU A HG2  7  
ATOM 8869  H HG3  . GLU A 1 64 ? 5.248   -12.503 -8.319  1.00 0.00 ? 64 GLU A HG3  7  
ATOM 8870  N N    . GLU A 1 65 ? 5.447   -12.474 -4.256  1.00 0.00 ? 65 GLU A N    7  
ATOM 8871  C CA   . GLU A 1 65 ? 6.801   -12.478 -3.635  1.00 0.00 ? 65 GLU A CA   7  
ATOM 8872  C C    . GLU A 1 65 ? 7.660   -11.295 -4.094  1.00 0.00 ? 65 GLU A C    7  
ATOM 8873  O O    . GLU A 1 65 ? 8.870   -11.385 -4.157  1.00 0.00 ? 65 GLU A O    7  
ATOM 8874  C CB   . GLU A 1 65 ? 7.504   -13.759 -4.077  1.00 0.00 ? 65 GLU A CB   7  
ATOM 8875  C CG   . GLU A 1 65 ? 6.787   -14.971 -3.477  1.00 0.00 ? 65 GLU A CG   7  
ATOM 8876  C CD   . GLU A 1 65 ? 7.059   -15.033 -1.973  1.00 0.00 ? 65 GLU A CD   7  
ATOM 8877  O OE1  . GLU A 1 65 ? 8.219   -14.978 -1.597  1.00 0.00 ? 65 GLU A OE1  7  
ATOM 8878  O OE2  . GLU A 1 65 ? 6.104   -15.133 -1.221  1.00 0.00 ? 65 GLU A OE2  7  
ATOM 8879  H H    . GLU A 1 65 ? 4.661   -12.698 -3.721  1.00 0.00 ? 65 GLU A H    7  
ATOM 8880  H HA   . GLU A 1 65 ? 6.725   -12.499 -2.560  1.00 0.00 ? 65 GLU A HA   7  
ATOM 8881  H HB2  . GLU A 1 65 ? 7.481   -13.826 -5.155  1.00 0.00 ? 65 GLU A HB2  7  
ATOM 8882  H HB3  . GLU A 1 65 ? 8.528   -13.744 -3.737  1.00 0.00 ? 65 GLU A HB3  7  
ATOM 8883  H HG2  . GLU A 1 65 ? 5.724   -14.880 -3.648  1.00 0.00 ? 65 GLU A HG2  7  
ATOM 8884  H HG3  . GLU A 1 65 ? 7.152   -15.873 -3.943  1.00 0.00 ? 65 GLU A HG3  7  
ATOM 8885  N N    . VAL A 1 66 ? 7.051   -10.176 -4.384  1.00 0.00 ? 66 VAL A N    7  
ATOM 8886  C CA   . VAL A 1 66 ? 7.840   -8.971  -4.802  1.00 0.00 ? 66 VAL A CA   7  
ATOM 8887  C C    . VAL A 1 66 ? 8.145   -8.140  -3.542  1.00 0.00 ? 66 VAL A C    7  
ATOM 8888  O O    . VAL A 1 66 ? 7.347   -8.063  -2.630  1.00 0.00 ? 66 VAL A O    7  
ATOM 8889  C CB   . VAL A 1 66 ? 7.002   -8.155  -5.812  1.00 0.00 ? 66 VAL A CB   7  
ATOM 8890  C CG1  . VAL A 1 66 ? 7.374   -6.665  -5.761  1.00 0.00 ? 66 VAL A CG1  7  
ATOM 8891  C CG2  . VAL A 1 66 ? 7.259   -8.683  -7.229  1.00 0.00 ? 66 VAL A CG2  7  
ATOM 8892  H H    . VAL A 1 66 ? 6.069   -10.117 -4.315  1.00 0.00 ? 66 VAL A H    7  
ATOM 8893  H HA   . VAL A 1 66 ? 8.765   -9.281  -5.275  1.00 0.00 ? 66 VAL A HA   7  
ATOM 8894  H HB   . VAL A 1 66 ? 5.956   -8.268  -5.574  1.00 0.00 ? 66 VAL A HB   7  
ATOM 8895  H HG11 . VAL A 1 66 ? 6.933   -6.215  -4.886  1.00 0.00 ? 66 VAL A HG11 7  
ATOM 8896  H HG12 . VAL A 1 66 ? 7.004   -6.168  -6.646  1.00 0.00 ? 66 VAL A HG12 7  
ATOM 8897  H HG13 . VAL A 1 66 ? 8.449   -6.566  -5.715  1.00 0.00 ? 66 VAL A HG13 7  
ATOM 8898  H HG21 . VAL A 1 66 ? 8.226   -8.342  -7.569  1.00 0.00 ? 66 VAL A HG21 7  
ATOM 8899  H HG22 . VAL A 1 66 ? 6.495   -8.314  -7.898  1.00 0.00 ? 66 VAL A HG22 7  
ATOM 8900  H HG23 . VAL A 1 66 ? 7.243   -9.764  -7.219  1.00 0.00 ? 66 VAL A HG23 7  
ATOM 8901  N N    . SER A 1 67 ? 9.300   -7.524  -3.490  1.00 0.00 ? 67 SER A N    7  
ATOM 8902  C CA   . SER A 1 67 ? 9.662   -6.704  -2.295  1.00 0.00 ? 67 SER A CA   7  
ATOM 8903  C C    . SER A 1 67 ? 8.507   -5.725  -1.982  1.00 0.00 ? 67 SER A C    7  
ATOM 8904  O O    . SER A 1 67 ? 7.786   -5.343  -2.881  1.00 0.00 ? 67 SER A O    7  
ATOM 8905  C CB   . SER A 1 67 ? 10.952  -5.926  -2.594  1.00 0.00 ? 67 SER A CB   7  
ATOM 8906  O OG   . SER A 1 67 ? 11.770  -6.698  -3.463  1.00 0.00 ? 67 SER A OG   7  
ATOM 8907  H H    . SER A 1 67 ? 9.931   -7.602  -4.237  1.00 0.00 ? 67 SER A H    7  
ATOM 8908  H HA   . SER A 1 67 ? 9.826   -7.369  -1.468  1.00 0.00 ? 67 SER A HA   7  
ATOM 8909  H HB2  . SER A 1 67 ? 10.716  -4.990  -3.069  1.00 0.00 ? 67 SER A HB2  7  
ATOM 8910  H HB3  . SER A 1 67 ? 11.482  -5.733  -1.671  1.00 0.00 ? 67 SER A HB3  7  
ATOM 8911  H HG   . SER A 1 67 ? 12.399  -6.106  -3.881  1.00 0.00 ? 67 SER A HG   7  
ATOM 8912  N N    . PRO A 1 68 ? 8.337   -5.349  -0.724  1.00 0.00 ? 68 PRO A N    7  
ATOM 8913  C CA   . PRO A 1 68 ? 7.243   -4.429  -0.336  1.00 0.00 ? 68 PRO A CA   7  
ATOM 8914  C C    . PRO A 1 68 ? 7.436   -3.008  -0.909  1.00 0.00 ? 68 PRO A C    7  
ATOM 8915  O O    . PRO A 1 68 ? 6.487   -2.371  -1.309  1.00 0.00 ? 68 PRO A O    7  
ATOM 8916  C CB   . PRO A 1 68 ? 7.296   -4.391  1.210   1.00 0.00 ? 68 PRO A CB   7  
ATOM 8917  C CG   . PRO A 1 68 ? 8.625   -5.064  1.642   1.00 0.00 ? 68 PRO A CG   7  
ATOM 8918  C CD   . PRO A 1 68 ? 9.186   -5.798  0.409   1.00 0.00 ? 68 PRO A CD   7  
ATOM 8919  H HA   . PRO A 1 68 ? 6.294   -4.835  -0.664  1.00 0.00 ? 68 PRO A HA   7  
ATOM 8920  H HB2  . PRO A 1 68 ? 7.261   -3.369  1.571   1.00 0.00 ? 68 PRO A HB2  7  
ATOM 8921  H HB3  . PRO A 1 68 ? 6.468   -4.942  1.620   1.00 0.00 ? 68 PRO A HB3  7  
ATOM 8922  H HG2  . PRO A 1 68 ? 9.327   -4.309  1.979   1.00 0.00 ? 68 PRO A HG2  7  
ATOM 8923  H HG3  . PRO A 1 68 ? 8.442   -5.772  2.440   1.00 0.00 ? 68 PRO A HG3  7  
ATOM 8924  H HD2  . PRO A 1 68 ? 10.220  -5.528  0.245   1.00 0.00 ? 68 PRO A HD2  7  
ATOM 8925  H HD3  . PRO A 1 68 ? 9.091   -6.865  0.545   1.00 0.00 ? 68 PRO A HD3  7  
ATOM 8926  N N    . GLU A 1 69 ? 8.634   -2.482  -0.911  1.00 0.00 ? 69 GLU A N    7  
ATOM 8927  C CA   . GLU A 1 69 ? 8.822   -1.082  -1.418  1.00 0.00 ? 69 GLU A CA   7  
ATOM 8928  C C    . GLU A 1 69 ? 8.821   -1.055  -2.956  1.00 0.00 ? 69 GLU A C    7  
ATOM 8929  O O    . GLU A 1 69 ? 8.643   -0.012  -3.572  1.00 0.00 ? 69 GLU A O    7  
ATOM 8930  C CB   . GLU A 1 69 ? 10.141  -0.492  -0.864  1.00 0.00 ? 69 GLU A CB   7  
ATOM 8931  C CG   . GLU A 1 69 ? 11.120  -1.615  -0.501  1.00 0.00 ? 69 GLU A CG   7  
ATOM 8932  C CD   . GLU A 1 69 ? 12.464  -1.005  -0.097  1.00 0.00 ? 69 GLU A CD   7  
ATOM 8933  O OE1  . GLU A 1 69 ? 12.597  -0.623  1.053   1.00 0.00 ? 69 GLU A OE1  7  
ATOM 8934  O OE2  . GLU A 1 69 ? 13.337  -0.930  -0.946  1.00 0.00 ? 69 GLU A OE2  7  
ATOM 8935  H H    . GLU A 1 69 ? 9.396   -2.984  -0.556  1.00 0.00 ? 69 GLU A H    7  
ATOM 8936  H HA   . GLU A 1 69 ? 7.995   -0.476  -1.068  1.00 0.00 ? 69 GLU A HA   7  
ATOM 8937  H HB2  . GLU A 1 69 ? 10.597  0.153   -1.602  1.00 0.00 ? 69 GLU A HB2  7  
ATOM 8938  H HB3  . GLU A 1 69 ? 9.929   0.087   0.026   1.00 0.00 ? 69 GLU A HB3  7  
ATOM 8939  H HG2  . GLU A 1 69 ? 10.723  -2.186  0.326   1.00 0.00 ? 69 GLU A HG2  7  
ATOM 8940  H HG3  . GLU A 1 69 ? 11.265  -2.261  -1.351  1.00 0.00 ? 69 GLU A HG3  7  
ATOM 8941  N N    . LEU A 1 70 ? 8.977   -2.181  -3.589  1.00 0.00 ? 70 LEU A N    7  
ATOM 8942  C CA   . LEU A 1 70 ? 8.950   -2.169  -5.075  1.00 0.00 ? 70 LEU A CA   7  
ATOM 8943  C C    . LEU A 1 70 ? 7.496   -1.951  -5.499  1.00 0.00 ? 70 LEU A C    7  
ATOM 8944  O O    . LEU A 1 70 ? 7.202   -1.650  -6.639  1.00 0.00 ? 70 LEU A O    7  
ATOM 8945  C CB   . LEU A 1 70 ? 9.512   -3.486  -5.632  1.00 0.00 ? 70 LEU A CB   7  
ATOM 8946  C CG   . LEU A 1 70 ? 11.044  -3.496  -5.519  1.00 0.00 ? 70 LEU A CG   7  
ATOM 8947  C CD1  . LEU A 1 70 ? 11.580  -4.897  -5.860  1.00 0.00 ? 70 LEU A CD1  7  
ATOM 8948  C CD2  . LEU A 1 70 ? 11.680  -2.457  -6.468  1.00 0.00 ? 70 LEU A CD2  7  
ATOM 8949  H H    . LEU A 1 70 ? 9.074   -3.016  -3.087  1.00 0.00 ? 70 LEU A H    7  
ATOM 8950  H HA   . LEU A 1 70 ? 9.536   -1.330  -5.419  1.00 0.00 ? 70 LEU A HA   7  
ATOM 8951  H HB2  . LEU A 1 70 ? 9.109   -4.311  -5.064  1.00 0.00 ? 70 LEU A HB2  7  
ATOM 8952  H HB3  . LEU A 1 70 ? 9.234   -3.596  -6.658  1.00 0.00 ? 70 LEU A HB3  7  
ATOM 8953  H HG   . LEU A 1 70 ? 11.307  -3.254  -4.513  1.00 0.00 ? 70 LEU A HG   7  
ATOM 8954  H HD11 . LEU A 1 70 ? 10.955  -5.650  -5.403  1.00 0.00 ? 70 LEU A HD11 7  
ATOM 8955  H HD12 . LEU A 1 70 ? 12.588  -4.995  -5.486  1.00 0.00 ? 70 LEU A HD12 7  
ATOM 8956  H HD13 . LEU A 1 70 ? 11.580  -5.030  -6.931  1.00 0.00 ? 70 LEU A HD13 7  
ATOM 8957  H HD21 . LEU A 1 70 ? 12.671  -2.782  -6.758  1.00 0.00 ? 70 LEU A HD21 7  
ATOM 8958  H HD22 . LEU A 1 70 ? 11.760  -1.509  -5.960  1.00 0.00 ? 70 LEU A HD22 7  
ATOM 8959  H HD23 . LEU A 1 70 ? 11.072  -2.342  -7.348  1.00 0.00 ? 70 LEU A HD23 7  
ATOM 8960  N N    . VAL A 1 71 ? 6.580   -2.131  -4.577  1.00 0.00 ? 71 VAL A N    7  
ATOM 8961  C CA   . VAL A 1 71 ? 5.137   -1.968  -4.911  1.00 0.00 ? 71 VAL A CA   7  
ATOM 8962  C C    . VAL A 1 71 ? 4.836   -0.516  -5.280  1.00 0.00 ? 71 VAL A C    7  
ATOM 8963  O O    . VAL A 1 71 ? 4.287   -0.251  -6.327  1.00 0.00 ? 71 VAL A O    7  
ATOM 8964  C CB   . VAL A 1 71 ? 4.259   -2.414  -3.715  1.00 0.00 ? 71 VAL A CB   7  
ATOM 8965  C CG1  . VAL A 1 71 ? 2.857   -1.756  -3.760  1.00 0.00 ? 71 VAL A CG1  7  
ATOM 8966  C CG2  . VAL A 1 71 ? 4.112   -3.940  -3.733  1.00 0.00 ? 71 VAL A CG2  7  
ATOM 8967  H H    . VAL A 1 71 ? 6.854   -2.408  -3.676  1.00 0.00 ? 71 VAL A H    7  
ATOM 8968  H HA   . VAL A 1 71 ? 4.935   -2.567  -5.784  1.00 0.00 ? 71 VAL A HA   7  
ATOM 8969  H HB   . VAL A 1 71 ? 4.745   -2.119  -2.800  1.00 0.00 ? 71 VAL A HB   7  
ATOM 8970  H HG11 . VAL A 1 71 ? 2.508   -1.721  -4.779  1.00 0.00 ? 71 VAL A HG11 7  
ATOM 8971  H HG12 . VAL A 1 71 ? 2.907   -0.748  -3.363  1.00 0.00 ? 71 VAL A HG12 7  
ATOM 8972  H HG13 . VAL A 1 71 ? 2.167   -2.330  -3.161  1.00 0.00 ? 71 VAL A HG13 7  
ATOM 8973  H HG21 . VAL A 1 71 ? 5.071   -4.396  -3.533  1.00 0.00 ? 71 VAL A HG21 7  
ATOM 8974  H HG22 . VAL A 1 71 ? 3.754   -4.259  -4.700  1.00 0.00 ? 71 VAL A HG22 7  
ATOM 8975  H HG23 . VAL A 1 71 ? 3.408   -4.241  -2.970  1.00 0.00 ? 71 VAL A HG23 7  
ATOM 8976  N N    . CYS A 1 72 ? 5.134   0.432   -4.439  1.00 0.00 ? 72 CYS A N    7  
ATOM 8977  C CA   . CYS A 1 72 ? 4.775   1.827   -4.806  1.00 0.00 ? 72 CYS A CA   7  
ATOM 8978  C C    . CYS A 1 72 ? 5.595   2.281   -6.028  1.00 0.00 ? 72 CYS A C    7  
ATOM 8979  O O    . CYS A 1 72 ? 5.161   3.116   -6.796  1.00 0.00 ? 72 CYS A O    7  
ATOM 8980  C CB   . CYS A 1 72 ? 5.010   2.757   -3.606  1.00 0.00 ? 72 CYS A CB   7  
ATOM 8981  S SG   . CYS A 1 72 ? 4.223   2.069   -2.123  1.00 0.00 ? 72 CYS A SG   7  
ATOM 8982  H H    . CYS A 1 72 ? 5.547   0.236   -3.570  1.00 0.00 ? 72 CYS A H    7  
ATOM 8983  H HA   . CYS A 1 72 ? 3.727   1.811   -5.064  1.00 0.00 ? 72 CYS A HA   7  
ATOM 8984  H HB2  . CYS A 1 72 ? 6.070   2.857   -3.430  1.00 0.00 ? 72 CYS A HB2  7  
ATOM 8985  H HB3  . CYS A 1 72 ? 4.591   3.723   -3.813  1.00 0.00 ? 72 CYS A HB3  7  
ATOM 8986  N N    . SER A 1 73 ? 6.773   1.734   -6.219  1.00 0.00 ? 73 SER A N    7  
ATOM 8987  C CA   . SER A 1 73 ? 7.596   2.146   -7.407  1.00 0.00 ? 73 SER A CA   7  
ATOM 8988  C C    . SER A 1 73 ? 7.048   1.513   -8.707  1.00 0.00 ? 73 SER A C    7  
ATOM 8989  O O    . SER A 1 73 ? 7.051   2.142   -9.747  1.00 0.00 ? 73 SER A O    7  
ATOM 8990  C CB   . SER A 1 73 ? 9.050   1.727   -7.200  1.00 0.00 ? 73 SER A CB   7  
ATOM 8991  O OG   . SER A 1 73 ? 9.440   2.026   -5.866  1.00 0.00 ? 73 SER A OG   7  
ATOM 8992  H H    . SER A 1 73 ? 7.111   1.069   -5.567  1.00 0.00 ? 73 SER A H    7  
ATOM 8993  H HA   . SER A 1 73 ? 7.538   3.219   -7.522  1.00 0.00 ? 73 SER A HA   7  
ATOM 8994  H HB2  . SER A 1 73 ? 9.146   0.668   -7.369  1.00 0.00 ? 73 SER A HB2  7  
ATOM 8995  H HB3  . SER A 1 73 ? 9.681   2.260   -7.899  1.00 0.00 ? 73 SER A HB3  7  
ATOM 8996  H HG   . SER A 1 73 ? 10.212  1.493   -5.657  1.00 0.00 ? 73 SER A HG   7  
ATOM 8997  N N    . MET A 1 74 ? 6.588   0.290   -8.675  1.00 0.00 ? 74 MET A N    7  
ATOM 8998  C CA   . MET A 1 74 ? 6.057   -0.355  -9.929  1.00 0.00 ? 74 MET A CA   7  
ATOM 8999  C C    . MET A 1 74 ? 4.691   0.246   -10.328 1.00 0.00 ? 74 MET A C    7  
ATOM 9000  O O    . MET A 1 74 ? 4.423   0.445   -11.496 1.00 0.00 ? 74 MET A O    7  
ATOM 9001  C CB   . MET A 1 74 ? 5.895   -1.887  -9.693  1.00 0.00 ? 74 MET A CB   7  
ATOM 9002  C CG   . MET A 1 74 ? 7.083   -2.679  -10.274 1.00 0.00 ? 74 MET A CG   7  
ATOM 9003  S SD   . MET A 1 74 ? 6.612   -4.419  -10.483 1.00 0.00 ? 74 MET A SD   7  
ATOM 9004  C CE   . MET A 1 74 ? 5.785   -4.663  -8.890  1.00 0.00 ? 74 MET A CE   7  
ATOM 9005  H H    . MET A 1 74 ? 6.594   -0.210  -7.832  1.00 0.00 ? 74 MET A H    7  
ATOM 9006  H HA   . MET A 1 74 ? 6.725   -0.201  -10.763 1.00 0.00 ? 74 MET A HA   7  
ATOM 9007  H HB2  . MET A 1 74 ? 5.844   -2.073  -8.634  1.00 0.00 ? 74 MET A HB2  7  
ATOM 9008  H HB3  . MET A 1 74 ? 4.986   -2.239  -10.163 1.00 0.00 ? 74 MET A HB3  7  
ATOM 9009  H HG2  . MET A 1 74 ? 7.362   -2.279  -11.236 1.00 0.00 ? 74 MET A HG2  7  
ATOM 9010  H HG3  . MET A 1 74 ? 7.922   -2.614  -9.604  1.00 0.00 ? 74 MET A HG3  7  
ATOM 9011  H HE1  . MET A 1 74 ? 5.636   -5.721  -8.724  1.00 0.00 ? 74 MET A HE1  7  
ATOM 9012  H HE2  . MET A 1 74 ? 4.828   -4.166  -8.896  1.00 0.00 ? 74 MET A HE2  7  
ATOM 9013  H HE3  . MET A 1 74 ? 6.398   -4.254  -8.100  1.00 0.00 ? 74 MET A HE3  7  
ATOM 9014  N N    . LEU A 1 75 ? 3.821   0.510   -9.396  1.00 0.00 ? 75 LEU A N    7  
ATOM 9015  C CA   . LEU A 1 75 ? 2.484   1.061   -9.777  1.00 0.00 ? 75 LEU A CA   7  
ATOM 9016  C C    . LEU A 1 75 ? 2.611   2.515   -10.256 1.00 0.00 ? 75 LEU A C    7  
ATOM 9017  O O    . LEU A 1 75 ? 1.651   3.257   -10.264 1.00 0.00 ? 75 LEU A O    7  
ATOM 9018  C CB   . LEU A 1 75 ? 1.527   0.987   -8.581  1.00 0.00 ? 75 LEU A CB   7  
ATOM 9019  C CG   . LEU A 1 75 ? 1.460   -0.449  -8.027  1.00 0.00 ? 75 LEU A CG   7  
ATOM 9020  C CD1  . LEU A 1 75 ? 0.356   -0.544  -6.973  1.00 0.00 ? 75 LEU A CD1  7  
ATOM 9021  C CD2  . LEU A 1 75 ? 1.170   -1.449  -9.157  1.00 0.00 ? 75 LEU A CD2  7  
ATOM 9022  H H    . LEU A 1 75 ? 4.038   0.323   -8.459  1.00 0.00 ? 75 LEU A H    7  
ATOM 9023  H HA   . LEU A 1 75 ? 2.079   0.473   -10.585 1.00 0.00 ? 75 LEU A HA   7  
ATOM 9024  H HB2  . LEU A 1 75 ? 1.878   1.650   -7.806  1.00 0.00 ? 75 LEU A HB2  7  
ATOM 9025  H HB3  . LEU A 1 75 ? 0.541   1.292   -8.896  1.00 0.00 ? 75 LEU A HB3  7  
ATOM 9026  H HG   . LEU A 1 75 ? 2.399   -0.694  -7.567  1.00 0.00 ? 75 LEU A HG   7  
ATOM 9027  H HD11 . LEU A 1 75 ? 0.163   -1.583  -6.750  1.00 0.00 ? 75 LEU A HD11 7  
ATOM 9028  H HD12 . LEU A 1 75 ? -0.544  -0.085  -7.350  1.00 0.00 ? 75 LEU A HD12 7  
ATOM 9029  H HD13 . LEU A 1 75 ? 0.673   -0.037  -6.075  1.00 0.00 ? 75 LEU A HD13 7  
ATOM 9030  H HD21 . LEU A 1 75 ? 0.768   -2.362  -8.740  1.00 0.00 ? 75 LEU A HD21 7  
ATOM 9031  H HD22 . LEU A 1 75 ? 2.086   -1.674  -9.684  1.00 0.00 ? 75 LEU A HD22 7  
ATOM 9032  H HD23 . LEU A 1 75 ? 0.453   -1.023  -9.844  1.00 0.00 ? 75 LEU A HD23 7  
ATOM 9033  N N    . HIS A 1 76 ? 3.793   2.921   -10.643 1.00 0.00 ? 76 HIS A N    7  
ATOM 9034  C CA   . HIS A 1 76 ? 4.006   4.325   -11.122 1.00 0.00 ? 76 HIS A CA   7  
ATOM 9035  C C    . HIS A 1 76 ? 3.338   5.309   -10.153 1.00 0.00 ? 76 HIS A C    7  
ATOM 9036  O O    . HIS A 1 76 ? 3.032   6.424   -10.527 1.00 0.00 ? 76 HIS A O    7  
ATOM 9037  C CB   . HIS A 1 76 ? 3.439   4.495   -12.540 1.00 0.00 ? 76 HIS A CB   7  
ATOM 9038  C CG   . HIS A 1 76 ? 1.935   4.501   -12.504 1.00 0.00 ? 76 HIS A CG   7  
ATOM 9039  N ND1  . HIS A 1 76 ? 1.214   5.557   -11.970 1.00 0.00 ? 76 HIS A ND1  7  
ATOM 9040  C CD2  . HIS A 1 76 ? 1.004   3.587   -12.928 1.00 0.00 ? 76 HIS A CD2  7  
ATOM 9041  C CE1  . HIS A 1 76 ? -0.092  5.253   -12.083 1.00 0.00 ? 76 HIS A CE1  7  
ATOM 9042  N NE2  . HIS A 1 76 ? -0.276  4.062   -12.660 1.00 0.00 ? 76 HIS A NE2  7  
ATOM 9043  H H    . HIS A 1 76 ? 4.549   2.299   -10.600 1.00 0.00 ? 76 HIS A H    7  
ATOM 9044  H HA   . HIS A 1 76 ? 5.066   4.523   -11.139 1.00 0.00 ? 76 HIS A HA   7  
ATOM 9045  H HB2  . HIS A 1 76 ? 3.790   5.428   -12.956 1.00 0.00 ? 76 HIS A HB2  7  
ATOM 9046  H HB3  . HIS A 1 76 ? 3.779   3.678   -13.160 1.00 0.00 ? 76 HIS A HB3  7  
ATOM 9047  H HD1  . HIS A 1 76 ? 1.587   6.374   -11.579 1.00 0.00 ? 76 HIS A HD1  7  
ATOM 9048  H HD2  . HIS A 1 76 ? 1.230   2.639   -13.396 1.00 0.00 ? 76 HIS A HD2  7  
ATOM 9049  H HE1  . HIS A 1 76 ? -0.894  5.894   -11.746 1.00 0.00 ? 76 HIS A HE1  7  
ATOM 9050  N N    . LEU A 1 77 ? 3.098   4.940   -8.932  1.00 0.00 ? 77 LEU A N    7  
ATOM 9051  C CA   . LEU A 1 77 ? 2.446   5.903   -7.996  1.00 0.00 ? 77 LEU A CA   7  
ATOM 9052  C C    . LEU A 1 77 ? 3.511   6.801   -7.366  1.00 0.00 ? 77 LEU A C    7  
ATOM 9053  O O    . LEU A 1 77 ? 3.201   7.788   -6.729  1.00 0.00 ? 77 LEU A O    7  
ATOM 9054  C CB   . LEU A 1 77 ? 1.691   5.140   -6.889  1.00 0.00 ? 77 LEU A CB   7  
ATOM 9055  C CG   . LEU A 1 77 ? 0.363   4.524   -7.385  1.00 0.00 ? 77 LEU A CG   7  
ATOM 9056  C CD1  . LEU A 1 77 ? -0.438  4.054   -6.166  1.00 0.00 ? 77 LEU A CD1  7  
ATOM 9057  C CD2  . LEU A 1 77 ? -0.493  5.540   -8.170  1.00 0.00 ? 77 LEU A CD2  7  
ATOM 9058  H H    . LEU A 1 77 ? 3.345   4.047   -8.629  1.00 0.00 ? 77 LEU A H    7  
ATOM 9059  H HA   . LEU A 1 77 ? 1.768   6.540   -8.532  1.00 0.00 ? 77 LEU A HA   7  
ATOM 9060  H HB2  . LEU A 1 77 ? 2.320   4.344   -6.532  1.00 0.00 ? 77 LEU A HB2  7  
ATOM 9061  H HB3  . LEU A 1 77 ? 1.485   5.809   -6.077  1.00 0.00 ? 77 LEU A HB3  7  
ATOM 9062  H HG   . LEU A 1 77 ? 0.587   3.675   -8.008  1.00 0.00 ? 77 LEU A HG   7  
ATOM 9063  H HD11 . LEU A 1 77 ? -1.320  3.526   -6.496  1.00 0.00 ? 77 LEU A HD11 7  
ATOM 9064  H HD12 . LEU A 1 77 ? -0.733  4.912   -5.582  1.00 0.00 ? 77 LEU A HD12 7  
ATOM 9065  H HD13 . LEU A 1 77 ? 0.170   3.403   -5.561  1.00 0.00 ? 77 LEU A HD13 7  
ATOM 9066  H HD21 . LEU A 1 77 ? -0.387  6.521   -7.732  1.00 0.00 ? 77 LEU A HD21 7  
ATOM 9067  H HD22 . LEU A 1 77 ? -1.534  5.246   -8.137  1.00 0.00 ? 77 LEU A HD22 7  
ATOM 9068  H HD23 . LEU A 1 77 ? -0.172  5.566   -9.200  1.00 0.00 ? 77 LEU A HD23 7  
ATOM 9069  N N    . CYS A 1 78 ? 4.767   6.474   -7.551  1.00 0.00 ? 78 CYS A N    7  
ATOM 9070  C CA   . CYS A 1 78 ? 5.871   7.313   -6.981  1.00 0.00 ? 78 CYS A CA   7  
ATOM 9071  C C    . CYS A 1 78 ? 6.882   7.613   -8.096  1.00 0.00 ? 78 CYS A C    7  
ATOM 9072  O O    . CYS A 1 78 ? 7.707   6.784   -8.427  1.00 0.00 ? 78 CYS A O    7  
ATOM 9073  C CB   . CYS A 1 78 ? 6.554   6.539   -5.836  1.00 0.00 ? 78 CYS A CB   7  
ATOM 9074  S SG   . CYS A 1 78 ? 6.794   7.618   -4.394  1.00 0.00 ? 78 CYS A SG   7  
ATOM 9075  H H    . CYS A 1 78 ? 4.988   5.673   -8.070  1.00 0.00 ? 78 CYS A H    7  
ATOM 9076  H HA   . CYS A 1 78 ? 5.468   8.241   -6.606  1.00 0.00 ? 78 CYS A HA   7  
ATOM 9077  H HB2  . CYS A 1 78 ? 5.928   5.710   -5.558  1.00 0.00 ? 78 CYS A HB2  7  
ATOM 9078  H HB3  . CYS A 1 78 ? 7.515   6.157   -6.161  1.00 0.00 ? 78 CYS A HB3  7  
ATOM 9079  N N    . SER A 1 79 ? 6.808   8.765   -8.713  1.00 0.00 ? 79 SER A N    7  
ATOM 9080  C CA   . SER A 1 79 ? 7.752   9.052   -9.834  1.00 0.00 ? 79 SER A CA   7  
ATOM 9081  C C    . SER A 1 79 ? 9.158   9.343   -9.295  1.00 0.00 ? 79 SER A C    7  
ATOM 9082  O O    . SER A 1 79 ? 9.353   9.400   -8.097  1.00 0.00 ? 79 SER A O    7  
ATOM 9083  C CB   . SER A 1 79 ? 7.236   10.232  -10.659 1.00 0.00 ? 79 SER A CB   7  
ATOM 9084  O OG   . SER A 1 79 ? 8.283   10.718  -11.489 1.00 0.00 ? 79 SER A OG   7  
ATOM 9085  H H    . SER A 1 79 ? 6.120   9.416   -8.465  1.00 0.00 ? 79 SER A H    7  
ATOM 9086  H HA   . SER A 1 79 ? 7.800   8.163   -10.447 1.00 0.00 ? 79 SER A HA   7  
ATOM 9087  H HB2  . SER A 1 79 ? 6.412   9.912   -11.277 1.00 0.00 ? 79 SER A HB2  7  
ATOM 9088  H HB3  . SER A 1 79 ? 6.897   11.017  -9.992  1.00 0.00 ? 79 SER A HB3  7  
ATOM 9089  H HG   . SER A 1 79 ? 8.046   10.539  -12.401 1.00 0.00 ? 79 SER A HG   7  
ATOM 9090  N N    . GLY A 1 80 ? 10.135  9.587   -10.132 1.00 0.00 ? 80 GLY A N    7  
ATOM 9091  C CA   . GLY A 1 80 ? 11.472  9.934   -9.588  1.00 0.00 ? 80 GLY A CA   7  
ATOM 9092  C C    . GLY A 1 80 ? 11.423  11.413  -9.209  1.00 0.00 ? 80 GLY A C    7  
ATOM 9093  O O    . GLY A 1 80 ? 12.160  12.224  -9.734  1.00 0.00 ? 80 GLY A O    7  
ATOM 9094  H H    . GLY A 1 80 ? 9.989   9.588   -11.100 1.00 0.00 ? 80 GLY A H    7  
ATOM 9095  H HA2  . GLY A 1 80 ? 11.686  9.329   -8.714  1.00 0.00 ? 80 GLY A HA2  7  
ATOM 9096  H HA3  . GLY A 1 80 ? 12.228  9.779   -10.339 1.00 0.00 ? 80 GLY A HA3  7  
ATOM 9097  N N    . LEU A 1 81 ? 10.538  11.778  -8.309  1.00 0.00 ? 81 LEU A N    7  
ATOM 9098  C CA   . LEU A 1 81 ? 10.419  13.203  -7.913  1.00 0.00 ? 81 LEU A CA   7  
ATOM 9099  C C    . LEU A 1 81 ? 11.447  13.486  -6.829  1.00 0.00 ? 81 LEU A C    7  
ATOM 9100  O O    . LEU A 1 81 ? 11.237  14.230  -5.894  1.00 0.00 ? 81 LEU A O    7  
ATOM 9101  C CB   . LEU A 1 81 ? 8.990   13.455  -7.381  1.00 0.00 ? 81 LEU A CB   7  
ATOM 9102  C CG   . LEU A 1 81 ? 8.524   14.874  -7.730  1.00 0.00 ? 81 LEU A CG   7  
ATOM 9103  C CD1  . LEU A 1 81 ? 7.073   15.056  -7.284  1.00 0.00 ? 81 LEU A CD1  7  
ATOM 9104  C CD2  . LEU A 1 81 ? 9.406   15.899  -7.013  1.00 0.00 ? 81 LEU A CD2  7  
ATOM 9105  H H    . LEU A 1 81 ? 9.944   11.114  -7.897  1.00 0.00 ? 81 LEU A H    7  
ATOM 9106  H HA   . LEU A 1 81 ? 10.612  13.835  -8.770  1.00 0.00 ? 81 LEU A HA   7  
ATOM 9107  H HB2  . LEU A 1 81 ? 8.315   12.743  -7.832  1.00 0.00 ? 81 LEU A HB2  7  
ATOM 9108  H HB3  . LEU A 1 81 ? 8.968   13.328  -6.306  1.00 0.00 ? 81 LEU A HB3  7  
ATOM 9109  H HG   . LEU A 1 81 ? 8.591   15.022  -8.798  1.00 0.00 ? 81 LEU A HG   7  
ATOM 9110  H HD11 . LEU A 1 81 ? 6.452   14.314  -7.764  1.00 0.00 ? 81 LEU A HD11 7  
ATOM 9111  H HD12 . LEU A 1 81 ? 6.732   16.043  -7.559  1.00 0.00 ? 81 LEU A HD12 7  
ATOM 9112  H HD13 . LEU A 1 81 ? 7.008   14.940  -6.212  1.00 0.00 ? 81 LEU A HD13 7  
ATOM 9113  H HD21 . LEU A 1 81 ? 10.414  15.836  -7.393  1.00 0.00 ? 81 LEU A HD21 7  
ATOM 9114  H HD22 . LEU A 1 81 ? 9.407   15.695  -5.952  1.00 0.00 ? 81 LEU A HD22 7  
ATOM 9115  H HD23 . LEU A 1 81 ? 9.018   16.891  -7.187  1.00 0.00 ? 81 LEU A HD23 7  
ATOM 9116  N N    . VAL A 1 82 ? 12.581  12.863  -7.008  1.00 0.00 ? 82 VAL A N    7  
ATOM 9117  C CA   . VAL A 1 82 ? 13.731  13.017  -6.066  1.00 0.00 ? 82 VAL A CA   7  
ATOM 9118  C C    . VAL A 1 82 ? 13.810  14.477  -5.560  1.00 0.00 ? 82 VAL A C    7  
ATOM 9119  O O    . VAL A 1 82 ? 13.408  15.378  -6.271  1.00 0.00 ? 82 VAL A O    7  
ATOM 9120  C CB   . VAL A 1 82 ? 15.007  12.678  -6.852  1.00 0.00 ? 82 VAL A CB   7  
ATOM 9121  C CG1  . VAL A 1 82 ? 15.015  11.186  -7.204  1.00 0.00 ? 82 VAL A CG1  7  
ATOM 9122  C CG2  . VAL A 1 82 ? 15.028  13.495  -8.147  1.00 0.00 ? 82 VAL A CG2  7  
ATOM 9123  H H    . VAL A 1 82 ? 12.675  12.273  -7.800  1.00 0.00 ? 82 VAL A H    7  
ATOM 9124  H HA   . VAL A 1 82 ? 13.613  12.332  -5.243  1.00 0.00 ? 82 VAL A HA   7  
ATOM 9125  H HB   . VAL A 1 82 ? 15.879  12.914  -6.267  1.00 0.00 ? 82 VAL A HB   7  
ATOM 9126  H HG11 . VAL A 1 82 ? 15.996  10.904  -7.556  1.00 0.00 ? 82 VAL A HG11 7  
ATOM 9127  H HG12 . VAL A 1 82 ? 14.287  10.997  -7.980  1.00 0.00 ? 82 VAL A HG12 7  
ATOM 9128  H HG13 . VAL A 1 82 ? 14.766  10.604  -6.329  1.00 0.00 ? 82 VAL A HG13 7  
ATOM 9129  H HG21 . VAL A 1 82 ? 15.953  13.313  -8.674  1.00 0.00 ? 82 VAL A HG21 7  
ATOM 9130  H HG22 . VAL A 1 82 ? 14.951  14.546  -7.911  1.00 0.00 ? 82 VAL A HG22 7  
ATOM 9131  H HG23 . VAL A 1 82 ? 14.195  13.204  -8.770  1.00 0.00 ? 82 VAL A HG23 7  
ATOM 9132  N N    . PRO A 1 83 ? 14.331  14.689  -4.361  1.00 0.00 ? 83 PRO A N    7  
ATOM 9133  C CA   . PRO A 1 83 ? 14.462  16.052  -3.806  1.00 0.00 ? 83 PRO A CA   7  
ATOM 9134  C C    . PRO A 1 83 ? 14.965  17.031  -4.878  1.00 0.00 ? 83 PRO A C    7  
ATOM 9135  O O    . PRO A 1 83 ? 16.109  16.983  -5.284  1.00 0.00 ? 83 PRO A O    7  
ATOM 9136  C CB   . PRO A 1 83 ? 15.492  15.893  -2.661  1.00 0.00 ? 83 PRO A CB   7  
ATOM 9137  C CG   . PRO A 1 83 ? 15.591  14.373  -2.345  1.00 0.00 ? 83 PRO A CG   7  
ATOM 9138  C CD   . PRO A 1 83 ? 14.836  13.621  -3.465  1.00 0.00 ? 83 PRO A CD   7  
ATOM 9139  H HA   . PRO A 1 83 ? 13.525  16.380  -3.382  1.00 0.00 ? 83 PRO A HA   7  
ATOM 9140  H HB2  . PRO A 1 83 ? 16.460  16.271  -2.973  1.00 0.00 ? 83 PRO A HB2  7  
ATOM 9141  H HB3  . PRO A 1 83 ? 15.159  16.427  -1.781  1.00 0.00 ? 83 PRO A HB3  7  
ATOM 9142  H HG2  . PRO A 1 83 ? 16.631  14.068  -2.324  1.00 0.00 ? 83 PRO A HG2  7  
ATOM 9143  H HG3  . PRO A 1 83 ? 15.130  14.162  -1.389  1.00 0.00 ? 83 PRO A HG3  7  
ATOM 9144  H HD2  . PRO A 1 83 ? 15.506  12.961  -3.988  1.00 0.00 ? 83 PRO A HD2  7  
ATOM 9145  H HD3  . PRO A 1 83 ? 14.006  13.063  -3.054  1.00 0.00 ? 83 PRO A HD3  7  
ATOM 9146  N N    . ARG A 1 84 ? 14.124  17.922  -5.334  1.00 0.00 ? 84 ARG A N    7  
ATOM 9147  C CA   . ARG A 1 84 ? 14.565  18.904  -6.369  1.00 0.00 ? 84 ARG A CA   7  
ATOM 9148  C C    . ARG A 1 84 ? 13.688  20.154  -6.291  1.00 0.00 ? 84 ARG A C    7  
ATOM 9149  O O    . ARG A 1 84 ? 13.948  21.083  -7.039  1.00 0.00 ? 84 ARG A O    7  
ATOM 9150  C CB   . ARG A 1 84 ? 14.445  18.276  -7.761  1.00 0.00 ? 84 ARG A CB   7  
ATOM 9151  C CG   . ARG A 1 84 ? 12.981  17.950  -8.063  1.00 0.00 ? 84 ARG A CG   7  
ATOM 9152  C CD   . ARG A 1 84 ? 12.895  17.177  -9.380  1.00 0.00 ? 84 ARG A CD   7  
ATOM 9153  N NE   . ARG A 1 84 ? 13.589  17.947  -10.452 1.00 0.00 ? 84 ARG A NE   7  
ATOM 9154  C CZ   . ARG A 1 84 ? 13.905  17.364  -11.575 1.00 0.00 ? 84 ARG A CZ   7  
ATOM 9155  N NH1  . ARG A 1 84 ? 13.609  16.108  -11.763 1.00 0.00 ? 84 ARG A NH1  7  
ATOM 9156  N NH2  . ARG A 1 84 ? 14.516  18.038  -12.511 1.00 0.00 ? 84 ARG A NH2  7  
ATOM 9157  O OXT  . ARG A 1 84 ? 12.772  20.163  -5.486  1.00 0.00 ? 84 ARG A OXT  7  
ATOM 9158  H H    . ARG A 1 84 ? 13.205  17.950  -4.994  1.00 0.00 ? 84 ARG A H    7  
ATOM 9159  H HA   . ARG A 1 84 ? 15.594  19.180  -6.187  1.00 0.00 ? 84 ARG A HA   7  
ATOM 9160  H HB2  . ARG A 1 84 ? 14.818  18.971  -8.500  1.00 0.00 ? 84 ARG A HB2  7  
ATOM 9161  H HB3  . ARG A 1 84 ? 15.029  17.368  -7.797  1.00 0.00 ? 84 ARG A HB3  7  
ATOM 9162  H HG2  . ARG A 1 84 ? 12.573  17.348  -7.263  1.00 0.00 ? 84 ARG A HG2  7  
ATOM 9163  H HG3  . ARG A 1 84 ? 12.415  18.865  -8.149  1.00 0.00 ? 84 ARG A HG3  7  
ATOM 9164  H HD2  . ARG A 1 84 ? 13.370  16.214  -9.265  1.00 0.00 ? 84 ARG A HD2  7  
ATOM 9165  H HD3  . ARG A 1 84 ? 11.859  17.039  -9.650  1.00 0.00 ? 84 ARG A HD3  7  
ATOM 9166  H HE   . ARG A 1 84 ? 13.809  18.892  -10.311 1.00 0.00 ? 84 ARG A HE   7  
ATOM 9167  H HH11 . ARG A 1 84 ? 13.141  15.591  -11.047 1.00 0.00 ? 84 ARG A HH11 7  
ATOM 9168  H HH12 . ARG A 1 84 ? 13.852  15.660  -12.624 1.00 0.00 ? 84 ARG A HH12 7  
ATOM 9169  H HH21 . ARG A 1 84 ? 14.741  19.002  -12.367 1.00 0.00 ? 84 ARG A HH21 7  
ATOM 9170  H HH22 . ARG A 1 84 ? 14.759  17.591  -13.372 1.00 0.00 ? 84 ARG A HH22 7  
ATOM 9171  N N    . SER A 1 1  ? 7.059   16.086  -0.516  1.00 0.00 ? 1  SER A N    8  
ATOM 9172  C CA   . SER A 1 1  ? 5.929   16.027  0.454   1.00 0.00 ? 1  SER A CA   8  
ATOM 9173  C C    . SER A 1 1  ? 4.705   15.414  -0.229  1.00 0.00 ? 1  SER A C    8  
ATOM 9174  O O    . SER A 1 1  ? 3.574   15.706  0.108   1.00 0.00 ? 1  SER A O    8  
ATOM 9175  C CB   . SER A 1 1  ? 5.593   17.439  0.933   1.00 0.00 ? 1  SER A CB   8  
ATOM 9176  O OG   . SER A 1 1  ? 4.468   17.387  1.799   1.00 0.00 ? 1  SER A OG   8  
ATOM 9177  H H1   . SER A 1 1  ? 7.037   15.245  -1.127  1.00 0.00 ? 1  SER A H1   8  
ATOM 9178  H H2   . SER A 1 1  ? 7.960   16.116  0.004   1.00 0.00 ? 1  SER A H2   8  
ATOM 9179  H H3   . SER A 1 1  ? 6.968   16.940  -1.103  1.00 0.00 ? 1  SER A H3   8  
ATOM 9180  H HA   . SER A 1 1  ? 6.213   15.418  1.300   1.00 0.00 ? 1  SER A HA   8  
ATOM 9181  H HB2  . SER A 1 1  ? 6.433   17.850  1.467   1.00 0.00 ? 1  SER A HB2  8  
ATOM 9182  H HB3  . SER A 1 1  ? 5.373   18.066  0.078   1.00 0.00 ? 1  SER A HB3  8  
ATOM 9183  H HG   . SER A 1 1  ? 4.586   16.642  2.394   1.00 0.00 ? 1  SER A HG   8  
ATOM 9184  N N    . ASP A 1 2  ? 4.933   14.565  -1.194  1.00 0.00 ? 2  ASP A N    8  
ATOM 9185  C CA   . ASP A 1 2  ? 3.807   13.919  -1.925  1.00 0.00 ? 2  ASP A CA   8  
ATOM 9186  C C    . ASP A 1 2  ? 2.999   13.033  -0.962  1.00 0.00 ? 2  ASP A C    8  
ATOM 9187  O O    . ASP A 1 2  ? 3.516   12.114  -0.362  1.00 0.00 ? 2  ASP A O    8  
ATOM 9188  C CB   . ASP A 1 2  ? 4.395   13.082  -3.082  1.00 0.00 ? 2  ASP A CB   8  
ATOM 9189  C CG   . ASP A 1 2  ? 4.825   11.693  -2.592  1.00 0.00 ? 2  ASP A CG   8  
ATOM 9190  O OD1  . ASP A 1 2  ? 3.949   10.891  -2.314  1.00 0.00 ? 2  ASP A OD1  8  
ATOM 9191  O OD2  . ASP A 1 2  ? 6.019   11.458  -2.509  1.00 0.00 ? 2  ASP A OD2  8  
ATOM 9192  H H    . ASP A 1 2  ? 5.858   14.354  -1.444  1.00 0.00 ? 2  ASP A H    8  
ATOM 9193  H HA   . ASP A 1 2  ? 3.164   14.678  -2.343  1.00 0.00 ? 2  ASP A HA   8  
ATOM 9194  H HB2  . ASP A 1 2  ? 3.653   12.972  -3.859  1.00 0.00 ? 2  ASP A HB2  8  
ATOM 9195  H HB3  . ASP A 1 2  ? 5.255   13.594  -3.485  1.00 0.00 ? 2  ASP A HB3  8  
ATOM 9196  N N    . VAL A 1 3  ? 1.742   13.343  -0.777  1.00 0.00 ? 3  VAL A N    8  
ATOM 9197  C CA   . VAL A 1 3  ? 0.904   12.560  0.181   1.00 0.00 ? 3  VAL A CA   8  
ATOM 9198  C C    . VAL A 1 3  ? 0.517   11.191  -0.400  1.00 0.00 ? 3  VAL A C    8  
ATOM 9199  O O    . VAL A 1 3  ? 0.084   10.314  0.327   1.00 0.00 ? 3  VAL A O    8  
ATOM 9200  C CB   . VAL A 1 3  ? -0.375  13.376  0.541   1.00 0.00 ? 3  VAL A CB   8  
ATOM 9201  C CG1  . VAL A 1 3  ? -0.102  14.870  0.363   1.00 0.00 ? 3  VAL A CG1  8  
ATOM 9202  C CG2  . VAL A 1 3  ? -1.575  12.988  -0.344  1.00 0.00 ? 3  VAL A CG2  8  
ATOM 9203  H H    . VAL A 1 3  ? 1.356   14.112  -1.245  1.00 0.00 ? 3  VAL A H    8  
ATOM 9204  H HA   . VAL A 1 3  ? 1.463   12.413  1.093   1.00 0.00 ? 3  VAL A HA   8  
ATOM 9205  H HB   . VAL A 1 3  ? -0.631  13.193  1.578   1.00 0.00 ? 3  VAL A HB   8  
ATOM 9206  H HG11 . VAL A 1 3  ? 0.840   15.122  0.829   1.00 0.00 ? 3  VAL A HG11 8  
ATOM 9207  H HG12 . VAL A 1 3  ? -0.897  15.437  0.826   1.00 0.00 ? 3  VAL A HG12 8  
ATOM 9208  H HG13 . VAL A 1 3  ? -0.058  15.105  -0.690  1.00 0.00 ? 3  VAL A HG13 8  
ATOM 9209  H HG21 . VAL A 1 3  ? -1.275  12.979  -1.381  1.00 0.00 ? 3  VAL A HG21 8  
ATOM 9210  H HG22 . VAL A 1 3  ? -2.372  13.707  -0.205  1.00 0.00 ? 3  VAL A HG22 8  
ATOM 9211  H HG23 . VAL A 1 3  ? -1.927  12.006  -0.060  1.00 0.00 ? 3  VAL A HG23 8  
ATOM 9212  N N    . TYR A 1 4  ? 0.611   10.987  -1.692  1.00 0.00 ? 4  TYR A N    8  
ATOM 9213  C CA   . TYR A 1 4  ? 0.164   9.669   -2.243  1.00 0.00 ? 4  TYR A CA   8  
ATOM 9214  C C    . TYR A 1 4  ? 1.189   8.563   -1.927  1.00 0.00 ? 4  TYR A C    8  
ATOM 9215  O O    . TYR A 1 4  ? 0.838   7.502   -1.451  1.00 0.00 ? 4  TYR A O    8  
ATOM 9216  C CB   . TYR A 1 4  ? -0.103  9.799   -3.746  1.00 0.00 ? 4  TYR A CB   8  
ATOM 9217  C CG   . TYR A 1 4  ? -1.528  10.243  -3.999  1.00 0.00 ? 4  TYR A CG   8  
ATOM 9218  C CD1  . TYR A 1 4  ? -2.579  9.337   -3.827  1.00 0.00 ? 4  TYR A CD1  8  
ATOM 9219  C CD2  . TYR A 1 4  ? -1.794  11.550  -4.428  1.00 0.00 ? 4  TYR A CD2  8  
ATOM 9220  C CE1  . TYR A 1 4  ? -3.894  9.732   -4.081  1.00 0.00 ? 4  TYR A CE1  8  
ATOM 9221  C CE2  . TYR A 1 4  ? -3.112  11.949  -4.677  1.00 0.00 ? 4  TYR A CE2  8  
ATOM 9222  C CZ   . TYR A 1 4  ? -4.164  11.040  -4.505  1.00 0.00 ? 4  TYR A CZ   8  
ATOM 9223  O OH   . TYR A 1 4  ? -5.462  11.431  -4.755  1.00 0.00 ? 4  TYR A OH   8  
ATOM 9224  H H    . TYR A 1 4  ? 0.929   11.687  -2.296  1.00 0.00 ? 4  TYR A H    8  
ATOM 9225  H HA   . TYR A 1 4  ? -0.738  9.422   -1.700  1.00 0.00 ? 4  TYR A HA   8  
ATOM 9226  H HB2  . TYR A 1 4  ? 0.576   10.528  -4.165  1.00 0.00 ? 4  TYR A HB2  8  
ATOM 9227  H HB3  . TYR A 1 4  ? 0.058   8.852   -4.223  1.00 0.00 ? 4  TYR A HB3  8  
ATOM 9228  H HD1  . TYR A 1 4  ? -2.374  8.334   -3.491  1.00 0.00 ? 4  TYR A HD1  8  
ATOM 9229  H HD2  . TYR A 1 4  ? -0.983  12.252  -4.559  1.00 0.00 ? 4  TYR A HD2  8  
ATOM 9230  H HE1  . TYR A 1 4  ? -4.701  9.026   -3.952  1.00 0.00 ? 4  TYR A HE1  8  
ATOM 9231  H HE2  . TYR A 1 4  ? -3.318  12.956  -5.005  1.00 0.00 ? 4  TYR A HE2  8  
ATOM 9232  H HH   . TYR A 1 4  ? -5.768  10.965  -5.537  1.00 0.00 ? 4  TYR A HH   8  
ATOM 9233  N N    . CYS A 1 5  ? 2.450   8.795   -2.202  1.00 0.00 ? 5  CYS A N    8  
ATOM 9234  C CA   . CYS A 1 5  ? 3.469   7.734   -1.925  1.00 0.00 ? 5  CYS A CA   8  
ATOM 9235  C C    . CYS A 1 5  ? 3.440   7.406   -0.421  1.00 0.00 ? 5  CYS A C    8  
ATOM 9236  O O    . CYS A 1 5  ? 3.500   6.259   -0.032  1.00 0.00 ? 5  CYS A O    8  
ATOM 9237  C CB   . CYS A 1 5  ? 4.871   8.211   -2.337  1.00 0.00 ? 5  CYS A CB   8  
