data_1M54
# 
_entry.id   1M54 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1M54         
RCSB  RCSB016609   
WWPDB D_1000016609 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1JBQ 
_pdbx_database_related.details        'oxidized vicinal thiols' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1M54 
_pdbx_database_status.recvd_initial_deposition_date   2002-07-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Taoka, S.'    1 
'Lepore, B.W.' 2 
'Kabil, O.'    3 
'Ojha, S.'     4 
'Ringe, D.'    5 
'Banerjee, R.' 6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;HUMAN CYSTATHIONINE BETA-SYNTHASE IS A HEME SENSOR PROTEIN. EVIDENCE THAT THE
REDOX SENSOR IS HEME AND NOT THE VICINAL CYSTEINES IN THE CXXC MOTIF SEEN IN THE CRYSTAL STRUCTURE OF THE TRUNCATED ENZYME
;
BIOCHEMISTRY 41 10454 10461 2002 BICHAW US 0006-2960 0033 ? 12173932 10.1021/bi026052d        
1       
;STRUCTURE OF HUMAN CYSTATHIONINE-SYNTHASE: A UNIQUE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT HEME PROTEIN
;
'Embo J.'    20 3910  3916  2001 EMJODG UK 0261-4189 0897 ? ?        10.1093/emboj/20.15.3910 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Taoka, S.'    1  
primary 'Lepore, B.W.' 2  
primary 'Kabil, O.'    3  
primary 'Ojha, S.'     4  
primary 'Ringe, D.'    5  
primary 'Banerjee, R.' 6  
1       'Meier, M.'    7  
1       'Janosik, M.'  8  
1       'Kery, V.'     9  
1       'Kraus, J.P.'  10 
1       'Burkhard, P.' 11 
# 
_cell.entry_id           1M54 
_cell.length_a           85.740 
_cell.length_b           85.626 
_cell.length_c           97.082 
_cell.angle_alpha        102.01 
_cell.angle_beta         101.53 
_cell.angle_gamma        112.60 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1M54 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CYSTATHIONINE BETA-SYNTHASE'     39922.727 6   4.2.1.22 I44M 'RESIDUES 44-406' ? 
2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"          247.142   6   ?        ?    ?                 ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   6   ?        ?    ?                 ? 
4 water       nat water                             18.015    104 ?        ?    ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Serine sulfhydrase, Beta-thionase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRIS
LRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESH
VGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPE
GSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQE
LQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRIS
LRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESH
VGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPE
GSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQE
LQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKK
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   PRO n 
1 4   ASP n 
1 5   ALA n 
1 6   PRO n 
1 7   SER n 
1 8   ARG n 
1 9   CYS n 
1 10  THR n 
1 11  TRP n 
1 12  GLN n 
1 13  LEU n 
1 14  GLY n 
1 15  ARG n 
1 16  PRO n 
1 17  ALA n 
1 18  SER n 
1 19  GLU n 
1 20  SER n 
1 21  PRO n 
1 22  HIS n 
1 23  HIS n 
1 24  HIS n 
1 25  THR n 
1 26  ALA n 
1 27  PRO n 
1 28  ALA n 
1 29  LYS n 
1 30  SER n 
1 31  PRO n 
1 32  LYS n 
1 33  ILE n 
1 34  LEU n 
1 35  PRO n 
1 36  ASP n 
1 37  ILE n 
1 38  LEU n 
1 39  LYS n 
1 40  LYS n 
1 41  ILE n 
1 42  GLY n 
1 43  ASP n 
1 44  THR n 
1 45  PRO n 
1 46  MET n 
1 47  VAL n 
1 48  ARG n 
1 49  ILE n 
1 50  ASN n 
1 51  LYS n 
1 52  ILE n 
1 53  GLY n 
1 54  LYS n 
1 55  LYS n 
1 56  PHE n 
1 57  GLY n 
1 58  LEU n 
1 59  LYS n 
1 60  CYS n 
1 61  GLU n 
1 62  LEU n 
1 63  LEU n 
1 64  ALA n 
1 65  LYS n 
1 66  CYS n 
1 67  GLU n 
1 68  PHE n 
1 69  PHE n 
1 70  ASN n 
1 71  ALA n 
1 72  GLY n 
1 73  GLY n 
1 74  SER n 
1 75  VAL n 
1 76  LYS n 
1 77  ASP n 
1 78  ARG n 
1 79  ILE n 
1 80  SER n 
1 81  LEU n 
1 82  ARG n 
1 83  MET n 
1 84  ILE n 
1 85  GLU n 
1 86  ASP n 
1 87  ALA n 
1 88  GLU n 
1 89  ARG n 
1 90  ASP n 
1 91  GLY n 
1 92  THR n 
1 93  LEU n 
1 94  LYS n 
1 95  PRO n 
1 96  GLY n 
1 97  ASP n 
1 98  THR n 
1 99  ILE n 
1 100 ILE n 
1 101 GLU n 
1 102 PRO n 
1 103 THR n 
1 104 SER n 
1 105 GLY n 
1 106 ASN n 
1 107 THR n 
1 108 GLY n 
1 109 ILE n 
1 110 GLY n 
1 111 LEU n 
1 112 ALA n 
1 113 LEU n 
1 114 ALA n 
1 115 ALA n 
1 116 ALA n 
1 117 VAL n 
1 118 ARG n 
1 119 GLY n 
1 120 TYR n 
1 121 ARG n 
1 122 CYS n 
1 123 ILE n 
1 124 ILE n 
1 125 VAL n 
1 126 MET n 
1 127 PRO n 
1 128 GLU n 
1 129 LYS n 
1 130 MET n 
1 131 SER n 
1 132 SER n 
1 133 GLU n 
1 134 LYS n 
1 135 VAL n 
1 136 ASP n 
1 137 VAL n 
1 138 LEU n 
1 139 ARG n 
1 140 ALA n 
1 141 LEU n 
1 142 GLY n 
1 143 ALA n 
1 144 GLU n 
1 145 ILE n 
1 146 VAL n 
1 147 ARG n 
1 148 THR n 
1 149 PRO n 
1 150 THR n 
1 151 ASN n 
1 152 ALA n 
1 153 ARG n 
1 154 PHE n 
1 155 ASP n 
1 156 SER n 
1 157 PRO n 
1 158 GLU n 
1 159 SER n 
1 160 HIS n 
1 161 VAL n 
1 162 GLY n 
1 163 VAL n 
1 164 ALA n 
1 165 TRP n 
1 166 ARG n 
1 167 LEU n 
1 168 LYS n 
1 169 ASN n 
1 170 GLU n 
1 171 ILE n 
1 172 PRO n 
1 173 ASN n 
1 174 SER n 
1 175 HIS n 
1 176 ILE n 
1 177 LEU n 
1 178 ASP n 
1 179 GLN n 
1 180 TYR n 
1 181 ARG n 
1 182 ASN n 
1 183 ALA n 
1 184 SER n 
1 185 ASN n 
1 186 PRO n 
1 187 LEU n 
1 188 ALA n 
1 189 HIS n 
1 190 TYR n 
1 191 ASP n 
1 192 THR n 
1 193 THR n 
1 194 ALA n 
1 195 ASP n 
1 196 GLU n 
1 197 ILE n 
1 198 LEU n 
1 199 GLN n 
1 200 GLN n 
1 201 CYS n 
1 202 ASP n 
1 203 GLY n 
1 204 LYS n 
1 205 LEU n 
1 206 ASP n 
1 207 MET n 
1 208 LEU n 
1 209 VAL n 
1 210 ALA n 
1 211 SER n 
1 212 VAL n 
1 213 GLY n 
1 214 THR n 
1 215 GLY n 
1 216 GLY n 
1 217 THR n 
1 218 ILE n 
1 219 THR n 
1 220 GLY n 
1 221 ILE n 
1 222 ALA n 
1 223 ARG n 
1 224 LYS n 
1 225 LEU n 
1 226 LYS n 
1 227 GLU n 
1 228 LYS n 
1 229 CYS n 
1 230 PRO n 
1 231 GLY n 
1 232 CYS n 
1 233 ARG n 
1 234 ILE n 
1 235 ILE n 
1 236 GLY n 
1 237 VAL n 
1 238 ASP n 
1 239 PRO n 
1 240 GLU n 
1 241 GLY n 
1 242 SER n 
1 243 ILE n 
1 244 LEU n 
1 245 ALA n 
1 246 GLU n 
1 247 PRO n 
1 248 GLU n 
1 249 GLU n 
1 250 LEU n 
1 251 ASN n 
1 252 GLN n 
1 253 THR n 
1 254 GLU n 
1 255 GLN n 
1 256 THR n 
1 257 THR n 
1 258 TYR n 
1 259 GLU n 
1 260 VAL n 
1 261 GLU n 
1 262 GLY n 
1 263 ILE n 
1 264 GLY n 
1 265 TYR n 
1 266 ASP n 
1 267 PHE n 
1 268 ILE n 
1 269 PRO n 
1 270 THR n 
1 271 VAL n 
1 272 LEU n 
1 273 ASP n 
1 274 ARG n 
1 275 THR n 
1 276 VAL n 
1 277 VAL n 
1 278 ASP n 
1 279 LYS n 
1 280 TRP n 
1 281 PHE n 
1 282 LYS n 
1 283 SER n 
1 284 ASN n 
1 285 ASP n 
1 286 GLU n 
1 287 GLU n 
1 288 ALA n 
1 289 PHE n 
1 290 THR n 
1 291 PHE n 
1 292 ALA n 
1 293 ARG n 
1 294 MET n 
1 295 LEU n 
1 296 ILE n 
1 297 ALA n 
1 298 GLN n 
1 299 GLU n 
1 300 GLY n 
1 301 LEU n 
1 302 LEU n 
1 303 CYS n 
1 304 GLY n 
1 305 GLY n 
1 306 SER n 
1 307 ALA n 
1 308 GLY n 
1 309 SER n 
1 310 THR n 
1 311 VAL n 
1 312 ALA n 
1 313 VAL n 
1 314 ALA n 
1 315 VAL n 
1 316 LYS n 
1 317 ALA n 
1 318 ALA n 
1 319 GLN n 
1 320 GLU n 
1 321 LEU n 
1 322 GLN n 
1 323 GLU n 
1 324 GLY n 
1 325 GLN n 
1 326 ARG n 
1 327 CYS n 
1 328 VAL n 
1 329 VAL n 
1 330 ILE n 
1 331 LEU n 
1 332 PRO n 
1 333 ASP n 
1 334 SER n 
1 335 VAL n 
1 336 ARG n 
1 337 ASN n 
1 338 TYR n 
1 339 MET n 
1 340 THR n 
1 341 LYS n 
1 342 PHE n 
1 343 LEU n 
1 344 SER n 
1 345 ASP n 
1 346 ARG n 
1 347 TRP n 
1 348 MET n 
1 349 LEU n 
1 350 GLN n 
1 351 LYS n 
1 352 GLY n 
1 353 PHE n 
1 354 LEU n 
1 355 LYS n 
1 356 GLU n 
1 357 GLU n 
1 358 ASP n 
1 359 LEU n 
1 360 THR n 
1 361 GLU n 
1 362 LYS n 
1 363 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CBS 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                blood 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pCBS-deltaN43/deltaC143 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CBS_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;IRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRIS
LRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESH
VGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPE
GSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQE
LQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGF
DQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGK
SSQRQMVFGVVTAIDLLNFVAAQERDQK
;
_struct_ref.pdbx_align_begin           43 
_struct_ref.pdbx_db_accession          P35520 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1M54 A 1 ? 363 ? P35520 43 ? 405 ? 44 406 
2 1 1M54 B 1 ? 363 ? P35520 43 ? 405 ? 44 406 
3 1 1M54 C 1 ? 363 ? P35520 43 ? 405 ? 44 406 
4 1 1M54 D 1 ? 363 ? P35520 43 ? 405 ? 44 406 
5 1 1M54 E 1 ? 363 ? P35520 43 ? 405 ? 44 406 
6 1 1M54 F 1 ? 363 ? P35520 43 ? 405 ? 44 406 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1M54 MET A 1 ? UNP P35520 ILE 43 ENGINEERED 44 1 
2 1M54 MET B 1 ? UNP P35520 ILE 43 ENGINEERED 44 2 
3 1M54 MET C 1 ? UNP P35520 ILE 43 ENGINEERED 44 3 
4 1M54 MET D 1 ? UNP P35520 ILE 43 ENGINEERED 44 4 
5 1M54 MET E 1 ? UNP P35520 ILE 43 ENGINEERED 44 5 
6 1M54 MET F 1 ? UNP P35520 ILE 43 ENGINEERED 44 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?                      'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?                      'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?                      'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?                      'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?                      'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?                      'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?                      'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?                      'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME                   'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?                      'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?                      'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?                      'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?                      'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?                      'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?                      'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?                      'C9 H11 N O2'      165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE"          'VITAMIN B6 Phosphate' 'C8 H10 N O6 P'    247.142 
PRO 'L-peptide linking' y PROLINE                           ?                      'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?                      'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?                      'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?                      'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?                      'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?                      'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1M54 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.83 
_exptl_crystal.density_Matthews      2.55 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            323 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'PEG 10K, Tris-HCl, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 323K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-03-16 
_diffrn_detector.details                'Bent cylindrical Si-mirror (Rh coating)' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111) double-crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.7401 1.0 
2 1.7372 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '1.7401, 1.7372' 
# 
_reflns.entry_id                     1M54 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.d_resolution_high            2.90 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   87507 
_reflns.number_obs                   87507 
_reflns.percent_possible_obs         83.2 
_reflns.pdbx_Rmerge_I_obs            0.1400000 
_reflns.pdbx_Rsym_value              0.1400000 
_reflns.pdbx_netI_over_sigmaI        9.2 
_reflns.B_iso_Wilson_estimate        58.127 
_reflns.pdbx_redundancy              12 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              3.0 
_reflns_shell.percent_possible_all   10.0 
_reflns_shell.Rmerge_I_obs           0.4590000 
_reflns_shell.pdbx_Rsym_value        0.4590000 
_reflns_shell.meanI_over_sigI_obs    3 
_reflns_shell.pdbx_redundancy        10 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      53028 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1M54 
_refine.ls_d_res_high                            2.90 
_refine.ls_d_res_low                             50.0 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_ls_sigma_I                          1.0 
_refine.ls_number_reflns_all                     87507 
_refine.ls_number_reflns_obs                     79364 
_refine.ls_number_reflns_R_free                  7535 
_refine.ls_percent_reflns_obs                    83.3 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2710000 
_refine.ls_R_factor_R_free                       0.3650000 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1JBQ' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.B_iso_mean                               33.6 
_refine.aniso_B[1][1]                            4.88 
_refine.aniso_B[1][2]                            -2.86 
_refine.aniso_B[1][3]                            -2.02 
_refine.aniso_B[2][2]                            15.93 
_refine.aniso_B[2][3]                            2.91 
_refine.aniso_B[3][3]                            3.65 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1M54 
_refine_analyze.Luzzati_coordinate_error_obs    0.44 
_refine_analyze.Luzzati_sigma_a_obs             0.38 
_refine_analyze.Luzzati_d_res_low_obs           50.0 
_refine_analyze.Luzzati_coordinate_error_free   0.63 
_refine_analyze.Luzzati_sigma_a_free            0.59 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        15951 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         348 
_refine_hist.number_atoms_solvent             104 
_refine_hist.number_atoms_total               16403 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.5  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        2.1   ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.18  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        3.08 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.3360000 
_refine_ls_shell.percent_reflns_obs               63.9 
_refine_ls_shell.R_factor_R_free                  0.4050000 
_refine_ls_shell.R_factor_R_free_error            0.012 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             1110 
_refine_ls_shell.number_reflns_obs                10105 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1M54 
_struct.title                     'CYSTATHIONINE-BETA SYNTHASE: REDUCED VICINAL THIOLS' 
_struct.pdbx_descriptor           'CYSTATHIONINE BETA-SYNTHASE (E.C.4.2.1.22)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1M54 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            
'PLP PROTEIN FOLD TYPE II (TRYPTOPHAN SYNTHASE), PLP AND HEME BOUND TO PROTEIN, REDUCED VICINAL CYSTEINES, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 2 ? 
L N N 3 ? 
M N N 2 ? 
N N N 3 ? 
O N N 2 ? 
P N N 3 ? 
Q N N 2 ? 
R N N 3 ? 
S N N 4 ? 
T N N 4 ? 
U N N 4 ? 
V N N 4 ? 
W N N 4 ? 
X N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;the biologically relevant entity is a dimer.  three dimers occupy the assymetric unit.  chain A is related to chain B by the followin 3x3 matrix: 
(  0.78094 -0.51950 -0.34677 ) 
( -0.51627 -0.84936  0.10976 ) 
( -0.35155  0.09331 -0.93151 ) 
translation: (-0.12746 -0.20056   -0.68113)
;
? 
2 ? ? 
3 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 75  ? GLU A 88  ? VAL A 118 GLU A 131 1 ? 14 
HELX_P HELX_P2  2  GLY A 105 ? GLY A 119 ? GLY A 148 GLY A 162 1 ? 15 
HELX_P HELX_P3  3  SER A 131 ? ALA A 140 ? SER A 174 ALA A 183 1 ? 10 
HELX_P HELX_P4  4  ALA A 183 ? THR A 192 ? ALA A 226 THR A 235 1 ? 10 
HELX_P HELX_P5  5  THR A 192 ? ASP A 202 ? THR A 235 ASP A 245 1 ? 11 
HELX_P HELX_P6  6  THR A 217 ? CYS A 229 ? THR A 260 CYS A 272 1 ? 13 
HELX_P HELX_P7  7  ASN A 284 ? GLN A 298 ? ASN A 327 GLN A 341 1 ? 15 
HELX_P HELX_P8  8  GLY A 304 ? ALA A 318 ? GLY A 347 ALA A 361 1 ? 15 
HELX_P HELX_P9  9  GLN A 319 ? LEU A 321 ? GLN A 362 LEU A 364 5 ? 3  
HELX_P HELX_P10 10 VAL A 335 ? MET A 339 ? VAL A 378 MET A 382 5 ? 5  
HELX_P HELX_P11 11 SER A 344 ? LYS A 351 ? SER A 387 LYS A 394 1 ? 8  
HELX_P HELX_P12 12 ASP B 36  ? ILE B 41  ? ASP B 79  ILE B 84  5 ? 6  
HELX_P HELX_P13 13 PHE B 68  ? ASN B 70  ? PHE B 111 ASN B 113 5 ? 3  
HELX_P HELX_P14 14 LYS B 76  ? GLY B 91  ? LYS B 119 GLY B 134 1 ? 16 
HELX_P HELX_P15 15 GLY B 105 ? GLY B 119 ? GLY B 148 GLY B 162 1 ? 15 
HELX_P HELX_P16 16 SER B 131 ? LEU B 141 ? SER B 174 LEU B 184 1 ? 11 
HELX_P HELX_P17 17 ALA B 183 ? THR B 192 ? ALA B 226 THR B 235 1 ? 10 
HELX_P HELX_P18 18 THR B 192 ? CYS B 201 ? THR B 235 CYS B 244 1 ? 10 
HELX_P HELX_P19 19 GLY B 215 ? CYS B 229 ? GLY B 258 CYS B 272 1 ? 15 
HELX_P HELX_P20 20 PRO B 247 ? GLN B 252 ? PRO B 290 GLN B 295 5 ? 6  
HELX_P HELX_P21 21 ASN B 284 ? GLY B 300 ? ASN B 327 GLY B 343 1 ? 17 
HELX_P HELX_P22 22 GLY B 304 ? ALA B 318 ? GLY B 347 ALA B 361 1 ? 15 
HELX_P HELX_P23 23 VAL B 335 ? MET B 339 ? VAL B 378 MET B 382 5 ? 5  
HELX_P HELX_P24 24 SER B 344 ? GLY B 352 ? SER B 387 GLY B 395 1 ? 9  
HELX_P HELX_P25 25 PRO C 16  ? SER C 20  ? PRO C 59  SER C 63  5 ? 5  
HELX_P HELX_P26 26 ASP C 36  ? LYS C 40  ? ASP C 79  LYS C 83  5 ? 5  
HELX_P HELX_P27 27 LYS C 51  ? PHE C 56  ? LYS C 94  PHE C 99  1 ? 6  
HELX_P HELX_P28 28 PHE C 68  ? ASN C 70  ? PHE C 111 ASN C 113 5 ? 3  
HELX_P HELX_P29 29 VAL C 75  ? ALA C 87  ? VAL C 118 ALA C 130 1 ? 13 
HELX_P HELX_P30 30 GLY C 105 ? GLY C 119 ? GLY C 148 GLY C 162 1 ? 15 
HELX_P HELX_P31 31 SER C 131 ? LEU C 141 ? SER C 174 LEU C 184 1 ? 11 
HELX_P HELX_P32 32 VAL C 161 ? ARG C 166 ? VAL C 204 ARG C 209 1 ? 6  
HELX_P HELX_P33 33 ARG C 166 ? ILE C 171 ? ARG C 209 ILE C 214 1 ? 6  
HELX_P HELX_P34 34 ALA C 183 ? THR C 192 ? ALA C 226 THR C 235 1 ? 10 
HELX_P HELX_P35 35 THR C 192 ? CYS C 201 ? THR C 235 CYS C 244 1 ? 10 
HELX_P HELX_P36 36 GLY C 215 ? CYS C 229 ? GLY C 258 CYS C 272 1 ? 15 
HELX_P HELX_P37 37 PRO C 247 ? GLN C 252 ? PRO C 290 GLN C 295 5 ? 6  
HELX_P HELX_P38 38 ASN C 284 ? ALA C 297 ? ASN C 327 ALA C 340 1 ? 14 
HELX_P HELX_P39 39 GLY C 304 ? ALA C 318 ? GLY C 347 ALA C 361 1 ? 15 
HELX_P HELX_P40 40 GLN C 319 ? LEU C 321 ? GLN C 362 LEU C 364 5 ? 3  
HELX_P HELX_P41 41 SER C 344 ? LYS C 351 ? SER C 387 LYS C 394 1 ? 8  
HELX_P HELX_P42 42 PRO D 16  ? SER D 20  ? PRO D 59  SER D 63  5 ? 5  
HELX_P HELX_P43 43 ASP D 36  ? ILE D 41  ? ASP D 79  ILE D 84  5 ? 6  
HELX_P HELX_P44 44 GLY D 53  ? GLY D 57  ? GLY D 96  GLY D 100 5 ? 5  
HELX_P HELX_P45 45 LYS D 76  ? GLU D 88  ? LYS D 119 GLU D 131 1 ? 13 
HELX_P HELX_P46 46 GLY D 105 ? GLY D 119 ? GLY D 148 GLY D 162 1 ? 15 
HELX_P HELX_P47 47 SER D 131 ? ARG D 139 ? SER D 174 ARG D 182 1 ? 9  
HELX_P HELX_P48 48 ARG D 166 ? ILE D 171 ? ARG D 209 ILE D 214 1 ? 6  
HELX_P HELX_P49 49 ALA D 183 ? THR D 192 ? ALA D 226 THR D 235 1 ? 10 
HELX_P HELX_P50 50 THR D 192 ? CYS D 201 ? THR D 235 CYS D 244 1 ? 10 
HELX_P HELX_P51 51 GLY D 215 ? CYS D 229 ? GLY D 258 CYS D 272 1 ? 15 
HELX_P HELX_P52 52 PRO D 247 ? ASN D 251 ? PRO D 290 ASN D 294 5 ? 5  
HELX_P HELX_P53 53 ASN D 284 ? GLU D 299 ? ASN D 327 GLU D 342 1 ? 16 
HELX_P HELX_P54 54 GLY D 304 ? ALA D 318 ? GLY D 347 ALA D 361 1 ? 15 
HELX_P HELX_P55 55 GLN D 319 ? LEU D 321 ? GLN D 362 LEU D 364 5 ? 3  
HELX_P HELX_P56 56 SER D 334 ? MET D 339 ? SER D 377 MET D 382 5 ? 6  
HELX_P HELX_P57 57 SER D 344 ? GLN D 350 ? SER D 387 GLN D 393 1 ? 7  
HELX_P HELX_P58 58 ASP E 36  ? ILE E 41  ? ASP E 79  ILE E 84  5 ? 6  
HELX_P HELX_P59 59 GLY E 53  ? GLY E 57  ? GLY E 96  GLY E 100 5 ? 5  
HELX_P HELX_P60 60 VAL E 75  ? ASP E 90  ? VAL E 118 ASP E 133 1 ? 16 
HELX_P HELX_P61 61 GLY E 105 ? ARG E 118 ? GLY E 148 ARG E 161 1 ? 14 
HELX_P HELX_P62 62 LYS E 134 ? ALA E 140 ? LYS E 177 ALA E 183 1 ? 7  
HELX_P HELX_P63 63 VAL E 161 ? ASN E 169 ? VAL E 204 ASN E 212 1 ? 9  
HELX_P HELX_P64 64 ALA E 183 ? THR E 192 ? ALA E 226 THR E 235 1 ? 10 
HELX_P HELX_P65 65 THR E 192 ? CYS E 201 ? THR E 235 CYS E 244 1 ? 10 
HELX_P HELX_P66 66 GLY E 215 ? CYS E 229 ? GLY E 258 CYS E 272 1 ? 15 
HELX_P HELX_P67 67 ASN E 284 ? GLN E 298 ? ASN E 327 GLN E 341 1 ? 15 
HELX_P HELX_P68 68 GLY E 304 ? ALA E 318 ? GLY E 347 ALA E 361 1 ? 15 
HELX_P HELX_P69 69 GLN E 319 ? LEU E 321 ? GLN E 362 LEU E 364 5 ? 3  
HELX_P HELX_P70 70 ASP F 36  ? ILE F 41  ? ASP F 79  ILE F 84  5 ? 6  
HELX_P HELX_P71 71 PHE F 68  ? ASN F 70  ? PHE F 111 ASN F 113 5 ? 3  
HELX_P HELX_P72 72 VAL F 75  ? MET F 83  ? VAL F 118 MET F 126 1 ? 9  
HELX_P HELX_P73 73 ASP F 86  ? ASP F 90  ? ASP F 129 ASP F 133 5 ? 5  
HELX_P HELX_P74 74 GLY F 105 ? GLY F 119 ? GLY F 148 GLY F 162 1 ? 15 
HELX_P HELX_P75 75 SER F 131 ? LEU F 141 ? SER F 174 LEU F 184 1 ? 11 
HELX_P HELX_P76 76 VAL F 161 ? ILE F 171 ? VAL F 204 ILE F 214 1 ? 11 
HELX_P HELX_P77 77 ALA F 183 ? THR F 192 ? ALA F 226 THR F 235 1 ? 10 
HELX_P HELX_P78 78 THR F 192 ? ASP F 202 ? THR F 235 ASP F 245 1 ? 11 
HELX_P HELX_P79 79 GLY F 215 ? CYS F 229 ? GLY F 258 CYS F 272 1 ? 15 
HELX_P HELX_P80 80 ASP F 273 ? VAL F 277 ? ASP F 316 VAL F 320 5 ? 5  
HELX_P HELX_P81 81 ASN F 284 ? GLN F 298 ? ASN F 327 GLN F 341 1 ? 15 
HELX_P HELX_P82 82 GLY F 304 ? ALA F 318 ? GLY F 347 ALA F 361 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A LYS 76 NZ  ? ? ? 1_555 G PLP . C4A ? ? A LYS 119 A PLP 1110 1_555 ? ? ? ? ? ? ? 1.456 ? 
covale2  covale ? ? B LYS 76 NZ  ? ? ? 1_555 I PLP . C4A ? ? B LYS 119 B PLP 1210 1_555 ? ? ? ? ? ? ? 1.025 ? 
covale3  covale ? ? C LYS 76 NZ  ? ? ? 1_555 K PLP . C4A ? ? C LYS 119 C PLP 1310 1_555 ? ? ? ? ? ? ? 1.050 ? 
covale4  covale ? ? D LYS 76 NZ  ? ? ? 1_555 M PLP . C4A ? ? D LYS 119 D PLP 1410 1_555 ? ? ? ? ? ? ? 1.471 ? 
covale5  covale ? ? E LYS 76 NZ  ? ? ? 1_555 O PLP . C4A ? ? E LYS 119 E PLP 1510 1_555 ? ? ? ? ? ? ? 1.461 ? 
covale6  covale ? ? F LYS 76 NZ  ? ? ? 1_555 Q PLP . C4A ? ? F LYS 119 F PLP 1610 1_555 ? ? ? ? ? ? ? 1.474 ? 
metalc1  metalc ? ? A HIS 22 NE2 ? ? ? 1_555 H HEM . FE  ? ? A HIS 65  A HEM 1120 1_555 ? ? ? ? ? ? ? 2.004 ? 
metalc2  metalc ? ? B HIS 22 NE2 ? ? ? 1_555 J HEM . FE  ? ? B HIS 65  B HEM 1220 1_555 ? ? ? ? ? ? ? 2.009 ? 
metalc3  metalc ? ? C HIS 22 NE2 ? ? ? 1_555 L HEM . FE  ? ? C HIS 65  C HEM 1320 1_555 ? ? ? ? ? ? ? 2.001 ? 
metalc4  metalc ? ? D HIS 22 NE2 ? ? ? 1_555 N HEM . FE  ? ? D HIS 65  D HEM 1420 1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc5  metalc ? ? E HIS 22 NE2 ? ? ? 1_555 P HEM . FE  ? ? E HIS 65  E HEM 1520 1_555 ? ? ? ? ? ? ? 2.005 ? 
metalc6  metalc ? ? F HIS 22 NE2 ? ? ? 1_555 R HEM . FE  ? ? F HIS 65  F HEM 1620 1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc7  metalc ? ? A CYS 9  SG  ? ? ? 1_555 H HEM . FE  ? ? A CYS 52  A HEM 1120 1_555 ? ? ? ? ? ? ? 2.537 ? 
metalc8  metalc ? ? B CYS 9  SG  ? ? ? 1_555 J HEM . FE  ? ? B CYS 52  B HEM 1220 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc9  metalc ? ? C CYS 9  SG  ? ? ? 1_555 L HEM . FE  ? ? C CYS 52  C HEM 1320 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc10 metalc ? ? D CYS 9  SG  ? ? ? 1_555 N HEM . FE  ? ? D CYS 52  D HEM 1420 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc11 metalc ? ? E CYS 9  SG  ? ? ? 1_555 P HEM . FE  ? ? E CYS 52  E HEM 1520 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc12 metalc ? ? F CYS 9  SG  ? ? ? 1_555 R HEM . FE  ? ? F CYS 52  F HEM 1620 1_555 ? ? ? ? ? ? ? 2.811 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 246 A . ? GLU 289 A PRO 247 A ? PRO 290 A 1 0.19 
2 GLU 246 E . ? GLU 289 E PRO 247 E ? PRO 290 E 1 0.65 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 5 ? 
D ? 3 ? 
E ? 4 ? 
F ? 2 ? 
G ? 2 ? 
H ? 5 ? 
I ? 2 ? 
J ? 2 ? 
K ? 4 ? 
L ? 4 ? 
M ? 7 ? 
N ? 4 ? 
O ? 6 ? 
P ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
F 1 2 ? parallel      
G 1 2 ? parallel      
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
I 1 2 ? parallel      
J 1 2 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? parallel      
K 3 4 ? parallel      
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
M 1 2 ? parallel      
M 2 3 ? parallel      
M 3 4 ? parallel      
M 4 5 ? parallel      
M 5 6 ? anti-parallel 
M 6 7 ? parallel      
N 1 2 ? parallel      
N 2 3 ? parallel      
N 3 4 ? parallel      
O 1 2 ? anti-parallel 
O 2 3 ? parallel      
O 3 4 ? parallel      
O 4 5 ? parallel      
O 5 6 ? parallel      
P 1 2 ? parallel      
P 2 3 ? parallel      
P 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 33  ? LEU A 34  ? ILE A 76  LEU A 77  
A 2 MET B 46  ? ARG B 48  ? MET B 89  ARG B 91  
A 3 GLU B 61  ? CYS B 66  ? GLU B 104 CYS B 109 
A 4 ARG B 326 ? CYS B 327 ? ARG B 369 CYS B 370 
B 1 ILE A 33  ? LEU A 34  ? ILE A 76  LEU A 77  
B 2 MET B 46  ? ARG B 48  ? MET B 89  ARG B 91  
B 3 GLU B 61  ? CYS B 66  ? GLU B 104 CYS B 109 
B 4 ILE B 330 ? LEU B 331 ? ILE B 373 LEU B 374 
C 1 ALA A 64  ? CYS A 66  ? ALA A 107 CYS A 109 
C 2 VAL A 328 ? LEU A 331 ? VAL A 371 LEU A 374 
C 3 LEU A 208 ? SER A 211 ? LEU A 251 SER A 254 
C 4 ILE A 235 ? PRO A 239 ? ILE A 278 PRO A 282 
C 5 LYS A 279 ? SER A 283 ? LYS A 322 SER A 326 
D 1 THR A 98  ? GLU A 101 ? THR A 141 GLU A 144 
D 2 ARG A 121 ? PRO A 127 ? ARG A 164 PRO A 170 
D 3 GLU A 144 ? THR A 148 ? GLU A 187 THR A 191 
E 1 GLU B 144 ? THR B 148 ? GLU B 187 THR B 191 
E 2 ARG B 121 ? PRO B 127 ? ARG B 164 PRO B 170 
E 3 THR B 98  ? GLU B 101 ? THR B 141 GLU B 144 
E 4 SER B 174 ? HIS B 175 ? SER B 217 HIS B 218 
F 1 ILE B 235 ? PRO B 239 ? ILE B 278 PRO B 282 
F 2 LYS B 279 ? SER B 283 ? LYS B 322 SER B 326 
G 1 MET C 46  ? VAL C 47  ? MET C 89  VAL C 90  
G 2 ILE D 33  ? LEU D 34  ? ILE D 76  LEU D 77  
H 1 GLU C 61  ? CYS C 66  ? GLU C 104 CYS C 109 
H 2 ARG C 326 ? LEU C 331 ? ARG C 369 LEU C 374 
H 3 MET C 207 ? SER C 211 ? MET C 250 SER C 254 
H 4 ARG C 233 ? PRO C 239 ? ARG C 276 PRO C 282 
H 5 LYS C 279 ? SER C 283 ? LYS C 322 SER C 326 
I 1 VAL C 125 ? PRO C 127 ? VAL C 168 PRO C 170 
I 2 VAL C 146 ? THR C 148 ? VAL C 189 THR C 191 
J 1 MET D 46  ? ARG D 48  ? MET D 89  ARG D 91  
J 2 LEU D 63  ? LYS D 65  ? LEU D 106 LYS D 108 
K 1 GLU D 144 ? ARG D 147 ? GLU D 187 ARG D 190 
K 2 ARG D 121 ? MET D 126 ? ARG D 164 MET D 169 
K 3 THR D 98  ? GLU D 101 ? THR D 141 GLU D 144 
K 4 SER D 174 ? HIS D 175 ? SER D 217 HIS D 218 
L 1 LYS D 279 ? SER D 283 ? LYS D 322 SER D 326 
L 2 ILE D 235 ? PRO D 239 ? ILE D 278 PRO D 282 
L 3 LEU D 208 ? SER D 211 ? LEU D 251 SER D 254 
L 4 VAL D 328 ? VAL D 329 ? VAL D 371 VAL D 372 
M 1 LYS E 279 ? SER E 283 ? LYS E 322 SER E 326 
M 2 ARG E 233 ? PRO E 239 ? ARG E 276 PRO E 282 
M 3 MET E 207 ? SER E 211 ? MET E 250 SER E 254 
M 4 VAL E 328 ? LEU E 331 ? VAL E 371 LEU E 374 
M 5 LEU E 63  ? CYS E 66  ? LEU E 106 CYS E 109 
M 6 MET E 46  ? ARG E 48  ? MET E 89  ARG E 91  
M 7 ILE F 33  ? LEU F 34  ? ILE F 76  LEU F 77  
N 1 GLU E 144 ? ARG E 147 ? GLU E 187 ARG E 190 
N 2 CYS E 122 ? MET E 126 ? CYS E 165 MET E 169 
N 3 ILE E 99  ? GLU E 101 ? ILE E 142 GLU E 144 
N 4 HIS E 175 ? ILE E 176 ? HIS E 218 ILE E 219 
O 1 MET F 46  ? ILE F 49  ? MET F 89  ILE F 92  
O 2 LEU F 62  ? CYS F 66  ? LEU F 105 CYS F 109 
O 3 VAL F 328 ? LEU F 331 ? VAL F 371 LEU F 374 
O 4 LEU F 208 ? SER F 211 ? LEU F 251 SER F 254 
O 5 ILE F 234 ? PRO F 239 ? ILE F 277 PRO F 282 
O 6 TRP F 280 ? SER F 283 ? TRP F 323 SER F 326 
P 1 GLU F 144 ? VAL F 146 ? GLU F 187 VAL F 189 
P 2 CYS F 122 ? VAL F 125 ? CYS F 165 VAL F 168 
P 3 ILE F 99  ? GLU F 101 ? ILE F 142 GLU F 144 
P 4 HIS F 175 ? ILE F 176 ? HIS F 218 ILE F 219 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 34  ? N LEU A 77  O ARG B 48  ? O ARG B 91  
A 2 3 N VAL B 47  ? N VAL B 90  O ALA B 64  ? O ALA B 107 
A 3 4 O GLU B 61  ? O GLU B 104 N CYS B 327 ? N CYS B 370 
B 1 2 N LEU A 34  ? N LEU A 77  O ARG B 48  ? O ARG B 91  
B 2 3 N VAL B 47  ? N VAL B 90  O ALA B 64  ? O ALA B 107 
B 3 4 N LYS B 65  ? N LYS B 108 O LEU B 331 ? O LEU B 374 
C 1 2 N LYS A 65  ? N LYS A 108 O LEU A 331 ? O LEU A 374 
C 2 3 O ILE A 330 ? O ILE A 373 N VAL A 209 ? N VAL A 252 
C 3 4 N ALA A 210 ? N ALA A 253 O ILE A 235 ? O ILE A 278 
C 4 5 N ASP A 238 ? N ASP A 281 O PHE A 281 ? O PHE A 324 
D 1 2 N ILE A 99  ? N ILE A 142 O ARG A 121 ? O ARG A 164 
D 2 3 N ILE A 124 ? N ILE A 167 O GLU A 144 ? O GLU A 187 
E 1 2 O GLU B 144 ? O GLU B 187 N ILE B 124 ? N ILE B 167 
E 2 3 O VAL B 125 ? O VAL B 168 N GLU B 101 ? N GLU B 144 
E 3 4 N THR B 98  ? N THR B 141 O HIS B 175 ? O HIS B 218 
F 1 2 N ASP B 238 ? N ASP B 281 O PHE B 281 ? O PHE B 324 
G 1 2 N MET C 46  ? N MET C 89  O LEU D 34  ? O LEU D 77  
H 1 2 N LYS C 65  ? N LYS C 108 O VAL C 329 ? O VAL C 372 
H 2 3 O VAL C 328 ? O VAL C 371 N MET C 207 ? N MET C 250 
H 3 4 N ALA C 210 ? N ALA C 253 O VAL C 237 ? O VAL C 280 
H 4 5 N ASP C 238 ? N ASP C 281 O PHE C 281 ? O PHE C 324 
I 1 2 N MET C 126 ? N MET C 169 O THR C 148 ? O THR C 191 
J 1 2 N VAL D 47  ? N VAL D 90  O ALA D 64  ? O ALA D 107 
K 1 2 O VAL D 146 ? O VAL D 189 N ILE D 124 ? N ILE D 167 
K 2 3 O ARG D 121 ? O ARG D 164 N ILE D 99  ? N ILE D 142 
K 3 4 N THR D 98  ? N THR D 141 O HIS D 175 ? O HIS D 218 
L 1 2 O SER D 283 ? O SER D 326 N ASP D 238 ? N ASP D 281 
L 2 3 O VAL D 237 ? O VAL D 280 N ALA D 210 ? N ALA D 253 
L 3 4 N VAL D 209 ? N VAL D 252 O VAL D 328 ? O VAL D 371 
M 1 2 O PHE E 281 ? O PHE E 324 N ASP E 238 ? N ASP E 281 
M 2 3 O ILE E 235 ? O ILE E 278 N ALA E 210 ? N ALA E 253 
M 3 4 N VAL E 209 ? N VAL E 252 O VAL E 328 ? O VAL E 371 
M 4 5 O VAL E 329 ? O VAL E 372 N LYS E 65  ? N LYS E 108 
M 5 6 O ALA E 64  ? O ALA E 107 N VAL E 47  ? N VAL E 90  
M 6 7 N MET E 46  ? N MET E 89  O LEU F 34  ? O LEU F 77  
N 1 2 O VAL E 146 ? O VAL E 189 N MET E 126 ? N MET E 169 
N 2 3 O ILE E 123 ? O ILE E 166 N GLU E 101 ? N GLU E 144 
N 3 4 N ILE E 100 ? N ILE E 143 O HIS E 175 ? O HIS E 218 
O 1 2 N VAL F 47  ? N VAL F 90  O ALA F 64  ? O ALA F 107 
O 2 3 N LYS F 65  ? N LYS F 108 O VAL F 329 ? O VAL F 372 
O 3 4 O VAL F 328 ? O VAL F 371 N VAL F 209 ? N VAL F 252 
O 4 5 N ALA F 210 ? N ALA F 253 O ILE F 235 ? O ILE F 278 
O 5 6 N GLY F 236 ? N GLY F 279 O PHE F 281 ? O PHE F 324 
P 1 2 O GLU F 144 ? O GLU F 187 N ILE F 124 ? N ILE F 167 
P 2 3 O VAL F 125 ? O VAL F 168 N GLU F 101 ? N GLU F 144 
P 3 4 N ILE F 100 ? N ILE F 143 O HIS F 175 ? O HIS F 218 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PLP A 1110' 
AC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PLP B 1210' 
AC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE PLP C 1310' 
AC4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PLP D 1410' 
AC5 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE PLP E 1510' 
AC6 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE PLP F 1610' 
AC7 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE HEM A 1120' 
AC8 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE HEM B 1220' 
AC9 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE HEM C 1320' 
BC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM D 1420' 
BC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE HEM E 1520' 
BC3 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE HEM F 1620' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 14 LYS A 76  ? LYS A 119  . ? 1_555 ? 
2   AC1 14 ASN A 106 ? ASN A 149  . ? 1_555 ? 
3   AC1 14 VAL A 212 ? VAL A 255  . ? 1_555 ? 
4   AC1 14 GLY A 213 ? GLY A 256  . ? 1_555 ? 
5   AC1 14 THR A 214 ? THR A 257  . ? 1_555 ? 
6   AC1 14 GLY A 215 ? GLY A 258  . ? 1_555 ? 
7   AC1 14 GLY A 216 ? GLY A 259  . ? 1_555 ? 
8   AC1 14 THR A 217 ? THR A 260  . ? 1_555 ? 
9   AC1 14 GLU A 261 ? GLU A 304  . ? 1_555 ? 
10  AC1 14 GLY A 262 ? GLY A 305  . ? 1_555 ? 
11  AC1 14 ILE A 263 ? ILE A 306  . ? 1_555 ? 
12  AC1 14 SER A 306 ? SER A 349  . ? 1_555 ? 
13  AC1 14 PRO A 332 ? PRO A 375  . ? 1_555 ? 
14  AC1 14 ASP A 333 ? ASP A 376  . ? 1_555 ? 
15  AC2 13 LYS B 76  ? LYS B 119  . ? 1_555 ? 
16  AC2 13 ASN B 106 ? ASN B 149  . ? 1_555 ? 
17  AC2 13 GLY B 213 ? GLY B 256  . ? 1_555 ? 
18  AC2 13 THR B 214 ? THR B 257  . ? 1_555 ? 
19  AC2 13 GLY B 215 ? GLY B 258  . ? 1_555 ? 
20  AC2 13 THR B 217 ? THR B 260  . ? 1_555 ? 
21  AC2 13 GLU B 261 ? GLU B 304  . ? 1_555 ? 
22  AC2 13 GLY B 262 ? GLY B 305  . ? 1_555 ? 
23  AC2 13 ILE B 263 ? ILE B 306  . ? 1_555 ? 
24  AC2 13 SER B 306 ? SER B 349  . ? 1_555 ? 
25  AC2 13 PRO B 332 ? PRO B 375  . ? 1_555 ? 
26  AC2 13 ASP B 333 ? ASP B 376  . ? 1_555 ? 
27  AC2 13 TYR B 338 ? TYR B 381  . ? 1_555 ? 
28  AC3 15 LYS C 76  ? LYS C 119  . ? 1_555 ? 
29  AC3 15 ASN C 106 ? ASN C 149  . ? 1_555 ? 
30  AC3 15 SER C 211 ? SER C 254  . ? 1_555 ? 
31  AC3 15 VAL C 212 ? VAL C 255  . ? 1_555 ? 
32  AC3 15 GLY C 213 ? GLY C 256  . ? 1_555 ? 
33  AC3 15 THR C 214 ? THR C 257  . ? 1_555 ? 
34  AC3 15 GLY C 215 ? GLY C 258  . ? 1_555 ? 
35  AC3 15 GLY C 216 ? GLY C 259  . ? 1_555 ? 
36  AC3 15 THR C 217 ? THR C 260  . ? 1_555 ? 
37  AC3 15 GLU C 261 ? GLU C 304  . ? 1_555 ? 
38  AC3 15 GLY C 262 ? GLY C 305  . ? 1_555 ? 
39  AC3 15 ILE C 263 ? ILE C 306  . ? 1_555 ? 
40  AC3 15 SER C 306 ? SER C 349  . ? 1_555 ? 
41  AC3 15 PRO C 332 ? PRO C 375  . ? 1_555 ? 
42  AC3 15 ASP C 333 ? ASP C 376  . ? 1_555 ? 
43  AC4 14 LYS D 76  ? LYS D 119  . ? 1_555 ? 
44  AC4 14 ASN D 106 ? ASN D 149  . ? 1_555 ? 
45  AC4 14 SER D 211 ? SER D 254  . ? 1_555 ? 
46  AC4 14 VAL D 212 ? VAL D 255  . ? 1_555 ? 
47  AC4 14 GLY D 213 ? GLY D 256  . ? 1_555 ? 
48  AC4 14 THR D 214 ? THR D 257  . ? 1_555 ? 
49  AC4 14 GLY D 215 ? GLY D 258  . ? 1_555 ? 
50  AC4 14 GLY D 216 ? GLY D 259  . ? 1_555 ? 
51  AC4 14 THR D 217 ? THR D 260  . ? 1_555 ? 
52  AC4 14 GLU D 261 ? GLU D 304  . ? 1_555 ? 
53  AC4 14 GLY D 262 ? GLY D 305  . ? 1_555 ? 
54  AC4 14 ILE D 263 ? ILE D 306  . ? 1_555 ? 
55  AC4 14 SER D 306 ? SER D 349  . ? 1_555 ? 
56  AC4 14 PRO D 332 ? PRO D 375  . ? 1_555 ? 
57  AC5 16 LYS E 76  ? LYS E 119  . ? 1_555 ? 
58  AC5 16 ASN E 106 ? ASN E 149  . ? 1_555 ? 
59  AC5 16 SER E 211 ? SER E 254  . ? 1_555 ? 
60  AC5 16 VAL E 212 ? VAL E 255  . ? 1_555 ? 
61  AC5 16 GLY E 213 ? GLY E 256  . ? 1_555 ? 
62  AC5 16 THR E 214 ? THR E 257  . ? 1_555 ? 
63  AC5 16 GLY E 215 ? GLY E 258  . ? 1_555 ? 
64  AC5 16 GLY E 216 ? GLY E 259  . ? 1_555 ? 
65  AC5 16 THR E 217 ? THR E 260  . ? 1_555 ? 
66  AC5 16 GLU E 261 ? GLU E 304  . ? 1_555 ? 
67  AC5 16 GLY E 262 ? GLY E 305  . ? 1_555 ? 
68  AC5 16 ILE E 263 ? ILE E 306  . ? 1_555 ? 
69  AC5 16 SER E 306 ? SER E 349  . ? 1_555 ? 
70  AC5 16 PRO E 332 ? PRO E 375  . ? 1_555 ? 
71  AC5 16 TYR E 338 ? TYR E 381  . ? 1_555 ? 
72  AC5 16 HOH W .   ? HOH E 1523 . ? 1_555 ? 
73  AC6 15 LYS F 76  ? LYS F 119  . ? 1_555 ? 
74  AC6 15 ASN F 106 ? ASN F 149  . ? 1_555 ? 
75  AC6 15 SER F 211 ? SER F 254  . ? 1_555 ? 
76  AC6 15 VAL F 212 ? VAL F 255  . ? 1_555 ? 
77  AC6 15 GLY F 213 ? GLY F 256  . ? 1_555 ? 
78  AC6 15 THR F 214 ? THR F 257  . ? 1_555 ? 
79  AC6 15 GLY F 215 ? GLY F 258  . ? 1_555 ? 
80  AC6 15 GLY F 216 ? GLY F 259  . ? 1_555 ? 
81  AC6 15 THR F 217 ? THR F 260  . ? 1_555 ? 
82  AC6 15 GLY F 262 ? GLY F 305  . ? 1_555 ? 
83  AC6 15 ILE F 263 ? ILE F 306  . ? 1_555 ? 
84  AC6 15 SER F 306 ? SER F 349  . ? 1_555 ? 
85  AC6 15 PRO F 332 ? PRO F 375  . ? 1_555 ? 
86  AC6 15 ASP F 333 ? ASP F 376  . ? 1_555 ? 
87  AC6 15 TYR F 338 ? TYR F 381  . ? 1_555 ? 
88  AC7 16 ARG A 8   ? ARG A 51   . ? 1_555 ? 
89  AC7 16 CYS A 9   ? CYS A 52   . ? 1_555 ? 
90  AC7 16 THR A 10  ? THR A 53   . ? 1_555 ? 
91  AC7 16 TRP A 11  ? TRP A 54   . ? 1_555 ? 
92  AC7 16 ARG A 15  ? ARG A 58   . ? 1_555 ? 
93  AC7 16 GLU A 19  ? GLU A 62   . ? 1_555 ? 
94  AC7 16 SER A 20  ? SER A 63   . ? 1_555 ? 
95  AC7 16 PRO A 21  ? PRO A 64   . ? 1_555 ? 
96  AC7 16 HIS A 22  ? HIS A 65   . ? 1_555 ? 
97  AC7 16 ALA A 183 ? ALA A 226  . ? 1_555 ? 
98  AC7 16 PRO A 186 ? PRO A 229  . ? 1_555 ? 
99  AC7 16 LEU A 187 ? LEU A 230  . ? 1_555 ? 
100 AC7 16 TYR A 190 ? TYR A 233  . ? 1_555 ? 
101 AC7 16 ARG A 223 ? ARG A 266  . ? 1_555 ? 
102 AC7 16 THR F 10  ? THR F 53   . ? 1_555 ? 
103 AC7 16 ARG F 15  ? ARG F 58   . ? 1_555 ? 
104 AC8 20 PRO B 6   ? PRO B 49   . ? 1_555 ? 
105 AC8 20 SER B 7   ? SER B 50   . ? 1_555 ? 
106 AC8 20 ARG B 8   ? ARG B 51   . ? 1_555 ? 
107 AC8 20 CYS B 9   ? CYS B 52   . ? 1_555 ? 
108 AC8 20 THR B 10  ? THR B 53   . ? 1_555 ? 
109 AC8 20 TRP B 11  ? TRP B 54   . ? 1_555 ? 
110 AC8 20 ARG B 15  ? ARG B 58   . ? 1_555 ? 
111 AC8 20 GLU B 19  ? GLU B 62   . ? 1_555 ? 
112 AC8 20 SER B 20  ? SER B 63   . ? 1_555 ? 
113 AC8 20 PRO B 21  ? PRO B 64   . ? 1_555 ? 
114 AC8 20 HIS B 22  ? HIS B 65   . ? 1_555 ? 
115 AC8 20 ARG B 181 ? ARG B 224  . ? 1_555 ? 
116 AC8 20 ALA B 183 ? ALA B 226  . ? 1_555 ? 
117 AC8 20 PRO B 186 ? PRO B 229  . ? 1_555 ? 
118 AC8 20 LEU B 187 ? LEU B 230  . ? 1_555 ? 
119 AC8 20 TYR B 190 ? TYR B 233  . ? 1_555 ? 
120 AC8 20 ARG B 223 ? ARG B 266  . ? 1_555 ? 
121 AC8 20 THR D 10  ? THR D 53   . ? 1_444 ? 
122 AC8 20 ARG D 15  ? ARG D 58   . ? 1_444 ? 
123 AC8 20 HEM N .   ? HEM D 1420 . ? 1_444 ? 
124 AC9 14 SER C 7   ? SER C 50   . ? 1_555 ? 
125 AC9 14 ARG C 8   ? ARG C 51   . ? 1_555 ? 
126 AC9 14 CYS C 9   ? CYS C 52   . ? 1_555 ? 
127 AC9 14 THR C 10  ? THR C 53   . ? 1_555 ? 
128 AC9 14 ARG C 15  ? ARG C 58   . ? 1_555 ? 
129 AC9 14 GLU C 19  ? GLU C 62   . ? 1_555 ? 
130 AC9 14 PRO C 21  ? PRO C 64   . ? 1_555 ? 
131 AC9 14 HIS C 22  ? HIS C 65   . ? 1_555 ? 
132 AC9 14 ALA C 183 ? ALA C 226  . ? 1_555 ? 
133 AC9 14 PRO C 186 ? PRO C 229  . ? 1_555 ? 
134 AC9 14 LEU C 187 ? LEU C 230  . ? 1_555 ? 
135 AC9 14 TYR C 190 ? TYR C 233  . ? 1_555 ? 
136 AC9 14 ARG C 223 ? ARG C 266  . ? 1_555 ? 
137 AC9 14 ARG E 15  ? ARG E 58   . ? 1_444 ? 
138 BC1 17 ARG B 15  ? ARG B 58   . ? 1_666 ? 
139 BC1 17 HEM J .   ? HEM B 1220 . ? 1_666 ? 
140 BC1 17 PRO D 6   ? PRO D 49   . ? 1_555 ? 
141 BC1 17 ARG D 8   ? ARG D 51   . ? 1_555 ? 
142 BC1 17 CYS D 9   ? CYS D 52   . ? 1_555 ? 
143 BC1 17 THR D 10  ? THR D 53   . ? 1_555 ? 
144 BC1 17 TRP D 11  ? TRP D 54   . ? 1_555 ? 
145 BC1 17 ARG D 15  ? ARG D 58   . ? 1_555 ? 
146 BC1 17 GLU D 19  ? GLU D 62   . ? 1_555 ? 
147 BC1 17 SER D 20  ? SER D 63   . ? 1_555 ? 
148 BC1 17 PRO D 21  ? PRO D 64   . ? 1_555 ? 
149 BC1 17 HIS D 22  ? HIS D 65   . ? 1_555 ? 
150 BC1 17 ALA D 183 ? ALA D 226  . ? 1_555 ? 
151 BC1 17 PRO D 186 ? PRO D 229  . ? 1_555 ? 
152 BC1 17 LEU D 187 ? LEU D 230  . ? 1_555 ? 
153 BC1 17 TYR D 190 ? TYR D 233  . ? 1_555 ? 
154 BC1 17 ARG D 223 ? ARG D 266  . ? 1_555 ? 
155 BC2 16 THR C 10  ? THR C 53   . ? 1_666 ? 
156 BC2 16 ARG C 15  ? ARG C 58   . ? 1_666 ? 
157 BC2 16 SER E 7   ? SER E 50   . ? 1_555 ? 
158 BC2 16 ARG E 8   ? ARG E 51   . ? 1_555 ? 
159 BC2 16 CYS E 9   ? CYS E 52   . ? 1_555 ? 
160 BC2 16 TRP E 11  ? TRP E 54   . ? 1_555 ? 
161 BC2 16 GLU E 19  ? GLU E 62   . ? 1_555 ? 
162 BC2 16 SER E 20  ? SER E 63   . ? 1_555 ? 
163 BC2 16 PRO E 21  ? PRO E 64   . ? 1_555 ? 
164 BC2 16 HIS E 22  ? HIS E 65   . ? 1_555 ? 
165 BC2 16 ALA E 183 ? ALA E 226  . ? 1_555 ? 
166 BC2 16 PRO E 186 ? PRO E 229  . ? 1_555 ? 
167 BC2 16 LEU E 187 ? LEU E 230  . ? 1_555 ? 
168 BC2 16 TYR E 190 ? TYR E 233  . ? 1_555 ? 
169 BC2 16 ARG E 223 ? ARG E 266  . ? 1_555 ? 
170 BC2 16 HOH W .   ? HOH E 1535 . ? 1_555 ? 
171 BC3 16 ARG A 15  ? ARG A 58   . ? 1_555 ? 
172 BC3 16 ARG F 8   ? ARG F 51   . ? 1_555 ? 
173 BC3 16 CYS F 9   ? CYS F 52   . ? 1_555 ? 
174 BC3 16 THR F 10  ? THR F 53   . ? 1_555 ? 
175 BC3 16 TRP F 11  ? TRP F 54   . ? 1_555 ? 
176 BC3 16 ARG F 15  ? ARG F 58   . ? 1_555 ? 
177 BC3 16 GLU F 19  ? GLU F 62   . ? 1_555 ? 
178 BC3 16 SER F 20  ? SER F 63   . ? 1_555 ? 
179 BC3 16 PRO F 21  ? PRO F 64   . ? 1_555 ? 
180 BC3 16 HIS F 22  ? HIS F 65   . ? 1_555 ? 
181 BC3 16 ARG F 181 ? ARG F 224  . ? 1_555 ? 
182 BC3 16 ALA F 183 ? ALA F 226  . ? 1_555 ? 
183 BC3 16 PRO F 186 ? PRO F 229  . ? 1_555 ? 
184 BC3 16 LEU F 187 ? LEU F 230  . ? 1_555 ? 
185 BC3 16 ARG F 223 ? ARG F 266  . ? 1_555 ? 
186 BC3 16 VAL F 271 ? VAL F 314  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1M54 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1M54 
_atom_sites.fract_transf_matrix[1][1]   0.011663 
_atom_sites.fract_transf_matrix[1][2]   0.004854 
_atom_sites.fract_transf_matrix[1][3]   0.004117 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012650 
_atom_sites.fract_transf_matrix[2][3]   0.004197 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011076 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . ASP A 1 4   ? 10.913  2.257   30.851  1.00 17.02 ? 47   ASP A N   1 
ATOM   2     C  CA  . ASP A 1 4   ? 11.117  1.222   31.905  1.00 16.73 ? 47   ASP A CA  1 
ATOM   3     C  C   . ASP A 1 4   ? 9.867   0.707   32.646  1.00 17.64 ? 47   ASP A C   1 
ATOM   4     O  O   . ASP A 1 4   ? 8.935   1.466   32.973  1.00 19.12 ? 47   ASP A O   1 
ATOM   5     C  CB  . ASP A 1 4   ? 12.150  1.716   32.915  1.00 17.85 ? 47   ASP A CB  1 
ATOM   6     C  CG  . ASP A 1 4   ? 13.570  1.486   32.439  1.00 17.79 ? 47   ASP A CG  1 
ATOM   7     O  OD1 . ASP A 1 4   ? 14.526  1.888   33.147  1.00 18.60 ? 47   ASP A OD1 1 
ATOM   8     O  OD2 . ASP A 1 4   ? 13.721  0.887   31.345  1.00 17.21 ? 47   ASP A OD2 1 
ATOM   9     N  N   . ALA A 1 5   ? 9.914   -0.607  32.913  1.00 30.44 ? 48   ALA A N   1 
ATOM   10    C  CA  . ALA A 1 5   ? 8.888   -1.439  33.569  1.00 30.91 ? 48   ALA A CA  1 
ATOM   11    C  C   . ALA A 1 5   ? 7.608   -0.855  34.186  1.00 32.08 ? 48   ALA A C   1 
ATOM   12    O  O   . ALA A 1 5   ? 6.537   -1.415  33.951  1.00 31.84 ? 48   ALA A O   1 
ATOM   13    C  CB  . ALA A 1 5   ? 9.563   -2.382  34.575  1.00 30.03 ? 48   ALA A CB  1 
ATOM   14    N  N   . PRO A 1 6   ? 7.683   0.231   35.000  1.00 25.30 ? 49   PRO A N   1 
ATOM   15    C  CA  . PRO A 1 6   ? 6.400   0.707   35.533  1.00 25.15 ? 49   PRO A CA  1 
ATOM   16    C  C   . PRO A 1 6   ? 5.976   2.132   35.165  1.00 24.64 ? 49   PRO A C   1 
ATOM   17    O  O   . PRO A 1 6   ? 6.734   3.078   35.352  1.00 25.64 ? 49   PRO A O   1 
ATOM   18    C  CB  . PRO A 1 6   ? 6.594   0.557   37.029  1.00 25.86 ? 49   PRO A CB  1 
ATOM   19    C  CG  . PRO A 1 6   ? 7.984   1.082   37.190  1.00 27.81 ? 49   PRO A CG  1 
ATOM   20    C  CD  . PRO A 1 6   ? 8.755   0.515   35.973  1.00 26.02 ? 49   PRO A CD  1 
ATOM   21    N  N   . SER A 1 7   ? 4.749   2.268   34.665  1.00 26.89 ? 50   SER A N   1 
ATOM   22    C  CA  . SER A 1 7   ? 4.172   3.562   34.298  1.00 25.51 ? 50   SER A CA  1 
ATOM   23    C  C   . SER A 1 7   ? 3.359   4.074   35.484  1.00 26.16 ? 50   SER A C   1 
ATOM   24    O  O   . SER A 1 7   ? 2.977   3.294   36.360  1.00 25.27 ? 50   SER A O   1 
ATOM   25    C  CB  . SER A 1 7   ? 3.252   3.405   33.080  1.00 23.68 ? 50   SER A CB  1 
ATOM   26    O  OG  . SER A 1 7   ? 1.990   4.056   33.247  1.00 17.23 ? 50   SER A OG  1 
ATOM   27    N  N   . ARG A 1 8   ? 3.076   5.372   35.521  1.00 26.02 ? 51   ARG A N   1 
ATOM   28    C  CA  . ARG A 1 8   ? 2.317   5.898   36.644  1.00 26.23 ? 51   ARG A CA  1 
ATOM   29    C  C   . ARG A 1 8   ? 0.849   6.030   36.324  1.00 27.19 ? 51   ARG A C   1 
ATOM   30    O  O   . ARG A 1 8   ? 0.032   6.317   37.192  1.00 28.34 ? 51   ARG A O   1 
ATOM   31    C  CB  . ARG A 1 8   ? 2.877   7.256   37.086  1.00 26.34 ? 51   ARG A CB  1 
ATOM   32    C  CG  . ARG A 1 8   ? 4.158   7.164   37.900  1.00 24.87 ? 51   ARG A CG  1 
ATOM   33    C  CD  . ARG A 1 8   ? 5.354   7.695   37.140  1.00 23.54 ? 51   ARG A CD  1 
ATOM   34    N  NE  . ARG A 1 8   ? 5.001   8.817   36.273  1.00 22.67 ? 51   ARG A NE  1 
ATOM   35    C  CZ  . ARG A 1 8   ? 5.883   9.600   35.664  1.00 21.80 ? 51   ARG A CZ  1 
ATOM   36    N  NH1 . ARG A 1 8   ? 7.188   9.400   35.825  1.00 21.97 ? 51   ARG A NH1 1 
ATOM   37    N  NH2 . ARG A 1 8   ? 5.461   10.575  34.875  1.00 21.08 ? 51   ARG A NH2 1 
ATOM   38    N  N   . CYS A 1 9   ? 0.513   5.806   35.066  1.00 28.17 ? 52   CYS A N   1 
ATOM   39    C  CA  . CYS A 1 9   ? -0.863  5.900   34.584  1.00 29.17 ? 52   CYS A CA  1 
ATOM   40    C  C   . CYS A 1 9   ? -1.919  5.266   35.511  1.00 27.61 ? 52   CYS A C   1 
ATOM   41    O  O   . CYS A 1 9   ? -1.919  4.047   35.718  1.00 24.99 ? 52   CYS A O   1 
ATOM   42    C  CB  . CYS A 1 9   ? -0.959  5.266   33.188  1.00 31.72 ? 52   CYS A CB  1 
ATOM   43    S  SG  . CYS A 1 9   ? -2.648  5.177   32.509  1.00 32.35 ? 52   CYS A SG  1 
ATOM   44    N  N   . THR A 1 10  ? -2.821  6.095   36.020  1.00 28.09 ? 53   THR A N   1 
ATOM   45    C  CA  . THR A 1 10  ? -3.930  5.612   36.840  1.00 29.65 ? 53   THR A CA  1 
ATOM   46    C  C   . THR A 1 10  ? -5.113  5.192   35.969  1.00 29.74 ? 53   THR A C   1 
ATOM   47    O  O   . THR A 1 10  ? -6.218  5.703   36.181  1.00 28.60 ? 53   THR A O   1 
ATOM   48    C  CB  . THR A 1 10  ? -4.498  6.710   37.754  1.00 29.46 ? 53   THR A CB  1 
ATOM   49    O  OG1 . THR A 1 10  ? -5.155  7.680   36.947  1.00 30.20 ? 53   THR A OG1 1 
ATOM   50    C  CG2 . THR A 1 10  ? -3.392  7.380   38.550  1.00 28.91 ? 53   THR A CG2 1 
ATOM   51    N  N   . TRP A 1 11  ? -4.901  4.308   35.050  1.00 28.79 ? 54   TRP A N   1 
ATOM   52    C  CA  . TRP A 1 11  ? -6.102  3.865   34.380  1.00 28.41 ? 54   TRP A CA  1 
ATOM   53    C  C   . TRP A 1 11  ? -6.646  2.715   35.201  1.00 27.76 ? 54   TRP A C   1 
ATOM   54    O  O   . TRP A 1 11  ? -5.948  2.202   36.060  1.00 26.72 ? 54   TRP A O   1 
ATOM   55    C  CB  . TRP A 1 11  ? -5.815  3.496   32.916  1.00 29.05 ? 54   TRP A CB  1 
ATOM   56    C  CG  . TRP A 1 11  ? -6.947  2.773   32.266  1.00 26.43 ? 54   TRP A CG  1 
ATOM   57    C  CD1 . TRP A 1 11  ? -8.009  3.317   31.599  1.00 25.75 ? 54   TRP A CD1 1 
ATOM   58    C  CD2 . TRP A 1 11  ? -7.138  1.367   32.213  1.00 24.82 ? 54   TRP A CD2 1 
ATOM   59    N  NE1 . TRP A 1 11  ? -8.856  2.328   31.136  1.00 24.75 ? 54   TRP A NE1 1 
ATOM   60    C  CE2 . TRP A 1 11  ? -8.344  1.118   31.523  1.00 24.59 ? 54   TRP A CE2 1 
ATOM   61    C  CE3 . TRP A 1 11  ? -6.407  0.287   32.716  1.00 24.16 ? 54   TRP A CE3 1 
ATOM   62    C  CZ2 . TRP A 1 11  ? -8.836  -0.170  31.327  1.00 24.06 ? 54   TRP A CZ2 1 
ATOM   63    C  CZ3 . TRP A 1 11  ? -6.896  -0.992  32.520  1.00 24.21 ? 54   TRP A CZ3 1 
ATOM   64    C  CH2 . TRP A 1 11  ? -8.098  -1.210  31.833  1.00 24.01 ? 54   TRP A CH2 1 
ATOM   65    N  N   . GLN A 1 12  ? -7.894  2.288   34.963  1.00 27.95 ? 55   GLN A N   1 
ATOM   66    C  CA  . GLN A 1 12  ? -8.470  1.148   35.710  1.00 29.55 ? 55   GLN A CA  1 
ATOM   67    C  C   . GLN A 1 12  ? -9.742  0.617   35.023  1.00 30.24 ? 55   GLN A C   1 
ATOM   68    O  O   . GLN A 1 12  ? -10.583 1.400   34.609  1.00 31.66 ? 55   GLN A O   1 
ATOM   69    C  CB  . GLN A 1 12  ? -8.836  1.589   37.131  1.00 30.92 ? 55   GLN A CB  1 
ATOM   70    C  CG  . GLN A 1 12  ? -8.288  0.724   38.273  1.00 31.19 ? 55   GLN A CG  1 
ATOM   71    C  CD  . GLN A 1 12  ? -9.071  0.909   39.565  1.00 31.13 ? 55   GLN A CD  1 
ATOM   72    O  OE1 . GLN A 1 12  ? -10.098 1.581   39.603  1.00 31.40 ? 55   GLN A OE1 1 
ATOM   73    N  NE2 . GLN A 1 12  ? -8.765  0.384   40.732  1.00 30.40 ? 55   GLN A NE2 1 
ATOM   74    N  N   . LEU A 1 13  ? -9.897  -0.695  34.909  1.00 29.23 ? 56   LEU A N   1 
ATOM   75    C  CA  . LEU A 1 13  ? -11.064 -1.196  34.221  1.00 28.13 ? 56   LEU A CA  1 
ATOM   76    C  C   . LEU A 1 13  ? -12.348 -1.027  35.050  1.00 28.42 ? 56   LEU A C   1 
ATOM   77    O  O   . LEU A 1 13  ? -12.889 -1.983  35.615  1.00 28.68 ? 56   LEU A O   1 
ATOM   78    C  CB  . LEU A 1 13  ? -10.838 -2.653  33.778  1.00 26.98 ? 56   LEU A CB  1 
ATOM   79    C  CG  . LEU A 1 13  ? -11.911 -3.224  32.848  1.00 23.66 ? 56   LEU A CG  1 
ATOM   80    C  CD1 . LEU A 1 13  ? -12.152 -2.291  31.682  1.00 21.69 ? 56   LEU A CD1 1 
ATOM   81    C  CD2 . LEU A 1 13  ? -11.523 -4.604  32.365  1.00 22.77 ? 56   LEU A CD2 1 
ATOM   82    N  N   . GLY A 1 14  ? -12.795 0.238   35.116  1.00 27.20 ? 57   GLY A N   1 
ATOM   83    C  CA  . GLY A 1 14  ? -13.994 0.650   35.855  1.00 27.91 ? 57   GLY A CA  1 
ATOM   84    C  C   . GLY A 1 14  ? -14.179 2.158   36.038  1.00 28.74 ? 57   GLY A C   1 
ATOM   85    O  O   . GLY A 1 14  ? -15.308 2.630   36.217  1.00 29.18 ? 57   GLY A O   1 
ATOM   86    N  N   . ARG A 1 15  ? -13.083 2.924   35.980  1.00 27.69 ? 58   ARG A N   1 
ATOM   87    C  CA  . ARG A 1 15  ? -13.116 4.353   36.142  1.00 26.92 ? 58   ARG A CA  1 
ATOM   88    C  C   . ARG A 1 15  ? -13.836 4.881   34.923  1.00 26.84 ? 58   ARG A C   1 
ATOM   89    O  O   . ARG A 1 15  ? -13.372 4.689   33.802  1.00 27.01 ? 58   ARG A O   1 
ATOM   90    C  CB  . ARG A 1 15  ? -11.726 4.942   36.255  1.00 25.98 ? 58   ARG A CB  1 
ATOM   91    C  CG  . ARG A 1 15  ? -10.714 3.972   36.858  1.00 24.28 ? 58   ARG A CG  1 
ATOM   92    C  CD  . ARG A 1 15  ? -10.314 4.432   38.242  1.00 23.95 ? 58   ARG A CD  1 
ATOM   93    N  NE  . ARG A 1 15  ? -9.049  5.161   38.214  1.00 21.49 ? 58   ARG A NE  1 
ATOM   94    C  CZ  . ARG A 1 15  ? -8.933  6.480   38.164  1.00 17.76 ? 58   ARG A CZ  1 
ATOM   95    N  NH1 . ARG A 1 15  ? -10.010 7.254   38.142  1.00 16.23 ? 58   ARG A NH1 1 
ATOM   96    N  NH2 . ARG A 1 15  ? -7.724  7.014   38.147  1.00 17.85 ? 58   ARG A NH2 1 
ATOM   97    N  N   . PRO A 1 16  ? -14.969 5.552   35.119  1.00 27.46 ? 59   PRO A N   1 
ATOM   98    C  CA  . PRO A 1 16  ? -15.697 6.085   33.968  1.00 28.53 ? 59   PRO A CA  1 
ATOM   99    C  C   . PRO A 1 16  ? -14.752 6.767   32.986  1.00 29.30 ? 59   PRO A C   1 
ATOM   100   O  O   . PRO A 1 16  ? -13.838 7.477   33.396  1.00 30.79 ? 59   PRO A O   1 
ATOM   101   C  CB  . PRO A 1 16  ? -16.665 7.059   34.614  1.00 28.95 ? 59   PRO A CB  1 
ATOM   102   C  CG  . PRO A 1 16  ? -17.031 6.321   35.883  1.00 29.68 ? 59   PRO A CG  1 
ATOM   103   C  CD  . PRO A 1 16  ? -15.692 5.800   36.377  1.00 27.42 ? 59   PRO A CD  1 
ATOM   104   N  N   . ALA A 1 17  ? -14.956 6.536   31.694  1.00 29.48 ? 60   ALA A N   1 
ATOM   105   C  CA  . ALA A 1 17  ? -14.107 7.154   30.690  1.00 27.79 ? 60   ALA A CA  1 
ATOM   106   C  C   . ALA A 1 17  ? -13.929 8.609   31.084  1.00 26.59 ? 60   ALA A C   1 
ATOM   107   O  O   . ALA A 1 17  ? -12.826 9.142   31.028  1.00 26.26 ? 60   ALA A O   1 
ATOM   108   C  CB  . ALA A 1 17  ? -14.759 7.056   29.327  1.00 30.27 ? 60   ALA A CB  1 
ATOM   109   N  N   . SER A 1 18  ? -15.028 9.232   31.503  1.00 25.64 ? 61   SER A N   1 
ATOM   110   C  CA  . SER A 1 18  ? -15.032 10.629  31.940  1.00 24.83 ? 61   SER A CA  1 
ATOM   111   C  C   . SER A 1 18  ? -13.766 11.015  32.705  1.00 25.28 ? 61   SER A C   1 
ATOM   112   O  O   . SER A 1 18  ? -13.118 12.004  32.374  1.00 25.38 ? 61   SER A O   1 
ATOM   113   C  CB  . SER A 1 18  ? -16.269 10.913  32.815  1.00 23.57 ? 61   SER A CB  1 
ATOM   114   O  OG  . SER A 1 18  ? -16.406 9.978   33.883  1.00 19.40 ? 61   SER A OG  1 
ATOM   115   N  N   . GLU A 1 19  ? -13.412 10.223  33.715  1.00 25.14 ? 62   GLU A N   1 
ATOM   116   C  CA  . GLU A 1 19  ? -12.234 10.485  34.543  1.00 24.72 ? 62   GLU A CA  1 
ATOM   117   C  C   . GLU A 1 19  ? -10.879 10.204  33.881  1.00 26.13 ? 62   GLU A C   1 
ATOM   118   O  O   . GLU A 1 19  ? -10.107 9.392   34.393  1.00 27.71 ? 62   GLU A O   1 
ATOM   119   C  CB  . GLU A 1 19  ? -12.308 9.666   35.834  1.00 23.37 ? 62   GLU A CB  1 
ATOM   120   C  CG  . GLU A 1 19  ? -13.598 9.824   36.614  1.00 22.95 ? 62   GLU A CG  1 
ATOM   121   C  CD  . GLU A 1 19  ? -13.620 8.979   37.881  1.00 22.37 ? 62   GLU A CD  1 
ATOM   122   O  OE1 . GLU A 1 19  ? -12.709 8.140   38.056  1.00 20.98 ? 62   GLU A OE1 1 
ATOM   123   O  OE2 . GLU A 1 19  ? -14.558 9.154   38.694  1.00 22.83 ? 62   GLU A OE2 1 
ATOM   124   N  N   . SER A 1 20  ? -10.577 10.863  32.762  1.00 26.44 ? 63   SER A N   1 
ATOM   125   C  CA  . SER A 1 20  ? -9.293  10.644  32.103  1.00 25.97 ? 63   SER A CA  1 
ATOM   126   C  C   . SER A 1 20  ? -8.604  11.907  31.650  1.00 25.91 ? 63   SER A C   1 
ATOM   127   O  O   . SER A 1 20  ? -9.106  12.627  30.789  1.00 25.72 ? 63   SER A O   1 
ATOM   128   C  CB  . SER A 1 20  ? -9.433  9.748   30.879  1.00 26.51 ? 63   SER A CB  1 
ATOM   129   O  OG  . SER A 1 20  ? -8.397  10.048  29.946  1.00 27.93 ? 63   SER A OG  1 
ATOM   130   N  N   . PRO A 1 21  ? -7.438  12.196  32.229  1.00 26.38 ? 64   PRO A N   1 
ATOM   131   C  CA  . PRO A 1 21  ? -6.636  13.365  31.900  1.00 27.37 ? 64   PRO A CA  1 
ATOM   132   C  C   . PRO A 1 21  ? -5.829  12.853  30.730  1.00 28.66 ? 64   PRO A C   1 
ATOM   133   O  O   . PRO A 1 21  ? -4.748  12.289  30.907  1.00 28.88 ? 64   PRO A O   1 
ATOM   134   C  CB  . PRO A 1 21  ? -5.781  13.531  33.133  1.00 27.70 ? 64   PRO A CB  1 
ATOM   135   C  CG  . PRO A 1 21  ? -5.449  12.108  33.432  1.00 26.86 ? 64   PRO A CG  1 
ATOM   136   C  CD  . PRO A 1 21  ? -6.818  11.459  33.336  1.00 27.15 ? 64   PRO A CD  1 
ATOM   137   N  N   . HIS A 1 22  ? -6.384  13.016  29.539  1.00 28.82 ? 65   HIS A N   1 
ATOM   138   C  CA  . HIS A 1 22  ? -5.753  12.540  28.324  1.00 28.03 ? 65   HIS A CA  1 
ATOM   139   C  C   . HIS A 1 22  ? -6.430  13.189  27.157  1.00 29.23 ? 65   HIS A C   1 
ATOM   140   O  O   . HIS A 1 22  ? -7.524  13.724  27.299  1.00 27.70 ? 65   HIS A O   1 
ATOM   141   C  CB  . HIS A 1 22  ? -5.888  11.018  28.248  1.00 25.47 ? 65   HIS A CB  1 
ATOM   142   C  CG  . HIS A 1 22  ? -4.852  10.306  29.032  1.00 22.43 ? 65   HIS A CG  1 
ATOM   143   N  ND1 . HIS A 1 22  ? -3.531  10.716  29.022  1.00 21.58 ? 65   HIS A ND1 1 
ATOM   144   C  CD2 . HIS A 1 22  ? -4.904  9.231   29.843  1.00 20.84 ? 65   HIS A CD2 1 
ATOM   145   C  CE1 . HIS A 1 22  ? -2.823  9.929   29.795  1.00 18.66 ? 65   HIS A CE1 1 
ATOM   146   N  NE2 . HIS A 1 22  ? -3.620  9.021   30.312  1.00 18.03 ? 65   HIS A NE2 1 
ATOM   147   N  N   . HIS A 1 23  ? -5.801  13.166  25.996  1.00 32.68 ? 66   HIS A N   1 
ATOM   148   C  CA  . HIS A 1 23  ? -6.495  13.779  24.897  1.00 36.40 ? 66   HIS A CA  1 
ATOM   149   C  C   . HIS A 1 23  ? -6.909  12.874  23.763  1.00 37.20 ? 66   HIS A C   1 
ATOM   150   O  O   . HIS A 1 23  ? -6.234  12.744  22.734  1.00 36.94 ? 66   HIS A O   1 
ATOM   151   C  CB  . HIS A 1 23  ? -5.763  14.998  24.376  1.00 39.33 ? 66   HIS A CB  1 
ATOM   152   C  CG  . HIS A 1 23  ? -6.699  16.120  24.086  1.00 41.72 ? 66   HIS A CG  1 
ATOM   153   N  ND1 . HIS A 1 23  ? -7.380  16.223  22.892  1.00 42.22 ? 66   HIS A ND1 1 
ATOM   154   C  CD2 . HIS A 1 23  ? -7.235  17.053  24.906  1.00 42.21 ? 66   HIS A CD2 1 
ATOM   155   C  CE1 . HIS A 1 23  ? -8.301  17.164  22.992  1.00 41.40 ? 66   HIS A CE1 1 
ATOM   156   N  NE2 . HIS A 1 23  ? -8.235  17.681  24.206  1.00 42.12 ? 66   HIS A NE2 1 
ATOM   157   N  N   . HIS A 1 24  ? -8.076  12.279  23.998  1.00 37.68 ? 67   HIS A N   1 
ATOM   158   C  CA  . HIS A 1 24  ? -8.741  11.349  23.110  1.00 37.00 ? 67   HIS A CA  1 
ATOM   159   C  C   . HIS A 1 24  ? -9.401  12.107  21.958  1.00 36.38 ? 67   HIS A C   1 
ATOM   160   O  O   . HIS A 1 24  ? -10.200 13.017  22.181  1.00 35.25 ? 67   HIS A O   1 
ATOM   161   C  CB  . HIS A 1 24  ? -9.806  10.574  23.908  1.00 37.39 ? 67   HIS A CB  1 
ATOM   162   C  CG  . HIS A 1 24  ? -9.301  9.974   25.192  1.00 37.26 ? 67   HIS A CG  1 
ATOM   163   N  ND1 . HIS A 1 24  ? -8.432  8.903   25.231  1.00 37.46 ? 67   HIS A ND1 1 
ATOM   164   C  CD2 . HIS A 1 24  ? -9.532  10.313  26.484  1.00 37.56 ? 67   HIS A CD2 1 
ATOM   165   C  CE1 . HIS A 1 24  ? -8.148  8.612   26.488  1.00 36.52 ? 67   HIS A CE1 1 
ATOM   166   N  NE2 . HIS A 1 24  ? -8.802  9.453   27.269  1.00 36.85 ? 67   HIS A NE2 1 
ATOM   167   N  N   . THR A 1 25  ? -9.045  11.739  20.728  1.00 36.18 ? 68   THR A N   1 
ATOM   168   C  CA  . THR A 1 25  ? -9.624  12.360  19.539  1.00 33.72 ? 68   THR A CA  1 
ATOM   169   C  C   . THR A 1 25  ? -10.486 11.338  18.851  1.00 33.00 ? 68   THR A C   1 
ATOM   170   O  O   . THR A 1 25  ? -9.974  10.412  18.234  1.00 31.22 ? 68   THR A O   1 
ATOM   171   C  CB  . THR A 1 25  ? -8.563  12.818  18.534  1.00 31.64 ? 68   THR A CB  1 
ATOM   172   O  OG1 . THR A 1 25  ? -7.487  11.879  18.505  1.00 29.56 ? 68   THR A OG1 1 
ATOM   173   C  CG2 . THR A 1 25  ? -8.056  14.187  18.899  1.00 33.09 ? 68   THR A CG2 1 
ATOM   174   N  N   . ALA A 1 26  ? -11.799 11.503  18.974  1.00 32.88 ? 69   ALA A N   1 
ATOM   175   C  CA  . ALA A 1 26  ? -12.748 10.579  18.347  1.00 32.87 ? 69   ALA A CA  1 
ATOM   176   C  C   . ALA A 1 26  ? -12.366 10.343  16.883  1.00 33.40 ? 69   ALA A C   1 
ATOM   177   O  O   . ALA A 1 26  ? -11.901 11.256  16.197  1.00 34.54 ? 69   ALA A O   1 
ATOM   178   C  CB  . ALA A 1 26  ? -14.155 11.130  18.458  1.00 31.31 ? 69   ALA A CB  1 
ATOM   179   N  N   . PRO A 1 27  ? -12.578 9.123   16.386  1.00 32.34 ? 70   PRO A N   1 
ATOM   180   C  CA  . PRO A 1 27  ? -12.252 8.735   15.005  1.00 31.54 ? 70   PRO A CA  1 
ATOM   181   C  C   . PRO A 1 27  ? -12.989 9.437   13.862  1.00 31.33 ? 70   PRO A C   1 
ATOM   182   O  O   . PRO A 1 27  ? -14.059 9.982   14.051  1.00 29.32 ? 70   PRO A O   1 
ATOM   183   C  CB  . PRO A 1 27  ? -12.588 7.241   14.969  1.00 31.69 ? 70   PRO A CB  1 
ATOM   184   C  CG  . PRO A 1 27  ? -12.382 6.830   16.317  1.00 32.80 ? 70   PRO A CG  1 
ATOM   185   C  CD  . PRO A 1 27  ? -12.921 7.937   17.182  1.00 32.08 ? 70   PRO A CD  1 
ATOM   186   N  N   . ALA A 1 28  ? -12.427 9.358   12.649  1.00 31.26 ? 71   ALA A N   1 
ATOM   187   C  CA  . ALA A 1 28  ? -13.014 9.951   11.460  1.00 31.79 ? 71   ALA A CA  1 
ATOM   188   C  C   . ALA A 1 28  ? -12.840 8.942   10.361  1.00 31.95 ? 71   ALA A C   1 
ATOM   189   O  O   . ALA A 1 28  ? -11.827 8.254   10.358  1.00 30.68 ? 71   ALA A O   1 
ATOM   190   C  CB  . ALA A 1 28  ? -12.326 11.400  11.104  1.00 33.79 ? 71   ALA A CB  1 
ATOM   191   N  N   . LYS A 1 29  ? -13.820 8.923   9.394   1.00 27.83 ? 72   LYS A N   1 
ATOM   192   C  CA  . LYS A 1 29  ? -13.873 7.964   8.243   1.00 27.02 ? 72   LYS A CA  1 
ATOM   193   C  C   . LYS A 1 29  ? -13.291 8.543   6.925   1.00 32.85 ? 72   LYS A C   1 
ATOM   194   O  O   . LYS A 1 29  ? -13.035 9.744   6.865   1.00 29.57 ? 72   LYS A O   1 
ATOM   195   C  CB  . LYS A 1 29  ? -15.322 7.550   7.950   1.00 36.74 ? 72   LYS A CB  1 
ATOM   196   C  CG  . LYS A 1 29  ? -15.869 6.427   8.808   1.00 40.70 ? 72   LYS A CG  1 
ATOM   197   C  CD  . LYS A 1 29  ? -17.283 6.069   8.368   1.00 42.11 ? 72   LYS A CD  1 
ATOM   198   C  CE  . LYS A 1 29  ? -17.743 4.773   8.991   1.00 25.71 ? 72   LYS A CE  1 
ATOM   199   N  NZ  . LYS A 1 29  ? -18.026 4.937   10.446  1.00 23.25 ? 72   LYS A NZ  1 
ATOM   200   N  N   . SER A 1 30  ? -12.925 7.711   5.915   1.00 27.84 ? 73   SER A N   1 
ATOM   201   C  CA  . SER A 1 30  ? -12.445 8.303   4.577   1.00 27.90 ? 73   SER A CA  1 
ATOM   202   C  C   . SER A 1 30  ? -13.444 9.215   3.729   1.00 26.50 ? 73   SER A C   1 
ATOM   203   O  O   . SER A 1 30  ? -14.575 8.825   3.433   1.00 26.60 ? 73   SER A O   1 
ATOM   204   C  CB  . SER A 1 30  ? -11.896 7.183   3.682   1.00 29.19 ? 73   SER A CB  1 
ATOM   205   O  OG  . SER A 1 30  ? -10.646 7.548   3.119   1.00 30.90 ? 73   SER A OG  1 
ATOM   206   N  N   . PRO A 1 31  ? -12.928 10.455  3.348   1.00 24.59 ? 74   PRO A N   1 
ATOM   207   C  CA  . PRO A 1 31  ? -13.676 11.635  2.683   1.00 21.91 ? 74   PRO A CA  1 
ATOM   208   C  C   . PRO A 1 31  ? -13.748 11.499  1.235   1.00 19.80 ? 74   PRO A C   1 
ATOM   209   O  O   . PRO A 1 31  ? -13.059 10.663  0.637   1.00 19.25 ? 74   PRO A O   1 
ATOM   210   C  CB  . PRO A 1 31  ? -12.828 12.836  2.760   1.00 24.19 ? 74   PRO A CB  1 
ATOM   211   C  CG  . PRO A 1 31  ? -12.302 12.642  4.132   1.00 24.36 ? 74   PRO A CG  1 
ATOM   212   C  CD  . PRO A 1 31  ? -12.422 11.173  4.499   1.00 23.61 ? 74   PRO A CD  1 
ATOM   213   N  N   . LYS A 1 32  ? -14.499 12.367  0.672   1.00 15.98 ? 75   LYS A N   1 
ATOM   214   C  CA  . LYS A 1 32  ? -14.476 12.251  -0.755  1.00 13.27 ? 75   LYS A CA  1 
ATOM   215   C  C   . LYS A 1 32  ? -13.068 12.561  -1.280  1.00 13.71 ? 75   LYS A C   1 
ATOM   216   O  O   . LYS A 1 32  ? -12.405 11.722  -1.892  1.00 12.60 ? 75   LYS A O   1 
ATOM   217   C  CB  . LYS A 1 32  ? -15.378 13.262  -1.457  1.00 14.18 ? 75   LYS A CB  1 
ATOM   218   C  CG  . LYS A 1 32  ? -16.862 13.040  -1.217  1.00 12.95 ? 75   LYS A CG  1 
ATOM   219   C  CD  . LYS A 1 32  ? -17.680 14.094  -1.915  1.00 13.41 ? 75   LYS A CD  1 
ATOM   220   C  CE  . LYS A 1 32  ? -19.145 13.710  -1.932  1.00 13.44 ? 75   LYS A CE  1 
ATOM   221   N  NZ  . LYS A 1 32  ? -19.352 12.251  -1.707  1.00 13.65 ? 75   LYS A NZ  1 
ATOM   222   N  N   . ILE A 1 33  ? -12.615 13.796  -1.028  1.00 14.95 ? 76   ILE A N   1 
ATOM   223   C  CA  . ILE A 1 33  ? -11.249 14.234  -1.410  1.00 14.56 ? 76   ILE A CA  1 
ATOM   224   C  C   . ILE A 1 33  ? -10.472 14.397  -0.115  1.00 13.61 ? 76   ILE A C   1 
ATOM   225   O  O   . ILE A 1 33  ? -11.047 14.770  0.896   1.00 16.15 ? 76   ILE A O   1 
ATOM   226   C  CB  . ILE A 1 33  ? -11.237 15.607  -2.122  1.00 14.53 ? 76   ILE A CB  1 
ATOM   227   C  CG1 . ILE A 1 33  ? -11.816 15.483  -3.533  1.00 11.79 ? 76   ILE A CG1 1 
ATOM   228   C  CG2 . ILE A 1 33  ? -9.826  16.175  -2.187  1.00 16.29 ? 76   ILE A CG2 1 
ATOM   229   C  CD1 . ILE A 1 33  ? -12.374 16.781  -4.088  1.00 9.51  ? 76   ILE A CD1 1 
ATOM   230   N  N   . LEU A 1 34  ? -9.201  14.141  -0.136  1.00 14.98 ? 77   LEU A N   1 
ATOM   231   C  CA  . LEU A 1 34  ? -8.417  14.282  1.098   1.00 16.91 ? 77   LEU A CA  1 
ATOM   232   C  C   . LEU A 1 34  ? -7.452  15.462  0.946   1.00 17.53 ? 77   LEU A C   1 
ATOM   233   O  O   . LEU A 1 34  ? -6.836  15.633  -0.105  1.00 18.48 ? 77   LEU A O   1 
ATOM   234   C  CB  . LEU A 1 34  ? -7.598  13.015  1.379   1.00 16.79 ? 77   LEU A CB  1 
ATOM   235   C  CG  . LEU A 1 34  ? -7.963  11.662  0.725   1.00 18.25 ? 77   LEU A CG  1 
ATOM   236   C  CD1 . LEU A 1 34  ? -7.304  10.537  1.534   1.00 17.78 ? 77   LEU A CD1 1 
ATOM   237   C  CD2 . LEU A 1 34  ? -9.480  11.443  0.673   1.00 16.50 ? 77   LEU A CD2 1 
ATOM   238   N  N   . PRO A 1 35  ? -7.318  16.305  1.981   1.00 18.72 ? 78   PRO A N   1 
ATOM   239   C  CA  . PRO A 1 35  ? -6.393  17.453  1.882   1.00 17.92 ? 78   PRO A CA  1 
ATOM   240   C  C   . PRO A 1 35  ? -4.930  17.011  1.653   1.00 17.40 ? 78   PRO A C   1 
ATOM   241   O  O   . PRO A 1 35  ? -4.250  17.496  0.749   1.00 17.29 ? 78   PRO A O   1 
ATOM   242   C  CB  . PRO A 1 35  ? -6.594  18.167  3.224   1.00 18.40 ? 78   PRO A CB  1 
ATOM   243   C  CG  . PRO A 1 35  ? -7.018  17.037  4.156   1.00 18.44 ? 78   PRO A CG  1 
ATOM   244   C  CD  . PRO A 1 35  ? -7.993  16.276  3.294   1.00 18.37 ? 78   PRO A CD  1 
ATOM   245   N  N   . ASP A 1 36  ? -4.468  16.087  2.486   1.00 15.12 ? 79   ASP A N   1 
ATOM   246   C  CA  . ASP A 1 36  ? -3.129  15.539  2.413   1.00 15.44 ? 79   ASP A CA  1 
ATOM   247   C  C   . ASP A 1 36  ? -3.277  14.048  2.628   1.00 17.16 ? 79   ASP A C   1 
ATOM   248   O  O   . ASP A 1 36  ? -4.261  13.600  3.198   1.00 18.57 ? 79   ASP A O   1 
ATOM   249   C  CB  . ASP A 1 36  ? -2.263  16.095  3.520   1.00 14.83 ? 79   ASP A CB  1 
ATOM   250   C  CG  . ASP A 1 36  ? -2.925  15.987  4.864   1.00 16.02 ? 79   ASP A CG  1 
ATOM   251   O  OD1 . ASP A 1 36  ? -2.217  15.694  5.841   1.00 17.55 ? 79   ASP A OD1 1 
ATOM   252   O  OD2 . ASP A 1 36  ? -4.152  16.208  4.952   1.00 16.16 ? 79   ASP A OD2 1 
ATOM   253   N  N   . ILE A 1 37  ? -2.300  13.268  2.199   1.00 19.00 ? 80   ILE A N   1 
ATOM   254   C  CA  . ILE A 1 37  ? -2.418  11.830  2.345   1.00 20.36 ? 80   ILE A CA  1 
ATOM   255   C  C   . ILE A 1 37  ? -2.298  11.293  3.791   1.00 22.19 ? 80   ILE A C   1 
ATOM   256   O  O   . ILE A 1 37  ? -2.126  10.100  4.012   1.00 23.48 ? 80   ILE A O   1 
ATOM   257   C  CB  . ILE A 1 37  ? -1.434  11.115  1.342   1.00 20.80 ? 80   ILE A CB  1 
ATOM   258   C  CG1 . ILE A 1 37  ? -1.729  9.624   1.271   1.00 20.65 ? 80   ILE A CG1 1 
ATOM   259   C  CG2 . ILE A 1 37  ? 0.004   11.316  1.760   1.00 23.02 ? 80   ILE A CG2 1 
ATOM   260   C  CD1 . ILE A 1 37  ? -3.191  9.303   1.349   1.00 19.50 ? 80   ILE A CD1 1 
ATOM   261   N  N   . LEU A 1 38  ? -2.415  12.158  4.791   1.00 23.76 ? 81   LEU A N   1 
ATOM   262   C  CA  . LEU A 1 38  ? -2.361  11.670  6.171   1.00 24.37 ? 81   LEU A CA  1 
ATOM   263   C  C   . LEU A 1 38  ? -3.783  11.297  6.594   1.00 25.21 ? 81   LEU A C   1 
ATOM   264   O  O   . LEU A 1 38  ? -4.002  10.561  7.561   1.00 25.12 ? 81   LEU A O   1 
ATOM   265   C  CB  . LEU A 1 38  ? -1.797  12.748  7.099   1.00 23.66 ? 81   LEU A CB  1 
ATOM   266   C  CG  . LEU A 1 38  ? -0.413  13.296  6.742   1.00 23.11 ? 81   LEU A CG  1 
ATOM   267   C  CD1 . LEU A 1 38  ? 0.003   14.324  7.760   1.00 22.81 ? 81   LEU A CD1 1 
ATOM   268   C  CD2 . LEU A 1 38  ? 0.579   12.167  6.685   1.00 20.23 ? 81   LEU A CD2 1 
ATOM   269   N  N   . LYS A 1 39  ? -4.749  11.835  5.861   1.00 25.98 ? 82   LYS A N   1 
ATOM   270   C  CA  . LYS A 1 39  ? -6.148  11.551  6.123   1.00 27.36 ? 82   LYS A CA  1 
ATOM   271   C  C   . LYS A 1 39  ? -6.383  10.130  5.607   1.00 28.37 ? 82   LYS A C   1 
ATOM   272   O  O   . LYS A 1 39  ? -7.479  9.575   5.688   1.00 28.49 ? 82   LYS A O   1 
ATOM   273   C  CB  . LYS A 1 39  ? -7.033  12.547  5.378   1.00 27.38 ? 82   LYS A CB  1 
ATOM   274   C  CG  . LYS A 1 39  ? -7.065  13.954  5.961   1.00 28.88 ? 82   LYS A CG  1 
ATOM   275   C  CD  . LYS A 1 39  ? -7.942  14.039  7.215   1.00 29.73 ? 82   LYS A CD  1 
ATOM   276   C  CE  . LYS A 1 39  ? -8.516  15.448  7.400   1.00 29.65 ? 82   LYS A CE  1 
ATOM   277   N  NZ  . LYS A 1 39  ? -7.467  16.499  7.336   1.00 28.17 ? 82   LYS A NZ  1 
ATOM   278   N  N   . LYS A 1 40  ? -5.325  9.552   5.057   1.00 28.84 ? 83   LYS A N   1 
ATOM   279   C  CA  . LYS A 1 40  ? -5.382  8.197   4.556   1.00 30.46 ? 83   LYS A CA  1 
ATOM   280   C  C   . LYS A 1 40  ? -5.169  7.258   5.720   1.00 31.51 ? 83   LYS A C   1 
ATOM   281   O  O   . LYS A 1 40  ? -5.771  6.186   5.778   1.00 33.26 ? 83   LYS A O   1 
ATOM   282   C  CB  . LYS A 1 40  ? -4.291  7.961   3.532   1.00 30.71 ? 83   LYS A CB  1 
ATOM   283   C  CG  . LYS A 1 40  ? -4.069  6.523   3.128   1.00 31.10 ? 83   LYS A CG  1 
ATOM   284   C  CD  . LYS A 1 40  ? -5.178  5.989   2.252   1.00 31.90 ? 83   LYS A CD  1 
ATOM   285   C  CE  . LYS A 1 40  ? -6.391  5.543   3.051   1.00 33.58 ? 83   LYS A CE  1 
ATOM   286   N  NZ  . LYS A 1 40  ? -7.367  6.634   3.297   1.00 31.72 ? 83   LYS A NZ  1 
ATOM   287   N  N   . ILE A 1 41  ? -4.289  7.646   6.635   1.00 30.70 ? 84   ILE A N   1 
ATOM   288   C  CA  . ILE A 1 41  ? -4.021  6.827   7.810   1.00 30.05 ? 84   ILE A CA  1 
ATOM   289   C  C   . ILE A 1 41  ? -5.338  6.640   8.574   1.00 29.16 ? 84   ILE A C   1 
ATOM   290   O  O   . ILE A 1 41  ? -6.146  7.564   8.671   1.00 29.12 ? 84   ILE A O   1 
ATOM   291   C  CB  . ILE A 1 41  ? -3.016  7.521   8.738   1.00 30.58 ? 84   ILE A CB  1 
ATOM   292   C  CG1 . ILE A 1 41  ? -1.842  8.071   7.921   1.00 30.97 ? 84   ILE A CG1 1 
ATOM   293   C  CG2 . ILE A 1 41  ? -2.548  6.542   9.794   1.00 30.43 ? 84   ILE A CG2 1 
ATOM   294   C  CD1 . ILE A 1 41  ? -0.977  9.081   8.659   1.00 30.83 ? 84   ILE A CD1 1 
ATOM   295   N  N   . GLY A 1 42  ? -5.575  5.464   9.157   1.00 27.52 ? 85   GLY A N   1 
ATOM   296   C  CA  . GLY A 1 42  ? -6.850  5.229   9.887   1.00 28.06 ? 85   GLY A CA  1 
ATOM   297   C  C   . GLY A 1 42  ? -7.910  4.818   8.810   1.00 28.36 ? 85   GLY A C   1 
ATOM   298   O  O   . GLY A 1 42  ? -7.726  5.182   7.648   1.00 27.57 ? 85   GLY A O   1 
ATOM   299   N  N   . ASP A 1 43  ? -9.017  4.084   9.167   1.00 28.45 ? 86   ASP A N   1 
ATOM   300   C  CA  . ASP A 1 43  ? -10.117 3.486   8.314   1.00 27.57 ? 86   ASP A CA  1 
ATOM   301   C  C   . ASP A 1 43  ? -9.505  2.261   7.668   1.00 25.63 ? 86   ASP A C   1 
ATOM   302   O  O   . ASP A 1 43  ? -10.002 1.832   6.628   1.00 24.22 ? 86   ASP A O   1 
ATOM   303   C  CB  . ASP A 1 43  ? -10.753 4.377   7.198   1.00 30.03 ? 86   ASP A CB  1 
ATOM   304   C  CG  . ASP A 1 43  ? -12.149 3.868   6.751   1.00 33.48 ? 86   ASP A CG  1 
ATOM   305   O  OD1 . ASP A 1 43  ? -13.115 4.234   7.449   1.00 32.21 ? 86   ASP A OD1 1 
ATOM   306   O  OD2 . ASP A 1 43  ? -12.233 3.141   5.736   1.00 35.54 ? 86   ASP A OD2 1 
ATOM   307   N  N   . THR A 1 44  ? -8.513  1.682   8.235   1.00 23.77 ? 87   THR A N   1 
ATOM   308   C  CA  . THR A 1 44  ? -8.016  0.519   7.491   1.00 22.00 ? 87   THR A CA  1 
ATOM   309   C  C   . THR A 1 44  ? -9.064  -0.605  7.364   1.00 22.85 ? 87   THR A C   1 
ATOM   310   O  O   . THR A 1 44  ? -10.122 -0.610  8.014   1.00 23.32 ? 87   THR A O   1 
ATOM   311   C  CB  . THR A 1 44  ? -6.831  -0.107  8.209   1.00 21.71 ? 87   THR A CB  1 
ATOM   312   O  OG1 . THR A 1 44  ? -7.294  -0.731  9.410   1.00 19.08 ? 87   THR A OG1 1 
ATOM   313   C  CG2 . THR A 1 44  ? -5.795  0.952   8.544   1.00 18.04 ? 87   THR A CG2 1 
ATOM   314   N  N   . PRO A 1 45  ? -8.736  -1.534  6.427   1.00 23.04 ? 88   PRO A N   1 
ATOM   315   C  CA  . PRO A 1 45  ? -9.580  -2.738  6.160   1.00 22.40 ? 88   PRO A CA  1 
ATOM   316   C  C   . PRO A 1 45  ? -9.733  -3.729  7.224   1.00 21.73 ? 88   PRO A C   1 
ATOM   317   O  O   . PRO A 1 45  ? -8.842  -3.940  8.049   1.00 23.83 ? 88   PRO A O   1 
ATOM   318   C  CB  . PRO A 1 45  ? -8.934  -3.427  4.969   1.00 22.62 ? 88   PRO A CB  1 
ATOM   319   C  CG  . PRO A 1 45  ? -8.551  -2.247  4.133   1.00 23.33 ? 88   PRO A CG  1 
ATOM   320   C  CD  . PRO A 1 45  ? -8.449  -1.048  5.039   1.00 23.15 ? 88   PRO A CD  1 
ATOM   321   N  N   . MET A 1 46  ? -10.868 -4.364  7.190   1.00 20.86 ? 89   MET A N   1 
ATOM   322   C  CA  . MET A 1 46  ? -10.844 -5.630  7.943   1.00 18.99 ? 89   MET A CA  1 
ATOM   323   C  C   . MET A 1 46  ? -11.132 -6.721  6.895   1.00 17.31 ? 89   MET A C   1 
ATOM   324   O  O   . MET A 1 46  ? -12.080 -6.624  6.116   1.00 16.20 ? 89   MET A O   1 
ATOM   325   C  CB  . MET A 1 46  ? -11.934 -5.628  9.013   1.00 19.49 ? 89   MET A CB  1 
ATOM   326   C  CG  . MET A 1 46  ? -11.947 -6.868  9.901   1.00 21.14 ? 89   MET A CG  1 
ATOM   327   S  SD  . MET A 1 46  ? -10.767 -6.815  11.274  1.00 23.27 ? 89   MET A SD  1 
ATOM   328   C  CE  . MET A 1 46  ? -11.705 -5.974  12.521  1.00 21.36 ? 89   MET A CE  1 
ATOM   329   N  N   . VAL A 1 47  ? -10.307 -7.753  6.874   1.00 16.02 ? 90   VAL A N   1 
ATOM   330   C  CA  . VAL A 1 47  ? -10.471 -8.818  5.896   1.00 15.37 ? 90   VAL A CA  1 
ATOM   331   C  C   . VAL A 1 47  ? -10.452 -10.238 6.438   1.00 15.80 ? 90   VAL A C   1 
ATOM   332   O  O   . VAL A 1 47  ? -9.494  -10.649 7.089   1.00 17.00 ? 90   VAL A O   1 
ATOM   333   C  CB  . VAL A 1 47  ? -9.379  -8.720  4.830   1.00 15.27 ? 90   VAL A CB  1 
ATOM   334   C  CG1 . VAL A 1 47  ? -9.289  -10.015 4.042   1.00 13.51 ? 90   VAL A CG1 1 
ATOM   335   C  CG2 . VAL A 1 47  ? -9.668  -7.546  3.925   1.00 16.46 ? 90   VAL A CG2 1 
ATOM   336   N  N   . ARG A 1 48  ? -11.503 -10.995 6.142   1.00 14.95 ? 91   ARG A N   1 
ATOM   337   C  CA  . ARG A 1 48  ? -11.591 -12.383 6.582   1.00 14.99 ? 91   ARG A CA  1 
ATOM   338   C  C   . ARG A 1 48  ? -10.473 -13.196 5.946   1.00 14.58 ? 91   ARG A C   1 
ATOM   339   O  O   . ARG A 1 48  ? -10.066 -12.923 4.831   1.00 14.60 ? 91   ARG A O   1 
ATOM   340   C  CB  . ARG A 1 48  ? -12.927 -12.978 6.177   1.00 14.39 ? 91   ARG A CB  1 
ATOM   341   C  CG  . ARG A 1 48  ? -13.217 -14.290 6.839   1.00 17.42 ? 91   ARG A CG  1 
ATOM   342   C  CD  . ARG A 1 48  ? -14.225 -15.120 6.062   1.00 19.46 ? 91   ARG A CD  1 
ATOM   343   N  NE  . ARG A 1 48  ? -15.536 -14.491 5.901   1.00 23.35 ? 91   ARG A NE  1 
ATOM   344   C  CZ  . ARG A 1 48  ? -15.797 -13.479 5.076   1.00 24.74 ? 91   ARG A CZ  1 
ATOM   345   N  NH1 . ARG A 1 48  ? -14.829 -12.965 4.330   1.00 24.87 ? 91   ARG A NH1 1 
ATOM   346   N  NH2 . ARG A 1 48  ? -17.032 -12.996 4.974   1.00 23.55 ? 91   ARG A NH2 1 
ATOM   347   N  N   . ILE A 1 49  ? -9.961  -14.183 6.663   1.00 15.48 ? 92   ILE A N   1 
ATOM   348   C  CA  . ILE A 1 49  ? -8.896  -15.025 6.127   1.00 16.70 ? 92   ILE A CA  1 
ATOM   349   C  C   . ILE A 1 49  ? -9.527  -16.376 5.833   1.00 17.89 ? 92   ILE A C   1 
ATOM   350   O  O   . ILE A 1 49  ? -9.535  -17.281 6.662   1.00 20.42 ? 92   ILE A O   1 
ATOM   351   C  CB  . ILE A 1 49  ? -7.743  -15.179 7.139   1.00 16.11 ? 92   ILE A CB  1 
ATOM   352   C  CG1 . ILE A 1 49  ? -6.957  -13.871 7.228   1.00 16.23 ? 92   ILE A CG1 1 
ATOM   353   C  CG2 . ILE A 1 49  ? -6.828  -16.337 6.738   1.00 14.94 ? 92   ILE A CG2 1 
ATOM   354   C  CD1 . ILE A 1 49  ? -5.654  -13.999 7.991   1.00 16.65 ? 92   ILE A CD1 1 
ATOM   355   N  N   . ASN A 1 50  ? -10.095 -16.494 4.631   1.00 18.26 ? 93   ASN A N   1 
ATOM   356   C  CA  . ASN A 1 50  ? -10.824 -17.665 4.111   1.00 18.33 ? 93   ASN A CA  1 
ATOM   357   C  C   . ASN A 1 50  ? -10.042 -18.974 3.889   1.00 19.19 ? 93   ASN A C   1 
ATOM   358   O  O   . ASN A 1 50  ? -10.685 -20.022 3.826   1.00 21.21 ? 93   ASN A O   1 
ATOM   359   C  CB  . ASN A 1 50  ? -11.482 -17.321 2.782   1.00 15.59 ? 93   ASN A CB  1 
ATOM   360   C  CG  . ASN A 1 50  ? -12.363 -16.111 2.870   1.00 15.42 ? 93   ASN A CG  1 
ATOM   361   O  OD1 . ASN A 1 50  ? -13.133 -15.971 3.824   1.00 14.61 ? 93   ASN A OD1 1 
ATOM   362   N  ND2 . ASN A 1 50  ? -12.250 -15.231 1.880   1.00 12.15 ? 93   ASN A ND2 1 
ATOM   363   N  N   . LYS A 1 51  ? -8.734  -19.016 3.762   1.00 17.83 ? 94   LYS A N   1 
ATOM   364   C  CA  . LYS A 1 51  ? -8.148  -20.327 3.523   1.00 17.63 ? 94   LYS A CA  1 
ATOM   365   C  C   . LYS A 1 51  ? -7.326  -20.767 4.719   1.00 17.15 ? 94   LYS A C   1 
ATOM   366   O  O   . LYS A 1 51  ? -7.602  -21.800 5.327   1.00 17.84 ? 94   LYS A O   1 
ATOM   367   C  CB  . LYS A 1 51  ? -7.280  -20.305 2.265   1.00 18.94 ? 94   LYS A CB  1 
ATOM   368   C  CG  . LYS A 1 51  ? -8.079  -20.149 0.972   1.00 20.38 ? 94   LYS A CG  1 
ATOM   369   C  CD  . LYS A 1 51  ? -7.183  -20.372 -0.237  1.00 21.72 ? 94   LYS A CD  1 
ATOM   370   C  CE  . LYS A 1 51  ? -6.073  -19.337 -0.317  1.00 21.99 ? 94   LYS A CE  1 
ATOM   371   N  NZ  . LYS A 1 51  ? -5.217  -19.523 -1.520  1.00 21.45 ? 94   LYS A NZ  1 
ATOM   372   N  N   . ILE A 1 52  ? -6.310  -19.983 5.042   1.00 16.32 ? 95   ILE A N   1 
ATOM   373   C  CA  . ILE A 1 52  ? -5.409  -20.267 6.150   1.00 15.76 ? 95   ILE A CA  1 
ATOM   374   C  C   . ILE A 1 52  ? -6.106  -20.682 7.437   1.00 15.36 ? 95   ILE A C   1 
ATOM   375   O  O   . ILE A 1 52  ? -5.604  -21.526 8.166   1.00 13.64 ? 95   ILE A O   1 
ATOM   376   C  CB  . ILE A 1 52  ? -4.499  -19.036 6.413   1.00 17.47 ? 95   ILE A CB  1 
ATOM   377   C  CG1 . ILE A 1 52  ? -3.823  -18.631 5.096   1.00 19.87 ? 95   ILE A CG1 1 
ATOM   378   C  CG2 . ILE A 1 52  ? -3.470  -19.345 7.503   1.00 14.58 ? 95   ILE A CG2 1 
ATOM   379   C  CD1 . ILE A 1 52  ? -2.813  -17.546 5.222   1.00 23.28 ? 95   ILE A CD1 1 
ATOM   380   N  N   . GLY A 1 53  ? -7.258  -20.086 7.718   1.00 16.05 ? 96   GLY A N   1 
ATOM   381   C  CA  . GLY A 1 53  ? -7.925  -20.469 8.952   1.00 17.98 ? 96   GLY A CA  1 
ATOM   382   C  C   . GLY A 1 53  ? -8.712  -21.776 8.804   1.00 19.14 ? 96   GLY A C   1 
ATOM   383   O  O   . GLY A 1 53  ? -8.612  -22.667 9.637   1.00 19.76 ? 96   GLY A O   1 
ATOM   384   N  N   . LYS A 1 54  ? -9.495  -21.855 7.749   1.00 19.06 ? 97   LYS A N   1 
ATOM   385   C  CA  . LYS A 1 54  ? -10.307 -23.072 7.626   1.00 17.40 ? 97   LYS A CA  1 
ATOM   386   C  C   . LYS A 1 54  ? -9.387  -24.296 7.524   1.00 19.22 ? 97   LYS A C   1 
ATOM   387   O  O   . LYS A 1 54  ? -9.853  -25.420 7.472   1.00 21.39 ? 97   LYS A O   1 
ATOM   388   C  CB  . LYS A 1 54  ? -11.266 -22.940 6.444   1.00 12.68 ? 97   LYS A CB  1 
ATOM   389   C  CG  . LYS A 1 54  ? -12.520 -22.149 6.761   1.00 8.89  ? 97   LYS A CG  1 
ATOM   390   C  CD  . LYS A 1 54  ? -13.052 -22.462 8.157   1.00 6.99  ? 97   LYS A CD  1 
ATOM   391   C  CE  . LYS A 1 54  ? -13.838 -21.294 8.740   1.00 3.95  ? 97   LYS A CE  1 
ATOM   392   N  NZ  . LYS A 1 54  ? -14.462 -20.463 7.668   1.00 5.60  ? 97   LYS A NZ  1 
ATOM   393   N  N   . LYS A 1 55  ? -8.081  -24.064 7.480   1.00 18.68 ? 98   LYS A N   1 
ATOM   394   C  CA  . LYS A 1 55  ? -7.077  -25.081 7.248   1.00 20.02 ? 98   LYS A CA  1 
ATOM   395   C  C   . LYS A 1 55  ? -6.195  -25.488 8.442   1.00 20.22 ? 98   LYS A C   1 
ATOM   396   O  O   . LYS A 1 55  ? -5.217  -26.229 8.313   1.00 20.10 ? 98   LYS A O   1 
ATOM   397   C  CB  . LYS A 1 55  ? -6.208  -24.537 6.116   1.00 21.33 ? 98   LYS A CB  1 
ATOM   398   C  CG  . LYS A 1 55  ? -5.470  -25.608 5.332   1.00 23.74 ? 98   LYS A CG  1 
ATOM   399   C  CD  . LYS A 1 55  ? -6.401  -26.592 4.671   1.00 24.74 ? 98   LYS A CD  1 
ATOM   400   C  CE  . LYS A 1 55  ? -5.681  -27.451 3.656   1.00 24.56 ? 98   LYS A CE  1 
ATOM   401   N  NZ  . LYS A 1 55  ? -4.964  -26.630 2.642   1.00 24.23 ? 98   LYS A NZ  1 
ATOM   402   N  N   . PHE A 1 56  ? -6.579  -24.993 9.611   1.00 19.44 ? 99   PHE A N   1 
ATOM   403   C  CA  . PHE A 1 56  ? -5.866  -25.295 10.846  1.00 17.94 ? 99   PHE A CA  1 
ATOM   404   C  C   . PHE A 1 56  ? -6.928  -25.523 11.911  1.00 18.99 ? 99   PHE A C   1 
ATOM   405   O  O   . PHE A 1 56  ? -6.650  -25.456 13.111  1.00 20.39 ? 99   PHE A O   1 
ATOM   406   C  CB  . PHE A 1 56  ? -4.949  -24.153 11.276  1.00 15.73 ? 99   PHE A CB  1 
ATOM   407   C  CG  . PHE A 1 56  ? -3.560  -24.224 10.697  1.00 13.49 ? 99   PHE A CG  1 
ATOM   408   C  CD1 . PHE A 1 56  ? -3.285  -23.738 9.431   1.00 11.86 ? 99   PHE A CD1 1 
ATOM   409   C  CD2 . PHE A 1 56  ? -2.514  -24.757 11.441  1.00 13.95 ? 99   PHE A CD2 1 
ATOM   410   C  CE1 . PHE A 1 56  ? -1.988  -23.779 8.929   1.00 11.47 ? 99   PHE A CE1 1 
ATOM   411   C  CE2 . PHE A 1 56  ? -1.220  -24.801 10.944  1.00 10.20 ? 99   PHE A CE2 1 
ATOM   412   C  CZ  . PHE A 1 56  ? -0.956  -24.313 9.697   1.00 10.08 ? 99   PHE A CZ  1 
ATOM   413   N  N   . GLY A 1 57  ? -8.154  -25.769 11.452  1.00 17.96 ? 100  GLY A N   1 
ATOM   414   C  CA  . GLY A 1 57  ? -9.249  -26.070 12.348  1.00 17.78 ? 100  GLY A CA  1 
ATOM   415   C  C   . GLY A 1 57  ? -9.951  -24.889 12.962  1.00 19.53 ? 100  GLY A C   1 
ATOM   416   O  O   . GLY A 1 57  ? -10.865 -25.059 13.772  1.00 17.93 ? 100  GLY A O   1 
ATOM   417   N  N   . LEU A 1 58  ? -9.545  -23.688 12.593  1.00 20.45 ? 101  LEU A N   1 
ATOM   418   C  CA  . LEU A 1 58  ? -10.199 -22.535 13.174  1.00 22.46 ? 101  LEU A CA  1 
ATOM   419   C  C   . LEU A 1 58  ? -11.722 -22.636 13.009  1.00 23.65 ? 101  LEU A C   1 
ATOM   420   O  O   . LEU A 1 58  ? -12.264 -22.584 11.908  1.00 25.53 ? 101  LEU A O   1 
ATOM   421   C  CB  . LEU A 1 58  ? -9.665  -21.252 12.547  1.00 23.06 ? 101  LEU A CB  1 
ATOM   422   C  CG  . LEU A 1 58  ? -8.593  -20.544 13.357  1.00 24.19 ? 101  LEU A CG  1 
ATOM   423   C  CD1 . LEU A 1 58  ? -7.562  -21.538 13.834  1.00 24.12 ? 101  LEU A CD1 1 
ATOM   424   C  CD2 . LEU A 1 58  ? -7.969  -19.472 12.487  1.00 25.87 ? 101  LEU A CD2 1 
ATOM   425   N  N   . LYS A 1 59  ? -12.415 -22.804 14.120  1.00 22.53 ? 102  LYS A N   1 
ATOM   426   C  CA  . LYS A 1 59  ? -13.844 -22.881 14.068  1.00 21.78 ? 102  LYS A CA  1 
ATOM   427   C  C   . LYS A 1 59  ? -14.383 -21.456 14.318  1.00 22.19 ? 102  LYS A C   1 
ATOM   428   O  O   . LYS A 1 59  ? -15.574 -21.313 14.586  1.00 24.02 ? 102  LYS A O   1 
ATOM   429   C  CB  . LYS A 1 59  ? -14.343 -23.852 15.147  1.00 21.81 ? 102  LYS A CB  1 
ATOM   430   C  CG  . LYS A 1 59  ? -14.443 -25.300 14.627  1.00 20.82 ? 102  LYS A CG  1 
ATOM   431   C  CD  . LYS A 1 59  ? -14.559 -26.389 15.668  1.00 19.08 ? 102  LYS A CD  1 
ATOM   432   C  CE  . LYS A 1 59  ? -13.479 -26.222 16.707  1.00 21.06 ? 102  LYS A CE  1 
ATOM   433   N  NZ  . LYS A 1 59  ? -13.513 -27.255 17.762  1.00 16.52 ? 102  LYS A NZ  1 
ATOM   434   N  N   . CYS A 1 60  ? -13.541 -20.398 14.231  1.00 22.18 ? 103  CYS A N   1 
ATOM   435   C  CA  . CYS A 1 60  ? -13.918 -19.012 14.545  1.00 21.94 ? 103  CYS A CA  1 
ATOM   436   C  C   . CYS A 1 60  ? -13.652 -17.981 13.426  1.00 20.47 ? 103  CYS A C   1 
ATOM   437   O  O   . CYS A 1 60  ? -12.511 -17.806 13.017  1.00 21.03 ? 103  CYS A O   1 
ATOM   438   C  CB  . CYS A 1 60  ? -13.140 -18.540 15.776  1.00 24.05 ? 103  CYS A CB  1 
ATOM   439   S  SG  . CYS A 1 60  ? -11.390 -18.147 15.456  1.00 29.31 ? 103  CYS A SG  1 
ATOM   440   N  N   . GLU A 1 61  ? -14.697 -17.309 12.920  1.00 17.56 ? 104  GLU A N   1 
ATOM   441   C  CA  . GLU A 1 61  ? -14.442 -16.324 11.909  1.00 15.82 ? 104  GLU A CA  1 
ATOM   442   C  C   . GLU A 1 61  ? -13.180 -15.564 12.309  1.00 15.20 ? 104  GLU A C   1 
ATOM   443   O  O   . GLU A 1 61  ? -13.151 -14.869 13.325  1.00 15.88 ? 104  GLU A O   1 
ATOM   444   C  CB  . GLU A 1 61  ? -15.622 -15.354 11.760  1.00 14.04 ? 104  GLU A CB  1 
ATOM   445   C  CG  . GLU A 1 61  ? -15.405 -14.293 10.694  1.00 12.82 ? 104  GLU A CG  1 
ATOM   446   C  CD  . GLU A 1 61  ? -16.638 -13.453 10.492  1.00 15.93 ? 104  GLU A CD  1 
ATOM   447   O  OE1 . GLU A 1 61  ? -17.392 -13.271 11.465  1.00 15.08 ? 104  GLU A OE1 1 
ATOM   448   O  OE2 . GLU A 1 61  ? -16.844 -12.984 9.350   1.00 17.40 ? 104  GLU A OE2 1 
ATOM   449   N  N   . LEU A 1 62  ? -12.120 -15.707 11.498  1.00 14.77 ? 105  LEU A N   1 
ATOM   450   C  CA  . LEU A 1 62  ? -10.809 -15.088 11.768  1.00 15.34 ? 105  LEU A CA  1 
ATOM   451   C  C   . LEU A 1 62  ? -10.516 -13.874 10.889  1.00 16.26 ? 105  LEU A C   1 
ATOM   452   O  O   . LEU A 1 62  ? -9.841  -14.003 9.879   1.00 17.33 ? 105  LEU A O   1 
ATOM   453   C  CB  . LEU A 1 62  ? -9.694  -16.125 11.511  1.00 14.17 ? 105  LEU A CB  1 
ATOM   454   C  CG  . LEU A 1 62  ? -8.263  -15.707 11.840  1.00 12.58 ? 105  LEU A CG  1 
ATOM   455   C  CD1 . LEU A 1 62  ? -7.993  -15.888 13.330  1.00 11.83 ? 105  LEU A CD1 1 
ATOM   456   C  CD2 . LEU A 1 62  ? -7.269  -16.486 10.991  1.00 11.66 ? 105  LEU A CD2 1 
ATOM   457   N  N   . LEU A 1 63  ? -11.003 -12.707 11.281  1.00 15.89 ? 106  LEU A N   1 
ATOM   458   C  CA  . LEU A 1 63  ? -10.776 -11.497 10.525  1.00 17.24 ? 106  LEU A CA  1 
ATOM   459   C  C   . LEU A 1 63  ? -9.305  -11.054 10.654  1.00 19.18 ? 106  LEU A C   1 
ATOM   460   O  O   . LEU A 1 63  ? -8.495  -11.717 11.325  1.00 18.85 ? 106  LEU A O   1 
ATOM   461   C  CB  . LEU A 1 63  ? -11.709 -10.419 11.051  1.00 17.37 ? 106  LEU A CB  1 
ATOM   462   C  CG  . LEU A 1 63  ? -13.187 -10.776 11.059  1.00 17.19 ? 106  LEU A CG  1 
ATOM   463   C  CD1 . LEU A 1 63  ? -13.967 -9.647  11.653  1.00 17.96 ? 106  LEU A CD1 1 
ATOM   464   C  CD2 . LEU A 1 63  ? -13.643 -11.019 9.654   1.00 16.86 ? 106  LEU A CD2 1 
ATOM   465   N  N   . ALA A 1 64  ? -8.959  -9.937  10.017  1.00 19.49 ? 107  ALA A N   1 
ATOM   466   C  CA  . ALA A 1 64  ? -7.592  -9.437  10.069  1.00 19.45 ? 107  ALA A CA  1 
ATOM   467   C  C   . ALA A 1 64  ? -7.473  -7.932  9.790   1.00 19.86 ? 107  ALA A C   1 
ATOM   468   O  O   . ALA A 1 64  ? -7.690  -7.488  8.650   1.00 19.46 ? 107  ALA A O   1 
ATOM   469   C  CB  . ALA A 1 64  ? -6.728  -10.210 9.092   1.00 17.57 ? 107  ALA A CB  1 
ATOM   470   N  N   . LYS A 1 65  ? -7.125  -7.163  10.833  1.00 17.89 ? 108  LYS A N   1 
ATOM   471   C  CA  . LYS A 1 65  ? -6.951  -5.711  10.724  1.00 14.74 ? 108  LYS A CA  1 
ATOM   472   C  C   . LYS A 1 65  ? -5.771  -5.472  9.814   1.00 15.29 ? 108  LYS A C   1 
ATOM   473   O  O   . LYS A 1 65  ? -4.624  -5.665  10.209  1.00 15.81 ? 108  LYS A O   1 
ATOM   474   C  CB  . LYS A 1 65  ? -6.682  -5.090  12.097  1.00 12.05 ? 108  LYS A CB  1 
ATOM   475   C  CG  . LYS A 1 65  ? -7.798  -4.196  12.606  1.00 8.65  ? 108  LYS A CG  1 
ATOM   476   C  CD  . LYS A 1 65  ? -7.994  -3.011  11.693  1.00 5.18  ? 108  LYS A CD  1 
ATOM   477   C  CE  . LYS A 1 65  ? -9.305  -2.341  11.954  1.00 3.95  ? 108  LYS A CE  1 
ATOM   478   N  NZ  . LYS A 1 65  ? -9.649  -1.351  10.912  1.00 4.45  ? 108  LYS A NZ  1 
ATOM   479   N  N   . CYS A 1 66  ? -6.054  -5.074  8.586   1.00 14.84 ? 109  CYS A N   1 
ATOM   480   C  CA  . CYS A 1 66  ? -4.993  -4.866  7.632   1.00 17.50 ? 109  CYS A CA  1 
ATOM   481   C  C   . CYS A 1 66  ? -4.530  -3.434  7.688   1.00 19.22 ? 109  CYS A C   1 
ATOM   482   O  O   . CYS A 1 66  ? -5.208  -2.527  7.212   1.00 20.87 ? 109  CYS A O   1 
ATOM   483   C  CB  . CYS A 1 66  ? -5.468  -5.272  6.232   1.00 17.35 ? 109  CYS A CB  1 
ATOM   484   S  SG  . CYS A 1 66  ? -5.798  -7.092  6.092   1.00 20.96 ? 109  CYS A SG  1 
ATOM   485   N  N   . GLU A 1 67  ? -3.362  -3.246  8.295   1.00 19.64 ? 110  GLU A N   1 
ATOM   486   C  CA  . GLU A 1 67  ? -2.789  -1.929  8.469   1.00 20.28 ? 110  GLU A CA  1 
ATOM   487   C  C   . GLU A 1 67  ? -1.788  -1.614  7.386   1.00 20.26 ? 110  GLU A C   1 
ATOM   488   O  O   . GLU A 1 67  ? -1.436  -0.452  7.206   1.00 21.07 ? 110  GLU A O   1 
ATOM   489   C  CB  . GLU A 1 67  ? -2.102  -1.816  9.841   1.00 21.70 ? 110  GLU A CB  1 
ATOM   490   C  CG  . GLU A 1 67  ? -2.594  -0.678  10.736  1.00 22.02 ? 110  GLU A CG  1 
ATOM   491   C  CD  . GLU A 1 67  ? -3.907  -1.015  11.388  1.00 22.83 ? 110  GLU A CD  1 
ATOM   492   O  OE1 . GLU A 1 67  ? -3.985  -2.100  11.974  1.00 22.70 ? 110  GLU A OE1 1 
ATOM   493   O  OE2 . GLU A 1 67  ? -4.866  -0.223  11.323  1.00 23.19 ? 110  GLU A OE2 1 
ATOM   494   N  N   . PHE A 1 68  ? -1.308  -2.625  6.672   1.00 20.02 ? 111  PHE A N   1 
ATOM   495   C  CA  . PHE A 1 68  ? -0.348  -2.346  5.618   1.00 20.17 ? 111  PHE A CA  1 
ATOM   496   C  C   . PHE A 1 68  ? -0.981  -1.427  4.581   1.00 19.34 ? 111  PHE A C   1 
ATOM   497   O  O   . PHE A 1 68  ? -0.331  -1.013  3.632   1.00 19.20 ? 111  PHE A O   1 
ATOM   498   C  CB  . PHE A 1 68  ? 0.182   -3.643  4.977   1.00 21.75 ? 111  PHE A CB  1 
ATOM   499   C  CG  . PHE A 1 68  ? -0.877  -4.691  4.695   1.00 23.19 ? 111  PHE A CG  1 
ATOM   500   C  CD1 . PHE A 1 68  ? -1.861  -4.478  3.731   1.00 21.90 ? 111  PHE A CD1 1 
ATOM   501   C  CD2 . PHE A 1 68  ? -0.868  -5.907  5.376   1.00 23.00 ? 111  PHE A CD2 1 
ATOM   502   C  CE1 . PHE A 1 68  ? -2.813  -5.464  3.451   1.00 22.32 ? 111  PHE A CE1 1 
ATOM   503   C  CE2 . PHE A 1 68  ? -1.822  -6.899  5.097   1.00 22.02 ? 111  PHE A CE2 1 
ATOM   504   C  CZ  . PHE A 1 68  ? -2.787  -6.674  4.137   1.00 21.74 ? 111  PHE A CZ  1 
ATOM   505   N  N   . PHE A 1 69  ? -2.258  -1.101  4.779   1.00 20.49 ? 112  PHE A N   1 
ATOM   506   C  CA  . PHE A 1 69  ? -2.973  -0.198  3.881   1.00 23.38 ? 112  PHE A CA  1 
ATOM   507   C  C   . PHE A 1 69  ? -2.959  1.284   4.303   1.00 23.88 ? 112  PHE A C   1 
ATOM   508   O  O   . PHE A 1 69  ? -3.720  2.093   3.761   1.00 24.58 ? 112  PHE A O   1 
ATOM   509   C  CB  . PHE A 1 69  ? -4.419  -0.669  3.713   1.00 27.01 ? 112  PHE A CB  1 
ATOM   510   C  CG  . PHE A 1 69  ? -4.569  -1.841  2.783   1.00 29.67 ? 112  PHE A CG  1 
ATOM   511   C  CD1 . PHE A 1 69  ? -5.547  -2.803  3.007   1.00 30.30 ? 112  PHE A CD1 1 
ATOM   512   C  CD2 . PHE A 1 69  ? -3.719  -1.990  1.689   1.00 30.33 ? 112  PHE A CD2 1 
ATOM   513   C  CE1 . PHE A 1 69  ? -5.670  -3.899  2.160   1.00 29.90 ? 112  PHE A CE1 1 
ATOM   514   C  CE2 . PHE A 1 69  ? -3.834  -3.072  0.845   1.00 28.92 ? 112  PHE A CE2 1 
ATOM   515   C  CZ  . PHE A 1 69  ? -4.808  -4.029  1.079   1.00 30.05 ? 112  PHE A CZ  1 
ATOM   516   N  N   . ASN A 1 70  ? -2.101  1.626   5.271   1.00 22.92 ? 113  ASN A N   1 
ATOM   517   C  CA  . ASN A 1 70  ? -1.939  3.006   5.765   1.00 19.46 ? 113  ASN A CA  1 
ATOM   518   C  C   . ASN A 1 70  ? -1.048  3.795   4.807   1.00 17.99 ? 113  ASN A C   1 
ATOM   519   O  O   . ASN A 1 70  ? -0.317  3.198   4.011   1.00 18.64 ? 113  ASN A O   1 
ATOM   520   C  CB  . ASN A 1 70  ? -1.311  2.989   7.157   1.00 19.01 ? 113  ASN A CB  1 
ATOM   521   C  CG  . ASN A 1 70  ? -2.309  2.641   8.235   1.00 17.87 ? 113  ASN A CG  1 
ATOM   522   O  OD1 . ASN A 1 70  ? -3.304  3.343   8.397   1.00 18.89 ? 113  ASN A OD1 1 
ATOM   523   N  ND2 . ASN A 1 70  ? -2.055  1.564   8.978   1.00 15.51 ? 113  ASN A ND2 1 
ATOM   524   N  N   . ALA A 1 71  ? -1.103  5.123   4.874   1.00 14.79 ? 114  ALA A N   1 
ATOM   525   C  CA  . ALA A 1 71  ? -0.301  5.962   3.982   1.00 13.40 ? 114  ALA A CA  1 
ATOM   526   C  C   . ALA A 1 71  ? 1.104   5.405   3.790   1.00 13.54 ? 114  ALA A C   1 
ATOM   527   O  O   . ALA A 1 71  ? 1.453   4.933   2.713   1.00 12.72 ? 114  ALA A O   1 
ATOM   528   C  CB  . ALA A 1 71  ? -0.226  7.365   4.524   1.00 13.19 ? 114  ALA A CB  1 
ATOM   529   N  N   . GLY A 1 72  ? 1.899   5.445   4.852   1.00 14.21 ? 115  GLY A N   1 
ATOM   530   C  CA  . GLY A 1 72  ? 3.256   4.944   4.785   1.00 14.61 ? 115  GLY A CA  1 
ATOM   531   C  C   . GLY A 1 72  ? 3.329   3.436   4.687   1.00 15.37 ? 115  GLY A C   1 
ATOM   532   O  O   . GLY A 1 72  ? 4.401   2.872   4.453   1.00 15.16 ? 115  GLY A O   1 
ATOM   533   N  N   . GLY A 1 73  ? 2.185   2.782   4.871   1.00 16.36 ? 116  GLY A N   1 
ATOM   534   C  CA  . GLY A 1 73  ? 2.116   1.332   4.795   1.00 16.14 ? 116  GLY A CA  1 
ATOM   535   C  C   . GLY A 1 73  ? 2.541   0.660   6.084   1.00 16.19 ? 116  GLY A C   1 
ATOM   536   O  O   . GLY A 1 73  ? 3.183   -0.385  6.057   1.00 17.54 ? 116  GLY A O   1 
ATOM   537   N  N   . SER A 1 74  ? 2.170   1.251   7.215   1.00 16.60 ? 117  SER A N   1 
ATOM   538   C  CA  . SER A 1 74  ? 2.542   0.716   8.517   1.00 16.64 ? 117  SER A CA  1 
ATOM   539   C  C   . SER A 1 74  ? 1.526   1.083   9.577   1.00 16.15 ? 117  SER A C   1 
ATOM   540   O  O   . SER A 1 74  ? 0.884   2.139   9.510   1.00 16.09 ? 117  SER A O   1 
ATOM   541   C  CB  . SER A 1 74  ? 3.887   1.290   8.935   1.00 19.85 ? 117  SER A CB  1 
ATOM   542   O  OG  . SER A 1 74  ? 3.859   2.714   8.862   1.00 22.13 ? 117  SER A OG  1 
ATOM   543   N  N   . VAL A 1 75  ? 1.394   0.211   10.569  1.00 14.34 ? 118  VAL A N   1 
ATOM   544   C  CA  . VAL A 1 75  ? 0.479   0.462   11.658  1.00 12.54 ? 118  VAL A CA  1 
ATOM   545   C  C   . VAL A 1 75  ? 1.075   1.655   12.417  1.00 15.28 ? 118  VAL A C   1 
ATOM   546   O  O   . VAL A 1 75  ? 0.377   2.398   13.121  1.00 15.56 ? 118  VAL A O   1 
ATOM   547   C  CB  . VAL A 1 75  ? 0.369   -0.783  12.564  1.00 9.13  ? 118  VAL A CB  1 
ATOM   548   C  CG1 . VAL A 1 75  ? 1.692   -1.096  13.171  1.00 5.18  ? 118  VAL A CG1 1 
ATOM   549   C  CG2 . VAL A 1 75  ? -0.665  -0.564  13.630  1.00 8.62  ? 118  VAL A CG2 1 
ATOM   550   N  N   . LYS A 1 76  ? 2.378   1.845   12.219  1.00 16.23 ? 119  LYS A N   1 
ATOM   551   C  CA  . LYS A 1 76  ? 3.132   2.906   12.859  1.00 15.47 ? 119  LYS A CA  1 
ATOM   552   C  C   . LYS A 1 76  ? 2.792   4.294   12.348  1.00 16.56 ? 119  LYS A C   1 
ATOM   553   O  O   . LYS A 1 76  ? 3.307   5.299   12.853  1.00 17.71 ? 119  LYS A O   1 
ATOM   554   C  CB  . LYS A 1 76  ? 4.617   2.654   12.674  1.00 15.44 ? 119  LYS A CB  1 
ATOM   555   C  CG  . LYS A 1 76  ? 5.152   1.536   13.515  1.00 16.47 ? 119  LYS A CG  1 
ATOM   556   C  CD  . LYS A 1 76  ? 4.867   1.752   15.000  1.00 15.82 ? 119  LYS A CD  1 
ATOM   557   C  CE  . LYS A 1 76  ? 5.860   0.967   15.855  1.00 16.48 ? 119  LYS A CE  1 
ATOM   558   N  NZ  . LYS A 1 76  ? 6.026   -0.379  15.329  1.00 16.59 ? 119  LYS A NZ  1 
ATOM   559   N  N   . ASP A 1 77  ? 1.936   4.366   11.342  1.00 15.86 ? 120  ASP A N   1 
ATOM   560   C  CA  . ASP A 1 77  ? 1.575   5.665   10.823  1.00 16.34 ? 120  ASP A CA  1 
ATOM   561   C  C   . ASP A 1 77  ? 0.538   6.284   11.740  1.00 16.61 ? 120  ASP A C   1 
ATOM   562   O  O   . ASP A 1 77  ? 0.476   7.502   11.881  1.00 16.15 ? 120  ASP A O   1 
ATOM   563   C  CB  . ASP A 1 77  ? 1.039   5.551   9.393   1.00 16.15 ? 120  ASP A CB  1 
ATOM   564   C  CG  . ASP A 1 77  ? 2.101   5.101   8.404   1.00 16.29 ? 120  ASP A CG  1 
ATOM   565   O  OD1 . ASP A 1 77  ? 3.306   5.289   8.688   1.00 14.36 ? 120  ASP A OD1 1 
ATOM   566   O  OD2 . ASP A 1 77  ? 1.729   4.570   7.334   1.00 15.31 ? 120  ASP A OD2 1 
ATOM   567   N  N   . ARG A 1 78  ? -0.262  5.437   12.381  1.00 17.47 ? 121  ARG A N   1 
ATOM   568   C  CA  . ARG A 1 78  ? -1.308  5.915   13.289  1.00 18.08 ? 121  ARG A CA  1 
ATOM   569   C  C   . ARG A 1 78  ? -0.660  6.620   14.470  1.00 18.51 ? 121  ARG A C   1 
ATOM   570   O  O   . ARG A 1 78  ? -1.075  7.719   14.857  1.00 18.16 ? 121  ARG A O   1 
ATOM   571   C  CB  . ARG A 1 78  ? -2.170  4.755   13.836  1.00 17.94 ? 121  ARG A CB  1 
ATOM   572   C  CG  . ARG A 1 78  ? -3.148  4.056   12.880  1.00 15.84 ? 121  ARG A CG  1 
ATOM   573   C  CD  . ARG A 1 78  ? -3.811  2.910   13.636  1.00 15.34 ? 121  ARG A CD  1 
ATOM   574   N  NE  . ARG A 1 78  ? -4.709  2.075   12.838  1.00 15.03 ? 121  ARG A NE  1 
ATOM   575   C  CZ  . ARG A 1 78  ? -6.039  2.140   12.873  1.00 14.07 ? 121  ARG A CZ  1 
ATOM   576   N  NH1 . ARG A 1 78  ? -6.662  3.009   13.654  1.00 12.23 ? 121  ARG A NH1 1 
ATOM   577   N  NH2 . ARG A 1 78  ? -6.756  1.300   12.155  1.00 15.15 ? 121  ARG A NH2 1 
ATOM   578   N  N   . ILE A 1 79  ? 0.353   5.972   15.044  1.00 18.35 ? 122  ILE A N   1 
ATOM   579   C  CA  . ILE A 1 79  ? 1.048   6.535   16.190  1.00 19.39 ? 122  ILE A CA  1 
ATOM   580   C  C   . ILE A 1 79  ? 1.996   7.658   15.744  1.00 21.64 ? 122  ILE A C   1 
ATOM   581   O  O   . ILE A 1 79  ? 2.210   8.639   16.465  1.00 22.99 ? 122  ILE A O   1 
ATOM   582   C  CB  . ILE A 1 79  ? 1.828   5.440   16.991  1.00 16.32 ? 122  ILE A CB  1 
ATOM   583   C  CG1 . ILE A 1 79  ? 3.238   5.258   16.442  1.00 14.98 ? 122  ILE A CG1 1 
ATOM   584   C  CG2 . ILE A 1 79  ? 1.086   4.129   16.918  1.00 17.32 ? 122  ILE A CG2 1 
ATOM   585   C  CD1 . ILE A 1 79  ? 4.070   4.333   17.279  1.00 11.98 ? 122  ILE A CD1 1 
ATOM   586   N  N   . SER A 1 80  ? 2.546   7.529   14.544  1.00 21.83 ? 123  SER A N   1 
ATOM   587   C  CA  . SER A 1 80  ? 3.450   8.548   14.042  1.00 21.29 ? 123  SER A CA  1 
ATOM   588   C  C   . SER A 1 80  ? 2.746   9.876   13.736  1.00 21.94 ? 123  SER A C   1 
ATOM   589   O  O   . SER A 1 80  ? 3.374   10.932  13.771  1.00 23.20 ? 123  SER A O   1 
ATOM   590   C  CB  . SER A 1 80  ? 4.148   8.046   12.794  1.00 19.77 ? 123  SER A CB  1 
ATOM   591   O  OG  . SER A 1 80  ? 5.238   8.882   12.505  1.00 17.72 ? 123  SER A OG  1 
ATOM   592   N  N   . LEU A 1 81  ? 1.448   9.832   13.441  1.00 22.03 ? 124  LEU A N   1 
ATOM   593   C  CA  . LEU A 1 81  ? 0.705   11.050  13.132  1.00 21.33 ? 124  LEU A CA  1 
ATOM   594   C  C   . LEU A 1 81  ? 0.258   11.744  14.392  1.00 22.70 ? 124  LEU A C   1 
ATOM   595   O  O   . LEU A 1 81  ? 0.409   12.957  14.514  1.00 22.71 ? 124  LEU A O   1 
ATOM   596   C  CB  . LEU A 1 81  ? -0.537  10.738  12.292  1.00 19.28 ? 124  LEU A CB  1 
ATOM   597   C  CG  . LEU A 1 81  ? -1.527  11.902  12.163  1.00 17.45 ? 124  LEU A CG  1 
ATOM   598   C  CD1 . LEU A 1 81  ? -0.884  13.015  11.384  1.00 15.96 ? 124  LEU A CD1 1 
ATOM   599   C  CD2 . LEU A 1 81  ? -2.802  11.441  11.492  1.00 17.48 ? 124  LEU A CD2 1 
ATOM   600   N  N   . ARG A 1 82  ? -0.313  10.947  15.303  1.00 23.67 ? 125  ARG A N   1 
ATOM   601   C  CA  . ARG A 1 82  ? -0.853  11.383  16.604  1.00 22.51 ? 125  ARG A CA  1 
ATOM   602   C  C   . ARG A 1 82  ? 0.203   11.896  17.574  1.00 22.87 ? 125  ARG A C   1 
ATOM   603   O  O   . ARG A 1 82  ? 0.035   12.954  18.170  1.00 23.39 ? 125  ARG A O   1 
ATOM   604   C  CB  . ARG A 1 82  ? -1.586  10.221  17.276  1.00 21.17 ? 125  ARG A CB  1 
ATOM   605   C  CG  . ARG A 1 82  ? -2.246  10.567  18.594  1.00 17.64 ? 125  ARG A CG  1 
ATOM   606   C  CD  . ARG A 1 82  ? -3.538  11.287  18.340  1.00 16.18 ? 125  ARG A CD  1 
ATOM   607   N  NE  . ARG A 1 82  ? -4.386  11.411  19.519  1.00 15.68 ? 125  ARG A NE  1 
ATOM   608   C  CZ  . ARG A 1 82  ? -4.503  10.490  20.465  1.00 16.82 ? 125  ARG A CZ  1 
ATOM   609   N  NH1 . ARG A 1 82  ? -3.809  9.368   20.382  1.00 17.93 ? 125  ARG A NH1 1 
ATOM   610   N  NH2 . ARG A 1 82  ? -5.341  10.682  21.477  1.00 15.57 ? 125  ARG A NH2 1 
ATOM   611   N  N   . MET A 1 83  ? 1.272   11.125  17.752  1.00 22.66 ? 126  MET A N   1 
ATOM   612   C  CA  . MET A 1 83  ? 2.358   11.518  18.637  1.00 23.65 ? 126  MET A CA  1 
ATOM   613   C  C   . MET A 1 83  ? 2.803   12.939  18.254  1.00 23.75 ? 126  MET A C   1 
ATOM   614   O  O   . MET A 1 83  ? 3.241   13.721  19.101  1.00 25.92 ? 126  MET A O   1 
ATOM   615   C  CB  . MET A 1 83  ? 3.510   10.525  18.502  1.00 22.70 ? 126  MET A CB  1 
ATOM   616   C  CG  . MET A 1 83  ? 4.509   10.559  19.631  1.00 23.07 ? 126  MET A CG  1 
ATOM   617   S  SD  . MET A 1 83  ? 5.748   9.286   19.408  1.00 23.10 ? 126  MET A SD  1 
ATOM   618   C  CE  . MET A 1 83  ? 4.863   7.917   19.910  1.00 23.89 ? 126  MET A CE  1 
ATOM   619   N  N   . ILE A 1 84  ? 2.686   13.261  16.973  1.00 22.03 ? 127  ILE A N   1 
ATOM   620   C  CA  . ILE A 1 84  ? 3.008   14.581  16.479  1.00 20.92 ? 127  ILE A CA  1 
ATOM   621   C  C   . ILE A 1 84  ? 1.805   15.490  16.747  1.00 21.29 ? 127  ILE A C   1 
ATOM   622   O  O   . ILE A 1 84  ? 1.926   16.511  17.405  1.00 21.62 ? 127  ILE A O   1 
ATOM   623   C  CB  . ILE A 1 84  ? 3.275   14.532  14.973  1.00 20.90 ? 127  ILE A CB  1 
ATOM   624   C  CG1 . ILE A 1 84  ? 4.602   13.820  14.729  1.00 21.11 ? 127  ILE A CG1 1 
ATOM   625   C  CG2 . ILE A 1 84  ? 3.243   15.934  14.372  1.00 18.83 ? 127  ILE A CG2 1 
ATOM   626   C  CD1 . ILE A 1 84  ? 5.057   13.859  13.293  1.00 20.84 ? 127  ILE A CD1 1 
ATOM   627   N  N   . GLU A 1 85  ? 0.636   15.095  16.247  1.00 21.89 ? 128  GLU A N   1 
ATOM   628   C  CA  . GLU A 1 85  ? -0.596  15.865  16.403  1.00 20.97 ? 128  GLU A CA  1 
ATOM   629   C  C   . GLU A 1 85  ? -0.873  16.320  17.828  1.00 20.31 ? 128  GLU A C   1 
ATOM   630   O  O   . GLU A 1 85  ? -1.466  17.369  18.052  1.00 19.07 ? 128  GLU A O   1 
ATOM   631   C  CB  . GLU A 1 85  ? -1.801  15.067  15.879  1.00 21.46 ? 128  GLU A CB  1 
ATOM   632   C  CG  . GLU A 1 85  ? -1.807  14.838  14.368  1.00 21.78 ? 128  GLU A CG  1 
ATOM   633   C  CD  . GLU A 1 85  ? -3.216  14.754  13.759  1.00 23.53 ? 128  GLU A CD  1 
ATOM   634   O  OE1 . GLU A 1 85  ? -3.311  14.465  12.548  1.00 23.67 ? 128  GLU A OE1 1 
ATOM   635   O  OE2 . GLU A 1 85  ? -4.223  14.983  14.468  1.00 22.50 ? 128  GLU A OE2 1 
ATOM   636   N  N   . ASP A 1 86  ? -0.463  15.522  18.799  1.00 21.09 ? 129  ASP A N   1 
ATOM   637   C  CA  . ASP A 1 86  ? -0.681  15.886  20.191  1.00 22.11 ? 129  ASP A CA  1 
ATOM   638   C  C   . ASP A 1 86  ? 0.372   16.916  20.570  1.00 22.91 ? 129  ASP A C   1 
ATOM   639   O  O   . ASP A 1 86  ? 0.091   17.888  21.274  1.00 23.27 ? 129  ASP A O   1 
ATOM   640   C  CB  . ASP A 1 86  ? -0.575  14.649  21.087  1.00 20.87 ? 129  ASP A CB  1 
ATOM   641   C  CG  . ASP A 1 86  ? -1.886  13.886  21.190  1.00 19.93 ? 129  ASP A CG  1 
ATOM   642   O  OD1 . ASP A 1 86  ? -1.888  12.791  21.776  1.00 21.75 ? 129  ASP A OD1 1 
ATOM   643   O  OD2 . ASP A 1 86  ? -2.920  14.379  20.703  1.00 19.63 ? 129  ASP A OD2 1 
ATOM   644   N  N   . ALA A 1 87  ? 1.588   16.705  20.078  1.00 22.49 ? 130  ALA A N   1 
ATOM   645   C  CA  . ALA A 1 87  ? 2.675   17.616  20.349  1.00 22.49 ? 130  ALA A CA  1 
ATOM   646   C  C   . ALA A 1 87  ? 2.340   18.958  19.723  1.00 24.18 ? 130  ALA A C   1 
ATOM   647   O  O   . ALA A 1 87  ? 2.956   19.971  20.043  1.00 27.01 ? 130  ALA A O   1 
ATOM   648   C  CB  . ALA A 1 87  ? 3.958   17.073  19.779  1.00 22.18 ? 130  ALA A CB  1 
ATOM   649   N  N   . GLU A 1 88  ? 1.360   18.965  18.826  1.00 24.93 ? 131  GLU A N   1 
ATOM   650   C  CA  . GLU A 1 88  ? 0.933   20.197  18.173  1.00 25.03 ? 131  GLU A CA  1 
ATOM   651   C  C   . GLU A 1 88  ? -0.259  20.822  18.880  1.00 26.16 ? 131  GLU A C   1 
ATOM   652   O  O   . GLU A 1 88  ? -0.808  21.809  18.386  1.00 27.14 ? 131  GLU A O   1 
ATOM   653   C  CB  . GLU A 1 88  ? 0.541   19.944  16.719  1.00 23.71 ? 131  GLU A CB  1 
ATOM   654   C  CG  . GLU A 1 88  ? 1.673   19.714  15.761  1.00 22.65 ? 131  GLU A CG  1 
ATOM   655   C  CD  . GLU A 1 88  ? 1.189   19.788  14.333  1.00 23.56 ? 131  GLU A CD  1 
ATOM   656   O  OE1 . GLU A 1 88  ? 2.000   19.569  13.412  1.00 22.75 ? 131  GLU A OE1 1 
ATOM   657   O  OE2 . GLU A 1 88  ? -0.009  20.079  14.132  1.00 22.88 ? 131  GLU A OE2 1 
ATOM   658   N  N   . ARG A 1 89  ? -0.654  20.242  20.017  1.00 27.63 ? 132  ARG A N   1 
ATOM   659   C  CA  . ARG A 1 89  ? -1.781  20.806  20.745  1.00 29.26 ? 132  ARG A CA  1 
ATOM   660   C  C   . ARG A 1 89  ? -1.370  21.263  22.146  1.00 29.03 ? 132  ARG A C   1 
ATOM   661   O  O   . ARG A 1 89  ? -2.216  21.534  22.987  1.00 29.32 ? 132  ARG A O   1 
ATOM   662   C  CB  . ARG A 1 89  ? -2.932  19.815  20.773  1.00 31.55 ? 132  ARG A CB  1 
ATOM   663   C  CG  . ARG A 1 89  ? -3.896  19.963  19.587  1.00 34.20 ? 132  ARG A CG  1 
ATOM   664   C  CD  . ARG A 1 89  ? -4.034  18.657  18.795  1.00 35.19 ? 132  ARG A CD  1 
ATOM   665   N  NE  . ARG A 1 89  ? -5.088  17.785  19.328  1.00 35.87 ? 132  ARG A NE  1 
ATOM   666   C  CZ  . ARG A 1 89  ? -4.917  17.023  20.405  1.00 35.88 ? 132  ARG A CZ  1 
ATOM   667   N  NH1 . ARG A 1 89  ? -3.749  17.015  21.040  1.00 35.92 ? 132  ARG A NH1 1 
ATOM   668   N  NH2 . ARG A 1 89  ? -5.918  16.279  20.861  1.00 34.38 ? 132  ARG A NH2 1 
ATOM   669   N  N   . ASP A 1 90  ? -0.073  21.370  22.369  1.00 29.40 ? 133  ASP A N   1 
ATOM   670   C  CA  . ASP A 1 90  ? 0.499   21.899  23.610  1.00 27.33 ? 133  ASP A CA  1 
ATOM   671   C  C   . ASP A 1 90  ? 1.876   22.557  23.348  1.00 26.07 ? 133  ASP A C   1 
ATOM   672   O  O   . ASP A 1 90  ? 2.901   21.884  23.474  1.00 25.94 ? 133  ASP A O   1 
ATOM   673   C  CB  . ASP A 1 90  ? 0.648   20.800  24.710  1.00 26.17 ? 133  ASP A CB  1 
ATOM   674   C  CG  . ASP A 1 90  ? 1.250   19.462  24.328  1.00 27.49 ? 133  ASP A CG  1 
ATOM   675   O  OD1 . ASP A 1 90  ? 2.210   19.442  23.534  1.00 27.93 ? 133  ASP A OD1 1 
ATOM   676   O  OD2 . ASP A 1 90  ? 0.744   18.437  24.822  1.00 29.04 ? 133  ASP A OD2 1 
ATOM   677   N  N   . GLY A 1 91  ? 1.959   23.831  22.943  1.00 25.41 ? 134  GLY A N   1 
ATOM   678   C  CA  . GLY A 1 91  ? 3.233   24.492  22.696  1.00 23.77 ? 134  GLY A CA  1 
ATOM   679   C  C   . GLY A 1 91  ? 4.330   23.650  22.035  1.00 22.46 ? 134  GLY A C   1 
ATOM   680   O  O   . GLY A 1 91  ? 4.777   23.962  20.935  1.00 21.73 ? 134  GLY A O   1 
ATOM   681   N  N   . THR A 1 92  ? 4.777   22.567  22.698  1.00 21.96 ? 135  THR A N   1 
ATOM   682   C  CA  . THR A 1 92  ? 5.942   21.771  22.261  1.00 22.08 ? 135  THR A CA  1 
ATOM   683   C  C   . THR A 1 92  ? 6.233   21.663  20.727  1.00 23.35 ? 135  THR A C   1 
ATOM   684   O  O   . THR A 1 92  ? 7.244   22.246  20.321  1.00 23.48 ? 135  THR A O   1 
ATOM   685   C  CB  . THR A 1 92  ? 5.888   20.406  22.986  1.00 22.19 ? 135  THR A CB  1 
ATOM   686   O  OG1 . THR A 1 92  ? 5.657   20.628  24.377  1.00 20.11 ? 135  THR A OG1 1 
ATOM   687   C  CG2 . THR A 1 92  ? 7.194   19.642  22.778  1.00 20.83 ? 135  THR A CG2 1 
ATOM   688   N  N   . LEU A 1 93  ? 5.465   20.989  19.863  1.00 23.05 ? 136  LEU A N   1 
ATOM   689   C  CA  . LEU A 1 93  ? 5.928   20.957  18.469  1.00 22.77 ? 136  LEU A CA  1 
ATOM   690   C  C   . LEU A 1 93  ? 5.622   22.276  17.742  1.00 22.48 ? 136  LEU A C   1 
ATOM   691   O  O   . LEU A 1 93  ? 4.444   22.553  17.481  1.00 22.60 ? 136  LEU A O   1 
ATOM   692   C  CB  . LEU A 1 93  ? 5.271   19.788  17.730  1.00 22.48 ? 136  LEU A CB  1 
ATOM   693   C  CG  . LEU A 1 93  ? 5.560   19.640  16.248  1.00 23.16 ? 136  LEU A CG  1 
ATOM   694   C  CD1 . LEU A 1 93  ? 7.043   19.366  16.018  1.00 22.06 ? 136  LEU A CD1 1 
ATOM   695   C  CD2 . LEU A 1 93  ? 4.714   18.527  15.660  1.00 26.06 ? 136  LEU A CD2 1 
ATOM   696   N  N   . LYS A 1 94  ? 6.636   23.089  17.394  1.00 20.68 ? 137  LYS A N   1 
ATOM   697   C  CA  . LYS A 1 94  ? 6.412   24.375  16.721  1.00 18.51 ? 137  LYS A CA  1 
ATOM   698   C  C   . LYS A 1 94  ? 6.599   24.269  15.232  1.00 14.81 ? 137  LYS A C   1 
ATOM   699   O  O   . LYS A 1 94  ? 7.446   23.519  14.763  1.00 13.93 ? 137  LYS A O   1 
ATOM   700   C  CB  . LYS A 1 94  ? 7.366   25.461  17.231  1.00 21.01 ? 137  LYS A CB  1 
ATOM   701   C  CG  . LYS A 1 94  ? 7.338   25.725  18.720  1.00 22.93 ? 137  LYS A CG  1 
ATOM   702   C  CD  . LYS A 1 94  ? 8.111   26.988  19.048  1.00 23.44 ? 137  LYS A CD  1 
ATOM   703   C  CE  . LYS A 1 94  ? 9.557   26.940  18.541  1.00 22.80 ? 137  LYS A CE  1 
ATOM   704   N  NZ  . LYS A 1 94  ? 10.353  25.854  19.160  1.00 21.57 ? 137  LYS A NZ  1 
ATOM   705   N  N   . PRO A 1 95  ? 5.773   24.972  14.465  1.00 11.64 ? 138  PRO A N   1 
ATOM   706   C  CA  . PRO A 1 95  ? 5.923   24.914  13.020  1.00 11.14 ? 138  PRO A CA  1 
ATOM   707   C  C   . PRO A 1 95  ? 7.401   24.917  12.631  1.00 10.05 ? 138  PRO A C   1 
ATOM   708   O  O   . PRO A 1 95  ? 8.189   25.641  13.232  1.00 12.77 ? 138  PRO A O   1 
ATOM   709   C  CB  . PRO A 1 95  ? 5.178   26.157  12.590  1.00 10.96 ? 138  PRO A CB  1 
ATOM   710   C  CG  . PRO A 1 95  ? 3.936   26.066  13.497  1.00 9.90  ? 138  PRO A CG  1 
ATOM   711   C  CD  . PRO A 1 95  ? 4.468   25.547  14.831  1.00 10.91 ? 138  PRO A CD  1 
ATOM   712   N  N   . GLY A 1 96  ? 7.767   24.133  11.623  1.00 9.32  ? 139  GLY A N   1 
ATOM   713   C  CA  . GLY A 1 96  ? 9.153   24.057  11.190  1.00 9.71  ? 139  GLY A CA  1 
ATOM   714   C  C   . GLY A 1 96  ? 10.166  23.450  12.164  1.00 12.92 ? 139  GLY A C   1 
ATOM   715   O  O   . GLY A 1 96  ? 11.358  23.398  11.866  1.00 12.66 ? 139  GLY A O   1 
ATOM   716   N  N   . ASP A 1 97  ? 9.735   22.957  13.317  1.00 14.99 ? 140  ASP A N   1 
ATOM   717   C  CA  . ASP A 1 97  ? 10.716  22.411  14.244  1.00 18.29 ? 140  ASP A CA  1 
ATOM   718   C  C   . ASP A 1 97  ? 11.284  21.109  13.709  1.00 19.34 ? 140  ASP A C   1 
ATOM   719   O  O   . ASP A 1 97  ? 10.821  20.625  12.697  1.00 21.01 ? 140  ASP A O   1 
ATOM   720   C  CB  . ASP A 1 97  ? 10.092  22.222  15.627  1.00 19.82 ? 140  ASP A CB  1 
ATOM   721   C  CG  . ASP A 1 97  ? 9.662   23.552  16.261  1.00 22.81 ? 140  ASP A CG  1 
ATOM   722   O  OD1 . ASP A 1 97  ? 9.890   24.640  15.653  1.00 21.46 ? 140  ASP A OD1 1 
ATOM   723   O  OD2 . ASP A 1 97  ? 9.094   23.496  17.372  1.00 21.93 ? 140  ASP A OD2 1 
ATOM   724   N  N   . THR A 1 98  ? 12.286  20.549  14.376  1.00 18.94 ? 141  THR A N   1 
ATOM   725   C  CA  . THR A 1 98  ? 12.907  19.313  13.934  1.00 19.04 ? 141  THR A CA  1 
ATOM   726   C  C   . THR A 1 98  ? 12.484  18.104  14.764  1.00 21.92 ? 141  THR A C   1 
ATOM   727   O  O   . THR A 1 98  ? 12.625  18.099  15.997  1.00 23.37 ? 141  THR A O   1 
ATOM   728   C  CB  . THR A 1 98  ? 14.429  19.412  14.027  1.00 18.21 ? 141  THR A CB  1 
ATOM   729   O  OG1 . THR A 1 98  ? 14.872  20.555  13.302  1.00 18.10 ? 141  THR A OG1 1 
ATOM   730   C  CG2 . THR A 1 98  ? 15.082  18.191  13.440  1.00 18.31 ? 141  THR A CG2 1 
ATOM   731   N  N   . ILE A 1 99  ? 11.976  17.073  14.098  1.00 21.76 ? 142  ILE A N   1 
ATOM   732   C  CA  . ILE A 1 99  ? 11.594  15.868  14.809  1.00 22.46 ? 142  ILE A CA  1 
ATOM   733   C  C   . ILE A 1 99  ? 12.783  14.923  14.814  1.00 22.95 ? 142  ILE A C   1 
ATOM   734   O  O   . ILE A 1 99  ? 13.375  14.653  13.773  1.00 23.21 ? 142  ILE A O   1 
ATOM   735   C  CB  . ILE A 1 99  ? 10.370  15.208  14.154  1.00 23.31 ? 142  ILE A CB  1 
ATOM   736   C  CG1 . ILE A 1 99  ? 9.122   16.029  14.507  1.00 22.86 ? 142  ILE A CG1 1 
ATOM   737   C  CG2 . ILE A 1 99  ? 10.235  13.778  14.628  1.00 23.14 ? 142  ILE A CG2 1 
ATOM   738   C  CD1 . ILE A 1 99  ? 7.846   15.620  13.819  1.00 20.46 ? 142  ILE A CD1 1 
ATOM   739   N  N   . ILE A 1 100 ? 13.144  14.439  15.996  1.00 23.70 ? 143  ILE A N   1 
ATOM   740   C  CA  . ILE A 1 100 ? 14.275  13.524  16.144  1.00 25.48 ? 143  ILE A CA  1 
ATOM   741   C  C   . ILE A 1 100 ? 13.827  12.208  16.772  1.00 27.33 ? 143  ILE A C   1 
ATOM   742   O  O   . ILE A 1 100 ? 13.472  12.168  17.955  1.00 28.85 ? 143  ILE A O   1 
ATOM   743   C  CB  . ILE A 1 100 ? 15.400  14.141  17.031  1.00 25.01 ? 143  ILE A CB  1 
ATOM   744   C  CG1 . ILE A 1 100 ? 16.092  15.272  16.278  1.00 24.42 ? 143  ILE A CG1 1 
ATOM   745   C  CG2 . ILE A 1 100 ? 16.414  13.079  17.435  1.00 24.66 ? 143  ILE A CG2 1 
ATOM   746   C  CD1 . ILE A 1 100 ? 17.195  15.894  17.046  1.00 23.73 ? 143  ILE A CD1 1 
ATOM   747   N  N   . GLU A 1 101 ? 13.843  11.142  15.971  1.00 26.82 ? 144  GLU A N   1 
ATOM   748   C  CA  . GLU A 1 101 ? 13.450  9.819   16.432  1.00 25.93 ? 144  GLU A CA  1 
ATOM   749   C  C   . GLU A 1 101 ? 14.625  8.849   16.400  1.00 25.00 ? 144  GLU A C   1 
ATOM   750   O  O   . GLU A 1 101 ? 15.400  8.818   15.437  1.00 24.58 ? 144  GLU A O   1 
ATOM   751   C  CB  . GLU A 1 101 ? 12.308  9.267   15.576  1.00 27.11 ? 144  GLU A CB  1 
ATOM   752   C  CG  . GLU A 1 101 ? 11.915  7.826   15.915  1.00 28.40 ? 144  GLU A CG  1 
ATOM   753   C  CD  . GLU A 1 101 ? 11.391  7.671   17.333  1.00 28.96 ? 144  GLU A CD  1 
ATOM   754   O  OE1 . GLU A 1 101 ? 11.651  6.610   17.944  1.00 29.43 ? 144  GLU A OE1 1 
ATOM   755   O  OE2 . GLU A 1 101 ? 10.717  8.599   17.833  1.00 27.65 ? 144  GLU A OE2 1 
ATOM   756   N  N   . PRO A 1 102 ? 14.779  8.056   17.475  1.00 24.44 ? 145  PRO A N   1 
ATOM   757   C  CA  . PRO A 1 102 ? 15.837  7.055   17.648  1.00 24.21 ? 145  PRO A CA  1 
ATOM   758   C  C   . PRO A 1 102 ? 15.546  5.693   17.027  1.00 25.03 ? 145  PRO A C   1 
ATOM   759   O  O   . PRO A 1 102 ? 16.467  4.934   16.736  1.00 24.92 ? 145  PRO A O   1 
ATOM   760   C  CB  . PRO A 1 102 ? 15.965  6.962   19.161  1.00 23.35 ? 145  PRO A CB  1 
ATOM   761   C  CG  . PRO A 1 102 ? 14.579  7.182   19.602  1.00 23.40 ? 145  PRO A CG  1 
ATOM   762   C  CD  . PRO A 1 102 ? 14.136  8.343   18.769  1.00 22.27 ? 145  PRO A CD  1 
ATOM   763   N  N   . THR A 1 103 ? 14.272  5.376   16.824  1.00 24.80 ? 146  THR A N   1 
ATOM   764   C  CA  . THR A 1 103 ? 13.939  4.081   16.257  1.00 24.93 ? 146  THR A CA  1 
ATOM   765   C  C   . THR A 1 103 ? 14.266  4.003   14.794  1.00 23.97 ? 146  THR A C   1 
ATOM   766   O  O   . THR A 1 103 ? 13.937  4.895   14.019  1.00 23.27 ? 146  THR A O   1 
ATOM   767   C  CB  . THR A 1 103 ? 12.445  3.724   16.429  1.00 26.63 ? 146  THR A CB  1 
ATOM   768   O  OG1 . THR A 1 103 ? 12.325  2.330   16.752  1.00 27.81 ? 146  THR A OG1 1 
ATOM   769   C  CG2 . THR A 1 103 ? 11.667  3.987   15.131  1.00 27.15 ? 146  THR A CG2 1 
ATOM   770   N  N   . SER A 1 104 ? 14.914  2.909   14.433  1.00 24.97 ? 147  SER A N   1 
ATOM   771   C  CA  . SER A 1 104 ? 15.300  2.630   13.059  1.00 26.97 ? 147  SER A CA  1 
ATOM   772   C  C   . SER A 1 104 ? 14.140  1.970   12.283  1.00 27.71 ? 147  SER A C   1 
ATOM   773   O  O   . SER A 1 104 ? 14.216  1.807   11.064  1.00 27.99 ? 147  SER A O   1 
ATOM   774   C  CB  . SER A 1 104 ? 16.505  1.689   13.062  1.00 27.10 ? 147  SER A CB  1 
ATOM   775   O  OG  . SER A 1 104 ? 16.200  0.489   13.757  1.00 26.79 ? 147  SER A OG  1 
ATOM   776   N  N   . GLY A 1 105 ? 13.070  1.613   12.997  1.00 26.84 ? 148  GLY A N   1 
ATOM   777   C  CA  . GLY A 1 105 ? 11.933  0.945   12.388  1.00 25.94 ? 148  GLY A CA  1 
ATOM   778   C  C   . GLY A 1 105 ? 10.895  1.727   11.604  1.00 25.83 ? 148  GLY A C   1 
ATOM   779   O  O   . GLY A 1 105 ? 11.189  2.717   10.935  1.00 25.15 ? 148  GLY A O   1 
ATOM   780   N  N   . ASN A 1 106 ? 9.656   1.263   11.691  1.00 25.24 ? 149  ASN A N   1 
ATOM   781   C  CA  . ASN A 1 106 ? 8.567   1.879   10.962  1.00 26.60 ? 149  ASN A CA  1 
ATOM   782   C  C   . ASN A 1 106 ? 8.233   3.279   11.391  1.00 27.07 ? 149  ASN A C   1 
ATOM   783   O  O   . ASN A 1 106 ? 7.972   4.131   10.543  1.00 26.85 ? 149  ASN A O   1 
ATOM   784   C  CB  . ASN A 1 106 ? 7.310   1.004   11.035  1.00 27.64 ? 149  ASN A CB  1 
ATOM   785   C  CG  . ASN A 1 106 ? 7.398   -0.204  10.120  1.00 29.60 ? 149  ASN A CG  1 
ATOM   786   O  OD1 . ASN A 1 106 ? 7.903   -0.108  8.992   1.00 29.75 ? 149  ASN A OD1 1 
ATOM   787   N  ND2 . ASN A 1 106 ? 6.906   -1.345  10.592  1.00 27.33 ? 149  ASN A ND2 1 
ATOM   788   N  N   . THR A 1 107 ? 8.234   3.512   12.700  1.00 26.86 ? 150  THR A N   1 
ATOM   789   C  CA  . THR A 1 107 ? 7.916   4.824   13.256  1.00 26.99 ? 150  THR A CA  1 
ATOM   790   C  C   . THR A 1 107 ? 8.751   5.959   12.637  1.00 26.90 ? 150  THR A C   1 
ATOM   791   O  O   . THR A 1 107 ? 8.249   7.063   12.396  1.00 25.88 ? 150  THR A O   1 
ATOM   792   C  CB  . THR A 1 107 ? 8.100   4.810   14.781  1.00 27.33 ? 150  THR A CB  1 
ATOM   793   O  OG1 . THR A 1 107 ? 7.207   3.849   15.352  1.00 27.46 ? 150  THR A OG1 1 
ATOM   794   C  CG2 . THR A 1 107 ? 7.800   6.177   15.372  1.00 27.32 ? 150  THR A CG2 1 
ATOM   795   N  N   . GLY A 1 108 ? 10.025  5.682   12.385  1.00 26.15 ? 151  GLY A N   1 
ATOM   796   C  CA  . GLY A 1 108 ? 10.885  6.679   11.775  1.00 26.73 ? 151  GLY A CA  1 
ATOM   797   C  C   . GLY A 1 108 ? 10.468  6.874   10.329  1.00 27.00 ? 151  GLY A C   1 
ATOM   798   O  O   . GLY A 1 108 ? 10.729  7.910   9.707   1.00 27.91 ? 151  GLY A O   1 
ATOM   799   N  N   . ILE A 1 109 ? 9.807   5.855   9.791   1.00 26.28 ? 152  ILE A N   1 
ATOM   800   C  CA  . ILE A 1 109 ? 9.327   5.880   8.416   1.00 24.32 ? 152  ILE A CA  1 
ATOM   801   C  C   . ILE A 1 109 ? 7.993   6.619   8.423   1.00 22.10 ? 152  ILE A C   1 
ATOM   802   O  O   . ILE A 1 109 ? 7.561   7.192   7.409   1.00 21.55 ? 152  ILE A O   1 
ATOM   803   C  CB  . ILE A 1 109 ? 9.146   4.437   7.885   1.00 25.30 ? 152  ILE A CB  1 
ATOM   804   C  CG1 . ILE A 1 109 ? 10.460  3.655   8.082   1.00 25.04 ? 152  ILE A CG1 1 
ATOM   805   C  CG2 . ILE A 1 109 ? 8.716   4.465   6.411   1.00 22.86 ? 152  ILE A CG2 1 
ATOM   806   C  CD1 . ILE A 1 109 ? 10.364  2.150   7.834   1.00 26.25 ? 152  ILE A CD1 1 
ATOM   807   N  N   . GLY A 1 110 ? 7.366   6.618   9.595   1.00 19.07 ? 153  GLY A N   1 
ATOM   808   C  CA  . GLY A 1 110 ? 6.089   7.277   9.758   1.00 17.42 ? 153  GLY A CA  1 
ATOM   809   C  C   . GLY A 1 110 ? 6.281   8.756   9.947   1.00 15.43 ? 153  GLY A C   1 
ATOM   810   O  O   . GLY A 1 110 ? 5.575   9.575   9.362   1.00 15.73 ? 153  GLY A O   1 
ATOM   811   N  N   . LEU A 1 111 ? 7.260   9.100   10.764  1.00 14.50 ? 154  LEU A N   1 
ATOM   812   C  CA  . LEU A 1 111 ? 7.544   10.499  11.043  1.00 13.72 ? 154  LEU A CA  1 
ATOM   813   C  C   . LEU A 1 111 ? 7.903   11.256  9.774   1.00 13.46 ? 154  LEU A C   1 
ATOM   814   O  O   . LEU A 1 111 ? 7.224   12.218  9.411   1.00 12.20 ? 154  LEU A O   1 
ATOM   815   C  CB  . LEU A 1 111 ? 8.660   10.591  12.084  1.00 11.54 ? 154  LEU A CB  1 
ATOM   816   C  CG  . LEU A 1 111 ? 8.215   9.966   13.416  1.00 12.12 ? 154  LEU A CG  1 
ATOM   817   C  CD1 . LEU A 1 111 ? 9.408   9.421   14.187  1.00 8.97  ? 154  LEU A CD1 1 
ATOM   818   C  CD2 . LEU A 1 111 ? 7.410   11.002  14.220  1.00 8.74  ? 154  LEU A CD2 1 
ATOM   819   N  N   . ALA A 1 112 ? 8.954   10.810  9.092   1.00 12.63 ? 155  ALA A N   1 
ATOM   820   C  CA  . ALA A 1 112 ? 9.384   11.446  7.855   1.00 12.23 ? 155  ALA A CA  1 
ATOM   821   C  C   . ALA A 1 112 ? 8.219   11.546  6.871   1.00 12.87 ? 155  ALA A C   1 
ATOM   822   O  O   . ALA A 1 112 ? 8.190   12.430  6.016   1.00 13.13 ? 155  ALA A O   1 
ATOM   823   C  CB  . ALA A 1 112 ? 10.523  10.645  7.226   1.00 11.21 ? 155  ALA A CB  1 
ATOM   824   N  N   . LEU A 1 113 ? 7.263   10.629  6.991   1.00 14.58 ? 156  LEU A N   1 
ATOM   825   C  CA  . LEU A 1 113 ? 6.132   10.594  6.084   1.00 13.60 ? 156  LEU A CA  1 
ATOM   826   C  C   . LEU A 1 113 ? 5.299   11.817  6.373   1.00 13.13 ? 156  LEU A C   1 
ATOM   827   O  O   . LEU A 1 113 ? 5.153   12.710  5.523   1.00 12.23 ? 156  LEU A O   1 
ATOM   828   C  CB  . LEU A 1 113 ? 5.316   9.319   6.314   1.00 13.09 ? 156  LEU A CB  1 
ATOM   829   C  CG  . LEU A 1 113 ? 4.413   8.880   5.151   1.00 12.75 ? 156  LEU A CG  1 
ATOM   830   C  CD1 . LEU A 1 113 ? 3.634   10.040  4.538   1.00 10.08 ? 156  LEU A CD1 1 
ATOM   831   C  CD2 . LEU A 1 113 ? 5.295   8.256   4.100   1.00 14.31 ? 156  LEU A CD2 1 
ATOM   832   N  N   . ALA A 1 114 ? 4.736   11.854  7.575   1.00 12.07 ? 157  ALA A N   1 
ATOM   833   C  CA  . ALA A 1 114 ? 3.943   13.011  7.966   1.00 13.40 ? 157  ALA A CA  1 
ATOM   834   C  C   . ALA A 1 114 ? 4.852   14.256  8.080   1.00 13.73 ? 157  ALA A C   1 
ATOM   835   O  O   . ALA A 1 114 ? 4.360   15.377  8.046   1.00 15.79 ? 157  ALA A O   1 
ATOM   836   C  CB  . ALA A 1 114 ? 3.254   12.766  9.280   1.00 12.61 ? 157  ALA A CB  1 
ATOM   837   N  N   . ALA A 1 115 ? 6.164   14.056  8.198   1.00 13.85 ? 158  ALA A N   1 
ATOM   838   C  CA  . ALA A 1 115 ? 7.139   15.138  8.310   1.00 14.55 ? 158  ALA A CA  1 
ATOM   839   C  C   . ALA A 1 115 ? 7.217   16.007  7.054   1.00 15.18 ? 158  ALA A C   1 
ATOM   840   O  O   . ALA A 1 115 ? 7.189   17.237  7.137   1.00 13.85 ? 158  ALA A O   1 
ATOM   841   C  CB  . ALA A 1 115 ? 8.499   14.548  8.600   1.00 17.79 ? 158  ALA A CB  1 
ATOM   842   N  N   . ALA A 1 116 ? 7.328   15.366  5.892   1.00 15.45 ? 159  ALA A N   1 
ATOM   843   C  CA  . ALA A 1 116 ? 7.414   16.094  4.627   1.00 16.21 ? 159  ALA A CA  1 
ATOM   844   C  C   . ALA A 1 116 ? 6.138   16.875  4.397   1.00 17.14 ? 159  ALA A C   1 
ATOM   845   O  O   . ALA A 1 116 ? 6.155   18.040  3.998   1.00 18.10 ? 159  ALA A O   1 
ATOM   846   C  CB  . ALA A 1 116 ? 7.671   15.134  3.476   1.00 14.67 ? 159  ALA A CB  1 
ATOM   847   N  N   . VAL A 1 117 ? 5.205   16.199  4.712   1.00 17.51 ? 160  VAL A N   1 
ATOM   848   C  CA  . VAL A 1 117 ? 4.012   16.765  4.458   1.00 17.64 ? 160  VAL A CA  1 
ATOM   849   C  C   . VAL A 1 117 ? 3.667   17.995  5.308   1.00 17.80 ? 160  VAL A C   1 
ATOM   850   O  O   . VAL A 1 117 ? 2.942   18.854  4.842   1.00 16.81 ? 160  VAL A O   1 
ATOM   851   C  CB  . VAL A 1 117 ? 3.022   15.670  4.675   1.00 17.58 ? 160  VAL A CB  1 
ATOM   852   C  CG1 . VAL A 1 117 ? 1.675   16.037  4.081   1.00 17.84 ? 160  VAL A CG1 1 
ATOM   853   C  CG2 . VAL A 1 117 ? 3.545   14.376  4.082   1.00 14.96 ? 160  VAL A CG2 1 
ATOM   854   N  N   . ARG A 1 118 ? 4.168   18.095  6.542   1.00 19.36 ? 161  ARG A N   1 
ATOM   855   C  CA  . ARG A 1 118 ? 3.429   19.144  7.508   1.00 22.47 ? 161  ARG A CA  1 
ATOM   856   C  C   . ARG A 1 118 ? 4.731   19.952  7.436   1.00 22.38 ? 161  ARG A C   1 
ATOM   857   O  O   . ARG A 1 118 ? 4.781   21.103  7.840   1.00 21.37 ? 161  ARG A O   1 
ATOM   858   C  CB  . ARG A 1 118 ? 3.139   18.742  8.961   1.00 23.37 ? 161  ARG A CB  1 
ATOM   859   C  CG  . ARG A 1 118 ? 1.945   17.804  9.115   1.00 26.02 ? 161  ARG A CG  1 
ATOM   860   C  CD  . ARG A 1 118 ? 0.623   18.431  8.675   1.00 28.99 ? 161  ARG A CD  1 
ATOM   861   N  NE  . ARG A 1 118 ? -0.552  17.658  9.098   1.00 29.10 ? 161  ARG A NE  1 
ATOM   862   C  CZ  . ARG A 1 118 ? -1.710  17.619  8.444   1.00 28.87 ? 161  ARG A CZ  1 
ATOM   863   N  NH1 . ARG A 1 118 ? -1.876  18.305  7.325   1.00 26.13 ? 161  ARG A NH1 1 
ATOM   864   N  NH2 . ARG A 1 118 ? -2.706  16.878  8.908   1.00 31.06 ? 161  ARG A NH2 1 
ATOM   865   N  N   . GLY A 1 119 ? 5.787   19.336  6.943   1.00 22.14 ? 162  GLY A N   1 
ATOM   866   C  CA  . GLY A 1 119 ? 7.050   20.045  6.734   1.00 23.53 ? 162  GLY A CA  1 
ATOM   867   C  C   . GLY A 1 119 ? 7.882   20.310  8.006   1.00 23.22 ? 162  GLY A C   1 
ATOM   868   O  O   . GLY A 1 119 ? 7.984   21.448  8.462   1.00 22.79 ? 162  GLY A O   1 
ATOM   869   N  N   . TYR A 1 120 ? 8.449   19.245  8.547   1.00 22.10 ? 163  TYR A N   1 
ATOM   870   C  CA  . TYR A 1 120 ? 9.299   19.335  9.713   1.00 22.02 ? 163  TYR A CA  1 
ATOM   871   C  C   . TYR A 1 120 ? 10.588  18.648  9.300   1.00 23.11 ? 163  TYR A C   1 
ATOM   872   O  O   . TYR A 1 120 ? 10.573  17.786  8.410   1.00 24.81 ? 163  TYR A O   1 
ATOM   873   C  CB  . TYR A 1 120 ? 8.714   18.544  10.874  1.00 22.94 ? 163  TYR A CB  1 
ATOM   874   C  CG  . TYR A 1 120 ? 7.470   19.107  11.507  1.00 22.35 ? 163  TYR A CG  1 
ATOM   875   C  CD1 . TYR A 1 120 ? 6.335   18.312  11.652  1.00 22.57 ? 163  TYR A CD1 1 
ATOM   876   C  CD2 . TYR A 1 120 ? 7.442   20.401  12.023  1.00 21.41 ? 163  TYR A CD2 1 
ATOM   877   C  CE1 . TYR A 1 120 ? 5.205   18.783  12.296  1.00 22.50 ? 163  TYR A CE1 1 
ATOM   878   C  CE2 . TYR A 1 120 ? 6.317   20.882  12.670  1.00 20.98 ? 163  TYR A CE2 1 
ATOM   879   C  CZ  . TYR A 1 120 ? 5.199   20.064  12.802  1.00 22.54 ? 163  TYR A CZ  1 
ATOM   880   O  OH  . TYR A 1 120 ? 4.061   20.512  13.425  1.00 23.15 ? 163  TYR A OH  1 
ATOM   881   N  N   . ARG A 1 121 ? 11.700  19.026  9.927   1.00 21.21 ? 164  ARG A N   1 
ATOM   882   C  CA  . ARG A 1 121 ? 12.955  18.374  9.632   1.00 20.34 ? 164  ARG A CA  1 
ATOM   883   C  C   . ARG A 1 121 ? 12.881  17.021  10.317  1.00 21.13 ? 164  ARG A C   1 
ATOM   884   O  O   . ARG A 1 121 ? 12.420  16.920  11.451  1.00 22.74 ? 164  ARG A O   1 
ATOM   885   C  CB  . ARG A 1 121 ? 14.134  19.140  10.203  1.00 19.47 ? 164  ARG A CB  1 
ATOM   886   C  CG  . ARG A 1 121 ? 15.405  18.372  10.017  1.00 23.00 ? 164  ARG A CG  1 
ATOM   887   C  CD  . ARG A 1 121 ? 16.622  19.145  10.408  1.00 26.50 ? 164  ARG A CD  1 
ATOM   888   N  NE  . ARG A 1 121 ? 17.804  18.608  9.736   1.00 30.84 ? 164  ARG A NE  1 
ATOM   889   C  CZ  . ARG A 1 121 ? 19.020  19.143  9.813   1.00 32.49 ? 164  ARG A CZ  1 
ATOM   890   N  NH1 . ARG A 1 121 ? 19.222  20.232  10.547  1.00 33.68 ? 164  ARG A NH1 1 
ATOM   891   N  NH2 . ARG A 1 121 ? 20.029  18.610  9.129   1.00 33.11 ? 164  ARG A NH2 1 
ATOM   892   N  N   . CYS A 1 122 ? 13.317  15.969  9.638   1.00 22.24 ? 165  CYS A N   1 
ATOM   893   C  CA  . CYS A 1 122 ? 13.278  14.661  10.260  1.00 21.47 ? 165  CYS A CA  1 
ATOM   894   C  C   . CYS A 1 122 ? 14.659  14.049  10.303  1.00 21.67 ? 165  CYS A C   1 
ATOM   895   O  O   . CYS A 1 122 ? 15.328  13.922  9.282   1.00 20.72 ? 165  CYS A O   1 
ATOM   896   C  CB  . CYS A 1 122 ? 12.326  13.732  9.519   1.00 21.78 ? 165  CYS A CB  1 
ATOM   897   S  SG  . CYS A 1 122 ? 11.745  12.380  10.550  1.00 22.97 ? 165  CYS A SG  1 
ATOM   898   N  N   . ILE A 1 123 ? 15.079  13.705  11.514  1.00 22.21 ? 166  ILE A N   1 
ATOM   899   C  CA  . ILE A 1 123 ? 16.374  13.093  11.768  1.00 21.90 ? 166  ILE A CA  1 
ATOM   900   C  C   . ILE A 1 123 ? 16.005  11.788  12.414  1.00 22.69 ? 166  ILE A C   1 
ATOM   901   O  O   . ILE A 1 123 ? 15.223  11.770  13.359  1.00 22.64 ? 166  ILE A O   1 
ATOM   902   C  CB  . ILE A 1 123 ? 17.194  13.865  12.816  1.00 22.02 ? 166  ILE A CB  1 
ATOM   903   C  CG1 . ILE A 1 123 ? 17.422  15.302  12.374  1.00 21.66 ? 166  ILE A CG1 1 
ATOM   904   C  CG2 . ILE A 1 123 ? 18.509  13.171  13.051  1.00 20.22 ? 166  ILE A CG2 1 
ATOM   905   C  CD1 . ILE A 1 123 ? 17.986  16.155  13.472  1.00 21.90 ? 166  ILE A CD1 1 
ATOM   906   N  N   . ILE A 1 124 ? 16.525  10.693  11.925  1.00 22.83 ? 167  ILE A N   1 
ATOM   907   C  CA  . ILE A 1 124 ? 16.235  9.418   12.520  1.00 25.96 ? 167  ILE A CA  1 
ATOM   908   C  C   . ILE A 1 124 ? 17.534  8.768   12.868  1.00 27.41 ? 167  ILE A C   1 
ATOM   909   O  O   . ILE A 1 124 ? 18.168  8.112   12.049  1.00 28.28 ? 167  ILE A O   1 
ATOM   910   C  CB  . ILE A 1 124 ? 15.457  8.534   11.539  1.00 27.16 ? 167  ILE A CB  1 
ATOM   911   C  CG1 . ILE A 1 124 ? 14.101  9.133   11.203  1.00 27.72 ? 167  ILE A CG1 1 
ATOM   912   C  CG2 . ILE A 1 124 ? 15.295  7.119   12.101  1.00 28.19 ? 167  ILE A CG2 1 
ATOM   913   C  CD1 . ILE A 1 124 ? 13.530  8.651   9.885   1.00 27.43 ? 167  ILE A CD1 1 
ATOM   914   N  N   . VAL A 1 125 ? 17.989  8.973   14.078  1.00 29.04 ? 168  VAL A N   1 
ATOM   915   C  CA  . VAL A 1 125 ? 19.202  8.317   14.528  1.00 30.29 ? 168  VAL A CA  1 
ATOM   916   C  C   . VAL A 1 125 ? 18.905  6.795   14.505  1.00 33.22 ? 168  VAL A C   1 
ATOM   917   O  O   . VAL A 1 125 ? 18.045  6.312   15.250  1.00 32.15 ? 168  VAL A O   1 
ATOM   918   C  CB  . VAL A 1 125 ? 19.631  8.817   15.917  1.00 27.81 ? 168  VAL A CB  1 
ATOM   919   C  CG1 . VAL A 1 125 ? 20.792  7.989   16.442  1.00 26.19 ? 168  VAL A CG1 1 
ATOM   920   C  CG2 . VAL A 1 125 ? 19.975  10.304  15.864  1.00 23.38 ? 168  VAL A CG2 1 
ATOM   921   N  N   . MET A 1 126 ? 19.628  6.064   13.653  1.00 35.24 ? 169  MET A N   1 
ATOM   922   C  CA  . MET A 1 126 ? 19.432  4.627   13.520  1.00 38.06 ? 169  MET A CA  1 
ATOM   923   C  C   . MET A 1 126 ? 20.720  3.864   13.242  1.00 39.69 ? 169  MET A C   1 
ATOM   924   O  O   . MET A 1 126 ? 21.659  4.394   12.647  1.00 39.43 ? 169  MET A O   1 
ATOM   925   C  CB  . MET A 1 126 ? 18.451  4.353   12.360  1.00 39.33 ? 169  MET A CB  1 
ATOM   926   C  CG  . MET A 1 126 ? 19.076  4.439   10.974  1.00 37.45 ? 169  MET A CG  1 
ATOM   927   S  SD  . MET A 1 126 ? 18.240  3.385   9.772   1.00 36.24 ? 169  MET A SD  1 
ATOM   928   C  CE  . MET A 1 126 ? 16.538  3.878   10.025  1.00 36.18 ? 169  MET A CE  1 
ATOM   929   N  N   . PRO A 1 127 ? 20.717  2.584   13.687  1.00 40.63 ? 170  PRO A N   1 
ATOM   930   C  CA  . PRO A 1 127 ? 21.903  1.732   13.464  1.00 41.47 ? 170  PRO A CA  1 
ATOM   931   C  C   . PRO A 1 127 ? 22.390  1.640   12.029  1.00 43.41 ? 170  PRO A C   1 
ATOM   932   O  O   . PRO A 1 127 ? 21.583  1.706   11.114  1.00 43.26 ? 170  PRO A O   1 
ATOM   933   C  CB  . PRO A 1 127 ? 21.523  0.451   14.167  1.00 42.01 ? 170  PRO A CB  1 
ATOM   934   C  CG  . PRO A 1 127 ? 20.806  0.945   15.359  1.00 41.34 ? 170  PRO A CG  1 
ATOM   935   C  CD  . PRO A 1 127 ? 20.253  2.309   15.049  1.00 40.56 ? 170  PRO A CD  1 
ATOM   936   N  N   . GLU A 1 128 ? 23.691  1.452   11.829  1.00 44.94 ? 171  GLU A N   1 
ATOM   937   C  CA  . GLU A 1 128 ? 24.161  1.429   10.461  1.00 46.71 ? 171  GLU A CA  1 
ATOM   938   C  C   . GLU A 1 128 ? 24.137  0.058   9.803   1.00 47.41 ? 171  GLU A C   1 
ATOM   939   O  O   . GLU A 1 128 ? 24.367  -0.058  8.604   1.00 47.43 ? 171  GLU A O   1 
ATOM   940   C  CB  . GLU A 1 128 ? 25.568  2.010   10.393  1.00 48.53 ? 171  GLU A CB  1 
ATOM   941   C  CG  . GLU A 1 128 ? 26.591  1.218   11.174  1.00 50.69 ? 171  GLU A CG  1 
ATOM   942   C  CD  . GLU A 1 128 ? 27.949  1.834   10.995  1.00 52.25 ? 171  GLU A CD  1 
ATOM   943   O  OE1 . GLU A 1 128 ? 28.380  2.037   9.850   1.00 52.16 ? 171  GLU A OE1 1 
ATOM   944   O  OE2 . GLU A 1 128 ? 28.604  2.122   12.022  1.00 52.05 ? 171  GLU A OE2 1 
ATOM   945   N  N   . LYS A 1 129 ? 23.844  -0.977  10.576  1.00 47.25 ? 172  LYS A N   1 
ATOM   946   C  CA  . LYS A 1 129 ? 23.799  -2.316  10.021  1.00 46.67 ? 172  LYS A CA  1 
ATOM   947   C  C   . LYS A 1 129 ? 22.391  -2.711  9.556   1.00 46.67 ? 172  LYS A C   1 
ATOM   948   O  O   . LYS A 1 129 ? 22.124  -3.893  9.337   1.00 48.27 ? 172  LYS A O   1 
ATOM   949   C  CB  . LYS A 1 129 ? 24.334  -3.308  11.054  1.00 46.53 ? 172  LYS A CB  1 
ATOM   950   C  CG  . LYS A 1 129 ? 23.903  -2.993  12.485  1.00 46.92 ? 172  LYS A CG  1 
ATOM   951   C  CD  . LYS A 1 129 ? 25.084  -3.060  13.470  1.00 47.50 ? 172  LYS A CD  1 
ATOM   952   C  CE  . LYS A 1 129 ? 26.039  -1.861  13.358  1.00 47.23 ? 172  LYS A CE  1 
ATOM   953   N  NZ  . LYS A 1 129 ? 25.398  -0.573  13.772  1.00 46.32 ? 172  LYS A NZ  1 
ATOM   954   N  N   . MET A 1 130 ? 21.499  -1.729  9.398   1.00 44.89 ? 173  MET A N   1 
ATOM   955   C  CA  . MET A 1 130 ? 20.127  -1.994  8.942   1.00 43.51 ? 173  MET A CA  1 
ATOM   956   C  C   . MET A 1 130 ? 20.058  -2.208  7.432   1.00 42.43 ? 173  MET A C   1 
ATOM   957   O  O   . MET A 1 130 ? 21.086  -2.249  6.760   1.00 43.10 ? 173  MET A O   1 
ATOM   958   C  CB  . MET A 1 130 ? 19.181  -0.858  9.339   1.00 44.19 ? 173  MET A CB  1 
ATOM   959   C  CG  . MET A 1 130 ? 18.125  -1.302  10.348  1.00 44.79 ? 173  MET A CG  1 
ATOM   960   S  SD  . MET A 1 130 ? 17.299  -2.858  9.854   1.00 47.62 ? 173  MET A SD  1 
ATOM   961   C  CE  . MET A 1 130 ? 15.537  -2.381  9.946   1.00 44.83 ? 173  MET A CE  1 
ATOM   962   N  N   . SER A 1 131 ? 18.847  -2.355  6.899   1.00 41.06 ? 174  SER A N   1 
ATOM   963   C  CA  . SER A 1 131 ? 18.660  -2.588  5.461   1.00 38.85 ? 174  SER A CA  1 
ATOM   964   C  C   . SER A 1 131 ? 18.212  -1.335  4.713   1.00 37.39 ? 174  SER A C   1 
ATOM   965   O  O   . SER A 1 131 ? 17.429  -0.535  5.233   1.00 37.02 ? 174  SER A O   1 
ATOM   966   C  CB  . SER A 1 131 ? 17.617  -3.675  5.245   1.00 39.45 ? 174  SER A CB  1 
ATOM   967   O  OG  . SER A 1 131 ? 16.341  -3.215  5.665   1.00 39.06 ? 174  SER A OG  1 
ATOM   968   N  N   . SER A 1 132 ? 18.687  -1.171  3.482   1.00 35.82 ? 175  SER A N   1 
ATOM   969   C  CA  . SER A 1 132 ? 18.310  0.000   2.697   1.00 34.90 ? 175  SER A CA  1 
ATOM   970   C  C   . SER A 1 132 ? 16.825  0.046   2.354   1.00 34.50 ? 175  SER A C   1 
ATOM   971   O  O   . SER A 1 132 ? 16.291  1.102   2.021   1.00 33.12 ? 175  SER A O   1 
ATOM   972   C  CB  . SER A 1 132 ? 19.141  0.081   1.416   1.00 34.13 ? 175  SER A CB  1 
ATOM   973   O  OG  . SER A 1 132 ? 20.359  0.775   1.649   1.00 31.70 ? 175  SER A OG  1 
ATOM   974   N  N   . GLU A 1 133 ? 16.156  -1.099  2.438   1.00 34.32 ? 176  GLU A N   1 
ATOM   975   C  CA  . GLU A 1 133 ? 14.729  -1.153  2.138   1.00 34.00 ? 176  GLU A CA  1 
ATOM   976   C  C   . GLU A 1 133 ? 14.020  -0.013  2.867   1.00 32.81 ? 176  GLU A C   1 
ATOM   977   O  O   . GLU A 1 133 ? 13.153  0.650   2.302   1.00 32.85 ? 176  GLU A O   1 
ATOM   978   C  CB  . GLU A 1 133 ? 14.139  -2.502  2.566   1.00 34.88 ? 176  GLU A CB  1 
ATOM   979   C  CG  . GLU A 1 133 ? 13.793  -3.466  1.412   1.00 35.58 ? 176  GLU A CG  1 
ATOM   980   C  CD  . GLU A 1 133 ? 14.885  -4.508  1.117   1.00 37.20 ? 176  GLU A CD  1 
ATOM   981   O  OE1 . GLU A 1 133 ? 15.318  -5.226  2.048   1.00 36.32 ? 176  GLU A OE1 1 
ATOM   982   O  OE2 . GLU A 1 133 ? 15.298  -4.622  -0.062  1.00 38.37 ? 176  GLU A OE2 1 
ATOM   983   N  N   . LYS A 1 134 ? 14.411  0.207   4.121   1.00 32.09 ? 177  LYS A N   1 
ATOM   984   C  CA  . LYS A 1 134 ? 13.848  1.265   4.964   1.00 29.83 ? 177  LYS A CA  1 
ATOM   985   C  C   . LYS A 1 134 ? 14.649  2.544   4.750   1.00 28.72 ? 177  LYS A C   1 
ATOM   986   O  O   . LYS A 1 134 ? 14.087  3.601   4.457   1.00 27.14 ? 177  LYS A O   1 
ATOM   987   C  CB  . LYS A 1 134 ? 13.931  0.871   6.445   1.00 29.39 ? 177  LYS A CB  1 
ATOM   988   C  CG  . LYS A 1 134 ? 13.126  -0.359  6.831   1.00 28.55 ? 177  LYS A CG  1 
ATOM   989   C  CD  . LYS A 1 134 ? 13.126  -0.561  8.341   1.00 27.45 ? 177  LYS A CD  1 
ATOM   990   C  CE  . LYS A 1 134 ? 12.114  -1.628  8.755   1.00 28.01 ? 177  LYS A CE  1 
ATOM   991   N  NZ  . LYS A 1 134 ? 11.986  -1.809  10.234  1.00 25.09 ? 177  LYS A NZ  1 
ATOM   992   N  N   . VAL A 1 135 ? 15.968  2.421   4.910   1.00 28.18 ? 178  VAL A N   1 
ATOM   993   C  CA  . VAL A 1 135 ? 16.923  3.521   4.741   1.00 27.34 ? 178  VAL A CA  1 
ATOM   994   C  C   . VAL A 1 135 ? 16.626  4.388   3.522   1.00 27.70 ? 178  VAL A C   1 
ATOM   995   O  O   . VAL A 1 135 ? 16.599  5.610   3.618   1.00 28.07 ? 178  VAL A O   1 
ATOM   996   C  CB  . VAL A 1 135 ? 18.358  2.972   4.604   1.00 26.49 ? 178  VAL A CB  1 
ATOM   997   C  CG1 . VAL A 1 135 ? 19.319  4.070   4.226   1.00 26.69 ? 178  VAL A CG1 1 
ATOM   998   C  CG2 . VAL A 1 135 ? 18.774  2.344   5.893   1.00 26.35 ? 178  VAL A CG2 1 
ATOM   999   N  N   . ASP A 1 136 ? 16.415  3.745   2.377   1.00 27.50 ? 179  ASP A N   1 
ATOM   1000  C  CA  . ASP A 1 136 ? 16.120  4.450   1.138   1.00 27.17 ? 179  ASP A CA  1 
ATOM   1001  C  C   . ASP A 1 136 ? 14.751  5.104   1.143   1.00 25.27 ? 179  ASP A C   1 
ATOM   1002  O  O   . ASP A 1 136 ? 14.586  6.180   0.596   1.00 24.17 ? 179  ASP A O   1 
ATOM   1003  C  CB  . ASP A 1 136 ? 16.233  3.501   -0.054  1.00 29.34 ? 179  ASP A CB  1 
ATOM   1004  C  CG  . ASP A 1 136 ? 17.647  2.954   -0.237  1.00 32.27 ? 179  ASP A CG  1 
ATOM   1005  O  OD1 . ASP A 1 136 ? 17.957  2.523   -1.375  1.00 32.40 ? 179  ASP A OD1 1 
ATOM   1006  O  OD2 . ASP A 1 136 ? 18.437  2.952   0.749   1.00 30.63 ? 179  ASP A OD2 1 
ATOM   1007  N  N   . VAL A 1 137 ? 13.763  4.460   1.753   1.00 24.53 ? 180  VAL A N   1 
ATOM   1008  C  CA  . VAL A 1 137 ? 12.432  5.057   1.806   1.00 24.19 ? 180  VAL A CA  1 
ATOM   1009  C  C   . VAL A 1 137 ? 12.513  6.311   2.656   1.00 23.57 ? 180  VAL A C   1 
ATOM   1010  O  O   . VAL A 1 137 ? 11.784  7.274   2.422   1.00 23.18 ? 180  VAL A O   1 
ATOM   1011  C  CB  . VAL A 1 137 ? 11.364  4.104   2.427   1.00 24.26 ? 180  VAL A CB  1 
ATOM   1012  C  CG1 . VAL A 1 137 ? 9.988   4.784   2.424   1.00 21.76 ? 180  VAL A CG1 1 
ATOM   1013  C  CG2 . VAL A 1 137 ? 11.303  2.804   1.649   1.00 22.99 ? 180  VAL A CG2 1 
ATOM   1014  N  N   . LEU A 1 138 ? 13.407  6.294   3.641   1.00 22.96 ? 181  LEU A N   1 
ATOM   1015  C  CA  . LEU A 1 138 ? 13.586  7.446   4.528   1.00 23.84 ? 181  LEU A CA  1 
ATOM   1016  C  C   . LEU A 1 138 ? 14.273  8.630   3.856   1.00 24.65 ? 181  LEU A C   1 
ATOM   1017  O  O   . LEU A 1 138 ? 13.783  9.755   3.908   1.00 25.92 ? 181  LEU A O   1 
ATOM   1018  C  CB  . LEU A 1 138 ? 14.369  7.046   5.779   1.00 21.10 ? 181  LEU A CB  1 
ATOM   1019  C  CG  . LEU A 1 138 ? 13.535  6.309   6.826   1.00 19.75 ? 181  LEU A CG  1 
ATOM   1020  C  CD1 . LEU A 1 138 ? 14.392  5.931   8.020   1.00 17.00 ? 181  LEU A CD1 1 
ATOM   1021  C  CD2 . LEU A 1 138 ? 12.363  7.189   7.240   1.00 17.39 ? 181  LEU A CD2 1 
ATOM   1022  N  N   . ARG A 1 139 ? 15.405  8.375   3.218   1.00 26.05 ? 182  ARG A N   1 
ATOM   1023  C  CA  . ARG A 1 139 ? 16.137  9.430   2.550   1.00 27.51 ? 182  ARG A CA  1 
ATOM   1024  C  C   . ARG A 1 139 ? 15.310  10.040  1.427   1.00 27.44 ? 182  ARG A C   1 
ATOM   1025  O  O   . ARG A 1 139 ? 15.557  11.172  1.015   1.00 28.32 ? 182  ARG A O   1 
ATOM   1026  C  CB  . ARG A 1 139 ? 17.459  8.876   2.009   1.00 29.25 ? 182  ARG A CB  1 
ATOM   1027  C  CG  . ARG A 1 139 ? 18.320  8.193   3.080   1.00 31.39 ? 182  ARG A CG  1 
ATOM   1028  C  CD  . ARG A 1 139 ? 19.701  7.780   2.570   1.00 32.72 ? 182  ARG A CD  1 
ATOM   1029  N  NE  . ARG A 1 139 ? 20.738  8.759   2.896   1.00 34.32 ? 182  ARG A NE  1 
ATOM   1030  C  CZ  . ARG A 1 139 ? 21.828  8.487   3.614   1.00 35.08 ? 182  ARG A CZ  1 
ATOM   1031  N  NH1 . ARG A 1 139 ? 22.027  7.259   4.086   1.00 35.01 ? 182  ARG A NH1 1 
ATOM   1032  N  NH2 . ARG A 1 139 ? 22.727  9.437   3.853   1.00 33.89 ? 182  ARG A NH2 1 
ATOM   1033  N  N   . ALA A 1 140 ? 14.317  9.298   0.943   1.00 28.33 ? 183  ALA A N   1 
ATOM   1034  C  CA  . ALA A 1 140 ? 13.465  9.771   -0.149  1.00 29.12 ? 183  ALA A CA  1 
ATOM   1035  C  C   . ALA A 1 140 ? 12.228  10.457  0.380   1.00 30.24 ? 183  ALA A C   1 
ATOM   1036  O  O   . ALA A 1 140 ? 11.312  10.775  -0.377  1.00 32.01 ? 183  ALA A O   1 
ATOM   1037  C  CB  . ALA A 1 140 ? 13.064  8.616   -1.057  1.00 27.53 ? 183  ALA A CB  1 
ATOM   1038  N  N   . LEU A 1 141 ? 12.196  10.667  1.688   1.00 30.73 ? 184  LEU A N   1 
ATOM   1039  C  CA  . LEU A 1 141 ? 11.077  11.340  2.333   1.00 31.26 ? 184  LEU A CA  1 
ATOM   1040  C  C   . LEU A 1 141 ? 11.634  12.624  2.926   1.00 33.07 ? 184  LEU A C   1 
ATOM   1041  O  O   . LEU A 1 141 ? 10.892  13.467  3.450   1.00 32.88 ? 184  LEU A O   1 
ATOM   1042  C  CB  . LEU A 1 141 ? 10.489  10.463  3.440   1.00 29.48 ? 184  LEU A CB  1 
ATOM   1043  C  CG  . LEU A 1 141 ? 9.378   9.501   3.038   1.00 27.39 ? 184  LEU A CG  1 
ATOM   1044  C  CD1 . LEU A 1 141 ? 9.185   8.462   4.119   1.00 27.47 ? 184  LEU A CD1 1 
ATOM   1045  C  CD2 . LEU A 1 141 ? 8.097   10.280  2.803   1.00 26.22 ? 184  LEU A CD2 1 
ATOM   1046  N  N   . GLY A 1 142 ? 12.956  12.762  2.830   1.00 33.75 ? 185  GLY A N   1 
ATOM   1047  C  CA  . GLY A 1 142 ? 13.628  13.935  3.357   1.00 34.48 ? 185  GLY A CA  1 
ATOM   1048  C  C   . GLY A 1 142 ? 14.275  13.637  4.692   1.00 34.54 ? 185  GLY A C   1 
ATOM   1049  O  O   . GLY A 1 142 ? 15.088  14.412  5.193   1.00 35.83 ? 185  GLY A O   1 
ATOM   1050  N  N   . ALA A 1 143 ? 13.907  12.505  5.276   1.00 32.99 ? 186  ALA A N   1 
ATOM   1051  C  CA  . ALA A 1 143 ? 14.467  12.123  6.553   1.00 32.02 ? 186  ALA A CA  1 
ATOM   1052  C  C   . ALA A 1 143 ? 15.969  12.084  6.399   1.00 30.75 ? 186  ALA A C   1 
ATOM   1053  O  O   . ALA A 1 143 ? 16.482  11.907  5.295   1.00 30.14 ? 186  ALA A O   1 
ATOM   1054  C  CB  . ALA A 1 143 ? 13.949  10.765  6.970   1.00 34.40 ? 186  ALA A CB  1 
ATOM   1055  N  N   . GLU A 1 144 ? 16.664  12.262  7.513   1.00 30.05 ? 187  GLU A N   1 
ATOM   1056  C  CA  . GLU A 1 144 ? 18.110  12.253  7.534   1.00 30.63 ? 187  GLU A CA  1 
ATOM   1057  C  C   . GLU A 1 144 ? 18.500  11.139  8.485   1.00 30.51 ? 187  GLU A C   1 
ATOM   1058  O  O   . GLU A 1 144 ? 17.840  10.933  9.502   1.00 29.86 ? 187  GLU A O   1 
ATOM   1059  C  CB  . GLU A 1 144 ? 18.616  13.616  8.010   1.00 31.95 ? 187  GLU A CB  1 
ATOM   1060  C  CG  . GLU A 1 144 ? 18.130  14.772  7.126   1.00 34.54 ? 187  GLU A CG  1 
ATOM   1061  C  CD  . GLU A 1 144 ? 18.442  16.147  7.698   1.00 36.22 ? 187  GLU A CD  1 
ATOM   1062  O  OE1 . GLU A 1 144 ? 18.134  17.163  7.027   1.00 34.39 ? 187  GLU A OE1 1 
ATOM   1063  O  OE2 . GLU A 1 144 ? 18.991  16.204  8.823   1.00 37.78 ? 187  GLU A OE2 1 
ATOM   1064  N  N   . ILE A 1 145 ? 19.564  10.384  8.149   1.00 32.16 ? 188  ILE A N   1 
ATOM   1065  C  CA  . ILE A 1 145 ? 20.004  9.256   8.971   1.00 34.67 ? 188  ILE A CA  1 
ATOM   1066  C  C   . ILE A 1 145 ? 21.346  9.447   9.678   1.00 35.89 ? 188  ILE A C   1 
ATOM   1067  O  O   . ILE A 1 145 ? 22.323  9.911   9.090   1.00 36.47 ? 188  ILE A O   1 
ATOM   1068  C  CB  . ILE A 1 145 ? 20.058  7.959   8.127   1.00 34.48 ? 188  ILE A CB  1 
ATOM   1069  C  CG1 . ILE A 1 145 ? 18.657  7.591   7.631   1.00 34.70 ? 188  ILE A CG1 1 
ATOM   1070  C  CG2 . ILE A 1 145 ? 20.671  6.829   8.937   1.00 34.49 ? 188  ILE A CG2 1 
ATOM   1071  C  CD1 . ILE A 1 145 ? 18.174  8.450   6.481   1.00 34.17 ? 188  ILE A CD1 1 
ATOM   1072  N  N   . VAL A 1 146 ? 21.359  9.081   10.958  1.00 36.93 ? 189  VAL A N   1 
ATOM   1073  C  CA  . VAL A 1 146 ? 22.533  9.146   11.811  1.00 36.96 ? 189  VAL A CA  1 
ATOM   1074  C  C   . VAL A 1 146 ? 22.848  7.737   12.313  1.00 38.36 ? 189  VAL A C   1 
ATOM   1075  O  O   . VAL A 1 146 ? 22.500  7.324   13.408  1.00 38.06 ? 189  VAL A O   1 
ATOM   1076  C  CB  . VAL A 1 146 ? 22.349  10.164  12.946  1.00 37.23 ? 189  VAL A CB  1 
ATOM   1077  C  CG1 . VAL A 1 146 ? 23.600  10.262  13.806  1.00 36.29 ? 189  VAL A CG1 1 
ATOM   1078  C  CG2 . VAL A 1 146 ? 21.998  11.514  12.367  1.00 34.41 ? 189  VAL A CG2 1 
ATOM   1079  N  N   . ARG A 1 147 ? 23.512  7.054   11.426  1.00 40.32 ? 190  ARG A N   1 
ATOM   1080  C  CA  . ARG A 1 147 ? 23.972  5.688   11.539  1.00 43.10 ? 190  ARG A CA  1 
ATOM   1081  C  C   . ARG A 1 147 ? 24.611  5.377   12.861  1.00 43.83 ? 190  ARG A C   1 
ATOM   1082  O  O   . ARG A 1 147 ? 25.597  6.017   13.215  1.00 44.34 ? 190  ARG A O   1 
ATOM   1083  C  CB  . ARG A 1 147 ? 24.924  5.433   10.381  1.00 44.19 ? 190  ARG A CB  1 
ATOM   1084  C  CG  . ARG A 1 147 ? 24.383  6.130   9.145   1.00 47.40 ? 190  ARG A CG  1 
ATOM   1085  C  CD  . ARG A 1 147 ? 23.124  5.435   8.672   1.00 49.28 ? 190  ARG A CD  1 
ATOM   1086  N  NE  . ARG A 1 147 ? 23.513  4.152   8.118   1.00 50.12 ? 190  ARG A NE  1 
ATOM   1087  C  CZ  . ARG A 1 147 ? 23.910  3.985   6.860   1.00 50.61 ? 190  ARG A CZ  1 
ATOM   1088  N  NH1 . ARG A 1 147 ? 23.931  5.019   6.016   1.00 51.80 ? 190  ARG A NH1 1 
ATOM   1089  N  NH2 . ARG A 1 147 ? 24.293  2.783   6.447   1.00 50.74 ? 190  ARG A NH2 1 
ATOM   1090  N  N   . THR A 1 148 ? 24.107  4.426   13.620  1.00 44.56 ? 191  THR A N   1 
ATOM   1091  C  CA  . THR A 1 148 ? 24.756  4.336   14.921  1.00 44.48 ? 191  THR A CA  1 
ATOM   1092  C  C   . THR A 1 148 ? 26.168  3.770   14.901  1.00 45.70 ? 191  THR A C   1 
ATOM   1093  O  O   . THR A 1 148 ? 26.430  2.600   14.607  1.00 47.09 ? 191  THR A O   1 
ATOM   1094  C  CB  . THR A 1 148 ? 23.866  3.653   15.915  1.00 43.43 ? 191  THR A CB  1 
ATOM   1095  O  OG1 . THR A 1 148 ? 22.726  3.087   15.251  1.00 41.49 ? 191  THR A OG1 1 
ATOM   1096  C  CG2 . THR A 1 148 ? 23.394  4.658   16.966  1.00 43.39 ? 191  THR A CG2 1 
ATOM   1097  N  N   . PRO A 1 149 ? 27.054  4.705   15.255  1.00 47.70 ? 192  PRO A N   1 
ATOM   1098  C  CA  . PRO A 1 149 ? 28.441  4.348   15.357  1.00 48.87 ? 192  PRO A CA  1 
ATOM   1099  C  C   . PRO A 1 149 ? 28.441  3.185   16.242  1.00 48.85 ? 192  PRO A C   1 
ATOM   1100  O  O   . PRO A 1 149 ? 29.293  2.298   16.174  1.00 48.29 ? 192  PRO A O   1 
ATOM   1101  C  CB  . PRO A 1 149 ? 29.158  5.604   15.790  1.00 49.26 ? 192  PRO A CB  1 
ATOM   1102  C  CG  . PRO A 1 149 ? 28.378  6.624   15.003  1.00 48.72 ? 192  PRO A CG  1 
ATOM   1103  C  CD  . PRO A 1 149 ? 27.023  6.046   14.679  1.00 48.30 ? 192  PRO A CD  1 
ATOM   1104  N  N   . THR A 1 150 ? 27.420  3.167   17.090  1.00 49.01 ? 193  THR A N   1 
ATOM   1105  C  CA  . THR A 1 150 ? 27.325  2.043   17.959  1.00 48.27 ? 193  THR A CA  1 
ATOM   1106  C  C   . THR A 1 150 ? 28.683  1.768   18.483  1.00 47.82 ? 193  THR A C   1 
ATOM   1107  O  O   . THR A 1 150 ? 28.995  0.601   18.695  1.00 48.07 ? 193  THR A O   1 
ATOM   1108  C  CB  . THR A 1 150 ? 27.040  0.765   17.178  1.00 47.33 ? 193  THR A CB  1 
ATOM   1109  O  OG1 . THR A 1 150 ? 26.515  -0.240  18.045  1.00 45.57 ? 193  THR A OG1 1 
ATOM   1110  C  CG2 . THR A 1 150 ? 28.317  0.267   16.519  1.00 46.35 ? 193  THR A CG2 1 
ATOM   1111  N  N   . ASN A 1 151 ? 29.552  2.719   18.710  1.00 36.70 ? 194  ASN A N   1 
ATOM   1112  C  CA  . ASN A 1 151 ? 30.830  2.132   19.080  1.00 37.10 ? 194  ASN A CA  1 
ATOM   1113  C  C   . ASN A 1 151 ? 31.188  2.217   20.558  1.00 35.62 ? 194  ASN A C   1 
ATOM   1114  O  O   . ASN A 1 151 ? 31.035  3.266   21.192  1.00 35.30 ? 194  ASN A O   1 
ATOM   1115  C  CB  . ASN A 1 151 ? 31.934  2.695   18.178  1.00 38.87 ? 194  ASN A CB  1 
ATOM   1116  C  CG  . ASN A 1 151 ? 32.583  1.593   17.339  1.00 40.18 ? 194  ASN A CG  1 
ATOM   1117  O  OD1 . ASN A 1 151 ? 32.020  0.514   17.129  1.00 39.58 ? 194  ASN A OD1 1 
ATOM   1118  N  ND2 . ASN A 1 151 ? 33.775  1.876   16.856  1.00 41.10 ? 194  ASN A ND2 1 
ATOM   1119  N  N   . PRO A 1 157 ? 28.038  3.811   21.767  1.00 50.94 ? 200  PRO A N   1 
ATOM   1120  C  CA  . PRO A 1 157 ? 27.673  4.802   22.754  1.00 51.76 ? 200  PRO A CA  1 
ATOM   1121  C  C   . PRO A 1 157 ? 26.703  4.165   23.646  1.00 52.40 ? 200  PRO A C   1 
ATOM   1122  O  O   . PRO A 1 157 ? 25.879  4.808   24.289  1.00 52.57 ? 200  PRO A O   1 
ATOM   1123  C  CB  . PRO A 1 157 ? 27.278  5.947   21.876  1.00 51.71 ? 200  PRO A CB  1 
ATOM   1124  C  CG  . PRO A 1 157 ? 28.278  5.801   20.746  1.00 51.54 ? 200  PRO A CG  1 
ATOM   1125  C  CD  . PRO A 1 157 ? 28.777  4.377   20.670  1.00 50.85 ? 200  PRO A CD  1 
ATOM   1126  N  N   . GLU A 1 158 ? 26.784  2.871   23.684  1.00 52.50 ? 201  GLU A N   1 
ATOM   1127  C  CA  . GLU A 1 158 ? 25.732  2.249   24.420  1.00 50.94 ? 201  GLU A CA  1 
ATOM   1128  C  C   . GLU A 1 158 ? 24.406  2.408   23.663  1.00 49.19 ? 201  GLU A C   1 
ATOM   1129  O  O   . GLU A 1 158 ? 23.413  2.931   24.171  1.00 49.59 ? 201  GLU A O   1 
ATOM   1130  C  CB  . GLU A 1 158 ? 25.591  2.853   25.797  1.00 51.86 ? 201  GLU A CB  1 
ATOM   1131  C  CG  . GLU A 1 158 ? 24.154  3.075   26.186  1.00 52.52 ? 201  GLU A CG  1 
ATOM   1132  C  CD  . GLU A 1 158 ? 23.536  1.801   26.683  1.00 53.49 ? 201  GLU A CD  1 
ATOM   1133  O  OE1 . GLU A 1 158 ? 24.024  0.700   26.311  1.00 53.69 ? 201  GLU A OE1 1 
ATOM   1134  O  OE2 . GLU A 1 158 ? 22.551  1.873   27.455  1.00 52.71 ? 201  GLU A OE2 1 
ATOM   1135  N  N   . SER A 1 159 ? 24.445  1.941   22.412  1.00 46.89 ? 202  SER A N   1 
ATOM   1136  C  CA  . SER A 1 159 ? 23.320  2.072   21.494  1.00 44.26 ? 202  SER A CA  1 
ATOM   1137  C  C   . SER A 1 159 ? 23.308  3.522   21.071  1.00 43.07 ? 202  SER A C   1 
ATOM   1138  O  O   . SER A 1 159 ? 24.333  4.194   21.114  1.00 41.23 ? 202  SER A O   1 
ATOM   1139  C  CB  . SER A 1 159 ? 21.953  1.776   22.136  1.00 42.91 ? 202  SER A CB  1 
ATOM   1140  O  OG  . SER A 1 159 ? 20.940  2.625   21.622  1.00 39.55 ? 202  SER A OG  1 
ATOM   1141  N  N   . HIS A 1 160 ? 22.162  3.991   20.686  1.00 42.54 ? 203  HIS A N   1 
ATOM   1142  C  CA  . HIS A 1 160 ? 22.037  5.391   20.398  1.00 41.15 ? 203  HIS A CA  1 
ATOM   1143  C  C   . HIS A 1 160 ? 20.615  5.641   20.831  1.00 39.41 ? 203  HIS A C   1 
ATOM   1144  O  O   . HIS A 1 160 ? 19.611  5.184   20.261  1.00 38.11 ? 203  HIS A O   1 
ATOM   1145  C  CB  . HIS A 1 160 ? 22.213  5.831   18.956  1.00 42.39 ? 203  HIS A CB  1 
ATOM   1146  C  CG  . HIS A 1 160 ? 21.266  4.952   18.219  1.00 42.36 ? 203  HIS A CG  1 
ATOM   1147  N  ND1 . HIS A 1 160 ? 21.203  3.637   18.570  1.00 42.32 ? 203  HIS A ND1 1 
ATOM   1148  C  CD2 . HIS A 1 160 ? 20.384  5.138   17.209  1.00 42.89 ? 203  HIS A CD2 1 
ATOM   1149  C  CE1 . HIS A 1 160 ? 20.305  3.034   17.839  1.00 42.90 ? 203  HIS A CE1 1 
ATOM   1150  N  NE2 . HIS A 1 160 ? 19.774  3.911   17.009  1.00 43.33 ? 203  HIS A NE2 1 
ATOM   1151  N  N   . VAL A 1 161 ? 20.615  6.376   21.861  1.00 38.69 ? 204  VAL A N   1 
ATOM   1152  C  CA  . VAL A 1 161 ? 19.527  6.906   22.596  1.00 37.59 ? 204  VAL A CA  1 
ATOM   1153  C  C   . VAL A 1 161 ? 20.433  7.979   23.133  1.00 36.69 ? 204  VAL A C   1 
ATOM   1154  O  O   . VAL A 1 161 ? 21.514  7.569   23.538  1.00 35.58 ? 204  VAL A O   1 
ATOM   1155  C  CB  . VAL A 1 161 ? 19.105  6.024   23.806  1.00 36.98 ? 204  VAL A CB  1 
ATOM   1156  C  CG1 . VAL A 1 161 ? 17.966  6.692   24.558  1.00 37.09 ? 204  VAL A CG1 1 
ATOM   1157  C  CG2 . VAL A 1 161 ? 18.715  4.633   23.339  1.00 37.12 ? 204  VAL A CG2 1 
ATOM   1158  N  N   . GLY A 1 162 ? 20.226  9.233   23.233  1.00 35.77 ? 205  GLY A N   1 
ATOM   1159  C  CA  . GLY A 1 162 ? 21.520  9.750   23.626  1.00 34.53 ? 205  GLY A CA  1 
ATOM   1160  C  C   . GLY A 1 162 ? 22.219  10.145  22.312  1.00 34.17 ? 205  GLY A C   1 
ATOM   1161  O  O   . GLY A 1 162 ? 22.232  11.366  22.083  1.00 35.08 ? 205  GLY A O   1 
ATOM   1162  N  N   . VAL A 1 163 ? 22.819  9.339   21.414  1.00 32.96 ? 206  VAL A N   1 
ATOM   1163  C  CA  . VAL A 1 163 ? 23.234  10.038  20.198  1.00 31.63 ? 206  VAL A CA  1 
ATOM   1164  C  C   . VAL A 1 163 ? 22.067  10.970  19.912  1.00 32.53 ? 206  VAL A C   1 
ATOM   1165  O  O   . VAL A 1 163 ? 22.249  12.131  19.534  1.00 31.10 ? 206  VAL A O   1 
ATOM   1166  C  CB  . VAL A 1 163 ? 23.500  9.157   18.966  1.00 29.79 ? 206  VAL A CB  1 
ATOM   1167  C  CG1 . VAL A 1 163 ? 23.763  10.006  17.735  1.00 29.70 ? 206  VAL A CG1 1 
ATOM   1168  C  CG2 . VAL A 1 163 ? 24.671  8.206   19.220  1.00 28.39 ? 206  VAL A CG2 1 
ATOM   1169  N  N   . ALA A 1 164 ? 20.871  10.428  20.101  1.00 34.87 ? 207  ALA A N   1 
ATOM   1170  C  CA  . ALA A 1 164 ? 19.651  11.181  19.873  1.00 36.87 ? 207  ALA A CA  1 
ATOM   1171  C  C   . ALA A 1 164 ? 19.401  12.159  21.023  1.00 38.31 ? 207  ALA A C   1 
ATOM   1172  O  O   . ALA A 1 164 ? 19.194  13.354  20.802  1.00 38.86 ? 207  ALA A O   1 
ATOM   1173  C  CB  . ALA A 1 164 ? 18.478  10.222  19.725  1.00 36.82 ? 207  ALA A CB  1 
ATOM   1174  N  N   . TRP A 1 165 ? 19.436  11.646  22.249  1.00 39.42 ? 208  TRP A N   1 
ATOM   1175  C  CA  . TRP A 1 165 ? 19.199  12.461  23.441  1.00 40.98 ? 208  TRP A CA  1 
ATOM   1176  C  C   . TRP A 1 165 ? 20.325  13.444  23.760  1.00 40.27 ? 208  TRP A C   1 
ATOM   1177  O  O   . TRP A 1 165 ? 20.188  14.289  24.637  1.00 41.35 ? 208  TRP A O   1 
ATOM   1178  C  CB  . TRP A 1 165 ? 18.951  11.541  24.642  1.00 42.97 ? 208  TRP A CB  1 
ATOM   1179  C  CG  . TRP A 1 165 ? 17.548  11.588  25.151  1.00 44.90 ? 208  TRP A CG  1 
ATOM   1180  C  CD1 . TRP A 1 165 ? 16.436  11.998  24.466  1.00 45.67 ? 208  TRP A CD1 1 
ATOM   1181  C  CD2 . TRP A 1 165 ? 17.098  11.207  26.454  1.00 45.78 ? 208  TRP A CD2 1 
ATOM   1182  N  NE1 . TRP A 1 165 ? 15.322  11.898  25.264  1.00 45.95 ? 208  TRP A NE1 1 
ATOM   1183  C  CE2 . TRP A 1 165 ? 15.698  11.414  26.490  1.00 46.87 ? 208  TRP A CE2 1 
ATOM   1184  C  CE3 . TRP A 1 165 ? 17.741  10.710  27.600  1.00 45.51 ? 208  TRP A CE3 1 
ATOM   1185  C  CZ2 . TRP A 1 165 ? 14.928  11.141  27.629  1.00 46.84 ? 208  TRP A CZ2 1 
ATOM   1186  C  CZ3 . TRP A 1 165 ? 16.975  10.436  28.736  1.00 46.49 ? 208  TRP A CZ3 1 
ATOM   1187  C  CH2 . TRP A 1 165 ? 15.583  10.654  28.738  1.00 46.18 ? 208  TRP A CH2 1 
ATOM   1188  N  N   . ARG A 1 166 ? 21.432  13.323  23.036  1.00 39.35 ? 209  ARG A N   1 
ATOM   1189  C  CA  . ARG A 1 166 ? 22.600  14.174  23.213  1.00 37.33 ? 209  ARG A CA  1 
ATOM   1190  C  C   . ARG A 1 166 ? 22.788  14.971  21.929  1.00 36.50 ? 209  ARG A C   1 
ATOM   1191  O  O   . ARG A 1 166 ? 23.881  15.431  21.609  1.00 36.28 ? 209  ARG A O   1 
ATOM   1192  C  CB  . ARG A 1 166 ? 23.820  13.297  23.486  1.00 37.96 ? 209  ARG A CB  1 
ATOM   1193  C  CG  . ARG A 1 166 ? 25.134  14.033  23.635  1.00 39.25 ? 209  ARG A CG  1 
ATOM   1194  C  CD  . ARG A 1 166 ? 26.152  13.437  22.680  1.00 41.34 ? 209  ARG A CD  1 
ATOM   1195  N  NE  . ARG A 1 166 ? 25.711  13.578  21.291  1.00 41.53 ? 209  ARG A NE  1 
ATOM   1196  C  CZ  . ARG A 1 166 ? 26.053  12.756  20.301  1.00 40.14 ? 209  ARG A CZ  1 
ATOM   1197  N  NH1 . ARG A 1 166 ? 26.843  11.716  20.533  1.00 39.39 ? 209  ARG A NH1 1 
ATOM   1198  N  NH2 . ARG A 1 166 ? 25.609  12.982  19.074  1.00 39.71 ? 209  ARG A NH2 1 
ATOM   1199  N  N   . LEU A 1 167 ? 21.699  15.111  21.187  1.00 35.41 ? 210  LEU A N   1 
ATOM   1200  C  CA  . LEU A 1 167 ? 21.693  15.851  19.937  1.00 34.32 ? 210  LEU A CA  1 
ATOM   1201  C  C   . LEU A 1 167 ? 20.404  16.641  19.987  1.00 34.05 ? 210  LEU A C   1 
ATOM   1202  O  O   . LEU A 1 167 ? 20.213  17.611  19.263  1.00 34.16 ? 210  LEU A O   1 
ATOM   1203  C  CB  . LEU A 1 167 ? 21.675  14.895  18.738  1.00 34.02 ? 210  LEU A CB  1 
ATOM   1204  C  CG  . LEU A 1 167 ? 22.814  14.981  17.709  1.00 34.00 ? 210  LEU A CG  1 
ATOM   1205  C  CD1 . LEU A 1 167 ? 22.530  14.028  16.567  1.00 33.24 ? 210  LEU A CD1 1 
ATOM   1206  C  CD2 . LEU A 1 167 ? 22.956  16.396  17.181  1.00 32.85 ? 210  LEU A CD2 1 
ATOM   1207  N  N   . LYS A 1 168 ? 19.513  16.203  20.863  1.00 34.32 ? 211  LYS A N   1 
ATOM   1208  C  CA  . LYS A 1 168 ? 18.238  16.869  21.035  1.00 35.06 ? 211  LYS A CA  1 
ATOM   1209  C  C   . LYS A 1 168 ? 18.585  18.307  21.379  1.00 36.10 ? 211  LYS A C   1 
ATOM   1210  O  O   . LYS A 1 168 ? 18.296  19.230  20.619  1.00 36.98 ? 211  LYS A O   1 
ATOM   1211  C  CB  . LYS A 1 168 ? 17.460  16.223  22.182  1.00 34.01 ? 211  LYS A CB  1 
ATOM   1212  C  CG  . LYS A 1 168 ? 15.962  16.466  22.158  1.00 33.85 ? 211  LYS A CG  1 
ATOM   1213  C  CD  . LYS A 1 168 ? 15.612  17.936  22.228  1.00 34.70 ? 211  LYS A CD  1 
ATOM   1214  C  CE  . LYS A 1 168 ? 16.106  18.557  23.518  1.00 36.24 ? 211  LYS A CE  1 
ATOM   1215  N  NZ  . LYS A 1 168 ? 15.556  17.867  24.721  1.00 37.06 ? 211  LYS A NZ  1 
ATOM   1216  N  N   . ASN A 1 169 ? 19.237  18.481  22.523  1.00 36.70 ? 212  ASN A N   1 
ATOM   1217  C  CA  . ASN A 1 169 ? 19.651  19.798  22.993  1.00 37.10 ? 212  ASN A CA  1 
ATOM   1218  C  C   . ASN A 1 169 ? 20.621  20.479  22.040  1.00 35.62 ? 212  ASN A C   1 
ATOM   1219  O  O   . ASN A 1 169 ? 20.457  21.650  21.708  1.00 35.30 ? 212  ASN A O   1 
ATOM   1220  C  CB  . ASN A 1 169 ? 20.300  19.675  24.370  1.00 38.87 ? 212  ASN A CB  1 
ATOM   1221  C  CG  . ASN A 1 169 ? 21.012  18.357  24.554  1.00 40.18 ? 212  ASN A CG  1 
ATOM   1222  O  OD1 . ASN A 1 169 ? 20.391  17.349  24.897  1.00 39.58 ? 212  ASN A OD1 1 
ATOM   1223  N  ND2 . ASN A 1 169 ? 22.323  18.349  24.311  1.00 41.10 ? 212  ASN A ND2 1 
ATOM   1224  N  N   . GLU A 1 170 ? 21.640  19.749  21.613  1.00 34.85 ? 213  GLU A N   1 
ATOM   1225  C  CA  . GLU A 1 170 ? 22.613  20.311  20.697  1.00 36.03 ? 213  GLU A CA  1 
ATOM   1226  C  C   . GLU A 1 170 ? 21.942  20.913  19.475  1.00 35.02 ? 213  GLU A C   1 
ATOM   1227  O  O   . GLU A 1 170 ? 22.532  21.751  18.784  1.00 32.78 ? 213  GLU A O   1 
ATOM   1228  C  CB  . GLU A 1 170 ? 23.602  19.244  20.241  1.00 38.15 ? 213  GLU A CB  1 
ATOM   1229  C  CG  . GLU A 1 170 ? 24.691  18.950  21.244  1.00 41.89 ? 213  GLU A CG  1 
ATOM   1230  C  CD  . GLU A 1 170 ? 25.793  18.093  20.651  1.00 44.78 ? 213  GLU A CD  1 
ATOM   1231  O  OE1 . GLU A 1 170 ? 25.482  16.960  20.213  1.00 44.83 ? 213  GLU A OE1 1 
ATOM   1232  O  OE2 . GLU A 1 170 ? 26.963  18.554  20.622  1.00 44.59 ? 213  GLU A OE2 1 
ATOM   1233  N  N   . ILE A 1 171 ? 20.708  20.487  19.209  1.00 35.13 ? 214  ILE A N   1 
ATOM   1234  C  CA  . ILE A 1 171 ? 19.981  20.979  18.044  1.00 34.74 ? 214  ILE A CA  1 
ATOM   1235  C  C   . ILE A 1 171 ? 18.775  21.839  18.393  1.00 32.78 ? 214  ILE A C   1 
ATOM   1236  O  O   . ILE A 1 171 ? 17.769  21.346  18.889  1.00 31.63 ? 214  ILE A O   1 
ATOM   1237  C  CB  . ILE A 1 171 ? 19.531  19.803  17.139  1.00 34.84 ? 214  ILE A CB  1 
ATOM   1238  C  CG1 . ILE A 1 171 ? 20.749  18.972  16.715  1.00 35.20 ? 214  ILE A CG1 1 
ATOM   1239  C  CG2 . ILE A 1 171 ? 18.831  20.334  15.896  1.00 34.65 ? 214  ILE A CG2 1 
ATOM   1240  C  CD1 . ILE A 1 171 ? 20.405  17.744  15.895  1.00 35.57 ? 214  ILE A CD1 1 
ATOM   1241  N  N   . PRO A 1 172 ? 18.879  23.159  18.158  1.00 33.08 ? 215  PRO A N   1 
ATOM   1242  C  CA  . PRO A 1 172 ? 17.775  24.073  18.452  1.00 33.33 ? 215  PRO A CA  1 
ATOM   1243  C  C   . PRO A 1 172 ? 16.503  23.606  17.771  1.00 31.42 ? 215  PRO A C   1 
ATOM   1244  O  O   . PRO A 1 172 ? 16.515  23.295  16.581  1.00 30.28 ? 215  PRO A O   1 
ATOM   1245  C  CB  . PRO A 1 172 ? 18.278  25.397  17.895  1.00 31.94 ? 215  PRO A CB  1 
ATOM   1246  C  CG  . PRO A 1 172 ? 19.730  25.341  18.223  1.00 32.86 ? 215  PRO A CG  1 
ATOM   1247  C  CD  . PRO A 1 172 ? 20.097  23.918  17.809  1.00 34.04 ? 215  PRO A CD  1 
ATOM   1248  N  N   . ASN A 1 173 ? 15.420  23.558  18.542  1.00 30.70 ? 216  ASN A N   1 
ATOM   1249  C  CA  . ASN A 1 173 ? 14.105  23.138  18.068  1.00 31.30 ? 216  ASN A CA  1 
ATOM   1250  C  C   . ASN A 1 173 ? 13.902  21.634  17.871  1.00 30.93 ? 216  ASN A C   1 
ATOM   1251  O  O   . ASN A 1 173 ? 12.979  21.209  17.175  1.00 31.78 ? 216  ASN A O   1 
ATOM   1252  C  CB  . ASN A 1 173 ? 13.742  23.881  16.789  1.00 31.22 ? 216  ASN A CB  1 
ATOM   1253  C  CG  . ASN A 1 173 ? 12.887  25.094  17.060  1.00 32.27 ? 216  ASN A CG  1 
ATOM   1254  O  OD1 . ASN A 1 173 ? 11.789  24.976  17.597  1.00 33.81 ? 216  ASN A OD1 1 
ATOM   1255  N  ND2 . ASN A 1 173 ? 13.381  26.268  16.691  1.00 31.93 ? 216  ASN A ND2 1 
ATOM   1256  N  N   . SER A 1 174 ? 14.755  20.838  18.508  1.00 29.66 ? 217  SER A N   1 
ATOM   1257  C  CA  . SER A 1 174 ? 14.661  19.391  18.433  1.00 28.76 ? 217  SER A CA  1 
ATOM   1258  C  C   . SER A 1 174 ? 13.569  18.889  19.364  1.00 27.99 ? 217  SER A C   1 
ATOM   1259  O  O   . SER A 1 174 ? 13.064  19.627  20.210  1.00 26.29 ? 217  SER A O   1 
ATOM   1260  C  CB  . SER A 1 174 ? 15.973  18.746  18.860  1.00 30.18 ? 217  SER A CB  1 
ATOM   1261  O  OG  . SER A 1 174 ? 17.072  19.285  18.155  1.00 33.41 ? 217  SER A OG  1 
ATOM   1262  N  N   . HIS A 1 175 ? 13.227  17.615  19.194  1.00 27.70 ? 218  HIS A N   1 
ATOM   1263  C  CA  . HIS A 1 175 ? 12.212  16.938  19.995  1.00 26.77 ? 218  HIS A CA  1 
ATOM   1264  C  C   . HIS A 1 175 ? 12.373  15.436  19.819  1.00 26.97 ? 218  HIS A C   1 
ATOM   1265  O  O   . HIS A 1 175 ? 12.981  14.971  18.859  1.00 27.49 ? 218  HIS A O   1 
ATOM   1266  C  CB  . HIS A 1 175 ? 10.815  17.325  19.538  1.00 26.42 ? 218  HIS A CB  1 
ATOM   1267  C  CG  . HIS A 1 175 ? 10.533  18.788  19.618  1.00 26.26 ? 218  HIS A CG  1 
ATOM   1268  N  ND1 . HIS A 1 175 ? 10.383  19.451  20.815  1.00 26.09 ? 218  HIS A ND1 1 
ATOM   1269  C  CD2 . HIS A 1 175 ? 10.359  19.715  18.648  1.00 27.18 ? 218  HIS A CD2 1 
ATOM   1270  C  CE1 . HIS A 1 175 ? 10.122  20.723  20.579  1.00 26.87 ? 218  HIS A CE1 1 
ATOM   1271  N  NE2 . HIS A 1 175 ? 10.101  20.909  19.271  1.00 26.90 ? 218  HIS A NE2 1 
ATOM   1272  N  N   . ILE A 1 176 ? 11.827  14.665  20.742  1.00 27.06 ? 219  ILE A N   1 
ATOM   1273  C  CA  . ILE A 1 176 ? 11.931  13.222  20.622  1.00 27.07 ? 219  ILE A CA  1 
ATOM   1274  C  C   . ILE A 1 176 ? 10.668  12.524  21.115  1.00 27.21 ? 219  ILE A C   1 
ATOM   1275  O  O   . ILE A 1 176 ? 10.616  11.975  22.223  1.00 25.99 ? 219  ILE A O   1 
ATOM   1276  C  CB  . ILE A 1 176 ? 13.171  12.668  21.374  1.00 27.16 ? 219  ILE A CB  1 
ATOM   1277  C  CG1 . ILE A 1 176 ? 14.464  13.189  20.711  1.00 27.00 ? 219  ILE A CG1 1 
ATOM   1278  C  CG2 . ILE A 1 176 ? 13.132  11.139  21.377  1.00 26.59 ? 219  ILE A CG2 1 
ATOM   1279  C  CD1 . ILE A 1 176 ? 15.790  12.714  21.370  1.00 24.97 ? 219  ILE A CD1 1 
ATOM   1280  N  N   . LEU A 1 177 ? 9.640   12.586  20.274  1.00 27.79 ? 220  LEU A N   1 
ATOM   1281  C  CA  . LEU A 1 177 ? 8.372   11.934  20.552  1.00 27.93 ? 220  LEU A CA  1 
ATOM   1282  C  C   . LEU A 1 177 ? 8.828   10.495  20.784  1.00 28.68 ? 220  LEU A C   1 
ATOM   1283  O  O   . LEU A 1 177 ? 9.323   9.839   19.866  1.00 28.25 ? 220  LEU A O   1 
ATOM   1284  C  CB  . LEU A 1 177 ? 7.478   12.038  19.313  1.00 25.68 ? 220  LEU A CB  1 
ATOM   1285  C  CG  . LEU A 1 177 ? 7.302   13.466  18.782  1.00 24.10 ? 220  LEU A CG  1 
ATOM   1286  C  CD1 . LEU A 1 177 ? 7.189   13.470  17.269  1.00 23.17 ? 220  LEU A CD1 1 
ATOM   1287  C  CD2 . LEU A 1 177 ? 6.089   14.097  19.431  1.00 22.47 ? 220  LEU A CD2 1 
ATOM   1288  N  N   . ASP A 1 178 ? 8.688   10.018  22.014  1.00 29.72 ? 221  ASP A N   1 
ATOM   1289  C  CA  . ASP A 1 178 ? 9.140   8.677   22.369  1.00 31.60 ? 221  ASP A CA  1 
ATOM   1290  C  C   . ASP A 1 178 ? 8.055   7.606   22.262  1.00 33.97 ? 221  ASP A C   1 
ATOM   1291  O  O   . ASP A 1 178 ? 7.133   7.567   23.076  1.00 35.68 ? 221  ASP A O   1 
ATOM   1292  C  CB  . ASP A 1 178 ? 9.697   8.706   23.792  1.00 30.10 ? 221  ASP A CB  1 
ATOM   1293  C  CG  . ASP A 1 178 ? 10.620  7.557   24.080  1.00 30.38 ? 221  ASP A CG  1 
ATOM   1294  O  OD1 . ASP A 1 178 ? 11.329  7.618   25.107  1.00 31.12 ? 221  ASP A OD1 1 
ATOM   1295  O  OD2 . ASP A 1 178 ? 10.639  6.597   23.285  1.00 30.03 ? 221  ASP A OD2 1 
ATOM   1296  N  N   . GLN A 1 179 ? 8.175   6.730   21.265  1.00 35.15 ? 222  GLN A N   1 
ATOM   1297  C  CA  . GLN A 1 179 ? 7.202   5.662   21.072  1.00 34.29 ? 222  GLN A CA  1 
ATOM   1298  C  C   . GLN A 1 179 ? 7.173   4.752   22.293  1.00 33.60 ? 222  GLN A C   1 
ATOM   1299  O  O   . GLN A 1 179 ? 6.151   4.127   22.609  1.00 32.84 ? 222  GLN A O   1 
ATOM   1300  C  CB  . GLN A 1 179 ? 7.540   4.844   19.821  1.00 33.89 ? 222  GLN A CB  1 
ATOM   1301  C  CG  . GLN A 1 179 ? 8.962   4.334   19.752  1.00 33.05 ? 222  GLN A CG  1 
ATOM   1302  C  CD  . GLN A 1 179 ? 9.144   3.277   18.678  1.00 32.65 ? 222  GLN A CD  1 
ATOM   1303  O  OE1 . GLN A 1 179 ? 8.726   2.137   18.839  1.00 31.84 ? 222  GLN A OE1 1 
ATOM   1304  N  NE2 . GLN A 1 179 ? 9.760   3.656   17.573  1.00 32.69 ? 222  GLN A NE2 1 
ATOM   1305  N  N   . TYR A 1 180 ? 8.301   4.700   22.988  1.00 32.93 ? 223  TYR A N   1 
ATOM   1306  C  CA  . TYR A 1 180 ? 8.425   3.868   24.168  1.00 32.22 ? 223  TYR A CA  1 
ATOM   1307  C  C   . TYR A 1 180 ? 7.879   4.534   25.441  1.00 31.95 ? 223  TYR A C   1 
ATOM   1308  O  O   . TYR A 1 180 ? 7.682   3.862   26.461  1.00 32.97 ? 223  TYR A O   1 
ATOM   1309  C  CB  . TYR A 1 180 ? 9.889   3.481   24.339  1.00 31.76 ? 223  TYR A CB  1 
ATOM   1310  C  CG  . TYR A 1 180 ? 10.438  2.682   23.176  1.00 32.02 ? 223  TYR A CG  1 
ATOM   1311  C  CD1 . TYR A 1 180 ? 10.201  1.314   23.068  1.00 32.85 ? 223  TYR A CD1 1 
ATOM   1312  C  CD2 . TYR A 1 180 ? 11.205  3.291   22.185  1.00 33.04 ? 223  TYR A CD2 1 
ATOM   1313  C  CE1 . TYR A 1 180 ? 10.719  0.574   22.001  1.00 32.95 ? 223  TYR A CE1 1 
ATOM   1314  C  CE2 . TYR A 1 180 ? 11.727  2.557   21.115  1.00 32.76 ? 223  TYR A CE2 1 
ATOM   1315  C  CZ  . TYR A 1 180 ? 11.482  1.202   21.032  1.00 32.23 ? 223  TYR A CZ  1 
ATOM   1316  O  OH  . TYR A 1 180 ? 12.015  0.470   19.995  1.00 32.92 ? 223  TYR A OH  1 
ATOM   1317  N  N   . ARG A 1 181 ? 7.623   5.844   25.375  1.00 30.82 ? 224  ARG A N   1 
ATOM   1318  C  CA  . ARG A 1 181 ? 7.091   6.594   26.517  1.00 30.02 ? 224  ARG A CA  1 
ATOM   1319  C  C   . ARG A 1 181 ? 5.777   7.310   26.216  1.00 28.74 ? 224  ARG A C   1 
ATOM   1320  O  O   . ARG A 1 181 ? 4.842   7.265   27.006  1.00 28.42 ? 224  ARG A O   1 
ATOM   1321  C  CB  . ARG A 1 181 ? 8.123   7.607   27.010  1.00 32.31 ? 224  ARG A CB  1 
ATOM   1322  C  CG  . ARG A 1 181 ? 9.111   7.052   28.043  1.00 33.64 ? 224  ARG A CG  1 
ATOM   1323  C  CD  . ARG A 1 181 ? 10.059  8.136   28.570  1.00 36.01 ? 224  ARG A CD  1 
ATOM   1324  N  NE  . ARG A 1 181 ? 9.345   9.345   28.991  1.00 37.05 ? 224  ARG A NE  1 
ATOM   1325  C  CZ  . ARG A 1 181 ? 8.978   10.325  28.166  1.00 36.98 ? 224  ARG A CZ  1 
ATOM   1326  N  NH1 . ARG A 1 181 ? 9.264   10.252  26.871  1.00 36.92 ? 224  ARG A NH1 1 
ATOM   1327  N  NH2 . ARG A 1 181 ? 8.300   11.367  28.627  1.00 36.96 ? 224  ARG A NH2 1 
ATOM   1328  N  N   . ASN A 1 182 ? 5.720   7.964   25.064  1.00 27.88 ? 225  ASN A N   1 
ATOM   1329  C  CA  . ASN A 1 182 ? 4.542   8.697   24.608  1.00 28.22 ? 225  ASN A CA  1 
ATOM   1330  C  C   . ASN A 1 182 ? 3.177   7.989   24.731  1.00 29.59 ? 225  ASN A C   1 
ATOM   1331  O  O   . ASN A 1 182 ? 2.967   6.902   24.191  1.00 30.43 ? 225  ASN A O   1 
ATOM   1332  C  CB  . ASN A 1 182 ? 4.749   9.111   23.149  1.00 26.85 ? 225  ASN A CB  1 
ATOM   1333  C  CG  . ASN A 1 182 ? 5.018   10.594  22.985  1.00 24.62 ? 225  ASN A CG  1 
ATOM   1334  O  OD1 . ASN A 1 182 ? 4.091   11.401  22.928  1.00 20.90 ? 225  ASN A OD1 1 
ATOM   1335  N  ND2 . ASN A 1 182 ? 6.294   10.959  22.904  1.00 24.15 ? 225  ASN A ND2 1 
ATOM   1336  N  N   . ALA A 1 183 ? 2.250   8.641   25.428  1.00 30.44 ? 226  ALA A N   1 
ATOM   1337  C  CA  . ALA A 1 183 ? 0.894   8.137   25.622  1.00 30.91 ? 226  ALA A CA  1 
ATOM   1338  C  C   . ALA A 1 183 ? 0.131   8.176   24.315  1.00 32.08 ? 226  ALA A C   1 
ATOM   1339  O  O   . ALA A 1 183 ? -0.832  7.426   24.115  1.00 31.84 ? 226  ALA A O   1 
ATOM   1340  C  CB  . ALA A 1 183 ? 0.169   8.990   26.633  1.00 30.03 ? 226  ALA A CB  1 
ATOM   1341  N  N   . SER A 1 184 ? 0.562   9.074   23.435  1.00 32.45 ? 227  SER A N   1 
ATOM   1342  C  CA  . SER A 1 184 ? -0.079  9.256   22.146  1.00 31.75 ? 227  SER A CA  1 
ATOM   1343  C  C   . SER A 1 184 ? -0.174  7.951   21.365  1.00 30.21 ? 227  SER A C   1 
ATOM   1344  O  O   . SER A 1 184 ? -1.103  7.771   20.587  1.00 30.55 ? 227  SER A O   1 
ATOM   1345  C  CB  . SER A 1 184 ? 0.683   10.309  21.329  1.00 33.27 ? 227  SER A CB  1 
ATOM   1346  O  OG  . SER A 1 184 ? 0.667   11.579  21.965  1.00 31.74 ? 227  SER A OG  1 
ATOM   1347  N  N   . ASN A 1 185 ? 0.788   7.051   21.579  1.00 29.70 ? 228  ASN A N   1 
ATOM   1348  C  CA  . ASN A 1 185 ? 0.836   5.747   20.899  1.00 28.54 ? 228  ASN A CA  1 
ATOM   1349  C  C   . ASN A 1 185 ? -0.320  4.870   21.361  1.00 28.41 ? 228  ASN A C   1 
ATOM   1350  O  O   . ASN A 1 185 ? -1.248  4.589   20.602  1.00 27.80 ? 228  ASN A O   1 
ATOM   1351  C  CB  . ASN A 1 185 ? 2.163   5.046   21.202  1.00 28.86 ? 228  ASN A CB  1 
ATOM   1352  C  CG  . ASN A 1 185 ? 2.281   3.713   20.523  1.00 27.87 ? 228  ASN A CG  1 
ATOM   1353  O  OD1 . ASN A 1 185 ? 1.291   3.024   20.309  1.00 26.73 ? 228  ASN A OD1 1 