ATOM 9238  S SG   . CYS A 1 5  ? 5.864   6.783   -2.842  1.00 0.00 ? 5  CYS A SG   8  
ATOM 9239  H H    . CYS A 1 5  ? 2.713   9.658   -2.584  1.00 0.00 ? 5  CYS A H    8  
ATOM 9240  H HA   . CYS A 1 5  ? 3.214   6.849   -2.499  1.00 0.00 ? 5  CYS A HA   8  
ATOM 9241  H HB2  . CYS A 1 5  ? 4.788   8.896   -3.162  1.00 0.00 ? 5  CYS A HB2  8  
ATOM 9242  H HB3  . CYS A 1 5  ? 5.357   8.703   -1.510  1.00 0.00 ? 5  CYS A HB3  8  
ATOM 9243  N N    . GLU A 1 6  ? 3.361   8.384   0.434   1.00 0.00 ? 6  GLU A N    8  
ATOM 9244  C CA   . GLU A 1 6  ? 3.347   8.075   1.894   1.00 0.00 ? 6  GLU A CA   8  
ATOM 9245  C C    . GLU A 1 6  ? 2.236   7.073   2.190   1.00 0.00 ? 6  GLU A C    8  
ATOM 9246  O O    . GLU A 1 6  ? 2.402   6.157   2.971   1.00 0.00 ? 6  GLU A O    8  
ATOM 9247  C CB   . GLU A 1 6  ? 3.108   9.356   2.687   1.00 0.00 ? 6  GLU A CB   8  
ATOM 9248  C CG   . GLU A 1 6  ? 4.166   10.382  2.297   1.00 0.00 ? 6  GLU A CG   8  
ATOM 9249  C CD   . GLU A 1 6  ? 5.546   9.887   2.734   1.00 0.00 ? 6  GLU A CD   8  
ATOM 9250  O OE1  . GLU A 1 6  ? 5.870   10.047  3.899   1.00 0.00 ? 6  GLU A OE1  8  
ATOM 9251  O OE2  . GLU A 1 6  ? 6.255   9.357   1.894   1.00 0.00 ? 6  GLU A OE2  8  
ATOM 9252  H H    . GLU A 1 6  ? 3.323   9.314   0.125   1.00 0.00 ? 6  GLU A H    8  
ATOM 9253  H HA   . GLU A 1 6  ? 4.300   7.653   2.177   1.00 0.00 ? 6  GLU A HA   8  
ATOM 9254  H HB2  . GLU A 1 6  ? 2.126   9.743   2.463   1.00 0.00 ? 6  GLU A HB2  8  
ATOM 9255  H HB3  . GLU A 1 6  ? 3.182   9.148   3.744   1.00 0.00 ? 6  GLU A HB3  8  
ATOM 9256  H HG2  . GLU A 1 6  ? 4.151   10.512  1.225   1.00 0.00 ? 6  GLU A HG2  8  
ATOM 9257  H HG3  . GLU A 1 6  ? 3.952   11.321  2.781   1.00 0.00 ? 6  GLU A HG3  8  
ATOM 9258  N N    . VAL A 1 7  ? 1.101   7.243   1.576   1.00 0.00 ? 7  VAL A N    8  
ATOM 9259  C CA   . VAL A 1 7  ? -0.027  6.304   1.828   1.00 0.00 ? 7  VAL A CA   8  
ATOM 9260  C C    . VAL A 1 7  ? 0.281   4.921   1.231   1.00 0.00 ? 7  VAL A C    8  
ATOM 9261  O O    . VAL A 1 7  ? 0.017   3.909   1.848   1.00 0.00 ? 7  VAL A O    8  
ATOM 9262  C CB   . VAL A 1 7  ? -1.311  6.885   1.226   1.00 0.00 ? 7  VAL A CB   8  
ATOM 9263  C CG1  . VAL A 1 7  ? -2.415  5.821   1.216   1.00 0.00 ? 7  VAL A CG1  8  
ATOM 9264  C CG2  . VAL A 1 7  ? -1.770  8.106   2.042   1.00 0.00 ? 7  VAL A CG2  8  
ATOM 9265  H H    . VAL A 1 7  ? 0.986   7.994   0.954   1.00 0.00 ? 7  VAL A H    8  
ATOM 9266  H HA   . VAL A 1 7  ? -0.144  6.143   2.896   1.00 0.00 ? 7  VAL A HA   8  
ATOM 9267  H HB   . VAL A 1 7  ? -1.106  7.197   0.215   1.00 0.00 ? 7  VAL A HB   8  
ATOM 9268  H HG11 . VAL A 1 7  ? -2.404  5.279   2.148   1.00 0.00 ? 7  VAL A HG11 8  
ATOM 9269  H HG12 . VAL A 1 7  ? -2.244  5.135   0.399   1.00 0.00 ? 7  VAL A HG12 8  
ATOM 9270  H HG13 . VAL A 1 7  ? -3.374  6.298   1.087   1.00 0.00 ? 7  VAL A HG13 8  
ATOM 9271  H HG21 . VAL A 1 7  ? -2.817  8.297   1.852   1.00 0.00 ? 7  VAL A HG21 8  
ATOM 9272  H HG22 . VAL A 1 7  ? -1.194  8.970   1.749   1.00 0.00 ? 7  VAL A HG22 8  
ATOM 9273  H HG23 . VAL A 1 7  ? -1.623  7.920   3.094   1.00 0.00 ? 7  VAL A HG23 8  
ATOM 9274  N N    . CYS A 1 8  ? 0.833   4.855   0.044   1.00 0.00 ? 8  CYS A N    8  
ATOM 9275  C CA   . CYS A 1 8  ? 1.142   3.525   -0.559  1.00 0.00 ? 8  CYS A CA   8  
ATOM 9276  C C    . CYS A 1 8  ? 2.111   2.769   0.339   1.00 0.00 ? 8  CYS A C    8  
ATOM 9277  O O    . CYS A 1 8  ? 2.061   1.559   0.434   1.00 0.00 ? 8  CYS A O    8  
ATOM 9278  C CB   . CYS A 1 8  ? 1.761   3.730   -1.942  1.00 0.00 ? 8  CYS A CB   8  
ATOM 9279  S SG   . CYS A 1 8  ? 3.471   4.282   -1.798  1.00 0.00 ? 8  CYS A SG   8  
ATOM 9280  H H    . CYS A 1 8  ? 1.057   5.660   -0.465  1.00 0.00 ? 8  CYS A H    8  
ATOM 9281  H HA   . CYS A 1 8  ? 0.236   2.945   -0.664  1.00 0.00 ? 8  CYS A HA   8  
ATOM 9282  H HB2  . CYS A 1 8  ? 1.741   2.801   -2.482  1.00 0.00 ? 8  CYS A HB2  8  
ATOM 9283  H HB3  . CYS A 1 8  ? 1.193   4.472   -2.477  1.00 0.00 ? 8  CYS A HB3  8  
ATOM 9284  N N    . GLU A 1 9  ? 2.984   3.460   1.019   1.00 0.00 ? 9  GLU A N    8  
ATOM 9285  C CA   . GLU A 1 9  ? 3.928   2.755   1.920   1.00 0.00 ? 9  GLU A CA   8  
ATOM 9286  C C    . GLU A 1 9  ? 3.207   2.420   3.220   1.00 0.00 ? 9  GLU A C    8  
ATOM 9287  O O    . GLU A 1 9  ? 3.531   1.450   3.878   1.00 0.00 ? 9  GLU A O    8  
ATOM 9288  C CB   . GLU A 1 9  ? 5.113   3.670   2.250   1.00 0.00 ? 9  GLU A CB   8  
ATOM 9289  C CG   . GLU A 1 9  ? 5.961   3.899   1.002   1.00 0.00 ? 9  GLU A CG   8  
ATOM 9290  C CD   . GLU A 1 9  ? 7.148   4.801   1.350   1.00 0.00 ? 9  GLU A CD   8  
ATOM 9291  O OE1  . GLU A 1 9  ? 6.919   5.850   1.927   1.00 0.00 ? 9  GLU A OE1  8  
ATOM 9292  O OE2  . GLU A 1 9  ? 8.265   4.426   1.031   1.00 0.00 ? 9  GLU A OE2  8  
ATOM 9293  H H    . GLU A 1 9  ? 3.014   4.437   0.963   1.00 0.00 ? 9  GLU A H    8  
ATOM 9294  H HA   . GLU A 1 9  ? 4.283   1.854   1.444   1.00 0.00 ? 9  GLU A HA   8  
ATOM 9295  H HB2  . GLU A 1 9  ? 4.743   4.619   2.611   1.00 0.00 ? 9  GLU A HB2  8  
ATOM 9296  H HB3  . GLU A 1 9  ? 5.720   3.208   3.014   1.00 0.00 ? 9  GLU A HB3  8  
ATOM 9297  H HG2  . GLU A 1 9  ? 6.325   2.950   0.638   1.00 0.00 ? 9  GLU A HG2  8  
ATOM 9298  H HG3  . GLU A 1 9  ? 5.361   4.376   0.244   1.00 0.00 ? 9  GLU A HG3  8  
ATOM 9299  N N    . PHE A 1 10 ? 2.227   3.194   3.611   1.00 0.00 ? 10 PHE A N    8  
ATOM 9300  C CA   . PHE A 1 10 ? 1.518   2.866   4.874   1.00 0.00 ? 10 PHE A CA   8  
ATOM 9301  C C    . PHE A 1 10 ? 0.670   1.599   4.678   1.00 0.00 ? 10 PHE A C    8  
ATOM 9302  O O    . PHE A 1 10 ? 0.718   0.689   5.482   1.00 0.00 ? 10 PHE A O    8  
ATOM 9303  C CB   . PHE A 1 10 ? 0.624   4.034   5.291   1.00 0.00 ? 10 PHE A CB   8  
ATOM 9304  C CG   . PHE A 1 10 ? -0.026  3.694   6.607   1.00 0.00 ? 10 PHE A CG   8  
ATOM 9305  C CD1  . PHE A 1 10 ? 0.693   3.844   7.798   1.00 0.00 ? 10 PHE A CD1  8  
ATOM 9306  C CD2  . PHE A 1 10 ? -1.337  3.210   6.635   1.00 0.00 ? 10 PHE A CD2  8  
ATOM 9307  C CE1  . PHE A 1 10 ? 0.099   3.516   9.021   1.00 0.00 ? 10 PHE A CE1  8  
ATOM 9308  C CE2  . PHE A 1 10 ? -1.934  2.877   7.859   1.00 0.00 ? 10 PHE A CE2  8  
ATOM 9309  C CZ   . PHE A 1 10 ? -1.215  3.032   9.051   1.00 0.00 ? 10 PHE A CZ   8  
ATOM 9310  H H    . PHE A 1 10 ? 1.955   3.985   3.098   1.00 0.00 ? 10 PHE A H    8  
ATOM 9311  H HA   . PHE A 1 10 ? 2.251   2.683   5.639   1.00 0.00 ? 10 PHE A HA   8  
ATOM 9312  H HB2  . PHE A 1 10 ? 1.224   4.926   5.401   1.00 0.00 ? 10 PHE A HB2  8  
ATOM 9313  H HB3  . PHE A 1 10 ? -0.136  4.197   4.542   1.00 0.00 ? 10 PHE A HB3  8  
ATOM 9314  H HD1  . PHE A 1 10 ? 1.705   4.219   7.772   1.00 0.00 ? 10 PHE A HD1  8  
ATOM 9315  H HD2  . PHE A 1 10 ? -1.888  3.099   5.712   1.00 0.00 ? 10 PHE A HD2  8  
ATOM 9316  H HE1  . PHE A 1 10 ? 0.655   3.632   9.941   1.00 0.00 ? 10 PHE A HE1  8  
ATOM 9317  H HE2  . PHE A 1 10 ? -2.947  2.497   7.883   1.00 0.00 ? 10 PHE A HE2  8  
ATOM 9318  H HZ   . PHE A 1 10 ? -1.674  2.777   9.995   1.00 0.00 ? 10 PHE A HZ   8  
ATOM 9319  N N    . LEU A 1 11 ? -0.094  1.515   3.615   1.00 0.00 ? 11 LEU A N    8  
ATOM 9320  C CA   . LEU A 1 11 ? -0.913  0.283   3.394   1.00 0.00 ? 11 LEU A CA   8  
ATOM 9321  C C    . LEU A 1 11 ? 0.027   -0.911  3.236   1.00 0.00 ? 11 LEU A C    8  
ATOM 9322  O O    . LEU A 1 11 ? -0.205  -1.964  3.798   1.00 0.00 ? 11 LEU A O    8  
ATOM 9323  C CB   . LEU A 1 11 ? -1.770  0.408   2.121   1.00 0.00 ? 11 LEU A CB   8  
ATOM 9324  C CG   . LEU A 1 11 ? -2.722  1.608   2.233   1.00 0.00 ? 11 LEU A CG   8  
ATOM 9325  C CD1  . LEU A 1 11 ? -3.312  1.915   0.853   1.00 0.00 ? 11 LEU A CD1  8  
ATOM 9326  C CD2  . LEU A 1 11 ? -3.865  1.297   3.212   1.00 0.00 ? 11 LEU A CD2  8  
ATOM 9327  H H    . LEU A 1 11 ? -0.120  2.251   2.969   1.00 0.00 ? 11 LEU A H    8  
ATOM 9328  H HA   . LEU A 1 11 ? -1.562  0.107   4.237   1.00 0.00 ? 11 LEU A HA   8  
ATOM 9329  H HB2  . LEU A 1 11 ? -1.125  0.545   1.264   1.00 0.00 ? 11 LEU A HB2  8  
ATOM 9330  H HB3  . LEU A 1 11 ? -2.348  -0.502  1.990   1.00 0.00 ? 11 LEU A HB3  8  
ATOM 9331  H HG   . LEU A 1 11 ? -2.171  2.469   2.582   1.00 0.00 ? 11 LEU A HG   8  
ATOM 9332  H HD11 . LEU A 1 11 ? -2.534  2.288   0.203   1.00 0.00 ? 11 LEU A HD11 8  
ATOM 9333  H HD12 . LEU A 1 11 ? -4.087  2.662   0.951   1.00 0.00 ? 11 LEU A HD12 8  
ATOM 9334  H HD13 . LEU A 1 11 ? -3.733  1.014   0.432   1.00 0.00 ? 11 LEU A HD13 8  
ATOM 9335  H HD21 . LEU A 1 11 ? -4.665  2.010   3.068   1.00 0.00 ? 11 LEU A HD21 8  
ATOM 9336  H HD22 . LEU A 1 11 ? -3.501  1.371   4.226   1.00 0.00 ? 11 LEU A HD22 8  
ATOM 9337  H HD23 . LEU A 1 11 ? -4.238  0.300   3.034   1.00 0.00 ? 11 LEU A HD23 8  
ATOM 9338  N N    . VAL A 1 12 ? 1.085   -0.773  2.484   1.00 0.00 ? 12 VAL A N    8  
ATOM 9339  C CA   . VAL A 1 12 ? 2.021   -1.913  2.308   1.00 0.00 ? 12 VAL A CA   8  
ATOM 9340  C C    . VAL A 1 12 ? 2.572   -2.339  3.680   1.00 0.00 ? 12 VAL A C    8  
ATOM 9341  O O    . VAL A 1 12 ? 2.586   -3.503  4.015   1.00 0.00 ? 12 VAL A O    8  
ATOM 9342  C CB   . VAL A 1 12 ? 3.165   -1.455  1.384   1.00 0.00 ? 12 VAL A CB   8  
ATOM 9343  C CG1  . VAL A 1 12 ? 4.390   -2.361  1.538   1.00 0.00 ? 12 VAL A CG1  8  
ATOM 9344  C CG2  . VAL A 1 12 ? 2.692   -1.502  -0.073  1.00 0.00 ? 12 VAL A CG2  8  
ATOM 9345  H H    . VAL A 1 12 ? 1.277   0.067   2.017   1.00 0.00 ? 12 VAL A H    8  
ATOM 9346  H HA   . VAL A 1 12 ? 1.500   -2.750  1.856   1.00 0.00 ? 12 VAL A HA   8  
ATOM 9347  H HB   . VAL A 1 12 ? 3.440   -0.441  1.636   1.00 0.00 ? 12 VAL A HB   8  
ATOM 9348  H HG11 . VAL A 1 12 ? 4.081   -3.393  1.489   1.00 0.00 ? 12 VAL A HG11 8  
ATOM 9349  H HG12 . VAL A 1 12 ? 4.867   -2.169  2.489   1.00 0.00 ? 12 VAL A HG12 8  
ATOM 9350  H HG13 . VAL A 1 12 ? 5.086   -2.151  0.743   1.00 0.00 ? 12 VAL A HG13 8  
ATOM 9351  H HG21 . VAL A 1 12 ? 2.611   -2.532  -0.393  1.00 0.00 ? 12 VAL A HG21 8  
ATOM 9352  H HG22 . VAL A 1 12 ? 3.405   -0.985  -0.700  1.00 0.00 ? 12 VAL A HG22 8  
ATOM 9353  H HG23 . VAL A 1 12 ? 1.728   -1.022  -0.154  1.00 0.00 ? 12 VAL A HG23 8  
ATOM 9354  N N    . LYS A 1 13 ? 3.020   -1.395  4.473   1.00 0.00 ? 13 LYS A N    8  
ATOM 9355  C CA   . LYS A 1 13 ? 3.572   -1.734  5.822   1.00 0.00 ? 13 LYS A CA   8  
ATOM 9356  C C    . LYS A 1 13 ? 2.508   -2.478  6.638   1.00 0.00 ? 13 LYS A C    8  
ATOM 9357  O O    . LYS A 1 13 ? 2.787   -3.450  7.315   1.00 0.00 ? 13 LYS A O    8  
ATOM 9358  C CB   . LYS A 1 13 ? 3.963   -0.426  6.534   1.00 0.00 ? 13 LYS A CB   8  
ATOM 9359  C CG   . LYS A 1 13 ? 4.171   -0.666  8.040   1.00 0.00 ? 13 LYS A CG   8  
ATOM 9360  C CD   . LYS A 1 13 ? 4.845   0.560   8.686   1.00 0.00 ? 13 LYS A CD   8  
ATOM 9361  C CE   . LYS A 1 13 ? 6.369   0.467   8.551   1.00 0.00 ? 13 LYS A CE   8  
ATOM 9362  N NZ   . LYS A 1 13 ? 6.849   -0.798  9.177   1.00 0.00 ? 13 LYS A NZ   8  
ATOM 9363  H H    . LYS A 1 13 ? 3.001   -0.460  4.177   1.00 0.00 ? 13 LYS A H    8  
ATOM 9364  H HA   . LYS A 1 13 ? 4.445   -2.358  5.704   1.00 0.00 ? 13 LYS A HA   8  
ATOM 9365  H HB2  . LYS A 1 13 ? 4.876   -0.048  6.101   1.00 0.00 ? 13 LYS A HB2  8  
ATOM 9366  H HB3  . LYS A 1 13 ? 3.177   0.302   6.396   1.00 0.00 ? 13 LYS A HB3  8  
ATOM 9367  H HG2  . LYS A 1 13 ? 3.209   -0.829  8.508   1.00 0.00 ? 13 LYS A HG2  8  
ATOM 9368  H HG3  . LYS A 1 13 ? 4.790   -1.538  8.183   1.00 0.00 ? 13 LYS A HG3  8  
ATOM 9369  H HD2  . LYS A 1 13 ? 4.497   1.463   8.202   1.00 0.00 ? 13 LYS A HD2  8  
ATOM 9370  H HD3  . LYS A 1 13 ? 4.585   0.599   9.734   1.00 0.00 ? 13 LYS A HD3  8  
ATOM 9371  H HE2  . LYS A 1 13 ? 6.642   0.478   7.507   1.00 0.00 ? 13 LYS A HE2  8  
ATOM 9372  H HE3  . LYS A 1 13 ? 6.824   1.310   9.050   1.00 0.00 ? 13 LYS A HE3  8  
ATOM 9373  H HZ1  . LYS A 1 13 ? 6.247   -1.032  9.990   1.00 0.00 ? 13 LYS A HZ1  8  
ATOM 9374  H HZ2  . LYS A 1 13 ? 7.832   -0.674  9.496   1.00 0.00 ? 13 LYS A HZ2  8  
ATOM 9375  H HZ3  . LYS A 1 13 ? 6.804   -1.568  8.482   1.00 0.00 ? 13 LYS A HZ3  8  
ATOM 9376  N N    . GLU A 1 14 ? 1.295   -2.010  6.589   1.00 0.00 ? 14 GLU A N    8  
ATOM 9377  C CA   . GLU A 1 14 ? 0.207   -2.659  7.373   1.00 0.00 ? 14 GLU A CA   8  
ATOM 9378  C C    . GLU A 1 14 ? -0.138  -4.012  6.749   1.00 0.00 ? 14 GLU A C    8  
ATOM 9379  O O    . GLU A 1 14 ? -0.441  -4.958  7.449   1.00 0.00 ? 14 GLU A O    8  
ATOM 9380  C CB   . GLU A 1 14 ? -1.033  -1.728  7.377   1.00 0.00 ? 14 GLU A CB   8  
ATOM 9381  C CG   . GLU A 1 14 ? -1.323  -1.226  8.798   1.00 0.00 ? 14 GLU A CG   8  
ATOM 9382  C CD   . GLU A 1 14 ? -1.827  -2.386  9.658   1.00 0.00 ? 14 GLU A CD   8  
ATOM 9383  O OE1  . GLU A 1 14 ? -2.708  -3.097  9.201   1.00 0.00 ? 14 GLU A OE1  8  
ATOM 9384  O OE2  . GLU A 1 14 ? -1.323  -2.545  10.758  1.00 0.00 ? 14 GLU A OE2  8  
ATOM 9385  H H    . GLU A 1 14 ? 1.106   -1.226  6.032   1.00 0.00 ? 14 GLU A H    8  
ATOM 9386  H HA   . GLU A 1 14 ? 0.551   -2.818  8.387   1.00 0.00 ? 14 GLU A HA   8  
ATOM 9387  H HB2  . GLU A 1 14 ? -0.839  -0.881  6.737   1.00 0.00 ? 14 GLU A HB2  8  
ATOM 9388  H HB3  . GLU A 1 14 ? -1.902  -2.258  7.007   1.00 0.00 ? 14 GLU A HB3  8  
ATOM 9389  H HG2  . GLU A 1 14 ? -0.417  -0.825  9.229   1.00 0.00 ? 14 GLU A HG2  8  
ATOM 9390  H HG3  . GLU A 1 14 ? -2.076  -0.455  8.760   1.00 0.00 ? 14 GLU A HG3  8  
ATOM 9391  N N    . VAL A 1 15 ? -0.120  -4.121  5.454   1.00 0.00 ? 15 VAL A N    8  
ATOM 9392  C CA   . VAL A 1 15 ? -0.481  -5.425  4.844   1.00 0.00 ? 15 VAL A CA   8  
ATOM 9393  C C    . VAL A 1 15 ? 0.583   -6.480  5.177   1.00 0.00 ? 15 VAL A C    8  
ATOM 9394  O O    . VAL A 1 15 ? 0.256   -7.612  5.452   1.00 0.00 ? 15 VAL A O    8  
ATOM 9395  C CB   . VAL A 1 15 ? -0.638  -5.274  3.316   1.00 0.00 ? 15 VAL A CB   8  
ATOM 9396  C CG1  . VAL A 1 15 ? -0.557  -6.646  2.630   1.00 0.00 ? 15 VAL A CG1  8  
ATOM 9397  C CG2  . VAL A 1 15 ? -2.000  -4.643  3.006   1.00 0.00 ? 15 VAL A CG2  8  
ATOM 9398  H H    . VAL A 1 15 ? 0.113   -3.356  4.889   1.00 0.00 ? 15 VAL A H    8  
ATOM 9399  H HA   . VAL A 1 15 ? -1.420  -5.747  5.271   1.00 0.00 ? 15 VAL A HA   8  
ATOM 9400  H HB   . VAL A 1 15 ? 0.144   -4.635  2.934   1.00 0.00 ? 15 VAL A HB   8  
ATOM 9401  H HG11 . VAL A 1 15 ? 0.455   -7.030  2.698   1.00 0.00 ? 15 VAL A HG11 8  
ATOM 9402  H HG12 . VAL A 1 15 ? -0.835  -6.546  1.592   1.00 0.00 ? 15 VAL A HG12 8  
ATOM 9403  H HG13 . VAL A 1 15 ? -1.234  -7.332  3.118   1.00 0.00 ? 15 VAL A HG13 8  
ATOM 9404  H HG21 . VAL A 1 15 ? -2.086  -3.699  3.524   1.00 0.00 ? 15 VAL A HG21 8  
ATOM 9405  H HG22 . VAL A 1 15 ? -2.788  -5.307  3.334   1.00 0.00 ? 15 VAL A HG22 8  
ATOM 9406  H HG23 . VAL A 1 15 ? -2.087  -4.480  1.941   1.00 0.00 ? 15 VAL A HG23 8  
ATOM 9407  N N    . THR A 1 16 ? 1.847   -6.163  5.122   1.00 0.00 ? 16 THR A N    8  
ATOM 9408  C CA   . THR A 1 16 ? 2.833   -7.242  5.407   1.00 0.00 ? 16 THR A CA   8  
ATOM 9409  C C    . THR A 1 16 ? 2.698   -7.730  6.843   1.00 0.00 ? 16 THR A C    8  
ATOM 9410  O O    . THR A 1 16 ? 2.785   -8.914  7.102   1.00 0.00 ? 16 THR A O    8  
ATOM 9411  C CB   . THR A 1 16 ? 4.277   -6.815  5.160   1.00 0.00 ? 16 THR A CB   8  
ATOM 9412  O OG1  . THR A 1 16 ? 4.809   -6.238  6.344   1.00 0.00 ? 16 THR A OG1  8  
ATOM 9413  C CG2  . THR A 1 16 ? 4.373   -5.806  4.010   1.00 0.00 ? 16 THR A CG2  8  
ATOM 9414  H H    . THR A 1 16 ? 2.132   -5.259  4.873   1.00 0.00 ? 16 THR A H    8  
ATOM 9415  H HA   . THR A 1 16 ? 2.607   -8.057  4.748   1.00 0.00 ? 16 THR A HA   8  
ATOM 9416  H HB   . THR A 1 16 ? 4.840   -7.702  4.905   1.00 0.00 ? 16 THR A HB   8  
ATOM 9417  H HG1  . THR A 1 16 ? 5.604   -5.754  6.108   1.00 0.00 ? 16 THR A HG1  8  
ATOM 9418  H HG21 . THR A 1 16 ? 3.503   -5.884  3.377   1.00 0.00 ? 16 THR A HG21 8  
ATOM 9419  H HG22 . THR A 1 16 ? 5.258   -6.010  3.424   1.00 0.00 ? 16 THR A HG22 8  
ATOM 9420  H HG23 . THR A 1 16 ? 4.437   -4.812  4.418   1.00 0.00 ? 16 THR A HG23 8  
ATOM 9421  N N    . LYS A 1 17 ? 2.475   -6.862  7.790   1.00 0.00 ? 17 LYS A N    8  
ATOM 9422  C CA   . LYS A 1 17 ? 2.334   -7.374  9.176   1.00 0.00 ? 17 LYS A CA   8  
ATOM 9423  C C    . LYS A 1 17 ? 1.119   -8.300  9.188   1.00 0.00 ? 17 LYS A C    8  
ATOM 9424  O O    . LYS A 1 17 ? 1.063   -9.281  9.902   1.00 0.00 ? 17 LYS A O    8  
ATOM 9425  C CB   . LYS A 1 17 ? 2.119   -6.222  10.171  1.00 0.00 ? 17 LYS A CB   8  
ATOM 9426  C CG   . LYS A 1 17 ? 1.530   -6.782  11.479  1.00 0.00 ? 17 LYS A CG   8  
ATOM 9427  C CD   . LYS A 1 17 ? 1.780   -5.826  12.640  1.00 0.00 ? 17 LYS A CD   8  
ATOM 9428  C CE   . LYS A 1 17 ? 1.265   -6.476  13.929  1.00 0.00 ? 17 LYS A CE   8  
ATOM 9429  N NZ   . LYS A 1 17 ? 1.774   -5.717  15.105  1.00 0.00 ? 17 LYS A NZ   8  
ATOM 9430  H H    . LYS A 1 17 ? 2.384   -5.907  7.590   1.00 0.00 ? 17 LYS A H    8  
ATOM 9431  H HA   . LYS A 1 17 ? 3.234   -7.914  9.435   1.00 0.00 ? 17 LYS A HA   8  
ATOM 9432  H HB2  . LYS A 1 17 ? 3.067   -5.744  10.375  1.00 0.00 ? 17 LYS A HB2  8  
ATOM 9433  H HB3  . LYS A 1 17 ? 1.436   -5.502  9.747   1.00 0.00 ? 17 LYS A HB3  8  
ATOM 9434  H HG2  . LYS A 1 17 ? 0.467   -6.923  11.359  1.00 0.00 ? 17 LYS A HG2  8  
ATOM 9435  H HG3  . LYS A 1 17 ? 1.991   -7.736  11.700  1.00 0.00 ? 17 LYS A HG3  8  
ATOM 9436  H HD2  . LYS A 1 17 ? 2.839   -5.630  12.727  1.00 0.00 ? 17 LYS A HD2  8  
ATOM 9437  H HD3  . LYS A 1 17 ? 1.250   -4.901  12.468  1.00 0.00 ? 17 LYS A HD3  8  
ATOM 9438  H HE2  . LYS A 1 17 ? 0.185   -6.464  13.931  1.00 0.00 ? 17 LYS A HE2  8  
ATOM 9439  H HE3  . LYS A 1 17 ? 1.611   -7.502  13.983  1.00 0.00 ? 17 LYS A HE3  8  
ATOM 9440  H HZ1  . LYS A 1 17 ? 1.679   -4.697  14.929  1.00 0.00 ? 17 LYS A HZ1  8  
ATOM 9441  H HZ2  . LYS A 1 17 ? 2.776   -5.952  15.262  1.00 0.00 ? 17 LYS A HZ2  8  
ATOM 9442  H HZ3  . LYS A 1 17 ? 1.222   -5.973  15.948  1.00 0.00 ? 17 LYS A HZ3  8  
ATOM 9443  N N    . LEU A 1 18 ? 0.150   -7.973  8.381   1.00 0.00 ? 18 LEU A N    8  
ATOM 9444  C CA   . LEU A 1 18 ? -1.083  -8.794  8.298   1.00 0.00 ? 18 LEU A CA   8  
ATOM 9445  C C    . LEU A 1 18 ? -0.725  -10.103 7.583   1.00 0.00 ? 18 LEU A C    8  
ATOM 9446  O O    . LEU A 1 18 ? -1.180  -11.168 7.944   1.00 0.00 ? 18 LEU A O    8  
ATOM 9447  C CB   . LEU A 1 18 ? -2.156  -8.014  7.510   1.00 0.00 ? 18 LEU A CB   8  
ATOM 9448  C CG   . LEU A 1 18 ? -2.771  -6.790  8.293   1.00 0.00 ? 18 LEU A CG   8  
ATOM 9449  C CD1  . LEU A 1 18 ? -4.289  -6.947  8.413   1.00 0.00 ? 18 LEU A CD1  8  
ATOM 9450  C CD2  . LEU A 1 18 ? -2.210  -6.616  9.719   1.00 0.00 ? 18 LEU A CD2  8  
ATOM 9451  H H    . LEU A 1 18 ? 0.240   -7.177  7.816   1.00 0.00 ? 18 LEU A H    8  
ATOM 9452  H HA   . LEU A 1 18 ? -1.442  -9.043  9.282   1.00 0.00 ? 18 LEU A HA   8  
ATOM 9453  H HB2  . LEU A 1 18 ? -1.704  -7.650  6.607   1.00 0.00 ? 18 LEU A HB2  8  
ATOM 9454  H HB3  . LEU A 1 18 ? -2.935  -8.691  7.235   1.00 0.00 ? 18 LEU A HB3  8  
ATOM 9455  H HG   . LEU A 1 18 ? -2.574  -5.884  7.732   1.00 0.00 ? 18 LEU A HG   8  
ATOM 9456  H HD11 . LEU A 1 18 ? -4.719  -7.052  7.428   1.00 0.00 ? 18 LEU A HD11 8  
ATOM 9457  H HD12 . LEU A 1 18 ? -4.702  -6.078  8.901   1.00 0.00 ? 18 LEU A HD12 8  
ATOM 9458  H HD13 . LEU A 1 18 ? -4.513  -7.818  9.001   1.00 0.00 ? 18 LEU A HD13 8  
ATOM 9459  H HD21 . LEU A 1 18 ? -2.556  -5.675  10.117  1.00 0.00 ? 18 LEU A HD21 8  
ATOM 9460  H HD22 . LEU A 1 18 ? -1.138  -6.611  9.697   1.00 0.00 ? 18 LEU A HD22 8  
ATOM 9461  H HD23 . LEU A 1 18 ? -2.563  -7.415  10.352  1.00 0.00 ? 18 LEU A HD23 8  
ATOM 9462  N N    . ILE A 1 19 ? 0.124   -10.027 6.593   1.00 0.00 ? 19 ILE A N    8  
ATOM 9463  C CA   . ILE A 1 19 ? 0.560   -11.256 5.875   1.00 0.00 ? 19 ILE A CA   8  
ATOM 9464  C C    . ILE A 1 19 ? 1.453   -12.035 6.829   1.00 0.00 ? 19 ILE A C    8  
ATOM 9465  O O    . ILE A 1 19 ? 1.493   -13.250 6.823   1.00 0.00 ? 19 ILE A O    8  
ATOM 9466  C CB   . ILE A 1 19 ? 1.350   -10.869 4.611   1.00 0.00 ? 19 ILE A CB   8  
ATOM 9467  C CG1  . ILE A 1 19 ? 0.393   -10.217 3.599   1.00 0.00 ? 19 ILE A CG1  8  
ATOM 9468  C CG2  . ILE A 1 19 ? 1.983   -12.114 3.986   1.00 0.00 ? 19 ILE A CG2  8  
ATOM 9469  C CD1  . ILE A 1 19 ? 1.178   -9.686  2.394   1.00 0.00 ? 19 ILE A CD1  8  
ATOM 9470  H H    . ILE A 1 19 ? 0.499   -9.164  6.345   1.00 0.00 ? 19 ILE A H    8  
ATOM 9471  H HA   . ILE A 1 19 ? -0.303  -11.850 5.608   1.00 0.00 ? 19 ILE A HA   8  
ATOM 9472  H HB   . ILE A 1 19 ? 2.135   -10.172 4.876   1.00 0.00 ? 19 ILE A HB   8  
ATOM 9473  H HG12 . ILE A 1 19 ? -0.325  -10.948 3.264   1.00 0.00 ? 19 ILE A HG12 8  
ATOM 9474  H HG13 . ILE A 1 19 ? -0.129  -9.403  4.070   1.00 0.00 ? 19 ILE A HG13 8  
ATOM 9475  H HG21 . ILE A 1 19 ? 1.226   -12.868 3.838   1.00 0.00 ? 19 ILE A HG21 8  
ATOM 9476  H HG22 . ILE A 1 19 ? 2.753   -12.495 4.640   1.00 0.00 ? 19 ILE A HG22 8  
ATOM 9477  H HG23 . ILE A 1 19 ? 2.424   -11.853 3.035   1.00 0.00 ? 19 ILE A HG23 8  
ATOM 9478  H HD11 . ILE A 1 19 ? 1.940   -9.004  2.733   1.00 0.00 ? 19 ILE A HD11 8  
ATOM 9479  H HD12 . ILE A 1 19 ? 0.505   -9.168  1.727   1.00 0.00 ? 19 ILE A HD12 8  
ATOM 9480  H HD13 . ILE A 1 19 ? 1.639   -10.511 1.872   1.00 0.00 ? 19 ILE A HD13 8  
ATOM 9481  N N    . ASP A 1 20 ? 2.171   -11.329 7.656   1.00 0.00 ? 20 ASP A N    8  
ATOM 9482  C CA   . ASP A 1 20 ? 3.075   -11.992 8.627   1.00 0.00 ? 20 ASP A CA   8  
ATOM 9483  C C    . ASP A 1 20 ? 2.266   -12.572 9.788   1.00 0.00 ? 20 ASP A C    8  
ATOM 9484  O O    . ASP A 1 20 ? 2.716   -13.482 10.456  1.00 0.00 ? 20 ASP A O    8  
ATOM 9485  C CB   . ASP A 1 20 ? 4.072   -10.967 9.169   1.00 0.00 ? 20 ASP A CB   8  
ATOM 9486  C CG   . ASP A 1 20 ? 5.152   -11.684 9.981   1.00 0.00 ? 20 ASP A CG   8  
ATOM 9487  O OD1  . ASP A 1 20 ? 5.603   -12.728 9.539   1.00 0.00 ? 20 ASP A OD1  8  
ATOM 9488  O OD2  . ASP A 1 20 ? 5.510   -11.177 11.031  1.00 0.00 ? 20 ASP A OD2  8  
ATOM 9489  H H    . ASP A 1 20 ? 2.116   -10.350 7.637   1.00 0.00 ? 20 ASP A H    8  
ATOM 9490  H HA   . ASP A 1 20 ? 3.615   -12.791 8.143   1.00 0.00 ? 20 ASP A HA   8  
ATOM 9491  H HB2  . ASP A 1 20 ? 4.531   -10.441 8.344   1.00 0.00 ? 20 ASP A HB2  8  
ATOM 9492  H HB3  . ASP A 1 20 ? 3.556   -10.262 9.804   1.00 0.00 ? 20 ASP A HB3  8  
ATOM 9493  N N    . ASN A 1 21 ? 1.078   -12.059 10.053  1.00 0.00 ? 21 ASN A N    8  
ATOM 9494  C CA   . ASN A 1 21 ? 0.279   -12.615 11.198  1.00 0.00 ? 21 ASN A CA   8  
ATOM 9495  C C    . ASN A 1 21 ? -0.575  -13.794 10.704  1.00 0.00 ? 21 ASN A C    8  
ATOM 9496  O O    . ASN A 1 21 ? -1.285  -14.407 11.470  1.00 0.00 ? 21 ASN A O    8  
ATOM 9497  C CB   . ASN A 1 21 ? -0.587  -11.529 11.843  1.00 0.00 ? 21 ASN A CB   8  
ATOM 9498  C CG   . ASN A 1 21 ? -1.318  -12.111 13.055  1.00 0.00 ? 21 ASN A CG   8  
ATOM 9499  O OD1  . ASN A 1 21 ? -1.018  -13.203 13.493  1.00 0.00 ? 21 ASN A OD1  8  
ATOM 9500  N ND2  . ASN A 1 21 ? -2.272  -11.421 13.618  1.00 0.00 ? 21 ASN A ND2  8  
ATOM 9501  H H    . ASN A 1 21 ? 0.726   -11.326 9.507   1.00 0.00 ? 21 ASN A H    8  
ATOM 9502  H HA   . ASN A 1 21 ? 0.983   -13.019 11.912  1.00 0.00 ? 21 ASN A HA   8  
ATOM 9503  H HB2  . ASN A 1 21 ? 0.042   -10.707 12.161  1.00 0.00 ? 21 ASN A HB2  8  
ATOM 9504  H HB3  . ASN A 1 21 ? -1.311  -11.172 11.126  1.00 0.00 ? 21 ASN A HB3  8  
ATOM 9505  H HD21 . ASN A 1 21 ? -2.514  -10.540 13.264  1.00 0.00 ? 21 ASN A HD21 8  
ATOM 9506  H HD22 . ASN A 1 21 ? -2.746  -11.785 14.395  1.00 0.00 ? 21 ASN A HD22 8  
ATOM 9507  N N    . ASN A 1 22 ? -0.444  -14.155 9.446   1.00 0.00 ? 22 ASN A N    8  
ATOM 9508  C CA   . ASN A 1 22 ? -1.172  -15.359 8.894   1.00 0.00 ? 22 ASN A CA   8  
ATOM 9509  C C    . ASN A 1 22 ? -2.652  -15.087 8.581   1.00 0.00 ? 22 ASN A C    8  
ATOM 9510  O O    . ASN A 1 22 ? -3.495  -15.917 8.858   1.00 0.00 ? 22 ASN A O    8  
ATOM 9511  C CB   . ASN A 1 22 ? -1.087  -16.525 9.899   1.00 0.00 ? 22 ASN A CB   8  
ATOM 9512  C CG   . ASN A 1 22 ? 0.275   -16.511 10.597  1.00 0.00 ? 22 ASN A CG   8  
ATOM 9513  O OD1  . ASN A 1 22 ? 0.365   -16.223 11.773  1.00 0.00 ? 22 ASN A OD1  8  
ATOM 9514  N ND2  . ASN A 1 22 ? 1.347   -16.811 9.915   1.00 0.00 ? 22 ASN A ND2  8  
ATOM 9515  H H    . ASN A 1 22 ? 0.182   -13.664 8.863   1.00 0.00 ? 22 ASN A H    8  
ATOM 9516  H HA   . ASN A 1 22 ? -0.658  -15.669 7.995   1.00 0.00 ? 22 ASN A HA   8  
ATOM 9517  H HB2  . ASN A 1 22 ? -1.874  -16.440 10.634  1.00 0.00 ? 22 ASN A HB2  8  
ATOM 9518  H HB3  . ASN A 1 22 ? -1.201  -17.460 9.369   1.00 0.00 ? 22 ASN A HB3  8  
ATOM 9519  H HD21 . ASN A 1 22 ? 1.275   -17.043 8.965   1.00 0.00 ? 22 ASN A HD21 8  
ATOM 9520  H HD22 . ASN A 1 22 ? 2.224   -16.804 10.352  1.00 0.00 ? 22 ASN A HD22 8  
ATOM 9521  N N    . LYS A 1 23 ? -2.991  -13.968 8.002   1.00 0.00 ? 23 LYS A N    8  
ATOM 9522  C CA   . LYS A 1 23 ? -4.435  -13.706 7.677   1.00 0.00 ? 23 LYS A CA   8  
ATOM 9523  C C    . LYS A 1 23 ? -4.687  -14.075 6.204   1.00 0.00 ? 23 LYS A C    8  
ATOM 9524  O O    . LYS A 1 23 ? -3.804  -13.997 5.373   1.00 0.00 ? 23 LYS A O    8  
ATOM 9525  C CB   . LYS A 1 23 ? -4.743  -12.226 7.910   1.00 0.00 ? 23 LYS A CB   8  
ATOM 9526  C CG   . LYS A 1 23 ? -4.068  -11.717 9.224   1.00 0.00 ? 23 LYS A CG   8  
ATOM 9527  C CD   . LYS A 1 23 ? -5.088  -11.010 10.136  1.00 0.00 ? 23 LYS A CD   8  
ATOM 9528  C CE   . LYS A 1 23 ? -4.407  -10.629 11.452  1.00 0.00 ? 23 LYS A CE   8  
ATOM 9529  N NZ   . LYS A 1 23 ? -3.339  -9.625  11.187  1.00 0.00 ? 23 LYS A NZ   8  
ATOM 9530  H H    . LYS A 1 23 ? -2.307  -13.305 7.772   1.00 0.00 ? 23 LYS A H    8  
ATOM 9531  H HA   . LYS A 1 23 ? -5.067  -14.282 8.320   1.00 0.00 ? 23 LYS A HA   8  
ATOM 9532  H HB2  . LYS A 1 23 ? -4.370  -11.677 7.070   1.00 0.00 ? 23 LYS A HB2  8  
ATOM 9533  H HB3  . LYS A 1 23 ? -5.815  -12.097 7.975   1.00 0.00 ? 23 LYS A HB3  8  
ATOM 9534  H HG2  . LYS A 1 23 ? -3.642  -12.547 9.770   1.00 0.00 ? 23 LYS A HG2  8  
ATOM 9535  H HG3  . LYS A 1 23 ? -3.280  -11.022 8.978   1.00 0.00 ? 23 LYS A HG3  8  
ATOM 9536  H HD2  . LYS A 1 23 ? -5.460  -10.116 9.653   1.00 0.00 ? 23 LYS A HD2  8  
ATOM 9537  H HD3  . LYS A 1 23 ? -5.909  -11.678 10.344  1.00 0.00 ? 23 LYS A HD3  8  
ATOM 9538  H HE2  . LYS A 1 23 ? -5.139  -10.207 12.126  1.00 0.00 ? 23 LYS A HE2  8  
ATOM 9539  H HE3  . LYS A 1 23 ? -3.971  -11.510 11.899  1.00 0.00 ? 23 LYS A HE3  8  
ATOM 9540  H HZ1  . LYS A 1 23 ? -3.128  -9.603  10.169  1.00 0.00 ? 23 LYS A HZ1  8  
ATOM 9541  H HZ2  . LYS A 1 23 ? -2.480  -9.886  11.715  1.00 0.00 ? 23 LYS A HZ2  8  
ATOM 9542  H HZ3  . LYS A 1 23 ? -3.661  -8.685  11.492  1.00 0.00 ? 23 LYS A HZ3  8  
ATOM 9543  N N    . THR A 1 24 ? -5.898  -14.473 5.881   1.00 0.00 ? 24 THR A N    8  
ATOM 9544  C CA   . THR A 1 24 ? -6.229  -14.844 4.470   1.00 0.00 ? 24 THR A CA   8  
ATOM 9545  C C    . THR A 1 24 ? -6.445  -13.586 3.623   1.00 0.00 ? 24 THR A C    8  
ATOM 9546  O O    . THR A 1 24 ? -6.454  -12.484 4.127   1.00 0.00 ? 24 THR A O    8  
ATOM 9547  C CB   . THR A 1 24 ? -7.515  -15.686 4.428   1.00 0.00 ? 24 THR A CB   8  
ATOM 9548  O OG1  . THR A 1 24 ? -8.637  -14.829 4.260   1.00 0.00 ? 24 THR A OG1  8  
ATOM 9549  C CG2  . THR A 1 24 ? -7.677  -16.473 5.726   1.00 0.00 ? 24 THR A CG2  8  
ATOM 9550  H H    . THR A 1 24 ? -6.593  -14.526 6.570   1.00 0.00 ? 24 THR A H    8  
ATOM 9551  H HA   . THR A 1 24 ? -5.418  -15.409 4.035   1.00 0.00 ? 24 THR A HA   8  
ATOM 9552  H HB   . THR A 1 24 ? -7.469  -16.377 3.599   1.00 0.00 ? 24 THR A HB   8  
ATOM 9553  H HG1  . THR A 1 24 ? -9.424  -15.376 4.219   1.00 0.00 ? 24 THR A HG1  8  
ATOM 9554  H HG21 . THR A 1 24 ? -6.719  -16.865 6.034   1.00 0.00 ? 24 THR A HG21 8  
ATOM 9555  H HG22 . THR A 1 24 ? -8.366  -17.287 5.564   1.00 0.00 ? 24 THR A HG22 8  
ATOM 9556  H HG23 . THR A 1 24 ? -8.066  -15.822 6.493   1.00 0.00 ? 24 THR A HG23 8  
ATOM 9557  N N    . GLU A 1 25 ? -6.652  -13.757 2.344   1.00 0.00 ? 25 GLU A N    8  
ATOM 9558  C CA   . GLU A 1 25 ? -6.901  -12.582 1.451   1.00 0.00 ? 25 GLU A CA   8  
ATOM 9559  C C    . GLU A 1 25 ? -8.250  -11.950 1.827   1.00 0.00 ? 25 GLU A C    8  
ATOM 9560  O O    . GLU A 1 25 ? -8.381  -10.748 1.929   1.00 0.00 ? 25 GLU A O    8  
ATOM 9561  C CB   . GLU A 1 25 ? -6.938  -13.061 -0.005  1.00 0.00 ? 25 GLU A CB   8  
ATOM 9562  C CG   . GLU A 1 25 ? -6.787  -11.869 -0.953  1.00 0.00 ? 25 GLU A CG   8  
ATOM 9563  C CD   . GLU A 1 25 ? -7.250  -12.266 -2.357  1.00 0.00 ? 25 GLU A CD   8  
ATOM 9564  O OE1  . GLU A 1 25 ? -8.424  -12.557 -2.511  1.00 0.00 ? 25 GLU A OE1  8  
ATOM 9565  O OE2  . GLU A 1 25 ? -6.422  -12.271 -3.252  1.00 0.00 ? 25 GLU A OE2  8  
ATOM 9566  H H    . GLU A 1 25 ? -6.664  -14.667 1.983   1.00 0.00 ? 25 GLU A H    8  
ATOM 9567  H HA   . GLU A 1 25 ? -6.112  -11.852 1.585   1.00 0.00 ? 25 GLU A HA   8  
ATOM 9568  H HB2  . GLU A 1 25 ? -6.128  -13.757 -0.172  1.00 0.00 ? 25 GLU A HB2  8  
ATOM 9569  H HB3  . GLU A 1 25 ? -7.880  -13.555 -0.195  1.00 0.00 ? 25 GLU A HB3  8  
ATOM 9570  H HG2  . GLU A 1 25 ? -7.388  -11.045 -0.595  1.00 0.00 ? 25 GLU A HG2  8  
ATOM 9571  H HG3  . GLU A 1 25 ? -5.750  -11.571 -0.991  1.00 0.00 ? 25 GLU A HG3  8  
ATOM 9572  N N    . LYS A 1 26 ? -9.251  -12.765 2.020   1.00 0.00 ? 26 LYS A N    8  
ATOM 9573  C CA   . LYS A 1 26 ? -10.610 -12.248 2.374   1.00 0.00 ? 26 LYS A CA   8  
ATOM 9574  C C    . LYS A 1 26 ? -10.551 -11.362 3.631   1.00 0.00 ? 26 LYS A C    8  
ATOM 9575  O O    . LYS A 1 26 ? -11.304 -10.418 3.766   1.00 0.00 ? 26 LYS A O    8  
ATOM 9576  C CB   . LYS A 1 26 ? -11.549 -13.450 2.610   1.00 0.00 ? 26 LYS A CB   8  
ATOM 9577  C CG   . LYS A 1 26 ? -12.981 -13.122 2.153   1.00 0.00 ? 26 LYS A CG   8  
ATOM 9578  C CD   . LYS A 1 26 ? -13.483 -11.855 2.858   1.00 0.00 ? 26 LYS A CD   8  
ATOM 9579  C CE   . LYS A 1 26 ? -15.013 -11.804 2.802   1.00 0.00 ? 26 LYS A CE   8  
ATOM 9580  N NZ   . LYS A 1 26 ? -15.458 -11.778 1.380   1.00 0.00 ? 26 LYS A NZ   8  
ATOM 9581  H H    . LYS A 1 26 ? -9.116  -13.728 1.918   1.00 0.00 ? 26 LYS A H    8  
ATOM 9582  H HA   . LYS A 1 26 ? -10.987 -11.653 1.566   1.00 0.00 ? 26 LYS A HA   8  
ATOM 9583  H HB2  . LYS A 1 26 ? -11.186 -14.295 2.044   1.00 0.00 ? 26 LYS A HB2  8  
ATOM 9584  H HB3  . LYS A 1 26 ? -11.561 -13.708 3.659   1.00 0.00 ? 26 LYS A HB3  8  
ATOM 9585  H HG2  . LYS A 1 26 ? -12.988 -12.964 1.084   1.00 0.00 ? 26 LYS A HG2  8  
ATOM 9586  H HG3  . LYS A 1 26 ? -13.630 -13.951 2.396   1.00 0.00 ? 26 LYS A HG3  8  
ATOM 9587  H HD2  . LYS A 1 26 ? -13.162 -11.863 3.890   1.00 0.00 ? 26 LYS A HD2  8  
ATOM 9588  H HD3  . LYS A 1 26 ? -13.081 -10.986 2.361   1.00 0.00 ? 26 LYS A HD3  8  
ATOM 9589  H HE2  . LYS A 1 26 ? -15.420 -12.676 3.291   1.00 0.00 ? 26 LYS A HE2  8  
ATOM 9590  H HE3  . LYS A 1 26 ? -15.361 -10.914 3.305   1.00 0.00 ? 26 LYS A HE3  8  
ATOM 9591  H HZ1  . LYS A 1 26 ? -16.441 -12.108 1.317   1.00 0.00 ? 26 LYS A HZ1  8  
ATOM 9592  H HZ2  . LYS A 1 26 ? -14.845 -12.402 0.814   1.00 0.00 ? 26 LYS A HZ2  8  
ATOM 9593  H HZ3  . LYS A 1 26 ? -15.396 -10.807 1.014   1.00 0.00 ? 26 LYS A HZ3  8  
ATOM 9594  N N    . GLU A 1 27 ? -9.677  -11.649 4.546   1.00 0.00 ? 27 GLU A N    8  
ATOM 9595  C CA   . GLU A 1 27 ? -9.598  -10.813 5.783   1.00 0.00 ? 27 GLU A CA   8  
ATOM 9596  C C    . GLU A 1 27 ? -8.880  -9.485  5.492   1.00 0.00 ? 27 GLU A C    8  
ATOM 9597  O O    . GLU A 1 27 ? -9.221  -8.462  6.052   1.00 0.00 ? 27 GLU A O    8  
ATOM 9598  C CB   . GLU A 1 27 ? -8.835  -11.581 6.867   1.00 0.00 ? 27 GLU A CB   8  
ATOM 9599  C CG   . GLU A 1 27 ? -9.745  -12.641 7.506   1.00 0.00 ? 27 GLU A CG   8  
ATOM 9600  C CD   . GLU A 1 27 ? -10.456 -13.450 6.418   1.00 0.00 ? 27 GLU A CD   8  
ATOM 9601  O OE1  . GLU A 1 27 ? -11.423 -12.945 5.871   1.00 0.00 ? 27 GLU A OE1  8  
ATOM 9602  O OE2  . GLU A 1 27 ? -10.026 -14.560 6.155   1.00 0.00 ? 27 GLU A OE2  8  
ATOM 9603  H H    . GLU A 1 27 ? -9.073  -12.411 4.422   1.00 0.00 ? 27 GLU A H    8  
ATOM 9604  H HA   . GLU A 1 27 ? -10.595 -10.605 6.143   1.00 0.00 ? 27 GLU A HA   8  
ATOM 9605  H HB2  . GLU A 1 27 ? -7.974  -12.059 6.429   1.00 0.00 ? 27 GLU A HB2  8  
ATOM 9606  H HB3  . GLU A 1 27 ? -8.513  -10.890 7.628   1.00 0.00 ? 27 GLU A HB3  8  