ATOM   1354  N  ND2 . ASN A 1 185 ? 3.504   3.329   20.193  1.00 29.04 ? 228  ASN A ND2 1 
ATOM   1355  N  N   . PRO A 1 186 ? -0.277  4.415   22.619  1.00 28.52 ? 229  PRO A N   1 
ATOM   1356  C  CA  . PRO A 1 186 ? -1.391  3.582   23.064  1.00 28.12 ? 229  PRO A CA  1 
ATOM   1357  C  C   . PRO A 1 186 ? -2.704  4.306   22.865  1.00 26.75 ? 229  PRO A C   1 
ATOM   1358  O  O   . PRO A 1 186 ? -3.711  3.692   22.537  1.00 27.86 ? 229  PRO A O   1 
ATOM   1359  C  CB  . PRO A 1 186 ? -1.071  3.329   24.536  1.00 29.70 ? 229  PRO A CB  1 
ATOM   1360  C  CG  . PRO A 1 186 ? -0.233  4.531   24.921  1.00 31.16 ? 229  PRO A CG  1 
ATOM   1361  C  CD  . PRO A 1 186 ? 0.667   4.657   23.724  1.00 29.12 ? 229  PRO A CD  1 
ATOM   1362  N  N   . LEU A 1 187 ? -2.698  5.613   23.071  1.00 25.51 ? 230  LEU A N   1 
ATOM   1363  C  CA  . LEU A 1 187 ? -3.910  6.395   22.883  1.00 25.59 ? 230  LEU A CA  1 
ATOM   1364  C  C   . LEU A 1 187 ? -4.510  6.164   21.505  1.00 24.81 ? 230  LEU A C   1 
ATOM   1365  O  O   . LEU A 1 187 ? -5.686  5.846   21.378  1.00 26.55 ? 230  LEU A O   1 
ATOM   1366  C  CB  . LEU A 1 187 ? -3.620  7.881   23.028  1.00 26.46 ? 230  LEU A CB  1 
ATOM   1367  C  CG  . LEU A 1 187 ? -3.405  8.442   24.419  1.00 26.88 ? 230  LEU A CG  1 
ATOM   1368  C  CD1 . LEU A 1 187 ? -3.096  9.914   24.278  1.00 27.60 ? 230  LEU A CD1 1 
ATOM   1369  C  CD2 . LEU A 1 187 ? -4.637  8.212   25.280  1.00 25.92 ? 230  LEU A CD2 1 
ATOM   1370  N  N   . ALA A 1 188 ? -3.688  6.337   20.477  1.00 22.75 ? 231  ALA A N   1 
ATOM   1371  C  CA  . ALA A 1 188 ? -4.109  6.177   19.092  1.00 21.63 ? 231  ALA A CA  1 
ATOM   1372  C  C   . ALA A 1 188 ? -4.927  4.895   18.832  1.00 21.52 ? 231  ALA A C   1 
ATOM   1373  O  O   . ALA A 1 188 ? -6.080  4.932   18.380  1.00 19.73 ? 231  ALA A O   1 
ATOM   1374  C  CB  . ALA A 1 188 ? -2.886  6.206   18.205  1.00 19.99 ? 231  ALA A CB  1 
ATOM   1375  N  N   . HIS A 1 189 ? -4.316  3.759   19.114  1.00 20.83 ? 232  HIS A N   1 
ATOM   1376  C  CA  . HIS A 1 189 ? -4.987  2.503   18.913  1.00 21.11 ? 232  HIS A CA  1 
ATOM   1377  C  C   . HIS A 1 189 ? -6.165  2.399   19.848  1.00 22.20 ? 232  HIS A C   1 
ATOM   1378  O  O   . HIS A 1 189 ? -7.097  1.628   19.611  1.00 24.44 ? 232  HIS A O   1 
ATOM   1379  C  CB  . HIS A 1 189 ? -3.997  1.382   19.129  1.00 21.12 ? 232  HIS A CB  1 
ATOM   1380  C  CG  . HIS A 1 189 ? -2.820  1.488   18.225  1.00 21.71 ? 232  HIS A CG  1 
ATOM   1381  N  ND1 . HIS A 1 189 ? -2.956  1.595   16.858  1.00 20.49 ? 232  HIS A ND1 1 
ATOM   1382  C  CD2 . HIS A 1 189 ? -1.497  1.582   18.485  1.00 21.46 ? 232  HIS A CD2 1 
ATOM   1383  C  CE1 . HIS A 1 189 ? -1.763  1.751   16.314  1.00 21.67 ? 232  HIS A CE1 1 
ATOM   1384  N  NE2 . HIS A 1 189 ? -0.860  1.746   17.279  1.00 21.30 ? 232  HIS A NE2 1 
ATOM   1385  N  N   . TYR A 1 190 ? -6.133  3.199   20.905  1.00 21.51 ? 233  TYR A N   1 
ATOM   1386  C  CA  . TYR A 1 190 ? -7.208  3.193   21.876  1.00 20.24 ? 233  TYR A CA  1 
ATOM   1387  C  C   . TYR A 1 190 ? -8.365  4.024   21.380  1.00 19.93 ? 233  TYR A C   1 
ATOM   1388  O  O   . TYR A 1 190 ? -9.514  3.618   21.480  1.00 19.66 ? 233  TYR A O   1 
ATOM   1389  C  CB  . TYR A 1 190 ? -6.733  3.775   23.191  1.00 18.88 ? 233  TYR A CB  1 
ATOM   1390  C  CG  . TYR A 1 190 ? -7.844  3.953   24.193  1.00 18.03 ? 233  TYR A CG  1 
ATOM   1391  C  CD1 . TYR A 1 190 ? -8.354  2.863   24.885  1.00 16.09 ? 233  TYR A CD1 1 
ATOM   1392  C  CD2 . TYR A 1 190 ? -8.381  5.212   24.451  1.00 17.49 ? 233  TYR A CD2 1 
ATOM   1393  C  CE1 . TYR A 1 190 ? -9.361  3.016   25.817  1.00 17.49 ? 233  TYR A CE1 1 
ATOM   1394  C  CE2 . TYR A 1 190 ? -9.395  5.377   25.375  1.00 15.95 ? 233  TYR A CE2 1 
ATOM   1395  C  CZ  . TYR A 1 190 ? -9.880  4.275   26.063  1.00 16.49 ? 233  TYR A CZ  1 
ATOM   1396  O  OH  . TYR A 1 190 ? -10.858 4.422   27.024  1.00 15.42 ? 233  TYR A OH  1 
ATOM   1397  N  N   . ASP A 1 191 ? -8.043  5.195   20.849  1.00 19.58 ? 234  ASP A N   1 
ATOM   1398  C  CA  . ASP A 1 191 ? -9.046  6.128   20.361  1.00 20.61 ? 234  ASP A CA  1 
ATOM   1399  C  C   . ASP A 1 191 ? -9.613  5.845   18.983  1.00 19.02 ? 234  ASP A C   1 
ATOM   1400  O  O   . ASP A 1 191 ? -10.829 5.880   18.798  1.00 17.73 ? 234  ASP A O   1 
ATOM   1401  C  CB  . ASP A 1 191 ? -8.489  7.561   20.386  1.00 23.89 ? 234  ASP A CB  1 
ATOM   1402  C  CG  . ASP A 1 191 ? -8.721  8.253   21.717  1.00 26.03 ? 234  ASP A CG  1 
ATOM   1403  O  OD1 . ASP A 1 191 ? -9.897  8.432   22.097  1.00 24.69 ? 234  ASP A OD1 1 
ATOM   1404  O  OD2 . ASP A 1 191 ? -7.731  8.613   22.384  1.00 27.04 ? 234  ASP A OD2 1 
ATOM   1405  N  N   . THR A 1 192 ? -8.722  5.583   18.025  1.00 18.88 ? 235  THR A N   1 
ATOM   1406  C  CA  . THR A 1 192 ? -9.093  5.314   16.633  1.00 17.76 ? 235  THR A CA  1 
ATOM   1407  C  C   . THR A 1 192 ? -9.163  3.820   16.247  1.00 19.81 ? 235  THR A C   1 
ATOM   1408  O  O   . THR A 1 192 ? -10.211 3.337   15.801  1.00 19.86 ? 235  THR A O   1 
ATOM   1409  C  CB  . THR A 1 192 ? -8.113  6.014   15.692  1.00 15.80 ? 235  THR A CB  1 
ATOM   1410  O  OG1 . THR A 1 192 ? -6.774  5.701   16.085  1.00 16.15 ? 235  THR A OG1 1 
ATOM   1411  C  CG2 . THR A 1 192 ? -8.287  7.500   15.758  1.00 15.24 ? 235  THR A CG2 1 
ATOM   1412  N  N   . THR A 1 193 ? -8.048  3.105   16.421  1.00 19.84 ? 236  THR A N   1 
ATOM   1413  C  CA  . THR A 1 193 ? -7.947  1.686   16.087  1.00 20.14 ? 236  THR A CA  1 
ATOM   1414  C  C   . THR A 1 193 ? -8.966  0.875   16.865  1.00 21.31 ? 236  THR A C   1 
ATOM   1415  O  O   . THR A 1 193 ? -9.796  0.149   16.295  1.00 21.54 ? 236  THR A O   1 
ATOM   1416  C  CB  . THR A 1 193 ? -6.573  1.109   16.461  1.00 20.47 ? 236  THR A CB  1 
ATOM   1417  O  OG1 . THR A 1 193 ? -5.523  1.844   15.823  1.00 22.80 ? 236  THR A OG1 1 
ATOM   1418  C  CG2 . THR A 1 193 ? -6.484  -0.310  16.036  1.00 21.56 ? 236  THR A CG2 1 
ATOM   1419  N  N   . ALA A 1 194 ? -8.884  1.012   18.185  1.00 21.95 ? 237  ALA A N   1 
ATOM   1420  C  CA  . ALA A 1 194 ? -9.735  0.282   19.117  1.00 22.61 ? 237  ALA A CA  1 
ATOM   1421  C  C   . ALA A 1 194 ? -11.213 0.484   18.871  1.00 23.30 ? 237  ALA A C   1 
ATOM   1422  O  O   . ALA A 1 194 ? -12.036 -0.215  19.459  1.00 23.29 ? 237  ALA A O   1 
ATOM   1423  C  CB  . ALA A 1 194 ? -9.390  0.672   20.551  1.00 20.84 ? 237  ALA A CB  1 
ATOM   1424  N  N   . ASP A 1 195 ? -11.558 1.441   18.016  1.00 24.41 ? 238  ASP A N   1 
ATOM   1425  C  CA  . ASP A 1 195 ? -12.968 1.704   17.742  1.00 25.33 ? 238  ASP A CA  1 
ATOM   1426  C  C   . ASP A 1 195 ? -13.412 1.145   16.398  1.00 24.54 ? 238  ASP A C   1 
ATOM   1427  O  O   . ASP A 1 195 ? -14.543 0.682   16.268  1.00 24.26 ? 238  ASP A O   1 
ATOM   1428  C  CB  . ASP A 1 195 ? -13.279 3.218   17.847  1.00 26.81 ? 238  ASP A CB  1 
ATOM   1429  C  CG  . ASP A 1 195 ? -13.773 3.634   19.266  1.00 28.62 ? 238  ASP A CG  1 
ATOM   1430  O  OD1 . ASP A 1 195 ? -13.786 4.852   19.576  1.00 27.68 ? 238  ASP A OD1 1 
ATOM   1431  O  OD2 . ASP A 1 195 ? -14.162 2.742   20.068  1.00 28.57 ? 238  ASP A OD2 1 
ATOM   1432  N  N   . GLU A 1 196 ? -12.520 1.172   15.412  1.00 23.35 ? 239  GLU A N   1 
ATOM   1433  C  CA  . GLU A 1 196 ? -12.831 0.631   14.098  1.00 21.43 ? 239  GLU A CA  1 
ATOM   1434  C  C   . GLU A 1 196 ? -13.107 -0.853  14.287  1.00 20.44 ? 239  GLU A C   1 
ATOM   1435  O  O   . GLU A 1 196 ? -14.156 -1.355  13.892  1.00 21.05 ? 239  GLU A O   1 
ATOM   1436  C  CB  . GLU A 1 196 ? -11.645 0.809   13.164  1.00 20.72 ? 239  GLU A CB  1 
ATOM   1437  C  CG  . GLU A 1 196 ? -11.180 2.242   13.003  1.00 20.63 ? 239  GLU A CG  1 
ATOM   1438  C  CD  . GLU A 1 196 ? -9.873  2.313   12.242  1.00 20.85 ? 239  GLU A CD  1 
ATOM   1439  O  OE1 . GLU A 1 196 ? -9.323  3.425   12.097  1.00 20.95 ? 239  GLU A OE1 1 
ATOM   1440  O  OE2 . GLU A 1 196 ? -9.402  1.242   11.797  1.00 18.06 ? 239  GLU A OE2 1 
ATOM   1441  N  N   . ILE A 1 197 ? -12.146 -1.544  14.894  1.00 18.35 ? 240  ILE A N   1 
ATOM   1442  C  CA  . ILE A 1 197 ? -12.271 -2.962  15.184  1.00 17.42 ? 240  ILE A CA  1 
ATOM   1443  C  C   . ILE A 1 197 ? -13.684 -3.249  15.721  1.00 18.32 ? 240  ILE A C   1 
ATOM   1444  O  O   . ILE A 1 197 ? -14.314 -4.246  15.349  1.00 17.23 ? 240  ILE A O   1 
ATOM   1445  C  CB  . ILE A 1 197 ? -11.219 -3.382  16.239  1.00 16.90 ? 240  ILE A CB  1 
ATOM   1446  C  CG1 . ILE A 1 197 ? -9.826  -3.237  15.642  1.00 15.91 ? 240  ILE A CG1 1 
ATOM   1447  C  CG2 . ILE A 1 197 ? -11.473 -4.803  16.732  1.00 15.02 ? 240  ILE A CG2 1 
ATOM   1448  C  CD1 . ILE A 1 197 ? -8.740  -3.879  16.465  1.00 15.24 ? 240  ILE A CD1 1 
ATOM   1449  N  N   . LEU A 1 198 ? -14.169 -2.364  16.593  1.00 18.02 ? 241  LEU A N   1 
ATOM   1450  C  CA  . LEU A 1 198 ? -15.495 -2.493  17.172  1.00 18.91 ? 241  LEU A CA  1 
ATOM   1451  C  C   . LEU A 1 198 ? -16.597 -2.158  16.172  1.00 19.41 ? 241  LEU A C   1 
ATOM   1452  O  O   . LEU A 1 198 ? -17.493 -2.965  15.960  1.00 20.32 ? 241  LEU A O   1 
ATOM   1453  C  CB  . LEU A 1 198 ? -15.662 -1.573  18.384  1.00 19.65 ? 241  LEU A CB  1 
ATOM   1454  C  CG  . LEU A 1 198 ? -15.047 -1.872  19.753  1.00 19.67 ? 241  LEU A CG  1 
ATOM   1455  C  CD1 . LEU A 1 198 ? -15.174 -0.639  20.635  1.00 20.43 ? 241  LEU A CD1 1 
ATOM   1456  C  CD2 . LEU A 1 198 ? -15.746 -3.033  20.402  1.00 20.40 ? 241  LEU A CD2 1 
ATOM   1457  N  N   . GLN A 1 199 ? -16.554 -0.971  15.567  1.00 19.02 ? 242  GLN A N   1 
ATOM   1458  C  CA  . GLN A 1 199 ? -17.605 -0.595  14.622  1.00 17.97 ? 242  GLN A CA  1 
ATOM   1459  C  C   . GLN A 1 199 ? -17.632 -1.600  13.498  1.00 17.32 ? 242  GLN A C   1 
ATOM   1460  O  O   . GLN A 1 199 ? -18.651 -1.752  12.821  1.00 18.27 ? 242  GLN A O   1 
ATOM   1461  C  CB  . GLN A 1 199 ? -17.374 0.802   14.045  1.00 19.27 ? 242  GLN A CB  1 
ATOM   1462  C  CG  . GLN A 1 199 ? -18.605 1.732   14.052  1.00 23.56 ? 242  GLN A CG  1 
ATOM   1463  C  CD  . GLN A 1 199 ? -19.833 1.155   13.342  1.00 26.14 ? 242  GLN A CD  1 
ATOM   1464  O  OE1 . GLN A 1 199 ? -19.736 0.674   12.216  1.00 28.01 ? 242  GLN A OE1 1 
ATOM   1465  N  NE2 . GLN A 1 199 ? -20.996 1.217   13.998  1.00 23.93 ? 242  GLN A NE2 1 
ATOM   1466  N  N   . GLN A 1 200 ? -16.514 -2.296  13.304  1.00 15.55 ? 243  GLN A N   1 
ATOM   1467  C  CA  . GLN A 1 200 ? -16.424 -3.288  12.246  1.00 13.81 ? 243  GLN A CA  1 
ATOM   1468  C  C   . GLN A 1 200 ? -17.168 -4.541  12.651  1.00 14.16 ? 243  GLN A C   1 
ATOM   1469  O  O   . GLN A 1 200 ? -18.176 -4.917  12.060  1.00 15.26 ? 243  GLN A O   1 
ATOM   1470  C  CB  . GLN A 1 200 ? -14.969 -3.618  11.955  1.00 13.09 ? 243  GLN A CB  1 
ATOM   1471  C  CG  . GLN A 1 200 ? -14.650 -3.602  10.490  1.00 14.40 ? 243  GLN A CG  1 
ATOM   1472  C  CD  . GLN A 1 200 ? -13.862 -2.397  10.038  1.00 13.37 ? 243  GLN A CD  1 
ATOM   1473  O  OE1 . GLN A 1 200 ? -12.663 -2.278  10.297  1.00 12.59 ? 243  GLN A OE1 1 
ATOM   1474  N  NE2 . GLN A 1 200 ? -14.338 -1.366  9.343   1.00 12.06 ? 243  GLN A NE2 1 
ATOM   1475  N  N   . CYS A 1 201 ? -16.643 -5.155  13.672  1.00 13.34 ? 244  CYS A N   1 
ATOM   1476  C  CA  . CYS A 1 201 ? -17.239 -6.381  14.128  1.00 14.73 ? 244  CYS A CA  1 
ATOM   1477  C  C   . CYS A 1 201 ? -18.711 -6.314  14.534  1.00 15.52 ? 244  CYS A C   1 
ATOM   1478  O  O   . CYS A 1 201 ? -19.361 -7.343  14.723  1.00 14.42 ? 244  CYS A O   1 
ATOM   1479  C  CB  . CYS A 1 201 ? -16.347 -6.953  15.220  1.00 13.70 ? 244  CYS A CB  1 
ATOM   1480  S  SG  . CYS A 1 201 ? -14.694 -7.474  14.667  1.00 15.36 ? 244  CYS A SG  1 
ATOM   1481  N  N   . ASP A 1 202 ? -19.236 -5.124  14.675  1.00 16.25 ? 245  ASP A N   1 
ATOM   1482  C  CA  . ASP A 1 202 ? -20.612 -4.966  15.090  1.00 19.52 ? 245  ASP A CA  1 
ATOM   1483  C  C   . ASP A 1 202 ? -20.585 -4.978  16.610  1.00 20.83 ? 245  ASP A C   1 
ATOM   1484  O  O   . ASP A 1 202 ? -21.643 -4.955  17.258  1.00 22.70 ? 245  ASP A O   1 
ATOM   1485  C  CB  . ASP A 1 202 ? -21.552 -5.967  14.399  1.00 19.84 ? 245  ASP A CB  1 
ATOM   1486  C  CG  . ASP A 1 202 ? -21.911 -5.508  12.991  1.00 21.35 ? 245  ASP A CG  1 
ATOM   1487  O  OD1 . ASP A 1 202 ? -22.490 -4.410  12.862  1.00 21.28 ? 245  ASP A OD1 1 
ATOM   1488  O  OD2 . ASP A 1 202 ? -21.604 -6.235  12.019  1.00 22.43 ? 245  ASP A OD2 1 
ATOM   1489  N  N   . GLY A 1 203 ? -19.413 -4.986  17.217  1.00 21.07 ? 246  GLY A N   1 
ATOM   1490  C  CA  . GLY A 1 203 ? -19.390 -4.927  18.681  1.00 22.02 ? 246  GLY A CA  1 
ATOM   1491  C  C   . GLY A 1 203 ? -19.055 -6.278  19.272  1.00 22.10 ? 246  GLY A C   1 
ATOM   1492  O  O   . GLY A 1 203 ? -18.509 -6.379  20.358  1.00 22.73 ? 246  GLY A O   1 
ATOM   1493  N  N   . LYS A 1 204 ? -19.403 -7.292  18.533  1.00 21.19 ? 247  LYS A N   1 
ATOM   1494  C  CA  . LYS A 1 204 ? -19.079 -8.626  19.017  1.00 20.19 ? 247  LYS A CA  1 
ATOM   1495  C  C   . LYS A 1 204 ? -17.829 -9.165  18.353  1.00 17.07 ? 247  LYS A C   1 
ATOM   1496  O  O   . LYS A 1 204 ? -17.720 -9.187  17.136  1.00 16.38 ? 247  LYS A O   1 
ATOM   1497  C  CB  . LYS A 1 204 ? -20.252 -9.584  18.793  1.00 23.50 ? 247  LYS A CB  1 
ATOM   1498  C  CG  . LYS A 1 204 ? -21.467 -9.306  19.683  1.00 26.01 ? 247  LYS A CG  1 
ATOM   1499  C  CD  . LYS A 1 204 ? -22.075 -7.931  19.406  1.00 27.89 ? 247  LYS A CD  1 
ATOM   1500  C  CE  . LYS A 1 204 ? -23.131 -7.560  20.445  1.00 28.92 ? 247  LYS A CE  1 
ATOM   1501  N  NZ  . LYS A 1 204 ? -23.536 -6.126  20.306  1.00 31.13 ? 247  LYS A NZ  1 
ATOM   1502  N  N   . LEU A 1 205 ? -16.886 -9.577  19.177  1.00 13.95 ? 248  LEU A N   1 
ATOM   1503  C  CA  . LEU A 1 205 ? -15.627 -10.150 18.733  1.00 12.91 ? 248  LEU A CA  1 
ATOM   1504  C  C   . LEU A 1 205 ? -15.317 -11.022 19.919  1.00 12.99 ? 248  LEU A C   1 
ATOM   1505  O  O   . LEU A 1 205 ? -15.740 -10.702 21.021  1.00 15.15 ? 248  LEU A O   1 
ATOM   1506  C  CB  . LEU A 1 205 ? -14.566 -9.076  18.586  1.00 15.11 ? 248  LEU A CB  1 
ATOM   1507  C  CG  . LEU A 1 205 ? -13.391 -9.393  17.654  1.00 17.12 ? 248  LEU A CG  1 
ATOM   1508  C  CD1 . LEU A 1 205 ? -12.175 -8.563  18.108  1.00 14.15 ? 248  LEU A CD1 1 
ATOM   1509  C  CD2 . LEU A 1 205 ? -13.086 -10.909 17.669  1.00 16.02 ? 248  LEU A CD2 1 
ATOM   1510  N  N   . ASP A 1 206 ? -14.581 -12.109 19.730  1.00 13.39 ? 249  ASP A N   1 
ATOM   1511  C  CA  . ASP A 1 206 ? -14.320 -13.021 20.847  1.00 13.67 ? 249  ASP A CA  1 
ATOM   1512  C  C   . ASP A 1 206 ? -12.848 -13.178 21.216  1.00 14.45 ? 249  ASP A C   1 
ATOM   1513  O  O   . ASP A 1 206 ? -12.502 -13.862 22.187  1.00 15.06 ? 249  ASP A O   1 
ATOM   1514  C  CB  . ASP A 1 206 ? -14.939 -14.388 20.524  1.00 12.69 ? 249  ASP A CB  1 
ATOM   1515  C  CG  . ASP A 1 206 ? -16.419 -14.286 20.207  1.00 12.68 ? 249  ASP A CG  1 
ATOM   1516  O  OD1 . ASP A 1 206 ? -17.223 -14.222 21.155  1.00 12.95 ? 249  ASP A OD1 1 
ATOM   1517  O  OD2 . ASP A 1 206 ? -16.781 -14.239 19.009  1.00 11.70 ? 249  ASP A OD2 1 
ATOM   1518  N  N   . MET A 1 207 ? -11.983 -12.542 20.438  1.00 14.07 ? 250  MET A N   1 
ATOM   1519  C  CA  . MET A 1 207 ? -10.555 -12.618 20.676  1.00 13.43 ? 250  MET A CA  1 
ATOM   1520  C  C   . MET A 1 207 ? -9.895  -11.580 19.811  1.00 14.28 ? 250  MET A C   1 
ATOM   1521  O  O   . MET A 1 207 ? -10.388 -11.274 18.720  1.00 15.04 ? 250  MET A O   1 
ATOM   1522  C  CB  . MET A 1 207 ? -10.025 -14.007 20.304  1.00 12.86 ? 250  MET A CB  1 
ATOM   1523  C  CG  . MET A 1 207 ? -8.517  -14.141 20.446  1.00 14.16 ? 250  MET A CG  1 
ATOM   1524  S  SD  . MET A 1 207 ? -7.895  -15.809 20.233  1.00 12.34 ? 250  MET A SD  1 
ATOM   1525  C  CE  . MET A 1 207 ? -9.064  -16.647 21.217  1.00 11.54 ? 250  MET A CE  1 
ATOM   1526  N  N   . LEU A 1 208 ? -8.784  -11.039 20.308  1.00 14.13 ? 251  LEU A N   1 
ATOM   1527  C  CA  . LEU A 1 208 ? -8.012  -10.036 19.590  1.00 12.92 ? 251  LEU A CA  1 
ATOM   1528  C  C   . LEU A 1 208 ? -6.541  -10.393 19.635  1.00 13.01 ? 251  LEU A C   1 
ATOM   1529  O  O   . LEU A 1 208 ? -5.791  -9.846  20.436  1.00 13.66 ? 251  LEU A O   1 
ATOM   1530  C  CB  . LEU A 1 208 ? -8.217  -8.657  20.213  1.00 12.54 ? 251  LEU A CB  1 
ATOM   1531  C  CG  . LEU A 1 208 ? -7.101  -7.639  19.944  1.00 13.16 ? 251  LEU A CG  1 
ATOM   1532  C  CD1 . LEU A 1 208 ? -7.104  -7.192  18.495  1.00 10.97 ? 251  LEU A CD1 1 
ATOM   1533  C  CD2 . LEU A 1 208 ? -7.272  -6.472  20.899  1.00 11.08 ? 251  LEU A CD2 1 
ATOM   1534  N  N   . VAL A 1 209 ? -6.118  -11.317 18.786  1.00 12.69 ? 252  VAL A N   1 
ATOM   1535  C  CA  . VAL A 1 209 ? -4.713  -11.705 18.759  1.00 11.99 ? 252  VAL A CA  1 
ATOM   1536  C  C   . VAL A 1 209 ? -3.819  -10.605 18.155  1.00 13.26 ? 252  VAL A C   1 
ATOM   1537  O  O   . VAL A 1 209 ? -3.817  -10.396 16.940  1.00 15.90 ? 252  VAL A O   1 
ATOM   1538  C  CB  . VAL A 1 209 ? -4.549  -13.003 17.981  1.00 9.39  ? 252  VAL A CB  1 
ATOM   1539  C  CG1 . VAL A 1 209 ? -3.106  -13.281 17.701  1.00 8.83  ? 252  VAL A CG1 1 
ATOM   1540  C  CG2 . VAL A 1 209 ? -5.137  -14.123 18.786  1.00 9.86  ? 252  VAL A CG2 1 
ATOM   1541  N  N   . ALA A 1 210 ? -3.069  -9.902  19.006  1.00 12.78 ? 253  ALA A N   1 
ATOM   1542  C  CA  . ALA A 1 210 ? -2.179  -8.826  18.547  1.00 12.09 ? 253  ALA A CA  1 
ATOM   1543  C  C   . ALA A 1 210 ? -0.794  -8.859  19.198  1.00 10.99 ? 253  ALA A C   1 
ATOM   1544  O  O   . ALA A 1 210 ? -0.680  -8.728  20.413  1.00 11.66 ? 253  ALA A O   1 
ATOM   1545  C  CB  . ALA A 1 210 ? -2.833  -7.471  18.800  1.00 11.75 ? 253  ALA A CB  1 
ATOM   1546  N  N   . SER A 1 211 ? 0.245   -9.015  18.378  1.00 10.13 ? 254  SER A N   1 
ATOM   1547  C  CA  . SER A 1 211 ? 1.628   -9.070  18.846  1.00 10.71 ? 254  SER A CA  1 
ATOM   1548  C  C   . SER A 1 211 ? 2.096   -7.745  19.467  1.00 11.86 ? 254  SER A C   1 
ATOM   1549  O  O   . SER A 1 211 ? 1.521   -6.689  19.204  1.00 10.86 ? 254  SER A O   1 
ATOM   1550  C  CB  . SER A 1 211 ? 2.550   -9.466  17.694  1.00 11.21 ? 254  SER A CB  1 
ATOM   1551  O  OG  . SER A 1 211 ? 2.525   -8.492  16.663  1.00 11.69 ? 254  SER A OG  1 
ATOM   1552  N  N   . VAL A 1 212 ? 3.153   -7.805  20.280  1.00 13.23 ? 255  VAL A N   1 
ATOM   1553  C  CA  . VAL A 1 212 ? 3.653   -6.617  20.973  1.00 13.89 ? 255  VAL A CA  1 
ATOM   1554  C  C   . VAL A 1 212 ? 5.027   -6.069  20.617  1.00 14.14 ? 255  VAL A C   1 
ATOM   1555  O  O   . VAL A 1 212 ? 6.036   -6.772  20.687  1.00 13.25 ? 255  VAL A O   1 
ATOM   1556  C  CB  . VAL A 1 212 ? 3.666   -6.820  22.498  1.00 13.97 ? 255  VAL A CB  1 
ATOM   1557  C  CG1 . VAL A 1 212 ? 3.916   -5.477  23.177  1.00 13.40 ? 255  VAL A CG1 1 
ATOM   1558  C  CG2 . VAL A 1 212 ? 2.368   -7.453  22.962  1.00 12.19 ? 255  VAL A CG2 1 
ATOM   1559  N  N   . GLY A 1 213 ? 5.046   -4.785  20.276  1.00 15.11 ? 256  GLY A N   1 
ATOM   1560  C  CA  . GLY A 1 213 ? 6.285   -4.117  19.928  1.00 16.04 ? 256  GLY A CA  1 
ATOM   1561  C  C   . GLY A 1 213 ? 6.645   -3.164  21.045  1.00 15.91 ? 256  GLY A C   1 
ATOM   1562  O  O   . GLY A 1 213 ? 7.751   -3.207  21.583  1.00 17.93 ? 256  GLY A O   1 
ATOM   1563  N  N   . THR A 1 214 ? 5.698   -2.302  21.387  1.00 15.22 ? 257  THR A N   1 
ATOM   1564  C  CA  . THR A 1 214 ? 5.858   -1.334  22.461  1.00 14.83 ? 257  THR A CA  1 
ATOM   1565  C  C   . THR A 1 214 ? 4.585   -1.368  23.281  1.00 16.09 ? 257  THR A C   1 
ATOM   1566  O  O   . THR A 1 214 ? 4.393   -0.562  24.180  1.00 16.02 ? 257  THR A O   1 
ATOM   1567  C  CB  . THR A 1 214 ? 6.030   0.110   21.931  1.00 14.45 ? 257  THR A CB  1 
ATOM   1568  O  OG1 . THR A 1 214 ? 5.082   0.358   20.885  1.00 13.79 ? 257  THR A OG1 1 
ATOM   1569  C  CG2 . THR A 1 214 ? 7.435   0.338   21.422  1.00 11.17 ? 257  THR A CG2 1 
ATOM   1570  N  N   . GLY A 1 215 ? 3.707   -2.306  22.950  1.00 16.84 ? 258  GLY A N   1 
ATOM   1571  C  CA  . GLY A 1 215 ? 2.448   -2.411  23.659  1.00 16.25 ? 258  GLY A CA  1 
ATOM   1572  C  C   . GLY A 1 215 ? 1.545   -1.256  23.280  1.00 16.13 ? 258  GLY A C   1 
ATOM   1573  O  O   . GLY A 1 215 ? 0.515   -1.031  23.902  1.00 15.36 ? 258  GLY A O   1 
ATOM   1574  N  N   . GLY A 1 216 ? 1.937   -0.518  22.250  1.00 17.35 ? 259  GLY A N   1 
ATOM   1575  C  CA  . GLY A 1 216 ? 1.136   0.608   21.811  1.00 19.53 ? 259  GLY A CA  1 
ATOM   1576  C  C   . GLY A 1 216 ? -0.199  0.226   21.197  1.00 21.20 ? 259  GLY A C   1 
ATOM   1577  O  O   . GLY A 1 216 ? -1.160  1.003   21.216  1.00 21.20 ? 259  GLY A O   1 
ATOM   1578  N  N   . THR A 1 217 ? -0.266  -0.988  20.654  1.00 23.86 ? 260  THR A N   1 
ATOM   1579  C  CA  . THR A 1 217 ? -1.478  -1.480  20.001  1.00 24.11 ? 260  THR A CA  1 
ATOM   1580  C  C   . THR A 1 217 ? -2.303  -2.418  20.851  1.00 24.53 ? 260  THR A C   1 
ATOM   1581  O  O   . THR A 1 217 ? -3.517  -2.252  20.934  1.00 25.88 ? 260  THR A O   1 
ATOM   1582  C  CB  . THR A 1 217 ? -1.156  -2.243  18.727  1.00 23.60 ? 260  THR A CB  1 
ATOM   1583  O  OG1 . THR A 1 217 ? -0.118  -3.177  19.017  1.00 26.80 ? 260  THR A OG1 1 
ATOM   1584  C  CG2 . THR A 1 217 ? -0.710  -1.317  17.624  1.00 22.54 ? 260  THR A CG2 1 
ATOM   1585  N  N   . ILE A 1 218 ? -1.671  -3.416  21.463  1.00 24.73 ? 261  ILE A N   1 
ATOM   1586  C  CA  . ILE A 1 218 ? -2.439  -4.364  22.271  1.00 24.80 ? 261  ILE A CA  1 
ATOM   1587  C  C   . ILE A 1 218 ? -3.037  -3.649  23.485  1.00 26.03 ? 261  ILE A C   1 
ATOM   1588  O  O   . ILE A 1 218 ? -4.234  -3.784  23.780  1.00 25.47 ? 261  ILE A O   1 
ATOM   1589  C  CB  . ILE A 1 218 ? -1.578  -5.574  22.727  1.00 24.18 ? 261  ILE A CB  1 
ATOM   1590  C  CG1 . ILE A 1 218 ? -2.491  -6.658  23.305  1.00 24.22 ? 261  ILE A CG1 1 
ATOM   1591  C  CG2 . ILE A 1 218 ? -0.559  -5.143  23.750  1.00 22.19 ? 261  ILE A CG2 1 
ATOM   1592  C  CD1 . ILE A 1 218 ? -1.784  -7.928  23.733  1.00 23.80 ? 261  ILE A CD1 1 
ATOM   1593  N  N   . THR A 1 219 ? -2.208  -2.857  24.160  1.00 25.93 ? 262  THR A N   1 
ATOM   1594  C  CA  . THR A 1 219 ? -2.653  -2.132  25.340  1.00 23.53 ? 262  THR A CA  1 
ATOM   1595  C  C   . THR A 1 219 ? -3.717  -1.125  24.946  1.00 23.19 ? 262  THR A C   1 
ATOM   1596  O  O   . THR A 1 219 ? -4.683  -0.904  25.680  1.00 22.54 ? 262  THR A O   1 
ATOM   1597  C  CB  . THR A 1 219 ? -1.487  -1.388  26.038  1.00 22.90 ? 262  THR A CB  1 
ATOM   1598  O  OG1 . THR A 1 219 ? -0.329  -2.230  26.090  1.00 20.88 ? 262  THR A OG1 1 
ATOM   1599  C  CG2 . THR A 1 219 ? -1.871  -1.040  27.457  1.00 21.34 ? 262  THR A CG2 1 
ATOM   1600  N  N   . GLY A 1 220 ? -3.536  -0.512  23.784  1.00 22.88 ? 263  GLY A N   1 
ATOM   1601  C  CA  . GLY A 1 220 ? -4.505  0.463   23.333  1.00 23.01 ? 263  GLY A CA  1 
ATOM   1602  C  C   . GLY A 1 220 ? -5.837  -0.219  23.123  1.00 23.31 ? 263  GLY A C   1 
ATOM   1603  O  O   . GLY A 1 220 ? -6.880  0.242   23.607  1.00 24.22 ? 263  GLY A O   1 
ATOM   1604  N  N   . ILE A 1 221 ? -5.793  -1.344  22.415  1.00 22.45 ? 264  ILE A N   1 
ATOM   1605  C  CA  . ILE A 1 221 ? -6.998  -2.099  22.100  1.00 19.97 ? 264  ILE A CA  1 
ATOM   1606  C  C   . ILE A 1 221 ? -7.552  -2.838  23.301  1.00 18.44 ? 264  ILE A C   1 
ATOM   1607  O  O   . ILE A 1 221 ? -8.753  -2.797  23.572  1.00 15.79 ? 264  ILE A O   1 
ATOM   1608  C  CB  . ILE A 1 221 ? -6.740  -3.105  20.969  1.00 18.41 ? 264  ILE A CB  1 
ATOM   1609  C  CG1 . ILE A 1 221 ? -6.121  -2.383  19.772  1.00 16.57 ? 264  ILE A CG1 1 
ATOM   1610  C  CG2 . ILE A 1 221 ? -8.042  -3.718  20.551  1.00 18.29 ? 264  ILE A CG2 1 
ATOM   1611  C  CD1 . ILE A 1 221 ? -5.882  -3.230  18.572  1.00 14.68 ? 264  ILE A CD1 1 
ATOM   1612  N  N   . ALA A 1 222 ? -6.662  -3.509  24.019  1.00 18.33 ? 265  ALA A N   1 
ATOM   1613  C  CA  . ALA A 1 222 ? -7.058  -4.257  25.191  1.00 20.28 ? 265  ALA A CA  1 
ATOM   1614  C  C   . ALA A 1 222 ? -7.763  -3.371  26.230  1.00 22.75 ? 265  ALA A C   1 
ATOM   1615  O  O   . ALA A 1 222 ? -8.702  -3.827  26.895  1.00 23.01 ? 265  ALA A O   1 
ATOM   1616  C  CB  . ALA A 1 222 ? -5.849  -4.931  25.797  1.00 19.40 ? 265  ALA A CB  1 
ATOM   1617  N  N   . ARG A 1 223 ? -7.327  -2.116  26.367  1.00 24.85 ? 266  ARG A N   1 
ATOM   1618  C  CA  . ARG A 1 223 ? -7.950  -1.200  27.329  1.00 25.99 ? 266  ARG A CA  1 
ATOM   1619  C  C   . ARG A 1 223 ? -9.361  -0.802  26.909  1.00 25.67 ? 266  ARG A C   1 
ATOM   1620  O  O   . ARG A 1 223 ? -10.228 -0.633  27.755  1.00 26.15 ? 266  ARG A O   1 
ATOM   1621  C  CB  . ARG A 1 223 ? -7.110  0.076   27.524  1.00 27.97 ? 266  ARG A CB  1 
ATOM   1622  C  CG  . ARG A 1 223 ? -5.812  -0.109  28.318  1.00 29.52 ? 266  ARG A CG  1 
ATOM   1623  C  CD  . ARG A 1 223 ? -5.337  1.197   28.974  1.00 28.25 ? 266  ARG A CD  1 
ATOM   1624  N  NE  . ARG A 1 223 ? -4.093  1.012   29.722  1.00 27.48 ? 266  ARG A NE  1 
ATOM   1625  C  CZ  . ARG A 1 223 ? -3.514  1.948   30.473  1.00 26.19 ? 266  ARG A CZ  1 
ATOM   1626  N  NH1 . ARG A 1 223 ? -4.068  3.142   30.585  1.00 22.54 ? 266  ARG A NH1 1 
ATOM   1627  N  NH2 . ARG A 1 223 ? -2.371  1.693   31.105  1.00 23.89 ? 266  ARG A NH2 1 
ATOM   1628  N  N   . LYS A 1 224 ? -9.599  -0.650  25.609  1.00 25.61 ? 267  LYS A N   1 
ATOM   1629  C  CA  . LYS A 1 224 ? -10.938 -0.277  25.141  1.00 25.53 ? 267  LYS A CA  1 
ATOM   1630  C  C   . LYS A 1 224 ? -11.885 -1.468  25.066  1.00 25.22 ? 267  LYS A C   1 
ATOM   1631  O  O   . LYS A 1 224 ? -13.024 -1.394  25.532  1.00 25.63 ? 267  LYS A O   1 
ATOM   1632  C  CB  . LYS A 1 224 ? -10.878 0.371   23.766  1.00 24.56 ? 267  LYS A CB  1 
ATOM   1633  C  CG  . LYS A 1 224 ? -12.223 0.871   23.305  1.00 23.92 ? 267  LYS A CG  1 
ATOM   1634  C  CD  . LYS A 1 224 ? -12.585 2.180   23.973  1.00 23.03 ? 267  LYS A CD  1 
ATOM   1635  C  CE  . LYS A 1 224 ? -11.752 3.318   23.400  1.00 21.70 ? 267  LYS A CE  1 
ATOM   1636  N  NZ  . LYS A 1 224 ? -12.047 3.574   21.955  1.00 19.77 ? 267  LYS A NZ  1 
ATOM   1637  N  N   . LEU A 1 225 ? -11.422 -2.555  24.456  1.00 24.75 ? 268  LEU A N   1 
ATOM   1638  C  CA  . LEU A 1 225 ? -12.242 -3.746  24.348  1.00 24.00 ? 268  LEU A CA  1 
ATOM   1639  C  C   . LEU A 1 225 ? -12.618 -4.203  25.747  1.00 24.16 ? 268  LEU A C   1 
ATOM   1640  O  O   . LEU A 1 225 ? -13.801 -4.286  26.076  1.00 23.95 ? 268  LEU A O   1 
ATOM   1641  C  CB  . LEU A 1 225 ? -11.511 -4.858  23.583  1.00 23.78 ? 268  LEU A CB  1 
ATOM   1642  C  CG  . LEU A 1 225 ? -11.936 -5.064  22.118  1.00 22.36 ? 268  LEU A CG  1 
ATOM   1643  C  CD1 . LEU A 1 225 ? -11.738 -3.786  21.315  1.00 20.57 ? 268  LEU A CD1 1 
ATOM   1644  C  CD2 . LEU A 1 225 ? -11.170 -6.232  21.510  1.00 22.85 ? 268  LEU A CD2 1 
ATOM   1645  N  N   . LYS A 1 226 ? -11.634 -4.467  26.582  1.00 24.14 ? 269  LYS A N   1 
ATOM   1646  C  CA  . LYS A 1 226 ? -11.929 -4.876  27.951  1.00 23.67 ? 269  LYS A CA  1 
ATOM   1647  C  C   . LYS A 1 226 ? -13.105 -4.047  28.532  1.00 23.08 ? 269  LYS A C   1 
ATOM   1648  O  O   . LYS A 1 226 ? -13.802 -4.530  29.417  1.00 21.48 ? 269  LYS A O   1 
ATOM   1649  C  CB  . LYS A 1 226 ? -10.697 -4.779  28.857  1.00 25.07 ? 269  LYS A CB  1 
ATOM   1650  C  CG  . LYS A 1 226 ? -9.798  -6.005  28.876  1.00 25.28 ? 269  LYS A CG  1 
ATOM   1651  C  CD  . LYS A 1 226 ? -10.386 -7.105  29.748  1.00 25.01 ? 269  LYS A CD  1 
ATOM   1652  C  CE  . LYS A 1 226 ? -9.577  -8.383  29.600  1.00 25.56 ? 269  LYS A CE  1 
ATOM   1653  N  NZ  . LYS A 1 226 ? -10.171 -9.286  28.578  1.00 24.28 ? 269  LYS A NZ  1 
ATOM   1654  N  N   . GLU A 1 227 ? -13.365 -2.810  28.074  1.00 23.11 ? 270  GLU A N   1 
ATOM   1655  C  CA  . GLU A 1 227 ? -14.474 -2.078  28.686  1.00 24.36 ? 270  GLU A CA  1 
ATOM   1656  C  C   . GLU A 1 227 ? -15.760 -1.991  27.860  1.00 24.43 ? 270  GLU A C   1 
ATOM   1657  O  O   . GLU A 1 227 ? -16.832 -2.192  28.435  1.00 26.26 ? 270  GLU A O   1 
ATOM   1658  C  CB  . GLU A 1 227 ? -14.028 -0.679  29.075  1.00 24.23 ? 270  GLU A CB  1 
ATOM   1659  C  CG  . GLU A 1 227 ? -12.810 -0.150  28.357  1.00 24.22 ? 270  GLU A CG  1 
ATOM   1660  C  CD  . GLU A 1 227 ? -12.702 1.319   28.611  1.00 25.52 ? 270  GLU A CD  1 
ATOM   1661  O  OE1 . GLU A 1 227 ? -13.173 2.085   27.756  1.00 26.02 ? 270  GLU A OE1 1 
ATOM   1662  O  OE2 . GLU A 1 227 ? -12.164 1.718   29.663  1.00 23.02 ? 270  GLU A OE2 1 
ATOM   1663  N  N   . LYS A 1 228 ? -15.727 -1.710  26.551  1.00 23.10 ? 271  LYS A N   1 
ATOM   1664  C  CA  . LYS A 1 228 ? -16.959 -1.719  25.812  1.00 22.58 ? 271  LYS A CA  1 
ATOM   1665  C  C   . LYS A 1 228 ? -17.209 -3.148  25.411  1.00 22.27 ? 271  LYS A C   1 
ATOM   1666  O  O   . LYS A 1 228 ? -18.346 -3.565  25.270  1.00 21.44 ? 271  LYS A O   1 
ATOM   1667  C  CB  . LYS A 1 228 ? -16.891 -0.722  24.655  1.00 24.26 ? 271  LYS A CB  1 
ATOM   1668  C  CG  . LYS A 1 228 ? -16.638 0.683   25.149  1.00 24.46 ? 271  LYS A CG  1 
ATOM   1669  C  CD  . LYS A 1 228 ? -15.774 1.467   24.198  1.00 25.77 ? 271  LYS A CD  1 
ATOM   1670  C  CE  . LYS A 1 228 ? -16.559 1.960   23.003  1.00 24.62 ? 271  LYS A CE  1 
ATOM   1671  N  NZ  . LYS A 1 228 ? -16.243 3.381   22.686  1.00 23.24 ? 271  LYS A NZ  1 
ATOM   1672  N  N   . CYS A 1 229 ? -16.158 -3.967  25.274  1.00 21.84 ? 272  CYS A N   1 
ATOM   1673  C  CA  . CYS A 1 229 ? -16.393 -5.396  24.983  1.00 20.37 ? 272  CYS A CA  1 
ATOM   1674  C  C   . CYS A 1 229 ? -15.667 -6.389  25.981  1.00 17.70 ? 272  CYS A C   1 
ATOM   1675  O  O   . CYS A 1 229 ? -14.554 -6.828  25.726  1.00 15.68 ? 272  CYS A O   1 
ATOM   1676  C  CB  . CYS A 1 229 ? -15.995 -5.724  23.550  1.00 21.43 ? 272  CYS A CB  1 
ATOM   1677  S  SG  . CYS A 1 229 ? -16.866 -7.154  22.839  1.00 26.51 ? 272  CYS A SG  1 
ATOM   1678  N  N   . PRO A 1 230 ? -16.356 -6.744  27.124  1.00 17.75 ? 273  PRO A N   1 
ATOM   1679  C  CA  . PRO A 1 230 ? -15.828 -7.705  28.227  1.00 19.50 ? 273  PRO A CA  1 
ATOM   1680  C  C   . PRO A 1 230 ? -15.408 -9.147  28.063  1.00 20.26 ? 273  PRO A C   1 
ATOM   1681  O  O   . PRO A 1 230 ? -14.360 -9.563  28.566  1.00 22.35 ? 273  PRO A O   1 
ATOM   1682  C  CB  . PRO A 1 230 ? -16.931 -7.613  29.260  1.00 19.44 ? 273  PRO A CB  1 
ATOM   1683  C  CG  . PRO A 1 230 ? -17.315 -6.184  29.202  1.00 20.31 ? 273  PRO A CG  1 
ATOM   1684  C  CD  . PRO A 1 230 ? -16.976 -5.623  27.848  1.00 18.68 ? 273  PRO A CD  1 
ATOM   1685  N  N   . GLY A 1 231 ? -16.236 -9.899  27.371  1.00 19.73 ? 274  GLY A N   1 
ATOM   1686  C  CA  . GLY A 1 231 ? -15.988 -11.295 27.120  1.00 18.13 ? 274  GLY A CA  1 
ATOM   1687  C  C   . GLY A 1 231 ? -14.805 -11.400 26.180  1.00 18.18 ? 274  GLY A C   1 
ATOM   1688  O  O   . GLY A 1 231 ? -14.082 -12.386 26.232  1.00 20.48 ? 274  GLY A O   1 
ATOM   1689  N  N   . CYS A 1 232 ? -14.592 -10.406 25.331  1.00 17.92 ? 275  CYS A N   1 
ATOM   1690  C  CA  . CYS A 1 232 ? -13.529 -10.537 24.324  1.00 17.53 ? 275  CYS A CA  1 
ATOM   1691  C  C   . CYS A 1 232 ? -12.163 -10.770 24.932  1.00 15.89 ? 275  CYS A C   1 
ATOM   1692  O  O   . CYS A 1 232 ? -11.665 -9.963  25.717  1.00 16.31 ? 275  CYS A O   1 
ATOM   1693  C  CB  . CYS A 1 232 ? -13.511 -9.301  23.408  1.00 18.64 ? 275  CYS A CB  1 
ATOM   1694  S  SG  . CYS A 1 232 ? -12.561 -9.523  21.868  1.00 25.14 ? 275  CYS A SG  1 
ATOM   1695  N  N   . ARG A 1 233 ? -11.546 -11.884 24.555  1.00 14.48 ? 276  ARG A N   1 
ATOM   1696  C  CA  . ARG A 1 233 ? -10.226 -12.261 25.037  1.00 13.04 ? 276  ARG A CA  1 
ATOM   1697  C  C   . ARG A 1 233 ? -9.182  -11.395 24.382  1.00 12.32 ? 276  ARG A C   1 
ATOM   1698  O  O   . ARG A 1 233 ? -9.467  -10.756 23.373  1.00 13.62 ? 276  ARG A O   1 
ATOM   1699  C  CB  . ARG A 1 233 ? -9.945  -13.721 24.707  1.00 12.55 ? 276  ARG A CB  1 
ATOM   1700  C  CG  . ARG A 1 233 ? -10.968 -14.698 25.291  1.00 15.07 ? 276  ARG A CG  1 
ATOM   1701  C  CD  . ARG A 1 233 ? -10.264 -15.846 26.009  1.00 15.15 ? 276  ARG A CD  1 
ATOM   1702  N  NE  . ARG A 1 233 ? -9.450  -15.349 27.115  1.00 15.49 ? 276  ARG A NE  1 
ATOM   1703  C  CZ  . ARG A 1 233 ? -8.368  -15.963 27.586  1.00 18.33 ? 276  ARG A CZ  1 
ATOM   1704  N  NH1 . ARG A 1 233 ? -7.959  -17.114 27.058  1.00 20.57 ? 276  ARG A NH1 1 
ATOM   1705  N  NH2 . ARG A 1 233 ? -7.668  -15.409 28.562  1.00 19.26 ? 276  ARG A NH2 1 
ATOM   1706  N  N   . ILE A 1 234 ? -7.976  -11.388 24.945  1.00 10.39 ? 277  ILE A N   1 
ATOM   1707  C  CA  . ILE A 1 234 ? -6.877  -10.579 24.430  1.00 7.78  ? 277  ILE A CA  1 
ATOM   1708  C  C   . ILE A 1 234 ? -5.604  -11.404 24.420  1.00 8.95  ? 277  ILE A C   1 
ATOM   1709  O  O   . ILE A 1 234 ? -4.912  -11.498 25.436  1.00 10.08 ? 277  ILE A O   1 
ATOM   1710  C  CB  . ILE A 1 234 ? -6.626  -9.350  25.329  1.00 6.29  ? 277  ILE A CB  1 
ATOM   1711  C  CG1 . ILE A 1 234 ? -7.924  -8.572  25.529  1.00 5.62  ? 277  ILE A CG1 1 
ATOM   1712  C  CG2 . ILE A 1 234 ? -5.541  -8.447  24.716  1.00 6.98  ? 277  ILE A CG2 1 
ATOM   1713  C  CD1 . ILE A 1 234 ? -8.385  -7.817  24.317  1.00 5.62  ? 277  ILE A CD1 1 
ATOM   1714  N  N   . ILE A 1 235 ? -5.276  -11.998 23.281  1.00 8.98  ? 278  ILE A N   1 
ATOM   1715  C  CA  . ILE A 1 235 ? -4.066  -12.805 23.211  1.00 9.33  ? 278  ILE A CA  1 
ATOM   1716  C  C   . ILE A 1 235 ? -2.890  -11.934 22.776  1.00 11.62 ? 278  ILE A C   1 
ATOM   1717  O  O   . ILE A 1 235 ? -3.067  -11.004 21.989  1.00 13.13 ? 278  ILE A O   1 
ATOM   1718  C  CB  . ILE A 1 235 ? -4.223  -13.957 22.209  1.00 8.70  ? 278  ILE A CB  1 
ATOM   1719  C  CG1 . ILE A 1 235 ? -5.580  -14.639 22.388  1.00 5.69  ? 278  ILE A CG1 1 
ATOM   1720  C  CG2 . ILE A 1 235 ? -3.099  -14.961 22.407  1.00 8.61  ? 278  ILE A CG2 1 
ATOM   1721  C  CD1 . ILE A 1 235 ? -5.716  -15.466 23.650  1.00 3.95  ? 278  ILE A CD1 1 
ATOM   1722  N  N   . GLY A 1 236 ? -1.694  -12.241 23.279  1.00 11.50 ? 279  GLY A N   1 
ATOM   1723  C  CA  . GLY A 1 236 ? -0.518  -11.455 22.931  1.00 12.28 ? 279  GLY A CA  1 
ATOM   1724  C  C   . GLY A 1 236 ? 0.586   -12.298 22.338  1.00 14.09 ? 279  GLY A C   1 
ATOM   1725  O  O   . GLY A 1 236 ? 0.816   -13.414 22.796  1.00 16.39 ? 279  GLY A O   1 
ATOM   1726  N  N   . VAL A 1 237 ? 1.277   -11.768 21.332  1.00 13.35 ? 280  VAL A N   1 
ATOM   1727  C  CA  . VAL A 1 237 ? 2.340   -12.498 20.661  1.00 13.53 ? 280  VAL A CA  1 
ATOM   1728  C  C   . VAL A 1 237 ? 3.713   -11.927 20.952  1.00 16.56 ? 280  VAL A C   1 
ATOM   1729  O  O   . VAL A 1 237 ? 3.993   -10.773 20.633  1.00 18.07 ? 280  VAL A O   1 
ATOM   1730  C  CB  . VAL A 1 237 ? 2.123   -12.499 19.143  1.00 13.11 ? 280  VAL A CB  1 
ATOM   1731  C  CG1 . VAL A 1 237 ? 3.339   -13.096 18.450  1.00 12.31 ? 280  VAL A CG1 1 
ATOM   1732  C  CG2 . VAL A 1 237 ? 0.858   -13.300 18.796  1.00 12.62 ? 280  VAL A CG2 1 
ATOM   1733  N  N   . ASP A 1 238 ? 4.574   -12.747 21.550  1.00 17.02 ? 281  ASP A N   1 
ATOM   1734  C  CA  . ASP A 1 238 ? 5.925   -12.330 21.902  1.00 16.73 ? 281  ASP A CA  1 
ATOM   1735  C  C   . ASP A 1 238 ? 6.916   -13.318 21.293  1.00 17.64 ? 281  ASP A C   1 
ATOM   1736  O  O   . ASP A 1 238 ? 6.659   -14.519 21.257  1.00 19.12 ? 281  ASP A O   1 
ATOM   1737  C  CB  . ASP A 1 238 ? 6.060   -12.316 23.422  1.00 17.85 ? 281  ASP A CB  1 
ATOM   1738  C  CG  . ASP A 1 238 ? 7.211   -11.469 23.895  1.00 17.79 ? 281  ASP A CG  1 
ATOM   1739  O  OD1 . ASP A 1 238 ? 8.051   -11.998 24.644  1.00 18.60 ? 281  ASP A OD1 1 
ATOM   1740  O  OD2 . ASP A 1 238 ? 7.271   -10.280 23.528  1.00 17.21 ? 281  ASP A OD2 1 
ATOM   1741  N  N   . PRO A 1 239 ? 8.061   -12.829 20.796  1.00 17.15 ? 282  PRO A N   1 
ATOM   1742  C  CA  . PRO A 1 239 ? 9.019   -13.764 20.202  1.00 16.77 ? 282  PRO A CA  1 
ATOM   1743  C  C   . PRO A 1 239 ? 10.009  -14.404 21.163  1.00 17.85 ? 282  PRO A C   1 
ATOM   1744  O  O   . PRO A 1 239 ? 10.501  -13.751 22.071  1.00 17.49 ? 282  PRO A O   1 
ATOM   1745  C  CB  . PRO A 1 239 ? 9.721   -12.906 19.154  1.00 16.80 ? 282  PRO A CB  1 
ATOM   1746  C  CG  . PRO A 1 239 ? 9.767   -11.572 19.794  1.00 14.88 ? 282  PRO A CG  1 
ATOM   1747  C  CD  . PRO A 1 239 ? 8.388   -11.439 20.424  1.00 16.92 ? 282  PRO A CD  1 
ATOM   1748  N  N   . GLU A 1 240 ? 10.315  -15.682 20.962  1.00 18.64 ? 283  GLU A N   1 
ATOM   1749  C  CA  . GLU A 1 240 ? 11.271  -16.322 21.836  1.00 19.62 ? 283  GLU A CA  1 
ATOM   1750  C  C   . GLU A 1 240 ? 12.579  -15.559 21.597  1.00 21.41 ? 283  GLU A C   1 
ATOM   1751  O  O   . GLU A 1 240 ? 13.247  -15.714 20.575  1.00 22.79 ? 283  GLU A O   1 
ATOM   1752  C  CB  . GLU A 1 240 ? 11.379  -17.821 21.522  1.00 19.58 ? 283  GLU A CB  1 
ATOM   1753  C  CG  . GLU A 1 240 ? 11.269  -18.741 22.779  1.00 22.47 ? 283  GLU A CG  1 
ATOM   1754  C  CD  . GLU A 1 240 ? 9.843   -19.267 23.080  1.00 25.10 ? 283  GLU A CD  1 
ATOM   1755  O  OE1 . GLU A 1 240 ? 9.366   -19.163 24.249  1.00 25.81 ? 283  GLU A OE1 1 
ATOM   1756  O  OE2 . GLU A 1 240 ? 9.204   -19.800 22.145  1.00 24.87 ? 283  GLU A OE2 1 
ATOM   1757  N  N   . GLY A 1 241 ? 12.895  -14.694 22.555  1.00 21.70 ? 284  GLY A N   1 
ATOM   1758  C  CA  . GLY A 1 241 ? 14.067  -13.839 22.500  1.00 20.31 ? 284  GLY A CA  1 
ATOM   1759  C  C   . GLY A 1 241 ? 13.727  -12.580 23.289  1.00 20.06 ? 284  GLY A C   1 
ATOM   1760  O  O   . GLY A 1 241 ? 14.582  -11.937 23.893  1.00 21.37 ? 284  GLY A O   1 
ATOM   1761  N  N   . SER A 1 242 ? 12.445  -12.234 23.286  1.00 19.17 ? 285  SER A N   1 
ATOM   1762  C  CA  . SER A 1 242 ? 11.928  -11.071 24.004  1.00 18.56 ? 285  SER A CA  1 
ATOM   1763  C  C   . SER A 1 242 ? 11.654  -11.441 25.467  1.00 17.32 ? 285  SER A C   1 
ATOM   1764  O  O   . SER A 1 242 ? 11.995  -12.537 25.914  1.00 17.01 ? 285  SER A O   1 
ATOM   1765  C  CB  . SER A 1 242 ? 10.627  -10.615 23.338  1.00 19.50 ? 285  SER A CB  1 
ATOM   1766  O  OG  . SER A 1 242 ? 10.302  -9.270  23.622  1.00 21.95 ? 285  SER A OG  1 
ATOM   1767  N  N   . ILE A 1 243 ? 11.021  -10.536 26.204  1.00 16.66 ? 286  ILE A N   1 
ATOM   1768  C  CA  . ILE A 1 243 ? 10.719  -10.778 27.613  1.00 17.60 ? 286  ILE A CA  1 
ATOM   1769  C  C   . ILE A 1 243 ? 9.457   -10.057 28.020  1.00 18.28 ? 286  ILE A C   1 
ATOM   1770  O  O   . ILE A 1 243 ? 9.100   -10.041 29.188  1.00 17.48 ? 286  ILE A O   1 
ATOM   1771  C  CB  . ILE A 1 243 ? 11.867  -10.299 28.548  1.00 16.79 ? 286  ILE A CB  1 
ATOM   1772  C  CG1 . ILE A 1 243 ? 12.323  -8.889  28.147  1.00 17.06 ? 286  ILE A CG1 1 
ATOM   1773  C  CG2 . ILE A 1 243 ? 13.023  -11.282 28.518  1.00 15.42 ? 286  ILE A CG2 1 
ATOM   1774  C  CD1 . ILE A 1 243 ? 11.475  -7.747  28.747  1.00 13.59 ? 286  ILE A CD1 1 
ATOM   1775  N  N   . LEU A 1 244 ? 8.792   -9.449  27.046  1.00 20.66 ? 287  LEU A N   1 
ATOM   1776  C  CA  . LEU A 1 244 ? 7.563   -8.718  27.301  1.00 23.35 ? 287  LEU A CA  1 
ATOM   1777  C  C   . LEU A 1 244 ? 6.419   -9.666  27.627  1.00 25.74 ? 287  LEU A C   1 
ATOM   1778  O  O   . LEU A 1 244 ? 5.311   -9.226  27.900  1.00 27.49 ? 287  LEU A O   1 
ATOM   1779  C  CB  . LEU A 1 244 ? 7.188   -7.878  26.078  1.00 23.31 ? 287  LEU A CB  1 
ATOM   1780  C  CG  . LEU A 1 244 ? 8.287   -6.959  25.533  1.00 24.80 ? 287  LEU A CG  1 
ATOM   1781  C  CD1 . LEU A 1 244 ? 7.740   -6.059  24.438  1.00 24.85 ? 287  LEU A CD1 1 
ATOM   1782  C  CD2 . LEU A 1 244 ? 8.823   -6.113  26.661  1.00 24.61 ? 287  LEU A CD2 1 
ATOM   1783  N  N   . ALA A 1 245 ? 6.679   -10.967 27.609  1.00 27.74 ? 288  ALA A N   1 
ATOM   1784  C  CA  . ALA A 1 245 ? 5.638   -11.942 27.880  1.00 29.21 ? 288  ALA A CA  1 
ATOM   1785  C  C   . ALA A 1 245 ? 5.584   -12.368 29.351  1.00 30.83 ? 288  ALA A C   1 
ATOM   1786  O  O   . ALA A 1 245 ? 6.578   -12.261 30.069  1.00 31.29 ? 288  ALA A O   1 
ATOM   1787  C  CB  . ALA A 1 245 ? 5.852   -13.147 26.989  1.00 28.52 ? 288  ALA A CB  1 
ATOM   1788  N  N   . GLU A 1 246 ? 4.416   -12.843 29.790  1.00 32.88 ? 289  GLU A N   1 
ATOM   1789  C  CA  . GLU A 1 246 ? 4.210   -13.321 31.168  1.00 35.40 ? 289  GLU A CA  1 
ATOM   1790  C  C   . GLU A 1 246 ? 3.604   -14.729 31.107  1.00 36.87 ? 289  GLU A C   1 
ATOM   1791  O  O   . GLU A 1 246 ? 2.836   -15.026 30.189  1.00 38.43 ? 289  GLU A O   1 
ATOM   1792  C  CB  . GLU A 1 246 ? 3.243   -12.410 31.927  1.00 35.41 ? 289  GLU A CB  1 
ATOM   1793  C  CG  . GLU A 1 246 ? 3.470   -10.927 31.733  1.00 35.60 ? 289  GLU A CG  1 
ATOM   1794  C  CD  . GLU A 1 246 ? 3.002   -10.123 32.921  1.00 35.18 ? 289  GLU A CD  1 
ATOM   1795  O  OE1 . GLU A 1 246 ? 3.661   -10.216 33.975  1.00 34.99 ? 289  GLU A OE1 1 
ATOM   1796  O  OE2 . GLU A 1 246 ? 1.982   -9.412  32.810  1.00 34.60 ? 289  GLU A OE2 1 
ATOM   1797  N  N   . PRO A 1 247 ? 3.907   -15.608 32.088  1.00 38.47 ? 290  PRO A N   1 
ATOM   1798  C  CA  . PRO A 1 247 ? 4.756   -15.470 33.282  1.00 39.39 ? 290  PRO A CA  1 
ATOM   1799  C  C   . PRO A 1 247 ? 6.152   -14.958 32.943  1.00 40.21 ? 290  PRO A C   1 
ATOM   1800  O  O   . PRO A 1 247 ? 6.579   -15.017 31.787  1.00 40.58 ? 290  PRO A O   1 
ATOM   1801  C  CB  . PRO A 1 247 ? 4.815   -16.898 33.842  1.00 39.65 ? 290  PRO A CB  1 
ATOM   1802  C  CG  . PRO A 1 247 ? 3.563   -17.529 33.351  1.00 39.09 ? 290  PRO A CG  1 
ATOM   1803  C  CD  . PRO A 1 247 ? 3.470   -17.010 31.939  1.00 38.83 ? 290  PRO A CD  1 
ATOM   1804  N  N   . GLU A 1 248 ? 6.864   -14.458 33.947  1.00 40.48 ? 291  GLU A N   1 
ATOM   1805  C  CA  . GLU A 1 248 ? 8.209   -13.971 33.707  1.00 41.00 ? 291  GLU A CA  1 
ATOM   1806  C  C   . GLU A 1 248 ? 9.028   -15.180 33.358  1.00 41.25 ? 291  GLU A C   1 
ATOM   1807  O  O   . GLU A 1 248 ? 9.943   -15.123 32.540  1.00 41.98 ? 291  GLU A O   1 
ATOM   1808  C  CB  . GLU A 1 248 ? 8.783   -13.326 34.959  1.00 41.42 ? 291  GLU A CB  1 
ATOM   1809  C  CG  . GLU A 1 248 ? 10.268  -13.017 34.850  1.00 41.55 ? 291  GLU A CG  1 
ATOM   1810  C  CD  . GLU A 1 248 ? 10.648  -12.368 33.520  1.00 41.61 ? 291  GLU A CD  1 
ATOM   1811  O  OE1 . GLU A 1 248 ? 9.985   -11.379 33.109  1.00 39.87 ? 291  GLU A OE1 1 
ATOM   1812  O  OE2 . GLU A 1 248 ? 11.622  -12.852 32.894  1.00 41.90 ? 291  GLU A OE2 1 
ATOM   1813  N  N   . GLU A 1 249 ? 8.660   -16.283 33.991  1.00 41.99 ? 292  GLU A N   1 
ATOM   1814  C  CA  . GLU A 1 249 ? 9.326   -17.558 33.851  1.00 43.08 ? 292  GLU A CA  1 
ATOM   1815  C  C   . GLU A 1 249 ? 9.460   -18.002 32.421  1.00 42.85 ? 292  GLU A C   1 
ATOM   1816  O  O   . GLU A 1 249 ? 10.506  -18.522 32.042  1.00 42.79 ? 292  GLU A O   1 
ATOM   1817  C  CB  . GLU A 1 249 ? 8.590   -18.623 34.671  1.00 44.22 ? 292  GLU A CB  1 
ATOM   1818  C  CG  . GLU A 1 249 ? 8.567   -18.332 36.163  1.00 44.38 ? 292  GLU A CG  1 
ATOM   1819  C  CD  . GLU A 1 249 ? 7.637   -17.196 36.552  1.00 45.25 ? 292  GLU A CD  1 
ATOM   1820  O  OE1 . GLU A 1 249 ? 8.030   -16.024 36.365  1.00 45.30 ? 292  GLU A OE1 1 
ATOM   1821  O  OE2 . GLU A 1 249 ? 6.523   -17.487 37.045  1.00 45.87 ? 292  GLU A OE2 1 
ATOM   1822  N  N   . LEU A 1 250 ? 8.417   -17.791 31.632  1.00 43.04 ? 293  LEU A N   1 
ATOM   1823  C  CA  . LEU A 1 250 ? 8.441   -18.270 30.253  1.00 44.08 ? 293  LEU A CA  1 
ATOM   1824  C  C   . LEU A 1 250 ? 9.528   -17.709 29.403  1.00 45.73 ? 293  LEU A C   1 
ATOM   1825  O  O   . LEU A 1 250 ? 10.463  -18.407 29.016  1.00 45.94 ? 293  LEU A O   1 
ATOM   1826  C  CB  . LEU A 1 250 ? 7.219   -17.826 29.448  1.00 42.38 ? 293  LEU A CB  1 
ATOM   1827  C  CG  . LEU A 1 250 ? 5.819   -18.204 29.909  1.00 41.44 ? 293  LEU A CG  1 
ATOM   1828  C  CD1 . LEU A 1 250 ? 4.828   -18.042 28.778  1.00 40.26 ? 293  LEU A CD1 1 
ATOM   1829  C  CD2 . LEU A 1 250 ? 5.783   -19.610 30.469  1.00 39.28 ? 293  LEU A CD2 1 
ATOM   1830  N  N   . ASN A 1 251 ? 9.405   -16.423 29.151  1.00 46.94 ? 294  ASN A N   1 
ATOM   1831  C  CA  . ASN A 1 251 ? 10.411  -15.764 28.366  1.00 47.58 ? 294  ASN A CA  1 
ATOM   1832  C  C   . ASN A 1 251 ? 11.732  -15.759 29.121  1.00 48.52 ? 294  ASN A C   1 
ATOM   1833  O  O   . ASN A 1 251 ? 11.842  -15.410 30.308  1.00 47.96 ? 294  ASN A O   1 
ATOM   1834  C  CB  . ASN A 1 251 ? 9.972   -14.379 27.957  1.00 45.64 ? 294  ASN A CB  1 
ATOM   1835  C  CG  . ASN A 1 251 ? 9.115   -13.807 29.043  1.00 44.57 ? 294  ASN A CG  1 
ATOM   1836  O  OD1 . ASN A 1 251 ? 7.916   -14.078 29.102  1.00 43.18 ? 294  ASN A OD1 1 
ATOM   1837  N  ND2 . ASN A 1 251 ? 9.730   -13.016 29.906  1.00 45.30 ? 294  ASN A ND2 1 
ATOM   1838  N  N   . GLN A 1 252 ? 12.720  -16.179 28.345  1.00 50.13 ? 295  GLN A N   1 
ATOM   1839  C  CA  . GLN A 1 252 ? 14.102  -16.386 28.715  1.00 51.97 ? 295  GLN A CA  1 
ATOM   1840  C  C   . GLN A 1 252 ? 14.834  -17.472 27.849  1.00 51.84 ? 295  GLN A C   1 
ATOM   1841  O  O   . GLN A 1 252 ? 14.517  -18.638 27.991  1.00 51.64 ? 295  GLN A O   1 
ATOM   1842  C  CB  . GLN A 1 252 ? 14.077  -16.727 30.218  1.00 53.36 ? 295  GLN A CB  1 
ATOM   1843  C  CG  . GLN A 1 252 ? 15.418  -17.059 30.828  1.00 54.65 ? 295  GLN A CG  1 
ATOM   1844  C  CD  . GLN A 1 252 ? 15.507  -18.505 31.291  1.00 55.50 ? 295  GLN A CD  1 
ATOM   1845  O  OE1 . GLN A 1 252 ? 16.224  -18.812 32.246  1.00 55.43 ? 295  GLN A OE1 1 
ATOM   1846  N  NE2 . GLN A 1 252 ? 14.860  -19.556 30.778  1.00 55.60 ? 295  GLN A NE2 1 
ATOM   1847  N  N   . THR A 1 253 ? 15.788  -17.086 26.995  1.00 51.35 ? 296  THR A N   1 
ATOM   1848  C  CA  . THR A 1 253 ? 16.433  -18.107 26.143  1.00 51.59 ? 296  THR A CA  1 
ATOM   1849  C  C   . THR A 1 253 ? 17.718  -17.595 25.515  1.00 51.46 ? 296  THR A C   1 
ATOM   1850  O  O   . THR A 1 253 ? 17.909  -16.389 25.392  1.00 51.32 ? 296  THR A O   1 
ATOM   1851  C  CB  . THR A 1 253 ? 15.442  -18.572 25.042  1.00 51.38 ? 296  THR A CB  1 
ATOM   1852  O  OG1 . THR A 1 253 ? 16.103  -19.451 24.125  1.00 50.07 ? 296  THR A OG1 1 
ATOM   1853  C  CG2 . THR A 1 253 ? 14.886  -17.370 24.287  1.00 50.27 ? 296  THR A CG2 1 
ATOM   1854  N  N   . GLU A 1 254 ? 18.567  -18.523 25.095  1.00 51.12 ? 297  GLU A N   1 
ATOM   1855  C  CA  . GLU A 1 254 ? 19.746  -18.160 24.335  1.00 50.25 ? 297  GLU A CA  1 
ATOM   1856  C  C   . GLU A 1 254 ? 19.187  -17.951 22.923  1.00 51.13 ? 297  GLU A C   1 
ATOM   1857  O  O   . GLU A 1 254 ? 19.460  -18.756 22.034  1.00 51.59 ? 297  GLU A O   1 
ATOM   1858  C  CB  . GLU A 1 254 ? 20.826  -19.242 24.321  1.00 47.46 ? 297  GLU A CB  1 
ATOM   1859  C  CG  . GLU A 1 254 ? 21.263  -19.760 25.678  1.00 43.47 ? 297  GLU A CG  1 
ATOM   1860  C  CD  . GLU A 1 254 ? 21.652  -18.643 26.622  1.00 41.45 ? 297  GLU A CD  1 
ATOM   1861  O  OE1 . GLU A 1 254 ? 22.532  -18.871 27.485  1.00 40.13 ? 297  GLU A OE1 1 
ATOM   1862  O  OE2 . GLU A 1 254 ? 21.081  -17.548 26.492  1.00 37.56 ? 297  GLU A OE2 1 
ATOM   1863  N  N   . GLN A 1 255 ? 18.430  -16.890 22.736  1.00 51.27 ? 298  GLN A N   1 
ATOM   1864  C  CA  . GLN A 1 255 ? 17.846  -16.566 21.418  1.00 50.55 ? 298  GLN A CA  1 
ATOM   1865  C  C   . GLN A 1 255 ? 17.815  -15.044 21.264  1.00 49.79 ? 298  GLN A C   1 
ATOM   1866  O  O   . GLN A 1 255 ? 17.314  -14.520 20.262  1.00 50.43 ? 298  GLN A O   1 
ATOM   1867  C  CB  . GLN A 1 255 ? 16.413  -17.114 21.233  1.00 50.24 ? 298  GLN A CB  1 
ATOM   1868  C  CG  . GLN A 1 255 ? 15.733  -16.641 19.944  1.00 50.73 ? 298  GLN A CG  1 
ATOM   1869  C  CD  . GLN A 1 255 ? 14.208  -16.739 19.903  1.00 50.79 ? 298  GLN A CD  1 
ATOM   1870  O  OE1 . GLN A 1 255 ? 13.591  -17.480 20.673  1.00 51.27 ? 298  GLN A OE1 1 
ATOM   1871  N  NE2 . GLN A 1 255 ? 13.413  -16.069 19.094  1.00 49.61 ? 298  GLN A NE2 1 
ATOM   1872  N  N   . THR A 1 256 ? 18.376  -14.336 22.229  1.00 48.10 ? 299  THR A N   1 
ATOM   1873  C  CA  . THR A 1 256 ? 18.312  -12.852 22.290  1.00 45.66 ? 299  THR A CA  1 
ATOM   1874  C  C   . THR A 1 256 ? 17.851  -12.112 21.022  1.00 42.17 ? 299  THR A C   1 
ATOM   1875  O  O   . THR A 1 256 ? 16.882  -11.347 21.106  1.00 41.57 ? 299  THR A O   1 
ATOM   1876  C  CB  . THR A 1 256 ? 19.656  -12.238 22.737  1.00 47.13 ? 299  THR A CB  1 
ATOM   1877  O  OG1 . THR A 1 256 ? 19.993  -12.753 24.029  1.00 48.06 ? 299  THR A OG1 1 
ATOM   1878  C  CG2 . THR A 1 256 ? 19.553  -10.723 22.779  1.00 45.66 ? 299  THR A CG2 1 
ATOM   1879  N  N   . THR A 1 257 ? 18.498  -12.278 19.858  1.00 39.23 ? 300  THR A N   1 
ATOM   1880  C  CA  . THR A 1 257 ? 18.174  -11.612 18.601  1.00 35.70 ? 300  THR A CA  1 
ATOM   1881  C  C   . THR A 1 257 ? 17.416  -12.539 17.659  1.00 34.87 ? 300  THR A C   1 
ATOM   1882  O  O   . THR A 1 257 ? 17.662  -13.744 17.631  1.00 35.36 ? 300  THR A O   1 
ATOM   1883  C  CB  . THR A 1 257 ? 19.448  -11.128 17.878  1.00 34.48 ? 300  THR A CB  1 
ATOM   1884  O  OG1 . THR A 1 257 ? 20.412  -12.187 17.844  1.00 31.50 ? 300  THR A OG1 1 
ATOM   1885  C  CG2 . THR A 1 257 ? 20.027  -9.922  18.576  1.00 33.15 ? 300  THR A CG2 1 
ATOM   1886  N  N   . TYR A 1 258 ? 16.490  -11.971 16.894  1.00 32.28 ? 301  TYR A N   1 
ATOM   1887  C  CA  . TYR A 1 258 ? 15.717  -12.749 15.938  1.00 29.50 ? 301  TYR A CA  1 
ATOM   1888  C  C   . TYR A 1 258 ? 15.679  -12.019 14.604  1.00 27.98 ? 301  TYR A C   1 
ATOM   1889  O  O   . TYR A 1 258 ? 16.500  -11.142 14.378  1.00 27.66 ? 301  TYR A O   1 
ATOM   1890  C  CB  . TYR A 1 258 ? 14.315  -13.024 16.487  1.00 29.56 ? 301  TYR A CB  1 
ATOM   1891  C  CG  . TYR A 1 258 ? 13.714  -11.889 17.281  1.00 29.57 ? 301  TYR A CG  1 
ATOM   1892  C  CD1 . TYR A 1 258 ? 13.059  -10.840 16.644  1.00 28.82 ? 301  TYR A CD1 1 
ATOM   1893  C  CD2 . TYR A 1 258 ? 13.787  -11.872 18.681  1.00 30.27 ? 301  TYR A CD2 1 
ATOM   1894  C  CE1 . TYR A 1 258 ? 12.488  -9.810  17.375  1.00 29.50 ? 301  TYR A CE1 1 
ATOM   1895  C  CE2 . TYR A 1 258 ? 13.225  -10.846 19.418  1.00 29.18 ? 301  TYR A CE2 1 
ATOM   1896  C  CZ  . TYR A 1 258 ? 12.580  -9.824  18.764  1.00 29.40 ? 301  TYR A CZ  1 
ATOM   1897  O  OH  . TYR A 1 258 ? 12.031  -8.820  19.522  1.00 31.03 ? 301  TYR A OH  1 
ATOM   1898  N  N   . GLU A 1 259 ? 14.756  -12.366 13.716  1.00 26.06 ? 302  GLU A N   1 
ATOM   1899  C  CA  . GLU A 1 259 ? 14.725  -11.696 12.418  1.00 25.57 ? 302  GLU A CA  1 
ATOM   1900  C  C   . GLU A 1 259 ? 13.390  -11.008 12.133  1.00 24.56 ? 302  GLU A C   1 
ATOM   1901  O  O   . GLU A 1 259 ? 13.252  -10.254 11.160  1.00 24.65 ? 302  GLU A O   1 
ATOM   1902  C  CB  . GLU A 1 259 ? 15.065  -12.700 11.302  1.00 26.19 ? 302  GLU A CB  1 
ATOM   1903  C  CG  . GLU A 1 259 ? 16.370  -13.501 11.527  1.00 25.90 ? 302  GLU A CG  1 
ATOM   1904  C  CD  . GLU A 1 259 ? 17.656  -12.705 11.263  1.00 24.86 ? 302  GLU A CD  1 
ATOM   1905  O  OE1 . GLU A 1 259 ? 17.577  -11.489 11.003  1.00 25.09 ? 302  GLU A OE1 1 
ATOM   1906  O  OE2 . GLU A 1 259 ? 18.754  -13.297 11.314  1.00 23.98 ? 302  GLU A OE2 1 
ATOM   1907  N  N   . VAL A 1 260 ? 12.400  -11.271 12.968  1.00 20.62 ? 303  VAL A N   1 
ATOM   1908  C  CA  . VAL A 1 260 ? 11.120  -10.635 12.772  1.00 18.64 ? 303  VAL A CA  1 
ATOM   1909  C  C   . VAL A 1 260 ? 11.375  -9.210  13.187  1.00 18.69 ? 303  VAL A C   1 
ATOM   1910  O  O   . VAL A 1 260 ? 11.834  -8.976  14.295  1.00 19.54 ? 303  VAL A O   1 
ATOM   1911  C  CB  . VAL A 1 260 ? 10.079  -11.260 13.676  1.00 18.27 ? 303  VAL A CB  1 
ATOM   1912  C  CG1 . VAL A 1 260 ? 8.734   -10.608 13.449  1.00 17.77 ? 303  VAL A CG1 1 
ATOM   1913  C  CG2 . VAL A 1 260 ? 10.024  -12.738 13.433  1.00 16.95 ? 303  VAL A CG2 1 
ATOM   1914  N  N   . GLU A 1 261 ? 11.104  -8.250  12.315  1.00 18.97 ? 304  GLU A N   1 
ATOM   1915  C  CA  . GLU A 1 261 ? 11.385  -6.859  12.665  1.00 18.58 ? 304  GLU A CA  1 
ATOM   1916  C  C   . GLU A 1 261 ? 10.197  -6.079  13.194  1.00 19.69 ? 304  GLU A C   1 
ATOM   1917  O  O   . GLU A 1 261 ? 9.180   -5.984  12.524  1.00 22.15 ? 304  GLU A O   1 
ATOM   1918  C  CB  . GLU A 1 261 ? 11.964  -6.125  11.453  1.00 15.71 ? 304  GLU A CB  1 
ATOM   1919  C  CG  . GLU A 1 261 ? 13.093  -6.892  10.779  1.00 16.47 ? 304  GLU A CG  1 
ATOM   1920  C  CD  . GLU A 1 261 ? 13.531  -6.296  9.447   1.00 17.23 ? 304  GLU A CD  1 
ATOM   1921  O  OE1 . GLU A 1 261 ? 14.223  -7.011  8.692   1.00 18.77 ? 304  GLU A OE1 1 
ATOM   1922  O  OE2 . GLU A 1 261 ? 13.202  -5.124  9.150   1.00 17.77 ? 304  GLU A OE2 1 
ATOM   1923  N  N   . GLY A 1 262 ? 10.320  -5.525  14.399  1.00 19.84 ? 305  GLY A N   1 
ATOM   1924  C  CA  . GLY A 1 262 ? 9.244   -4.717  14.948  1.00 18.13 ? 305  GLY A CA  1 
ATOM   1925  C  C   . GLY A 1 262 ? 8.608   -5.164  16.249  1.00 18.49 ? 305  GLY A C   1 
ATOM   1926  O  O   . GLY A 1 262 ? 7.914   -4.381  16.905  1.00 17.46 ? 305  GLY A O   1 
ATOM   1927  N  N   . ILE A 1 263 ? 8.841   -6.408  16.648  1.00 17.92 ? 306  ILE A N   1 
ATOM   1928  C  CA  . ILE A 1 263 ? 8.219   -6.905  17.866  1.00 17.99 ? 306  ILE A CA  1 
ATOM   1929  C  C   . ILE A 1 263 ? 9.228   -7.298  18.914  1.00 18.82 ? 306  ILE A C   1 
ATOM   1930  O  O   . ILE A 1 263 ? 10.358  -7.581  18.581  1.00 17.17 ? 306  ILE A O   1 
ATOM   1931  C  CB  . ILE A 1 263 ? 7.344   -8.154  17.580  1.00 19.36 ? 306  ILE A CB  1 
ATOM   1932  C  CG1 . ILE A 1 263 ? 8.154   -9.206  16.818  1.00 16.96 ? 306  ILE A CG1 1 
ATOM   1933  C  CG2 . ILE A 1 263 ? 6.114   -7.764  16.799  1.00 17.89 ? 306  ILE A CG2 1 
ATOM   1934  C  CD1 . ILE A 1 263 ? 7.500   -10.539 16.798  1.00 15.84 ? 306  ILE A CD1 1 
ATOM   1935  N  N   . GLY A 1 264 ? 8.801   -7.323  20.175  1.00 21.35 ? 307  GLY A N   1 
ATOM   1936  C  CA  . GLY A 1 264 ? 9.680   -7.721  21.264  1.00 25.00 ? 307  GLY A CA  1 
ATOM   1937  C  C   . GLY A 1 264 ? 10.816  -6.768  21.569  1.00 26.56 ? 307  GLY A C   1 
ATOM   1938  O  O   . GLY A 1 264 ? 11.582  -6.404  20.685  1.00 27.02 ? 307  GLY A O   1 
ATOM   1939  N  N   . TYR A 1 265 ? 10.936  -6.374  22.830  1.00 28.90 ? 308  TYR A N   1 
ATOM   1940  C  CA  . TYR A 1 265 ? 11.986  -5.451  23.233  1.00 30.23 ? 308  TYR A CA  1 
ATOM   1941  C  C   . TYR A 1 265 ? 12.680  -6.027  24.463  1.00 30.30 ? 308  TYR A C   1 
ATOM   1942  O  O   . TYR A 1 265 ? 12.136  -6.910  25.121  1.00 29.65 ? 308  TYR A O   1 
ATOM   1943  C  CB  . TYR A 1 265 ? 11.359  -4.090  23.556  1.00 31.07 ? 308  TYR A CB  1 
ATOM   1944  C  CG  . TYR A 1 265 ? 12.227  -2.888  23.248  1.00 33.28 ? 308  TYR A CG  1 
ATOM   1945  C  CD1 . TYR A 1 265 ? 12.744  -2.688  21.970  1.00 32.74 ? 308  TYR A CD1 1 
ATOM   1946  C  CD2 . TYR A 1 265 ? 12.484  -1.917  24.226  1.00 33.80 ? 308  TYR A CD2 1 
ATOM   1947  C  CE1 . TYR A 1 265 ? 13.491  -1.551  21.662  1.00 34.29 ? 308  TYR A CE1 1 
ATOM   1948  C  CE2 . TYR A 1 265 ? 13.231  -0.768  23.934  1.00 33.27 ? 308  TYR A CE2 1 
ATOM   1949  C  CZ  . TYR A 1 265 ? 13.730  -0.588  22.643  1.00 34.49 ? 308  TYR A CZ  1 
ATOM   1950  O  OH  . TYR A 1 265 ? 14.425  0.564   22.310  1.00 33.56 ? 308  TYR A OH  1 
ATOM   1951  N  N   . ASP A 1 266 ? 13.883  -5.543  24.762  1.00 31.36 ? 309  ASP A N   1 
ATOM   1952  C  CA  . ASP A 1 266 ? 14.627  -6.009  25.937  1.00 31.52 ? 309  ASP A CA  1 
ATOM   1953  C  C   . ASP A 1 266 ? 14.145  -5.303  27.211  1.00 31.51 ? 309  ASP A C   1 
ATOM   1954  O  O   . ASP A 1 266 ? 14.305  -5.825  28.309  1.00 31.01 ? 309  ASP A O   1 
ATOM   1955  C  CB  . ASP A 1 266 ? 16.144  -5.770  25.754  1.00 31.36 ? 309  ASP A CB  1 
ATOM   1956  C  CG  . ASP A 1 266 ? 16.495  -4.470  25.068  1.00 31.64 ? 309  ASP A CG  1 
ATOM   1957  O  OD1 . ASP A 1 266 ? 15.836  -3.461  25.374  1.00 30.74 ? 309  ASP A OD1 1 
ATOM   1958  O  OD2 . ASP A 1 266 ? 17.420  -4.464  24.229  1.00 31.27 ? 309  ASP A OD2 1 
ATOM   1959  N  N   . PHE A 1 267 ? 13.585  -4.119  27.045  1.00 32.38 ? 310  PHE A N   1 
ATOM   1960  C  CA  . PHE A 1 267 ? 12.988  -3.358  28.125  1.00 33.63 ? 310  PHE A CA  1 
ATOM   1961  C  C   . PHE A 1 267 ? 11.528  -3.745  28.256  1.00 32.26 ? 310  PHE A C   1 
ATOM   1962  O  O   . PHE A 1 267 ? 11.046  -4.673  27.600  1.00 33.56 ? 310  PHE A O   1 
ATOM   1963  C  CB  . PHE A 1 267 ? 12.943  -1.869  27.790  1.00 36.01 ? 310  PHE A CB  1 
ATOM   1964  C  CG  . PHE A 1 267 ? 14.260  -1.134  27.767  1.00 39.53 ? 310  PHE A CG  1 
ATOM   1965  C  CD1 . PHE A 1 267 ? 14.343  0.169   27.272  1.00 40.63 ? 310  PHE A CD1 1 
ATOM   1966  C  CD2 . PHE A 1 267 ? 15.419  -1.719  28.246  1.00 41.07 ? 310  PHE A CD2 1 
ATOM   1967  C  CE1 . PHE A 1 267 ? 15.563  0.856   27.250  1.00 41.50 ? 310  PHE A CE1 1 
ATOM   1968  C  CE2 . PHE A 1 267 ? 16.620  -1.042  28.231  1.00 41.73 ? 310  PHE A CE2 1 
ATOM   1969  C  CZ  . PHE A 1 267 ? 16.691  0.234   27.731  1.00 42.49 ? 310  PHE A CZ  1 
ATOM   1970  N  N   . ILE A 1 268 ? 10.873  -3.011  29.110  1.00 29.58 ? 311  ILE A N   1 
ATOM   1971  C  CA  . ILE A 1 268 ? 9.479   -3.139  29.348  1.00 27.29 ? 311  ILE A CA  1 
ATOM   1972  C  C   . ILE A 1 268 ? 8.922   -1.713  29.222  1.00 26.09 ? 311  ILE A C   1 
ATOM   1973  O  O   . ILE A 1 268 ? 8.641   -1.052  30.209  1.00 25.24 ? 311  ILE A O   1 
ATOM   1974  C  CB  . ILE A 1 268 ? 9.180   -3.689  30.743  1.00 27.49 ? 311  ILE A CB  1 
ATOM   1975  C  CG1 . ILE A 1 268 ? 9.879   -5.027  30.906  1.00 29.71 ? 311  ILE A CG1 1 
ATOM   1976  C  CG2 . ILE A 1 268 ? 7.685   -3.800  30.991  1.00 25.95 ? 311  ILE A CG2 1 
ATOM   1977  C  CD1 . ILE A 1 268 ? 9.183   -5.960  31.867  1.00 31.32 ? 311  ILE A CD1 1 
ATOM   1978  N  N   . PRO A 1 269 ? 8.761   -1.279  27.973  1.00 25.30 ? 312  PRO A N   1 
ATOM   1979  C  CA  . PRO A 1 269 ? 8.263   0.039   27.589  1.00 25.15 ? 312  PRO A CA  1 
ATOM   1980  C  C   . PRO A 1 269 ? 7.264   0.513   28.585  1.00 24.64 ? 312  PRO A C   1 
ATOM   1981  O  O   . PRO A 1 269 ? 6.384   -0.245  28.980  1.00 25.64 ? 312  PRO A O   1 
ATOM   1982  C  CB  . PRO A 1 269 ? 7.634   -0.215  26.235  1.00 25.86 ? 312  PRO A CB  1 
ATOM   1983  C  CG  . PRO A 1 269 ? 8.530   -1.248  25.666  1.00 27.81 ? 312  PRO A CG  1 
ATOM   1984  C  CD  . PRO A 1 269 ? 8.689   -2.201  26.826  1.00 26.02 ? 312  PRO A CD  1 
ATOM   1985  N  N   . THR A 1 270 ? 7.394   1.759   29.008  1.00 22.50 ? 313  THR A N   1 
ATOM   1986  C  CA  . THR A 1 270 ? 6.441   2.263   29.973  1.00 21.69 ? 313  THR A CA  1 
ATOM   1987  C  C   . THR A 1 270 ? 5.083   2.333   29.286  1.00 20.23 ? 313  THR A C   1 
ATOM   1988  O  O   . THR A 1 270 ? 4.050   2.342   29.967  1.00 17.50 ? 313  THR A O   1 
ATOM   1989  C  CB  . THR A 1 270 ? 6.818   3.653   30.485  1.00 22.39 ? 313  THR A CB  1 
ATOM   1990  O  OG1 . THR A 1 270 ? 6.468   4.630   29.501  1.00 23.75 ? 313  THR A OG1 1 
ATOM   1991  C  CG2 . THR A 1 270 ? 8.314   3.723   30.765  1.00 22.81 ? 313  THR A CG2 1 
ATOM   1992  N  N   . VAL A 1 271 ? 5.091   2.367   27.943  1.00 18.61 ? 314  VAL A N   1 
ATOM   1993  C  CA  . VAL A 1 271 ? 3.845   2.421   27.162  1.00 16.04 ? 314  VAL A CA  1 
ATOM   1994  C  C   . VAL A 1 271 ? 3.048   1.114   27.176  1.00 16.20 ? 314  VAL A C   1 
ATOM   1995  O  O   . VAL A 1 271 ? 1.833   1.117   26.959  1.00 16.67 ? 314  VAL A O   1 
ATOM   1996  C  CB  . VAL A 1 271 ? 4.070   2.787   25.677  1.00 13.84 ? 314  VAL A CB  1 
ATOM   1997  C  CG1 . VAL A 1 271 ? 3.615   4.199   25.412  1.00 10.83 ? 314  VAL A CG1 1 
ATOM   1998  C  CG2 . VAL A 1 271 ? 5.509   2.611   25.310  1.00 13.69 ? 314  VAL A CG2 1 
ATOM   1999  N  N   . LEU A 1 272 ? 3.709   -0.004  27.432  1.00 14.16 ? 315  LEU A N   1 
ATOM   2000  C  CA  . LEU A 1 272 ? 2.980   -1.254  27.454  1.00 13.78 ? 315  LEU A CA  1 
ATOM   2001  C  C   . LEU A 1 272 ? 2.444   -1.584  28.836  1.00 13.32 ? 315  LEU A C   1 
ATOM   2002  O  O   . LEU A 1 272 ? 3.126   -1.378  29.831  1.00 14.46 ? 315  LEU A O   1 
ATOM   2003  C  CB  . LEU A 1 272 ? 3.867   -2.407  26.959  1.00 12.12 ? 315  LEU A CB  1 
ATOM   2004  C  CG  . LEU A 1 272 ? 3.362   -3.780  27.402  1.00 9.71  ? 315  LEU A CG  1 
ATOM   2005  C  CD1 . LEU A 1 272 ? 2.004   -4.044  26.834  1.00 8.69  ? 315  LEU A CD1 1 
ATOM   2006  C  CD2 . LEU A 1 272 ? 4.327   -4.834  26.990  1.00 13.28 ? 315  LEU A CD2 1 
ATOM   2007  N  N   . ASP A 1 273 ? 1.219   -2.099  28.886  1.00 12.67 ? 316  ASP A N   1 
ATOM   2008  C  CA  . ASP A 1 273 ? 0.613   -2.510  30.143  1.00 11.59 ? 316  ASP A CA  1 
ATOM   2009  C  C   . ASP A 1 273 ? 0.180   -3.957  30.044  1.00 10.85 ? 316  ASP A C   1 
ATOM   2010  O  O   . ASP A 1 273 ? -0.864  -4.240  29.484  1.00 12.16 ? 316  ASP A O   1 
ATOM   2011  C  CB  . ASP A 1 273 ? -0.613  -1.674  30.462  1.00 12.97 ? 316  ASP A CB  1 
ATOM   2012  C  CG  . ASP A 1 273 ? -1.412  -2.237  31.628  1.00 15.75 ? 316  ASP A CG  1 
ATOM   2013  O  OD1 . ASP A 1 273 ? -2.533  -1.738  31.880  1.00 15.06 ? 316  ASP A OD1 1 
ATOM   2014  O  OD2 . ASP A 1 273 ? -0.922  -3.176  32.296  1.00 15.49 ? 316  ASP A OD2 1 
ATOM   2015  N  N   . ARG A 1 274 ? 0.978   -4.861  30.600  1.00 9.97  ? 317  ARG A N   1 
ATOM   2016  C  CA  . ARG A 1 274 ? 0.695   -6.297  30.595  1.00 9.71  ? 317  ARG A CA  1 
ATOM   2017  C  C   . ARG A 1 274 ? -0.614  -6.722  31.257  1.00 10.98 ? 317  ARG A C   1 
ATOM   2018  O  O   . ARG A 1 274 ? -1.038  -7.867  31.108  1.00 10.69 ? 317  ARG A O   1 
ATOM   2019  C  CB  . ARG A 1 274 ? 1.796   -7.058  31.327  1.00 10.15 ? 317  ARG A CB  1 
ATOM   2020  C  CG  . ARG A 1 274 ? 2.976   -7.482  30.524  1.00 8.98  ? 317  ARG A CG  1 
ATOM   2021  C  CD  . ARG A 1 274 ? 4.056   -6.473  30.545  1.00 6.76  ? 317  ARG A CD  1 
ATOM   2022  N  NE  . ARG A 1 274 ? 5.340   -7.133  30.362  1.00 8.05  ? 317  ARG A NE  1 
ATOM   2023  C  CZ  . ARG A 1 274 ? 5.883   -7.967  31.246  1.00 5.37  ? 317  ARG A CZ  1 
ATOM   2024  N  NH1 . ARG A 1 274 ? 5.252   -8.246  32.377  1.00 3.95  ? 317  ARG A NH1 1 
ATOM   2025  N  NH2 . ARG A 1 274 ? 7.069   -8.507  31.007  1.00 3.95  ? 317  ARG A NH2 1 
ATOM   2026  N  N   . THR A 1 275 ? -1.237  -5.826  32.008  1.00 12.20 ? 318  THR A N   1 
ATOM   2027  C  CA  . THR A 1 275 ? -2.462  -6.178  32.745  1.00 14.99 ? 318  THR A CA  1 
ATOM   2028  C  C   . THR A 1 275 ? -3.622  -6.546  31.819  1.00 15.37 ? 318  THR A C   1 
ATOM   2029  O  O   . THR A 1 275 ? -4.123  -7.677  31.840  1.00 15.52 ? 318  THR A O   1 
ATOM   2030  C  CB  . THR A 1 275 ? -2.918  -5.047  33.654  1.00 15.23 ? 318  THR A CB  1 
ATOM   2031  O  OG1 . THR A 1 275 ? -2.031  -4.950  34.770  1.00 15.61 ? 318  THR A OG1 1 
ATOM   2032  C  CG2 . THR A 1 275 ? -4.338  -5.302  34.134  1.00 14.36 ? 318  THR A CG2 1 
ATOM   2033  N  N   . VAL A 1 276 ? -4.025  -5.586  30.973  1.00 15.05 ? 319  VAL A N   1 
ATOM   2034  C  CA  . VAL A 1 276 ? -5.134  -5.806  30.066  1.00 15.27 ? 319  VAL A CA  1 
ATOM   2035  C  C   . VAL A 1 276 ? -4.911  -7.072  29.244  1.00 15.18 ? 319  VAL A C   1 
ATOM   2036  O  O   . VAL A 1 276 ? -5.870  -7.617  28.713  1.00 16.21 ? 319  VAL A O   1 
ATOM   2037  C  CB  . VAL A 1 276 ? -5.422  -4.574  29.196  1.00 16.22 ? 319  VAL A CB  1 
ATOM   2038  C  CG1 . VAL A 1 276 ? -5.979  -3.445  30.059  1.00 17.78 ? 319  VAL A CG1 1 
ATOM   2039  C  CG2 . VAL A 1 276 ? -4.181  -4.135  28.454  1.00 17.47 ? 319  VAL A CG2 1 
ATOM   2040  N  N   . VAL A 1 277 ? -3.702  -7.585  29.111  1.00 14.50 ? 320  VAL A N   1 
ATOM   2041  C  CA  . VAL A 1 277 ? -3.418  -8.792  28.312  1.00 15.88 ? 320  VAL A CA  1 
ATOM   2042  C  C   . VAL A 1 277 ? -3.986  -10.040 29.066  1.00 17.36 ? 320  VAL A C   1 
ATOM   2043  O  O   . VAL A 1 277 ? -3.779  -10.158 30.287  1.00 17.74 ? 320  VAL A O   1 
ATOM   2044  C  CB  . VAL A 1 277 ? -1.892  -8.804  27.979  1.00 14.94 ? 320  VAL A CB  1 
ATOM   2045  C  CG1 . VAL A 1 277 ? -1.536  -9.944  27.037  1.00 12.61 ? 320  VAL A CG1 1 
ATOM   2046  C  CG2 . VAL A 1 277 ? -1.485  -7.462  27.364  1.00 14.54 ? 320  VAL A CG2 1 
ATOM   2047  N  N   . ASP A 1 278 ? -4.684  -10.938 28.420  1.00 17.86 ? 321  ASP A N   1 
ATOM   2048  C  CA  . ASP A 1 278 ? -5.223  -12.089 29.118  1.00 19.33 ? 321  ASP A CA  1 
ATOM   2049  C  C   . ASP A 1 278 ? -4.290  -13.307 29.010  1.00 19.23 ? 321  ASP A C   1 
ATOM   2050  O  O   . ASP A 1 278 ? -4.473  -14.318 29.686  1.00 18.79 ? 321  ASP A O   1 
ATOM   2051  C  CB  . ASP A 1 278 ? -6.608  -12.468 28.575  1.00 20.70 ? 321  ASP A CB  1 
ATOM   2052  C  CG  . ASP A 1 278 ? -7.632  -11.344 28.678  1.00 24.66 ? 321  ASP A CG  1 
ATOM   2053  O  OD1 . ASP A 1 278 ? -8.026  -11.016 29.815  1.00 25.19 ? 321  ASP A OD1 1 
ATOM   2054  O  OD2 . ASP A 1 278 ? -8.042  -10.784 27.638  1.00 26.00 ? 321  ASP A OD2 1 
ATOM   2055  N  N   . LYS A 1 279 ? -3.276  -13.166 28.155  1.00 18.77 ? 322  LYS A N   1 
ATOM   2056  C  CA  . LYS A 1 279 ? -2.325  -14.259 27.936  1.00 18.85 ? 322  LYS A CA  1 
ATOM   2057  C  C   . LYS A 1 279 ? -1.216  -13.903 26.951  1.00 20.15 ? 322  LYS A C   1 
ATOM   2058  O  O   . LYS A 1 279 ? -1.279  -12.868 26.302  1.00 22.17 ? 322  LYS A O   1 
ATOM   2059  C  CB  . LYS A 1 279 ? -3.055  -15.512 27.436  1.00 16.90 ? 322  LYS A CB  1 
ATOM   2060  C  CG  . LYS A 1 279 ? -2.121  -16.695 27.290  1.00 18.05 ? 322  LYS A CG  1 
ATOM   2061  C  CD  . LYS A 1 279 ? -2.779  -17.814 26.502  1.00 18.39 ? 322  LYS A CD  1 
ATOM   2062  C  CE  . LYS A 1 279 ? -3.541  -18.773 27.396  1.00 16.51 ? 322  LYS A CE  1 
ATOM   2063  N  NZ  . LYS A 1 279 ? -3.764  -20.092 26.754  1.00 13.65 ? 322  LYS A NZ  1 
ATOM   2064  N  N   . TRP A 1 280 ? -0.209  -14.773 26.836  1.00 20.53 ? 323  TRP A N   1 
ATOM   2065  C  CA  . TRP A 1 280 ? 0.927   -14.552 25.931  1.00 19.91 ? 323  TRP A CA  1 
ATOM   2066  C  C   . TRP A 1 280 ? 1.408   -15.795 25.188  1.00 20.44 ? 323  TRP A C   1 
ATOM   2067  O  O   . TRP A 1 280 ? 1.535   -16.865 25.776  1.00 20.72 ? 323  TRP A O   1 
ATOM   2068  C  CB  . TRP A 1 280 ? 2.123   -13.993 26.708  1.00 19.92 ? 323  TRP A CB  1 
ATOM   2069  C  CG  . TRP A 1 280 ? 1.874   -12.664 27.339  1.00 20.78 ? 323  TRP A CG  1 
ATOM   2070  C  CD1 . TRP A 1 280 ? 1.160   -12.408 28.474  1.00 20.76 ? 323  TRP A CD1 1 
ATOM   2071  C  CD2 . TRP A 1 280 ? 2.293   -11.394 26.832  1.00 22.08 ? 323  TRP A CD2 1 
ATOM   2072  N  NE1 . TRP A 1 280 ? 1.105   -11.050 28.704  1.00 22.12 ? 323  TRP A NE1 1 
ATOM   2073  C  CE2 . TRP A 1 280 ? 1.792   -10.407 27.709  1.00 21.92 ? 323  TRP A CE2 1 
ATOM   2074  C  CE3 . TRP A 1 280 ? 3.043   -10.996 25.719  1.00 22.56 ? 323  TRP A CE3 1 
ATOM   2075  C  CZ2 . TRP A 1 280 ? 2.015   -9.053  27.508  1.00 21.98 ? 323  TRP A CZ2 1 
ATOM   2076  C  CZ3 . TRP A 1 280 ? 3.263   -9.652  25.521  1.00 23.52 ? 323  TRP A CZ3 1 
ATOM   2077  C  CH2 . TRP A 1 280 ? 2.750   -8.692  26.412  1.00 22.93 ? 323  TRP A CH2 1 
ATOM   2078  N  N   . PHE A 1 281 ? 1.689   -15.644 23.896  1.00 21.95 ? 324  PHE A N   1 
ATOM   2079  C  CA  . PHE A 1 281 ? 2.209   -16.740 23.078  1.00 23.24 ? 324  PHE A CA  1 
ATOM   2080  C  C   . PHE A 1 281 ? 3.607   -16.381 22.599  1.00 24.76 ? 324  PHE A C   1 
ATOM   2081  O  O   . PHE A 1 281 ? 3.861   -15.245 22.198  1.00 25.80 ? 324  PHE A O   1 
ATOM   2082  C  CB  . PHE A 1 281 ? 1.320   -16.994 21.866  1.00 24.45 ? 324  PHE A CB  1 
ATOM   2083  C  CG  . PHE A 1 281 ? 0.142   -17.881 22.155  1.00 27.25 ? 324  PHE A CG  1 
ATOM   2084  C  CD1 . PHE A 1 281 ? -0.991  -17.377 22.793  1.00 27.99 ? 324  PHE A CD1 1 
ATOM   2085  C  CD2 . PHE A 1 281 ? 0.179   -19.234 21.831  1.00 27.22 ? 324  PHE A CD2 1 
ATOM   2086  C  CE1 . PHE A 1 281 ? -2.062  -18.206 23.106  1.00 27.84 ? 324  PHE A CE1 1 
ATOM   2087  C  CE2 . PHE A 1 281 ? -0.889  -20.066 22.142  1.00 27.05 ? 324  PHE A CE2 1 
ATOM   2088  C  CZ  . PHE A 1 281 ? -2.012  -19.551 22.781  1.00 27.34 ? 324  PHE A CZ  1 
ATOM   2089  N  N   . LYS A 1 282 ? 4.524   -17.337 22.649  1.00 25.67 ? 325  LYS A N   1 
ATOM   2090  C  CA  . LYS A 1 282 ? 5.880   -17.065 22.191  1.00 28.38 ? 325  LYS A CA  1 
ATOM   2091  C  C   . LYS A 1 282 ? 6.168   -17.622 20.790  1.00 28.25 ? 325  LYS A C   1 
ATOM   2092  O  O   . LYS A 1 282 ? 6.605   -18.762 20.641  1.00 28.90 ? 325  LYS A O   1 
ATOM   2093  C  CB  . LYS A 1 282 ? 6.895   -17.621 23.200  1.00 30.65 ? 325  LYS A CB  1 
ATOM   2094  C  CG  . LYS A 1 282 ? 6.805   -17.003 24.610  1.00 30.79 ? 325  LYS A CG  1 
ATOM   2095  C  CD  . LYS A 1 282 ? 6.875   -15.460 24.599  1.00 29.91 ? 325  LYS A CD  1 
ATOM   2096  C  CE  . LYS A 1 282 ? 8.180   -14.921 24.013  1.00 31.47 ? 325  LYS A CE  1 
ATOM   2097  N  NZ  . LYS A 1 282 ? 9.373   -15.182 24.866  1.00 33.49 ? 325  LYS A NZ  1 
ATOM   2098  N  N   . SER A 1 283 ? 5.923   -16.814 19.764  1.00 28.44 ? 326  SER A N   1 
ATOM   2099  C  CA  . SER A 1 283 ? 6.166   -17.240 18.383  1.00 29.19 ? 326  SER A CA  1 
ATOM   2100  C  C   . SER A 1 283 ? 7.645   -17.196 18.021  1.00 28.67 ? 326  SER A C   1 
ATOM   2101  O  O   . SER A 1 283 ? 8.450   -16.670 18.779  1.00 29.36 ? 326  SER A O   1 
ATOM   2102  C  CB  . SER A 1 283 ? 5.395   -16.350 17.407  1.00 29.60 ? 326  SER A CB  1 
ATOM   2103  O  OG  . SER A 1 283 ? 5.930   -16.469 16.096  1.00 29.23 ? 326  SER A OG  1 
ATOM   2104  N  N   . ASN A 1 284 ? 8.003   -17.733 16.858  1.00 28.36 ? 327  ASN A N   1 
ATOM   2105  C  CA  . ASN A 1 284 ? 9.402   -17.723 16.435  1.00 28.00 ? 327  ASN A CA  1 
ATOM   2106  C  C   . ASN A 1 284 ? 9.603   -17.307 14.974  1.00 26.86 ? 327  ASN A C   1 
ATOM   2107  O  O   . ASN A 1 284 ? 8.642   -17.137 14.229  1.00 26.99 ? 327  ASN A O   1 
ATOM   2108  C  CB  . ASN A 1 284 ? 10.024  -19.092 16.661  1.00 31.20 ? 327  ASN A CB  1 
ATOM   2109  C  CG  . ASN A 1 284 ? 9.889   -19.982 15.465  1.00 32.94 ? 327  ASN A CG  1 
ATOM   2110  O  OD1 . ASN A 1 284 ? 10.458  -19.700 14.409  1.00 33.55 ? 327  ASN A OD1 1 
ATOM   2111  N  ND2 . ASN A 1 284 ? 9.132   -21.066 15.611  1.00 33.98 ? 327  ASN A ND2 1 
ATOM   2112  N  N   . ASP A 1 285 ? 10.864  -17.154 14.578  1.00 25.15 ? 328  ASP A N   1 
ATOM   2113  C  CA  . ASP A 1 285 ? 11.214  -16.732 13.232  1.00 23.91 ? 328  ASP A CA  1 
ATOM   2114  C  C   . ASP A 1 285 ? 10.665  -17.661 12.181  1.00 25.14 ? 328  ASP A C   1 
ATOM   2115  O  O   . ASP A 1 285 ? 9.839   -17.258 11.356  1.00 25.21 ? 328  ASP A O   1 
ATOM   2116  C  CB  . ASP A 1 285 ? 12.726  -16.648 13.094  1.00 24.48 ? 328  ASP A CB  1 
ATOM   2117  C  CG  . ASP A 1 285 ? 13.254  -15.252 13.336  1.00 23.52 ? 328  ASP A CG  1 
ATOM   2118  O  OD1 . ASP A 1 285 ? 14.491  -15.089 13.414  1.00 22.98 ? 328  ASP A OD1 1 
ATOM   2119  O  OD2 . ASP A 1 285 ? 12.430  -14.321 13.439  1.00 22.95 ? 328  ASP A OD2 1 
ATOM   2120  N  N   . GLU A 1 286 ? 11.149  -18.902 12.214  1.00 25.17 ? 329  GLU A N   1 
ATOM   2121  C  CA  . GLU A 1 286 ? 10.733  -19.963 11.296  1.00 24.56 ? 329  GLU A CA  1 
ATOM   2122  C  C   . GLU A 1 286 ? 9.248   -19.895 10.940  1.00 22.90 ? 329  GLU A C   1 
ATOM   2123  O  O   . GLU A 1 286 ? 8.883   -19.648 9.797   1.00 23.10 ? 329  GLU A O   1 
ATOM   2124  C  CB  . GLU A 1 286 ? 11.026  -21.331 11.927  1.00 26.84 ? 329  GLU A CB  1 
ATOM   2125  C  CG  . GLU A 1 286 ? 10.724  -22.543 11.032  1.00 29.45 ? 329  GLU A CG  1 
ATOM   2126  C  CD  . GLU A 1 286 ? 11.727  -22.709 9.885   1.00 30.82 ? 329  GLU A CD  1 
ATOM   2127  O  OE1 . GLU A 1 286 ? 12.946  -22.838 10.172  1.00 32.06 ? 329  GLU A OE1 1 
ATOM   2128  O  OE2 . GLU A 1 286 ? 11.298  -22.713 8.701   1.00 29.37 ? 329  GLU A OE2 1 
ATOM   2129  N  N   . GLU A 1 287 ? 8.398   -20.120 11.931  1.00 21.56 ? 330  GLU A N   1 
ATOM   2130  C  CA  . GLU A 1 287 ? 6.963   -20.106 11.715  1.00 21.15 ? 330  GLU A CA  1 
ATOM   2131  C  C   . GLU A 1 287 ? 6.466   -18.768 11.229  1.00 21.75 ? 330  GLU A C   1 
ATOM   2132  O  O   . GLU A 1 287 ? 5.646   -18.701 10.311  1.00 21.98 ? 330  GLU A O   1 
ATOM   2133  C  CB  . GLU A 1 287 ? 6.213   -20.486 12.996  1.00 20.29 ? 330  GLU A CB  1 
ATOM   2134  C  CG  . GLU A 1 287 ? 6.218   -19.449 14.100  1.00 16.96 ? 330  GLU A CG  1 
ATOM   2135  C  CD  . GLU A 1 287 ? 5.439   -19.923 15.311  1.00 18.65 ? 330  GLU A CD  1 
ATOM   2136  O  OE1 . GLU A 1 287 ? 5.814   -20.961 15.893  1.00 20.25 ? 330  GLU A OE1 1 
ATOM   2137  O  OE2 . GLU A 1 287 ? 4.446   -19.275 15.683  1.00 16.35 ? 330  GLU A OE2 1 
ATOM   2138  N  N   . ALA A 1 288 ? 6.961   -17.706 11.856  1.00 21.44 ? 331  ALA A N   1 
ATOM   2139  C  CA  . ALA A 1 288 ? 6.572   -16.345 11.508  1.00 20.69 ? 331  ALA A CA  1 
ATOM   2140  C  C   . ALA A 1 288 ? 6.548   -16.172 9.990   1.00 19.92 ? 331  ALA A C   1 
ATOM   2141  O  O   . ALA A 1 288 ? 5.540   -15.778 9.402   1.00 17.44 ? 331  ALA A O   1 
ATOM   2142  C  CB  . ALA A 1 288 ? 7.553   -15.354 12.140  1.00 20.20 ? 331  ALA A CB  1 
ATOM   2143  N  N   . PHE A 1 289 ? 7.678   -16.476 9.371   1.00 18.87 ? 332  PHE A N   1 
ATOM   2144  C  CA  . PHE A 1 289 ? 7.835   -16.380 7.939   1.00 19.32 ? 332  PHE A CA  1 
ATOM   2145  C  C   . PHE A 1 289 ? 7.029   -17.457 7.194   1.00 20.24 ? 332  PHE A C   1 
ATOM   2146  O  O   . PHE A 1 289 ? 6.457   -17.197 6.128   1.00 19.54 ? 332  PHE A O   1 
ATOM   2147  C  CB  . PHE A 1 289 ? 9.320   -16.476 7.639   1.00 20.05 ? 332  PHE A CB  1 
ATOM   2148  C  CG  . PHE A 1 289 ? 10.117  -15.374 8.264   1.00 19.04 ? 332  PHE A CG  1 
ATOM   2149  C  CD1 . PHE A 1 289 ? 11.435  -15.572 8.627   1.00 18.32 ? 332  PHE A CD1 1 
ATOM   2150  C  CD2 . PHE A 1 289 ? 9.546   -14.125 8.470   1.00 18.89 ? 332  PHE A CD2 1 
ATOM   2151  C  CE1 . PHE A 1 289 ? 12.175  -14.540 9.187   1.00 21.25 ? 332  PHE A CE1 1 
ATOM   2152  C  CE2 . PHE A 1 289 ? 10.280  -13.089 9.030   1.00 18.73 ? 332  PHE A CE2 1 
ATOM   2153  C  CZ  . PHE A 1 289 ? 11.594  -13.294 9.389   1.00 18.79 ? 332  PHE A CZ  1 
ATOM   2154  N  N   . THR A 1 290 ? 6.974   -18.659 7.756   1.00 19.82 ? 333  THR A N   1 
ATOM   2155  C  CA  . THR A 1 290 ? 6.208   -19.739 7.148   1.00 20.35 ? 333  THR A CA  1 
ATOM   2156  C  C   . THR A 1 290 ? 4.755   -19.270 6.901   1.00 20.77 ? 333  THR A C   1 
ATOM   2157  O  O   . THR A 1 290 ? 4.196   -19.434 5.810   1.00 22.86 ? 333  THR A O   1 
ATOM   2158  C  CB  . THR A 1 290 ? 6.199   -20.990 8.072   1.00 20.92 ? 333  THR A CB  1 
ATOM   2159  O  OG1 . THR A 1 290 ? 7.519   -21.545 8.154   1.00 19.77 ? 333  THR A OG1 1 
ATOM   2160  C  CG2 . THR A 1 290 ? 5.230   -22.048 7.549   1.00 20.67 ? 333  THR A CG2 1 
ATOM   2161  N  N   . PHE A 1 291 ? 4.145   -18.692 7.928   1.00 18.98 ? 334  PHE A N   1 
ATOM   2162  C  CA  . PHE A 1 291 ? 2.783   -18.207 7.811   1.00 15.90 ? 334  PHE A CA  1 
ATOM   2163  C  C   . PHE A 1 291 ? 2.754   -16.905 7.046   1.00 15.72 ? 334  PHE A C   1 
ATOM   2164  O  O   . PHE A 1 291 ? 1.710   -16.498 6.540   1.00 16.50 ? 334  PHE A O   1 
ATOM   2165  C  CB  . PHE A 1 291 ? 2.158   -17.992 9.194   1.00 11.84 ? 334  PHE A CB  1 
ATOM   2166  C  CG  . PHE A 1 291 ? 1.638   -19.246 9.831   1.00 7.32  ? 334  PHE A CG  1 
ATOM   2167  C  CD1 . PHE A 1 291 ? 2.510   -20.235 10.271  1.00 5.69  ? 334  PHE A CD1 1 
ATOM   2168  C  CD2 . PHE A 1 291 ? 0.272   -19.447 9.968   1.00 5.34  ? 334  PHE A CD2 1 
ATOM   2169  C  CE1 . PHE A 1 291 ? 2.025   -21.417 10.840  1.00 4.57  ? 334  PHE A CE1 1 
ATOM   2170  C  CE2 . PHE A 1 291 ? -0.214  -20.614 10.530  1.00 4.67  ? 334  PHE A CE2 1 
ATOM   2171  C  CZ  . PHE A 1 291 ? 0.668   -21.607 10.969  1.00 3.95  ? 334  PHE A CZ  1 
ATOM   2172  N  N   . ALA A 1 292 ? 3.901   -16.245 6.961   1.00 16.58 ? 335  ALA A N   1 
ATOM   2173  C  CA  . ALA A 1 292 ? 3.975   -14.969 6.259   1.00 17.58 ? 335  ALA A CA  1 
ATOM   2174  C  C   . ALA A 1 292 ? 3.736   -15.208 4.782   1.00 16.35 ? 335  ALA A C   1 
ATOM   2175  O  O   . ALA A 1 292 ? 2.798   -14.658 4.209   1.00 15.35 ? 335  ALA A O   1 
ATOM   2176  C  CB  . ALA A 1 292 ? 5.327   -14.312 6.489   1.00 18.76 ? 335  ALA A CB  1 
ATOM   2177  N  N   . ARG A 1 293 ? 4.584   -16.038 4.183   1.00 15.83 ? 336  ARG A N   1 
ATOM   2178  C  CA  . ARG A 1 293 ? 4.465   -16.399 2.773   1.00 16.60 ? 336  ARG A CA  1 
ATOM   2179  C  C   . ARG A 1 293 ? 3.107   -17.046 2.546   1.00 16.09 ? 336  ARG A C   1 
ATOM   2180  O  O   . ARG A 1 293 ? 2.524   -16.950 1.471   1.00 16.52 ? 336  ARG A O   1 
ATOM   2181  C  CB  . ARG A 1 293 ? 5.553   -17.395 2.391   1.00 17.75 ? 336  ARG A CB  1 
ATOM   2182  C  CG  . ARG A 1 293 ? 6.878   -16.768 2.063   1.00 19.39 ? 336  ARG A CG  1 
ATOM   2183  C  CD  . ARG A 1 293 ? 8.002   -17.438 2.826   1.00 20.78 ? 336  ARG A CD  1 
ATOM   2184  N  NE  . ARG A 1 293 ? 9.272   -17.317 2.116   1.00 21.92 ? 336  ARG A NE  1 
ATOM   2185  C  CZ  . ARG A 1 293 ? 9.644   -18.102 1.106   1.00 23.90 ? 336  ARG A CZ  1 
ATOM   2186  N  NH1 . ARG A 1 293 ? 10.816  -17.911 0.519   1.00 23.68 ? 336  ARG A NH1 1 
ATOM   2187  N  NH2 . ARG A 1 293 ? 8.857   -19.093 0.694   1.00 24.29 ? 336  ARG A NH2 1 
ATOM   2188  N  N   . MET A 1 294 ? 2.606   -17.705 3.578   1.00 15.58 ? 337  MET A N   1 
ATOM   2189  C  CA  . MET A 1 294 ? 1.332   -18.370 3.491   1.00 14.65 ? 337  MET A CA  1 
ATOM   2190  C  C   . MET A 1 294 ? 0.220   -17.370 3.360   1.00 14.28 ? 337  MET A C   1 
ATOM   2191  O  O   . MET A 1 294 ? -0.763  -17.638 2.702   1.00 14.41 ? 337  MET A O   1 
ATOM   2192  C  CB  . MET A 1 294 ? 1.115   -19.230 4.718   1.00 16.77 ? 337  MET A CB  1 
ATOM   2193  C  CG  . MET A 1 294 ? 0.059   -20.278 4.530   1.00 19.81 ? 337  MET A CG  1 
ATOM   2194  S  SD  . MET A 1 294 ? 0.207   -21.513 5.801   1.00 21.77 ? 337  MET A SD  1 
ATOM   2195  C  CE  . MET A 1 294 ? -0.911  -20.885 7.036   1.00 21.11 ? 337  MET A CE  1 
ATOM   2196  N  N   . LEU A 1 295 ? 0.369   -16.211 3.985   1.00 15.51 ? 338  LEU A N   1 
ATOM   2197  C  CA  . LEU A 1 295 ? -0.660  -15.179 3.897   1.00 17.31 ? 338  LEU A CA  1 
ATOM   2198  C  C   . LEU A 1 295 ? -0.759  -14.577 2.500   1.00 18.32 ? 338  LEU A C   1 
ATOM   2199  O  O   . LEU A 1 295 ? -1.797  -14.035 2.109   1.00 17.51 ? 338  LEU A O   1 
ATOM   2200  C  CB  . LEU A 1 295 ? -0.368  -14.079 4.897   1.00 17.79 ? 338  LEU A CB  1 
ATOM   2201  C  CG  . LEU A 1 295 ? -0.796  -14.375 6.319   1.00 17.14 ? 338  LEU A CG  1 
ATOM   2202  C  CD1 . LEU A 1 295 ? -0.322  -13.261 7.220   1.00 17.81 ? 338  LEU A CD1 1 
ATOM   2203  C  CD2 . LEU A 1 295 ? -2.294  -14.485 6.368   1.00 16.43 ? 338  LEU A CD2 1 
ATOM   2204  N  N   . ILE A 1 296 ? 0.337   -14.678 1.755   1.00 19.87 ? 339  ILE A N   1 
ATOM   2205  C  CA  . ILE A 1 296 ? 0.411   -14.163 0.390   1.00 22.81 ? 339  ILE A CA  1 
ATOM   2206  C  C   . ILE A 1 296 ? -0.113  -15.189 -0.622  1.00 24.86 ? 339  ILE A C   1 
ATOM   2207  O  O   . ILE A 1 296 ? -1.122  -14.955 -1.299  1.00 26.77 ? 339  ILE A O   1 
ATOM   2208  C  CB  . ILE A 1 296 ? 1.875   -13.783 0.004   1.00 20.72 ? 339  ILE A CB  1 
ATOM   2209  C  CG1 . ILE A 1 296 ? 2.359   -12.624 0.876   1.00 21.75 ? 339  ILE A CG1 1 
ATOM   2210  C  CG2 . ILE A 1 296 ? 1.946   -13.364 -1.443  1.00 20.40 ? 339  ILE A CG2 1 
ATOM   2211  C  CD1 . ILE A 1 296 ? 3.804   -12.242 0.655   1.00 19.38 ? 339  ILE A CD1 1 
ATOM   2212  N  N   . ALA A 1 297 ? 0.579   -16.323 -0.707  1.00 26.65 ? 340  ALA A N   1 
ATOM   2213  C  CA  . ALA A 1 297 ? 0.234   -17.405 -1.632  1.00 27.36 ? 340  ALA A CA  1 
ATOM   2214  C  C   . ALA A 1 297 ? -1.205  -17.877 -1.505  1.00 26.98 ? 340  ALA A C   1 
ATOM   2215  O  O   . ALA A 1 297 ? -1.769  -18.448 -2.442  1.00 27.88 ? 340  ALA A O   1 
ATOM   2216  C  CB  . ALA A 1 297 ? 1.170   -18.579 -1.420  1.00 28.73 ? 340  ALA A CB  1 
ATOM   2217  N  N   . GLN A 1 298 ? -1.759  -17.648 -0.338  1.00 25.66 ? 341  GLN A N   1 
ATOM   2218  C  CA  . GLN A 1 298 ? -3.121  -18.024 -0.131  1.00 24.18 ? 341  GLN A CA  1 
ATOM   2219  C  C   . GLN A 1 298 ? -4.077  -16.878 0.017   1.00 23.13 ? 341  GLN A C   1 
ATOM   2220  O  O   . GLN A 1 298 ? -5.059  -16.787 -0.711  1.00 24.52 ? 341  GLN A O   1 
ATOM   2221  C  CB  . GLN A 1 298 ? -3.233  -18.859 1.162   1.00 26.50 ? 341  GLN A CB  1 
ATOM   2222  C  CG  . GLN A 1 298 ? -3.159  -20.359 0.988   1.00 27.40 ? 341  GLN A CG  1 
ATOM   2223  C  CD  . GLN A 1 298 ? -3.539  -21.107 2.266   1.00 28.68 ? 341  GLN A CD  1 
ATOM   2224  O  OE1 . GLN A 1 298 ? -4.643  -20.952 2.779   1.00 29.07 ? 341  GLN A OE1 1 
ATOM   2225  N  NE2 . GLN A 1 298 ? -2.779  -21.960 2.948   1.00 27.80 ? 341  GLN A NE2 1 
ATOM   2226  N  N   . GLU A 1 299 ? -3.821  -16.009 0.958   1.00 22.44 ? 342  GLU A N   1 
ATOM   2227  C  CA  . GLU A 1 299 ? -4.992  -15.118 1.419   1.00 19.59 ? 342  GLU A CA  1 
ATOM   2228  C  C   . GLU A 1 299 ? -4.794  -13.937 0.492   1.00 17.40 ? 342  GLU A C   1 
ATOM   2229  O  O   . GLU A 1 299 ? -5.712  -13.144 0.280   1.00 16.01 ? 342  GLU A O   1 
ATOM   2230  C  CB  . GLU A 1 299 ? -4.840  -14.684 2.871   1.00 20.24 ? 342  GLU A CB  1 
ATOM   2231  C  CG  . GLU A 1 299 ? -5.169  -15.795 3.863   1.00 22.72 ? 342  GLU A CG  1 
ATOM   2232  C  CD  . GLU A 1 299 ? -6.559  -16.392 3.663   1.00 23.91 ? 342  GLU A CD  1 
ATOM   2233  O  OE1 . GLU A 1 299 ? -7.502  -15.644 3.345   1.00 23.55 ? 342  GLU A OE1 1 
ATOM   2234  O  OE2 . GLU A 1 299 ? -6.709  -17.614 3.842   1.00 25.44 ? 342  GLU A OE2 1 
ATOM   2235  N  N   . GLY A 1 300 ? -3.601  -13.821 -0.069  1.00 16.55 ? 343  GLY A N   1 
ATOM   2236  C  CA  . GLY A 1 300 ? -3.350  -12.726 -0.984  1.00 16.86 ? 343  GLY A CA  1 
ATOM   2237  C  C   . GLY A 1 300 ? -3.168  -11.409 -0.261  1.00 16.79 ? 343  GLY A C   1 
ATOM   2238  O  O   . GLY A 1 300 ? -3.526  -10.348 -0.770  1.00 16.42 ? 343  GLY A O   1 
ATOM   2239  N  N   . LEU A 1 301 ? -2.615  -11.483 0.940   1.00 15.57 ? 344  LEU A N   1 
ATOM   2240  C  CA  . LEU A 1 301 ? -2.356  -10.293 1.723   1.00 13.06 ? 344  LEU A CA  1 
ATOM   2241  C  C   . LEU A 1 301 ? -0.866  -10.085 1.625   1.00 12.78 ? 344  LEU A C   1 
ATOM   2242  O  O   . LEU A 1 301 ? -0.103  -11.000 1.896   1.00 11.57 ? 344  LEU A O   1 
ATOM   2243  C  CB  . LEU A 1 301 ? -2.771  -10.526 3.177   1.00 11.58 ? 344  LEU A CB  1 
ATOM   2244  C  CG  . LEU A 1 301 ? -4.264  -10.854 3.304   1.00 9.59  ? 344  LEU A CG  1 
ATOM   2245  C  CD1 . LEU A 1 301 ? -4.663  -11.027 4.759   1.00 7.34  ? 344  LEU A CD1 1 
ATOM   2246  C  CD2 . LEU A 1 301 ? -5.075  -9.733  2.675   1.00 9.29  ? 344  LEU A CD2 1 
ATOM   2247  N  N   . LEU A 1 302 ? -0.440  -8.906  1.198   1.00 12.90 ? 345  LEU A N   1 
ATOM   2248  C  CA  . LEU A 1 302 ? 0.991   -8.630  1.097   1.00 14.93 ? 345  LEU A CA  1 
ATOM   2249  C  C   . LEU A 1 302 ? 1.487   -8.100  2.431   1.00 17.02 ? 345  LEU A C   1 
ATOM   2250  O  O   . LEU A 1 302 ? 1.922   -6.956  2.514   1.00 18.76 ? 345  LEU A O   1 
ATOM   2251  C  CB  . LEU A 1 302 ? 1.254   -7.570  0.047   1.00 12.90 ? 345  LEU A CB  1 
ATOM   2252  C  CG  . LEU A 1 302 ? 0.862   -7.819  -1.404  1.00 11.34 ? 345  LEU A CG  1 
ATOM   2253  C  CD1 . LEU A 1 302 ? 0.802   -6.501  -2.177  1.00 10.37 ? 345  LEU A CD1 1 
ATOM   2254  C  CD2 . LEU A 1 302 ? 1.866   -8.747  -1.993  1.00 7.55  ? 345  LEU A CD2 1 
ATOM   2255  N  N   . CYS A 1 303 ? 1.423   -8.900  3.480   1.00 17.10 ? 346  CYS A N   1 
ATOM   2256  C  CA  . CYS A 1 303 ? 1.875   -8.383  4.743   1.00 16.32 ? 346  CYS A CA  1 
ATOM   2257  C  C   . CYS A 1 303 ? 3.342   -8.680  4.897   1.00 15.72 ? 346  CYS A C   1 
ATOM   2258  O  O   . CYS A 1 303 ? 4.007   -9.068  3.932   1.00 15.22 ? 346  CYS A O   1 
ATOM   2259  C  CB  . CYS A 1 303 ? 1.068   -8.981  5.882   1.00 18.20 ? 346  CYS A CB  1 
ATOM   2260  S  SG  . CYS A 1 303 ? 1.335   -10.720 6.081   1.00 26.85 ? 346  CYS A SG  1 
ATOM   2261  N  N   . GLY A 1 304 ? 3.829   -8.492  6.117   1.00 14.40 ? 347  GLY A N   1 
ATOM   2262  C  CA  . GLY A 1 304 ? 5.227   -8.707  6.428   1.00 12.02 ? 347  GLY A CA  1 
ATOM   2263  C  C   . GLY A 1 304 ? 5.344   -9.746  7.510   1.00 9.64  ? 347  GLY A C   1 
ATOM   2264  O  O   . GLY A 1 304 ? 4.344   -10.145 8.073   1.00 8.91  ? 347  GLY A O   1 
ATOM   2265  N  N   . GLY A 1 305 ? 6.567   -10.177 7.789   1.00 9.44  ? 348  GLY A N   1 
ATOM   2266  C  CA  . GLY A 1 305 ? 6.812   -11.205 8.784   1.00 8.95  ? 348  GLY A CA  1 
ATOM   2267  C  C   . GLY A 1 305 ? 6.134   -11.016 10.126  1.00 9.49  ? 348  GLY A C   1 
ATOM   2268  O  O   . GLY A 1 305 ? 5.647   -11.972 10.720  1.00 8.35  ? 348  GLY A O   1 
ATOM   2269  N  N   . SER A 1 306 ? 6.132   -9.789  10.627  1.00 11.51 ? 349  SER A N   1 
ATOM   2270  C  CA  . SER A 1 306 ? 5.506   -9.499  11.906  1.00 13.18 ? 349  SER A CA  1 
ATOM   2271  C  C   . SER A 1 306 ? 4.131   -10.139 11.919  1.00 14.50 ? 349  SER A C   1 
ATOM   2272  O  O   . SER A 1 306 ? 3.703   -10.705 12.923  1.00 14.88 ? 349  SER A O   1 
ATOM   2273  C  CB  . SER A 1 306 ? 5.384   -7.998  12.082  1.00 13.85 ? 349  SER A CB  1 
ATOM   2274  O  OG  . SER A 1 306 ? 4.627   -7.712  13.232  1.00 17.83 ? 349  SER A OG  1 
ATOM   2275  N  N   . ALA A 1 307 ? 3.448   -10.047 10.782  1.00 15.76 ? 350  ALA A N   1 
ATOM   2276  C  CA  . ALA A 1 307 ? 2.122   -10.621 10.617  1.00 16.13 ? 350  ALA A CA  1 
ATOM   2277  C  C   . ALA A 1 307 ? 2.237   -12.126 10.753  1.00 16.91 ? 350  ALA A C   1 
ATOM   2278  O  O   . ALA A 1 307 ? 1.449   -12.770 11.445  1.00 18.25 ? 350  ALA A O   1 
ATOM   2279  C  CB  . ALA A 1 307 ? 1.585   -10.274 9.269   1.00 13.99 ? 350  ALA A CB  1 
ATOM   2280  N  N   . GLY A 1 308 ? 3.221   -12.694 10.082  1.00 17.12 ? 351  GLY A N   1 
ATOM   2281  C  CA  . GLY A 1 308 ? 3.392   -14.121 10.187  1.00 20.51 ? 351  GLY A CA  1 
ATOM   2282  C  C   . GLY A 1 308 ? 3.324   -14.532 11.644  1.00 21.48 ? 351  GLY A C   1 
ATOM   2283  O  O   . GLY A 1 308 ? 2.550   -15.411 12.015  1.00 22.15 ? 351  GLY A O   1 
ATOM   2284  N  N   . SER A 1 309 ? 4.125   -13.866 12.469  1.00 23.16 ? 352  SER A N   1 
ATOM   2285  C  CA  . SER A 1 309 ? 4.202   -14.146 13.904  1.00 24.53 ? 352  SER A CA  1 
ATOM   2286  C  C   . SER A 1 309 ? 2.833   -14.114 14.572  1.00 24.79 ? 352  SER A C   1 
ATOM   2287  O  O   . SER A 1 309 ? 2.574   -14.847 15.522  1.00 24.67 ? 352  SER A O   1 
ATOM   2288  C  CB  . SER A 1 309 ? 5.134   -13.129 14.602  1.00 25.61 ? 352  SER A CB  1 
ATOM   2289  O  OG  . SER A 1 309 ? 6.483   -13.250 14.173  1.00 25.81 ? 352  SER A OG  1 
ATOM   2290  N  N   . THR A 1 310 ? 1.952   -13.272 14.057  1.00 25.20 ? 353  THR A N   1 
ATOM   2291  C  CA  . THR A 1 310 ? 0.630   -13.139 14.639  1.00 26.39 ? 353  THR A CA  1 
ATOM   2292  C  C   . THR A 1 310 ? -0.394  -14.156 14.127  1.00 27.68 ? 353  THR A C   1 
ATOM   2293  O  O   . THR A 1 310 ? -1.121  -14.759 14.921  1.00 27.86 ? 353  THR A O   1 
ATOM   2294  C  CB  . THR A 1 310 ? 0.084   -11.711 14.418  1.00 27.28 ? 353  THR A CB  1 
ATOM   2295  O  OG1 . THR A 1 310 ? 1.136   -10.757 14.636  1.00 26.33 ? 353  THR A OG1 1 
ATOM   2296  C  CG2 . THR A 1 310 ? -1.068  -11.423 15.386  1.00 26.85 ? 353  THR A CG2 1 
ATOM   2297  N  N   . VAL A 1 311 ? -0.468  -14.348 12.811  1.00 28.27 ? 354  VAL A N   1 
ATOM   2298  C  CA  . VAL A 1 311 ? -1.433  -15.306 12.270  1.00 28.14 ? 354  VAL A CA  1 
ATOM   2299  C  C   . VAL A 1 311 ? -0.971  -16.728 12.578  1.00 29.12 ? 354  VAL A C   1 
ATOM   2300  O  O   . VAL A 1 311 ? -1.749  -17.678 12.515  1.00 29.26 ? 354  VAL A O   1 
ATOM   2301  C  CB  . VAL A 1 311 ? -1.633  -15.127 10.746  1.00 26.51 ? 354  VAL A CB  1 
ATOM   2302  C  CG1 . VAL A 1 311 ? -2.644  -16.114 10.252  1.00 23.77 ? 354  VAL A CG1 1 
ATOM   2303  C  CG2 . VAL A 1 311 ? -2.117  -13.724 10.443  1.00 24.81 ? 354  VAL A CG2 1 
ATOM   2304  N  N   . ALA A 1 312 ? 0.300   -16.863 12.933  1.00 29.62 ? 355  ALA A N   1 
ATOM   2305  C  CA  . ALA A 1 312 ? 0.843   -18.167 13.274  1.00 30.89 ? 355  ALA A CA  1 
ATOM   2306  C  C   . ALA A 1 312 ? 0.306   -18.559 14.645  1.00 32.00 ? 355  ALA A C   1 
ATOM   2307  O  O   . ALA A 1 312 ? -0.013  -19.726 14.900  1.00 32.97 ? 355  ALA A O   1 
ATOM   2308  C  CB  . ALA A 1 312 ? 2.357   -18.106 13.311  1.00 29.83 ? 355  ALA A CB  1 
ATOM   2309  N  N   . VAL A 1 313 ? 0.210   -17.562 15.521  1.00 32.17 ? 356  VAL A N   1 
ATOM   2310  C  CA  . VAL A 1 313 ? -0.272  -17.760 16.883  1.00 31.22 ? 356  VAL A CA  1 
ATOM   2311  C  C   . VAL A 1 313 ? -1.795  -17.883 16.969  1.00 29.72 ? 356  VAL A C   1 
ATOM   2312  O  O   . VAL A 1 313 ? -2.322  -18.618 17.804  1.00 29.48 ? 356  VAL A O   1 
ATOM   2313  C  CB  . VAL A 1 313 ? 0.223   -16.598 17.808  1.00 32.95 ? 356  VAL A CB  1 
ATOM   2314  C  CG1 . VAL A 1 313 ? -0.449  -16.680 19.181  1.00 32.74 ? 356  VAL A CG1 1 
ATOM   2315  C  CG2 . VAL A 1 313 ? 1.742   -16.669 17.966  1.00 31.13 ? 356  VAL A CG2 1 
ATOM   2316  N  N   . ALA A 1 314 ? -2.498  -17.170 16.100  1.00 27.83 ? 357  ALA A N   1 
ATOM   2317  C  CA  . ALA A 1 314 ? -3.956  -17.203 16.090  1.00 25.43 ? 357  ALA A CA  1 
ATOM   2318  C  C   . ALA A 1 314 ? -4.537  -18.566 15.731  1.00 24.92 ? 357  ALA A C   1 
ATOM   2319  O  O   . ALA A 1 314 ? -5.601  -18.926 16.208  1.00 24.72 ? 357  ALA A O   1 
ATOM   2320  C  CB  . ALA A 1 314 ? -4.484  -16.158 15.134  1.00 24.51 ? 357  ALA A CB  1 
ATOM   2321  N  N   . VAL A 1 315 ? -3.856  -19.329 14.885  1.00 24.94 ? 358  VAL A N   1 
ATOM   2322  C  CA  . VAL A 1 315 ? -4.389  -20.633 14.522  1.00 24.03 ? 358  VAL A CA  1 
ATOM   2323  C  C   . VAL A 1 315 ? -4.218  -21.596 15.680  1.00 23.68 ? 358  VAL A C   1 
ATOM   2324  O  O   . VAL A 1 315 ? -4.701  -22.721 15.633  1.00 24.90 ? 358  VAL A O   1 
ATOM   2325  C  CB  . VAL A 1 315 ? -3.717  -21.224 13.252  1.00 23.30 ? 358  VAL A CB  1 
ATOM   2326  C  CG1 . VAL A 1 315 ? -3.681  -20.187 12.134  1.00 21.84 ? 358  VAL A CG1 1 
ATOM   2327  C  CG2 . VAL A 1 315 ? -2.329  -21.726 13.568  1.00 22.30 ? 358  VAL A CG2 1 
ATOM   2328  N  N   . LYS A 1 316 ? -3.524  -21.144 16.719  1.00 23.60 ? 359  LYS A N   1 
ATOM   2329  C  CA  . LYS A 1 316 ? -3.272  -21.986 17.907  1.00 22.46 ? 359  LYS A CA  1 
ATOM   2330  C  C   . LYS A 1 316 ? -4.239  -21.656 19.020  1.00 21.50 ? 359  LYS A C   1 
ATOM   2331  O  O   . LYS A 1 316 ? -4.846  -22.521 19.635  1.00 20.02 ? 359  LYS A O   1 
ATOM   2332  C  CB  . LYS A 1 316 ? -1.926  -21.700 18.561  1.00 23.48 ? 359  LYS A CB  1 
ATOM   2333  C  CG  . LYS A 1 316 ? -0.658  -21.816 17.736  1.00 24.14 ? 359  LYS A CG  1 
ATOM   2334  C  CD  . LYS A 1 316 ? 0.527   -21.331 18.551  1.00 24.52 ? 359  LYS A CD  1 
ATOM   2335  C  CE  . LYS A 1 316 ? 1.800   -21.296 17.719  1.00 25.03 ? 359  LYS A CE  1 
ATOM   2336  N  NZ  . LYS A 1 316 ? 2.688   -20.169 18.128  1.00 23.41 ? 359  LYS A NZ  1 
ATOM   2337  N  N   . ALA A 1 317 ? -4.340  -20.362 19.255  1.00 22.04 ? 360  ALA A N   1 
ATOM   2338  C  CA  . ALA A 1 317 ? -5.157  -19.779 20.299  1.00 23.69 ? 360  ALA A CA  1 
ATOM   2339  C  C   . ALA A 1 317 ? -6.655  -19.890 19.984  1.00 24.77 ? 360  ALA A C   1 
ATOM   2340  O  O   . ALA A 1 317 ? -7.444  -20.388 20.784  1.00 23.90 ? 360  ALA A O   1 
ATOM   2341  C  CB  . ALA A 1 317 ? -4.774  -18.315 20.514  1.00 23.81 ? 360  ALA A CB  1 
ATOM   2342  N  N   . ALA A 1 318 ? -7.045  -19.433 18.797  1.00 25.84 ? 361  ALA A N   1 
ATOM   2343  C  CA  . ALA A 1 318 ? -8.446  -19.437 18.351  1.00 26.91 ? 361  ALA A CA  1 
ATOM   2344  C  C   . ALA A 1 318 ? -9.186  -20.795 18.359  1.00 27.90 ? 361  ALA A C   1 
ATOM   2345  O  O   . ALA A 1 318 ? -10.425 -20.838 18.288  1.00 28.09 ? 361  ALA A O   1 
ATOM   2346  C  CB  . ALA A 1 318 ? -8.528  -18.801 16.952  1.00 24.66 ? 361  ALA A CB  1 
ATOM   2347  N  N   . GLN A 1 319 ? -8.431  -21.888 18.442  1.00 28.12 ? 362  GLN A N   1 
ATOM   2348  C  CA  . GLN A 1 319 ? -9.002  -23.231 18.456  1.00 29.02 ? 362  GLN A CA  1 
ATOM   2349  C  C   . GLN A 1 319 ? -10.188 -23.355 19.443  1.00 30.68 ? 362  GLN A C   1 
ATOM   2350  O  O   . GLN A 1 319 ? -11.226 -23.943 19.128  1.00 32.28 ? 362  GLN A O   1 
ATOM   2351  C  CB  . GLN A 1 319 ? -7.907  -24.230 18.819  1.00 28.50 ? 362  GLN A CB  1 
ATOM   2352  C  CG  . GLN A 1 319 ? -6.697  -24.210 17.929  1.00 30.00 ? 362  GLN A CG  1 
ATOM   2353  C  CD  . GLN A 1 319 ? -6.849  -25.095 16.731  1.00 30.38 ? 362  GLN A CD  1 
ATOM   2354  O  OE1 . GLN A 1 319 ? -7.685  -25.997 16.699  1.00 31.79 ? 362  GLN A OE1 1 
ATOM   2355  N  NE2 . GLN A 1 319 ? -6.028  -24.876 15.720  1.00 30.36 ? 362  GLN A NE2 1 
ATOM   2356  N  N   . GLU A 1 320 ? -10.024 -22.781 20.629  1.00 32.07 ? 363  GLU A N   1 
ATOM   2357  C  CA  . GLU A 1 320 ? -11.040 -22.795 21.680  1.00 32.67 ? 363  GLU A CA  1 
ATOM   2358  C  C   . GLU A 1 320 ? -12.359 -22.117 21.276  1.00 31.52 ? 363  GLU A C   1 
ATOM   2359  O  O   . GLU A 1 320 ? -13.406 -22.336 21.901  1.00 30.90 ? 363  GLU A O   1 
ATOM   2360  C  CB  . GLU A 1 320 ? -10.476 -22.087 22.911  1.00 35.68 ? 363  GLU A CB  1 
ATOM   2361  C  CG  . GLU A 1 320 ? -10.125 -20.624 22.643  1.00 37.94 ? 363  GLU A CG  1 
ATOM   2362  C  CD  . GLU A 1 320 ? -9.381  -19.979 23.795  1.00 40.65 ? 363  GLU A CD  1 
ATOM   2363  O  OE1 . GLU A 1 320 ? -9.946  -19.947 24.916  1.00 41.19 ? 363  GLU A OE1 1 
ATOM   2364  O  OE2 . GLU A 1 320 ? -8.235  -19.506 23.575  1.00 39.87 ? 363  GLU A OE2 1 
ATOM   2365  N  N   . LEU A 1 321 ? -12.302 -21.272 20.254  1.00 30.37 ? 364  LEU A N   1 
ATOM   2366  C  CA  . LEU A 1 321 ? -13.494 -20.569 19.792  1.00 28.78 ? 364  LEU A CA  1 
ATOM   2367  C  C   . LEU A 1 321 ? -14.373 -21.500 18.959  1.00 27.43 ? 364  LEU A C   1 
ATOM   2368  O  O   . LEU A 1 321 ? -13.890 -22.501 18.441  1.00 27.63 ? 364  LEU A O   1 
ATOM   2369  C  CB  . LEU A 1 321 ? -13.076 -19.328 18.995  1.00 29.21 ? 364  LEU A CB  1 
ATOM   2370  C  CG  . LEU A 1 321 ? -12.904 -18.014 19.776  1.00 27.55 ? 364  LEU A CG  1 
ATOM   2371  C  CD1 . LEU A 1 321 ? -12.162 -18.264 21.075  1.00 25.90 ? 364  LEU A CD1 1 
ATOM   2372  C  CD2 . LEU A 1 321 ? -12.169 -16.999 18.905  1.00 26.06 ? 364  LEU A CD2 1 
ATOM   2373  N  N   . GLN A 1 322 ? -15.654 -21.175 18.828  1.00 26.79 ? 365  GLN A N   1 
ATOM   2374  C  CA  . GLN A 1 322 ? -16.572 -22.053 18.085  1.00 27.49 ? 365  GLN A CA  1 
ATOM   2375  C  C   . GLN A 1 322 ? -17.511 -21.394 17.038  1.00 27.37 ? 365  GLN A C   1 
ATOM   2376  O  O   . GLN A 1 322 ? -17.705 -20.167 17.017  1.00 27.41 ? 365  GLN A O   1 
ATOM   2377  C  CB  . GLN A 1 322 ? -17.436 -22.823 19.067  1.00 27.02 ? 365  GLN A CB  1 
ATOM   2378  C  CG  . GLN A 1 322 ? -16.697 -24.002 19.686  1.00 27.16 ? 365  GLN A CG  1 
ATOM   2379  C  CD  . GLN A 1 322 ? -17.419 -24.528 20.900  1.00 29.06 ? 365  GLN A CD  1 
ATOM   2380  O  OE1 . GLN A 1 322 ? -18.643 -24.426 20.991  1.00 30.04 ? 365  GLN A OE1 1 
ATOM   2381  N  NE2 . GLN A 1 322 ? -16.865 -25.132 21.936  1.00 28.28 ? 365  GLN A NE2 1 
ATOM   2382  N  N   . GLU A 1 323 ? -18.090 -22.299 16.166  1.00 26.67 ? 366  GLU A N   1 
ATOM   2383  C  CA  . GLU A 1 323 ? -19.070 -22.066 15.078  1.00 25.98 ? 366  GLU A CA  1 
ATOM   2384  C  C   . GLU A 1 323 ? -20.122 -21.170 15.800  1.00 25.10 ? 366  GLU A C   1 
ATOM   2385  O  O   . GLU A 1 323 ? -20.599 -21.438 16.895  1.00 25.73 ? 366  GLU A O   1 
ATOM   2386  C  CB  . GLU A 1 323 ? -19.127 -23.361 14.288  1.00 26.90 ? 366  GLU A CB  1 
ATOM   2387  C  CG  . GLU A 1 323 ? -17.706 -23.606 13.753  1.00 29.79 ? 366  GLU A CG  1 
ATOM   2388  C  CD  . GLU A 1 323 ? -17.362 -25.049 13.413  1.00 32.14 ? 366  GLU A CD  1 
ATOM   2389  O  OE1 . GLU A 1 323 ? -17.541 -25.408 12.225  1.00 31.92 ? 366  GLU A OE1 1 
ATOM   2390  O  OE2 . GLU A 1 323 ? -16.931 -25.789 14.311  1.00 30.83 ? 366  GLU A OE2 1 
ATOM   2391  N  N   . GLY A 1 324 ? -20.392 -20.136 15.052  1.00 22.86 ? 367  GLY A N   1 
ATOM   2392  C  CA  . GLY A 1 324 ? -20.358 -18.482 15.736  1.00 21.43 ? 367  GLY A CA  1 
ATOM   2393  C  C   . GLY A 1 324 ? -19.540 -17.253 16.211  1.00 18.81 ? 367  GLY A C   1 
ATOM   2394  O  O   . GLY A 1 324 ? -20.026 -16.128 16.174  1.00 15.00 ? 367  GLY A O   1 
ATOM   2395  N  N   . GLN A 1 325 ? -18.302 -17.497 16.648  1.00 17.68 ? 368  GLN A N   1 
ATOM   2396  C  CA  . GLN A 1 325 ? -17.417 -16.419 17.178  1.00 16.84 ? 368  GLN A CA  1 
ATOM   2397  C  C   . GLN A 1 325 ? -16.308 -15.899 16.224  1.00 16.12 ? 368  GLN A C   1 
ATOM   2398  O  O   . GLN A 1 325 ? -15.832 -16.613 15.335  1.00 16.36 ? 368  GLN A O   1 
ATOM   2399  C  CB  . GLN A 1 325 ? -16.768 -16.900 18.490  1.00 16.01 ? 368  GLN A CB  1 
ATOM   2400  C  CG  . GLN A 1 325 ? -17.716 -17.716 19.378  1.00 14.18 ? 368  GLN A CG  1 
ATOM   2401  C  CD  . GLN A 1 325 ? -17.065 -18.264 20.637  1.00 12.26 ? 368  GLN A CD  1 
ATOM   2402  O  OE1 . GLN A 1 325 ? -16.542 -19.390 20.665  1.00 10.72 ? 368  GLN A OE1 1 
ATOM   2403  N  NE2 . GLN A 1 325 ? -16.992 -17.634 21.801  1.00 10.34 ? 368  GLN A NE2 1 
ATOM   2404  N  N   . ARG A 1 326 ? -15.902 -14.633 16.409  1.00 14.74 ? 369  ARG A N   1 
ATOM   2405  C  CA  . ARG A 1 326 ? -14.862 -13.996 15.600  1.00 14.64 ? 369  ARG A CA  1 
ATOM   2406  C  C   . ARG A 1 326 ? -13.488 -13.982 16.320  1.00 14.85 ? 369  ARG A C   1 
ATOM   2407  O  O   . ARG A 1 326 ? -13.431 -14.192 17.526  1.00 14.12 ? 369  ARG A O   1 
ATOM   2408  C  CB  . ARG A 1 326 ? -15.292 -12.566 15.265  1.00 13.84 ? 369  ARG A CB  1 
ATOM   2409  C  CG  . ARG A 1 326 ? -16.148 -12.466 14.017  1.00 10.56 ? 369  ARG A CG  1 
ATOM   2410  C  CD  . ARG A 1 326 ? -15.974 -11.104 13.365  1.00 7.37  ? 369  ARG A CD  1 
ATOM   2411  N  NE  . ARG A 1 326 ? -17.048 -10.160 13.740  1.00 6.08  ? 369  ARG A NE  1 
ATOM   2412  C  CZ  . ARG A 1 326 ? -18.321 -10.378 13.472  1.00 6.56  ? 369  ARG A CZ  1 
ATOM   2413  N  NH1 . ARG A 1 326 ? -18.696 -11.472 12.837  1.00 5.46  ? 369  ARG A NH1 1 
ATOM   2414  N  NH2 . ARG A 1 326 ? -19.233 -9.505  13.862  1.00 3.95  ? 369  ARG A NH2 1 
ATOM   2415  N  N   . CYS A 1 327 ? -12.374 -13.708 15.588  1.00 14.08 ? 370  CYS A N   1 
ATOM   2416  C  CA  . CYS A 1 327 ? -11.018 -13.594 16.176  1.00 15.42 ? 370  CYS A CA  1 
ATOM   2417  C  C   . CYS A 1 327 ? -10.220 -12.589 15.414  1.00 15.48 ? 370  CYS A C   1 
ATOM   2418  O  O   . CYS A 1 327 ? -9.543  -12.915 14.440  1.00 15.55 ? 370  CYS A O   1 
ATOM   2419  C  CB  . CYS A 1 327 ? -10.267 -14.924 16.164  1.00 16.56 ? 370  CYS A CB  1 
ATOM   2420  S  SG  . CYS A 1 327 ? -8.554  -14.813 16.760  1.00 17.13 ? 370  CYS A SG  1 
ATOM   2421  N  N   . VAL A 1 328 ? -10.299 -11.367 15.862  1.00 16.18 ? 371  VAL A N   1 
ATOM   2422  C  CA  . VAL A 1 328 ? -9.521  -10.444 14.919  1.00 17.18 ? 371  VAL A CA  1 
ATOM   2423  C  C   . VAL A 1 328 ? -8.003  -10.619 15.089  1.00 19.00 ? 371  VAL A C   1 
ATOM   2424  O  O   . VAL A 1 328 ? -7.503  -10.699 16.213  1.00 18.99 ? 371  VAL A O   1 
ATOM   2425  C  CB  . VAL A 1 328 ? -9.920  -9.037  15.363  1.00 17.46 ? 371  VAL A CB  1 
ATOM   2426  C  CG1 . VAL A 1 328 ? -8.920  -7.999  14.867  1.00 19.72 ? 371  VAL A CG1 1 
ATOM   2427  C  CG2 . VAL A 1 328 ? -11.330 -8.704  14.879  1.00 18.45 ? 371  VAL A CG2 1 
ATOM   2428  N  N   . VAL A 1 329 ? -7.289  -10.661 13.965  1.00 19.04 ? 372  VAL A N   1 
ATOM   2429  C  CA  . VAL A 1 329 ? -5.833  -10.792 13.937  1.00 17.65 ? 372  VAL A CA  1 
ATOM   2430  C  C   . VAL A 1 329 ? -5.292  -9.470  13.396  1.00 18.66 ? 372  VAL A C   1 
ATOM   2431  O  O   . VAL A 1 329 ? -5.753  -9.011  12.352  1.00 20.32 ? 372  VAL A O   1 
ATOM   2432  C  CB  . VAL A 1 329 ? -5.393  -11.959 12.997  1.00 16.60 ? 372  VAL A CB  1 
ATOM   2433  C  CG1 . VAL A 1 329 ? -4.233  -11.529 12.104  1.00 15.54 ? 372  VAL A CG1 1 
ATOM   2434  C  CG2 . VAL A 1 329 ? -4.984  -13.148 13.826  1.00 14.91 ? 372  VAL A CG2 1 
ATOM   2435  N  N   . ILE A 1 330 ? -4.340  -8.846  14.086  1.00 16.91 ? 373  ILE A N   1 
ATOM   2436  C  CA  . ILE A 1 330 ? -3.815  -7.570  13.594  1.00 14.94 ? 373  ILE A CA  1 
ATOM   2437  C  C   . ILE A 1 330 ? -2.566  -7.785  12.785  1.00 14.73 ? 373  ILE A C   1 
ATOM   2438  O  O   . ILE A 1 330 ? -1.636  -8.444  13.234  1.00 15.37 ? 373  ILE A O   1 
ATOM   2439  C  CB  . ILE A 1 330 ? -3.485  -6.611  14.747  1.00 14.52 ? 373  ILE A CB  1 
ATOM   2440  C  CG1 . ILE A 1 330 ? -4.773  -6.197  15.442  1.00 14.19 ? 373  ILE A CG1 1 
ATOM   2441  C  CG2 . ILE A 1 330 ? -2.730  -5.388  14.259  1.00 9.87  ? 373  ILE A CG2 1 
ATOM   2442  C  CD1 . ILE A 1 330 ? -4.543  -5.312  16.646  1.00 17.74 ? 373  ILE A CD1 1 
ATOM   2443  N  N   . LEU A 1 331 ? -2.495  -7.238  11.595  1.00 14.39 ? 374  LEU A N   1 
ATOM   2444  C  CA  . LEU A 1 331 ? -1.300  -7.389  10.778  1.00 15.10 ? 374  LEU A CA  1 
ATOM   2445  C  C   . LEU A 1 331 ? -0.622  -6.008  10.624  1.00 16.19 ? 374  LEU A C   1 
ATOM   2446  O  O   . LEU A 1 331 ? -1.138  -5.110  9.963   1.00 17.53 ? 374  LEU A O   1 
ATOM   2447  C  CB  . LEU A 1 331 ? -1.624  -7.981  9.401   1.00 15.25 ? 374  LEU A CB  1 
ATOM   2448  C  CG  . LEU A 1 331 ? -2.632  -9.118  9.252   1.00 13.73 ? 374  LEU A CG  1 
ATOM   2449  C  CD1 . LEU A 1 331 ? -2.951  -9.344  7.780   1.00 15.73 ? 374  LEU A CD1 1 
ATOM   2450  C  CD2 . LEU A 1 331 ? -2.113  -10.391 9.893   1.00 12.16 ? 374  LEU A CD2 1 
ATOM   2451  N  N   . PRO A 1 332 ? 0.548   -5.914  11.290  1.00 16.53 ? 375  PRO A N   1 
ATOM   2452  C  CA  . PRO A 1 332 ? 1.401   -4.676  11.408  1.00 16.18 ? 375  PRO A CA  1 
ATOM   2453  C  C   . PRO A 1 332 ? 1.800   -3.874  10.174  1.00 17.46 ? 375  PRO A C   1 
ATOM   2454  O  O   . PRO A 1 332 ? 1.484   -2.690  10.093  1.00 18.63 ? 375  PRO A O   1 
ATOM   2455  C  CB  . PRO A 1 332 ? 2.530   -5.109  12.337  1.00 16.45 ? 375  PRO A CB  1 
ATOM   2456  C  CG  . PRO A 1 332 ? 1.806   -6.000  13.295  1.00 16.98 ? 375  PRO A CG  1 
ATOM   2457  C  CD  . PRO A 1 332 ? 0.610   -6.572  12.589  1.00 17.11 ? 375  PRO A CD  1 
ATOM   2458  N  N   . ASP A 1 333 ? 2.511   -4.465  9.243   1.00 18.81 ? 376  ASP A N   1 
ATOM   2459  C  CA  . ASP A 1 333 ? 2.951   -3.739  8.098   1.00 21.03 ? 376  ASP A CA  1 
ATOM   2460  C  C   . ASP A 1 333 ? 3.037   -4.676  6.912   1.00 21.03 ? 376  ASP A C   1 
ATOM   2461  O  O   . ASP A 1 333 ? 2.630   -5.831  6.990   1.00 22.88 ? 376  ASP A O   1 
ATOM   2462  C  CB  . ASP A 1 333 ? 4.298   -3.089  8.369   1.00 23.18 ? 376  ASP A CB  1 
ATOM   2463  C  CG  . ASP A 1 333 ? 5.343   -4.131  8.536   1.00 26.98 ? 376  ASP A CG  1 
ATOM   2464  O  OD1 . ASP A 1 333 ? 6.501   -3.778  8.835   1.00 27.66 ? 376  ASP A OD1 1 
ATOM   2465  O  OD2 . ASP A 1 333 ? 5.025   -5.333  8.357   1.00 28.78 ? 376  ASP A OD2 1 
ATOM   2466  N  N   . SER A 1 334 ? 3.563   -4.171  5.818   1.00 21.99 ? 377  SER A N   1 
ATOM   2467  C  CA  . SER A 1 334 ? 3.580   -4.907  4.574   1.00 22.44 ? 377  SER A CA  1 
ATOM   2468  C  C   . SER A 1 334 ? 4.873   -5.541  4.145   1.00 22.30 ? 377  SER A C   1 
ATOM   2469  O  O   . SER A 1 334 ? 5.842   -5.582  4.882   1.00 22.42 ? 377  SER A O   1 
ATOM   2470  C  CB  . SER A 1 334 ? 3.087   -3.982  3.451   1.00 22.94 ? 377  SER A CB  1 
ATOM   2471  O  OG  . SER A 1 334 ? 4.147   -3.171  2.973   1.00 22.85 ? 377  SER A OG  1 
ATOM   2472  N  N   . VAL A 1 335 ? 4.882   -6.057  2.937   1.00 22.70 ? 378  VAL A N   1 
ATOM   2473  C  CA  . VAL A 1 335 ? 6.092   -6.710  2.415   1.00 23.45 ? 378  VAL A CA  1 
ATOM   2474  C  C   . VAL A 1 335 ? 7.193   -5.720  2.139   1.00 23.19 ? 378  VAL A C   1 
ATOM   2475  O  O   . VAL A 1 335 ? 8.334   -5.989  2.465   1.00 23.22 ? 378  VAL A O   1 
ATOM   2476  C  CB  . VAL A 1 335 ? 5.832   -7.462  1.099   1.00 24.22 ? 378  VAL A CB  1 
ATOM   2477  C  CG1 . VAL A 1 335 ? 5.020   -8.730  1.355   1.00 24.42 ? 378  VAL A CG1 1 
ATOM   2478  C  CG2 . VAL A 1 335 ? 5.120   -6.563  0.103   1.00 24.53 ? 378  VAL A CG2 1 
ATOM   2479  N  N   . ARG A 1 336 ? 6.870   -4.579  1.534   1.00 22.89 ? 379  ARG A N   1 
ATOM   2480  C  CA  . ARG A 1 336 ? 7.859   -3.567  1.168   1.00 23.41 ? 379  ARG A CA  1 
ATOM   2481  C  C   . ARG A 1 336 ? 9.004   -3.502  2.123   1.00 24.34 ? 379  ARG A C   1 
ATOM   2482  O  O   . ARG A 1 336 ? 10.129  -3.861  1.755   1.00 25.35 ? 379  ARG A O   1 
ATOM   2483  C  CB  . ARG A 1 336 ? 7.190   -2.200  1.037   1.00 24.63 ? 379  ARG A CB  1 
ATOM   2484  C  CG  . ARG A 1 336 ? 8.091   -1.098  0.473   1.00 25.56 ? 379  ARG A CG  1 
ATOM   2485  C  CD  . ARG A 1 336 ? 7.924   0.224   1.205   1.00 25.04 ? 379  ARG A CD  1 
ATOM   2486  N  NE  . ARG A 1 336 ? 8.133   0.063   2.635   1.00 26.71 ? 379  ARG A NE  1 
ATOM   2487  C  CZ  . ARG A 1 336 ? 7.773   0.967   3.543   1.00 27.56 ? 379  ARG A CZ  1 
ATOM   2488  N  NH1 . ARG A 1 336 ? 7.207   2.103   3.167   1.00 25.77 ? 379  ARG A NH1 1 
ATOM   2489  N  NH2 . ARG A 1 336 ? 7.997   0.731   4.826   1.00 28.14 ? 379  ARG A NH2 1 
ATOM   2490  N  N   . ASN A 1 337 ? 8.808   -3.065  3.337   1.00 24.03 ? 380  ASN A N   1 
ATOM   2491  C  CA  . ASN A 1 337 ? 10.224  -3.318  4.031   1.00 23.12 ? 380  ASN A CA  1 
ATOM   2492  C  C   . ASN A 1 337 ? 11.046  -4.604  3.810   1.00 22.12 ? 380  ASN A C   1 
ATOM   2493  O  O   . ASN A 1 337 ? 12.272  -4.579  3.874   1.00 23.69 ? 380  ASN A O   1 
ATOM   2494  C  CB  . ASN A 1 337 ? 9.929   -3.077  5.533   1.00 25.10 ? 380  ASN A CB  1 
ATOM   2495  C  CG  . ASN A 1 337 ? 9.672   -1.590  5.798   1.00 26.56 ? 380  ASN A CG  1 
ATOM   2496  O  OD1 . ASN A 1 337 ? 10.285  -0.716  5.199   1.00 28.16 ? 380  ASN A OD1 1 
ATOM   2497  N  ND2 . ASN A 1 337 ? 8.748   -1.329  6.712   1.00 26.99 ? 380  ASN A ND2 1 
ATOM   2498  N  N   . TYR A 1 338 ? 10.375  -5.717  3.566   1.00 21.06 ? 381  TYR A N   1 
ATOM   2499  C  CA  . TYR A 1 338 ? 11.074  -6.984  3.366   1.00 20.21 ? 381  TYR A CA  1 
ATOM   2500  C  C   . TYR A 1 338 ? 11.361  -7.522  1.940   1.00 20.71 ? 381  TYR A C   1 
ATOM   2501  O  O   . TYR A 1 338 ? 11.780  -8.670  1.792   1.00 20.48 ? 381  TYR A O   1 
ATOM   2502  C  CB  . TYR A 1 338 ? 10.344  -8.047  4.178   1.00 18.78 ? 381  TYR A CB  1 
ATOM   2503  C  CG  . TYR A 1 338 ? 9.778   -7.492  5.452   1.00 18.93 ? 381  TYR A CG  1 
ATOM   2504  C  CD1 . TYR A 1 338 ? 8.669   -6.636  5.428   1.00 21.37 ? 381  TYR A CD1 1 
ATOM   2505  C  CD2 . TYR A 1 338 ? 10.356  -7.786  6.677   1.00 19.74 ? 381  TYR A CD2 1 
ATOM   2506  C  CE1 . TYR A 1 338 ? 8.143   -6.085  6.604   1.00 21.99 ? 381  TYR A CE1 1 
ATOM   2507  C  CE2 . TYR A 1 338 ? 9.843   -7.238  7.869   1.00 21.30 ? 381  TYR A CE2 1 
ATOM   2508  C  CZ  . TYR A 1 338 ? 8.731   -6.395  7.824   1.00 22.44 ? 381  TYR A CZ  1 
ATOM   2509  O  OH  . TYR A 1 338 ? 8.175   -5.935  9.001   1.00 20.24 ? 381  TYR A OH  1 
ATOM   2510  N  N   . MET A 1 339 ? 11.202  -6.712  0.899   1.00 20.01 ? 382  MET A N   1 
ATOM   2511  C  CA  . MET A 1 339 ? 11.419  -7.176  -0.476  1.00 19.67 ? 382  MET A CA  1 
ATOM   2512  C  C   . MET A 1 339 ? 12.596  -8.141  -0.667  1.00 19.35 ? 382  MET A C   1 
ATOM   2513  O  O   . MET A 1 339 ? 12.468  -9.147  -1.356  1.00 19.71 ? 382  MET A O   1 
ATOM   2514  C  CB  . MET A 1 339 ? 11.571  -5.982  -1.414  1.00 19.54 ? 382  MET A CB  1 
ATOM   2515  C  CG  . MET A 1 339 ? 10.348  -5.070  -1.426  1.00 20.05 ? 382  MET A CG  1 
ATOM   2516  S  SD  . MET A 1 339 ? 8.829   -5.918  -1.911  1.00 19.83 ? 382  MET A SD  1 
ATOM   2517  C  CE  . MET A 1 339 ? 9.472   -7.138  -3.056  1.00 17.00 ? 382  MET A CE  1 
ATOM   2518  N  N   . THR A 1 340 ? 13.739  -7.850  -0.063  1.00 18.13 ? 383  THR A N   1 
ATOM   2519  C  CA  . THR A 1 340 ? 14.890  -8.721  -0.228  1.00 18.19 ? 383  THR A CA  1 
ATOM   2520  C  C   . THR A 1 340 ? 15.188  -9.615  0.985   1.00 18.45 ? 383  THR A C   1 
ATOM   2521  O  O   . THR A 1 340 ? 16.347  -9.913  1.229   1.00 17.77 ? 383  THR A O   1 
ATOM   2522  C  CB  . THR A 1 340 ? 16.166  -7.922  -0.483  1.00 18.35 ? 383  THR A CB  1 
ATOM   2523  O  OG1 . THR A 1 340 ? 16.349  -6.951  0.546   1.00 21.13 ? 383  THR A OG1 1 
ATOM   2524  C  CG2 . THR A 1 340 ? 16.078  -7.234  -1.840  1.00 17.55 ? 383  THR A CG2 1 
ATOM   2525  N  N   . LYS A 1 341 ? 14.222  -10.038 1.759   1.00 19.55 ? 384  LYS A N   1 
ATOM   2526  C  CA  . LYS A 1 341 ? 14.438  -10.941 2.879   1.00 21.42 ? 384  LYS A CA  1 
ATOM   2527  C  C   . LYS A 1 341 ? 13.227  -11.867 2.875   1.00 22.55 ? 384  LYS A C   1 
ATOM   2528  O  O   . LYS A 1 341 ? 12.488  -11.886 1.907   1.00 23.02 ? 384  LYS A O   1 
ATOM   2529  C  CB  . LYS A 1 341 ? 14.543  -10.175 4.224   1.00 22.64 ? 384  LYS A CB  1 
ATOM   2530  C  CG  . LYS A 1 341 ? 14.765  -8.689  4.064   1.00 22.68 ? 384  LYS A CG  1 
ATOM   2531  C  CD  . LYS A 1 341 ? 15.871  -8.182  4.991   1.00 22.16 ? 384  LYS A CD  1 
ATOM   2532  C  CE  . LYS A 1 341 ? 15.614  -8.594  6.436   1.00 23.62 ? 384  LYS A CE  1 
ATOM   2533  N  NZ  . LYS A 1 341 ? 14.791  -7.589  7.169   1.00 22.07 ? 384  LYS A NZ  1 
ATOM   2534  N  N   . PHE A 1 342 ? 12.980  -12.635 3.917   1.00 23.17 ? 385  PHE A N   1 
ATOM   2535  C  CA  . PHE A 1 342 ? 11.838  -13.530 3.897   1.00 24.28 ? 385  PHE A CA  1 
ATOM   2536  C  C   . PHE A 1 342 ? 11.013  -13.479 2.560   1.00 25.02 ? 385  PHE A C   1 
ATOM   2537  O  O   . PHE A 1 342 ? 10.018  -14.188 2.458   1.00 25.44 ? 385  PHE A O   1 
ATOM   2538  C  CB  . PHE A 1 342 ? 10.885  -13.306 5.123   1.00 24.36 ? 385  PHE A CB  1 
ATOM   2539  C  CG  . PHE A 1 342 ? 9.555   -12.603 4.925   1.00 25.45 ? 385  PHE A CG  1 
ATOM   2540  C  CD1 . PHE A 1 342 ? 8.358   -13.262 4.559   1.00 25.64 ? 385  PHE A CD1 1 
ATOM   2541  C  CD2 . PHE A 1 342 ? 9.488   -11.223 5.103   1.00 26.31 ? 385  PHE A CD2 1 
ATOM   2542  C  CE1 . PHE A 1 342 ? 7.174   -12.556 4.374   1.00 26.22 ? 385  PHE A CE1 1 
ATOM   2543  C  CE2 . PHE A 1 342 ? 8.302   -10.508 4.888   1.00 26.60 ? 385  PHE A CE2 1 
ATOM   2544  C  CZ  . PHE A 1 342 ? 7.145   -11.181 4.522   1.00 25.93 ? 385  PHE A CZ  1 
ATOM   2545  N  N   . LEU A 1 343 ? 11.381  -12.699 1.539   1.00 25.14 ? 386  LEU A N   1 
ATOM   2546  C  CA  . LEU A 1 343 ? 10.650  -12.769 0.286   1.00 26.46 ? 386  LEU A CA  1 
ATOM   2547  C  C   . LEU A 1 343 ? 11.630  -13.451 -0.642  1.00 27.95 ? 386  LEU A C   1 
ATOM   2548  O  O   . LEU A 1 343 ? 11.305  -14.374 -1.390  1.00 30.02 ? 386  LEU A O   1 
ATOM   2549  C  CB  . LEU A 1 343 ? 10.250  -11.383 -0.274  1.00 26.96 ? 386  LEU A CB  1 
ATOM   2550  C  CG  . LEU A 1 343 ? 8.772   -11.062 -0.600  1.00 28.45 ? 386  LEU A CG  1 
ATOM   2551  C  CD1 . LEU A 1 343 ? 8.680   -9.774  -1.401  1.00 28.05 ? 386  LEU A CD1 1 
ATOM   2552  C  CD2 . LEU A 1 343 ? 8.106   -12.201 -1.337  1.00 25.86 ? 386  LEU A CD2 1 
ATOM   2553  N  N   . SER A 1 344 ? 12.859  -12.959 -0.574  1.00 28.19 ? 387  SER A N   1 
ATOM   2554  C  CA  . SER A 1 344 ? 13.926  -13.546 -1.363  1.00 29.34 ? 387  SER A CA  1 
ATOM   2555  C  C   . SER A 1 344 ? 14.229  -14.929 -0.848  1.00 30.09 ? 387  SER A C   1 
ATOM   2556  O  O   . SER A 1 344 ? 14.781  -15.081 0.236   1.00 31.07 ? 387  SER A O   1 
ATOM   2557  C  CB  . SER A 1 344 ? 15.195  -12.704 -1.278  1.00 30.85 ? 387  SER A CB  1 
ATOM   2558  O  OG  . SER A 1 344 ? 16.321  -13.442 -1.723  1.00 31.10 ? 387  SER A OG  1 
ATOM   2559  N  N   . ASP A 1 345 ? 13.871  -15.945 -1.618  1.00 30.33 ? 388  ASP A N   1 
ATOM   2560  C  CA  . ASP A 1 345 ? 14.150  -17.302 -1.188  1.00 29.76 ? 388  ASP A CA  1 
ATOM   2561  C  C   . ASP A 1 345 ? 15.658  -17.439 -1.059  1.00 29.06 ? 388  ASP A C   1 
ATOM   2562  O  O   . ASP A 1 345 ? 16.162  -18.307 -0.346  1.00 28.02 ? 388  ASP A O   1 
ATOM   2563  C  CB  . ASP A 1 345 ? 13.583  -18.310 -2.187  1.00 30.17 ? 388  ASP A CB  1 
ATOM   2564  C  CG  . ASP A 1 345 ? 12.057  -18.344 -2.175  1.00 32.20 ? 388  ASP A CG  1 
ATOM   2565  O  OD1 . ASP A 1 345 ? 11.472  -19.359 -2.622  1.00 33.94 ? 388  ASP A OD1 1 
ATOM   2566  O  OD2 . ASP A 1 345 ? 11.436  -17.355 -1.727  1.00 31.45 ? 388  ASP A OD2 1 
ATOM   2567  N  N   . ARG A 1 346 ? 16.380  -16.554 -1.738  1.00 29.20 ? 389  ARG A N   1 
ATOM   2568  C  CA  . ARG A 1 346 ? 17.836  -16.571 -1.681  1.00 28.49 ? 389  ARG A CA  1 
ATOM   2569  C  C   . ARG A 1 346 ? 18.184  -16.291 -0.225  1.00 28.74 ? 389  ARG A C   1 
ATOM   2570  O  O   . ARG A 1 346 ? 19.130  -16.858 0.327   1.00 28.61 ? 389  ARG A O   1 
ATOM   2571  C  CB  . ARG A 1 346 ? 18.407  -15.485 -2.595  1.00 27.06 ? 389  ARG A CB  1 
ATOM   2572  C  CG  . ARG A 1 346 ? 19.685  -15.851 -3.350  1.00 25.58 ? 389  ARG A CG  1 
ATOM   2573  C  CD  . ARG A 1 346 ? 20.891  -16.028 -2.437  1.00 24.81 ? 389  ARG A CD  1 
ATOM   2574  N  NE  . ARG A 1 346 ? 20.939  -17.367 -1.852  1.00 24.61 ? 389  ARG A NE  1 
ATOM   2575  C  CZ  . ARG A 1 346 ? 21.962  -17.836 -1.143  1.00 23.45 ? 389  ARG A CZ  1 
ATOM   2576  N  NH1 . ARG A 1 346 ? 23.029  -17.072 -0.928  1.00 22.98 ? 389  ARG A NH1 1 
ATOM   2577  N  NH2 . ARG A 1 346 ? 21.919  -19.070 -0.654  1.00 22.15 ? 389  ARG A NH2 1 
ATOM   2578  N  N   . TRP A 1 347 ? 17.384  -15.426 0.393   1.00 28.16 ? 390  TRP A N   1 
ATOM   2579  C  CA  . TRP A 1 347 ? 17.565  -15.058 1.788   1.00 27.97 ? 390  TRP A CA  1 
ATOM   2580  C  C   . TRP A 1 347 ? 17.112  -16.199 2.683   1.00 27.84 ? 390  TRP A C   1 
ATOM   2581  O  O   . TRP A 1 347 ? 17.905  -16.746 3.454   1.00 29.25 ? 390  TRP A O   1 
ATOM   2582  C  CB  . TRP A 1 347 ? 16.743  -13.824 2.111   1.00 29.14 ? 390  TRP A CB  1 
ATOM   2583  C  CG  . TRP A 1 347 ? 16.927  -13.308 3.501   1.00 28.67 ? 390  TRP A CG  1 
ATOM   2584  C  CD1 . TRP A 1 347 ? 17.907  -12.469 3.935   1.00 28.30 ? 390  TRP A CD1 1 
ATOM   2585  C  CD2 . TRP A 1 347 ? 16.074  -13.546 4.625   1.00 27.82 ? 390  TRP A CD2 1 
ATOM   2586  N  NE1 . TRP A 1 347 ? 17.714  -12.162 5.256   1.00 28.64 ? 390  TRP A NE1 1 
ATOM   2587  C  CE2 . TRP A 1 347 ? 16.594  -12.810 5.705   1.00 28.21 ? 390  TRP A CE2 1 
ATOM   2588  C  CE3 . TRP A 1 347 ? 14.920  -14.307 4.823   1.00 27.83 ? 390  TRP A CE3 1 
ATOM   2589  C  CZ2 . TRP A 1 347 ? 15.995  -12.810 6.973   1.00 28.10 ? 390  TRP A CZ2 1 
ATOM   2590  C  CZ3 . TRP A 1 347 ? 14.327  -14.307 6.080   1.00 27.83 ? 390  TRP A CZ3 1 
ATOM   2591  C  CH2 . TRP A 1 347 ? 14.867  -13.562 7.137   1.00 26.86 ? 390  TRP A CH2 1 
ATOM   2592  N  N   . MET A 1 348 ? 15.833  -16.551 2.585   1.00 26.42 ? 391  MET A N   1 
ATOM   2593  C  CA  . MET A 1 348 ? 15.278  -17.641 3.379   1.00 26.09 ? 391  MET A CA  1 
ATOM   2594  C  C   . MET A 1 348 ? 16.226  -18.829 3.342   1.00 25.86 ? 391  MET A C   1 
ATOM   2595  O  O   . MET A 1 348 ? 16.210  -19.691 4.218   1.00 25.74 ? 391  MET A O   1 
ATOM   2596  C  CB  . MET A 1 348 ? 13.918  -18.049 2.826   1.00 26.23 ? 391  MET A CB  1 
ATOM   2597  C  CG  . MET A 1 348 ? 12.800  -17.146 3.248   1.00 26.46 ? 391  MET A CG  1 
ATOM   2598  S  SD  . MET A 1 348 ? 12.529  -17.365 4.991   1.00 28.34 ? 391  MET A SD  1 
ATOM   2599  C  CE  . MET A 1 348 ? 10.821  -17.971 4.980   1.00 28.68 ? 391  MET A CE  1 
ATOM   2600  N  N   . LEU A 1 349 ? 17.053  -18.857 2.309   1.00 25.72 ? 392  LEU A N   1 
ATOM   2601  C  CA  . LEU A 1 349 ? 18.023  -19.913 2.136   1.00 26.36 ? 392  LEU A CA  1 
ATOM   2602  C  C   . LEU A 1 349 ? 19.247  -19.723 3.017   1.00 26.78 ? 392  LEU A C   1 
ATOM   2603  O  O   . LEU A 1 349 ? 19.541  -20.554 3.868   1.00 25.86 ? 392  LEU A O   1 
ATOM   2604  C  CB  . LEU A 1 349 ? 18.461  -19.984 0.681   1.00 26.74 ? 392  LEU A CB  1 
ATOM   2605  C  CG  . LEU A 1 349 ? 17.637  -20.910 -0.199  1.00 26.96 ? 392  LEU A CG  1 
ATOM   2606  C  CD1 . LEU A 1 349 ? 18.282  -20.964 -1.582  1.00 26.55 ? 392  LEU A CD1 1 
ATOM   2607  C  CD2 . LEU A 1 349 ? 17.566  -22.306 0.437   1.00 25.38 ? 392  LEU A CD2 1 
ATOM   2608  N  N   . GLN A 1 350 ? 19.969  -18.630 2.812   1.00 27.36 ? 393  GLN A N   1 
ATOM   2609  C  CA  . GLN A 1 350 ? 21.162  -18.397 3.606   1.00 28.55 ? 393  GLN A CA  1 
ATOM   2610  C  C   . GLN A 1 350 ? 20.843  -18.241 5.092   1.00 28.32 ? 393  GLN A C   1 
ATOM   2611  O  O   . GLN A 1 350 ? 21.542  -18.792 5.937   1.00 28.05 ? 393  GLN A O   1 
ATOM   2612  C  CB  . GLN A 1 350 ? 21.933  -17.183 3.068   1.00 28.29 ? 393  GLN A CB  1 
ATOM   2613  C  CG  . GLN A 1 350 ? 21.154  -15.885 3.001   1.00 29.12 ? 393  GLN A CG  1 
ATOM   2614  C  CD  . GLN A 1 350 ? 21.852  -14.847 2.137   1.00 29.71 ? 393  GLN A CD  1 
ATOM   2615  O  OE1 . GLN A 1 350 ? 23.076  -14.723 2.172   1.00 30.52 ? 393  GLN A OE1 1 
ATOM   2616  N  NE2 . GLN A 1 350 ? 21.076  -14.089 1.363   1.00 29.82 ? 393  GLN A NE2 1 
ATOM   2617  N  N   . LYS A 1 351 ? 19.777  -17.515 5.408   1.00 28.51 ? 394  LYS A N   1 
ATOM   2618  C  CA  . LYS A 1 351 ? 19.381  -17.313 6.797   1.00 28.96 ? 394  LYS A CA  1 
ATOM   2619  C  C   . LYS A 1 351 ? 18.812  -18.577 7.426   1.00 30.30 ? 394  LYS A C   1 
ATOM   2620  O  O   . LYS A 1 351 ? 18.213  -18.524 8.501   1.00 30.32 ? 394  LYS A O   1 
ATOM   2621  C  CB  . LYS A 1 351 ? 18.346  -16.203 6.888   1.00 28.40 ? 394  LYS A CB  1 
ATOM   2622  C  CG  . LYS A 1 351 ? 18.926  -14.822 6.695   1.00 28.75 ? 394  LYS A CG  1 
ATOM   2623  C  CD  . LYS A 1 351 ? 19.838  -14.466 7.845   1.00 28.30 ? 394  LYS A CD  1 
ATOM   2624  C  CE  . LYS A 1 351 ? 20.215  -12.995 7.805   1.00 27.08 ? 394  LYS A CE  1 
ATOM   2625  N  NZ  . LYS A 1 351 ? 21.440  -12.718 8.605   1.00 26.49 ? 394  LYS A NZ  1 
ATOM   2626  N  N   . GLY A 1 352 ? 18.975  -19.709 6.754   1.00 31.22 ? 395  GLY A N   1 
ATOM   2627  C  CA  . GLY A 1 352 ? 18.465  -21.001 7.223   1.00 32.39 ? 395  GLY A CA  1 
ATOM   2628  C  C   . GLY A 1 352 ? 16.968  -20.964 7.515   1.00 34.13 ? 395  GLY A C   1 
ATOM   2629  O  O   . GLY A 1 352 ? 16.558  -20.415 8.539   1.00 35.25 ? 395  GLY A O   1 
ATOM   2630  N  N   . PHE A 1 353 ? 16.280  -21.524 6.528   1.00 34.75 ? 396  PHE A N   1 
ATOM   2631  C  CA  . PHE A 1 353 ? 14.824  -21.684 6.385   1.00 36.02 ? 396  PHE A CA  1 
ATOM   2632  C  C   . PHE A 1 353 ? 14.472  -22.248 5.023   1.00 37.23 ? 396  PHE A C   1 
ATOM   2633  O  O   . PHE A 1 353 ? 14.450  -21.505 4.026   1.00 37.13 ? 396  PHE A O   1 
ATOM   2634  C  CB  . PHE A 1 353 ? 14.073  -20.332 6.448   1.00 35.50 ? 396  PHE A CB  1 
ATOM   2635  C  CG  . PHE A 1 353 ? 14.372  -19.292 7.512   1.00 34.94 ? 396  PHE A CG  1 
ATOM   2636  C  CD1 . PHE A 1 353 ? 15.034  -18.105 7.218   1.00 35.23 ? 396  PHE A CD1 1 
ATOM   2637  C  CD2 . PHE A 1 353 ? 13.970  -19.491 8.827   1.00 34.81 ? 396  PHE A CD2 1 
ATOM   2638  C  CE1 . PHE A 1 353 ? 15.297  -17.127 8.185   1.00 34.34 ? 396  PHE A CE1 1 
ATOM   2639  C  CE2 . PHE A 1 353 ? 14.197  -18.522 9.800   1.00 35.54 ? 396  PHE A CE2 1 
ATOM   2640  C  CZ  . PHE A 1 353 ? 14.863  -17.337 9.489   1.00 34.90 ? 396  PHE A CZ  1 
ATOM   2641  N  N   . LEU A 1 354 ? 14.226  -23.556 4.950   1.00 38.63 ? 397  LEU A N   1 
ATOM   2642  C  CA  . LEU A 1 354 ? 13.640  -24.281 3.766   1.00 39.77 ? 397  LEU A CA  1 
ATOM   2643  C  C   . LEU A 1 354 ? 14.403  -24.632 2.494   1.00 41.22 ? 397  LEU A C   1 
ATOM   2644  O  O   . LEU A 1 354 ? 13.800  -24.656 1.425   1.00 41.53 ? 397  LEU A O   1 
ATOM   2645  C  CB  . LEU A 1 354 ? 12.327  -23.580 3.376   1.00 38.84 ? 397  LEU A CB  1 
ATOM   2646  C  CG  . LEU A 1 354 ? 12.335  -22.041 3.257   1.00 37.64 ? 397  LEU A CG  1 
ATOM   2647  C  CD1 . LEU A 1 354 ? 11.211  -21.449 4.100   1.00 38.31 ? 397  LEU A CD1 1 
ATOM   2648  C  CD2 . LEU A 1 354 ? 13.696  -21.490 3.668   1.00 36.90 ? 397  LEU A CD2 1 
ATOM   2649  N  N   . LYS A 1 355 ? 15.660  -24.972 2.597   1.00 42.36 ? 398  LYS A N   1 
ATOM   2650  C  CA  . LYS A 1 355 ? 16.528  -25.260 1.457   1.00 42.87 ? 398  LYS A CA  1 
ATOM   2651  C  C   . LYS A 1 355 ? 16.300  -26.571 0.638   1.00 44.54 ? 398  LYS A C   1 
ATOM   2652  O  O   . LYS A 1 355 ? 16.528  -27.695 1.094   1.00 44.92 ? 398  LYS A O   1 
ATOM   2653  C  CB  . LYS A 1 355 ? 17.947  -25.081 1.979   1.00 40.43 ? 398  LYS A CB  1 
ATOM   2654  C  CG  . LYS A 1 355 ? 18.005  -24.478 3.371   1.00 39.47 ? 398  LYS A CG  1 
ATOM   2655  C  CD  . LYS A 1 355 ? 17.921  -25.547 4.431   1.00 38.43 ? 398  LYS A CD  1 
ATOM   2656  C  CE  . LYS A 1 355 ? 18.946  -25.306 5.538   1.00 37.92 ? 398  LYS A CE  1 
ATOM   2657  N  NZ  . LYS A 1 355 ? 20.236  -25.997 5.271   1.00 34.67 ? 398  LYS A NZ  1 
ATOM   2658  N  N   . GLU A 1 356 ? 15.818  -26.279 -0.661  1.00 45.82 ? 399  GLU A N   1 
ATOM   2659  C  CA  . GLU A 1 356 ? 15.549  -27.209 -1.881  1.00 46.73 ? 399  GLU A CA  1 
ATOM   2660  C  C   . GLU A 1 356 ? 14.479  -26.973 -3.075  1.00 47.89 ? 399  GLU A C   1 
ATOM   2661  O  O   . GLU A 1 356 ? 13.323  -26.747 -2.763  1.00 48.26 ? 399  GLU A O   1 
ATOM   2662  C  CB  . GLU A 1 356 ? 15.275  -28.604 -1.245  1.00 45.09 ? 399  GLU A CB  1 
ATOM   2663  C  CG  . GLU A 1 356 ? 13.827  -29.101 -1.359  1.00 42.20 ? 399  GLU A CG  1 
ATOM   2664  C  CD  . GLU A 1 356 ? 13.114  -29.379 -0.023  1.00 40.77 ? 399  GLU A CD  1 
ATOM   2665  O  OE1 . GLU A 1 356 ? 12.453  -30.442 0.078   1.00 38.67 ? 399  GLU A OE1 1 
ATOM   2666  O  OE2 . GLU A 1 356 ? 13.224  -28.550 0.909   1.00 39.91 ? 399  GLU A OE2 1 
ATOM   2667  N  N   . GLU A 1 357 ? 14.850  -27.025 -4.507  1.00 49.89 ? 400  GLU A N   1 
ATOM   2668  C  CA  . GLU A 1 357 ? 13.842  -27.305 -5.588  1.00 51.67 ? 400  GLU A CA  1 
ATOM   2669  C  C   . GLU A 1 357 ? 14.051  -26.715 -7.005  1.00 53.74 ? 400  GLU A C   1 
ATOM   2670  O  O   . GLU A 1 357 ? 13.411  -27.222 -7.930  1.00 54.11 ? 400  GLU A O   1 
ATOM   2671  C  CB  . GLU A 1 357 ? 12.483  -26.872 -5.066  1.00 49.90 ? 400  GLU A CB  1 
ATOM   2672  C  CG  . GLU A 1 357 ? 11.295  -27.368 -5.874  1.00 48.29 ? 400  GLU A CG  1 
ATOM   2673  C  CD  . GLU A 1 357 ? 11.090  -28.876 -5.765  1.00 47.16 ? 400  GLU A CD  1 
ATOM   2674  O  OE1 . GLU A 1 357 ? 11.880  -29.623 -6.378  1.00 46.40 ? 400  GLU A OE1 1 
ATOM   2675  O  OE2 . GLU A 1 357 ? 10.162  -29.316 -5.058  1.00 46.64 ? 400  GLU A OE2 1 
ATOM   2676  N  N   . ASP A 1 358 ? 14.911  -25.683 -7.254  1.00 55.79 ? 401  ASP A N   1 
ATOM   2677  C  CA  . ASP A 1 358 ? 14.981  -25.041 -8.614  1.00 57.57 ? 401  ASP A CA  1 
ATOM   2678  C  C   . ASP A 1 358 ? 15.816  -25.690 -9.704  1.00 58.21 ? 401  ASP A C   1 
ATOM   2679  O  O   . ASP A 1 358 ? 17.045  -25.711 -9.713  1.00 57.85 ? 401  ASP A O   1 
ATOM   2680  C  CB  . ASP A 1 358 ? 15.386  -23.575 -8.509  1.00 57.76 ? 401  ASP A CB  1 
ATOM   2681  C  CG  . ASP A 1 358 ? 15.559  -22.938 -9.888  1.00 57.83 ? 401  ASP A CG  1 
ATOM   2682  O  OD1 . ASP A 1 358 ? 16.721  -22.859 -10.346 1.00 57.07 ? 401  ASP A OD1 1 
ATOM   2683  O  OD2 . ASP A 1 358 ? 14.540  -22.529 -10.496 1.00 57.34 ? 401  ASP A OD2 1 
ATOM   2684  N  N   . LEU A 1 359 ? 15.014  -26.198 -10.605 1.00 59.13 ? 402  LEU A N   1 
ATOM   2685  C  CA  . LEU A 1 359 ? 15.250  -27.027 -11.776 1.00 60.29 ? 402  LEU A CA  1 
ATOM   2686  C  C   . LEU A 1 359 ? 15.884  -26.452 -13.099 1.00 60.33 ? 402  LEU A C   1 
ATOM   2687  O  O   . LEU A 1 359 ? 16.900  -26.961 -13.546 1.00 60.00 ? 402  LEU A O   1 
ATOM   2688  C  CB  . LEU A 1 359 ? 13.869  -27.565 -12.238 1.00 61.17 ? 402  LEU A CB  1 
ATOM   2689  C  CG  . LEU A 1 359 ? 13.626  -29.058 -12.371 1.00 61.05 ? 402  LEU A CG  1 
ATOM   2690  C  CD1 . LEU A 1 359 ? 13.967  -29.532 -13.769 1.00 60.27 ? 402  LEU A CD1 1 
ATOM   2691  C  CD2 . LEU A 1 359 ? 14.417  -29.823 -11.328 1.00 59.72 ? 402  LEU A CD2 1 
ATOM   2692  N  N   . THR A 1 360 ? 15.273  -25.416 -13.713 1.00 60.84 ? 403  THR A N   1 
ATOM   2693  C  CA  . THR A 1 360 ? 15.550  -24.967 -15.128 1.00 61.20 ? 403  THR A CA  1 
ATOM   2694  C  C   . THR A 1 360 ? 14.711  -25.816 -16.084 1.00 61.45 ? 403  THR A C   1 
ATOM   2695  O  O   . THR A 1 360 ? 13.812  -26.578 -15.795 1.00 61.11 ? 403  THR A O   1 
ATOM   2696  C  CB  . THR A 1 360 ? 17.021  -25.059 -15.579 1.00 61.16 ? 403  THR A CB  1 
ATOM   2697  O  OG1 . THR A 1 360 ? 17.438  -26.431 -15.609 1.00 60.26 ? 403  THR A OG1 1 
ATOM   2698  C  CG2 . THR A 1 360 ? 17.903  -24.278 -14.623 1.00 61.48 ? 403  THR A CG2 1 
ATOM   2699  N  N   . ARG B 1 2   ? -3.022  -3.942  -30.345 1.00 28.58 ? 45   ARG B N   1 
ATOM   2700  C  CA  . ARG B 1 2   ? -2.216  -4.707  -31.297 1.00 28.66 ? 45   ARG B CA  1 
ATOM   2701  C  C   . ARG B 1 2   ? -2.003  -3.957  -32.604 1.00 29.29 ? 45   ARG B C   1 
ATOM   2702  O  O   . ARG B 1 2   ? -2.738  -3.005  -32.897 1.00 29.08 ? 45   ARG B O   1 
ATOM   2703  C  CB  . ARG B 1 2   ? -2.871  -6.037  -31.654 1.00 28.16 ? 45   ARG B CB  1 
ATOM   2704  C  CG  . ARG B 1 2   ? -3.450  -6.838  -30.507 1.00 21.52 ? 45   ARG B CG  1 
ATOM   2705  C  CD  . ARG B 1 2   ? -3.881  -8.203  -31.011 1.00 21.52 ? 45   ARG B CD  1 
ATOM   2706  N  NE  . ARG B 1 2   ? -2.749  -9.114  -31.203 1.00 21.52 ? 45   ARG B NE  1 
ATOM   2707  C  CZ  . ARG B 1 2   ? -2.817  -10.260 -31.884 1.00 21.52 ? 45   ARG B CZ  1 
ATOM   2708  N  NH1 . ARG B 1 2   ? -3.967  -10.621 -32.448 1.00 21.52 ? 45   ARG B NH1 1 
ATOM   2709  N  NH2 . ARG B 1 2   ? -1.754  -11.033 -32.000 1.00 21.52 ? 45   ARG B NH2 1 
ATOM   2710  N  N   . PRO B 1 3   ? -0.983  -4.392  -33.380 1.00 22.55 ? 46   PRO B N   1 
ATOM   2711  C  CA  . PRO B 1 3   ? -0.730  -3.808  -34.739 1.00 22.50 ? 46   PRO B CA  1 
ATOM   2712  C  C   . PRO B 1 3   ? -1.936  -3.853  -35.706 1.00 23.64 ? 46   PRO B C   1 
ATOM   2713  O  O   . PRO B 1 3   ? -2.817  -4.687  -35.561 1.00 24.04 ? 46   PRO B O   1 
ATOM   2714  C  CB  . PRO B 1 3   ? 0.566   -4.478  -35.194 1.00 23.03 ? 46   PRO B CB  1 
ATOM   2715  C  CG  . PRO B 1 3   ? 1.316   -4.550  -33.911 1.00 21.71 ? 46   PRO B CG  1 
ATOM   2716  C  CD  . PRO B 1 3   ? 0.344   -4.530  -32.779 1.00 21.71 ? 46   PRO B CD  1 
ATOM   2717  N  N   . ASP B 1 4   ? -1.974  -2.925  -36.702 1.00 22.55 ? 47   ASP B N   1 
ATOM   2718  C  CA  . ASP B 1 4   ? -3.064  -2.943  -37.690 1.00 22.50 ? 47   ASP B CA  1 
ATOM   2719  C  C   . ASP B 1 4   ? -4.311  -3.210  -36.928 1.00 23.64 ? 47   ASP B C   1 
ATOM   2720  O  O   . ASP B 1 4   ? -4.876  -4.275  -37.189 1.00 24.04 ? 47   ASP B O   1 
ATOM   2721  C  CB  . ASP B 1 4   ? -3.226  -4.254  -38.427 1.00 23.03 ? 47   ASP B CB  1 
ATOM   2722  C  CG  . ASP B 1 4   ? -4.461  -5.015  -37.871 1.00 21.71 ? 47   ASP B CG  1 
ATOM   2723  O  OD1 . ASP B 1 4   ? -4.628  -5.003  -36.631 1.00 21.71 ? 47   ASP B OD1 1 
ATOM   2724  O  OD2 . ASP B 1 4   ? -5.217  -5.595  -38.687 1.00 21.71 ? 47   ASP B OD2 1 
ATOM   2725  N  N   . ALA B 1 5   ? -4.833  -2.481  -36.059 1.00 28.58 ? 48   ALA B N   1 
ATOM   2726  C  CA  . ALA B 1 5   ? -5.787  -3.443  -35.554 1.00 28.66 ? 48   ALA B CA  1 
ATOM   2727  C  C   . ALA B 1 5   ? -7.066  -2.858  -35.147 1.00 29.29 ? 48   ALA B C   1 
ATOM   2728  O  O   . ALA B 1 5   ? -7.308  -2.534  -33.983 1.00 29.08 ? 48   ALA B O   1 
ATOM   2729  C  CB  . ALA B 1 5   ? -5.159  -4.189  -34.386 1.00 28.16 ? 48   ALA B CB  1 
ATOM   2730  N  N   . PRO B 1 6   ? -7.912  -2.701  -36.140 1.00 25.67 ? 49   PRO B N   1 
ATOM   2731  C  CA  . PRO B 1 6   ? -9.171  -2.021  -35.816 1.00 25.30 ? 49   PRO B CA  1 
ATOM   2732  C  C   . PRO B 1 6   ? -9.875  -2.494  -34.587 1.00 25.69 ? 49   PRO B C   1 
ATOM   2733  O  O   . PRO B 1 6   ? -9.957  -3.710  -34.335 1.00 24.38 ? 49   PRO B O   1 
ATOM   2734  C  CB  . PRO B 1 6   ? -9.913  -2.096  -37.147 1.00 26.75 ? 49   PRO B CB  1 
ATOM   2735  C  CG  . PRO B 1 6   ? -8.792  -1.885  -38.109 1.00 25.47 ? 49   PRO B CG  1 
ATOM   2736  C  CD  . PRO B 1 6   ? -7.484  -2.323  -37.496 1.00 25.73 ? 49   PRO B CD  1 
ATOM   2737  N  N   . SER B 1 7   ? -10.373 -1.577  -33.799 1.00 24.32 ? 50   SER B N   1 
ATOM   2738  C  CA  . SER B 1 7   ? -11.181 -2.069  -32.725 1.00 22.52 ? 50   SER B CA  1 
ATOM   2739  C  C   . SER B 1 7   ? -12.541 -2.071  -33.334 1.00 20.66 ? 50   SER B C   1 
ATOM   2740  O  O   . SER B 1 7   ? -13.432 -2.860  -32.992 1.00 18.79 ? 50   SER B O   1 
ATOM   2741  C  CB  . SER B 1 7   ? -11.219 -1.132  -31.518 1.00 23.42 ? 50   SER B CB  1 
ATOM   2742  O  OG  . SER B 1 7   ? -12.262 -0.176  -31.648 1.00 17.23 ? 50   SER B OG  1 
ATOM   2743  N  N   . ARG B 1 8   ? -12.689 -1.159  -34.267 1.00 20.67 ? 51   ARG B N   1 
ATOM   2744  C  CA  . ARG B 1 8   ? -13.971 -1.007  -34.896 1.00 23.41 ? 51   ARG B CA  1 
ATOM   2745  C  C   . ARG B 1 8   ? -15.062 -1.109  -33.875 1.00 24.64 ? 51   ARG B C   1 
ATOM   2746  O  O   . ARG B 1 8   ? -16.115 -1.658  -34.177 1.00 23.66 ? 51   ARG B O   1 
ATOM   2747  C  CB  . ARG B 1 8   ? -14.231 -2.062  -35.968 1.00 21.42 ? 51   ARG B CB  1 
ATOM   2748  C  CG  . ARG B 1 8   ? -14.688 -3.393  -35.428 1.00 21.00 ? 51   ARG B CG  1 
ATOM   2749  C  CD  . ARG B 1 8   ? -13.647 -4.458  -35.689 1.00 16.38 ? 51   ARG B CD  1 
ATOM   2750  N  NE  . ARG B 1 8   ? -13.545 -5.380  -34.579 1.00 13.17 ? 51   ARG B NE  1 
ATOM   2751  C  CZ  . ARG B 1 8   ? -12.846 -6.501  -34.643 1.00 12.53 ? 51   ARG B CZ  1 
ATOM   2752  N  NH1 . ARG B 1 8   ? -12.202 -6.825  -35.751 1.00 10.78 ? 51   ARG B NH1 1 
ATOM   2753  N  NH2 . ARG B 1 8   ? -12.804 -7.312  -33.597 1.00 13.56 ? 51   ARG B NH2 1 
ATOM   2754  N  N   . CYS B 1 9   ? -14.868 -0.642  -32.687 1.00 26.01 ? 52   CYS B N   1 
ATOM   2755  C  CA  . CYS B 1 9   ? -16.022 -0.756  -31.834 1.00 26.72 ? 52   CYS B CA  1 
ATOM   2756  C  C   . CYS B 1 9   ? -17.108 0.219   -32.293 1.00 27.22 ? 52   CYS B C   1 
ATOM   2757  O  O   . CYS B 1 9   ? -16.868 1.042   -33.184 1.00 27.25 ? 52   CYS B O   1 
ATOM   2758  C  CB  . CYS B 1 9   ? -15.622 -0.525  -30.384 1.00 25.85 ? 52   CYS B CB  1 
ATOM   2759  S  SG  . CYS B 1 9   ? -16.927 0.177   -29.327 1.00 27.75 ? 52   CYS B SG  1 
ATOM   2760  N  N   . THR B 1 10  ? -18.302 0.176   -31.692 1.00 27.80 ? 53   THR B N   1 
ATOM   2761  C  CA  . THR B 1 10  ? -19.312 1.122   -32.200 1.00 29.62 ? 53   THR B CA  1 
ATOM   2762  C  C   . THR B 1 10  ? -19.665 2.244   -31.237 1.00 31.61 ? 53   THR B C   1 
ATOM   2763  O  O   . THR B 1 10  ? -20.847 2.616   -31.109 1.00 31.49 ? 53   THR B O   1 
ATOM   2764  C  CB  . THR B 1 10  ? -20.549 0.358   -32.686 1.00 28.84 ? 53   THR B CB  1 
ATOM   2765  O  OG1 . THR B 1 10  ? -20.164 -0.958  -33.109 1.00 27.09 ? 53   THR B OG1 1 
ATOM   2766  C  CG2 . THR B 1 10  ? -21.207 1.101   -33.829 1.00 27.63 ? 53   THR B CG2 1 
ATOM   2767  N  N   . TRP B 1 11  ? -18.650 2.788   -30.555 1.00 32.80 ? 54   TRP B N   1 
ATOM   2768  C  CA  . TRP B 1 11  ? -18.833 3.900   -29.603 1.00 32.66 ? 54   TRP B CA  1 
ATOM   2769  C  C   . TRP B 1 11  ? -18.714 5.248   -30.307 1.00 33.29 ? 54   TRP B C   1 
ATOM   2770  O  O   . TRP B 1 11  ? -17.867 5.428   -31.189 1.00 32.50 ? 54   TRP B O   1 
ATOM   2771  C  CB  . TRP B 1 11  ? -17.849 3.822   -28.428 1.00 31.29 ? 54   TRP B CB  1 
ATOM   2772  C  CG  . TRP B 1 11  ? -18.154 4.876   -27.428 1.00 30.66 ? 54   TRP B CG  1 
ATOM   2773  C  CD1 . TRP B 1 11  ? -18.960 4.770   -26.335 1.00 30.52 ? 54   TRP B CD1 1 
ATOM   2774  C  CD2 . TRP B 1 11  ? -17.708 6.234   -27.433 1.00 29.71 ? 54   TRP B CD2 1 
ATOM   2775  N  NE1 . TRP B 1 11  ? -19.049 5.979   -25.658 1.00 29.65 ? 54   TRP B NE1 1 
ATOM   2776  C  CE2 . TRP B 1 11  ? -18.294 6.896   -26.333 1.00 29.33 ? 54   TRP B CE2 1 
ATOM   2777  C  CE3 . TRP B 1 11  ? -16.875 6.956   -28.295 1.00 28.68 ? 54   TRP B CE3 1 
ATOM   2778  C  CZ2 . TRP B 1 11  ? -18.080 8.240   -26.074 1.00 30.53 ? 54   TRP B CZ2 1 
ATOM   2779  C  CZ3 . TRP B 1 11  ? -16.662 8.288   -28.041 1.00 30.53 ? 54   TRP B CZ3 1 
ATOM   2780  C  CH2 . TRP B 1 11  ? -17.264 8.923   -26.936 1.00 31.65 ? 54   TRP B CH2 1 
ATOM   2781  N  N   . GLN B 1 12  ? -19.575 6.189   -29.929 1.00 33.98 ? 55   GLN B N   1 
ATOM   2782  C  CA  . GLN B 1 12  ? -19.567 7.539   -30.485 1.00 33.80 ? 55   GLN B CA  1 
ATOM   2783  C  C   . GLN B 1 12  ? -20.225 8.505   -29.494 1.00 33.82 ? 55   GLN B C   1 
ATOM   2784  O  O   . GLN B 1 12  ? -21.393 8.338   -29.141 1.00 34.16 ? 55   GLN B O   1 
ATOM   2785  C  CB  . GLN B 1 12  ? -20.323 7.576   -31.819 1.00 33.67 ? 55   GLN B CB  1 
ATOM   2786  C  CG  . GLN B 1 12  ? -19.632 6.906   -32.988 1.00 34.09 ? 55   GLN B CG  1 
ATOM   2787  C  CD  . GLN B 1 12  ? -18.325 7.570   -33.361 1.00 34.39 ? 55   GLN B CD  1 
ATOM   2788  O  OE1 . GLN B 1 12  ? -17.364 7.581   -32.590 1.00 34.27 ? 55   GLN B OE1 1 
ATOM   2789  N  NE2 . GLN B 1 12  ? -18.261 8.132   -34.561 1.00 33.76 ? 55   GLN B NE2 1 
ATOM   2790  N  N   . LEU B 1 13  ? -19.475 9.506   -29.036 1.00 34.18 ? 56   LEU B N   1 
ATOM   2791  C  CA  . LEU B 1 13  ? -20.020 10.465  -28.085 1.00 32.88 ? 56   LEU B CA  1 
ATOM   2792  C  C   . LEU B 1 13  ? -21.398 10.878  -28.536 1.00 32.18 ? 56   LEU B C   1 
ATOM   2793  O  O   . LEU B 1 13  ? -21.552 11.466  -29.604 1.00 31.33 ? 56   LEU B O   1 
ATOM   2794  C  CB  . LEU B 1 13  ? -19.132 11.710  -27.974 1.00 31.24 ? 56   LEU B CB  1 
ATOM   2795  C  CG  . LEU B 1 13  ? -19.774 12.892  -27.230 1.00 29.90 ? 56   LEU B CG  1 
ATOM   2796  C  CD1 . LEU B 1 13  ? -20.178 12.481  -25.824 1.00 28.04 ? 56   LEU B CD1 1 
ATOM   2797  C  CD2 . LEU B 1 13  ? -18.795 14.056  -27.190 1.00 30.09 ? 56   LEU B CD2 1 
ATOM   2798  N  N   . GLY B 1 14  ? -22.395 10.561  -27.723 1.00 31.78 ? 57   GLY B N   1 
ATOM   2799  C  CA  . GLY B 1 14  ? -23.752 10.930  -28.062 1.00 33.13 ? 57   GLY B CA  1 
ATOM   2800  C  C   . GLY B 1 14  ? -24.717 9.769   -28.015 1.00 33.75 ? 57   GLY B C   1 
ATOM   2801  O  O   . GLY B 1 14  ? -25.920 9.964   -27.807 1.00 33.82 ? 57   GLY B O   1 
ATOM   2802  N  N   . ARG B 1 15  ? -24.202 8.558   -28.207 1.00 34.73 ? 58   ARG B N   1 
ATOM   2803  C  CA  . ARG B 1 15  ? -25.058 7.380   -28.183 1.00 35.70 ? 58   ARG B CA  1 
ATOM   2804  C  C   . ARG B 1 15  ? -25.522 7.054   -26.780 1.00 36.14 ? 58   ARG B C   1 
ATOM   2805  O  O   . ARG B 1 15  ? -24.712 6.933   -25.857 1.00 35.63 ? 58   ARG B O   1 
ATOM   2806  C  CB  . ARG B 1 15  ? -24.342 6.168   -28.787 1.00 36.03 ? 58   ARG B CB  1 
ATOM   2807  C  CG  . ARG B 1 15  ? -24.242 6.226   -30.301 1.00 36.42 ? 58   ARG B CG  1 
ATOM   2808  C  CD  . ARG B 1 15  ? -24.846 4.999   -30.947 1.00 34.15 ? 58   ARG B CD  1 
ATOM   2809  N  NE  . ARG B 1 15  ? -23.875 3.920   -31.056 1.00 34.29 ? 58   ARG B NE  1 
ATOM   2810  C  CZ  . ARG B 1 15  ? -24.135 2.739   -31.603 1.00 34.58 ? 58   ARG B CZ  1 
ATOM   2811  N  NH1 . ARG B 1 15  ? -25.344 2.484   -32.083 1.00 35.29 ? 58   ARG B NH1 1 
ATOM   2812  N  NH2 . ARG B 1 15  ? -23.181 1.825   -31.696 1.00 34.59 ? 58   ARG B NH2 1 
ATOM   2813  N  N   . PRO B 1 16  ? -26.847 6.917   -26.606 1.00 36.33 ? 59   PRO B N   1 
ATOM   2814  C  CA  . PRO B 1 16  ? -27.516 6.600   -25.340 1.00 36.33 ? 59   PRO B CA  1 
ATOM   2815  C  C   . PRO B 1 16  ? -26.820 5.464   -24.614 1.00 35.21 ? 59   PRO B C   1 
ATOM   2816  O  O   . PRO B 1 16  ? -26.399 4.494   -25.235 1.00 34.32 ? 59   PRO B O   1 
ATOM   2817  C  CB  . PRO B 1 16  ? -28.923 6.218   -25.786 1.00 36.63 ? 59   PRO B CB  1 
ATOM   2818  C  CG  . PRO B 1 16  ? -29.154 7.150   -26.927 1.00 37.51 ? 59   PRO B CG  1 
ATOM   2819  C  CD  . PRO B 1 16  ? -27.835 7.079   -27.689 1.00 36.03 ? 59   PRO B CD  1 
ATOM   2820  N  N   . ALA B 1 17  ? -26.690 5.590   -23.301 1.00 35.09 ? 60   ALA B N   1 
ATOM   2821  C  CA  . ALA B 1 17  ? -26.028 4.548   -22.539 1.00 35.19 ? 60   ALA B CA  1 
ATOM   2822  C  C   . ALA B 1 17  ? -26.598 3.202   -22.971 1.00 35.62 ? 60   ALA B C   1 
ATOM   2823  O  O   . ALA B 1 17  ? -25.851 2.253   -23.206 1.00 36.60 ? 60   ALA B O   1 
ATOM   2824  C  CB  . ALA B 1 17  ? -26.239 4.765   -21.040 1.00 34.03 ? 60   ALA B CB  1 
ATOM   2825  N  N   . SER B 1 18  ? -27.921 3.140   -23.109 1.00 34.86 ? 61   SER B N   1 
ATOM   2826  C  CA  . SER B 1 18  ? -28.603 1.911   -23.502 1.00 34.18 ? 61   SER B CA  1 
ATOM   2827  C  C   . SER B 1 18  ? -27.948 1.184   -24.670 1.00 33.10 ? 61   SER B C   1 
ATOM   2828  O  O   . SER B 1 18  ? -27.657 -0.006  -24.599 1.00 33.26 ? 61   SER B O   1 
ATOM   2829  C  CB  . SER B 1 18  ? -30.083 2.198   -23.817 1.00 34.84 ? 61   SER B CB  1 
ATOM   2830  O  OG  . SER B 1 18  ? -30.203 3.300   -24.695 1.00 36.28 ? 61   SER B OG  1 
ATOM   2831  N  N   . GLU B 1 19  ? -27.738 1.904   -25.755 1.00 31.58 ? 62   GLU B N   1 
ATOM   2832  C  CA  . GLU B 1 19  ? -27.097 1.307   -26.886 1.00 30.13 ? 62   GLU B CA  1 
ATOM   2833  C  C   . GLU B 1 19  ? -25.698 0.851   -26.483 1.00 29.04 ? 62   GLU B C   1 
ATOM   2834  O  O   . GLU B 1 19  ? -24.779 1.670   -26.320 1.00 29.92 ? 62   GLU B O   1 
ATOM   2835  C  CB  . GLU B 1 19  ? -27.145 2.260   -28.089 1.00 30.04 ? 62   GLU B CB  1 
ATOM   2836  C  CG  . GLU B 1 19  ? -28.545 2.727   -28.411 1.00 28.55 ? 62   GLU B CG  1 
ATOM   2837  C  CD  . GLU B 1 19  ? -28.576 3.599   -29.636 1.00 26.95 ? 62   GLU B CD  1 
ATOM   2838  O  OE1 . GLU B 1 19  ? -28.020 3.206   -30.688 1.00 27.09 ? 62   GLU B OE1 1 
ATOM   2839  O  OE2 . GLU B 1 19  ? -29.163 4.694   -29.560 1.00 26.27 ? 62   GLU B OE2 1 
ATOM   2840  N  N   . SER B 1 20  ? -25.521 -0.481  -26.345 1.00 27.79 ? 63   SER B N   1 
ATOM   2841  C  CA  . SER B 1 20  ? -24.194 -1.050  -26.001 1.00 26.04 ? 63   SER B CA  1 
ATOM   2842  C  C   . SER B 1 20  ? -24.155 -2.573  -25.729 1.00 26.34 ? 63   SER B C   1 
ATOM   2843  O  O   . SER B 1 20  ? -24.937 -3.110  -24.954 1.00 26.01 ? 63   SER B O   1 
ATOM   2844  C  CB  . SER B 1 20  ? -23.608 -0.350  -24.771 1.00 22.27 ? 63   SER B CB  1 
ATOM   2845  O  OG  . SER B 1 20  ? -22.410 -0.984  -24.363 1.00 17.85 ? 63   SER B OG  1 
ATOM   2846  N  N   . PRO B 1 21  ? -23.211 -3.261  -26.398 1.00 25.67 ? 64   PRO B N   1 
ATOM   2847  C  CA  . PRO B 1 21  ? -22.988 -4.700  -26.221 1.00 25.30 ? 64   PRO B CA  1 
ATOM   2848  C  C   . PRO B 1 21  ? -21.889 -4.715  -25.185 1.00 25.69 ? 64   PRO B C   1 
ATOM   2849  O  O   . PRO B 1 21  ? -20.724 -4.908  -25.526 1.00 24.38 ? 64   PRO B O   1 
ATOM   2850  C  CB  . PRO B 1 21  ? -22.355 -5.166  -27.531 1.00 26.75 ? 64   PRO B CB  1 
ATOM   2851  C  CG  . PRO B 1 21  ? -22.639 -4.150  -28.514 1.00 25.47 ? 64   PRO B CG  1 
ATOM   2852  C  CD  . PRO B 1 21  ? -23.203 -2.922  -27.834 1.00 25.73 ? 64   PRO B CD  1 
ATOM   2853  N  N   . HIS B 1 22  ? -22.176 -4.509  -23.935 1.00 26.10 ? 65   HIS B N   1 
ATOM   2854  C  CA  . HIS B 1 22  ? -21.030 -4.506  -23.066 1.00 26.57 ? 65   HIS B CA  1 
ATOM   2855  C  C   . HIS B 1 22  ? -21.516 -4.845  -21.675 1.00 28.08 ? 65   HIS B C   1 
ATOM   2856  O  O   . HIS B 1 22  ? -22.492 -4.280  -21.186 1.00 26.53 ? 65   HIS B O   1 
ATOM   2857  C  CB  . HIS B 1 22  ? -20.328 -3.115  -23.207 1.00 26.96 ? 65   HIS B CB  1 
ATOM   2858  C  CG  . HIS B 1 22  ? -19.379 -3.019  -24.382 1.00 25.06 ? 65   HIS B CG  1 
ATOM   2859  N  ND1 . HIS B 1 22  ? -18.209 -3.741  -24.435 1.00 23.83 ? 65   HIS B ND1 1 
ATOM   2860  C  CD2 . HIS B 1 22  ? -19.436 -2.318  -25.543 1.00 23.51 ? 65   HIS B CD2 1 
ATOM   2861  C  CE1 . HIS B 1 22  ? -17.584 -3.497  -25.574 1.00 20.87 ? 65   HIS B CE1 1 
ATOM   2862  N  NE2 . HIS B 1 22  ? -18.307 -2.637  -26.272 1.00 21.51 ? 65   HIS B NE2 1 
ATOM   2863  N  N   . HIS B 1 23  ? -20.876 -5.821  -21.060 1.00 29.62 ? 66   HIS B N   1 
ATOM   2864  C  CA  . HIS B 1 23  ? -21.276 -6.193  -19.727 1.00 32.09 ? 66   HIS B CA  1 
ATOM   2865  C  C   . HIS B 1 23  ? -20.826 -5.090  -18.773 1.00 32.13 ? 66   HIS B C   1 
ATOM   2866  O  O   . HIS B 1 23  ? -19.907 -5.271  -17.974 1.00 31.96 ? 66   HIS B O   1 
ATOM   2867  C  CB  . HIS B 1 23  ? -20.656 -7.529  -19.348 1.00 36.03 ? 66   HIS B CB  1 
ATOM   2868  C  CG  . HIS B 1 23  ? -21.121 -8.036  -18.022 1.00 38.54 ? 66   HIS B CG  1 
ATOM   2869  N  ND1 . HIS B 1 23  ? -20.545 -9.118  -17.393 1.00 40.56 ? 66   HIS B ND1 1 
ATOM   2870  C  CD2 . HIS B 1 23  ? -22.082 -7.578  -17.185 1.00 40.49 ? 66   HIS B CD2 1 
ATOM   2871  C  CE1 . HIS B 1 23  ? -21.127 -9.301  -16.221 1.00 41.70 ? 66   HIS B CE1 1 
ATOM   2872  N  NE2 . HIS B 1 23  ? -22.062 -8.380  -16.070 1.00 41.78 ? 66   HIS B NE2 1 
ATOM   2873  N  N   . HIS B 1 24  ? -21.483 -3.939  -18.875 1.00 31.63 ? 67   HIS B N   1 
ATOM   2874  C  CA  . HIS B 1 24  ? -21.156 -2.771  -18.055 1.00 30.61 ? 67   HIS B CA  1 
ATOM   2875  C  C   . HIS B 1 24  ? -21.336 -2.981  -16.559 1.00 29.85 ? 67   HIS B C   1 
ATOM   2876  O  O   . HIS B 1 24  ? -22.447 -3.222  -16.089 1.00 29.42 ? 67   HIS B O   1 
ATOM   2877  C  CB  . HIS B 1 24  ? -21.997 -1.558  -18.485 1.00 30.91 ? 67   HIS B CB  1 
ATOM   2878  C  CG  . HIS B 1 24  ? -21.612 -0.981  -19.818 1.00 30.01 ? 67   HIS B CG  1 
ATOM   2879  N  ND1 . HIS B 1 24  ? -20.314 -0.653  -20.143 1.00 28.24 ? 67   HIS B ND1 1 
ATOM   2880  C  CD2 . HIS B 1 24  ? -22.364 -0.642  -20.892 1.00 29.37 ? 67   HIS B CD2 1 
ATOM   2881  C  CE1 . HIS B 1 24  ? -20.284 -0.137  -21.358 1.00 29.29 ? 67   HIS B CE1 1 
ATOM   2882  N  NE2 . HIS B 1 24  ? -21.515 -0.119  -21.834 1.00 29.24 ? 67   HIS B NE2 1 
ATOM   2883  N  N   . THR B 1 25  ? -20.238 -2.866  -15.810 1.00 30.67 ? 68   THR B N   1 
ATOM   2884  C  CA  . THR B 1 25  ? -20.281 -3.035  -14.352 1.00 29.16 ? 68   THR B CA  1 
ATOM   2885  C  C   . THR B 1 25  ? -20.586 -1.732  -13.624 1.00 27.52 ? 68   THR B C   1 
ATOM   2886  O  O   . THR B 1 25  ? -20.567 -0.648  -14.203 1.00 24.97 ? 68   THR B O   1 
ATOM   2887  C  CB  . THR B 1 25  ? -18.960 -3.586  -13.784 1.00 28.79 ? 68   THR B CB  1 
ATOM   2888  O  OG1 . THR B 1 25  ? -19.217 -4.229  -12.538 1.00 29.01 ? 68   THR B OG1 1 
ATOM   2889  C  CG2 . THR B 1 25  ? -17.978 -2.465  -13.524 1.00 30.80 ? 68   THR B CG2 1 
ATOM   2890  N  N   . ALA B 1 26  ? -20.873 -1.864  -12.342 1.00 27.44 ? 69   ALA B N   1 
ATOM   2891  C  CA  . ALA B 1 26  ? -21.195 -0.722  -11.514 1.00 29.13 ? 69   ALA B CA  1 
ATOM   2892  C  C   . ALA B 1 26  ? -20.067 -0.559  -10.513 1.00 29.66 ? 69   ALA B C   1 
ATOM   2893  O  O   . ALA B 1 26  ? -19.226 -1.442  -10.362 1.00 28.89 ? 69   ALA B O   1 
ATOM   2894  C  CB  . ALA B 1 26  ? -22.516 -0.964  -10.790 1.00 29.39 ? 69   ALA B CB  1 
ATOM   2895  N  N   . PRO B 1 27  ? -20.012 0.586   -9.837  1.00 30.54 ? 70   PRO B N   1 
ATOM   2896  C  CA  . PRO B 1 27  ? -18.930 0.757   -8.865  1.00 32.62 ? 70   PRO B CA  1 
ATOM   2897  C  C   . PRO B 1 27  ? -19.386 0.311   -7.480  1.00 34.55 ? 70   PRO B C   1 
ATOM   2898  O  O   . PRO B 1 27  ? -20.583 0.078   -7.257  1.00 34.05 ? 70   PRO B O   1 
ATOM   2899  C  CB  . PRO B 1 27  ? -18.634 2.257   -8.922  1.00 32.28 ? 70   PRO B CB  1 
ATOM   2900  C  CG  . PRO B 1 27  ? -19.229 2.695   -10.237 1.00 32.64 ? 70   PRO B CG  1 
ATOM   2901  C  CD  . PRO B 1 27  ? -20.492 1.887   -10.309 1.00 30.22 ? 70   PRO B CD  1 
ATOM   2902  N  N   . ALA B 1 28  ? -18.436 0.208   -6.554  1.00 35.91 ? 71   ALA B N   1 
ATOM   2903  C  CA  . ALA B 1 28  ? -18.749 -0.215  -5.196  1.00 37.10 ? 71   ALA B CA  1 
ATOM   2904  C  C   . ALA B 1 28  ? -17.905 0.447   -4.099  1.00 37.69 ? 71   ALA B C   1 
ATOM   2905  O  O   . ALA B 1 28  ? -16.676 0.533   -4.198  1.00 36.95 ? 71   ALA B O   1 
ATOM   2906  C  CB  . ALA B 1 28  ? -18.627 -1.741  -5.097  1.00 37.84 ? 71   ALA B CB  1 
ATOM   2907  N  N   . LYS B 1 29  ? -18.583 0.913   -3.051  1.00 38.27 ? 72   LYS B N   1 
ATOM   2908  C  CA  . LYS B 1 29  ? -17.911 1.535   -1.909  1.00 37.87 ? 72   LYS B CA  1 
ATOM   2909  C  C   . LYS B 1 29  ? -17.464 0.380   -1.013  1.00 35.95 ? 72   LYS B C   1 
ATOM   2910  O  O   . LYS B 1 29  ? -18.159 -0.630  -0.909  1.00 35.92 ? 72   LYS B O   1 
ATOM   2911  C  CB  . LYS B 1 29  ? -18.882 2.453   -1.147  1.00 37.91 ? 72   LYS B CB  1 
ATOM   2912  C  CG  . LYS B 1 29  ? -19.490 3.588   -1.989  1.00 37.93 ? 72   LYS B CG  1 
ATOM   2913  C  CD  . LYS B 1 29  ? -18.700 4.899   -1.892  1.00 36.92 ? 72   LYS B CD  1 
ATOM   2914  C  CE  . LYS B 1 29  ? -17.231 4.754   -2.283  1.00 35.32 ? 72   LYS B CE  1 
ATOM   2915  N  NZ  . LYS B 1 29  ? -16.440 3.987   -1.285  1.00 31.46 ? 72   LYS B NZ  1 
ATOM   2916  N  N   . SER B 1 30  ? -16.302 0.510   -0.387  1.00 33.62 ? 73   SER B N   1 
ATOM   2917  C  CA  . SER B 1 30  ? -15.815 -0.561  0.466   1.00 30.73 ? 73   SER B CA  1 
ATOM   2918  C  C   . SER B 1 30  ? -16.878 -0.802  1.538   1.00 30.95 ? 73   SER B C   1 
ATOM   2919  O  O   . SER B 1 30  ? -17.564 0.136   1.964   1.00 30.71 ? 73   SER B O   1 
ATOM   2920  C  CB  . SER B 1 30  ? -14.471 -0.170  1.098   1.00 28.77 ? 73   SER B CB  1 
ATOM   2921  O  OG  . SER B 1 30  ? -13.796 -1.289  1.648   1.00 23.56 ? 73   SER B OG  1 
ATOM   2922  N  N   . PRO B 1 31  ? -17.064 -2.071  1.943   1.00 30.11 ? 74   PRO B N   1 
ATOM   2923  C  CA  . PRO B 1 31  ? -18.036 -2.487  2.962   1.00 29.80 ? 74   PRO B CA  1 
ATOM   2924  C  C   . PRO B 1 31  ? -17.394 -2.697  4.334   1.00 28.52 ? 74   PRO B C   1 
ATOM   2925  O  O   . PRO B 1 31  ? -16.166 -2.732  4.444   1.00 29.44 ? 74   PRO B O   1 
ATOM   2926  C  CB  . PRO B 1 31  ? -18.587 -3.780  2.383   1.00 32.04 ? 74   PRO B CB  1 
ATOM   2927  C  CG  . PRO B 1 31  ? -17.352 -4.393  1.792   1.00 32.47 ? 74   PRO B CG  1 
ATOM   2928  C  CD  . PRO B 1 31  ? -16.672 -3.220  1.102   1.00 30.44 ? 74   PRO B CD  1 
ATOM   2929  N  N   . LYS B 1 32  ? -18.229 -2.856  5.363   1.00 24.89 ? 75   LYS B N   1 
ATOM   2930  C  CA  . LYS B 1 32  ? -17.761 -3.038  6.732   1.00 21.68 ? 75   LYS B CA  1 
ATOM   2931  C  C   . LYS B 1 32  ? -16.599 -3.998  6.847   1.00 20.88 ? 75   LYS B C   1 
ATOM   2932  O  O   . LYS B 1 32  ? -15.497 -3.601  7.203   1.00 20.30 ? 75   LYS B O   1 
ATOM   2933  C  CB  . LYS B 1 32  ? -18.896 -3.518  7.638   1.00 22.58 ? 75   LYS B CB  1 
ATOM   2934  C  CG  . LYS B 1 32  ? -19.846 -2.434  8.093   1.00 20.37 ? 75   LYS B CG  1 
ATOM   2935  C  CD  . LYS B 1 32  ? -20.631 -2.871  9.315   1.00 21.10 ? 75   LYS B CD  1 
ATOM   2936  C  CE  . LYS B 1 32  ? -21.594 -1.779  9.759   1.00 22.16 ? 75   LYS B CE  1 
ATOM   2937  N  NZ  . LYS B 1 32  ? -22.478 -1.354  8.632   1.00 23.62 ? 75   LYS B NZ  1 
ATOM   2938  N  N   . ILE B 1 33  ? -16.861 -5.269  6.577   1.00 21.02 ? 76   ILE B N   1 
ATOM   2939  C  CA  . ILE B 1 33  ? -15.835 -6.307  6.620   1.00 21.09 ? 76   ILE B CA  1 
ATOM   2940  C  C   . ILE B 1 33  ? -15.711 -6.823  5.187   1.00 20.28 ? 76   ILE B C   1 
ATOM   2941  O  O   . ILE B 1 33  ? -16.715 -7.107  4.538   1.00 21.02 ? 76   ILE B O   1 
ATOM   2942  C  CB  . ILE B 1 33  ? -16.238 -7.457  7.578   1.00 21.45 ? 76   ILE B CB  1 
ATOM   2943  C  CG1 . ILE B 1 33  ? -16.292 -6.922  9.016   1.00 23.83 ? 76   ILE B CG1 1 
ATOM   2944  C  CG2 . ILE B 1 33  ? -15.255 -8.608  7.465   1.00 21.65 ? 76   ILE B CG2 1 
ATOM   2945  C  CD1 . ILE B 1 33  ? -16.561 -7.958  10.090  1.00 24.42 ? 76   ILE B CD1 1 
ATOM   2946  N  N   . LEU B 1 34  ? -14.492 -6.913  4.674   1.00 18.38 ? 77   LEU B N   1 
ATOM   2947  C  CA  . LEU B 1 34  ? -14.313 -7.376  3.300   1.00 16.69 ? 77   LEU B CA  1 
ATOM   2948  C  C   . LEU B 1 34  ? -14.232 -8.897  3.274   1.00 17.31 ? 77   LEU B C   1 
ATOM   2949  O  O   . LEU B 1 34  ? -13.418 -9.502  3.970   1.00 17.70 ? 77   LEU B O   1 
ATOM   2950  C  CB  . LEU B 1 34  ? -13.033 -6.784  2.692   1.00 14.00 ? 77   LEU B CB  1 
ATOM   2951  C  CG  . LEU B 1 34  ? -12.578 -5.344  2.946   1.00 8.62  ? 77   LEU B CG  1 
ATOM   2952  C  CD1 . LEU B 1 34  ? -11.469 -5.099  1.992   1.00 6.43  ? 77   LEU B CD1 1 
ATOM   2953  C  CD2 . LEU B 1 34  ? -13.651 -4.314  2.732   1.00 7.84  ? 77   LEU B CD2 1 
ATOM   2954  N  N   . PRO B 1 35  ? -15.091 -9.544  2.483   1.00 18.59 ? 78   PRO B N   1 
ATOM   2955  C  CA  . PRO B 1 35  ? -15.010 -11.011 2.456   1.00 18.28 ? 78   PRO B CA  1 
ATOM   2956  C  C   . PRO B 1 35  ? -13.630 -11.583 2.084   1.00 18.29 ? 78   PRO B C   1 
ATOM   2957  O  O   . PRO B 1 35  ? -13.185 -12.578 2.663   1.00 17.04 ? 78   PRO B O   1 
ATOM   2958  C  CB  . PRO B 1 35  ? -16.129 -11.413 1.477   1.00 18.06 ? 78   PRO B CB  1 
ATOM   2959  C  CG  . PRO B 1 35  ? -16.508 -10.103 0.760   1.00 17.26 ? 78   PRO B CG  1 
ATOM   2960  C  CD  . PRO B 1 35  ? -16.300 -9.052  1.801   1.00 17.40 ? 78   PRO B CD  1 
ATOM   2961  N  N   . ASP B 1 36  ? -12.966 -10.961 1.110   1.00 18.03 ? 79   ASP B N   1 
ATOM   2962  C  CA  . ASP B 1 36  ? -11.636 -11.379 0.675   1.00 17.92 ? 79   ASP B CA  1 
ATOM   2963  C  C   . ASP B 1 36  ? -10.908 -10.147 0.192   1.00 18.64 ? 79   ASP B C   1 
ATOM   2964  O  O   . ASP B 1 36  ? -11.520 -9.210  -0.303  1.00 18.88 ? 79   ASP B O   1 
ATOM   2965  C  CB  . ASP B 1 36  ? -11.704 -12.409 -0.453  1.00 17.96 ? 79   ASP B CB  1 
ATOM   2966  C  CG  . ASP B 1 36  ? -12.036 -11.798 -1.793  1.00 18.29 ? 79   ASP B CG  1 
ATOM   2967  O  OD1 . ASP B 1 36  ? -11.165 -11.117 -2.373  1.00 17.27 ? 79   ASP B OD1 1 
ATOM   2968  O  OD2 . ASP B 1 36  ? -13.177 -12.010 -2.264  1.00 22.35 ? 79   ASP B OD2 1 
ATOM   2969  N  N   . ILE B 1 37  ? -9.593  -10.152 0.335   1.00 19.06 ? 80   ILE B N   1 
ATOM   2970  C  CA  . ILE B 1 37  ? -8.774  -9.022  -0.058  1.00 19.82 ? 80   ILE B CA  1 
ATOM   2971  C  C   . ILE B 1 37  ? -9.095  -8.335  -1.396  1.00 21.36 ? 80   ILE B C   1 
ATOM   2972  O  O   . ILE B 1 37  ? -8.839  -7.144  -1.553  1.00 23.42 ? 80   ILE B O   1 
ATOM   2973  C  CB  . ILE B 1 37  ? -7.309  -9.432  -0.078  1.00 18.93 ? 80   ILE B CB  1 
ATOM   2974  C  CG1 . ILE B 1 37  ? -6.450  -8.186  -0.066  1.00 16.72 ? 80   ILE B CG1 1 
ATOM   2975  C  CG2 . ILE B 1 37  ? -7.014  -10.260 -1.317  1.00 19.93 ? 80   ILE B CG2 1 
ATOM   2976  C  CD1 . ILE B 1 37  ? -6.859  -7.235  1.008   1.00 15.79 ? 80   ILE B CD1 1 
ATOM   2977  N  N   . LEU B 1 38  ? -9.655  -9.071  -2.353  1.00 21.32 ? 81   LEU B N   1 
ATOM   2978  C  CA  . LEU B 1 38  ? -9.958  -8.513  -3.674  1.00 20.36 ? 81   LEU B CA  1 
ATOM   2979  C  C   . LEU B 1 38  ? -10.994 -7.398  -3.716  1.00 19.63 ? 81   LEU B C   1 
ATOM   2980  O  O   . LEU B 1 38  ? -10.985 -6.562  -4.621  1.00 19.07 ? 81   LEU B O   1 
ATOM   2981  C  CB  . LEU B 1 38  ? -10.372 -9.643  -4.586  1.00 20.34 ? 81   LEU B CB  1 
ATOM   2982  C  CG  . LEU B 1 38  ? -9.282  -10.705 -4.771  1.00 20.06 ? 81   LEU B CG  1 
ATOM   2983  C  CD1 . LEU B 1 38  ? -9.778  -11.855 -5.638  1.00 20.64 ? 81   LEU B CD1 1 
ATOM   2984  C  CD2 . LEU B 1 38  ? -8.025  -10.104 -5.373  1.00 20.80 ? 81   LEU B CD2 1 
ATOM   2985  N  N   . LYS B 1 39  ? -11.894 -7.391  -2.747  1.00 18.55 ? 82   LYS B N   1 
ATOM   2986  C  CA  . LYS B 1 39  ? -12.904 -6.360  -2.657  1.00 18.17 ? 82   LYS B CA  1 
ATOM   2987  C  C   . LYS B 1 39  ? -12.207 -5.055  -2.368  1.00 17.95 ? 82   LYS B C   1 
ATOM   2988  O  O   . LYS B 1 39  ? -12.845 -3.996  -2.258  1.00 18.22 ? 82   LYS B O   1 
ATOM   2989  C  CB  . LYS B 1 39  ? -13.935 -6.686  -1.570  1.00 21.03 ? 82   LYS B CB  1 
ATOM   2990  C  CG  . LYS B 1 39  ? -14.872 -7.842  -1.952  1.00 26.30 ? 82   LYS B CG  1 
ATOM   2991  C  CD  . LYS B 1 39  ? -15.676 -7.493  -3.200  1.00 28.59 ? 82   LYS B CD  1 
ATOM   2992  C  CE  . LYS B 1 39  ? -16.156 -8.730  -3.956  1.00 28.08 ? 82   LYS B CE  1 
ATOM   2993  N  NZ  . LYS B 1 39  ? -16.835 -8.356  -5.225  1.00 28.67 ? 82   LYS B NZ  1 
ATOM   2994  N  N   . LYS B 1 40  ? -10.898 -5.110  -2.214  1.00 17.63 ? 83   LYS B N   1 
ATOM   2995  C  CA  . LYS B 1 40  ? -10.075 -3.922  -1.953  1.00 17.05 ? 83   LYS B CA  1 
ATOM   2996  C  C   . LYS B 1 40  ? -9.492  -3.368  -3.255  1.00 16.76 ? 83   LYS B C   1 
ATOM   2997  O  O   . LYS B 1 40  ? -8.464  -2.713  -3.242  1.00 16.12 ? 83   LYS B O   1 
ATOM   2998  C  CB  . LYS B 1 40  ? -8.945  -4.281  -0.973  1.00 18.69 ? 83   LYS B CB  1 
ATOM   2999  C  CG  . LYS B 1 40  ? -8.043  -3.124  -0.575  1.00 18.37 ? 83   LYS B CG  1 
ATOM   3000  C  CD  . LYS B 1 40  ? -8.863  -1.893  -0.188  1.00 19.46 ? 83   LYS B CD  1 
ATOM   3001  C  CE  . LYS B 1 40  ? -7.968  -0.675  -0.046  1.00 21.03 ? 83   LYS B CE  1 
ATOM   3002  N  NZ  . LYS B 1 40  ? -8.697  0.606   -0.268  1.00 21.22 ? 83   LYS B NZ  1 
ATOM   3003  N  N   . ILE B 1 41  ? -10.172 -3.632  -4.355  1.00 15.79 ? 84   ILE B N   1 
ATOM   3004  C  CA  . ILE B 1 41  ? -9.709  -3.136  -5.637  1.00 17.80 ? 84   ILE B CA  1 
ATOM   3005  C  C   . ILE B 1 41  ? -10.659 -2.030  -6.098  1.00 18.94 ? 84   ILE B C   1 
ATOM   3006  O  O   . ILE B 1 41  ? -11.824 -2.289  -6.416  1.00 18.66 ? 84   ILE B O   1 
ATOM   3007  C  CB  . ILE B 1 41  ? -9.645  -4.275  -6.685  1.00 16.69 ? 84   ILE B CB  1 
ATOM   3008  C  CG1 . ILE B 1 41  ? -8.616  -5.311  -6.246  1.00 16.82 ? 84   ILE B CG1 1 
ATOM   3009  C  CG2 . ILE B 1 41  ? -9.282  -3.715  -8.039  1.00 16.29 ? 84   ILE B CG2 1 
ATOM   3010  C  CD1 . ILE B 1 41  ? -8.721  -6.612  -6.961  1.00 16.69 ? 84   ILE B CD1 1 
ATOM   3011  N  N   . GLY B 1 42  ? -10.170 -0.794  -6.116  1.00 19.25 ? 85   GLY B N   1 
ATOM   3012  C  CA  . GLY B 1 42  ? -11.021 0.304   -6.534  1.00 19.90 ? 85   GLY B CA  1 
ATOM   3013  C  C   . GLY B 1 42  ? -11.524 1.072   -5.338  1.00 19.27 ? 85   GLY B C   1 
ATOM   3014  O  O   . GLY B 1 42  ? -11.374 0.620   -4.203  1.00 19.11 ? 85   GLY B O   1 
ATOM   3015  N  N   . ASP B 1 43  ? -12.130 2.221   -5.604  1.00 19.78 ? 86   ASP B N   1 
ATOM   3016  C  CA  . ASP B 1 43  ? -12.630 3.112   -4.571  1.00 20.68 ? 86   ASP B CA  1 
ATOM   3017  C  C   . ASP B 1 43  ? -11.400 3.836   -4.020  1.00 21.36 ? 86   ASP B C   1 
ATOM   3018  O  O   . ASP B 1 43  ? -11.440 4.410   -2.930  1.00 21.55 ? 86   ASP B O   1 
ATOM   3019  C  CB  . ASP B 1 43  ? -13.307 2.331   -3.446  1.00 20.66 ? 86   ASP B CB  1 
ATOM   3020  C  CG  . ASP B 1 43  ? -13.950 3.238   -2.434  1.00 23.00 ? 86   ASP B CG  1 
ATOM   3021  O  OD1 . ASP B 1 43  ? -14.574 4.208   -2.900  1.00 23.34 ? 86   ASP B OD1 1 
ATOM   3022  O  OD2 . ASP B 1 43  ? -13.837 3.002   -1.203  1.00 23.21 ? 86   ASP B OD2 1 
ATOM   3023  N  N   . THR B 1 44  ? -10.305 3.800   -4.764  1.00 21.05 ? 87   THR B N   1 
ATOM   3024  C  CA  . THR B 1 44  ? -9.118  4.447   -4.287  1.00 19.08 ? 87   THR B CA  1 
ATOM   3025  C  C   . THR B 1 44  ? -9.360  5.912   -3.979  1.00 19.91 ? 87   THR B C   1 
ATOM   3026  O  O   . THR B 1 44  ? -10.250 6.522   -4.507  1.00 18.67 ? 87   THR B O   1 
ATOM   3027  C  CB  . THR B 1 44  ? -7.931  4.170   -5.261  1.00 18.06 ? 87   THR B CB  1 
ATOM   3028  O  OG1 . THR B 1 44  ? -8.354  4.395   -6.607  1.00 15.32 ? 87   THR B OG1 1 
ATOM   3029  C  CG2 . THR B 1 44  ? -7.437  2.744   -5.085  1.00 15.16 ? 87   THR B CG2 1 
ATOM   3030  N  N   . PRO B 1 45  ? -8.611  6.502   -3.093  1.00 20.41 ? 88   PRO B N   1 
ATOM   3031  C  CA  . PRO B 1 45  ? -8.659  7.890   -2.650  1.00 20.66 ? 88   PRO B CA  1 
ATOM   3032  C  C   . PRO B 1 45  ? -8.254  8.934   -3.670  1.00 21.24 ? 88   PRO B C   1 
ATOM   3033  O  O   . PRO B 1 45  ? -7.492  8.668   -4.592  1.00 21.26 ? 88   PRO B O   1 
ATOM   3034  C  CB  . PRO B 1 45  ? -7.718  7.888   -1.477  1.00 22.18 ? 88   PRO B CB  1 
ATOM   3035  C  CG  . PRO B 1 45  ? -6.722  6.868   -1.942  1.00 21.89 ? 88   PRO B CG  1 
ATOM   3036  C  CD  . PRO B 1 45  ? -7.503  5.786   -2.466  1.00 21.25 ? 88   PRO B CD  1 
ATOM   3037  N  N   . MET B 1 46  ? -8.789  10.137  -3.484  1.00 21.38 ? 89   MET B N   1 
ATOM   3038  C  CA  . MET B 1 46  ? -8.504  11.269  -4.333  1.00 21.38 ? 89   MET B CA  1 
ATOM   3039  C  C   . MET B 1 46  ? -7.757  12.165  -3.344  1.00 20.02 ? 89   MET B C   1 
ATOM   3040  O  O   . MET B 1 46  ? -8.169  12.331  -2.201  1.00 19.10 ? 89   MET B O   1 
ATOM   3041  C  CB  . MET B 1 46  ? -9.830  11.889  -4.799  1.00 22.60 ? 89   MET B CB  1 
ATOM   3042  C  CG  . MET B 1 46  ? -9.702  12.979  -5.832  1.00 25.00 ? 89   MET B CG  1 
ATOM   3043  S  SD  . MET B 1 46  ? -8.968  12.460  -7.407  1.00 29.81 ? 89   MET B SD  1 
ATOM   3044  C  CE  . MET B 1 46  ? -10.405 12.306  -8.472  1.00 26.40 ? 89   MET B CE  1 
ATOM   3045  N  N   . VAL B 1 47  ? -6.636  12.714  -3.758  1.00 19.33 ? 90   VAL B N   1 
ATOM   3046  C  CA  . VAL B 1 47  ? -5.863  13.503  -2.829  1.00 18.82 ? 90   VAL B CA  1 
ATOM   3047  C  C   . VAL B 1 47  ? -5.330  14.788  -3.395  1.00 18.29 ? 90   VAL B C   1 
ATOM   3048  O  O   . VAL B 1 47  ? -4.887  14.831  -4.533  1.00 19.67 ? 90   VAL B O   1 
ATOM   3049  C  CB  . VAL B 1 47  ? -4.690  12.687  -2.338  1.00 18.56 ? 90   VAL B CB  1 
ATOM   3050  C  CG1 . VAL B 1 47  ? -3.778  13.545  -1.501  1.00 20.24 ? 90   VAL B CG1 1 
ATOM   3051  C  CG2 . VAL B 1 47  ? -5.202  11.492  -1.564  1.00 18.80 ? 90   VAL B CG2 1 
ATOM   3052  N  N   . ARG B 1 48  ? -5.353  15.830  -2.578  1.00 16.63 ? 91   ARG B N   1 
ATOM   3053  C  CA  . ARG B 1 48  ? -4.854  17.135  -2.982  1.00 15.52 ? 91   ARG B CA  1 
ATOM   3054  C  C   . ARG B 1 48  ? -3.321  17.256  -2.919  1.00 14.47 ? 91   ARG B C   1 
ATOM   3055  O  O   . ARG B 1 48  ? -2.691  16.901  -1.919  1.00 13.78 ? 91   ARG B O   1 
ATOM   3056  C  CB  . ARG B 1 48  ? -5.498  18.209  -2.103  1.00 15.60 ? 91   ARG B CB  1 
ATOM   3057  C  CG  . ARG B 1 48  ? -5.241  19.652  -2.513  1.00 17.14 ? 91   ARG B CG  1 
ATOM   3058  C  CD  . ARG B 1 48  ? -6.341  20.557  -1.991  1.00 17.18 ? 91   ARG B CD  1 
ATOM   3059  N  NE  . ARG B 1 48  ? -6.581  20.295  -0.579  1.00 21.42 ? 91   ARG B NE  1 
ATOM   3060  C  CZ  . ARG B 1 48  ? -7.780  20.306  -0.010  1.00 22.47 ? 91   ARG B CZ  1 
ATOM   3061  N  NH1 . ARG B 1 48  ? -8.863  20.579  -0.733  1.00 21.36 ? 91   ARG B NH1 1 
ATOM   3062  N  NH2 . ARG B 1 48  ? -7.901  20.002  1.277   1.00 23.88 ? 91   ARG B NH2 1 
ATOM   3063  N  N   . ILE B 1 49  ? -2.731  17.728  -4.014  1.00 14.03 ? 92   ILE B N   1 
ATOM   3064  C  CA  . ILE B 1 49  ? -1.292  17.960  -4.082  1.00 14.15 ? 92   ILE B CA  1 
ATOM   3065  C  C   . ILE B 1 49  ? -1.099  19.385  -3.548  1.00 14.09 ? 92   ILE B C   1 
ATOM   3066  O  O   . ILE B 1 49  ? -1.476  20.369  -4.189  1.00 11.29 ? 92   ILE B O   1 
ATOM   3067  C  CB  . ILE B 1 49  ? -0.780  17.914  -5.517  1.00 14.14 ? 92   ILE B CB  1 
ATOM   3068  C  CG1 . ILE B 1 49  ? -0.977  16.521  -6.103  1.00 12.29 ? 92   ILE B CG1 1 
ATOM   3069  C  CG2 . ILE B 1 49  ? 0.683   18.331  -5.539  1.00 14.78 ? 92   ILE B CG2 1 
ATOM   3070  C  CD1 . ILE B 1 49  ? 0.025   15.514  -5.620  1.00 12.10 ? 92   ILE B CD1 1 
ATOM   3071  N  N   . ASN B 1 50  ? -0.501  19.480  -2.371  1.00 14.63 ? 93   ASN B N   1 
ATOM   3072  C  CA  . ASN B 1 50  ? -0.315  20.764  -1.722  1.00 17.07 ? 93   ASN B CA  1 
ATOM   3073  C  C   . ASN B 1 50  ? 0.956   21.552  -2.024  1.00 18.96 ? 93   ASN B C   1 
ATOM   3074  O  O   . ASN B 1 50  ? 0.953   22.778  -2.008  1.00 18.55 ? 93   ASN B O   1 
ATOM   3075  C  CB  . ASN B 1 50  ? -0.455  20.583  -0.218  1.00 15.11 ? 93   ASN B CB  1 
ATOM   3076  C  CG  . ASN B 1 50  ? -1.872  20.417  0.194   1.00 14.98 ? 93   ASN B CG  1 
ATOM   3077  O  OD1 . ASN B 1 50  ? -2.736  21.160  -0.252  1.00 17.51 ? 93   ASN B OD1 1 
ATOM   3078  N  ND2 . ASN B 1 50  ? -2.131  19.455  1.051   1.00 10.56 ? 93   ASN B ND2 1 
ATOM   3079  N  N   . LYS B 1 51  ? 2.015   20.865  -2.303  1.00 20.86 ? 94   LYS B N   1 
ATOM   3080  C  CA  . LYS B 1 51  ? 3.235   21.578  -2.586  1.00 22.71 ? 94   LYS B CA  1 
ATOM   3081  C  C   . LYS B 1 51  ? 3.555   21.694  -4.096  1.00 23.75 ? 94   LYS B C   1 
ATOM   3082  O  O   . LYS B 1 51  ? 3.690   22.797  -4.630  1.00 24.20 ? 94   LYS B O   1 
ATOM   3083  C  CB  . LYS B 1 51  ? 4.415   20.931  -1.840  1.00 23.70 ? 94   LYS B CB  1 
ATOM   3084  C  CG  . LYS B 1 51  ? 4.157   20.725  -0.354  1.00 22.54 ? 94   LYS B CG  1 
ATOM   3085  C  CD  . LYS B 1 51  ? 5.354   20.123  0.350   1.00 24.08 ? 94   LYS B CD  1 
ATOM   3086  C  CE  . LYS B 1 51  ? 5.103   19.965  1.836   1.00 22.71 ? 94   LYS B CE  1 
ATOM   3087  N  NZ  . LYS B 1 51  ? 3.859   19.204  2.124   1.00 25.12 ? 94   LYS B NZ  1 
ATOM   3088  N  N   . ILE B 1 52  ? 3.673   20.568  -4.779  1.00 23.81 ? 95   ILE B N   1 
ATOM   3089  C  CA  . ILE B 1 52  ? 4.135   20.521  -6.177  1.00 23.44 ? 95   ILE B CA  1 
ATOM   3090  C  C   . ILE B 1 52  ? 3.350   21.420  -7.107  1.00 22.63 ? 95   ILE B C   1 
ATOM   3091  O  O   . ILE B 1 52  ? 3.902   22.150  -7.931  1.00 23.21 ? 95   ILE B O   1 
ATOM   3092  C  CB  . ILE B 1 52  ? 4.063   19.077  -6.736  1.00 24.28 ? 95   ILE B CB  1 
ATOM   3093  C  CG1 . ILE B 1 52  ? 4.764   18.079  -5.809  1.00 25.40 ? 95   ILE B CG1 1 
ATOM   3094  C  CG2 . ILE B 1 52  ? 4.673   19.012  -8.139  1.00 22.65 ? 95   ILE B CG2 1 
ATOM   3095  C  CD1 . ILE B 1 52  ? 4.425   16.631  -6.100  1.00 25.27 ? 95   ILE B CD1 1 
ATOM   3096  N  N   . GLY B 1 53  ? 2.063   21.351  -6.977  1.00 21.98 ? 96   GLY B N   1 
ATOM   3097  C  CA  . GLY B 1 53  ? 1.199   22.127  -7.843  1.00 21.62 ? 96   GLY B CA  1 
ATOM   3098  C  C   . GLY B 1 53  ? 1.337   23.629  -7.769  1.00 22.15 ? 96   GLY B C   1 
ATOM   3099  O  O   . GLY B 1 53  ? 1.226   24.315  -8.793  1.00 24.40 ? 96   GLY B O   1 
ATOM   3100  N  N   . LYS B 1 54  ? 1.583   24.140  -6.567  1.00 19.57 ? 97   LYS B N   1 
ATOM   3101  C  CA  . LYS B 1 54  ? 1.706   25.572  -6.351  1.00 16.88 ? 97   LYS B CA  1 
ATOM   3102  C  C   . LYS B 1 54  ? 3.120   26.127  -6.582  1.00 17.38 ? 97   LYS B C   1 
ATOM   3103  O  O   . LYS B 1 54  ? 3.299   27.280  -6.974  1.00 16.20 ? 97   LYS B O   1 
ATOM   3104  C  CB  . LYS B 1 54  ? 1.230   25.899  -4.934  1.00 15.44 ? 97   LYS B CB  1 
ATOM   3105  C  CG  . LYS B 1 54  ? -0.264  25.624  -4.653  1.00 9.91  ? 97   LYS B CG  1 
ATOM   3106  C  CD  . LYS B 1 54  ? -1.148  26.494  -5.495  1.00 5.59  ? 97   LYS B CD  1 
ATOM   3107  C  CE  . LYS B 1 54  ? -2.338  27.006  -4.722  1.00 3.95  ? 97   LYS B CE  1 
ATOM   3108  N  NZ  . LYS B 1 54  ? -3.098  25.909  -4.089  1.00 6.57  ? 97   LYS B NZ  1 
ATOM   3109  N  N   . LYS B 1 55  ? 4.134   25.308  -6.356  1.00 18.47 ? 98   LYS B N   1 
ATOM   3110  C  CA  . LYS B 1 55  ? 5.492   25.780  -6.553  1.00 22.29 ? 98   LYS B CA  1 
ATOM   3111  C  C   . LYS B 1 55  ? 5.759   25.838  -8.063  1.00 23.38 ? 98   LYS B C   1 
ATOM   3112  O  O   . LYS B 1 55  ? 6.907   25.962  -8.506  1.00 24.15 ? 98   LYS B O   1 
ATOM   3113  C  CB  . LYS B 1 55  ? 6.468   24.832  -5.856  1.00 23.24 ? 98   LYS B CB  1 
ATOM   3114  C  CG  . LYS B 1 55  ? 7.864   25.378  -5.706  1.00 26.51 ? 98   LYS B CG  1 
ATOM   3115  C  CD  . LYS B 1 55  ? 8.654   24.651  -4.613  1.00 29.56 ? 98   LYS B CD  1 
ATOM   3116  C  CE  . LYS B 1 55  ? 10.126  25.128  -4.528  1.00 31.16 ? 98   LYS B CE  1 
ATOM   3117  N  NZ  . LYS B 1 55  ? 10.929  24.317  -3.545  1.00 29.88 ? 98   LYS B NZ  1 
ATOM   3118  N  N   . PHE B 1 56  ? 4.677   25.738  -8.841  1.00 22.80 ? 99   PHE B N   1 
ATOM   3119  C  CA  . PHE B 1 56  ? 4.735   25.771  -10.297 1.00 21.83 ? 99   PHE B CA  1 
ATOM   3120  C  C   . PHE B 1 56  ? 3.717   26.714  -10.923 1.00 22.62 ? 99   PHE B C   1 
ATOM   3121  O  O   . PHE B 1 56  ? 3.564   26.731  -12.138 1.00 22.40 ? 99   PHE B O   1 
ATOM   3122  C  CB  . PHE B 1 56  ? 4.528   24.373  -10.882 1.00 18.96 ? 99   PHE B CB  1 
ATOM   3123  C  CG  . PHE B 1 56  ? 5.804   23.627  -11.172 1.00 15.69 ? 99   PHE B CG  1 
ATOM   3124  C  CD1 . PHE B 1 56  ? 6.539   23.063  -10.143 1.00 16.24 ? 99   PHE B CD1 1 
ATOM   3125  C  CD2 . PHE B 1 56  ? 6.245   23.457  -12.483 1.00 14.13 ? 99   PHE B CD2 1 
ATOM   3126  C  CE1 . PHE B 1 56  ? 7.691   22.338  -10.402 1.00 15.53 ? 99   PHE B CE1 1 
ATOM   3127  C  CE2 . PHE B 1 56  ? 7.392   22.737  -12.755 1.00 13.95 ? 99   PHE B CE2 1 
ATOM   3128  C  CZ  . PHE B 1 56  ? 8.118   22.175  -11.716 1.00 14.33 ? 99   PHE B CZ  1 
ATOM   3129  N  N   . GLY B 1 57  ? 3.016   27.483  -10.098 1.00 22.28 ? 100  GLY B N   1 
ATOM   3130  C  CA  . GLY B 1 57  ? 2.057   28.418  -10.645 1.00 22.03 ? 100  GLY B CA  1 
ATOM   3131  C  C   . GLY B 1 57  ? 0.689   27.850  -10.946 1.00 23.64 ? 100  GLY B C   1 
ATOM   3132  O  O   . GLY B 1 57  ? -0.254  28.596  -11.224 1.00 24.46 ? 100  GLY B O   1 
ATOM   3133  N  N   . LEU B 1 58  ? 0.565   26.530  -10.888 1.00 22.88 ? 101  LEU B N   1 
ATOM   3134  C  CA  . LEU B 1 58  ? -0.711  25.890  -11.156 1.00 22.47 ? 101  LEU B CA  1 
ATOM   3135  C  C   . LEU B 1 58  ? -1.823  26.558  -10.327 1.00 23.84 ? 101  LEU B C   1 
ATOM   3136  O  O   . LEU B 1 58  ? -1.829  26.492  -9.092  1.00 25.18 ? 101  LEU B O   1 
ATOM   3137  C  CB  . LEU B 1 58  ? -0.611  24.398  -10.830 1.00 20.79 ? 101  LEU B CB  1 
ATOM   3138  C  CG  . LEU B 1 58  ? -1.218  23.412  -11.835 1.00 19.65 ? 101  LEU B CG  1 
ATOM   3139  C  CD1 . LEU B 1 58  ? -0.317  23.298  -13.076 1.00 17.79 ? 101  LEU B CD1 1 
ATOM   3140  C  CD2 . LEU B 1 58  ? -1.390  22.062  -11.162 1.00 18.30 ? 101  LEU B CD2 1 
ATOM   3141  N  N   . LYS B 1 59  ? -2.761  27.209  -11.008 1.00 24.73 ? 102  LYS B N   1 
ATOM   3142  C  CA  . LYS B 1 59  ? -3.857  27.902  -10.325 1.00 25.63 ? 102  LYS B CA  1 
ATOM   3143  C  C   . LYS B 1 59  ? -5.008  26.974  -10.006 1.00 25.04 ? 102  LYS B C   1 
ATOM   3144  O  O   . LYS B 1 59  ? -5.918  27.337  -9.272  1.00 25.18 ? 102  LYS B O   1 
ATOM   3145  C  CB  . LYS B 1 59  ? -4.377  29.070  -11.176 1.00 25.19 ? 102  LYS B CB  1 
ATOM   3146  C  CG  . LYS B 1 59  ? -3.367  30.212  -11.390 1.00 25.82 ? 102  LYS B CG  1 
ATOM   3147  C  CD  . LYS B 1 59  ? -3.828  31.150  -12.513 1.00 25.68 ? 102  LYS B CD  1 
ATOM   3148  C  CE  . LYS B 1 59  ? -2.759  32.177  -12.884 1.00 26.55 ? 102  LYS B CE  1 
ATOM   3149  N  NZ  . LYS B 1 59  ? -1.447  31.562  -13.263 1.00 25.57 ? 102  LYS B NZ  1 
ATOM   3150  N  N   . CYS B 1 60  ? -4.955  25.770  -10.549 1.00 24.72 ? 103  CYS B N   1 
ATOM   3151  C  CA  . CYS B 1 60  ? -6.010  24.783  -10.331 1.00 26.02 ? 103  CYS B CA  1 