ATOM 9607  H HG2  . GLU A 1 27 ? -9.149  -13.306 8.113   1.00 0.00 ? 27 GLU A HG2  8  
ATOM 9608  H HG3  . GLU A 1 27 ? -10.481 -12.153 8.126   1.00 0.00 ? 27 GLU A HG3  8  
ATOM 9609  N N    . ILE A 1 28 ? -7.890  -9.482  4.642   1.00 0.00 ? 28 ILE A N    8  
ATOM 9610  C CA   . ILE A 1 28 ? -7.169  -8.205  4.353   1.00 0.00 ? 28 ILE A CA   8  
ATOM 9611  C C    . ILE A 1 28 ? -8.138  -7.236  3.681   1.00 0.00 ? 28 ILE A C    8  
ATOM 9612  O O    . ILE A 1 28 ? -8.141  -6.054  3.963   1.00 0.00 ? 28 ILE A O    8  
ATOM 9613  C CB   . ILE A 1 28 ? -5.970  -8.502  3.434   1.00 0.00 ? 28 ILE A CB   8  
ATOM 9614  C CG1  . ILE A 1 28 ? -5.233  -9.777  3.955   1.00 0.00 ? 28 ILE A CG1  8  
ATOM 9615  C CG2  . ILE A 1 28 ? -5.042  -7.284  3.372   1.00 0.00 ? 28 ILE A CG2  8  
ATOM 9616  C CD1  . ILE A 1 28 ? -3.709  -9.616  4.018   1.00 0.00 ? 28 ILE A CD1  8  
ATOM 9617  H H    . ILE A 1 28 ? -7.617  -10.310 4.194   1.00 0.00 ? 28 ILE A H    8  
ATOM 9618  H HA   . ILE A 1 28 ? -6.832  -7.777  5.287   1.00 0.00 ? 28 ILE A HA   8  
ATOM 9619  H HB   . ILE A 1 28 ? -6.345  -8.690  2.439   1.00 0.00 ? 28 ILE A HB   8  
ATOM 9620  H HG12 . ILE A 1 28 ? -5.590  -10.018 4.936   1.00 0.00 ? 28 ILE A HG12 8  
ATOM 9621  H HG13 . ILE A 1 28 ? -5.458  -10.597 3.303   1.00 0.00 ? 28 ILE A HG13 8  
ATOM 9622  H HG21 . ILE A 1 28 ? -4.254  -7.473  2.658   1.00 0.00 ? 28 ILE A HG21 8  
ATOM 9623  H HG22 . ILE A 1 28 ? -4.614  -7.100  4.344   1.00 0.00 ? 28 ILE A HG22 8  
ATOM 9624  H HG23 . ILE A 1 28 ? -5.608  -6.423  3.058   1.00 0.00 ? 28 ILE A HG23 8  
ATOM 9625  H HD11 . ILE A 1 28 ? -3.271  -10.544 4.367   1.00 0.00 ? 28 ILE A HD11 8  
ATOM 9626  H HD12 . ILE A 1 28 ? -3.455  -8.823  4.703   1.00 0.00 ? 28 ILE A HD12 8  
ATOM 9627  H HD13 . ILE A 1 28 ? -3.327  -9.385  3.036   1.00 0.00 ? 28 ILE A HD13 8  
ATOM 9628  N N    . LEU A 1 29 ? -8.965  -7.720  2.804   1.00 0.00 ? 29 LEU A N    8  
ATOM 9629  C CA   . LEU A 1 29 ? -9.937  -6.821  2.129   1.00 0.00 ? 29 LEU A CA   8  
ATOM 9630  C C    . LEU A 1 29 ? -11.045 -6.431  3.116   1.00 0.00 ? 29 LEU A C    8  
ATOM 9631  O O    . LEU A 1 29 ? -11.620 -5.366  3.037   1.00 0.00 ? 29 LEU A O    8  
ATOM 9632  C CB   . LEU A 1 29 ? -10.531 -7.553  0.926   1.00 0.00 ? 29 LEU A CB   8  
ATOM 9633  C CG   . LEU A 1 29 ? -9.394  -8.070  0.033   1.00 0.00 ? 29 LEU A CG   8  
ATOM 9634  C CD1  . LEU A 1 29 ? -9.987  -8.908  -1.103  1.00 0.00 ? 29 LEU A CD1  8  
ATOM 9635  C CD2  . LEU A 1 29 ? -8.610  -6.883  -0.557  1.00 0.00 ? 29 LEU A CD2  8  
ATOM 9636  H H    . LEU A 1 29 ? -8.952  -8.673  2.580   1.00 0.00 ? 29 LEU A H    8  
ATOM 9637  H HA   . LEU A 1 29 ? -9.429  -5.930  1.795   1.00 0.00 ? 29 LEU A HA   8  
ATOM 9638  H HB2  . LEU A 1 29 ? -11.125 -8.388  1.272   1.00 0.00 ? 29 LEU A HB2  8  
ATOM 9639  H HB3  . LEU A 1 29 ? -11.153 -6.876  0.361   1.00 0.00 ? 29 LEU A HB3  8  
ATOM 9640  H HG   . LEU A 1 29 ? -8.727  -8.687  0.624   1.00 0.00 ? 29 LEU A HG   8  
ATOM 9641  H HD11 . LEU A 1 29 ? -10.819 -8.380  -1.544  1.00 0.00 ? 29 LEU A HD11 8  
ATOM 9642  H HD12 . LEU A 1 29 ? -10.328 -9.855  -0.713  1.00 0.00 ? 29 LEU A HD12 8  
ATOM 9643  H HD13 . LEU A 1 29 ? -9.231  -9.080  -1.856  1.00 0.00 ? 29 LEU A HD13 8  
ATOM 9644  H HD21 . LEU A 1 29 ? -9.293  -6.087  -0.815  1.00 0.00 ? 29 LEU A HD21 8  
ATOM 9645  H HD22 . LEU A 1 29 ? -8.080  -7.202  -1.442  1.00 0.00 ? 29 LEU A HD22 8  
ATOM 9646  H HD23 . LEU A 1 29 ? -7.898  -6.523  0.172   1.00 0.00 ? 29 LEU A HD23 8  
ATOM 9647  N N    . ASP A 1 30 ? -11.331 -7.285  4.061   1.00 0.00 ? 30 ASP A N    8  
ATOM 9648  C CA   . ASP A 1 30 ? -12.378 -6.957  5.073   1.00 0.00 ? 30 ASP A CA   8  
ATOM 9649  C C    . ASP A 1 30 ? -11.855 -5.820  5.963   1.00 0.00 ? 30 ASP A C    8  
ATOM 9650  O O    . ASP A 1 30 ? -12.567 -4.885  6.273   1.00 0.00 ? 30 ASP A O    8  
ATOM 9651  C CB   . ASP A 1 30 ? -12.670 -8.189  5.931   1.00 0.00 ? 30 ASP A CB   8  
ATOM 9652  C CG   . ASP A 1 30 ? -13.815 -7.880  6.896   1.00 0.00 ? 30 ASP A CG   8  
ATOM 9653  O OD1  . ASP A 1 30 ? -14.720 -7.163  6.501   1.00 0.00 ? 30 ASP A OD1  8  
ATOM 9654  O OD2  . ASP A 1 30 ? -13.767 -8.364  8.015   1.00 0.00 ? 30 ASP A OD2  8  
ATOM 9655  H H    . ASP A 1 30 ? -10.848 -8.137  4.098   1.00 0.00 ? 30 ASP A H    8  
ATOM 9656  H HA   . ASP A 1 30 ? -13.282 -6.630  4.579   1.00 0.00 ? 30 ASP A HA   8  
ATOM 9657  H HB2  . ASP A 1 30 ? -12.950 -9.014  5.292   1.00 0.00 ? 30 ASP A HB2  8  
ATOM 9658  H HB3  . ASP A 1 30 ? -11.788 -8.453  6.495   1.00 0.00 ? 30 ASP A HB3  8  
ATOM 9659  N N    . ALA A 1 31 ? -10.627 -5.910  6.392   1.00 0.00 ? 31 ALA A N    8  
ATOM 9660  C CA   . ALA A 1 31 ? -10.056 -4.856  7.285   1.00 0.00 ? 31 ALA A CA   8  
ATOM 9661  C C    . ALA A 1 31 ? -9.872  -3.536  6.522   1.00 0.00 ? 31 ALA A C    8  
ATOM 9662  O O    . ALA A 1 31 ? -9.876  -2.473  7.112   1.00 0.00 ? 31 ALA A O    8  
ATOM 9663  C CB   . ALA A 1 31 ? -8.704  -5.337  7.816   1.00 0.00 ? 31 ALA A CB   8  
ATOM 9664  H H    . ALA A 1 31 ? -10.079 -6.682  6.142   1.00 0.00 ? 31 ALA A H    8  
ATOM 9665  H HA   . ALA A 1 31 ? -10.721 -4.694  8.121   1.00 0.00 ? 31 ALA A HA   8  
ATOM 9666  H HB1  . ALA A 1 31 ? -8.381  -4.687  8.616   1.00 0.00 ? 31 ALA A HB1  8  
ATOM 9667  H HB2  . ALA A 1 31 ? -7.976  -5.323  7.018   1.00 0.00 ? 31 ALA A HB2  8  
ATOM 9668  H HB3  . ALA A 1 31 ? -8.805  -6.344  8.192   1.00 0.00 ? 31 ALA A HB3  8  
ATOM 9669  N N    . PHE A 1 32 ? -9.726  -3.579  5.228   1.00 0.00 ? 32 PHE A N    8  
ATOM 9670  C CA   . PHE A 1 32 ? -9.562  -2.312  4.450   1.00 0.00 ? 32 PHE A CA   8  
ATOM 9671  C C    . PHE A 1 32 ? -10.673 -1.335  4.830   1.00 0.00 ? 32 PHE A C    8  
ATOM 9672  O O    . PHE A 1 32 ? -10.619 -0.166  4.504   1.00 0.00 ? 32 PHE A O    8  
ATOM 9673  C CB   . PHE A 1 32 ? -9.649  -2.658  2.953   1.00 0.00 ? 32 PHE A CB   8  
ATOM 9674  C CG   . PHE A 1 32 ? -8.300  -3.101  2.389   1.00 0.00 ? 32 PHE A CG   8  
ATOM 9675  C CD1  . PHE A 1 32 ? -7.230  -3.515  3.220   1.00 0.00 ? 32 PHE A CD1  8  
ATOM 9676  C CD2  . PHE A 1 32 ? -8.118  -3.074  0.999   1.00 0.00 ? 32 PHE A CD2  8  
ATOM 9677  C CE1  . PHE A 1 32 ? -6.008  -3.885  2.649   1.00 0.00 ? 32 PHE A CE1  8  
ATOM 9678  C CE2  . PHE A 1 32 ? -6.894  -3.455  0.439   1.00 0.00 ? 32 PHE A CE2  8  
ATOM 9679  C CZ   . PHE A 1 32 ? -5.840  -3.857  1.264   1.00 0.00 ? 32 PHE A CZ   8  
ATOM 9680  H H    . PHE A 1 32 ? -9.736  -4.433  4.750   1.00 0.00 ? 32 PHE A H    8  
ATOM 9681  H HA   . PHE A 1 32 ? -8.609  -1.858  4.661   1.00 0.00 ? 32 PHE A HA   8  
ATOM 9682  H HB2  . PHE A 1 32 ? -10.360 -3.453  2.820   1.00 0.00 ? 32 PHE A HB2  8  
ATOM 9683  H HB3  . PHE A 1 32 ? -9.990  -1.793  2.405   1.00 0.00 ? 32 PHE A HB3  8  
ATOM 9684  H HD1  . PHE A 1 32 ? -7.342  -3.563  4.288   1.00 0.00 ? 32 PHE A HD1  8  
ATOM 9685  H HD2  . PHE A 1 32 ? -8.930  -2.772  0.358   1.00 0.00 ? 32 PHE A HD2  8  
ATOM 9686  H HE1  . PHE A 1 32 ? -5.191  -4.191  3.283   1.00 0.00 ? 32 PHE A HE1  8  
ATOM 9687  H HE2  . PHE A 1 32 ? -6.761  -3.434  -0.633  1.00 0.00 ? 32 PHE A HE2  8  
ATOM 9688  H HZ   . PHE A 1 32 ? -4.896  -4.148  0.830   1.00 0.00 ? 32 PHE A HZ   8  
ATOM 9689  N N    . ASP A 1 33 ? -11.683 -1.796  5.509   1.00 0.00 ? 33 ASP A N    8  
ATOM 9690  C CA   . ASP A 1 33 ? -12.791 -0.882  5.894   1.00 0.00 ? 33 ASP A CA   8  
ATOM 9691  C C    . ASP A 1 33 ? -12.437 -0.166  7.202   1.00 0.00 ? 33 ASP A C    8  
ATOM 9692  O O    . ASP A 1 33 ? -12.917 0.920   7.464   1.00 0.00 ? 33 ASP A O    8  
ATOM 9693  C CB   . ASP A 1 33 ? -14.082 -1.691  6.068   1.00 0.00 ? 33 ASP A CB   8  
ATOM 9694  C CG   . ASP A 1 33 ? -14.662 -2.034  4.694   1.00 0.00 ? 33 ASP A CG   8  
ATOM 9695  O OD1  . ASP A 1 33 ? -14.917 -1.114  3.934   1.00 0.00 ? 33 ASP A OD1  8  
ATOM 9696  O OD2  . ASP A 1 33 ? -14.840 -3.211  4.424   1.00 0.00 ? 33 ASP A OD2  8  
ATOM 9697  H H    . ASP A 1 33 ? -11.715 -2.744  5.762   1.00 0.00 ? 33 ASP A H    8  
ATOM 9698  H HA   . ASP A 1 33 ? -12.937 -0.144  5.117   1.00 0.00 ? 33 ASP A HA   8  
ATOM 9699  H HB2  . ASP A 1 33 ? -13.865 -2.605  6.601   1.00 0.00 ? 33 ASP A HB2  8  
ATOM 9700  H HB3  . ASP A 1 33 ? -14.802 -1.110  6.624   1.00 0.00 ? 33 ASP A HB3  8  
ATOM 9701  N N    . LYS A 1 34 ? -11.592 -0.753  8.025   1.00 0.00 ? 34 LYS A N    8  
ATOM 9702  C CA   . LYS A 1 34 ? -11.196 -0.094  9.315   1.00 0.00 ? 34 LYS A CA   8  
ATOM 9703  C C    . LYS A 1 34 ? -9.715  0.299   9.273   1.00 0.00 ? 34 LYS A C    8  
ATOM 9704  O O    . LYS A 1 34 ? -9.169  0.786   10.242  1.00 0.00 ? 34 LYS A O    8  
ATOM 9705  C CB   . LYS A 1 34 ? -11.390 -1.071  10.481  1.00 0.00 ? 34 LYS A CB   8  
ATOM 9706  C CG   . LYS A 1 34 ? -12.846 -1.543  10.544  1.00 0.00 ? 34 LYS A CG   8  
ATOM 9707  C CD   . LYS A 1 34 ? -13.146 -2.103  11.938  1.00 0.00 ? 34 LYS A CD   8  
ATOM 9708  C CE   . LYS A 1 34 ? -12.239 -3.304  12.208  1.00 0.00 ? 34 LYS A CE   8  
ATOM 9709  N NZ   . LYS A 1 34 ? -12.733 -4.042  13.405  1.00 0.00 ? 34 LYS A NZ   8  
ATOM 9710  H H    . LYS A 1 34 ? -11.212 -1.629  7.803   1.00 0.00 ? 34 LYS A H    8  
ATOM 9711  H HA   . LYS A 1 34 ? -11.797 0.788   9.487   1.00 0.00 ? 34 LYS A HA   8  
ATOM 9712  H HB2  . LYS A 1 34 ? -10.744 -1.924  10.341  1.00 0.00 ? 34 LYS A HB2  8  
ATOM 9713  H HB3  . LYS A 1 34 ? -11.133 -0.575  11.405  1.00 0.00 ? 34 LYS A HB3  8  
ATOM 9714  H HG2  . LYS A 1 34 ? -13.506 -0.713  10.340  1.00 0.00 ? 34 LYS A HG2  8  
ATOM 9715  H HG3  . LYS A 1 34 ? -13.000 -2.318  9.811   1.00 0.00 ? 34 LYS A HG3  8  
ATOM 9716  H HD2  . LYS A 1 34 ? -12.964 -1.339  12.679  1.00 0.00 ? 34 LYS A HD2  8  
ATOM 9717  H HD3  . LYS A 1 34 ? -14.179 -2.415  11.986  1.00 0.00 ? 34 LYS A HD3  8  
ATOM 9718  H HE2  . LYS A 1 34 ? -12.246 -3.962  11.351  1.00 0.00 ? 34 LYS A HE2  8  
ATOM 9719  H HE3  . LYS A 1 34 ? -11.231 -2.960  12.388  1.00 0.00 ? 34 LYS A HE3  8  
ATOM 9720  H HZ1  . LYS A 1 34 ? -12.392 -3.572  14.268  1.00 0.00 ? 34 LYS A HZ1  8  
ATOM 9721  H HZ2  . LYS A 1 34 ? -12.381 -5.021  13.379  1.00 0.00 ? 34 LYS A HZ2  8  
ATOM 9722  H HZ3  . LYS A 1 34 ? -13.773 -4.047  13.405  1.00 0.00 ? 34 LYS A HZ3  8  
ATOM 9723  N N    . MET A 1 35 ? -9.050  0.086   8.163   1.00 0.00 ? 35 MET A N    8  
ATOM 9724  C CA   . MET A 1 35 ? -7.600  0.445   8.082   1.00 0.00 ? 35 MET A CA   8  
ATOM 9725  C C    . MET A 1 35 ? -7.462  1.944   7.794   1.00 0.00 ? 35 MET A C    8  
ATOM 9726  O O    . MET A 1 35 ? -6.661  2.615   8.412   1.00 0.00 ? 35 MET A O    8  
ATOM 9727  C CB   . MET A 1 35 ? -6.920  -0.396  6.975   1.00 0.00 ? 35 MET A CB   8  
ATOM 9728  C CG   . MET A 1 35 ? -5.700  -1.140  7.521   1.00 0.00 ? 35 MET A CG   8  
ATOM 9729  S SD   . MET A 1 35 ? -4.735  -1.808  6.138   1.00 0.00 ? 35 MET A SD   8  
ATOM 9730  C CE   . MET A 1 35 ? -5.146  -3.556  6.371   1.00 0.00 ? 35 MET A CE   8  
ATOM 9731  H H    . MET A 1 35 ? -9.500  -0.314  7.389   1.00 0.00 ? 35 MET A H    8  
ATOM 9732  H HA   . MET A 1 35 ? -7.137  0.235   9.039   1.00 0.00 ? 35 MET A HA   8  
ATOM 9733  H HB2  . MET A 1 35 ? -7.624  -1.115  6.618   1.00 0.00 ? 35 MET A HB2  8  
ATOM 9734  H HB3  . MET A 1 35 ? -6.607  0.235   6.154   1.00 0.00 ? 35 MET A HB3  8  
ATOM 9735  H HG2  . MET A 1 35 ? -5.090  -0.457  8.091   1.00 0.00 ? 35 MET A HG2  8  
ATOM 9736  H HG3  . MET A 1 35 ? -6.033  -1.945  8.158   1.00 0.00 ? 35 MET A HG3  8  
ATOM 9737  H HE1  . MET A 1 35 ? -6.220  -3.680  6.361   1.00 0.00 ? 35 MET A HE1  8  
ATOM 9738  H HE2  . MET A 1 35 ? -4.759  -3.890  7.318   1.00 0.00 ? 35 MET A HE2  8  
ATOM 9739  H HE3  . MET A 1 35 ? -4.702  -4.141  5.576   1.00 0.00 ? 35 MET A HE3  8  
ATOM 9740  N N    . CYS A 1 36 ? -8.217  2.504   6.881   1.00 0.00 ? 36 CYS A N    8  
ATOM 9741  C CA   . CYS A 1 36 ? -8.053  3.959   6.650   1.00 0.00 ? 36 CYS A CA   8  
ATOM 9742  C C    . CYS A 1 36 ? -8.478  4.658   7.940   1.00 0.00 ? 36 CYS A C    8  
ATOM 9743  O O    . CYS A 1 36 ? -8.431  5.867   8.050   1.00 0.00 ? 36 CYS A O    8  
ATOM 9744  C CB   . CYS A 1 36 ? -8.890  4.428   5.456   1.00 0.00 ? 36 CYS A CB   8  
ATOM 9745  S SG   . CYS A 1 36 ? -7.923  4.255   3.938   1.00 0.00 ? 36 CYS A SG   8  
ATOM 9746  H H    . CYS A 1 36 ? -8.874  1.985   6.371   1.00 0.00 ? 36 CYS A H    8  
ATOM 9747  H HA   . CYS A 1 36 ? -7.006  4.160   6.496   1.00 0.00 ? 36 CYS A HA   8  
ATOM 9748  H HB2  . CYS A 1 36 ? -9.783  3.824   5.385   1.00 0.00 ? 36 CYS A HB2  8  
ATOM 9749  H HB3  . CYS A 1 36 ? -9.166  5.465   5.588   1.00 0.00 ? 36 CYS A HB3  8  
ATOM 9750  N N    . SER A 1 37 ? -8.892  3.904   8.918   1.00 0.00 ? 37 SER A N    8  
ATOM 9751  C CA   . SER A 1 37 ? -9.323  4.531   10.206  1.00 0.00 ? 37 SER A CA   8  
ATOM 9752  C C    . SER A 1 37 ? -8.102  4.877   11.080  1.00 0.00 ? 37 SER A C    8  
ATOM 9753  O O    . SER A 1 37 ? -8.242  5.557   12.078  1.00 0.00 ? 37 SER A O    8  
ATOM 9754  C CB   . SER A 1 37 ? -10.225 3.558   10.965  1.00 0.00 ? 37 SER A CB   8  
ATOM 9755  O OG   . SER A 1 37 ? -11.155 2.978   10.061  1.00 0.00 ? 37 SER A OG   8  
ATOM 9756  H H    . SER A 1 37 ? -8.929  2.924   8.804   1.00 0.00 ? 37 SER A H    8  
ATOM 9757  H HA   . SER A 1 37 ? -9.875  5.435   9.996   1.00 0.00 ? 37 SER A HA   8  
ATOM 9758  H HB2  . SER A 1 37 ? -9.627  2.780   11.408  1.00 0.00 ? 37 SER A HB2  8  
ATOM 9759  H HB3  . SER A 1 37 ? -10.751 4.093   11.746  1.00 0.00 ? 37 SER A HB3  8  
ATOM 9760  H HG   . SER A 1 37 ? -11.511 3.679   9.511   1.00 0.00 ? 37 SER A HG   8  
ATOM 9761  N N    . LYS A 1 38 ? -6.913  4.417   10.749  1.00 0.00 ? 38 LYS A N    8  
ATOM 9762  C CA   . LYS A 1 38 ? -5.723  4.740   11.617  1.00 0.00 ? 38 LYS A CA   8  
ATOM 9763  C C    . LYS A 1 38 ? -4.988  6.000   11.105  1.00 0.00 ? 38 LYS A C    8  
ATOM 9764  O O    . LYS A 1 38 ? -3.987  6.403   11.665  1.00 0.00 ? 38 LYS A O    8  
ATOM 9765  C CB   . LYS A 1 38 ? -4.749  3.541   11.655  1.00 0.00 ? 38 LYS A CB   8  
ATOM 9766  C CG   . LYS A 1 38 ? -5.516  2.220   11.547  1.00 0.00 ? 38 LYS A CG   8  
ATOM 9767  C CD   . LYS A 1 38 ? -6.568  2.125   12.656  1.00 0.00 ? 38 LYS A CD   8  
ATOM 9768  C CE   . LYS A 1 38 ? -7.020  0.668   12.813  1.00 0.00 ? 38 LYS A CE   8  
ATOM 9769  N NZ   . LYS A 1 38 ? -5.995  -0.089  13.585  1.00 0.00 ? 38 LYS A NZ   8  
ATOM 9770  H H    . LYS A 1 38 ? -6.805  3.859   9.950   1.00 0.00 ? 38 LYS A H    8  
ATOM 9771  H HA   . LYS A 1 38 ? -6.065  4.934   12.626  1.00 0.00 ? 38 LYS A HA   8  
ATOM 9772  H HB2  . LYS A 1 38 ? -4.053  3.608   10.837  1.00 0.00 ? 38 LYS A HB2  8  
ATOM 9773  H HB3  . LYS A 1 38 ? -4.201  3.554   12.587  1.00 0.00 ? 38 LYS A HB3  8  
ATOM 9774  H HG2  . LYS A 1 38 ? -6.002  2.166   10.589  1.00 0.00 ? 38 LYS A HG2  8  
ATOM 9775  H HG3  . LYS A 1 38 ? -4.822  1.399   11.643  1.00 0.00 ? 38 LYS A HG3  8  
ATOM 9776  H HD2  . LYS A 1 38 ? -6.143  2.473   13.587  1.00 0.00 ? 38 LYS A HD2  8  
ATOM 9777  H HD3  . LYS A 1 38 ? -7.419  2.736   12.399  1.00 0.00 ? 38 LYS A HD3  8  
ATOM 9778  H HE2  . LYS A 1 38 ? -7.962  0.640   13.342  1.00 0.00 ? 38 LYS A HE2  8  
ATOM 9779  H HE3  . LYS A 1 38 ? -7.142  0.218   11.837  1.00 0.00 ? 38 LYS A HE3  8  
ATOM 9780  H HZ1  . LYS A 1 38 ? -5.194  -0.320  12.964  1.00 0.00 ? 38 LYS A HZ1  8  
ATOM 9781  H HZ2  . LYS A 1 38 ? -6.416  -0.967  13.951  1.00 0.00 ? 38 LYS A HZ2  8  
ATOM 9782  H HZ3  . LYS A 1 38 ? -5.659  0.491   14.378  1.00 0.00 ? 38 LYS A HZ3  8  
ATOM 9783  N N    . LEU A 1 39 ? -5.478  6.635   10.063  1.00 0.00 ? 39 LEU A N    8  
ATOM 9784  C CA   . LEU A 1 39 ? -4.813  7.881   9.532   1.00 0.00 ? 39 LEU A CA   8  
ATOM 9785  C C    . LEU A 1 39 ? -5.680  9.105   9.919   1.00 0.00 ? 39 LEU A C    8  
ATOM 9786  O O    . LEU A 1 39 ? -6.890  9.011   9.861   1.00 0.00 ? 39 LEU A O    8  
ATOM 9787  C CB   . LEU A 1 39 ? -4.723  7.788   8.004   1.00 0.00 ? 39 LEU A CB   8  
ATOM 9788  C CG   . LEU A 1 39 ? -3.956  6.517   7.598   1.00 0.00 ? 39 LEU A CG   8  
ATOM 9789  C CD1  . LEU A 1 39 ? -3.997  6.364   6.076   1.00 0.00 ? 39 LEU A CD1  8  
ATOM 9790  C CD2  . LEU A 1 39 ? -2.488  6.608   8.057   1.00 0.00 ? 39 LEU A CD2  8  
ATOM 9791  H H    . LEU A 1 39 ? -6.294  6.300   9.632   1.00 0.00 ? 39 LEU A H    8  
ATOM 9792  H HA   . LEU A 1 39 ? -3.824  7.975   9.939   1.00 0.00 ? 39 LEU A HA   8  
ATOM 9793  H HB2  . LEU A 1 39 ? -5.721  7.751   7.593   1.00 0.00 ? 39 LEU A HB2  8  
ATOM 9794  H HB3  . LEU A 1 39 ? -4.209  8.653   7.617   1.00 0.00 ? 39 LEU A HB3  8  
ATOM 9795  H HG   . LEU A 1 39 ? -4.426  5.660   8.051   1.00 0.00 ? 39 LEU A HG   8  
ATOM 9796  H HD11 . LEU A 1 39 ? -3.739  5.351   5.810   1.00 0.00 ? 39 LEU A HD11 8  
ATOM 9797  H HD12 . LEU A 1 39 ? -3.289  7.041   5.629   1.00 0.00 ? 39 LEU A HD12 8  
ATOM 9798  H HD13 . LEU A 1 39 ? -4.987  6.590   5.718   1.00 0.00 ? 39 LEU A HD13 8  
ATOM 9799  H HD21 . LEU A 1 39 ? -2.121  7.608   7.900   1.00 0.00 ? 39 LEU A HD21 8  
ATOM 9800  H HD22 . LEU A 1 39 ? -1.885  5.916   7.485   1.00 0.00 ? 39 LEU A HD22 8  
ATOM 9801  H HD23 . LEU A 1 39 ? -2.417  6.358   9.102   1.00 0.00 ? 39 LEU A HD23 8  
ATOM 9802  N N    . PRO A 1 40 ? -5.072  10.224  10.302  1.00 0.00 ? 40 PRO A N    8  
ATOM 9803  C CA   . PRO A 1 40 ? -5.851  11.424  10.679  1.00 0.00 ? 40 PRO A CA   8  
ATOM 9804  C C    . PRO A 1 40 ? -6.998  11.647  9.669   1.00 0.00 ? 40 PRO A C    8  
ATOM 9805  O O    . PRO A 1 40 ? -6.974  11.120  8.574   1.00 0.00 ? 40 PRO A O    8  
ATOM 9806  C CB   . PRO A 1 40 ? -4.810  12.572  10.690  1.00 0.00 ? 40 PRO A CB   8  
ATOM 9807  C CG   . PRO A 1 40 ? -3.400  11.914  10.629  1.00 0.00 ? 40 PRO A CG   8  
ATOM 9808  C CD   . PRO A 1 40 ? -3.602  10.403  10.390  1.00 0.00 ? 40 PRO A CD   8  
ATOM 9809  H HA   . PRO A 1 40 ? -6.261  11.292  11.670  1.00 0.00 ? 40 PRO A HA   8  
ATOM 9810  H HB2  . PRO A 1 40 ? -4.951  13.216  9.833   1.00 0.00 ? 40 PRO A HB2  8  
ATOM 9811  H HB3  . PRO A 1 40 ? -4.897  13.151  11.599  1.00 0.00 ? 40 PRO A HB3  8  
ATOM 9812  H HG2  . PRO A 1 40 ? -2.826  12.345  9.815   1.00 0.00 ? 40 PRO A HG2  8  
ATOM 9813  H HG3  . PRO A 1 40 ? -2.877  12.070  11.562  1.00 0.00 ? 40 PRO A HG3  8  
ATOM 9814  H HD2  . PRO A 1 40 ? -3.121  10.108  9.474   1.00 0.00 ? 40 PRO A HD2  8  
ATOM 9815  H HD3  . PRO A 1 40 ? -3.210  9.833   11.222  1.00 0.00 ? 40 PRO A HD3  8  
ATOM 9816  N N    . LYS A 1 41 ? -8.018  12.393  10.035  1.00 0.00 ? 41 LYS A N    8  
ATOM 9817  C CA   . LYS A 1 41 ? -9.165  12.603  9.098   1.00 0.00 ? 41 LYS A CA   8  
ATOM 9818  C C    . LYS A 1 41 ? -8.743  13.364  7.837   1.00 0.00 ? 41 LYS A C    8  
ATOM 9819  O O    . LYS A 1 41 ? -9.421  13.337  6.830   1.00 0.00 ? 41 LYS A O    8  
ATOM 9820  C CB   . LYS A 1 41 ? -10.305 13.346  9.800   1.00 0.00 ? 41 LYS A CB   8  
ATOM 9821  C CG   . LYS A 1 41 ? -11.613 13.115  9.029   1.00 0.00 ? 41 LYS A CG   8  
ATOM 9822  C CD   . LYS A 1 41 ? -12.719 14.018  9.591   1.00 0.00 ? 41 LYS A CD   8  
ATOM 9823  C CE   . LYS A 1 41 ? -12.955 13.703  11.072  1.00 0.00 ? 41 LYS A CE   8  
ATOM 9824  N NZ   . LYS A 1 41 ? -12.887 12.230  11.292  1.00 0.00 ? 41 LYS A NZ   8  
ATOM 9825  H H    . LYS A 1 41 ? -8.038  12.801  10.927  1.00 0.00 ? 41 LYS A H    8  
ATOM 9826  H HA   . LYS A 1 41 ? -9.524  11.645  8.747   1.00 0.00 ? 41 LYS A HA   8  
ATOM 9827  H HB2  . LYS A 1 41 ? -10.407 12.973  10.808  1.00 0.00 ? 41 LYS A HB2  8  
ATOM 9828  H HB3  . LYS A 1 41 ? -10.085 14.402  9.824   1.00 0.00 ? 41 LYS A HB3  8  
ATOM 9829  H HG2  . LYS A 1 41 ? -11.457 13.348  7.985   1.00 0.00 ? 41 LYS A HG2  8  
ATOM 9830  H HG3  . LYS A 1 41 ? -11.908 12.082  9.122   1.00 0.00 ? 41 LYS A HG3  8  
ATOM 9831  H HD2  . LYS A 1 41 ? -12.424 15.052  9.486   1.00 0.00 ? 41 LYS A HD2  8  
ATOM 9832  H HD3  . LYS A 1 41 ? -13.632 13.848  9.041   1.00 0.00 ? 41 LYS A HD3  8  
ATOM 9833  H HE2  . LYS A 1 41 ? -12.201 14.192  11.670  1.00 0.00 ? 41 LYS A HE2  8  
ATOM 9834  H HE3  . LYS A 1 41 ? -13.931 14.064  11.363  1.00 0.00 ? 41 LYS A HE3  8  
ATOM 9835  H HZ1  . LYS A 1 41 ? -13.540 11.962  12.054  1.00 0.00 ? 41 LYS A HZ1  8  
ATOM 9836  H HZ2  . LYS A 1 41 ? -11.916 11.965  11.557  1.00 0.00 ? 41 LYS A HZ2  8  
ATOM 9837  H HZ3  . LYS A 1 41 ? -13.155 11.735  10.418  1.00 0.00 ? 41 LYS A HZ3  8  
ATOM 9838  N N    . SER A 1 42 ? -7.683  14.121  7.913   1.00 0.00 ? 42 SER A N    8  
ATOM 9839  C CA   . SER A 1 42 ? -7.293  14.973  6.751   1.00 0.00 ? 42 SER A CA   8  
ATOM 9840  C C    . SER A 1 42 ? -6.668  14.184  5.606   1.00 0.00 ? 42 SER A C    8  
ATOM 9841  O O    . SER A 1 42 ? -6.379  14.697  4.545   1.00 0.00 ? 42 SER A O    8  
ATOM 9842  C CB   . SER A 1 42 ? -6.320  16.056  7.215   1.00 0.00 ? 42 SER A CB   8  
ATOM 9843  O OG   . SER A 1 42 ? -5.165  15.442  7.769   1.00 0.00 ? 42 SER A OG   8  
ATOM 9844  H H    . SER A 1 42 ? -7.170  14.174  8.746   1.00 0.00 ? 42 SER A H    8  
ATOM 9845  H HA   . SER A 1 42 ? -8.183  15.444  6.366   1.00 0.00 ? 42 SER A HA   8  
ATOM 9846  H HB2  . SER A 1 42 ? -6.030  16.666  6.376   1.00 0.00 ? 42 SER A HB2  8  
ATOM 9847  H HB3  . SER A 1 42 ? -6.803  16.677  7.959   1.00 0.00 ? 42 SER A HB3  8  
ATOM 9848  H HG   . SER A 1 42 ? -4.431  15.595  7.169   1.00 0.00 ? 42 SER A HG   8  
ATOM 9849  N N    . LEU A 1 43 ? -6.422  12.932  5.864   1.00 0.00 ? 43 LEU A N    8  
ATOM 9850  C CA   . LEU A 1 43 ? -5.766  12.026  4.880   1.00 0.00 ? 43 LEU A CA   8  
ATOM 9851  C C    . LEU A 1 43 ? -6.790  10.966  4.473   1.00 0.00 ? 43 LEU A C    8  
ATOM 9852  O O    . LEU A 1 43 ? -6.548  10.144  3.611   1.00 0.00 ? 43 LEU A O    8  
ATOM 9853  C CB   . LEU A 1 43 ? -4.576  11.373  5.633   1.00 0.00 ? 43 LEU A CB   8  
ATOM 9854  C CG   . LEU A 1 43 ? -3.238  11.746  5.001   1.00 0.00 ? 43 LEU A CG   8  
ATOM 9855  C CD1  . LEU A 1 43 ? -3.104  13.279  4.814   1.00 0.00 ? 43 LEU A CD1  8  
ATOM 9856  C CD2  . LEU A 1 43 ? -2.082  11.216  5.868   1.00 0.00 ? 43 LEU A CD2  8  
ATOM 9857  H H    . LEU A 1 43 ? -6.654  12.573  6.741   1.00 0.00 ? 43 LEU A H    8  
ATOM 9858  H HA   . LEU A 1 43 ? -5.435  12.587  4.021   1.00 0.00 ? 43 LEU A HA   8  
ATOM 9859  H HB2  . LEU A 1 43 ? -4.584  11.712  6.653   1.00 0.00 ? 43 LEU A HB2  8  
ATOM 9860  H HB3  . LEU A 1 43 ? -4.680  10.298  5.619   1.00 0.00 ? 43 LEU A HB3  8  
ATOM 9861  H HG   . LEU A 1 43 ? -3.205  11.269  4.057   1.00 0.00 ? 43 LEU A HG   8  
ATOM 9862  H HD11 . LEU A 1 43 ? -3.787  13.794  5.474   1.00 0.00 ? 43 LEU A HD11 8  
ATOM 9863  H HD12 . LEU A 1 43 ? -3.336  13.536  3.792   1.00 0.00 ? 43 LEU A HD12 8  
ATOM 9864  H HD13 . LEU A 1 43 ? -2.091  13.594  5.031   1.00 0.00 ? 43 LEU A HD13 8  
ATOM 9865  H HD21 . LEU A 1 43 ? -2.301  11.379  6.910   1.00 0.00 ? 43 LEU A HD21 8  
ATOM 9866  H HD22 . LEU A 1 43 ? -1.170  11.735  5.609   1.00 0.00 ? 43 LEU A HD22 8  
ATOM 9867  H HD23 . LEU A 1 43 ? -1.953  10.162  5.687   1.00 0.00 ? 43 LEU A HD23 8  
ATOM 9868  N N    . SER A 1 44 ? -7.915  10.988  5.106   1.00 0.00 ? 44 SER A N    8  
ATOM 9869  C CA   . SER A 1 44 ? -8.993  9.998   4.809   1.00 0.00 ? 44 SER A CA   8  
ATOM 9870  C C    . SER A 1 44 ? -9.083  9.712   3.307   1.00 0.00 ? 44 SER A C    8  
ATOM 9871  O O    . SER A 1 44 ? -8.958  8.597   2.843   1.00 0.00 ? 44 SER A O    8  
ATOM 9872  C CB   . SER A 1 44 ? -10.330 10.567  5.284   1.00 0.00 ? 44 SER A CB   8  
ATOM 9873  O OG   . SER A 1 44 ? -11.381 9.703   4.872   1.00 0.00 ? 44 SER A OG   8  
ATOM 9874  H H    . SER A 1 44 ? -8.049  11.659  5.800   1.00 0.00 ? 44 SER A H    8  
ATOM 9875  H HA   . SER A 1 44 ? -8.792  9.083   5.349   1.00 0.00 ? 44 SER A HA   8  
ATOM 9876  H HB2  . SER A 1 44 ? -10.333 10.639  6.359   1.00 0.00 ? 44 SER A HB2  8  
ATOM 9877  H HB3  . SER A 1 44 ? -10.472 11.552  4.860   1.00 0.00 ? 44 SER A HB3  8  
ATOM 9878  H HG   . SER A 1 44 ? -11.682 9.212   5.641   1.00 0.00 ? 44 SER A HG   8  
ATOM 9879  N N    . GLU A 1 45 ? -9.469  10.735  2.589   1.00 0.00 ? 45 GLU A N    8  
ATOM 9880  C CA   . GLU A 1 45 ? -9.795  10.660  1.133   1.00 0.00 ? 45 GLU A CA   8  
ATOM 9881  C C    . GLU A 1 45 ? -8.755  10.102  0.167   1.00 0.00 ? 45 GLU A C    8  
ATOM 9882  O O    . GLU A 1 45 ? -9.013  9.172   -0.572  1.00 0.00 ? 45 GLU A O    8  
ATOM 9883  C CB   . GLU A 1 45 ? -10.082 12.089  0.670   1.00 0.00 ? 45 GLU A CB   8  
ATOM 9884  C CG   . GLU A 1 45 ? -11.246 12.673  1.474   1.00 0.00 ? 45 GLU A CG   8  
ATOM 9885  C CD   . GLU A 1 45 ? -11.491 14.118  1.037   1.00 0.00 ? 45 GLU A CD   8  
ATOM 9886  O OE1  . GLU A 1 45 ? -11.870 14.314  -0.105  1.00 0.00 ? 45 GLU A OE1  8  
ATOM 9887  O OE2  . GLU A 1 45 ? -11.293 15.003  1.853   1.00 0.00 ? 45 GLU A OE2  8  
ATOM 9888  H H    . GLU A 1 45 ? -9.657  11.596  3.017   1.00 0.00 ? 45 GLU A H    8  
ATOM 9889  H HA   . GLU A 1 45 ? -10.704 10.097  1.014   1.00 0.00 ? 45 GLU A HA   8  
ATOM 9890  H HB2  . GLU A 1 45 ? -9.193  12.697  0.821   1.00 0.00 ? 45 GLU A HB2  8  
ATOM 9891  H HB3  . GLU A 1 45 ? -10.336 12.085  -0.380  1.00 0.00 ? 45 GLU A HB3  8  
ATOM 9892  H HG2  . GLU A 1 45 ? -12.136 12.086  1.295   1.00 0.00 ? 45 GLU A HG2  8  
ATOM 9893  H HG3  . GLU A 1 45 ? -11.008 12.653  2.525   1.00 0.00 ? 45 GLU A HG3  8  
ATOM 9894  N N    . GLU A 1 46 ? -7.587  10.660  0.165   1.00 0.00 ? 46 GLU A N    8  
ATOM 9895  C CA   . GLU A 1 46 ? -6.537  10.164  -0.752  1.00 0.00 ? 46 GLU A CA   8  
ATOM 9896  C C    . GLU A 1 46 ? -6.333  8.675   -0.519  1.00 0.00 ? 46 GLU A C    8  
ATOM 9897  O O    . GLU A 1 46 ? -5.858  7.967   -1.379  1.00 0.00 ? 46 GLU A O    8  
ATOM 9898  C CB   . GLU A 1 46 ? -5.238  10.916  -0.482  1.00 0.00 ? 46 GLU A CB   8  
ATOM 9899  C CG   . GLU A 1 46 ? -5.414  12.387  -0.870  1.00 0.00 ? 46 GLU A CG   8  
ATOM 9900  C CD   . GLU A 1 46 ? -6.278  13.090  0.177   1.00 0.00 ? 46 GLU A CD   8  
ATOM 9901  O OE1  . GLU A 1 46 ? -6.086  12.822  1.352   1.00 0.00 ? 46 GLU A OE1  8  
ATOM 9902  O OE2  . GLU A 1 46 ? -7.119  13.885  -0.212  1.00 0.00 ? 46 GLU A OE2  8  
ATOM 9903  H H    . GLU A 1 46 ? -7.398  11.414  0.762   1.00 0.00 ? 46 GLU A H    8  
ATOM 9904  H HA   . GLU A 1 46 ? -6.834  10.308  -1.777  1.00 0.00 ? 46 GLU A HA   8  
ATOM 9905  H HB2  . GLU A 1 46 ? -4.996  10.844  0.567   1.00 0.00 ? 46 GLU A HB2  8  
ATOM 9906  H HB3  . GLU A 1 46 ? -4.443  10.483  -1.066  1.00 0.00 ? 46 GLU A HB3  8  
ATOM 9907  H HG2  . GLU A 1 46 ? -4.448  12.864  -0.919  1.00 0.00 ? 46 GLU A HG2  8  
ATOM 9908  H HG3  . GLU A 1 46 ? -5.896  12.452  -1.833  1.00 0.00 ? 46 GLU A HG3  8  
ATOM 9909  N N    . CYS A 1 47 ? -6.703  8.186   0.624   1.00 0.00 ? 47 CYS A N    8  
ATOM 9910  C CA   . CYS A 1 47 ? -6.542  6.733   0.884   1.00 0.00 ? 47 CYS A CA   8  
ATOM 9911  C C    . CYS A 1 47 ? -7.689  5.989   0.200   1.00 0.00 ? 47 CYS A C    8  
ATOM 9912  O O    . CYS A 1 47 ? -7.495  4.965   -0.424  1.00 0.00 ? 47 CYS A O    8  
ATOM 9913  C CB   . CYS A 1 47 ? -6.559  6.491   2.408   1.00 0.00 ? 47 CYS A CB   8  
ATOM 9914  S SG   . CYS A 1 47 ? -8.214  6.009   2.983   1.00 0.00 ? 47 CYS A SG   8  
ATOM 9915  H H    . CYS A 1 47 ? -7.102  8.769   1.302   1.00 0.00 ? 47 CYS A H    8  
ATOM 9916  H HA   . CYS A 1 47 ? -5.606  6.395   0.462   1.00 0.00 ? 47 CYS A HA   8  
ATOM 9917  H HB2  . CYS A 1 47 ? -5.859  5.707   2.653   1.00 0.00 ? 47 CYS A HB2  8  
ATOM 9918  H HB3  . CYS A 1 47 ? -6.267  7.405   2.911   1.00 0.00 ? 47 CYS A HB3  8  
ATOM 9919  N N    . GLN A 1 48 ? -8.880  6.496   0.312   1.00 0.00 ? 48 GLN A N    8  
ATOM 9920  C CA   . GLN A 1 48 ? -10.031 5.812   -0.330  1.00 0.00 ? 48 GLN A CA   8  
ATOM 9921  C C    . GLN A 1 48 ? -9.718  5.576   -1.804  1.00 0.00 ? 48 GLN A C    8  
ATOM 9922  O O    . GLN A 1 48 ? -10.016 4.535   -2.356  1.00 0.00 ? 48 GLN A O    8  
ATOM 9923  C CB   . GLN A 1 48 ? -11.281 6.684   -0.213  1.00 0.00 ? 48 GLN A CB   8  
ATOM 9924  C CG   . GLN A 1 48 ? -11.777 6.674   1.232   1.00 0.00 ? 48 GLN A CG   8  
ATOM 9925  C CD   . GLN A 1 48 ? -12.990 7.598   1.363   1.00 0.00 ? 48 GLN A CD   8  
ATOM 9926  O OE1  . GLN A 1 48 ? -13.200 8.466   0.538   1.00 0.00 ? 48 GLN A OE1  8  
ATOM 9927  N NE2  . GLN A 1 48 ? -13.803 7.447   2.372   1.00 0.00 ? 48 GLN A NE2  8  
ATOM 9928  H H    . GLN A 1 48 ? -9.014  7.318   0.831   1.00 0.00 ? 48 GLN A H    8  
ATOM 9929  H HA   . GLN A 1 48 ? -10.201 4.861   0.155   1.00 0.00 ? 48 GLN A HA   8  
ATOM 9930  H HB2  . GLN A 1 48 ? -11.042 7.698   -0.504  1.00 0.00 ? 48 GLN A HB2  8  
ATOM 9931  H HB3  . GLN A 1 48 ? -12.054 6.297   -0.860  1.00 0.00 ? 48 GLN A HB3  8  
ATOM 9932  H HG2  . GLN A 1 48 ? -12.058 5.668   1.506   1.00 0.00 ? 48 GLN A HG2  8  
ATOM 9933  H HG3  . GLN A 1 48 ? -10.991 7.020   1.884   1.00 0.00 ? 48 GLN A HG3  8  
ATOM 9934  H HE21 . GLN A 1 48 ? -13.634 6.748   3.037   1.00 0.00 ? 48 GLN A HE21 8  
ATOM 9935  H HE22 . GLN A 1 48 ? -14.582 8.035   2.466   1.00 0.00 ? 48 GLN A HE22 8  
ATOM 9936  N N    . GLU A 1 49 ? -9.134  6.545   -2.454  1.00 0.00 ? 49 GLU A N    8  
ATOM 9937  C CA   . GLU A 1 49 ? -8.819  6.390   -3.897  1.00 0.00 ? 49 GLU A CA   8  
ATOM 9938  C C    . GLU A 1 49 ? -7.719  5.343   -4.101  1.00 0.00 ? 49 GLU A C    8  
ATOM 9939  O O    . GLU A 1 49 ? -7.778  4.543   -5.014  1.00 0.00 ? 49 GLU A O    8  
ATOM 9940  C CB   . GLU A 1 49 ? -8.357  7.736   -4.462  1.00 0.00 ? 49 GLU A CB   8  
ATOM 9941  C CG   . GLU A 1 49 ? -7.919  7.561   -5.917  1.00 0.00 ? 49 GLU A CG   8  
ATOM 9942  C CD   . GLU A 1 49 ? -7.755  8.934   -6.570  1.00 0.00 ? 49 GLU A CD   8  
ATOM 9943  O OE1  . GLU A 1 49 ? -7.142  9.791   -5.955  1.00 0.00 ? 49 GLU A OE1  8  
ATOM 9944  O OE2  . GLU A 1 49 ? -8.246  9.105   -7.674  1.00 0.00 ? 49 GLU A OE2  8  
ATOM 9945  H H    . GLU A 1 49 ? -8.914  7.386   -2.002  1.00 0.00 ? 49 GLU A H    8  
ATOM 9946  H HA   . GLU A 1 49 ? -9.711  6.075   -4.419  1.00 0.00 ? 49 GLU A HA   8  
ATOM 9947  H HB2  . GLU A 1 49 ? -9.174  8.443   -4.414  1.00 0.00 ? 49 GLU A HB2  8  
ATOM 9948  H HB3  . GLU A 1 49 ? -7.528  8.106   -3.879  1.00 0.00 ? 49 GLU A HB3  8  
ATOM 9949  H HG2  . GLU A 1 49 ? -6.976  7.033   -5.948  1.00 0.00 ? 49 GLU A HG2  8  
ATOM 9950  H HG3  . GLU A 1 49 ? -8.666  6.996   -6.453  1.00 0.00 ? 49 GLU A HG3  8  
ATOM 9951  N N    . VAL A 1 50 ? -6.718  5.332   -3.257  1.00 0.00 ? 50 VAL A N    8  
ATOM 9952  C CA   . VAL A 1 50 ? -5.634  4.324   -3.418  1.00 0.00 ? 50 VAL A CA   8  
ATOM 9953  C C    . VAL A 1 50 ? -6.185  2.942   -3.089  1.00 0.00 ? 50 VAL A C    8  
ATOM 9954  O O    . VAL A 1 50 ? -6.024  2.002   -3.841  1.00 0.00 ? 50 VAL A O    8  
ATOM 9955  C CB   . VAL A 1 50 ? -4.458  4.617   -2.475  1.00 0.00 ? 50 VAL A CB   8  
ATOM 9956  C CG1  . VAL A 1 50 ? -3.324  3.624   -2.754  1.00 0.00 ? 50 VAL A CG1  8  
ATOM 9957  C CG2  . VAL A 1 50 ? -3.947  6.053   -2.695  1.00 0.00 ? 50 VAL A CG2  8  
ATOM 9958  H H    . VAL A 1 50 ? -6.685  5.977   -2.523  1.00 0.00 ? 50 VAL A H    8  
ATOM 9959  H HA   . VAL A 1 50 ? -5.285  4.352   -4.432  1.00 0.00 ? 50 VAL A HA   8  
ATOM 9960  H HB   . VAL A 1 50 ? -4.778  4.491   -1.454  1.00 0.00 ? 50 VAL A HB   8  
ATOM 9961  H HG11 . VAL A 1 50 ? -3.660  2.621   -2.534  1.00 0.00 ? 50 VAL A HG11 8  
ATOM 9962  H HG12 . VAL A 1 50 ? -2.476  3.863   -2.130  1.00 0.00 ? 50 VAL A HG12 8  
ATOM 9963  H HG13 . VAL A 1 50 ? -3.036  3.688   -3.792  1.00 0.00 ? 50 VAL A HG13 8  
ATOM 9964  H HG21 . VAL A 1 50 ? -4.768  6.698   -2.956  1.00 0.00 ? 50 VAL A HG21 8  
ATOM 9965  H HG22 . VAL A 1 50 ? -3.221  6.065   -3.496  1.00 0.00 ? 50 VAL A HG22 8  
ATOM 9966  H HG23 . VAL A 1 50 ? -3.484  6.412   -1.787  1.00 0.00 ? 50 VAL A HG23 8  
ATOM 9967  N N    . VAL A 1 51 ? -6.802  2.797   -1.944  1.00 0.00 ? 51 VAL A N    8  
ATOM 9968  C CA   . VAL A 1 51 ? -7.319  1.462   -1.549  1.00 0.00 ? 51 VAL A CA   8  
ATOM 9969  C C    . VAL A 1 51 ? -8.349  0.970   -2.575  1.00 0.00 ? 51 VAL A C    8  
ATOM 9970  O O    . VAL A 1 51 ? -8.272  -0.134  -3.076  1.00 0.00 ? 51 VAL A O    8  
ATOM 9971  C CB   . VAL A 1 51 ? -7.897  1.534   -0.129  1.00 0.00 ? 51 VAL A CB   8  
ATOM 9972  C CG1  . VAL A 1 51 ? -8.302  0.144   0.343   1.00 0.00 ? 51 VAL A CG1  8  
ATOM 9973  C CG2  . VAL A 1 51 ? -6.846  2.103   0.831   1.00 0.00 ? 51 VAL A CG2  8  
ATOM 9974  H H    . VAL A 1 51 ? -6.895  3.549   -1.322  1.00 0.00 ? 51 VAL A H    8  
ATOM 9975  H HA   . VAL A 1 51 ? -6.494  0.775   -1.598  1.00 0.00 ? 51 VAL A HA   8  
ATOM 9976  H HB   . VAL A 1 51 ? -8.761  2.178   -0.128  1.00 0.00 ? 51 VAL A HB   8  
ATOM 9977  H HG11 . VAL A 1 51 ? -7.467  -0.529  0.229   1.00 0.00 ? 51 VAL A HG11 8  
ATOM 9978  H HG12 . VAL A 1 51 ? -9.136  -0.205  -0.247  1.00 0.00 ? 51 VAL A HG12 8  
ATOM 9979  H HG13 . VAL A 1 51 ? -8.589  0.192   1.382   1.00 0.00 ? 51 VAL A HG13 8  
ATOM 9980  H HG21 . VAL A 1 51 ? -6.437  3.015   0.421   1.00 0.00 ? 51 VAL A HG21 8  
ATOM 9981  H HG22 . VAL A 1 51 ? -6.055  1.381   0.965   1.00 0.00 ? 51 VAL A HG22 8  
ATOM 9982  H HG23 . VAL A 1 51 ? -7.306  2.314   1.788   1.00 0.00 ? 51 VAL A HG23 8  
ATOM 9983  N N    . ASP A 1 52 ? -9.350  1.770   -2.832  1.00 0.00 ? 52 ASP A N    8  
ATOM 9984  C CA   . ASP A 1 52 ? -10.446 1.360   -3.759  1.00 0.00 ? 52 ASP A CA   8  
ATOM 9985  C C    . ASP A 1 52 ? -9.945  1.123   -5.184  1.00 0.00 ? 52 ASP A C    8  
ATOM 9986  O O    . ASP A 1 52 ? -10.360 0.194   -5.849  1.00 0.00 ? 52 ASP A O    8  
ATOM 9987  C CB   . ASP A 1 52 ? -11.509 2.464   -3.782  1.00 0.00 ? 52 ASP A CB   8  
ATOM 9988  C CG   . ASP A 1 52 ? -12.005 2.725   -2.358  1.00 0.00 ? 52 ASP A CG   8  
ATOM 9989  O OD1  . ASP A 1 52 ? -12.019 1.788   -1.576  1.00 0.00 ? 52 ASP A OD1  8  
ATOM 9990  O OD2  . ASP A 1 52 ? -12.361 3.856   -2.074  1.00 0.00 ? 52 ASP A OD2  8  
ATOM 9991  H H    . ASP A 1 52 ? -9.403  2.640   -2.383  1.00 0.00 ? 52 ASP A H    8  
ATOM 9992  H HA   . ASP A 1 52 ? -10.905 0.460   -3.381  1.00 0.00 ? 52 ASP A HA   8  
ATOM 9993  H HB2  . ASP A 1 52 ? -11.085 3.371   -4.186  1.00 0.00 ? 52 ASP A HB2  8  
ATOM 9994  H HB3  . ASP A 1 52 ? -12.340 2.150   -4.397  1.00 0.00 ? 52 ASP A HB3  8  
ATOM 9995  N N    . THR A 1 53 ? -9.080  1.966   -5.671  1.00 0.00 ? 53 THR A N    8  
ATOM 9996  C CA   . THR A 1 53 ? -8.579  1.803   -7.065  1.00 0.00 ? 53 THR A CA   8  
ATOM 9997  C C    . THR A 1 53 ? -7.375  0.869   -7.106  1.00 0.00 ? 53 THR A C    8  
ATOM 9998  O O    . THR A 1 53 ? -7.241  0.083   -8.023  1.00 0.00 ? 53 THR A O    8  
ATOM 9999  C CB   . THR A 1 53 ? -8.177  3.174   -7.615  1.00 0.00 ? 53 THR A CB   8  
ATOM 10000 O OG1  . THR A 1 53 ? -9.249  4.089   -7.426  1.00 0.00 ? 53 THR A OG1  8  
ATOM 10001 C CG2  . THR A 1 53 ? -7.860  3.059   -9.106  1.00 0.00 ? 53 THR A CG2  8  
ATOM 10002 H H    . THR A 1 53 ? -8.768  2.721   -5.131  1.00 0.00 ? 53 THR A H    8  
ATOM 10003 H HA   . THR A 1 53 ? -9.348  1.389   -7.693  1.00 0.00 ? 53 THR A HA   8  
ATOM 10004 H HB   . THR A 1 53 ? -7.305  3.531   -7.093  1.00 0.00 ? 53 THR A HB   8  
ATOM 10005 H HG1  . THR A 1 53 ? -9.941  3.869   -8.055  1.00 0.00 ? 53 THR A HG1  8  
ATOM 10006 H HG21 . THR A 1 53 ? -8.748  2.755   -9.640  1.00 0.00 ? 53 THR A HG21 8  
ATOM 10007 H HG22 . THR A 1 53 ? -7.083  2.323   -9.254  1.00 0.00 ? 53 THR A HG22 8  
ATOM 10008 H HG23 . THR A 1 53 ? -7.525  4.015   -9.479  1.00 0.00 ? 53 THR A HG23 8  
ATOM 10009 N N    . TYR A 1 54 ? -6.481  0.956   -6.152  1.00 0.00 ? 54 TYR A N    8  
ATOM 10010 C CA   . TYR A 1 54 ? -5.266  0.080   -6.182  1.00 0.00 ? 54 TYR A CA   8  
ATOM 10011 C C    . TYR A 1 54 ? -5.284  -0.978  -5.073  1.00 0.00 ? 54 TYR A C    8  
ATOM 10012 O O    . TYR A 1 54 ? -4.261  -1.358  -4.544  1.00 0.00 ? 54 TYR A O    8  
ATOM 10013 C CB   . TYR A 1 54 ? -4.024  0.947   -6.036  1.00 0.00 ? 54 TYR A CB   8  
ATOM 10014 C CG   . TYR A 1 54 ? -3.877  1.826   -7.256  1.00 0.00 ? 54 TYR A CG   8  
ATOM 10015 C CD1  . TYR A 1 54 ? -4.494  3.076   -7.284  1.00 0.00 ? 54 TYR A CD1  8  
ATOM 10016 C CD2  . TYR A 1 54 ? -3.121  1.395   -8.352  1.00 0.00 ? 54 TYR A CD2  8  
ATOM 10017 C CE1  . TYR A 1 54 ? -4.365  3.902   -8.401  1.00 0.00 ? 54 TYR A CE1  8  
ATOM 10018 C CE2  . TYR A 1 54 ? -2.987  2.222   -9.476  1.00 0.00 ? 54 TYR A CE2  8  
ATOM 10019 C CZ   . TYR A 1 54 ? -3.609  3.477   -9.500  1.00 0.00 ? 54 TYR A CZ   8  
ATOM 10020 O OH   . TYR A 1 54 ? -3.477  4.292   -10.606 1.00 0.00 ? 54 TYR A OH   8  
ATOM 10021 H H    . TYR A 1 54 ? -6.594  1.613   -5.433  1.00 0.00 ? 54 TYR A H    8  
ATOM 10022 H HA   . TYR A 1 54 ? -5.209  -0.440  -7.128  1.00 0.00 ? 54 TYR A HA   8  
ATOM 10023 H HB2  . TYR A 1 54 ? -4.125  1.563   -5.161  1.00 0.00 ? 54 TYR A HB2  8  
ATOM 10024 H HB3  . TYR A 1 54 ? -3.154  0.317   -5.939  1.00 0.00 ? 54 TYR A HB3  8  
ATOM 10025 H HD1  . TYR A 1 54 ? -5.076  3.402   -6.445  1.00 0.00 ? 54 TYR A HD1  8  
ATOM 10026 H HD2  . TYR A 1 54 ? -2.644  0.427   -8.334  1.00 0.00 ? 54 TYR A HD2  8  
ATOM 10027 H HE1  . TYR A 1 54 ? -4.846  4.871   -8.411  1.00 0.00 ? 54 TYR A HE1  8  
ATOM 10028 H HE2  . TYR A 1 54 ? -2.405  1.891   -10.323 1.00 0.00 ? 54 TYR A HE2  8  
ATOM 10029 H HH   . TYR A 1 54 ? -2.545  4.494   -10.716 1.00 0.00 ? 54 TYR A HH   8  
ATOM 10030 N N    . GLY A 1 55 ? -6.450  -1.420  -4.686  1.00 0.00 ? 55 GLY A N    8  
ATOM 10031 C CA   . GLY A 1 55 ? -6.551  -2.412  -3.577  1.00 0.00 ? 55 GLY A CA   8  
ATOM 10032 C C    . GLY A 1 55 ? -6.266  -3.834  -4.061  1.00 0.00 ? 55 GLY A C    8  
ATOM 10033 O O    . GLY A 1 55 ? -5.435  -4.523  -3.503  1.00 0.00 ? 55 GLY A O    8  
ATOM 10034 H H    . GLY A 1 55 ? -7.262  -1.091  -5.117  1.00 0.00 ? 55 GLY A H    8  
ATOM 10035 H HA2  . GLY A 1 55 ? -5.836  -2.153  -2.810  1.00 0.00 ? 55 GLY A HA2  8  
ATOM 10036 H HA3  . GLY A 1 55 ? -7.545  -2.375  -3.158  1.00 0.00 ? 55 GLY A HA3  8  
ATOM 10037 N N    . SER A 1 56 ? -6.954  -4.304  -5.066  1.00 0.00 ? 56 SER A N    8  
ATOM 10038 C CA   . SER A 1 56 ? -6.704  -5.697  -5.517  1.00 0.00 ? 56 SER A CA   8  
ATOM 10039 C C    . SER A 1 56 ? -5.315  -5.807  -6.128  1.00 0.00 ? 56 SER A C    8  
ATOM 10040 O O    . SER A 1 56 ? -4.711  -6.861  -6.147  1.00 0.00 ? 56 SER A O    8  
ATOM 10041 C CB   . SER A 1 56 ? -7.738  -6.119  -6.559  1.00 0.00 ? 56 SER A CB   8  
ATOM 10042 O OG   . SER A 1 56 ? -9.003  -5.568  -6.220  1.00 0.00 ? 56 SER A OG   8  
ATOM 10043 H H    . SER A 1 56 ? -7.638  -3.756  -5.506  1.00 0.00 ? 56 SER A H    8  
ATOM 10044 H HA   . SER A 1 56 ? -6.775  -6.348  -4.660  1.00 0.00 ? 56 SER A HA   8  
ATOM 10045 H HB2  . SER A 1 56 ? -7.440  -5.761  -7.535  1.00 0.00 ? 56 SER A HB2  8  
ATOM 10046 H HB3  . SER A 1 56 ? -7.795  -7.201  -6.578  1.00 0.00 ? 56 SER A HB3  8  
ATOM 10047 H HG   . SER A 1 56 ? -9.604  -6.294  -6.037  1.00 0.00 ? 56 SER A HG   8  
ATOM 10048 N N    . SER A 1 57 ? -4.833  -4.734  -6.697  1.00 0.00 ? 57 SER A N    8  
ATOM 10049 C CA   . SER A 1 57 ? -3.518  -4.804  -7.384  1.00 0.00 ? 57 SER A CA   8  
ATOM 10050 C C    . SER A 1 57 ? -2.367  -4.830  -6.380  1.00 0.00 ? 57 SER A C    8  
ATOM 10051 O O    . SER A 1 57 ? -1.491  -5.663  -6.462  1.00 0.00 ? 57 SER A O    8  
ATOM 10052 C CB   . SER A 1 57 ? -3.357  -3.640  -8.359  1.00 0.00 ? 57 SER A CB   8  
ATOM 10053 O OG   . SER A 1 57 ? -3.387  -2.416  -7.637  1.00 0.00 ? 57 SER A OG   8  
ATOM 10054 H H    . SER A 1 57 ? -5.356  -3.905  -6.693  1.00 0.00 ? 57 SER A H    8  
ATOM 10055 H HA   . SER A 1 57 ? -3.492  -5.743  -7.918  1.00 0.00 ? 57 SER A HA   8  
ATOM 10056 H HB2  . SER A 1 57 ? -2.414  -3.725  -8.873  1.00 0.00 ? 57 SER A HB2  8  
ATOM 10057 H HB3  . SER A 1 57 ? -4.162  -3.663  -9.082  1.00 0.00 ? 57 SER A HB3  8  
ATOM 10058 H HG   . SER A 1 57 ? -3.457  -2.625  -6.702  1.00 0.00 ? 57 SER A HG   8  
ATOM 10059 N N    . ILE A 1 58 ? -2.385  -3.964  -5.400  1.00 0.00 ? 58 ILE A N    8  
ATOM 10060 C CA   . ILE A 1 58 ? -1.307  -3.987  -4.373  1.00 0.00 ? 58 ILE A CA   8  
ATOM 10061 C C    . ILE A 1 58 ? -1.284  -5.370  -3.740  1.00 0.00 ? 58 ILE A C    8  
ATOM 10062 O O    . ILE A 1 58 ? -0.284  -6.059  -3.700  1.00 0.00 ? 58 ILE A O    8  
ATOM 10063 C CB   . ILE A 1 58 ? -1.608  -2.951  -3.275  1.00 0.00 ? 58 ILE A CB   8  
ATOM 10064 C CG1  . ILE A 1 58 ? -1.400  -1.536  -3.830  1.00 0.00 ? 58 ILE A CG1  8  
ATOM 10065 C CG2  . ILE A 1 58 ? -0.666  -3.180  -2.076  1.00 0.00 ? 58 ILE A CG2  8  
ATOM 10066 C CD1  . ILE A 1 58 ? -1.894  -0.500  -2.811  1.00 0.00 ? 58 ILE A CD1  8  
ATOM 10067 H H    . ILE A 1 58 ? -3.126  -3.328  -5.307  1.00 0.00 ? 58 ILE A H    8  
ATOM 10068 H HA   . ILE A 1 58 ? -0.344  -3.776  -4.811  1.00 0.00 ? 58 ILE A HA   8  
ATOM 10069 H HB   . ILE A 1 58 ? -2.633  -3.067  -2.950  1.00 0.00 ? 58 ILE A HB   8  
ATOM 10070 H HG12 . ILE A 1 58 ? -0.349  -1.378  -4.019  1.00 0.00 ? 58 ILE A HG12 8  
ATOM 10071 H HG13 . ILE A 1 58 ? -1.949  -1.424  -4.751  1.00 0.00 ? 58 ILE A HG13 8  
ATOM 10072 H HG21 . ILE A 1 58 ? -1.001  -4.041  -1.514  1.00 0.00 ? 58 ILE A HG21 8  
ATOM 10073 H HG22 . ILE A 1 58 ? -0.667  -2.313  -1.433  1.00 0.00 ? 58 ILE A HG22 8  
ATOM 10074 H HG23 . ILE A 1 58 ? 0.335   -3.358  -2.437  1.00 0.00 ? 58 ILE A HG23 8  
ATOM 10075 H HD11 . ILE A 1 58 ? -1.156  -0.395  -2.030  1.00 0.00 ? 58 ILE A HD11 8  
ATOM 10076 H HD12 . ILE A 1 58 ? -2.829  -0.826  -2.379  1.00 0.00 ? 58 ILE A HD12 8  
ATOM 10077 H HD13 . ILE A 1 58 ? -2.043  0.453   -3.299  1.00 0.00 ? 58 ILE A HD13 8  
ATOM 10078 N N    . LEU A 1 59 ? -2.418  -5.747  -3.232  1.00 0.00 ? 59 LEU A N    8  
ATOM 10079 C CA   . LEU A 1 59 ? -2.572  -7.055  -2.563  1.00 0.00 ? 59 LEU A CA   8  
ATOM 10080 C C    . LEU A 1 59 ? -2.220  -8.169  -3.543  1.00 0.00 ? 59 LEU A C    8  
ATOM 10081 O O    . LEU A 1 59 ? -1.850  -9.248  -3.137  1.00 0.00 ? 59 LEU A O    8  
ATOM 10082 C CB   . LEU A 1 59 ? -4.028  -7.181  -2.096  1.00 0.00 ? 59 LEU A CB   8  
ATOM 10083 C CG   . LEU A 1 59 ? -4.306  -8.580  -1.529  1.00 0.00 ? 59 LEU A CG   8  
ATOM 10084 C CD1  . LEU A 1 59 ? -3.283  -8.913  -0.431  1.00 0.00 ? 59 LEU A CD1  8  
ATOM 10085 C CD2  . LEU A 1 59 ? -5.731  -8.626  -0.938  1.00 0.00 ? 59 LEU A CD2  8  
ATOM 10086 H H    . LEU A 1 59 ? -3.187  -5.144  -3.302  1.00 0.00 ? 59 LEU A H    8  
ATOM 10087 H HA   . LEU A 1 59 ? -1.911  -7.103  -1.712  1.00 0.00 ? 59 LEU A HA   8  
ATOM 10088 H HB2  . LEU A 1 59 ? -4.215  -6.442  -1.332  1.00 0.00 ? 59 LEU A HB2  8  
ATOM 10089 H HB3  . LEU A 1 59 ? -4.687  -7.000  -2.934  1.00 0.00 ? 59 LEU A HB3  8  
ATOM 10090 H HG   . LEU A 1 59 ? -4.231  -9.304  -2.331  1.00 0.00 ? 59 LEU A HG   8  
ATOM 10091 H HD11 . LEU A 1 59 ? -2.360  -9.236  -0.881  1.00 0.00 ? 59 LEU A HD11 8  
ATOM 10092 H HD12 . LEU A 1 59 ? -3.669  -9.705  0.195   1.00 0.00 ? 59 LEU A HD12 8  
ATOM 10093 H HD13 . LEU A 1 59 ? -3.103  -8.036  0.174   1.00 0.00 ? 59 LEU A HD13 8  
ATOM 10094 H HD21 . LEU A 1 59 ? -5.787  -9.397  -0.183  1.00 0.00 ? 59 LEU A HD21 8  
ATOM 10095 H HD22 . LEU A 1 59 ? -6.438  -8.847  -1.722  1.00 0.00 ? 59 LEU A HD22 8  
ATOM 10096 H HD23 . LEU A 1 59 ? -5.976  -7.674  -0.490  1.00 0.00 ? 59 LEU A HD23 8  
ATOM 10097 N N    . SER A 1 60 ? -2.341  -7.958  -4.830  1.00 0.00 ? 60 SER A N    8  
ATOM 10098 C CA   . SER A 1 60 ? -2.014  -9.078  -5.763  1.00 0.00 ? 60 SER A CA   8  
ATOM 10099 C C    . SER A 1 60 ? -0.497  -9.142  -5.977  1.00 0.00 ? 60 SER A C    8  
ATOM 10100 O O    . SER A 1 60 ? 0.085   -10.198 -6.127  1.00 0.00 ? 60 SER A O    8  
ATOM 10101 C CB   . SER A 1 60 ? -2.718  -8.847  -7.096  1.00 0.00 ? 60 SER A CB   8  
ATOM 10102 O OG   . SER A 1 60 ? -2.216  -9.763  -8.061  1.00 0.00 ? 60 SER A OG   8  
ATOM 10103 H H    . SER A 1 60 ? -2.653  -7.094  -5.171  1.00 0.00 ? 60 SER A H    8  
ATOM 10104 H HA   . SER A 1 60 ? -2.402  -9.968  -5.288  1.00 0.00 ? 60 SER A HA   8  
ATOM 10105 H HB2  . SER A 1 60 ? -3.776  -8.999  -6.976  1.00 0.00 ? 60 SER A HB2  8  
ATOM 10106 H HB3  . SER A 1 60 ? -2.536  -7.830  -7.419  1.00 0.00 ? 60 SER A HB3  8  
ATOM 10107 H HG   . SER A 1 60 ? -1.385  -10.114 -7.732  1.00 0.00 ? 60 SER A HG   8  
ATOM 10108 N N    . ILE A 1 61 ? 0.138   -7.994  -5.998  1.00 0.00 ? 61 ILE A N    8  
ATOM 10109 C CA   . ILE A 1 61 ? 1.617   -7.929  -6.210  1.00 0.00 ? 61 ILE A CA   8  
ATOM 10110 C C    . ILE A 1 61 ? 2.358   -8.506  -5.000  1.00 0.00 ? 61 ILE A C    8  
ATOM 10111 O O    . ILE A 1 61 ? 3.269   -9.299  -5.133  1.00 0.00 ? 61 ILE A O    8  
ATOM 10112 C CB   . ILE A 1 61 ? 2.036   -6.455  -6.365  1.00 0.00 ? 61 ILE A CB   8  
ATOM 10113 C CG1  . ILE A 1 61 ? 1.121   -5.728  -7.410  1.00 0.00 ? 61 ILE A CG1  8  
ATOM 10114 C CG2  . ILE A 1 61 ? 3.520   -6.391  -6.760  1.00 0.00 ? 61 ILE A CG2  8  
ATOM 10115 C CD1  . ILE A 1 61 ? 1.920   -5.167  -8.595  1.00 0.00 ? 61 ILE A CD1  8  
ATOM 10116 H H    . ILE A 1 61 ? -0.369  -7.163  -5.885  1.00 0.00 ? 61 ILE A H    8  
ATOM 10117 H HA   . ILE A 1 61 ? 1.884   -8.477  -7.100  1.00 0.00 ? 61 ILE A HA   8  
ATOM 10118 H HB   . ILE A 1 61 ? 1.925   -5.971  -5.401  1.00 0.00 ? 61 ILE A HB   8  
ATOM 10119 H HG12 . ILE A 1 61 ? 0.375   -6.414  -7.790  1.00 0.00 ? 61 ILE A HG12 8  
ATOM 10120 H HG13 . ILE A 1 61 ? 0.617   -4.905  -6.922  1.00 0.00 ? 61 ILE A HG13 8  
ATOM 10121 H HG21 . ILE A 1 61 ? 4.113   -6.872  -6.000  1.00 0.00 ? 61 ILE A HG21 8  
ATOM 10122 H HG22 . ILE A 1 61 ? 3.826   -5.360  -6.851  1.00 0.00 ? 61 ILE A HG22 8  
ATOM 10123 H HG23 . ILE A 1 61 ? 3.664   -6.896  -7.704  1.00 0.00 ? 61 ILE A HG23 8  
ATOM 10124 H HD11 . ILE A 1 61 ? 1.244   -4.706  -9.296  1.00 0.00 ? 61 ILE A HD11 8  
ATOM 10125 H HD12 . ILE A 1 61 ? 2.456   -5.965  -9.085  1.00 0.00 ? 61 ILE A HD12 8  
ATOM 10126 H HD13 . ILE A 1 61 ? 2.621   -4.426  -8.233  1.00 0.00 ? 61 ILE A HD13 8  
ATOM 10127 N N    . LEU A 1 62 ? 1.998   -8.075  -3.825  1.00 0.00 ? 62 LEU A N    8  
ATOM 10128 C CA   . LEU A 1 62 ? 2.698   -8.549  -2.601  1.00 0.00 ? 62 LEU A CA   8  
ATOM 10129 C C    . LEU A 1 62 ? 2.660   -10.083 -2.532  1.00 0.00 ? 62 LEU A C    8  
ATOM 10130 O O    . LEU A 1 62 ? 3.551   -10.710 -1.997  1.00 0.00 ? 62 LEU A O    8  
ATOM 10131 C CB   . LEU A 1 62 ? 2.005   -7.919  -1.370  1.00 0.00 ? 62 LEU A CB   8  
ATOM 10132 C CG   . LEU A 1 62 ? 2.939   -6.908  -0.676  1.00 0.00 ? 62 LEU A CG   8  
ATOM 10133 C CD1  . LEU A 1 62 ? 2.112   -5.942  0.182   1.00 0.00 ? 62 LEU A CD1  8  
ATOM 10134 C CD2  . LEU A 1 62 ? 3.941   -7.670  0.199   1.00 0.00 ? 62 LEU A CD2  8  
ATOM 10135 H H    . LEU A 1 62 ? 1.280   -7.412  -3.751  1.00 0.00 ? 62 LEU A H    8  
ATOM 10136 H HA   . LEU A 1 62 ? 3.728   -8.226  -2.659  1.00 0.00 ? 62 LEU A HA   8  
ATOM 10137 H HB2  . LEU A 1 62 ? 1.111   -7.407  -1.697  1.00 0.00 ? 62 LEU A HB2  8  
ATOM 10138 H HB3  . LEU A 1 62 ? 1.726   -8.689  -0.662  1.00 0.00 ? 62 LEU A HB3  8  
ATOM 10139 H HG   . LEU A 1 62 ? 3.473   -6.336  -1.423  1.00 0.00 ? 62 LEU A HG   8  
ATOM 10140 H HD11 . LEU A 1 62 ? 1.306   -6.477  0.651   1.00 0.00 ? 62 LEU A HD11 8  
ATOM 10141 H HD12 . LEU A 1 62 ? 1.705   -5.164  -0.447  1.00 0.00 ? 62 LEU A HD12 8  
ATOM 10142 H HD13 . LEU A 1 62 ? 2.739   -5.499  0.938   1.00 0.00 ? 62 LEU A HD13 8  
ATOM 10143 H HD21 . LEU A 1 62 ? 4.565   -8.292  -0.427  1.00 0.00 ? 62 LEU A HD21 8  
ATOM 10144 H HD22 . LEU A 1 62 ? 3.408   -8.291  0.901   1.00 0.00 ? 62 LEU A HD22 8  
ATOM 10145 H HD23 . LEU A 1 62 ? 4.556   -6.972  0.737   1.00 0.00 ? 62 LEU A HD23 8  
ATOM 10146 N N    . LEU A 1 63 ? 1.633   -10.687 -3.056  1.00 0.00 ? 63 LEU A N    8  
ATOM 10147 C CA   . LEU A 1 63 ? 1.540   -12.173 -3.006  1.00 0.00 ? 63 LEU A CA   8  
ATOM 10148 C C    . LEU A 1 63 ? 2.439   -12.817 -4.061  1.00 0.00 ? 63 LEU A C    8  
ATOM 10149 O O    . LEU A 1 63 ? 2.680   -14.008 -4.028  1.00 0.00 ? 63 LEU A O    8  
ATOM 10150 C CB   . LEU A 1 63 ? 0.088   -12.610 -3.203  1.00 0.00 ? 63 LEU A CB   8  
ATOM 10151 C CG   . LEU A 1 63 ? -0.778  -12.035 -2.077  1.00 0.00 ? 63 LEU A CG   8  
ATOM 10152 C CD1  . LEU A 1 63 ? -2.239  -12.427 -2.317  1.00 0.00 ? 63 LEU A CD1  8  
ATOM 10153 C CD2  . LEU A 1 63 ? -0.307  -12.578 -0.714  1.00 0.00 ? 63 LEU A CD2  8  
ATOM 10154 H H    . LEU A 1 63 ? 0.918   -10.165 -3.476  1.00 0.00 ? 63 LEU A H    8  
ATOM 10155 H HA   . LEU A 1 63 ? 1.898   -12.535 -2.056  1.00 0.00 ? 63 LEU A HA   8  
ATOM 10156 H HB2  . LEU A 1 63 ? -0.271  -12.245 -4.155  1.00 0.00 ? 63 LEU A HB2  8  
ATOM 10157 H HB3  . LEU A 1 63 ? 0.030   -13.687 -3.186  1.00 0.00 ? 63 LEU A HB3  8  
ATOM 10158 H HG   . LEU A 1 63 ? -0.693  -10.959 -2.080  1.00 0.00 ? 63 LEU A HG   8  
ATOM 10159 H HD11 . LEU A 1 63 ? -2.305  -13.494 -2.463  1.00 0.00 ? 63 LEU A HD11 8  
ATOM 10160 H HD12 . LEU A 1 63 ? -2.606  -11.920 -3.196  1.00 0.00 ? 63 LEU A HD12 8  
ATOM 10161 H HD13 . LEU A 1 63 ? -2.833  -12.142 -1.462  1.00 0.00 ? 63 LEU A HD13 8  
ATOM 10162 H HD21 . LEU A 1 63 ? 0.492   -11.953 -0.338  1.00 0.00 ? 63 LEU A HD21 8  
ATOM 10163 H HD22 . LEU A 1 63 ? 0.055   -13.591 -0.827  1.00 0.00 ? 63 LEU A HD22 8  
ATOM 10164 H HD23 . LEU A 1 63 ? -1.128  -12.567 -0.011  1.00 0.00 ? 63 LEU A HD23 8  
ATOM 10165 N N    . GLU A 1 64 ? 2.955   -12.058 -4.989  1.00 0.00 ? 64 GLU A N    8  
ATOM 10166 C CA   . GLU A 1 64 ? 3.849   -12.663 -6.016  1.00 0.00 ? 64 GLU A CA   8  
ATOM 10167 C C    . GLU A 1 64 ? 5.264   -12.694 -5.445  1.00 0.00 ? 64 GLU A C    8  
ATOM 10168 O O    . GLU A 1 64 ? 6.203   -13.064 -6.120  1.00 0.00 ? 64 GLU A O    8  
ATOM 10169 C CB   . GLU A 1 64 ? 3.808   -11.842 -7.306  1.00 0.00 ? 64 GLU A CB   8  
ATOM 10170 C CG   . GLU A 1 64 ? 2.511   -12.140 -8.063  1.00 0.00 ? 64 GLU A CG   8  
ATOM 10171 C CD   . GLU A 1 64 ? 2.564   -13.560 -8.632  1.00 0.00 ? 64 GLU A CD   8  
ATOM 10172 O OE1  . GLU A 1 64 ? 3.581   -13.908 -9.209  1.00 0.00 ? 64 GLU A OE1  8  
ATOM 10173 O OE2  . GLU A 1 64 ? 1.588   -14.274 -8.481  1.00 0.00 ? 64 GLU A OE2  8  
ATOM 10174 H H    . GLU A 1 64 ? 2.770   -11.100 -5.004  1.00 0.00 ? 64 GLU A H    8  
ATOM 10175 H HA   . GLU A 1 64 ? 3.532   -13.681 -6.211  1.00 0.00 ? 64 GLU A HA   8  
ATOM 10176 H HB2  . GLU A 1 64 ? 3.847   -10.791 -7.064  1.00 0.00 ? 64 GLU A HB2  8  
ATOM 10177 H HB3  . GLU A 1 64 ? 4.651   -12.104 -7.927  1.00 0.00 ? 64 GLU A HB3  8  
ATOM 10178 H HG2  . GLU A 1 64 ? 1.673   -12.054 -7.389  1.00 0.00 ? 64 GLU A HG2  8  
ATOM 10179 H HG3  . GLU A 1 64 ? 2.396   -11.435 -8.872  1.00 0.00 ? 64 GLU A HG3  8  
ATOM 10180 N N    . GLU A 1 65 ? 5.411   -12.335 -4.190  1.00 0.00 ? 65 GLU A N    8  
ATOM 10181 C CA   . GLU A 1 65 ? 6.762   -12.377 -3.543  1.00 0.00 ? 65 GLU A CA   8  
ATOM 10182 C C    . GLU A 1 65 ? 7.638   -11.206 -4.008  1.00 0.00 ? 65 GLU A C    8  
ATOM 10183 O O    . GLU A 1 65 ? 8.850   -11.298 -4.045  1.00 0.00 ? 65 GLU A O    8  
ATOM 10184 C CB   . GLU A 1 65 ? 7.454   -13.706 -3.951  1.00 0.00 ? 65 GLU A CB   8  
ATOM 10185 C CG   . GLU A 1 65 ? 8.330   -14.216 -2.804  1.00 0.00 ? 65 GLU A CG   8  
ATOM 10186 C CD   . GLU A 1 65 ? 9.162   -15.407 -3.283  1.00 0.00 ? 65 GLU A CD   8  
ATOM 10187 O OE1  . GLU A 1 65 ? 9.648   -15.353 -4.401  1.00 0.00 ? 65 GLU A OE1  8  
ATOM 10188 O OE2  . GLU A 1 65 ? 9.298   -16.353 -2.525  1.00 0.00 ? 65 GLU A OE2  8  
ATOM 10189 H H    . GLU A 1 65 ? 4.617   -12.055 -3.686  1.00 0.00 ? 65 GLU A H    8  
ATOM 10190 H HA   . GLU A 1 65 ? 6.671   -12.382 -2.463  1.00 0.00 ? 65 GLU A HA   8  
ATOM 10191 H HB2  . GLU A 1 65 ? 6.699   -14.446 -4.172  1.00 0.00 ? 65 GLU A HB2  8  
ATOM 10192 H HB3  . GLU A 1 65 ? 8.070   -13.555 -4.828  1.00 0.00 ? 65 GLU A HB3  8  
ATOM 10193 H HG2  . GLU A 1 65 ? 8.985   -13.423 -2.476  1.00 0.00 ? 65 GLU A HG2  8  
ATOM 10194 H HG3  . GLU A 1 65 ? 7.698   -14.524 -1.986  1.00 0.00 ? 65 GLU A HG3  8  
ATOM 10195 N N    . VAL A 1 66 ? 7.030   -10.097 -4.334  1.00 0.00 ? 66 VAL A N    8  
ATOM 10196 C CA   . VAL A 1 66 ? 7.815   -8.896  -4.766  1.00 0.00 ? 66 VAL A CA   8  
ATOM 10197 C C    . VAL A 1 66 ? 8.118   -8.057  -3.513  1.00 0.00 ? 66 VAL A C    8  
ATOM 10198 O O    . VAL A 1 66 ? 7.312   -7.967  -2.607  1.00 0.00 ? 66 VAL A O    8  
ATOM 10199 C CB   . VAL A 1 66 ? 6.967   -8.094  -5.782  1.00 0.00 ? 66 VAL A CB   8  
ATOM 10200 C CG1  . VAL A 1 66 ? 7.307   -6.597  -5.728  1.00 0.00 ? 66 VAL A CG1  8  
ATOM 10201 C CG2  . VAL A 1 66 ? 7.234   -8.616  -7.202  1.00 0.00 ? 66 VAL A CG2  8  
ATOM 10202 H H    . VAL A 1 66 ? 6.047   -10.042 -4.281  1.00 0.00 ? 66 VAL A H    8  
ATOM 10203 H HA   . VAL A 1 66 ? 8.741   -9.208  -5.237  1.00 0.00 ? 66 VAL A HA   8  
ATOM 10204 H HB   . VAL A 1 66 ? 5.924   -8.229  -5.546  1.00 0.00 ? 66 VAL A HB   8  
ATOM 10205 H HG11 . VAL A 1 66 ? 6.835   -6.154  -4.865  1.00 0.00 ? 66 VAL A HG11 8  
ATOM 10206 H HG12 . VAL A 1 66 ? 6.948   -6.109  -6.622  1.00 0.00 ? 66 VAL A HG12 8  
ATOM 10207 H HG13 . VAL A 1 66 ? 8.377   -6.476  -5.655  1.00 0.00 ? 66 VAL A HG13 8  
ATOM 10208 H HG21 . VAL A 1 66 ? 7.270   -9.694  -7.190  1.00 0.00 ? 66 VAL A HG21 8  
ATOM 10209 H HG22 . VAL A 1 66 ? 8.181   -8.230  -7.556  1.00 0.00 ? 66 VAL A HG22 8  
ATOM 10210 H HG23 . VAL A 1 66 ? 6.445   -8.287  -7.862  1.00 0.00 ? 66 VAL A HG23 8  
ATOM 10211 N N    . SER A 1 67 ? 9.274   -7.443  -3.455  1.00 0.00 ? 67 SER A N    8  
ATOM 10212 C CA   . SER A 1 67 ? 9.624   -6.616  -2.261  1.00 0.00 ? 67 SER A CA   8  
ATOM 10213 C C    . SER A 1 67 ? 8.476   -5.615  -1.990  1.00 0.00 ? 67 SER A C    8  
ATOM 10214 O O    . SER A 1 67 ? 7.763   -5.262  -2.906  1.00 0.00 ? 67 SER A O    8  
ATOM 10215 C CB   . SER A 1 67 ? 10.946  -5.874  -2.528  1.00 0.00 ? 67 SER A CB   8  
ATOM 10216 O OG   . SER A 1 67 ? 11.761  -5.932  -1.365  1.00 0.00 ? 67 SER A OG   8  
ATOM 10217 H H    . SER A 1 67 ? 9.912   -7.528  -4.195  1.00 0.00 ? 67 SER A H    8  
ATOM 10218 H HA   . SER A 1 67 ? 9.747   -7.276  -1.422  1.00 0.00 ? 67 SER A HA   8  
ATOM 10219 H HB2  . SER A 1 67 ? 11.465  -6.354  -3.339  1.00 0.00 ? 67 SER A HB2  8  
ATOM 10220 H HB3  . SER A 1 67 ? 10.750  -4.842  -2.793  1.00 0.00 ? 67 SER A HB3  8  
ATOM 10221 H HG   . SER A 1 67 ? 12.607  -6.310  -1.614  1.00 0.00 ? 67 SER A HG   8  
ATOM 10222 N N    . PRO A 1 68 ? 8.306   -5.194  -0.749  1.00 0.00 ? 68 PRO A N    8  
ATOM 10223 C CA   . PRO A 1 68 ? 7.218   -4.254  -0.403  1.00 0.00 ? 68 PRO A CA   8  
ATOM 10224 C C    . PRO A 1 68 ? 7.423   -2.859  -1.031  1.00 0.00 ? 68 PRO A C    8  
ATOM 10225 O O    . PRO A 1 68 ? 6.481   -2.242  -1.482  1.00 0.00 ? 68 PRO A O    8  
ATOM 10226 C CB   . PRO A 1 68 ? 7.262   -4.157  1.143   1.00 0.00 ? 68 PRO A CB   8  
ATOM 10227 C CG   . PRO A 1 68 ? 8.573   -4.841  1.610   1.00 0.00 ? 68 PRO A CG   8  
ATOM 10228 C CD   . PRO A 1 68 ? 9.147   -5.608  0.401   1.00 0.00 ? 68 PRO A CD   8  
ATOM 10229 H HA   . PRO A 1 68 ? 6.270   -4.667  -0.720  1.00 0.00 ? 68 PRO A HA   8  
ATOM 10230 H HB2  . PRO A 1 68 ? 7.245   -3.122  1.463   1.00 0.00 ? 68 PRO A HB2  8  
ATOM 10231 H HB3  . PRO A 1 68 ? 6.419   -4.674  1.568   1.00 0.00 ? 68 PRO A HB3  8  
ATOM 10232 H HG2  . PRO A 1 68 ? 9.280   -4.090  1.946   1.00 0.00 ? 68 PRO A HG2  8  
ATOM 10233 H HG3  . PRO A 1 68 ? 8.364   -5.531  2.418   1.00 0.00 ? 68 PRO A HG3  8  
ATOM 10234 H HD2  . PRO A 1 68 ? 10.180  -5.336  0.236   1.00 0.00 ? 68 PRO A HD2  8  
ATOM 10235 H HD3  . PRO A 1 68 ? 9.055   -6.670  0.566   1.00 0.00 ? 68 PRO A HD3  8  
ATOM 10236 N N    . GLU A 1 69 ? 8.620   -2.330  -1.023  1.00 0.00 ? 69 GLU A N    8  
ATOM 10237 C CA   . GLU A 1 69 ? 8.814   -0.953  -1.579  1.00 0.00 ? 69 GLU A CA   8  
ATOM 10238 C C    . GLU A 1 69 ? 8.834   -0.967  -3.110  1.00 0.00 ? 69 GLU A C    8  
ATOM 10239 O O    . GLU A 1 69 ? 8.681   0.065   -3.753  1.00 0.00 ? 69 GLU A O    8  
ATOM 10240 C CB   . GLU A 1 69 ? 10.118  -0.346  -1.040  1.00 0.00 ? 69 GLU A CB   8  
ATOM 10241 C CG   . GLU A 1 69 ? 11.299  -1.292  -1.281  1.00 0.00 ? 69 GLU A CG   8  
ATOM 10242 C CD   . GLU A 1 69 ? 12.533  -0.757  -0.550  1.00 0.00 ? 69 GLU A CD   8  
ATOM 10243 O OE1  . GLU A 1 69 ? 12.900  0.379   -0.802  1.00 0.00 ? 69 GLU A OE1  8  
ATOM 10244 O OE2  . GLU A 1 69 ? 13.089  -1.492  0.248   1.00 0.00 ? 69 GLU A OE2  8  
ATOM 10245 H H    . GLU A 1 69 ? 9.375   -2.814  -0.627  1.00 0.00 ? 69 GLU A H    8  
ATOM 10246 H HA   . GLU A 1 69 ? 7.990   -0.334  -1.254  1.00 0.00 ? 69 GLU A HA   8  
ATOM 10247 H HB2  . GLU A 1 69 ? 10.305  0.593   -1.538  1.00 0.00 ? 69 GLU A HB2  8  
ATOM 10248 H HB3  . GLU A 1 69 ? 10.014  -0.171  0.021   1.00 0.00 ? 69 GLU A HB3  8  
ATOM 10249 H HG2  . GLU A 1 69 ? 11.061  -2.275  -0.905  1.00 0.00 ? 69 GLU A HG2  8  
ATOM 10250 H HG3  . GLU A 1 69 ? 11.511  -1.347  -2.338  1.00 0.00 ? 69 GLU A HG3  8  
ATOM 10251 N N    . LEU A 1 70 ? 8.979   -2.109  -3.725  1.00 0.00 ? 70 LEU A N    8  
ATOM 10252 C CA   . LEU A 1 70 ? 8.971   -2.113  -5.210  1.00 0.00 ? 70 LEU A CA   8  
ATOM 10253 C C    . LEU A 1 70 ? 7.526   -1.862  -5.649  1.00 0.00 ? 70 LEU A C    8  
ATOM 10254 O O    . LEU A 1 70 ? 7.252   -1.545  -6.790  1.00 0.00 ? 70 LEU A O    8  
ATOM 10255 C CB   . LEU A 1 70 ? 9.507   -3.450  -5.752  1.00 0.00 ? 70 LEU A CB   8  
ATOM 10256 C CG   . LEU A 1 70 ? 11.036  -3.517  -5.619  1.00 0.00 ? 70 LEU A CG   8  
ATOM 10257 C CD1  . LEU A 1 70 ? 11.528  -4.902  -6.068  1.00 0.00 ? 70 LEU A CD1  8  
ATOM 10258 C CD2  . LEU A 1 70 ? 11.719  -2.426  -6.473  1.00 0.00 ? 70 LEU A CD2  8  
ATOM 10259 H H    . LEU A 1 70 ? 9.060   -2.942  -3.215  1.00 0.00 ? 70 LEU A H    8  
ATOM 10260 H HA   . LEU A 1 70 ? 9.578   -1.290  -5.550  1.00 0.00 ? 70 LEU A HA   8  
ATOM 10261 H HB2  . LEU A 1 70 ? 9.072   -4.261  -5.191  1.00 0.00 ? 70 LEU A HB2  8  
ATOM 10262 H HB3  . LEU A 1 70 ? 9.244   -3.553  -6.781  1.00 0.00 ? 70 LEU A HB3  8  
ATOM 10263 H HG   . LEU A 1 70 ? 11.288  -3.370  -4.593  1.00 0.00 ? 70 LEU A HG   8  
ATOM 10264 H HD11 . LEU A 1 70 ? 11.554  -4.943  -7.146  1.00 0.00 ? 70 LEU A HD11 8  
ATOM 10265 H HD12 . LEU A 1 70 ? 10.860  -5.667  -5.696  1.00 0.00 ? 70 LEU A HD12 8  
ATOM 10266 H HD13 . LEU A 1 70 ? 12.521  -5.073  -5.680  1.00 0.00 ? 70 LEU A HD13 8  
ATOM 10267 H HD21 . LEU A 1 70 ? 11.115  -2.203  -7.335  1.00 0.00 ? 70 LEU A HD21 8  
ATOM 10268 H HD22 . LEU A 1 70 ? 12.693  -2.769  -6.798  1.00 0.00 ? 70 LEU A HD22 8  
ATOM 10269 H HD23 . LEU A 1 70 ? 11.844  -1.533  -5.879  1.00 0.00 ? 70 LEU A HD23 8  
ATOM 10270 N N    . VAL A 1 71 ? 6.596   -2.032  -4.740  1.00 0.00 ? 71 VAL A N    8  
ATOM 10271 C CA   . VAL A 1 71 ? 5.159   -1.835  -5.087  1.00 0.00 ? 71 VAL A CA   8  
ATOM 10272 C C    . VAL A 1 71 ? 4.896   -0.372  -5.452  1.00 0.00 ? 71 VAL A C    8  
ATOM 10273 O O    . VAL A 1 71 ? 4.356   -0.087  -6.499  1.00 0.00 ? 71 VAL A O    8  
ATOM 10274 C CB   . VAL A 1 71 ? 4.265   -2.260  -3.898  1.00 0.00 ? 71 VAL A CB   8  
ATOM 10275 C CG1  . VAL A 1 71 ? 2.850   -1.650  -4.006  1.00 0.00 ? 71 VAL A CG1  8  
ATOM 10276 C CG2  . VAL A 1 71 ? 4.160   -3.788  -3.863  1.00 0.00 ? 71 VAL A CG2  8  
ATOM 10277 H H    . VAL A 1 71 ? 6.854   -2.321  -3.839  1.00 0.00 ? 71 VAL A H    8  
ATOM 10278 H HA   . VAL A 1 71 ? 4.948   -2.428  -5.962  1.00 0.00 ? 71 VAL A HA   8  
ATOM 10279 H HB   . VAL A 1 71 ? 4.720   -1.918  -2.981  1.00 0.00 ? 71 VAL A HB   8  
ATOM 10280 H HG11 . VAL A 1 71 ? 2.176   -2.178  -3.345  1.00 0.00 ? 71 VAL A HG11 8  
ATOM 10281 H HG12 . VAL A 1 71 ? 2.496   -1.732  -5.021  1.00 0.00 ? 71 VAL A HG12 8  
ATOM 10282 H HG13 . VAL A 1 71 ? 2.875   -0.607  -3.720  1.00 0.00 ? 71 VAL A HG13 8  
ATOM 10283 H HG21 . VAL A 1 71 ? 3.430   -4.080  -3.122  1.00 0.00 ? 71 VAL A HG21 8  
ATOM 10284 H HG22 . VAL A 1 71 ? 5.121   -4.209  -3.603  1.00 0.00 ? 71 VAL A HG22 8  
ATOM 10285 H HG23 . VAL A 1 71 ? 3.855   -4.154  -4.832  1.00 0.00 ? 71 VAL A HG23 8  
ATOM 10286 N N    . CYS A 1 72 ? 5.219   0.560   -4.605  1.00 0.00 ? 72 CYS A N    8  
ATOM 10287 C CA   . CYS A 1 72 ? 4.903   1.968   -4.955  1.00 0.00 ? 72 CYS A CA   8  
ATOM 10288 C C    . CYS A 1 72 ? 5.687   2.402   -6.203  1.00 0.00 ? 72 CYS A C    8  
ATOM 10289 O O    . CYS A 1 72 ? 5.254   3.248   -6.960  1.00 0.00 ? 72 CYS A O    8  
ATOM 10290 C CB   . CYS A 1 72 ? 5.241   2.878   -3.758  1.00 0.00 ? 72 CYS A CB   8  
ATOM 10291 S SG   . CYS A 1 72 ? 4.119   4.289   -3.709  1.00 0.00 ? 72 CYS A SG   8  
ATOM 10292 H H    . CYS A 1 72 ? 5.617   0.344   -3.735  1.00 0.00 ? 72 CYS A H    8  
ATOM 10293 H HA   . CYS A 1 72 ? 3.840   1.996   -5.138  1.00 0.00 ? 72 CYS A HA   8  
ATOM 10294 H HB2  . CYS A 1 72 ? 5.129   2.320   -2.847  1.00 0.00 ? 72 CYS A HB2  8  
ATOM 10295 H HB3  . CYS A 1 72 ? 6.257   3.235   -3.827  1.00 0.00 ? 72 CYS A HB3  8  
ATOM 10296 N N    . SER A 1 73 ? 6.838   1.812   -6.423  1.00 0.00 ? 73 SER A N    8  
ATOM 10297 C CA   . SER A 1 73 ? 7.644   2.181   -7.630  1.00 0.00 ? 73 SER A CA   8  
ATOM 10298 C C    . SER A 1 73 ? 7.081   1.516   -8.910  1.00 0.00 ? 73 SER A C    8  
ATOM 10299 O O    . SER A 1 73 ? 7.051   2.126   -9.959  1.00 0.00 ? 73 SER A O    8  
ATOM 10300 C CB   . SER A 1 73 ? 9.097   1.757   -7.429  1.00 0.00 ? 73 SER A CB   8  
ATOM 10301 O OG   . SER A 1 73 ? 9.929   2.499   -8.311  1.00 0.00 ? 73 SER A OG   8  
ATOM 10302 H H    . SER A 1 73 ? 7.165   1.138   -5.773  1.00 0.00 ? 73 SER A H    8  
ATOM 10303 H HA   . SER A 1 73 ? 7.600   3.251   -7.766  1.00 0.00 ? 73 SER A HA   8  
ATOM 10304 H HB2  . SER A 1 73 ? 9.395   1.954   -6.412  1.00 0.00 ? 73 SER A HB2  8  
ATOM 10305 H HB3  . SER A 1 73 ? 9.193   0.699   -7.632  1.00 0.00 ? 73 SER A HB3  8  
ATOM 10306 H HG   . SER A 1 73 ? 10.018  1.999   -9.126  1.00 0.00 ? 73 SER A HG   8  
ATOM 10307 N N    . MET A 1 74 ? 6.642   0.280   -8.843  1.00 0.00 ? 74 MET A N    8  
ATOM 10308 C CA   . MET A 1 74 ? 6.095   -0.393  -10.075 1.00 0.00 ? 74 MET A CA   8  
ATOM 10309 C C    . MET A 1 74 ? 4.718   0.190   -10.449 1.00 0.00 ? 74 MET A C    8  
ATOM 10310 O O    . MET A 1 74 ? 4.433   0.403   -11.611 1.00 0.00 ? 74 MET A O    8  
ATOM 10311 C CB   . MET A 1 74 ? 5.958   -1.925  -9.824  1.00 0.00 ? 74 MET A CB   8  
ATOM 10312 C CG   . MET A 1 74 ? 7.152   -2.704  -10.409 1.00 0.00 ? 74 MET A CG   8  
ATOM 10313 S SD   . MET A 1 74 ? 6.702   -4.452  -10.611 1.00 0.00 ? 74 MET A SD   8  
ATOM 10314 C CE   . MET A 1 74 ? 5.861   -4.702  -9.025  1.00 0.00 ? 74 MET A CE   8  
ATOM 10315 H H    . MET A 1 74 ? 6.674   -0.206  -7.993  1.00 0.00 ? 74 MET A H    8  
ATOM 10316 H HA   . MET A 1 74 ? 6.749   -0.233  -10.915 1.00 0.00 ? 74 MET A HA   8  
ATOM 10317 H HB2  . MET A 1 74 ? 5.916   -2.105  -8.764  1.00 0.00 ? 74 MET A HB2  8  
ATOM 10318 H HB3  . MET A 1 74 ? 5.050   -2.292  -10.286 1.00 0.00 ? 74 MET A HB3  8  
ATOM 10319 H HG2  . MET A 1 74 ? 7.419   -2.303  -11.375 1.00 0.00 ? 74 MET A HG2  8  
ATOM 10320 H HG3  . MET A 1 74 ? 7.995   -2.625  -9.745  1.00 0.00 ? 74 MET A HG3  8  
ATOM 10321 H HE1  . MET A 1 74 ? 6.459   -4.283  -8.230  1.00 0.00 ? 74 MET A HE1  8  
ATOM 10322 H HE2  . MET A 1 74 ? 5.731   -5.758  -8.850  1.00 0.00 ? 74 MET A HE2  8  
ATOM 10323 H HE3  . MET A 1 74 ? 4.892   -4.225  -9.046  1.00 0.00 ? 74 MET A HE3  8  
ATOM 10324 N N    . LEU A 1 75 ? 3.856   0.439   -9.501  1.00 0.00 ? 75 LEU A N    8  
ATOM 10325 C CA   . LEU A 1 75 ? 2.513   0.989   -9.861  1.00 0.00 ? 75 LEU A CA   8  
ATOM 10326 C C    . LEU A 1 75 ? 2.649   2.451   -10.310 1.00 0.00 ? 75 LEU A C    8  
ATOM 10327 O O    . LEU A 1 75 ? 1.682   3.182   -10.378 1.00 0.00 ? 75 LEU A O    8  
ATOM 10328 C CB   . LEU A 1 75 ? 1.573   0.895   -8.651  1.00 0.00 ? 75 LEU A CB   8  
ATOM 10329 C CG   . LEU A 1 75 ? 1.530   -0.548  -8.110  1.00 0.00 ? 75 LEU A CG   8  
ATOM 10330 C CD1  . LEU A 1 75 ? 0.437   -0.670  -7.043  1.00 0.00 ? 75 LEU A CD1  8  
ATOM 10331 C CD2  . LEU A 1 75 ? 1.237   -1.536  -9.249  1.00 0.00 ? 75 LEU A CD2  8  
ATOM 10332 H H    . LEU A 1 75 ? 4.082   0.255   -8.565  1.00 0.00 ? 75 LEU A H    8  
ATOM 10333 H HA   . LEU A 1 75 ? 2.098   0.414   -10.676 1.00 0.00 ? 75 LEU A HA   8  
ATOM 10334 H HB2  . LEU A 1 75 ? 1.930   1.555   -7.876  1.00 0.00 ? 75 LEU A HB2  8  
ATOM 10335 H HB3  . LEU A 1 75 ? 0.581   1.194   -8.950  1.00 0.00 ? 75 LEU A HB3  8  
ATOM 10336 H HG   . LEU A 1 75 ? 2.477   -0.786  -7.663  1.00 0.00 ? 75 LEU A HG   8  
ATOM 10337 H HD11 . LEU A 1 75 ? 0.764   -0.186  -6.136  1.00 0.00 ? 75 LEU A HD11 8  
ATOM 10338 H HD12 . LEU A 1 75 ? 0.246   -1.714  -6.843  1.00 0.00 ? 75 LEU A HD12 8  
ATOM 10339 H HD13 . LEU A 1 75 ? -0.467  -0.202  -7.396  1.00 0.00 ? 75 LEU A HD13 8  
ATOM 10340 H HD21 . LEU A 1 75 ? 2.148   -1.737  -9.793  1.00 0.00 ? 75 LEU A HD21 8  
ATOM 10341 H HD22 . LEU A 1 75 ? 0.503   -1.113  -9.918  1.00 0.00 ? 75 LEU A HD22 8  
ATOM 10342 H HD23 . LEU A 1 75 ? 0.856   -2.461  -8.839  1.00 0.00 ? 75 LEU A HD23 8  
ATOM 10343 N N    . HIS A 1 76 ? 3.844   2.876   -10.620 1.00 0.00 ? 76 HIS A N    8  
ATOM 10344 C CA   . HIS A 1 76 ? 4.058   4.285   -11.072 1.00 0.00 ? 76 HIS A CA   8  
ATOM 10345 C C    . HIS A 1 76 ? 3.387   5.254   -10.092 1.00 0.00 ? 76 HIS A C    8  