ATOM   3152  C  C   . CYS B 1 60  ? -5.856  24.022  -9.007  1.00 24.42 ? 103  CYS B C   1 
ATOM   3153  O  O   . CYS B 1 60  ? -4.968  24.313  -8.207  1.00 24.23 ? 103  CYS B O   1 
ATOM   3154  C  CB  . CYS B 1 60  ? -6.006  23.773  -11.479 1.00 27.79 ? 103  CYS B CB  1 
ATOM   3155  S  SG  . CYS B 1 60  ? -4.481  22.776  -11.527 1.00 33.01 ? 103  CYS B SG  1 
ATOM   3156  N  N   . GLU B 1 61  ? -6.736  23.042  -8.808  1.00 22.97 ? 104  GLU B N   1 
ATOM   3157  C  CA  . GLU B 1 61  ? -6.734  22.182  -7.636  1.00 23.55 ? 104  GLU B CA  1 
ATOM   3158  C  C   . GLU B 1 61  ? -6.157  20.834  -8.066  1.00 26.24 ? 104  GLU B C   1 
ATOM   3159  O  O   . GLU B 1 61  ? -6.866  19.962  -8.577  1.00 27.47 ? 104  GLU B O   1 
ATOM   3160  C  CB  . GLU B 1 61  ? -8.153  21.993  -7.109  1.00 20.45 ? 104  GLU B CB  1 
ATOM   3161  C  CG  . GLU B 1 61  ? -8.286  20.966  -5.994  1.00 18.77 ? 104  GLU B CG  1 
ATOM   3162  C  CD  . GLU B 1 61  ? -9.718  20.860  -5.501  1.00 19.91 ? 104  GLU B CD  1 
ATOM   3163  O  OE1 . GLU B 1 61  ? -10.611 21.357  -6.222  1.00 19.89 ? 104  GLU B OE1 1 
ATOM   3164  O  OE2 . GLU B 1 61  ? -9.964  20.285  -4.415  1.00 18.66 ? 104  GLU B OE2 1 
ATOM   3165  N  N   . LEU B 1 62  ? -4.854  20.670  -7.854  1.00 27.53 ? 105  LEU B N   1 
ATOM   3166  C  CA  . LEU B 1 62  ? -4.163  19.452  -8.237  1.00 26.63 ? 105  LEU B CA  1 
ATOM   3167  C  C   . LEU B 1 62  ? -4.492  18.276  -7.332  1.00 26.90 ? 105  LEU B C   1 
ATOM   3168  O  O   . LEU B 1 62  ? -3.843  18.067  -6.302  1.00 27.04 ? 105  LEU B O   1 
ATOM   3169  C  CB  . LEU B 1 62  ? -2.648  19.695  -8.267  1.00 25.74 ? 105  LEU B CB  1 
ATOM   3170  C  CG  . LEU B 1 62  ? -1.905  18.832  -9.291  1.00 25.36 ? 105  LEU B CG  1 
ATOM   3171  C  CD1 . LEU B 1 62  ? -2.709  18.767  -10.590 1.00 26.57 ? 105  LEU B CD1 1 
ATOM   3172  C  CD2 . LEU B 1 62  ? -0.534  19.409  -9.558  1.00 24.01 ? 105  LEU B CD2 1 
ATOM   3173  N  N   . LEU B 1 63  ? -5.516  17.521  -7.722  1.00 26.42 ? 106  LEU B N   1 
ATOM   3174  C  CA  . LEU B 1 63  ? -5.922  16.340  -6.977  1.00 24.85 ? 106  LEU B CA  1 
ATOM   3175  C  C   . LEU B 1 63  ? -5.189  15.151  -7.603  1.00 25.46 ? 106  LEU B C   1 
ATOM   3176  O  O   . LEU B 1 63  ? -4.643  15.256  -8.706  1.00 24.13 ? 106  LEU B O   1 
ATOM   3177  C  CB  . LEU B 1 63  ? -7.432  16.136  -7.069  1.00 22.90 ? 106  LEU B CB  1 
ATOM   3178  C  CG  . LEU B 1 63  ? -8.334  17.203  -6.457  1.00 20.52 ? 106  LEU B CG  1 
ATOM   3179  C  CD1 . LEU B 1 63  ? -9.406  17.587  -7.448  1.00 20.97 ? 106  LEU B CD1 1 
ATOM   3180  C  CD2 . LEU B 1 63  ? -8.960  16.682  -5.197  1.00 20.96 ? 106  LEU B CD2 1 
ATOM   3181  N  N   . ALA B 1 64  ? -5.189  14.021  -6.900  1.00 26.00 ? 107  ALA B N   1 
ATOM   3182  C  CA  . ALA B 1 64  ? -4.493  12.835  -7.377  1.00 24.90 ? 107  ALA B CA  1 
ATOM   3183  C  C   . ALA B 1 64  ? -5.184  11.518  -7.057  1.00 25.01 ? 107  ALA B C   1 
ATOM   3184  O  O   . ALA B 1 64  ? -5.265  11.130  -5.896  1.00 24.34 ? 107  ALA B O   1 
ATOM   3185  C  CB  . ALA B 1 64  ? -3.096  12.814  -6.801  1.00 23.56 ? 107  ALA B CB  1 
ATOM   3186  N  N   . LYS B 1 65  ? -5.673  10.834  -8.095  1.00 24.51 ? 108  LYS B N   1 
ATOM   3187  C  CA  . LYS B 1 65  ? -6.308  9.526   -7.931  1.00 22.31 ? 108  LYS B CA  1 
ATOM   3188  C  C   . LYS B 1 65  ? -5.128  8.635   -7.621  1.00 21.35 ? 108  LYS B C   1 
ATOM   3189  O  O   . LYS B 1 65  ? -4.389  8.274   -8.520  1.00 20.86 ? 108  LYS B O   1 
ATOM   3190  C  CB  . LYS B 1 65  ? -6.949  9.052   -9.240  1.00 21.11 ? 108  LYS B CB  1 
ATOM   3191  C  CG  . LYS B 1 65  ? -8.358  9.557   -9.527  1.00 20.83 ? 108  LYS B CG  1 
ATOM   3192  C  CD  . LYS B 1 65  ? -9.376  8.923   -8.607  1.00 22.12 ? 108  LYS B CD  1 
ATOM   3193  C  CE  . LYS B 1 65  ? -9.245  7.409   -8.597  1.00 22.82 ? 108  LYS B CE  1 
ATOM   3194  N  NZ  . LYS B 1 65  ? -10.136 6.774   -7.575  1.00 23.05 ? 108  LYS B NZ  1 
ATOM   3195  N  N   . CYS B 1 66  ? -4.930  8.300   -6.355  1.00 21.44 ? 109  CYS B N   1 
ATOM   3196  C  CA  . CYS B 1 66  ? -3.803  7.458   -5.971  1.00 22.55 ? 109  CYS B CA  1 
ATOM   3197  C  C   . CYS B 1 66  ? -4.168  5.998   -6.172  1.00 22.78 ? 109  CYS B C   1 
ATOM   3198  O  O   . CYS B 1 66  ? -4.800  5.369   -5.327  1.00 23.66 ? 109  CYS B O   1 
ATOM   3199  C  CB  . CYS B 1 66  ? -3.437  7.725   -4.522  1.00 21.20 ? 109  CYS B CB  1 
ATOM   3200  S  SG  . CYS B 1 66  ? -3.406  9.480   -4.173  1.00 22.09 ? 109  CYS B SG  1 
ATOM   3201  N  N   . GLU B 1 67  ? -3.748  5.455   -7.299  1.00 23.03 ? 110  GLU B N   1 
ATOM   3202  C  CA  . GLU B 1 67  ? -4.080  4.098   -7.619  1.00 24.23 ? 110  GLU B CA  1 
ATOM   3203  C  C   . GLU B 1 67  ? -3.119  3.142   -6.931  1.00 25.42 ? 110  GLU B C   1 
ATOM   3204  O  O   . GLU B 1 67  ? -3.434  1.966   -6.797  1.00 28.49 ? 110  GLU B O   1 
ATOM   3205  C  CB  . GLU B 1 67  ? -4.057  3.919   -9.145  1.00 22.10 ? 110  GLU B CB  1 
ATOM   3206  C  CG  . GLU B 1 67  ? -5.192  3.086   -9.735  1.00 20.06 ? 110  GLU B CG  1 
ATOM   3207  C  CD  . GLU B 1 67  ? -6.564  3.558   -9.324  1.00 18.02 ? 110  GLU B CD  1 
ATOM   3208  O  OE1 . GLU B 1 67  ? -6.786  4.780   -9.262  1.00 18.62 ? 110  GLU B OE1 1 
ATOM   3209  O  OE2 . GLU B 1 67  ? -7.427  2.700   -9.072  1.00 17.65 ? 110  GLU B OE2 1 
ATOM   3210  N  N   . PHE B 1 68  ? -1.968  3.628   -6.471  1.00 24.77 ? 111  PHE B N   1 
ATOM   3211  C  CA  . PHE B 1 68  ? -1.047  2.722   -5.822  1.00 23.46 ? 111  PHE B CA  1 
ATOM   3212  C  C   . PHE B 1 68  ? -1.693  1.932   -4.675  1.00 22.10 ? 111  PHE B C   1 
ATOM   3213  O  O   . PHE B 1 68  ? -1.190  0.893   -4.266  1.00 21.43 ? 111  PHE B O   1 
ATOM   3214  C  CB  . PHE B 1 68  ? 0.250   3.457   -5.382  1.00 22.90 ? 111  PHE B CB  1 
ATOM   3215  C  CG  . PHE B 1 68  ? 0.050   4.781   -4.687  1.00 21.96 ? 111  PHE B CG  1 
ATOM   3216  C  CD1 . PHE B 1 68  ? -0.136  4.850   -3.312  1.00 21.47 ? 111  PHE B CD1 1 
ATOM   3217  C  CD2 . PHE B 1 68  ? 0.141   5.969   -5.403  1.00 22.41 ? 111  PHE B CD2 1 
ATOM   3218  C  CE1 . PHE B 1 68  ? -0.220  6.100   -2.657  1.00 22.30 ? 111  PHE B CE1 1 
ATOM   3219  C  CE2 . PHE B 1 68  ? 0.060   7.212   -4.761  1.00 22.27 ? 111  PHE B CE2 1 
ATOM   3220  C  CZ  . PHE B 1 68  ? -0.117  7.283   -3.399  1.00 22.36 ? 111  PHE B CZ  1 
ATOM   3221  N  N   . PHE B 1 69  ? -2.841  2.392   -4.197  1.00 22.55 ? 112  PHE B N   1 
ATOM   3222  C  CA  . PHE B 1 69  ? -3.559  1.731   -3.097  1.00 23.75 ? 112  PHE B CA  1 
ATOM   3223  C  C   . PHE B 1 69  ? -4.405  0.451   -3.292  1.00 23.86 ? 112  PHE B C   1 
ATOM   3224  O  O   . PHE B 1 69  ? -5.061  -0.001  -2.348  1.00 24.77 ? 112  PHE B O   1 
ATOM   3225  C  CB  . PHE B 1 69  ? -4.431  2.762   -2.392  1.00 24.37 ? 112  PHE B CB  1 
ATOM   3226  C  CG  . PHE B 1 69  ? -3.658  3.684   -1.506  1.00 26.32 ? 112  PHE B CG  1 
ATOM   3227  C  CD1 . PHE B 1 69  ? -3.901  5.055   -1.514  1.00 25.56 ? 112  PHE B CD1 1 
ATOM   3228  C  CD2 . PHE B 1 69  ? -2.659  3.182   -0.671  1.00 26.28 ? 112  PHE B CD2 1 
ATOM   3229  C  CE1 . PHE B 1 69  ? -3.158  5.904   -0.707  1.00 25.36 ? 112  PHE B CE1 1 
ATOM   3230  C  CE2 . PHE B 1 69  ? -1.915  4.030   0.140   1.00 25.77 ? 112  PHE B CE2 1 
ATOM   3231  C  CZ  . PHE B 1 69  ? -2.168  5.395   0.118   1.00 25.74 ? 112  PHE B CZ  1 
ATOM   3232  N  N   . ASN B 1 70  ? -4.421  -0.142  -4.479  1.00 23.17 ? 113  ASN B N   1 
ATOM   3233  C  CA  . ASN B 1 70  ? -5.203  -1.368  -4.645  1.00 22.73 ? 113  ASN B CA  1 
ATOM   3234  C  C   . ASN B 1 70  ? -4.470  -2.508  -3.944  1.00 22.36 ? 113  ASN B C   1 
ATOM   3235  O  O   . ASN B 1 70  ? -3.264  -2.404  -3.697  1.00 22.60 ? 113  ASN B O   1 
ATOM   3236  C  CB  . ASN B 1 70  ? -5.391  -1.695  -6.121  1.00 21.59 ? 113  ASN B CB  1 
ATOM   3237  C  CG  . ASN B 1 70  ? -6.456  -0.856  -6.759  1.00 19.57 ? 113  ASN B CG  1 
ATOM   3238  O  OD1 . ASN B 1 70  ? -7.640  -0.977  -6.429  1.00 13.96 ? 113  ASN B OD1 1 
ATOM   3239  N  ND2 . ASN B 1 70  ? -6.045  0.018   -7.678  1.00 17.93 ? 113  ASN B ND2 1 
ATOM   3240  N  N   . ALA B 1 71  ? -5.202  -3.577  -3.621  1.00 21.66 ? 114  ALA B N   1 
ATOM   3241  C  CA  . ALA B 1 71  ? -4.645  -4.741  -2.932  1.00 22.26 ? 114  ALA B CA  1 
ATOM   3242  C  C   . ALA B 1 71  ? -3.269  -5.135  -3.437  1.00 22.00 ? 114  ALA B C   1 
ATOM   3243  O  O   . ALA B 1 71  ? -2.371  -5.397  -2.632  1.00 21.77 ? 114  ALA B O   1 
ATOM   3244  C  CB  . ALA B 1 71  ? -5.588  -5.928  -3.048  1.00 25.52 ? 114  ALA B CB  1 
ATOM   3245  N  N   . GLY B 1 72  ? -3.100  -5.179  -4.757  1.00 20.38 ? 115  GLY B N   1 
ATOM   3246  C  CA  . GLY B 1 72  ? -1.806  -5.537  -5.315  1.00 19.20 ? 115  GLY B CA  1 
ATOM   3247  C  C   . GLY B 1 72  ? -0.841  -4.362  -5.426  1.00 18.19 ? 115  GLY B C   1 
ATOM   3248  O  O   . GLY B 1 72  ? 0.323   -4.527  -5.789  1.00 17.35 ? 115  GLY B O   1 
ATOM   3249  N  N   . GLY B 1 73  ? -1.322  -3.166  -5.112  1.00 17.66 ? 116  GLY B N   1 
ATOM   3250  C  CA  . GLY B 1 73  ? -0.476  -1.996  -5.191  1.00 18.71 ? 116  GLY B CA  1 
ATOM   3251  C  C   . GLY B 1 73  ? -0.357  -1.502  -6.614  1.00 20.07 ? 116  GLY B C   1 
ATOM   3252  O  O   . GLY B 1 73  ? 0.726   -1.120  -7.053  1.00 20.86 ? 116  GLY B O   1 
ATOM   3253  N  N   . SER B 1 74  ? -1.474  -1.517  -7.341  1.00 21.77 ? 117  SER B N   1 
ATOM   3254  C  CA  . SER B 1 74  ? -1.504  -1.064  -8.731  1.00 21.15 ? 117  SER B CA  1 
ATOM   3255  C  C   . SER B 1 74  ? -2.888  -0.844  -9.312  1.00 20.20 ? 117  SER B C   1 
ATOM   3256  O  O   . SER B 1 74  ? -3.887  -1.344  -8.811  1.00 17.67 ? 117  SER B O   1 
ATOM   3257  C  CB  . SER B 1 74  ? -0.770  -2.044  -9.632  1.00 20.54 ? 117  SER B CB  1 
ATOM   3258  O  OG  . SER B 1 74  ? -1.230  -1.953  -10.966 1.00 20.85 ? 117  SER B OG  1 
ATOM   3259  N  N   . VAL B 1 75  ? -2.918  -0.068  -10.386 1.00 20.31 ? 118  VAL B N   1 
ATOM   3260  C  CA  . VAL B 1 75  ? -4.151  0.243   -11.097 1.00 19.83 ? 118  VAL B CA  1 
ATOM   3261  C  C   . VAL B 1 75  ? -4.574  -1.011  -11.832 1.00 19.20 ? 118  VAL B C   1 
ATOM   3262  O  O   . VAL B 1 75  ? -5.760  -1.345  -11.883 1.00 20.60 ? 118  VAL B O   1 
ATOM   3263  C  CB  . VAL B 1 75  ? -3.932  1.377   -12.154 1.00 18.97 ? 118  VAL B CB  1 
ATOM   3264  C  CG1 . VAL B 1 75  ? -2.902  0.949   -13.198 1.00 17.27 ? 118  VAL B CG1 1 
ATOM   3265  C  CG2 . VAL B 1 75  ? -5.238  1.752   -12.829 1.00 17.03 ? 118  VAL B CG2 1 
ATOM   3266  N  N   . LYS B 1 76  ? -3.608  -1.692  -12.415 1.00 17.79 ? 119  LYS B N   1 
ATOM   3267  C  CA  . LYS B 1 76  ? -3.883  -2.865  -13.179 1.00 17.67 ? 119  LYS B CA  1 
ATOM   3268  C  C   . LYS B 1 76  ? -4.643  -3.931  -12.386 1.00 17.65 ? 119  LYS B C   1 
ATOM   3269  O  O   . LYS B 1 76  ? -5.167  -4.865  -12.968 1.00 19.00 ? 119  LYS B O   1 
ATOM   3270  C  CB  . LYS B 1 76  ? -2.580  -3.361  -13.807 1.00 18.36 ? 119  LYS B CB  1 
ATOM   3271  C  CG  . LYS B 1 76  ? -1.841  -2.282  -14.587 1.00 18.52 ? 119  LYS B CG  1 
ATOM   3272  C  CD  . LYS B 1 76  ? -1.498  -2.701  -16.004 1.00 19.52 ? 119  LYS B CD  1 
ATOM   3273  C  CE  . LYS B 1 76  ? -1.456  -1.533  -16.969 1.00 21.09 ? 119  LYS B CE  1 
ATOM   3274  N  NZ  . LYS B 1 76  ? -0.739  -0.366  -16.391 1.00 18.89 ? 119  LYS B NZ  1 
ATOM   3275  N  N   . ASP B 1 77  ? -4.677  -3.841  -11.062 1.00 16.87 ? 120  ASP B N   1 
ATOM   3276  C  CA  . ASP B 1 77  ? -5.407  -4.825  -10.273 1.00 16.06 ? 120  ASP B CA  1 
ATOM   3277  C  C   . ASP B 1 77  ? -6.889  -4.812  -10.661 1.00 14.16 ? 120  ASP B C   1 
ATOM   3278  O  O   . ASP B 1 77  ? -7.626  -5.769  -10.393 1.00 11.12 ? 120  ASP B O   1 
ATOM   3279  C  CB  . ASP B 1 77  ? -5.257  -4.567  -8.783  1.00 19.41 ? 120  ASP B CB  1 
ATOM   3280  C  CG  . ASP B 1 77  ? -3.811  -4.331  -8.365  1.00 21.63 ? 120  ASP B CG  1 
ATOM   3281  O  OD1 . ASP B 1 77  ? -2.919  -5.079  -8.812  1.00 21.34 ? 120  ASP B OD1 1 
ATOM   3282  O  OD2 . ASP B 1 77  ? -3.567  -3.378  -7.593  1.00 22.19 ? 120  ASP B OD2 1 
ATOM   3283  N  N   . ARG B 1 78  ? -7.315  -3.726  -11.299 1.00 12.98 ? 121  ARG B N   1 
ATOM   3284  C  CA  . ARG B 1 78  ? -8.709  -3.537  -11.715 1.00 12.31 ? 121  ARG B CA  1 
ATOM   3285  C  C   . ARG B 1 78  ? -9.077  -4.271  -13.004 1.00 12.74 ? 121  ARG B C   1 
ATOM   3286  O  O   . ARG B 1 78  ? -10.147 -4.892  -13.099 1.00 12.08 ? 121  ARG B O   1 
ATOM   3287  C  CB  . ARG B 1 78  ? -9.069  -2.052  -11.935 1.00 10.39 ? 121  ARG B CB  1 
ATOM   3288  C  CG  . ARG B 1 78  ? -9.147  -1.126  -10.735 1.00 9.29  ? 121  ARG B CG  1 
ATOM   3289  C  CD  . ARG B 1 78  ? -9.293  0.311   -11.242 1.00 9.75  ? 121  ARG B CD  1 
ATOM   3290  N  NE  . ARG B 1 78  ? -9.383  1.338   -10.206 1.00 11.36 ? 121  ARG B NE  1 
ATOM   3291  C  CZ  . ARG B 1 78  ? -10.520 1.789   -9.674  1.00 14.46 ? 121  ARG B CZ  1 
ATOM   3292  N  NH1 . ARG B 1 78  ? -11.698 1.310   -10.064 1.00 15.73 ? 121  ARG B NH1 1 
ATOM   3293  N  NH2 . ARG B 1 78  ? -10.484 2.756   -8.768  1.00 15.26 ? 121  ARG B NH2 1 
ATOM   3294  N  N   . ILE B 1 79  ? -8.218  -4.150  -14.017 1.00 12.19 ? 122  ILE B N   1 
ATOM   3295  C  CA  . ILE B 1 79  ? -8.461  -4.827  -15.291 1.00 11.85 ? 122  ILE B CA  1 
ATOM   3296  C  C   . ILE B 1 79  ? -8.124  -6.292  -15.068 1.00 12.29 ? 122  ILE B C   1 
ATOM   3297  O  O   . ILE B 1 79  ? -8.813  -7.189  -15.529 1.00 13.47 ? 122  ILE B O   1 
ATOM   3298  C  CB  . ILE B 1 79  ? -7.574  -4.281  -16.452 1.00 9.03  ? 122  ILE B CB  1 
ATOM   3299  C  CG1 . ILE B 1 79  ? -6.107  -4.417  -16.098 1.00 5.86  ? 122  ILE B CG1 1 
ATOM   3300  C  CG2 . ILE B 1 79  ? -7.902  -2.862  -16.745 1.00 8.87  ? 122  ILE B CG2 1 
ATOM   3301  C  CD1 . ILE B 1 79  ? -5.230  -4.126  -17.208 1.00 3.95  ? 122  ILE B CD1 1 
ATOM   3302  N  N   . SER B 1 80  ? -7.053  -6.513  -14.332 1.00 12.83 ? 123  SER B N   1 
ATOM   3303  C  CA  . SER B 1 80  ? -6.629  -7.845  -14.005 1.00 13.12 ? 123  SER B CA  1 
ATOM   3304  C  C   . SER B 1 80  ? -7.864  -8.554  -13.492 1.00 14.32 ? 123  SER B C   1 
ATOM   3305  O  O   . SER B 1 80  ? -8.105  -9.725  -13.777 1.00 15.52 ? 123  SER B O   1 
ATOM   3306  C  CB  . SER B 1 80  ? -5.572  -7.766  -12.906 1.00 12.11 ? 123  SER B CB  1 
ATOM   3307  O  OG  . SER B 1 80  ? -4.844  -8.961  -12.834 1.00 12.73 ? 123  SER B OG  1 
ATOM   3308  N  N   . LEU B 1 81  ? -8.660  -7.805  -12.747 1.00 15.10 ? 124  LEU B N   1 
ATOM   3309  C  CA  . LEU B 1 81  ? -9.881  -8.316  -12.144 1.00 14.13 ? 124  LEU B CA  1 
ATOM   3310  C  C   . LEU B 1 81  ? -11.129 -8.290  -13.023 1.00 15.16 ? 124  LEU B C   1 
ATOM   3311  O  O   . LEU B 1 81  ? -11.914 -9.220  -12.976 1.00 16.13 ? 124  LEU B O   1 
ATOM   3312  C  CB  . LEU B 1 81  ? -10.169 -7.540  -10.869 1.00 11.42 ? 124  LEU B CB  1 
ATOM   3313  C  CG  . LEU B 1 81  ? -11.231 -8.104  -9.952  1.00 7.70  ? 124  LEU B CG  1 
ATOM   3314  C  CD1 . LEU B 1 81  ? -10.594 -9.167  -9.133  1.00 9.89  ? 124  LEU B CD1 1 
ATOM   3315  C  CD2 . LEU B 1 81  ? -11.786 -7.008  -9.092  1.00 3.95  ? 124  LEU B CD2 1 
ATOM   3316  N  N   . ARG B 1 82  ? -11.336 -7.222  -13.786 1.00 16.20 ? 125  ARG B N   1 
ATOM   3317  C  CA  . ARG B 1 82  ? -12.507 -7.128  -14.659 1.00 15.85 ? 125  ARG B CA  1 
ATOM   3318  C  C   . ARG B 1 82  ? -12.428 -8.247  -15.689 1.00 17.63 ? 125  ARG B C   1 
ATOM   3319  O  O   . ARG B 1 82  ? -13.453 -8.808  -16.087 1.00 19.60 ? 125  ARG B O   1 
ATOM   3320  C  CB  . ARG B 1 82  ? -12.548 -5.771  -15.346 1.00 14.35 ? 125  ARG B CB  1 
ATOM   3321  C  CG  . ARG B 1 82  ? -13.730 -5.536  -16.250 1.00 11.46 ? 125  ARG B CG  1 
ATOM   3322  C  CD  . ARG B 1 82  ? -15.052 -5.812  -15.571 1.00 10.41 ? 125  ARG B CD  1 
ATOM   3323  N  NE  . ARG B 1 82  ? -16.160 -5.437  -16.440 1.00 12.74 ? 125  ARG B NE  1 
ATOM   3324  C  CZ  . ARG B 1 82  ? -16.647 -4.206  -16.531 1.00 15.50 ? 125  ARG B CZ  1 
ATOM   3325  N  NH1 . ARG B 1 82  ? -16.123 -3.240  -15.794 1.00 20.14 ? 125  ARG B NH1 1 
ATOM   3326  N  NH2 . ARG B 1 82  ? -17.644 -3.931  -17.361 1.00 17.78 ? 125  ARG B NH2 1 
ATOM   3327  N  N   . MET B 1 83  ? -11.219 -8.584  -16.125 1.00 17.51 ? 126  MET B N   1 
ATOM   3328  C  CA  . MET B 1 83  ? -11.101 -9.685  -17.061 1.00 19.77 ? 126  MET B CA  1 
ATOM   3329  C  C   . MET B 1 83  ? -11.518 -10.919 -16.267 1.00 21.09 ? 126  MET B C   1 
ATOM   3330  O  O   . MET B 1 83  ? -12.594 -11.477 -16.493 1.00 22.11 ? 126  MET B O   1 
ATOM   3331  C  CB  . MET B 1 83  ? -9.670  -9.841  -17.580 1.00 20.40 ? 126  MET B CB  1 
ATOM   3332  C  CG  . MET B 1 83  ? -9.320  -8.895  -18.733 1.00 21.43 ? 126  MET B CG  1 
ATOM   3333  S  SD  . MET B 1 83  ? -7.743  -9.299  -19.523 1.00 23.65 ? 126  MET B SD  1 
ATOM   3334  C  CE  . MET B 1 83  ? -6.633  -8.311  -18.548 1.00 21.81 ? 126  MET B CE  1 
ATOM   3335  N  N   . ILE B 1 84  ? -10.688 -11.325 -15.313 1.00 20.83 ? 127  ILE B N   1 
ATOM   3336  C  CA  . ILE B 1 84  ? -11.015 -12.493 -14.506 1.00 18.95 ? 127  ILE B CA  1 
ATOM   3337  C  C   . ILE B 1 84  ? -12.511 -12.572 -14.286 1.00 18.71 ? 127  ILE B C   1 
ATOM   3338  O  O   . ILE B 1 84  ? -13.159 -13.527 -14.677 1.00 20.25 ? 127  ILE B O   1 
ATOM   3339  C  CB  . ILE B 1 84  ? -10.294 -12.463 -13.132 1.00 18.03 ? 127  ILE B CB  1 
ATOM   3340  C  CG1 . ILE B 1 84  ? -8.800  -12.751 -13.354 1.00 17.11 ? 127  ILE B CG1 1 
ATOM   3341  C  CG2 . ILE B 1 84  ? -10.962 -13.449 -12.152 1.00 14.59 ? 127  ILE B CG2 1 
ATOM   3342  C  CD1 . ILE B 1 84  ? -7.992  -13.062 -12.120 1.00 14.88 ? 127  ILE B CD1 1 
ATOM   3343  N  N   . GLU B 1 85  ? -13.075 -11.548 -13.685 1.00 19.46 ? 128  GLU B N   1 
ATOM   3344  C  CA  . GLU B 1 85  ? -14.491 -11.574 -13.431 1.00 20.12 ? 128  GLU B CA  1 
ATOM   3345  C  C   . GLU B 1 85  ? -15.250 -11.738 -14.739 1.00 20.22 ? 128  GLU B C   1 
ATOM   3346  O  O   . GLU B 1 85  ? -16.159 -12.577 -14.842 1.00 21.22 ? 128  GLU B O   1 
ATOM   3347  C  CB  . GLU B 1 85  ? -14.916 -10.311 -12.659 1.00 19.52 ? 128  GLU B CB  1 
ATOM   3348  C  CG  . GLU B 1 85  ? -14.407 -10.313 -11.211 1.00 20.31 ? 128  GLU B CG  1 
ATOM   3349  C  CD  . GLU B 1 85  ? -14.978 -9.194  -10.359 1.00 23.48 ? 128  GLU B CD  1 
ATOM   3350  O  OE1 . GLU B 1 85  ? -14.843 -9.261  -9.111  1.00 21.64 ? 128  GLU B OE1 1 
ATOM   3351  O  OE2 . GLU B 1 85  ? -15.559 -8.246  -10.933 1.00 23.54 ? 128  GLU B OE2 1 
ATOM   3352  N  N   . ASP B 1 86  ? -14.865 -10.972 -15.753 1.00 18.80 ? 129  ASP B N   1 
ATOM   3353  C  CA  . ASP B 1 86  ? -15.561 -11.087 -17.028 1.00 17.78 ? 129  ASP B CA  1 
ATOM   3354  C  C   . ASP B 1 86  ? -15.548 -12.516 -17.579 1.00 17.79 ? 129  ASP B C   1 
ATOM   3355  O  O   . ASP B 1 86  ? -16.607 -13.112 -17.787 1.00 18.48 ? 129  ASP B O   1 
ATOM   3356  C  CB  . ASP B 1 86  ? -14.993 -10.095 -18.042 1.00 14.55 ? 129  ASP B CB  1 
ATOM   3357  C  CG  . ASP B 1 86  ? -15.566 -8.706  -17.858 1.00 13.02 ? 129  ASP B CG  1 
ATOM   3358  O  OD1 . ASP B 1 86  ? -15.282 -7.799  -18.663 1.00 13.30 ? 129  ASP B OD1 1 
ATOM   3359  O  OD2 . ASP B 1 86  ? -16.319 -8.523  -16.895 1.00 11.47 ? 129  ASP B OD2 1 
ATOM   3360  N  N   . ALA B 1 87  ? -14.371 -13.088 -17.790 1.00 17.36 ? 130  ALA B N   1 
ATOM   3361  C  CA  . ALA B 1 87  ? -14.308 -14.448 -18.313 1.00 18.09 ? 130  ALA B CA  1 
ATOM   3362  C  C   . ALA B 1 87  ? -15.239 -15.374 -17.545 1.00 18.75 ? 130  ALA B C   1 
ATOM   3363  O  O   . ALA B 1 87  ? -15.941 -16.186 -18.138 1.00 19.08 ? 130  ALA B O   1 
ATOM   3364  C  CB  . ALA B 1 87  ? -12.887 -14.976 -18.259 1.00 16.88 ? 130  ALA B CB  1 
ATOM   3365  N  N   . GLU B 1 88  ? -15.253 -15.244 -16.225 1.00 20.09 ? 131  GLU B N   1 
ATOM   3366  C  CA  . GLU B 1 88  ? -16.103 -16.083 -15.398 1.00 20.40 ? 131  GLU B CA  1 
ATOM   3367  C  C   . GLU B 1 88  ? -17.574 -15.844 -15.677 1.00 21.25 ? 131  GLU B C   1 
ATOM   3368  O  O   . GLU B 1 88  ? -18.385 -16.743 -15.484 1.00 20.99 ? 131  GLU B O   1 
ATOM   3369  C  CB  . GLU B 1 88  ? -15.829 -15.818 -13.927 1.00 20.29 ? 131  GLU B CB  1 
ATOM   3370  C  CG  . GLU B 1 88  ? -14.432 -16.157 -13.481 1.00 18.40 ? 131  GLU B CG  1 
ATOM   3371  C  CD  . GLU B 1 88  ? -14.156 -15.637 -12.090 1.00 17.20 ? 131  GLU B CD  1 
ATOM   3372  O  OE1 . GLU B 1 88  ? -13.027 -15.791 -11.594 1.00 17.34 ? 131  GLU B OE1 1 
ATOM   3373  O  OE2 . GLU B 1 88  ? -15.080 -15.059 -11.494 1.00 15.88 ? 131  GLU B OE2 1 
ATOM   3374  N  N   . ARG B 1 89  ? -17.927 -14.628 -16.096 1.00 23.65 ? 132  ARG B N   1 
ATOM   3375  C  CA  . ARG B 1 89  ? -19.323 -14.310 -16.406 1.00 25.45 ? 132  ARG B CA  1 
ATOM   3376  C  C   . ARG B 1 89  ? -19.634 -14.785 -17.813 1.00 26.20 ? 132  ARG B C   1 
ATOM   3377  O  O   . ARG B 1 89  ? -20.802 -15.028 -18.139 1.00 25.99 ? 132  ARG B O   1 
ATOM   3378  C  CB  . ARG B 1 89  ? -19.598 -12.811 -16.305 1.00 26.54 ? 132  ARG B CB  1 
ATOM   3379  C  CG  . ARG B 1 89  ? -19.879 -12.298 -14.898 1.00 29.13 ? 132  ARG B CG  1 
ATOM   3380  C  CD  . ARG B 1 89  ? -19.000 -11.077 -14.582 1.00 32.11 ? 132  ARG B CD  1 
ATOM   3381  N  NE  . ARG B 1 89  ? -19.713 -9.994  -13.894 1.00 33.39 ? 132  ARG B NE  1 
ATOM   3382  C  CZ  . ARG B 1 89  ? -19.144 -8.854  -13.507 1.00 33.85 ? 132  ARG B CZ  1 
ATOM   3383  N  NH1 . ARG B 1 89  ? -17.850 -8.653  -13.743 1.00 32.98 ? 132  ARG B NH1 1 
ATOM   3384  N  NH2 . ARG B 1 89  ? -19.869 -7.922  -12.882 1.00 33.85 ? 132  ARG B NH2 1 
ATOM   3385  N  N   . ASP B 1 90  ? -18.586 -14.906 -18.637 1.00 25.94 ? 133  ASP B N   1 
ATOM   3386  C  CA  . ASP B 1 90  ? -18.718 -15.403 -20.012 1.00 27.38 ? 133  ASP B CA  1 
ATOM   3387  C  C   . ASP B 1 90  ? -19.072 -16.885 -19.984 1.00 26.87 ? 133  ASP B C   1 
ATOM   3388  O  O   . ASP B 1 90  ? -19.876 -17.355 -20.786 1.00 27.43 ? 133  ASP B O   1 
ATOM   3389  C  CB  . ASP B 1 90  ? -17.401 -15.295 -20.788 1.00 28.15 ? 133  ASP B CB  1 
ATOM   3390  C  CG  . ASP B 1 90  ? -17.174 -13.935 -21.383 1.00 28.69 ? 133  ASP B CG  1 
ATOM   3391  O  OD1 . ASP B 1 90  ? -18.166 -13.280 -21.777 1.00 29.53 ? 133  ASP B OD1 1 
ATOM   3392  O  OD2 . ASP B 1 90  ? -15.990 -13.536 -21.478 1.00 28.17 ? 133  ASP B OD2 1 
ATOM   3393  N  N   . GLY B 1 91  ? -18.425 -17.604 -19.065 1.00 26.25 ? 134  GLY B N   1 
ATOM   3394  C  CA  . GLY B 1 91  ? -18.607 -19.035 -18.913 1.00 25.07 ? 134  GLY B CA  1 
ATOM   3395  C  C   . GLY B 1 91  ? -17.316 -19.736 -19.311 1.00 25.31 ? 134  GLY B C   1 
ATOM   3396  O  O   . GLY B 1 91  ? -17.172 -20.942 -19.135 1.00 25.59 ? 134  GLY B O   1 
ATOM   3397  N  N   . THR B 1 92  ? -16.367 -18.979 -19.852 1.00 24.50 ? 135  THR B N   1 
ATOM   3398  C  CA  . THR B 1 92  ? -15.099 -19.559 -20.264 1.00 24.88 ? 135  THR B CA  1 
ATOM   3399  C  C   . THR B 1 92  ? -14.119 -19.777 -19.103 1.00 25.08 ? 135  THR B C   1 
ATOM   3400  O  O   . THR B 1 92  ? -13.376 -20.764 -19.089 1.00 25.38 ? 135  THR B O   1 
ATOM   3401  C  CB  . THR B 1 92  ? -14.414 -18.709 -21.374 1.00 25.15 ? 135  THR B CB  1 
ATOM   3402  O  OG1 . THR B 1 92  ? -14.466 -17.323 -21.029 1.00 26.75 ? 135  THR B OG1 1 
ATOM   3403  C  CG2 . THR B 1 92  ? -15.113 -18.904 -22.704 1.00 26.09 ? 135  THR B CG2 1 
ATOM   3404  N  N   . LEU B 1 93  ? -14.103 -18.885 -18.119 1.00 24.10 ? 136  LEU B N   1 
ATOM   3405  C  CA  . LEU B 1 93  ? -13.176 -19.097 -17.017 1.00 24.64 ? 136  LEU B CA  1 
ATOM   3406  C  C   . LEU B 1 93  ? -13.727 -20.089 -15.999 1.00 23.21 ? 136  LEU B C   1 
ATOM   3407  O  O   . LEU B 1 93  ? -14.589 -19.761 -15.186 1.00 21.98 ? 136  LEU B O   1 
ATOM   3408  C  CB  . LEU B 1 93  ? -12.819 -17.777 -16.329 1.00 26.28 ? 136  LEU B CB  1 
ATOM   3409  C  CG  . LEU B 1 93  ? -11.645 -17.903 -15.340 1.00 26.45 ? 136  LEU B CG  1 
ATOM   3410  C  CD1 . LEU B 1 93  ? -10.565 -18.845 -15.909 1.00 24.15 ? 136  LEU B CD1 1 
ATOM   3411  C  CD2 . LEU B 1 93  ? -11.070 -16.513 -15.046 1.00 26.45 ? 136  LEU B CD2 1 
ATOM   3412  N  N   . LYS B 1 94  ? -13.192 -21.306 -16.065 1.00 21.75 ? 137  LYS B N   1 
ATOM   3413  C  CA  . LYS B 1 94  ? -13.590 -22.411 -15.210 1.00 20.33 ? 137  LYS B CA  1 
ATOM   3414  C  C   . LYS B 1 94  ? -12.791 -22.542 -13.938 1.00 19.00 ? 137  LYS B C   1 
ATOM   3415  O  O   . LYS B 1 94  ? -11.559 -22.567 -13.956 1.00 16.93 ? 137  LYS B O   1 
ATOM   3416  C  CB  . LYS B 1 94  ? -13.452 -23.746 -15.948 1.00 20.95 ? 137  LYS B CB  1 
ATOM   3417  C  CG  . LYS B 1 94  ? -14.266 -23.919 -17.199 1.00 18.71 ? 137  LYS B CG  1 
ATOM   3418  C  CD  . LYS B 1 94  ? -13.963 -25.277 -17.777 1.00 16.60 ? 137  LYS B CD  1 
ATOM   3419  C  CE  . LYS B 1 94  ? -12.633 -25.283 -18.482 1.00 14.58 ? 137  LYS B CE  1 
ATOM   3420  N  NZ  . LYS B 1 94  ? -12.827 -24.812 -19.874 1.00 17.14 ? 137  LYS B NZ  1 
ATOM   3421  N  N   . PRO B 1 95  ? -13.485 -22.605 -12.809 1.00 18.92 ? 138  PRO B N   1 
ATOM   3422  C  CA  . PRO B 1 95  ? -12.738 -22.760 -11.573 1.00 19.98 ? 138  PRO B CA  1 
ATOM   3423  C  C   . PRO B 1 95  ? -11.661 -23.846 -11.714 1.00 19.55 ? 138  PRO B C   1 
ATOM   3424  O  O   . PRO B 1 95  ? -11.907 -24.918 -12.277 1.00 20.96 ? 138  PRO B O   1 
ATOM   3425  C  CB  . PRO B 1 95  ? -13.840 -23.116 -10.600 1.00 20.27 ? 138  PRO B CB  1 
ATOM   3426  C  CG  . PRO B 1 95  ? -14.920 -22.105 -11.026 1.00 20.78 ? 138  PRO B CG  1 
ATOM   3427  C  CD  . PRO B 1 95  ? -14.816 -22.026 -12.541 1.00 19.86 ? 138  PRO B CD  1 
ATOM   3428  N  N   . GLY B 1 96  ? -10.469 -23.543 -11.205 1.00 17.30 ? 139  GLY B N   1 
ATOM   3429  C  CA  . GLY B 1 96  ? -9.360  -24.471 -11.261 1.00 15.24 ? 139  GLY B CA  1 
ATOM   3430  C  C   . GLY B 1 96  ? -8.596  -24.353 -12.557 1.00 14.93 ? 139  GLY B C   1 
ATOM   3431  O  O   . GLY B 1 96  ? -7.677  -25.131 -12.811 1.00 11.02 ? 139  GLY B O   1 
ATOM   3432  N  N   . ASP B 1 97  ? -8.969  -23.382 -13.384 1.00 15.56 ? 140  ASP B N   1 
ATOM   3433  C  CA  . ASP B 1 97  ? -8.287  -23.221 -14.660 1.00 19.51 ? 140  ASP B CA  1 
ATOM   3434  C  C   . ASP B 1 97  ? -6.916  -22.564 -14.533 1.00 20.75 ? 140  ASP B C   1 
ATOM   3435  O  O   . ASP B 1 97  ? -6.441  -22.283 -13.433 1.00 22.10 ? 140  ASP B O   1 
ATOM   3436  C  CB  . ASP B 1 97  ? -9.147  -22.441 -15.666 1.00 20.55 ? 140  ASP B CB  1 
ATOM   3437  C  CG  . ASP B 1 97  ? -10.216 -23.307 -16.339 1.00 22.47 ? 140  ASP B CG  1 
ATOM   3438  O  OD1 . ASP B 1 97  ? -10.111 -24.556 -16.299 1.00 21.83 ? 140  ASP B OD1 1 
ATOM   3439  O  OD2 . ASP B 1 97  ? -11.163 -22.734 -16.922 1.00 22.21 ? 140  ASP B OD2 1 
ATOM   3440  N  N   . THR B 1 98  ? -6.280  -22.336 -15.675 1.00 20.21 ? 141  THR B N   1 
ATOM   3441  C  CA  . THR B 1 98  ? -4.959  -21.750 -15.718 1.00 18.53 ? 141  THR B CA  1 
ATOM   3442  C  C   . THR B 1 98  ? -4.916  -20.480 -16.535 1.00 19.42 ? 141  THR B C   1 
ATOM   3443  O  O   . THR B 1 98  ? -5.174  -20.524 -17.735 1.00 20.90 ? 141  THR B O   1 
ATOM   3444  C  CB  . THR B 1 98  ? -3.997  -22.740 -16.345 1.00 19.59 ? 141  THR B CB  1 
ATOM   3445  O  OG1 . THR B 1 98  ? -3.888  -23.889 -15.495 1.00 19.54 ? 141  THR B OG1 1 
ATOM   3446  C  CG2 . THR B 1 98  ? -2.627  -22.104 -16.568 1.00 20.81 ? 141  THR B CG2 1 
ATOM   3447  N  N   . ILE B 1 99  ? -4.606  -19.350 -15.896 1.00 20.12 ? 142  ILE B N   1 
ATOM   3448  C  CA  . ILE B 1 99  ? -4.492  -18.070 -16.609 1.00 19.35 ? 142  ILE B CA  1 
ATOM   3449  C  C   . ILE B 1 99  ? -3.049  -17.967 -17.080 1.00 21.29 ? 142  ILE B C   1 
ATOM   3450  O  O   . ILE B 1 99  ? -2.145  -18.423 -16.377 1.00 21.91 ? 142  ILE B O   1 
ATOM   3451  C  CB  . ILE B 1 99  ? -4.761  -16.885 -15.704 1.00 17.16 ? 142  ILE B CB  1 
ATOM   3452  C  CG1 . ILE B 1 99  ? -6.183  -16.951 -15.163 1.00 17.92 ? 142  ILE B CG1 1 
ATOM   3453  C  CG2 . ILE B 1 99  ? -4.543  -15.616 -16.474 1.00 16.48 ? 142  ILE B CG2 1 
ATOM   3454  C  CD1 . ILE B 1 99  ? -6.499  -15.884 -14.157 1.00 18.62 ? 142  ILE B CD1 1 
ATOM   3455  N  N   . ILE B 1 100 ? -2.823  -17.401 -18.266 1.00 23.27 ? 143  ILE B N   1 
ATOM   3456  C  CA  . ILE B 1 100 ? -1.452  -17.265 -18.809 1.00 24.60 ? 143  ILE B CA  1 
ATOM   3457  C  C   . ILE B 1 100 ? -1.183  -15.875 -19.397 1.00 25.63 ? 143  ILE B C   1 
ATOM   3458  O  O   . ILE B 1 100 ? -1.773  -15.505 -20.411 1.00 23.92 ? 143  ILE B O   1 
ATOM   3459  C  CB  . ILE B 1 100 ? -1.165  -18.313 -19.923 1.00 23.81 ? 143  ILE B CB  1 
ATOM   3460  C  CG1 . ILE B 1 100 ? -1.254  -19.726 -19.348 1.00 25.57 ? 143  ILE B CG1 1 
ATOM   3461  C  CG2 . ILE B 1 100 ? 0.215   -18.094 -20.501 1.00 22.81 ? 143  ILE B CG2 1 
ATOM   3462  C  CD1 . ILE B 1 100 ? -0.900  -20.837 -20.318 1.00 24.60 ? 143  ILE B CD1 1 
ATOM   3463  N  N   . GLU B 1 101 ? -0.296  -15.116 -18.759 1.00 25.81 ? 144  GLU B N   1 
ATOM   3464  C  CA  . GLU B 1 101 ? 0.025   -13.776 -19.231 1.00 26.96 ? 144  GLU B CA  1 
ATOM   3465  C  C   . GLU B 1 101 ? 1.441   -13.744 -19.763 1.00 27.18 ? 144  GLU B C   1 
ATOM   3466  O  O   . GLU B 1 101 ? 2.336   -14.333 -19.159 1.00 28.46 ? 144  GLU B O   1 
ATOM   3467  C  CB  . GLU B 1 101 ? -0.108  -12.762 -18.099 1.00 28.19 ? 144  GLU B CB  1 
ATOM   3468  C  CG  . GLU B 1 101 ? -0.309  -11.353 -18.596 1.00 29.22 ? 144  GLU B CG  1 
ATOM   3469  C  CD  . GLU B 1 101 ? -1.660  -11.184 -19.250 1.00 30.06 ? 144  GLU B CD  1 
ATOM   3470  O  OE1 . GLU B 1 101 ? -1.908  -10.105 -19.819 1.00 31.40 ? 144  GLU B OE1 1 
ATOM   3471  O  OE2 . GLU B 1 101 ? -2.483  -12.126 -19.187 1.00 30.51 ? 144  GLU B OE2 1 
ATOM   3472  N  N   . PRO B 1 102 ? 1.662   -13.066 -20.903 1.00 26.33 ? 145  PRO B N   1 
ATOM   3473  C  CA  . PRO B 1 102 ? 2.974   -12.936 -21.552 1.00 25.16 ? 145  PRO B CA  1 
ATOM   3474  C  C   . PRO B 1 102 ? 3.757   -11.728 -21.013 1.00 25.06 ? 145  PRO B C   1 
ATOM   3475  O  O   . PRO B 1 102 ? 4.990   -11.604 -21.160 1.00 24.70 ? 145  PRO B O   1 
ATOM   3476  C  CB  . PRO B 1 102 ? 2.596   -12.792 -23.019 1.00 25.50 ? 145  PRO B CB  1 
ATOM   3477  C  CG  . PRO B 1 102 ? 1.344   -11.985 -22.944 1.00 25.93 ? 145  PRO B CG  1 
ATOM   3478  C  CD  . PRO B 1 102 ? 0.584   -12.615 -21.803 1.00 25.96 ? 145  PRO B CD  1 
ATOM   3479  N  N   . THR B 1 103 ? 3.009   -10.845 -20.375 1.00 24.48 ? 146  THR B N   1 
ATOM   3480  C  CA  . THR B 1 103 ? 3.571   -9.654  -19.794 1.00 24.54 ? 146  THR B CA  1 
ATOM   3481  C  C   . THR B 1 103 ? 3.731   -9.842  -18.279 1.00 23.91 ? 146  THR B C   1 
ATOM   3482  O  O   . THR B 1 103 ? 2.750   -9.985  -17.557 1.00 24.66 ? 146  THR B O   1 
ATOM   3483  C  CB  . THR B 1 103 ? 2.659   -8.452  -20.096 1.00 24.87 ? 146  THR B CB  1 
ATOM   3484  O  OG1 . THR B 1 103 ? 3.267   -7.258  -19.589 1.00 25.78 ? 146  THR B OG1 1 
ATOM   3485  C  CG2 . THR B 1 103 ? 1.271   -8.667  -19.475 1.00 25.25 ? 146  THR B CG2 1 
ATOM   3486  N  N   . SER B 1 104 ? 4.975   -9.869  -17.813 1.00 21.87 ? 147  SER B N   1 
ATOM   3487  C  CA  . SER B 1 104 ? 5.256   -10.011 -16.392 1.00 21.67 ? 147  SER B CA  1 
ATOM   3488  C  C   . SER B 1 104 ? 5.446   -8.601  -15.844 1.00 22.18 ? 147  SER B C   1 
ATOM   3489  O  O   . SER B 1 104 ? 6.547   -8.191  -15.479 1.00 23.37 ? 147  SER B O   1 
ATOM   3490  C  CB  . SER B 1 104 ? 6.521   -10.844 -16.168 1.00 21.90 ? 147  SER B CB  1 
ATOM   3491  O  OG  . SER B 1 104 ? 7.643   -10.270 -16.814 1.00 24.38 ? 147  SER B OG  1 
ATOM   3492  N  N   . GLY B 1 105 ? 4.353   -7.857  -15.809 1.00 21.26 ? 148  GLY B N   1 
ATOM   3493  C  CA  . GLY B 1 105 ? 4.404   -6.500  -15.325 1.00 19.89 ? 148  GLY B CA  1 
ATOM   3494  C  C   . GLY B 1 105 ? 3.253   -6.382  -14.375 1.00 20.33 ? 148  GLY B C   1 
ATOM   3495  O  O   . GLY B 1 105 ? 2.738   -7.402  -13.912 1.00 20.59 ? 148  GLY B O   1 
ATOM   3496  N  N   . ASN B 1 106 ? 2.847   -5.151  -14.090 1.00 20.07 ? 149  ASN B N   1 
ATOM   3497  C  CA  . ASN B 1 106 ? 1.746   -4.921  -13.180 1.00 19.99 ? 149  ASN B CA  1 
ATOM   3498  C  C   . ASN B 1 106 ? 0.578   -5.856  -13.426 1.00 19.89 ? 149  ASN B C   1 
ATOM   3499  O  O   . ASN B 1 106 ? -0.005  -6.369  -12.473 1.00 20.40 ? 149  ASN B O   1 
ATOM   3500  C  CB  . ASN B 1 106 ? 1.272   -3.468  -13.252 1.00 19.29 ? 149  ASN B CB  1 
ATOM   3501  C  CG  . ASN B 1 106 ? 2.068   -2.561  -12.346 1.00 18.26 ? 149  ASN B CG  1 
ATOM   3502  O  OD1 . ASN B 1 106 ? 2.417   -2.943  -11.227 1.00 18.41 ? 149  ASN B OD1 1 
ATOM   3503  N  ND2 . ASN B 1 106 ? 2.356   -1.353  -12.814 1.00 17.38 ? 149  ASN B ND2 1 
ATOM   3504  N  N   . THR B 1 107 ? 0.241   -6.083  -14.693 1.00 18.36 ? 150  THR B N   1 
ATOM   3505  C  CA  . THR B 1 107 ? -0.872  -6.964  -15.028 1.00 17.29 ? 150  THR B CA  1 
ATOM   3506  C  C   . THR B 1 107 ? -0.641  -8.409  -14.566 1.00 16.12 ? 150  THR B C   1 
ATOM   3507  O  O   . THR B 1 107 ? -1.514  -9.008  -13.975 1.00 15.28 ? 150  THR B O   1 
ATOM   3508  C  CB  . THR B 1 107 ? -1.175  -6.904  -16.554 1.00 17.95 ? 150  THR B CB  1 
ATOM   3509  O  OG1 . THR B 1 107 ? -1.954  -5.729  -16.842 1.00 17.05 ? 150  THR B OG1 1 
ATOM   3510  C  CG2 . THR B 1 107 ? -1.919  -8.146  -17.017 1.00 17.49 ? 150  THR B CG2 1 
ATOM   3511  N  N   . GLY B 1 108 ? 0.533   -8.968  -14.817 1.00 16.13 ? 151  GLY B N   1 
ATOM   3512  C  CA  . GLY B 1 108 ? 0.788   -10.328 -14.374 1.00 17.72 ? 151  GLY B CA  1 
ATOM   3513  C  C   . GLY B 1 108 ? 0.928   -10.340 -12.862 1.00 19.35 ? 151  GLY B C   1 
ATOM   3514  O  O   . GLY B 1 108 ? 1.165   -11.374 -12.222 1.00 19.91 ? 151  GLY B O   1 
ATOM   3515  N  N   . ILE B 1 109 ? 0.785   -9.153  -12.291 1.00 19.49 ? 152  ILE B N   1 
ATOM   3516  C  CA  . ILE B 1 109 ? 0.880   -8.957  -10.858 1.00 18.38 ? 152  ILE B CA  1 
ATOM   3517  C  C   . ILE B 1 109 ? -0.529  -8.928  -10.299 1.00 17.90 ? 152  ILE B C   1 
ATOM   3518  O  O   . ILE B 1 109 ? -0.794  -9.490  -9.239  1.00 19.45 ? 152  ILE B O   1 
ATOM   3519  C  CB  . ILE B 1 109 ? 1.604   -7.625  -10.545 1.00 19.00 ? 152  ILE B CB  1 
ATOM   3520  C  CG1 . ILE B 1 109 ? 3.021   -7.929  -10.042 1.00 19.22 ? 152  ILE B CG1 1 
ATOM   3521  C  CG2 . ILE B 1 109 ? 0.777   -6.779  -9.559  1.00 19.19 ? 152  ILE B CG2 1 
ATOM   3522  C  CD1 . ILE B 1 109 ? 3.926   -6.715  -9.925  1.00 16.12 ? 152  ILE B CD1 1 
ATOM   3523  N  N   . GLY B 1 110 ? -1.427  -8.266  -11.019 1.00 15.80 ? 153  GLY B N   1 
ATOM   3524  C  CA  . GLY B 1 110 ? -2.801  -8.182  -10.583 1.00 14.24 ? 153  GLY B CA  1 
ATOM   3525  C  C   . GLY B 1 110 ? -3.444  -9.548  -10.640 1.00 14.89 ? 153  GLY B C   1 
ATOM   3526  O  O   . GLY B 1 110 ? -4.170  -9.931  -9.743  1.00 15.00 ? 153  GLY B O   1 
ATOM   3527  N  N   . LEU B 1 111 ? -3.167  -10.285 -11.722 1.00 13.93 ? 154  LEU B N   1 
ATOM   3528  C  CA  . LEU B 1 111 ? -3.723  -11.621 -11.935 1.00 12.34 ? 154  LEU B CA  1 
ATOM   3529  C  C   . LEU B 1 111 ? -3.085  -12.640 -11.018 1.00 13.71 ? 154  LEU B C   1 
ATOM   3530  O  O   . LEU B 1 111 ? -3.778  -13.497 -10.470 1.00 15.63 ? 154  LEU B O   1 
ATOM   3531  C  CB  . LEU B 1 111 ? -3.506  -12.079 -13.385 1.00 11.57 ? 154  LEU B CB  1 
ATOM   3532  C  CG  . LEU B 1 111 ? -4.345  -11.425 -14.481 1.00 10.52 ? 154  LEU B CG  1 
ATOM   3533  C  CD1 . LEU B 1 111 ? -3.803  -11.795 -15.844 1.00 7.31  ? 154  LEU B CD1 1 
ATOM   3534  C  CD2 . LEU B 1 111 ? -5.803  -11.823 -14.351 1.00 11.21 ? 154  LEU B CD2 1 
ATOM   3535  N  N   . ALA B 1 112 ? -1.768  -12.570 -10.857 1.00 13.32 ? 155  ALA B N   1 
ATOM   3536  C  CA  . ALA B 1 112 ? -1.085  -13.509 -9.979  1.00 13.43 ? 155  ALA B CA  1 
ATOM   3537  C  C   . ALA B 1 112 ? -1.746  -13.425 -8.610  1.00 16.15 ? 155  ALA B C   1 
ATOM   3538  O  O   . ALA B 1 112 ? -1.862  -14.407 -7.867  1.00 17.54 ? 155  ALA B O   1 
ATOM   3539  C  CB  . ALA B 1 112 ? 0.403   -13.217 -9.892  1.00 12.58 ? 155  ALA B CB  1 
ATOM   3540  N  N   . LEU B 1 113 ? -2.184  -12.202 -8.327  1.00 16.82 ? 156  LEU B N   1 
ATOM   3541  C  CA  . LEU B 1 113 ? -2.843  -11.847 -7.075  1.00 18.01 ? 156  LEU B CA  1 
ATOM   3542  C  C   . LEU B 1 113 ? -4.258  -12.419 -6.975  1.00 18.25 ? 156  LEU B C   1 
ATOM   3543  O  O   . LEU B 1 113 ? -4.595  -13.152 -6.040  1.00 18.08 ? 156  LEU B O   1 
ATOM   3544  C  CB  . LEU B 1 113 ? -2.892  -10.300 -6.969  1.00 19.67 ? 156  LEU B CB  1 
ATOM   3545  C  CG  . LEU B 1 113 ? -3.523  -9.605  -5.734  1.00 19.87 ? 156  LEU B CG  1 
ATOM   3546  C  CD1 . LEU B 1 113 ? -4.542  -10.520 -5.061  1.00 20.59 ? 156  LEU B CD1 1 
ATOM   3547  C  CD2 . LEU B 1 113 ? -2.443  -9.195  -4.738  1.00 22.37 ? 156  LEU B CD2 1 
ATOM   3548  N  N   . ALA B 1 114 ? -5.075  -12.049 -7.954  1.00 18.67 ? 157  ALA B N   1 
ATOM   3549  C  CA  . ALA B 1 114 ? -6.467  -12.487 -7.991  1.00 19.09 ? 157  ALA B CA  1 
ATOM   3550  C  C   . ALA B 1 114 ? -6.492  -13.988 -8.177  1.00 20.34 ? 157  ALA B C   1 
ATOM   3551  O  O   . ALA B 1 114 ? -7.469  -14.643 -7.812  1.00 20.34 ? 157  ALA B O   1 
ATOM   3552  C  CB  . ALA B 1 114 ? -7.252  -11.781 -9.095  1.00 16.52 ? 157  ALA B CB  1 
ATOM   3553  N  N   . ALA B 1 115 ? -5.427  -14.497 -8.726  1.00 20.29 ? 158  ALA B N   1 
ATOM   3554  C  CA  . ALA B 1 115 ? -5.365  -15.892 -9.014  1.00 20.42 ? 158  ALA B CA  1 
ATOM   3555  C  C   . ALA B 1 115 ? -5.457  -16.761 -7.753  1.00 21.02 ? 158  ALA B C   1 
ATOM   3556  O  O   . ALA B 1 115 ? -6.419  -17.504 -7.590  1.00 22.69 ? 158  ALA B O   1 
ATOM   3557  C  CB  . ALA B 1 115 ? -4.061  -16.212 -9.738  1.00 21.64 ? 158  ALA B CB  1 
ATOM   3558  N  N   . ALA B 1 116 ? -4.464  -16.671 -6.892  1.00 20.57 ? 159  ALA B N   1 
ATOM   3559  C  CA  . ALA B 1 116 ? -4.358  -17.592 -5.786  1.00 19.70 ? 159  ALA B CA  1 
ATOM   3560  C  C   . ALA B 1 116 ? -5.500  -17.406 -4.817  1.00 18.53 ? 159  ALA B C   1 
ATOM   3561  O  O   . ALA B 1 116 ? -5.761  -18.265 -3.967  1.00 18.47 ? 159  ALA B O   1 
ATOM   3562  C  CB  . ALA B 1 116 ? -3.024  -17.410 -5.083  1.00 21.50 ? 159  ALA B CB  1 
ATOM   3563  N  N   . VAL B 1 117 ? -6.162  -16.267 -4.943  1.00 17.74 ? 160  VAL B N   1 
ATOM   3564  C  CA  . VAL B 1 117 ? -7.292  -15.974 -4.065  1.00 17.11 ? 160  VAL B CA  1 
ATOM   3565  C  C   . VAL B 1 117 ? -8.489  -16.768 -4.582  1.00 17.47 ? 160  VAL B C   1 
ATOM   3566  O  O   . VAL B 1 117 ? -9.188  -17.427 -3.820  1.00 17.19 ? 160  VAL B O   1 
ATOM   3567  C  CB  . VAL B 1 117 ? -7.690  -14.480 -4.102  1.00 17.61 ? 160  VAL B CB  1 
ATOM   3568  C  CG1 . VAL B 1 117 ? -9.088  -14.306 -3.545  1.00 15.74 ? 160  VAL B CG1 1 
ATOM   3569  C  CG2 . VAL B 1 117 ? -6.692  -13.637 -3.323  1.00 16.95 ? 160  VAL B CG2 1 
ATOM   3570  N  N   . ARG B 1 118 ? -8.722  -16.703 -5.889  1.00 17.35 ? 161  ARG B N   1 
ATOM   3571  C  CA  . ARG B 1 118 ? -9.845  -17.410 -6.468  1.00 17.54 ? 161  ARG B CA  1 
ATOM   3572  C  C   . ARG B 1 118 ? -9.507  -18.869 -6.816  1.00 17.70 ? 161  ARG B C   1 
ATOM   3573  O  O   . ARG B 1 118 ? -10.407 -19.702 -7.057  1.00 17.25 ? 161  ARG B O   1 
ATOM   3574  C  CB  . ARG B 1 118 ? -10.381 -16.616 -7.665  1.00 15.24 ? 161  ARG B CB  1 
ATOM   3575  C  CG  . ARG B 1 118 ? -10.856 -15.226 -7.249  1.00 11.85 ? 161  ARG B CG  1 
ATOM   3576  C  CD  . ARG B 1 118 ? -12.058 -14.786 -8.051  1.00 12.29 ? 161  ARG B CD  1 
ATOM   3577  N  NE  . ARG B 1 118 ? -12.752 -13.597 -7.539  1.00 9.45  ? 161  ARG B NE  1 
ATOM   3578  C  CZ  . ARG B 1 118 ? -12.971 -13.330 -6.251  1.00 9.09  ? 161  ARG B CZ  1 
ATOM   3579  N  NH1 . ARG B 1 118 ? -12.535 -14.146 -5.295  1.00 8.50  ? 161  ARG B NH1 1 
ATOM   3580  N  NH2 . ARG B 1 118 ? -13.697 -12.276 -5.915  1.00 5.96  ? 161  ARG B NH2 1 
ATOM   3581  N  N   . GLY B 1 119 ? -8.211  -19.176 -6.816  1.00 16.63 ? 162  GLY B N   1 
ATOM   3582  C  CA  . GLY B 1 119 ? -7.762  -20.540 -7.073  1.00 17.27 ? 162  GLY B CA  1 
ATOM   3583  C  C   . GLY B 1 119 ? -7.306  -20.969 -8.462  1.00 16.94 ? 162  GLY B C   1 
ATOM   3584  O  O   . GLY B 1 119 ? -7.228  -22.169 -8.744  1.00 16.87 ? 162  GLY B O   1 
ATOM   3585  N  N   . TYR B 1 120 ? -6.995  -20.005 -9.323  1.00 15.41 ? 163  TYR B N   1 
ATOM   3586  C  CA  . TYR B 1 120 ? -6.563  -20.299 -10.679 1.00 14.04 ? 163  TYR B CA  1 
ATOM   3587  C  C   . TYR B 1 120 ? -5.069  -20.542 -10.719 1.00 14.68 ? 163  TYR B C   1 
ATOM   3588  O  O   . TYR B 1 120 ? -4.327  -19.914 -9.971  1.00 15.94 ? 163  TYR B O   1 
ATOM   3589  C  CB  . TYR B 1 120 ? -6.891  -19.118 -11.586 1.00 12.06 ? 163  TYR B CB  1 
ATOM   3590  C  CG  . TYR B 1 120 ? -8.355  -18.794 -11.679 1.00 8.23  ? 163  TYR B CG  1 
ATOM   3591  C  CD1 . TYR B 1 120 ? -8.799  -17.480 -11.636 1.00 9.40  ? 163  TYR B CD1 1 
ATOM   3592  C  CD2 . TYR B 1 120 ? -9.294  -19.789 -11.847 1.00 7.43  ? 163  TYR B CD2 1 
ATOM   3593  C  CE1 . TYR B 1 120 ? -10.147 -17.167 -11.759 1.00 8.68  ? 163  TYR B CE1 1 
ATOM   3594  C  CE2 . TYR B 1 120 ? -10.646 -19.490 -11.970 1.00 7.23  ? 163  TYR B CE2 1 
ATOM   3595  C  CZ  . TYR B 1 120 ? -11.066 -18.183 -11.926 1.00 7.54  ? 163  TYR B CZ  1 
ATOM   3596  O  OH  . TYR B 1 120 ? -12.404 -17.899 -12.051 1.00 6.64  ? 163  TYR B OH  1 
ATOM   3597  N  N   . ARG B 1 121 ? -4.615  -21.453 -11.574 1.00 15.22 ? 164  ARG B N   1 
ATOM   3598  C  CA  . ARG B 1 121 ? -3.176  -21.676 -11.681 1.00 15.86 ? 164  ARG B CA  1 
ATOM   3599  C  C   . ARG B 1 121 ? -2.676  -20.460 -12.429 1.00 15.23 ? 164  ARG B C   1 
ATOM   3600  O  O   . ARG B 1 121 ? -3.380  -19.939 -13.284 1.00 15.09 ? 164  ARG B O   1 
ATOM   3601  C  CB  . ARG B 1 121 ? -2.846  -22.933 -12.489 1.00 16.96 ? 164  ARG B CB  1 
ATOM   3602  C  CG  . ARG B 1 121 ? -1.838  -23.845 -11.793 1.00 19.35 ? 164  ARG B CG  1 
ATOM   3603  C  CD  . ARG B 1 121 ? -1.233  -24.883 -12.726 1.00 19.44 ? 164  ARG B CD  1 
ATOM   3604  N  NE  . ARG B 1 121 ? -0.219  -24.319 -13.614 1.00 22.47 ? 164  ARG B NE  1 
ATOM   3605  C  CZ  . ARG B 1 121 ? 0.549   -25.054 -14.418 1.00 23.99 ? 164  ARG B CZ  1 
ATOM   3606  N  NH1 . ARG B 1 121 ? 0.403   -26.372 -14.429 1.00 23.89 ? 164  ARG B NH1 1 
ATOM   3607  N  NH2 . ARG B 1 121 ? 1.462   -24.484 -15.204 1.00 20.86 ? 164  ARG B NH2 1 
ATOM   3608  N  N   . CYS B 1 122 ? -1.479  -19.990 -12.117 1.00 14.67 ? 165  CYS B N   1 
ATOM   3609  C  CA  . CYS B 1 122 ? -0.983  -18.822 -12.813 1.00 14.58 ? 165  CYS B CA  1 
ATOM   3610  C  C   . CYS B 1 122 ? 0.402   -19.032 -13.372 1.00 15.86 ? 165  CYS B C   1 
ATOM   3611  O  O   . CYS B 1 122 ? 1.285   -19.540 -12.690 1.00 17.23 ? 165  CYS B O   1 
ATOM   3612  C  CB  . CYS B 1 122 ? -0.973  -17.621 -11.883 1.00 15.62 ? 165  CYS B CB  1 
ATOM   3613  S  SG  . CYS B 1 122 ? -0.993  -16.062 -12.759 1.00 15.38 ? 165  CYS B SG  1 
ATOM   3614  N  N   . ILE B 1 123 ? 0.589   -18.632 -14.622 1.00 15.90 ? 166  ILE B N   1 
ATOM   3615  C  CA  . ILE B 1 123 ? 1.874   -18.769 -15.292 1.00 17.38 ? 166  ILE B CA  1 
ATOM   3616  C  C   . ILE B 1 123 ? 2.185   -17.426 -15.952 1.00 19.89 ? 166  ILE B C   1 
ATOM   3617  O  O   . ILE B 1 123 ? 1.431   -16.951 -16.809 1.00 20.56 ? 166  ILE B O   1 
ATOM   3618  C  CB  . ILE B 1 123 ? 1.810   -19.892 -16.370 1.00 18.01 ? 166  ILE B CB  1 
ATOM   3619  C  CG1 . ILE B 1 123 ? 1.388   -21.218 -15.711 1.00 18.27 ? 166  ILE B CG1 1 
ATOM   3620  C  CG2 . ILE B 1 123 ? 3.161   -20.003 -17.115 1.00 15.39 ? 166  ILE B CG2 1 
ATOM   3621  C  CD1 . ILE B 1 123 ? 1.000   -22.293 -16.688 1.00 16.61 ? 166  ILE B CD1 1 
ATOM   3622  N  N   . ILE B 1 124 ? 3.269   -16.788 -15.531 1.00 21.46 ? 167  ILE B N   1 
ATOM   3623  C  CA  . ILE B 1 124 ? 3.624   -15.508 -16.129 1.00 23.89 ? 167  ILE B CA  1 
ATOM   3624  C  C   . ILE B 1 124 ? 4.885   -15.691 -16.956 1.00 25.98 ? 167  ILE B C   1 
ATOM   3625  O  O   . ILE B 1 124 ? 5.950   -16.006 -16.431 1.00 25.88 ? 167  ILE B O   1 
ATOM   3626  C  CB  . ILE B 1 124 ? 3.816   -14.399 -15.064 1.00 22.37 ? 167  ILE B CB  1 
ATOM   3627  C  CG1 . ILE B 1 124 ? 2.459   -13.836 -14.640 1.00 21.65 ? 167  ILE B CG1 1 
ATOM   3628  C  CG2 . ILE B 1 124 ? 4.723   -13.310 -15.613 1.00 22.51 ? 167  ILE B CG2 1 
ATOM   3629  C  CD1 . ILE B 1 124 ? 1.793   -14.642 -13.548 1.00 18.95 ? 167  ILE B CD1 1 
ATOM   3630  N  N   . VAL B 1 125 ? 4.738   -15.484 -18.263 1.00 28.85 ? 168  VAL B N   1 
ATOM   3631  C  CA  . VAL B 1 125 ? 5.844   -15.642 -19.202 1.00 32.01 ? 168  VAL B CA  1 
ATOM   3632  C  C   . VAL B 1 125 ? 6.717   -14.390 -19.220 1.00 33.48 ? 168  VAL B C   1 
ATOM   3633  O  O   . VAL B 1 125 ? 6.273   -13.309 -19.594 1.00 34.15 ? 168  VAL B O   1 
ATOM   3634  C  CB  . VAL B 1 125 ? 5.327   -15.944 -20.620 1.00 31.68 ? 168  VAL B CB  1 
ATOM   3635  C  CG1 . VAL B 1 125 ? 6.486   -16.272 -21.546 1.00 32.04 ? 168  VAL B CG1 1 
ATOM   3636  C  CG2 . VAL B 1 125 ? 4.322   -17.087 -20.602 1.00 30.49 ? 168  VAL B CG2 1 
ATOM   3637  N  N   . MET B 1 126 ? 7.958   -14.575 -18.797 1.00 35.01 ? 169  MET B N   1 
ATOM   3638  C  CA  . MET B 1 126 ? 8.927   -13.497 -18.736 1.00 36.35 ? 169  MET B CA  1 
ATOM   3639  C  C   . MET B 1 126 ? 10.342  -13.894 -19.218 1.00 36.17 ? 169  MET B C   1 
ATOM   3640  O  O   . MET B 1 126 ? 10.917  -14.896 -18.796 1.00 35.21 ? 169  MET B O   1 
ATOM   3641  C  CB  . MET B 1 126 ? 9.007   -12.965 -17.311 1.00 37.92 ? 169  MET B CB  1 
ATOM   3642  C  CG  . MET B 1 126 ? 9.793   -13.870 -16.377 1.00 38.38 ? 169  MET B CG  1 
ATOM   3643  S  SD  . MET B 1 126 ? 10.564  -12.961 -15.015 1.00 36.52 ? 169  MET B SD  1 
ATOM   3644  C  CE  . MET B 1 126 ? 9.206   -12.868 -13.858 1.00 35.45 ? 169  MET B CE  1 
ATOM   3645  N  N   . PRO B 1 127 ? 10.840  -13.066 -20.140 1.00 37.74 ? 170  PRO B N   1 
ATOM   3646  C  CA  . PRO B 1 127 ? 12.250  -13.163 -20.612 1.00 39.86 ? 170  PRO B CA  1 
ATOM   3647  C  C   . PRO B 1 127 ? 13.356  -13.012 -19.604 1.00 42.54 ? 170  PRO B C   1 
ATOM   3648  O  O   . PRO B 1 127 ? 13.157  -12.450 -18.531 1.00 43.68 ? 170  PRO B O   1 
ATOM   3649  C  CB  . PRO B 1 127 ? 12.287  -12.193 -21.780 1.00 38.74 ? 170  PRO B CB  1 
ATOM   3650  C  CG  . PRO B 1 127 ? 10.975  -12.403 -22.407 1.00 38.13 ? 170  PRO B CG  1 
ATOM   3651  C  CD  . PRO B 1 127 ? 10.031  -12.946 -21.371 1.00 37.72 ? 170  PRO B CD  1 
ATOM   3652  N  N   . GLU B 1 128 ? 14.545  -13.460 -19.993 1.00 44.33 ? 171  GLU B N   1 
ATOM   3653  C  CA  . GLU B 1 128 ? 15.656  -13.224 -19.065 1.00 45.96 ? 171  GLU B CA  1 
ATOM   3654  C  C   . GLU B 1 128 ? 15.981  -11.748 -18.937 1.00 47.79 ? 171  GLU B C   1 
ATOM   3655  O  O   . GLU B 1 128 ? 16.610  -11.100 -19.779 1.00 48.89 ? 171  GLU B O   1 
ATOM   3656  C  CB  . GLU B 1 128 ? 16.881  -14.110 -19.374 1.00 44.76 ? 171  GLU B CB  1 
ATOM   3657  C  CG  . GLU B 1 128 ? 17.536  -14.039 -20.756 1.00 44.23 ? 171  GLU B CG  1 
ATOM   3658  C  CD  . GLU B 1 128 ? 18.909  -14.728 -20.858 1.00 43.37 ? 171  GLU B CD  1 
ATOM   3659  O  OE1 . GLU B 1 128 ? 18.959  -15.876 -21.343 1.00 43.89 ? 171  GLU B OE1 1 
ATOM   3660  O  OE2 . GLU B 1 128 ? 19.924  -14.100 -20.458 1.00 42.44 ? 171  GLU B OE2 1 
ATOM   3661  N  N   . LYS B 1 129 ? 15.446  -11.280 -17.784 1.00 48.92 ? 172  LYS B N   1 
ATOM   3662  C  CA  . LYS B 1 129 ? 15.578  -9.971  -17.028 1.00 49.07 ? 172  LYS B CA  1 
ATOM   3663  C  C   . LYS B 1 129 ? 14.530  -8.805  -17.180 1.00 49.20 ? 172  LYS B C   1 
ATOM   3664  O  O   . LYS B 1 129 ? 13.892  -8.538  -18.204 1.00 49.25 ? 172  LYS B O   1 
ATOM   3665  C  CB  . LYS B 1 129 ? 17.065  -9.604  -17.122 1.00 48.50 ? 172  LYS B CB  1 
ATOM   3666  C  CG  . LYS B 1 129 ? 17.980  -10.658 -16.490 1.00 47.72 ? 172  LYS B CG  1 
ATOM   3667  C  CD  . LYS B 1 129 ? 18.257  -10.401 -15.026 1.00 47.06 ? 172  LYS B CD  1 
ATOM   3668  C  CE  . LYS B 1 129 ? 19.552  -11.097 -14.655 1.00 46.56 ? 172  LYS B CE  1 
ATOM   3669  N  NZ  . LYS B 1 129 ? 20.286  -11.568 -15.857 1.00 45.20 ? 172  LYS B NZ  1 
ATOM   3670  N  N   . MET B 1 130 ? 14.513  -8.195  -15.993 1.00 48.83 ? 173  MET B N   1 
ATOM   3671  C  CA  . MET B 1 130 ? 13.521  -7.447  -15.202 1.00 48.31 ? 173  MET B CA  1 
ATOM   3672  C  C   . MET B 1 130 ? 13.460  -7.591  -13.676 1.00 48.19 ? 173  MET B C   1 
ATOM   3673  O  O   . MET B 1 130 ? 12.680  -8.398  -13.159 1.00 47.68 ? 173  MET B O   1 
ATOM   3674  C  CB  . MET B 1 130 ? 12.133  -7.764  -15.769 1.00 48.29 ? 173  MET B CB  1 
ATOM   3675  C  CG  . MET B 1 130 ? 11.779  -6.951  -17.018 1.00 48.20 ? 173  MET B CG  1 
ATOM   3676  S  SD  . MET B 1 130 ? 11.645  -5.190  -16.666 1.00 48.54 ? 173  MET B SD  1 
ATOM   3677  C  CE  . MET B 1 130 ? 10.052  -5.139  -15.859 1.00 47.36 ? 173  MET B CE  1 
ATOM   3678  N  N   . SER B 1 131 ? 14.252  -6.822  -12.975 1.00 47.85 ? 174  SER B N   1 
ATOM   3679  C  CA  . SER B 1 131 ? 14.312  -6.706  -11.497 1.00 47.49 ? 174  SER B CA  1 
ATOM   3680  C  C   . SER B 1 131 ? 13.778  -7.831  -10.623 1.00 48.48 ? 174  SER B C   1 
ATOM   3681  O  O   . SER B 1 131 ? 12.724  -8.415  -10.894 1.00 48.94 ? 174  SER B O   1 
ATOM   3682  C  CB  . SER B 1 131 ? 13.630  -5.389  -11.106 1.00 46.87 ? 174  SER B CB  1 
ATOM   3683  O  OG  . SER B 1 131 ? 12.316  -5.607  -10.628 1.00 45.49 ? 174  SER B OG  1 
ATOM   3684  N  N   . SER B 1 132 ? 14.535  -8.126  -9.540  1.00 48.31 ? 175  SER B N   1 
ATOM   3685  C  CA  . SER B 1 132 ? 14.143  -9.174  -8.616  1.00 46.96 ? 175  SER B CA  1 
ATOM   3686  C  C   . SER B 1 132 ? 12.953  -8.781  -7.757  1.00 46.12 ? 175  SER B C   1 
ATOM   3687  O  O   . SER B 1 132 ? 12.085  -9.609  -7.466  1.00 46.30 ? 175  SER B O   1 
ATOM   3688  C  CB  . SER B 1 132 ? 15.323  -9.552  -7.711  1.00 47.59 ? 175  SER B CB  1 
ATOM   3689  O  OG  . SER B 1 132 ? 15.015  -10.677 -6.897  1.00 48.69 ? 175  SER B OG  1 
ATOM   3690  N  N   . GLU B 1 133 ? 12.901  -7.522  -7.347  1.00 44.84 ? 176  GLU B N   1 
ATOM   3691  C  CA  . GLU B 1 133 ? 11.803  -7.110  -6.497  1.00 43.10 ? 176  GLU B CA  1 
ATOM   3692  C  C   . GLU B 1 133 ? 10.452  -7.440  -7.104  1.00 40.97 ? 176  GLU B C   1 
ATOM   3693  O  O   . GLU B 1 133 ? 9.442   -7.311  -6.427  1.00 41.99 ? 176  GLU B O   1 
ATOM   3694  C  CB  . GLU B 1 133 ? 11.904  -5.619  -6.139  1.00 44.28 ? 176  GLU B CB  1 
ATOM   3695  C  CG  . GLU B 1 133 ? 12.497  -5.347  -4.734  1.00 45.67 ? 176  GLU B CG  1 
ATOM   3696  C  CD  . GLU B 1 133 ? 13.692  -6.238  -4.367  1.00 46.04 ? 176  GLU B CD  1 
ATOM   3697  O  OE1 . GLU B 1 133 ? 14.642  -6.332  -5.167  1.00 44.82 ? 176  GLU B OE1 1 
ATOM   3698  O  OE2 . GLU B 1 133 ? 13.685  -6.838  -3.267  1.00 46.17 ? 176  GLU B OE2 1 
ATOM   3699  N  N   . LYS B 1 134 ? 10.421  -7.854  -8.369  1.00 38.55 ? 177  LYS B N   1 
ATOM   3700  C  CA  . LYS B 1 134 ? 9.152   -8.231  -8.990  1.00 35.82 ? 177  LYS B CA  1 
ATOM   3701  C  C   . LYS B 1 134 ? 9.003   -9.758  -8.992  1.00 33.08 ? 177  LYS B C   1 
ATOM   3702  O  O   . LYS B 1 134 ? 7.983   -10.281 -8.546  1.00 32.21 ? 177  LYS B O   1 
ATOM   3703  C  CB  . LYS B 1 134 ? 9.059   -7.698  -10.425 1.00 36.43 ? 177  LYS B CB  1 
ATOM   3704  C  CG  . LYS B 1 134 ? 8.849   -6.189  -10.556 1.00 35.53 ? 177  LYS B CG  1 
ATOM   3705  C  CD  . LYS B 1 134 ? 8.627   -5.808  -12.023 1.00 34.73 ? 177  LYS B CD  1 
ATOM   3706  C  CE  . LYS B 1 134 ? 8.795   -4.310  -12.276 1.00 35.11 ? 177  LYS B CE  1 
ATOM   3707  N  NZ  . LYS B 1 134 ? 10.230  -3.882  -12.157 1.00 32.72 ? 177  LYS B NZ  1 
ATOM   3708  N  N   . VAL B 1 135 ? 10.020  -10.464 -9.495  1.00 29.65 ? 178  VAL B N   1 
ATOM   3709  C  CA  . VAL B 1 135 ? 9.997   -11.927 -9.549  1.00 26.01 ? 178  VAL B CA  1 
ATOM   3710  C  C   . VAL B 1 135 ? 9.627   -12.457 -8.182  1.00 24.68 ? 178  VAL B C   1 
ATOM   3711  O  O   . VAL B 1 135 ? 8.644   -13.170 -8.036  1.00 23.70 ? 178  VAL B O   1 
ATOM   3712  C  CB  . VAL B 1 135 ? 11.375  -12.537 -9.937  1.00 24.70 ? 178  VAL B CB  1 
ATOM   3713  C  CG1 . VAL B 1 135 ? 11.288  -14.060 -9.985  1.00 22.61 ? 178  VAL B CG1 1 
ATOM   3714  C  CG2 . VAL B 1 135 ? 11.817  -12.021 -11.275 1.00 21.41 ? 178  VAL B CG2 1 
ATOM   3715  N  N   . ASP B 1 136 ? 10.421  -12.105 -7.181  1.00 23.81 ? 179  ASP B N   1 
ATOM   3716  C  CA  . ASP B 1 136 ? 10.145  -12.544 -5.823  1.00 22.62 ? 179  ASP B CA  1 
ATOM   3717  C  C   . ASP B 1 136 ? 8.682   -12.251 -5.466  1.00 22.30 ? 179  ASP B C   1 
ATOM   3718  O  O   . ASP B 1 136 ? 8.087   -12.949 -4.646  1.00 21.88 ? 179  ASP B O   1 
ATOM   3719  C  CB  . ASP B 1 136 ? 11.084  -11.842 -4.832  1.00 20.84 ? 179  ASP B CB  1 
ATOM   3720  C  CG  . ASP B 1 136 ? 12.508  -12.376 -4.885  1.00 18.59 ? 179  ASP B CG  1 
ATOM   3721  O  OD1 . ASP B 1 136 ? 12.733  -13.557 -4.553  1.00 18.33 ? 179  ASP B OD1 1 
ATOM   3722  O  OD2 . ASP B 1 136 ? 13.410  -11.605 -5.252  1.00 15.52 ? 179  ASP B OD2 1 
ATOM   3723  N  N   . VAL B 1 137 ? 8.097   -11.232 -6.087  1.00 21.93 ? 180  VAL B N   1 
ATOM   3724  C  CA  . VAL B 1 137 ? 6.702   -10.901 -5.812  1.00 23.49 ? 180  VAL B CA  1 
ATOM   3725  C  C   . VAL B 1 137 ? 5.745   -11.905 -6.453  1.00 23.52 ? 180  VAL B C   1 
ATOM   3726  O  O   . VAL B 1 137 ? 4.624   -12.093 -5.987  1.00 22.98 ? 180  VAL B O   1 
ATOM   3727  C  CB  . VAL B 1 137 ? 6.324   -9.514  -6.346  1.00 24.67 ? 180  VAL B CB  1 
ATOM   3728  C  CG1 . VAL B 1 137 ? 4.880   -9.222  -6.025  1.00 25.21 ? 180  VAL B CG1 1 
ATOM   3729  C  CG2 . VAL B 1 137 ? 7.172   -8.465  -5.712  1.00 26.27 ? 180  VAL B CG2 1 
ATOM   3730  N  N   . LEU B 1 138 ? 6.203   -12.550 -7.521  1.00 24.00 ? 181  LEU B N   1 
ATOM   3731  C  CA  . LEU B 1 138 ? 5.401   -13.528 -8.251  1.00 23.81 ? 181  LEU B CA  1 
ATOM   3732  C  C   . LEU B 1 138 ? 5.388   -14.918 -7.606  1.00 24.26 ? 181  LEU B C   1 
ATOM   3733  O  O   . LEU B 1 138 ? 4.324   -15.425 -7.264  1.00 25.43 ? 181  LEU B O   1 
ATOM   3734  C  CB  . LEU B 1 138 ? 5.912   -13.607 -9.678  1.00 23.75 ? 181  LEU B CB  1 
ATOM   3735  C  CG  . LEU B 1 138 ? 5.976   -12.226 -10.325 1.00 22.89 ? 181  LEU B CG  1 
ATOM   3736  C  CD1 . LEU B 1 138 ? 6.873   -12.276 -11.532 1.00 23.38 ? 181  LEU B CD1 1 
ATOM   3737  C  CD2 . LEU B 1 138 ? 4.582   -11.763 -10.678 1.00 22.05 ? 181  LEU B CD2 1 
ATOM   3738  N  N   . ARG B 1 139 ? 6.555   -15.533 -7.430  1.00 24.32 ? 182  ARG B N   1 
ATOM   3739  C  CA  . ARG B 1 139 ? 6.618   -16.851 -6.796  1.00 24.29 ? 182  ARG B CA  1 
ATOM   3740  C  C   . ARG B 1 139 ? 5.893   -16.834 -5.449  1.00 24.28 ? 182  ARG B C   1 
ATOM   3741  O  O   . ARG B 1 139 ? 5.113   -17.730 -5.136  1.00 25.22 ? 182  ARG B O   1 
ATOM   3742  C  CB  . ARG B 1 139 ? 8.067   -17.279 -6.551  1.00 23.49 ? 182  ARG B CB  1 
ATOM   3743  C  CG  . ARG B 1 139 ? 9.069   -16.775 -7.555  1.00 24.24 ? 182  ARG B CG  1 
ATOM   3744  C  CD  . ARG B 1 139 ? 10.347  -17.608 -7.484  1.00 26.83 ? 182  ARG B CD  1 
ATOM   3745  N  NE  . ARG B 1 139 ? 10.357  -18.693 -8.473  1.00 31.47 ? 182  ARG B NE  1 
ATOM   3746  C  CZ  . ARG B 1 139 ? 11.192  -18.757 -9.512  1.00 33.47 ? 182  ARG B CZ  1 
ATOM   3747  N  NH1 . ARG B 1 139 ? 12.095  -17.801 -9.701  1.00 33.70 ? 182  ARG B NH1 1 
ATOM   3748  N  NH2 . ARG B 1 139 ? 11.121  -19.768 -10.370 1.00 31.22 ? 182  ARG B NH2 1 
ATOM   3749  N  N   . ALA B 1 140 ? 6.164   -15.812 -4.646  1.00 24.51 ? 183  ALA B N   1 
ATOM   3750  C  CA  . ALA B 1 140 ? 5.551   -15.693 -3.334  1.00 22.99 ? 183  ALA B CA  1 
ATOM   3751  C  C   . ALA B 1 140 ? 4.050   -15.755 -3.464  1.00 21.71 ? 183  ALA B C   1 
ATOM   3752  O  O   . ALA B 1 140 ? 3.380   -16.377 -2.644  1.00 20.68 ? 183  ALA B O   1 
ATOM   3753  C  CB  . ALA B 1 140 ? 5.946   -14.387 -2.695  1.00 23.19 ? 183  ALA B CB  1 
ATOM   3754  N  N   . LEU B 1 141 ? 3.532   -15.109 -4.506  1.00 21.36 ? 184  LEU B N   1 
ATOM   3755  C  CA  . LEU B 1 141 ? 2.098   -15.060 -4.746  1.00 20.71 ? 184  LEU B CA  1 
ATOM   3756  C  C   . LEU B 1 141 ? 1.587   -16.295 -5.477  1.00 20.74 ? 184  LEU B C   1 
ATOM   3757  O  O   . LEU B 1 141 ? 0.447   -16.333 -5.937  1.00 22.21 ? 184  LEU B O   1 
ATOM   3758  C  CB  . LEU B 1 141 ? 1.745   -13.796 -5.526  1.00 19.85 ? 184  LEU B CB  1 
ATOM   3759  C  CG  . LEU B 1 141 ? 0.710   -12.913 -4.826  1.00 21.59 ? 184  LEU B CG  1 
ATOM   3760  C  CD1 . LEU B 1 141 ? 0.806   -11.498 -5.309  1.00 22.42 ? 184  LEU B CD1 1 
ATOM   3761  C  CD2 . LEU B 1 141 ? -0.677  -13.458 -5.082  1.00 23.41 ? 184  LEU B CD2 1 
ATOM   3762  N  N   . GLY B 1 142 ? 2.440   -17.307 -5.584  1.00 20.54 ? 185  GLY B N   1 
ATOM   3763  C  CA  . GLY B 1 142 ? 2.050   -18.552 -6.229  1.00 19.04 ? 185  GLY B CA  1 
ATOM   3764  C  C   . GLY B 1 142 ? 2.180   -18.686 -7.740  1.00 18.07 ? 185  GLY B C   1 
ATOM   3765  O  O   . GLY B 1 142 ? 1.933   -19.768 -8.273  1.00 18.82 ? 185  GLY B O   1 
ATOM   3766  N  N   . ALA B 1 143 ? 2.571   -17.621 -8.435  1.00 17.43 ? 186  ALA B N   1 
ATOM   3767  C  CA  . ALA B 1 143 ? 2.691   -17.664 -9.886  1.00 17.25 ? 186  ALA B CA  1 
ATOM   3768  C  C   . ALA B 1 143 ? 3.864   -18.503 -10.341 1.00 17.86 ? 186  ALA B C   1 
ATOM   3769  O  O   . ALA B 1 143 ? 4.763   -18.814 -9.562  1.00 16.96 ? 186  ALA B O   1 
ATOM   3770  C  CB  . ALA B 1 143 ? 2.804   -16.249 -10.454 1.00 16.78 ? 186  ALA B CB  1 
ATOM   3771  N  N   . GLU B 1 144 ? 3.835   -18.878 -11.615 1.00 18.74 ? 187  GLU B N   1 
ATOM   3772  C  CA  . GLU B 1 144 ? 4.894   -19.688 -12.204 1.00 19.40 ? 187  GLU B CA  1 
ATOM   3773  C  C   . GLU B 1 144 ? 5.496   -18.887 -13.327 1.00 19.41 ? 187  GLU B C   1 
ATOM   3774  O  O   . GLU B 1 144 ? 4.783   -18.414 -14.210 1.00 18.25 ? 187  GLU B O   1 
ATOM   3775  C  CB  . GLU B 1 144 ? 4.342   -21.007 -12.763 1.00 18.66 ? 187  GLU B CB  1 
ATOM   3776  C  CG  . GLU B 1 144 ? 3.548   -21.863 -11.776 1.00 15.98 ? 187  GLU B CG  1 
ATOM   3777  C  CD  . GLU B 1 144 ? 3.302   -23.265 -12.301 1.00 15.02 ? 187  GLU B CD  1 
ATOM   3778  O  OE1 . GLU B 1 144 ? 2.320   -23.904 -11.894 1.00 15.20 ? 187  GLU B OE1 1 
ATOM   3779  O  OE2 . GLU B 1 144 ? 4.100   -23.741 -13.121 1.00 14.22 ? 187  GLU B OE2 1 
ATOM   3780  N  N   . ILE B 1 145 ? 6.808   -18.721 -13.296 1.00 21.72 ? 188  ILE B N   1 
ATOM   3781  C  CA  . ILE B 1 145 ? 7.453   -17.946 -14.339 1.00 25.24 ? 188  ILE B CA  1 
ATOM   3782  C  C   . ILE B 1 145 ? 8.272   -18.806 -15.276 1.00 26.86 ? 188  ILE B C   1 
ATOM   3783  O  O   . ILE B 1 145 ? 9.103   -19.604 -14.842 1.00 26.01 ? 188  ILE B O   1 
ATOM   3784  C  CB  . ILE B 1 145 ? 8.374   -16.818 -13.759 1.00 24.80 ? 188  ILE B CB  1 
ATOM   3785  C  CG1 . ILE B 1 145 ? 9.392   -17.393 -12.756 1.00 26.11 ? 188  ILE B CG1 1 
ATOM   3786  C  CG2 . ILE B 1 145 ? 7.508   -15.725 -13.121 1.00 24.94 ? 188  ILE B CG2 1 
ATOM   3787  C  CD1 . ILE B 1 145 ? 8.831   -17.659 -11.354 1.00 24.82 ? 188  ILE B CD1 1 
ATOM   3788  N  N   . VAL B 1 146 ? 8.025   -18.628 -16.569 1.00 29.52 ? 189  VAL B N   1 
ATOM   3789  C  CA  . VAL B 1 146 ? 8.731   -19.359 -17.605 1.00 30.70 ? 189  VAL B CA  1 
ATOM   3790  C  C   . VAL B 1 146 ? 9.884   -18.556 -18.198 1.00 31.01 ? 189  VAL B C   1 
ATOM   3791  O  O   . VAL B 1 146 ? 9.727   -17.401 -18.592 1.00 31.84 ? 189  VAL B O   1 
ATOM   3792  C  CB  . VAL B 1 146 ? 7.764   -19.719 -18.715 1.00 31.07 ? 189  VAL B CB  1 
ATOM   3793  C  CG1 . VAL B 1 146 ? 8.462   -20.539 -19.772 1.00 32.75 ? 189  VAL B CG1 1 
ATOM   3794  C  CG2 . VAL B 1 146 ? 6.568   -20.455 -18.124 1.00 31.49 ? 189  VAL B CG2 1 
ATOM   3795  N  N   . ARG B 1 147 ? 11.053  -19.178 -18.236 1.00 32.15 ? 190  ARG B N   1 
ATOM   3796  C  CA  . ARG B 1 147 ? 12.235  -18.541 -18.787 1.00 33.57 ? 190  ARG B CA  1 
ATOM   3797  C  C   . ARG B 1 147 ? 12.165  -18.432 -20.315 1.00 33.98 ? 190  ARG B C   1 
ATOM   3798  O  O   . ARG B 1 147 ? 12.782  -19.197 -21.043 1.00 33.65 ? 190  ARG B O   1 
ATOM   3799  C  CB  . ARG B 1 147 ? 13.472  -19.325 -18.335 1.00 33.51 ? 190  ARG B CB  1 
ATOM   3800  C  CG  . ARG B 1 147 ? 13.557  -19.525 -16.804 1.00 33.25 ? 190  ARG B CG  1 
ATOM   3801  C  CD  . ARG B 1 147 ? 14.015  -18.281 -15.998 1.00 33.93 ? 190  ARG B CD  1 
ATOM   3802  N  NE  . ARG B 1 147 ? 13.106  -17.146 -16.106 1.00 33.35 ? 190  ARG B NE  1 
ATOM   3803  C  CZ  . ARG B 1 147 ? 13.184  -16.204 -17.040 1.00 33.87 ? 190  ARG B CZ  1 
ATOM   3804  N  NH1 . ARG B 1 147 ? 14.142  -16.238 -17.969 1.00 34.56 ? 190  ARG B NH1 1 
ATOM   3805  N  NH2 . ARG B 1 147 ? 12.286  -15.226 -17.044 1.00 33.79 ? 190  ARG B NH2 1 
ATOM   3806  N  N   . THR B 1 148 ? 11.368  -17.476 -20.777 1.00 35.45 ? 191  THR B N   1 
ATOM   3807  C  CA  . THR B 1 148 ? 11.179  -17.222 -22.196 1.00 37.87 ? 191  THR B CA  1 
ATOM   3808  C  C   . THR B 1 148 ? 12.474  -17.246 -23.012 1.00 40.36 ? 191  THR B C   1 
ATOM   3809  O  O   . THR B 1 148 ? 13.448  -16.506 -22.712 1.00 40.83 ? 191  THR B O   1 
ATOM   3810  C  CB  . THR B 1 148 ? 10.453  -15.865 -22.405 1.00 35.99 ? 191  THR B CB  1 
ATOM   3811  O  OG1 . THR B 1 148 ? 9.103   -16.126 -22.774 1.00 32.65 ? 191  THR B OG1 1 
ATOM   3812  C  CG2 . THR B 1 148 ? 11.098  -15.005 -23.489 1.00 35.12 ? 191  THR B CG2 1 
ATOM   3813  N  N   . PRO B 1 149 ? 12.520  -18.154 -24.013 1.00 43.70 ? 192  PRO B N   1 
ATOM   3814  C  CA  . PRO B 1 149 ? 13.667  -18.304 -24.918 1.00 45.44 ? 192  PRO B CA  1 
ATOM   3815  C  C   . PRO B 1 149 ? 13.889  -17.062 -25.819 1.00 45.44 ? 192  PRO B C   1 
ATOM   3816  O  O   . PRO B 1 149 ? 12.990  -16.219 -26.043 1.00 45.70 ? 192  PRO B O   1 
ATOM   3817  C  CB  . PRO B 1 149 ? 13.280  -19.495 -25.783 1.00 45.31 ? 192  PRO B CB  1 
ATOM   3818  C  CG  . PRO B 1 149 ? 12.537  -20.370 -24.891 1.00 46.35 ? 192  PRO B CG  1 
ATOM   3819  C  CD  . PRO B 1 149 ? 11.827  -19.456 -23.868 1.00 45.34 ? 192  PRO B CD  1 
ATOM   3820  N  N   . THR B 1 150 ? 15.091  -16.976 -26.363 1.00 46.10 ? 193  THR B N   1 
ATOM   3821  C  CA  . THR B 1 150 ? 15.418  -15.883 -27.249 1.00 44.69 ? 193  THR B CA  1 
ATOM   3822  C  C   . THR B 1 150 ? 14.531  -16.182 -28.436 1.00 44.18 ? 193  THR B C   1 
ATOM   3823  O  O   . THR B 1 150 ? 13.999  -15.294 -29.078 1.00 42.90 ? 193  THR B O   1 
ATOM   3824  C  CB  . THR B 1 150 ? 16.886  -15.931 -27.687 1.00 43.44 ? 193  THR B CB  1 
ATOM   3825  O  OG1 . THR B 1 150 ? 17.717  -16.310 -26.576 1.00 41.78 ? 193  THR B OG1 1 
ATOM   3826  C  CG2 . THR B 1 150 ? 17.292  -14.574 -28.184 1.00 41.45 ? 193  THR B CG2 1 
ATOM   3827  N  N   . SER B 1 159 ? 11.545  -15.798 -27.955 1.00 55.56 ? 202  SER B N   1 
ATOM   3828  C  CA  . SER B 1 159 ? 10.265  -15.536 -28.606 1.00 52.37 ? 202  SER B CA  1 
ATOM   3829  C  C   . SER B 1 159 ? 9.607   -14.235 -28.061 1.00 49.44 ? 202  SER B C   1 
ATOM   3830  O  O   . SER B 1 159 ? 9.825   -13.131 -28.533 1.00 48.05 ? 202  SER B O   1 
ATOM   3831  C  CB  . SER B 1 159 ? 9.323   -16.729 -28.418 1.00 52.95 ? 202  SER B CB  1 
ATOM   3832  O  OG  . SER B 1 159 ? 8.595   -17.003 -29.601 1.00 50.75 ? 202  SER B OG  1 
ATOM   3833  N  N   . HIS B 1 160 ? 8.811   -14.439 -26.987 1.00 46.94 ? 203  HIS B N   1 
ATOM   3834  C  CA  . HIS B 1 160 ? 8.022   -13.446 -26.199 1.00 45.14 ? 203  HIS B CA  1 
ATOM   3835  C  C   . HIS B 1 160 ? 6.674   -13.136 -26.799 1.00 43.80 ? 203  HIS B C   1 
ATOM   3836  O  O   . HIS B 1 160 ? 6.560   -12.335 -27.733 1.00 43.51 ? 203  HIS B O   1 
ATOM   3837  C  CB  . HIS B 1 160 ? 8.741   -12.092 -25.967 1.00 44.78 ? 203  HIS B CB  1 
ATOM   3838  C  CG  . HIS B 1 160 ? 8.984   -11.050 -27.115 1.00 44.00 ? 203  HIS B CG  1 
ATOM   3839  N  ND1 . HIS B 1 160 ? 10.212  -10.949 -27.710 1.00 44.04 ? 203  HIS B ND1 1 
ATOM   3840  C  CD2 . HIS B 1 160 ? 8.220   -10.092 -27.706 1.00 43.07 ? 203  HIS B CD2 1 
ATOM   3841  C  CE1 . HIS B 1 160 ? 10.207  -10.005 -28.626 1.00 43.51 ? 203  HIS B CE1 1 
ATOM   3842  N  NE2 . HIS B 1 160 ? 9.008   -9.462  -28.651 1.00 43.06 ? 203  HIS B NE2 1 
ATOM   3843  N  N   . VAL B 1 161 ? 5.664   -13.748 -26.268 1.00 41.63 ? 204  VAL B N   1 
ATOM   3844  C  CA  . VAL B 1 161 ? 4.341   -13.548 -26.795 1.00 39.63 ? 204  VAL B CA  1 
ATOM   3845  C  C   . VAL B 1 161 ? 4.151   -14.376 -28.044 1.00 38.37 ? 204  VAL B C   1 
ATOM   3846  O  O   . VAL B 1 161 ? 3.275   -14.113 -28.873 1.00 39.43 ? 204  VAL B O   1 
ATOM   3847  C  CB  . VAL B 1 161 ? 3.990   -12.074 -27.004 1.00 39.99 ? 204  VAL B CB  1 
ATOM   3848  C  CG1 . VAL B 1 161 ? 2.511   -11.834 -26.734 1.00 38.89 ? 204  VAL B CG1 1 
ATOM   3849  C  CG2 . VAL B 1 161 ? 4.832   -11.177 -26.120 1.00 39.82 ? 204  VAL B CG2 1 
ATOM   3850  N  N   . GLY B 1 162 ? 5.033   -15.361 -28.157 1.00 35.55 ? 205  GLY B N   1 
ATOM   3851  C  CA  . GLY B 1 162 ? 5.015   -16.396 -29.170 1.00 32.26 ? 205  GLY B CA  1 
ATOM   3852  C  C   . GLY B 1 162 ? 4.925   -17.673 -28.337 1.00 30.43 ? 205  GLY B C   1 
ATOM   3853  O  O   . GLY B 1 162 ? 4.125   -18.569 -28.624 1.00 30.57 ? 205  GLY B O   1 
ATOM   3854  N  N   . VAL B 1 163 ? 5.762   -17.697 -27.301 1.00 28.32 ? 206  VAL B N   1 
ATOM   3855  C  CA  . VAL B 1 163 ? 5.770   -18.798 -26.406 1.00 27.12 ? 206  VAL B CA  1 
ATOM   3856  C  C   . VAL B 1 163 ? 4.482   -18.739 -25.581 1.00 26.77 ? 206  VAL B C   1 
ATOM   3857  O  O   . VAL B 1 163 ? 4.151   -19.692 -24.869 1.00 26.20 ? 206  VAL B O   1 
ATOM   3858  C  CB  . VAL B 1 163 ? 7.013   -18.774 -25.512 1.00 26.93 ? 206  VAL B CB  1 
ATOM   3859  C  CG1 . VAL B 1 163 ? 6.955   -19.905 -24.501 1.00 25.91 ? 206  VAL B CG1 1 
ATOM   3860  C  CG2 . VAL B 1 163 ? 8.283   -18.852 -26.358 1.00 25.95 ? 206  VAL B CG2 1 
ATOM   3861  N  N   . ALA B 1 164 ? 3.750   -17.632 -25.667 1.00 26.34 ? 207  ALA B N   1 
ATOM   3862  C  CA  . ALA B 1 164 ? 2.515   -17.464 -24.898 1.00 27.61 ? 207  ALA B CA  1 
ATOM   3863  C  C   . ALA B 1 164 ? 1.272   -18.178 -25.464 1.00 28.85 ? 207  ALA B C   1 
ATOM   3864  O  O   . ALA B 1 164 ? 0.663   -19.010 -24.777 1.00 27.71 ? 207  ALA B O   1 
ATOM   3865  C  CB  . ALA B 1 164 ? 2.215   -15.970 -24.761 1.00 27.22 ? 207  ALA B CB  1 
ATOM   3866  N  N   . TRP B 1 165 ? 0.910   -17.859 -26.704 1.00 31.04 ? 208  TRP B N   1 
ATOM   3867  C  CA  . TRP B 1 165 ? -0.264  -18.468 -27.318 1.00 32.46 ? 208  TRP B CA  1 
ATOM   3868  C  C   . TRP B 1 165 ? 0.022   -19.909 -27.696 1.00 33.20 ? 208  TRP B C   1 
ATOM   3869  O  O   . TRP B 1 165 ? -0.893  -20.693 -27.962 1.00 33.02 ? 208  TRP B O   1 
ATOM   3870  C  CB  . TRP B 1 165 ? -0.707  -17.652 -28.536 1.00 32.35 ? 208  TRP B CB  1 
ATOM   3871  C  CG  . TRP B 1 165 ? -1.721  -16.605 -28.167 1.00 33.24 ? 208  TRP B CG  1 
ATOM   3872  C  CD1 . TRP B 1 165 ? -2.996  -16.826 -27.733 1.00 33.31 ? 208  TRP B CD1 1 
ATOM   3873  C  CD2 . TRP B 1 165 ? -1.529  -15.181 -28.132 1.00 34.63 ? 208  TRP B CD2 1 
ATOM   3874  N  NE1 . TRP B 1 165 ? -3.607  -15.638 -27.425 1.00 33.30 ? 208  TRP B NE1 1 
ATOM   3875  C  CE2 . TRP B 1 165 ? -2.731  -14.610 -27.658 1.00 34.34 ? 208  TRP B CE2 1 
ATOM   3876  C  CE3 . TRP B 1 165 ? -0.456  -14.333 -28.448 1.00 34.80 ? 208  TRP B CE3 1 
ATOM   3877  C  CZ2 . TRP B 1 165 ? -2.894  -13.225 -27.488 1.00 33.77 ? 208  TRP B CZ2 1 
ATOM   3878  C  CZ3 . TRP B 1 165 ? -0.618  -12.958 -28.278 1.00 33.97 ? 208  TRP B CZ3 1 
ATOM   3879  C  CH2 . TRP B 1 165 ? -1.831  -12.419 -27.800 1.00 32.56 ? 208  TRP B CH2 1 
ATOM   3880  N  N   . ARG B 1 166 ? 1.306   -20.255 -27.695 1.00 33.53 ? 209  ARG B N   1 
ATOM   3881  C  CA  . ARG B 1 166 ? 1.744   -21.605 -28.027 1.00 32.49 ? 209  ARG B CA  1 
ATOM   3882  C  C   . ARG B 1 166 ? 1.776   -22.490 -26.784 1.00 30.12 ? 209  ARG B C   1 
ATOM   3883  O  O   . ARG B 1 166 ? 2.185   -23.643 -26.850 1.00 30.59 ? 209  ARG B O   1 
ATOM   3884  C  CB  . ARG B 1 166 ? 3.123   -21.553 -28.715 1.00 33.61 ? 209  ARG B CB  1 
ATOM   3885  C  CG  . ARG B 1 166 ? 3.061   -21.332 -30.244 1.00 34.70 ? 209  ARG B CG  1 
ATOM   3886  C  CD  . ARG B 1 166 ? 4.214   -20.454 -30.775 1.00 36.77 ? 209  ARG B CD  1 
ATOM   3887  N  NE  . ARG B 1 166 ? 5.537   -20.879 -30.300 1.00 38.45 ? 209  ARG B NE  1 
ATOM   3888  C  CZ  . ARG B 1 166 ? 6.618   -20.098 -30.284 1.00 37.70 ? 209  ARG B CZ  1 
ATOM   3889  N  NH1 . ARG B 1 166 ? 6.542   -18.845 -30.721 1.00 36.45 ? 209  ARG B NH1 1 
ATOM   3890  N  NH2 . ARG B 1 166 ? 7.769   -20.560 -29.811 1.00 37.20 ? 209  ARG B NH2 1 
ATOM   3891  N  N   . LEU B 1 167 ? 1.338   -21.936 -25.659 1.00 29.08 ? 210  LEU B N   1 
ATOM   3892  C  CA  . LEU B 1 167 ? 1.292   -22.665 -24.391 1.00 29.23 ? 210  LEU B CA  1 
ATOM   3893  C  C   . LEU B 1 167 ? -0.162  -22.980 -24.109 1.00 28.84 ? 210  LEU B C   1 
ATOM   3894  O  O   . LEU B 1 167 ? -0.488  -24.027 -23.560 1.00 26.87 ? 210  LEU B O   1 
ATOM   3895  C  CB  . LEU B 1 167 ? 1.838   -21.817 -23.235 1.00 29.76 ? 210  LEU B CB  1 
ATOM   3896  C  CG  . LEU B 1 167 ? 3.115   -22.248 -22.503 1.00 29.42 ? 210  LEU B CG  1 
ATOM   3897  C  CD1 . LEU B 1 167 ? 3.234   -21.439 -21.222 1.00 27.57 ? 210  LEU B CD1 1 
ATOM   3898  C  CD2 . LEU B 1 167 ? 3.079   -23.731 -22.178 1.00 29.06 ? 210  LEU B CD2 1 
ATOM   3899  N  N   . LYS B 1 168 ? -1.029  -22.050 -24.494 1.00 29.11 ? 211  LYS B N   1 
ATOM   3900  C  CA  . LYS B 1 168 ? -2.464  -22.200 -24.303 1.00 30.57 ? 211  LYS B CA  1 
ATOM   3901  C  C   . LYS B 1 168 ? -2.921  -23.443 -25.050 1.00 31.67 ? 211  LYS B C   1 
ATOM   3902  O  O   . LYS B 1 168 ? -4.044  -23.936 -24.867 1.00 32.38 ? 211  LYS B O   1 
ATOM   3903  C  CB  . LYS B 1 168 ? -3.205  -20.970 -24.841 1.00 28.93 ? 211  LYS B CB  1 
ATOM   3904  C  CG  . LYS B 1 168 ? -4.716  -21.041 -24.649 1.00 29.03 ? 211  LYS B CG  1 
ATOM   3905  C  CD  . LYS B 1 168 ? -5.391  -19.719 -24.944 1.00 28.92 ? 211  LYS B CD  1 
ATOM   3906  C  CE  . LYS B 1 168 ? -6.846  -19.727 -24.469 1.00 29.75 ? 211  LYS B CE  1 
ATOM   3907  N  NZ  . LYS B 1 168 ? -7.418  -18.353 -24.194 1.00 27.47 ? 211  LYS B NZ  1 
ATOM   3908  N  N   . ASN B 1 169 ? -2.032  -23.945 -25.896 1.00 32.00 ? 212  ASN B N   1 
ATOM   3909  C  CA  . ASN B 1 169 ? -2.307  -25.123 -26.694 1.00 32.43 ? 212  ASN B CA  1 
ATOM   3910  C  C   . ASN B 1 169 ? -1.810  -26.349 -25.955 1.00 33.00 ? 212  ASN B C   1 
ATOM   3911  O  O   . ASN B 1 169 ? -2.513  -27.351 -25.865 1.00 33.64 ? 212  ASN B O   1 
ATOM   3912  C  CB  . ASN B 1 169 ? -1.619  -24.993 -28.052 1.00 31.60 ? 212  ASN B CB  1 
ATOM   3913  C  CG  . ASN B 1 169 ? -1.810  -23.613 -28.661 1.00 31.55 ? 212  ASN B CG  1 
ATOM   3914  O  OD1 . ASN B 1 169 ? -2.941  -23.140 -28.815 1.00 31.94 ? 212  ASN B OD1 1 
ATOM   3915  N  ND2 . ASN B 1 169 ? -0.706  -22.957 -29.000 1.00 30.10 ? 212  ASN B ND2 1 
ATOM   3916  N  N   . GLU B 1 170 ? -0.606  -26.272 -25.405 1.00 32.71 ? 213  GLU B N   1 
ATOM   3917  C  CA  . GLU B 1 170 ? -0.070  -27.411 -24.683 1.00 32.65 ? 213  GLU B CA  1 
ATOM   3918  C  C   . GLU B 1 170 ? -0.818  -27.633 -23.367 1.00 33.88 ? 213  GLU B C   1 
ATOM   3919  O  O   . GLU B 1 170 ? -0.933  -28.765 -22.895 1.00 35.86 ? 213  GLU B O   1 
ATOM   3920  C  CB  . GLU B 1 170 ? 1.418   -27.216 -24.384 1.00 31.30 ? 213  GLU B CB  1 
ATOM   3921  C  CG  . GLU B 1 170 ? 2.296   -26.868 -25.576 1.00 31.38 ? 213  GLU B CG  1 
ATOM   3922  C  CD  . GLU B 1 170 ? 3.719   -27.411 -25.424 1.00 31.95 ? 213  GLU B CD  1 
ATOM   3923  O  OE1 . GLU B 1 170 ? 4.657   -26.857 -26.043 1.00 30.28 ? 213  GLU B OE1 1 
ATOM   3924  O  OE2 . GLU B 1 170 ? 3.892   -28.412 -24.691 1.00 33.46 ? 213  GLU B OE2 1 
ATOM   3925  N  N   . ILE B 1 171 ? -1.336  -26.555 -22.783 1.00 34.04 ? 214  ILE B N   1 
ATOM   3926  C  CA  . ILE B 1 171 ? -2.027  -26.648 -21.504 1.00 31.61 ? 214  ILE B CA  1 
ATOM   3927  C  C   . ILE B 1 171 ? -3.528  -26.592 -21.555 1.00 30.00 ? 214  ILE B C   1 
ATOM   3928  O  O   . ILE B 1 171 ? -4.116  -25.571 -21.904 1.00 29.10 ? 214  ILE B O   1 
ATOM   3929  C  CB  . ILE B 1 171 ? -1.590  -25.535 -20.547 1.00 31.98 ? 214  ILE B CB  1 
ATOM   3930  C  CG1 . ILE B 1 171 ? -0.067  -25.549 -20.376 1.00 31.91 ? 214  ILE B CG1 1 
ATOM   3931  C  CG2 . ILE B 1 171 ? -2.280  -25.712 -19.215 1.00 32.11 ? 214  ILE B CG2 1 
ATOM   3932  C  CD1 . ILE B 1 171 ? 0.535   -24.168 -20.149 1.00 31.71 ? 214  ILE B CD1 1 
ATOM   3933  N  N   . PRO B 1 172 ? -4.170  -27.713 -21.247 1.00 29.74 ? 215  PRO B N   1 
ATOM   3934  C  CA  . PRO B 1 172 ? -5.625  -27.847 -21.216 1.00 30.51 ? 215  PRO B CA  1 
ATOM   3935  C  C   . PRO B 1 172 ? -6.251  -26.791 -20.295 1.00 30.48 ? 215  PRO B C   1 
ATOM   3936  O  O   . PRO B 1 172 ? -5.638  -26.383 -19.303 1.00 29.16 ? 215  PRO B O   1 
ATOM   3937  C  CB  . PRO B 1 172 ? -5.796  -29.252 -20.684 1.00 29.58 ? 215  PRO B CB  1 
ATOM   3938  C  CG  . PRO B 1 172 ? -4.697  -29.988 -21.452 1.00 30.02 ? 215  PRO B CG  1 
ATOM   3939  C  CD  . PRO B 1 172 ? -3.540  -29.011 -21.554 1.00 28.96 ? 215  PRO B CD  1 
ATOM   3940  N  N   . ASN B 1 173 ? -7.474  -26.381 -20.615 1.00 30.93 ? 216  ASN B N   1 
ATOM   3941  C  CA  . ASN B 1 173 ? -8.188  -25.378 -19.831 1.00 32.04 ? 216  ASN B CA  1 
ATOM   3942  C  C   . ASN B 1 173 ? -7.257  -24.186 -19.575 1.00 32.23 ? 216  ASN B C   1 
ATOM   3943  O  O   . ASN B 1 173 ? -7.350  -23.512 -18.544 1.00 32.39 ? 216  ASN B O   1 
ATOM   3944  C  CB  . ASN B 1 173 ? -8.661  -25.971 -18.496 1.00 33.89 ? 216  ASN B CB  1 
ATOM   3945  C  CG  . ASN B 1 173 ? -9.484  -27.246 -18.664 1.00 35.56 ? 216  ASN B CG  1 
ATOM   3946  O  OD1 . ASN B 1 173 ? -10.469 -27.276 -19.400 1.00 37.18 ? 216  ASN B OD1 1 
ATOM   3947  N  ND2 . ASN B 1 173 ? -9.086  -28.299 -17.963 1.00 35.88 ? 216  ASN B ND2 1 
ATOM   3948  N  N   . SER B 1 174 ? -6.355  -23.942 -20.522 1.00 31.07 ? 217  SER B N   1 
ATOM   3949  C  CA  . SER B 1 174 ? -5.401  -22.843 -20.418 1.00 30.12 ? 217  SER B CA  1 
ATOM   3950  C  C   . SER B 1 174 ? -6.154  -21.554 -20.704 1.00 29.63 ? 217  SER B C   1 
ATOM   3951  O  O   . SER B 1 174 ? -7.293  -21.604 -21.139 1.00 31.52 ? 217  SER B O   1 
ATOM   3952  C  CB  . SER B 1 174 ? -4.275  -23.027 -21.436 1.00 30.23 ? 217  SER B CB  1 
ATOM   3953  O  OG  . SER B 1 174 ? -3.128  -22.265 -21.100 1.00 30.48 ? 217  SER B OG  1 
ATOM   3954  N  N   . HIS B 1 175 ? -5.524  -20.407 -20.475 1.00 28.62 ? 218  HIS B N   1 
ATOM   3955  C  CA  . HIS B 1 175 ? -6.182  -19.125 -20.703 1.00 27.28 ? 218  HIS B CA  1 
ATOM   3956  C  C   . HIS B 1 175 ? -5.271  -17.921 -20.954 1.00 28.23 ? 218  HIS B C   1 
ATOM   3957  O  O   . HIS B 1 175 ? -4.155  -17.856 -20.440 1.00 29.88 ? 218  HIS B O   1 
ATOM   3958  C  CB  . HIS B 1 175 ? -7.078  -18.821 -19.521 1.00 23.99 ? 218  HIS B CB  1 
ATOM   3959  C  CG  . HIS B 1 175 ? -8.478  -19.271 -19.726 1.00 22.38 ? 218  HIS B CG  1 
ATOM   3960  N  ND1 . HIS B 1 175 ? -9.336  -18.630 -20.589 1.00 21.07 ? 218  HIS B ND1 1 
ATOM   3961  C  CD2 . HIS B 1 175 ? -9.155  -20.331 -19.235 1.00 23.64 ? 218  HIS B CD2 1 
ATOM   3962  C  CE1 . HIS B 1 175 ? -10.482 -19.280 -20.626 1.00 23.11 ? 218  HIS B CE1 1 
ATOM   3963  N  NE2 . HIS B 1 175 ? -10.399 -20.318 -19.815 1.00 23.57 ? 218  HIS B NE2 1 
ATOM   3964  N  N   . ILE B 1 176 ? -5.755  -16.959 -21.733 1.00 27.24 ? 219  ILE B N   1 
ATOM   3965  C  CA  . ILE B 1 176 ? -4.961  -15.772 -22.013 1.00 26.27 ? 219  ILE B CA  1 
ATOM   3966  C  C   . ILE B 1 176 ? -5.815  -14.508 -21.995 1.00 26.21 ? 219  ILE B C   1 
ATOM   3967  O  O   . ILE B 1 176 ? -6.503  -14.191 -22.971 1.00 25.23 ? 219  ILE B O   1 
ATOM   3968  C  CB  . ILE B 1 176 ? -4.227  -15.878 -23.372 1.00 25.64 ? 219  ILE B CB  1 
ATOM   3969  C  CG1 . ILE B 1 176 ? -3.342  -17.136 -23.389 1.00 25.79 ? 219  ILE B CG1 1 
ATOM   3970  C  CG2 . ILE B 1 176 ? -3.379  -14.625 -23.602 1.00 25.30 ? 219  ILE B CG2 1 
ATOM   3971  C  CD1 . ILE B 1 176 ? -2.440  -17.297 -24.633 1.00 22.82 ? 219  ILE B CD1 1 
ATOM   3972  N  N   . LEU B 1 177 ? -5.771  -13.797 -20.868 1.00 25.67 ? 220  LEU B N   1 
ATOM   3973  C  CA  . LEU B 1 177 ? -6.525  -12.563 -20.704 1.00 23.96 ? 220  LEU B CA  1 
ATOM   3974  C  C   . LEU B 1 177 ? -5.582  -11.466 -21.132 1.00 24.85 ? 220  LEU B C   1 
ATOM   3975  O  O   . LEU B 1 177 ? -4.685  -11.085 -20.386 1.00 26.04 ? 220  LEU B O   1 
ATOM   3976  C  CB  . LEU B 1 177 ? -6.941  -12.407 -19.253 1.00 20.48 ? 220  LEU B CB  1 
ATOM   3977  C  CG  . LEU B 1 177 ? -7.782  -13.597 -18.788 1.00 18.67 ? 220  LEU B CG  1 
ATOM   3978  C  CD1 . LEU B 1 177 ? -8.038  -13.492 -17.301 1.00 20.37 ? 220  LEU B CD1 1 
ATOM   3979  C  CD2 . LEU B 1 177 ? -9.082  -13.639 -19.550 1.00 15.05 ? 220  LEU B CD2 1 
ATOM   3980  N  N   . ASP B 1 178 ? -5.792  -10.983 -22.354 1.00 25.73 ? 221  ASP B N   1 
ATOM   3981  C  CA  . ASP B 1 178 ? -4.945  -9.966  -22.981 1.00 24.85 ? 221  ASP B CA  1 
ATOM   3982  C  C   . ASP B 1 178 ? -5.378  -8.533  -22.766 1.00 24.70 ? 221  ASP B C   1 
ATOM   3983  O  O   . ASP B 1 178 ? -6.473  -8.143  -23.149 1.00 23.60 ? 221  ASP B O   1 
ATOM   3984  C  CB  . ASP B 1 178 ? -4.846  -10.251 -24.484 1.00 22.75 ? 221  ASP B CB  1 
ATOM   3985  C  CG  . ASP B 1 178 ? -3.898  -9.327  -25.188 1.00 20.74 ? 221  ASP B CG  1 
ATOM   3986  O  OD1 . ASP B 1 178 ? -3.161  -9.801  -26.078 1.00 20.41 ? 221  ASP B OD1 1 
ATOM   3987  O  OD2 . ASP B 1 178 ? -3.899  -8.129  -24.863 1.00 20.12 ? 221  ASP B OD2 1 
ATOM   3988  N  N   . GLN B 1 179 ? -4.482  -7.745  -22.178 1.00 25.46 ? 222  GLN B N   1 
ATOM   3989  C  CA  . GLN B 1 179 ? -4.751  -6.341  -21.890 1.00 24.99 ? 222  GLN B CA  1 
ATOM   3990  C  C   . GLN B 1 179 ? -4.739  -5.423  -23.103 1.00 24.13 ? 222  GLN B C   1 
ATOM   3991  O  O   . GLN B 1 179 ? -5.558  -4.505  -23.201 1.00 22.82 ? 222  GLN B O   1 
ATOM   3992  C  CB  . GLN B 1 179 ? -3.769  -5.822  -20.829 1.00 25.61 ? 222  GLN B CB  1 
ATOM   3993  C  CG  . GLN B 1 179 ? -2.287  -6.021  -21.132 1.00 25.09 ? 222  GLN B CG  1 
ATOM   3994  C  CD  . GLN B 1 179 ? -1.401  -5.780  -19.908 1.00 24.53 ? 222  GLN B CD  1 
ATOM   3995  O  OE1 . GLN B 1 179 ? -1.233  -4.646  -19.445 1.00 21.98 ? 222  GLN B OE1 1 
ATOM   3996  N  NE2 . GLN B 1 179 ? -0.841  -6.859  -19.373 1.00 23.83 ? 222  GLN B NE2 1 
ATOM   3997  N  N   . TYR B 1 180 ? -3.820  -5.655  -24.029 1.00 23.87 ? 223  TYR B N   1 
ATOM   3998  C  CA  . TYR B 1 180 ? -3.769  -4.808  -25.206 1.00 24.72 ? 223  TYR B CA  1 
ATOM   3999  C  C   . TYR B 1 180 ? -4.970  -5.074  -26.104 1.00 25.34 ? 223  TYR B C   1 
ATOM   4000  O  O   . TYR B 1 180 ? -5.017  -4.518  -27.201 1.00 25.95 ? 223  TYR B O   1 
ATOM   4001  C  CB  . TYR B 1 180 ? -2.453  -5.010  -25.966 1.00 23.76 ? 223  TYR B CB  1 
ATOM   4002  C  CG  . TYR B 1 180 ? -1.237  -4.557  -25.179 1.00 24.02 ? 223  TYR B CG  1 
ATOM   4003  C  CD1 . TYR B 1 180 ? -1.228  -3.323  -24.547 1.00 25.07 ? 223  TYR B CD1 1 
ATOM   4004  C  CD2 . TYR B 1 180 ? -0.089  -5.356  -25.079 1.00 24.24 ? 223  TYR B CD2 1 
ATOM   4005  C  CE1 . TYR B 1 180 ? -0.121  -2.888  -23.838 1.00 26.88 ? 223  TYR B CE1 1 
ATOM   4006  C  CE2 . TYR B 1 180 ? 1.030   -4.928  -24.370 1.00 24.22 ? 223  TYR B CE2 1 
ATOM   4007  C  CZ  . TYR B 1 180 ? 1.008   -3.686  -23.751 1.00 26.42 ? 223  TYR B CZ  1 
ATOM   4008  O  OH  . TYR B 1 180 ? 2.106   -3.232  -23.062 1.00 25.88 ? 223  TYR B OH  1 
ATOM   4009  N  N   . ARG B 1 181 ? -5.948  -5.820  -25.753 1.00 26.15 ? 224  ARG B N   1 
ATOM   4010  C  CA  . ARG B 1 181 ? -7.065  -5.964  -26.698 1.00 25.74 ? 224  ARG B CA  1 
ATOM   4011  C  C   . ARG B 1 181 ? -8.215  -6.219  -25.798 1.00 24.45 ? 224  ARG B C   1 
ATOM   4012  O  O   . ARG B 1 181 ? -8.273  -7.360  -25.319 1.00 25.06 ? 224  ARG B O   1 
ATOM   4013  C  CB  . ARG B 1 181 ? -6.790  -7.154  -27.675 1.00 28.97 ? 224  ARG B CB  1 
ATOM   4014  C  CG  . ARG B 1 181 ? -7.959  -7.640  -28.559 1.00 32.62 ? 224  ARG B CG  1 
ATOM   4015  C  CD  . ARG B 1 181 ? -7.832  -9.125  -28.945 1.00 35.77 ? 224  ARG B CD  1 
ATOM   4016  N  NE  . ARG B 1 181 ? -7.711  -9.373  -30.378 1.00 40.11 ? 224  ARG B NE  1 
ATOM   4017  C  CZ  . ARG B 1 181 ? -8.207  -8.577  -31.345 1.00 41.78 ? 224  ARG B CZ  1 
ATOM   4018  N  NH1 . ARG B 1 181 ? -8.866  -7.474  -31.011 1.00 43.23 ? 224  ARG B NH1 1 
ATOM   4019  N  NH2 . ARG B 1 181 ? -8.029  -8.880  -32.623 1.00 41.70 ? 224  ARG B NH2 1 
ATOM   4020  N  N   . ASN B 1 182 ? -9.201  -5.354  -25.454 1.00 24.15 ? 225  ASN B N   1 
ATOM   4021  C  CA  . ASN B 1 182 ? -9.521  -7.274  -23.837 1.00 24.04 ? 225  ASN B CA  1 
ATOM   4022  C  C   . ASN B 1 182 ? -10.267 -6.079  -23.298 1.00 24.03 ? 225  ASN B C   1 
ATOM   4023  O  O   . ASN B 1 182 ? -9.732  -5.259  -22.541 1.00 23.74 ? 225  ASN B O   1 
ATOM   4024  C  CB  . ASN B 1 182 ? -9.287  -8.277  -22.668 1.00 26.20 ? 225  ASN B CB  1 
ATOM   4025  C  CG  . ASN B 1 182 ? -10.561 -8.958  -22.128 1.00 27.30 ? 225  ASN B CG  1 
ATOM   4026  O  OD1 . ASN B 1 182 ? -11.521 -8.274  -21.751 1.00 27.99 ? 225  ASN B OD1 1 
ATOM   4027  N  ND2 . ASN B 1 182 ? -10.557 -10.294 -22.083 1.00 27.52 ? 225  ASN B ND2 1 
ATOM   4028  N  N   . ALA B 1 183 ? -11.499 -6.015  -23.696 1.00 23.18 ? 226  ALA B N   1 
ATOM   4029  C  CA  . ALA B 1 183 ? -12.345 -4.894  -23.323 1.00 22.92 ? 226  ALA B CA  1 
ATOM   4030  C  C   . ALA B 1 183 ? -12.536 -4.782  -21.818 1.00 23.48 ? 226  ALA B C   1 
ATOM   4031  O  O   . ALA B 1 183 ? -12.853 -3.706  -21.309 1.00 23.70 ? 226  ALA B O   1 
ATOM   4032  C  CB  . ALA B 1 183 ? -13.695 -5.017  -24.001 1.00 22.16 ? 226  ALA B CB  1 
ATOM   4033  N  N   . SER B 1 184 ? -12.358 -5.887  -21.102 1.00 23.52 ? 227  SER B N   1 
ATOM   4034  C  CA  . SER B 1 184 ? -12.515 -5.857  -19.653 1.00 22.16 ? 227  SER B CA  1 
ATOM   4035  C  C   . SER B 1 184 ? -11.526 -4.853  -19.067 1.00 20.80 ? 227  SER B C   1 
ATOM   4036  O  O   . SER B 1 184 ? -11.592 -4.539  -17.888 1.00 21.11 ? 227  SER B O   1 
ATOM   4037  C  CB  . SER B 1 184 ? -12.263 -7.242  -19.047 1.00 21.65 ? 227  SER B CB  1 
ATOM   4038  O  OG  . SER B 1 184 ? -13.181 -8.191  -19.543 1.00 20.64 ? 227  SER B OG  1 
ATOM   4039  N  N   . ASN B 1 185 ? -10.608 -4.361  -19.895 1.00 18.43 ? 228  ASN B N   1 
ATOM   4040  C  CA  . ASN B 1 185 ? -9.626  -3.385  -19.452 1.00 17.60 ? 228  ASN B CA  1 
ATOM   4041  C  C   . ASN B 1 185 ? -10.201 -1.959  -19.499 1.00 17.66 ? 228  ASN B C   1 
ATOM   4042  O  O   . ASN B 1 185 ? -10.411 -1.328  -18.459 1.00 16.77 ? 228  ASN B O   1 
ATOM   4043  C  CB  . ASN B 1 185 ? -8.379  -3.491  -20.326 1.00 18.03 ? 228  ASN B CB  1 
ATOM   4044  C  CG  . ASN B 1 185 ? -7.361  -2.399  -20.042 1.00 18.83 ? 228  ASN B CG  1 
ATOM   4045  O  OD1 . ASN B 1 185 ? -7.708  -1.222  -19.905 1.00 16.07 ? 228  ASN B OD1 1 
ATOM   4046  N  ND2 . ASN B 1 185 ? -6.090  -2.785  -19.974 1.00 18.18 ? 228  ASN B ND2 1 
ATOM   4047  N  N   . PRO B 1 186 ? -10.469 -1.431  -20.707 1.00 16.83 ? 229  PRO B N   1 
ATOM   4048  C  CA  . PRO B 1 186 ? -11.015 -0.080  -20.752 1.00 16.51 ? 229  PRO B CA  1 
ATOM   4049  C  C   . PRO B 1 186 ? -12.393 0.007   -20.124 1.00 16.14 ? 229  PRO B C   1 
ATOM   4050  O  O   . PRO B 1 186 ? -12.815 1.063   -19.670 1.00 18.63 ? 229  PRO B O   1 
ATOM   4051  C  CB  . PRO B 1 186 ? -11.025 0.235   -22.242 1.00 16.30 ? 229  PRO B CB  1 