ATOM 10346 O O    . HIS A 1 76 ? 3.072   6.372   -10.453 1.00 0.00 ? 76 HIS A O    8  
ATOM 10347 C CB   . HIS A 1 76 ? 3.476   4.476   -12.477 1.00 0.00 ? 76 HIS A CB   8  
ATOM 10348 C CG   . HIS A 1 76 ? 4.079   3.460   -13.409 1.00 0.00 ? 76 HIS A CG   8  
ATOM 10349 N ND1  . HIS A 1 76 ? 3.493   3.130   -14.621 1.00 0.00 ? 76 HIS A ND1  8  
ATOM 10350 C CD2  . HIS A 1 76 ? 5.216   2.695   -13.321 1.00 0.00 ? 76 HIS A CD2  8  
ATOM 10351 C CE1  . HIS A 1 76 ? 4.271   2.202   -15.207 1.00 0.00 ? 76 HIS A CE1  8  
ATOM 10352 N NE2  . HIS A 1 76 ? 5.334   1.901   -14.457 1.00 0.00 ? 76 HIS A NE2  8  
ATOM 10353 H H    . HIS A 1 76 ? 4.606   2.264   -10.553 1.00 0.00 ? 76 HIS A H    8  
ATOM 10354 H HA   . HIS A 1 76 ? 5.118   4.485   -11.091 1.00 0.00 ? 76 HIS A HA   8  
ATOM 10355 H HB2  . HIS A 1 76 ? 2.405   4.344   -12.448 1.00 0.00 ? 76 HIS A HB2  8  
ATOM 10356 H HB3  . HIS A 1 76 ? 3.708   5.469   -12.831 1.00 0.00 ? 76 HIS A HB3  8  
ATOM 10357 H HD1  . HIS A 1 76 ? 2.662   3.504   -14.984 1.00 0.00 ? 76 HIS A HD1  8  
ATOM 10358 H HD2  . HIS A 1 76 ? 5.911   2.707   -12.494 1.00 0.00 ? 76 HIS A HD2  8  
ATOM 10359 H HE1  . HIS A 1 76 ? 4.061   1.755   -16.168 1.00 0.00 ? 76 HIS A HE1  8  
ATOM 10360 N N    . LEU A 1 77 ? 3.159   4.867   -8.869  1.00 0.00 ? 77 LEU A N    8  
ATOM 10361 C CA   . LEU A 1 77 ? 2.508   5.812   -7.914  1.00 0.00 ? 77 LEU A CA   8  
ATOM 10362 C C    . LEU A 1 77 ? 3.577   6.696   -7.273  1.00 0.00 ? 77 LEU A C    8  
ATOM 10363 O O    . LEU A 1 77 ? 3.270   7.690   -6.643  1.00 0.00 ? 77 LEU A O    8  
ATOM 10364 C CB   . LEU A 1 77 ? 1.762   5.031   -6.813  1.00 0.00 ? 77 LEU A CB   8  
ATOM 10365 C CG   . LEU A 1 77 ? 0.423   4.444   -7.312  1.00 0.00 ? 77 LEU A CG   8  
ATOM 10366 C CD1  . LEU A 1 77 ? -0.335  3.884   -6.104  1.00 0.00 ? 77 LEU A CD1  8  
ATOM 10367 C CD2  . LEU A 1 77 ? -0.456  5.518   -7.991  1.00 0.00 ? 77 LEU A CD2  8  
ATOM 10368 H H    . LEU A 1 77 ? 3.415   3.973   -8.576  1.00 0.00 ? 77 LEU A H    8  
ATOM 10369 H HA   . LEU A 1 77 ? 1.824   6.451   -8.442  1.00 0.00 ? 77 LEU A HA   8  
ATOM 10370 H HB2  . LEU A 1 77 ? 2.389   4.220   -6.478  1.00 0.00 ? 77 LEU A HB2  8  
ATOM 10371 H HB3  . LEU A 1 77 ? 1.567   5.684   -5.984  1.00 0.00 ? 77 LEU A HB3  8  
ATOM 10372 H HG   . LEU A 1 77 ? 0.624   3.644   -8.007  1.00 0.00 ? 77 LEU A HG   8  
ATOM 10373 H HD11 . LEU A 1 77 ? -0.681  4.700   -5.491  1.00 0.00 ? 77 LEU A HD11 8  
ATOM 10374 H HD12 . LEU A 1 77 ? 0.323   3.257   -5.525  1.00 0.00 ? 77 LEU A HD12 8  
ATOM 10375 H HD13 . LEU A 1 77 ? -1.183  3.308   -6.444  1.00 0.00 ? 77 LEU A HD13 8  
ATOM 10376 H HD21 . LEU A 1 77 ? -0.291  6.474   -7.516  1.00 0.00 ? 77 LEU A HD21 8  
ATOM 10377 H HD22 . LEU A 1 77 ? -1.501  5.251   -7.902  1.00 0.00 ? 77 LEU A HD22 8  
ATOM 10378 H HD23 . LEU A 1 77 ? -0.201  5.586   -9.037  1.00 0.00 ? 77 LEU A HD23 8  
ATOM 10379 N N    . CYS A 1 78 ? 4.832   6.353   -7.439  1.00 0.00 ? 78 CYS A N    8  
ATOM 10380 C CA   . CYS A 1 78 ? 5.937   7.180   -6.856  1.00 0.00 ? 78 CYS A CA   8  
ATOM 10381 C C    . CYS A 1 78 ? 6.938   7.512   -7.975  1.00 0.00 ? 78 CYS A C    8  
ATOM 10382 O O    . CYS A 1 78 ? 7.043   6.790   -8.947  1.00 0.00 ? 78 CYS A O    8  
ATOM 10383 C CB   . CYS A 1 78 ? 6.636   6.390   -5.742  1.00 0.00 ? 78 CYS A CB   8  
ATOM 10384 S SG   . CYS A 1 78 ? 7.010   7.486   -4.348  1.00 0.00 ? 78 CYS A SG   8  
ATOM 10385 H H    . CYS A 1 78 ? 5.050   5.549   -7.957  1.00 0.00 ? 78 CYS A H    8  
ATOM 10386 H HA   . CYS A 1 78 ? 5.530   8.109   -6.472  1.00 0.00 ? 78 CYS A HA   8  
ATOM 10387 H HB2  . CYS A 1 78 ? 5.983   5.601   -5.417  1.00 0.00 ? 78 CYS A HB2  8  
ATOM 10388 H HB3  . CYS A 1 78 ? 7.558   5.954   -6.112  1.00 0.00 ? 78 CYS A HB3  8  
ATOM 10389 N N    . SER A 1 79 ? 7.669   8.587   -7.860  1.00 0.00 ? 79 SER A N    8  
ATOM 10390 C CA   . SER A 1 79 ? 8.640   8.923   -8.938  1.00 0.00 ? 79 SER A CA   8  
ATOM 10391 C C    . SER A 1 79 ? 9.781   7.890   -8.887  1.00 0.00 ? 79 SER A C    8  
ATOM 10392 O O    . SER A 1 79 ? 10.282  7.619   -7.814  1.00 0.00 ? 79 SER A O    8  
ATOM 10393 C CB   . SER A 1 79 ? 9.211   10.319  -8.675  1.00 0.00 ? 79 SER A CB   8  
ATOM 10394 O OG   . SER A 1 79 ? 8.154   11.268  -8.687  1.00 0.00 ? 79 SER A OG   8  
ATOM 10395 H H    . SER A 1 79 ? 7.578   9.166   -7.075  1.00 0.00 ? 79 SER A H    8  
ATOM 10396 H HA   . SER A 1 79 ? 8.097   8.925   -9.872  1.00 0.00 ? 79 SER A HA   8  
ATOM 10397 H HB2  . SER A 1 79 ? 9.695   10.337  -7.713  1.00 0.00 ? 79 SER A HB2  8  
ATOM 10398 H HB3  . SER A 1 79 ? 9.935   10.562  -9.443  1.00 0.00 ? 79 SER A HB3  8  
ATOM 10399 H HG   . SER A 1 79 ? 7.651   11.161  -7.875  1.00 0.00 ? 79 SER A HG   8  
ATOM 10400 N N    . GLY A 1 80 ? 10.227  7.297   -9.981  1.00 0.00 ? 80 GLY A N    8  
ATOM 10401 C CA   . GLY A 1 80 ? 11.342  6.300   -9.871  1.00 0.00 ? 80 GLY A CA   8  
ATOM 10402 C C    . GLY A 1 80 ? 12.674  6.987   -10.180 1.00 0.00 ? 80 GLY A C    8  
ATOM 10403 O O    . GLY A 1 80 ? 12.740  8.189   -10.345 1.00 0.00 ? 80 GLY A O    8  
ATOM 10404 H H    . GLY A 1 80 ? 9.867   7.477   -10.875 1.00 0.00 ? 80 GLY A H    8  
ATOM 10405 H HA2  . GLY A 1 80 ? 11.372  5.879   -8.875  1.00 0.00 ? 80 GLY A HA2  8  
ATOM 10406 H HA3  . GLY A 1 80 ? 11.181  5.510   -10.587 1.00 0.00 ? 80 GLY A HA3  8  
ATOM 10407 N N    . LEU A 1 81 ? 13.736  6.232   -10.263 1.00 0.00 ? 81 LEU A N    8  
ATOM 10408 C CA   . LEU A 1 81 ? 15.065  6.837   -10.569 1.00 0.00 ? 81 LEU A CA   8  
ATOM 10409 C C    . LEU A 1 81 ? 15.211  6.985   -12.084 1.00 0.00 ? 81 LEU A C    8  
ATOM 10410 O O    . LEU A 1 81 ? 15.771  6.132   -12.744 1.00 0.00 ? 81 LEU A O    8  
ATOM 10411 C CB   . LEU A 1 81 ? 16.179  5.928   -10.040 1.00 0.00 ? 81 LEU A CB   8  
ATOM 10412 C CG   . LEU A 1 81 ? 15.849  5.478   -8.614  1.00 0.00 ? 81 LEU A CG   8  
ATOM 10413 C CD1  . LEU A 1 81 ? 16.957  4.553   -8.106  1.00 0.00 ? 81 LEU A CD1  8  
ATOM 10414 C CD2  . LEU A 1 81 ? 15.746  6.704   -7.698  1.00 0.00 ? 81 LEU A CD2  8  
ATOM 10415 H H    . LEU A 1 81 ? 13.659  5.263   -10.130 1.00 0.00 ? 81 LEU A H    8  
ATOM 10416 H HA   . LEU A 1 81 ? 15.139  7.807   -10.098 1.00 0.00 ? 81 LEU A HA   8  
ATOM 10417 H HB2  . LEU A 1 81 ? 16.269  5.061   -10.679 1.00 0.00 ? 81 LEU A HB2  8  
ATOM 10418 H HB3  . LEU A 1 81 ? 17.113  6.470   -10.037 1.00 0.00 ? 81 LEU A HB3  8  
ATOM 10419 H HG   . LEU A 1 81 ? 14.910  4.945   -8.614  1.00 0.00 ? 81 LEU A HG   8  
ATOM 10420 H HD11 . LEU A 1 81 ? 16.965  3.646   -8.693  1.00 0.00 ? 81 LEU A HD11 8  
ATOM 10421 H HD12 . LEU A 1 81 ? 16.776  4.310   -7.069  1.00 0.00 ? 81 LEU A HD12 8  
ATOM 10422 H HD13 . LEU A 1 81 ? 17.911  5.050   -8.198  1.00 0.00 ? 81 LEU A HD13 8  
ATOM 10423 H HD21 . LEU A 1 81 ? 15.811  6.390   -6.666  1.00 0.00 ? 81 LEU A HD21 8  
ATOM 10424 H HD22 . LEU A 1 81 ? 14.800  7.198   -7.864  1.00 0.00 ? 81 LEU A HD22 8  
ATOM 10425 H HD23 . LEU A 1 81 ? 16.552  7.389   -7.918  1.00 0.00 ? 81 LEU A HD23 8  
ATOM 10426 N N    . VAL A 1 82 ? 14.697  8.055   -12.640 1.00 0.00 ? 82 VAL A N    8  
ATOM 10427 C CA   . VAL A 1 82 ? 14.783  8.274   -14.123 1.00 0.00 ? 82 VAL A CA   8  
ATOM 10428 C C    . VAL A 1 82 ? 15.640  9.529   -14.418 1.00 0.00 ? 82 VAL A C    8  
ATOM 10429 O O    . VAL A 1 82 ? 15.121  10.626  -14.423 1.00 0.00 ? 82 VAL A O    8  
ATOM 10430 C CB   . VAL A 1 82 ? 13.360  8.459   -14.690 1.00 0.00 ? 82 VAL A CB   8  
ATOM 10431 C CG1  . VAL A 1 82 ? 12.543  9.452   -13.845 1.00 0.00 ? 82 VAL A CG1  8  
ATOM 10432 C CG2  . VAL A 1 82 ? 13.436  8.966   -16.136 1.00 0.00 ? 82 VAL A CG2  8  
ATOM 10433 H H    . VAL A 1 82 ? 14.240  8.719   -12.078 1.00 0.00 ? 82 VAL A H    8  
ATOM 10434 H HA   . VAL A 1 82 ? 15.218  7.408   -14.595 1.00 0.00 ? 82 VAL A HA   8  
ATOM 10435 H HB   . VAL A 1 82 ? 12.861  7.502   -14.680 1.00 0.00 ? 82 VAL A HB   8  
ATOM 10436 H HG11 . VAL A 1 82 ? 11.495  9.337   -14.077 1.00 0.00 ? 82 VAL A HG11 8  
ATOM 10437 H HG12 . VAL A 1 82 ? 12.848  10.461  -14.073 1.00 0.00 ? 82 VAL A HG12 8  
ATOM 10438 H HG13 . VAL A 1 82 ? 12.697  9.259   -12.795 1.00 0.00 ? 82 VAL A HG13 8  
ATOM 10439 H HG21 . VAL A 1 82 ? 14.226  8.447   -16.659 1.00 0.00 ? 82 VAL A HG21 8  
ATOM 10440 H HG22 . VAL A 1 82 ? 13.640  10.027  -16.138 1.00 0.00 ? 82 VAL A HG22 8  
ATOM 10441 H HG23 . VAL A 1 82 ? 12.494  8.781   -16.631 1.00 0.00 ? 82 VAL A HG23 8  
ATOM 10442 N N    . PRO A 1 83 ? 16.930  9.355   -14.652 1.00 0.00 ? 83 PRO A N    8  
ATOM 10443 C CA   . PRO A 1 83 ? 17.813  10.502  -14.938 1.00 0.00 ? 83 PRO A CA   8  
ATOM 10444 C C    . PRO A 1 83 ? 17.454  11.098  -16.308 1.00 0.00 ? 83 PRO A C    8  
ATOM 10445 O O    . PRO A 1 83 ? 18.155  11.941  -16.830 1.00 0.00 ? 83 PRO A O    8  
ATOM 10446 C CB   . PRO A 1 83 ? 19.246  9.915   -14.934 1.00 0.00 ? 83 PRO A CB   8  
ATOM 10447 C CG   . PRO A 1 83 ? 19.118  8.375   -14.739 1.00 0.00 ? 83 PRO A CG   8  
ATOM 10448 C CD   . PRO A 1 83 ? 17.613  8.042   -14.647 1.00 0.00 ? 83 PRO A CD   8  
ATOM 10449 H HA   . PRO A 1 83 ? 17.715  11.256  -14.172 1.00 0.00 ? 83 PRO A HA   8  
ATOM 10450 H HB2  . PRO A 1 83 ? 19.746  10.131  -15.873 1.00 0.00 ? 83 PRO A HB2  8  
ATOM 10451 H HB3  . PRO A 1 83 ? 19.816  10.337  -14.117 1.00 0.00 ? 83 PRO A HB3  8  
ATOM 10452 H HG2  . PRO A 1 83 ? 19.565  7.858   -15.580 1.00 0.00 ? 83 PRO A HG2  8  
ATOM 10453 H HG3  . PRO A 1 83 ? 19.614  8.075   -13.824 1.00 0.00 ? 83 PRO A HG3  8  
ATOM 10454 H HD2  . PRO A 1 83 ? 17.308  7.457   -15.507 1.00 0.00 ? 83 PRO A HD2  8  
ATOM 10455 H HD3  . PRO A 1 83 ? 17.393  7.510   -13.735 1.00 0.00 ? 83 PRO A HD3  8  
ATOM 10456 N N    . ARG A 1 84 ? 16.368  10.665  -16.888 1.00 0.00 ? 84 ARG A N    8  
ATOM 10457 C CA   . ARG A 1 84 ? 15.968  11.208  -18.217 1.00 0.00 ? 84 ARG A CA   8  
ATOM 10458 C C    . ARG A 1 84 ? 17.139  11.083  -19.193 1.00 0.00 ? 84 ARG A C    8  
ATOM 10459 O O    . ARG A 1 84 ? 17.965  11.981  -19.216 1.00 0.00 ? 84 ARG A O    8  
ATOM 10460 C CB   . ARG A 1 84 ? 15.583  12.681  -18.068 1.00 0.00 ? 84 ARG A CB   8  
ATOM 10461 C CG   . ARG A 1 84 ? 14.940  13.176  -19.364 1.00 0.00 ? 84 ARG A CG   8  
ATOM 10462 C CD   . ARG A 1 84 ? 14.610  14.663  -19.235 1.00 0.00 ? 84 ARG A CD   8  
ATOM 10463 N NE   . ARG A 1 84 ? 14.024  15.155  -20.514 1.00 0.00 ? 84 ARG A NE   8  
ATOM 10464 C CZ   . ARG A 1 84 ? 13.396  16.298  -20.547 1.00 0.00 ? 84 ARG A CZ   8  
ATOM 10465 N NH1  . ARG A 1 84 ? 13.282  17.012  -19.461 1.00 0.00 ? 84 ARG A NH1  8  
ATOM 10466 N NH2  . ARG A 1 84 ? 12.881  16.727  -21.667 1.00 0.00 ? 84 ARG A NH2  8  
ATOM 10467 O OXT  . ARG A 1 84 ? 17.191  10.092  -19.902 1.00 0.00 ? 84 ARG A OXT  8  
ATOM 10468 H H    . ARG A 1 84 ? 15.816  9.985   -16.449 1.00 0.00 ? 84 ARG A H    8  
ATOM 10469 H HA   . ARG A 1 84 ? 15.123  10.651  -18.594 1.00 0.00 ? 84 ARG A HA   8  
ATOM 10470 H HB2  . ARG A 1 84 ? 14.881  12.789  -17.253 1.00 0.00 ? 84 ARG A HB2  8  
ATOM 10471 H HB3  . ARG A 1 84 ? 16.467  13.265  -17.861 1.00 0.00 ? 84 ARG A HB3  8  
ATOM 10472 H HG2  . ARG A 1 84 ? 15.627  13.028  -20.186 1.00 0.00 ? 84 ARG A HG2  8  
ATOM 10473 H HG3  . ARG A 1 84 ? 14.032  12.622  -19.550 1.00 0.00 ? 84 ARG A HG3  8  
ATOM 10474 H HD2  . ARG A 1 84 ? 13.898  14.807  -18.435 1.00 0.00 ? 84 ARG A HD2  8  
ATOM 10475 H HD3  . ARG A 1 84 ? 15.512  15.214  -19.017 1.00 0.00 ? 84 ARG A HD3  8  
ATOM 10476 H HE   . ARG A 1 84 ? 14.111  14.619  -21.330 1.00 0.00 ? 84 ARG A HE   8  
ATOM 10477 H HH11 . ARG A 1 84 ? 13.676  16.683  -18.603 1.00 0.00 ? 84 ARG A HH11 8  
ATOM 10478 H HH12 . ARG A 1 84 ? 12.800  17.887  -19.485 1.00 0.00 ? 84 ARG A HH12 8  
ATOM 10479 H HH21 . ARG A 1 84 ? 12.969  16.180  -22.499 1.00 0.00 ? 84 ARG A HH21 8  
ATOM 10480 H HH22 . ARG A 1 84 ? 12.399  17.603  -21.693 1.00 0.00 ? 84 ARG A HH22 8  
ATOM 10481 N N    . SER A 1 1  ? 6.277   17.009  -1.446  1.00 0.00 ? 1  SER A N    9  
ATOM 10482 C CA   . SER A 1 1  ? 5.250   16.776  -0.392  1.00 0.00 ? 1  SER A CA   9  
ATOM 10483 C C    . SER A 1 1  ? 4.140   15.884  -0.952  1.00 0.00 ? 1  SER A C    9  
ATOM 10484 O O    . SER A 1 1  ? 2.976   16.048  -0.644  1.00 0.00 ? 1  SER A O    9  
ATOM 10485 C CB   . SER A 1 1  ? 4.654   18.116  0.044   1.00 0.00 ? 1  SER A CB   9  
ATOM 10486 O OG   . SER A 1 1  ? 3.583   17.881  0.948   1.00 0.00 ? 1  SER A OG   9  
ATOM 10487 H H1   . SER A 1 1  ? 7.210   17.124  -1.003  1.00 0.00 ? 1  SER A H1   9  
ATOM 10488 H H2   . SER A 1 1  ? 6.037   17.870  -1.979  1.00 0.00 ? 1  SER A H2   9  
ATOM 10489 H H3   . SER A 1 1  ? 6.301   16.195  -2.093  1.00 0.00 ? 1  SER A H3   9  
ATOM 10490 H HA   . SER A 1 1  ? 5.708   16.292  0.458   1.00 0.00 ? 1  SER A HA   9  
ATOM 10491 H HB2  . SER A 1 1  ? 5.410   18.705  0.535   1.00 0.00 ? 1  SER A HB2  9  
ATOM 10492 H HB3  . SER A 1 1  ? 4.295   18.648  -0.827  1.00 0.00 ? 1  SER A HB3  9  
ATOM 10493 H HG   . SER A 1 1  ? 3.843   17.170  1.538   1.00 0.00 ? 1  SER A HG   9  
ATOM 10494 N N    . ASP A 1 2  ? 4.501   14.948  -1.788  1.00 0.00 ? 2  ASP A N    9  
ATOM 10495 C CA   . ASP A 1 2  ? 3.486   14.043  -2.397  1.00 0.00 ? 2  ASP A CA   9  
ATOM 10496 C C    . ASP A 1 2  ? 2.912   13.098  -1.335  1.00 0.00 ? 2  ASP A C    9  
ATOM 10497 O O    . ASP A 1 2  ? 3.588   12.231  -0.817  1.00 0.00 ? 2  ASP A O    9  
ATOM 10498 C CB   . ASP A 1 2  ? 4.148   13.234  -3.518  1.00 0.00 ? 2  ASP A CB   9  
ATOM 10499 C CG   . ASP A 1 2  ? 3.198   12.135  -4.004  1.00 0.00 ? 2  ASP A CG   9  
ATOM 10500 O OD1  . ASP A 1 2  ? 3.237   11.055  -3.439  1.00 0.00 ? 2  ASP A OD1  9  
ATOM 10501 O OD2  . ASP A 1 2  ? 2.450   12.393  -4.931  1.00 0.00 ? 2  ASP A OD2  9  
ATOM 10502 H H    . ASP A 1 2  ? 5.446   14.846  -2.025  1.00 0.00 ? 2  ASP A H    9  
ATOM 10503 H HA   . ASP A 1 2  ? 2.686   14.634  -2.814  1.00 0.00 ? 2  ASP A HA   9  
ATOM 10504 H HB2  . ASP A 1 2  ? 4.385   13.893  -4.341  1.00 0.00 ? 2  ASP A HB2  9  
ATOM 10505 H HB3  . ASP A 1 2  ? 5.057   12.786  -3.147  1.00 0.00 ? 2  ASP A HB3  9  
ATOM 10506 N N    . VAL A 1 3  ? 1.663   13.283  -1.010  1.00 0.00 ? 3  VAL A N    9  
ATOM 10507 C CA   . VAL A 1 3  ? 0.999   12.435  0.019   1.00 0.00 ? 3  VAL A CA   9  
ATOM 10508 C C    . VAL A 1 3  ? 0.692   11.038  -0.535  1.00 0.00 ? 3  VAL A C    9  
ATOM 10509 O O    . VAL A 1 3  ? 0.278   10.172  0.209   1.00 0.00 ? 3  VAL A O    9  
ATOM 10510 C CB   . VAL A 1 3  ? -0.330  13.109  0.426   1.00 0.00 ? 3  VAL A CB   9  
ATOM 10511 C CG1  . VAL A 1 3  ? -0.111  14.616  0.585   1.00 0.00 ? 3  VAL A CG1  9  
ATOM 10512 C CG2  . VAL A 1 3  ? -1.418  12.870  -0.633  1.00 0.00 ? 3  VAL A CG2  9  
ATOM 10513 H H    . VAL A 1 3  ? 1.154   13.999  -1.445  1.00 0.00 ? 3  VAL A H    9  
ATOM 10514 H HA   . VAL A 1 3  ? 1.611   12.371  0.908   1.00 0.00 ? 3  VAL A HA   9  
ATOM 10515 H HB   . VAL A 1 3  ? -0.658  12.701  1.373   1.00 0.00 ? 3  VAL A HB   9  
ATOM 10516 H HG11 . VAL A 1 3  ? 0.697   14.791  1.280   1.00 0.00 ? 3  VAL A HG11 9  
ATOM 10517 H HG12 . VAL A 1 3  ? -1.015  15.071  0.962   1.00 0.00 ? 3  VAL A HG12 9  
ATOM 10518 H HG13 . VAL A 1 3  ? 0.136   15.046  -0.373  1.00 0.00 ? 3  VAL A HG13 9  
ATOM 10519 H HG21 . VAL A 1 3  ? -2.235  13.562  -0.477  1.00 0.00 ? 3  VAL A HG21 9  
ATOM 10520 H HG22 . VAL A 1 3  ? -1.785  11.857  -0.547  1.00 0.00 ? 3  VAL A HG22 9  
ATOM 10521 H HG23 . VAL A 1 3  ? -1.003  13.020  -1.619  1.00 0.00 ? 3  VAL A HG23 9  
ATOM 10522 N N    . TYR A 1 4  ? 0.825   10.792  -1.821  1.00 0.00 ? 4  TYR A N    9  
ATOM 10523 C CA   . TYR A 1 4  ? 0.446   9.426   -2.317  1.00 0.00 ? 4  TYR A CA   9  
ATOM 10524 C C    . TYR A 1 4  ? 1.519   8.401   -1.924  1.00 0.00 ? 4  TYR A C    9  
ATOM 10525 O O    . TYR A 1 4  ? 1.220   7.340   -1.413  1.00 0.00 ? 4  TYR A O    9  
ATOM 10526 C CB   . TYR A 1 4  ? 0.225   9.435   -3.834  1.00 0.00 ? 4  TYR A CB   9  
ATOM 10527 C CG   . TYR A 1 4  ? -1.184  9.870   -4.172  1.00 0.00 ? 4  TYR A CG   9  
ATOM 10528 C CD1  . TYR A 1 4  ? -2.262  9.039   -3.855  1.00 0.00 ? 4  TYR A CD1  9  
ATOM 10529 C CD2  . TYR A 1 4  ? -1.408  11.085  -4.833  1.00 0.00 ? 4  TYR A CD2  9  
ATOM 10530 C CE1  . TYR A 1 4  ? -3.564  9.418   -4.195  1.00 0.00 ? 4  TYR A CE1  9  
ATOM 10531 C CE2  . TYR A 1 4  ? -2.711  11.464  -5.176  1.00 0.00 ? 4  TYR A CE2  9  
ATOM 10532 C CZ   . TYR A 1 4  ? -3.789  10.630  -4.859  1.00 0.00 ? 4  TYR A CZ   9  
ATOM 10533 O OH   . TYR A 1 4  ? -5.073  11.003  -5.196  1.00 0.00 ? 4  TYR A OH   9  
ATOM 10534 H H    . TYR A 1 4  ? 1.122   11.487  -2.443  1.00 0.00 ? 4  TYR A H    9  
ATOM 10535 H HA   . TYR A 1 4  ? -0.451  9.164   -1.775  1.00 0.00 ? 4  TYR A HA   9  
ATOM 10536 H HB2  . TYR A 1 4  ? 0.928   10.117  -4.289  1.00 0.00 ? 4  TYR A HB2  9  
ATOM 10537 H HB3  . TYR A 1 4  ? 0.391   8.444   -4.228  1.00 0.00 ? 4  TYR A HB3  9  
ATOM 10538 H HD1  . TYR A 1 4  ? -2.092  8.113   -3.333  1.00 0.00 ? 4  TYR A HD1  9  
ATOM 10539 H HD2  . TYR A 1 4  ? -0.577  11.729  -5.079  1.00 0.00 ? 4  TYR A HD2  9  
ATOM 10540 H HE1  . TYR A 1 4  ? -4.390  8.768   -3.959  1.00 0.00 ? 4  TYR A HE1  9  
ATOM 10541 H HE2  . TYR A 1 4  ? -2.884  12.399  -5.686  1.00 0.00 ? 4  TYR A HE2  9  
ATOM 10542 H HH   . TYR A 1 4  ? -5.503  11.334  -4.405  1.00 0.00 ? 4  TYR A HH   9  
ATOM 10543 N N    . CYS A 1 5  ? 2.764   8.716   -2.155  1.00 0.00 ? 5  CYS A N    9  
ATOM 10544 C CA   . CYS A 1 5  ? 3.853   7.767   -1.787  1.00 0.00 ? 5  CYS A CA   9  
ATOM 10545 C C    . CYS A 1 5  ? 3.724   7.430   -0.289  1.00 0.00 ? 5  CYS A C    9  
ATOM 10546 O O    . CYS A 1 5  ? 3.879   6.295   0.118   1.00 0.00 ? 5  CYS A O    9  
ATOM 10547 C CB   . CYS A 1 5  ? 5.224   8.415   -2.078  1.00 0.00 ? 5  CYS A CB   9  
ATOM 10548 S SG   . CYS A 1 5  ? 6.296   7.236   -2.944  1.00 0.00 ? 5  CYS A SG   9  
ATOM 10549 H H    . CYS A 1 5  ? 2.980   9.583   -2.558  1.00 0.00 ? 5  CYS A H    9  
ATOM 10550 H HA   . CYS A 1 5  ? 3.745   6.849   -2.351  1.00 0.00 ? 5  CYS A HA   9  
ATOM 10551 H HB2  . CYS A 1 5  ? 5.080   9.287   -2.696  1.00 0.00 ? 5  CYS A HB2  9  
ATOM 10552 H HB3  . CYS A 1 5  ? 5.702   8.714   -1.154  1.00 0.00 ? 5  CYS A HB3  9  
ATOM 10553 N N    . GLU A 1 6  ? 3.460   8.412   0.529   1.00 0.00 ? 6  GLU A N    9  
ATOM 10554 C CA   . GLU A 1 6  ? 3.343   8.164   1.998   1.00 0.00 ? 6  GLU A CA   9  
ATOM 10555 C C    . GLU A 1 6  ? 2.217   7.165   2.297   1.00 0.00 ? 6  GLU A C    9  
ATOM 10556 O O    . GLU A 1 6  ? 2.377   6.265   3.096   1.00 0.00 ? 6  GLU A O    9  
ATOM 10557 C CB   . GLU A 1 6  ? 3.051   9.492   2.704   1.00 0.00 ? 6  GLU A CB   9  
ATOM 10558 C CG   . GLU A 1 6  ? 2.775   9.241   4.188   1.00 0.00 ? 6  GLU A CG   9  
ATOM 10559 C CD   . GLU A 1 6  ? 2.857   10.562  4.956   1.00 0.00 ? 6  GLU A CD   9  
ATOM 10560 O OE1  . GLU A 1 6  ? 3.960   11.050  5.139   1.00 0.00 ? 6  GLU A OE1  9  
ATOM 10561 O OE2  . GLU A 1 6  ? 1.816   11.062  5.349   1.00 0.00 ? 6  GLU A OE2  9  
ATOM 10562 H H    . GLU A 1 6  ? 3.362   9.320   0.175   1.00 0.00 ? 6  GLU A H    9  
ATOM 10563 H HA   . GLU A 1 6  ? 4.274   7.764   2.368   1.00 0.00 ? 6  GLU A HA   9  
ATOM 10564 H HB2  . GLU A 1 6  ? 3.904   10.147  2.602   1.00 0.00 ? 6  GLU A HB2  9  
ATOM 10565 H HB3  . GLU A 1 6  ? 2.186   9.956   2.254   1.00 0.00 ? 6  GLU A HB3  9  
ATOM 10566 H HG2  . GLU A 1 6  ? 1.788   8.818   4.303   1.00 0.00 ? 6  GLU A HG2  9  
ATOM 10567 H HG3  . GLU A 1 6  ? 3.510   8.553   4.579   1.00 0.00 ? 6  GLU A HG3  9  
ATOM 10568 N N    . VAL A 1 7  ? 1.073   7.327   1.691   1.00 0.00 ? 7  VAL A N    9  
ATOM 10569 C CA   . VAL A 1 7  ? -0.057  6.393   1.982   1.00 0.00 ? 7  VAL A CA   9  
ATOM 10570 C C    . VAL A 1 7  ? 0.211   5.004   1.390   1.00 0.00 ? 7  VAL A C    9  
ATOM 10571 O O    . VAL A 1 7  ? -0.110  3.999   1.993   1.00 0.00 ? 7  VAL A O    9  
ATOM 10572 C CB   . VAL A 1 7  ? -1.365  6.975   1.433   1.00 0.00 ? 7  VAL A CB   9  
ATOM 10573 C CG1  . VAL A 1 7  ? -2.496  5.961   1.621   1.00 0.00 ? 7  VAL A CG1  9  
ATOM 10574 C CG2  . VAL A 1 7  ? -1.706  8.285   2.172   1.00 0.00 ? 7  VAL A CG2  9  
ATOM 10575 H H    . VAL A 1 7  ? 0.949   8.069   1.064   1.00 0.00 ? 7  VAL A H    9  
ATOM 10576 H HA   . VAL A 1 7  ? -0.135  6.248   3.057   1.00 0.00 ? 7  VAL A HA   9  
ATOM 10577 H HB   . VAL A 1 7  ? -1.246  7.180   0.380   1.00 0.00 ? 7  VAL A HB   9  
ATOM 10578 H HG11 . VAL A 1 7  ? -3.448  6.459   1.511   1.00 0.00 ? 7  VAL A HG11 9  
ATOM 10579 H HG12 . VAL A 1 7  ? -2.429  5.523   2.604   1.00 0.00 ? 7  VAL A HG12 9  
ATOM 10580 H HG13 . VAL A 1 7  ? -2.409  5.184   0.875   1.00 0.00 ? 7  VAL A HG13 9  
ATOM 10581 H HG21 . VAL A 1 7  ? -1.137  9.097   1.745   1.00 0.00 ? 7  VAL A HG21 9  
ATOM 10582 H HG22 . VAL A 1 7  ? -1.460  8.190   3.221   1.00 0.00 ? 7  VAL A HG22 9  
ATOM 10583 H HG23 . VAL A 1 7  ? -2.761  8.497   2.072   1.00 0.00 ? 7  VAL A HG23 9  
ATOM 10584 N N    . CYS A 1 8  ? 0.799   4.926   0.224   1.00 0.00 ? 8  CYS A N    9  
ATOM 10585 C CA   . CYS A 1 8  ? 1.083   3.593   -0.382  1.00 0.00 ? 8  CYS A CA   9  
ATOM 10586 C C    . CYS A 1 8  ? 1.981   2.796   0.562   1.00 0.00 ? 8  CYS A C    9  
ATOM 10587 O O    . CYS A 1 8  ? 1.740   1.638   0.838   1.00 0.00 ? 8  CYS A O    9  
ATOM 10588 C CB   . CYS A 1 8  ? 1.780   3.807   -1.738  1.00 0.00 ? 8  CYS A CB   9  
ATOM 10589 S SG   . CYS A 1 8  ? 3.564   4.011   -1.522  1.00 0.00 ? 8  CYS A SG   9  
ATOM 10590 H H    . CYS A 1 8  ? 1.068   5.731   -0.264  1.00 0.00 ? 8  CYS A H    9  
ATOM 10591 H HA   . CYS A 1 8  ? 0.163   3.048   -0.540  1.00 0.00 ? 8  CYS A HA   9  
ATOM 10592 H HB2  . CYS A 1 8  ? 1.603   2.955   -2.371  1.00 0.00 ? 8  CYS A HB2  9  
ATOM 10593 H HB3  . CYS A 1 8  ? 1.376   4.691   -2.206  1.00 0.00 ? 8  CYS A HB3  9  
ATOM 10594 N N    . GLU A 1 9  ? 3.021   3.408   1.053   1.00 0.00 ? 9  GLU A N    9  
ATOM 10595 C CA   . GLU A 1 9  ? 3.934   2.685   1.966   1.00 0.00 ? 9  GLU A CA   9  
ATOM 10596 C C    . GLU A 1 9  ? 3.202   2.381   3.268   1.00 0.00 ? 9  GLU A C    9  
ATOM 10597 O O    . GLU A 1 9  ? 3.482   1.392   3.917   1.00 0.00 ? 9  GLU A O    9  
ATOM 10598 C CB   . GLU A 1 9  ? 5.165   3.556   2.261   1.00 0.00 ? 9  GLU A CB   9  
ATOM 10599 C CG   . GLU A 1 9  ? 6.147   3.485   1.087   1.00 0.00 ? 9  GLU A CG   9  
ATOM 10600 C CD   . GLU A 1 9  ? 6.823   2.114   1.068   1.00 0.00 ? 9  GLU A CD   9  
ATOM 10601 O OE1  . GLU A 1 9  ? 7.512   1.801   2.024   1.00 0.00 ? 9  GLU A OE1  9  
ATOM 10602 O OE2  . GLU A 1 9  ? 6.639   1.399   0.096   1.00 0.00 ? 9  GLU A OE2  9  
ATOM 10603 H H    . GLU A 1 9  ? 3.207   4.338   0.811   1.00 0.00 ? 9  GLU A H    9  
ATOM 10604 H HA   . GLU A 1 9  ? 4.246   1.767   1.492   1.00 0.00 ? 9  GLU A HA   9  
ATOM 10605 H HB2  . GLU A 1 9  ? 4.853   4.580   2.406   1.00 0.00 ? 9  GLU A HB2  9  
ATOM 10606 H HB3  . GLU A 1 9  ? 5.655   3.200   3.155   1.00 0.00 ? 9  GLU A HB3  9  
ATOM 10607 H HG2  . GLU A 1 9  ? 5.613   3.637   0.162   1.00 0.00 ? 9  GLU A HG2  9  
ATOM 10608 H HG3  . GLU A 1 9  ? 6.897   4.253   1.201   1.00 0.00 ? 9  GLU A HG3  9  
ATOM 10609 N N    . PHE A 1 10 ? 2.259   3.195   3.673   1.00 0.00 ? 10 PHE A N    9  
ATOM 10610 C CA   . PHE A 1 10 ? 1.550   2.876   4.937   1.00 0.00 ? 10 PHE A CA   9  
ATOM 10611 C C    . PHE A 1 10 ? 0.696   1.615   4.742   1.00 0.00 ? 10 PHE A C    9  
ATOM 10612 O O    . PHE A 1 10 ? 0.741   0.703   5.544   1.00 0.00 ? 10 PHE A O    9  
ATOM 10613 C CB   . PHE A 1 10 ? 0.654   4.038   5.365   1.00 0.00 ? 10 PHE A CB   9  
ATOM 10614 C CG   . PHE A 1 10 ? -0.028  3.645   6.649   1.00 0.00 ? 10 PHE A CG   9  
ATOM 10615 C CD1  . PHE A 1 10 ? 0.630   3.816   7.871   1.00 0.00 ? 10 PHE A CD1  9  
ATOM 10616 C CD2  . PHE A 1 10 ? -1.307  3.080   6.613   1.00 0.00 ? 10 PHE A CD2  9  
ATOM 10617 C CE1  . PHE A 1 10 ? 0.010   3.424   9.062   1.00 0.00 ? 10 PHE A CE1  9  
ATOM 10618 C CE2  . PHE A 1 10 ? -1.932  2.689   7.805   1.00 0.00 ? 10 PHE A CE2  9  
ATOM 10619 C CZ   . PHE A 1 10 ? -1.271  2.860   9.029   1.00 0.00 ? 10 PHE A CZ   9  
ATOM 10620 H H    . PHE A 1 10 ? 2.017   4.002   3.169   1.00 0.00 ? 10 PHE A H    9  
ATOM 10621 H HA   . PHE A 1 10 ? 2.280   2.691   5.703   1.00 0.00 ? 10 PHE A HA   9  
ATOM 10622 H HB2  . PHE A 1 10 ? 1.256   4.921   5.526   1.00 0.00 ? 10 PHE A HB2  9  
ATOM 10623 H HB3  . PHE A 1 10 ? -0.085  4.231   4.604   1.00 0.00 ? 10 PHE A HB3  9  
ATOM 10624 H HD1  . PHE A 1 10 ? 1.618   4.254   7.894   1.00 0.00 ? 10 PHE A HD1  9  
ATOM 10625 H HD2  . PHE A 1 10 ? -1.812  2.956   5.665   1.00 0.00 ? 10 PHE A HD2  9  
ATOM 10626 H HE1  . PHE A 1 10 ? 0.521   3.554   10.006  1.00 0.00 ? 10 PHE A HE1  9  
ATOM 10627 H HE2  . PHE A 1 10 ? -2.919  2.247   7.781   1.00 0.00 ? 10 PHE A HE2  9  
ATOM 10628 H HZ   . PHE A 1 10 ? -1.750  2.557   9.947   1.00 0.00 ? 10 PHE A HZ   9  
ATOM 10629 N N    . LEU A 1 11 ? -0.069  1.537   3.678   1.00 0.00 ? 11 LEU A N    9  
ATOM 10630 C CA   . LEU A 1 11 ? -0.893  0.308   3.457   1.00 0.00 ? 11 LEU A CA   9  
ATOM 10631 C C    . LEU A 1 11 ? 0.047   -0.884  3.299   1.00 0.00 ? 11 LEU A C    9  
ATOM 10632 O O    . LEU A 1 11 ? -0.180  -1.935  3.866   1.00 0.00 ? 11 LEU A O    9  
ATOM 10633 C CB   . LEU A 1 11 ? -1.755  0.436   2.188   1.00 0.00 ? 11 LEU A CB   9  
ATOM 10634 C CG   . LEU A 1 11 ? -2.713  1.631   2.309   1.00 0.00 ? 11 LEU A CG   9  
ATOM 10635 C CD1  . LEU A 1 11 ? -3.251  1.998   0.923   1.00 0.00 ? 11 LEU A CD1  9  
ATOM 10636 C CD2  . LEU A 1 11 ? -3.896  1.280   3.225   1.00 0.00 ? 11 LEU A CD2  9  
ATOM 10637 H H    . LEU A 1 11 ? -0.092  2.273   3.032   1.00 0.00 ? 11 LEU A H    9  
ATOM 10638 H HA   . LEU A 1 11 ? -1.539  0.134   4.303   1.00 0.00 ? 11 LEU A HA   9  
ATOM 10639 H HB2  . LEU A 1 11 ? -1.112  0.579   1.330   1.00 0.00 ? 11 LEU A HB2  9  
ATOM 10640 H HB3  . LEU A 1 11 ? -2.329  -0.477  2.055   1.00 0.00 ? 11 LEU A HB3  9  
ATOM 10641 H HG   . LEU A 1 11 ? -2.180  2.476   2.719   1.00 0.00 ? 11 LEU A HG   9  
ATOM 10642 H HD11 . LEU A 1 11 ? -2.453  2.411   0.326   1.00 0.00 ? 11 LEU A HD11 9  
ATOM 10643 H HD12 . LEU A 1 11 ? -4.041  2.728   1.024   1.00 0.00 ? 11 LEU A HD12 9  
ATOM 10644 H HD13 . LEU A 1 11 ? -3.640  1.112   0.442   1.00 0.00 ? 11 LEU A HD13 9  
ATOM 10645 H HD21 . LEU A 1 11 ? -4.668  2.028   3.115   1.00 0.00 ? 11 LEU A HD21 9  
ATOM 10646 H HD22 . LEU A 1 11 ? -3.566  1.258   4.252   1.00 0.00 ? 11 LEU A HD22 9  
ATOM 10647 H HD23 . LEU A 1 11 ? -4.295  0.313   2.954   1.00 0.00 ? 11 LEU A HD23 9  
ATOM 10648 N N    . VAL A 1 12 ? 1.101   -0.745  2.539   1.00 0.00 ? 12 VAL A N    9  
ATOM 10649 C CA   . VAL A 1 12 ? 2.037   -1.884  2.363   1.00 0.00 ? 12 VAL A CA   9  
ATOM 10650 C C    . VAL A 1 12 ? 2.597   -2.300  3.736   1.00 0.00 ? 12 VAL A C    9  
ATOM 10651 O O    . VAL A 1 12 ? 2.603   -3.461  4.085   1.00 0.00 ? 12 VAL A O    9  
ATOM 10652 C CB   . VAL A 1 12 ? 3.180   -1.429  1.438   1.00 0.00 ? 12 VAL A CB   9  
ATOM 10653 C CG1  . VAL A 1 12 ? 4.386   -2.363  1.561   1.00 0.00 ? 12 VAL A CG1  9  
ATOM 10654 C CG2  . VAL A 1 12 ? 2.689   -1.431  -0.013  1.00 0.00 ? 12 VAL A CG2  9  
ATOM 10655 H H    . VAL A 1 12 ? 1.290   0.093   2.068   1.00 0.00 ? 12 VAL A H    9  
ATOM 10656 H HA   . VAL A 1 12 ? 1.515   -2.723  1.912   1.00 0.00 ? 12 VAL A HA   9  
ATOM 10657 H HB   . VAL A 1 12 ? 3.478   -0.428  1.711   1.00 0.00 ? 12 VAL A HB   9  
ATOM 10658 H HG11 . VAL A 1 12 ? 4.054   -3.389  1.500   1.00 0.00 ? 12 VAL A HG11 9  
ATOM 10659 H HG12 . VAL A 1 12 ? 4.878   -2.199  2.509   1.00 0.00 ? 12 VAL A HG12 9  
ATOM 10660 H HG13 . VAL A 1 12 ? 5.078   -2.157  0.760   1.00 0.00 ? 12 VAL A HG13 9  
ATOM 10661 H HG21 . VAL A 1 12 ? 2.506   -2.449  -0.328  1.00 0.00 ? 12 VAL A HG21 9  
ATOM 10662 H HG22 . VAL A 1 12 ? 3.441   -0.987  -0.648  1.00 0.00 ? 12 VAL A HG22 9  
ATOM 10663 H HG23 . VAL A 1 12 ? 1.775   -0.862  -0.085  1.00 0.00 ? 12 VAL A HG23 9  
ATOM 10664 N N    . LYS A 1 13 ? 3.057   -1.351  4.520   1.00 0.00 ? 13 LYS A N    9  
ATOM 10665 C CA   . LYS A 1 13 ? 3.612   -1.687  5.869   1.00 0.00 ? 13 LYS A CA   9  
ATOM 10666 C C    . LYS A 1 13 ? 2.529   -2.392  6.693   1.00 0.00 ? 13 LYS A C    9  
ATOM 10667 O O    . LYS A 1 13 ? 2.777   -3.372  7.367   1.00 0.00 ? 13 LYS A O    9  
ATOM 10668 C CB   . LYS A 1 13 ? 4.054   -0.389  6.566   1.00 0.00 ? 13 LYS A CB   9  
ATOM 10669 C CG   . LYS A 1 13 ? 4.291   -0.637  8.065   1.00 0.00 ? 13 LYS A CG   9  
ATOM 10670 C CD   . LYS A 1 13 ? 4.992   0.575   8.702   1.00 0.00 ? 13 LYS A CD   9  
ATOM 10671 C CE   . LYS A 1 13 ? 6.396   0.781   8.100   1.00 0.00 ? 13 LYS A CE   9  
ATOM 10672 N NZ   . LYS A 1 13 ? 6.963   -0.525  7.660   1.00 0.00 ? 13 LYS A NZ   9  
ATOM 10673 H H    . LYS A 1 13 ? 3.044   -0.418  4.217   1.00 0.00 ? 13 LYS A H    9  
ATOM 10674 H HA   . LYS A 1 13 ? 4.462   -2.342  5.747   1.00 0.00 ? 13 LYS A HA   9  
ATOM 10675 H HB2  . LYS A 1 13 ? 4.966   -0.040  6.108   1.00 0.00 ? 13 LYS A HB2  9  
ATOM 10676 H HB3  . LYS A 1 13 ? 3.286   0.360   6.446   1.00 0.00 ? 13 LYS A HB3  9  
ATOM 10677 H HG2  . LYS A 1 13 ? 3.337   -0.785  8.554   1.00 0.00 ? 13 LYS A HG2  9  
ATOM 10678 H HG3  . LYS A 1 13 ? 4.897   -1.518  8.197   1.00 0.00 ? 13 LYS A HG3  9  
ATOM 10679 H HD2  . LYS A 1 13 ? 4.394   1.459   8.530   1.00 0.00 ? 13 LYS A HD2  9  
ATOM 10680 H HD3  . LYS A 1 13 ? 5.081   0.409   9.767   1.00 0.00 ? 13 LYS A HD3  9  
ATOM 10681 H HE2  . LYS A 1 13 ? 6.332   1.447   7.251   1.00 0.00 ? 13 LYS A HE2  9  
ATOM 10682 H HE3  . LYS A 1 13 ? 7.045   1.220   8.845   1.00 0.00 ? 13 LYS A HE3  9  
ATOM 10683 H HZ1  . LYS A 1 13 ? 6.907   -1.209  8.442   1.00 0.00 ? 13 LYS A HZ1  9  
ATOM 10684 H HZ2  . LYS A 1 13 ? 7.957   -0.396  7.383   1.00 0.00 ? 13 LYS A HZ2  9  
ATOM 10685 H HZ3  . LYS A 1 13 ? 6.420   -0.885  6.850   1.00 0.00 ? 13 LYS A HZ3  9  
ATOM 10686 N N    . GLU A 1 14 ? 1.337   -1.870  6.662   1.00 0.00 ? 14 GLU A N    9  
ATOM 10687 C CA   . GLU A 1 14 ? 0.230   -2.466  7.461   1.00 0.00 ? 14 GLU A CA   9  
ATOM 10688 C C    . GLU A 1 14 ? -0.185  -3.802  6.846   1.00 0.00 ? 14 GLU A C    9  
ATOM 10689 O O    . GLU A 1 14 ? -0.517  -4.738  7.547   1.00 0.00 ? 14 GLU A O    9  
ATOM 10690 C CB   . GLU A 1 14 ? -0.962  -1.481  7.472   1.00 0.00 ? 14 GLU A CB   9  
ATOM 10691 C CG   . GLU A 1 14 ? -1.616  -1.452  8.860   1.00 0.00 ? 14 GLU A CG   9  
ATOM 10692 C CD   . GLU A 1 14 ? -2.187  -2.832  9.186   1.00 0.00 ? 14 GLU A CD   9  
ATOM 10693 O OE1  . GLU A 1 14 ? -2.696  -3.467  8.280   1.00 0.00 ? 14 GLU A OE1  9  
ATOM 10694 O OE2  . GLU A 1 14 ? -2.103  -3.230  10.336  1.00 0.00 ? 14 GLU A OE2  9  
ATOM 10695 H H    . GLU A 1 14 ? 1.178   -1.073  6.114   1.00 0.00 ? 14 GLU A H    9  
ATOM 10696 H HA   . GLU A 1 14 ? 0.569   -2.630  8.473   1.00 0.00 ? 14 GLU A HA   9  
ATOM 10697 H HB2  . GLU A 1 14 ? -0.602  -0.491  7.231   1.00 0.00 ? 14 GLU A HB2  9  
ATOM 10698 H HB3  . GLU A 1 14 ? -1.698  -1.777  6.737   1.00 0.00 ? 14 GLU A HB3  9  
ATOM 10699 H HG2  . GLU A 1 14 ? -0.877  -1.184  9.601   1.00 0.00 ? 14 GLU A HG2  9  
ATOM 10700 H HG3  . GLU A 1 14 ? -2.411  -0.725  8.869   1.00 0.00 ? 14 GLU A HG3  9  
ATOM 10701 N N    . VAL A 1 15 ? -0.187  -3.902  5.552   1.00 0.00 ? 15 VAL A N    9  
ATOM 10702 C CA   . VAL A 1 15 ? -0.603  -5.179  4.922   1.00 0.00 ? 15 VAL A CA   9  
ATOM 10703 C C    . VAL A 1 15 ? 0.443   -6.271  5.181   1.00 0.00 ? 15 VAL A C    9  
ATOM 10704 O O    . VAL A 1 15 ? 0.102   -7.385  5.497   1.00 0.00 ? 15 VAL A O    9  
ATOM 10705 C CB   . VAL A 1 15 ? -0.806  -4.968  3.412   1.00 0.00 ? 15 VAL A CB   9  
ATOM 10706 C CG1  . VAL A 1 15 ? -0.762  -6.322  2.677   1.00 0.00 ? 15 VAL A CG1  9  
ATOM 10707 C CG2  . VAL A 1 15 ? -2.166  -4.296  3.173   1.00 0.00 ? 15 VAL A CG2  9  
ATOM 10708 H H    . VAL A 1 15 ? 0.072   -3.136  4.997   1.00 0.00 ? 15 VAL A H    9  
ATOM 10709 H HA   . VAL A 1 15 ? -1.540  -5.498  5.359   1.00 0.00 ? 15 VAL A HA   9  
ATOM 10710 H HB   . VAL A 1 15 ? -0.023  -4.328  3.032   1.00 0.00 ? 15 VAL A HB   9  
ATOM 10711 H HG11 . VAL A 1 15 ? -1.328  -6.256  1.762   1.00 0.00 ? 15 VAL A HG11 9  
ATOM 10712 H HG12 . VAL A 1 15 ? -1.188  -7.091  3.306   1.00 0.00 ? 15 VAL A HG12 9  
ATOM 10713 H HG13 . VAL A 1 15 ? 0.269   -6.575  2.453   1.00 0.00 ? 15 VAL A HG13 9  
ATOM 10714 H HG21 . VAL A 1 15 ? -2.277  -4.070  2.123   1.00 0.00 ? 15 VAL A HG21 9  