ATOM   4052  C  CG  . PRO B 1 186 ? -11.250 -1.063  -22.851 1.00 16.86 ? 229  PRO B CG  1 
ATOM   4053  C  CD  . PRO B 1 186 ? -10.338 -1.968  -22.071 1.00 17.86 ? 229  PRO B CD  1 
ATOM   4054  N  N   . LEU B 1 187 ? -13.105 -1.102  -20.096 1.00 15.50 ? 230  LEU B N   1 
ATOM   4055  C  CA  . LEU B 1 187 ? -14.433 -1.096  -19.504 1.00 14.51 ? 230  LEU B CA  1 
ATOM   4056  C  C   . LEU B 1 187 ? -14.349 -0.901  -17.996 1.00 12.62 ? 230  LEU B C   1 
ATOM   4057  O  O   . LEU B 1 187 ? -15.113 -0.130  -17.423 1.00 10.62 ? 230  LEU B O   1 
ATOM   4058  C  CB  . LEU B 1 187 ? -15.163 -2.396  -19.855 1.00 15.28 ? 230  LEU B CB  1 
ATOM   4059  C  CG  . LEU B 1 187 ? -15.565 -2.383  -21.331 1.00 15.45 ? 230  LEU B CG  1 
ATOM   4060  C  CD1 . LEU B 1 187 ? -15.809 -3.789  -21.842 1.00 15.19 ? 230  LEU B CD1 1 
ATOM   4061  C  CD2 . LEU B 1 187 ? -16.793 -1.503  -21.488 1.00 14.90 ? 230  LEU B CD2 1 
ATOM   4062  N  N   . ALA B 1 188 ? -13.411 -1.585  -17.352 1.00 11.52 ? 231  ALA B N   1 
ATOM   4063  C  CA  . ALA B 1 188 ? -13.266 -1.443  -15.915 1.00 10.63 ? 231  ALA B CA  1 
ATOM   4064  C  C   . ALA B 1 188 ? -13.086 0.038   -15.621 1.00 11.27 ? 231  ALA B C   1 
ATOM   4065  O  O   . ALA B 1 188 ? -13.803 0.646   -14.820 1.00 9.82  ? 231  ALA B O   1 
ATOM   4066  C  CB  . ALA B 1 188 ? -12.057 -2.218  -15.426 1.00 11.11 ? 231  ALA B CB  1 
ATOM   4067  N  N   . HIS B 1 189 ? -12.120 0.630   -16.296 1.00 11.64 ? 232  HIS B N   1 
ATOM   4068  C  CA  . HIS B 1 189 ? -11.872 2.021   -16.075 1.00 11.08 ? 232  HIS B CA  1 
ATOM   4069  C  C   . HIS B 1 189 ? -13.068 2.847   -16.462 1.00 12.55 ? 232  HIS B C   1 
ATOM   4070  O  O   . HIS B 1 189 ? -13.310 3.882   -15.854 1.00 14.59 ? 232  HIS B O   1 
ATOM   4071  C  CB  . HIS B 1 189 ? -10.618 2.434   -16.815 1.00 9.53  ? 232  HIS B CB  1 
ATOM   4072  C  CG  . HIS B 1 189 ? -9.398  1.762   -16.286 1.00 7.70  ? 232  HIS B CG  1 
ATOM   4073  N  ND1 . HIS B 1 189 ? -9.191  1.573   -14.936 1.00 5.86  ? 232  HIS B ND1 1 
ATOM   4074  C  CD2 . HIS B 1 189 ? -8.337  1.207   -16.912 1.00 7.84  ? 232  HIS B CD2 1 
ATOM   4075  C  CE1 . HIS B 1 189 ? -8.055  0.926   -14.755 1.00 7.39  ? 232  HIS B CE1 1 
ATOM   4076  N  NE2 . HIS B 1 189 ? -7.517  0.692   -15.937 1.00 8.56  ? 232  HIS B NE2 1 
ATOM   4077  N  N   . TYR B 1 190 ? -13.842 2.385   -17.438 1.00 12.49 ? 233  TYR B N   1 
ATOM   4078  C  CA  . TYR B 1 190 ? -15.021 3.131   -17.857 1.00 12.38 ? 233  TYR B CA  1 
ATOM   4079  C  C   . TYR B 1 190 ? -16.157 2.984   -16.864 1.00 11.45 ? 233  TYR B C   1 
ATOM   4080  O  O   . TYR B 1 190 ? -16.890 3.930   -16.614 1.00 12.02 ? 233  TYR B O   1 
ATOM   4081  C  CB  . TYR B 1 190 ? -15.515 2.649   -19.217 1.00 13.36 ? 233  TYR B CB  1 
ATOM   4082  C  CG  . TYR B 1 190 ? -16.775 3.338   -19.728 1.00 14.14 ? 233  TYR B CG  1 
ATOM   4083  C  CD1 . TYR B 1 190 ? -16.693 4.363   -20.667 1.00 15.47 ? 233  TYR B CD1 1 
ATOM   4084  C  CD2 . TYR B 1 190 ? -18.048 2.937   -19.300 1.00 14.60 ? 233  TYR B CD2 1 
ATOM   4085  C  CE1 . TYR B 1 190 ? -17.837 4.973   -21.176 1.00 16.46 ? 233  TYR B CE1 1 
ATOM   4086  C  CE2 . TYR B 1 190 ? -19.202 3.538   -19.801 1.00 16.14 ? 233  TYR B CE2 1 
ATOM   4087  C  CZ  . TYR B 1 190 ? -19.090 4.557   -20.744 1.00 17.26 ? 233  TYR B CZ  1 
ATOM   4088  O  OH  . TYR B 1 190 ? -20.211 5.157   -21.281 1.00 16.39 ? 233  TYR B OH  1 
ATOM   4089  N  N   . ASP B 1 191 ? -16.333 1.794   -16.334 1.00 10.63 ? 234  ASP B N   1 
ATOM   4090  C  CA  . ASP B 1 191 ? -17.486 1.536   -15.497 1.00 12.74 ? 234  ASP B CA  1 
ATOM   4091  C  C   . ASP B 1 191 ? -17.365 1.965   -14.072 1.00 14.32 ? 234  ASP B C   1 
ATOM   4092  O  O   . ASP B 1 191 ? -18.276 2.547   -13.486 1.00 13.57 ? 234  ASP B O   1 
ATOM   4093  C  CB  . ASP B 1 191 ? -17.812 0.063   -15.538 1.00 12.36 ? 234  ASP B CB  1 
ATOM   4094  C  CG  . ASP B 1 191 ? -18.638 -0.260  -16.734 1.00 9.92  ? 234  ASP B CG  1 
ATOM   4095  O  OD1 . ASP B 1 191 ? -19.351 0.634   -17.217 1.00 8.95  ? 234  ASP B OD1 1 
ATOM   4096  O  OD2 . ASP B 1 191 ? -18.588 -1.424  -17.186 1.00 6.61  ? 234  ASP B OD2 1 
ATOM   4097  N  N   . THR B 1 192 ? -16.168 1.718   -13.520 1.00 15.95 ? 235  THR B N   1 
ATOM   4098  C  CA  . THR B 1 192 ? -15.847 1.934   -12.105 1.00 15.62 ? 235  THR B CA  1 
ATOM   4099  C  C   . THR B 1 192 ? -14.949 3.185   -11.781 1.00 16.16 ? 235  THR B C   1 
ATOM   4100  O  O   . THR B 1 192 ? -15.383 4.068   -11.029 1.00 15.46 ? 235  THR B O   1 
ATOM   4101  C  CB  . THR B 1 192 ? -15.067 0.723   -11.598 1.00 15.66 ? 235  THR B CB  1 
ATOM   4102  O  OG1 . THR B 1 192 ? -14.027 0.408   -12.532 1.00 16.58 ? 235  THR B OG1 1 
ATOM   4103  C  CG2 . THR B 1 192 ? -15.993 -0.482  -11.452 1.00 12.73 ? 235  THR B CG2 1 
ATOM   4104  N  N   . THR B 1 193 ? -13.708 3.276   -12.359 1.00 16.03 ? 236  THR B N   1 
ATOM   4105  C  CA  . THR B 1 193 ? -12.639 4.295   -12.021 1.00 17.54 ? 236  THR B CA  1 
ATOM   4106  C  C   . THR B 1 193 ? -13.090 5.662   -12.434 1.00 17.76 ? 236  THR B C   1 
ATOM   4107  O  O   . THR B 1 193 ? -13.071 6.635   -11.667 1.00 18.87 ? 236  THR B O   1 
ATOM   4108  C  CB  . THR B 1 193 ? -11.292 4.029   -12.703 1.00 19.62 ? 236  THR B CB  1 
ATOM   4109  O  OG1 . THR B 1 193 ? -10.789 2.764   -12.268 1.00 21.24 ? 236  THR B OG1 1 
ATOM   4110  C  CG2 . THR B 1 193 ? -10.300 5.131   -12.356 1.00 17.63 ? 236  THR B CG2 1 
ATOM   4111  N  N   . ALA B 1 194 ? -13.482 5.693   -13.688 1.00 17.99 ? 237  ALA B N   1 
ATOM   4112  C  CA  . ALA B 1 194 ? -14.110 6.864   -14.285 1.00 17.12 ? 237  ALA B CA  1 
ATOM   4113  C  C   . ALA B 1 194 ? -15.285 7.386   -13.493 1.00 17.37 ? 237  ALA B C   1 
ATOM   4114  O  O   . ALA B 1 194 ? -15.468 8.590   -13.412 1.00 17.89 ? 237  ALA B O   1 
ATOM   4115  C  CB  . ALA B 1 194 ? -14.547 6.565   -15.712 1.00 16.41 ? 237  ALA B CB  1 
ATOM   4116  N  N   . ASP B 1 195 ? -16.100 6.507   -12.916 1.00 17.93 ? 238  ASP B N   1 
ATOM   4117  C  CA  . ASP B 1 195 ? -17.243 7.014   -12.149 1.00 18.67 ? 238  ASP B CA  1 
ATOM   4118  C  C   . ASP B 1 195 ? -16.913 7.428   -10.706 1.00 18.55 ? 238  ASP B C   1 
ATOM   4119  O  O   . ASP B 1 195 ? -17.611 8.263   -10.117 1.00 16.96 ? 238  ASP B O   1 
ATOM   4120  C  CB  . ASP B 1 195 ? -18.427 6.033   -12.183 1.00 17.75 ? 238  ASP B CB  1 
ATOM   4121  C  CG  . ASP B 1 195 ? -19.554 6.513   -13.111 1.00 17.85 ? 238  ASP B CG  1 
ATOM   4122  O  OD1 . ASP B 1 195 ? -20.681 5.997   -13.000 1.00 19.12 ? 238  ASP B OD1 1 
ATOM   4123  O  OD2 . ASP B 1 195 ? -19.318 7.410   -13.953 1.00 16.99 ? 238  ASP B OD2 1 
ATOM   4124  N  N   . GLU B 1 196 ? -15.847 6.849   -10.151 1.00 19.61 ? 239  GLU B N   1 
ATOM   4125  C  CA  . GLU B 1 196 ? -15.385 7.199   -8.805  1.00 18.13 ? 239  GLU B CA  1 
ATOM   4126  C  C   . GLU B 1 196 ? -14.896 8.644   -8.930  1.00 17.48 ? 239  GLU B C   1 
ATOM   4127  O  O   . GLU B 1 196 ? -15.303 9.537   -8.185  1.00 17.15 ? 239  GLU B O   1 
ATOM   4128  C  CB  . GLU B 1 196 ? -14.190 6.334   -8.386  1.00 18.05 ? 239  GLU B CB  1 
ATOM   4129  C  CG  . GLU B 1 196 ? -14.444 4.847   -8.169  1.00 18.70 ? 239  GLU B CG  1 
ATOM   4130  C  CD  . GLU B 1 196 ? -13.187 4.124   -7.660  1.00 19.71 ? 239  GLU B CD  1 
ATOM   4131  O  OE1 . GLU B 1 196 ? -13.271 2.897   -7.420  1.00 19.21 ? 239  GLU B OE1 1 
ATOM   4132  O  OE2 . GLU B 1 196 ? -12.122 4.781   -7.504  1.00 16.36 ? 239  GLU B OE2 1 
ATOM   4133  N  N   . ILE B 1 197 ? -14.006 8.850   -9.893  1.00 14.61 ? 240  ILE B N   1 
ATOM   4134  C  CA  . ILE B 1 197 ? -13.454 10.153  -10.156 1.00 11.61 ? 240  ILE B CA  1 
ATOM   4135  C  C   . ILE B 1 197 ? -14.562 11.185  -10.200 1.00 12.90 ? 240  ILE B C   1 
ATOM   4136  O  O   . ILE B 1 197 ? -14.512 12.179  -9.488  1.00 14.00 ? 240  ILE B O   1 
ATOM   4137  C  CB  . ILE B 1 197 ? -12.671 10.140  -11.488 1.00 7.19  ? 240  ILE B CB  1 
ATOM   4138  C  CG1 . ILE B 1 197 ? -11.313 9.504   -11.251 1.00 3.95  ? 240  ILE B CG1 1 
ATOM   4139  C  CG2 . ILE B 1 197 ? -12.517 11.543  -12.048 1.00 6.61  ? 240  ILE B CG2 1 
ATOM   4140  C  CD1 . ILE B 1 197 ? -10.556 9.279   -12.486 1.00 3.95  ? 240  ILE B CD1 1 
ATOM   4141  N  N   . LEU B 1 198 ? -15.574 10.934  -11.015 1.00 13.99 ? 241  LEU B N   1 
ATOM   4142  C  CA  . LEU B 1 198 ? -16.677 11.870  -11.157 1.00 17.54 ? 241  LEU B CA  1 
ATOM   4143  C  C   . LEU B 1 198 ? -17.577 11.994  -9.927  1.00 19.36 ? 241  LEU B C   1 
ATOM   4144  O  O   . LEU B 1 198 ? -18.440 12.876  -9.873  1.00 20.92 ? 241  LEU B O   1 
ATOM   4145  C  CB  . LEU B 1 198 ? -17.532 11.494  -12.380 1.00 18.64 ? 241  LEU B CB  1 
ATOM   4146  C  CG  . LEU B 1 198 ? -17.131 12.026  -13.759 1.00 18.70 ? 241  LEU B CG  1 
ATOM   4147  C  CD1 . LEU B 1 198 ? -18.104 11.512  -14.827 1.00 15.53 ? 241  LEU B CD1 1 
ATOM   4148  C  CD2 . LEU B 1 198 ? -17.129 13.571  -13.712 1.00 17.97 ? 241  LEU B CD2 1 
ATOM   4149  N  N   . GLN B 1 199 ? -17.389 11.108  -8.951  1.00 20.46 ? 242  GLN B N   1 
ATOM   4150  C  CA  . GLN B 1 199 ? -18.198 11.133  -7.735  1.00 20.48 ? 242  GLN B CA  1 
ATOM   4151  C  C   . GLN B 1 199 ? -17.417 11.825  -6.659  1.00 19.63 ? 242  GLN B C   1 
ATOM   4152  O  O   . GLN B 1 199 ? -17.991 12.458  -5.790  1.00 19.51 ? 242  GLN B O   1 
ATOM   4153  C  CB  . GLN B 1 199 ? -18.551 9.713   -7.278  1.00 22.25 ? 242  GLN B CB  1 
ATOM   4154  C  CG  . GLN B 1 199 ? -18.976 9.591   -5.816  1.00 21.91 ? 242  GLN B CG  1 
ATOM   4155  C  CD  . GLN B 1 199 ? -20.394 10.069  -5.545  1.00 22.90 ? 242  GLN B CD  1 
ATOM   4156  O  OE1 . GLN B 1 199 ? -21.356 9.463   -6.000  1.00 23.50 ? 242  GLN B OE1 1 
ATOM   4157  N  NE2 . GLN B 1 199 ? -20.526 11.158  -4.793  1.00 22.85 ? 242  GLN B NE2 1 
ATOM   4158  N  N   . GLN B 1 200 ? -16.101 11.702  -6.725  1.00 18.90 ? 243  GLN B N   1 
ATOM   4159  C  CA  . GLN B 1 200 ? -15.239 12.337  -5.745  1.00 19.83 ? 243  GLN B CA  1 
ATOM   4160  C  C   . GLN B 1 200 ? -15.070 13.823  -6.049  1.00 20.69 ? 243  GLN B C   1 
ATOM   4161  O  O   . GLN B 1 200 ? -14.485 14.559  -5.260  1.00 22.44 ? 243  GLN B O   1 
ATOM   4162  C  CB  . GLN B 1 200 ? -13.873 11.645  -5.715  1.00 17.79 ? 243  GLN B CB  1 
ATOM   4163  C  CG  . GLN B 1 200 ? -13.968 10.173  -5.375  1.00 14.92 ? 243  GLN B CG  1 
ATOM   4164  C  CD  . GLN B 1 200 ? -12.631 9.461   -5.325  1.00 15.21 ? 243  GLN B CD  1 
ATOM   4165  O  OE1 . GLN B 1 200 ? -11.799 9.573   -6.234  1.00 14.00 ? 243  GLN B OE1 1 
ATOM   4166  N  NE2 . GLN B 1 200 ? -12.428 8.697   -4.260  1.00 14.31 ? 243  GLN B NE2 1 
ATOM   4167  N  N   . CYS B 1 201 ? -15.603 14.261  -7.186  1.00 20.98 ? 244  CYS B N   1 
ATOM   4168  C  CA  . CYS B 1 201 ? -15.496 15.658  -7.589  1.00 22.18 ? 244  CYS B CA  1 
ATOM   4169  C  C   . CYS B 1 201 ? -16.831 16.358  -7.738  1.00 21.93 ? 244  CYS B C   1 
ATOM   4170  O  O   . CYS B 1 201 ? -16.882 17.472  -8.245  1.00 22.02 ? 244  CYS B O   1 
ATOM   4171  C  CB  . CYS B 1 201 ? -14.725 15.779  -8.911  1.00 22.79 ? 244  CYS B CB  1 
ATOM   4172  S  SG  . CYS B 1 201 ? -12.962 15.427  -8.788  1.00 23.56 ? 244  CYS B SG  1 
ATOM   4173  N  N   . ASP B 1 202 ? -17.909 15.718  -7.302  1.00 21.95 ? 245  ASP B N   1 
ATOM   4174  C  CA  . ASP B 1 202 ? -19.237 16.320  -7.413  1.00 22.56 ? 245  ASP B CA  1 
ATOM   4175  C  C   . ASP B 1 202 ? -19.538 16.579  -8.906  1.00 22.24 ? 245  ASP B C   1 
ATOM   4176  O  O   . ASP B 1 202 ? -20.306 17.472  -9.282  1.00 20.68 ? 245  ASP B O   1 
ATOM   4177  C  CB  . ASP B 1 202 ? -19.291 17.629  -6.606  1.00 25.59 ? 245  ASP B CB  1 
ATOM   4178  C  CG  . ASP B 1 202 ? -18.849 17.452  -5.142  1.00 27.87 ? 245  ASP B CG  1 
ATOM   4179  O  OD1 . ASP B 1 202 ? -19.716 17.328  -4.240  1.00 27.23 ? 245  ASP B OD1 1 
ATOM   4180  O  OD2 . ASP B 1 202 ? -17.619 17.435  -4.892  1.00 28.32 ? 245  ASP B OD2 1 
ATOM   4181  N  N   . GLY B 1 203 ? -18.895 15.792  -9.755  1.00 21.34 ? 246  GLY B N   1 
ATOM   4182  C  CA  . GLY B 1 203 ? -19.128 15.907  -11.175 1.00 20.69 ? 246  GLY B CA  1 
ATOM   4183  C  C   . GLY B 1 203 ? -18.514 17.088  -11.876 1.00 20.36 ? 246  GLY B C   1 
ATOM   4184  O  O   . GLY B 1 203 ? -18.556 17.158  -13.107 1.00 21.58 ? 246  GLY B O   1 
ATOM   4185  N  N   . LYS B 1 204 ? -17.954 18.021  -11.116 1.00 19.29 ? 247  LYS B N   1 
ATOM   4186  C  CA  . LYS B 1 204 ? -17.331 19.196  -11.723 1.00 18.29 ? 247  LYS B CA  1 
ATOM   4187  C  C   . LYS B 1 204 ? -15.845 18.907  -11.904 1.00 16.73 ? 247  LYS B C   1 
ATOM   4188  O  O   . LYS B 1 204 ? -15.088 18.880  -10.943 1.00 17.44 ? 247  LYS B O   1 
ATOM   4189  C  CB  . LYS B 1 204 ? -17.565 20.426  -10.839 1.00 17.86 ? 247  LYS B CB  1 
ATOM   4190  C  CG  . LYS B 1 204 ? -19.034 20.576  -10.400 1.00 19.05 ? 247  LYS B CG  1 
ATOM   4191  C  CD  . LYS B 1 204 ? -19.412 22.005  -10.004 1.00 18.57 ? 247  LYS B CD  1 
ATOM   4192  C  CE  . LYS B 1 204 ? -20.898 22.098  -9.661  1.00 19.70 ? 247  LYS B CE  1 
ATOM   4193  N  NZ  . LYS B 1 204 ? -21.447 23.487  -9.580  1.00 18.80 ? 247  LYS B NZ  1 
ATOM   4194  N  N   . LEU B 1 205 ? -15.441 18.659  -13.144 1.00 14.06 ? 248  LEU B N   1 
ATOM   4195  C  CA  . LEU B 1 205 ? -14.054 18.341  -13.453 1.00 10.44 ? 248  LEU B CA  1 
ATOM   4196  C  C   . LEU B 1 205 ? -13.643 19.152  -14.669 1.00 11.24 ? 248  LEU B C   1 
ATOM   4197  O  O   . LEU B 1 205 ? -14.476 19.477  -15.531 1.00 9.83  ? 248  LEU B O   1 
ATOM   4198  C  CB  . LEU B 1 205 ? -13.917 16.846  -13.727 1.00 7.95  ? 248  LEU B CB  1 
ATOM   4199  C  CG  . LEU B 1 205 ? -12.601 16.233  -13.295 1.00 6.31  ? 248  LEU B CG  1 
ATOM   4200  C  CD1 . LEU B 1 205 ? -12.702 14.758  -13.230 1.00 3.95  ? 248  LEU B CD1 1 
ATOM   4201  C  CD2 . LEU B 1 205 ? -11.536 16.648  -14.243 1.00 7.64  ? 248  LEU B CD2 1 
ATOM   4202  N  N   . ASP B 1 206 ? -12.355 19.472  -14.745 1.00 11.73 ? 249  ASP B N   1 
ATOM   4203  C  CA  . ASP B 1 206 ? -11.850 20.309  -15.830 1.00 11.97 ? 249  ASP B CA  1 
ATOM   4204  C  C   . ASP B 1 206 ? -10.747 19.760  -16.703 1.00 14.52 ? 249  ASP B C   1 
ATOM   4205  O  O   . ASP B 1 206 ? -10.550 20.261  -17.809 1.00 15.15 ? 249  ASP B O   1 
ATOM   4206  C  CB  . ASP B 1 206 ? -11.374 21.638  -15.262 1.00 7.55  ? 249  ASP B CB  1 
ATOM   4207  C  CG  . ASP B 1 206 ? -12.500 22.475  -14.748 1.00 5.94  ? 249  ASP B CG  1 
ATOM   4208  O  OD1 . ASP B 1 206 ? -13.146 23.139  -15.584 1.00 4.21  ? 249  ASP B OD1 1 
ATOM   4209  O  OD2 . ASP B 1 206 ? -12.750 22.460  -13.517 1.00 5.64  ? 249  ASP B OD2 1 
ATOM   4210  N  N   . MET B 1 207 ? -10.011 18.766  -16.216 1.00 16.21 ? 250  MET B N   1 
ATOM   4211  C  CA  . MET B 1 207 ? -8.915  18.198  -16.995 1.00 18.09 ? 250  MET B CA  1 
ATOM   4212  C  C   . MET B 1 207 ? -8.449  16.903  -16.364 1.00 18.16 ? 250  MET B C   1 
ATOM   4213  O  O   . MET B 1 207 ? -8.578  16.710  -15.159 1.00 17.65 ? 250  MET B O   1 
ATOM   4214  C  CB  . MET B 1 207 ? -7.742  19.184  -17.052 1.00 19.66 ? 250  MET B CB  1 
ATOM   4215  C  CG  . MET B 1 207 ? -6.579  18.759  -17.945 1.00 21.84 ? 250  MET B CG  1 
ATOM   4216  S  SD  . MET B 1 207 ? -5.053  19.693  -17.623 1.00 22.32 ? 250  MET B SD  1 
ATOM   4217  C  CE  . MET B 1 207 ? -5.599  21.359  -17.945 1.00 23.04 ? 250  MET B CE  1 
ATOM   4218  N  N   . LEU B 1 208 ? -7.899  16.020  -17.189 1.00 18.99 ? 251  LEU B N   1 
ATOM   4219  C  CA  . LEU B 1 208 ? -7.402  14.735  -16.719 1.00 18.47 ? 251  LEU B CA  1 
ATOM   4220  C  C   . LEU B 1 208 ? -6.082  14.385  -17.410 1.00 19.17 ? 251  LEU B C   1 
ATOM   4221  O  O   . LEU B 1 208 ? -6.035  14.128  -18.614 1.00 19.74 ? 251  LEU B O   1 
ATOM   4222  C  CB  . LEU B 1 208 ? -8.431  13.647  -17.004 1.00 17.28 ? 251  LEU B CB  1 
ATOM   4223  C  CG  . LEU B 1 208 ? -8.025  12.222  -16.628 1.00 17.58 ? 251  LEU B CG  1 
ATOM   4224  C  CD1 . LEU B 1 208 ? -8.702  11.894  -15.327 1.00 17.25 ? 251  LEU B CD1 1 
ATOM   4225  C  CD2 . LEU B 1 208 ? -8.427  11.218  -17.714 1.00 16.22 ? 251  LEU B CD2 1 
ATOM   4226  N  N   . VAL B 1 209 ? -4.998  14.392  -16.654 1.00 18.92 ? 252  VAL B N   1 
ATOM   4227  C  CA  . VAL B 1 209 ? -3.725  14.043  -17.239 1.00 19.91 ? 252  VAL B CA  1 
ATOM   4228  C  C   . VAL B 1 209 ? -3.749  12.531  -17.108 1.00 20.15 ? 252  VAL B C   1 
ATOM   4229  O  O   . VAL B 1 209 ? -4.404  12.020  -16.205 1.00 22.04 ? 252  VAL B O   1 
ATOM   4230  C  CB  . VAL B 1 209 ? -2.567  14.635  -16.417 1.00 20.40 ? 252  VAL B CB  1 
ATOM   4231  C  CG1 . VAL B 1 209 ? -1.307  14.724  -17.266 1.00 20.86 ? 252  VAL B CG1 1 
ATOM   4232  C  CG2 . VAL B 1 209 ? -2.964  15.995  -15.887 1.00 21.04 ? 252  VAL B CG2 1 
ATOM   4233  N  N   . ALA B 1 210 ? -3.076  11.808  -17.997 1.00 19.74 ? 253  ALA B N   1 
ATOM   4234  C  CA  . ALA B 1 210 ? -3.064  10.351  -17.896 1.00 19.23 ? 253  ALA B CA  1 
ATOM   4235  C  C   . ALA B 1 210 ? -1.917  9.670   -18.646 1.00 19.82 ? 253  ALA B C   1 
ATOM   4236  O  O   . ALA B 1 210 ? -1.758  9.851   -19.852 1.00 20.02 ? 253  ALA B O   1 
ATOM   4237  C  CB  . ALA B 1 210 ? -4.393  9.802   -18.372 1.00 16.89 ? 253  ALA B CB  1 
ATOM   4238  N  N   . SER B 1 211 ? -1.109  8.897   -17.929 1.00 20.12 ? 254  SER B N   1 
ATOM   4239  C  CA  . SER B 1 211 ? -0.009  8.197   -18.566 1.00 21.58 ? 254  SER B CA  1 
ATOM   4240  C  C   . SER B 1 211 ? -0.688  7.164   -19.433 1.00 22.74 ? 254  SER B C   1 
ATOM   4241  O  O   . SER B 1 211 ? -1.745  6.671   -19.051 1.00 22.40 ? 254  SER B O   1 
ATOM   4242  C  CB  . SER B 1 211 ? 0.867   7.493   -17.527 1.00 22.46 ? 254  SER B CB  1 
ATOM   4243  O  OG  . SER B 1 211 ? 1.768   8.392   -16.904 1.00 23.15 ? 254  SER B OG  1 
ATOM   4244  N  N   . VAL B 1 212 ? -0.113  6.830   -20.590 1.00 22.93 ? 255  VAL B N   1 
ATOM   4245  C  CA  . VAL B 1 212 ? -0.755  5.833   -21.438 1.00 22.75 ? 255  VAL B CA  1 
ATOM   4246  C  C   . VAL B 1 212 ? 0.032   4.572   -21.714 1.00 22.93 ? 255  VAL B C   1 
ATOM   4247  O  O   . VAL B 1 212 ? 1.176   4.624   -22.148 1.00 23.48 ? 255  VAL B O   1 
ATOM   4248  C  CB  . VAL B 1 212 ? -1.171  6.403   -22.789 1.00 22.80 ? 255  VAL B CB  1 
ATOM   4249  C  CG1 . VAL B 1 212 ? -2.068  5.393   -23.500 1.00 24.03 ? 255  VAL B CG1 1 
ATOM   4250  C  CG2 . VAL B 1 212 ? -1.902  7.720   -22.606 1.00 22.80 ? 255  VAL B CG2 1 
ATOM   4251  N  N   . GLY B 1 213 ? -0.611  3.436   -21.458 1.00 23.57 ? 256  GLY B N   1 
ATOM   4252  C  CA  . GLY B 1 213 ? 0.007   2.143   -21.693 1.00 24.20 ? 256  GLY B CA  1 
ATOM   4253  C  C   . GLY B 1 213 ? -0.888  1.324   -22.612 1.00 23.87 ? 256  GLY B C   1 
ATOM   4254  O  O   . GLY B 1 213 ? -0.874  1.512   -23.826 1.00 23.55 ? 256  GLY B O   1 
ATOM   4255  N  N   . THR B 1 214 ? -1.670  0.412   -22.049 1.00 22.33 ? 257  THR B N   1 
ATOM   4256  C  CA  . THR B 1 214 ? -2.575  -0.380  -22.875 1.00 22.65 ? 257  THR B CA  1 
ATOM   4257  C  C   . THR B 1 214 ? -3.518  0.607   -23.546 1.00 22.10 ? 257  THR B C   1 
ATOM   4258  O  O   . THR B 1 214 ? -4.081  0.340   -24.599 1.00 21.16 ? 257  THR B O   1 
ATOM   4259  C  CB  . THR B 1 214 ? -3.424  -1.394  -22.033 1.00 23.88 ? 257  THR B CB  1 
ATOM   4260  O  OG1 . THR B 1 214 ? -4.169  -0.699  -21.019 1.00 21.89 ? 257  THR B OG1 1 
ATOM   4261  C  CG2 . THR B 1 214 ? -2.524  -2.447  -21.380 1.00 22.28 ? 257  THR B CG2 1 
ATOM   4262  N  N   . GLY B 1 215 ? -3.657  1.766   -22.920 1.00 22.05 ? 258  GLY B N   1 
ATOM   4263  C  CA  . GLY B 1 215 ? -4.538  2.798   -23.424 1.00 22.10 ? 258  GLY B CA  1 
ATOM   4264  C  C   . GLY B 1 215 ? -5.868  2.641   -22.718 1.00 22.29 ? 258  GLY B C   1 
ATOM   4265  O  O   . GLY B 1 215 ? -6.675  3.567   -22.642 1.00 22.27 ? 258  GLY B O   1 
ATOM   4266  N  N   . GLY B 1 216 ? -6.086  1.453   -22.175 1.00 21.37 ? 259  GLY B N   1 
ATOM   4267  C  CA  . GLY B 1 216 ? -7.334  1.179   -21.498 1.00 21.69 ? 259  GLY B CA  1 
ATOM   4268  C  C   . GLY B 1 216 ? -7.778  2.168   -20.439 1.00 21.91 ? 259  GLY B C   1 
ATOM   4269  O  O   . GLY B 1 216 ? -8.978  2.334   -20.232 1.00 22.99 ? 259  GLY B O   1 
ATOM   4270  N  N   . THR B 1 217 ? -6.837  2.832   -19.770 1.00 21.98 ? 260  THR B N   1 
ATOM   4271  C  CA  . THR B 1 217 ? -7.222  3.766   -18.714 1.00 20.15 ? 260  THR B CA  1 
ATOM   4272  C  C   . THR B 1 217 ? -7.758  5.106   -19.217 1.00 19.44 ? 260  THR B C   1 
ATOM   4273  O  O   . THR B 1 217 ? -8.911  5.454   -18.960 1.00 19.72 ? 260  THR B O   1 
ATOM   4274  C  CB  . THR B 1 217 ? -6.065  4.046   -17.734 1.00 19.10 ? 260  THR B CB  1 
ATOM   4275  O  OG1 . THR B 1 217 ? -5.596  2.826   -17.154 1.00 17.96 ? 260  THR B OG1 1 
ATOM   4276  C  CG2 . THR B 1 217 ? -6.554  4.938   -16.629 1.00 19.36 ? 260  THR B CG2 1 
ATOM   4277  N  N   . ILE B 1 218 ? -6.928  5.861   -19.926 1.00 18.17 ? 261  ILE B N   1 
ATOM   4278  C  CA  . ILE B 1 218 ? -7.361  7.149   -20.428 1.00 16.34 ? 261  ILE B CA  1 
ATOM   4279  C  C   . ILE B 1 218 ? -8.593  6.951   -21.295 1.00 17.16 ? 261  ILE B C   1 
ATOM   4280  O  O   . ILE B 1 218 ? -9.506  7.769   -21.288 1.00 17.46 ? 261  ILE B O   1 
ATOM   4281  C  CB  . ILE B 1 218 ? -6.252  7.829   -21.251 1.00 15.65 ? 261  ILE B CB  1 
ATOM   4282  C  CG1 . ILE B 1 218 ? -6.711  9.220   -21.697 1.00 14.60 ? 261  ILE B CG1 1 
ATOM   4283  C  CG2 . ILE B 1 218 ? -5.885  6.967   -22.430 1.00 15.89 ? 261  ILE B CG2 1 
ATOM   4284  C  CD1 . ILE B 1 218 ? -5.625  10.060  -22.306 1.00 13.44 ? 261  ILE B CD1 1 
ATOM   4285  N  N   . THR B 1 219 ? -8.619  5.847   -22.027 1.00 16.34 ? 262  THR B N   1 
ATOM   4286  C  CA  . THR B 1 219 ? -9.739  5.531   -22.898 1.00 15.82 ? 262  THR B CA  1 
ATOM   4287  C  C   . THR B 1 219 ? -11.028 5.351   -22.098 1.00 17.26 ? 262  THR B C   1 
ATOM   4288  O  O   . THR B 1 219 ? -11.962 6.149   -22.212 1.00 17.61 ? 262  THR B O   1 
ATOM   4289  C  CB  . THR B 1 219 ? -9.462  4.244   -23.680 1.00 15.62 ? 262  THR B CB  1 
ATOM   4290  O  OG1 . THR B 1 219 ? -8.226  4.378   -24.390 1.00 12.69 ? 262  THR B OG1 1 
ATOM   4291  C  CG2 . THR B 1 219 ? -10.585 3.970   -24.656 1.00 14.49 ? 262  THR B CG2 1 
ATOM   4292  N  N   . GLY B 1 220 ? -11.087 4.291   -21.302 1.00 16.59 ? 263  GLY B N   1 
ATOM   4293  C  CA  . GLY B 1 220 ? -12.267 4.069   -20.496 1.00 17.71 ? 263  GLY B CA  1 
ATOM   4294  C  C   . GLY B 1 220 ? -12.717 5.363   -19.846 1.00 18.04 ? 263  GLY B C   1 
ATOM   4295  O  O   . GLY B 1 220 ? -13.884 5.718   -19.877 1.00 16.49 ? 263  GLY B O   1 
ATOM   4296  N  N   . ILE B 1 221 ? -11.778 6.091   -19.264 1.00 20.22 ? 264  ILE B N   1 
ATOM   4297  C  CA  . ILE B 1 221 ? -12.116 7.353   -18.614 1.00 21.72 ? 264  ILE B CA  1 
ATOM   4298  C  C   . ILE B 1 221 ? -12.573 8.400   -19.628 1.00 20.95 ? 264  ILE B C   1 
ATOM   4299  O  O   . ILE B 1 221 ? -13.587 9.062   -19.434 1.00 20.03 ? 264  ILE B O   1 
ATOM   4300  C  CB  . ILE B 1 221 ? -10.908 7.891   -17.784 1.00 21.22 ? 264  ILE B CB  1 
ATOM   4301  C  CG1 . ILE B 1 221 ? -10.677 6.976   -16.576 1.00 20.58 ? 264  ILE B CG1 1 
ATOM   4302  C  CG2 . ILE B 1 221 ? -11.177 9.302   -17.297 1.00 21.74 ? 264  ILE B CG2 1 
ATOM   4303  C  CD1 . ILE B 1 221 ? -9.553  7.411   -15.655 1.00 19.53 ? 264  ILE B CD1 1 
ATOM   4304  N  N   . ALA B 1 222 ? -11.828 8.530   -20.717 1.00 21.19 ? 265  ALA B N   1 
ATOM   4305  C  CA  . ALA B 1 222 ? -12.149 9.503   -21.752 1.00 21.81 ? 265  ALA B CA  1 
ATOM   4306  C  C   . ALA B 1 222 ? -13.568 9.354   -22.275 1.00 21.51 ? 265  ALA B C   1 
ATOM   4307  O  O   . ALA B 1 222 ? -14.305 10.334  -22.367 1.00 21.69 ? 265  ALA B O   1 
ATOM   4308  C  CB  . ALA B 1 222 ? -11.166 9.389   -22.884 1.00 22.43 ? 265  ALA B CB  1 
ATOM   4309  N  N   . ARG B 1 223 ? -13.963 8.141   -22.629 1.00 20.90 ? 266  ARG B N   1 
ATOM   4310  C  CA  . ARG B 1 223 ? -15.322 7.955   -23.116 1.00 20.78 ? 266  ARG B CA  1 
ATOM   4311  C  C   . ARG B 1 223 ? -16.359 8.294   -22.039 1.00 19.40 ? 266  ARG B C   1 
ATOM   4312  O  O   . ARG B 1 223 ? -17.380 8.906   -22.334 1.00 20.56 ? 266  ARG B O   1 
ATOM   4313  C  CB  . ARG B 1 223 ? -15.523 6.522   -23.618 1.00 23.16 ? 266  ARG B CB  1 
ATOM   4314  C  CG  . ARG B 1 223 ? -15.190 6.358   -25.082 1.00 25.59 ? 266  ARG B CG  1 
ATOM   4315  C  CD  . ARG B 1 223 ? -15.120 4.909   -25.531 1.00 24.98 ? 266  ARG B CD  1 
ATOM   4316  N  NE  . ARG B 1 223 ? -14.897 4.884   -26.971 1.00 27.56 ? 266  ARG B NE  1 
ATOM   4317  C  CZ  . ARG B 1 223 ? -14.292 3.907   -27.629 1.00 27.71 ? 266  ARG B CZ  1 
ATOM   4318  N  NH1 . ARG B 1 223 ? -13.838 2.848   -26.978 1.00 25.68 ? 266  ARG B NH1 1 
ATOM   4319  N  NH2 . ARG B 1 223 ? -14.133 4.003   -28.940 1.00 28.26 ? 266  ARG B NH2 1 
ATOM   4320  N  N   . LYS B 1 224 ? -16.102 7.903   -20.795 1.00 17.34 ? 267  LYS B N   1 
ATOM   4321  C  CA  . LYS B 1 224 ? -17.027 8.201   -19.704 1.00 15.27 ? 267  LYS B CA  1 
ATOM   4322  C  C   . LYS B 1 224 ? -16.991 9.693   -19.362 1.00 14.35 ? 267  LYS B C   1 
ATOM   4323  O  O   . LYS B 1 224 ? -18.025 10.326  -19.125 1.00 12.20 ? 267  LYS B O   1 
ATOM   4324  C  CB  . LYS B 1 224 ? -16.650 7.387   -18.466 1.00 15.42 ? 267  LYS B CB  1 
ATOM   4325  C  CG  . LYS B 1 224 ? -17.524 7.643   -17.236 1.00 17.07 ? 267  LYS B CG  1 
ATOM   4326  C  CD  . LYS B 1 224 ? -19.026 7.511   -17.553 1.00 16.76 ? 267  LYS B CD  1 
ATOM   4327  C  CE  . LYS B 1 224 ? -19.690 6.318   -16.846 1.00 15.35 ? 267  LYS B CE  1 
ATOM   4328  N  NZ  . LYS B 1 224 ? -19.339 4.994   -17.419 1.00 12.24 ? 267  LYS B NZ  1 
ATOM   4329  N  N   . LEU B 1 225 ? -15.787 10.250  -19.369 1.00 14.06 ? 268  LEU B N   1 
ATOM   4330  C  CA  . LEU B 1 225 ? -15.603 11.642  -19.039 1.00 14.14 ? 268  LEU B CA  1 
ATOM   4331  C  C   . LEU B 1 225 ? -16.138 12.610  -20.077 1.00 14.65 ? 268  LEU B C   1 
ATOM   4332  O  O   . LEU B 1 225 ? -16.691 13.626  -19.708 1.00 15.00 ? 268  LEU B O   1 
ATOM   4333  C  CB  . LEU B 1 225 ? -14.133 11.924  -18.757 1.00 15.58 ? 268  LEU B CB  1 
ATOM   4334  C  CG  . LEU B 1 225 ? -13.825 13.066  -17.772 1.00 17.61 ? 268  LEU B CG  1 
ATOM   4335  C  CD1 . LEU B 1 225 ? -14.562 12.886  -16.443 1.00 14.87 ? 268  LEU B CD1 1 
ATOM   4336  C  CD2 . LEU B 1 225 ? -12.317 13.093  -17.540 1.00 19.07 ? 268  LEU B CD2 1 
ATOM   4337  N  N   . LYS B 1 226 ? -15.988 12.318  -21.363 1.00 14.74 ? 269  LYS B N   1 
ATOM   4338  C  CA  . LYS B 1 226 ? -16.505 13.229  -22.385 1.00 15.54 ? 269  LYS B CA  1 
ATOM   4339  C  C   . LYS B 1 226 ? -18.021 13.171  -22.403 1.00 17.19 ? 269  LYS B C   1 
ATOM   4340  O  O   . LYS B 1 226 ? -18.676 14.128  -22.800 1.00 17.17 ? 269  LYS B O   1 
ATOM   4341  C  CB  . LYS B 1 226 ? -15.983 12.849  -23.763 1.00 14.82 ? 269  LYS B CB  1 
ATOM   4342  C  CG  . LYS B 1 226 ? -14.475 12.869  -23.864 1.00 18.14 ? 269  LYS B CG  1 
ATOM   4343  C  CD  . LYS B 1 226 ? -14.004 13.551  -25.152 1.00 20.55 ? 269  LYS B CD  1 
ATOM   4344  C  CE  . LYS B 1 226 ? -14.314 15.058  -25.155 1.00 20.77 ? 269  LYS B CE  1 
ATOM   4345  N  NZ  . LYS B 1 226 ? -13.753 15.748  -26.351 1.00 21.70 ? 269  LYS B NZ  1 
ATOM   4346  N  N   . GLU B 1 227 ? -18.550 12.026  -21.956 1.00 19.85 ? 270  GLU B N   1 
ATOM   4347  C  CA  . GLU B 1 227 ? -19.988 11.704  -21.900 1.00 19.97 ? 270  GLU B CA  1 
ATOM   4348  C  C   . GLU B 1 227 ? -20.757 12.406  -20.787 1.00 20.49 ? 270  GLU B C   1 
ATOM   4349  O  O   . GLU B 1 227 ? -21.756 13.074  -21.051 1.00 19.68 ? 270  GLU B O   1 
ATOM   4350  C  CB  . GLU B 1 227 ? -20.174 10.189  -21.740 1.00 20.62 ? 270  GLU B CB  1 
ATOM   4351  C  CG  . GLU B 1 227 ? -20.618 9.438   -22.995 1.00 21.27 ? 270  GLU B CG  1 
ATOM   4352  C  CD  . GLU B 1 227 ? -20.618 7.926   -22.800 1.00 21.84 ? 270  GLU B CD  1 
ATOM   4353  O  OE1 . GLU B 1 227 ? -20.966 7.482   -21.679 1.00 21.16 ? 270  GLU B OE1 1 
ATOM   4354  O  OE2 . GLU B 1 227 ? -20.281 7.190   -23.764 1.00 19.15 ? 270  GLU B OE2 1 
ATOM   4355  N  N   . LYS B 1 228 ? -20.305 12.232  -19.545 1.00 20.40 ? 271  LYS B N   1 
ATOM   4356  C  CA  . LYS B 1 228 ? -20.947 12.863  -18.389 1.00 19.80 ? 271  LYS B CA  1 
ATOM   4357  C  C   . LYS B 1 228 ? -20.454 14.289  -18.173 1.00 19.79 ? 271  LYS B C   1 
ATOM   4358  O  O   . LYS B 1 228 ? -21.258 15.192  -17.951 1.00 19.11 ? 271  LYS B O   1 
ATOM   4359  C  CB  . LYS B 1 228 ? -20.700 12.027  -17.147 1.00 19.15 ? 271  LYS B CB  1 
ATOM   4360  C  CG  . LYS B 1 228 ? -21.316 10.642  -17.264 1.00 22.17 ? 271  LYS B CG  1 
ATOM   4361  C  CD  . LYS B 1 228 ? -22.852 10.590  -17.064 1.00 18.93 ? 271  LYS B CD  1 
ATOM   4362  C  CE  . LYS B 1 228 ? -23.215 9.950   -15.711 1.00 19.59 ? 271  LYS B CE  1 
ATOM   4363  N  NZ  . LYS B 1 228 ? -22.525 8.642   -15.439 1.00 16.30 ? 271  LYS B NZ  1 
ATOM   4364  N  N   . CYS B 1 229 ? -19.137 14.490  -18.203 1.00 21.81 ? 272  CYS B N   1 
ATOM   4365  C  CA  . CYS B 1 229 ? -18.566 15.844  -18.077 1.00 22.81 ? 272  CYS B CA  1 
ATOM   4366  C  C   . CYS B 1 229 ? -18.073 16.220  -19.465 1.00 20.26 ? 272  CYS B C   1 
ATOM   4367  O  O   . CYS B 1 229 ? -16.959 15.846  -19.879 1.00 18.74 ? 272  CYS B O   1 
ATOM   4368  C  CB  . CYS B 1 229 ? -17.384 15.883  -17.083 1.00 26.07 ? 272  CYS B CB  1 
ATOM   4369  S  SG  . CYS B 1 229 ? -17.496 17.185  -15.778 1.00 29.85 ? 272  CYS B SG  1 
ATOM   4370  N  N   . PRO B 1 230 ? -18.904 16.969  -20.198 1.00 18.26 ? 273  PRO B N   1 
ATOM   4371  C  CA  . PRO B 1 230 ? -18.546 17.389  -21.551 1.00 18.83 ? 273  PRO B CA  1 
ATOM   4372  C  C   . PRO B 1 230 ? -17.366 18.334  -21.537 1.00 19.39 ? 273  PRO B C   1 
ATOM   4373  O  O   . PRO B 1 230 ? -16.351 18.095  -22.194 1.00 18.25 ? 273  PRO B O   1 
ATOM   4374  C  CB  . PRO B 1 230 ? -19.808 18.071  -22.059 1.00 18.70 ? 273  PRO B CB  1 
ATOM   4375  C  CG  . PRO B 1 230 ? -20.492 18.514  -20.777 1.00 17.42 ? 273  PRO B CG  1 
ATOM   4376  C  CD  . PRO B 1 230 ? -20.292 17.333  -19.885 1.00 17.54 ? 273  PRO B CD  1 
ATOM   4377  N  N   . GLY B 1 231 ? -17.531 19.428  -20.798 1.00 19.93 ? 274  GLY B N   1 
ATOM   4378  C  CA  . GLY B 1 231 ? -16.499 20.443  -20.700 1.00 21.13 ? 274  GLY B CA  1 
ATOM   4379  C  C   . GLY B 1 231 ? -15.148 19.833  -20.416 1.00 21.87 ? 274  GLY B C   1 
ATOM   4380  O  O   . GLY B 1 231 ? -14.152 20.208  -21.029 1.00 21.37 ? 274  GLY B O   1 
ATOM   4381  N  N   . CYS B 1 232 ? -15.126 18.862  -19.509 1.00 23.28 ? 275  CYS B N   1 
ATOM   4382  C  CA  . CYS B 1 232 ? -13.877 18.216  -19.132 1.00 23.98 ? 275  CYS B CA  1 
ATOM   4383  C  C   . CYS B 1 232 ? -12.943 17.962  -20.313 1.00 23.19 ? 275  CYS B C   1 
ATOM   4384  O  O   . CYS B 1 232 ? -13.374 17.641  -21.409 1.00 23.78 ? 275  CYS B O   1 
ATOM   4385  C  CB  . CYS B 1 232 ? -14.144 16.910  -18.395 1.00 24.52 ? 275  CYS B CB  1 
ATOM   4386  S  SG  . CYS B 1 232 ? -12.635 16.282  -17.669 1.00 26.93 ? 275  CYS B SG  1 
ATOM   4387  N  N   . ARG B 1 233 ? -11.653 18.130  -20.075 1.00 22.66 ? 276  ARG B N   1 
ATOM   4388  C  CA  . ARG B 1 233 ? -10.658 17.933  -21.107 1.00 22.23 ? 276  ARG B CA  1 
ATOM   4389  C  C   . ARG B 1 233 ? -10.147 16.531  -20.958 1.00 21.56 ? 276  ARG B C   1 
ATOM   4390  O  O   . ARG B 1 233 ? -10.778 15.717  -20.287 1.00 24.04 ? 276  ARG B O   1 
ATOM   4391  C  CB  . ARG B 1 233 ? -9.511  18.914  -20.914 1.00 22.43 ? 276  ARG B CB  1 
ATOM   4392  C  CG  . ARG B 1 233 ? -9.901  20.357  -21.136 1.00 24.51 ? 276  ARG B CG  1 
ATOM   4393  C  CD  . ARG B 1 233 ? -9.091  20.928  -22.271 1.00 25.93 ? 276  ARG B CD  1 
ATOM   4394  N  NE  . ARG B 1 233 ? -9.584  20.503  -23.575 1.00 26.25 ? 276  ARG B NE  1 
ATOM   4395  C  CZ  . ARG B 1 233 ? -8.849  20.494  -24.685 1.00 27.15 ? 276  ARG B CZ  1 
ATOM   4396  N  NH1 . ARG B 1 233 ? -7.577  20.879  -24.648 1.00 28.62 ? 276  ARG B NH1 1 
ATOM   4397  N  NH2 . ARG B 1 233 ? -9.392  20.127  -25.841 1.00 25.89 ? 276  ARG B NH2 1 
ATOM   4398  N  N   . ILE B 1 234 ? -9.016  16.252  -21.598 1.00 18.56 ? 277  ILE B N   1 
ATOM   4399  C  CA  . ILE B 1 234 ? -8.367  14.952  -21.523 1.00 15.22 ? 277  ILE B CA  1 
ATOM   4400  C  C   . ILE B 1 234 ? -6.921  15.130  -21.993 1.00 15.30 ? 277  ILE B C   1 
ATOM   4401  O  O   . ILE B 1 234 ? -6.677  15.627  -23.083 1.00 16.04 ? 277  ILE B O   1 
ATOM   4402  C  CB  . ILE B 1 234 ? -9.045  13.894  -22.426 1.00 13.30 ? 277  ILE B CB  1 
ATOM   4403  C  CG1 . ILE B 1 234 ? -10.483 13.619  -21.981 1.00 11.10 ? 277  ILE B CG1 1 
ATOM   4404  C  CG2 . ILE B 1 234 ? -8.246  12.608  -22.372 1.00 13.21 ? 277  ILE B CG2 1 
ATOM   4405  C  CD1 . ILE B 1 234 ? -10.606 12.977  -20.622 1.00 7.40  ? 277  ILE B CD1 1 
ATOM   4406  N  N   . ILE B 1 235 ? -5.966  14.734  -21.163 1.00 13.02 ? 278  ILE B N   1 
ATOM   4407  C  CA  . ILE B 1 235 ? -4.570  14.845  -21.510 1.00 11.85 ? 278  ILE B CA  1 
ATOM   4408  C  C   . ILE B 1 235 ? -3.949  13.499  -21.200 1.00 12.62 ? 278  ILE B C   1 
ATOM   4409  O  O   . ILE B 1 235 ? -4.155  12.937  -20.121 1.00 11.15 ? 278  ILE B O   1 
ATOM   4410  C  CB  . ILE B 1 235 ? -3.860  15.945  -20.667 1.00 13.23 ? 278  ILE B CB  1 
ATOM   4411  C  CG1 . ILE B 1 235 ? -4.487  17.315  -20.944 1.00 12.22 ? 278  ILE B CG1 1 
ATOM   4412  C  CG2 . ILE B 1 235 ? -2.356  15.986  -20.998 1.00 11.06 ? 278  ILE B CG2 1 
ATOM   4413  C  CD1 . ILE B 1 235 ? -3.910  18.036  -22.166 1.00 11.35 ? 278  ILE B CD1 1 
ATOM   4414  N  N   . GLY B 1 236 ? -3.189  12.985  -22.155 1.00 13.44 ? 279  GLY B N   1 
ATOM   4415  C  CA  . GLY B 1 236 ? -2.539  11.705  -21.979 1.00 13.99 ? 279  GLY B CA  1 
ATOM   4416  C  C   . GLY B 1 236 ? -1.060  11.870  -22.232 1.00 15.12 ? 279  GLY B C   1 
ATOM   4417  O  O   . GLY B 1 236 ? -0.657  12.725  -23.028 1.00 14.26 ? 279  GLY B O   1 
ATOM   4418  N  N   . VAL B 1 237 ? -0.264  11.043  -21.559 1.00 16.17 ? 280  VAL B N   1 
ATOM   4419  C  CA  . VAL B 1 237 ? 1.190   11.085  -21.652 1.00 17.86 ? 280  VAL B CA  1 
ATOM   4420  C  C   . VAL B 1 237 ? 1.781   9.828   -22.276 1.00 20.01 ? 280  VAL B C   1 
ATOM   4421  O  O   . VAL B 1 237 ? 1.469   8.718   -21.854 1.00 19.84 ? 280  VAL B O   1 
ATOM   4422  C  CB  . VAL B 1 237 ? 1.819   11.265  -20.246 1.00 17.30 ? 280  VAL B CB  1 
ATOM   4423  C  CG1 . VAL B 1 237 ? 3.333   11.090  -20.312 1.00 14.53 ? 280  VAL B CG1 1 
ATOM   4424  C  CG2 . VAL B 1 237 ? 1.441   12.631  -19.683 1.00 16.52 ? 280  VAL B CG2 1 
ATOM   4425  N  N   . ASP B 1 238 ? 2.646   10.029  -23.272 1.00 21.72 ? 281  ASP B N   1 
ATOM   4426  C  CA  . ASP B 1 238 ? 3.330   8.954   -23.997 1.00 22.17 ? 281  ASP B CA  1 
ATOM   4427  C  C   . ASP B 1 238 ? 4.831   9.251   -23.878 1.00 22.49 ? 281  ASP B C   1 
ATOM   4428  O  O   . ASP B 1 238 ? 5.276   10.340  -24.216 1.00 22.02 ? 281  ASP B O   1 
ATOM   4429  C  CB  . ASP B 1 238 ? 2.898   8.973   -25.473 1.00 21.95 ? 281  ASP B CB  1 
ATOM   4430  C  CG  . ASP B 1 238 ? 3.411   7.772   -26.268 1.00 22.85 ? 281  ASP B CG  1 
ATOM   4431  O  OD1 . ASP B 1 238 ? 3.260   7.778   -27.505 1.00 23.07 ? 281  ASP B OD1 1 
ATOM   4432  O  OD2 . ASP B 1 238 ? 3.954   6.819   -25.672 1.00 22.15 ? 281  ASP B OD2 1 
ATOM   4433  N  N   . PRO B 1 239 ? 5.626   8.287   -23.392 1.00 22.99 ? 282  PRO B N   1 
ATOM   4434  C  CA  . PRO B 1 239 ? 7.065   8.510   -23.250 1.00 24.36 ? 282  PRO B CA  1 
ATOM   4435  C  C   . PRO B 1 239 ? 7.799   8.783   -24.560 1.00 25.03 ? 282  PRO B C   1 
ATOM   4436  O  O   . PRO B 1 239 ? 7.276   8.508   -25.637 1.00 23.39 ? 282  PRO B O   1 
ATOM   4437  C  CB  . PRO B 1 239 ? 7.547   7.218   -22.583 1.00 24.05 ? 282  PRO B CB  1 
ATOM   4438  C  CG  . PRO B 1 239 ? 6.638   6.203   -23.141 1.00 22.30 ? 282  PRO B CG  1 
ATOM   4439  C  CD  . PRO B 1 239 ? 5.290   6.899   -23.037 1.00 22.73 ? 282  PRO B CD  1 
ATOM   4440  N  N   . GLU B 1 240 ? 9.002   9.349   -24.457 1.00 26.40 ? 283  GLU B N   1 
ATOM   4441  C  CA  . GLU B 1 240 ? 9.808   9.606   -25.637 1.00 26.48 ? 283  GLU B CA  1 
ATOM   4442  C  C   . GLU B 1 240 ? 10.261  8.218   -25.999 1.00 27.44 ? 283  GLU B C   1 
ATOM   4443  O  O   . GLU B 1 240 ? 10.336  7.354   -25.123 1.00 27.52 ? 283  GLU B O   1 
ATOM   4444  C  CB  . GLU B 1 240 ? 11.028  10.460  -25.318 1.00 26.70 ? 283  GLU B CB  1 
ATOM   4445  C  CG  . GLU B 1 240 ? 10.763  11.944  -25.164 1.00 26.26 ? 283  GLU B CG  1 
ATOM   4446  C  CD  . GLU B 1 240 ? 12.044  12.738  -24.981 1.00 26.25 ? 283  GLU B CD  1 
ATOM   4447  O  OE1 . GLU B 1 240 ? 11.950  13.977  -24.849 1.00 26.90 ? 283  GLU B OE1 1 
ATOM   4448  O  OE2 . GLU B 1 240 ? 13.139  12.122  -24.972 1.00 25.10 ? 283  GLU B OE2 1 
ATOM   4449  N  N   . GLY B 1 241 ? 10.564  8.002   -27.275 1.00 28.10 ? 284  GLY B N   1 
ATOM   4450  C  CA  . GLY B 1 241 ? 10.976  6.681   -27.711 1.00 28.95 ? 284  GLY B CA  1 
ATOM   4451  C  C   . GLY B 1 241 ? 9.772   5.748   -27.753 1.00 29.68 ? 284  GLY B C   1 
ATOM   4452  O  O   . GLY B 1 241 ? 9.913   4.534   -27.568 1.00 30.31 ? 284  GLY B O   1 
ATOM   4453  N  N   . SER B 1 242 ? 8.595   6.338   -27.979 1.00 29.41 ? 285  SER B N   1 
ATOM   4454  C  CA  . SER B 1 242 ? 7.305   5.641   -28.077 1.00 29.25 ? 285  SER B CA  1 
ATOM   4455  C  C   . SER B 1 242 ? 6.434   6.369   -29.113 1.00 29.75 ? 285  SER B C   1 
ATOM   4456  O  O   . SER B 1 242 ? 6.599   7.571   -29.334 1.00 30.77 ? 285  SER B O   1 
ATOM   4457  C  CB  . SER B 1 242 ? 6.591   5.599   -26.722 1.00 28.59 ? 285  SER B CB  1 
ATOM   4458  O  OG  . SER B 1 242 ? 5.230   5.227   -26.872 1.00 28.36 ? 285  SER B OG  1 
ATOM   4459  N  N   . ILE B 1 243 ? 5.499   5.659   -29.769 1.00 29.67 ? 286  ILE B N   1 
ATOM   4460  C  CA  . ILE B 1 243 ? 4.657   6.306   -30.797 1.00 29.45 ? 286  ILE B CA  1 
ATOM   4461  C  C   . ILE B 1 243 ? 3.148   6.289   -30.521 1.00 28.57 ? 286  ILE B C   1 
ATOM   4462  O  O   . ILE B 1 243 ? 2.380   6.676   -31.399 1.00 27.24 ? 286  ILE B O   1 
ATOM   4463  C  CB  . ILE B 1 243 ? 4.930   5.629   -32.155 1.00 30.43 ? 286  ILE B CB  1 
ATOM   4464  C  CG1 . ILE B 1 243 ? 4.950   4.093   -32.042 1.00 31.24 ? 286  ILE B CG1 1 
ATOM   4465  C  CG2 . ILE B 1 243 ? 6.234   6.132   -32.738 1.00 28.69 ? 286  ILE B CG2 1 
ATOM   4466  C  CD1 . ILE B 1 243 ? 3.645   3.511   -31.559 1.00 30.89 ? 286  ILE B CD1 1 
ATOM   4467  N  N   . LEU B 1 244 ? 2.719   5.843   -29.334 1.00 27.96 ? 287  LEU B N   1 
ATOM   4468  C  CA  . LEU B 1 244 ? 1.300   5.851   -29.017 1.00 27.91 ? 287  LEU B CA  1 
ATOM   4469  C  C   . LEU B 1 244 ? 0.982   7.300   -28.632 1.00 28.17 ? 287  LEU B C   1 
ATOM   4470  O  O   . LEU B 1 244 ? 0.483   7.585   -27.533 1.00 29.65 ? 287  LEU B O   1 
ATOM   4471  C  CB  . LEU B 1 244 ? 0.931   4.903   -27.874 1.00 28.90 ? 287  LEU B CB  1 
ATOM   4472  C  CG  . LEU B 1 244 ? 1.863   3.736   -27.546 1.00 31.15 ? 287  LEU B CG  1 
ATOM   4473  C  CD1 . LEU B 1 244 ? 1.499   3.083   -26.220 1.00 30.65 ? 287  LEU B CD1 1 
ATOM   4474  C  CD2 . LEU B 1 244 ? 1.824   2.714   -28.675 1.00 32.32 ? 287  LEU B CD2 1 
ATOM   4475  N  N   . ALA B 1 245 ? 1.291   8.177   -29.577 1.00 28.58 ? 288  ALA B N   1 
ATOM   4476  C  CA  . ALA B 1 245 ? 1.195   9.633   -29.391 1.00 28.66 ? 288  ALA B CA  1 
ATOM   4477  C  C   . ALA B 1 245 ? 0.867   10.417  -30.650 1.00 29.29 ? 288  ALA B C   1 
ATOM   4478  O  O   . ALA B 1 245 ? 1.345   10.144  -31.754 1.00 29.08 ? 288  ALA B O   1 
ATOM   4479  C  CB  . ALA B 1 245 ? 2.467   10.149  -28.758 1.00 28.16 ? 288  ALA B CB  1 
ATOM   4480  N  N   . GLU B 1 246 ? 0.021   11.417  -30.457 1.00 29.47 ? 289  GLU B N   1 
ATOM   4481  C  CA  . GLU B 1 246 ? -0.460  12.197  -31.618 1.00 29.58 ? 289  GLU B CA  1 
ATOM   4482  C  C   . GLU B 1 246 ? 0.022   13.688  -31.681 1.00 30.31 ? 289  GLU B C   1 
ATOM   4483  O  O   . GLU B 1 246 ? 0.055   14.419  -30.695 1.00 30.99 ? 289  GLU B O   1 
ATOM   4484  C  CB  . GLU B 1 246 ? -1.972  12.080  -31.669 1.00 28.83 ? 289  GLU B CB  1 
ATOM   4485  C  CG  . GLU B 1 246 ? -2.315  10.678  -32.109 1.00 29.89 ? 289  GLU B CG  1 
ATOM   4486  C  CD  . GLU B 1 246 ? -3.748  10.498  -32.489 1.00 28.53 ? 289  GLU B CD  1 
ATOM   4487  O  OE1 . GLU B 1 246 ? -4.048  10.531  -33.696 1.00 28.46 ? 289  GLU B OE1 1 
ATOM   4488  O  OE2 . GLU B 1 246 ? -4.582  10.311  -31.581 1.00 26.65 ? 289  GLU B OE2 1 
ATOM   4489  N  N   . PRO B 1 247 ? 0.370   14.025  -32.931 1.00 30.27 ? 290  PRO B N   1 
ATOM   4490  C  CA  . PRO B 1 247 ? 0.752   14.438  -34.244 1.00 29.38 ? 290  PRO B CA  1 
ATOM   4491  C  C   . PRO B 1 247 ? 2.050   13.677  -34.347 1.00 30.11 ? 290  PRO B C   1 
ATOM   4492  O  O   . PRO B 1 247 ? 2.958   13.954  -33.569 1.00 29.45 ? 290  PRO B O   1 
ATOM   4493  C  CB  . PRO B 1 247 ? 0.826   15.891  -34.104 1.00 28.96 ? 290  PRO B CB  1 
ATOM   4494  C  CG  . PRO B 1 247 ? -0.565  16.041  -33.539 1.00 28.46 ? 290  PRO B CG  1 
ATOM   4495  C  CD  . PRO B 1 247 ? -0.564  15.137  -32.506 1.00 29.17 ? 290  PRO B CD  1 
ATOM   4496  N  N   . GLU B 1 248 ? 2.108   12.717  -35.280 1.00 30.55 ? 291  GLU B N   1 
ATOM   4497  C  CA  . GLU B 1 248 ? 3.282   11.861  -35.448 1.00 31.57 ? 291  GLU B CA  1 
ATOM   4498  C  C   . GLU B 1 248 ? 4.552   12.617  -35.072 1.00 31.76 ? 291  GLU B C   1 
ATOM   4499  O  O   . GLU B 1 248 ? 5.333   12.113  -34.279 1.00 31.42 ? 291  GLU B O   1 
ATOM   4500  C  CB  . GLU B 1 248 ? 3.289   11.275  -36.875 1.00 32.11 ? 291  GLU B CB  1 
ATOM   4501  C  CG  . GLU B 1 248 ? 4.217   10.062  -37.061 1.00 34.10 ? 291  GLU B CG  1 
ATOM   4502  C  CD  . GLU B 1 248 ? 4.112   9.014   -35.938 1.00 34.44 ? 291  GLU B CD  1 
ATOM   4503  O  OE1 . GLU B 1 248 ? 3.303   8.066   -36.045 1.00 37.04 ? 291  GLU B OE1 1 
ATOM   4504  O  OE2 . GLU B 1 248 ? 4.838   9.144   -34.933 1.00 31.10 ? 291  GLU B OE2 1 
ATOM   4505  N  N   . GLU B 1 249 ? 4.732   13.825  -35.593 1.00 32.03 ? 292  GLU B N   1 
ATOM   4506  C  CA  . GLU B 1 249 ? 5.922   14.624  -35.277 1.00 32.81 ? 292  GLU B CA  1 
ATOM   4507  C  C   . GLU B 1 249 ? 6.406   14.470  -33.820 1.00 33.39 ? 292  GLU B C   1 
ATOM   4508  O  O   . GLU B 1 249 ? 7.611   14.371  -33.574 1.00 31.71 ? 292  GLU B O   1 
ATOM   4509  C  CB  . GLU B 1 249 ? 5.669   16.110  -35.564 1.00 32.78 ? 292  GLU B CB  1 
ATOM   4510  C  CG  . GLU B 1 249 ? 4.995   16.387  -36.893 1.00 32.41 ? 292  GLU B CG  1 
ATOM   4511  C  CD  . GLU B 1 249 ? 3.490   16.168  -36.837 1.00 33.47 ? 292  GLU B CD  1 
ATOM   4512  O  OE1 . GLU B 1 249 ? 2.730   17.145  -37.024 1.00 31.98 ? 292  GLU B OE1 1 
ATOM   4513  O  OE2 . GLU B 1 249 ? 3.062   15.019  -36.601 1.00 33.29 ? 292  GLU B OE2 1 
ATOM   4514  N  N   . LEU B 1 250 ? 5.439   14.422  -32.864 1.00 34.21 ? 293  LEU B N   1 
ATOM   4515  C  CA  . LEU B 1 250 ? 5.755   14.319  -31.433 1.00 35.05 ? 293  LEU B CA  1 
ATOM   4516  C  C   . LEU B 1 250 ? 6.544   13.056  -31.044 1.00 36.36 ? 293  LEU B C   1 
ATOM   4517  O  O   . LEU B 1 250 ? 7.009   12.966  -29.909 1.00 35.71 ? 293  LEU B O   1 
ATOM   4518  C  CB  . LEU B 1 250 ? 4.488   14.523  -30.619 1.00 33.72 ? 293  LEU B CB  1 
ATOM   4519  C  CG  . LEU B 1 250 ? 4.151   15.975  -30.247 1.00 34.17 ? 293  LEU B CG  1 
ATOM   4520  C  CD1 . LEU B 1 250 ? 2.819   16.059  -29.529 1.00 32.31 ? 293  LEU B CD1 1 
ATOM   4521  C  CD2 . LEU B 1 250 ? 5.243   16.583  -29.379 1.00 35.27 ? 293  LEU B CD2 1 
ATOM   4522  N  N   . ASN B 1 251 ? 6.652   12.119  -31.976 1.00 38.65 ? 294  ASN B N   1 
ATOM   4523  C  CA  . ASN B 1 251 ? 7.353   10.904  -31.681 1.00 41.67 ? 294  ASN B CA  1 
ATOM   4524  C  C   . ASN B 1 251 ? 8.675   10.759  -32.417 1.00 44.35 ? 294  ASN B C   1 
ATOM   4525  O  O   . ASN B 1 251 ? 9.060   9.660   -32.806 1.00 45.87 ? 294  ASN B O   1 
ATOM   4526  C  CB  . ASN B 1 251 ? 6.420   9.711   -31.920 1.00 40.38 ? 294  ASN B CB  1 
ATOM   4527  C  CG  . ASN B 1 251 ? 5.319   9.598   -30.864 1.00 39.66 ? 294  ASN B CG  1 
ATOM   4528  O  OD1 . ASN B 1 251 ? 5.524   9.004   -29.804 1.00 38.84 ? 294  ASN B OD1 1 
ATOM   4529  N  ND2 . ASN B 1 251 ? 4.158   10.161  -31.154 1.00 37.81 ? 294  ASN B ND2 1 
ATOM   4530  N  N   . GLN B 1 252 ? 9.386   11.866  -32.618 1.00 47.03 ? 295  GLN B N   1 
ATOM   4531  C  CA  . GLN B 1 252 ? 10.769  11.773  -33.156 1.00 49.11 ? 295  GLN B CA  1 
ATOM   4532  C  C   . GLN B 1 252 ? 11.996  12.176  -32.326 1.00 50.21 ? 295  GLN B C   1 
ATOM   4533  O  O   . GLN B 1 252 ? 12.302  13.361  -32.182 1.00 50.08 ? 295  GLN B O   1 
ATOM   4534  C  CB  . GLN B 1 252 ? 10.700  12.692  -34.374 1.00 49.79 ? 295  GLN B CB  1 
ATOM   4535  C  CG  . GLN B 1 252 ? 9.681   12.324  -35.430 1.00 50.19 ? 295  GLN B CG  1 
ATOM   4536  C  CD  . GLN B 1 252 ? 9.747   13.278  -36.610 1.00 50.67 ? 295  GLN B CD  1 
ATOM   4537  O  OE1 . GLN B 1 252 ? 10.799  13.430  -37.240 1.00 50.81 ? 295  GLN B OE1 1 
ATOM   4538  N  NE2 . GLN B 1 252 ? 8.626   13.934  -36.912 1.00 52.35 ? 295  GLN B NE2 1 
ATOM   4539  N  N   . THR B 1 253 ? 12.710  11.189  -31.801 1.00 51.08 ? 296  THR B N   1 
ATOM   4540  C  CA  . THR B 1 253 ? 13.896  11.471  -31.012 1.00 51.41 ? 296  THR B CA  1 
ATOM   4541  C  C   . THR B 1 253 ? 14.922  10.363  -31.147 1.00 51.62 ? 296  THR B C   1 
ATOM   4542  O  O   . THR B 1 253 ? 14.565  9.192   -31.275 1.00 51.39 ? 296  THR B O   1 
ATOM   4543  C  CB  . THR B 1 253 ? 13.560  11.619  -29.527 1.00 52.18 ? 296  THR B CB  1 
ATOM   4544  O  OG1 . THR B 1 253 ? 14.771  11.837  -28.790 1.00 52.37 ? 296  THR B OG1 1 
ATOM   4545  C  CG2 . THR B 1 253 ? 12.872  10.359  -29.007 1.00 51.44 ? 296  THR B CG2 1 
ATOM   4546  N  N   . GLU B 1 254 ? 16.199  10.737  -31.109 1.00 51.53 ? 297  GLU B N   1 
ATOM   4547  C  CA  . GLU B 1 254 ? 17.281  9.764   -31.220 1.00 51.63 ? 297  GLU B CA  1 
ATOM   4548  C  C   . GLU B 1 254 ? 17.375  8.929   -29.952 1.00 51.40 ? 297  GLU B C   1 
ATOM   4549  O  O   . GLU B 1 254 ? 18.356  8.226   -29.724 1.00 51.61 ? 297  GLU B O   1 
ATOM   4550  C  CB  . GLU B 1 254 ? 18.624  10.458  -31.498 1.00 52.15 ? 297  GLU B CB  1 
ATOM   4551  C  CG  . GLU B 1 254 ? 18.824  10.919  -32.953 1.00 52.17 ? 297  GLU B CG  1 
ATOM   4552  C  CD  . GLU B 1 254 ? 18.603  9.800   -33.972 1.00 51.45 ? 297  GLU B CD  1 
ATOM   4553  O  OE1 . GLU B 1 254 ? 19.049  8.660   -33.710 1.00 50.98 ? 297  GLU B OE1 1 
ATOM   4554  O  OE2 . GLU B 1 254 ? 17.995  10.066  -35.035 1.00 49.84 ? 297  GLU B OE2 1 
ATOM   4555  N  N   . GLN B 1 255 ? 16.347  9.028   -29.121 1.00 51.26 ? 298  GLN B N   1 
ATOM   4556  C  CA  . GLN B 1 255 ? 16.285  8.254   -27.894 1.00 51.58 ? 298  GLN B CA  1 
ATOM   4557  C  C   . GLN B 1 255 ? 15.332  7.106   -28.215 1.00 51.54 ? 298  GLN B C   1 
ATOM   4558  O  O   . GLN B 1 255 ? 14.223  7.332   -28.726 1.00 50.61 ? 298  GLN B O   1 
ATOM   4559  C  CB  . GLN B 1 255 ? 15.728  9.106   -26.760 1.00 52.37 ? 298  GLN B CB  1 
ATOM   4560  C  CG  . GLN B 1 255 ? 15.683  8.402   -25.431 1.00 53.30 ? 298  GLN B CG  1 
ATOM   4561  C  CD  . GLN B 1 255 ? 14.325  8.502   -24.789 1.00 52.64 ? 298  GLN B CD  1 
ATOM   4562  O  OE1 . GLN B 1 255 ? 13.739  9.580   -24.722 1.00 52.08 ? 298  GLN B OE1 1 
ATOM   4563  N  NE2 . GLN B 1 255 ? 13.816  7.378   -24.306 1.00 50.94 ? 298  GLN B NE2 1 
ATOM   4564  N  N   . THR B 1 256 ? 15.751  5.878   -27.924 1.00 50.38 ? 299  THR B N   1 
ATOM   4565  C  CA  . THR B 1 256 ? 14.911  4.734   -28.244 1.00 50.07 ? 299  THR B CA  1 
ATOM   4566  C  C   . THR B 1 256 ? 14.473  3.865   -27.068 1.00 49.63 ? 299  THR B C   1 
ATOM   4567  O  O   . THR B 1 256 ? 13.516  3.095   -27.188 1.00 49.69 ? 299  THR B O   1 
ATOM   4568  C  CB  . THR B 1 256 ? 15.608  3.853   -29.287 1.00 50.47 ? 299  THR B CB  1 
ATOM   4569  O  OG1 . THR B 1 256 ? 15.932  4.653   -30.432 1.00 50.21 ? 299  THR B OG1 1 
ATOM   4570  C  CG2 . THR B 1 256 ? 14.701  2.706   -29.713 1.00 51.59 ? 299  THR B CG2 1 
ATOM   4571  N  N   . THR B 1 257 ? 15.151  3.989   -25.932 1.00 47.96 ? 300  THR B N   1 
ATOM   4572  C  CA  . THR B 1 257 ? 14.790  3.185   -24.775 1.00 46.93 ? 300  THR B CA  1 
ATOM   4573  C  C   . THR B 1 257 ? 14.639  3.992   -23.498 1.00 45.98 ? 300  THR B C   1 
ATOM   4574  O  O   . THR B 1 257 ? 15.570  4.673   -23.061 1.00 46.35 ? 300  THR B O   1 
ATOM   4575  C  CB  . THR B 1 257 ? 15.817  2.072   -24.529 1.00 46.43 ? 300  THR B CB  1 
ATOM   4576  O  OG1 . THR B 1 257 ? 15.905  1.253   -25.695 1.00 45.57 ? 300  THR B OG1 1 
ATOM   4577  C  CG2 . THR B 1 257 ? 15.397  1.202   -23.358 1.00 45.61 ? 300  THR B CG2 1 
ATOM   4578  N  N   . TYR B 1 258 ? 13.451  3.892   -22.906 1.00 44.62 ? 301  TYR B N   1 
ATOM   4579  C  CA  . TYR B 1 258 ? 13.121  4.581   -21.667 1.00 41.79 ? 301  TYR B CA  1 
ATOM   4580  C  C   . TYR B 1 258 ? 13.125  3.588   -20.502 1.00 39.22 ? 301  TYR B C   1 
ATOM   4581  O  O   . TYR B 1 258 ? 12.743  2.429   -20.665 1.00 39.79 ? 301  TYR B O   1 
ATOM   4582  C  CB  . TYR B 1 258 ? 11.756  5.260   -21.811 1.00 42.33 ? 301  TYR B CB  1 
ATOM   4583  C  CG  . TYR B 1 258 ? 10.679  4.389   -22.421 1.00 43.19 ? 301  TYR B CG  1 
ATOM   4584  C  CD1 . TYR B 1 258 ? 9.980   3.464   -21.648 1.00 43.94 ? 301  TYR B CD1 1 
ATOM   4585  C  CD2 . TYR B 1 258 ? 10.359  4.491   -23.775 1.00 43.75 ? 301  TYR B CD2 1 
ATOM   4586  C  CE1 . TYR B 1 258 ? 8.986   2.661   -22.205 1.00 44.97 ? 301  TYR B CE1 1 
ATOM   4587  C  CE2 . TYR B 1 258 ? 9.368   3.693   -24.344 1.00 44.05 ? 301  TYR B CE2 1 
ATOM   4588  C  CZ  . TYR B 1 258 ? 8.685   2.778   -23.554 1.00 44.35 ? 301  TYR B CZ  1 
ATOM   4589  O  OH  . TYR B 1 258 ? 7.714   1.973   -24.112 1.00 43.21 ? 301  TYR B OH  1 
ATOM   4590  N  N   . GLU B 1 259 ? 13.574  4.041   -19.334 1.00 35.84 ? 302  GLU B N   1 
ATOM   4591  C  CA  . GLU B 1 259 ? 13.646  3.182   -18.152 1.00 33.22 ? 302  GLU B CA  1 
ATOM   4592  C  C   . GLU B 1 259 ? 12.296  3.123   -17.426 1.00 32.10 ? 302  GLU B C   1 
ATOM   4593  O  O   . GLU B 1 259 ? 12.082  2.264   -16.559 1.00 31.76 ? 302  GLU B O   1 
ATOM   4594  C  CB  . GLU B 1 259 ? 14.733  3.694   -17.184 1.00 32.59 ? 302  GLU B CB  1 
ATOM   4595  C  CG  . GLU B 1 259 ? 16.159  3.801   -17.751 1.00 28.68 ? 302  GLU B CG  1 
ATOM   4596  C  CD  . GLU B 1 259 ? 16.886  2.465   -17.847 1.00 28.59 ? 302  GLU B CD  1 
ATOM   4597  O  OE1 . GLU B 1 259 ? 17.003  1.759   -16.827 1.00 28.91 ? 302  GLU B OE1 1 
ATOM   4598  O  OE2 . GLU B 1 259 ? 17.358  2.117   -18.947 1.00 30.68 ? 302  GLU B OE2 1 
ATOM   4599  N  N   . VAL B 1 260 ? 11.401  4.045   -17.790 1.00 30.41 ? 303  VAL B N   1 
ATOM   4600  C  CA  . VAL B 1 260 ? 10.063  4.134   -17.195 1.00 28.58 ? 303  VAL B CA  1 
ATOM   4601  C  C   . VAL B 1 260 ? 9.288   2.837   -17.414 1.00 28.08 ? 303  VAL B C   1 
ATOM   4602  O  O   . VAL B 1 260 ? 9.430   2.187   -18.450 1.00 27.52 ? 303  VAL B O   1 
ATOM   4603  C  CB  . VAL B 1 260 ? 9.256   5.312   -17.793 1.00 28.44 ? 303  VAL B CB  1 
ATOM   4604  C  CG1 . VAL B 1 260 ? 7.954   5.490   -17.026 1.00 28.30 ? 303  VAL B CG1 1 
ATOM   4605  C  CG2 . VAL B 1 260 ? 10.080  6.586   -17.753 1.00 25.74 ? 303  VAL B CG2 1 
ATOM   4606  N  N   . GLU B 1 261 ? 8.461   2.475   -16.436 1.00 28.16 ? 304  GLU B N   1 
ATOM   4607  C  CA  . GLU B 1 261 ? 7.696   1.234   -16.495 1.00 28.00 ? 304  GLU B CA  1 
ATOM   4608  C  C   . GLU B 1 261 ? 6.181   1.373   -16.460 1.00 28.65 ? 304  GLU B C   1 
ATOM   4609  O  O   . GLU B 1 261 ? 5.617   2.027   -15.574 1.00 30.05 ? 304  GLU B O   1 
ATOM   4610  C  CB  . GLU B 1 261 ? 8.133   0.310   -15.358 1.00 26.24 ? 304  GLU B CB  1 
ATOM   4611  C  CG  . GLU B 1 261 ? 9.609   0.000   -15.368 1.00 25.82 ? 304  GLU B CG  1 
ATOM   4612  C  CD  . GLU B 1 261 ? 9.927   -1.307  -14.680 1.00 27.20 ? 304  GLU B CD  1 
ATOM   4613  O  OE1 . GLU B 1 261 ? 10.287  -1.294  -13.481 1.00 27.65 ? 304  GLU B OE1 1 
ATOM   4614  O  OE2 . GLU B 1 261 ? 9.804   -2.356  -15.344 1.00 27.98 ? 304  GLU B OE2 1 
ATOM   4615  N  N   . GLY B 1 262 ? 5.531   0.729   -17.426 1.00 28.81 ? 305  GLY B N   1 
ATOM   4616  C  CA  . GLY B 1 262 ? 4.081   0.759   -17.509 1.00 28.19 ? 305  GLY B CA  1 
ATOM   4617  C  C   . GLY B 1 262 ? 3.477   1.654   -18.581 1.00 28.35 ? 305  GLY B C   1 
ATOM   4618  O  O   . GLY B 1 262 ? 2.323   1.476   -18.960 1.00 27.88 ? 305  GLY B O   1 
ATOM   4619  N  N   . ILE B 1 263 ? 4.235   2.623   -19.082 1.00 28.38 ? 306  ILE B N   1 
ATOM   4620  C  CA  . ILE B 1 263 ? 3.684   3.509   -20.092 1.00 28.30 ? 306  ILE B CA  1 
ATOM   4621  C  C   . ILE B 1 263 ? 4.355   3.298   -21.420 1.00 29.31 ? 306  ILE B C   1 
ATOM   4622  O  O   . ILE B 1 263 ? 5.349   2.584   -21.506 1.00 29.03 ? 306  ILE B O   1 
ATOM   4623  C  CB  . ILE B 1 263 ? 3.843   5.002   -19.710 1.00 26.69 ? 306  ILE B CB  1 
ATOM   4624  C  CG1 . ILE B 1 263 ? 5.318   5.392   -19.731 1.00 26.15 ? 306  ILE B CG1 1 
ATOM   4625  C  CG2 . ILE B 1 263 ? 3.238   5.259   -18.339 1.00 25.41 ? 306  ILE B CG2 1 
ATOM   4626  C  CD1 . ILE B 1 263 ? 5.552   6.866   -19.523 1.00 25.04 ? 306  ILE B CD1 1 
ATOM   4627  N  N   . GLY B 1 264 ? 3.779   3.926   -22.444 1.00 30.92 ? 307  GLY B N   1 
ATOM   4628  C  CA  . GLY B 1 264 ? 4.300   3.871   -23.798 1.00 33.11 ? 307  GLY B CA  1 
ATOM   4629  C  C   . GLY B 1 264 ? 4.481   2.506   -24.419 1.00 34.44 ? 307  GLY B C   1 
ATOM   4630  O  O   . GLY B 1 264 ? 4.944   1.570   -23.775 1.00 33.93 ? 307  GLY B O   1 
ATOM   4631  N  N   . TYR B 1 265 ? 4.123   2.395   -25.691 1.00 36.57 ? 308  TYR B N   1 
ATOM   4632  C  CA  . TYR B 1 265 ? 4.264   1.132   -26.387 1.00 39.14 ? 308  TYR B CA  1 
ATOM   4633  C  C   . TYR B 1 265 ? 4.653   1.384   -27.848 1.00 38.70 ? 308  TYR B C   1 
ATOM   4634  O  O   . TYR B 1 265 ? 4.663   2.533   -28.298 1.00 39.04 ? 308  TYR B O   1 
ATOM   4635  C  CB  . TYR B 1 265 ? 2.956   0.335   -26.272 1.00 42.10 ? 308  TYR B CB  1 
ATOM   4636  C  CG  . TYR B 1 265 ? 3.175   -1.159  -26.259 1.00 45.87 ? 308  TYR B CG  1 
ATOM   4637  C  CD1 . TYR B 1 265 ? 4.208   -1.720  -25.503 1.00 47.08 ? 308  TYR B CD1 1 
ATOM   4638  C  CD2 . TYR B 1 265 ? 2.387   -2.010  -27.038 1.00 48.21 ? 308  TYR B CD2 1 
ATOM   4639  C  CE1 . TYR B 1 265 ? 4.464   -3.085  -25.528 1.00 48.14 ? 308  TYR B CE1 1 
ATOM   4640  C  CE2 . TYR B 1 265 ? 2.630   -3.387  -27.070 1.00 49.35 ? 308  TYR B CE2 1 
ATOM   4641  C  CZ  . TYR B 1 265 ? 3.673   -3.915  -26.315 1.00 49.64 ? 308  TYR B CZ  1 
ATOM   4642  O  OH  . TYR B 1 265 ? 3.936   -5.267  -26.356 1.00 51.67 ? 308  TYR B OH  1 
ATOM   4643  N  N   . ASP B 1 266 ? 4.992   0.321   -28.578 1.00 37.45 ? 309  ASP B N   1 
ATOM   4644  C  CA  . ASP B 1 266 ? 5.396   0.447   -29.983 1.00 35.49 ? 309  ASP B CA  1 
ATOM   4645  C  C   . ASP B 1 266 ? 4.245   0.224   -30.933 1.00 34.30 ? 309  ASP B C   1 
ATOM   4646  O  O   . ASP B 1 266 ? 4.397   0.339   -32.138 1.00 32.62 ? 309  ASP B O   1 
ATOM   4647  C  CB  . ASP B 1 266 ? 6.534   -0.535  -30.297 1.00 34.87 ? 309  ASP B CB  1 
ATOM   4648  C  CG  . ASP B 1 266 ? 6.626   -1.675  -29.290 1.00 34.09 ? 309  ASP B CG  1 
ATOM   4649  O  OD1 . ASP B 1 266 ? 5.568   -2.224  -28.916 1.00 34.54 ? 309  ASP B OD1 1 
ATOM   4650  O  OD2 . ASP B 1 266 ? 7.757   -2.028  -28.879 1.00 32.68 ? 309  ASP B OD2 1 
ATOM   4651  N  N   . PHE B 1 267 ? 3.121   -0.082  -30.368 1.00 33.55 ? 310  PHE B N   1 
ATOM   4652  C  CA  . PHE B 1 267 ? 1.937   -0.350  -31.110 1.00 33.23 ? 310  PHE B CA  1 
ATOM   4653  C  C   . PHE B 1 267 ? 0.808   0.637   -30.788 1.00 31.03 ? 310  PHE B C   1 
ATOM   4654  O  O   . PHE B 1 267 ? 0.974   1.620   -30.057 1.00 29.67 ? 310  PHE B O   1 
ATOM   4655  C  CB  . PHE B 1 267 ? 1.299   -1.695  -30.767 1.00 36.93 ? 310  PHE B CB  1 
ATOM   4656  C  CG  . PHE B 1 267 ? 2.074   -2.942  -31.106 1.00 39.24 ? 310  PHE B CG  1 
ATOM   4657  C  CD1 . PHE B 1 267 ? 1.871   -4.118  -30.388 1.00 40.37 ? 310  PHE B CD1 1 
ATOM   4658  C  CD2 . PHE B 1 267 ? 3.003   -2.931  -32.114 1.00 40.53 ? 310  PHE B CD2 1 
ATOM   4659  C  CE1 . PHE B 1 267 ? 2.582   -5.279  -30.702 1.00 40.43 ? 310  PHE B CE1 1 
ATOM   4660  C  CE2 . PHE B 1 267 ? 3.719   -4.074  -32.408 1.00 41.35 ? 310  PHE B CE2 1 
ATOM   4661  C  CZ  . PHE B 1 267 ? 3.509   -5.256  -31.718 1.00 41.95 ? 310  PHE B CZ  1 
ATOM   4662  N  N   . ILE B 1 268 ? -0.317  0.281   -31.356 1.00 29.77 ? 311  ILE B N   1 
ATOM   4663  C  CA  . ILE B 1 268 ? -1.579  0.961   -31.234 1.00 27.60 ? 311  ILE B CA  1 
ATOM   4664  C  C   . ILE B 1 268 ? -2.608  -0.007  -30.642 1.00 26.80 ? 311  ILE B C   1 
ATOM   4665  O  O   . ILE B 1 268 ? -3.415  -0.608  -31.353 1.00 26.64 ? 311  ILE B O   1 
ATOM   4666  C  CB  . ILE B 1 268 ? -2.079  1.463   -32.602 1.00 27.93 ? 311  ILE B CB  1 
ATOM   4667  C  CG1 . ILE B 1 268 ? -0.942  1.557   -33.602 1.00 27.27 ? 311  ILE B CG1 1 
ATOM   4668  C  CG2 . ILE B 1 268 ? -2.765  2.815   -32.469 1.00 26.61 ? 311  ILE B CG2 1 
ATOM   4669  C  CD1 . ILE B 1 268 ? -1.135  0.681   -34.821 1.00 24.17 ? 311  ILE B CD1 1 
ATOM   4670  N  N   . PRO B 1 269 ? -2.548  -0.117  -29.329 1.00 25.59 ? 312  PRO B N   1 
ATOM   4671  C  CA  . PRO B 1 269 ? -3.480  -1.069  -28.688 1.00 25.26 ? 312  PRO B CA  1 
ATOM   4672  C  C   . PRO B 1 269 ? -4.906  -0.907  -29.140 1.00 24.18 ? 312  PRO B C   1 
ATOM   4673  O  O   . PRO B 1 269 ? -5.422  0.220   -29.178 1.00 24.16 ? 312  PRO B O   1 
ATOM   4674  C  CB  . PRO B 1 269 ? -3.131  -0.929  -27.221 1.00 25.39 ? 312  PRO B CB  1 
ATOM   4675  C  CG  . PRO B 1 269 ? -1.627  -0.763  -27.261 1.00 25.55 ? 312  PRO B CG  1 
ATOM   4676  C  CD  . PRO B 1 269 ? -1.271  -0.184  -28.606 1.00 25.60 ? 312  PRO B CD  1 
ATOM   4677  N  N   . THR B 1 270 ? -5.580  -1.983  -29.493 1.00 23.55 ? 313  THR B N   1 
ATOM   4678  C  CA  . THR B 1 270 ? -6.956  -1.832  -29.906 1.00 22.85 ? 313  THR B CA  1 
ATOM   4679  C  C   . THR B 1 270 ? -7.797  -1.248  -28.764 1.00 22.93 ? 313  THR B C   1 
ATOM   4680  O  O   . THR B 1 270 ? -8.738  -0.499  -29.016 1.00 22.50 ? 313  THR B O   1 
ATOM   4681  C  CB  . THR B 1 270 ? -7.552  -3.188  -30.431 1.00 21.23 ? 313  THR B CB  1 
ATOM   4682  O  OG1 . THR B 1 270 ? -7.931  -4.021  -29.330 1.00 22.72 ? 313  THR B OG1 1 
ATOM   4683  C  CG2 . THR B 1 270 ? -6.530  -3.919  -31.265 1.00 19.33 ? 313  THR B CG2 1 
ATOM   4684  N  N   . VAL B 1 271 ? -7.442  -1.560  -27.518 1.00 23.20 ? 314  VAL B N   1 
ATOM   4685  C  CA  . VAL B 1 271 ? -8.205  -1.056  -26.375 1.00 24.48 ? 314  VAL B CA  1 
ATOM   4686  C  C   . VAL B 1 271 ? -8.135  0.465   -26.267 1.00 24.42 ? 314  VAL B C   1 
ATOM   4687  O  O   . VAL B 1 271 ? -8.993  1.083   -25.639 1.00 25.96 ? 314  VAL B O   1 
ATOM   4688  C  CB  . VAL B 1 271 ? -7.702  -1.629  -25.023 1.00 25.43 ? 314  VAL B CB  1 
ATOM   4689  C  CG1 . VAL B 1 271 ? -7.504  -3.137  -25.113 1.00 26.75 ? 314  VAL B CG1 1 
ATOM   4690  C  CG2 . VAL B 1 271 ? -6.410  -0.960  -24.630 1.00 25.70 ? 314  VAL B CG2 1 
ATOM   4691  N  N   . LEU B 1 272 ? -7.113  1.066   -26.868 1.00 22.73 ? 315  LEU B N   1 
ATOM   4692  C  CA  . LEU B 1 272 ? -6.948  2.505   -26.803 1.00 21.30 ? 315  LEU B CA  1 
ATOM   4693  C  C   . LEU B 1 272 ? -7.667  3.252   -27.911 1.00 22.06 ? 315  LEU B C   1 
ATOM   4694  O  O   . LEU B 1 272 ? -7.496  2.960   -29.078 1.00 23.98 ? 315  LEU B O   1 
ATOM   4695  C  CB  . LEU B 1 272 ? -5.453  2.863   -26.823 1.00 18.73 ? 315  LEU B CB  1 
ATOM   4696  C  CG  . LEU B 1 272 ? -5.059  4.316   -27.098 1.00 16.14 ? 315  LEU B CG  1 
ATOM   4697  C  CD1 . LEU B 1 272 ? -5.756  5.241   -26.150 1.00 14.33 ? 315  LEU B CD1 1 
ATOM   4698  C  CD2 . LEU B 1 272 ? -3.574  4.452   -27.001 1.00 13.56 ? 315  LEU B CD2 1 
ATOM   4699  N  N   . ASP B 1 273 ? -8.474  4.227   -27.524 1.00 22.55 ? 316  ASP B N   1 
ATOM   4700  C  CA  . ASP B 1 273 ? -9.190  5.062   -28.467 1.00 22.50 ? 316  ASP B CA  1 
ATOM   4701  C  C   . ASP B 1 273 ? -8.508  6.417   -28.439 1.00 23.64 ? 316  ASP B C   1 
ATOM   4702  O  O   . ASP B 1 273 ? -8.928  7.324   -27.727 1.00 24.04 ? 316  ASP B O   1 
ATOM   4703  C  CB  . ASP B 1 273 ? -10.659 5.200   -28.055 1.00 23.03 ? 316  ASP B CB  1 
ATOM   4704  C  CG  . ASP B 1 273 ? -11.519 5.853   -29.140 1.00 25.71 ? 316  ASP B CG  1 
ATOM   4705  O  OD1 . ASP B 1 273 ? -12.767 5.850   -29.025 1.00 24.82 ? 316  ASP B OD1 1 
ATOM   4706  O  OD2 . ASP B 1 273 ? -10.942 6.375   -30.114 1.00 24.65 ? 316  ASP B OD2 1 
ATOM   4707  N  N   . ARG B 1 274 ? -7.441  6.549   -29.216 1.00 24.03 ? 317  ARG B N   1 
ATOM   4708  C  CA  . ARG B 1 274 ? -6.699  7.799   -29.271 1.00 24.12 ? 317  ARG B CA  1 
ATOM   4709  C  C   . ARG B 1 274 ? -7.590  8.928   -29.761 1.00 25.16 ? 317  ARG B C   1 
ATOM   4710  O  O   . ARG B 1 274 ? -7.174  10.082  -29.808 1.00 27.02 ? 317  ARG B O   1 
ATOM   4711  C  CB  . ARG B 1 274 ? -5.494  7.646   -30.198 1.00 22.71 ? 317  ARG B CB  1 
ATOM   4712  C  CG  . ARG B 1 274 ? -5.534  6.382   -31.056 1.00 25.10 ? 317  ARG B CG  1 
ATOM   4713  C  CD  . ARG B 1 274 ? -4.505  6.434   -32.190 1.00 26.98 ? 317  ARG B CD  1 
ATOM   4714  N  NE  . ARG B 1 274 ? -3.126  6.398   -31.707 1.00 28.09 ? 317  ARG B NE  1 
ATOM   4715  C  CZ  . ARG B 1 274 ? -2.120  7.046   -32.280 1.00 28.05 ? 317  ARG B CZ  1 
ATOM   4716  N  NH1 . ARG B 1 274 ? -2.337  7.785   -33.355 1.00 29.47 ? 317  ARG B NH1 1 
ATOM   4717  N  NH2 . ARG B 1 274 ? -0.899  6.959   -31.779 1.00 29.29 ? 317  ARG B NH2 1 
ATOM   4718  N  N   . THR B 1 275 ? -8.825  8.583   -30.107 1.00 26.28 ? 318  THR B N   1 
ATOM   4719  C  CA  . THR B 1 275 ? -9.800  9.533   -30.637 1.00 26.75 ? 318  THR B CA  1 
ATOM   4720  C  C   . THR B 1 275 ? -10.417 10.381  -29.544 1.00 26.06 ? 318  THR B C   1 
ATOM   4721  O  O   . THR B 1 275 ? -11.274 11.230  -29.810 1.00 24.45 ? 318  THR B O   1 
ATOM   4722  C  CB  . THR B 1 275 ? -10.945 8.793   -31.375 1.00 28.59 ? 318  THR B CB  1 
ATOM   4723  O  OG1 . THR B 1 275 ? -10.392 7.761   -32.203 1.00 30.89 ? 318  THR B OG1 1 
ATOM   4724  C  CG2 . THR B 1 275 ? -11.748 9.752   -32.246 1.00 27.79 ? 318  THR B CG2 1 
ATOM   4725  N  N   . VAL B 1 276 ? -9.991  10.150  -28.309 1.00 25.90 ? 319  VAL B N   1 
ATOM   4726  C  CA  . VAL B 1 276 ? -10.545 10.925  -27.221 1.00 25.69 ? 319  VAL B CA  1 
ATOM   4727  C  C   . VAL B 1 276 ? -9.526  11.820  -26.546 1.00 26.43 ? 319  VAL B C   1 
ATOM   4728  O  O   . VAL B 1 276 ? -9.874  12.890  -26.059 1.00 27.80 ? 319  VAL B O   1 
ATOM   4729  C  CB  . VAL B 1 276 ? -11.187 10.025  -26.202 1.00 24.21 ? 319  VAL B CB  1 
ATOM   4730  C  CG1 . VAL B 1 276 ? -12.246 10.807  -25.442 1.00 24.16 ? 319  VAL B CG1 1 
ATOM   4731  C  CG2 . VAL B 1 276 ? -11.788 8.810   -26.903 1.00 25.03 ? 319  VAL B CG2 1 
ATOM   4732  N  N   . VAL B 1 277 ? -8.268  11.398  -26.522 1.00 26.21 ? 320  VAL B N   1 
ATOM   4733  C  CA  . VAL B 1 277 ? -7.229  12.223  -25.935 1.00 24.51 ? 320  VAL B CA  1 
ATOM   4734  C  C   . VAL B 1 277 ? -7.264  13.537  -26.713 1.00 24.31 ? 320  VAL B C   1 
ATOM   4735  O  O   . VAL B 1 277 ? -7.015  13.540  -27.917 1.00 24.22 ? 320  VAL B O   1 
ATOM   4736  C  CB  . VAL B 1 277 ? -5.860  11.577  -26.127 1.00 24.23 ? 320  VAL B CB  1 
ATOM   4737  C  CG1 . VAL B 1 277 ? -4.912  12.071  -25.072 1.00 23.32 ? 320  VAL B CG1 1 
ATOM   4738  C  CG2 . VAL B 1 277 ? -5.985  10.075  -26.092 1.00 23.42 ? 320  VAL B CG2 1 
ATOM   4739  N  N   . ASP B 1 278 ? -7.588  14.637  -26.033 1.00 23.52 ? 321  ASP B N   1 
ATOM   4740  C  CA  . ASP B 1 278 ? -7.675  15.952  -26.671 1.00 23.23 ? 321  ASP B CA  1 
ATOM   4741  C  C   . ASP B 1 278 ? -6.318  16.575  -26.970 1.00 22.65 ? 321  ASP B C   1 
ATOM   4742  O  O   . ASP B 1 278 ? -6.205  17.408  -27.861 1.00 22.88 ? 321  ASP B O   1 
ATOM   4743  C  CB  . ASP B 1 278 ? -8.490  16.917  -25.816 1.00 25.74 ? 321  ASP B CB  1 
ATOM   4744  C  CG  . ASP B 1 278 ? -9.887  16.402  -25.524 1.00 30.40 ? 321  ASP B CG  1 
ATOM   4745  O  OD1 . ASP B 1 278 ? -10.151 16.025  -24.354 1.00 33.65 ? 321  ASP B OD1 1 
ATOM   4746  O  OD2 . ASP B 1 278 ? -10.721 16.371  -26.462 1.00 30.54 ? 321  ASP B OD2 1 
ATOM   4747  N  N   . LYS B 1 279 ? -5.295  16.179  -26.217 1.00 21.78 ? 322  LYS B N   1 
ATOM   4748  C  CA  . LYS B 1 279 ? -3.941  16.676  -26.427 1.00 21.77 ? 322  LYS B CA  1 
ATOM   4749  C  C   . LYS B 1 279 ? -2.929  15.663  -25.921 1.00 21.03 ? 322  LYS B C   1 
ATOM   4750  O  O   . LYS B 1 279 ? -3.212  14.919  -24.998 1.00 21.65 ? 322  LYS B O   1 
ATOM   4751  C  CB  . LYS B 1 279 ? -3.724  18.015  -25.716 1.00 24.41 ? 322  LYS B CB  1 
ATOM   4752  C  CG  . LYS B 1 279 ? -4.324  19.235  -26.432 1.00 27.10 ? 322  LYS B CG  1 
ATOM   4753  C  CD  . LYS B 1 279 ? -3.662  20.545  -25.976 1.00 28.36 ? 322  LYS B CD  1 
ATOM   4754  C  CE  . LYS B 1 279 ? -4.278  21.782  -26.633 1.00 26.14 ? 322  LYS B CE  1 
ATOM   4755  N  NZ  . LYS B 1 279 ? -3.539  23.028  -26.268 1.00 21.23 ? 322  LYS B NZ  1 
ATOM   4756  N  N   . TRP B 1 280 ? -1.754  15.620  -26.533 1.00 19.64 ? 323  TRP B N   1 
ATOM   4757  C  CA  . TRP B 1 280 ? -0.733  14.684  -26.098 1.00 20.97 ? 323  TRP B CA  1 
ATOM   4758  C  C   . TRP B 1 280 ? 0.521   15.437  -25.680 1.00 22.85 ? 323  TRP B C   1 
ATOM   4759  O  O   . TRP B 1 280 ? 0.822   16.500  -26.229 1.00 24.24 ? 323  TRP B O   1 
ATOM   4760  C  CB  . TRP B 1 280 ? -0.374  13.701  -27.218 1.00 21.86 ? 323  TRP B CB  1 
ATOM   4761  C  CG  . TRP B 1 280 ? -1.387  12.606  -27.435 1.00 22.98 ? 323  TRP B CG  1 
ATOM   4762  C  CD1 . TRP B 1 280 ? -2.497  12.651  -28.236 1.00 22.21 ? 323  TRP B CD1 1 
ATOM   4763  C  CD2 . TRP B 1 280 ? -1.406  11.320  -26.797 1.00 21.93 ? 323  TRP B CD2 1 
ATOM   4764  N  NE1 . TRP B 1 280 ? -3.203  11.475  -28.130 1.00 22.84 ? 323  TRP B NE1 1 
ATOM   4765  C  CE2 . TRP B 1 280 ? -2.556  10.643  -27.254 1.00 21.08 ? 323  TRP B CE2 1 
ATOM   4766  C  CE3 . TRP B 1 280 ? -0.562  10.678  -25.881 1.00 22.42 ? 323  TRP B CE3 1 
ATOM   4767  C  CZ2 . TRP B 1 280 ? -2.883  9.357   -26.825 1.00 20.24 ? 323  TRP B CZ2 1 
ATOM   4768  C  CZ3 . TRP B 1 280 ? -0.889  9.398   -25.456 1.00 21.59 ? 323  TRP B CZ3 1 
ATOM   4769  C  CH2 . TRP B 1 280 ? -2.040  8.752   -25.929 1.00 20.91 ? 323  TRP B CH2 1 
ATOM   4770  N  N   . PHE B 1 281 ? 1.235   14.886  -24.695 1.00 23.31 ? 324  PHE B N   1 
ATOM   4771  C  CA  . PHE B 1 281 ? 2.488   15.456  -24.184 1.00 22.79 ? 324  PHE B CA  1 
ATOM   4772  C  C   . PHE B 1 281 ? 3.534   14.337  -24.108 1.00 22.44 ? 324  PHE B C   1 
ATOM   4773  O  O   . PHE B 1 281 ? 3.221   13.189  -23.758 1.00 21.28 ? 324  PHE B O   1 
ATOM   4774  C  CB  . PHE B 1 281 ? 2.302   16.061  -22.786 1.00 24.39 ? 324  PHE B CB  1 
ATOM   4775  C  CG  . PHE B 1 281 ? 1.671   17.437  -22.771 1.00 25.84 ? 324  PHE B CG  1 
ATOM   4776  C  CD1 . PHE B 1 281 ? 0.337   17.624  -23.134 1.00 26.15 ? 324  PHE B CD1 1 
ATOM   4777  C  CD2 . PHE B 1 281 ? 2.406   18.544  -22.334 1.00 27.13 ? 324  PHE B CD2 1 
ATOM   4778  C  CE1 . PHE B 1 281 ? -0.258  18.893  -23.058 1.00 27.35 ? 324  PHE B CE1 1 
ATOM   4779  C  CE2 . PHE B 1 281 ? 1.826   19.816  -22.251 1.00 27.15 ? 324  PHE B CE2 1 
ATOM   4780  C  CZ  . PHE B 1 281 ? 0.490   19.992  -22.613 1.00 28.11 ? 324  PHE B CZ  1 
ATOM   4781  N  N   . LYS B 1 282 ? 4.776   14.674  -24.432 1.00 22.02 ? 325  LYS B N   1 
ATOM   4782  C  CA  . LYS B 1 282 ? 5.847   13.689  -24.410 1.00 22.23 ? 325  LYS B CA  1 
ATOM   4783  C  C   . LYS B 1 282 ? 6.545   13.645  -23.069 1.00 21.30 ? 325  LYS B C   1 
ATOM   4784  O  O   . LYS B 1 282 ? 6.341   14.528  -22.253 1.00 22.68 ? 325  LYS B O   1 
ATOM   4785  C  CB  . LYS B 1 282 ? 6.842   13.984  -25.526 1.00 23.13 ? 325  LYS B CB  1 
ATOM   4786  C  CG  . LYS B 1 282 ? 6.182   14.030  -26.883 1.00 23.71 ? 325  LYS B CG  1 
ATOM   4787  C  CD  . LYS B 1 282 ? 5.326   12.786  -27.136 1.00 21.06 ? 325  LYS B CD  1 
ATOM   4788  C  CE  . LYS B 1 282 ? 6.147   11.514  -27.297 1.00 20.20 ? 325  LYS B CE  1 
ATOM   4789  N  NZ  . LYS B 1 282 ? 6.845   11.094  -26.065 1.00 20.67 ? 325  LYS B NZ  1 
ATOM   4790  N  N   . SER B 1 283 ? 7.366   12.625  -22.841 1.00 20.85 ? 326  SER B N   1 
ATOM   4791  C  CA  . SER B 1 283 ? 8.040   12.501  -21.560 1.00 21.88 ? 326  SER B CA  1 
ATOM   4792  C  C   . SER B 1 283 ? 9.287   11.629  -21.567 1.00 22.28 ? 326  SER B C   1 
ATOM   4793  O  O   . SER B 1 283 ? 9.384   10.677  -22.338 1.00 21.58 ? 326  SER B O   1 
ATOM   4794  C  CB  . SER B 1 283 ? 7.045   11.963  -20.517 1.00 23.49 ? 326  SER B CB  1 
ATOM   4795  O  OG  . SER B 1 283 ? 7.682   11.448  -19.348 1.00 23.82 ? 326  SER B OG  1 
ATOM   4796  N  N   . ASN B 1 284 ? 10.219  11.961  -20.670 1.00 23.03 ? 327  ASN B N   1 
ATOM   4797  C  CA  . ASN B 1 284 ? 11.488  11.246  -20.507 1.00 23.36 ? 327  ASN B CA  1 
ATOM   4798  C  C   . ASN B 1 284 ? 11.683  10.741  -19.070 1.00 24.17 ? 327  ASN B C   1 
ATOM   4799  O  O   . ASN B 1 284 ? 11.021  11.216  -18.140 1.00 22.34 ? 327  ASN B O   1 
ATOM   4800  C  CB  . ASN B 1 284 ? 12.650  12.165  -20.862 1.00 23.92 ? 327  ASN B CB  1 
ATOM   4801  C  CG  . ASN B 1 284 ? 12.594  13.478  -20.104 1.00 25.06 ? 327  ASN B CG  1 
ATOM   4802  O  OD1 . ASN B 1 284 ? 13.623  14.066  -19.784 1.00 25.52 ? 327  ASN B OD1 1 
ATOM   4803  N  ND2 . ASN B 1 284 ? 11.383  13.949  -19.823 1.00 24.83 ? 327  ASN B ND2 1 
ATOM   4804  N  N   . ASP B 1 285 ? 12.599  9.789   -18.900 1.00 24.90 ? 328  ASP B N   1 
ATOM   4805  C  CA  . ASP B 1 285 ? 12.896  9.212   -17.591 1.00 26.36 ? 328  ASP B CA  1 
ATOM   4806  C  C   . ASP B 1 285 ? 13.175  10.260  -16.539 1.00 27.28 ? 328  ASP B C   1 
ATOM   4807  O  O   . ASP B 1 285 ? 12.447  10.379  -15.559 1.00 27.53 ? 328  ASP B O   1 
ATOM   4808  C  CB  . ASP B 1 285 ? 14.122  8.314   -17.658 1.00 28.48 ? 328  ASP B CB  1 
ATOM   4809  C  CG  . ASP B 1 285 ? 13.920  7.132   -18.538 1.00 30.45 ? 328  ASP B CG  1 
ATOM   4810  O  OD1 . ASP B 1 285 ? 14.861  6.322   -18.648 1.00 32.62 ? 328  ASP B OD1 1 
ATOM   4811  O  OD2 . ASP B 1 285 ? 12.822  7.017   -19.116 1.00 32.22 ? 328  ASP B OD2 1 
ATOM   4812  N  N   . GLU B 1 286 ? 14.270  10.986  -16.745 1.00 28.39 ? 329  GLU B N   1 
ATOM   4813  C  CA  . GLU B 1 286 ? 14.709  12.042  -15.845 1.00 29.76 ? 329  GLU B CA  1 
ATOM   4814  C  C   . GLU B 1 286 ? 13.505  12.859  -15.370 1.00 28.35 ? 329  GLU B C   1 
ATOM   4815  O  O   . GLU B 1 286 ? 13.146  12.818  -14.194 1.00 26.63 ? 329  GLU B O   1 
ATOM   4816  C  CB  . GLU B 1 286 ? 15.751  12.923  -16.565 1.00 34.06 ? 329  GLU B CB  1 
ATOM   4817  C  CG  . GLU B 1 286 ? 17.117  12.228  -16.767 1.00 37.38 ? 329  GLU B CG  1 
ATOM   4818  C  CD  . GLU B 1 286 ? 17.994  12.850  -17.859 1.00 40.15 ? 329  GLU B CD  1 
ATOM   4819  O  OE1 . GLU B 1 286 ? 18.269  14.070  -17.797 1.00 39.26 ? 329  GLU B OE1 1 
ATOM   4820  O  OE2 . GLU B 1 286 ? 18.420  12.109  -18.778 1.00 41.07 ? 329  GLU B OE2 1 
ATOM   4821  N  N   . GLU B 1 287 ? 12.874  13.584  -16.283 1.00 27.59 ? 330  GLU B N   1 
ATOM   4822  C  CA  . GLU B 1 287 ? 11.703  14.375  -15.937 1.00 29.61 ? 330  GLU B CA  1 
ATOM   4823  C  C   . GLU B 1 287 ? 10.727  13.514  -15.142 1.00 30.80 ? 330  GLU B C   1 
ATOM   4824  O  O   . GLU B 1 287 ? 10.110  13.970  -14.179 1.00 31.26 ? 330  GLU B O   1 
ATOM   4825  C  CB  . GLU B 1 287 ? 11.029  14.884  -17.211 1.00 30.45 ? 330  GLU B CB  1 
ATOM   4826  C  CG  . GLU B 1 287 ? 9.705   15.579  -17.006 1.00 32.42 ? 330  GLU B CG  1 
ATOM   4827  C  CD  . GLU B 1 287 ? 9.122   16.071  -18.311 1.00 34.22 ? 330  GLU B CD  1 
ATOM   4828  O  OE1 . GLU B 1 287 ? 8.048   16.708  -18.283 1.00 33.79 ? 330  GLU B OE1 1 
ATOM   4829  O  OE2 . GLU B 1 287 ? 9.739   15.821  -19.370 1.00 34.13 ? 330  GLU B OE2 1 
ATOM   4830  N  N   . ALA B 1 288 ? 10.596  12.259  -15.551 1.00 30.79 ? 331  ALA B N   1 
ATOM   4831  C  CA  . ALA B 1 288 ? 9.696   11.334  -14.883 1.00 30.00 ? 331  ALA B CA  1 
ATOM   4832  C  C   . ALA B 1 288 ? 10.141  11.010  -13.464 1.00 28.63 ? 331  ALA B C   1 
ATOM   4833  O  O   . ALA B 1 288 ? 9.425   11.268  -12.499 1.00 29.11 ? 331  ALA B O   1 
ATOM   4834  C  CB  . ALA B 1 288 ? 9.589   10.048  -15.689 1.00 31.56 ? 331  ALA B CB  1 
ATOM   4835  N  N   . PHE B 1 289 ? 11.327  10.436  -13.343 1.00 26.72 ? 332  PHE B N   1 
ATOM   4836  C  CA  . PHE B 1 289 ? 11.838  10.055  -12.046 1.00 25.90 ? 332  PHE B CA  1 
ATOM   4837  C  C   . PHE B 1 289 ? 11.962  11.185  -11.036 1.00 25.74 ? 332  PHE B C   1 
ATOM   4838  O  O   . PHE B 1 289 ? 11.650  10.991  -9.864  1.00 25.33 ? 332  PHE B O   1 
ATOM   4839  C  CB  . PHE B 1 289 ? 13.159  9.320   -12.227 1.00 25.44 ? 332  PHE B CB  1 
ATOM   4840  C  CG  . PHE B 1 289 ? 13.000  7.977   -12.887 1.00 26.02 ? 332  PHE B CG  1 
ATOM   4841  C  CD1 . PHE B 1 289 ? 13.711  7.654   -14.036 1.00 26.12 ? 332  PHE B CD1 1 
ATOM   4842  C  CD2 . PHE B 1 289 ? 12.116  7.035   -12.365 1.00 26.24 ? 332  PHE B CD2 1 
ATOM   4843  C  CE1 . PHE B 1 289 ? 13.545  6.413   -14.653 1.00 25.21 ? 332  PHE B CE1 1 
ATOM   4844  C  CE2 . PHE B 1 289 ? 11.948  5.799   -12.972 1.00 25.41 ? 332  PHE B CE2 1 
ATOM   4845  C  CZ  . PHE B 1 289 ? 12.666  5.491   -14.118 1.00 25.69 ? 332  PHE B CZ  1 
ATOM   4846  N  N   . THR B 1 290 ? 12.390  12.369  -11.463 1.00 25.42 ? 333  THR B N   1 
ATOM   4847  C  CA  . THR B 1 290 ? 12.502  13.468  -10.509 1.00 23.81 ? 333  THR B CA  1 
ATOM   4848  C  C   . THR B 1 290 ? 11.124  13.814  -9.956  1.00 22.89 ? 333  THR B C   1 
ATOM   4849  O  O   . THR B 1 290 ? 10.970  14.038  -8.759  1.00 22.62 ? 333  THR B O   1 
ATOM   4850  C  CB  . THR B 1 290 ? 13.114  14.739  -11.131 1.00 23.33 ? 333  THR B CB  1 
ATOM   4851  O  OG1 . THR B 1 290 ? 12.108  15.469  -11.840 1.00 23.52 ? 333  THR B OG1 1 
ATOM   4852  C  CG2 . THR B 1 290 ? 14.246  14.374  -12.074 1.00 24.30 ? 333  THR B CG2 1 
ATOM   4853  N  N   . PHE B 1 291 ? 10.119  13.850  -10.823 1.00 21.97 ? 334  PHE B N   1 
ATOM   4854  C  CA  . PHE B 1 291 ? 8.780   14.161  -10.362 1.00 21.41 ? 334  PHE B CA  1 
ATOM   4855  C  C   . PHE B 1 291 ? 8.252   13.037  -9.490  1.00 21.89 ? 334  PHE B C   1 
ATOM   4856  O  O   . PHE B 1 291 ? 7.377   13.249  -8.650  1.00 22.72 ? 334  PHE B O   1 
ATOM   4857  C  CB  . PHE B 1 291 ? 7.833   14.420  -11.534 1.00 19.52 ? 334  PHE B CB  1 
ATOM   4858  C  CG  . PHE B 1 291 ? 7.630   15.891  -11.837 1.00 19.04 ? 334  PHE B CG  1 
ATOM   4859  C  CD1 . PHE B 1 291 ? 8.318   16.509  -12.873 1.00 17.35 ? 334  PHE B CD1 1 
ATOM   4860  C  CD2 . PHE B 1 291 ? 6.749   16.662  -11.067 1.00 17.79 ? 334  PHE B CD2 1 
ATOM   4861  C  CE1 . PHE B 1 291 ? 8.130   17.858  -13.136 1.00 15.57 ? 334  PHE B CE1 1 
ATOM   4862  C  CE2 . PHE B 1 291 ? 6.558   18.011  -11.326 1.00 14.70 ? 334  PHE B CE2 1 
ATOM   4863  C  CZ  . PHE B 1 291 ? 7.248   18.607  -12.360 1.00 15.16 ? 334  PHE B CZ  1 
ATOM   4864  N  N   . ALA B 1 292 ? 8.797   11.842  -9.669  1.00 21.80 ? 335  ALA B N   1 
ATOM   4865  C  CA  . ALA B 1 292 ? 8.355   10.710  -8.866  1.00 22.27 ? 335  ALA B CA  1 
ATOM   4866  C  C   . ALA B 1 292 ? 9.024   10.852  -7.512  1.00 21.62 ? 335  ALA B C   1 
ATOM   4867  O  O   . ALA B 1 292 ? 8.390   10.750  -6.467  1.00 22.43 ? 335  ALA B O   1 
ATOM   4868  C  CB  . ALA B 1 292 ? 8.750   9.396   -9.537  1.00 22.87 ? 335  ALA B CB  1 
ATOM   4869  N  N   . ARG B 1 293 ? 10.321  11.102  -7.539  1.00 21.84 ? 336  ARG B N   1 
ATOM   4870  C  CA  . ARG B 1 293 ? 11.059  11.284  -6.311  1.00 21.56 ? 336  ARG B CA  1 
ATOM   4871  C  C   . ARG B 1 293 ? 10.441  12.476  -5.583  1.00 23.35 ? 336  ARG B C   1 
ATOM   4872  O  O   . ARG B 1 293 ? 10.310  12.484  -4.358  1.00 24.81 ? 336  ARG B O   1 
ATOM   4873  C  CB  . ARG B 1 293 ? 12.532  11.571  -6.618  1.00 20.14 ? 336  ARG B CB  1 
ATOM   4874  C  CG  . ARG B 1 293 ? 13.352  10.336  -6.917  1.00 17.72 ? 336  ARG B CG  1 
ATOM   4875  C  CD  . ARG B 1 293 ? 14.770  10.498  -6.414  1.00 16.94 ? 336  ARG B CD  1 
ATOM   4876  N  NE  . ARG B 1 293 ? 15.397  9.205   -6.182  1.00 18.03 ? 336  ARG B NE  1 
ATOM   4877  C  CZ  . ARG B 1 293 ? 16.493  9.014   -5.452  1.00 20.65 ? 336  ARG B CZ  1 
ATOM   4878  N  NH1 . ARG B 1 293 ? 16.986  7.791   -5.295  1.00 19.42 ? 336  ARG B NH1 1 
ATOM   4879  N  NH2 . ARG B 1 293 ? 17.097  10.043  -4.870  1.00 25.04 ? 336  ARG B NH2 1 
ATOM   4880  N  N   . MET B 1 294 ? 10.034  13.480  -6.339  1.00 23.16 ? 337  MET B N   1 
ATOM   4881  C  CA  . MET B 1 294 ? 9.472   14.650  -5.709  1.00 24.08 ? 337  MET B CA  1 
ATOM   4882  C  C   . MET B 1 294 ? 8.166   14.365  -5.002  1.00 24.17 ? 337  MET B C   1 
ATOM   4883  O  O   . MET B 1 294 ? 7.947   14.825  -3.891  1.00 25.05 ? 337  MET B O   1 
ATOM   4884  C  CB  . MET B 1 294 ? 9.283   15.761  -6.739  1.00 25.81 ? 337  MET B CB  1 
ATOM   4885  C  CG  . MET B 1 294 ? 9.016   17.135  -6.131  1.00 27.01 ? 337  MET B CG  1 
ATOM   4886  S  SD  . MET B 1 294 ? 9.117   18.404  -7.397  1.00 29.78 ? 337  MET B SD  1 
ATOM   4887  C  CE  . MET B 1 294 ? 7.574   18.205  -8.263  1.00 28.29 ? 337  MET B CE  1 
ATOM   4888  N  N   . LEU B 1 295 ? 7.296   13.601  -5.648  1.00 25.81 ? 338  LEU B N   1 
ATOM   4889  C  CA  . LEU B 1 295 ? 5.992   13.276  -5.067  1.00 24.61 ? 338  LEU B CA  1 
ATOM   4890  C  C   . LEU B 1 295 ? 6.123   12.623  -3.696  1.00 23.40 ? 338  LEU B C   1 
ATOM   4891  O  O   . LEU B 1 295 ? 5.305   12.860  -2.800  1.00 22.35 ? 338  LEU B O   1 
ATOM   4892  C  CB  . LEU B 1 295 ? 5.203   12.370  -6.015  1.00 23.58 ? 338  LEU B CB  1 
ATOM   4893  C  CG  . LEU B 1 295 ? 4.195   13.069  -6.923  1.00 24.32 ? 338  LEU B CG  1 
ATOM   4894  C  CD1 . LEU B 1 295 ? 4.874   14.066  -7.829  1.00 23.23 ? 338  LEU B CD1 1 
ATOM   4895  C  CD2 . LEU B 1 295 ? 3.492   12.023  -7.742  1.00 25.32 ? 338  LEU B CD2 1 
ATOM   4896  N  N   . ILE B 1 296 ? 7.153   11.804  -3.531  1.00 21.21 ? 339  ILE B N   1 
ATOM   4897  C  CA  . ILE B 1 296 ? 7.370   11.152  -2.253  1.00 20.26 ? 339  ILE B CA  1 
ATOM   4898  C  C   . ILE B 1 296 ? 7.851   12.187  -1.237  1.00 20.10 ? 339  ILE B C   1 
ATOM   4899  O  O   . ILE B 1 296 ? 7.306   12.295  -0.134  1.00 20.78 ? 339  ILE B O   1 
ATOM   4900  C  CB  . ILE B 1 296 ? 8.434   10.048  -2.365  1.00 19.06 ? 339  ILE B CB  1 
ATOM   4901  C  CG1 . ILE B 1 296 ? 8.092   9.116   -3.530  1.00 19.71 ? 339  ILE B CG1 1 
ATOM   4902  C  CG2 . ILE B 1 296 ? 8.522   9.281   -1.071  1.00 16.90 ? 339  ILE B CG2 1 
ATOM   4903  C  CD1 . ILE B 1 296 ? 9.043   7.922   -3.698  1.00 20.90 ? 339  ILE B CD1 1 
ATOM   4904  N  N   . ALA B 1 297 ? 8.853   12.967  -1.640  1.00 19.08 ? 340  ALA B N   1 
ATOM   4905  C  CA  . ALA B 1 297 ? 9.469   13.980  -0.789  1.00 18.21 ? 340  ALA B CA  1 
ATOM   4906  C  C   . ALA B 1 297 ? 8.599   15.083  -0.222  1.00 17.63 ? 340  ALA B C   1 
ATOM   4907  O  O   . ALA B 1 297 ? 8.720   15.421  0.950   1.00 16.64 ? 340  ALA B O   1 
ATOM   4908  C  CB  . ALA B 1 297 ? 10.635  14.611  -1.513  1.00 18.12 ? 340  ALA B CB  1 
ATOM   4909  N  N   . GLN B 1 298 ? 7.723   15.649  -1.038  1.00 18.08 ? 341  GLN B N   1 
ATOM   4910  C  CA  . GLN B 1 298 ? 6.917   16.763  -0.565  1.00 18.43 ? 341  GLN B CA  1 
ATOM   4911  C  C   . GLN B 1 298 ? 5.414   16.576  -0.410  1.00 17.52 ? 341  GLN B C   1 
ATOM   4912  O  O   . GLN B 1 298 ? 4.733   17.483  0.057   1.00 17.29 ? 341  GLN B O   1 
ATOM   4913  C  CB  . GLN B 1 298 ? 7.196   17.998  -1.447  1.00 20.39 ? 341  GLN B CB  1 
ATOM   4914  C  CG  . GLN B 1 298 ? 8.622   18.594  -1.293  1.00 22.71 ? 341  GLN B CG  1 
ATOM   4915  C  CD  . GLN B 1 298 ? 8.829   19.864  -2.110  1.00 22.98 ? 341  GLN B CD  1 
ATOM   4916  O  OE1 . GLN B 1 298 ? 8.077   20.829  -1.969  1.00 22.97 ? 341  GLN B OE1 1 
ATOM   4917  N  NE2 . GLN B 1 298 ? 9.857   19.871  -2.964  1.00 22.54 ? 341  GLN B NE2 1 
ATOM   4918  N  N   . GLU B 1 299 ? 4.895   15.412  -0.778  1.00 17.01 ? 342  GLU B N   1 
ATOM   4919  C  CA  . GLU B 1 299 ? 3.462   15.155  -0.675  1.00 15.54 ? 342  GLU B CA  1 
ATOM   4920  C  C   . GLU B 1 299 ? 3.220   13.893  0.142   1.00 15.25 ? 342  GLU B C   1 
ATOM   4921  O  O   . GLU B 1 299 ? 2.119   13.670  0.670   1.00 13.86 ? 342  GLU B O   1 
ATOM   4922  C  CB  . GLU B 1 299 ? 2.861   14.973  -2.067  1.00 15.12 ? 342  GLU B CB  1 
ATOM   4923  C  CG  . GLU B 1 299 ? 2.932   16.176  -2.961  1.00 16.67 ? 342  GLU B CG  1 
ATOM   4924  C  CD  . GLU B 1 299 ? 1.939   17.242  -2.582  1.00 19.20 ? 342  GLU B CD  1 
ATOM   4925  O  OE1 . GLU B 1 299 ? 0.800   16.912  -2.183  1.00 21.50 ? 342  GLU B OE1 1 
ATOM   4926  O  OE2 . GLU B 1 299 ? 2.287   18.425  -2.705  1.00 19.53 ? 342  GLU B OE2 1 
ATOM   4927  N  N   . GLY B 1 300 ? 4.255   13.065  0.224   1.00 14.28 ? 343  GLY B N   1 
ATOM   4928  C  CA  . GLY B 1 300 ? 4.153   11.829  0.973   1.00 15.09 ? 343  GLY B CA  1 
ATOM   4929  C  C   . GLY B 1 300 ? 3.433   10.739  0.207   1.00 15.44 ? 343  GLY B C   1 
ATOM   4930  O  O   . GLY B 1 300 ? 2.842   9.819   0.794   1.00 17.10 ? 343  GLY B O   1 
ATOM   4931  N  N   . LEU B 1 301 ? 3.484   10.836  -1.113  1.00 13.23 ? 344  LEU B N   1 
ATOM   4932  C  CA  . LEU B 1 301 ? 2.836   9.853   -1.950  1.00 11.57 ? 344  LEU B CA  1 
ATOM   4933  C  C   . LEU B 1 301 ? 3.879   8.878   -2.454  1.00 12.27 ? 344  LEU B C   1 
ATOM   4934  O  O   . LEU B 1 301 ? 4.674   9.223   -3.319  1.00 12.13 ? 344  LEU B O   1 
ATOM   4935  C  CB  . LEU B 1 301 ? 2.143   10.563  -3.103  1.00 8.01  ? 344  LEU B CB  1 
ATOM   4936  C  CG  . LEU B 1 301 ? 1.058   11.465  -2.522  1.00 4.89  ? 344  LEU B CG  1 
ATOM   4937  C  CD1 . LEU B 1 301 ? 0.665   12.563  -3.494  1.00 5.05  ? 344  LEU B CD1 1 
ATOM   4938  C  CD2 . LEU B 1 301 ? -0.124  10.598  -2.134  1.00 3.95  ? 344  LEU B CD2 1 
ATOM   4939  N  N   . LEU B 1 302 ? 3.865   7.659   -1.913  1.00 12.58 ? 345  LEU B N   1 
ATOM   4940  C  CA  . LEU B 1 302 ? 4.833   6.626   -2.283  1.00 14.11 ? 345  LEU B CA  1 
ATOM   4941  C  C   . LEU B 1 302 ? 4.619   5.910   -3.637  1.00 16.21 ? 345  LEU B C   1 
ATOM   4942  O  O   . LEU B 1 302 ? 4.483   4.682   -3.700  1.00 15.83 ? 345  LEU B O   1 
ATOM   4943  C  CB  . LEU B 1 302 ? 4.918   5.607   -1.148  1.00 12.81 ? 345  LEU B CB  1 
ATOM   4944  C  CG  . LEU B 1 302 ? 5.703   6.016   0.095   1.00 12.60 ? 345  LEU B CG  1 
ATOM   4945  C  CD1 . LEU B 1 302 ? 5.631   4.930   1.125   1.00 13.22 ? 345  LEU B CD1 1 
ATOM   4946  C  CD2 . LEU B 1 302 ? 7.144   6.252   -0.259  1.00 12.87 ? 345  LEU B CD2 1 
ATOM   4947  N  N   . CYS B 1 303 ? 4.645   6.690   -4.717  1.00 18.42 ? 346  CYS B N   1 
ATOM   4948  C  CA  . CYS B 1 303 ? 4.432   6.190   -6.081  1.00 20.53 ? 346  CYS B CA  1 
ATOM   4949  C  C   . CYS B 1 303 ? 5.694   5.982   -6.905  1.00 20.27 ? 346  CYS B C   1 
ATOM   4950  O  O   . CYS B 1 303 ? 6.810   6.178   -6.424  1.00 21.67 ? 346  CYS B O   1 