ATOM 10715 H HG22 . VAL A 1 15 ? -2.222  -3.382  3.745   1.00 0.00 ? 15 VAL A HG22 9  
ATOM 10716 H HG23 . VAL A 1 15 ? -2.958  -4.964  3.484   1.00 0.00 ? 15 VAL A HG23 9  
ATOM 10717 N N    . THR A 1 16 ? 1.707   -5.999  5.026   1.00 0.00 ? 16 THR A N    9  
ATOM 10718 C CA   . THR A 1 16 ? 2.676   -7.106  5.250   1.00 0.00 ? 16 THR A CA   9  
ATOM 10719 C C    . THR A 1 16 ? 2.577   -7.593  6.689   1.00 0.00 ? 16 THR A C    9  
ATOM 10720 O O    . THR A 1 16 ? 2.677   -8.777  6.946   1.00 0.00 ? 16 THR A O    9  
ATOM 10721 C CB   . THR A 1 16 ? 4.120   -6.697  4.963   1.00 0.00 ? 16 THR A CB   9  
ATOM 10722 O OG1  . THR A 1 16 ? 4.667   -6.066  6.112   1.00 0.00 ? 16 THR A OG1  9  
ATOM 10723 C CG2  . THR A 1 16 ? 4.218   -5.743  3.760   1.00 0.00 ? 16 THR A CG2  9  
ATOM 10724 H H    . THR A 1 16 ? 1.998   -5.104  4.753   1.00 0.00 ? 16 THR A H    9  
ATOM 10725 H HA   . THR A 1 16 ? 2.409   -7.911  4.586   1.00 0.00 ? 16 THR A HA   9  
ATOM 10726 H HB   . THR A 1 16 ? 4.676   -7.597  4.749   1.00 0.00 ? 16 THR A HB   9  
ATOM 10727 H HG1  . THR A 1 16 ? 4.360   -6.542  6.887   1.00 0.00 ? 16 THR A HG1  9  
ATOM 10728 H HG21 . THR A 1 16 ? 4.517   -4.767  4.110   1.00 0.00 ? 16 THR A HG21 9  
ATOM 10729 H HG22 . THR A 1 16 ? 3.267   -5.672  3.259   1.00 0.00 ? 16 THR A HG22 9  
ATOM 10730 H HG23 . THR A 1 16 ? 4.958   -6.111  3.063   1.00 0.00 ? 16 THR A HG23 9  
ATOM 10731 N N    . LYS A 1 17 ? 2.373   -6.727  7.641   1.00 0.00 ? 17 LYS A N    9  
ATOM 10732 C CA   . LYS A 1 17 ? 2.271   -7.238  9.030   1.00 0.00 ? 17 LYS A CA   9  
ATOM 10733 C C    . LYS A 1 17 ? 1.055   -8.159  9.079   1.00 0.00 ? 17 LYS A C    9  
ATOM 10734 O O    . LYS A 1 17 ? 1.018   -9.138  9.798   1.00 0.00 ? 17 LYS A O    9  
ATOM 10735 C CB   . LYS A 1 17 ? 2.095   -6.086  10.029  1.00 0.00 ? 17 LYS A CB   9  
ATOM 10736 C CG   . LYS A 1 17 ? 1.575   -6.650  11.366  1.00 0.00 ? 17 LYS A CG   9  
ATOM 10737 C CD   . LYS A 1 17 ? 1.880   -5.698  12.522  1.00 0.00 ? 17 LYS A CD   9  
ATOM 10738 C CE   . LYS A 1 17 ? 1.590   -6.420  13.842  1.00 0.00 ? 17 LYS A CE   9  
ATOM 10739 N NZ   . LYS A 1 17 ? 1.512   -5.423  14.948  1.00 0.00 ? 17 LYS A NZ   9  
ATOM 10740 H H    . LYS A 1 17 ? 2.274   -5.773  7.442   1.00 0.00 ? 17 LYS A H    9  
ATOM 10741 H HA   . LYS A 1 17 ? 3.175   -7.785  9.256   1.00 0.00 ? 17 LYS A HA   9  
ATOM 10742 H HB2  . LYS A 1 17 ? 3.046   -5.595  10.180  1.00 0.00 ? 17 LYS A HB2  9  
ATOM 10743 H HB3  . LYS A 1 17 ? 1.382   -5.376  9.636   1.00 0.00 ? 17 LYS A HB3  9  
ATOM 10744 H HG2  . LYS A 1 17 ? 0.507   -6.792  11.299  1.00 0.00 ? 17 LYS A HG2  9  
ATOM 10745 H HG3  . LYS A 1 17 ? 2.047   -7.603  11.562  1.00 0.00 ? 17 LYS A HG3  9  
ATOM 10746 H HD2  . LYS A 1 17 ? 2.919   -5.405  12.490  1.00 0.00 ? 17 LYS A HD2  9  
ATOM 10747 H HD3  . LYS A 1 17 ? 1.253   -4.822  12.447  1.00 0.00 ? 17 LYS A HD3  9  
ATOM 10748 H HE2  . LYS A 1 17 ? 0.648   -6.952  13.767  1.00 0.00 ? 17 LYS A HE2  9  
ATOM 10749 H HE3  . LYS A 1 17 ? 2.381   -7.126  14.047  1.00 0.00 ? 17 LYS A HE3  9  
ATOM 10750 H HZ1  . LYS A 1 17 ? 1.752   -4.481  14.583  1.00 0.00 ? 17 LYS A HZ1  9  
ATOM 10751 H HZ2  . LYS A 1 17 ? 2.183   -5.686  15.699  1.00 0.00 ? 17 LYS A HZ2  9  
ATOM 10752 H HZ3  . LYS A 1 17 ? 0.547   -5.409  15.335  1.00 0.00 ? 17 LYS A HZ3  9  
ATOM 10753 N N    . LEU A 1 18 ? 0.065   -7.837  8.298   1.00 0.00 ? 18 LEU A N    9  
ATOM 10754 C CA   . LEU A 1 18 ? -1.164  -8.663  8.253   1.00 0.00 ? 18 LEU A CA   9  
ATOM 10755 C C    . LEU A 1 18 ? -0.812  -9.977  7.542   1.00 0.00 ? 18 LEU A C    9  
ATOM 10756 O O    . LEU A 1 18 ? -1.288  -11.037 7.896   1.00 0.00 ? 18 LEU A O    9  
ATOM 10757 C CB   . LEU A 1 18 ? -2.267  -7.889  7.496   1.00 0.00 ? 18 LEU A CB   9  
ATOM 10758 C CG   . LEU A 1 18 ? -2.858  -6.667  8.299   1.00 0.00 ? 18 LEU A CG   9  
ATOM 10759 C CD1  . LEU A 1 18 ? -4.382  -6.789  8.397   1.00 0.00 ? 18 LEU A CD1  9  
ATOM 10760 C CD2  . LEU A 1 18 ? -2.310  -6.539  9.737   1.00 0.00 ? 18 LEU A CD2  9  
ATOM 10761 H H    . LEU A 1 18 ? 0.140   -7.047  7.722   1.00 0.00 ? 18 LEU A H    9  
ATOM 10762 H HA   . LEU A 1 18 ? -1.489  -8.912  9.248   1.00 0.00 ? 18 LEU A HA   9  
ATOM 10763 H HB2  . LEU A 1 18 ? -1.849  -7.522  6.577   1.00 0.00 ? 18 LEU A HB2  9  
ATOM 10764 H HB3  . LEU A 1 18 ? -3.051  -8.567  7.247   1.00 0.00 ? 18 LEU A HB3  9  
ATOM 10765 H HG   . LEU A 1 18 ? -2.629  -5.754  7.760   1.00 0.00 ? 18 LEU A HG   9  
ATOM 10766 H HD11 . LEU A 1 18 ? -4.801  -6.887  7.404   1.00 0.00 ? 18 LEU A HD11 9  
ATOM 10767 H HD12 . LEU A 1 18 ? -4.784  -5.911  8.876   1.00 0.00 ? 18 LEU A HD12 9  
ATOM 10768 H HD13 . LEU A 1 18 ? -4.635  -7.657  8.981   1.00 0.00 ? 18 LEU A HD13 9  
ATOM 10769 H HD21 . LEU A 1 18 ? -2.688  -7.347  10.345  1.00 0.00 ? 18 LEU A HD21 9  
ATOM 10770 H HD22 . LEU A 1 18 ? -2.642  -5.601  10.156  1.00 0.00 ? 18 LEU A HD22 9  
ATOM 10771 H HD23 . LEU A 1 18 ? -1.235  -6.557  9.731   1.00 0.00 ? 18 LEU A HD23 9  
ATOM 10772 N N    . ILE A 1 19 ? 0.059   -9.912  6.572   1.00 0.00 ? 19 ILE A N    9  
ATOM 10773 C CA   . ILE A 1 19 ? 0.495   -11.147 5.864   1.00 0.00 ? 19 ILE A CA   9  
ATOM 10774 C C    . ILE A 1 19 ? 1.388   -11.921 6.825   1.00 0.00 ? 19 ILE A C    9  
ATOM 10775 O O    . ILE A 1 19 ? 1.420   -13.136 6.831   1.00 0.00 ? 19 ILE A O    9  
ATOM 10776 C CB   . ILE A 1 19 ? 1.288   -10.766 4.602   1.00 0.00 ? 19 ILE A CB   9  
ATOM 10777 C CG1  . ILE A 1 19 ? 0.353   -10.039 3.625   1.00 0.00 ? 19 ILE A CG1  9  
ATOM 10778 C CG2  . ILE A 1 19 ? 1.850   -12.024 3.928   1.00 0.00 ? 19 ILE A CG2  9  
ATOM 10779 C CD1  . ILE A 1 19 ? 1.130   -9.597  2.382   1.00 0.00 ? 19 ILE A CD1  9  
ATOM 10780 H H    . ILE A 1 19 ? 0.451   -9.054  6.336   1.00 0.00 ? 19 ILE A H    9  
ATOM 10781 H HA   . ILE A 1 19 ? -0.367  -11.742 5.599   1.00 0.00 ? 19 ILE A HA   9  
ATOM 10782 H HB   . ILE A 1 19 ? 2.110   -10.115 4.875   1.00 0.00 ? 19 ILE A HB   9  
ATOM 10783 H HG12 . ILE A 1 19 ? -0.446  -10.702 3.333   1.00 0.00 ? 19 ILE A HG12 9  
ATOM 10784 H HG13 . ILE A 1 19 ? -0.067  -9.177  4.106   1.00 0.00 ? 19 ILE A HG13 9  
ATOM 10785 H HG21 . ILE A 1 19 ? 1.039   -12.684 3.664   1.00 0.00 ? 19 ILE A HG21 9  
ATOM 10786 H HG22 . ILE A 1 19 ? 2.523   -12.530 4.603   1.00 0.00 ? 19 ILE A HG22 9  
ATOM 10787 H HG23 . ILE A 1 19 ? 2.391   -11.743 3.036   1.00 0.00 ? 19 ILE A HG23 9  
ATOM 10788 H HD11 . ILE A 1 19 ? 2.096   -9.217  2.676   1.00 0.00 ? 19 ILE A HD11 9  
ATOM 10789 H HD12 . ILE A 1 19 ? 0.578   -8.822  1.873   1.00 0.00 ? 19 ILE A HD12 9  
ATOM 10790 H HD13 . ILE A 1 19 ? 1.259   -10.440 1.721   1.00 0.00 ? 19 ILE A HD13 9  
ATOM 10791 N N    . ASP A 1 20 ? 2.118   -11.210 7.638   1.00 0.00 ? 20 ASP A N    9  
ATOM 10792 C CA   . ASP A 1 20 ? 3.026   -11.868 8.610   1.00 0.00 ? 20 ASP A CA   9  
ATOM 10793 C C    . ASP A 1 20 ? 2.222   -12.444 9.776   1.00 0.00 ? 20 ASP A C    9  
ATOM 10794 O O    . ASP A 1 20 ? 2.677   -13.351 10.445  1.00 0.00 ? 20 ASP A O    9  
ATOM 10795 C CB   . ASP A 1 20 ? 4.022   -10.838 9.144   1.00 0.00 ? 20 ASP A CB   9  
ATOM 10796 C CG   . ASP A 1 20 ? 5.084   -11.545 9.990   1.00 0.00 ? 20 ASP A CG   9  
ATOM 10797 O OD1  . ASP A 1 20 ? 5.993   -12.114 9.409   1.00 0.00 ? 20 ASP A OD1  9  
ATOM 10798 O OD2  . ASP A 1 20 ? 4.970   -11.505 11.203  1.00 0.00 ? 20 ASP A OD2  9  
ATOM 10799 H H    . ASP A 1 20 ? 2.071   -10.231 7.607   1.00 0.00 ? 20 ASP A H    9  
ATOM 10800 H HA   . ASP A 1 20 ? 3.567   -12.669 8.129   1.00 0.00 ? 20 ASP A HA   9  
ATOM 10801 H HB2  . ASP A 1 20 ? 4.498   -10.334 8.316   1.00 0.00 ? 20 ASP A HB2  9  
ATOM 10802 H HB3  . ASP A 1 20 ? 3.501   -10.116 9.756   1.00 0.00 ? 20 ASP A HB3  9  
ATOM 10803 N N    . ASN A 1 21 ? 1.035   -11.936 10.041  1.00 0.00 ? 21 ASN A N    9  
ATOM 10804 C CA   . ASN A 1 21 ? 0.241   -12.489 11.191  1.00 0.00 ? 21 ASN A CA   9  
ATOM 10805 C C    . ASN A 1 21 ? -0.609  -13.671 10.703  1.00 0.00 ? 21 ASN A C    9  
ATOM 10806 O O    . ASN A 1 21 ? -1.326  -14.278 11.470  1.00 0.00 ? 21 ASN A O    9  
ATOM 10807 C CB   . ASN A 1 21 ? -0.626  -11.402 11.832  1.00 0.00 ? 21 ASN A CB   9  
ATOM 10808 C CG   . ASN A 1 21 ? -1.400  -11.994 13.011  1.00 0.00 ? 21 ASN A CG   9  
ATOM 10809 O OD1  . ASN A 1 21 ? -2.396  -11.445 13.437  1.00 0.00 ? 21 ASN A OD1  9  
ATOM 10810 N ND2  . ASN A 1 21 ? -0.980  -13.101 13.561  1.00 0.00 ? 21 ASN A ND2  9  
ATOM 10811 H H    . ASN A 1 21 ? 0.679   -11.207 9.492   1.00 0.00 ? 21 ASN A H    9  
ATOM 10812 H HA   . ASN A 1 21 ? 0.947   -12.889 11.905  1.00 0.00 ? 21 ASN A HA   9  
ATOM 10813 H HB2  . ASN A 1 21 ? 0.006   -10.595 12.184  1.00 0.00 ? 21 ASN A HB2  9  
ATOM 10814 H HB3  . ASN A 1 21 ? -1.323  -11.019 11.103  1.00 0.00 ? 21 ASN A HB3  9  
ATOM 10815 H HD21 . ASN A 1 21 ? -0.175  -13.544 13.218  1.00 0.00 ? 21 ASN A HD21 9  
ATOM 10816 H HD22 . ASN A 1 21 ? -1.468  -13.489 14.317  1.00 0.00 ? 21 ASN A HD22 9  
ATOM 10817 N N    . ASN A 1 22 ? -0.469  -14.044 9.449   1.00 0.00 ? 22 ASN A N    9  
ATOM 10818 C CA   . ASN A 1 22 ? -1.193  -15.250 8.904   1.00 0.00 ? 22 ASN A CA   9  
ATOM 10819 C C    . ASN A 1 22 ? -2.673  -14.982 8.588   1.00 0.00 ? 22 ASN A C    9  
ATOM 10820 O O    . ASN A 1 22 ? -3.517  -15.812 8.864   1.00 0.00 ? 22 ASN A O    9  
ATOM 10821 C CB   . ASN A 1 22 ? -1.106  -16.411 9.916   1.00 0.00 ? 22 ASN A CB   9  
ATOM 10822 C CG   . ASN A 1 22 ? 0.256   -16.384 10.616  1.00 0.00 ? 22 ASN A CG   9  
ATOM 10823 O OD1  . ASN A 1 22 ? 1.251   -16.024 10.020  1.00 0.00 ? 22 ASN A OD1  9  
ATOM 10824 N ND2  . ASN A 1 22 ? 0.340   -16.751 11.866  1.00 0.00 ? 22 ASN A ND2  9  
ATOM 10825 H H    . ASN A 1 22 ? 0.160   -13.557 8.866   1.00 0.00 ? 22 ASN A H    9  
ATOM 10826 H HA   . ASN A 1 22 ? -0.679  -15.566 8.006   1.00 0.00 ? 22 ASN A HA   9  
ATOM 10827 H HB2  . ASN A 1 22 ? -1.895  -16.325 10.649  1.00 0.00 ? 22 ASN A HB2  9  
ATOM 10828 H HB3  . ASN A 1 22 ? -1.214  -17.350 9.392   1.00 0.00 ? 22 ASN A HB3  9  
ATOM 10829 H HD21 . ASN A 1 22 ? -0.462  -17.041 12.348  1.00 0.00 ? 22 ASN A HD21 9  
ATOM 10830 H HD22 . ASN A 1 22 ? 1.207   -16.737 12.323  1.00 0.00 ? 22 ASN A HD22 9  
ATOM 10831 N N    . LYS A 1 23 ? -3.011  -13.864 8.005   1.00 0.00 ? 23 LYS A N    9  
ATOM 10832 C CA   . LYS A 1 23 ? -4.453  -13.604 7.673   1.00 0.00 ? 23 LYS A CA   9  
ATOM 10833 C C    . LYS A 1 23 ? -4.699  -13.982 6.201   1.00 0.00 ? 23 LYS A C    9  
ATOM 10834 O O    . LYS A 1 23 ? -3.811  -13.912 5.374   1.00 0.00 ? 23 LYS A O    9  
ATOM 10835 C CB   . LYS A 1 23 ? -4.759  -12.123 7.895   1.00 0.00 ? 23 LYS A CB   9  
ATOM 10836 C CG   . LYS A 1 23 ? -4.125  -11.611 9.228   1.00 0.00 ? 23 LYS A CG   9  
ATOM 10837 C CD   . LYS A 1 23 ? -5.182  -10.943 10.130  1.00 0.00 ? 23 LYS A CD   9  
ATOM 10838 C CE   . LYS A 1 23 ? -4.585  -10.690 11.516  1.00 0.00 ? 23 LYS A CE   9  
ATOM 10839 N NZ   . LYS A 1 23 ? -5.648  -10.187 12.430  1.00 0.00 ? 23 LYS A NZ   9  
ATOM 10840 H H    . LYS A 1 23 ? -2.326  -13.203 7.774   1.00 0.00 ? 23 LYS A H    9  
ATOM 10841 H HA   . LYS A 1 23 ? -5.087  -14.174 8.317   1.00 0.00 ? 23 LYS A HA   9  
ATOM 10842 H HB2  . LYS A 1 23 ? -4.357  -11.581 7.065   1.00 0.00 ? 23 LYS A HB2  9  
ATOM 10843 H HB3  . LYS A 1 23 ? -5.832  -11.989 7.924   1.00 0.00 ? 23 LYS A HB3  9  
ATOM 10844 H HG2  . LYS A 1 23 ? -3.685  -12.436 9.771   1.00 0.00 ? 23 LYS A HG2  9  
ATOM 10845 H HG3  . LYS A 1 23 ? -3.351  -10.890 9.006   1.00 0.00 ? 23 LYS A HG3  9  
ATOM 10846 H HD2  . LYS A 1 23 ? -5.495  -9.998  9.699   1.00 0.00 ? 23 LYS A HD2  9  
ATOM 10847 H HD3  . LYS A 1 23 ? -6.035  -11.594 10.229  1.00 0.00 ? 23 LYS A HD3  9  
ATOM 10848 H HE2  . LYS A 1 23 ? -4.181  -11.613 11.908  1.00 0.00 ? 23 LYS A HE2  9  
ATOM 10849 H HE3  . LYS A 1 23 ? -3.798  -9.956  11.441  1.00 0.00 ? 23 LYS A HE3  9  
ATOM 10850 H HZ1  . LYS A 1 23 ? -5.398  -10.416 13.413  1.00 0.00 ? 23 LYS A HZ1  9  
ATOM 10851 H HZ2  . LYS A 1 23 ? -6.554  -10.637 12.187  1.00 0.00 ? 23 LYS A HZ2  9  
ATOM 10852 H HZ3  . LYS A 1 23 ? -5.733  -9.156  12.329  1.00 0.00 ? 23 LYS A HZ3  9  
ATOM 10853 N N    . THR A 1 24 ? -5.910  -14.379 5.872   1.00 0.00 ? 24 THR A N    9  
ATOM 10854 C CA   . THR A 1 24 ? -6.233  -14.761 4.460   1.00 0.00 ? 24 THR A CA   9  
ATOM 10855 C C    . THR A 1 24 ? -6.467  -13.516 3.601   1.00 0.00 ? 24 THR A C    9  
ATOM 10856 O O    . THR A 1 24 ? -6.570  -12.417 4.102   1.00 0.00 ? 24 THR A O    9  
ATOM 10857 C CB   . THR A 1 24 ? -7.513  -15.607 4.417   1.00 0.00 ? 24 THR A CB   9  
ATOM 10858 O OG1  . THR A 1 24 ? -8.643  -14.746 4.368   1.00 0.00 ? 24 THR A OG1  9  
ATOM 10859 C CG2  . THR A 1 24 ? -7.606  -16.487 5.657   1.00 0.00 ? 24 THR A CG2  9  
ATOM 10860 H H    . THR A 1 24 ? -6.606  -14.427 6.560   1.00 0.00 ? 24 THR A H    9  
ATOM 10861 H HA   . THR A 1 24 ? -5.420  -15.324 4.027   1.00 0.00 ? 24 THR A HA   9  
ATOM 10862 H HB   . THR A 1 24 ? -7.503  -16.232 3.537   1.00 0.00 ? 24 THR A HB   9  
ATOM 10863 H HG1  . THR A 1 24 ? -9.294  -15.076 4.991   1.00 0.00 ? 24 THR A HG1  9  
ATOM 10864 H HG21 . THR A 1 24 ? -8.476  -17.122 5.575   1.00 0.00 ? 24 THR A HG21 9  
ATOM 10865 H HG22 . THR A 1 24 ? -7.695  -15.866 6.532   1.00 0.00 ? 24 THR A HG22 9  
ATOM 10866 H HG23 . THR A 1 24 ? -6.719  -17.097 5.733   1.00 0.00 ? 24 THR A HG23 9  
ATOM 10867 N N    . GLU A 1 25 ? -6.591  -13.698 2.311   1.00 0.00 ? 25 GLU A N    9  
ATOM 10868 C CA   . GLU A 1 25 ? -6.857  -12.538 1.408   1.00 0.00 ? 25 GLU A CA   9  
ATOM 10869 C C    . GLU A 1 25 ? -8.232  -11.953 1.772   1.00 0.00 ? 25 GLU A C    9  
ATOM 10870 O O    . GLU A 1 25 ? -8.401  -10.755 1.878   1.00 0.00 ? 25 GLU A O    9  
ATOM 10871 C CB   . GLU A 1 25 ? -6.848  -13.020 -0.048  1.00 0.00 ? 25 GLU A CB   9  
ATOM 10872 C CG   . GLU A 1 25 ? -6.772  -11.822 -1.001  1.00 0.00 ? 25 GLU A CG   9  
ATOM 10873 C CD   . GLU A 1 25 ? -7.263  -12.236 -2.392  1.00 0.00 ? 25 GLU A CD   9  
ATOM 10874 O OE1  . GLU A 1 25 ? -6.509  -12.892 -3.092  1.00 0.00 ? 25 GLU A OE1  9  
ATOM 10875 O OE2  . GLU A 1 25 ? -8.382  -11.890 -2.731  1.00 0.00 ? 25 GLU A OE2  9  
ATOM 10876 H H    . GLU A 1 25 ? -6.533  -14.607 1.952   1.00 0.00 ? 25 GLU A H    9  
ATOM 10877 H HA   . GLU A 1 25 ? -6.096  -11.784 1.556   1.00 0.00 ? 25 GLU A HA   9  
ATOM 10878 H HB2  . GLU A 1 25 ? -5.987  -13.656 -0.206  1.00 0.00 ? 25 GLU A HB2  9  
ATOM 10879 H HB3  . GLU A 1 25 ? -7.748  -13.582 -0.243  1.00 0.00 ? 25 GLU A HB3  9  
ATOM 10880 H HG2  . GLU A 1 25 ? -7.391  -11.019 -0.626  1.00 0.00 ? 25 GLU A HG2  9  
ATOM 10881 H HG3  . GLU A 1 25 ? -5.749  -11.487 -1.071  1.00 0.00 ? 25 GLU A HG3  9  
ATOM 10882 N N    . LYS A 1 26 ? -9.212  -12.799 1.957   1.00 0.00 ? 26 LYS A N    9  
ATOM 10883 C CA   . LYS A 1 26 ? -10.585 -12.321 2.308   1.00 0.00 ? 26 LYS A CA   9  
ATOM 10884 C C    . LYS A 1 26 ? -10.545 -11.427 3.559   1.00 0.00 ? 26 LYS A C    9  
ATOM 10885 O O    . LYS A 1 26 ? -11.324 -10.504 3.692   1.00 0.00 ? 26 LYS A O    9  
ATOM 10886 C CB   . LYS A 1 26 ? -11.498 -13.542 2.565   1.00 0.00 ? 26 LYS A CB   9  
ATOM 10887 C CG   . LYS A 1 26 ? -12.247 -13.932 1.280   1.00 0.00 ? 26 LYS A CG   9  
ATOM 10888 C CD   . LYS A 1 26 ? -12.810 -15.349 1.420   1.00 0.00 ? 26 LYS A CD   9  
ATOM 10889 C CE   . LYS A 1 26 ? -13.792 -15.399 2.592   1.00 0.00 ? 26 LYS A CE   9  
ATOM 10890 N NZ   . LYS A 1 26 ? -14.623 -16.632 2.489   1.00 0.00 ? 26 LYS A NZ   9  
ATOM 10891 H H    . LYS A 1 26 ? -9.047  -13.758 1.856   1.00 0.00 ? 26 LYS A H    9  
ATOM 10892 H HA   . LYS A 1 26 ? -10.981 -11.741 1.498   1.00 0.00 ? 26 LYS A HA   9  
ATOM 10893 H HB2  . LYS A 1 26 ? -10.893 -14.376 2.888   1.00 0.00 ? 26 LYS A HB2  9  
ATOM 10894 H HB3  . LYS A 1 26 ? -12.221 -13.309 3.335   1.00 0.00 ? 26 LYS A HB3  9  
ATOM 10895 H HG2  . LYS A 1 26 ? -13.059 -13.237 1.115   1.00 0.00 ? 26 LYS A HG2  9  
ATOM 10896 H HG3  . LYS A 1 26 ? -11.570 -13.896 0.443   1.00 0.00 ? 26 LYS A HG3  9  
ATOM 10897 H HD2  . LYS A 1 26 ? -13.320 -15.624 0.508   1.00 0.00 ? 26 LYS A HD2  9  
ATOM 10898 H HD3  . LYS A 1 26 ? -12.000 -16.041 1.601   1.00 0.00 ? 26 LYS A HD3  9  
ATOM 10899 H HE2  . LYS A 1 26 ? -13.243 -15.413 3.522   1.00 0.00 ? 26 LYS A HE2  9  
ATOM 10900 H HE3  . LYS A 1 26 ? -14.433 -14.530 2.565   1.00 0.00 ? 26 LYS A HE3  9  
ATOM 10901 H HZ1  . LYS A 1 26 ? -14.950 -16.910 3.436   1.00 0.00 ? 26 LYS A HZ1  9  
ATOM 10902 H HZ2  . LYS A 1 26 ? -14.054 -17.400 2.078   1.00 0.00 ? 26 LYS A HZ2  9  
ATOM 10903 H HZ3  . LYS A 1 26 ? -15.447 -16.446 1.882   1.00 0.00 ? 26 LYS A HZ3  9  
ATOM 10904 N N    . GLU A 1 27 ? -9.664  -11.693 4.475   1.00 0.00 ? 27 GLU A N    9  
ATOM 10905 C CA   . GLU A 1 27 ? -9.604  -10.860 5.711   1.00 0.00 ? 27 GLU A CA   9  
ATOM 10906 C C    . GLU A 1 27 ? -8.908  -9.518  5.434   1.00 0.00 ? 27 GLU A C    9  
ATOM 10907 O O    . GLU A 1 27 ? -9.281  -8.501  5.985   1.00 0.00 ? 27 GLU A O    9  
ATOM 10908 C CB   . GLU A 1 27 ? -8.834  -11.617 6.794   1.00 0.00 ? 27 GLU A CB   9  
ATOM 10909 C CG   . GLU A 1 27 ? -9.711  -12.734 7.368   1.00 0.00 ? 27 GLU A CG   9  
ATOM 10910 C CD   . GLU A 1 27 ? -10.823 -12.124 8.224   1.00 0.00 ? 27 GLU A CD   9  
ATOM 10911 O OE1  . GLU A 1 27 ? -10.498 -11.450 9.189   1.00 0.00 ? 27 GLU A OE1  9  
ATOM 10912 O OE2  . GLU A 1 27 ? -11.979 -12.340 7.901   1.00 0.00 ? 27 GLU A OE2  9  
ATOM 10913 H H    . GLU A 1 27 ? -9.048  -12.446 4.353   1.00 0.00 ? 27 GLU A H    9  
ATOM 10914 H HA   . GLU A 1 27 ? -10.605 -10.670 6.070   1.00 0.00 ? 27 GLU A HA   9  
ATOM 10915 H HB2  . GLU A 1 27 ? -7.938  -12.043 6.371   1.00 0.00 ? 27 GLU A HB2  9  
ATOM 10916 H HB3  . GLU A 1 27 ? -8.572  -10.933 7.583   1.00 0.00 ? 27 GLU A HB3  9  
ATOM 10917 H HG2  . GLU A 1 27 ? -10.148 -13.299 6.559   1.00 0.00 ? 27 GLU A HG2  9  
ATOM 10918 H HG3  . GLU A 1 27 ? -9.108  -13.387 7.980   1.00 0.00 ? 27 GLU A HG3  9  
ATOM 10919 N N    . ILE A 1 28 ? -7.905  -9.491  4.598   1.00 0.00 ? 28 ILE A N    9  
ATOM 10920 C CA   . ILE A 1 28 ? -7.211  -8.197  4.320   1.00 0.00 ? 28 ILE A CA   9  
ATOM 10921 C C    . ILE A 1 28 ? -8.198  -7.246  3.649   1.00 0.00 ? 28 ILE A C    9  
ATOM 10922 O O    . ILE A 1 28 ? -8.218  -6.063  3.926   1.00 0.00 ? 28 ILE A O    9  
ATOM 10923 C CB   . ILE A 1 28 ? -6.003  -8.468  3.405   1.00 0.00 ? 28 ILE A CB   9  
ATOM 10924 C CG1  . ILE A 1 28 ? -5.249  -9.728  3.933   1.00 0.00 ? 28 ILE A CG1  9  
ATOM 10925 C CG2  . ILE A 1 28 ? -5.097  -7.232  3.359   1.00 0.00 ? 28 ILE A CG2  9  
ATOM 10926 C CD1  . ILE A 1 28 ? -3.723  -9.558  3.959   1.00 0.00 ? 28 ILE A CD1  9  
ATOM 10927 H H    . ILE A 1 28 ? -7.607  -10.313 4.154   1.00 0.00 ? 28 ILE A H    9  
ATOM 10928 H HA   . ILE A 1 28 ? -6.879  -7.764  5.253   1.00 0.00 ? 28 ILE A HA   9  
ATOM 10929 H HB   . ILE A 1 28 ? -6.365  -8.660  2.408   1.00 0.00 ? 28 ILE A HB   9  
ATOM 10930 H HG12 . ILE A 1 28 ? -5.582  -9.949  4.926   1.00 0.00 ? 28 ILE A HG12 9  
ATOM 10931 H HG13 . ILE A 1 28 ? -5.486  -10.562 3.306   1.00 0.00 ? 28 ILE A HG13 9  
ATOM 10932 H HG21 . ILE A 1 28 ? -4.670  -7.055  4.333   1.00 0.00 ? 28 ILE A HG21 9  
ATOM 10933 H HG22 . ILE A 1 28 ? -5.678  -6.377  3.058   1.00 0.00 ? 28 ILE A HG22 9  
ATOM 10934 H HG23 . ILE A 1 28 ? -4.307  -7.396  2.641   1.00 0.00 ? 28 ILE A HG23 9  
ATOM 10935 H HD11 . ILE A 1 28 ? -3.270  -10.485 4.294   1.00 0.00 ? 28 ILE A HD11 9  
ATOM 10936 H HD12 . ILE A 1 28 ? -3.456  -8.766  4.638   1.00 0.00 ? 28 ILE A HD12 9  
ATOM 10937 H HD13 . ILE A 1 28 ? -3.366  -9.324  2.966   1.00 0.00 ? 28 ILE A HD13 9  
ATOM 10938 N N    . LEU A 1 29 ? -9.023  -7.746  2.778   1.00 0.00 ? 29 LEU A N    9  
ATOM 10939 C CA   . LEU A 1 29 ? -10.013 -6.867  2.104   1.00 0.00 ? 29 LEU A CA   9  
ATOM 10940 C C    . LEU A 1 29 ? -11.126 -6.493  3.091   1.00 0.00 ? 29 LEU A C    9  
ATOM 10941 O O    . LEU A 1 29 ? -11.719 -5.439  3.012   1.00 0.00 ? 29 LEU A O    9  
ATOM 10942 C CB   . LEU A 1 29 ? -10.596 -7.613  0.903   1.00 0.00 ? 29 LEU A CB   9  
ATOM 10943 C CG   . LEU A 1 29 ? -9.452  -8.113  0.012   1.00 0.00 ? 29 LEU A CG   9  
ATOM 10944 C CD1  . LEU A 1 29 ? -10.031 -8.953  -1.131  1.00 0.00 ? 29 LEU A CD1  9  
ATOM 10945 C CD2  . LEU A 1 29 ? -8.681  -6.915  -0.570  1.00 0.00 ? 29 LEU A CD2  9  
ATOM 10946 H H    . LEU A 1 29 ? -8.997  -8.701  2.557   1.00 0.00 ? 29 LEU A H    9  
ATOM 10947 H HA   . LEU A 1 29 ? -9.523  -5.967  1.766   1.00 0.00 ? 29 LEU A HA   9  
ATOM 10948 H HB2  . LEU A 1 29 ? -11.176 -8.458  1.253   1.00 0.00 ? 29 LEU A HB2  9  
ATOM 10949 H HB3  . LEU A 1 29 ? -11.230 -6.949  0.337   1.00 0.00 ? 29 LEU A HB3  9  
ATOM 10950 H HG   . LEU A 1 29 ? -8.777  -8.725  0.602   1.00 0.00 ? 29 LEU A HG   9  
ATOM 10951 H HD11 . LEU A 1 29 ? -9.278  -9.093  -1.893  1.00 0.00 ? 29 LEU A HD11 9  
ATOM 10952 H HD12 . LEU A 1 29 ? -10.883 -8.442  -1.557  1.00 0.00 ? 29 LEU A HD12 9  
ATOM 10953 H HD13 . LEU A 1 29 ? -10.341 -9.913  -0.750  1.00 0.00 ? 29 LEU A HD13 9  
ATOM 10954 H HD21 . LEU A 1 29 ? -7.970  -6.554  0.159   1.00 0.00 ? 29 LEU A HD21 9  
ATOM 10955 H HD22 . LEU A 1 29 ? -9.371  -6.123  -0.820  1.00 0.00 ? 29 LEU A HD22 9  
ATOM 10956 H HD23 . LEU A 1 29 ? -8.152  -7.221  -1.462  1.00 0.00 ? 29 LEU A HD23 9  
ATOM 10957 N N    . ASP A 1 30 ? -11.399 -7.351  4.037   1.00 0.00 ? 30 ASP A N    9  
ATOM 10958 C CA   . ASP A 1 30 ? -12.449 -7.036  5.050   1.00 0.00 ? 30 ASP A CA   9  
ATOM 10959 C C    . ASP A 1 30 ? -11.944 -5.887  5.933   1.00 0.00 ? 30 ASP A C    9  
ATOM 10960 O O    . ASP A 1 30 ? -12.669 -4.962  6.240   1.00 0.00 ? 30 ASP A O    9  
ATOM 10961 C CB   . ASP A 1 30 ? -12.719 -8.270  5.914   1.00 0.00 ? 30 ASP A CB   9  
ATOM 10962 C CG   . ASP A 1 30 ? -13.883 -7.983  6.864   1.00 0.00 ? 30 ASP A CG   9  
ATOM 10963 O OD1  . ASP A 1 30 ? -14.915 -7.538  6.387   1.00 0.00 ? 30 ASP A OD1  9  
ATOM 10964 O OD2  . ASP A 1 30 ? -13.724 -8.213  8.051   1.00 0.00 ? 30 ASP A OD2  9  
ATOM 10965 H H    . ASP A 1 30 ? -10.903 -8.195  4.076   1.00 0.00 ? 30 ASP A H    9  
ATOM 10966 H HA   . ASP A 1 30 ? -13.360 -6.723  4.561   1.00 0.00 ? 30 ASP A HA   9  
ATOM 10967 H HB2  . ASP A 1 30 ? -12.970 -9.107  5.277   1.00 0.00 ? 30 ASP A HB2  9  
ATOM 10968 H HB3  . ASP A 1 30 ? -11.837 -8.507  6.490   1.00 0.00 ? 30 ASP A HB3  9  
ATOM 10969 N N    . ALA A 1 31 ? -10.713 -5.953  6.360   1.00 0.00 ? 31 ALA A N    9  
ATOM 10970 C CA   . ALA A 1 31 ? -10.158 -4.885  7.244   1.00 0.00 ? 31 ALA A CA   9  
ATOM 10971 C C    . ALA A 1 31 ? -10.006 -3.565  6.471   1.00 0.00 ? 31 ALA A C    9  
ATOM 10972 O O    . ALA A 1 31 ? -10.032 -2.500  7.056   1.00 0.00 ? 31 ALA A O    9  
ATOM 10973 C CB   . ALA A 1 31 ? -8.794  -5.341  7.768   1.00 0.00 ? 31 ALA A CB   9  
ATOM 10974 H H    . ALA A 1 31 ? -10.152 -6.718  6.111   1.00 0.00 ? 31 ALA A H    9  
ATOM 10975 H HA   . ALA A 1 31 ? -10.822 -4.732  8.082   1.00 0.00 ? 31 ALA A HA   9  
ATOM 10976 H HB1  . ALA A 1 31 ? -8.871  -6.357  8.128   1.00 0.00 ? 31 ALA A HB1  9  
ATOM 10977 H HB2  . ALA A 1 31 ? -8.484  -4.698  8.576   1.00 0.00 ? 31 ALA A HB2  9  
ATOM 10978 H HB3  . ALA A 1 31 ? -8.068  -5.299  6.970   1.00 0.00 ? 31 ALA A HB3  9  
ATOM 10979 N N    . PHE A 1 32 ? -9.869  -3.608  5.176   1.00 0.00 ? 32 PHE A N    9  
ATOM 10980 C CA   . PHE A 1 32 ? -9.743  -2.338  4.394   1.00 0.00 ? 32 PHE A CA   9  
ATOM 10981 C C    . PHE A 1 32 ? -10.889 -1.397  4.768   1.00 0.00 ? 32 PHE A C    9  
ATOM 10982 O O    . PHE A 1 32 ? -10.863 -0.221  4.461   1.00 0.00 ? 32 PHE A O    9  
ATOM 10983 C CB   . PHE A 1 32 ? -9.820  -2.691  2.898   1.00 0.00 ? 32 PHE A CB   9  
ATOM 10984 C CG   . PHE A 1 32 ? -8.462  -3.111  2.338   1.00 0.00 ? 32 PHE A CG   9  
ATOM 10985 C CD1  . PHE A 1 32 ? -7.384  -3.496  3.173   1.00 0.00 ? 32 PHE A CD1  9  
ATOM 10986 C CD2  . PHE A 1 32 ? -8.280  -3.099  0.949   1.00 0.00 ? 32 PHE A CD2  9  
ATOM 10987 C CE1  . PHE A 1 32 ? -6.156  -3.853  2.607   1.00 0.00 ? 32 PHE A CE1  9  
ATOM 10988 C CE2  . PHE A 1 32 ? -7.048  -3.457  0.391   1.00 0.00 ? 32 PHE A CE2  9  
ATOM 10989 C CZ   . PHE A 1 32 ? -5.987  -3.830  1.220   1.00 0.00 ? 32 PHE A CZ   9  
ATOM 10990 H H    . PHE A 1 32 ? -9.864  -4.465  4.702   1.00 0.00 ? 32 PHE A H    9  
ATOM 10991 H HA   . PHE A 1 32 ? -8.804  -1.854  4.601   1.00 0.00 ? 32 PHE A HA   9  
ATOM 10992 H HB2  . PHE A 1 32 ? -10.515 -3.499  2.765   1.00 0.00 ? 32 PHE A HB2  9  
ATOM 10993 H HB3  . PHE A 1 32 ? -10.175 -1.832  2.346   1.00 0.00 ? 32 PHE A HB3  9  
ATOM 10994 H HD1  . PHE A 1 32 ? -7.496  -3.538  4.243   1.00 0.00 ? 32 PHE A HD1  9  
ATOM 10995 H HD2  . PHE A 1 32 ? -9.099  -2.815  0.304   1.00 0.00 ? 32 PHE A HD2  9  
ATOM 10996 H HE1  . PHE A 1 32 ? -5.332  -4.133  3.245   1.00 0.00 ? 32 PHE A HE1  9  
ATOM 10997 H HE2  . PHE A 1 32 ? -6.917  -3.445  -0.681  1.00 0.00 ? 32 PHE A HE2  9  
ATOM 10998 H HZ   . PHE A 1 32 ? -5.037  -4.107  0.789   1.00 0.00 ? 32 PHE A HZ   9  
ATOM 10999 N N    . ASP A 1 33 ? -11.901 -1.901  5.414   1.00 0.00 ? 33 ASP A N    9  
ATOM 11000 C CA   . ASP A 1 33 ? -13.050 -1.032  5.787   1.00 0.00 ? 33 ASP A CA   9  
ATOM 11001 C C    . ASP A 1 33 ? -12.729 -0.268  7.081   1.00 0.00 ? 33 ASP A C    9  
ATOM 11002 O O    . ASP A 1 33 ? -13.294 0.777   7.338   1.00 0.00 ? 33 ASP A O    9  
ATOM 11003 C CB   . ASP A 1 33 ? -14.301 -1.907  5.967   1.00 0.00 ? 33 ASP A CB   9  
ATOM 11004 C CG   . ASP A 1 33 ? -15.393 -1.134  6.717   1.00 0.00 ? 33 ASP A CG   9  
ATOM 11005 O OD1  . ASP A 1 33 ? -15.959 -0.228  6.129   1.00 0.00 ? 33 ASP A OD1  9  
ATOM 11006 O OD2  . ASP A 1 33 ? -15.641 -1.463  7.865   1.00 0.00 ? 33 ASP A OD2  9  
ATOM 11007 H H    . ASP A 1 33 ? -11.911 -2.854  5.645   1.00 0.00 ? 33 ASP A H    9  
ATOM 11008 H HA   . ASP A 1 33 ? -13.230 -0.319  4.994   1.00 0.00 ? 33 ASP A HA   9  
ATOM 11009 H HB2  . ASP A 1 33 ? -14.675 -2.192  4.993   1.00 0.00 ? 33 ASP A HB2  9  
ATOM 11010 H HB3  . ASP A 1 33 ? -14.044 -2.795  6.521   1.00 0.00 ? 33 ASP A HB3  9  
ATOM 11011 N N    . LYS A 1 34 ? -11.826 -0.771  7.896   1.00 0.00 ? 34 LYS A N    9  
ATOM 11012 C CA   . LYS A 1 34 ? -11.466 -0.062  9.173   1.00 0.00 ? 34 LYS A CA   9  
ATOM 11013 C C    . LYS A 1 34 ? -9.974  0.290   9.176   1.00 0.00 ? 34 LYS A C    9  
ATOM 11014 O O    . LYS A 1 34 ? -9.434  0.707   10.180  1.00 0.00 ? 34 LYS A O    9  
ATOM 11015 C CB   . LYS A 1 34 ? -11.750 -0.977  10.370  1.00 0.00 ? 34 LYS A CB   9  
ATOM 11016 C CG   . LYS A 1 34 ? -13.155 -1.573  10.256  1.00 0.00 ? 34 LYS A CG   9  
ATOM 11017 C CD   . LYS A 1 34 ? -13.604 -2.103  11.620  1.00 0.00 ? 34 LYS A CD   9  
ATOM 11018 C CE   . LYS A 1 34 ? -12.683 -3.244  12.051  1.00 0.00 ? 34 LYS A CE   9  
ATOM 11019 N NZ   . LYS A 1 34 ? -13.304 -3.982  13.188  1.00 0.00 ? 34 LYS A NZ   9  
ATOM 11020 H H    . LYS A 1 34 ? -11.380 -1.616  7.678   1.00 0.00 ? 34 LYS A H    9  
ATOM 11021 H HA   . LYS A 1 34 ? -12.046 0.845   9.275   1.00 0.00 ? 34 LYS A HA   9  
ATOM 11022 H HB2  . LYS A 1 34 ? -11.022 -1.775  10.390  1.00 0.00 ? 34 LYS A HB2  9  
ATOM 11023 H HB3  . LYS A 1 34 ? -11.676 -0.402  11.282  1.00 0.00 ? 34 LYS A HB3  9  
ATOM 11024 H HG2  . LYS A 1 34 ? -13.844 -0.811  9.921   1.00 0.00 ? 34 LYS A HG2  9  
ATOM 11025 H HG3  . LYS A 1 34 ? -13.141 -2.384  9.547   1.00 0.00 ? 34 LYS A HG3  9  
ATOM 11026 H HD2  . LYS A 1 34 ? -13.559 -1.307  12.349  1.00 0.00 ? 34 LYS A HD2  9  
ATOM 11027 H HD3  . LYS A 1 34 ? -14.617 -2.468  11.548  1.00 0.00 ? 34 LYS A HD3  9  
ATOM 11028 H HE2  . LYS A 1 34 ? -12.534 -3.920  11.221  1.00 0.00 ? 34 LYS A HE2  9  
ATOM 11029 H HE3  . LYS A 1 34 ? -11.731 -2.840  12.361  1.00 0.00 ? 34 LYS A HE3  9  
ATOM 11030 H HZ1  . LYS A 1 34 ? -14.082 -3.417  13.584  1.00 0.00 ? 34 LYS A HZ1  9  
ATOM 11031 H HZ2  . LYS A 1 34 ? -12.588 -4.153  13.923  1.00 0.00 ? 34 LYS A HZ2  9  
ATOM 11032 H HZ3  . LYS A 1 34 ? -13.678 -4.891  12.850  1.00 0.00 ? 34 LYS A HZ3  9  
ATOM 11033 N N    . MET A 1 35 ? -9.296  0.120   8.069   1.00 0.00 ? 35 MET A N    9  
ATOM 11034 C CA   . MET A 1 35 ? -7.836  0.445   8.035   1.00 0.00 ? 35 MET A CA   9  
ATOM 11035 C C    . MET A 1 35 ? -7.650  1.951   7.813   1.00 0.00 ? 35 MET A C    9  
ATOM 11036 O O    . MET A 1 35 ? -6.831  2.565   8.470   1.00 0.00 ? 35 MET A O    9  
ATOM 11037 C CB   . MET A 1 35 ? -7.153  -0.368  6.911   1.00 0.00 ? 35 MET A CB   9  
ATOM 11038 C CG   . MET A 1 35 ? -5.904  -1.081  7.433   1.00 0.00 ? 35 MET A CG   9  
ATOM 11039 S SD   . MET A 1 35 ? -4.911  -1.664  6.030   1.00 0.00 ? 35 MET A SD   9  
ATOM 11040 C CE   . MET A 1 35 ? -5.141  -3.445  6.276   1.00 0.00 ? 35 MET A CE   9  
ATOM 11041 H H    . MET A 1 35 ? -9.743  -0.224  7.267   1.00 0.00 ? 35 MET A H    9  
ATOM 11042 H HA   . MET A 1 35 ? -7.400  0.182   8.991   1.00 0.00 ? 35 MET A HA   9  
ATOM 11043 H HB2  . MET A 1 35 ? -7.843  -1.105  6.562   1.00 0.00 ? 35 MET A HB2  9  
ATOM 11044 H HB3  . MET A 1 35 ? -6.872  0.277   6.089   1.00 0.00 ? 35 MET A HB3  9  
ATOM 11045 H HG2  . MET A 1 35 ? -5.324  -0.392  8.026   1.00 0.00 ? 35 MET A HG2  9  
ATOM 11046 H HG3  . MET A 1 35 ? -6.203  -1.918  8.043   1.00 0.00 ? 35 MET A HG3  9  
ATOM 11047 H HE1  . MET A 1 35 ? -6.191  -3.689  6.187   1.00 0.00 ? 35 MET A HE1  9  
ATOM 11048 H HE2  . MET A 1 35 ? -4.795  -3.718  7.259   1.00 0.00 ? 35 MET A HE2  9  
ATOM 11049 H HE3  . MET A 1 35 ? -4.574  -3.988  5.534   1.00 0.00 ? 35 MET A HE3  9  
ATOM 11050 N N    . CYS A 1 36 ? -8.382  2.580   6.923   1.00 0.00 ? 36 CYS A N    9  
ATOM 11051 C CA   . CYS A 1 36 ? -8.161  4.041   6.768   1.00 0.00 ? 36 CYS A CA   9  
ATOM 11052 C C    . CYS A 1 36 ? -8.577  4.693   8.079   1.00 0.00 ? 36 CYS A C    9  
ATOM 11053 O O    . CYS A 1 36 ? -8.463  5.889   8.263   1.00 0.00 ? 36 CYS A O    9  
ATOM 11054 C CB   . CYS A 1 36 ? -8.973  4.628   5.609   1.00 0.00 ? 36 CYS A CB   9  
ATOM 11055 S SG   . CYS A 1 36 ? -8.148  6.117   5.010   1.00 0.00 ? 36 CYS A SG   9  
ATOM 11056 H H    . CYS A 1 36 ? -9.058  2.112   6.389   1.00 0.00 ? 36 CYS A H    9  
ATOM 11057 H HA   . CYS A 1 36 ? -7.106  4.212   6.618   1.00 0.00 ? 36 CYS A HA   9  
ATOM 11058 H HB2  . CYS A 1 36 ? -9.037  3.911   4.810   1.00 0.00 ? 36 CYS A HB2  9  
ATOM 11059 H HB3  . CYS A 1 36 ? -9.968  4.884   5.941   1.00 0.00 ? 36 CYS A HB3  9  
ATOM 11060 N N    . SER A 1 37 ? -9.070  3.905   8.993   1.00 0.00 ? 37 SER A N    9  
ATOM 11061 C CA   . SER A 1 37 ? -9.509  4.469   10.304  1.00 0.00 ? 37 SER A CA   9  
ATOM 11062 C C    . SER A 1 37 ? -8.309  4.628   11.246  1.00 0.00 ? 37 SER A C    9  
ATOM 11063 O O    . SER A 1 37 ? -8.476  4.867   12.426  1.00 0.00 ? 37 SER A O    9  
ATOM 11064 C CB   . SER A 1 37 ? -10.531 3.530   10.945  1.00 0.00 ? 37 SER A CB   9  
ATOM 11065 O OG   . SER A 1 37 ? -11.212 4.217   11.987  1.00 0.00 ? 37 SER A OG   9  
ATOM 11066 H H    . SER A 1 37 ? -9.157  2.934   8.809   1.00 0.00 ? 37 SER A H    9  
ATOM 11067 H HA   . SER A 1 37 ? -9.967  5.435   10.145  1.00 0.00 ? 37 SER A HA   9  
ATOM 11068 H HB2  . SER A 1 37 ? -11.246 3.213   10.205  1.00 0.00 ? 37 SER A HB2  9  
ATOM 11069 H HB3  . SER A 1 37 ? -10.022 2.663   11.345  1.00 0.00 ? 37 SER A HB3  9  
ATOM 11070 H HG   . SER A 1 37 ? -10.597 4.838   12.384  1.00 0.00 ? 37 SER A HG   9  
ATOM 11071 N N    . LYS A 1 38 ? -7.101  4.498   10.739  1.00 0.00 ? 38 LYS A N    9  
ATOM 11072 C CA   . LYS A 1 38 ? -5.884  4.640   11.613  1.00 0.00 ? 38 LYS A CA   9  
ATOM 11073 C C    . LYS A 1 38 ? -5.018  5.817   11.131  1.00 0.00 ? 38 LYS A C    9  
ATOM 11074 O O    . LYS A 1 38 ? -3.889  5.973   11.555  1.00 0.00 ? 38 LYS A O    9  
ATOM 11075 C CB   . LYS A 1 38 ? -5.071  3.337   11.570  1.00 0.00 ? 38 LYS A CB   9  
ATOM 11076 C CG   . LYS A 1 38 ? -5.730  2.289   12.472  1.00 0.00 ? 38 LYS A CG   9  
ATOM 11077 C CD   . LYS A 1 38 ? -4.985  0.959   12.339  1.00 0.00 ? 38 LYS A CD   9  
ATOM 11078 C CE   . LYS A 1 38 ? -5.781  -0.147  13.035  1.00 0.00 ? 38 LYS A CE   9  
ATOM 11079 N NZ   . LYS A 1 38 ? -7.155  -0.208  12.462  1.00 0.00 ? 38 LYS A NZ   9  
ATOM 11080 H H    . LYS A 1 38 ? -6.993  4.304   9.785   1.00 0.00 ? 38 LYS A H    9  
ATOM 11081 H HA   . LYS A 1 38 ? -6.184  4.833   12.635  1.00 0.00 ? 38 LYS A HA   9  
ATOM 11082 H HB2  . LYS A 1 38 ? -5.038  2.963   10.559  1.00 0.00 ? 38 LYS A HB2  9  
ATOM 11083 H HB3  . LYS A 1 38 ? -4.066  3.524   11.920  1.00 0.00 ? 38 LYS A HB3  9  
ATOM 11084 H HG2  . LYS A 1 38 ? -5.693  2.624   13.499  1.00 0.00 ? 38 LYS A HG2  9  
ATOM 11085 H HG3  . LYS A 1 38 ? -6.760  2.154   12.174  1.00 0.00 ? 38 LYS A HG3  9  
ATOM 11086 H HD2  . LYS A 1 38 ? -4.867  0.717   11.293  1.00 0.00 ? 38 LYS A HD2  9  
ATOM 11087 H HD3  . LYS A 1 38 ? -4.013  1.045   12.801  1.00 0.00 ? 38 LYS A HD3  9  
ATOM 11088 H HE2  . LYS A 1 38 ? -5.285  -1.095  12.884  1.00 0.00 ? 38 LYS A HE2  9  
ATOM 11089 H HE3  . LYS A 1 38 ? -5.841  0.064   14.093  1.00 0.00 ? 38 LYS A HE3  9  
ATOM 11090 H HZ1  . LYS A 1 38 ? -7.608  -1.101  12.743  1.00 0.00 ? 38 LYS A HZ1  9  
ATOM 11091 H HZ2  . LYS A 1 38 ? -7.099  -0.159  11.424  1.00 0.00 ? 38 LYS A HZ2  9  
ATOM 11092 H HZ3  . LYS A 1 38 ? -7.716  0.590   12.819  1.00 0.00 ? 38 LYS A HZ3  9  
ATOM 11093 N N    . LEU A 1 39 ? -5.540  6.651   10.258  1.00 0.00 ? 39 LEU A N    9  
ATOM 11094 C CA   . LEU A 1 39 ? -4.759  7.835   9.749   1.00 0.00 ? 39 LEU A CA   9  
ATOM 11095 C C    . LEU A 1 39 ? -5.555  9.117   10.067  1.00 0.00 ? 39 LEU A C    9  
ATOM 11096 O O    . LEU A 1 39 ? -6.766  9.098   9.975   1.00 0.00 ? 39 LEU A O    9  
ATOM 11097 C CB   . LEU A 1 39 ? -4.612  7.728   8.221   1.00 0.00 ? 39 LEU A CB   9  
ATOM 11098 C CG   . LEU A 1 39 ? -3.890  6.432   7.830   1.00 0.00 ? 39 LEU A CG   9  
ATOM 11099 C CD1  . LEU A 1 39 ? -3.885  6.305   6.306   1.00 0.00 ? 39 LEU A CD1  9  
ATOM 11100 C CD2  . LEU A 1 39 ? -2.440  6.454   8.336   1.00 0.00 ? 39 LEU A CD2  9  
ATOM 11101 H H    . LEU A 1 39 ? -6.456  6.504   9.940   1.00 0.00 ? 39 LEU A H    9  
ATOM 11102 H HA   . LEU A 1 39 ? -3.788  7.864   10.212  1.00 0.00 ? 39 LEU A HA   9  
ATOM 11103 H HB2  . LEU A 1 39 ? -5.595  7.735   7.774   1.00 0.00 ? 39 LEU A HB2  9  
ATOM 11104 H HB3  . LEU A 1 39 ? -4.052  8.570   7.850   1.00 0.00 ? 39 LEU A HB3  9  
ATOM 11105 H HG   . LEU A 1 39 ? -4.412  5.591   8.254   1.00 0.00 ? 39 LEU A HG   9  
ATOM 11106 H HD11 . LEU A 1 39 ? -3.163  6.991   5.895   1.00 0.00 ? 39 LEU A HD11 9  
ATOM 11107 H HD12 . LEU A 1 39 ? -4.865  6.538   5.919   1.00 0.00 ? 39 LEU A HD12 9  
ATOM 11108 H HD13 . LEU A 1 39 ? -3.619  5.297   6.030   1.00 0.00 ? 39 LEU A HD13 9  
ATOM 11109 H HD21 . LEU A 1 39 ? -2.418  6.207   9.387   1.00 0.00 ? 39 LEU A HD21 9  
ATOM 11110 H HD22 . LEU A 1 39 ? -2.020  7.436   8.185   1.00 0.00 ? 39 LEU A HD22 9  
ATOM 11111 H HD23 . LEU A 1 39 ? -1.854  5.732   7.788   1.00 0.00 ? 39 LEU A HD23 9  
ATOM 11112 N N    . PRO A 1 40 ? -4.888  10.208  10.421  1.00 0.00 ? 40 PRO A N    9  
ATOM 11113 C CA   . PRO A 1 40 ? -5.602  11.459  10.719  1.00 0.00 ? 40 PRO A CA   9  
ATOM 11114 C C    . PRO A 1 40 ? -6.678  11.730  9.648   1.00 0.00 ? 40 PRO A C    9  
ATOM 11115 O O    . PRO A 1 40 ? -6.613  11.189  8.562   1.00 0.00 ? 40 PRO A O    9  
ATOM 11116 C CB   . PRO A 1 40 ? -4.499  12.545  10.761  1.00 0.00 ? 40 PRO A CB   9  
ATOM 11117 C CG   . PRO A 1 40 ? -3.131  11.806  10.762  1.00 0.00 ? 40 PRO A CG   9  
ATOM 11118 C CD   . PRO A 1 40 ? -3.415  10.302  10.560  1.00 0.00 ? 40 PRO A CD   9  
ATOM 11119 H HA   . PRO A 1 40 ? -6.074  11.376  11.683  1.00 0.00 ? 40 PRO A HA   9  
ATOM 11120 H HB2  . PRO A 1 40 ? -4.572  13.189  9.893   1.00 0.00 ? 40 PRO A HB2  9  
ATOM 11121 H HB3  . PRO A 1 40 ? -4.590  13.137  11.662  1.00 0.00 ? 40 PRO A HB3  9  
ATOM 11122 H HG2  . PRO A 1 40 ? -2.509  12.180  9.955   1.00 0.00 ? 40 PRO A HG2  9  
ATOM 11123 H HG3  . PRO A 1 40 ? -2.625  11.958  11.707  1.00 0.00 ? 40 PRO A HG3  9  
ATOM 11124 H HD2  . PRO A 1 40 ? -2.923  9.950   9.675   1.00 0.00 ? 40 PRO A HD2  9  
ATOM 11125 H HD3  . PRO A 1 40 ? -3.090  9.736   11.422  1.00 0.00 ? 40 PRO A HD3  9  
ATOM 11126 N N    . LYS A 1 41 ? -7.673  12.528  9.924   1.00 0.00 ? 41 LYS A N    9  
ATOM 11127 C CA   . LYS A 1 41 ? -8.726  12.766  8.891   1.00 0.00 ? 41 LYS A CA   9  
ATOM 11128 C C    . LYS A 1 41 ? -8.153  13.478  7.661   1.00 0.00 ? 41 LYS A C    9  
ATOM 11129 O O    . LYS A 1 41 ? -8.794  13.560  6.632   1.00 0.00 ? 41 LYS A O    9  
ATOM 11130 C CB   . LYS A 1 41 ? -9.857  13.607  9.486   1.00 0.00 ? 41 LYS A CB   9  
ATOM 11131 C CG   . LYS A 1 41 ? -11.144 13.402  8.668   1.00 0.00 ? 41 LYS A CG   9  
ATOM 11132 C CD   . LYS A 1 41 ? -12.241 14.395  9.123   1.00 0.00 ? 41 LYS A CD   9  
ATOM 11133 C CE   . LYS A 1 41 ? -12.231 15.649  8.237   1.00 0.00 ? 41 LYS A CE   9  
ATOM 11134 N NZ   . LYS A 1 41 ? -10.854 16.210  8.171   1.00 0.00 ? 41 LYS A NZ   9  
ATOM 11135 H H    . LYS A 1 41 ? -7.741  12.962  10.801  1.00 0.00 ? 41 LYS A H    9  
ATOM 11136 H HA   . LYS A 1 41 ? -9.122  11.824  8.542   1.00 0.00 ? 41 LYS A HA   9  
ATOM 11137 H HB2  . LYS A 1 41 ? -10.026 13.305  10.507  1.00 0.00 ? 41 LYS A HB2  9  
ATOM 11138 H HB3  . LYS A 1 41 ? -9.577  14.649  9.461   1.00 0.00 ? 41 LYS A HB3  9  
ATOM 11139 H HG2  . LYS A 1 41 ? -10.928 13.548  7.619   1.00 0.00 ? 41 LYS A HG2  9  
ATOM 11140 H HG3  . LYS A 1 41 ? -11.495 12.390  8.817   1.00 0.00 ? 41 LYS A HG3  9  
ATOM 11141 H HD2  . LYS A 1 41 ? -13.209 13.920  9.046   1.00 0.00 ? 41 LYS A HD2  9  
ATOM 11142 H HD3  . LYS A 1 41 ? -12.072 14.686  10.151  1.00 0.00 ? 41 LYS A HD3  9  
ATOM 11143 H HE2  . LYS A 1 41 ? -12.560 15.388  7.242   1.00 0.00 ? 41 LYS A HE2  9  
ATOM 11144 H HE3  . LYS A 1 41 ? -12.901 16.388  8.653   1.00 0.00 ? 41 LYS A HE3  9  
ATOM 11145 H HZ1  . LYS A 1 41 ? -10.244 15.571  7.625   1.00 0.00 ? 41 LYS A HZ1  9  
ATOM 11146 H HZ2  . LYS A 1 41 ? -10.476 16.312  9.135   1.00 0.00 ? 41 LYS A HZ2  9  
ATOM 11147 H HZ3  . LYS A 1 41 ? -10.880 17.141  7.709   1.00 0.00 ? 41 LYS A HZ3  9  
ATOM 11148 N N    . SER A 1 42 ? -6.995  14.065  7.773   1.00 0.00 ? 42 SER A N    9  
ATOM 11149 C CA   . SER A 1 42 ? -6.455  14.847  6.623   1.00 0.00 ? 42 SER A CA   9  
ATOM 11150 C C    . SER A 1 42 ? -5.984  13.972  5.457   1.00 0.00 ? 42 SER A C    9  
ATOM 11151 O O    . SER A 1 42 ? -5.786  14.450  4.358   1.00 0.00 ? 42 SER A O    9  
ATOM 11152 C CB   . SER A 1 42 ? -5.325  15.764  7.087   1.00 0.00 ? 42 SER A CB   9  
ATOM 11153 O OG   . SER A 1 42 ? -4.662  16.303  5.952   1.00 0.00 ? 42 SER A OG   9  
ATOM 11154 H H    . SER A 1 42 ? -6.510  14.042  8.624   1.00 0.00 ? 42 SER A H    9  
ATOM 11155 H HA   . SER A 1 42 ? -7.256  15.440  6.213   1.00 0.00 ? 42 SER A HA   9  
ATOM 11156 H HB2  . SER A 1 42 ? -5.731  16.569  7.677   1.00 0.00 ? 42 SER A HB2  9  
ATOM 11157 H HB3  . SER A 1 42 ? -4.628  15.197  7.690   1.00 0.00 ? 42 SER A HB3  9  
ATOM 11158 H HG   . SER A 1 42 ? -3.746  16.462  6.190   1.00 0.00 ? 42 SER A HG   9  
ATOM 11159 N N    . LEU A 1 43 ? -5.823  12.690  5.686   1.00 0.00 ? 43 LEU A N    9  
ATOM 11160 C CA   . LEU A 1 43 ? -5.382  11.762  4.585   1.00 0.00 ? 43 LEU A CA   9  
ATOM 11161 C C    . LEU A 1 43 ? -6.515  10.783  4.275   1.00 0.00 ? 43 LEU A C    9  
ATOM 11162 O O    . LEU A 1 43 ? -6.379  9.936   3.415   1.00 0.00 ? 43 LEU A O    9  
ATOM 11163 C CB   . LEU A 1 43 ? -4.148  10.952  5.012   1.00 0.00 ? 43 LEU A CB   9  
ATOM 11164 C CG   . LEU A 1 43 ? -3.093  11.855  5.650   1.00 0.00 ? 43 LEU A CG   9  
ATOM 11165 C CD1  . LEU A 1 43 ? -1.834  11.044  5.959   1.00 0.00 ? 43 LEU A CD1  9  
ATOM 11166 C CD2  . LEU A 1 43 ? -2.735  13.005  4.701   1.00 0.00 ? 43 LEU A CD2  9  
ATOM 11167 H H    . LEU A 1 43 ? -6.011  12.333  6.580   1.00 0.00 ? 43 LEU A H    9  
ATOM 11168 H HA   . LEU A 1 43 ? -5.145  12.322  3.689   1.00 0.00 ? 43 LEU A HA   9  
ATOM 11169 H HB2  . LEU A 1 43 ? -4.447  10.205  5.728   1.00 0.00 ? 43 LEU A HB2  9  
ATOM 11170 H HB3  . LEU A 1 43 ? -3.724  10.470  4.144   1.00 0.00 ? 43 LEU A HB3  9  
ATOM 11171 H HG   . LEU A 1 43 ? -3.485  12.246  6.565   1.00 0.00 ? 43 LEU A HG   9  
ATOM 11172 H HD11 . LEU A 1 43 ? -1.590  10.419  5.113   1.00 0.00 ? 43 LEU A HD11 9  
ATOM 11173 H HD12 . LEU A 1 43 ? -2.010  10.426  6.826   1.00 0.00 ? 43 LEU A HD12 9  
ATOM 11174 H HD13 . LEU A 1 43 ? -1.011  11.715  6.159   1.00 0.00 ? 43 LEU A HD13 9  
ATOM 11175 H HD21 . LEU A 1 43 ? -2.566  12.614  3.710   1.00 0.00 ? 43 LEU A HD21 9  
ATOM 11176 H HD22 . LEU A 1 43 ? -1.837  13.492  5.052   1.00 0.00 ? 43 LEU A HD22 9  
ATOM 11177 H HD23 . LEU A 1 43 ? -3.541  13.718  4.675   1.00 0.00 ? 43 LEU A HD23 9  
ATOM 11178 N N    . SER A 1 44 ? -7.620  10.878  4.980   1.00 0.00 ? 44 SER A N    9  
ATOM 11179 C CA   . SER A 1 44 ? -8.769  9.940   4.740   1.00 0.00 ? 44 SER A CA   9  
ATOM 11180 C C    . SER A 1 44 ? -8.902  9.640   3.249   1.00 0.00 ? 44 SER A C    9  
ATOM 11181 O O    . SER A 1 44 ? -8.801  8.523   2.790   1.00 0.00 ? 44 SER A O    9  
ATOM 11182 C CB   . SER A 1 44 ? -10.061 10.583  5.246   1.00 0.00 ? 44 SER A CB   9  
ATOM 11183 O OG   . SER A 1 44 ? -11.171 9.794   4.837   1.00 0.00 ? 44 SER A OG   9  
ATOM 11184 H H    . SER A 1 44 ? -7.692  11.559  5.681   1.00 0.00 ? 44 SER A H    9  
ATOM 11185 H HA   . SER A 1 44 ? -8.594  9.014   5.277   1.00 0.00 ? 44 SER A HA   9  
ATOM 11186 H HB2  . SER A 1 44 ? -10.042 10.637  6.322   1.00 0.00 ? 44 SER A HB2  9  
ATOM 11187 H HB3  . SER A 1 44 ? -10.146 11.583  4.840   1.00 0.00 ? 44 SER A HB3  9  
ATOM 11188 H HG   . SER A 1 44 ? -11.735 9.655   5.601   1.00 0.00 ? 44 SER A HG   9  
ATOM 11189 N N    . GLU A 1 45 ? -9.290  10.661  2.535   1.00 0.00 ? 45 GLU A N    9  
ATOM 11190 C CA   . GLU A 1 45 ? -9.644  10.574  1.094   1.00 0.00 ? 45 GLU A CA   9  
ATOM 11191 C C    . GLU A 1 45 ? -8.630  9.964   0.139   1.00 0.00 ? 45 GLU A C    9  
ATOM 11192 O O    . GLU A 1 45 ? -8.926  9.047   -0.603  1.00 0.00 ? 45 GLU A O    9  
ATOM 11193 C CB   . GLU A 1 45 ? -9.897  12.000  0.604   1.00 0.00 ? 45 GLU A CB   9  
ATOM 11194 C CG   . GLU A 1 45 ? -11.034 12.633  1.410   1.00 0.00 ? 45 GLU A CG   9  
ATOM 11195 C CD   . GLU A 1 45 ? -11.221 14.086  0.972   1.00 0.00 ? 45 GLU A CD   9  
ATOM 11196 O OE1  . GLU A 1 45 ? -11.541 14.300  -0.186  1.00 0.00 ? 45 GLU A OE1  9  
ATOM 11197 O OE2  . GLU A 1 45 ? -11.039 14.962  1.802   1.00 0.00 ? 45 GLU A OE2  9  
ATOM 11198 H H    . GLU A 1 45 ? -9.451  11.529  2.959   1.00 0.00 ? 45 GLU A H    9  
ATOM 11199 H HA   . GLU A 1 45 ? -10.568 10.033  1.000   1.00 0.00 ? 45 GLU A HA   9  
ATOM 11200 H HB2  . GLU A 1 45 ? -8.991  12.587  0.730   1.00 0.00 ? 45 GLU A HB2  9  
ATOM 11201 H HB3  . GLU A 1 45 ? -10.164 11.981  -0.442  1.00 0.00 ? 45 GLU A HB3  9  
ATOM 11202 H HG2  . GLU A 1 45 ? -11.948 12.083  1.234   1.00 0.00 ? 45 GLU A HG2  9  
ATOM 11203 H HG3  . GLU A 1 45 ? -10.793 12.603  2.460   1.00 0.00 ? 45 GLU A HG3  9  
ATOM 11204 N N    . GLU A 1 46 ? -7.437  10.462  0.157   1.00 0.00 ? 46 GLU A N    9  
ATOM 11205 C CA   . GLU A 1 46 ? -6.394  9.918   -0.737  1.00 0.00 ? 46 GLU A CA   9  
ATOM 11206 C C    . GLU A 1 46 ? -6.234  8.422   -0.482  1.00 0.00 ? 46 GLU A C    9  
ATOM 11207 O O    . GLU A 1 46 ? -5.773  7.693   -1.330  1.00 0.00 ? 46 GLU A O    9  
ATOM 11208 C CB   . GLU A 1 46 ? -5.072  10.641  -0.465  1.00 0.00 ? 46 GLU A CB   9  
ATOM 11209 C CG   . GLU A 1 46 ? -5.327  12.142  -0.281  1.00 0.00 ? 46 GLU A CG   9  
ATOM 11210 C CD   . GLU A 1 46 ? -6.169  12.672  -1.444  1.00 0.00 ? 46 GLU A CD   9  
ATOM 11211 O OE1  . GLU A 1 46 ? -5.904  12.281  -2.569  1.00 0.00 ? 46 GLU A OE1  9  
ATOM 11212 O OE2  . GLU A 1 46 ? -7.066  13.459  -1.190  1.00 0.00 ? 46 GLU A OE2  9  
ATOM 11213 H H    . GLU A 1 46 ? -7.223  11.205  0.757   1.00 0.00 ? 46 GLU A H    9  
ATOM 11214 H HA   . GLU A 1 46 ? -6.682  10.065  -1.763  1.00 0.00 ? 46 GLU A HA   9  
ATOM 11215 H HB2  . GLU A 1 46 ? -4.622  10.240  0.432   1.00 0.00 ? 46 GLU A HB2  9  
ATOM 11216 H HB3  . GLU A 1 46 ? -4.404  10.494  -1.296  1.00 0.00 ? 46 GLU A HB3  9  
ATOM 11217 H HG2  . GLU A 1 46 ? -5.850  12.308  0.649   1.00 0.00 ? 46 GLU A HG2  9  
ATOM 11218 H HG3  . GLU A 1 46 ? -4.386  12.663  -0.258  1.00 0.00 ? 46 GLU A HG3  9  
ATOM 11219 N N    . CYS A 1 47 ? -6.624  7.947   0.667   1.00 0.00 ? 47 CYS A N    9  
ATOM 11220 C CA   . CYS A 1 47 ? -6.495  6.491   0.932   1.00 0.00 ? 47 CYS A CA   9  
ATOM 11221 C C    . CYS A 1 47 ? -7.659  5.777   0.244   1.00 0.00 ? 47 CYS A C    9  
ATOM 11222 O O    . CYS A 1 47 ? -7.490  4.747   -0.378  1.00 0.00 ? 47 CYS A O    9  
ATOM 11223 C CB   . CYS A 1 47 ? -6.530  6.247   2.454   1.00 0.00 ? 47 CYS A CB   9  
ATOM 11224 S SG   . CYS A 1 47 ? -8.226  5.911   3.008   1.00 0.00 ? 47 CYS A SG   9  
ATOM 11225 H H    . CYS A 1 47 ? -7.013  8.539   1.344   1.00 0.00 ? 47 CYS A H    9  
ATOM 11226 H HA   . CYS A 1 47 ? -5.567  6.131   0.511   1.00 0.00 ? 47 CYS A HA   9  
ATOM 11227 H HB2  . CYS A 1 47 ? -5.905  5.403   2.700   1.00 0.00 ? 47 CYS A HB2  9  
ATOM 11228 H HB3  . CYS A 1 47 ? -6.164  7.128   2.966   1.00 0.00 ? 47 CYS A HB3  9  
ATOM 11229 N N    . GLN A 1 48 ? -8.839  6.312   0.355   1.00 0.00 ? 48 GLN A N    9  
ATOM 11230 C CA   . GLN A 1 48 ? -10.006 5.654   -0.288  1.00 0.00 ? 48 GLN A CA   9  
ATOM 11231 C C    . GLN A 1 48 ? -9.702  5.426   -1.762  1.00 0.00 ? 48 GLN A C    9  
ATOM 11232 O O    . GLN A 1 48 ? -9.951  4.367   -2.304  1.00 0.00 ? 48 GLN A O    9  
ATOM 11233 C CB   . GLN A 1 48 ? -11.244 6.541   -0.156  1.00 0.00 ? 48 GLN A CB   9  
ATOM 11234 C CG   . GLN A 1 48 ? -11.740 6.506   1.288   1.00 0.00 ? 48 GLN A CG   9  
ATOM 11235 C CD   . GLN A 1 48 ? -12.355 5.139   1.590   1.00 0.00 ? 48 GLN A CD   9  
ATOM 11236 O OE1  . GLN A 1 48 ? -11.659 4.216   1.965   1.00 0.00 ? 48 GLN A OE1  9  
ATOM 11237 N NE2  . GLN A 1 48 ? -13.641 4.970   1.444   1.00 0.00 ? 48 GLN A NE2  9  
ATOM 11238 H H    . GLN A 1 48 ? -8.954  7.138   0.871   1.00 0.00 ? 48 GLN A H    9  
ATOM 11239 H HA   . GLN A 1 48 ? -10.189 4.702   0.190   1.00 0.00 ? 48 GLN A HA   9  
ATOM 11240 H HB2  . GLN A 1 48 ? -10.991 7.555   -0.428  1.00 0.00 ? 48 GLN A HB2  9  
ATOM 11241 H HB3  . GLN A 1 48 ? -12.020 6.175   -0.810  1.00 0.00 ? 48 GLN A HB3  9  
ATOM 11242 H HG2  . GLN A 1 48 ? -10.908 6.684   1.954   1.00 0.00 ? 48 GLN A HG2  9  
ATOM 11243 H HG3  . GLN A 1 48 ? -12.484 7.274   1.427   1.00 0.00 ? 48 GLN A HG3  9  
ATOM 11244 H HE21 . GLN A 1 48 ? -14.202 5.714   1.143   1.00 0.00 ? 48 GLN A HE21 9  
ATOM 11245 H HE22 . GLN A 1 48 ? -14.045 4.097   1.636   1.00 0.00 ? 48 GLN A HE22 9  
ATOM 11246 N N    . GLU A 1 49 ? -9.178  6.421   -2.422  1.00 0.00 ? 49 GLU A N    9  
ATOM 11247 C CA   . GLU A 1 49 ? -8.873  6.273   -3.865  1.00 0.00 ? 49 GLU A CA   9  
ATOM 11248 C C    . GLU A 1 49 ? -7.761  5.242   -4.070  1.00 0.00 ? 49 GLU A C    9  
ATOM 11249 O O    . GLU A 1 49 ? -7.813  4.434   -4.976  1.00 0.00 ? 49 GLU A O    9  
ATOM 11250 C CB   . GLU A 1 49 ? -8.430  7.623   -4.431  1.00 0.00 ? 49 GLU A CB   9  
ATOM 11251 C CG   . GLU A 1 49 ? -8.019  7.452   -5.895  1.00 0.00 ? 49 GLU A CG   9  
ATOM 11252 C CD   . GLU A 1 49 ? -7.875  8.828   -6.549  1.00 0.00 ? 49 GLU A CD   9  
ATOM 11253 O OE1  . GLU A 1 49 ? -8.615  9.721   -6.173  1.00 0.00 ? 49 GLU A OE1  9  
ATOM 11254 O OE2  . GLU A 1 49 ? -7.024  8.965   -7.414  1.00 0.00 ? 49 GLU A OE2  9  
ATOM 11255 H H    . GLU A 1 49 ? -8.996  7.274   -1.976  1.00 0.00 ? 49 GLU A H    9  
ATOM 11256 H HA   . GLU A 1 49 ? -9.764  5.946   -4.378  1.00 0.00 ? 49 GLU A HA   9  
ATOM 11257 H HB2  . GLU A 1 49 ? -9.248  8.326   -4.366  1.00 0.00 ? 49 GLU A HB2  9  
ATOM 11258 H HB3  . GLU A 1 49 ? -7.590  7.995   -3.865  1.00 0.00 ? 49 GLU A HB3  9  
ATOM 11259 H HG2  . GLU A 1 49 ? -7.076  6.927   -5.946  1.00 0.00 ? 49 GLU A HG2  9  
ATOM 11260 H HG3  . GLU A 1 49 ? -8.775  6.886   -6.418  1.00 0.00 ? 49 GLU A HG3  9  
ATOM 11261 N N    . VAL A 1 50 ? -6.754  5.252   -3.231  1.00 0.00 ? 50 VAL A N    9  
ATOM 11262 C CA   . VAL A 1 50 ? -5.658  4.258   -3.388  1.00 0.00 ? 50 VAL A CA   9  
ATOM 11263 C C    . VAL A 1 50 ? -6.192  2.871   -3.055  1.00 0.00 ? 50 VAL A C    9  
ATOM 11264 O O    . VAL A 1 50 ? -6.029  1.933   -3.810  1.00 0.00 ? 50 VAL A O    9  
ATOM 11265 C CB   . VAL A 1 50 ? -4.490  4.578   -2.444  1.00 0.00 ? 50 VAL A CB   9  
ATOM 11266 C CG1  . VAL A 1 50 ? -3.375  3.546   -2.651  1.00 0.00 ? 50 VAL A CG1  9  
ATOM 11267 C CG2  . VAL A 1 50 ? -3.949  5.993   -2.734  1.00 0.00 ? 50 VAL A CG2  9  
ATOM 11268 H H    . VAL A 1 50 ? -6.728  5.901   -2.501  1.00 0.00 ? 50 VAL A H    9  
ATOM 11269 H HA   . VAL A 1 50 ? -5.307  4.285   -4.402  1.00 0.00 ? 50 VAL A HA   9  
ATOM 11270 H HB   . VAL A 1 50 ? -4.828  4.514   -1.424  1.00 0.00 ? 50 VAL A HB   9  
ATOM 11271 H HG11 . VAL A 1 50 ? -2.501  3.843   -2.091  1.00 0.00 ? 50 VAL A HG11 9  
ATOM 11272 H HG12 . VAL A 1 50 ? -3.128  3.489   -3.699  1.00 0.00 ? 50 VAL A HG12 9  
ATOM 11273 H HG13 . VAL A 1 50 ? -3.710  2.579   -2.306  1.00 0.00 ? 50 VAL A HG13 9  
ATOM 11274 H HG21 . VAL A 1 50 ? -3.538  6.415   -1.828  1.00 0.00 ? 50 VAL A HG21 9  
ATOM 11275 H HG22 . VAL A 1 50 ? -4.747  6.624   -3.093  1.00 0.00 ? 50 VAL A HG22 9  
ATOM 11276 H HG23 . VAL A 1 50 ? -3.174  5.945   -3.487  1.00 0.00 ? 50 VAL A HG23 9  
ATOM 11277 N N    . VAL A 1 51 ? -6.805  2.721   -1.910  1.00 0.00 ? 51 VAL A N    9  
ATOM 11278 C CA   . VAL A 1 51 ? -7.313  1.381   -1.517  1.00 0.00 ? 51 VAL A CA   9  
ATOM 11279 C C    . VAL A 1 51 ? -8.350  0.893   -2.538  1.00 0.00 ? 51 VAL A C    9  
ATOM 11280 O O    . VAL A 1 51 ? -8.283  -0.212  -3.037  1.00 0.00 ? 51 VAL A O    9  
ATOM 11281 C CB   . VAL A 1 51 ? -7.875  1.450   -0.091  1.00 0.00 ? 51 VAL A CB   9  
ATOM 11282 C CG1  . VAL A 1 51 ? -8.322  0.068   0.369   1.00 0.00 ? 51 VAL A CG1  9  
ATOM 11283 C CG2  . VAL A 1 51 ? -6.788  1.967   0.860   1.00 0.00 ? 51 VAL A CG2  9  
ATOM 11284 H H    . VAL A 1 51 ? -6.904  3.473   -1.290  1.00 0.00 ? 51 VAL A H    9  
ATOM 11285 H HA   . VAL A 1 51 ? -6.485  0.692   -1.569  1.00 0.00 ? 51 VAL A HA   9  
ATOM 11286 H HB   . VAL A 1 51 ? -8.716  2.125   -0.069  1.00 0.00 ? 51 VAL A HB   9  
ATOM 11287 H HG11 . VAL A 1 51 ? -8.599  0.113   1.412   1.00 0.00 ? 51 VAL A HG11 9  
ATOM 11288 H HG12 . VAL A 1 51 ? -7.510  -0.631  0.243   1.00 0.00 ? 51 VAL A HG12 9  
ATOM 11289 H HG13 . VAL A 1 51 ? -9.171  -0.248  -0.216  1.00 0.00 ? 51 VAL A HG13 9  
ATOM 11290 H HG21 . VAL A 1 51 ? -6.355  2.869   0.456   1.00 0.00 ? 51 VAL A HG21 9  
ATOM 11291 H HG22 . VAL A 1 51 ? -6.020  1.216   0.968   1.00 0.00 ? 51 VAL A HG22 9  
ATOM 11292 H HG23 . VAL A 1 51 ? -7.221  2.178   1.828   1.00 0.00 ? 51 VAL A HG23 9  
ATOM 11293 N N    . ASP A 1 52 ? -9.346  1.702   -2.797  1.00 0.00 ? 52 ASP A N    9  
ATOM 11294 C CA   . ASP A 1 52 ? -10.450 1.300   -3.721  1.00 0.00 ? 52 ASP A CA   9  
ATOM 11295 C C    . ASP A 1 52 ? -9.959  1.066   -5.150  1.00 0.00 ? 52 ASP A C    9  
ATOM 11296 O O    . ASP A 1 52 ? -10.363 0.126   -5.807  1.00 0.00 ? 52 ASP A O    9  
ATOM 11297 C CB   . ASP A 1 52 ? -11.512 2.406   -3.732  1.00 0.00 ? 52 ASP A CB   9  
ATOM 11298 C CG   . ASP A 1 52 ? -12.023 2.634   -2.307  1.00 0.00 ? 52 ASP A CG   9  
ATOM 11299 O OD1  . ASP A 1 52 ? -11.234 2.496   -1.387  1.00 0.00 ? 52 ASP A OD1  9  
ATOM 11300 O OD2  . ASP A 1 52 ? -13.194 2.943   -2.162  1.00 0.00 ? 52 ASP A OD2  9  
ATOM 11301 H H    . ASP A 1 52 ? -9.390  2.573   -2.352  1.00 0.00 ? 52 ASP A H    9  
ATOM 11302 H HA   . ASP A 1 52 ? -10.911 0.399   -3.343  1.00 0.00 ? 52 ASP A HA   9  
ATOM 11303 H HB2  . ASP A 1 52 ? -11.081 3.321   -4.109  1.00 0.00 ? 52 ASP A HB2  9  
ATOM 11304 H HB3  . ASP A 1 52 ? -12.336 2.109   -4.363  1.00 0.00 ? 52 ASP A HB3  9  
ATOM 11305 N N    . THR A 1 53 ? -9.111  1.921   -5.648  1.00 0.00 ? 53 THR A N    9  
ATOM 11306 C CA   . THR A 1 53 ? -8.619  1.760   -7.044  1.00 0.00 ? 53 THR A CA   9  
ATOM 11307 C C    . THR A 1 53 ? -7.420  0.820   -7.088  1.00 0.00 ? 53 THR A C    9  
ATOM 11308 O O    . THR A 1 53 ? -7.295  0.031   -8.004  1.00 0.00 ? 53 THR A O    9  
ATOM 11309 C CB   . THR A 1 53 ? -8.210  3.130   -7.592  1.00 0.00 ? 53 THR A CB   9  
ATOM 11310 O OG1  . THR A 1 53 ? -9.270  4.054   -7.385  1.00 0.00 ? 53 THR A OG1  9  
ATOM 11311 C CG2  . THR A 1 53 ? -7.914  3.017   -9.088  1.00 0.00 ? 53 THR A CG2  9  
ATOM 11312 H H    . THR A 1 53 ? -8.806  2.682   -5.112  1.00 0.00 ? 53 THR A H    9  
ATOM 11313 H HA   . THR A 1 53 ? -9.389  1.349   -7.671  1.00 0.00 ? 53 THR A HA   9  
ATOM 11314 H HB   . THR A 1 53 ? -7.328  3.475   -7.080  1.00 0.00 ? 53 THR A HB   9  
ATOM 11315 H HG1  . THR A 1 53 ? -10.026 3.567   -7.049  1.00 0.00 ? 53 THR A HG1  9  
ATOM 11316 H HG21 . THR A 1 53 ? -7.571  3.971   -9.459  1.00 0.00 ? 53 THR A HG21 9  
ATOM 11317 H HG22 . THR A 1 53 ? -8.814  2.730   -9.612  1.00 0.00 ? 53 THR A HG22 9  
ATOM 11318 H HG23 . THR A 1 53 ? -7.150  2.271   -9.249  1.00 0.00 ? 53 THR A HG23 9  
ATOM 11319 N N    . TYR A 1 54 ? -6.522  0.905   -6.139  1.00 0.00 ? 54 TYR A N    9  
ATOM 11320 C CA   . TYR A 1 54 ? -5.311  0.023   -6.173  1.00 0.00 ? 54 TYR A CA   9  
ATOM 11321 C C    . TYR A 1 54 ? -5.328  -1.032  -5.061  1.00 0.00 ? 54 TYR A C    9  
ATOM 11322 O O    . TYR A 1 54 ? -4.303  -1.410  -4.533  1.00 0.00 ? 54 TYR A O    9  
ATOM 11323 C CB   . TYR A 1 54 ? -4.065  0.885   -6.042  1.00 0.00 ? 54 TYR A CB   9  
ATOM 11324 C CG   . TYR A 1 54 ? -3.936  1.766   -7.263  1.00 0.00 ? 54 TYR A CG   9  
ATOM 11325 C CD1  . TYR A 1 54 ? -4.540  3.024   -7.274  1.00 0.00 ? 54 TYR A CD1  9  
ATOM 11326 C CD2  . TYR A 1 54 ? -3.212  1.329   -8.378  1.00 0.00 ? 54 TYR A CD2  9  
ATOM 11327 C CE1  . TYR A 1 54 ? -4.426  3.852   -8.391  1.00 0.00 ? 54 TYR A CE1  9  
ATOM 11328 C CE2  . TYR A 1 54 ? -3.096  2.157   -9.503  1.00 0.00 ? 54 TYR A CE2  9  
ATOM 11329 C CZ   . TYR A 1 54 ? -3.703  3.420   -9.509  1.00 0.00 ? 54 TYR A CZ   9  
ATOM 11330 O OH   . TYR A 1 54 ? -3.589  4.235   -10.617 1.00 0.00 ? 54 TYR A OH   9  
ATOM 11331 H H    . TYR A 1 54 ? -6.628  1.564   -5.421  1.00 0.00 ? 54 TYR A H    9  
ATOM 11332 H HA   . TYR A 1 54 ? -5.263  -0.500  -7.119  1.00 0.00 ? 54 TYR A HA   9  
ATOM 11333 H HB2  . TYR A 1 54 ? -4.153  1.501   -5.162  1.00 0.00 ? 54 TYR A HB2  9  
ATOM 11334 H HB3  . TYR A 1 54 ? -3.196  0.254   -5.959  1.00 0.00 ? 54 TYR A HB3  9  
ATOM 11335 H HD1  . TYR A 1 54 ? -5.097  3.354   -6.421  1.00 0.00 ? 54 TYR A HD1  9  
ATOM 11336 H HD2  . TYR A 1 54 ? -2.747  0.356   -8.373  1.00 0.00 ? 54 TYR A HD2  9  
ATOM 11337 H HE1  . TYR A 1 54 ? -4.897  4.825   -8.388  1.00 0.00 ? 54 TYR A HE1  9  
ATOM 11338 H HE2  . TYR A 1 54 ? -2.538  1.821   -10.365 1.00 0.00 ? 54 TYR A HE2  9  
ATOM 11339 H HH   . TYR A 1 54 ? -3.504  5.141   -10.310 1.00 0.00 ? 54 TYR A HH   9  
ATOM 11340 N N    . GLY A 1 55 ? -6.492  -1.474  -4.672  1.00 0.00 ? 55 GLY A N    9  
ATOM 11341 C CA   . GLY A 1 55 ? -6.590  -2.463  -3.561  1.00 0.00 ? 55 GLY A CA   9  
ATOM 11342 C C    . GLY A 1 55 ? -6.295  -3.882  -4.041  1.00 0.00 ? 55 GLY A C    9  
ATOM 11343 O O    . GLY A 1 55 ? -5.433  -4.552  -3.506  1.00 0.00 ? 55 GLY A O    9  
ATOM 11344 H H    . GLY A 1 55 ? -7.306  -1.148  -5.102  1.00 0.00 ? 55 GLY A H    9  
ATOM 11345 H HA2  . GLY A 1 55 ? -5.877  -2.199  -2.794  1.00 0.00 ? 55 GLY A HA2  9  
ATOM 11346 H HA3  . GLY A 1 55 ? -7.584  -2.434  -3.143  1.00 0.00 ? 55 GLY A HA3  9  
ATOM 11347 N N    . SER A 1 56 ? -7.007  -4.372  -5.021  1.00 0.00 ? 56 SER A N    9  
ATOM 11348 C CA   . SER A 1 56 ? -6.741  -5.762  -5.467  1.00 0.00 ? 56 SER A CA   9  
ATOM 11349 C C    . SER A 1 56 ? -5.353  -5.845  -6.079  1.00 0.00 ? 56 SER A C    9  
ATOM 11350 O O    . SER A 1 56 ? -4.726  -6.885  -6.098  1.00 0.00 ? 56 SER A O    9  
ATOM 11351 C CB   . SER A 1 56 ? -7.773  -6.203  -6.504  1.00 0.00 ? 56 SER A CB   9  
ATOM 11352 O OG   . SER A 1 56 ? -9.042  -5.657  -6.172  1.00 0.00 ? 56 SER A OG   9  
ATOM 11353 H H    . SER A 1 56 ? -7.716  -3.844  -5.447  1.00 0.00 ? 56 SER A H    9  
ATOM 11354 H HA   . SER A 1 56 ? -6.801  -6.406  -4.604  1.00 0.00 ? 56 SER A HA   9  
ATOM 11355 H HB2  . SER A 1 56 ? -7.479  -5.854  -7.484  1.00 0.00 ? 56 SER A HB2  9  
ATOM 11356 H HB3  . SER A 1 56 ? -7.823  -7.285  -6.511  1.00 0.00 ? 56 SER A HB3  9  
ATOM 11357 H HG   . SER A 1 56 ? -9.711  -6.148  -6.654  1.00 0.00 ? 56 SER A HG   9  
ATOM 11358 N N    . SER A 1 57 ? -4.899  -4.760  -6.651  1.00 0.00 ? 57 SER A N    9  
ATOM 11359 C CA   . SER A 1 57 ? -3.585  -4.800  -7.341  1.00 0.00 ? 57 SER A CA   9  
ATOM 11360 C C    . SER A 1 57 ? -2.431  -4.805  -6.341  1.00 0.00 ? 57 SER A C    9  
ATOM 11361 O O    . SER A 1 57 ? -1.539  -5.621  -6.426  1.00 0.00 ? 57 SER A O    9  
ATOM 11362 C CB   . SER A 1 57 ? -3.451  -3.633  -8.319  1.00 0.00 ? 57 SER A CB   9  
ATOM 11363 O OG   . SER A 1 57 ? -3.629  -2.410  -7.616  1.00 0.00 ? 57 SER A OG   9  
ATOM 11364 H H    . SER A 1 57 ? -5.441  -3.944  -6.648  1.00 0.00 ? 57 SER A H    9  
ATOM 11365 H HA   . SER A 1 57 ? -3.542  -5.738  -7.872  1.00 0.00 ? 57 SER A HA   9  
ATOM 11366 H HB2  . SER A 1 57 ? -2.471  -3.645  -8.766  1.00 0.00 ? 57 SER A HB2  9  
ATOM 11367 H HB3  . SER A 1 57 ? -4.200  -3.727  -9.095  1.00 0.00 ? 57 SER A HB3  9  
ATOM 11368 H HG   . SER A 1 57 ? -2.988  -1.779  -7.951  1.00 0.00 ? 57 SER A HG   9  
ATOM 11369 N N    . ILE A 1 58 ? -2.466  -3.940  -5.359  1.00 0.00 ? 58 ILE A N    9  
ATOM 11370 C CA   . ILE A 1 58 ? -1.387  -3.942  -4.333  1.00 0.00 ? 58 ILE A CA   9  
ATOM 11371 C C    . ILE A 1 58 ? -1.341  -5.324  -3.690  1.00 0.00 ? 58 ILE A C    9  
ATOM 11372 O O    . ILE A 1 58 ? -0.336  -6.006  -3.669  1.00 0.00 ? 58 ILE A O    9  
ATOM 11373 C CB   . ILE A 1 58 ? -1.699  -2.900  -3.237  1.00 0.00 ? 58 ILE A CB   9  
ATOM 11374 C CG1  . ILE A 1 58 ? -1.449  -1.484  -3.783  1.00 0.00 ? 58 ILE A CG1  9  
ATOM 11375 C CG2  . ILE A 1 58 ? -0.799  -3.151  -2.008  1.00 0.00 ? 58 ILE A CG2  9  
ATOM 11376 C CD1  . ILE A 1 58 ? -1.919  -0.440  -2.760  1.00 0.00 ? 58 ILE A CD1  9  
ATOM 11377 H H    . ILE A 1 58 ? -3.218  -3.319  -5.268  1.00 0.00 ? 58 ILE A H    9  
ATOM 11378 H HA   . ILE A 1 58 ? -0.428  -3.719  -4.774  1.00 0.00 ? 58 ILE A HA   9  
ATOM 11379 H HB   . ILE A 1 58 ? -2.734  -2.995  -2.943  1.00 0.00 ? 58 ILE A HB   9  
ATOM 11380 H HG12 . ILE A 1 58 ? -0.394  -1.355  -3.966  1.00 0.00 ? 58 ILE A HG12 9  
ATOM 11381 H HG13 . ILE A 1 58 ? -1.989  -1.352  -4.706  1.00 0.00 ? 58 ILE A HG13 9  
ATOM 11382 H HG21 . ILE A 1 58 ? -1.220  -3.949  -1.418  1.00 0.00 ? 58 ILE A HG21 9  
ATOM 11383 H HG22 . ILE A 1 58 ? -0.731  -2.259  -1.402  1.00 0.00 ? 58 ILE A HG22 9  
ATOM 11384 H HG23 . ILE A 1 58 ? 0.191   -3.435  -2.337  1.00 0.00 ? 58 ILE A HG23 9  
ATOM 11385 H HD11 . ILE A 1 58 ? -2.855  -0.751  -2.320  1.00 0.00 ? 58 ILE A HD11 9  
ATOM 11386 H HD12 . ILE A 1 58 ? -2.057  0.515   -3.249  1.00 0.00 ? 58 ILE A HD12 9  
ATOM 11387 H HD13 . ILE A 1 58 ? -1.171  -0.345  -1.983  1.00 0.00 ? 58 ILE A HD13 9  
ATOM 11388 N N    . LEU A 1 59 ? -2.462  -5.707  -3.158  1.00 0.00 ? 59 LEU A N    9  
ATOM 11389 C CA   . LEU A 1 59 ? -2.598  -7.016  -2.479  1.00 0.00 ? 59 LEU A CA   9  
ATOM 11390 C C    . LEU A 1 59 ? -2.240  -8.135  -3.454  1.00 0.00 ? 59 LEU A C    9  
ATOM 11391 O O    . LEU A 1 59 ? -1.884  -9.219  -3.042  1.00 0.00 ? 59 LEU A O    9  
ATOM 11392 C CB   . LEU A 1 59 ? -4.052  -7.153  -2.004  1.00 0.00 ? 59 LEU A CB   9  
ATOM 11393 C CG   . LEU A 1 59 ? -4.316  -8.553  -1.431  1.00 0.00 ? 59 LEU A CG   9  
ATOM 11394 C CD1  . LEU A 1 59 ? -3.288  -8.872  -0.333  1.00 0.00 ? 59 LEU A CD1  9  
ATOM 11395 C CD2  . LEU A 1 59 ? -5.737  -8.609  -0.834  1.00 0.00 ? 59 LEU A CD2  9  
ATOM 11396 H H    . LEU A 1 59 ? -3.236  -5.109  -3.222  1.00 0.00 ? 59 LEU A H    9  
ATOM 11397 H HA   . LEU A 1 59 ? -1.933  -7.053  -1.630  1.00 0.00 ? 59 LEU A HA   9  
ATOM 11398 H HB2  . LEU A 1 59 ? -4.241  -6.414  -1.240  1.00 0.00 ? 59 LEU A HB2  9  
ATOM 11399 H HB3  . LEU A 1 59 ? -4.715  -6.980  -2.837  1.00 0.00 ? 59 LEU A HB3  9  
ATOM 11400 H HG   . LEU A 1 59 ? -4.236  -9.281  -2.229  1.00 0.00 ? 59 LEU A HG   9  
ATOM 11401 H HD11 . LEU A 1 59 ? -3.118  -7.992  0.269   1.00 0.00 ? 59 LEU A HD11 9  
ATOM 11402 H HD12 . LEU A 1 59 ? -2.360  -9.183  -0.783  1.00 0.00 ? 59 LEU A HD12 9  
ATOM 11403 H HD13 . LEU A 1 59 ? -3.663  -9.668  0.294   1.00 0.00 ? 59 LEU A HD13 9  
ATOM 11404 H HD21 . LEU A 1 59 ? -6.447  -8.817  -1.620  1.00 0.00 ? 59 LEU A HD21 9  
ATOM 11405 H HD22 . LEU A 1 59 ? -5.981  -7.663  -0.372  1.00 0.00 ? 59 LEU A HD22 9  
ATOM 11406 H HD23 . LEU A 1 59 ? -5.791  -9.389  -0.090  1.00 0.00 ? 59 LEU A HD23 9  
ATOM 11407 N N    . SER A 1 60 ? -2.352  -7.927  -4.739  1.00 0.00 ? 60 SER A N    9  
ATOM 11408 C CA   . SER A 1 60 ? -2.034  -9.052  -5.671  1.00 0.00 ? 60 SER A CA   9  
ATOM 11409 C C    . SER A 1 60 ? -0.514  -9.156  -5.878  1.00 0.00 ? 60 SER A C    9  
ATOM 11410 O O    . SER A 1 60 ? 0.034   -10.231 -6.019  1.00 0.00 ? 60 SER A O    9  
ATOM 11411 C CB   . SER A 1 60 ? -2.720  -8.803  -7.008  1.00 0.00 ? 60 SER A CB   9  
ATOM 11412 O OG   . SER A 1 60 ? -4.110  -9.074  -6.881  1.00 0.00 ? 60 SER A OG   9  
ATOM 11413 H H    . SER A 1 60 ? -2.661  -7.063  -5.083  1.00 0.00 ? 60 SER A H    9  
ATOM 11414 H HA   . SER A 1 60 ? -2.442  -9.937  -5.205  1.00 0.00 ? 60 SER A HA   9  
ATOM 11415 H HB2  . SER A 1 60 ? -2.584  -7.772  -7.288  1.00 0.00 ? 60 SER A HB2  9  
ATOM 11416 H HB3  . SER A 1 60 ? -2.283  -9.441  -7.763  1.00 0.00 ? 60 SER A HB3  9  
ATOM 11417 H HG   . SER A 1 60 ? -4.248  -10.007 -7.060  1.00 0.00 ? 60 SER A HG   9  
ATOM 11418 N N    . ILE A 1 61 ? 0.160   -8.034  -5.902  1.00 0.00 ? 61 ILE A N    9  
ATOM 11419 C CA   . ILE A 1 61 ? 1.643   -8.036  -6.104  1.00 0.00 ? 61 ILE A CA   9  
ATOM 11420 C C    . ILE A 1 61 ? 2.344   -8.626  -4.876  1.00 0.00 ? 61 ILE A C    9  
ATOM 11421 O O    . ILE A 1 61 ? 3.238   -9.442  -4.988  1.00 0.00 ? 61 ILE A O    9  
ATOM 11422 C CB   . ILE A 1 61 ? 2.129   -6.588  -6.303  1.00 0.00 ? 61 ILE A CB   9  
ATOM 11423 C CG1  . ILE A 1 61 ? 1.192   -5.832  -7.306  1.00 0.00 ? 61 ILE A CG1  9  
ATOM 11424 C CG2  . ILE A 1 61 ? 3.583   -6.622  -6.793  1.00 0.00 ? 61 ILE A CG2  9  
ATOM 11425 C CD1  . ILE A 1 61 ? 1.980   -5.151  -8.436  1.00 0.00 ? 61 ILE A CD1  9  
ATOM 11426 H H    . ILE A 1 61 ? -0.312  -7.183  -5.793  1.00 0.00 ? 61 ILE A H    9  
ATOM 11427 H HA   . ILE A 1 61 ? 1.893   -8.620  -6.977  1.00 0.00 ? 61 ILE A HA   9  
ATOM 11428 H HB   . ILE A 1 61 ? 2.108   -6.084  -5.344  1.00 0.00 ? 61 ILE A HB   9  
ATOM 11429 H HG12 . ILE A 1 61 ? 0.484   -6.524  -7.744  1.00 0.00 ? 61 ILE A HG12 9  
ATOM 11430 H HG13 . ILE A 1 61 ? 0.647   -5.071  -6.767  1.00 0.00 ? 61 ILE A HG13 9  
ATOM 11431 H HG21 . ILE A 1 61 ? 4.172   -7.211  -6.113  1.00 0.00 ? 61 ILE A HG21 9  
ATOM 11432 H HG22 . ILE A 1 61 ? 3.975   -5.616  -6.829  1.00 0.00 ? 61 ILE A HG22 9  
ATOM 11433 H HG23 . ILE A 1 61 ? 3.624   -7.062  -7.779  1.00 0.00 ? 61 ILE A HG23 9  
ATOM 11434 H HD11 . ILE A 1 61 ? 2.700   -4.466  -8.011  1.00 0.00 ? 61 ILE A HD11 9  
ATOM 11435 H HD12 . ILE A 1 61 ? 1.296   -4.605  -9.068  1.00 0.00 ? 61 ILE A HD12 9  
ATOM 11436 H HD13 . ILE A 1 61 ? 2.493   -5.897  -9.025  1.00 0.00 ? 61 ILE A HD13 9  
ATOM 11437 N N    . LEU A 1 62 ? 1.957   -8.196  -3.708  1.00 0.00 ? 62 LEU A N    9  
ATOM 11438 C CA   . LEU A 1 62 ? 2.603   -8.694  -2.460  1.00 0.00 ? 62 LEU A CA   9  
ATOM 11439 C C    . LEU A 1 62 ? 2.719   -10.223 -2.480  1.00 0.00 ? 62 LEU A C    9  
ATOM 11440 O O    . LEU A 1 62 ? 3.661   -10.788 -1.961  1.00 0.00 ? 62 LEU A O    9  
ATOM 11441 C CB   . LEU A 1 62 ? 1.743   -8.269  -1.263  1.00 0.00 ? 62 LEU A CB   9  
ATOM 11442 C CG   . LEU A 1 62 ? 1.987   -6.773  -0.936  1.00 0.00 ? 62 LEU A CG   9  
ATOM 11443 C CD1  . LEU A 1 62 ? 0.674   -6.115  -0.494  1.00 0.00 ? 62 LEU A CD1  9  
ATOM 11444 C CD2  . LEU A 1 62 ? 3.019   -6.648  0.191   1.00 0.00 ? 62 LEU A CD2  9  
ATOM 11445 H H    . LEU A 1 62 ? 1.246   -7.524  -3.646  1.00 0.00 ? 62 LEU A H    9  
ATOM 11446 H HA   . LEU A 1 62 ? 3.581   -8.242  -2.370  1.00 0.00 ? 62 LEU A HA   9  
ATOM 11447 H HB2  . LEU A 1 62 ? 0.700   -8.424  -1.509  1.00 0.00 ? 62 LEU A HB2  9  
ATOM 11448 H HB3  . LEU A 1 62 ? 1.995   -8.876  -0.403  1.00 0.00 ? 62 LEU A HB3  9  
ATOM 11449 H HG   . LEU A 1 62 ? 2.354   -6.259  -1.817  1.00 0.00 ? 62 LEU A HG   9  
ATOM 11450 H HD11 . LEU A 1 62 ? 0.086   -5.872  -1.364  1.00 0.00 ? 62 LEU A HD11 9  
ATOM 11451 H HD12 . LEU A 1 62 ? 0.882   -5.213  0.063   1.00 0.00 ? 62 LEU A HD12 9  
ATOM 11452 H HD13 . LEU A 1 62 ? 0.126   -6.804  0.125   1.00 0.00 ? 62 LEU A HD13 9  