ATOM   4951  C  CB  . CYS B 1 303 ? 3.522   7.150   -6.829  1.00 21.31 ? 346  CYS B CB  1 
ATOM   4952  S  SG  . CYS B 1 303 ? 4.091   8.838   -6.660  1.00 24.66 ? 346  CYS B SG  1 
ATOM   4953  N  N   . GLY B 1 304 ? 5.496   5.614   -8.168  1.00 19.82 ? 347  GLY B N   1 
ATOM   4954  C  CA  . GLY B 1 304 ? 6.620   5.324   -9.050  1.00 18.55 ? 347  GLY B CA  1 
ATOM   4955  C  C   . GLY B 1 304 ? 6.635   6.067   -10.390 1.00 16.83 ? 347  GLY B C   1 
ATOM   4956  O  O   . GLY B 1 304 ? 5.774   6.893   -10.674 1.00 16.89 ? 347  GLY B O   1 
ATOM   4957  N  N   . GLY B 1 305 ? 7.631   5.724   -11.205 1.00 15.87 ? 348  GLY B N   1 
ATOM   4958  C  CA  . GLY B 1 305 ? 7.844   6.321   -12.518 1.00 16.75 ? 348  GLY B CA  1 
ATOM   4959  C  C   . GLY B 1 305 ? 6.543   6.817   -13.170 1.00 17.05 ? 348  GLY B C   1 
ATOM   4960  O  O   . GLY B 1 305 ? 6.392   7.994   -13.462 1.00 17.97 ? 348  GLY B O   1 
ATOM   4961  N  N   . SER B 1 306 ? 5.637   5.871   -13.383 1.00 17.72 ? 349  SER B N   1 
ATOM   4962  C  CA  . SER B 1 306 ? 4.352   6.255   -13.944 1.00 18.27 ? 349  SER B CA  1 
ATOM   4963  C  C   . SER B 1 306 ? 3.942   7.640   -13.514 1.00 18.62 ? 349  SER B C   1 
ATOM   4964  O  O   . SER B 1 306 ? 3.878   8.565   -14.344 1.00 16.97 ? 349  SER B O   1 
ATOM   4965  C  CB  . SER B 1 306 ? 3.272   5.257   -13.566 1.00 20.55 ? 349  SER B CB  1 
ATOM   4966  O  OG  . SER B 1 306 ? 3.145   5.146   -12.155 1.00 19.40 ? 349  SER B OG  1 
ATOM   4967  N  N   . ALA B 1 307 ? 3.648   7.847   -12.246 1.00 18.96 ? 350  ALA B N   1 
ATOM   4968  C  CA  . ALA B 1 307 ? 3.209   9.150   -11.806 1.00 18.70 ? 350  ALA B CA  1 
ATOM   4969  C  C   . ALA B 1 307 ? 4.165   10.275  -12.132 1.00 19.03 ? 350  ALA B C   1 
ATOM   4970  O  O   . ALA B 1 307 ? 3.740   11.324  -12.629 1.00 21.03 ? 350  ALA B O   1 
ATOM   4971  C  CB  . ALA B 1 307 ? 2.948   9.115   -10.311 1.00 18.30 ? 350  ALA B CB  1 
ATOM   4972  N  N   . GLY B 1 308 ? 5.446   10.074  -11.838 1.00 17.21 ? 351  GLY B N   1 
ATOM   4973  C  CA  . GLY B 1 308 ? 6.420   11.100  -12.160 1.00 16.31 ? 351  GLY B CA  1 
ATOM   4974  C  C   . GLY B 1 308 ? 6.020   11.709  -13.491 1.00 15.04 ? 351  GLY B C   1 
ATOM   4975  O  O   . GLY B 1 308 ? 5.705   12.889  -13.569 1.00 14.66 ? 351  GLY B O   1 
ATOM   4976  N  N   . SER B 1 309 ? 6.020   10.878  -14.529 1.00 13.73 ? 352  SER B N   1 
ATOM   4977  C  CA  . SER B 1 309 ? 5.634   11.299  -15.871 1.00 13.26 ? 352  SER B CA  1 
ATOM   4978  C  C   . SER B 1 309 ? 4.256   11.939  -15.910 1.00 13.14 ? 352  SER B C   1 
ATOM   4979  O  O   . SER B 1 309 ? 4.071   12.978  -16.537 1.00 14.15 ? 352  SER B O   1 
ATOM   4980  C  CB  . SER B 1 309 ? 5.654   10.110  -16.835 1.00 12.75 ? 352  SER B CB  1 
ATOM   4981  O  OG  . SER B 1 309 ? 6.943   9.527   -16.915 1.00 11.76 ? 352  SER B OG  1 
ATOM   4982  N  N   . THR B 1 310 ? 3.286   11.335  -15.239 1.00 12.49 ? 353  THR B N   1 
ATOM   4983  C  CA  . THR B 1 310 ? 1.940   11.895  -15.252 1.00 11.54 ? 353  THR B CA  1 
ATOM   4984  C  C   . THR B 1 310 ? 1.910   13.301  -14.676 1.00 14.05 ? 353  THR B C   1 
ATOM   4985  O  O   . THR B 1 310 ? 1.404   14.228  -15.310 1.00 14.70 ? 353  THR B O   1 
ATOM   4986  C  CB  . THR B 1 310 ? 0.940   11.018  -14.470 1.00 9.56  ? 353  THR B CB  1 
ATOM   4987  O  OG1 . THR B 1 310 ? 0.923   9.701   -15.033 1.00 9.45  ? 353  THR B OG1 1 
ATOM   4988  C  CG2 . THR B 1 310 ? -0.468  11.615  -14.534 1.00 6.16  ? 353  THR B CG2 1 
ATOM   4989  N  N   . VAL B 1 311 ? 2.456   13.473  -13.482 1.00 15.76 ? 354  VAL B N   1 
ATOM   4990  C  CA  . VAL B 1 311 ? 2.442   14.798  -12.884 1.00 18.24 ? 354  VAL B CA  1 
ATOM   4991  C  C   . VAL B 1 311 ? 3.496   15.729  -13.513 1.00 20.25 ? 354  VAL B C   1 
ATOM   4992  O  O   . VAL B 1 311 ? 3.344   16.962  -13.517 1.00 21.01 ? 354  VAL B O   1 
ATOM   4993  C  CB  . VAL B 1 311 ? 2.618   14.717  -11.345 1.00 17.69 ? 354  VAL B CB  1 
ATOM   4994  C  CG1 . VAL B 1 311 ? 2.658   16.124  -10.756 1.00 16.48 ? 354  VAL B CG1 1 
ATOM   4995  C  CG2 . VAL B 1 311 ? 1.464   13.926  -10.727 1.00 13.64 ? 354  VAL B CG2 1 
ATOM   4996  N  N   . ALA B 1 312 ? 4.548   15.144  -14.066 1.00 20.17 ? 355  ALA B N   1 
ATOM   4997  C  CA  . ALA B 1 312 ? 5.570   15.951  -14.718 1.00 21.94 ? 355  ALA B CA  1 
ATOM   4998  C  C   . ALA B 1 312 ? 4.961   16.797  -15.833 1.00 21.62 ? 355  ALA B C   1 
ATOM   4999  O  O   . ALA B 1 312 ? 5.605   17.687  -16.361 1.00 21.57 ? 355  ALA B O   1 
ATOM   5000  C  CB  . ALA B 1 312 ? 6.656   15.055  -15.311 1.00 24.73 ? 355  ALA B CB  1 
ATOM   5001  N  N   . VAL B 1 313 ? 3.720   16.503  -16.191 1.00 21.66 ? 356  VAL B N   1 
ATOM   5002  C  CA  . VAL B 1 313 ? 3.035   17.203  -17.266 1.00 21.32 ? 356  VAL B CA  1 
ATOM   5003  C  C   . VAL B 1 313 ? 1.946   18.152  -16.761 1.00 21.93 ? 356  VAL B C   1 
ATOM   5004  O  O   . VAL B 1 313 ? 1.743   19.219  -17.339 1.00 22.39 ? 356  VAL B O   1 
ATOM   5005  C  CB  . VAL B 1 313 ? 2.385   16.170  -18.237 1.00 21.09 ? 356  VAL B CB  1 
ATOM   5006  C  CG1 . VAL B 1 313 ? 1.902   16.850  -19.498 1.00 19.08 ? 356  VAL B CG1 1 
ATOM   5007  C  CG2 . VAL B 1 313 ? 3.375   15.069  -18.573 1.00 19.02 ? 356  VAL B CG2 1 
ATOM   5008  N  N   . ALA B 1 314 ? 1.241   17.760  -15.695 1.00 21.73 ? 357  ALA B N   1 
ATOM   5009  C  CA  . ALA B 1 314 ? 0.161   18.588  -15.133 1.00 20.78 ? 357  ALA B CA  1 
ATOM   5010  C  C   . ALA B 1 314 ? 0.651   20.005  -14.840 1.00 21.08 ? 357  ALA B C   1 
ATOM   5011  O  O   . ALA B 1 314 ? -0.052  20.984  -15.098 1.00 20.58 ? 357  ALA B O   1 
ATOM   5012  C  CB  . ALA B 1 314 ? -0.399  17.956  -13.862 1.00 19.48 ? 357  ALA B CB  1 
ATOM   5013  N  N   . VAL B 1 315 ? 1.860   20.108  -14.299 1.00 21.08 ? 358  VAL B N   1 
ATOM   5014  C  CA  . VAL B 1 315 ? 2.425   21.405  -14.003 1.00 20.01 ? 358  VAL B CA  1 
ATOM   5015  C  C   . VAL B 1 315 ? 2.397   22.287  -15.251 1.00 20.05 ? 358  VAL B C   1 
ATOM   5016  O  O   . VAL B 1 315 ? 1.879   23.396  -15.198 1.00 21.36 ? 358  VAL B O   1 
ATOM   5017  C  CB  . VAL B 1 315 ? 3.879   21.286  -13.465 1.00 20.43 ? 358  VAL B CB  1 
ATOM   5018  C  CG1 . VAL B 1 315 ? 3.861   20.870  -12.008 1.00 19.07 ? 358  VAL B CG1 1 
ATOM   5019  C  CG2 . VAL B 1 315 ? 4.652   20.258  -14.255 1.00 20.23 ? 358  VAL B CG2 1 
ATOM   5020  N  N   . LYS B 1 316 ? 2.920   21.810  -16.379 1.00 18.54 ? 359  LYS B N   1 
ATOM   5021  C  CA  . LYS B 1 316 ? 2.905   22.640  -17.579 1.00 19.31 ? 359  LYS B CA  1 
ATOM   5022  C  C   . LYS B 1 316 ? 1.553   22.698  -18.281 1.00 20.95 ? 359  LYS B C   1 
ATOM   5023  O  O   . LYS B 1 316 ? 1.172   23.737  -18.813 1.00 21.74 ? 359  LYS B O   1 
ATOM   5024  C  CB  . LYS B 1 316 ? 3.962   22.189  -18.582 1.00 18.51 ? 359  LYS B CB  1 
ATOM   5025  C  CG  . LYS B 1 316 ? 4.707   20.916  -18.238 1.00 22.06 ? 359  LYS B CG  1 
ATOM   5026  C  CD  . LYS B 1 316 ? 5.805   21.119  -17.202 1.00 23.37 ? 359  LYS B CD  1 
ATOM   5027  C  CE  . LYS B 1 316 ? 6.764   19.935  -17.214 1.00 23.93 ? 359  LYS B CE  1 
ATOM   5028  N  NZ  . LYS B 1 316 ? 7.892   20.026  -16.263 1.00 24.04 ? 359  LYS B NZ  1 
ATOM   5029  N  N   . ALA B 1 317 ? 0.822   21.588  -18.283 1.00 21.94 ? 360  ALA B N   1 
ATOM   5030  C  CA  . ALA B 1 317 ? -0.481  21.577  -18.906 1.00 22.43 ? 360  ALA B CA  1 
ATOM   5031  C  C   . ALA B 1 317 ? -1.546  22.202  -18.017 1.00 23.65 ? 360  ALA B C   1 
ATOM   5032  O  O   . ALA B 1 317 ? -2.454  22.877  -18.486 1.00 22.11 ? 360  ALA B O   1 
ATOM   5033  C  CB  . ALA B 1 317 ? -0.889  20.139  -19.253 1.00 21.72 ? 360  ALA B CB  1 
ATOM   5034  N  N   . ALA B 1 318 ? -1.410  21.961  -16.736 1.00 25.93 ? 361  ALA B N   1 
ATOM   5035  C  CA  . ALA B 1 318 ? -2.387  22.452  -15.766 1.00 28.56 ? 361  ALA B CA  1 
ATOM   5036  C  C   . ALA B 1 318 ? -2.304  23.973  -15.515 1.00 30.45 ? 361  ALA B C   1 
ATOM   5037  O  O   . ALA B 1 318 ? -2.872  24.500  -14.545 1.00 30.79 ? 361  ALA B O   1 
ATOM   5038  C  CB  . ALA B 1 318 ? -2.225  21.705  -14.452 1.00 27.90 ? 361  ALA B CB  1 
ATOM   5039  N  N   . GLN B 1 319 ? -1.585  24.636  -16.439 1.00 32.29 ? 362  GLN B N   1 
ATOM   5040  C  CA  . GLN B 1 319 ? -1.370  26.086  -16.449 1.00 33.66 ? 362  GLN B CA  1 
ATOM   5041  C  C   . GLN B 1 319 ? -2.615  26.862  -16.893 1.00 34.80 ? 362  GLN B C   1 
ATOM   5042  O  O   . GLN B 1 319 ? -3.065  27.733  -16.163 1.00 35.72 ? 362  GLN B O   1 
ATOM   5043  C  CB  . GLN B 1 319 ? -0.183  26.419  -17.376 1.00 33.36 ? 362  GLN B CB  1 
ATOM   5044  C  CG  . GLN B 1 319 ? 1.145   25.836  -16.946 1.00 32.97 ? 362  GLN B CG  1 
ATOM   5045  C  CD  . GLN B 1 319 ? 1.589   26.375  -15.597 1.00 34.70 ? 362  GLN B CD  1 
ATOM   5046  O  OE1 . GLN B 1 319 ? 2.124   27.480  -15.498 1.00 34.54 ? 362  GLN B OE1 1 
ATOM   5047  N  NE2 . GLN B 1 319 ? 1.461   25.754  -14.430 1.00 36.20 ? 362  GLN B NE2 1 
ATOM   5048  N  N   . GLU B 1 320 ? -3.165  26.542  -18.054 1.00 36.21 ? 363  GLU B N   1 
ATOM   5049  C  CA  . GLU B 1 320 ? -4.321  27.328  -18.410 1.00 36.76 ? 363  GLU B CA  1 
ATOM   5050  C  C   . GLU B 1 320 ? -5.242  27.564  -17.223 1.00 36.47 ? 363  GLU B C   1 
ATOM   5051  O  O   . GLU B 1 320 ? -5.662  28.700  -16.975 1.00 37.67 ? 363  GLU B O   1 
ATOM   5052  C  CB  . GLU B 1 320 ? -5.148  26.673  -19.574 1.00 37.79 ? 363  GLU B CB  1 
ATOM   5053  C  CG  . GLU B 1 320 ? -4.927  25.188  -19.906 1.00 39.98 ? 363  GLU B CG  1 
ATOM   5054  C  CD  . GLU B 1 320 ? -5.580  24.742  -21.224 1.00 41.34 ? 363  GLU B CD  1 
ATOM   5055  O  OE1 . GLU B 1 320 ? -4.993  25.039  -22.281 1.00 42.81 ? 363  GLU B OE1 1 
ATOM   5056  O  OE2 . GLU B 1 320 ? -6.664  24.113  -21.173 1.00 41.84 ? 363  GLU B OE2 1 
ATOM   5057  N  N   . LEU B 1 321 ? -5.571  26.508  -16.513 1.00 36.24 ? 364  LEU B N   1 
ATOM   5058  C  CA  . LEU B 1 321 ? -6.563  26.516  -15.460 1.00 35.63 ? 364  LEU B CA  1 
ATOM   5059  C  C   . LEU B 1 321 ? -6.526  27.649  -14.424 1.00 35.03 ? 364  LEU B C   1 
ATOM   5060  O  O   . LEU B 1 321 ? -5.459  28.165  -14.110 1.00 35.62 ? 364  LEU B O   1 
ATOM   5061  C  CB  . LEU B 1 321 ? -6.526  25.160  -14.780 1.00 35.46 ? 364  LEU B CB  1 
ATOM   5062  C  CG  . LEU B 1 321 ? -7.344  24.044  -15.429 1.00 35.27 ? 364  LEU B CG  1 
ATOM   5063  C  CD1 . LEU B 1 321 ? -7.095  23.992  -16.930 1.00 34.47 ? 364  LEU B CD1 1 
ATOM   5064  C  CD2 . LEU B 1 321 ? -6.996  22.715  -14.792 1.00 35.46 ? 364  LEU B CD2 1 
ATOM   5065  N  N   . GLN B 1 322 ? -7.715  28.019  -13.892 1.00 34.24 ? 365  GLN B N   1 
ATOM   5066  C  CA  . GLN B 1 322 ? -7.827  29.038  -12.837 1.00 33.63 ? 365  GLN B CA  1 
ATOM   5067  C  C   . GLN B 1 322 ? -8.647  28.511  -11.655 1.00 32.74 ? 365  GLN B C   1 
ATOM   5068  O  O   . GLN B 1 322 ? -9.009  27.342  -11.579 1.00 30.90 ? 365  GLN B O   1 
ATOM   5069  C  CB  . GLN B 1 322 ? -8.510  30.325  -13.348 1.00 34.00 ? 365  GLN B CB  1 
ATOM   5070  C  CG  . GLN B 1 322 ? -7.797  30.999  -14.508 1.00 33.81 ? 365  GLN B CG  1 
ATOM   5071  C  CD  . GLN B 1 322 ? -7.957  32.494  -14.532 1.00 33.51 ? 365  GLN B CD  1 
ATOM   5072  O  OE1 . GLN B 1 322 ? -7.536  33.139  -15.481 1.00 33.47 ? 365  GLN B OE1 1 
ATOM   5073  N  NE2 . GLN B 1 322 ? -8.518  33.248  -13.608 1.00 32.06 ? 365  GLN B NE2 1 
ATOM   5074  N  N   . GLU B 1 323 ? -8.934  29.428  -10.734 1.00 31.67 ? 366  GLU B N   1 
ATOM   5075  C  CA  . GLU B 1 323 ? -9.700  29.140  -9.525  1.00 31.25 ? 366  GLU B CA  1 
ATOM   5076  C  C   . GLU B 1 323 ? -11.026 28.455  -9.847  1.00 30.10 ? 366  GLU B C   1 
ATOM   5077  O  O   . GLU B 1 323 ? -11.610 28.636  -10.906 1.00 28.99 ? 366  GLU B O   1 
ATOM   5078  C  CB  . GLU B 1 323 ? -9.909  30.398  -8.676  1.00 31.38 ? 366  GLU B CB  1 
ATOM   5079  C  CG  . GLU B 1 323 ? -8.627  30.803  -7.974  1.00 33.21 ? 366  GLU B CG  1 
ATOM   5080  C  CD  . GLU B 1 323 ? -7.586  31.250  -8.958  1.00 34.33 ? 366  GLU B CD  1 
ATOM   5081  O  OE1 . GLU B 1 323 ? -7.828  32.259  -9.654  1.00 34.22 ? 366  GLU B OE1 1 
ATOM   5082  O  OE2 . GLU B 1 323 ? -6.517  30.613  -9.031  1.00 34.54 ? 366  GLU B OE2 1 
ATOM   5083  N  N   . GLY B 1 324 ? -11.469 27.681  -8.861  1.00 29.27 ? 367  GLY B N   1 
ATOM   5084  C  CA  . GLY B 1 324 ? -12.520 26.726  -8.871  1.00 28.73 ? 367  GLY B CA  1 
ATOM   5085  C  C   . GLY B 1 324 ? -12.387 25.649  -9.932  1.00 27.32 ? 367  GLY B C   1 
ATOM   5086  O  O   . GLY B 1 324 ? -13.368 24.937  -10.170 1.00 27.70 ? 367  GLY B O   1 
ATOM   5087  N  N   . GLN B 1 325 ? -11.227 25.509  -10.566 1.00 24.67 ? 368  GLN B N   1 
ATOM   5088  C  CA  . GLN B 1 325 ? -11.083 24.510  -11.607 1.00 22.72 ? 368  GLN B CA  1 
ATOM   5089  C  C   . GLN B 1 325 ? -10.276 23.371  -11.049 1.00 20.54 ? 368  GLN B C   1 
ATOM   5090  O  O   . GLN B 1 325 ? -9.249  23.599  -10.423 1.00 20.47 ? 368  GLN B O   1 
ATOM   5091  C  CB  . GLN B 1 325 ? -10.372 25.069  -12.841 1.00 23.07 ? 368  GLN B CB  1 
ATOM   5092  C  CG  . GLN B 1 325 ? -11.085 26.210  -13.531 1.00 23.72 ? 368  GLN B CG  1 
ATOM   5093  C  CD  . GLN B 1 325 ? -10.751 26.294  -15.012 1.00 23.76 ? 368  GLN B CD  1 
ATOM   5094  O  OE1 . GLN B 1 325 ? -9.584  26.265  -15.417 1.00 23.31 ? 368  GLN B OE1 1 
ATOM   5095  N  NE2 . GLN B 1 325 ? -11.786 26.401  -15.831 1.00 22.97 ? 368  GLN B NE2 1 
ATOM   5096  N  N   . ARG B 1 326 ? -10.754 22.150  -11.260 1.00 17.57 ? 369  ARG B N   1 
ATOM   5097  C  CA  . ARG B 1 326 ? -10.037 20.986  -10.796 1.00 15.94 ? 369  ARG B CA  1 
ATOM   5098  C  C   . ARG B 1 326 ? -9.274  20.397  -11.971 1.00 17.22 ? 369  ARG B C   1 
ATOM   5099  O  O   . ARG B 1 326 ? -9.468  20.790  -13.122 1.00 16.80 ? 369  ARG B O   1 
ATOM   5100  C  CB  . ARG B 1 326 ? -10.983 19.914  -10.248 1.00 15.00 ? 369  ARG B CB  1 
ATOM   5101  C  CG  . ARG B 1 326 ? -11.580 20.164  -8.867  1.00 13.83 ? 369  ARG B CG  1 
ATOM   5102  C  CD  . ARG B 1 326 ? -12.282 18.903  -8.354  1.00 11.00 ? 369  ARG B CD  1 
ATOM   5103  N  NE  . ARG B 1 326 ? -13.628 19.170  -7.868  1.00 11.06 ? 369  ARG B NE  1 
ATOM   5104  C  CZ  . ARG B 1 326 ? -13.908 19.830  -6.751  1.00 12.37 ? 369  ARG B CZ  1 
ATOM   5105  N  NH1 . ARG B 1 326 ? -12.927 20.294  -5.992  1.00 12.45 ? 369  ARG B NH1 1 
ATOM   5106  N  NH2 . ARG B 1 326 ? -15.170 20.032  -6.391  1.00 10.65 ? 369  ARG B NH2 1 
ATOM   5107  N  N   . CYS B 1 327 ? -8.393  19.457  -11.653 1.00 17.70 ? 370  CYS B N   1 
ATOM   5108  C  CA  . CYS B 1 327 ? -7.595  18.741  -12.627 1.00 17.52 ? 370  CYS B CA  1 
ATOM   5109  C  C   . CYS B 1 327 ? -7.148  17.472  -11.950 1.00 19.71 ? 370  CYS B C   1 
ATOM   5110  O  O   . CYS B 1 327 ? -6.271  17.497  -11.081 1.00 21.29 ? 370  CYS B O   1 
ATOM   5111  C  CB  . CYS B 1 327 ? -6.363  19.515  -13.051 1.00 16.22 ? 370  CYS B CB  1 
ATOM   5112  S  SG  . CYS B 1 327 ? -5.270  18.465  -14.017 1.00 17.26 ? 370  CYS B SG  1 
ATOM   5113  N  N   . VAL B 1 328 ? -7.767  16.365  -12.344 1.00 20.11 ? 371  VAL B N   1 
ATOM   5114  C  CA  . VAL B 1 328 ? -7.448  15.067  -11.777 1.00 18.71 ? 371  VAL B CA  1 
ATOM   5115  C  C   . VAL B 1 328 ? -6.288  14.428  -12.510 1.00 18.82 ? 371  VAL B C   1 
ATOM   5116  O  O   . VAL B 1 328 ? -6.107  14.620  -13.715 1.00 18.82 ? 371  VAL B O   1 
ATOM   5117  C  CB  . VAL B 1 328 ? -8.670  14.136  -11.815 1.00 18.08 ? 371  VAL B CB  1 
ATOM   5118  C  CG1 . VAL B 1 328 ? -8.287  12.753  -11.348 1.00 19.16 ? 371  VAL B CG1 1 
ATOM   5119  C  CG2 . VAL B 1 328 ? -9.761  14.697  -10.927 1.00 17.94 ? 371  VAL B CG2 1 
ATOM   5120  N  N   . VAL B 1 329 ? -5.511  13.669  -11.747 1.00 18.87 ? 372  VAL B N   1 
ATOM   5121  C  CA  . VAL B 1 329 ? -4.310  12.975  -12.212 1.00 17.79 ? 372  VAL B CA  1 
ATOM   5122  C  C   . VAL B 1 329 ? -4.381  11.492  -11.823 1.00 19.26 ? 372  VAL B C   1 
ATOM   5123  O  O   . VAL B 1 329 ? -4.997  11.138  -10.814 1.00 19.46 ? 372  VAL B O   1 
ATOM   5124  C  CB  . VAL B 1 329 ? -3.036  13.637  -11.567 1.00 16.12 ? 372  VAL B CB  1 
ATOM   5125  C  CG1 . VAL B 1 329 ? -1.989  12.599  -11.254 1.00 15.81 ? 372  VAL B CG1 1 
ATOM   5126  C  CG2 . VAL B 1 329 ? -2.473  14.689  -12.491 1.00 13.32 ? 372  VAL B CG2 1 
ATOM   5127  N  N   . ILE B 1 330 ? -3.759  10.631  -12.623 1.00 19.39 ? 373  ILE B N   1 
ATOM   5128  C  CA  . ILE B 1 330 ? -3.749  9.206   -12.329 1.00 18.83 ? 373  ILE B CA  1 
ATOM   5129  C  C   . ILE B 1 330 ? -2.372  8.747   -11.864 1.00 20.09 ? 373  ILE B C   1 
ATOM   5130  O  O   . ILE B 1 330 ? -1.394  8.825   -12.603 1.00 20.42 ? 373  ILE B O   1 
ATOM   5131  C  CB  . ILE B 1 330 ? -4.169  8.370   -13.564 1.00 18.93 ? 373  ILE B CB  1 
ATOM   5132  C  CG1 . ILE B 1 330 ? -5.635  8.607   -13.883 1.00 19.87 ? 373  ILE B CG1 1 
ATOM   5133  C  CG2 . ILE B 1 330 ? -4.042  6.892   -13.276 1.00 18.35 ? 373  ILE B CG2 1 
ATOM   5134  C  CD1 . ILE B 1 330 ? -6.580  7.974   -12.874 1.00 20.44 ? 373  ILE B CD1 1 
ATOM   5135  N  N   . LEU B 1 331 ? -2.290  8.286   -10.626 1.00 21.16 ? 374  LEU B N   1 
ATOM   5136  C  CA  . LEU B 1 331 ? -1.029  7.790   -10.112 1.00 23.76 ? 374  LEU B CA  1 
ATOM   5137  C  C   . LEU B 1 331 ? -1.110  6.277   -10.206 1.00 25.86 ? 374  LEU B C   1 
ATOM   5138  O  O   . LEU B 1 331 ? -1.612  5.615   -9.290  1.00 28.21 ? 374  LEU B O   1 
ATOM   5139  C  CB  . LEU B 1 331 ? -0.798  8.239   -8.662  1.00 23.85 ? 374  LEU B CB  1 
ATOM   5140  C  CG  . LEU B 1 331 ? -0.764  9.725   -8.395  1.00 25.11 ? 374  LEU B CG  1 
ATOM   5141  C  CD1 . LEU B 1 331 ? -0.486  10.009  -6.939  1.00 25.50 ? 374  LEU B CD1 1 
ATOM   5142  C  CD2 . LEU B 1 331 ? 0.281   10.406  -9.279  1.00 24.55 ? 374  LEU B CD2 1 
ATOM   5143  N  N   . PRO B 1 332 ? -0.603  5.708   -11.294 1.00 27.17 ? 375  PRO B N   1 
ATOM   5144  C  CA  . PRO B 1 332 ? -0.764  4.262   -11.516 1.00 26.34 ? 375  PRO B CA  1 
ATOM   5145  C  C   . PRO B 1 332 ? -0.407  3.205   -10.501 1.00 25.93 ? 375  PRO B C   1 
ATOM   5146  O  O   . PRO B 1 332 ? -1.179  2.264   -10.268 1.00 26.94 ? 375  PRO B O   1 
ATOM   5147  C  CB  . PRO B 1 332 ? -0.033  4.012   -12.814 1.00 27.16 ? 375  PRO B CB  1 
ATOM   5148  C  CG  . PRO B 1 332 ? -0.428  5.207   -13.615 1.00 27.73 ? 375  PRO B CG  1 
ATOM   5149  C  CD  . PRO B 1 332 ? -0.785  6.286   -12.641 1.00 26.80 ? 375  PRO B CD  1 
ATOM   5150  N  N   . ASP B 1 333 ? 0.783   3.281   -9.998  1.00 26.02 ? 376  ASP B N   1 
ATOM   5151  C  CA  . ASP B 1 333 ? 1.214   2.219   -9.143  1.00 25.29 ? 376  ASP B CA  1 
ATOM   5152  C  C   . ASP B 1 333 ? 2.201   2.728   -8.113  1.00 23.75 ? 376  ASP B C   1 
ATOM   5153  O  O   . ASP B 1 333 ? 2.690   3.856   -8.241  1.00 22.80 ? 376  ASP B O   1 
ATOM   5154  C  CB  . ASP B 1 333 ? 1.762   1.047   -9.990  1.00 25.97 ? 376  ASP B CB  1 
ATOM   5155  C  CG  . ASP B 1 333 ? 3.245   1.080   -10.320 1.00 27.03 ? 376  ASP B CG  1 
ATOM   5156  O  OD1 . ASP B 1 333 ? 3.819   -0.007  -10.499 1.00 26.38 ? 376  ASP B OD1 1 
ATOM   5157  O  OD2 . ASP B 1 333 ? 3.823   2.171   -10.412 1.00 28.30 ? 376  ASP B OD2 1 
ATOM   5158  N  N   . SER B 1 334 ? 2.490   1.913   -7.113  1.00 23.57 ? 377  SER B N   1 
ATOM   5159  C  CA  . SER B 1 334 ? 3.364   2.255   -5.991  1.00 24.01 ? 377  SER B CA  1 
ATOM   5160  C  C   . SER B 1 334 ? 4.862   2.088   -6.262  1.00 24.27 ? 377  SER B C   1 
ATOM   5161  O  O   . SER B 1 334 ? 5.303   1.779   -7.354  1.00 24.35 ? 377  SER B O   1 
ATOM   5162  C  CB  . SER B 1 334 ? 3.019   1.419   -4.770  1.00 23.61 ? 377  SER B CB  1 
ATOM   5163  O  OG  . SER B 1 334 ? 3.953   0.359   -4.601  1.00 24.94 ? 377  SER B OG  1 
ATOM   5164  N  N   . VAL B 1 335 ? 5.626   2.300   -5.179  1.00 25.26 ? 378  VAL B N   1 
ATOM   5165  C  CA  . VAL B 1 335 ? 7.089   2.221   -5.234  1.00 25.62 ? 378  VAL B CA  1 
ATOM   5166  C  C   . VAL B 1 335 ? 7.666   0.844   -5.054  1.00 25.62 ? 378  VAL B C   1 
ATOM   5167  O  O   . VAL B 1 335 ? 8.838   0.631   -5.325  1.00 26.04 ? 378  VAL B O   1 
ATOM   5168  C  CB  . VAL B 1 335 ? 7.731   3.108   -4.125  1.00 26.65 ? 378  VAL B CB  1 
ATOM   5169  C  CG1 . VAL B 1 335 ? 8.027   4.493   -4.657  1.00 27.64 ? 378  VAL B CG1 1 
ATOM   5170  C  CG2 . VAL B 1 335 ? 6.800   3.191   -2.921  1.00 26.23 ? 378  VAL B CG2 1 
ATOM   5171  N  N   . ARG B 1 336 ? 6.862   -0.091  -4.590  1.00 25.13 ? 379  ARG B N   1 
ATOM   5172  C  CA  . ARG B 1 336 ? 7.364   -1.445  -4.334  1.00 24.87 ? 379  ARG B CA  1 
ATOM   5173  C  C   . ARG B 1 336 ? 8.125   -2.063  -5.509  1.00 24.99 ? 379  ARG B C   1 
ATOM   5174  O  O   . ARG B 1 336 ? 9.301   -2.408  -5.348  1.00 25.36 ? 379  ARG B O   1 
ATOM   5175  C  CB  . ARG B 1 336 ? 6.253   -2.406  -3.923  1.00 22.55 ? 379  ARG B CB  1 
ATOM   5176  C  CG  . ARG B 1 336 ? 6.830   -3.727  -3.432  1.00 22.58 ? 379  ARG B CG  1 
ATOM   5177  C  CD  . ARG B 1 336 ? 5.799   -4.832  -3.339  1.00 23.09 ? 379  ARG B CD  1 
ATOM   5178  N  NE  . ARG B 1 336 ? 5.177   -5.126  -4.626  1.00 22.66 ? 379  ARG B NE  1 
ATOM   5179  C  CZ  . ARG B 1 336 ? 4.218   -4.386  -5.178  1.00 24.79 ? 379  ARG B CZ  1 
ATOM   5180  N  NH1 . ARG B 1 336 ? 3.761   -3.301  -4.560  1.00 24.36 ? 379  ARG B NH1 1 
ATOM   5181  N  NH2 . ARG B 1 336 ? 3.713   -4.729  -6.354  1.00 25.48 ? 379  ARG B NH2 1 
ATOM   5182  N  N   . ASN B 1 337 ? 7.484   -2.202  -6.686  1.00 25.44 ? 380  ASN B N   1 
ATOM   5183  C  CA  . ASN B 1 337 ? 8.243   -2.761  -7.809  1.00 25.88 ? 380  ASN B CA  1 
ATOM   5184  C  C   . ASN B 1 337 ? 9.295   -1.759  -8.276  1.00 25.73 ? 380  ASN B C   1 
ATOM   5185  O  O   . ASN B 1 337 ? 10.037  -2.037  -9.212  1.00 25.78 ? 380  ASN B O   1 
ATOM   5186  C  CB  . ASN B 1 337 ? 7.343   -3.285  -8.917  1.00 27.15 ? 380  ASN B CB  1 
ATOM   5187  C  CG  . ASN B 1 337 ? 6.099   -2.488  -9.096  1.00 27.60 ? 380  ASN B CG  1 
ATOM   5188  O  OD1 . ASN B 1 337 ? 5.377   -2.182  -8.151  1.00 26.60 ? 380  ASN B OD1 1 
ATOM   5189  N  ND2 . ASN B 1 337 ? 5.827   -2.136  -10.347 1.00 26.23 ? 380  ASN B ND2 1 
ATOM   5190  N  N   . TYR B 1 338 ? 9.360   -0.605  -7.655  1.00 26.47 ? 381  TYR B N   1 
ATOM   5191  C  CA  . TYR B 1 338 ? 10.598  0.249   -7.830  1.00 27.37 ? 381  TYR B CA  1 
ATOM   5192  C  C   . TYR B 1 338 ? 11.649  0.523   -6.729  1.00 27.86 ? 381  TYR B C   1 
ATOM   5193  O  O   . TYR B 1 338 ? 12.370  1.533   -6.776  1.00 28.51 ? 381  TYR B O   1 
ATOM   5194  C  CB  . TYR B 1 338 ? 9.839   1.543   -8.157  1.00 27.58 ? 381  TYR B CB  1 
ATOM   5195  C  CG  . TYR B 1 338 ? 8.860   1.423   -9.317  1.00 28.63 ? 381  TYR B CG  1 
ATOM   5196  C  CD1 . TYR B 1 338 ? 7.643   2.111   -9.308  1.00 26.94 ? 381  TYR B CD1 1 
ATOM   5197  C  CD2 . TYR B 1 338 ? 9.151   0.618   -10.425 1.00 29.34 ? 381  TYR B CD2 1 
ATOM   5198  C  CE1 . TYR B 1 338 ? 6.745   2.006   -10.367 1.00 25.99 ? 381  TYR B CE1 1 
ATOM   5199  C  CE2 . TYR B 1 338 ? 8.262   0.508   -11.492 1.00 28.43 ? 381  TYR B CE2 1 
ATOM   5200  C  CZ  . TYR B 1 338 ? 7.063   1.204   -11.462 1.00 27.65 ? 381  TYR B CZ  1 
ATOM   5201  O  OH  . TYR B 1 338 ? 6.213   1.111   -12.545 1.00 25.00 ? 381  TYR B OH  1 
ATOM   5202  N  N   . MET B 1 339 ? 11.739  -0.386  -5.752  1.00 27.46 ? 382  MET B N   1 
ATOM   5203  C  CA  . MET B 1 339 ? 12.678  -0.283  -4.625  1.00 26.10 ? 382  MET B CA  1 
ATOM   5204  C  C   . MET B 1 339 ? 14.148  -0.458  -4.986  1.00 26.52 ? 382  MET B C   1 
ATOM   5205  O  O   . MET B 1 339 ? 15.037  -0.059  -4.223  1.00 27.03 ? 382  MET B O   1 
ATOM   5206  C  CB  . MET B 1 339 ? 12.340  -1.334  -3.572  1.00 24.41 ? 382  MET B CB  1 
ATOM   5207  C  CG  . MET B 1 339 ? 10.913  -1.266  -3.043  1.00 23.55 ? 382  MET B CG  1 
ATOM   5208  S  SD  . MET B 1 339 ? 10.662  0.067   -1.867  1.00 24.60 ? 382  MET B SD  1 
ATOM   5209  C  CE  . MET B 1 339 ? 11.465  -0.593  -0.415  1.00 24.05 ? 382  MET B CE  1 
ATOM   5210  N  N   . THR B 1 340 ? 14.446  -1.041  -6.146  1.00 26.70 ? 383  THR B N   1 
ATOM   5211  C  CA  . THR B 1 340 ? 15.834  -1.224  -6.545  1.00 25.22 ? 383  THR B CA  1 
ATOM   5212  C  C   . THR B 1 340 ? 16.222  -0.426  -7.809  1.00 25.45 ? 383  THR B C   1 
ATOM   5213  O  O   . THR B 1 340 ? 17.217  -0.747  -8.443  1.00 25.19 ? 383  THR B O   1 
ATOM   5214  C  CB  . THR B 1 340 ? 16.116  -2.701  -6.834  1.00 24.29 ? 383  THR B CB  1 
ATOM   5215  O  OG1 . THR B 1 340 ? 15.023  -3.259  -7.577  1.00 25.17 ? 383  THR B OG1 1 
ATOM   5216  C  CG2 . THR B 1 340 ? 16.303  -3.468  -5.541  1.00 23.49 ? 383  THR B CG2 1 
ATOM   5217  N  N   . LYS B 1 341 ? 15.432  0.580   -8.113  1.00 27.19 ? 384  LYS B N   1 
ATOM   5218  C  CA  . LYS B 1 341 ? 15.643  1.488   -9.231  1.00 29.60 ? 384  LYS B CA  1 
ATOM   5219  C  C   . LYS B 1 341 ? 14.739  2.680   -9.064  1.00 30.24 ? 384  LYS B C   1 
ATOM   5220  O  O   . LYS B 1 341 ? 13.514  2.552   -8.963  1.00 30.03 ? 384  LYS B O   1 
ATOM   5221  C  CB  . LYS B 1 341 ? 15.313  0.910   -10.630 1.00 29.18 ? 384  LYS B CB  1 
ATOM   5222  C  CG  . LYS B 1 341 ? 15.077  -0.591  -10.774 1.00 31.34 ? 384  LYS B CG  1 
ATOM   5223  C  CD  . LYS B 1 341 ? 14.139  -0.894  -11.951 1.00 32.21 ? 384  LYS B CD  1 
ATOM   5224  C  CE  . LYS B 1 341 ? 14.802  -1.760  -13.009 1.00 31.72 ? 384  LYS B CE  1 
ATOM   5225  N  NZ  . LYS B 1 341 ? 13.870  -2.125  -14.110 1.00 30.17 ? 384  LYS B NZ  1 
ATOM   5226  N  N   . PHE B 1 342 ? 15.327  3.857   -9.098  1.00 29.81 ? 385  PHE B N   1 
ATOM   5227  C  CA  . PHE B 1 342 ? 14.522  5.084   -9.087  1.00 28.99 ? 385  PHE B CA  1 
ATOM   5228  C  C   . PHE B 1 342 ? 14.368  5.723   -7.746  1.00 28.97 ? 385  PHE B C   1 
ATOM   5229  O  O   . PHE B 1 342 ? 14.460  6.946   -7.577  1.00 30.50 ? 385  PHE B O   1 
ATOM   5230  C  CB  . PHE B 1 342 ? 13.103  4.798   -9.613  1.00 28.43 ? 385  PHE B CB  1 
ATOM   5231  C  CG  . PHE B 1 342 ? 11.977  5.392   -8.814  1.00 27.27 ? 385  PHE B CG  1 
ATOM   5232  C  CD1 . PHE B 1 342 ? 11.427  6.599   -9.182  1.00 25.87 ? 385  PHE B CD1 1 
ATOM   5233  C  CD2 . PHE B 1 342 ? 11.458  4.767   -7.692  1.00 25.82 ? 385  PHE B CD2 1 
ATOM   5234  C  CE1 . PHE B 1 342 ? 10.348  7.153   -8.466  1.00 24.84 ? 385  PHE B CE1 1 
ATOM   5235  C  CE2 . PHE B 1 342 ? 10.385  5.288   -6.995  1.00 23.69 ? 385  PHE B CE2 1 
ATOM   5236  C  CZ  . PHE B 1 342 ? 9.821   6.480   -7.372  1.00 22.38 ? 385  PHE B CZ  1 
ATOM   5237  N  N   . LEU B 1 343 ? 14.122  4.837   -6.809  1.00 28.69 ? 386  LEU B N   1 
ATOM   5238  C  CA  . LEU B 1 343 ? 13.936  5.046   -5.397  1.00 28.24 ? 386  LEU B CA  1 
ATOM   5239  C  C   . LEU B 1 343 ? 15.306  4.970   -4.707  1.00 28.67 ? 386  LEU B C   1 
ATOM   5240  O  O   . LEU B 1 343 ? 15.469  5.508   -3.619  1.00 28.40 ? 386  LEU B O   1 
ATOM   5241  C  CB  . LEU B 1 343 ? 12.967  3.994   -4.829  1.00 26.84 ? 386  LEU B CB  1 
ATOM   5242  C  CG  . LEU B 1 343 ? 12.404  4.212   -3.427  1.00 24.75 ? 386  LEU B CG  1 
ATOM   5243  C  CD1 . LEU B 1 343 ? 13.393  3.759   -2.370  1.00 24.29 ? 386  LEU B CD1 1 
ATOM   5244  C  CD2 . LEU B 1 343 ? 12.042  5.667   -3.217  1.00 23.32 ? 386  LEU B CD2 1 
ATOM   5245  N  N   . SER B 1 344 ? 16.272  4.287   -5.329  1.00 29.73 ? 387  SER B N   1 
ATOM   5246  C  CA  . SER B 1 344 ? 17.588  4.171   -4.711  1.00 31.71 ? 387  SER B CA  1 
ATOM   5247  C  C   . SER B 1 344 ? 18.648  4.887   -5.541  1.00 32.68 ? 387  SER B C   1 
ATOM   5248  O  O   . SER B 1 344 ? 18.849  4.563   -6.705  1.00 32.86 ? 387  SER B O   1 
ATOM   5249  C  CB  . SER B 1 344 ? 17.975  2.698   -4.529  1.00 32.09 ? 387  SER B CB  1 
ATOM   5250  O  OG  . SER B 1 344 ? 16.936  1.966   -3.896  1.00 33.87 ? 387  SER B OG  1 
ATOM   5251  N  N   . ASP B 1 345 ? 19.342  5.843   -4.926  1.00 34.30 ? 388  ASP B N   1 
ATOM   5252  C  CA  . ASP B 1 345 ? 20.349  6.639   -5.624  1.00 34.29 ? 388  ASP B CA  1 
ATOM   5253  C  C   . ASP B 1 345 ? 21.474  5.858   -6.288  1.00 34.09 ? 388  ASP B C   1 
ATOM   5254  O  O   . ASP B 1 345 ? 22.137  6.378   -7.189  1.00 33.16 ? 388  ASP B O   1 
ATOM   5255  C  CB  . ASP B 1 345 ? 20.889  7.713   -4.680  1.00 34.87 ? 388  ASP B CB  1 
ATOM   5256  C  CG  . ASP B 1 345 ? 19.764  8.527   -4.036  1.00 36.11 ? 388  ASP B CG  1 
ATOM   5257  O  OD1 . ASP B 1 345 ? 19.818  9.781   -4.040  1.00 36.53 ? 388  ASP B OD1 1 
ATOM   5258  O  OD2 . ASP B 1 345 ? 18.814  7.895   -3.524  1.00 36.08 ? 388  ASP B OD2 1 
ATOM   5259  N  N   . ARG B 1 346 ? 21.687  4.614   -5.862  1.00 34.61 ? 389  ARG B N   1 
ATOM   5260  C  CA  . ARG B 1 346 ? 22.712  3.776   -6.488  1.00 34.73 ? 389  ARG B CA  1 
ATOM   5261  C  C   . ARG B 1 346 ? 22.327  3.707   -7.965  1.00 33.79 ? 389  ARG B C   1 
ATOM   5262  O  O   . ARG B 1 346 ? 23.097  4.113   -8.834  1.00 33.56 ? 389  ARG B O   1 
ATOM   5263  C  CB  . ARG B 1 346 ? 22.709  2.377   -5.871  1.00 36.47 ? 389  ARG B CB  1 
ATOM   5264  C  CG  . ARG B 1 346 ? 23.213  2.336   -4.430  1.00 38.66 ? 389  ARG B CG  1 
ATOM   5265  C  CD  . ARG B 1 346 ? 22.603  1.190   -3.622  1.00 39.22 ? 389  ARG B CD  1 
ATOM   5266  N  NE  . ARG B 1 346 ? 21.176  1.408   -3.380  1.00 40.34 ? 389  ARG B NE  1 
ATOM   5267  C  CZ  . ARG B 1 346 ? 20.374  0.538   -2.772  1.00 40.62 ? 389  ARG B CZ  1 
ATOM   5268  N  NH1 . ARG B 1 346 ? 20.849  -0.625  -2.330  1.00 40.99 ? 389  ARG B NH1 1 
ATOM   5269  N  NH2 . ARG B 1 346 ? 19.090  0.824   -2.617  1.00 39.56 ? 389  ARG B NH2 1 
ATOM   5270  N  N   . TRP B 1 347 ? 21.112  3.218   -8.221  1.00 32.72 ? 390  TRP B N   1 
ATOM   5271  C  CA  . TRP B 1 347 ? 20.534  3.100   -9.566  1.00 31.14 ? 390  TRP B CA  1 
ATOM   5272  C  C   . TRP B 1 347 ? 20.471  4.477   -10.224 1.00 29.57 ? 390  TRP B C   1 
ATOM   5273  O  O   . TRP B 1 347 ? 21.100  4.717   -11.247 1.00 29.18 ? 390  TRP B O   1 
ATOM   5274  C  CB  . TRP B 1 347 ? 19.106  2.540   -9.467  1.00 32.07 ? 390  TRP B CB  1 
ATOM   5275  C  CG  . TRP B 1 347 ? 18.432  2.186   -10.787 1.00 32.51 ? 390  TRP B CG  1 
ATOM   5276  C  CD1 . TRP B 1 347 ? 18.463  0.977   -11.424 1.00 33.08 ? 390  TRP B CD1 1 
ATOM   5277  C  CD2 . TRP B 1 347 ? 17.599  3.038   -11.592 1.00 31.89 ? 390  TRP B CD2 1 
ATOM   5278  N  NE1 . TRP B 1 347 ? 17.700  1.022   -12.567 1.00 32.73 ? 390  TRP B NE1 1 
ATOM   5279  C  CE2 . TRP B 1 347 ? 17.159  2.273   -12.694 1.00 31.95 ? 390  TRP B CE2 1 
ATOM   5280  C  CE3 . TRP B 1 347 ? 17.183  4.371   -11.487 1.00 31.25 ? 390  TRP B CE3 1 
ATOM   5281  C  CZ2 . TRP B 1 347 ? 16.320  2.796   -13.685 1.00 31.82 ? 390  TRP B CZ2 1 
ATOM   5282  C  CZ3 . TRP B 1 347 ? 16.350  4.891   -12.474 1.00 31.97 ? 390  TRP B CZ3 1 
ATOM   5283  C  CH2 . TRP B 1 347 ? 15.928  4.102   -13.558 1.00 31.40 ? 390  TRP B CH2 1 
ATOM   5284  N  N   . MET B 1 348 ? 19.687  5.366   -9.618  1.00 28.76 ? 391  MET B N   1 
ATOM   5285  C  CA  . MET B 1 348 ? 19.492  6.733   -10.092 1.00 27.69 ? 391  MET B CA  1 
ATOM   5286  C  C   . MET B 1 348 ? 20.786  7.388   -10.518 1.00 28.23 ? 391  MET B C   1 
ATOM   5287  O  O   . MET B 1 348 ? 20.797  8.272   -11.376 1.00 28.47 ? 391  MET B O   1 
ATOM   5288  C  CB  . MET B 1 348 ? 18.841  7.570   -9.000  1.00 25.97 ? 391  MET B CB  1 
ATOM   5289  C  CG  . MET B 1 348 ? 17.340  7.585   -9.062  1.00 23.99 ? 391  MET B CG  1 
ATOM   5290  S  SD  . MET B 1 348 ? 16.758  8.645   -10.382 1.00 26.20 ? 391  MET B SD  1 
ATOM   5291  C  CE  . MET B 1 348 ? 15.923  9.938   -9.470  1.00 22.70 ? 391  MET B CE  1 
ATOM   5292  N  N   . LEU B 1 349 ? 21.881  6.969   -9.906  1.00 28.21 ? 392  LEU B N   1 
ATOM   5293  C  CA  . LEU B 1 349 ? 23.166  7.522   -10.276 1.00 28.83 ? 392  LEU B CA  1 
ATOM   5294  C  C   . LEU B 1 349 ? 23.678  6.828   -11.530 1.00 29.13 ? 392  LEU B C   1 
ATOM   5295  O  O   . LEU B 1 349 ? 24.070  7.478   -12.494 1.00 28.08 ? 392  LEU B O   1 
ATOM   5296  C  CB  . LEU B 1 349 ? 24.173  7.355   -9.136  1.00 28.19 ? 392  LEU B CB  1 
ATOM   5297  C  CG  . LEU B 1 349 ? 24.093  8.378   -7.996  1.00 26.53 ? 392  LEU B CG  1 
ATOM   5298  C  CD1 . LEU B 1 349 ? 25.182  8.051   -6.990  1.00 24.13 ? 392  LEU B CD1 1 
ATOM   5299  C  CD2 . LEU B 1 349 ? 24.241  9.811   -8.533  1.00 23.24 ? 392  LEU B CD2 1 
ATOM   5300  N  N   . GLN B 1 350 ? 23.652  5.499   -11.511 1.00 30.65 ? 393  GLN B N   1 
ATOM   5301  C  CA  . GLN B 1 350 ? 24.124  4.707   -12.635 1.00 31.58 ? 393  GLN B CA  1 
ATOM   5302  C  C   . GLN B 1 350 ? 23.484  5.113   -13.938 1.00 32.63 ? 393  GLN B C   1 
ATOM   5303  O  O   . GLN B 1 350 ? 24.160  5.290   -14.953 1.00 33.69 ? 393  GLN B O   1 
ATOM   5304  C  CB  . GLN B 1 350 ? 23.864  3.224   -12.432 1.00 31.19 ? 393  GLN B CB  1 
ATOM   5305  C  CG  . GLN B 1 350 ? 24.981  2.413   -13.092 1.00 31.59 ? 393  GLN B CG  1 
ATOM   5306  C  CD  . GLN B 1 350 ? 26.303  3.087   -12.813 1.00 32.38 ? 393  GLN B CD  1 
ATOM   5307  O  OE1 . GLN B 1 350 ? 26.517  3.589   -11.713 1.00 32.09 ? 393  GLN B OE1 1 
ATOM   5308  N  NE2 . GLN B 1 350 ? 27.324  3.220   -13.639 1.00 31.55 ? 393  GLN B NE2 1 
ATOM   5309  N  N   . LYS B 1 351 ? 22.169  5.274   -13.923 1.00 32.31 ? 394  LYS B N   1 
ATOM   5310  C  CA  . LYS B 1 351 ? 21.462  5.672   -15.156 1.00 31.57 ? 394  LYS B CA  1 
ATOM   5311  C  C   . LYS B 1 351 ? 22.011  6.968   -15.717 1.00 32.85 ? 394  LYS B C   1 
ATOM   5312  O  O   . LYS B 1 351 ? 22.585  7.009   -16.811 1.00 32.58 ? 394  LYS B O   1 
ATOM   5313  C  CB  . LYS B 1 351 ? 19.978  5.791   -14.885 1.00 30.31 ? 394  LYS B CB  1 
ATOM   5314  C  CG  . LYS B 1 351 ? 19.253  4.482   -14.635 1.00 28.18 ? 394  LYS B CG  1 
ATOM   5315  C  CD  . LYS B 1 351 ? 19.336  3.578   -15.846 1.00 26.38 ? 394  LYS B CD  1 
ATOM   5316  C  CE  . LYS B 1 351 ? 20.482  2.589   -15.724 1.00 26.59 ? 394  LYS B CE  1 
ATOM   5317  N  NZ  . LYS B 1 351 ? 20.237  1.574   -14.665 1.00 24.06 ? 394  LYS B NZ  1 
ATOM   5318  N  N   . GLY B 1 352 ? 21.822  8.037   -14.940 1.00 36.15 ? 395  GLY B N   1 
ATOM   5319  C  CA  . GLY B 1 352 ? 22.322  9.345   -15.317 1.00 40.07 ? 395  GLY B CA  1 
ATOM   5320  C  C   . GLY B 1 352 ? 21.452  10.523  -14.814 1.00 42.78 ? 395  GLY B C   1 
ATOM   5321  O  O   . GLY B 1 352 ? 20.973  11.306  -15.628 1.00 42.46 ? 395  GLY B O   1 
ATOM   5322  N  N   . PHE B 1 353 ? 21.263  10.629  -13.497 1.00 46.01 ? 396  PHE B N   1 
ATOM   5323  C  CA  . PHE B 1 353 ? 20.449  11.695  -12.914 1.00 49.80 ? 396  PHE B CA  1 
ATOM   5324  C  C   . PHE B 1 353 ? 21.179  12.700  -11.992 1.00 52.69 ? 396  PHE B C   1 
ATOM   5325  O  O   . PHE B 1 353 ? 21.870  12.327  -11.033 1.00 52.79 ? 396  PHE B O   1 
ATOM   5326  C  CB  . PHE B 1 353 ? 19.256  11.043  -12.216 1.00 48.49 ? 396  PHE B CB  1 
ATOM   5327  C  CG  . PHE B 1 353 ? 18.529  10.047  -13.093 1.00 47.76 ? 396  PHE B CG  1 
ATOM   5328  C  CD1 . PHE B 1 353 ? 18.344  8.735   -12.681 1.00 46.26 ? 396  PHE B CD1 1 
ATOM   5329  C  CD2 . PHE B 1 353 ? 18.058  10.417  -14.351 1.00 47.18 ? 396  PHE B CD2 1 
ATOM   5330  C  CE1 . PHE B 1 353 ? 17.704  7.800   -13.503 1.00 45.74 ? 396  PHE B CE1 1 
ATOM   5331  C  CE2 . PHE B 1 353 ? 17.416  9.485   -15.185 1.00 45.97 ? 396  PHE B CE2 1 
ATOM   5332  C  CZ  . PHE B 1 353 ? 17.240  8.175   -14.757 1.00 44.56 ? 396  PHE B CZ  1 
ATOM   5333  N  N   . GLU B 1 356 ? 22.409  15.976  -9.884  1.00 71.47 ? 399  GLU B N   1 
ATOM   5334  C  CA  . GLU B 1 356 ? 23.153  16.404  -8.681  1.00 72.62 ? 399  GLU B CA  1 
ATOM   5335  C  C   . GLU B 1 356 ? 24.663  15.995  -8.748  1.00 73.12 ? 399  GLU B C   1 
ATOM   5336  O  O   . GLU B 1 356 ? 24.976  14.872  -8.368  1.00 73.91 ? 399  GLU B O   1 
ATOM   5337  C  CB  . GLU B 1 356 ? 22.848  15.553  -7.436  1.00 72.55 ? 399  GLU B CB  1 
ATOM   5338  C  CG  . GLU B 1 356 ? 23.818  14.374  -7.266  1.00 74.06 ? 399  GLU B CG  1 
ATOM   5339  C  CD  . GLU B 1 356 ? 25.132  14.680  -6.516  1.00 74.61 ? 399  GLU B CD  1 
ATOM   5340  O  OE1 . GLU B 1 356 ? 25.121  15.572  -5.633  1.00 75.75 ? 399  GLU B OE1 1 
ATOM   5341  O  OE2 . GLU B 1 356 ? 26.140  14.014  -6.804  1.00 74.75 ? 399  GLU B OE2 1 
ATOM   5342  N  N   . GLU B 1 357 ? 25.600  16.805  -9.189  1.00 73.16 ? 400  GLU B N   1 
ATOM   5343  C  CA  . GLU B 1 357 ? 26.912  16.350  -9.056  1.00 72.53 ? 400  GLU B CA  1 
ATOM   5344  C  C   . GLU B 1 357 ? 27.681  16.803  -7.843  1.00 72.93 ? 400  GLU B C   1 
ATOM   5345  O  O   . GLU B 1 357 ? 28.811  16.335  -7.719  1.00 73.39 ? 400  GLU B O   1 
ATOM   5346  C  CB  . GLU B 1 357 ? 27.556  16.761  -10.392 1.00 71.26 ? 400  GLU B CB  1 
ATOM   5347  C  CG  . GLU B 1 357 ? 29.062  16.808  -10.452 1.00 69.66 ? 400  GLU B CG  1 
ATOM   5348  C  CD  . GLU B 1 357 ? 29.581  17.862  -11.432 1.00 69.08 ? 400  GLU B CD  1 
ATOM   5349  O  OE1 . GLU B 1 357 ? 30.598  17.607  -12.103 1.00 69.58 ? 400  GLU B OE1 1 
ATOM   5350  O  OE2 . GLU B 1 357 ? 28.978  18.949  -11.533 1.00 69.42 ? 400  GLU B OE2 1 
ATOM   5351  N  N   . ASP B 1 358 ? 27.542  17.820  -7.077  1.00 73.14 ? 401  ASP B N   1 
ATOM   5352  C  CA  . ASP B 1 358 ? 28.871  17.906  -6.428  1.00 72.72 ? 401  ASP B CA  1 
ATOM   5353  C  C   . ASP B 1 358 ? 29.690  16.636  -6.631  1.00 72.23 ? 401  ASP B C   1 
ATOM   5354  O  O   . ASP B 1 358 ? 31.905  18.027  -6.025  1.00 72.35 ? 401  ASP B O   1 
ATOM   5355  C  CB  . ASP B 1 358 ? 28.688  18.188  -5.006  1.00 73.12 ? 401  ASP B CB  1 
ATOM   5356  C  CG  . ASP B 1 358 ? 27.651  19.260  -5.141  1.00 73.00 ? 401  ASP B CG  1 
ATOM   5357  O  OD1 . ASP B 1 358 ? 28.006  20.420  -5.400  1.00 73.07 ? 401  ASP B OD1 1 
ATOM   5358  O  OD2 . ASP B 1 358 ? 26.446  18.930  -4.977  1.00 72.89 ? 401  ASP B OD2 1 
ATOM   5359  N  N   . ASP C 1 4   ? -34.734 25.698  5.306   1.00 15.74 ? 47   ASP C N   1 
ATOM   5360  C  CA  . ASP C 1 4   ? -36.043 25.503  5.996   1.00 15.40 ? 47   ASP C CA  1 
ATOM   5361  C  C   . ASP C 1 4   ? -36.593 24.091  5.802   1.00 16.59 ? 47   ASP C C   1 
ATOM   5362  O  O   . ASP C 1 4   ? -35.869 23.151  5.455   1.00 16.47 ? 47   ASP C O   1 
ATOM   5363  C  CB  . ASP C 1 4   ? -37.076 26.553  5.520   1.00 12.49 ? 47   ASP C CB  1 
ATOM   5364  C  CG  . ASP C 1 4   ? -38.396 26.538  6.350   1.00 21.52 ? 47   ASP C CG  1 
ATOM   5365  O  OD1 . ASP C 1 4   ? -38.430 25.991  7.484   1.00 21.52 ? 47   ASP C OD1 1 
ATOM   5366  O  OD2 . ASP C 1 4   ? -39.402 27.103  5.861   1.00 21.52 ? 47   ASP C OD2 1 
ATOM   5367  N  N   . ALA C 1 5   ? -37.901 24.001  5.994   1.00 15.74 ? 48   ALA C N   1 
ATOM   5368  C  CA  . ALA C 1 5   ? -38.668 22.782  5.898   1.00 15.40 ? 48   ALA C CA  1 
ATOM   5369  C  C   . ALA C 1 5   ? -38.011 21.514  5.471   1.00 16.59 ? 48   ALA C C   1 
ATOM   5370  O  O   . ALA C 1 5   ? -37.497 21.319  4.315   1.00 16.47 ? 48   ALA C O   1 
ATOM   5371  C  CB  . ALA C 1 5   ? -40.042 23.063  5.111   1.00 12.49 ? 48   ALA C CB  1 
ATOM   5372  N  N   . PRO C 1 6   ? -38.088 20.483  6.303   1.00 27.87 ? 49   PRO C N   1 
ATOM   5373  C  CA  . PRO C 1 6   ? -38.077 19.281  7.112   1.00 29.08 ? 49   PRO C CA  1 
ATOM   5374  C  C   . PRO C 1 6   ? -36.865 18.568  7.541   1.00 31.57 ? 49   PRO C C   1 
ATOM   5375  O  O   . PRO C 1 6   ? -36.778 17.382  7.279   1.00 32.12 ? 49   PRO C O   1 
ATOM   5376  C  CB  . PRO C 1 6   ? -38.919 18.321  6.270   1.00 27.71 ? 49   PRO C CB  1 
ATOM   5377  C  CG  . PRO C 1 6   ? -39.960 19.139  6.032   1.00 25.38 ? 49   PRO C CG  1 
ATOM   5378  C  CD  . PRO C 1 6   ? -39.284 20.280  5.441   1.00 26.59 ? 49   PRO C CD  1 
ATOM   5379  N  N   . SER C 1 7   ? -35.925 19.226  8.202   1.00 27.11 ? 50   SER C N   1 
ATOM   5380  C  CA  . SER C 1 7   ? -34.827 18.386  8.715   1.00 26.62 ? 50   SER C CA  1 
ATOM   5381  C  C   . SER C 1 7   ? -34.454 17.408  7.603   1.00 26.97 ? 50   SER C C   1 
ATOM   5382  O  O   . SER C 1 7   ? -34.626 17.701  6.416   1.00 27.98 ? 50   SER C O   1 
ATOM   5383  C  CB  . SER C 1 7   ? -35.384 17.589  9.896   1.00 26.76 ? 50   SER C CB  1 
ATOM   5384  O  OG  . SER C 1 7   ? -36.467 16.736  9.485   1.00 17.23 ? 50   SER C OG  1 
ATOM   5385  N  N   . ARG C 1 8   ? -34.033 16.216  8.018   1.00 25.59 ? 51   ARG C N   1 
ATOM   5386  C  CA  . ARG C 1 8   ? -33.662 15.142  7.103   1.00 23.35 ? 51   ARG C CA  1 
ATOM   5387  C  C   . ARG C 1 8   ? -32.701 14.212  7.829   1.00 22.40 ? 51   ARG C C   1 
ATOM   5388  O  O   . ARG C 1 8   ? -31.848 13.594  7.205   1.00 21.69 ? 51   ARG C O   1 
ATOM   5389  C  CB  . ARG C 1 8   ? -32.941 15.719  5.897   1.00 22.67 ? 51   ARG C CB  1 
ATOM   5390  C  CG  . ARG C 1 8   ? -33.068 14.968  4.610   1.00 23.88 ? 51   ARG C CG  1 
ATOM   5391  C  CD  . ARG C 1 8   ? -32.081 15.593  3.673   1.00 25.73 ? 51   ARG C CD  1 
ATOM   5392  N  NE  . ARG C 1 8   ? -32.432 15.378  2.285   1.00 28.81 ? 51   ARG C NE  1 
ATOM   5393  C  CZ  . ARG C 1 8   ? -31.748 15.893  1.276   1.00 31.03 ? 51   ARG C CZ  1 
ATOM   5394  N  NH1 . ARG C 1 8   ? -30.679 16.642  1.526   1.00 32.58 ? 51   ARG C NH1 1 
ATOM   5395  N  NH2 . ARG C 1 8   ? -32.152 15.687  0.028   1.00 30.39 ? 51   ARG C NH2 1 
ATOM   5396  N  N   . CYS C 1 9   ? -32.833 14.135  9.149   1.00 21.43 ? 52   CYS C N   1 
ATOM   5397  C  CA  . CYS C 1 9   ? -31.928 13.340  9.972   1.00 20.51 ? 52   CYS C CA  1 
ATOM   5398  C  C   . CYS C 1 9   ? -32.658 12.256  10.746  1.00 19.45 ? 52   CYS C C   1 
ATOM   5399  O  O   . CYS C 1 9   ? -33.740 12.490  11.290  1.00 17.72 ? 52   CYS C O   1 
ATOM   5400  C  CB  . CYS C 1 9   ? -31.164 14.269  10.935  1.00 20.52 ? 52   CYS C CB  1 
ATOM   5401  S  SG  . CYS C 1 9   ? -30.041 13.442  12.074  1.00 20.67 ? 52   CYS C SG  1 
ATOM   5402  N  N   . THR C 1 10  ? -32.027 11.086  10.819  1.00 18.99 ? 53   THR C N   1 
ATOM   5403  C  CA  . THR C 1 10  ? -32.621 9.928   11.462  1.00 20.49 ? 53   THR C CA  1 
ATOM   5404  C  C   . THR C 1 10  ? -32.273 9.666   12.941  1.00 22.19 ? 53   THR C C   1 
ATOM   5405  O  O   . THR C 1 10  ? -32.489 8.566   13.469  1.00 20.89 ? 53   THR C O   1 
ATOM   5406  C  CB  . THR C 1 10  ? -32.342 8.654   10.585  1.00 18.81 ? 53   THR C CB  1 
ATOM   5407  O  OG1 . THR C 1 10  ? -30.950 8.297   10.622  1.00 15.49 ? 53   THR C OG1 1 
ATOM   5408  C  CG2 . THR C 1 10  ? -32.737 8.937   9.152   1.00 17.78 ? 53   THR C CG2 1 
ATOM   5409  N  N   . TRP C 1 11  ? -31.757 10.681  13.621  1.00 22.85 ? 54   TRP C N   1 
ATOM   5410  C  CA  . TRP C 1 11  ? -31.419 10.497  15.022  1.00 23.38 ? 54   TRP C CA  1 
ATOM   5411  C  C   . TRP C 1 11  ? -32.643 9.980   15.746  1.00 25.38 ? 54   TRP C C   1 
ATOM   5412  O  O   . TRP C 1 11  ? -33.769 10.292  15.377  1.00 25.97 ? 54   TRP C O   1 
ATOM   5413  C  CB  . TRP C 1 11  ? -30.963 11.818  15.653  1.00 20.67 ? 54   TRP C CB  1 
ATOM   5414  C  CG  . TRP C 1 11  ? -30.761 11.712  17.131  1.00 17.82 ? 54   TRP C CG  1 
ATOM   5415  C  CD1 . TRP C 1 11  ? -29.759 11.042  17.781  1.00 17.39 ? 54   TRP C CD1 1 
ATOM   5416  C  CD2 . TRP C 1 11  ? -31.629 12.230  18.155  1.00 15.06 ? 54   TRP C CD2 1 
ATOM   5417  N  NE1 . TRP C 1 11  ? -29.957 11.109  19.146  1.00 13.92 ? 54   TRP C NE1 1 
ATOM   5418  C  CE2 . TRP C 1 11  ? -31.096 11.829  19.399  1.00 13.17 ? 54   TRP C CE2 1 
ATOM   5419  C  CE3 . TRP C 1 11  ? -32.806 12.988  18.137  1.00 12.25 ? 54   TRP C CE3 1 
ATOM   5420  C  CZ2 . TRP C 1 11  ? -31.702 12.158  20.611  1.00 13.05 ? 54   TRP C CZ2 1 
ATOM   5421  C  CZ3 . TRP C 1 11  ? -33.405 13.312  19.343  1.00 13.88 ? 54   TRP C CZ3 1 
ATOM   5422  C  CH2 . TRP C 1 11  ? -32.854 12.897  20.563  1.00 12.54 ? 54   TRP C CH2 1 
ATOM   5423  N  N   . GLN C 1 12  ? -32.418 9.181   16.777  1.00 27.32 ? 55   GLN C N   1 
ATOM   5424  C  CA  . GLN C 1 12  ? -33.516 8.635   17.559  1.00 29.55 ? 55   GLN C CA  1 
ATOM   5425  C  C   . GLN C 1 12  ? -33.152 8.588   19.034  1.00 29.26 ? 55   GLN C C   1 
ATOM   5426  O  O   . GLN C 1 12  ? -32.071 8.115   19.416  1.00 28.37 ? 55   GLN C O   1 
ATOM   5427  C  CB  . GLN C 1 12  ? -33.880 7.208   17.090  1.00 31.84 ? 55   GLN C CB  1 
ATOM   5428  C  CG  . GLN C 1 12  ? -34.948 7.120   15.995  1.00 32.48 ? 55   GLN C CG  1 
ATOM   5429  C  CD  . GLN C 1 12  ? -36.377 7.061   16.547  1.00 34.33 ? 55   GLN C CD  1 
ATOM   5430  O  OE1 . GLN C 1 12  ? -37.348 7.147   15.792  1.00 34.27 ? 55   GLN C OE1 1 
ATOM   5431  N  NE2 . GLN C 1 12  ? -36.533 6.906   17.878  1.00 33.03 ? 55   GLN C NE2 1 
ATOM   5432  N  N   . LEU C 1 13  ? -34.064 9.092   19.860  1.00 28.35 ? 56   LEU C N   1 
ATOM   5433  C  CA  . LEU C 1 13  ? -33.871 9.076   21.301  1.00 28.14 ? 56   LEU C CA  1 
ATOM   5434  C  C   . LEU C 1 13  ? -33.992 7.613   21.730  1.00 28.32 ? 56   LEU C C   1 
ATOM   5435  O  O   . LEU C 1 13  ? -34.850 7.261   22.546  1.00 29.59 ? 56   LEU C O   1 
ATOM   5436  C  CB  . LEU C 1 13  ? -34.942 9.944   21.980  1.00 27.44 ? 56   LEU C CB  1 
ATOM   5437  C  CG  . LEU C 1 13  ? -35.039 10.066  23.510  1.00 26.32 ? 56   LEU C CG  1 
ATOM   5438  C  CD1 . LEU C 1 13  ? -33.648 10.079  24.139  1.00 26.02 ? 56   LEU C CD1 1 
ATOM   5439  C  CD2 . LEU C 1 13  ? -35.823 11.344  23.873  1.00 24.82 ? 56   LEU C CD2 1 
ATOM   5440  N  N   . GLY C 1 14  ? -33.118 6.781   21.152  1.00 26.94 ? 57   GLY C N   1 
ATOM   5441  C  CA  . GLY C 1 14  ? -33.078 5.359   21.421  1.00 26.57 ? 57   GLY C CA  1 
ATOM   5442  C  C   . GLY C 1 14  ? -32.196 4.652   20.400  1.00 27.23 ? 57   GLY C C   1 
ATOM   5443  O  O   . GLY C 1 14  ? -32.236 3.428   20.294  1.00 27.12 ? 57   GLY C O   1 
ATOM   5444  N  N   . ARG C 1 15  ? -31.400 5.406   19.642  1.00 26.86 ? 58   ARG C N   1 
ATOM   5445  C  CA  . ARG C 1 15  ? -30.517 4.809   18.640  1.00 26.47 ? 58   ARG C CA  1 
ATOM   5446  C  C   . ARG C 1 15  ? -29.049 4.868   19.055  1.00 27.28 ? 58   ARG C C   1 
ATOM   5447  O  O   . ARG C 1 15  ? -28.549 5.902   19.485  1.00 27.41 ? 58   ARG C O   1 
ATOM   5448  C  CB  . ARG C 1 15  ? -30.684 5.511   17.281  1.00 25.92 ? 58   ARG C CB  1 
ATOM   5449  C  CG  . ARG C 1 15  ? -31.549 4.774   16.248  1.00 26.42 ? 58   ARG C CG  1 
ATOM   5450  C  CD  . ARG C 1 15  ? -30.827 4.641   14.887  1.00 23.59 ? 58   ARG C CD  1 
ATOM   5451  N  NE  . ARG C 1 15  ? -31.630 5.141   13.769  1.00 22.78 ? 58   ARG C NE  1 
ATOM   5452  C  CZ  . ARG C 1 15  ? -31.155 5.393   12.551  1.00 21.62 ? 58   ARG C CZ  1 
ATOM   5453  N  NH1 . ARG C 1 15  ? -29.876 5.188   12.295  1.00 21.63 ? 58   ARG C NH1 1 
ATOM   5454  N  NH2 . ARG C 1 15  ? -31.951 5.856   11.592  1.00 19.65 ? 58   ARG C NH2 1 
ATOM   5455  N  N   . PRO C 1 16  ? -28.393 3.750   18.726  1.00 28.98 ? 59   PRO C N   1 
ATOM   5456  C  CA  . PRO C 1 16  ? -27.000 3.635   19.115  1.00 29.50 ? 59   PRO C CA  1 
ATOM   5457  C  C   . PRO C 1 16  ? -25.952 4.684   18.899  1.00 27.98 ? 59   PRO C C   1 
ATOM   5458  O  O   . PRO C 1 16  ? -25.696 5.022   17.734  1.00 25.85 ? 59   PRO C O   1 
ATOM   5459  C  CB  . PRO C 1 16  ? -26.634 2.273   18.514  1.00 29.63 ? 59   PRO C CB  1 
ATOM   5460  C  CG  . PRO C 1 16  ? -27.875 1.484   18.750  1.00 30.29 ? 59   PRO C CG  1 
ATOM   5461  C  CD  . PRO C 1 16  ? -29.032 2.440   18.821  1.00 29.48 ? 59   PRO C CD  1 
ATOM   5462  N  N   . ALA C 1 17  ? -25.110 5.116   19.824  1.00 28.23 ? 60   ALA C N   1 
ATOM   5463  C  CA  . ALA C 1 17  ? -23.963 5.937   19.337  1.00 28.29 ? 60   ALA C CA  1 
ATOM   5464  C  C   . ALA C 1 17  ? -23.262 5.440   18.024  1.00 27.65 ? 60   ALA C C   1 
ATOM   5465  O  O   . ALA C 1 17  ? -23.137 6.239   17.099  1.00 28.99 ? 60   ALA C O   1 
ATOM   5466  C  CB  . ALA C 1 17  ? -22.914 6.058   20.442  1.00 29.34 ? 60   ALA C CB  1 
ATOM   5467  N  N   . SER C 1 18  ? -22.844 4.151   17.918  1.00 27.04 ? 61   SER C N   1 
ATOM   5468  C  CA  . SER C 1 18  ? -22.173 3.589   16.725  1.00 28.15 ? 61   SER C CA  1 
ATOM   5469  C  C   . SER C 1 18  ? -22.940 3.866   15.409  1.00 28.85 ? 61   SER C C   1 
ATOM   5470  O  O   . SER C 1 18  ? -22.340 4.031   14.347  1.00 27.97 ? 61   SER C O   1 
ATOM   5471  C  CB  . SER C 1 18  ? -22.001 2.080   16.893  1.00 28.06 ? 61   SER C CB  1 
ATOM   5472  O  OG  . SER C 1 18  ? -23.255 1.456   17.101  1.00 28.18 ? 61   SER C OG  1 
ATOM   5473  N  N   . GLU C 1 19  ? -24.270 3.920   15.491  1.00 30.07 ? 62   GLU C N   1 
ATOM   5474  C  CA  . GLU C 1 19  ? -25.206 4.059   14.372  1.00 30.07 ? 62   GLU C CA  1 
ATOM   5475  C  C   . GLU C 1 19  ? -25.137 5.371   13.537  1.00 29.65 ? 62   GLU C C   1 
ATOM   5476  O  O   . GLU C 1 19  ? -25.878 5.516   12.569  1.00 30.37 ? 62   GLU C O   1 
ATOM   5477  C  CB  . GLU C 1 19  ? -26.592 3.786   14.928  1.00 31.59 ? 62   GLU C CB  1 
ATOM   5478  C  CG  . GLU C 1 19  ? -26.531 2.612   15.894  1.00 35.25 ? 62   GLU C CG  1 
ATOM   5479  C  CD  . GLU C 1 19  ? -27.778 1.763   15.931  1.00 37.21 ? 62   GLU C CD  1 
ATOM   5480  O  OE1 . GLU C 1 19  ? -27.881 0.814   15.137  1.00 36.35 ? 62   GLU C OE1 1 
ATOM   5481  O  OE2 . GLU C 1 19  ? -28.655 2.045   16.767  1.00 36.85 ? 62   GLU C OE2 1 
ATOM   5482  N  N   . SER C 1 20  ? -24.267 6.308   13.908  1.00 29.78 ? 63   SER C N   1 
ATOM   5483  C  CA  . SER C 1 20  ? -24.189 7.573   13.151  1.00 29.27 ? 63   SER C CA  1 
ATOM   5484  C  C   . SER C 1 20  ? -23.273 7.586   11.873  1.00 28.02 ? 63   SER C C   1 
ATOM   5485  O  O   . SER C 1 20  ? -22.201 6.995   11.860  1.00 27.30 ? 63   SER C O   1 
ATOM   5486  C  CB  . SER C 1 20  ? -23.793 8.664   14.131  1.00 28.09 ? 63   SER C CB  1 
ATOM   5487  O  OG  . SER C 1 20  ? -23.524 9.874   13.448  1.00 29.48 ? 63   SER C OG  1 
ATOM   5488  N  N   . PRO C 1 21  ? -23.743 8.308   10.815  1.00 27.87 ? 64   PRO C N   1 
ATOM   5489  C  CA  . PRO C 1 21  ? -22.969 8.566   9.606   1.00 29.08 ? 64   PRO C CA  1 
ATOM   5490  C  C   . PRO C 1 21  ? -22.338 9.929   9.716   1.00 31.57 ? 64   PRO C C   1 
ATOM   5491  O  O   . PRO C 1 21  ? -22.099 10.594  8.701   1.00 32.12 ? 64   PRO C O   1 
ATOM   5492  C  CB  . PRO C 1 21  ? -24.033 8.562   8.537   1.00 27.71 ? 64   PRO C CB  1 
ATOM   5493  C  CG  . PRO C 1 21  ? -25.125 9.332   9.219   1.00 25.38 ? 64   PRO C CG  1 
ATOM   5494  C  CD  . PRO C 1 21  ? -25.145 8.710   10.613  1.00 26.59 ? 64   PRO C CD  1 
ATOM   5495  N  N   . HIS C 1 22  ? -22.087 10.350  10.952  1.00 33.19 ? 65   HIS C N   1 
ATOM   5496  C  CA  . HIS C 1 22  ? -21.511 11.667  11.205  1.00 33.40 ? 65   HIS C CA  1 
ATOM   5497  C  C   . HIS C 1 22  ? -20.033 11.698  11.659  1.00 33.39 ? 65   HIS C C   1 
ATOM   5498  O  O   . HIS C 1 22  ? -19.411 10.662  11.914  1.00 33.33 ? 65   HIS C O   1 
ATOM   5499  C  CB  . HIS C 1 22  ? -22.403 12.405  12.223  1.00 31.21 ? 65   HIS C CB  1 
ATOM   5500  C  CG  . HIS C 1 22  ? -23.724 12.858  11.666  1.00 29.72 ? 65   HIS C CG  1 
ATOM   5501  N  ND1 . HIS C 1 22  ? -23.827 13.784  10.650  1.00 28.76 ? 65   HIS C ND1 1 
ATOM   5502  C  CD2 . HIS C 1 22  ? -24.995 12.548  12.015  1.00 29.07 ? 65   HIS C CD2 1 
ATOM   5503  C  CE1 . HIS C 1 22  ? -25.102 14.028  10.401  1.00 27.23 ? 65   HIS C CE1 1 
ATOM   5504  N  NE2 . HIS C 1 22  ? -25.833 13.292  11.216  1.00 26.77 ? 65   HIS C NE2 1 
ATOM   5505  N  N   . HIS C 1 23  ? -19.477 12.906  11.725  1.00 34.00 ? 66   HIS C N   1 
ATOM   5506  C  CA  . HIS C 1 23  ? -18.104 13.119  12.174  1.00 33.42 ? 66   HIS C CA  1 
ATOM   5507  C  C   . HIS C 1 23  ? -18.151 13.639  13.610  1.00 32.97 ? 66   HIS C C   1 
ATOM   5508  O  O   . HIS C 1 23  ? -18.321 14.826  13.840  1.00 32.48 ? 66   HIS C O   1 
ATOM   5509  C  CB  . HIS C 1 23  ? -17.414 14.149  11.292  1.00 33.73 ? 66   HIS C CB  1 
ATOM   5510  C  CG  . HIS C 1 23  ? -16.574 13.552  10.214  1.00 35.43 ? 66   HIS C CG  1 
ATOM   5511  N  ND1 . HIS C 1 23  ? -15.601 12.608  10.470  1.00 37.39 ? 66   HIS C ND1 1 
ATOM   5512  C  CD2 . HIS C 1 23  ? -16.528 13.790  8.883   1.00 36.18 ? 66   HIS C CD2 1 
ATOM   5513  C  CE1 . HIS C 1 23  ? -14.990 12.291  9.342   1.00 37.33 ? 66   HIS C CE1 1 
ATOM   5514  N  NE2 . HIS C 1 23  ? -15.533 12.995  8.364   1.00 37.40 ? 66   HIS C NE2 1 
ATOM   5515  N  N   . HIS C 1 24  ? -18.004 12.741  14.572  1.00 32.32 ? 67   HIS C N   1 
ATOM   5516  C  CA  . HIS C 1 24  ? -18.046 13.116  15.973  1.00 32.03 ? 67   HIS C CA  1 
ATOM   5517  C  C   . HIS C 1 24  ? -16.662 13.331  16.560  1.00 31.62 ? 67   HIS C C   1 
ATOM   5518  O  O   . HIS C 1 24  ? -15.758 12.523  16.341  1.00 29.61 ? 67   HIS C O   1 
ATOM   5519  C  CB  . HIS C 1 24  ? -18.764 12.035  16.765  1.00 34.75 ? 67   HIS C CB  1 
ATOM   5520  C  CG  . HIS C 1 24  ? -20.234 11.975  16.504  1.00 36.10 ? 67   HIS C CG  1 
ATOM   5521  N  ND1 . HIS C 1 24  ? -21.124 12.865  17.065  1.00 36.78 ? 67   HIS C ND1 1 
ATOM   5522  C  CD2 . HIS C 1 24  ? -20.972 11.131  15.746  1.00 37.39 ? 67   HIS C CD2 1 
ATOM   5523  C  CE1 . HIS C 1 24  ? -22.348 12.570  16.666  1.00 37.36 ? 67   HIS C CE1 1 
ATOM   5524  N  NE2 . HIS C 1 24  ? -22.284 11.522  15.865  1.00 37.66 ? 67   HIS C NE2 1 
ATOM   5525  N  N   . THR C 1 25  ? -16.512 14.420  17.317  1.00 31.78 ? 68   THR C N   1 
ATOM   5526  C  CA  . THR C 1 25  ? -15.241 14.769  17.957  1.00 31.02 ? 68   THR C CA  1 
ATOM   5527  C  C   . THR C 1 25  ? -15.392 14.789  19.462  1.00 30.42 ? 68   THR C C   1 
ATOM   5528  O  O   . THR C 1 25  ? -16.468 15.089  19.970  1.00 29.63 ? 68   THR C O   1 
ATOM   5529  C  CB  . THR C 1 25  ? -14.768 16.160  17.559  1.00 31.46 ? 68   THR C CB  1 
ATOM   5530  O  OG1 . THR C 1 25  ? -14.918 16.331  16.150  1.00 34.65 ? 68   THR C OG1 1 
ATOM   5531  C  CG2 . THR C 1 25  ? -13.301 16.342  17.932  1.00 32.32 ? 68   THR C CG2 1 
ATOM   5532  N  N   . ALA C 1 26  ? -14.306 14.486  20.169  1.00 30.22 ? 69   ALA C N   1 
ATOM   5533  C  CA  . ALA C 1 26  ? -14.319 14.486  21.630  1.00 30.06 ? 69   ALA C CA  1 
ATOM   5534  C  C   . ALA C 1 26  ? -13.913 15.868  22.126  1.00 29.19 ? 69   ALA C C   1 
ATOM   5535  O  O   . ALA C 1 26  ? -13.301 16.642  21.396  1.00 28.93 ? 69   ALA C O   1 
ATOM   5536  C  CB  . ALA C 1 26  ? -13.354 13.430  22.170  1.00 29.61 ? 69   ALA C CB  1 
ATOM   5537  N  N   . PRO C 1 27  ? -14.272 16.210  23.367  1.00 29.18 ? 70   PRO C N   1 
ATOM   5538  C  CA  . PRO C 1 27  ? -13.873 17.535  23.834  1.00 30.13 ? 70   PRO C CA  1 
ATOM   5539  C  C   . PRO C 1 27  ? -12.362 17.706  23.864  1.00 30.57 ? 70   PRO C C   1 
ATOM   5540  O  O   . PRO C 1 27  ? -11.603 16.749  23.667  1.00 30.58 ? 70   PRO C O   1 
ATOM   5541  C  CB  . PRO C 1 27  ? -14.501 17.614  25.217  1.00 30.71 ? 70   PRO C CB  1 
ATOM   5542  C  CG  . PRO C 1 27  ? -15.770 16.842  25.024  1.00 30.09 ? 70   PRO C CG  1 
ATOM   5543  C  CD  . PRO C 1 27  ? -15.310 15.638  24.240  1.00 28.90 ? 70   PRO C CD  1 
ATOM   5544  N  N   . ALA C 1 28  ? -11.933 18.937  24.111  1.00 30.43 ? 71   ALA C N   1 
ATOM   5545  C  CA  . ALA C 1 28  ? -10.520 19.239  24.156  1.00 30.57 ? 71   ALA C CA  1 
ATOM   5546  C  C   . ALA C 1 28  ? -10.074 19.902  25.453  1.00 30.79 ? 71   ALA C C   1 
ATOM   5547  O  O   . ALA C 1 28  ? -10.628 20.926  25.874  1.00 29.66 ? 71   ALA C O   1 
ATOM   5548  C  CB  . ALA C 1 28  ? -10.140 20.111  22.964  1.00 30.07 ? 71   ALA C CB  1 
ATOM   5549  N  N   . LYS C 1 29  ? -9.069  19.294  26.081  1.00 31.53 ? 72   LYS C N   1 
ATOM   5550  C  CA  . LYS C 1 29  ? -8.471  19.812  27.311  1.00 32.14 ? 72   LYS C CA  1 
ATOM   5551  C  C   . LYS C 1 29  ? -7.613  21.036  26.914  1.00 31.56 ? 72   LYS C C   1 
ATOM   5552  O  O   . LYS C 1 29  ? -7.228  21.168  25.741  1.00 30.75 ? 72   LYS C O   1 
ATOM   5553  C  CB  . LYS C 1 29  ? -7.611  18.715  27.975  1.00 32.30 ? 72   LYS C CB  1 
ATOM   5554  C  CG  . LYS C 1 29  ? -8.421  17.580  28.642  1.00 32.00 ? 72   LYS C CG  1 
ATOM   5555  C  CD  . LYS C 1 29  ? -9.274  16.786  27.636  1.00 29.65 ? 72   LYS C CD  1 
ATOM   5556  C  CE  . LYS C 1 29  ? -10.250 15.796  28.313  1.00 27.87 ? 72   LYS C CE  1 
ATOM   5557  N  NZ  . LYS C 1 29  ? -9.595  14.714  29.101  1.00 22.77 ? 72   LYS C NZ  1 
ATOM   5558  N  N   . SER C 1 30  ? -7.321  21.926  27.867  1.00 30.81 ? 73   SER C N   1 
ATOM   5559  C  CA  . SER C 1 30  ? -6.537  23.129  27.552  1.00 29.99 ? 73   SER C CA  1 
ATOM   5560  C  C   . SER C 1 30  ? -5.018  22.975  27.652  1.00 28.59 ? 73   SER C C   1 
ATOM   5561  O  O   . SER C 1 30  ? -4.444  22.926  28.746  1.00 29.00 ? 73   SER C O   1 
ATOM   5562  C  CB  . SER C 1 30  ? -6.978  24.306  28.425  1.00 30.61 ? 73   SER C CB  1 
ATOM   5563  O  OG  . SER C 1 30  ? -6.384  25.508  27.958  1.00 30.85 ? 73   SER C OG  1 
ATOM   5564  N  N   . PRO C 1 31  ? -4.344  22.947  26.494  1.00 26.55 ? 74   PRO C N   1 
ATOM   5565  C  CA  . PRO C 1 31  ? -2.892  22.800  26.379  1.00 23.97 ? 74   PRO C CA  1 
ATOM   5566  C  C   . PRO C 1 31  ? -2.106  23.845  27.169  1.00 23.29 ? 74   PRO C C   1 
ATOM   5567  O  O   . PRO C 1 31  ? -2.649  24.884  27.534  1.00 23.34 ? 74   PRO C O   1 
ATOM   5568  C  CB  . PRO C 1 31  ? -2.664  22.926  24.879  1.00 23.41 ? 74   PRO C CB  1 
ATOM   5569  C  CG  . PRO C 1 31  ? -3.705  23.886  24.468  1.00 22.55 ? 74   PRO C CG  1 
ATOM   5570  C  CD  . PRO C 1 31  ? -4.920  23.388  25.210  1.00 25.08 ? 74   PRO C CD  1 
ATOM   5571  N  N   . LYS C 1 32  ? -0.831  23.560  27.431  1.00 22.13 ? 75   LYS C N   1 
ATOM   5572  C  CA  . LYS C 1 32  ? 0.032   24.487  28.154  1.00 20.55 ? 75   LYS C CA  1 
ATOM   5573  C  C   . LYS C 1 32  ? 0.289   25.735  27.327  1.00 20.27 ? 75   LYS C C   1 
ATOM   5574  O  O   . LYS C 1 32  ? 0.244   26.844  27.842  1.00 22.38 ? 75   LYS C O   1 
ATOM   5575  C  CB  . LYS C 1 32  ? 1.363   23.830  28.502  1.00 21.39 ? 75   LYS C CB  1 
ATOM   5576  C  CG  . LYS C 1 32  ? 1.249   22.774  29.575  1.00 21.11 ? 75   LYS C CG  1 
ATOM   5577  C  CD  . LYS C 1 32  ? 2.604   22.457  30.171  1.00 21.69 ? 75   LYS C CD  1 
ATOM   5578  C  CE  . LYS C 1 32  ? 2.421   21.873  31.545  1.00 20.60 ? 75   LYS C CE  1 
ATOM   5579  N  NZ  . LYS C 1 32  ? 1.523   22.784  32.314  1.00 22.91 ? 75   LYS C NZ  1 
ATOM   5580  N  N   . ILE C 1 33  ? 0.570   25.557  26.045  1.00 19.16 ? 76   ILE C N   1 
ATOM   5581  C  CA  . ILE C 1 33  ? 0.791   26.694  25.172  1.00 20.12 ? 76   ILE C CA  1 
ATOM   5582  C  C   . ILE C 1 33  ? -0.137  26.624  23.965  1.00 20.36 ? 76   ILE C C   1 
ATOM   5583  O  O   . ILE C 1 33  ? 0.035   25.749  23.126  1.00 20.06 ? 76   ILE C O   1 
ATOM   5584  C  CB  . ILE C 1 33  ? 2.209   26.711  24.639  1.00 20.75 ? 76   ILE C CB  1 
ATOM   5585  C  CG1 . ILE C 1 33  ? 3.197   26.933  25.781  1.00 22.55 ? 76   ILE C CG1 1 
ATOM   5586  C  CG2 . ILE C 1 33  ? 2.327   27.770  23.551  1.00 21.92 ? 76   ILE C CG2 1 
ATOM   5587  C  CD1 . ILE C 1 33  ? 4.640   27.100  25.325  1.00 21.93 ? 76   ILE C CD1 1 
ATOM   5588  N  N   . LEU C 1 34  ? -1.112  27.528  23.872  1.00 20.31 ? 77   LEU C N   1 
ATOM   5589  C  CA  . LEU C 1 34  ? -2.017  27.518  22.731  1.00 21.23 ? 77   LEU C CA  1 
ATOM   5590  C  C   . LEU C 1 34  ? -1.262  27.867  21.468  1.00 22.51 ? 77   LEU C C   1 
ATOM   5591  O  O   . LEU C 1 34  ? -0.698  28.952  21.368  1.00 24.18 ? 77   LEU C O   1 
ATOM   5592  C  CB  . LEU C 1 34  ? -3.168  28.529  22.901  1.00 19.10 ? 77   LEU C CB  1 
ATOM   5593  C  CG  . LEU C 1 34  ? -4.471  28.171  23.610  1.00 16.48 ? 77   LEU C CG  1 
ATOM   5594  C  CD1 . LEU C 1 34  ? -4.239  28.157  25.095  1.00 15.23 ? 77   LEU C CD1 1 
ATOM   5595  C  CD2 . LEU C 1 34  ? -5.537  29.176  23.242  1.00 13.16 ? 77   LEU C CD2 1 
ATOM   5596  N  N   . PRO C 1 35  ? -1.205  26.946  20.500  1.00 22.89 ? 78   PRO C N   1 
ATOM   5597  C  CA  . PRO C 1 35  ? -0.532  27.157  19.219  1.00 23.96 ? 78   PRO C CA  1 
ATOM   5598  C  C   . PRO C 1 35  ? -0.924  28.514  18.596  1.00 25.13 ? 78   PRO C C   1 
ATOM   5599  O  O   . PRO C 1 35  ? -0.083  29.261  18.102  1.00 25.87 ? 78   PRO C O   1 
ATOM   5600  C  CB  . PRO C 1 35  ? -1.077  26.019  18.394  1.00 23.88 ? 78   PRO C CB  1 
ATOM   5601  C  CG  . PRO C 1 35  ? -1.091  24.903  19.384  1.00 23.10 ? 78   PRO C CG  1 
ATOM   5602  C  CD  . PRO C 1 35  ? -1.430  25.508  20.721  1.00 22.68 ? 78   PRO C CD  1 
ATOM   5603  N  N   . ASP C 1 36  ? -2.230  28.789  18.593  1.00 25.11 ? 79   ASP C N   1 
ATOM   5604  C  CA  . ASP C 1 36  ? -2.808  29.993  18.045  1.00 26.28 ? 79   ASP C CA  1 
ATOM   5605  C  C   . ASP C 1 36  ? -4.075  30.369  18.820  1.00 27.61 ? 79   ASP C C   1 
ATOM   5606  O  O   . ASP C 1 36  ? -4.694  29.493  19.430  1.00 27.41 ? 79   ASP C O   1 
ATOM   5607  C  CB  . ASP C 1 36  ? -3.079  29.839  16.536  1.00 25.02 ? 79   ASP C CB  1 
ATOM   5608  C  CG  . ASP C 1 36  ? -3.804  28.569  16.195  1.00 27.30 ? 79   ASP C CG  1 
ATOM   5609  O  OD1 . ASP C 1 36  ? -4.990  28.473  16.537  1.00 25.75 ? 79   ASP C OD1 1 
ATOM   5610  O  OD2 . ASP C 1 36  ? -3.188  27.665  15.602  1.00 27.37 ? 79   ASP C OD2 1 
ATOM   5611  N  N   . ILE C 1 37  ? -4.443  31.627  18.839  1.00 27.23 ? 80   ILE C N   1 
ATOM   5612  C  CA  . ILE C 1 37  ? -5.580  31.924  19.692  1.00 26.24 ? 80   ILE C CA  1 
ATOM   5613  C  C   . ILE C 1 37  ? -6.752  30.926  19.476  1.00 26.23 ? 80   ILE C C   1 
ATOM   5614  O  O   . ILE C 1 37  ? -7.346  30.493  20.455  1.00 26.08 ? 80   ILE C O   1 
ATOM   5615  C  CB  . ILE C 1 37  ? -5.941  33.417  19.587  1.00 26.02 ? 80   ILE C CB  1 
ATOM   5616  C  CG1 . ILE C 1 37  ? -6.379  33.938  20.954  1.00 26.65 ? 80   ILE C CG1 1 
ATOM   5617  C  CG2 . ILE C 1 37  ? -7.024  33.652  18.545  1.00 24.82 ? 80   ILE C CG2 1 
ATOM   5618  C  CD1 . ILE C 1 37  ? -6.935  32.874  21.878  1.00 28.16 ? 80   ILE C CD1 1 
ATOM   5619  N  N   . LEU C 1 38  ? -7.046  30.551  18.274  1.00 25.86 ? 81   LEU C N   1 
ATOM   5620  C  CA  . LEU C 1 38  ? -8.090  29.574  18.033  1.00 25.49 ? 81   LEU C CA  1 
ATOM   5621  C  C   . LEU C 1 38  ? -8.326  28.512  19.076  1.00 25.46 ? 81   LEU C C   1 
ATOM   5622  O  O   . LEU C 1 38  ? -9.460  28.205  19.417  1.00 26.59 ? 81   LEU C O   1 
ATOM   5623  C  CB  . LEU C 1 38  ? -7.766  28.794  16.761  1.00 26.11 ? 81   LEU C CB  1 
ATOM   5624  C  CG  . LEU C 1 38  ? -8.200  29.424  15.446  1.00 26.23 ? 81   LEU C CG  1 
ATOM   5625  C  CD1 . LEU C 1 38  ? -8.064  28.446  14.284  1.00 25.31 ? 81   LEU C CD1 1 
ATOM   5626  C  CD2 . LEU C 1 38  ? -9.642  29.913  15.541  1.00 25.45 ? 81   LEU C CD2 1 
ATOM   5627  N  N   . LYS C 1 39  ? -7.252  27.963  19.581  1.00 23.38 ? 82   LYS C N   1 
ATOM   5628  C  CA  . LYS C 1 39  ? -7.495  26.831  20.483  1.00 21.80 ? 82   LYS C CA  1 
ATOM   5629  C  C   . LYS C 1 39  ? -8.281  27.226  21.732  1.00 20.72 ? 82   LYS C C   1 
ATOM   5630  O  O   . LYS C 1 39  ? -8.709  26.368  22.499  1.00 19.43 ? 82   LYS C O   1 
ATOM   5631  C  CB  . LYS C 1 39  ? -6.177  26.100  20.729  1.00 23.73 ? 82   LYS C CB  1 
ATOM   5632  C  CG  . LYS C 1 39  ? -5.679  25.320  19.499  1.00 26.52 ? 82   LYS C CG  1 
ATOM   5633  C  CD  . LYS C 1 39  ? -5.841  26.065  18.178  1.00 29.84 ? 82   LYS C CD  1 
ATOM   5634  C  CE  . LYS C 1 39  ? -4.963  25.445  17.104  1.00 32.00 ? 82   LYS C CE  1 
ATOM   5635  N  NZ  . LYS C 1 39  ? -5.672  24.378  16.355  1.00 32.48 ? 82   LYS C NZ  1 
ATOM   5636  N  N   . LYS C 1 40  ? -8.472  28.536  21.926  1.00 18.80 ? 83   LYS C N   1 
ATOM   5637  C  CA  . LYS C 1 40  ? -9.250  28.999  23.035  1.00 18.11 ? 83   LYS C CA  1 
ATOM   5638  C  C   . LYS C 1 40  ? -10.660 29.313  22.526  1.00 17.22 ? 83   LYS C C   1 
ATOM   5639  O  O   . LYS C 1 40  ? -10.990 30.455  22.163  1.00 16.09 ? 83   LYS C O   1 
ATOM   5640  C  CB  . LYS C 1 40  ? -8.604  30.194  23.765  1.00 19.30 ? 83   LYS C CB  1 
ATOM   5641  C  CG  . LYS C 1 40  ? -9.210  30.486  25.143  1.00 17.42 ? 83   LYS C CG  1 
ATOM   5642  C  CD  . LYS C 1 40  ? -8.376  29.992  26.328  1.00 18.24 ? 83   LYS C CD  1 
ATOM   5643  C  CE  . LYS C 1 40  ? -8.934  30.473  27.661  1.00 21.13 ? 83   LYS C CE  1 
ATOM   5644  N  NZ  . LYS C 1 40  ? -8.948  29.395  28.683  1.00 20.76 ? 83   LYS C NZ  1 
ATOM   5645  N  N   . ILE C 1 41  ? -11.485 28.250  22.509  1.00 15.91 ? 84   ILE C N   1 
ATOM   5646  C  CA  . ILE C 1 41  ? -12.883 28.144  22.080  1.00 14.33 ? 84   ILE C CA  1 
ATOM   5647  C  C   . ILE C 1 41  ? -13.370 26.805  22.649  1.00 14.12 ? 84   ILE C C   1 
ATOM   5648  O  O   . ILE C 1 41  ? -12.657 25.809  22.539  1.00 12.60 ? 84   ILE C O   1 
ATOM   5649  C  CB  . ILE C 1 41  ? -13.082 28.152  20.552  1.00 15.13 ? 84   ILE C CB  1 
ATOM   5650  C  CG1 . ILE C 1 41  ? -12.245 29.271  19.934  1.00 14.78 ? 84   ILE C CG1 1 
ATOM   5651  C  CG2 . ILE C 1 41  ? -14.542 28.334  20.206  1.00 15.83 ? 84   ILE C CG2 1 
ATOM   5652  C  CD1 . ILE C 1 41  ? -12.455 29.425  18.445  1.00 15.46 ? 84   ILE C CD1 1 
ATOM   5653  N  N   . GLY C 1 42  ? -14.546 26.745  23.261  1.00 14.82 ? 85   GLY C N   1 
ATOM   5654  C  CA  . GLY C 1 42  ? -14.996 25.519  23.880  1.00 13.89 ? 85   GLY C CA  1 
ATOM   5655  C  C   . GLY C 1 42  ? -14.237 25.392  25.190  1.00 14.61 ? 85   GLY C C   1 
ATOM   5656  O  O   . GLY C 1 42  ? -13.286 26.126  25.447  1.00 13.22 ? 85   GLY C O   1 
ATOM   5657  N  N   . ASP C 1 43  ? -14.641 24.456  26.027  1.00 16.13 ? 86   ASP C N   1 
ATOM   5658  C  CA  . ASP C 1 43  ? -13.995 24.271  27.319  1.00 16.25 ? 86   ASP C CA  1 
ATOM   5659  C  C   . ASP C 1 43  ? -14.348 25.434  28.243  1.00 15.55 ? 86   ASP C C   1 
ATOM   5660  O  O   . ASP C 1 43  ? -13.744 25.588  29.308  1.00 15.34 ? 86   ASP C O   1 
ATOM   5661  C  CB  . ASP C 1 43  ? -12.485 24.162  27.167  1.00 16.43 ? 86   ASP C CB  1 
ATOM   5662  C  CG  . ASP C 1 43  ? -11.791 23.937  28.492  1.00 20.77 ? 86   ASP C CG  1 
ATOM   5663  O  OD1 . ASP C 1 43  ? -12.145 22.946  29.178  1.00 21.48 ? 86   ASP C OD1 1 
ATOM   5664  O  OD2 . ASP C 1 43  ? -10.897 24.746  28.848  1.00 21.86 ? 86   ASP C OD2 1 
ATOM   5665  N  N   . THR C 1 44  ? -15.314 26.238  27.816  1.00 15.39 ? 87   THR C N   1 
ATOM   5666  C  CA  . THR C 1 44  ? -15.794 27.373  28.590  1.00 16.31 ? 87   THR C CA  1 
ATOM   5667  C  C   . THR C 1 44  ? -16.107 26.888  29.993  1.00 19.14 ? 87   THR C C   1 
ATOM   5668  O  O   . THR C 1 44  ? -16.453 25.728  30.186  1.00 18.32 ? 87   THR C O   1 
ATOM   5669  C  CB  . THR C 1 44  ? -17.052 27.997  27.940  1.00 15.86 ? 87   THR C CB  1 
ATOM   5670  O  OG1 . THR C 1 44  ? -18.182 27.128  28.100  1.00 11.31 ? 87   THR C OG1 1 
ATOM   5671  C  CG2 . THR C 1 44  ? -16.788 28.243  26.444  1.00 14.74 ? 87   THR C CG2 1 
ATOM   5672  N  N   . PRO C 1 45  ? -16.011 27.772  30.993  1.00 20.12 ? 88   PRO C N   1 
ATOM   5673  C  CA  . PRO C 1 45  ? -16.253 27.483  32.407  1.00 20.71 ? 88   PRO C CA  1 
ATOM   5674  C  C   . PRO C 1 45  ? -17.679 27.360  32.888  1.00 21.19 ? 88   PRO C C   1 
ATOM   5675  O  O   . PRO C 1 45  ? -18.609 27.882  32.284  1.00 20.35 ? 88   PRO C O   1 
ATOM   5676  C  CB  . PRO C 1 45  ? -15.568 28.638  33.091  1.00 21.16 ? 88   PRO C CB  1 
ATOM   5677  C  CG  . PRO C 1 45  ? -15.976 29.751  32.207  1.00 20.02 ? 88   PRO C CG  1 
ATOM   5678  C  CD  . PRO C 1 45  ? -15.749 29.206  30.811  1.00 20.53 ? 88   PRO C CD  1 
ATOM   5679  N  N   . MET C 1 46  ? -17.831 26.682  34.018  1.00 22.01 ? 89   MET C N   1 
ATOM   5680  C  CA  . MET C 1 46  ? -19.132 26.523  34.638  1.00 24.00 ? 89   MET C CA  1 
ATOM   5681  C  C   . MET C 1 46  ? -19.144 27.456  35.854  1.00 23.29 ? 89   MET C C   1 
ATOM   5682  O  O   . MET C 1 46  ? -18.448 27.215  36.843  1.00 23.35 ? 89   MET C O   1 
ATOM   5683  C  CB  . MET C 1 46  ? -19.351 25.063  35.074  1.00 26.55 ? 89   MET C CB  1 
ATOM   5684  C  CG  . MET C 1 46  ? -20.779 24.737  35.504  1.00 27.41 ? 89   MET C CG  1 
ATOM   5685  S  SD  . MET C 1 46  ? -21.994 25.143  34.221  1.00 31.44 ? 89   MET C SD  1 
ATOM   5686  C  CE  . MET C 1 46  ? -22.015 23.636  33.252  1.00 28.74 ? 89   MET C CE  1 
ATOM   5687  N  N   . VAL C 1 47  ? -19.923 28.528  35.757  1.00 22.11 ? 90   VAL C N   1 
ATOM   5688  C  CA  . VAL C 1 47  ? -20.026 29.511  36.829  1.00 21.94 ? 90   VAL C CA  1 
ATOM   5689  C  C   . VAL C 1 47  ? -21.367 29.449  37.563  1.00 23.04 ? 90   VAL C C   1 
ATOM   5690  O  O   . VAL C 1 47  ? -22.415 29.623  36.961  1.00 24.01 ? 90   VAL C O   1 
ATOM   5691  C  CB  . VAL C 1 47  ? -19.863 30.928  36.280  1.00 20.81 ? 90   VAL C CB  1 
ATOM   5692  C  CG1 . VAL C 1 47  ? -19.843 31.927  37.424  1.00 19.22 ? 90   VAL C CG1 1 
ATOM   5693  C  CG2 . VAL C 1 47  ? -18.606 31.002  35.454  1.00 17.86 ? 90   VAL C CG2 1 
ATOM   5694  N  N   . ARG C 1 48  ? -21.315 29.226  38.868  1.00 21.87 ? 91   ARG C N   1 
ATOM   5695  C  CA  . ARG C 1 48  ? -22.502 29.141  39.706  1.00 21.90 ? 91   ARG C CA  1 
ATOM   5696  C  C   . ARG C 1 48  ? -23.138 30.516  40.021  1.00 21.80 ? 91   ARG C C   1 
ATOM   5697  O  O   . ARG C 1 48  ? -22.447 31.535  40.132  1.00 22.55 ? 91   ARG C O   1 
ATOM   5698  C  CB  . ARG C 1 48  ? -22.103 28.423  40.995  1.00 23.53 ? 91   ARG C CB  1 
ATOM   5699  C  CG  . ARG C 1 48  ? -23.203 28.194  41.998  1.00 25.94 ? 91   ARG C CG  1 
ATOM   5700  C  CD  . ARG C 1 48  ? -22.596 27.618  43.266  1.00 27.07 ? 91   ARG C CD  1 
ATOM   5701  N  NE  . ARG C 1 48  ? -22.063 28.651  44.152  1.00 27.23 ? 91   ARG C NE  1 
ATOM   5702  C  CZ  . ARG C 1 48  ? -21.177 28.421  45.117  1.00 26.42 ? 91   ARG C CZ  1 
ATOM   5703  N  NH1 . ARG C 1 48  ? -20.714 27.188  45.310  1.00 25.10 ? 91   ARG C NH1 1 
ATOM   5704  N  NH2 . ARG C 1 48  ? -20.781 29.417  45.904  1.00 25.15 ? 91   ARG C NH2 1 
ATOM   5705  N  N   . ILE C 1 49  ? -24.458 30.541  40.163  1.00 20.04 ? 92   ILE C N   1 
ATOM   5706  C  CA  . ILE C 1 49  ? -25.162 31.776  40.480  1.00 18.89 ? 92   ILE C CA  1 
ATOM   5707  C  C   . ILE C 1 49  ? -25.417 31.858  41.984  1.00 19.92 ? 92   ILE C C   1 
ATOM   5708  O  O   . ILE C 1 49  ? -26.147 31.035  42.554  1.00 19.49 ? 92   ILE C O   1 
ATOM   5709  C  CB  . ILE C 1 49  ? -26.492 31.852  39.719  1.00 17.17 ? 92   ILE C CB  1 
ATOM   5710  C  CG1 . ILE C 1 49  ? -26.206 32.011  38.233  1.00 15.39 ? 92   ILE C CG1 1 
ATOM   5711  C  CG2 . ILE C 1 49  ? -27.328 33.020  40.219  1.00 16.03 ? 92   ILE C CG2 1 
ATOM   5712  C  CD1 . ILE C 1 49  ? -25.376 33.224  37.916  1.00 14.00 ? 92   ILE C CD1 1 
ATOM   5713  N  N   . ASN C 1 50  ? -24.804 32.860  42.617  1.00 18.35 ? 93   ASN C N   1 
ATOM   5714  C  CA  . ASN C 1 50  ? -24.907 33.057  44.064  1.00 17.85 ? 93   ASN C CA  1 
ATOM   5715  C  C   . ASN C 1 50  ? -25.987 34.053  44.558  1.00 19.05 ? 93   ASN C C   1 
ATOM   5716  O  O   . ASN C 1 50  ? -26.742 33.763  45.503  1.00 18.84 ? 93   ASN C O   1 
ATOM   5717  C  CB  . ASN C 1 50  ? -23.528 33.471  44.605  1.00 15.33 ? 93   ASN C CB  1 
ATOM   5718  C  CG  . ASN C 1 50  ? -22.469 32.422  44.363  1.00 13.94 ? 93   ASN C CG  1 
ATOM   5719  O  OD1 . ASN C 1 50  ? -22.230 31.555  45.199  1.00 16.03 ? 93   ASN C OD1 1 
ATOM   5720  N  ND2 . ASN C 1 50  ? -21.835 32.484  43.209  1.00 12.48 ? 93   ASN C ND2 1 
ATOM   5721  N  N   . LYS C 1 51  ? -26.075 35.189  43.930  1.00 19.21 ? 94   LYS C N   1 
ATOM   5722  C  CA  . LYS C 1 51  ? -27.049 36.112  44.405  1.00 20.49 ? 94   LYS C CA  1 
ATOM   5723  C  C   . LYS C 1 51  ? -28.322 36.128  43.607  1.00 21.09 ? 94   LYS C C   1 
ATOM   5724  O  O   . LYS C 1 51  ? -29.416 36.113  44.175  1.00 22.05 ? 94   LYS C O   1 
ATOM   5725  C  CB  . LYS C 1 51  ? -26.487 37.556  44.409  1.00 21.60 ? 94   LYS C CB  1 
ATOM   5726  C  CG  . LYS C 1 51  ? -25.044 37.718  44.866  1.00 20.93 ? 94   LYS C CG  1 
ATOM   5727  C  CD  . LYS C 1 51  ? -24.589 39.176  44.854  1.00 20.28 ? 94   LYS C CD  1 
ATOM   5728  C  CE  . LYS C 1 51  ? -23.203 39.309  45.451  1.00 20.62 ? 94   LYS C CE  1 
ATOM   5729  N  NZ  . LYS C 1 51  ? -22.693 40.703  45.351  1.00 21.58 ? 94   LYS C NZ  1 
ATOM   5730  N  N   . ILE C 1 52  ? -28.244 36.156  42.295  1.00 22.06 ? 95   ILE C N   1 
ATOM   5731  C  CA  . ILE C 1 52  ? -29.465 36.455  41.566  1.00 23.70 ? 95   ILE C CA  1 
ATOM   5732  C  C   . ILE C 1 52  ? -30.438 35.328  41.797  1.00 24.60 ? 95   ILE C C   1 
ATOM   5733  O  O   . ILE C 1 52  ? -31.597 35.507  42.148  1.00 24.30 ? 95   ILE C O   1 
ATOM   5734  C  CB  . ILE C 1 52  ? -29.228 36.690  40.069  1.00 24.56 ? 95   ILE C CB  1 
ATOM   5735  C  CG1 . ILE C 1 52  ? -28.655 38.073  39.802  1.00 24.26 ? 95   ILE C CG1 1 
ATOM   5736  C  CG2 . ILE C 1 52  ? -30.528 36.488  39.292  1.00 23.66 ? 95   ILE C CG2 1 
ATOM   5737  C  CD1 . ILE C 1 52  ? -28.006 38.201  38.445  1.00 25.77 ? 95   ILE C CD1 1 
ATOM   5738  N  N   . GLY C 1 53  ? -29.870 34.142  41.572  1.00 25.24 ? 96   GLY C N   1 
ATOM   5739  C  CA  . GLY C 1 53  ? -30.614 32.899  41.766  1.00 24.63 ? 96   GLY C CA  1 
ATOM   5740  C  C   . GLY C 1 53  ? -31.162 32.676  43.161  1.00 25.36 ? 96   GLY C C   1 
ATOM   5741  O  O   . GLY C 1 53  ? -31.481 31.552  43.524  1.00 27.44 ? 96   GLY C O   1 
ATOM   5742  N  N   . LYS C 1 54  ? -31.255 33.755  43.939  1.00 24.49 ? 97   LYS C N   1 
ATOM   5743  C  CA  . LYS C 1 54  ? -31.760 33.739  45.323  1.00 22.17 ? 97   LYS C CA  1 
ATOM   5744  C  C   . LYS C 1 54  ? -32.774 34.843  45.505  1.00 23.79 ? 97   LYS C C   1 
ATOM   5745  O  O   . LYS C 1 54  ? -33.582 34.811  46.432  1.00 24.93 ? 97   LYS C O   1 
ATOM   5746  C  CB  . LYS C 1 54  ? -30.659 34.044  46.323  1.00 18.49 ? 97   LYS C CB  1 
ATOM   5747  C  CG  . LYS C 1 54  ? -29.600 33.005  46.465  1.00 12.50 ? 97   LYS C CG  1 
ATOM   5748  C  CD  . LYS C 1 54  ? -30.239 31.729  46.879  1.00 9.24  ? 97   LYS C CD  1 
ATOM   5749  C  CE  . LYS C 1 54  ? -29.249 30.907  47.631  1.00 5.18  ? 97   LYS C CE  1 
ATOM   5750  N  NZ  . LYS C 1 54  ? -29.675 29.515  47.838  1.00 4.65  ? 97   LYS C NZ  1 
ATOM   5751  N  N   . LYS C 1 55  ? -32.694 35.845  44.640  1.00 25.03 ? 98   LYS C N   1 
ATOM   5752  C  CA  . LYS C 1 55  ? -33.586 36.984  44.700  1.00 27.07 ? 98   LYS C CA  1 
ATOM   5753  C  C   . LYS C 1 55  ? -34.973 36.501  44.344  1.00 27.68 ? 98   LYS C C   1 
ATOM   5754  O  O   . LYS C 1 55  ? -35.936 36.831  45.025  1.00 29.16 ? 98   LYS C O   1 
ATOM   5755  C  CB  . LYS C 1 55  ? -33.127 38.064  43.722  1.00 27.85 ? 98   LYS C CB  1 
ATOM   5756  C  CG  . LYS C 1 55  ? -33.677 39.449  44.020  1.00 30.55 ? 98   LYS C CG  1 
ATOM   5757  C  CD  . LYS C 1 55  ? -32.721 40.274  44.905  1.00 32.72 ? 98   LYS C CD  1 
ATOM   5758  C  CE  . LYS C 1 55  ? -33.220 41.715  45.097  1.00 32.27 ? 98   LYS C CE  1 
ATOM   5759  N  NZ  . LYS C 1 55  ? -32.199 42.595  45.748  1.00 32.38 ? 98   LYS C NZ  1 
ATOM   5760  N  N   . PHE C 1 56  ? -35.069 35.690  43.295  1.00 28.44 ? 99   PHE C N   1 
ATOM   5761  C  CA  . PHE C 1 56  ? -36.358 35.172  42.857  1.00 27.74 ? 99   PHE C CA  1 
ATOM   5762  C  C   . PHE C 1 56  ? -36.804 33.903  43.542  1.00 27.52 ? 99   PHE C C   1 
ATOM   5763  O  O   . PHE C 1 56  ? -37.830 33.337  43.194  1.00 28.35 ? 99   PHE C O   1 
ATOM   5764  C  CB  . PHE C 1 56  ? -36.353 34.964  41.356  1.00 25.83 ? 99   PHE C CB  1 
ATOM   5765  C  CG  . PHE C 1 56  ? -36.217 36.235  40.591  1.00 26.87 ? 99   PHE C CG  1 
ATOM   5766  C  CD1 . PHE C 1 56  ? -35.002 36.898  40.531  1.00 27.20 ? 99   PHE C CD1 1 
ATOM   5767  C  CD2 . PHE C 1 56  ? -37.309 36.797  39.952  1.00 27.28 ? 99   PHE C CD2 1 
ATOM   5768  C  CE1 . PHE C 1 56  ? -34.877 38.101  39.846  1.00 25.55 ? 99   PHE C CE1 1 
ATOM   5769  C  CE2 . PHE C 1 56  ? -37.185 38.003  39.265  1.00 26.82 ? 99   PHE C CE2 1 
ATOM   5770  C  CZ  . PHE C 1 56  ? -35.969 38.648  39.216  1.00 26.27 ? 99   PHE C CZ  1 
ATOM   5771  N  N   . GLY C 1 57  ? -36.022 33.458  44.510  1.00 27.10 ? 100  GLY C N   1 
ATOM   5772  C  CA  . GLY C 1 57  ? -36.376 32.280  45.260  1.00 26.97 ? 100  GLY C CA  1 
ATOM   5773  C  C   . GLY C 1 57  ? -36.226 30.934  44.597  1.00 26.94 ? 100  GLY C C   1 
ATOM   5774  O  O   . GLY C 1 57  ? -37.059 30.092  44.860  1.00 27.15 ? 100  GLY C O   1 
ATOM   5775  N  N   . LEU C 1 58  ? -35.210 30.707  43.763  1.00 26.07 ? 101  LEU C N   1 
ATOM   5776  C  CA  . LEU C 1 58  ? -35.037 29.384  43.148  1.00 24.27 ? 101  LEU C CA  1 
ATOM   5777  C  C   . LEU C 1 58  ? -34.657 28.419  44.282  1.00 24.68 ? 101  LEU C C   1 
ATOM   5778  O  O   . LEU C 1 58  ? -34.571 28.849  45.429  1.00 25.97 ? 101  LEU C O   1 
ATOM   5779  C  CB  . LEU C 1 58  ? -33.952 29.450  42.067  1.00 21.78 ? 101  LEU C CB  1 
ATOM   5780  C  CG  . LEU C 1 58  ? -34.525 29.664  40.658  1.00 21.77 ? 101  LEU C CG  1 
ATOM   5781  C  CD1 . LEU C 1 58  ? -35.522 30.830  40.632  1.00 21.38 ? 101  LEU C CD1 1 
ATOM   5782  C  CD2 . LEU C 1 58  ? -33.380 29.896  39.690  1.00 19.64 ? 101  LEU C CD2 1 
ATOM   5783  N  N   . LYS C 1 59  ? -34.445 27.135  44.004  1.00 24.79 ? 102  LYS C N   1 
ATOM   5784  C  CA  . LYS C 1 59  ? -34.093 26.213  45.090  1.00 23.65 ? 102  LYS C CA  1 
ATOM   5785  C  C   . LYS C 1 59  ? -32.969 25.264  44.728  1.00 23.18 ? 102  LYS C C   1 
ATOM   5786  O  O   . LYS C 1 59  ? -32.382 24.622  45.594  1.00 24.32 ? 102  LYS C O   1 
ATOM   5787  C  CB  . LYS C 1 59  ? -35.322 25.404  45.530  1.00 23.58 ? 102  LYS C CB  1 
ATOM   5788  C  CG  . LYS C 1 59  ? -36.365 26.221  46.259  1.00 22.22 ? 102  LYS C CG  1 
ATOM   5789  C  CD  . LYS C 1 59  ? -37.319 25.367  47.092  1.00 22.58 ? 102  LYS C CD  1 
ATOM   5790  C  CE  . LYS C 1 59  ? -38.422 24.729  46.249  1.00 23.34 ? 102  LYS C CE  1 
ATOM   5791  N  NZ  . LYS C 1 59  ? -39.030 25.705  45.286  1.00 23.35 ? 102  LYS C NZ  1 
ATOM   5792  N  N   . CYS C 1 60  ? -32.674 25.178  43.443  1.00 21.93 ? 103  CYS C N   1 
ATOM   5793  C  CA  . CYS C 1 60  ? -31.625 24.298  42.955  1.00 21.83 ? 103  CYS C CA  1 
ATOM   5794  C  C   . CYS C 1 60  ? -30.320 25.042  42.858  1.00 21.19 ? 103  CYS C C   1 
ATOM   5795  O  O   . CYS C 1 60  ? -30.273 26.241  43.121  1.00 21.08 ? 103  CYS C O   1 
ATOM   5796  C  CB  . CYS C 1 60  ? -32.005 23.829  41.573  1.00 21.89 ? 103  CYS C CB  1 
ATOM   5797  S  SG  . CYS C 1 60  ? -32.595 25.226  40.616  1.00 24.00 ? 103  CYS C SG  1 
ATOM   5798  N  N   . GLU C 1 61  ? -29.254 24.342  42.489  1.00 20.90 ? 104  GLU C N   1 
ATOM   5799  C  CA  . GLU C 1 61  ? -27.996 25.036  42.313  1.00 22.10 ? 104  GLU C CA  1 
ATOM   5800  C  C   . GLU C 1 61  ? -28.246 25.702  40.978  1.00 22.27 ? 104  GLU C C   1 
ATOM   5801  O  O   . GLU C 1 61  ? -29.164 25.309  40.261  1.00 21.47 ? 104  GLU C O   1 
ATOM   5802  C  CB  . GLU C 1 61  ? -26.788 24.093  42.244  1.00 22.00 ? 104  GLU C CB  1 
ATOM   5803  C  CG  . GLU C 1 61  ? -25.471 24.850  42.011  1.00 23.81 ? 104  GLU C CG  1 
ATOM   5804  C  CD  . GLU C 1 61  ? -24.232 24.010  42.257  1.00 25.21 ? 104  GLU C CD  1 
ATOM   5805  O  OE1 . GLU C 1 61  ? -24.293 22.788  42.040  1.00 26.08 ? 104  GLU C OE1 1 
ATOM   5806  O  OE2 . GLU C 1 61  ? -23.188 24.566  42.657  1.00 26.62 ? 104  GLU C OE2 1 
ATOM   5807  N  N   . LEU C 1 62  ? -27.473 26.730  40.663  1.00 22.45 ? 105  LEU C N   1 
ATOM   5808  C  CA  . LEU C 1 62  ? -27.674 27.440  39.416  1.00 23.01 ? 105  LEU C CA  1 
ATOM   5809  C  C   . LEU C 1 62  ? -26.319 27.742  38.800  1.00 22.66 ? 105  LEU C C   1 
ATOM   5810  O  O   . LEU C 1 62  ? -25.649 28.691  39.190  1.00 24.21 ? 105  LEU C O   1 
ATOM   5811  C  CB  . LEU C 1 62  ? -28.459 28.735  39.680  1.00 23.90 ? 105  LEU C CB  1 
ATOM   5812  C  CG  . LEU C 1 62  ? -29.167 29.417  38.497  1.00 26.27 ? 105  LEU C CG  1 
ATOM   5813  C  CD1 . LEU C 1 62  ? -30.122 28.435  37.829  1.00 24.43 ? 105  LEU C CD1 1 
ATOM   5814  C  CD2 . LEU C 1 62  ? -29.922 30.659  38.987  1.00 23.09 ? 105  LEU C CD2 1 
ATOM   5815  N  N   . LEU C 1 63  ? -25.926 26.917  37.838  1.00 21.85 ? 106  LEU C N   1 
ATOM   5816  C  CA  . LEU C 1 63  ? -24.648 27.058  37.160  1.00 21.37 ? 106  LEU C CA  1 
ATOM   5817  C  C   . LEU C 1 63  ? -24.798 27.917  35.911  1.00 21.51 ? 106  LEU C C   1 
ATOM   5818  O  O   . LEU C 1 63  ? -25.895 28.162  35.447  1.00 21.88 ? 106  LEU C O   1 
ATOM   5819  C  CB  . LEU C 1 63  ? -24.124 25.674  36.768  1.00 22.25 ? 106  LEU C CB  1 
ATOM   5820  C  CG  . LEU C 1 63  ? -24.033 24.563  37.824  1.00 21.35 ? 106  LEU C CG  1 
ATOM   5821  C  CD1 . LEU C 1 63  ? -24.074 23.220  37.128  1.00 17.68 ? 106  LEU C CD1 1 
ATOM   5822  C  CD2 . LEU C 1 63  ? -22.768 24.711  38.658  1.00 20.38 ? 106  LEU C CD2 1 
ATOM   5823  N  N   . ALA C 1 64  ? -23.687 28.375  35.361  1.00 22.23 ? 107  ALA C N   1 
ATOM   5824  C  CA  . ALA C 1 64  ? -23.736 29.201  34.167  1.00 22.84 ? 107  ALA C CA  1 
ATOM   5825  C  C   . ALA C 1 64  ? -22.576 28.837  33.262  1.00 23.71 ? 107  ALA C C   1 
ATOM   5826  O  O   . ALA C 1 64  ? -21.422 29.114  33.583  1.00 24.07 ? 107  ALA C O   1 
ATOM   5827  C  CB  . ALA C 1 64  ? -23.667 30.678  34.539  1.00 22.23 ? 107  ALA C CB  1 
ATOM   5828  N  N   . LYS C 1 65  ? -22.885 28.183  32.146  1.00 23.82 ? 108  LYS C N   1 
ATOM   5829  C  CA  . LYS C 1 65  ? -21.860 27.807  31.189  1.00 22.59 ? 108  LYS C CA  1 
ATOM   5830  C  C   . LYS C 1 65  ? -21.544 29.110  30.479  1.00 24.03 ? 108  LYS C C   1 
ATOM   5831  O  O   . LYS C 1 65  ? -22.262 29.511  29.556  1.00 24.37 ? 108  LYS C O   1 
ATOM   5832  C  CB  . LYS C 1 65  ? -22.413 26.798  30.193  1.00 20.18 ? 108  LYS C CB  1 
ATOM   5833  C  CG  . LYS C 1 65  ? -21.377 26.202  29.255  1.00 17.01 ? 108  LYS C CG  1 
ATOM   5834  C  CD  . LYS C 1 65  ? -20.460 25.228  29.969  1.00 13.97 ? 108  LYS C CD  1 
ATOM   5835  C  CE  . LYS C 1 65  ? -19.571 24.513  28.977  1.00 13.02 ? 108  LYS C CE  1 
ATOM   5836  N  NZ  . LYS C 1 65  ? -18.550 23.671  29.625  1.00 11.99 ? 108  LYS C NZ  1 
ATOM   5837  N  N   . CYS C 1 66  ? -20.482 29.778  30.926  1.00 24.30 ? 109  CYS C N   1 
ATOM   5838  C  CA  . CYS C 1 66  ? -20.093 31.055  30.351  1.00 26.61 ? 109  CYS C CA  1 
ATOM   5839  C  C   . CYS C 1 66  ? -19.355 30.944  29.030  1.00 27.52 ? 109  CYS C C   1 
ATOM   5840  O  O   . CYS C 1 66  ? -18.132 30.757  28.965  1.00 27.11 ? 109  CYS C O   1 
ATOM   5841  C  CB  . CYS C 1 66  ? -19.297 31.856  31.367  1.00 25.66 ? 109  CYS C CB  1 
ATOM   5842  S  SG  . CYS C 1 66  ? -20.335 32.251  32.783  1.00 31.46 ? 109  CYS C SG  1 
ATOM   5843  N  N   . GLU C 1 67  ? -20.149 31.093  27.972  1.00 28.62 ? 110  GLU C N   1 
ATOM   5844  C  CA  . GLU C 1 67  ? -19.691 30.994  26.598  1.00 29.83 ? 110  GLU C CA  1 
ATOM   5845  C  C   . GLU C 1 67  ? -19.161 32.301  26.045  1.00 30.70 ? 110  GLU C C   1 
ATOM   5846  O  O   . GLU C 1 67  ? -18.786 32.356  24.874  1.00 31.80 ? 110  GLU C O   1 
ATOM   5847  C  CB  . GLU C 1 67  ? -20.842 30.505  25.726  1.00 28.64 ? 110  GLU C CB  1 
ATOM   5848  C  CG  . GLU C 1 67  ? -20.507 29.354  24.793  1.00 26.93 ? 110  GLU C CG  1 
ATOM   5849  C  CD  . GLU C 1 67  ? -19.986 28.133  25.503  1.00 24.50 ? 110  GLU C CD  1 
ATOM   5850  O  OE1 . GLU C 1 67  ? -20.430 27.855  26.640  1.00 21.80 ? 110  GLU C OE1 1 