ATOM 11453 H HD21 . LEU A 1 62 ? 3.152   -5.606  0.436   1.00 0.00 ? 62 LEU A HD21 9  
ATOM 11454 H HD22 . LEU A 1 62 ? 3.958   -7.069  -0.132  1.00 0.00 ? 62 LEU A HD22 9  
ATOM 11455 H HD23 . LEU A 1 62 ? 2.666   -7.180  1.061   1.00 0.00 ? 62 LEU A HD23 9  
ATOM 11456 N N    . LEU A 1 63 ? 1.759   -10.896 -3.052  1.00 0.00 ? 63 LEU A N    9  
ATOM 11457 C CA   . LEU A 1 63 ? 1.805   -12.383 -3.076  1.00 0.00 ? 63 LEU A CA   9  
ATOM 11458 C C    . LEU A 1 63 ? 2.796   -12.876 -4.131  1.00 0.00 ? 63 LEU A C    9  
ATOM 11459 O O    . LEU A 1 63 ? 3.173   -14.032 -4.135  1.00 0.00 ? 63 LEU A O    9  
ATOM 11460 C CB   . LEU A 1 63 ? 0.405   -12.936 -3.354  1.00 0.00 ? 63 LEU A CB   9  
ATOM 11461 C CG   . LEU A 1 63 ? -0.611  -12.241 -2.439  1.00 0.00 ? 63 LEU A CG   9  
ATOM 11462 C CD1  . LEU A 1 63 ? -1.983  -12.903 -2.601  1.00 0.00 ? 63 LEU A CD1  9  
ATOM 11463 C CD2  . LEU A 1 63 ? -0.158  -12.354 -0.977  1.00 0.00 ? 63 LEU A CD2  9  
ATOM 11464 H H    . LEU A 1 63 ? 0.999   -10.425 -3.454  1.00 0.00 ? 63 LEU A H    9  
ATOM 11465 H HA   . LEU A 1 63 ? 2.149   -12.757 -2.124  1.00 0.00 ? 63 LEU A HA   9  
ATOM 11466 H HB2  . LEU A 1 63 ? 0.142   -12.753 -4.385  1.00 0.00 ? 63 LEU A HB2  9  
ATOM 11467 H HB3  . LEU A 1 63 ? 0.392   -13.997 -3.161  1.00 0.00 ? 63 LEU A HB3  9  
ATOM 11468 H HG   . LEU A 1 63 ? -0.684  -11.199 -2.713  1.00 0.00 ? 63 LEU A HG   9  
ATOM 11469 H HD11 . LEU A 1 63 ? -2.640  -12.572 -1.809  1.00 0.00 ? 63 LEU A HD11 9  
ATOM 11470 H HD12 . LEU A 1 63 ? -1.873  -13.976 -2.550  1.00 0.00 ? 63 LEU A HD12 9  
ATOM 11471 H HD13 . LEU A 1 63 ? -2.404  -12.630 -3.556  1.00 0.00 ? 63 LEU A HD13 9  
ATOM 11472 H HD21 . LEU A 1 63 ? 0.221   -13.347 -0.790  1.00 0.00 ? 63 LEU A HD21 9  
ATOM 11473 H HD22 . LEU A 1 63 ? -0.995  -12.157 -0.320  1.00 0.00 ? 63 LEU A HD22 9  
ATOM 11474 H HD23 . LEU A 1 63 ? 0.621   -11.629 -0.787  1.00 0.00 ? 63 LEU A HD23 9  
ATOM 11475 N N    . GLU A 1 64 ? 3.229   -12.027 -5.028  1.00 0.00 ? 64 GLU A N    9  
ATOM 11476 C CA   . GLU A 1 64 ? 4.198   -12.488 -6.067  1.00 0.00 ? 64 GLU A CA   9  
ATOM 11477 C C    . GLU A 1 64 ? 5.618   -12.371 -5.506  1.00 0.00 ? 64 GLU A C    9  
ATOM 11478 O O    . GLU A 1 64 ? 6.581   -12.212 -6.229  1.00 0.00 ? 64 GLU A O    9  
ATOM 11479 C CB   . GLU A 1 64 ? 4.052   -11.652 -7.342  1.00 0.00 ? 64 GLU A CB   9  
ATOM 11480 C CG   . GLU A 1 64 ? 2.830   -12.114 -8.138  1.00 0.00 ? 64 GLU A CG   9  
ATOM 11481 C CD   . GLU A 1 64 ? 2.810   -11.409 -9.495  1.00 0.00 ? 64 GLU A CD   9  
ATOM 11482 O OE1  . GLU A 1 64 ? 3.473   -11.889 -10.400 1.00 0.00 ? 64 GLU A OE1  9  
ATOM 11483 O OE2  . GLU A 1 64 ? 2.132   -10.401 -9.607  1.00 0.00 ? 64 GLU A OE2  9  
ATOM 11484 H H    . GLU A 1 64 ? 2.924   -11.098 -5.020  1.00 0.00 ? 64 GLU A H    9  
ATOM 11485 H HA   . GLU A 1 64 ? 4.007   -13.530 -6.282  1.00 0.00 ? 64 GLU A HA   9  
ATOM 11486 H HB2  . GLU A 1 64 ? 3.931   -10.614 -7.078  1.00 0.00 ? 64 GLU A HB2  9  
ATOM 11487 H HB3  . GLU A 1 64 ? 4.934   -11.771 -7.952  1.00 0.00 ? 64 GLU A HB3  9  
ATOM 11488 H HG2  . GLU A 1 64 ? 2.879   -13.182 -8.289  1.00 0.00 ? 64 GLU A HG2  9  
ATOM 11489 H HG3  . GLU A 1 64 ? 1.934   -11.866 -7.595  1.00 0.00 ? 64 GLU A HG3  9  
ATOM 11490 N N    . GLU A 1 65 ? 5.737   -12.503 -4.213  1.00 0.00 ? 65 GLU A N    9  
ATOM 11491 C CA   . GLU A 1 65 ? 7.080   -12.464 -3.563  1.00 0.00 ? 65 GLU A CA   9  
ATOM 11492 C C    . GLU A 1 65 ? 7.912   -11.261 -4.024  1.00 0.00 ? 65 GLU A C    9  
ATOM 11493 O O    . GLU A 1 65 ? 9.126   -11.311 -4.066  1.00 0.00 ? 65 GLU A O    9  
ATOM 11494 C CB   . GLU A 1 65 ? 7.833   -13.729 -3.981  1.00 0.00 ? 65 GLU A CB   9  
ATOM 11495 C CG   . GLU A 1 65 ? 7.162   -14.955 -3.359  1.00 0.00 ? 65 GLU A CG   9  
ATOM 11496 C CD   . GLU A 1 65 ? 7.819   -16.226 -3.902  1.00 0.00 ? 65 GLU A CD   9  
ATOM 11497 O OE1  . GLU A 1 65 ? 7.454   -16.639 -4.990  1.00 0.00 ? 65 GLU A OE1  9  
ATOM 11498 O OE2  . GLU A 1 65 ? 8.676   -16.765 -3.220  1.00 0.00 ? 65 GLU A OE2  9  
ATOM 11499 H H    . GLU A 1 65 ? 4.932   -12.674 -3.683  1.00 0.00 ? 65 GLU A H    9  
ATOM 11500 H HA   . GLU A 1 65 ? 6.985   -12.485 -2.490  1.00 0.00 ? 65 GLU A HA   9  
ATOM 11501 H HB2  . GLU A 1 65 ? 7.818   -13.819 -5.058  1.00 0.00 ? 65 GLU A HB2  9  
ATOM 11502 H HB3  . GLU A 1 65 ? 8.855   -13.669 -3.640  1.00 0.00 ? 65 GLU A HB3  9  
ATOM 11503 H HG2  . GLU A 1 65 ? 7.277   -14.921 -2.285  1.00 0.00 ? 65 GLU A HG2  9  
ATOM 11504 H HG3  . GLU A 1 65 ? 6.113   -14.959 -3.610  1.00 0.00 ? 65 GLU A HG3  9  
ATOM 11505 N N    . VAL A 1 66 ? 7.264   -10.170 -4.340  1.00 0.00 ? 66 VAL A N    9  
ATOM 11506 C CA   . VAL A 1 66 ? 7.997   -8.935  -4.766  1.00 0.00 ? 66 VAL A CA   9  
ATOM 11507 C C    . VAL A 1 66 ? 8.260   -8.075  -3.516  1.00 0.00 ? 66 VAL A C    9  
ATOM 11508 O O    . VAL A 1 66 ? 7.457   -8.037  -2.603  1.00 0.00 ? 66 VAL A O    9  
ATOM 11509 C CB   . VAL A 1 66 ? 7.113   -8.173  -5.779  1.00 0.00 ? 66 VAL A CB   9  
ATOM 11510 C CG1  . VAL A 1 66 ? 7.384   -6.662  -5.731  1.00 0.00 ? 66 VAL A CG1  9  
ATOM 11511 C CG2  . VAL A 1 66 ? 7.394   -8.682  -7.200  1.00 0.00 ? 66 VAL A CG2  9  
ATOM 11512 H H    . VAL A 1 66 ? 6.284   -10.150 -4.288  1.00 0.00 ? 66 VAL A H    9  
ATOM 11513 H HA   . VAL A 1 66 ? 8.936   -9.205  -5.235  1.00 0.00 ? 66 VAL A HA   9  
ATOM 11514 H HB   . VAL A 1 66 ? 6.078   -8.353  -5.540  1.00 0.00 ? 66 VAL A HB   9  
ATOM 11515 H HG11 . VAL A 1 66 ? 8.450   -6.490  -5.732  1.00 0.00 ? 66 VAL A HG11 9  
ATOM 11516 H HG12 . VAL A 1 66 ? 6.953   -6.247  -4.832  1.00 0.00 ? 66 VAL A HG12 9  
ATOM 11517 H HG13 . VAL A 1 66 ? 6.941   -6.188  -6.594  1.00 0.00 ? 66 VAL A HG13 9  
ATOM 11518 H HG21 . VAL A 1 66 ? 8.314   -8.245  -7.565  1.00 0.00 ? 66 VAL A HG21 9  
ATOM 11519 H HG22 . VAL A 1 66 ? 6.581   -8.400  -7.852  1.00 0.00 ? 66 VAL A HG22 9  
ATOM 11520 H HG23 . VAL A 1 66 ? 7.490   -9.756  -7.184  1.00 0.00 ? 66 VAL A HG23 9  
ATOM 11521 N N    . SER A 1 67 ? 9.375   -7.390  -3.463  1.00 0.00 ? 67 SER A N    9  
ATOM 11522 C CA   . SER A 1 67 ? 9.671   -6.544  -2.266  1.00 0.00 ? 67 SER A CA   9  
ATOM 11523 C C    . SER A 1 67 ? 8.506   -5.547  -2.043  1.00 0.00 ? 67 SER A C    9  
ATOM 11524 O O    . SER A 1 67 ? 7.938   -5.068  -3.004  1.00 0.00 ? 67 SER A O    9  
ATOM 11525 C CB   . SER A 1 67 ? 10.978  -5.778  -2.496  1.00 0.00 ? 67 SER A CB   9  
ATOM 11526 O OG   . SER A 1 67 ? 11.557  -5.447  -1.239  1.00 0.00 ? 67 SER A OG   9  
ATOM 11527 H H    . SER A 1 67 ? 10.012  -7.432  -4.205  1.00 0.00 ? 67 SER A H    9  
ATOM 11528 H HA   . SER A 1 67 ? 9.783   -7.192  -1.420  1.00 0.00 ? 67 SER A HA   9  
ATOM 11529 H HB2  . SER A 1 67 ? 11.667  -6.395  -3.047  1.00 0.00 ? 67 SER A HB2  9  
ATOM 11530 H HB3  . SER A 1 67 ? 10.779  -4.876  -3.059  1.00 0.00 ? 67 SER A HB3  9  
ATOM 11531 H HG   . SER A 1 67 ? 12.015  -6.224  -0.910  1.00 0.00 ? 67 SER A HG   9  
ATOM 11532 N N    . PRO A 1 68 ? 8.167   -5.258  -0.794  1.00 0.00 ? 68 PRO A N    9  
ATOM 11533 C CA   . PRO A 1 68 ? 7.057   -4.322  -0.491  1.00 0.00 ? 68 PRO A CA   9  
ATOM 11534 C C    . PRO A 1 68 ? 7.295   -2.903  -1.057  1.00 0.00 ? 68 PRO A C    9  
ATOM 11535 O O    . PRO A 1 68 ? 6.364   -2.234  -1.443  1.00 0.00 ? 68 PRO A O    9  
ATOM 11536 C CB   . PRO A 1 68 ? 6.988   -4.276  1.057   1.00 0.00 ? 68 PRO A CB   9  
ATOM 11537 C CG   . PRO A 1 68 ? 8.141   -5.157  1.609   1.00 0.00 ? 68 PRO A CG   9  
ATOM 11538 C CD   . PRO A 1 68 ? 8.827   -5.831  0.406   1.00 0.00 ? 68 PRO A CD   9  
ATOM 11539 H HA   . PRO A 1 68 ? 6.134   -4.720  -0.884  1.00 0.00 ? 68 PRO A HA   9  
ATOM 11540 H HB2  . PRO A 1 68 ? 7.101   -3.258  1.411   1.00 0.00 ? 68 PRO A HB2  9  
ATOM 11541 H HB3  . PRO A 1 68 ? 6.045   -4.668  1.396   1.00 0.00 ? 68 PRO A HB3  9  
ATOM 11542 H HG2  . PRO A 1 68 ? 8.851   -4.540  2.147   1.00 0.00 ? 68 PRO A HG2  9  
ATOM 11543 H HG3  . PRO A 1 68 ? 7.740   -5.912  2.274   1.00 0.00 ? 68 PRO A HG3  9  
ATOM 11544 H HD2  . PRO A 1 68 ? 9.887   -5.613  0.398   1.00 0.00 ? 68 PRO A HD2  9  
ATOM 11545 H HD3  . PRO A 1 68 ? 8.661   -6.899  0.444   1.00 0.00 ? 68 PRO A HD3  9  
ATOM 11546 N N    . GLU A 1 69 ? 8.508   -2.414  -1.068  1.00 0.00 ? 69 GLU A N    9  
ATOM 11547 C CA   . GLU A 1 69 ? 8.728   -1.016  -1.570  1.00 0.00 ? 69 GLU A CA   9  
ATOM 11548 C C    . GLU A 1 69 ? 8.743   -0.985  -3.108  1.00 0.00 ? 69 GLU A C    9  
ATOM 11549 O O    . GLU A 1 69 ? 8.580   0.061   -3.725  1.00 0.00 ? 69 GLU A O    9  
ATOM 11550 C CB   . GLU A 1 69 ? 10.054  -0.458  -0.999  1.00 0.00 ? 69 GLU A CB   9  
ATOM 11551 C CG   . GLU A 1 69 ? 11.004  -1.602  -0.626  1.00 0.00 ? 69 GLU A CG   9  
ATOM 11552 C CD   . GLU A 1 69 ? 12.350  -1.023  -0.188  1.00 0.00 ? 69 GLU A CD   9  
ATOM 11553 O OE1  . GLU A 1 69 ? 12.343  -0.033  0.524   1.00 0.00 ? 69 GLU A OE1  9  
ATOM 11554 O OE2  . GLU A 1 69 ? 13.365  -1.580  -0.573  1.00 0.00 ? 69 GLU A OE2  9  
ATOM 11555 H H    . GLU A 1 69 ? 9.257   -2.942  -0.723  1.00 0.00 ? 69 GLU A H    9  
ATOM 11556 H HA   . GLU A 1 69 ? 7.911   -0.394  -1.227  1.00 0.00 ? 69 GLU A HA   9  
ATOM 11557 H HB2  . GLU A 1 69 ? 10.534  0.179   -1.730  1.00 0.00 ? 69 GLU A HB2  9  
ATOM 11558 H HB3  . GLU A 1 69 ? 9.843   0.124   -0.112  1.00 0.00 ? 69 GLU A HB3  9  
ATOM 11559 H HG2  . GLU A 1 69 ? 10.579  -2.172  0.188   1.00 0.00 ? 69 GLU A HG2  9  
ATOM 11560 H HG3  . GLU A 1 69 ? 11.153  -2.245  -1.478  1.00 0.00 ? 69 GLU A HG3  9  
ATOM 11561 N N    . LEU A 1 70 ? 8.894   -2.110  -3.745  1.00 0.00 ? 70 LEU A N    9  
ATOM 11562 C CA   . LEU A 1 70 ? 8.879   -2.094  -5.229  1.00 0.00 ? 70 LEU A CA   9  
ATOM 11563 C C    . LEU A 1 70 ? 7.431   -1.846  -5.664  1.00 0.00 ? 70 LEU A C    9  
ATOM 11564 O O    . LEU A 1 70 ? 7.152   -1.536  -6.806  1.00 0.00 ? 70 LEU A O    9  
ATOM 11565 C CB   . LEU A 1 70 ? 9.418   -3.421  -5.785  1.00 0.00 ? 70 LEU A CB   9  
ATOM 11566 C CG   . LEU A 1 70 ? 10.948  -3.462  -5.676  1.00 0.00 ? 70 LEU A CG   9  
ATOM 11567 C CD1  . LEU A 1 70 ? 11.454  -4.865  -6.047  1.00 0.00 ? 70 LEU A CD1  9  
ATOM 11568 C CD2  . LEU A 1 70 ? 11.603  -2.416  -6.605  1.00 0.00 ? 70 LEU A CD2  9  
ATOM 11569 H H    . LEU A 1 70 ? 8.974   -2.948  -3.244  1.00 0.00 ? 70 LEU A H    9  
ATOM 11570 H HA   . LEU A 1 70 ? 9.484   -1.267  -5.567  1.00 0.00 ? 70 LEU A HA   9  
ATOM 11571 H HB2  . LEU A 1 70 ? 9.001   -4.237  -5.217  1.00 0.00 ? 70 LEU A HB2  9  
ATOM 11572 H HB3  . LEU A 1 70 ? 9.138   -3.525  -6.810  1.00 0.00 ? 70 LEU A HB3  9  
ATOM 11573 H HG   . LEU A 1 70 ? 11.217  -3.247  -4.666  1.00 0.00 ? 70 LEU A HG   9  
ATOM 11574 H HD11 . LEU A 1 70 ? 10.828  -5.613  -5.584  1.00 0.00 ? 70 LEU A HD11 9  
ATOM 11575 H HD12 . LEU A 1 70 ? 12.470  -4.984  -5.702  1.00 0.00 ? 70 LEU A HD12 9  
ATOM 11576 H HD13 . LEU A 1 70 ? 11.424  -4.987  -7.119  1.00 0.00 ? 70 LEU A HD13 9  
ATOM 11577 H HD21 . LEU A 1 70 ? 11.717  -1.484  -6.071  1.00 0.00 ? 70 LEU A HD21 9  
ATOM 11578 H HD22 . LEU A 1 70 ? 10.990  -2.260  -7.473  1.00 0.00 ? 70 LEU A HD22 9  
ATOM 11579 H HD23 . LEU A 1 70 ? 12.580  -2.763  -6.917  1.00 0.00 ? 70 LEU A HD23 9  
ATOM 11580 N N    . VAL A 1 71 ? 6.504   -2.010  -4.750  1.00 0.00 ? 71 VAL A N    9  
ATOM 11581 C CA   . VAL A 1 71 ? 5.065   -1.816  -5.092  1.00 0.00 ? 71 VAL A CA   9  
ATOM 11582 C C    . VAL A 1 71 ? 4.799   -0.356  -5.462  1.00 0.00 ? 71 VAL A C    9  
ATOM 11583 O O    . VAL A 1 71 ? 4.256   -0.078  -6.510  1.00 0.00 ? 71 VAL A O    9  
ATOM 11584 C CB   . VAL A 1 71 ? 4.175   -2.244  -3.896  1.00 0.00 ? 71 VAL A CB   9  
ATOM 11585 C CG1  . VAL A 1 71 ? 2.791   -1.551  -3.930  1.00 0.00 ? 71 VAL A CG1  9  
ATOM 11586 C CG2  . VAL A 1 71 ? 3.987   -3.765  -3.921  1.00 0.00 ? 71 VAL A CG2  9  
ATOM 11587 H H    . VAL A 1 71 ? 6.766   -2.293  -3.848  1.00 0.00 ? 71 VAL A H    9  
ATOM 11588 H HA   . VAL A 1 71 ? 4.852   -2.412  -5.964  1.00 0.00 ? 71 VAL A HA   9  
ATOM 11589 H HB   . VAL A 1 71 ? 4.672   -1.969  -2.983  1.00 0.00 ? 71 VAL A HB   9  
ATOM 11590 H HG11 . VAL A 1 71 ? 2.421   -1.532  -4.942  1.00 0.00 ? 71 VAL A HG11 9  
ATOM 11591 H HG12 . VAL A 1 71 ? 2.876   -0.536  -3.559  1.00 0.00 ? 71 VAL A HG12 9  
ATOM 11592 H HG13 . VAL A 1 71 ? 2.099   -2.091  -3.301  1.00 0.00 ? 71 VAL A HG13 9  
ATOM 11593 H HG21 . VAL A 1 71 ? 3.605   -4.068  -4.884  1.00 0.00 ? 71 VAL A HG21 9  
ATOM 11594 H HG22 . VAL A 1 71 ? 3.288   -4.052  -3.148  1.00 0.00 ? 71 VAL A HG22 9  
ATOM 11595 H HG23 . VAL A 1 71 ? 4.937   -4.248  -3.741  1.00 0.00 ? 71 VAL A HG23 9  
ATOM 11596 N N    . CYS A 1 72 ? 5.121   0.581   -4.622  1.00 0.00 ? 72 CYS A N    9  
ATOM 11597 C CA   . CYS A 1 72 ? 4.801   1.984   -4.982  1.00 0.00 ? 72 CYS A CA   9  
ATOM 11598 C C    . CYS A 1 72 ? 5.602   2.409   -6.226  1.00 0.00 ? 72 CYS A C    9  
ATOM 11599 O O    . CYS A 1 72 ? 5.183   3.259   -6.985  1.00 0.00 ? 72 CYS A O    9  
ATOM 11600 C CB   . CYS A 1 72 ? 5.136   2.906   -3.800  1.00 0.00 ? 72 CYS A CB   9  
ATOM 11601 S SG   . CYS A 1 72 ? 4.330   2.315   -2.302  1.00 0.00 ? 72 CYS A SG   9  
ATOM 11602 H H    . CYS A 1 72 ? 5.526   0.375   -3.752  1.00 0.00 ? 72 CYS A H    9  
ATOM 11603 H HA   . CYS A 1 72 ? 3.736   2.015   -5.180  1.00 0.00 ? 72 CYS A HA   9  
ATOM 11604 H HB2  . CYS A 1 72 ? 6.202   2.931   -3.639  1.00 0.00 ? 72 CYS A HB2  9  
ATOM 11605 H HB3  . CYS A 1 72 ? 4.786   3.898   -4.009  1.00 0.00 ? 72 CYS A HB3  9  
ATOM 11606 N N    . SER A 1 73 ? 6.752   1.810   -6.437  1.00 0.00 ? 73 SER A N    9  
ATOM 11607 C CA   . SER A 1 73 ? 7.573   2.176   -7.637  1.00 0.00 ? 73 SER A CA   9  
ATOM 11608 C C    . SER A 1 73 ? 7.012   1.523   -8.923  1.00 0.00 ? 73 SER A C    9  
ATOM 11609 O O    . SER A 1 73 ? 6.998   2.138   -9.971  1.00 0.00 ? 73 SER A O    9  
ATOM 11610 C CB   . SER A 1 73 ? 9.019   1.733   -7.426  1.00 0.00 ? 73 SER A CB   9  
ATOM 11611 O OG   . SER A 1 73 ? 9.415   2.039   -6.095  1.00 0.00 ? 73 SER A OG   9  
ATOM 11612 H H    . SER A 1 73 ? 7.071   1.133   -5.784  1.00 0.00 ? 73 SER A H    9  
ATOM 11613 H HA   . SER A 1 73 ? 7.539   3.247   -7.773  1.00 0.00 ? 73 SER A HA   9  
ATOM 11614 H HB2  . SER A 1 73 ? 9.095   0.671   -7.584  1.00 0.00 ? 73 SER A HB2  9  
ATOM 11615 H HB3  . SER A 1 73 ? 9.658   2.247   -8.132  1.00 0.00 ? 73 SER A HB3  9  
ATOM 11616 H HG   . SER A 1 73 ? 10.308  2.388   -6.125  1.00 0.00 ? 73 SER A HG   9  
ATOM 11617 N N    . MET A 1 74 ? 6.557   0.296   -8.868  1.00 0.00 ? 74 MET A N    9  
ATOM 11618 C CA   . MET A 1 74 ? 6.012   -0.367  -10.108 1.00 0.00 ? 74 MET A CA   9  
ATOM 11619 C C    . MET A 1 74 ? 4.643   0.232   -10.495 1.00 0.00 ? 74 MET A C    9  
ATOM 11620 O O    . MET A 1 74 ? 4.360   0.418   -11.662 1.00 0.00 ? 74 MET A O    9  
ATOM 11621 C CB   . MET A 1 74 ? 5.856   -1.897  -9.859  1.00 0.00 ? 74 MET A CB   9  
ATOM 11622 C CG   . MET A 1 74 ? 7.031   -2.695  -10.460 1.00 0.00 ? 74 MET A CG   9  
ATOM 11623 S SD   . MET A 1 74 ? 6.545   -4.432  -10.662 1.00 0.00 ? 74 MET A SD   9  
ATOM 11624 C CE   . MET A 1 74 ? 5.740   -4.673  -9.057  1.00 0.00 ? 74 MET A CE   9  
ATOM 11625 H H    . MET A 1 74 ? 6.576   -0.194  -8.019  1.00 0.00 ? 74 MET A H    9  
ATOM 11626 H HA   . MET A 1 74 ? 6.673   -0.216  -10.945 1.00 0.00 ? 74 MET A HA   9  
ATOM 11627 H HB2  . MET A 1 74 ? 5.825   -2.079  -8.798  1.00 0.00 ? 74 MET A HB2  9  
ATOM 11628 H HB3  . MET A 1 74 ? 4.937   -2.250  -10.309 1.00 0.00 ? 74 MET A HB3  9  
ATOM 11629 H HG2  . MET A 1 74 ? 7.296   -2.295  -11.425 1.00 0.00 ? 74 MET A HG2  9  
ATOM 11630 H HG3  . MET A 1 74 ? 7.881   -2.635  -9.802  1.00 0.00 ? 74 MET A HG3  9  
ATOM 11631 H HE1  . MET A 1 74 ? 5.589   -5.731  -8.889  1.00 0.00 ? 74 MET A HE1  9  
ATOM 11632 H HE2  . MET A 1 74 ? 4.786   -4.173  -9.048  1.00 0.00 ? 74 MET A HE2  9  
ATOM 11633 H HE3  . MET A 1 74 ? 6.365   -4.267  -8.277  1.00 0.00 ? 74 MET A HE3  9  
ATOM 11634 N N    . LEU A 1 75 ? 3.786   0.507   -9.554  1.00 0.00 ? 75 LEU A N    9  
ATOM 11635 C CA   . LEU A 1 75 ? 2.443   1.056   -9.922  1.00 0.00 ? 75 LEU A CA   9  
ATOM 11636 C C    . LEU A 1 75 ? 2.563   2.515   -10.396 1.00 0.00 ? 75 LEU A C    9  
ATOM 11637 O O    . LEU A 1 75 ? 1.588   3.238   -10.449 1.00 0.00 ? 75 LEU A O    9  
ATOM 11638 C CB   . LEU A 1 75 ? 1.500   0.973   -8.711  1.00 0.00 ? 75 LEU A CB   9  
ATOM 11639 C CG   . LEU A 1 75 ? 1.449   -0.467  -8.165  1.00 0.00 ? 75 LEU A CG   9  
ATOM 11640 C CD1  . LEU A 1 75 ? 0.370   -0.573  -7.084  1.00 0.00 ? 75 LEU A CD1  9  
ATOM 11641 C CD2  . LEU A 1 75 ? 1.132   -1.458  -9.297  1.00 0.00 ? 75 LEU A CD2  9  
ATOM 11642 H H    . LEU A 1 75 ? 4.013   0.331   -8.617  1.00 0.00 ? 75 LEU A H    9  
ATOM 11643 H HA   . LEU A 1 75 ? 2.032   0.470   -10.728 1.00 0.00 ? 75 LEU A HA   9  
ATOM 11644 H HB2  . LEU A 1 75 ? 1.859   1.635   -7.936  1.00 0.00 ? 75 LEU A HB2  9  
ATOM 11645 H HB3  . LEU A 1 75 ? 0.509   1.276   -9.009  1.00 0.00 ? 75 LEU A HB3  9  
ATOM 11646 H HG   . LEU A 1 75 ? 2.398   -0.712  -7.729  1.00 0.00 ? 75 LEU A HG   9  
ATOM 11647 H HD11 . LEU A 1 75 ? 0.190   -1.614  -6.859  1.00 0.00 ? 75 LEU A HD11 9  
ATOM 11648 H HD12 . LEU A 1 75 ? -0.541  -0.121  -7.438  1.00 0.00 ? 75 LEU A HD12 9  
ATOM 11649 H HD13 . LEU A 1 75 ? 0.704   -0.066  -6.191  1.00 0.00 ? 75 LEU A HD13 9  
ATOM 11650 H HD21 . LEU A 1 75 ? 0.409   -1.022  -9.970  1.00 0.00 ? 75 LEU A HD21 9  
ATOM 11651 H HD22 . LEU A 1 75 ? 0.729   -2.368  -8.881  1.00 0.00 ? 75 LEU A HD22 9  
ATOM 11652 H HD23 . LEU A 1 75 ? 2.038   -1.685  -9.840  1.00 0.00 ? 75 LEU A HD23 9  
ATOM 11653 N N    . HIS A 1 76 ? 3.746   2.955   -10.738 1.00 0.00 ? 76 HIS A N    9  
ATOM 11654 C CA   . HIS A 1 76 ? 3.920   4.369   -11.204 1.00 0.00 ? 76 HIS A CA   9  
ATOM 11655 C C    . HIS A 1 76 ? 3.185   5.308   -10.239 1.00 0.00 ? 76 HIS A C    9  
ATOM 11656 O O    . HIS A 1 76 ? 2.864   6.427   -10.586 1.00 0.00 ? 76 HIS A O    9  
ATOM 11657 C CB   . HIS A 1 76 ? 3.368   4.525   -12.628 1.00 0.00 ? 76 HIS A CB   9  
ATOM 11658 C CG   . HIS A 1 76 ? 4.164   3.659   -13.566 1.00 0.00 ? 76 HIS A CG   9  
ATOM 11659 N ND1  . HIS A 1 76 ? 3.826   3.513   -14.902 1.00 0.00 ? 76 HIS A ND1  9  
ATOM 11660 C CD2  . HIS A 1 76 ? 5.284   2.889   -13.375 1.00 0.00 ? 76 HIS A CD2  9  
ATOM 11661 C CE1  . HIS A 1 76 ? 4.727   2.684   -15.459 1.00 0.00 ? 76 HIS A CE1  9  
ATOM 11662 N NE2  . HIS A 1 76 ? 5.637   2.273   -14.572 1.00 0.00 ? 76 HIS A NE2  9  
ATOM 11663 H H    . HIS A 1 76 ? 4.520   2.357   -10.674 1.00 0.00 ? 76 HIS A H    9  
ATOM 11664 H HA   . HIS A 1 76 ? 4.972   4.608   -11.197 1.00 0.00 ? 76 HIS A HA   9  
ATOM 11665 H HB2  . HIS A 1 76 ? 2.331   4.222   -12.655 1.00 0.00 ? 76 HIS A HB2  9  
ATOM 11666 H HB3  . HIS A 1 76 ? 3.451   5.557   -12.938 1.00 0.00 ? 76 HIS A HB3  9  
ATOM 11667 H HD1  . HIS A 1 76 ? 3.070   3.938   -15.359 1.00 0.00 ? 76 HIS A HD1  9  
ATOM 11668 H HD2  . HIS A 1 76 ? 5.809   2.776   -12.438 1.00 0.00 ? 76 HIS A HD2  9  
ATOM 11669 H HE1  . HIS A 1 76 ? 4.716   2.385   -16.497 1.00 0.00 ? 76 HIS A HE1  9  
ATOM 11670 N N    . LEU A 1 77 ? 2.900   4.875   -9.047  1.00 0.00 ? 77 LEU A N    9  
ATOM 11671 C CA   . LEU A 1 77 ? 2.171   5.753   -8.092  1.00 0.00 ? 77 LEU A CA   9  
ATOM 11672 C C    . LEU A 1 77 ? 3.149   6.765   -7.472  1.00 0.00 ? 77 LEU A C    9  
ATOM 11673 O O    . LEU A 1 77 ? 2.730   7.707   -6.831  1.00 0.00 ? 77 LEU A O    9  
ATOM 11674 C CB   . LEU A 1 77 ? 1.507   4.858   -7.009  1.00 0.00 ? 77 LEU A CB   9  
ATOM 11675 C CG   . LEU A 1 77 ? -0.001  5.157   -6.850  1.00 0.00 ? 77 LEU A CG   9  
ATOM 11676 C CD1  . LEU A 1 77 ? -0.744  5.147   -8.212  1.00 0.00 ? 77 LEU A CD1  9  
ATOM 11677 C CD2  . LEU A 1 77 ? -0.627  4.112   -5.915  1.00 0.00 ? 77 LEU A CD2  9  
ATOM 11678 H H    . LEU A 1 77 ? 3.154   3.974   -8.778  1.00 0.00 ? 77 LEU A H    9  
ATOM 11679 H HA   . LEU A 1 77 ? 1.420   6.322   -8.613  1.00 0.00 ? 77 LEU A HA   9  
ATOM 11680 H HB2  . LEU A 1 77 ? 1.624   3.829   -7.289  1.00 0.00 ? 77 LEU A HB2  9  
ATOM 11681 H HB3  . LEU A 1 77 ? 1.991   5.018   -6.057  1.00 0.00 ? 77 LEU A HB3  9  
ATOM 11682 H HG   . LEU A 1 77 ? -0.101  6.120   -6.404  1.00 0.00 ? 77 LEU A HG   9  
ATOM 11683 H HD11 . LEU A 1 77 ? -0.896  6.165   -8.540  1.00 0.00 ? 77 LEU A HD11 9  
ATOM 11684 H HD12 . LEU A 1 77 ? -1.707  4.663   -8.112  1.00 0.00 ? 77 LEU A HD12 9  
ATOM 11685 H HD13 . LEU A 1 77 ? -0.156  4.622   -8.948  1.00 0.00 ? 77 LEU A HD13 9  
ATOM 11686 H HD21 . LEU A 1 77 ? -1.554  4.494   -5.522  1.00 0.00 ? 77 LEU A HD21 9  
ATOM 11687 H HD22 . LEU A 1 77 ? 0.048   3.900   -5.100  1.00 0.00 ? 77 LEU A HD22 9  
ATOM 11688 H HD23 . LEU A 1 77 ? -0.821  3.209   -6.465  1.00 0.00 ? 77 LEU A HD23 9  
ATOM 11689 N N    . CYS A 1 78 ? 4.440   6.588   -7.657  1.00 0.00 ? 78 CYS A N    9  
ATOM 11690 C CA   . CYS A 1 78 ? 5.427   7.560   -7.074  1.00 0.00 ? 78 CYS A CA   9  
ATOM 11691 C C    . CYS A 1 78 ? 6.401   8.040   -8.165  1.00 0.00 ? 78 CYS A C    9  
ATOM 11692 O O    . CYS A 1 78 ? 7.574   7.724   -8.143  1.00 0.00 ? 78 CYS A O    9  
ATOM 11693 C CB   . CYS A 1 78 ? 6.201   6.886   -5.943  1.00 0.00 ? 78 CYS A CB   9  
ATOM 11694 S SG   . CYS A 1 78 ? 6.687   8.123   -4.715  1.00 0.00 ? 78 CYS A SG   9  
ATOM 11695 H H    . CYS A 1 78 ? 4.759   5.817   -8.171  1.00 0.00 ? 78 CYS A H    9  
ATOM 11696 H HA   . CYS A 1 78 ? 4.899   8.427   -6.696  1.00 0.00 ? 78 CYS A HA   9  
ATOM 11697 H HB2  . CYS A 1 78 ? 5.567   6.157   -5.486  1.00 0.00 ? 78 CYS A HB2  9  
ATOM 11698 H HB3  . CYS A 1 78 ? 7.083   6.394   -6.331  1.00 0.00 ? 78 CYS A HB3  9  
ATOM 11699 N N    . SER A 1 79 ? 5.968   8.930   -9.017  1.00 0.00 ? 79 SER A N    9  
ATOM 11700 C CA   . SER A 1 79 ? 6.938   9.553   -9.964  1.00 0.00 ? 79 SER A CA   9  
ATOM 11701 C C    . SER A 1 79 ? 6.182   10.427  -10.974 1.00 0.00 ? 79 SER A C    9  
ATOM 11702 O O    . SER A 1 79 ? 6.587   10.573  -12.111 1.00 0.00 ? 79 SER A O    9  
ATOM 11703 C CB   . SER A 1 79 ? 7.831   8.503   -10.641 1.00 0.00 ? 79 SER A CB   9  
ATOM 11704 O OG   . SER A 1 79 ? 9.027   8.349   -9.886  1.00 0.00 ? 79 SER A OG   9  
ATOM 11705 H H    . SER A 1 79 ? 5.053   9.271   -8.952  1.00 0.00 ? 79 SER A H    9  
ATOM 11706 H HA   . SER A 1 79 ? 7.504   10.179  -9.291  1.00 0.00 ? 79 SER A HA   9  
ATOM 11707 H HB2  . SER A 1 79 ? 7.313   7.559   -10.677 1.00 0.00 ? 79 SER A HB2  9  
ATOM 11708 H HB3  . SER A 1 79 ? 8.071   8.817   -11.649 1.00 0.00 ? 79 SER A HB3  9  
ATOM 11709 H HG   . SER A 1 79 ? 8.823   8.533   -8.966  1.00 0.00 ? 79 SER A HG   9  
ATOM 11710 N N    . GLY A 1 80 ? 5.085   11.006  -10.569 1.00 0.00 ? 80 GLY A N    9  
ATOM 11711 C CA   . GLY A 1 80 ? 4.308   11.867  -11.506 1.00 0.00 ? 80 GLY A CA   9  
ATOM 11712 C C    . GLY A 1 80 ? 5.102   13.135  -11.821 1.00 0.00 ? 80 GLY A C    9  
ATOM 11713 O O    . GLY A 1 80 ? 6.317   13.143  -11.785 1.00 0.00 ? 80 GLY A O    9  
ATOM 11714 H H    . GLY A 1 80 ? 4.773   10.877  -9.649  1.00 0.00 ? 80 GLY A H    9  
ATOM 11715 H HA2  . GLY A 1 80 ? 4.119   11.321  -12.422 1.00 0.00 ? 80 GLY A HA2  9  
ATOM 11716 H HA3  . GLY A 1 80 ? 3.368   12.139  -11.050 1.00 0.00 ? 80 GLY A HA3  9  
ATOM 11717 N N    . LEU A 1 81 ? 4.427   14.209  -12.129 1.00 0.00 ? 81 LEU A N    9  
ATOM 11718 C CA   . LEU A 1 81 ? 5.145   15.475  -12.446 1.00 0.00 ? 81 LEU A CA   9  
ATOM 11719 C C    . LEU A 1 81 ? 5.801   16.020  -11.175 1.00 0.00 ? 81 LEU A C    9  
ATOM 11720 O O    . LEU A 1 81 ? 5.417   17.053  -10.661 1.00 0.00 ? 81 LEU A O    9  
ATOM 11721 C CB   . LEU A 1 81 ? 4.149   16.504  -12.992 1.00 0.00 ? 81 LEU A CB   9  
ATOM 11722 C CG   . LEU A 1 81 ? 3.210   15.829  -13.993 1.00 0.00 ? 81 LEU A CG   9  
ATOM 11723 C CD1  . LEU A 1 81 ? 2.283   16.879  -14.610 1.00 0.00 ? 81 LEU A CD1  9  
ATOM 11724 C CD2  . LEU A 1 81 ? 4.032   15.163  -15.101 1.00 0.00 ? 81 LEU A CD2  9  
ATOM 11725 H H    . LEU A 1 81 ? 3.448   14.181  -12.153 1.00 0.00 ? 81 LEU A H    9  
ATOM 11726 H HA   . LEU A 1 81 ? 5.906   15.283  -13.187 1.00 0.00 ? 81 LEU A HA   9  
ATOM 11727 H HB2  . LEU A 1 81 ? 3.570   16.913  -12.175 1.00 0.00 ? 81 LEU A HB2  9  
ATOM 11728 H HB3  . LEU A 1 81 ? 4.687   17.298  -13.485 1.00 0.00 ? 81 LEU A HB3  9  
ATOM 11729 H HG   . LEU A 1 81 ? 2.617   15.083  -13.484 1.00 0.00 ? 81 LEU A HG   9  
ATOM 11730 H HD11 . LEU A 1 81 ? 1.660   17.306  -13.838 1.00 0.00 ? 81 LEU A HD11 9  
ATOM 11731 H HD12 . LEU A 1 81 ? 1.660   16.414  -15.359 1.00 0.00 ? 81 LEU A HD12 9  
ATOM 11732 H HD13 . LEU A 1 81 ? 2.876   17.657  -15.067 1.00 0.00 ? 81 LEU A HD13 9  
ATOM 11733 H HD21 . LEU A 1 81 ? 4.476   14.253  -14.723 1.00 0.00 ? 81 LEU A HD21 9  
ATOM 11734 H HD22 . LEU A 1 81 ? 4.813   15.836  -15.425 1.00 0.00 ? 81 LEU A HD22 9  
ATOM 11735 H HD23 . LEU A 1 81 ? 3.390   14.928  -15.937 1.00 0.00 ? 81 LEU A HD23 9  
ATOM 11736 N N    . VAL A 1 82 ? 6.789   15.327  -10.663 1.00 0.00 ? 82 VAL A N    9  
ATOM 11737 C CA   . VAL A 1 82 ? 7.486   15.786  -9.417  1.00 0.00 ? 82 VAL A CA   9  
ATOM 11738 C C    . VAL A 1 82 ? 9.017   15.687  -9.624  1.00 0.00 ? 82 VAL A C    9  
ATOM 11739 O O    . VAL A 1 82 ? 9.571   14.618  -9.460  1.00 0.00 ? 82 VAL A O    9  
ATOM 11740 C CB   . VAL A 1 82 ? 7.069   14.864  -8.256  1.00 0.00 ? 82 VAL A CB   9  
ATOM 11741 C CG1  . VAL A 1 82 ? 5.740   15.342  -7.662  1.00 0.00 ? 82 VAL A CG1  9  
ATOM 11742 C CG2  . VAL A 1 82 ? 6.897   13.433  -8.776  1.00 0.00 ? 82 VAL A CG2  9  
ATOM 11743 H H    . VAL A 1 82 ? 7.072   14.494  -11.101 1.00 0.00 ? 82 VAL A H    9  
ATOM 11744 H HA   . VAL A 1 82 ? 7.203   16.800  -9.183  1.00 0.00 ? 82 VAL A HA   9  
ATOM 11745 H HB   . VAL A 1 82 ? 7.829   14.880  -7.486  1.00 0.00 ? 82 VAL A HB   9  
ATOM 11746 H HG11 . VAL A 1 82 ? 4.988   15.369  -8.437  1.00 0.00 ? 82 VAL A HG11 9  
ATOM 11747 H HG12 . VAL A 1 82 ? 5.865   16.332  -7.248  1.00 0.00 ? 82 VAL A HG12 9  
ATOM 11748 H HG13 . VAL A 1 82 ? 5.428   14.663  -6.882  1.00 0.00 ? 82 VAL A HG13 9  
ATOM 11749 H HG21 . VAL A 1 82 ? 6.849   12.750  -7.941  1.00 0.00 ? 82 VAL A HG21 9  
ATOM 11750 H HG22 . VAL A 1 82 ? 7.734   13.173  -9.406  1.00 0.00 ? 82 VAL A HG22 9  
ATOM 11751 H HG23 . VAL A 1 82 ? 5.983   13.366  -9.349  1.00 0.00 ? 82 VAL A HG23 9  
ATOM 11752 N N    . PRO A 1 83 ? 9.677   16.779  -9.984  1.00 0.00 ? 83 PRO A N    9  
ATOM 11753 C CA   . PRO A 1 83 ? 11.136  16.739  -10.204 1.00 0.00 ? 83 PRO A CA   9  
ATOM 11754 C C    . PRO A 1 83 ? 11.851  16.415  -8.884  1.00 0.00 ? 83 PRO A C    9  
ATOM 11755 O O    . PRO A 1 83 ? 13.062  16.325  -8.827  1.00 0.00 ? 83 PRO A O    9  
ATOM 11756 C CB   . PRO A 1 83 ? 11.506  18.152  -10.720 1.00 0.00 ? 83 PRO A CB   9  
ATOM 11757 C CG   . PRO A 1 83 ? 10.194  18.990  -10.764 1.00 0.00 ? 83 PRO A CG   9  
ATOM 11758 C CD   . PRO A 1 83 ? 9.058   18.109  -10.199 1.00 0.00 ? 83 PRO A CD   9  
ATOM 11759 H HA   . PRO A 1 83 ? 11.379  15.997  -10.948 1.00 0.00 ? 83 PRO A HA   9  
ATOM 11760 H HB2  . PRO A 1 83 ? 12.224  18.620  -10.054 1.00 0.00 ? 83 PRO A HB2  9  
ATOM 11761 H HB3  . PRO A 1 83 ? 11.927  18.085  -11.713 1.00 0.00 ? 83 PRO A HB3  9  
ATOM 11762 H HG2  . PRO A 1 83 ? 10.308  19.885  -10.163 1.00 0.00 ? 83 PRO A HG2  9  
ATOM 11763 H HG3  . PRO A 1 83 ? 9.967   19.267  -11.785 1.00 0.00 ? 83 PRO A HG3  9  
ATOM 11764 H HD2  . PRO A 1 83 ? 8.706   18.517  -9.259  1.00 0.00 ? 83 PRO A HD2  9  
ATOM 11765 H HD3  . PRO A 1 83 ? 8.245   18.035  -10.905 1.00 0.00 ? 83 PRO A HD3  9  
ATOM 11766 N N    . ARG A 1 84 ? 11.108  16.239  -7.826  1.00 0.00 ? 84 ARG A N    9  
ATOM 11767 C CA   . ARG A 1 84 ? 11.741  15.921  -6.515  1.00 0.00 ? 84 ARG A CA   9  
ATOM 11768 C C    . ARG A 1 84 ? 12.881  16.905  -6.244  1.00 0.00 ? 84 ARG A C    9  
ATOM 11769 O O    . ARG A 1 84 ? 12.621  17.929  -5.636  1.00 0.00 ? 84 ARG A O    9  
ATOM 11770 C CB   . ARG A 1 84 ? 12.294  14.494  -6.548  1.00 0.00 ? 84 ARG A CB   9  
ATOM 11771 C CG   . ARG A 1 84 ? 12.823  14.120  -5.161  1.00 0.00 ? 84 ARG A CG   9  
ATOM 11772 C CD   . ARG A 1 84 ? 13.351  12.683  -5.180  1.00 0.00 ? 84 ARG A CD   9  
ATOM 11773 N NE   . ARG A 1 84 ? 12.355  11.778  -5.848  1.00 0.00 ? 84 ARG A NE   9  
ATOM 11774 C CZ   . ARG A 1 84 ? 11.127  11.671  -5.417  1.00 0.00 ? 84 ARG A CZ   9  
ATOM 11775 N NH1  . ARG A 1 84 ? 10.771  12.212  -4.284  1.00 0.00 ? 84 ARG A NH1  9  
ATOM 11776 N NH2  . ARG A 1 84 ? 10.261  10.971  -6.098  1.00 0.00 ? 84 ARG A NH2  9  
ATOM 11777 O OXT  . ARG A 1 84 ? 13.995  16.616  -6.650  1.00 0.00 ? 84 ARG A OXT  9  
ATOM 11778 H H    . ARG A 1 84 ? 10.134  16.314  -7.894  1.00 0.00 ? 84 ARG A H    9  
ATOM 11779 H HA   . ARG A 1 84 ? 11.002  16.002  -5.730  1.00 0.00 ? 84 ARG A HA   9  
ATOM 11780 H HB2  . ARG A 1 84 ? 11.508  13.812  -6.834  1.00 0.00 ? 84 ARG A HB2  9  
ATOM 11781 H HB3  . ARG A 1 84 ? 13.099  14.437  -7.265  1.00 0.00 ? 84 ARG A HB3  9  
ATOM 11782 H HG2  . ARG A 1 84 ? 13.628  14.792  -4.896  1.00 0.00 ? 84 ARG A HG2  9  
ATOM 11783 H HG3  . ARG A 1 84 ? 12.032  14.210  -4.436  1.00 0.00 ? 84 ARG A HG3  9  
ATOM 11784 H HD2  . ARG A 1 84 ? 14.255  12.647  -5.755  1.00 0.00 ? 84 ARG A HD2  9  
ATOM 11785 H HD3  . ARG A 1 84 ? 13.567  12.366  -4.161  1.00 0.00 ? 84 ARG A HD3  9  
ATOM 11786 H HE   . ARG A 1 84 ? 12.622  11.293  -6.656  1.00 0.00 ? 84 ARG A HE   9  
ATOM 11787 H HH11 . ARG A 1 84 ? 11.441  12.712  -3.736  1.00 0.00 ? 84 ARG A HH11 9  
ATOM 11788 H HH12 . ARG A 1 84 ? 9.828   12.127  -3.964  1.00 0.00 ? 84 ARG A HH12 9  
ATOM 11789 H HH21 . ARG A 1 84 ? 10.539  10.520  -6.945  1.00 0.00 ? 84 ARG A HH21 9  
ATOM 11790 H HH22 . ARG A 1 84 ? 9.320   10.886  -5.771  1.00 0.00 ? 84 ARG A HH22 9  
ATOM 11791 N N    . SER A 1 1  ? 5.979   17.194  -0.899  1.00 0.00 ? 1  SER A N    10 
ATOM 11792 C CA   . SER A 1 1  ? 4.955   16.885  0.137   1.00 0.00 ? 1  SER A CA   10 
ATOM 11793 C C    . SER A 1 1  ? 3.904   15.940  -0.449  1.00 0.00 ? 1  SER A C    10 
ATOM 11794 O O    . SER A 1 1  ? 2.729   16.019  -0.150  1.00 0.00 ? 1  SER A O    10 
ATOM 11795 C CB   . SER A 1 1  ? 4.278   18.180  0.586   1.00 0.00 ? 1  SER A CB   10 
ATOM 11796 O OG   . SER A 1 1  ? 3.606   18.767  -0.521  1.00 0.00 ? 1  SER A OG   10 
ATOM 11797 H H1   . SER A 1 1  ? 5.821   16.596  -1.734  1.00 0.00 ? 1  SER A H1   10 
ATOM 11798 H H2   . SER A 1 1  ? 6.929   17.009  -0.514  1.00 0.00 ? 1  SER A H2   10 
ATOM 11799 H H3   . SER A 1 1  ? 5.905   18.194  -1.174  1.00 0.00 ? 1  SER A H3   10 
ATOM 11800 H HA   . SER A 1 1  ? 5.430   16.414  0.985   1.00 0.00 ? 1  SER A HA   10 
ATOM 11801 H HB2  . SER A 1 1  ? 3.563   17.966  1.362   1.00 0.00 ? 1  SER A HB2  10 
ATOM 11802 H HB3  . SER A 1 1  ? 5.027   18.862  0.969   1.00 0.00 ? 1  SER A HB3  10 
ATOM 11803 H HG   . SER A 1 1  ? 4.270   19.112  -1.122  1.00 0.00 ? 1  SER A HG   10 
ATOM 11804 N N    . ASP A 1 2  ? 4.340   15.064  -1.316  1.00 0.00 ? 2  ASP A N    10 
ATOM 11805 C CA   . ASP A 1 2  ? 3.415   14.109  -1.987  1.00 0.00 ? 2  ASP A CA   10 
ATOM 11806 C C    . ASP A 1 2  ? 2.755   13.171  -0.966  1.00 0.00 ? 2  ASP A C    10 
ATOM 11807 O O    . ASP A 1 2  ? 3.371   12.274  -0.425  1.00 0.00 ? 2  ASP A O    10 
ATOM 11808 C CB   . ASP A 1 2  ? 4.224   13.296  -3.007  1.00 0.00 ? 2  ASP A CB   10 
ATOM 11809 C CG   . ASP A 1 2  ? 5.219   12.393  -2.275  1.00 0.00 ? 2  ASP A CG   10 
ATOM 11810 O OD1  . ASP A 1 2  ? 5.575   12.720  -1.155  1.00 0.00 ? 2  ASP A OD1  10 
ATOM 11811 O OD2  . ASP A 1 2  ? 5.611   11.391  -2.849  1.00 0.00 ? 2  ASP A OD2  10 
ATOM 11812 H H    . ASP A 1 2  ? 5.294   15.050  -1.543  1.00 0.00 ? 2  ASP A H    10 
ATOM 11813 H HA   . ASP A 1 2  ? 2.649   14.663  -2.508  1.00 0.00 ? 2  ASP A HA   10 
ATOM 11814 H HB2  . ASP A 1 2  ? 3.561   12.693  -3.605  1.00 0.00 ? 2  ASP A HB2  10 
ATOM 11815 H HB3  . ASP A 1 2  ? 4.767   13.972  -3.650  1.00 0.00 ? 2  ASP A HB3  10 
ATOM 11816 N N    . VAL A 1 3  ? 1.496   13.407  -0.688  1.00 0.00 ? 3  VAL A N    10 
ATOM 11817 C CA   . VAL A 1 3  ? 0.751   12.583  0.311   1.00 0.00 ? 3  VAL A CA   10 
ATOM 11818 C C    . VAL A 1 3  ? 0.395   11.198  -0.259  1.00 0.00 ? 3  VAL A C    10 
ATOM 11819 O O    . VAL A 1 3  ? 0.023   10.306  0.482   1.00 0.00 ? 3  VAL A O    10 
ATOM 11820 C CB   . VAL A 1 3  ? -0.554  13.336  0.706   1.00 0.00 ? 3  VAL A CB   10 
ATOM 11821 C CG1  . VAL A 1 3  ? -0.312  14.844  0.642   1.00 0.00 ? 3  VAL A CG1  10 
ATOM 11822 C CG2  . VAL A 1 3  ? -1.727  12.987  -0.227