ATOM   5851  O  OE2 . GLU C 1 67  ? -19.137 27.445  24.903  1.00 23.10 ? 110  GLU C OE2 1 
ATOM   5852  N  N   . PHE C 1 68  ? -19.144 33.349  26.873  1.00 31.23 ? 111  PHE C N   1 
ATOM   5853  C  CA  . PHE C 1 68  ? -18.636 34.656  26.453  1.00 30.46 ? 111  PHE C CA  1 
ATOM   5854  C  C   . PHE C 1 68  ? -17.135 34.753  26.681  1.00 29.32 ? 111  PHE C C   1 
ATOM   5855  O  O   . PHE C 1 68  ? -16.548 35.823  26.616  1.00 27.95 ? 111  PHE C O   1 
ATOM   5856  C  CB  . PHE C 1 68  ? -19.376 35.792  27.176  1.00 30.04 ? 111  PHE C CB  1 
ATOM   5857  C  CG  . PHE C 1 68  ? -19.586 35.569  28.656  1.00 29.38 ? 111  PHE C CG  1 
ATOM   5858  C  CD1 . PHE C 1 68  ? -18.561 35.792  29.568  1.00 29.04 ? 111  PHE C CD1 1 
ATOM   5859  C  CD2 . PHE C 1 68  ? -20.832 35.165  29.137  1.00 28.71 ? 111  PHE C CD2 1 
ATOM   5860  C  CE1 . PHE C 1 68  ? -18.775 35.620  30.934  1.00 28.78 ? 111  PHE C CE1 1 
ATOM   5861  C  CE2 . PHE C 1 68  ? -21.052 34.990  30.502  1.00 28.68 ? 111  PHE C CE2 1 
ATOM   5862  C  CZ  . PHE C 1 68  ? -20.020 35.219  31.399  1.00 29.05 ? 111  PHE C CZ  1 
ATOM   5863  N  N   . PHE C 1 69  ? -16.522 33.604  26.931  1.00 30.28 ? 112  PHE C N   1 
ATOM   5864  C  CA  . PHE C 1 69  ? -15.085 33.524  27.155  1.00 30.87 ? 112  PHE C CA  1 
ATOM   5865  C  C   . PHE C 1 69  ? -14.335 33.021  25.919  1.00 30.13 ? 112  PHE C C   1 
ATOM   5866  O  O   . PHE C 1 69  ? -13.106 33.177  25.826  1.00 29.73 ? 112  PHE C O   1 
ATOM   5867  C  CB  . PHE C 1 69  ? -14.780 32.605  28.344  1.00 31.88 ? 112  PHE C CB  1 
ATOM   5868  C  CG  . PHE C 1 69  ? -14.729 33.321  29.659  1.00 33.61 ? 112  PHE C CG  1 
ATOM   5869  C  CD1 . PHE C 1 69  ? -15.889 33.805  30.248  1.00 34.73 ? 112  PHE C CD1 1 
ATOM   5870  C  CD2 . PHE C 1 69  ? -13.509 33.563  30.282  1.00 34.54 ? 112  PHE C CD2 1 
ATOM   5871  C  CE1 . PHE C 1 69  ? -15.835 34.521  31.432  1.00 35.07 ? 112  PHE C CE1 1 
ATOM   5872  C  CE2 . PHE C 1 69  ? -13.449 34.280  31.468  1.00 34.39 ? 112  PHE C CE2 1 
ATOM   5873  C  CZ  . PHE C 1 69  ? -14.617 34.760  32.041  1.00 34.60 ? 112  PHE C CZ  1 
ATOM   5874  N  N   . ASN C 1 70  ? -15.063 32.414  24.982  1.00 27.87 ? 113  ASN C N   1 
ATOM   5875  C  CA  . ASN C 1 70  ? -14.438 31.904  23.767  1.00 25.37 ? 113  ASN C CA  1 
ATOM   5876  C  C   . ASN C 1 70  ? -13.632 33.026  23.171  1.00 24.33 ? 113  ASN C C   1 
ATOM   5877  O  O   . ASN C 1 70  ? -14.081 34.170  23.202  1.00 24.44 ? 113  ASN C O   1 
ATOM   5878  C  CB  . ASN C 1 70  ? -15.498 31.452  22.771  1.00 25.09 ? 113  ASN C CB  1 
ATOM   5879  C  CG  . ASN C 1 70  ? -16.089 30.117  23.124  1.00 22.89 ? 113  ASN C CG  1 
ATOM   5880  O  OD1 . ASN C 1 70  ? -15.382 29.113  23.166  1.00 21.51 ? 113  ASN C OD1 1 
ATOM   5881  N  ND2 . ASN C 1 70  ? -17.390 30.094  23.385  1.00 22.87 ? 113  ASN C ND2 1 
ATOM   5882  N  N   . ALA C 1 71  ? -12.453 32.712  22.640  1.00 23.13 ? 114  ALA C N   1 
ATOM   5883  C  CA  . ALA C 1 71  ? -11.597 33.732  22.054  1.00 21.66 ? 114  ALA C CA  1 
ATOM   5884  C  C   . ALA C 1 71  ? -12.449 34.819  21.412  1.00 21.37 ? 114  ALA C C   1 
ATOM   5885  O  O   . ALA C 1 71  ? -12.268 36.008  21.680  1.00 21.79 ? 114  ALA C O   1 
ATOM   5886  C  CB  . ALA C 1 71  ? -10.697 33.105  21.029  1.00 23.20 ? 114  ALA C CB  1 
ATOM   5887  N  N   . GLY C 1 72  ? -13.406 34.384  20.595  1.00 20.19 ? 115  GLY C N   1 
ATOM   5888  C  CA  . GLY C 1 72  ? -14.294 35.292  19.900  1.00 17.67 ? 115  GLY C CA  1 
ATOM   5889  C  C   . GLY C 1 72  ? -15.197 36.150  20.759  1.00 16.15 ? 115  GLY C C   1 
ATOM   5890  O  O   . GLY C 1 72  ? -15.499 37.279  20.388  1.00 16.40 ? 115  GLY C O   1 
ATOM   5891  N  N   . GLY C 1 73  ? -15.631 35.629  21.899  1.00 14.88 ? 116  GLY C N   1 
ATOM   5892  C  CA  . GLY C 1 73  ? -16.508 36.389  22.771  1.00 14.78 ? 116  GLY C CA  1 
ATOM   5893  C  C   . GLY C 1 73  ? -17.925 35.892  22.626  1.00 14.40 ? 116  GLY C C   1 
ATOM   5894  O  O   . GLY C 1 73  ? -18.816 36.236  23.395  1.00 14.63 ? 116  GLY C O   1 
ATOM   5895  N  N   . SER C 1 74  ? -18.106 35.043  21.626  1.00 15.26 ? 117  SER C N   1 
ATOM   5896  C  CA  . SER C 1 74  ? -19.393 34.450  21.281  1.00 13.92 ? 117  SER C CA  1 
ATOM   5897  C  C   . SER C 1 74  ? -19.418 32.952  21.514  1.00 12.46 ? 117  SER C C   1 
ATOM   5898  O  O   . SER C 1 74  ? -18.389 32.317  21.703  1.00 10.09 ? 117  SER C O   1 
ATOM   5899  C  CB  . SER C 1 74  ? -19.678 34.705  19.804  1.00 14.41 ? 117  SER C CB  1 
ATOM   5900  O  OG  . SER C 1 74  ? -18.572 34.300  18.993  1.00 12.47 ? 117  SER C OG  1 
ATOM   5901  N  N   . VAL C 1 75  ? -20.615 32.392  21.519  1.00 11.90 ? 118  VAL C N   1 
ATOM   5902  C  CA  . VAL C 1 75  ? -20.777 30.967  21.651  1.00 10.41 ? 118  VAL C CA  1 
ATOM   5903  C  C   . VAL C 1 75  ? -20.630 30.390  20.254  1.00 11.45 ? 118  VAL C C   1 
ATOM   5904  O  O   . VAL C 1 75  ? -20.294 29.233  20.078  1.00 12.46 ? 118  VAL C O   1 
ATOM   5905  C  CB  . VAL C 1 75  ? -22.178 30.614  22.176  1.00 10.32 ? 118  VAL C CB  1 
ATOM   5906  C  CG1 . VAL C 1 75  ? -23.246 31.104  21.222  1.00 10.63 ? 118  VAL C CG1 1 
ATOM   5907  C  CG2 . VAL C 1 75  ? -22.308 29.102  22.385  1.00 10.72 ? 118  VAL C CG2 1 
ATOM   5908  N  N   . LYS C 1 76  ? -20.881 31.220  19.248  1.00 10.45 ? 119  LYS C N   1 
ATOM   5909  C  CA  . LYS C 1 76  ? -20.839 30.719  17.882  1.00 10.29 ? 119  LYS C CA  1 
ATOM   5910  C  C   . LYS C 1 76  ? -19.421 30.507  17.341  1.00 10.35 ? 119  LYS C C   1 
ATOM   5911  O  O   . LYS C 1 76  ? -19.277 30.220  16.162  1.00 10.46 ? 119  LYS C O   1 
ATOM   5912  C  CB  . LYS C 1 76  ? -21.699 31.627  16.995  1.00 10.01 ? 119  LYS C CB  1 
ATOM   5913  C  CG  . LYS C 1 76  ? -23.202 31.570  17.312  1.00 9.84  ? 119  LYS C CG  1 
ATOM   5914  C  CD  . LYS C 1 76  ? -24.050 31.817  16.078  1.00 7.48  ? 119  LYS C CD  1 
ATOM   5915  C  CE  . LYS C 1 76  ? -25.473 31.321  16.292  1.00 11.54 ? 119  LYS C CE  1 
ATOM   5916  N  NZ  . LYS C 1 76  ? -25.978 31.629  17.657  1.00 14.53 ? 119  LYS C NZ  1 
ATOM   5917  N  N   . ASP C 1 77  ? -18.414 30.649  18.181  1.00 11.80 ? 120  ASP C N   1 
ATOM   5918  C  CA  . ASP C 1 77  ? -17.081 30.374  17.691  1.00 16.56 ? 120  ASP C CA  1 
ATOM   5919  C  C   . ASP C 1 77  ? -16.949 28.879  17.613  1.00 18.31 ? 120  ASP C C   1 
ATOM   5920  O  O   . ASP C 1 77  ? -16.117 28.327  16.890  1.00 19.35 ? 120  ASP C O   1 
ATOM   5921  C  CB  . ASP C 1 77  ? -16.040 31.017  18.586  1.00 17.26 ? 120  ASP C CB  1 
ATOM   5922  C  CG  . ASP C 1 77  ? -16.372 32.458  18.872  1.00 19.48 ? 120  ASP C CG  1 
ATOM   5923  O  OD1 . ASP C 1 77  ? -16.302 33.291  17.945  1.00 17.92 ? 120  ASP C OD1 1 
ATOM   5924  O  OD2 . ASP C 1 77  ? -16.717 32.760  20.037  1.00 21.85 ? 120  ASP C OD2 1 
ATOM   5925  N  N   . ARG C 1 78  ? -17.805 28.225  18.412  1.00 19.48 ? 121  ARG C N   1 
ATOM   5926  C  CA  . ARG C 1 78  ? -17.824 26.791  18.487  1.00 20.12 ? 121  ARG C CA  1 
ATOM   5927  C  C   . ARG C 1 78  ? -18.278 26.278  17.133  1.00 20.58 ? 121  ARG C C   1 
ATOM   5928  O  O   . ARG C 1 78  ? -17.566 25.508  16.477  1.00 21.36 ? 121  ARG C O   1 
ATOM   5929  C  CB  . ARG C 1 78  ? -18.779 26.301  19.578  1.00 20.36 ? 121  ARG C CB  1 
ATOM   5930  C  CG  . ARG C 1 78  ? -18.154 26.253  20.952  1.00 20.06 ? 121  ARG C CG  1 
ATOM   5931  C  CD  . ARG C 1 78  ? -19.205 26.261  22.035  1.00 20.80 ? 121  ARG C CD  1 
ATOM   5932  N  NE  . ARG C 1 78  ? -18.642 25.917  23.333  1.00 21.78 ? 121  ARG C NE  1 
ATOM   5933  C  CZ  . ARG C 1 78  ? -18.191 24.709  23.656  1.00 24.49 ? 121  ARG C CZ  1 
ATOM   5934  N  NH1 . ARG C 1 78  ? -18.234 23.717  22.779  1.00 22.88 ? 121  ARG C NH1 1 
ATOM   5935  N  NH2 . ARG C 1 78  ? -17.691 24.489  24.863  1.00 26.12 ? 121  ARG C NH2 1 
ATOM   5936  N  N   . ILE C 1 79  ? -19.459 26.708  16.697  1.00 19.90 ? 122  ILE C N   1 
ATOM   5937  C  CA  . ILE C 1 79  ? -19.944 26.249  15.407  1.00 20.87 ? 122  ILE C CA  1 
ATOM   5938  C  C   . ILE C 1 79  ? -19.064 26.790  14.288  1.00 21.97 ? 122  ILE C C   1 
ATOM   5939  O  O   . ILE C 1 79  ? -18.743 26.059  13.356  1.00 23.10 ? 122  ILE C O   1 
ATOM   5940  C  CB  . ILE C 1 79  ? -21.415 26.628  15.151  1.00 18.10 ? 122  ILE C CB  1 
ATOM   5941  C  CG1 . ILE C 1 79  ? -21.579 28.134  15.049  1.00 17.79 ? 122  ILE C CG1 1 
ATOM   5942  C  CG2 . ILE C 1 79  ? -22.259 26.096  16.261  1.00 17.48 ? 122  ILE C CG2 1 
ATOM   5943  C  CD1 . ILE C 1 79  ? -22.832 28.535  14.332  1.00 17.53 ? 122  ILE C CD1 1 
ATOM   5944  N  N   . SER C 1 80  ? -18.661 28.053  14.380  1.00 22.42 ? 123  SER C N   1 
ATOM   5945  C  CA  . SER C 1 80  ? -17.789 28.634  13.358  1.00 24.40 ? 123  SER C CA  1 
ATOM   5946  C  C   . SER C 1 80  ? -16.626 27.680  13.070  1.00 24.61 ? 123  SER C C   1 
ATOM   5947  O  O   . SER C 1 80  ? -16.508 27.135  11.972  1.00 24.91 ? 123  SER C O   1 
ATOM   5948  C  CB  . SER C 1 80  ? -17.217 29.979  13.828  1.00 24.63 ? 123  SER C CB  1 
ATOM   5949  O  OG  . SER C 1 80  ? -18.167 31.024  13.746  1.00 24.86 ? 123  SER C OG  1 
ATOM   5950  N  N   . LEU C 1 81  ? -15.778 27.488  14.079  1.00 24.25 ? 124  LEU C N   1 
ATOM   5951  C  CA  . LEU C 1 81  ? -14.617 26.618  13.989  1.00 22.99 ? 124  LEU C CA  1 
ATOM   5952  C  C   . LEU C 1 81  ? -14.981 25.222  13.501  1.00 23.67 ? 124  LEU C C   1 
ATOM   5953  O  O   . LEU C 1 81  ? -14.426 24.744  12.521  1.00 22.50 ? 124  LEU C O   1 
ATOM   5954  C  CB  . LEU C 1 81  ? -13.942 26.524  15.354  1.00 20.99 ? 124  LEU C CB  1 
ATOM   5955  C  CG  . LEU C 1 81  ? -12.758 25.558  15.458  1.00 22.13 ? 124  LEU C CG  1 
ATOM   5956  C  CD1 . LEU C 1 81  ? -11.622 26.021  14.552  1.00 20.06 ? 124  LEU C CD1 1 
ATOM   5957  C  CD2 . LEU C 1 81  ? -12.306 25.463  16.915  1.00 19.36 ? 124  LEU C CD2 1 
ATOM   5958  N  N   . ARG C 1 82  ? -15.908 24.564  14.191  1.00 24.76 ? 125  ARG C N   1 
ATOM   5959  C  CA  . ARG C 1 82  ? -16.318 23.217  13.802  1.00 24.17 ? 125  ARG C CA  1 
ATOM   5960  C  C   . ARG C 1 82  ? -16.723 23.216  12.342  1.00 24.65 ? 125  ARG C C   1 
ATOM   5961  O  O   . ARG C 1 82  ? -16.577 22.219  11.652  1.00 26.70 ? 125  ARG C O   1 
ATOM   5962  C  CB  . ARG C 1 82  ? -17.459 22.699  14.697  1.00 22.45 ? 125  ARG C CB  1 
ATOM   5963  C  CG  . ARG C 1 82  ? -18.017 21.331  14.293  1.00 20.33 ? 125  ARG C CG  1 
ATOM   5964  C  CD  . ARG C 1 82  ? -16.949 20.260  14.422  1.00 20.44 ? 125  ARG C CD  1 
ATOM   5965  N  NE  . ARG C 1 82  ? -17.437 18.912  14.109  1.00 18.91 ? 125  ARG C NE  1 
ATOM   5966  C  CZ  . ARG C 1 82  ? -18.242 18.185  14.884  1.00 20.31 ? 125  ARG C CZ  1 
ATOM   5967  N  NH1 . ARG C 1 82  ? -18.684 18.677  16.043  1.00 21.66 ? 125  ARG C NH1 1 
ATOM   5968  N  NH2 . ARG C 1 82  ? -18.592 16.973  14.509  1.00 21.64 ? 125  ARG C NH2 1 
ATOM   5969  N  N   . MET C 1 83  ? -17.220 24.342  11.861  1.00 23.51 ? 126  MET C N   1 
ATOM   5970  C  CA  . MET C 1 83  ? -17.638 24.417  10.475  1.00 24.51 ? 126  MET C CA  1 
ATOM   5971  C  C   . MET C 1 83  ? -16.462 24.758  9.572   1.00 25.13 ? 126  MET C C   1 
ATOM   5972  O  O   . MET C 1 83  ? -16.317 24.183  8.501   1.00 26.84 ? 126  MET C O   1 
ATOM   5973  C  CB  . MET C 1 83  ? -18.752 25.450  10.339  1.00 25.16 ? 126  MET C CB  1 
ATOM   5974  C  CG  . MET C 1 83  ? -19.596 25.301  9.096   1.00 24.43 ? 126  MET C CG  1 
ATOM   5975  S  SD  . MET C 1 83  ? -20.841 26.590  8.929   1.00 27.25 ? 126  MET C SD  1 
ATOM   5976  C  CE  . MET C 1 83  ? -21.954 26.166  10.266  1.00 21.06 ? 126  MET C CE  1 
ATOM   5977  N  N   . ILE C 1 84  ? -15.621 25.721  10.007  1.00 23.99 ? 127  ILE C N   1 
ATOM   5978  C  CA  . ILE C 1 84  ? -14.485 26.139  9.216   1.00 21.82 ? 127  ILE C CA  1 
ATOM   5979  C  C   . ILE C 1 84  ? -13.526 24.993  9.090   1.00 21.40 ? 127  ILE C C   1 
ATOM   5980  O  O   . ILE C 1 84  ? -12.482 25.095  8.458   1.00 19.11 ? 127  ILE C O   1 
ATOM   5981  C  CB  . ILE C 1 84  ? -13.864 27.426  9.769   1.00 22.51 ? 127  ILE C CB  1 
ATOM   5982  C  CG1 . ILE C 1 84  ? -14.873 28.532  9.503   1.00 21.45 ? 127  ILE C CG1 1 
ATOM   5983  C  CG2 . ILE C 1 84  ? -12.501 27.718  9.139   1.00 22.00 ? 127  ILE C CG2 1 
ATOM   5984  C  CD1 . ILE C 1 84  ? -14.361 29.916  9.821   1.00 20.91 ? 127  ILE C CD1 1 
ATOM   5985  N  N   . GLU C 1 85  ? -13.905 23.881  9.728   1.00 23.00 ? 128  GLU C N   1 
ATOM   5986  C  CA  . GLU C 1 85  ? -13.081 22.692  9.649   1.00 23.80 ? 128  GLU C CA  1 
ATOM   5987  C  C   . GLU C 1 85  ? -13.857 21.405  9.325   1.00 24.83 ? 128  GLU C C   1 
ATOM   5988  O  O   . GLU C 1 85  ? -13.246 20.455  8.820   1.00 25.34 ? 128  GLU C O   1 
ATOM   5989  C  CB  . GLU C 1 85  ? -12.256 22.578  10.887  1.00 23.49 ? 128  GLU C CB  1 
ATOM   5990  C  CG  . GLU C 1 85  ? -12.927 21.767  11.951  1.00 25.05 ? 128  GLU C CG  1 
ATOM   5991  C  CD  . GLU C 1 85  ? -12.230 22.001  13.258  1.00 25.84 ? 128  GLU C CD  1 
ATOM   5992  O  OE1 . GLU C 1 85  ? -11.446 22.957  13.352  1.00 26.94 ? 128  GLU C OE1 1 
ATOM   5993  O  OE2 . GLU C 1 85  ? -12.463 21.226  14.202  1.00 23.76 ? 128  GLU C OE2 1 
ATOM   5994  N  N   . ASP C 1 86  ? -15.147 21.317  9.579   1.00 25.91 ? 129  ASP C N   1 
ATOM   5995  C  CA  . ASP C 1 86  ? -15.796 20.069  9.179   1.00 27.40 ? 129  ASP C CA  1 
ATOM   5996  C  C   . ASP C 1 86  ? -15.785 20.078  7.659   1.00 28.39 ? 129  ASP C C   1 
ATOM   5997  O  O   . ASP C 1 86  ? -16.178 19.135  6.997   1.00 28.59 ? 129  ASP C O   1 
ATOM   5998  C  CB  . ASP C 1 86  ? -17.236 20.011  9.738   1.00 26.72 ? 129  ASP C CB  1 
ATOM   5999  C  CG  . ASP C 1 86  ? -17.395 19.130  10.967  1.00 27.79 ? 129  ASP C CG  1 
ATOM   6000  O  OD1 . ASP C 1 86  ? -18.564 18.839  11.335  1.00 26.81 ? 129  ASP C OD1 1 
ATOM   6001  O  OD2 . ASP C 1 86  ? -16.363 18.730  11.561  1.00 28.39 ? 129  ASP C OD2 1 
ATOM   6002  N  N   . ALA C 1 87  ? -15.296 21.213  7.163   1.00 27.80 ? 130  ALA C N   1 
ATOM   6003  C  CA  . ALA C 1 87  ? -15.227 21.489  5.737   1.00 26.98 ? 130  ALA C CA  1 
ATOM   6004  C  C   . ALA C 1 87  ? -13.779 21.466  5.260   1.00 27.32 ? 130  ALA C C   1 
ATOM   6005  O  O   . ALA C 1 87  ? -13.507 21.294  4.067   1.00 28.29 ? 130  ALA C O   1 
ATOM   6006  C  CB  . ALA C 1 87  ? -15.866 22.841  5.406   1.00 26.72 ? 130  ALA C CB  1 
ATOM   6007  N  N   . GLU C 1 88  ? -12.843 21.626  6.186   1.00 26.60 ? 131  GLU C N   1 
ATOM   6008  C  CA  . GLU C 1 88  ? -11.444 21.583  5.800   1.00 25.21 ? 131  GLU C CA  1 
ATOM   6009  C  C   . GLU C 1 88  ? -11.141 20.140  5.478   1.00 23.66 ? 131  GLU C C   1 
ATOM   6010  O  O   . GLU C 1 88  ? -10.450 19.849  4.518   1.00 24.59 ? 131  GLU C O   1 
ATOM   6011  C  CB  . GLU C 1 88  ? -10.521 22.017  6.944   1.00 26.83 ? 131  GLU C CB  1 
ATOM   6012  C  CG  . GLU C 1 88  ? -10.611 23.478  7.398   1.00 29.22 ? 131  GLU C CG  1 
ATOM   6013  C  CD  . GLU C 1 88  ? -9.393  23.903  8.243   1.00 29.56 ? 131  GLU C CD  1 
ATOM   6014  O  OE1 . GLU C 1 88  ? -8.390  24.383  7.664   1.00 27.00 ? 131  GLU C OE1 1 
ATOM   6015  O  OE2 . GLU C 1 88  ? -9.424  23.740  9.486   1.00 31.25 ? 131  GLU C OE2 1 
ATOM   6016  N  N   . ARG C 1 89  ? -11.676 19.253  6.318   1.00 22.75 ? 132  ARG C N   1 
ATOM   6017  C  CA  . ARG C 1 89  ? -11.510 17.801  6.237   1.00 21.26 ? 132  ARG C CA  1 
ATOM   6018  C  C   . ARG C 1 89  ? -12.498 17.138  5.291   1.00 21.47 ? 132  ARG C C   1 
ATOM   6019  O  O   . ARG C 1 89  ? -12.220 16.081  4.740   1.00 21.07 ? 132  ARG C O   1 
ATOM   6020  C  CB  . ARG C 1 89  ? -11.630 17.195  7.630   1.00 20.58 ? 132  ARG C CB  1 
ATOM   6021  C  CG  . ARG C 1 89  ? -11.872 15.694  7.636   1.00 22.82 ? 132  ARG C CG  1 
ATOM   6022  C  CD  . ARG C 1 89  ? -11.938 15.153  9.060   1.00 22.77 ? 132  ARG C CD  1 
ATOM   6023  N  NE  . ARG C 1 89  ? -12.810 15.968  9.906   1.00 23.08 ? 132  ARG C NE  1 
ATOM   6024  C  CZ  . ARG C 1 89  ? -13.210 15.611  11.120  1.00 23.85 ? 132  ARG C CZ  1 
ATOM   6025  N  NH1 . ARG C 1 89  ? -12.825 14.448  11.627  1.00 24.14 ? 132  ARG C NH1 1 
ATOM   6026  N  NH2 . ARG C 1 89  ? -13.982 16.416  11.831  1.00 24.07 ? 132  ARG C NH2 1 
ATOM   6027  N  N   . ASP C 1 90  ? -13.627 17.799  5.108   1.00 21.72 ? 133  ASP C N   1 
ATOM   6028  C  CA  . ASP C 1 90  ? -14.652 17.321  4.180   1.00 20.07 ? 133  ASP C CA  1 
ATOM   6029  C  C   . ASP C 1 90  ? -14.070 17.333  2.786   1.00 17.92 ? 133  ASP C C   1 
ATOM   6030  O  O   . ASP C 1 90  ? -14.705 16.871  1.837   1.00 16.94 ? 133  ASP C O   1 
ATOM   6031  C  CB  . ASP C 1 90  ? -15.920 18.147  4.286   1.00 22.83 ? 133  ASP C CB  1 
ATOM   6032  C  CG  . ASP C 1 90  ? -17.123 17.449  3.675   1.00 26.80 ? 133  ASP C CG  1 
ATOM   6033  O  OD1 . ASP C 1 90  ? -17.546 16.414  4.206   1.00 27.48 ? 133  ASP C OD1 1 
ATOM   6034  O  OD2 . ASP C 1 90  ? -17.651 17.953  2.665   1.00 27.88 ? 133  ASP C OD2 1 
ATOM   6035  N  N   . GLY C 1 91  ? -12.837 17.846  2.657   1.00 17.79 ? 134  GLY C N   1 
ATOM   6036  C  CA  . GLY C 1 91  ? -12.150 17.885  1.361   1.00 16.18 ? 134  GLY C CA  1 
ATOM   6037  C  C   . GLY C 1 91  ? -12.500 19.142  0.578   1.00 16.58 ? 134  GLY C C   1 
ATOM   6038  O  O   . GLY C 1 91  ? -11.760 19.529  -0.321  1.00 14.25 ? 134  GLY C O   1 
ATOM   6039  N  N   . THR C 1 92  ? -13.628 19.773  0.931   1.00 16.75 ? 135  THR C N   1 
ATOM   6040  C  CA  . THR C 1 92  ? -14.130 20.976  0.251   1.00 17.92 ? 135  THR C CA  1 
ATOM   6041  C  C   . THR C 1 92  ? -13.421 22.277  0.589   1.00 18.90 ? 135  THR C C   1 
ATOM   6042  O  O   . THR C 1 92  ? -13.069 22.995  -0.343  1.00 21.60 ? 135  THR C O   1 
ATOM   6043  C  CB  . THR C 1 92  ? -15.632 21.098  0.507   1.00 19.25 ? 135  THR C CB  1 
ATOM   6044  O  OG1 . THR C 1 92  ? -16.231 19.807  0.460   1.00 21.68 ? 135  THR C OG1 1 
ATOM   6045  C  CG2 . THR C 1 92  ? -16.258 22.019  -0.536  1.00 21.26 ? 135  THR C CG2 1 
ATOM   6046  N  N   . LEU C 1 93  ? -13.195 22.625  1.834   1.00 18.99 ? 136  LEU C N   1 
ATOM   6047  C  CA  . LEU C 1 93  ? -12.559 23.921  2.033   1.00 19.31 ? 136  LEU C CA  1 
ATOM   6048  C  C   . LEU C 1 93  ? -11.034 23.844  1.861   1.00 19.01 ? 136  LEU C C   1 
ATOM   6049  O  O   . LEU C 1 93  ? -10.333 23.325  2.720   1.00 18.50 ? 136  LEU C O   1 
ATOM   6050  C  CB  . LEU C 1 93  ? -12.942 24.445  3.408   1.00 19.84 ? 136  LEU C CB  1 
ATOM   6051  C  CG  . LEU C 1 93  ? -12.423 25.818  3.790   1.00 19.53 ? 136  LEU C CG  1 
ATOM   6052  C  CD1 . LEU C 1 93  ? -12.510 26.771  2.598   1.00 19.15 ? 136  LEU C CD1 1 
ATOM   6053  C  CD2 . LEU C 1 93  ? -13.180 26.374  4.981   1.00 19.30 ? 136  LEU C CD2 1 
ATOM   6054  N  N   . LYS C 1 94  ? -10.544 24.377  0.742   1.00 19.04 ? 137  LYS C N   1 
ATOM   6055  C  CA  . LYS C 1 94  ? -9.126  24.402  0.382   1.00 18.67 ? 137  LYS C CA  1 
ATOM   6056  C  C   . LYS C 1 94  ? -8.329  25.571  0.968   1.00 18.86 ? 137  LYS C C   1 
ATOM   6057  O  O   . LYS C 1 94  ? -8.873  26.631  1.239   1.00 18.28 ? 137  LYS C O   1 
ATOM   6058  C  CB  . LYS C 1 94  ? -8.987  24.463  -1.143  1.00 16.97 ? 137  LYS C CB  1 
ATOM   6059  C  CG  . LYS C 1 94  ? -9.579  23.305  -1.908  1.00 15.85 ? 137  LYS C CG  1 
ATOM   6060  C  CD  . LYS C 1 94  ? -9.296  23.430  -3.406  1.00 11.96 ? 137  LYS C CD  1 
ATOM   6061  C  CE  . LYS C 1 94  ? -9.940  24.655  -4.011  1.00 9.62  ? 137  LYS C CE  1 
ATOM   6062  N  NZ  . LYS C 1 94  ? -11.342 24.760  -3.590  1.00 8.09  ? 137  LYS C NZ  1 
ATOM   6063  N  N   . PRO C 1 95  ? -7.012  25.393  1.134   1.00 19.54 ? 138  PRO C N   1 
ATOM   6064  C  CA  . PRO C 1 95  ? -6.170  26.458  1.680   1.00 20.17 ? 138  PRO C CA  1 
ATOM   6065  C  C   . PRO C 1 95  ? -6.293  27.749  0.857   1.00 21.10 ? 138  PRO C C   1 
ATOM   6066  O  O   . PRO C 1 95  ? -6.241  27.713  -0.374  1.00 22.85 ? 138  PRO C O   1 
ATOM   6067  C  CB  . PRO C 1 95  ? -4.773  25.856  1.600   1.00 19.44 ? 138  PRO C CB  1 
ATOM   6068  C  CG  . PRO C 1 95  ? -5.025  24.386  1.733   1.00 18.74 ? 138  PRO C CG  1 
ATOM   6069  C  CD  . PRO C 1 95  ? -6.215  24.184  0.852   1.00 19.50 ? 138  PRO C CD  1 
ATOM   6070  N  N   . GLY C 1 96  ? -6.461  28.882  1.537   1.00 20.81 ? 139  GLY C N   1 
ATOM   6071  C  CA  . GLY C 1 96  ? -6.581  30.155  0.852   1.00 19.17 ? 139  GLY C CA  1 
ATOM   6072  C  C   . GLY C 1 96  ? -7.914  30.336  0.166   1.00 19.15 ? 139  GLY C C   1 
ATOM   6073  O  O   . GLY C 1 96  ? -8.094  31.249  -0.635  1.00 17.03 ? 139  GLY C O   1 
ATOM   6074  N  N   . ASP C 1 97  ? -8.856  29.451  0.457   1.00 21.20 ? 140  ASP C N   1 
ATOM   6075  C  CA  . ASP C 1 97  ? -10.171 29.569  -0.155  1.00 23.57 ? 140  ASP C CA  1 
ATOM   6076  C  C   . ASP C 1 97  ? -10.859 30.699  0.572   1.00 24.12 ? 140  ASP C C   1 
ATOM   6077  O  O   . ASP C 1 97  ? -10.365 31.194  1.583   1.00 24.48 ? 140  ASP C O   1 
ATOM   6078  C  CB  . ASP C 1 97  ? -10.988 28.284  0.011   1.00 24.67 ? 140  ASP C CB  1 
ATOM   6079  C  CG  . ASP C 1 97  ? -10.579 27.194  -0.966  1.00 27.46 ? 140  ASP C CG  1 
ATOM   6080  O  OD1 . ASP C 1 97  ? -9.377  27.151  -1.327  1.00 26.40 ? 140  ASP C OD1 1 
ATOM   6081  O  OD2 . ASP C 1 97  ? -11.456 26.375  -1.357  1.00 26.71 ? 140  ASP C OD2 1 
ATOM   6082  N  N   . THR C 1 98  ? -12.010 31.102  0.062   1.00 23.82 ? 141  THR C N   1 
ATOM   6083  C  CA  . THR C 1 98  ? -12.759 32.175  0.685   1.00 21.16 ? 141  THR C CA  1 
ATOM   6084  C  C   . THR C 1 98  ? -14.082 31.647  1.235   1.00 22.59 ? 141  THR C C   1 
ATOM   6085  O  O   . THR C 1 98  ? -14.744 30.805  0.618   1.00 20.84 ? 141  THR C O   1 
ATOM   6086  C  CB  . THR C 1 98  ? -13.032 33.289  -0.322  1.00 20.38 ? 141  THR C CB  1 
ATOM   6087  O  OG1 . THR C 1 98  ? -11.807 33.625  -0.981  1.00 18.07 ? 141  THR C OG1 1 
ATOM   6088  C  CG2 . THR C 1 98  ? -13.593 34.514  0.375   1.00 18.71 ? 141  THR C CG2 1 
ATOM   6089  N  N   . ILE C 1 99  ? -14.436 32.150  2.407   1.00 21.61 ? 142  ILE C N   1 
ATOM   6090  C  CA  . ILE C 1 99  ? -15.650 31.774  3.086   1.00 19.64 ? 142  ILE C CA  1 
ATOM   6091  C  C   . ILE C 1 99  ? -16.656 32.842  2.694   1.00 22.59 ? 142  ILE C C   1 
ATOM   6092  O  O   . ILE C 1 99  ? -16.330 33.707  1.878   1.00 24.06 ? 142  ILE C O   1 
ATOM   6093  C  CB  . ILE C 1 99  ? -15.398 31.721  4.612   1.00 17.01 ? 142  ILE C CB  1 
ATOM   6094  C  CG1 . ILE C 1 99  ? -14.359 30.633  4.906   1.00 14.27 ? 142  ILE C CG1 1 
ATOM   6095  C  CG2 . ILE C 1 99  ? -16.692 31.498  5.345   1.00 17.07 ? 142  ILE C CG2 1 
ATOM   6096  C  CD1 . ILE C 1 99  ? -14.331 30.159  6.311   1.00 10.96 ? 142  ILE C CD1 1 
ATOM   6097  N  N   . ILE C 1 100 ? -17.874 32.778  3.235   1.00 23.49 ? 143  ILE C N   1 
ATOM   6098  C  CA  . ILE C 1 100 ? -18.920 33.753  2.916   1.00 23.80 ? 143  ILE C CA  1 
ATOM   6099  C  C   . ILE C 1 100 ? -19.980 33.760  3.991   1.00 27.25 ? 143  ILE C C   1 
ATOM   6100  O  O   . ILE C 1 100 ? -20.692 32.771  4.109   1.00 28.65 ? 143  ILE C O   1 
ATOM   6101  C  CB  . ILE C 1 100 ? -19.684 33.388  1.616   1.00 21.29 ? 143  ILE C CB  1 
ATOM   6102  C  CG1 . ILE C 1 100 ? -18.944 33.870  0.370   1.00 20.97 ? 143  ILE C CG1 1 
ATOM   6103  C  CG2 . ILE C 1 100 ? -21.068 34.045  1.606   1.00 20.20 ? 143  ILE C CG2 1 
ATOM   6104  C  CD1 . ILE C 1 100 ? -19.695 33.594  -0.900  1.00 20.33 ? 143  ILE C CD1 1 
ATOM   6105  N  N   . GLU C 1 101 ? -20.117 34.825  4.775   1.00 28.23 ? 144  GLU C N   1 
ATOM   6106  C  CA  . GLU C 1 101 ? -21.204 34.782  5.734   1.00 29.60 ? 144  GLU C CA  1 
ATOM   6107  C  C   . GLU C 1 101 ? -22.250 35.890  5.549   1.00 31.31 ? 144  GLU C C   1 
ATOM   6108  O  O   . GLU C 1 101 ? -21.935 37.089  5.535   1.00 32.55 ? 144  GLU C O   1 
ATOM   6109  C  CB  . GLU C 1 101 ? -20.691 34.733  7.172   1.00 28.12 ? 144  GLU C CB  1 
ATOM   6110  C  CG  . GLU C 1 101 ? -21.764 34.269  8.132   1.00 31.09 ? 144  GLU C CG  1 
ATOM   6111  C  CD  . GLU C 1 101 ? -22.496 33.041  7.617   1.00 32.45 ? 144  GLU C CD  1 
ATOM   6112  O  OE1 . GLU C 1 101 ? -23.712 32.914  7.868   1.00 32.43 ? 144  GLU C OE1 1 
ATOM   6113  O  OE2 . GLU C 1 101 ? -21.854 32.198  6.960   1.00 33.78 ? 144  GLU C OE2 1 
ATOM   6114  N  N   . PRO C 1 102 ? -23.518 35.484  5.309   1.00 31.58 ? 145  PRO C N   1 
ATOM   6115  C  CA  . PRO C 1 102 ? -24.674 36.378  5.117   1.00 31.00 ? 145  PRO C CA  1 
ATOM   6116  C  C   . PRO C 1 102 ? -25.111 36.951  6.453   1.00 33.27 ? 145  PRO C C   1 
ATOM   6117  O  O   . PRO C 1 102 ? -26.075 37.709  6.554   1.00 32.54 ? 145  PRO C O   1 
ATOM   6118  C  CB  . PRO C 1 102 ? -25.770 35.446  4.649   1.00 30.70 ? 145  PRO C CB  1 
ATOM   6119  C  CG  . PRO C 1 102 ? -25.082 34.358  3.986   1.00 31.11 ? 145  PRO C CG  1 
ATOM   6120  C  CD  . PRO C 1 102 ? -23.695 34.246  4.530   1.00 29.23 ? 145  PRO C CD  1 
ATOM   6121  N  N   . THR C 1 103 ? -24.401 36.582  7.498   1.00 34.68 ? 146  THR C N   1 
ATOM   6122  C  CA  . THR C 1 103 ? -24.803 36.968  8.842   1.00 34.92 ? 146  THR C CA  1 
ATOM   6123  C  C   . THR C 1 103 ? -23.804 37.757  9.660   1.00 34.60 ? 146  THR C C   1 
ATOM   6124  O  O   . THR C 1 103 ? -22.818 37.211  10.138  1.00 34.64 ? 146  THR C O   1 
ATOM   6125  C  CB  . THR C 1 103 ? -25.183 35.694  9.565   1.00 35.59 ? 146  THR C CB  1 
ATOM   6126  O  OG1 . THR C 1 103 ? -26.357 35.179  8.933   1.00 37.90 ? 146  THR C OG1 1 
ATOM   6127  C  CG2 . THR C 1 103 ? -25.401 35.931  11.026  1.00 36.73 ? 146  THR C CG2 1 
ATOM   6128  N  N   . SER C 1 104 ? -24.057 39.052  9.813   1.00 34.29 ? 147  SER C N   1 
ATOM   6129  C  CA  . SER C 1 104 ? -23.175 39.915  10.602  1.00 33.63 ? 147  SER C CA  1 
ATOM   6130  C  C   . SER C 1 104 ? -23.541 39.768  12.079  1.00 32.92 ? 147  SER C C   1 
ATOM   6131  O  O   . SER C 1 104 ? -23.900 40.743  12.742  1.00 32.53 ? 147  SER C O   1 
ATOM   6132  C  CB  . SER C 1 104 ? -23.338 41.375  10.181  1.00 34.26 ? 147  SER C CB  1 
ATOM   6133  O  OG  . SER C 1 104 ? -24.687 41.794  10.317  1.00 35.89 ? 147  SER C OG  1 
ATOM   6134  N  N   . GLY C 1 105 ? -23.477 38.533  12.575  1.00 31.82 ? 148  GLY C N   1 
ATOM   6135  C  CA  . GLY C 1 105 ? -23.774 38.254  13.969  1.00 28.77 ? 148  GLY C CA  1 
ATOM   6136  C  C   . GLY C 1 105 ? -22.517 37.708  14.626  1.00 27.44 ? 148  GLY C C   1 
ATOM   6137  O  O   . GLY C 1 105 ? -21.406 37.911  14.127  1.00 26.39 ? 148  GLY C O   1 
ATOM   6138  N  N   . ASN C 1 106 ? -22.673 37.016  15.746  1.00 25.92 ? 149  ASN C N   1 
ATOM   6139  C  CA  . ASN C 1 106 ? -21.516 36.460  16.417  1.00 23.84 ? 149  ASN C CA  1 
ATOM   6140  C  C   . ASN C 1 106 ? -20.875 35.421  15.501  1.00 24.47 ? 149  ASN C C   1 
ATOM   6141  O  O   . ASN C 1 106 ? -19.666 35.165  15.570  1.00 25.34 ? 149  ASN C O   1 
ATOM   6142  C  CB  . ASN C 1 106 ? -21.931 35.842  17.752  1.00 21.36 ? 149  ASN C CB  1 
ATOM   6143  C  CG  . ASN C 1 106 ? -22.254 36.893  18.794  1.00 20.62 ? 149  ASN C CG  1 
ATOM   6144  O  OD1 . ASN C 1 106 ? -21.548 37.879  18.914  1.00 22.17 ? 149  ASN C OD1 1 
ATOM   6145  N  ND2 . ASN C 1 106 ? -23.313 36.684  19.552  1.00 18.72 ? 149  ASN C ND2 1 
ATOM   6146  N  N   . THR C 1 107 ? -21.696 34.850  14.621  1.00 23.80 ? 150  THR C N   1 
ATOM   6147  C  CA  . THR C 1 107 ? -21.258 33.832  13.670  1.00 21.85 ? 150  THR C CA  1 
ATOM   6148  C  C   . THR C 1 107 ? -20.278 34.399  12.650  1.00 21.33 ? 150  THR C C   1 
ATOM   6149  O  O   . THR C 1 107 ? -19.367 33.705  12.204  1.00 20.02 ? 150  THR C O   1 
ATOM   6150  C  CB  . THR C 1 107 ? -22.455 33.244  12.917  1.00 21.69 ? 150  THR C CB  1 
ATOM   6151  O  OG1 . THR C 1 107 ? -23.673 33.722  13.499  1.00 21.14 ? 150  THR C OG1 1 
ATOM   6152  C  CG2 . THR C 1 107 ? -22.433 31.748  13.003  1.00 21.09 ? 150  THR C CG2 1 
ATOM   6153  N  N   . GLY C 1 108 ? -20.475 35.664  12.285  1.00 21.16 ? 151  GLY C N   1 
ATOM   6154  C  CA  . GLY C 1 108 ? -19.599 36.318  11.323  1.00 21.03 ? 151  GLY C CA  1 
ATOM   6155  C  C   . GLY C 1 108 ? -18.233 36.565  11.928  1.00 20.49 ? 151  GLY C C   1 
ATOM   6156  O  O   . GLY C 1 108 ? -17.193 36.344  11.295  1.00 21.12 ? 151  GLY C O   1 
ATOM   6157  N  N   . ILE C 1 109 ? -18.250 37.030  13.170  1.00 18.83 ? 152  ILE C N   1 
ATOM   6158  C  CA  . ILE C 1 109 ? -17.042 37.299  13.927  1.00 16.74 ? 152  ILE C CA  1 
ATOM   6159  C  C   . ILE C 1 109 ? -16.318 35.966  14.111  1.00 16.62 ? 152  ILE C C   1 
ATOM   6160  O  O   . ILE C 1 109 ? -15.096 35.882  13.975  1.00 14.73 ? 152  ILE C O   1 
ATOM   6161  C  CB  . ILE C 1 109 ? -17.422 37.875  15.296  1.00 17.22 ? 152  ILE C CB  1 
ATOM   6162  C  CG1 . ILE C 1 109 ? -18.357 39.071  15.087  1.00 16.71 ? 152  ILE C CG1 1 
ATOM   6163  C  CG2 . ILE C 1 109 ? -16.178 38.251  16.091  1.00 14.52 ? 152  ILE C CG2 1 
ATOM   6164  C  CD1 . ILE C 1 109 ? -18.978 39.600  16.358  1.00 16.82 ? 152  ILE C CD1 1 
ATOM   6165  N  N   . GLY C 1 110 ? -17.097 34.927  14.416  1.00 16.33 ? 153  GLY C N   1 
ATOM   6166  C  CA  . GLY C 1 110 ? -16.551 33.597  14.624  1.00 15.15 ? 153  GLY C CA  1 
ATOM   6167  C  C   . GLY C 1 110 ? -15.809 33.134  13.403  1.00 15.54 ? 153  GLY C C   1 
ATOM   6168  O  O   . GLY C 1 110 ? -14.667 32.694  13.475  1.00 17.13 ? 153  GLY C O   1 
ATOM   6169  N  N   . LEU C 1 111 ? -16.468 33.231  12.263  1.00 16.16 ? 154  LEU C N   1 
ATOM   6170  C  CA  . LEU C 1 111 ? -15.853 32.837  11.013  1.00 15.50 ? 154  LEU C CA  1 
ATOM   6171  C  C   . LEU C 1 111 ? -14.628 33.700  10.773  1.00 16.02 ? 154  LEU C C   1 
ATOM   6172  O  O   . LEU C 1 111 ? -13.541 33.177  10.537  1.00 16.60 ? 154  LEU C O   1 
ATOM   6173  C  CB  . LEU C 1 111 ? -16.841 33.017  9.862   1.00 15.49 ? 154  LEU C CB  1 
ATOM   6174  C  CG  . LEU C 1 111 ? -18.060 32.089  9.806   1.00 13.82 ? 154  LEU C CG  1 
ATOM   6175  C  CD1 . LEU C 1 111 ? -19.073 32.625  8.807   1.00 12.41 ? 154  LEU C CD1 1 
ATOM   6176  C  CD2 . LEU C 1 111 ? -17.660 30.670  9.450   1.00 11.11 ? 154  LEU C CD2 1 
ATOM   6177  N  N   . ALA C 1 112 ? -14.806 35.021  10.840  1.00 15.90 ? 155  ALA C N   1 
ATOM   6178  C  CA  . ALA C 1 112 ? -13.705 35.968  10.622  1.00 14.47 ? 155  ALA C CA  1 
ATOM   6179  C  C   . ALA C 1 112 ? -12.542 35.742  11.586  1.00 14.53 ? 155  ALA C C   1 
ATOM   6180  O  O   . ALA C 1 112 ? -11.380 35.943  11.235  1.00 15.45 ? 155  ALA C O   1 
ATOM   6181  C  CB  . ALA C 1 112 ? -14.209 37.396  10.739  1.00 12.27 ? 155  ALA C CB  1 
ATOM   6182  N  N   . LEU C 1 113 ? -12.854 35.307  12.782  1.00 14.10 ? 156  LEU C N   1 
ATOM   6183  C  CA  . LEU C 1 113 ? -11.804 35.076  13.750  1.00 12.40 ? 156  LEU C CA  1 
ATOM   6184  C  C   . LEU C 1 113 ? -10.930 33.962  13.227  1.00 11.89 ? 156  LEU C C   1 
ATOM   6185  O  O   . LEU C 1 113 ? -9.744  34.151  13.012  1.00 13.15 ? 156  LEU C O   1 
ATOM   6186  C  CB  . LEU C 1 113 ? -12.388 34.692  15.106  1.00 12.11 ? 156  LEU C CB  1 
ATOM   6187  C  CG  . LEU C 1 113 ? -11.431 34.581  16.268  1.00 12.31 ? 156  LEU C CG  1 
ATOM   6188  C  CD1 . LEU C 1 113 ? -10.207 33.761  15.885  1.00 11.75 ? 156  LEU C CD1 1 
ATOM   6189  C  CD2 . LEU C 1 113 ? -11.013 35.960  16.753  1.00 12.66 ? 156  LEU C CD2 1 
ATOM   6190  N  N   . ALA C 1 114 ? -11.536 32.792  13.027  1.00 11.54 ? 157  ALA C N   1 
ATOM   6191  C  CA  . ALA C 1 114 ? -10.815 31.603  12.540  1.00 11.31 ? 157  ALA C CA  1 
ATOM   6192  C  C   . ALA C 1 114 ? -10.224 31.827  11.159  1.00 11.30 ? 157  ALA C C   1 
ATOM   6193  O  O   . ALA C 1 114 ? -9.246  31.200  10.770  1.00 8.62  ? 157  ALA C O   1 
ATOM   6194  C  CB  . ALA C 1 114 ? -11.726 30.387  12.518  1.00 8.47  ? 157  ALA C CB  1 
ATOM   6195  N  N   . ALA C 1 115 ? -10.855 32.721  10.434  1.00 12.51 ? 158  ALA C N   1 
ATOM   6196  C  CA  . ALA C 1 115 ? -10.428 33.045  9.079   1.00 14.26 ? 158  ALA C CA  1 
ATOM   6197  C  C   . ALA C 1 115 ? -9.068  33.717  9.089   1.00 16.25 ? 158  ALA C C   1 
ATOM   6198  O  O   . ALA C 1 115 ? -8.202  33.398  8.288   1.00 17.70 ? 158  ALA C O   1 
ATOM   6199  C  CB  . ALA C 1 115 ? -11.434 33.958  8.436   1.00 13.39 ? 158  ALA C CB  1 
ATOM   6200  N  N   . ALA C 1 116 ? -8.895  34.658  10.010  1.00 17.45 ? 159  ALA C N   1 
ATOM   6201  C  CA  . ALA C 1 116 ? -7.651  35.404  10.164  1.00 16.69 ? 159  ALA C CA  1 
ATOM   6202  C  C   . ALA C 1 116 ? -6.485  34.478  10.480  1.00 16.69 ? 159  ALA C C   1 
ATOM   6203  O  O   . ALA C 1 116 ? -5.408  34.587  9.904   1.00 16.99 ? 159  ALA C O   1 
ATOM   6204  C  CB  . ALA C 1 116 ? -7.815  36.430  11.275  1.00 15.75 ? 159  ALA C CB  1 
ATOM   6205  N  N   . VAL C 1 117 ? -6.720  33.559  11.404  1.00 17.77 ? 160  VAL C N   1 
ATOM   6206  C  CA  . VAL C 1 117 ? -5.713  32.600  11.834  1.00 17.67 ? 160  VAL C CA  1 
ATOM   6207  C  C   . VAL C 1 117 ? -5.473  31.499  10.811  1.00 18.89 ? 160  VAL C C   1 
ATOM   6208  O  O   . VAL C 1 117 ? -4.370  31.343  10.327  1.00 19.71 ? 160  VAL C O   1 
ATOM   6209  C  CB  . VAL C 1 117 ? -6.133  31.915  13.139  1.00 16.82 ? 160  VAL C CB  1 
ATOM   6210  C  CG1 . VAL C 1 117 ? -5.023  30.991  13.598  1.00 17.64 ? 160  VAL C CG1 1 
ATOM   6211  C  CG2 . VAL C 1 117 ? -6.512  32.948  14.206  1.00 12.39 ? 160  VAL C CG2 1 
ATOM   6212  N  N   . ARG C 1 118 ? -6.518  30.741  10.494  1.00 21.18 ? 161  ARG C N   1 
ATOM   6213  C  CA  . ARG C 1 118 ? -6.420  29.640  9.546   1.00 23.53 ? 161  ARG C CA  1 
ATOM   6214  C  C   . ARG C 1 118 ? -5.969  30.117  8.174   1.00 23.70 ? 161  ARG C C   1 
ATOM   6215  O  O   . ARG C 1 118 ? -5.352  29.360  7.427   1.00 24.75 ? 161  ARG C O   1 
ATOM   6216  C  CB  . ARG C 1 118 ? -7.764  28.921  9.434   1.00 26.23 ? 161  ARG C CB  1 
ATOM   6217  C  CG  . ARG C 1 118 ? -8.146  28.085  10.665  1.00 28.15 ? 161  ARG C CG  1 
ATOM   6218  C  CD  . ARG C 1 118 ? -7.701  26.636  10.528  1.00 29.30 ? 161  ARG C CD  1 
ATOM   6219  N  NE  . ARG C 1 118 ? -7.623  25.979  11.827  1.00 31.29 ? 161  ARG C NE  1 
ATOM   6220  C  CZ  . ARG C 1 118 ? -6.719  26.271  12.762  1.00 33.38 ? 161  ARG C CZ  1 
ATOM   6221  N  NH1 . ARG C 1 118 ? -5.800  27.212  12.549  1.00 33.06 ? 161  ARG C NH1 1 
ATOM   6222  N  NH2 . ARG C 1 118 ? -6.741  25.628  13.920  1.00 33.63 ? 161  ARG C NH2 1 
ATOM   6223  N  N   . GLY C 1 119 ? -6.292  31.361  7.830   1.00 23.43 ? 162  GLY C N   1 
ATOM   6224  C  CA  . GLY C 1 119 ? -5.848  31.893  6.546   1.00 23.18 ? 162  GLY C CA  1 
ATOM   6225  C  C   . GLY C 1 119 ? -6.847  32.393  5.502   1.00 21.86 ? 162  GLY C C   1 
ATOM   6226  O  O   . GLY C 1 119 ? -6.652  33.448  4.896   1.00 21.50 ? 162  GLY C O   1 
ATOM   6227  N  N   . TYR C 1 120 ? -7.903  31.624  5.277   1.00 20.60 ? 163  TYR C N   1 
ATOM   6228  C  CA  . TYR C 1 120 ? -8.932  31.948  4.300   1.00 19.45 ? 163  TYR C CA  1 
ATOM   6229  C  C   . TYR C 1 120 ? -9.442  33.389  4.327   1.00 19.09 ? 163  TYR C C   1 
ATOM   6230  O  O   . TYR C 1 120 ? -9.538  34.009  5.386   1.00 19.76 ? 163  TYR C O   1 
ATOM   6231  C  CB  . TYR C 1 120 ? -10.120 31.032  4.528   1.00 18.85 ? 163  TYR C CB  1 
ATOM   6232  C  CG  . TYR C 1 120 ? -9.757  29.597  4.787   1.00 15.58 ? 163  TYR C CG  1 
ATOM   6233  C  CD1 . TYR C 1 120 ? -10.549 28.813  5.611   1.00 14.89 ? 163  TYR C CD1 1 
ATOM   6234  C  CD2 . TYR C 1 120 ? -8.659  29.011  4.188   1.00 15.40 ? 163  TYR C CD2 1 
ATOM   6235  C  CE1 . TYR C 1 120 ? -10.269 27.491  5.832   1.00 12.68 ? 163  TYR C CE1 1 
ATOM   6236  C  CE2 . TYR C 1 120 ? -8.367  27.670  4.410   1.00 16.67 ? 163  TYR C CE2 1 
ATOM   6237  C  CZ  . TYR C 1 120 ? -9.189  26.924  5.237   1.00 15.46 ? 163  TYR C CZ  1 
ATOM   6238  O  OH  . TYR C 1 120 ? -8.940  25.603  5.484   1.00 18.42 ? 163  TYR C OH  1 
ATOM   6239  N  N   . ARG C 1 121 ? -9.790  33.900  3.150   1.00 17.79 ? 164  ARG C N   1 
ATOM   6240  C  CA  . ARG C 1 121 ? -10.343 35.234  3.015   1.00 17.15 ? 164  ARG C CA  1 
ATOM   6241  C  C   . ARG C 1 121 ? -11.788 35.053  3.409   1.00 16.38 ? 164  ARG C C   1 
ATOM   6242  O  O   . ARG C 1 121 ? -12.344 33.981  3.184   1.00 16.85 ? 164  ARG C O   1 
ATOM   6243  C  CB  . ARG C 1 121 ? -10.248 35.689  1.567   1.00 18.65 ? 164  ARG C CB  1 
ATOM   6244  C  CG  . ARG C 1 121 ? -11.024 36.949  1.240   1.00 20.98 ? 164  ARG C CG  1 
ATOM   6245  C  CD  . ARG C 1 121 ? -10.985 37.207  -0.265  1.00 21.78 ? 164  ARG C CD  1 
ATOM   6246  N  NE  . ARG C 1 121 ? -11.629 38.459  -0.658  1.00 25.49 ? 164  ARG C NE  1 
ATOM   6247  C  CZ  . ARG C 1 121 ? -12.027 38.749  -1.898  1.00 26.83 ? 164  ARG C CZ  1 
ATOM   6248  N  NH1 . ARG C 1 121 ? -11.854 37.868  -2.879  1.00 27.90 ? 164  ARG C NH1 1 
ATOM   6249  N  NH2 . ARG C 1 121 ? -12.591 39.928  -2.162  1.00 27.59 ? 164  ARG C NH2 1 
ATOM   6250  N  N   . CYS C 1 122 ? -12.387 36.087  3.994   1.00 16.32 ? 165  CYS C N   1 
ATOM   6251  C  CA  . CYS C 1 122 ? -13.775 36.019  4.443   1.00 15.09 ? 165  CYS C CA  1 
ATOM   6252  C  C   . CYS C 1 122 ? -14.575 37.288  4.152   1.00 14.83 ? 165  CYS C C   1 
ATOM   6253  O  O   . CYS C 1 122 ? -14.097 38.401  4.358   1.00 15.62 ? 165  CYS C O   1 
ATOM   6254  C  CB  . CYS C 1 122 ? -13.808 35.710  5.933   1.00 13.47 ? 165  CYS C CB  1 
ATOM   6255  S  SG  . CYS C 1 122 ? -15.232 36.368  6.779   1.00 16.64 ? 165  CYS C SG  1 
ATOM   6256  N  N   . ILE C 1 123 ? -15.804 37.095  3.681   1.00 13.33 ? 166  ILE C N   1 
ATOM   6257  C  CA  . ILE C 1 123 ? -16.697 38.182  3.326   1.00 13.70 ? 166  ILE C CA  1 
ATOM   6258  C  C   . ILE C 1 123 ? -17.871 38.251  4.297   1.00 15.69 ? 166  ILE C C   1 
ATOM   6259  O  O   . ILE C 1 123 ? -18.005 37.398  5.161   1.00 15.08 ? 166  ILE C O   1 
ATOM   6260  C  CB  . ILE C 1 123 ? -17.206 37.978  1.888   1.00 13.10 ? 166  ILE C CB  1 
ATOM   6261  C  CG1 . ILE C 1 123 ? -16.002 37.857  0.950   1.00 13.17 ? 166  ILE C CG1 1 
ATOM   6262  C  CG2 . ILE C 1 123 ? -18.076 39.140  1.454   1.00 12.62 ? 166  ILE C CG2 1 
ATOM   6263  C  CD1 . ILE C 1 123 ? -16.317 38.064  -0.511  1.00 11.21 ? 166  ILE C CD1 1 
ATOM   6264  N  N   . ILE C 1 124 ? -18.718 39.264  4.169   1.00 17.72 ? 167  ILE C N   1 
ATOM   6265  C  CA  . ILE C 1 124 ? -19.857 39.394  5.059   1.00 22.18 ? 167  ILE C CA  1 
ATOM   6266  C  C   . ILE C 1 124 ? -20.973 40.185  4.400   1.00 25.26 ? 167  ILE C C   1 
ATOM   6267  O  O   . ILE C 1 124 ? -20.739 41.249  3.845   1.00 25.79 ? 167  ILE C O   1 
ATOM   6268  C  CB  . ILE C 1 124 ? -19.473 40.125  6.361   1.00 22.56 ? 167  ILE C CB  1 
ATOM   6269  C  CG1 . ILE C 1 124 ? -18.403 39.341  7.110   1.00 23.48 ? 167  ILE C CG1 1 
ATOM   6270  C  CG2 . ILE C 1 124 ? -20.697 40.276  7.254   1.00 20.52 ? 167  ILE C CG2 1 
ATOM   6271  C  CD1 . ILE C 1 124 ? -17.808 40.089  8.274   1.00 25.25 ? 167  ILE C CD1 1 
ATOM   6272  N  N   . VAL C 1 125 ? -22.191 39.668  4.468   1.00 29.06 ? 168  VAL C N   1 
ATOM   6273  C  CA  . VAL C 1 125 ? -23.329 40.360  3.886   1.00 33.65 ? 168  VAL C CA  1 
ATOM   6274  C  C   . VAL C 1 125 ? -24.009 41.139  5.004   1.00 35.91 ? 168  VAL C C   1 
ATOM   6275  O  O   . VAL C 1 125 ? -24.590 40.555  5.913   1.00 36.39 ? 168  VAL C O   1 
ATOM   6276  C  CB  . VAL C 1 125 ? -24.311 39.352  3.218   1.00 33.84 ? 168  VAL C CB  1 
ATOM   6277  C  CG1 . VAL C 1 125 ? -25.653 40.019  2.915   1.00 33.92 ? 168  VAL C CG1 1 
ATOM   6278  C  CG2 . VAL C 1 125 ? -23.685 38.832  1.918   1.00 35.07 ? 168  VAL C CG2 1 
ATOM   6279  N  N   . MET C 1 126 ? -23.921 42.464  4.922   1.00 39.04 ? 169  MET C N   1 
ATOM   6280  C  CA  . MET C 1 126 ? -24.488 43.364  5.926   1.00 42.84 ? 169  MET C CA  1 
ATOM   6281  C  C   . MET C 1 126 ? -25.622 44.256  5.396   1.00 44.62 ? 169  MET C C   1 
ATOM   6282  O  O   . MET C 1 126 ? -25.458 44.959  4.397   1.00 45.43 ? 169  MET C O   1 
ATOM   6283  C  CB  . MET C 1 126 ? -23.359 44.245  6.481   1.00 43.66 ? 169  MET C CB  1 
ATOM   6284  C  CG  . MET C 1 126 ? -23.761 45.309  7.501   1.00 44.64 ? 169  MET C CG  1 
ATOM   6285  S  SD  . MET C 1 126 ? -22.428 46.558  7.667   1.00 43.25 ? 169  MET C SD  1 
ATOM   6286  C  CE  . MET C 1 126 ? -23.403 48.102  7.825   1.00 42.56 ? 169  MET C CE  1 
ATOM   6287  N  N   . PRO C 1 127 ? -26.794 44.228  6.058   1.00 46.57 ? 170  PRO C N   1 
ATOM   6288  C  CA  . PRO C 1 127 ? -27.913 45.063  5.612   1.00 47.18 ? 170  PRO C CA  1 
ATOM   6289  C  C   . PRO C 1 127 ? -27.430 46.501  5.703   1.00 48.64 ? 170  PRO C C   1 
ATOM   6290  O  O   . PRO C 1 127 ? -26.442 46.775  6.390   1.00 49.28 ? 170  PRO C O   1 
ATOM   6291  C  CB  . PRO C 1 127 ? -28.997 44.777  6.647   1.00 46.82 ? 170  PRO C CB  1 
ATOM   6292  C  CG  . PRO C 1 127 ? -28.684 43.397  7.107   1.00 45.89 ? 170  PRO C CG  1 
ATOM   6293  C  CD  . PRO C 1 127 ? -27.184 43.394  7.209   1.00 46.44 ? 170  PRO C CD  1 
ATOM   6294  N  N   . GLU C 1 128 ? -28.109 47.421  5.026   1.00 49.95 ? 171  GLU C N   1 
ATOM   6295  C  CA  . GLU C 1 128 ? -27.695 48.823  5.078   1.00 50.23 ? 171  GLU C CA  1 
ATOM   6296  C  C   . GLU C 1 128 ? -27.679 49.326  6.526   1.00 50.11 ? 171  GLU C C   1 
ATOM   6297  O  O   . GLU C 1 128 ? -26.879 50.192  6.884   1.00 48.94 ? 171  GLU C O   1 
ATOM   6298  C  CB  . GLU C 1 128 ? -28.623 49.692  4.215   1.00 50.04 ? 171  GLU C CB  1 
ATOM   6299  C  CG  . GLU C 1 128 ? -28.415 49.514  2.713   1.00 50.03 ? 171  GLU C CG  1 
ATOM   6300  C  CD  . GLU C 1 128 ? -29.264 50.459  1.875   1.00 50.26 ? 171  GLU C CD  1 
ATOM   6301  O  OE1 . GLU C 1 128 ? -29.063 50.495  0.644   1.00 50.21 ? 171  GLU C OE1 1 
ATOM   6302  O  OE2 . GLU C 1 128 ? -30.132 51.162  2.438   1.00 50.38 ? 171  GLU C OE2 1 
ATOM   6303  N  N   . LYS C 1 129 ? -28.558 48.792  7.353   1.00 50.35 ? 172  LYS C N   1 
ATOM   6304  C  CA  . LYS C 1 129 ? -28.630 49.178  8.738   1.00 50.27 ? 172  LYS C CA  1 
ATOM   6305  C  C   . LYS C 1 129 ? -27.512 48.609  9.534   1.00 51.34 ? 172  LYS C C   1 
ATOM   6306  O  O   . LYS C 1 129 ? -26.799 47.736  9.038   1.00 52.10 ? 172  LYS C O   1 
ATOM   6307  C  CB  . LYS C 1 129 ? -29.918 48.533  9.324   1.00 48.92 ? 172  LYS C CB  1 
ATOM   6308  C  CG  . LYS C 1 129 ? -30.092 47.053  8.969   1.00 46.52 ? 172  LYS C CG  1 
ATOM   6309  C  CD  . LYS C 1 129 ? -31.311 46.450  9.618   1.00 44.64 ? 172  LYS C CD  1 
ATOM   6310  C  CE  . LYS C 1 129 ? -32.580 47.199  9.199   1.00 44.27 ? 172  LYS C CE  1 
ATOM   6311  N  NZ  . LYS C 1 129 ? -32.819 47.099  7.733   1.00 42.22 ? 172  LYS C NZ  1 
ATOM   6312  N  N   . MET C 1 130 ? -27.297 49.055  10.797  1.00 51.81 ? 173  MET C N   1 
ATOM   6313  C  CA  . MET C 1 130 ? -26.536 47.586  11.582  1.00 52.24 ? 173  MET C CA  1 
ATOM   6314  C  C   . MET C 1 130 ? -25.574 48.578  12.243  1.00 51.42 ? 173  MET C C   1 
ATOM   6315  O  O   . MET C 1 130 ? -25.249 49.628  11.682  1.00 51.90 ? 173  MET C O   1 
ATOM   6316  C  CB  . MET C 1 130 ? -25.723 46.562  10.786  1.00 52.51 ? 173  MET C CB  1 
ATOM   6317  C  CG  . MET C 1 130 ? -26.500 45.306  10.437  1.00 51.96 ? 173  MET C CG  1 
ATOM   6318  S  SD  . MET C 1 130 ? -27.053 44.431  11.910  1.00 50.33 ? 173  MET C SD  1 
ATOM   6319  C  CE  . MET C 1 130 ? -25.488 43.655  12.428  1.00 49.94 ? 173  MET C CE  1 
ATOM   6320  N  N   . SER C 1 131 ? -25.098 48.204  13.431  1.00 49.74 ? 174  SER C N   1 
ATOM   6321  C  CA  . SER C 1 131 ? -24.187 49.035  14.222  1.00 47.90 ? 174  SER C CA  1 
ATOM   6322  C  C   . SER C 1 131 ? -22.702 48.846  13.929  1.00 46.85 ? 174  SER C C   1 
ATOM   6323  O  O   . SER C 1 131 ? -22.190 47.720  13.942  1.00 45.80 ? 174  SER C O   1 
ATOM   6324  C  CB  . SER C 1 131 ? -24.408 48.773  15.710  1.00 47.14 ? 174  SER C CB  1 
ATOM   6325  O  OG  . SER C 1 131 ? -23.901 47.500  16.064  1.00 45.87 ? 174  SER C OG  1 
ATOM   6326  N  N   . SER C 1 132 ? -22.007 49.958  13.695  1.00 45.63 ? 175  SER C N   1 
ATOM   6327  C  CA  . SER C 1 132 ? -20.574 49.905  13.431  1.00 42.78 ? 175  SER C CA  1 
ATOM   6328  C  C   . SER C 1 132 ? -19.920 49.282  14.660  1.00 40.29 ? 175  SER C C   1 
ATOM   6329  O  O   . SER C 1 132 ? -18.711 49.056  14.703  1.00 39.12 ? 175  SER C O   1 
ATOM   6330  C  CB  . SER C 1 132 ? -20.015 51.312  13.174  1.00 43.77 ? 175  SER C CB  1 
ATOM   6331  O  OG  . SER C 1 132 ? -20.392 51.806  11.895  1.00 43.32 ? 175  SER C OG  1 
ATOM   6332  N  N   . GLU C 1 133 ? -20.751 49.006  15.658  1.00 37.88 ? 176  GLU C N   1 
ATOM   6333  C  CA  . GLU C 1 133 ? -20.303 48.384  16.887  1.00 34.92 ? 176  GLU C CA  1 
ATOM   6334  C  C   . GLU C 1 133 ? -19.639 47.054  16.574  1.00 32.74 ? 176  GLU C C   1 
ATOM   6335  O  O   . GLU C 1 133 ? -18.612 46.726  17.165  1.00 32.45 ? 176  GLU C O   1 
ATOM   6336  C  CB  . GLU C 1 133 ? -21.498 48.162  17.812  1.00 34.97 ? 176  GLU C CB  1 
ATOM   6337  C  CG  . GLU C 1 133 ? -21.275 47.130  18.912  1.00 36.66 ? 176  GLU C CG  1 
ATOM   6338  C  CD  . GLU C 1 133 ? -20.246 47.560  19.937  1.00 38.26 ? 176  GLU C CD  1 
ATOM   6339  O  OE1 . GLU C 1 133 ? -20.486 48.583  20.617  1.00 39.56 ? 176  GLU C OE1 1 
ATOM   6340  O  OE2 . GLU C 1 133 ? -19.204 46.876  20.061  1.00 37.96 ? 176  GLU C OE2 1 
ATOM   6341  N  N   . LYS C 1 134 ? -20.226 46.304  15.638  1.00 30.76 ? 177  LYS C N   1 
ATOM   6342  C  CA  . LYS C 1 134 ? -19.725 44.974  15.234  1.00 27.59 ? 177  LYS C CA  1 
ATOM   6343  C  C   . LYS C 1 134 ? -19.030 44.978  13.877  1.00 25.10 ? 177  LYS C C   1 
ATOM   6344  O  O   . LYS C 1 134 ? -18.269 44.073  13.562  1.00 22.63 ? 177  LYS C O   1 
ATOM   6345  C  CB  . LYS C 1 134 ? -20.873 43.956  15.196  1.00 26.08 ? 177  LYS C CB  1 
ATOM   6346  C  CG  . LYS C 1 134 ? -21.644 43.825  16.495  1.00 23.47 ? 177  LYS C CG  1 
ATOM   6347  C  CD  . LYS C 1 134 ? -23.114 44.170  16.310  1.00 22.27 ? 177  LYS C CD  1 
ATOM   6348  C  CE  . LYS C 1 134 ? -23.863 44.089  17.645  1.00 22.86 ? 177  LYS C CE  1 
ATOM   6349  N  NZ  . LYS C 1 134 ? -25.340 44.280  17.512  1.00 20.15 ? 177  LYS C NZ  1 
ATOM   6350  N  N   . VAL C 1 135 ? -19.321 45.981  13.060  1.00 25.18 ? 178  VAL C N   1 
ATOM   6351  C  CA  . VAL C 1 135 ? -18.677 46.093  11.756  1.00 24.17 ? 178  VAL C CA  1 
ATOM   6352  C  C   . VAL C 1 135 ? -17.223 46.415  12.069  1.00 25.40 ? 178  VAL C C   1 
ATOM   6353  O  O   . VAL C 1 135 ? -16.311 45.862  11.464  1.00 26.60 ? 178  VAL C O   1 
ATOM   6354  C  CB  . VAL C 1 135 ? -19.277 47.245  10.908  1.00 21.20 ? 178  VAL C CB  1 
ATOM   6355  C  CG1 . VAL C 1 135 ? -18.708 47.220  9.518   1.00 18.07 ? 178  VAL C CG1 1 
ATOM   6356  C  CG2 . VAL C 1 135 ? -20.780 47.122  10.870  1.00 21.24 ? 178  VAL C CG2 1 
ATOM   6357  N  N   . ASP C 1 136 ? -17.019 47.314  13.028  1.00 26.48 ? 179  ASP C N   1 
ATOM   6358  C  CA  . ASP C 1 136 ? -15.677 47.694  13.444  1.00 27.55 ? 179  ASP C CA  1 
ATOM   6359  C  C   . ASP C 1 136 ? -14.931 46.457  13.945  1.00 28.29 ? 179  ASP C C   1 
ATOM   6360  O  O   . ASP C 1 136 ? -13.753 46.278  13.649  1.00 28.00 ? 179  ASP C O   1 
ATOM   6361  C  CB  . ASP C 1 136 ? -15.730 48.753  14.557  1.00 26.85 ? 179  ASP C CB  1 
ATOM   6362  C  CG  . ASP C 1 136 ? -15.785 50.186  14.020  1.00 26.68 ? 179  ASP C CG  1 
ATOM   6363  O  OD1 . ASP C 1 136 ? -14.877 50.578  13.259  1.00 26.17 ? 179  ASP C OD1 1 
ATOM   6364  O  OD2 . ASP C 1 136 ? -16.724 50.926  14.373  1.00 24.63 ? 179  ASP C OD2 1 
ATOM   6365  N  N   . VAL C 1 137 ? -15.614 45.595  14.691  1.00 29.09 ? 180  VAL C N   1 
ATOM   6366  C  CA  . VAL C 1 137 ? -14.964 44.400  15.206  1.00 30.80 ? 180  VAL C CA  1 
ATOM   6367  C  C   . VAL C 1 137 ? -14.610 43.474  14.053  1.00 32.31 ? 180  VAL C C   1 
ATOM   6368  O  O   . VAL C 1 137 ? -13.585 42.786  14.080  1.00 33.58 ? 180  VAL C O   1 
ATOM   6369  C  CB  . VAL C 1 137 ? -15.868 43.631  16.177  1.00 30.92 ? 180  VAL C CB  1 
ATOM   6370  C  CG1 . VAL C 1 137 ? -15.027 42.679  17.016  1.00 30.52 ? 180  VAL C CG1 1 
ATOM   6371  C  CG2 . VAL C 1 137 ? -16.633 44.598  17.055  1.00 30.88 ? 180  VAL C CG2 1 
ATOM   6372  N  N   . LEU C 1 138 ? -15.468 43.464  13.039  1.00 33.06 ? 181  LEU C N   1 
ATOM   6373  C  CA  . LEU C 1 138 ? -15.264 42.628  11.861  1.00 32.94 ? 181  LEU C CA  1 
ATOM   6374  C  C   . LEU C 1 138 ? -14.105 43.118  11.002  1.00 33.00 ? 181  LEU C C   1 
ATOM   6375  O  O   . LEU C 1 138 ? -13.147 42.376  10.765  1.00 33.38 ? 181  LEU C O   1 
ATOM   6376  C  CB  . LEU C 1 138 ? -16.544 42.579  11.028  1.00 31.68 ? 181  LEU C CB  1 
ATOM   6377  C  CG  . LEU C 1 138 ? -17.642 41.802  11.745  1.00 30.89 ? 181  LEU C CG  1 
ATOM   6378  C  CD1 . LEU C 1 138 ? -18.982 42.117  11.160  1.00 30.99 ? 181  LEU C CD1 1 
ATOM   6379  C  CD2 . LEU C 1 138 ? -17.329 40.332  11.651  1.00 30.88 ? 181  LEU C CD2 1 
ATOM   6380  N  N   . ARG C 1 139 ? -14.189 44.364  10.543  1.00 32.00 ? 182  ARG C N   1 
ATOM   6381  C  CA  . ARG C 1 139 ? -13.140 44.932  9.707   1.00 31.23 ? 182  ARG C CA  1 
ATOM   6382  C  C   . ARG C 1 139 ? -11.783 44.719  10.362  1.00 31.35 ? 182  ARG C C   1 
ATOM   6383  O  O   . ARG C 1 139 ? -10.803 44.366  9.700   1.00 31.95 ? 182  ARG C O   1 
ATOM   6384  C  CB  . ARG C 1 139 ? -13.386 46.431  9.470   1.00 30.92 ? 182  ARG C CB  1 
ATOM   6385  C  CG  . ARG C 1 139 ? -14.591 46.746  8.580   1.00 30.39 ? 182  ARG C CG  1 
ATOM   6386  C  CD  . ARG C 1 139 ? -14.246 47.794  7.523   1.00 30.77 ? 182  ARG C CD  1 
ATOM   6387  N  NE  . ARG C 1 139 ? -15.229 47.871  6.439   1.00 30.99 ? 182  ARG C NE  1 
ATOM   6388  C  CZ  . ARG C 1 139 ? -16.495 48.254  6.589   1.00 31.33 ? 182  ARG C CZ  1 
ATOM   6389  N  NH1 . ARG C 1 139 ? -16.942 48.599  7.787   1.00 31.23 ? 182  ARG C NH1 1 
ATOM   6390  N  NH2 . ARG C 1 139 ? -17.315 48.301  5.541   1.00 30.24 ? 182  ARG C NH2 1 
ATOM   6391  N  N   . ALA C 1 140 ? -11.737 44.922  11.673  1.00 31.15 ? 183  ALA C N   1 
ATOM   6392  C  CA  . ALA C 1 140 ? -10.500 44.764  12.424  1.00 29.86 ? 183  ALA C CA  1 
ATOM   6393  C  C   . ALA C 1 140 ? -9.938  43.367  12.252  1.00 28.68 ? 183  ALA C C   1 
ATOM   6394  O  O   . ALA C 1 140 ? -8.722  43.180  12.264  1.00 28.49 ? 183  ALA C O   1 
ATOM   6395  C  CB  . ALA C 1 140 ? -10.747 45.043  13.895  1.00 30.33 ? 183  ALA C CB  1 
ATOM   6396  N  N   . LEU C 1 141 ? -10.834 42.392  12.100  1.00 27.71 ? 184  LEU C N   1 
ATOM   6397  C  CA  . LEU C 1 141 ? -10.451 40.991  11.934  1.00 25.78 ? 184  LEU C CA  1 
ATOM   6398  C  C   . LEU C 1 141 ? -9.997  40.647  10.513  1.00 25.74 ? 184  LEU C C   1 
ATOM   6399  O  O   . LEU C 1 141 ? -9.579  39.519  10.248  1.00 25.45 ? 184  LEU C O   1 
ATOM   6400  C  CB  . LEU C 1 141 ? -11.608 40.083  12.367  1.00 24.33 ? 184  LEU C CB  1 
ATOM   6401  C  CG  . LEU C 1 141 ? -11.420 39.393  13.721  1.00 23.17 ? 184  LEU C CG  1 
ATOM   6402  C  CD1 . LEU C 1 141 ? -12.742 39.011  14.305  1.00 22.06 ? 184  LEU C CD1 1 
ATOM   6403  C  CD2 . LEU C 1 141 ? -10.536 38.175  13.545  1.00 23.58 ? 184  LEU C CD2 1 
ATOM   6404  N  N   . GLY C 1 142 ? -10.075 41.622  9.609   1.00 24.81 ? 185  GLY C N   1 
ATOM   6405  C  CA  . GLY C 1 142 ? -9.642  41.411  8.237   1.00 25.06 ? 185  GLY C CA  1 
ATOM   6406  C  C   . GLY C 1 142 ? -10.707 41.009  7.229   1.00 25.43 ? 185  GLY C C   1 
ATOM   6407  O  O   . GLY C 1 142 ? -10.370 40.633  6.104   1.00 25.28 ? 185  GLY C O   1 
ATOM   6408  N  N   . ALA C 1 143 ? -11.979 41.114  7.619   1.00 25.06 ? 186  ALA C N   1 
ATOM   6409  C  CA  . ALA C 1 143 ? -13.110 40.730  6.768   1.00 25.53 ? 186  ALA C CA  1 
ATOM   6410  C  C   . ALA C 1 143 ? -13.597 41.732  5.721   1.00 26.31 ? 186  ALA C C   1 
ATOM   6411  O  O   . ALA C 1 143 ? -13.503 42.956  5.898   1.00 27.36 ? 186  ALA C O   1 
ATOM   6412  C  CB  . ALA C 1 143 ? -14.286 40.325  7.639   1.00 24.10 ? 186  ALA C CB  1 
ATOM   6413  N  N   . GLU C 1 144 ? -14.151 41.189  4.638   1.00 25.95 ? 187  GLU C N   1 
ATOM   6414  C  CA  . GLU C 1 144 ? -14.680 42.002  3.551   1.00 25.02 ? 187  GLU C CA  1 
ATOM   6415  C  C   . GLU C 1 144 ? -16.174 42.191  3.841   1.00 25.20 ? 187  GLU C C   1 
ATOM   6416  O  O   . GLU C 1 144 ? -16.848 41.267  4.303   1.00 24.80 ? 187  GLU C O   1 
ATOM   6417  C  CB  . GLU C 1 144 ? -14.446 41.298  2.203   1.00 23.53 ? 187  GLU C CB  1 
ATOM   6418  C  CG  . GLU C 1 144 ? -13.236 40.338  2.217   1.00 23.28 ? 187  GLU C CG  1 
ATOM   6419  C  CD  . GLU C 1 144 ? -12.227 40.571  1.092   1.00 23.06 ? 187  GLU C CD  1 
ATOM   6420  O  OE1 . GLU C 1 144 ? -11.096 40.029  1.173   1.00 22.39 ? 187  GLU C OE1 1 
ATOM   6421  O  OE2 . GLU C 1 144 ? -12.556 41.287  0.125   1.00 23.65 ? 187  GLU C OE2 1 
ATOM   6422  N  N   . ILE C 1 145 ? -16.672 43.401  3.604   1.00 25.96 ? 188  ILE C N   1 
ATOM   6423  C  CA  . ILE C 1 145 ? -18.071 43.726  3.855   1.00 26.62 ? 188  ILE C CA  1 
ATOM   6424  C  C   . ILE C 1 145 ? -18.815 44.123  2.575   1.00 27.45 ? 188  ILE C C   1 
ATOM   6425  O  O   . ILE C 1 145 ? -18.367 44.973  1.810   1.00 27.54 ? 188  ILE C O   1 
ATOM   6426  C  CB  . ILE C 1 145 ? -18.197 44.874  4.880   1.00 26.29 ? 188  ILE C CB  1 
ATOM   6427  C  CG1 . ILE C 1 145 ? -17.402 44.549  6.146   1.00 26.85 ? 188  ILE C CG1 1 
ATOM   6428  C  CG2 . ILE C 1 145 ? -19.652 45.067  5.267   1.00 26.11 ? 188  ILE C CG2 1 
ATOM   6429  C  CD1 . ILE C 1 145 ? -15.884 44.617  5.988   1.00 28.59 ? 188  ILE C CD1 1 
ATOM   6430  N  N   . VAL C 1 146 ? -19.957 43.484  2.356   1.00 29.45 ? 189  VAL C N   1 
ATOM   6431  C  CA  . VAL C 1 146 ? -20.795 43.696  1.193   1.00 32.10 ? 189  VAL C CA  1 
ATOM   6432  C  C   . VAL C 1 146 ? -22.174 44.092  1.735   1.00 34.73 ? 189  VAL C C   1 
ATOM   6433  O  O   . VAL C 1 146 ? -22.857 43.269  2.344   1.00 34.81 ? 189  VAL C O   1 
ATOM   6434  C  CB  . VAL C 1 146 ? -20.887 42.449  0.304   1.00 32.34 ? 189  VAL C CB  1 
ATOM   6435  C  CG1 . VAL C 1 146 ? -21.745 42.719  -0.925  1.00 30.91 ? 189  VAL C CG1 1 
ATOM   6436  C  CG2 . VAL C 1 146 ? -19.513 41.961  -0.112  1.00 30.54 ? 189  VAL C CG2 1 
ATOM   6437  N  N   . ARG C 1 147 ? -22.579 45.335  1.510   1.00 38.51 ? 190  ARG C N   1 
ATOM   6438  C  CA  . ARG C 1 147 ? -23.854 45.829  2.012   1.00 43.59 ? 190  ARG C CA  1 
ATOM   6439  C  C   . ARG C 1 147 ? -25.077 45.504  1.170   1.00 45.75 ? 190  ARG C C   1 
ATOM   6440  O  O   . ARG C 1 147 ? -25.119 45.727  -0.025  1.00 44.90 ? 190  ARG C O   1 
ATOM   6441  C  CB  . ARG C 1 147 ? -23.771 47.343  2.216   1.00 46.39 ? 190  ARG C CB  1 
ATOM   6442  C  CG  . ARG C 1 147 ? -22.805 47.773  3.315   1.00 49.69 ? 190  ARG C CG  1 
ATOM   6443  C  CD  . ARG C 1 147 ? -23.426 47.633  4.697   1.00 51.05 ? 190  ARG C CD  1 
ATOM   6444  N  NE  . ARG C 1 147 ? -24.402 48.685  4.970   1.00 54.71 ? 190  ARG C NE  1 
ATOM   6445  C  CZ  . ARG C 1 147 ? -24.103 49.980  5.040   1.00 57.06 ? 190  ARG C CZ  1 
ATOM   6446  N  NH1 . ARG C 1 147 ? -22.849 50.387  4.860   1.00 58.03 ? 190  ARG C NH1 1 
ATOM   6447  N  NH2 . ARG C 1 147 ? -25.057 50.874  5.283   1.00 58.03 ? 190  ARG C NH2 1 
ATOM   6448  N  N   . THR C 1 148 ? -26.104 44.983  1.899   1.00 48.13 ? 191  THR C N   1 
ATOM   6449  C  CA  . THR C 1 148 ? -27.384 44.532  1.245   1.00 49.91 ? 191  THR C CA  1 
ATOM   6450  C  C   . THR C 1 148 ? -28.309 45.707  0.885   1.00 51.38 ? 191  THR C C   1 
ATOM   6451  O  O   . THR C 1 148 ? -29.098 46.266  1.652   1.00 51.97 ? 191  THR C O   1 
ATOM   6452  C  CB  . THR C 1 148 ? -27.984 43.411  2.076   1.00 49.73 ? 191  THR C CB  1 
ATOM   6453  O  OG1 . THR C 1 148 ? -27.404 42.153  1.675   1.00 48.01 ? 191  THR C OG1 1 
ATOM   6454  C  CG2 . THR C 1 148 ? -29.505 43.384  1.913   1.00 49.29 ? 191  THR C CG2 1 
ATOM   6455  N  N   . PRO C 1 149 ? -28.084 45.966  -0.434  1.00 53.73 ? 192  PRO C N   1 
ATOM   6456  C  CA  . PRO C 1 149 ? -28.526 47.084  -1.429  1.00 54.26 ? 192  PRO C CA  1 
ATOM   6457  C  C   . PRO C 1 149 ? -29.868 47.781  -1.795  1.00 55.07 ? 192  PRO C C   1 
ATOM   6458  O  O   . PRO C 1 149 ? -29.910 48.995  -1.587  1.00 55.60 ? 192  PRO C O   1 
ATOM   6459  C  CB  . PRO C 1 149 ? -27.840 46.741  -2.735  1.00 54.24 ? 192  PRO C CB  1 
ATOM   6460  C  CG  . PRO C 1 149 ? -26.534 46.270  -2.243  1.00 54.83 ? 192  PRO C CG  1 
ATOM   6461  C  CD  . PRO C 1 149 ? -26.722 45.665  -0.895  1.00 54.54 ? 192  PRO C CD  1 
ATOM   6462  N  N   . THR C 1 150 ? -30.958 47.214  -2.310  1.00 55.87 ? 193  THR C N   1 
ATOM   6463  C  CA  . THR C 1 150 ? -31.961 48.222  -2.766  1.00 55.98 ? 193  THR C CA  1 
ATOM   6464  C  C   . THR C 1 150 ? -33.236 47.557  -3.276  1.00 55.15 ? 193  THR C C   1 
ATOM   6465  O  O   . THR C 1 150 ? -34.205 48.222  -3.631  1.00 54.66 ? 193  THR C O   1 
ATOM   6466  C  CB  . THR C 1 150 ? -31.352 49.149  -3.864  1.00 55.90 ? 193  THR C CB  1 
ATOM   6467  O  OG1 . THR C 1 150 ? -30.082 49.620  -3.426  1.00 55.37 ? 193  THR C OG1 1 
ATOM   6468  C  CG2 . THR C 1 150 ? -32.271 50.320  -4.146  1.00 54.43 ? 193  THR C CG2 1 
ATOM   6469  N  N   . GLU C 1 158 ? -29.720 43.087  -2.798  1.00 43.33 ? 201  GLU C N   1 
ATOM   6470  C  CA  . GLU C 1 158 ? -30.680 42.070  -2.380  1.00 44.13 ? 201  GLU C CA  1 
ATOM   6471  C  C   . GLU C 1 158 ? -30.544 41.816  -0.886  1.00 43.87 ? 201  GLU C C   1 
ATOM   6472  O  O   . GLU C 1 158 ? -29.661 42.374  -0.241  1.00 42.95 ? 201  GLU C O   1 
ATOM   6473  C  CB  . GLU C 1 158 ? -30.449 40.766  -3.152  1.00 43.29 ? 201  GLU C CB  1 
ATOM   6474  C  CG  . GLU C 1 158 ? -31.692 39.876  -3.268  1.00 43.45 ? 201  GLU C CG  1 
ATOM   6475  C  CD  . GLU C 1 158 ? -32.905 40.620  -3.844  1.00 42.48 ? 201  GLU C CD  1 
ATOM   6476  O  OE1 . GLU C 1 158 ? -32.752 41.300  -4.885  1.00 41.50 ? 201  GLU C OE1 1 
ATOM   6477  O  OE2 . GLU C 1 158 ? -34.010 40.520  -3.259  1.00 40.98 ? 201  GLU C OE2 1 
ATOM   6478  N  N   . SER C 1 159 ? -31.409 40.964  -0.346  1.00 44.15 ? 202  SER C N   1 
ATOM   6479  C  CA  . SER C 1 159 ? -31.386 40.670  1.081   1.00 45.32 ? 202  SER C CA  1 
ATOM   6480  C  C   . SER C 1 159 ? -30.063 40.118  1.606   1.00 46.12 ? 202  SER C C   1 
ATOM   6481  O  O   . SER C 1 159 ? -28.981 40.424  1.094   1.00 46.12 ? 202  SER C O   1 
ATOM   6482  C  CB  . SER C 1 159 ? -32.515 39.705  1.453   1.00 44.50 ? 202  SER C CB  1 
ATOM   6483  O  OG  . SER C 1 159 ? -32.673 39.634  2.862   1.00 42.36 ? 202  SER C OG  1 
ATOM   6484  N  N   . HIS C 1 160 ? -30.164 39.291  2.637   1.00 46.15 ? 203  HIS C N   1 
ATOM   6485  C  CA  . HIS C 1 160 ? -28.985 38.727  3.265   1.00 47.22 ? 203  HIS C CA  1 
ATOM   6486  C  C   . HIS C 1 160 ? -28.375 37.572  2.487   1.00 46.15 ? 203  HIS C C   1 
ATOM   6487  O  O   . HIS C 1 160 ? -27.155 37.388  2.508   1.00 46.67 ? 203  HIS C O   1 
ATOM   6488  C  CB  . HIS C 1 160 ? -29.330 38.295  4.697   1.00 47.65 ? 203  HIS C CB  1 
ATOM   6489  C  CG  . HIS C 1 160 ? -30.183 39.287  5.421   1.00 48.95 ? 203  HIS C CG  1 
ATOM   6490  N  ND1 . HIS C 1 160 ? -29.918 40.641  5.412   1.00 48.75 ? 203  HIS C ND1 1 
ATOM   6491  C  CD2 . HIS C 1 160 ? -31.325 39.133  6.134   1.00 49.36 ? 203  HIS C CD2 1 
ATOM   6492  C  CE1 . HIS C 1 160 ? -30.862 41.278  6.083   1.00 48.78 ? 203  HIS C CE1 1 
ATOM   6493  N  NE2 . HIS C 1 160 ? -31.728 40.386  6.532   1.00 48.54 ? 203  HIS C NE2 1 
ATOM   6494  N  N   . VAL C 1 161 ? -29.207 36.799  1.795   1.00 44.90 ? 204  VAL C N   1 
ATOM   6495  C  CA  . VAL C 1 161 ? -28.680 35.675  1.037   1.00 42.94 ? 204  VAL C CA  1 
ATOM   6496  C  C   . VAL C 1 161 ? -28.534 35.996  -0.439  1.00 42.54 ? 204  VAL C C   1 
ATOM   6497  O  O   . VAL C 1 161 ? -27.536 35.630  -1.058  1.00 42.47 ? 204  VAL C O   1 
ATOM   6498  C  CB  . VAL C 1 161 ? -29.553 34.437  1.184   1.00 41.57 ? 204  VAL C CB  1 
ATOM   6499  C  CG1 . VAL C 1 161 ? -28.816 33.238  0.649   1.00 39.95 ? 204  VAL C CG1 1 
ATOM   6500  C  CG2 . VAL C 1 161 ? -29.917 34.237  2.634   1.00 41.63 ? 204  VAL C CG2 1 
ATOM   6501  N  N   . GLY C 1 162 ? -29.524 36.679  -1.002  1.00 41.70 ? 205  GLY C N   1 
ATOM   6502  C  CA  . GLY C 1 162 ? -29.449 37.028  -2.404  1.00 41.66 ? 205  GLY C CA  1 
ATOM   6503  C  C   . GLY C 1 162 ? -28.015 37.324  -2.795  1.00 41.81 ? 205  GLY C C   1 
ATOM   6504  O  O   . GLY C 1 162 ? -27.475 36.718  -3.719  1.00 41.37 ? 205  GLY C O   1 
ATOM   6505  N  N   . VAL C 1 163 ? -27.389 38.232  -2.054  1.00 42.74 ? 206  VAL C N   1 
ATOM   6506  C  CA  . VAL C 1 163 ? -26.009 38.651  -2.315  1.00 43.49 ? 206  VAL C CA  1 
ATOM   6507  C  C   . VAL C 1 163 ? -24.964 37.533  -2.185  1.00 43.46 ? 206  VAL C C   1 
ATOM   6508  O  O   . VAL C 1 163 ? -24.021 37.454  -2.981  1.00 42.66 ? 206  VAL C O   1 
ATOM   6509  C  CB  . VAL C 1 163 ? -25.605 39.833  -1.381  1.00 43.47 ? 206  VAL C CB  1 
ATOM   6510  C  CG1 . VAL C 1 163 ? -24.281 40.428  -1.828  1.00 43.16 ? 206  VAL C CG1 1 
ATOM   6511  C  CG2 . VAL C 1 163 ? -26.695 40.904  -1.385  1.00 44.34 ? 206  VAL C CG2 1 
ATOM   6512  N  N   . ALA C 1 164 ? -25.124 36.671  -1.187  1.00 43.73 ? 207  ALA C N   1 
ATOM   6513  C  CA  . ALA C 1 164 ? -24.181 35.576  -0.995  1.00 44.62 ? 207  ALA C CA  1 
ATOM   6514  C  C   . ALA C 1 164 ? -24.381 34.479  -2.047  1.00 45.61 ? 207  ALA C C   1 
ATOM   6515  O  O   . ALA C 1 164 ? -23.433 34.106  -2.748  1.00 45.74 ? 207  ALA C O   1 
ATOM   6516  C  CB  . ALA C 1 164 ? -24.329 35.001  0.408   1.00 44.42 ? 207  ALA C CB  1 
ATOM   6517  N  N   . TRP C 1 165 ? -25.608 33.971  -2.163  1.00 45.92 ? 208  TRP C N   1 
ATOM   6518  C  CA  . TRP C 1 165 ? -25.904 32.923  -3.141  1.00 46.06 ? 208  TRP C CA  1 
ATOM   6519  C  C   . TRP C 1 165 ? -25.559 33.365  -4.551  1.00 44.72 ? 208  TRP C C   1 
ATOM   6520  O  O   . TRP C 1 165 ? -25.269 32.539  -5.411  1.00 44.73 ? 208  TRP C O   1 
ATOM   6521  C  CB  . TRP C 1 165 ? -27.379 32.512  -3.092  1.00 48.22 ? 208  TRP C CB  1 
ATOM   6522  C  CG  . TRP C 1 165 ? -27.680 31.405  -2.121  1.00 50.38 ? 208  TRP C CG  1 
ATOM   6523  C  CD1 . TRP C 1 165 ? -26.774 30.607  -1.475  1.00 50.33 ? 208  TRP C CD1 1 
ATOM   6524  C  CD2 . TRP C 1 165 ? -28.980 30.955  -1.703  1.00 52.27 ? 208  TRP C CD2 1 
ATOM   6525  N  NE1 . TRP C 1 165 ? -27.428 29.694  -0.683  1.00 51.43 ? 208  TRP C NE1 1 
ATOM   6526  C  CE2 . TRP C 1 165 ? -28.782 29.883  -0.803  1.00 52.42 ? 208  TRP C CE2 1 
ATOM   6527  C  CE3 . TRP C 1 165 ? -30.294 31.354  -2.001  1.00 53.30 ? 208  TRP C CE3 1 
ATOM   6528  C  CZ2 . TRP C 1 165 ? -29.852 29.202  -0.198  1.00 52.68 ? 208  TRP C CZ2 1 
ATOM   6529  C  CZ3 . TRP C 1 165 ? -31.357 30.673  -1.395  1.00 53.11 ? 208  TRP C CZ3 1 
ATOM   6530  C  CH2 . TRP C 1 165 ? -31.126 29.611  -0.506  1.00 52.25 ? 208  TRP C CH2 1 
ATOM   6531  N  N   . ARG C 1 166 ? -25.604 34.667  -4.801  1.00 44.27 ? 209  ARG C N   1 
ATOM   6532  C  CA  . ARG C 1 166 ? -25.254 35.156  -6.124  1.00 43.93 ? 209  ARG C CA  1 
ATOM   6533  C  C   . ARG C 1 166 ? -23.757 35.410  -6.184  1.00 41.73 ? 209  ARG C C   1 
ATOM   6534  O  O   . ARG C 1 166 ? -23.193 35.584  -7.269  1.00 41.89 ? 209  ARG C O   1 
ATOM   6535  C  CB  . ARG C 1 166 ? -26.023 36.438  -6.470  1.00 46.34 ? 209  ARG C CB  1 
ATOM   6536  C  CG  . ARG C 1 166 ? -27.490 36.199  -6.832  1.00 50.07 ? 209  ARG C CG  1 
ATOM   6537  C  CD  . ARG C 1 166 ? -28.036 37.296  -7.736  1.00 52.09 ? 209  ARG C CD  1 
ATOM   6538  N  NE  . ARG C 1 166 ? -28.183 38.570  -7.043  1.00 54.28 ? 209  ARG C NE  1 
ATOM   6539  C  CZ  . ARG C 1 166 ? -29.073 38.804  -6.083  1.00 55.81 ? 209  ARG C CZ  1 
ATOM   6540  N  NH1 . ARG C 1 166 ? -29.907 37.845  -5.691  1.00 56.41 ? 209  ARG C NH1 1 
ATOM   6541  N  NH2 . ARG C 1 166 ? -29.137 40.003  -5.520  1.00 56.65 ? 209  ARG C NH2 1 
ATOM   6542  N  N   . LEU C 1 167 ? -23.115 35.417  -5.016  1.00 37.74 ? 210  LEU C N   1 
ATOM   6543  C  CA  . LEU C 1 167 ? -21.680 35.648  -4.945  1.00 33.43 ? 210  LEU C CA  1 
ATOM   6544  C  C   . LEU C 1 167 ? -20.878 34.379  -5.066  1.00 31.33 ? 210  LEU C C   1 
ATOM   6545  O  O   . LEU C 1 167 ? -19.824 34.365  -5.694  1.00 31.82 ? 210  LEU C O   1 
ATOM   6546  C  CB  . LEU C 1 167 ? -21.298 36.332  -3.643  1.00 32.80 ? 210  LEU C CB  1 
ATOM   6547  C  CG  . LEU C 1 167 ? -21.223 37.852  -3.659  1.00 31.44 ? 210  LEU C CG  1 
ATOM   6548  C  CD1 . LEU C 1 167 ? -20.585 38.312  -2.353  1.00 30.95 ? 210  LEU C CD1 1 
ATOM   6549  C  CD2 . LEU C 1 167 ? -20.409 38.326  -4.847  1.00 30.87 ? 210  LEU C CD2 1 
ATOM   6550  N  N   . LYS C 1 168 ? -21.365 33.310  -4.457  1.00 28.15 ? 211  LYS C N   1 
ATOM   6551  C  CA  . LYS C 1 168 ? -20.657 32.034  -4.505  1.00 26.30 ? 211  LYS C CA  1 
ATOM   6552  C  C   . LYS C 1 168 ? -20.271 31.616  -5.927  1.00 24.86 ? 211  LYS C C   1 
ATOM   6553  O  O   . LYS C 1 168 ? -19.449 30.720  -6.132  1.00 22.72 ? 211  LYS C O   1 
ATOM   6554  C  CB  . LYS C 1 168 ? -21.528 30.959  -3.880  1.00 25.16 ? 211  LYS C CB  1 
ATOM   6555  C  CG  . LYS C 1 168 ? -20.898 29.590  -3.780  1.00 22.75 ? 211  LYS C CG  1 
ATOM   6556  C  CD  . LYS C 1 168 ? -21.957 28.552  -3.442  1.00 21.19 ? 211  LYS C CD  1 
ATOM   6557  C  CE  . LYS C 1 168 ? -22.874 29.017  -2.315  1.00 20.48 ? 211  LYS C CE  1 
ATOM   6558  N  NZ  . LYS C 1 168 ? -23.767 30.144  -2.719  1.00 19.20 ? 211  LYS C NZ  1 
ATOM   6559  N  N   . ASN C 1 169 ? -20.882 32.269  -6.908  1.00 25.29 ? 212  ASN C N   1 
ATOM   6560  C  CA  . ASN C 1 169 ? -20.609 31.976  -8.306  1.00 25.76 ? 212  ASN C CA  1 
ATOM   6561  C  C   . ASN C 1 169 ? -19.692 33.055  -8.848  1.00 24.23 ? 212  ASN C C   1 
ATOM   6562  O  O   . ASN C 1 169 ? -18.599 32.769  -9.314  1.00 23.53 ? 212  ASN C O   1 
ATOM   6563  C  CB  . ASN C 1 169 ? -21.918 31.936  -9.114  1.00 27.48 ? 212  ASN C CB  1 
ATOM   6564  C  CG  . ASN C 1 169 ? -22.840 30.773  -8.710  1.00 28.26 ? 212  ASN C CG  1 
ATOM   6565  O  OD1 . ASN C 1 169 ? -22.482 29.595  -8.824  1.00 28.91 ? 212  ASN C OD1 1 
ATOM   6566  N  ND2 . ASN C 1 169 ? -24.033 31.111  -8.245  1.00 27.73 ? 212  ASN C ND2 1 
ATOM   6567  N  N   . GLU C 1 170 ? -20.143 34.300  -8.770  1.00 23.81 ? 213  GLU C N   1 
ATOM   6568  C  CA  . GLU C 1 170 ? -19.359 35.438  -9.243  1.00 23.36 ? 213  GLU C CA  1 
ATOM   6569  C  C   . GLU C 1 170 ? -17.895 35.275  -8.816  1.00 24.13 ? 213  GLU C C   1 
ATOM   6570  O  O   . GLU C 1 170 ? -16.969 35.461  -9.613  1.00 25.89 ? 213  GLU C O   1 
ATOM   6571  C  CB  . GLU C 1 170 ? -19.911 36.739  -8.649  1.00 23.15 ? 213  GLU C CB  1 
ATOM   6572  C  CG  . GLU C 1 170 ? -21.403 37.022  -8.888  1.00 23.70 ? 213  GLU C CG  1 
ATOM   6573  C  CD  . GLU C 1 170 ? -21.722 37.386  -10.333 1.00 24.67 ? 213  GLU C CD  1 
ATOM   6574  O  OE1 . GLU C 1 170 ? -22.852 37.868  -10.603 1.00 21.46 ? 213  GLU C OE1 1 
ATOM   6575  O  OE2 . GLU C 1 170 ? -20.837 37.183  -11.200 1.00 26.56 ? 213  GLU C OE2 1 
ATOM   6576  N  N   . ILE C 1 171 ? -17.707 34.911  -7.548  1.00 23.62 ? 214  ILE C N   1 
ATOM   6577  C  CA  . ILE C 1 171 ? -16.382 34.728  -6.955  1.00 20.71 ? 214  ILE C CA  1 
ATOM   6578  C  C   . ILE C 1 171 ? -15.972 33.268  -6.909  1.00 19.50 ? 214  ILE C C   1 
ATOM   6579  O  O   . ILE C 1 171 ? -16.686 32.437  -6.349  1.00 19.48 ? 214  ILE C O   1 
ATOM   6580  C  CB  . ILE C 1 171 ? -16.339 35.199  -5.483  1.00 21.24 ? 214  ILE C CB  1 
ATOM   6581  C  CG1 . ILE C 1 171 ? -16.921 36.605  -5.338  1.00 20.73 ? 214  ILE C CG1 1 
ATOM   6582  C  CG2 . ILE C 1 171 ? -14.921 35.103  -4.966  1.00 18.87 ? 214  ILE C CG2 1 
ATOM   6583  C  CD1 . ILE C 1 171 ? -17.251 36.972  -3.906  1.00 19.55 ? 214  ILE C CD1 1 
ATOM   6584  N  N   . PRO C 1 172 ? -14.839 32.966  -7.514  1.00 18.45 ? 215  PRO C N   1 
ATOM   6585  C  CA  . PRO C 1 172 ? -14.339 31.635  -7.384  1.00 17.70 ? 215  PRO C CA  1 
ATOM   6586  C  C   . PRO C 1 172 ? -14.295 31.205  -5.977  1.00 17.56 ? 215  PRO C C   1 
ATOM   6587  O  O   . PRO C 1 172 ? -15.032 31.654  -5.081  1.00 17.81 ? 215  PRO C O   1 
ATOM   6588  C  CB  . PRO C 1 172 ? -13.056 31.622  -8.171  1.00 17.22 ? 215  PRO C CB  1 
ATOM   6589  C  CG  . PRO C 1 172 ? -13.447 32.497  -9.327  1.00 15.77 ? 215  PRO C CG  1 
ATOM   6590  C  CD  . PRO C 1 172 ? -14.571 33.383  -8.907  1.00 18.73 ? 215  PRO C CD  1 
ATOM   6591  N  N   . ASN C 1 173 ? -13.459 30.258  -5.869  1.00 17.87 ? 216  ASN C N   1 
ATOM   6592  C  CA  . ASN C 1 173 ? -13.305 29.503  -4.687  1.00 19.97 ? 216  ASN C CA  1 
ATOM   6593  C  C   . ASN C 1 173 ? -14.393 29.746  -3.508  1.00 21.03 ? 216  ASN C C   1 
ATOM   6594  O  O   . ASN C 1 173 ? -14.174 29.170  -2.430  1.00 21.73 ? 216  ASN C O   1 
ATOM   6595  C  CB  . ASN C 1 173 ? -11.823 29.486  -4.370  1.00 20.92 ? 216  ASN C CB  1 
ATOM   6596  C  CG  . ASN C 1 173 ? -11.167 28.392  -5.209  1.00 23.32 ? 216  ASN C CG  1 
ATOM   6597  O  OD1 . ASN C 1 173 ? -10.971 27.285  -4.711  1.00 22.93 ? 216  ASN C OD1 1 
ATOM   6598  N  ND2 . ASN C 1 173 ? -10.852 28.697  -6.460  1.00 22.50 ? 216  ASN C ND2 1 
ATOM   6599  N  N   . SER C 1 174 ? -15.516 30.544  -3.636  1.00 21.66 ? 217  SER C N   1 
ATOM   6600  C  CA  . SER C 1 174 ? -16.528 30.738  -2.557  1.00 22.03 ? 217  SER C CA  1 
ATOM   6601  C  C   . SER C 1 174 ? -16.941 29.485  -1.744  1.00 21.67 ? 217  SER C C   1 
ATOM   6602  O  O   . SER C 1 174 ? -16.966 28.374  -2.275  1.00 22.69 ? 217  SER C O   1 
ATOM   6603  C  CB  . SER C 1 174 ? -17.764 31.365  -3.162  1.00 23.02 ? 217  SER C CB  1 
ATOM   6604  O  OG  . SER C 1 174 ? -17.544 32.728  -3.488  1.00 24.17 ? 217  SER C OG  1 
ATOM   6605  N  N   . HIS C 1 175 ? -17.240 29.686  -0.470  1.00 19.59 ? 218  HIS C N   1 
ATOM   6606  C  CA  . HIS C 1 175 ? -17.699 28.644  0.407   1.00 16.61 ? 218  HIS C CA  1 
ATOM   6607  C  C   . HIS C 1 175 ? -18.541 29.300  1.468   1.00 16.46 ? 218  HIS C C   1 
ATOM   6608  O  O   . HIS C 1 175 ? -18.044 29.754  2.495   1.00 15.65 ? 218  HIS C O   1 
ATOM   6609  C  CB  . HIS C 1 175 ? -16.575 27.790  0.986   1.00 14.30 ? 218  HIS C CB  1 
ATOM   6610  C  CG  . HIS C 1 175 ? -16.334 26.590  0.033   1.00 16.94 ? 218  HIS C CG  1 
ATOM   6611  N  ND1 . HIS C 1 175 ? -17.358 25.851  -0.500  1.00 19.57 ? 218  HIS C ND1 1 
ATOM   6612  C  CD2 . HIS C 1 175 ? -15.188 26.077  -0.467  1.00 20.65 ? 218  HIS C CD2 1 
ATOM   6613  C  CE1 . HIS C 1 175 ? -16.856 24.912  -1.274  1.00 21.22 ? 218  HIS C CE1 1 
ATOM   6614  N  NE2 . HIS C 1 175 ? -15.539 25.027  -1.270  1.00 21.47 ? 218  HIS C NE2 1 
ATOM   6615  N  N   . ILE C 1 176 ? -19.861 29.330  1.205   1.00 16.14 ? 219  ILE C N   1 
ATOM   6616  C  CA  . ILE C 1 176 ? -20.844 29.847  2.135   1.00 17.05 ? 219  ILE C CA  1 
ATOM   6617  C  C   . ILE C 1 176 ? -21.033 28.808  3.204   1.00 19.94 ? 219  ILE C C   1 
ATOM   6618  O  O   . ILE C 1 176 ? -21.399 27.662  2.917   1.00 21.31 ? 219  ILE C O   1 
ATOM   6619  C  CB  . ILE C 1 176 ? -22.236 30.071  1.525   1.00 14.60 ? 219  ILE C CB  1 
ATOM   6620  C  CG1 . ILE C 1 176 ? -22.358 31.297  0.613   1.00 13.10 ? 219  ILE C CG1 1 
ATOM   6621  C  CG2 . ILE C 1 176 ? -23.260 30.152  2.632   1.00 16.46 ? 219  ILE C CG2 1 
ATOM   6622  C  CD1 . ILE C 1 176 ? -23.718 31.446  -0.034  1.00 7.29  ? 219  ILE C CD1 1 
ATOM   6623  N  N   . LEU C 1 177 ? -20.794 29.177  4.441   1.00 22.43 ? 220  LEU C N   1 
ATOM   6624  C  CA  . LEU C 1 177 ? -20.986 28.244  5.524   1.00 23.79 ? 220  LEU C CA  1 
ATOM   6625  C  C   . LEU C 1 177 ? -22.294 28.623  6.144   1.00 25.09 ? 220  LEU C C   1 
ATOM   6626  O  O   . LEU C 1 177 ? -22.530 29.821  6.313   1.00 27.28 ? 220  LEU C O   1 
ATOM   6627  C  CB  . LEU C 1 177 ? -19.838 28.280  6.521   1.00 21.40 ? 220  LEU C CB  1 
ATOM   6628  C  CG  . LEU C 1 177 ? -18.555 27.664  5.959   1.00 24.60 ? 220  LEU C CG  1 
ATOM   6629  C  CD1 . LEU C 1 177 ? -17.418 27.800  6.950   1.00 24.07 ? 220  LEU C CD1 1 
ATOM   6630  C  CD2 . LEU C 1 177 ? -18.784 26.207  5.578   1.00 26.05 ? 220  LEU C CD2 1 
ATOM   6631  N  N   . ASP C 1 178 ? -23.160 27.684  6.504   1.00 25.34 ? 221  ASP C N   1 
ATOM   6632  C  CA  . ASP C 1 178 ? -24.447 28.086  7.052   1.00 26.70 ? 221  ASP C CA  1 
ATOM   6633  C  C   . ASP C 1 178 ? -24.858 27.515  8.407   1.00 27.85 ? 221  ASP C C   1 
ATOM   6634  O  O   . ASP C 1 178 ? -25.016 26.304  8.588   1.00 28.99 ? 221  ASP C O   1 
ATOM   6635  C  CB  . ASP C 1 178 ? -25.537 27.770  6.028   1.00 25.99 ? 221  ASP C CB  1 
ATOM   6636  C  CG  . ASP C 1 178 ? -26.809 28.514  6.347   1.00 26.33 ? 221  ASP C CG  1 
ATOM   6637  O  OD1 . ASP C 1 178 ? -27.787 27.845  6.725   1.00 25.84 ? 221  ASP C OD1 1 
ATOM   6638  O  OD2 . ASP C 1 178 ? -26.819 29.755  6.231   1.00 27.74 ? 221  ASP C OD2 1 
ATOM   6639  N  N   . GLN C 1 179 ? -25.030 28.420  9.354   1.00 27.85 ? 222  GLN C N   1 
ATOM   6640  C  CA  . GLN C 1 179 ? -25.448 28.059  10.707  1.00 27.46 ? 222  GLN C CA  1 
ATOM   6641  C  C   . GLN C 1 179 ? -26.810 27.407  10.714  1.00 27.25 ? 222  GLN C C   1 
ATOM   6642  O  O   . GLN C 1 179 ? -27.094 26.545  11.547  1.00 26.91 ? 222  GLN C O   1 
ATOM   6643  C  CB  . GLN C 1 179 ? -25.492 29.319  11.579  1.00 28.23 ? 222  GLN C CB  1 
ATOM   6644  C  CG  . GLN C 1 179 ? -26.353 30.427  10.955  1.00 28.85 ? 222  GLN C CG  1 
ATOM   6645  C  CD  . GLN C 1 179 ? -26.115 31.799  11.534  1.00 28.59 ? 222  GLN C CD  1 
ATOM   6646  O  OE1 . GLN C 1 179 ? -26.169 31.993  12.736  1.00 27.78 ? 222  GLN C OE1 1 
ATOM   6647  N  NE2 . GLN C 1 179 ? -25.840 32.903  10.863  1.00 28.29 ? 222  GLN C NE2 1 
ATOM   6648  N  N   . TYR C 1 180 ? -27.674 27.809  9.791   1.00 27.20 ? 223  TYR C N   1 
ATOM   6649  C  CA  . TYR C 1 180 ? -29.045 27.324  9.751   1.00 27.33 ? 223  TYR C CA  1 
ATOM   6650  C  C   . TYR C 1 180 ? -29.307 26.019  9.030   1.00 26.30 ? 223  TYR C C   1 
ATOM   6651  O  O   . TYR C 1 180 ? -30.443 25.545  9.038   1.00 26.40 ? 223  TYR C O   1 
ATOM   6652  C  CB  . TYR C 1 180 ? -29.913 28.410  9.085   1.00 27.84 ? 223  TYR C CB  1 
ATOM   6653  C  CG  . TYR C 1 180 ? -29.977 29.653  9.911   1.00 30.32 ? 223  TYR C CG  1 
ATOM   6654  C  CD1 . TYR C 1 180 ? -30.717 29.658  11.097  1.00 30.63 ? 223  TYR C CD1 1 
ATOM   6655  C  CD2 . TYR C 1 180 ? -29.303 30.819  9.554   1.00 31.39 ? 223  TYR C CD2 1 
ATOM   6656  C  CE1 . TYR C 1 180 ? -30.780 30.798  11.900  1.00 31.48 ? 223  TYR C CE1 1 
ATOM   6657  C  CE2 . TYR C 1 180 ? -29.362 31.958  10.348  1.00 32.08 ? 223  TYR C CE2 1 
ATOM   6658  C  CZ  . TYR C 1 180 ? -30.103 31.943  11.517  1.00 32.04 ? 223  TYR C CZ  1 
ATOM   6659  O  OH  . TYR C 1 180 ? -30.166 33.075  12.295  1.00 32.35 ? 223  TYR C OH  1 
ATOM   6660  N  N   . ARG C 1 181 ? -28.275 25.450  8.396   1.00 25.39 ? 224  ARG C N   1 
ATOM   6661  C  CA  . ARG C 1 181 ? -28.541 24.209  7.611   1.00 23.32 ? 224  ARG C CA  1 
ATOM   6662  C  C   . ARG C 1 181 ? -27.481 23.172  7.750   1.00 21.36 ? 224  ARG C C   1 
ATOM   6663  O  O   . ARG C 1 181 ? -27.608 22.066  7.235   1.00 19.72 ? 224  ARG C O   1 
ATOM   6664  C  CB  . ARG C 1 181 ? -28.469 24.498  6.085   1.00 24.49 ? 224  ARG C CB  1 
ATOM   6665  C  CG  . ARG C 1 181 ? -27.734 23.524  5.124   1.00 24.34 ? 224  ARG C CG  1 
ATOM   6666  C  CD  . ARG C 1 181 ? -26.198 23.430  5.226   1.00 26.46 ? 224  ARG C CD  1 
ATOM   6667  N  NE  . ARG C 1 181 ? -25.393 24.404  4.446   1.00 28.28 ? 224  ARG C NE  1 
ATOM   6668  C  CZ  . ARG C 1 181 ? -25.452 24.604  3.110   1.00 31.24 ? 224  ARG C CZ  1 
ATOM   6669  N  NH1 . ARG C 1 181 ? -26.299 23.903  2.373   1.00 32.36 ? 224  ARG C NH1 1 
ATOM   6670  N  NH2 . ARG C 1 181 ? -24.645 25.504  2.550   1.00 31.78 ? 224  ARG C NH2 1 
ATOM   6671  N  N   . ASN C 1 182 ? -26.255 23.690  8.073   1.00 20.08 ? 225  ASN C N   1 
ATOM   6672  C  CA  . ASN C 1 182 ? -25.056 22.859  7.988   1.00 19.49 ? 225  ASN C CA  1 
ATOM   6673  C  C   . ASN C 1 182 ? -24.945 22.085  9.258   1.00 18.94 ? 225  ASN C C   1 
ATOM   6674  O  O   . ASN C 1 182 ? -24.972 22.621  10.370  1.00 20.08 ? 225  ASN C O   1 
ATOM   6675  C  CB  . ASN C 1 182 ? -23.775 23.656  7.702   1.00 18.62 ? 225  ASN C CB  1 
ATOM   6676  C  CG  . ASN C 1 182 ? -22.541 22.775  7.442   1.00 17.57 ? 225  ASN C CG  1 
ATOM   6677  O  OD1 . ASN C 1 182 ? -22.216 21.892  8.243   1.00 17.72 ? 225  ASN C OD1 1 
ATOM   6678  N  ND2 . ASN C 1 182 ? -21.853 23.015  6.323   1.00 17.75 ? 225  ASN C ND2 1 
ATOM   6679  N  N   . ALA C 1 183 ? -24.803 20.783  9.032   1.00 18.41 ? 226  ALA C N   1 
ATOM   6680  C  CA  . ALA C 1 183 ? -24.745 19.823  10.124  1.00 18.97 ? 226  ALA C CA  1 
ATOM   6681  C  C   . ALA C 1 183 ? -23.855 20.194  11.304  1.00 19.49 ? 226  ALA C C   1 
ATOM   6682  O  O   . ALA C 1 183 ? -24.215 19.957  12.459  1.00 19.44 ? 226  ALA C O   1 
ATOM   6683  C  CB  . ALA C 1 183 ? -24.303 18.485  9.569   1.00 18.85 ? 226  ALA C CB  1 
ATOM   6684  N  N   . SER C 1 184 ? -22.703 20.771  11.003  1.00 18.51 ? 227  SER C N   1 
ATOM   6685  C  CA  . SER C 1 184 ? -21.661 21.129  11.990  1.00 15.41 ? 227  SER C CA  1 
ATOM   6686  C  C   . SER C 1 184 ? -22.095 21.962  13.188  1.00 14.03 ? 227  SER C C   1 
ATOM   6687  O  O   . SER C 1 184 ? -21.577 21.764  14.276  1.00 13.36 ? 227  SER C O   1 
ATOM   6688  C  CB  . SER C 1 184 ? -20.509 21.816  11.272  1.00 14.62 ? 227  SER C CB  1 
ATOM   6689  O  OG  . SER C 1 184 ? -20.433 21.388  9.920   1.00 14.78 ? 227  SER C OG  1 
ATOM   6690  N  N   . ASN C 1 185 ? -23.037 22.850  13.015  1.00 12.73 ? 228  ASN C N   1 
ATOM   6691  C  CA  . ASN C 1 185 ? -23.471 23.578  14.149  1.00 13.95 ? 228  ASN C CA  1 
ATOM   6692  C  C   . ASN C 1 185 ? -24.038 22.715  15.289  1.00 16.24 ? 228  ASN C C   1 
ATOM   6693  O  O   . ASN C 1 185 ? -23.579 22.841  16.410  1.00 16.87 ? 228  ASN C O   1 
ATOM   6694  C  CB  . ASN C 1 185 ? -24.479 24.669  13.734  1.00 11.52 ? 228  ASN C CB  1 
ATOM   6695  C  CG  . ASN C 1 185 ? -25.228 25.330  14.867  1.00 14.21 ? 228  ASN C CG  1 
ATOM   6696  O  OD1 . ASN C 1 185 ? -24.851 25.183  16.035  1.00 13.38 ? 228  ASN C OD1 1 
ATOM   6697  N  ND2 . ASN C 1 185 ? -26.301 26.045  14.549  1.00 14.58 ? 228  ASN C ND2 1 
ATOM   6698  N  N   . PRO C 1 186 ? -25.018 21.868  14.998  1.00 18.18 ? 229  PRO C N   1 
ATOM   6699  C  CA  . PRO C 1 186 ? -25.671 21.129  16.075  1.00 19.20 ? 229  PRO C CA  1 
ATOM   6700  C  C   . PRO C 1 186 ? -24.722 20.302  16.721  1.00 19.71 ? 229  PRO C C   1 
ATOM   6701  O  O   . PRO C 1 186 ? -24.565 20.156  17.941  1.00 22.16 ? 229  PRO C O   1 
ATOM   6702  C  CB  . PRO C 1 186 ? -26.711 20.249  15.443  1.00 18.37 ? 229  PRO C CB  1 
ATOM   6703  C  CG  . PRO C 1 186 ? -27.203 21.212  14.425  1.00 20.70 ? 229  PRO C CG  1 
ATOM   6704  C  CD  . PRO C 1 186 ? -26.154 22.275  14.184  1.00 19.16 ? 229  PRO C CD  1 
ATOM   6705  N  N   . LEU C 1 187 ? -24.086 19.714  15.777  1.00 19.53 ? 230  LEU C N   1 
ATOM   6706  C  CA  . LEU C 1 187 ? -23.134 18.679  16.083  1.00 20.46 ? 230  LEU C CA  1 
ATOM   6707  C  C   . LEU C 1 187 ? -22.039 19.106  17.029  1.00 19.64 ? 230  LEU C C   1 
ATOM   6708  O  O   . LEU C 1 187 ? -21.632 18.343  17.901  1.00 20.49 ? 230  LEU C O   1 
ATOM   6709  C  CB  . LEU C 1 187 ? -22.567 18.109  14.785  1.00 21.73 ? 230  LEU C CB  1 
ATOM   6710  C  CG  . LEU C 1 187 ? -23.306 16.867  14.236  1.00 21.74 ? 230  LEU C CG  1 
ATOM   6711  C  CD1 . LEU C 1 187 ? -22.524 16.262  13.082  1.00 21.51 ? 230  LEU C CD1 1 
ATOM   6712  C  CD2 . LEU C 1 187 ? -23.531 15.845  15.338  1.00 21.47 ? 230  LEU C CD2 1 
ATOM   6713  N  N   . ALA C 1 188 ? -21.531 20.325  16.896  1.00 18.02 ? 231  ALA C N   1 
ATOM   6714  C  CA  . ALA C 1 188 ? -20.440 20.765  17.752  1.00 17.14 ? 231  ALA C CA  1 
ATOM   6715  C  C   . ALA C 1 188 ? -20.911 20.875  19.193  1.00 17.30 ? 231  ALA C C   1 
ATOM   6716  O  O   . ALA C 1 188 ? -20.197 20.516  20.133  1.00 16.24 ? 231  ALA C O   1 
ATOM   6717  C  CB  . ALA C 1 188 ? -19.915 22.090  17.274  1.00 16.59 ? 231  ALA C CB  1 
ATOM   6718  N  N   . HIS C 1 189 ? -22.125 21.373  19.363  1.00 16.96 ? 232  HIS C N   1 
ATOM   6719  C  CA  . HIS C 1 189 ? -22.678 21.524  20.688  1.00 18.59 ? 232  HIS C CA  1 
ATOM   6720  C  C   . HIS C 1 189 ? -23.012 20.159  21.273  1.00 20.53 ? 232  HIS C C   1 
ATOM   6721  O  O   . HIS C 1 189 ? -23.119 20.005  22.490  1.00 21.88 ? 232  HIS C O   1 
ATOM   6722  C  CB  . HIS C 1 189 ? -23.918 22.420  20.640  1.00 18.71 ? 232  HIS C CB  1 
ATOM   6723  C  CG  . HIS C 1 189 ? -23.612 23.850  20.314  1.00 17.04 ? 232  HIS C CG  1 
ATOM   6724  N  ND1 . HIS C 1 189 ? -22.688 24.590  21.017  1.00 14.99 ? 232  HIS C ND1 1 
ATOM   6725  C  CD2 . HIS C 1 189 ? -24.116 24.679  19.372  1.00 16.09 ? 232  HIS C CD2 1 
ATOM   6726  C  CE1 . HIS C 1 189 ? -22.638 25.812  20.522  1.00 14.16 ? 232  HIS C CE1 1 
ATOM   6727  N  NE2 . HIS C 1 189 ? -23.496 25.893  19.525  1.00 13.69 ? 232  HIS C NE2 1 
ATOM   6728  N  N   . TYR C 1 190 ? -23.169 19.167  20.400  1.00 21.24 ? 233  TYR C N   1 
ATOM   6729  C  CA  . TYR C 1 190 ? -23.480 17.804  20.826  1.00 21.96 ? 233  TYR C CA  1 
ATOM   6730  C  C   . TYR C 1 190 ? -22.186 17.172  21.310  1.00 21.83 ? 233  TYR C C   1 
ATOM   6731  O  O   . TYR C 1 190 ? -22.060 16.763  22.468  1.00 20.93 ? 233  TYR C O   1 
ATOM   6732  C  CB  . TYR C 1 190 ? -24.014 17.005  19.638  1.00 21.50 ? 233  TYR C CB  1 
ATOM   6733  C  CG  . TYR C 1 190 ? -24.364 15.560  19.930  1.00 22.66 ? 233  TYR C CG  1 
ATOM   6734  C  CD1 . TYR C 1 190 ? -25.452 15.232  20.728  1.00 22.97 ? 233  TYR C CD1 1 
ATOM   6735  C  CD2 . TYR C 1 190 ? -23.640 14.519  19.347  1.00 23.12 ? 233  TYR C CD2 1 
ATOM   6736  C  CE1 . TYR C 1 190 ? -25.822 13.899  20.928  1.00 24.39 ? 233  TYR C CE1 1 
ATOM   6737  C  CE2 . TYR C 1 190 ? -23.992 13.185  19.544  1.00 22.60 ? 233  TYR C CE2 1 
ATOM   6738  C  CZ  . TYR C 1 190 ? -25.085 12.877  20.330  1.00 24.57 ? 233  TYR C CZ  1 
ATOM   6739  O  OH  . TYR C 1 190 ? -25.447 11.555  20.515  1.00 24.69 ? 233  TYR C OH  1 
ATOM   6740  N  N   . ASP C 1 191 ? -21.261 17.190  20.386  1.00 21.46 ? 234  ASP C N   1 
ATOM   6741  C  CA  . ASP C 1 191 ? -19.930 16.686  20.610  1.00 21.61 ? 234  ASP C CA  1 
ATOM   6742  C  C   . ASP C 1 191 ? -19.193 17.414  21.732  1.00 20.18 ? 234  ASP C C   1 
ATOM   6743  O  O   . ASP C 1 191 ? -18.651 16.747  22.618  1.00 19.02 ? 234  ASP C O   1 
ATOM   6744  C  CB  . ASP C 1 191 ? -19.093 16.823  19.324  1.00 22.89 ? 234  ASP C CB  1 
ATOM   6745  C  CG  . ASP C 1 191 ? -19.338 15.810  18.196  1.00 24.13 ? 234  ASP C CG  1 
ATOM   6746  O  OD1 . ASP C 1 191 ? -19.918 14.746  18.482  1.00 22.69 ? 234  ASP C OD1 1 
ATOM   6747  O  OD2 . ASP C 1 191 ? -18.955 16.077  17.039  1.00 20.50 ? 234  ASP C OD2 1 
ATOM   6748  N  N   . THR C 1 192 ? -19.126 18.728  21.772  1.00 19.90 ? 235  THR C N   1 
ATOM   6749  C  CA  . THR C 1 192 ? -18.238 19.381  22.764  1.00 19.43 ? 235  THR C CA  1 
ATOM   6750  C  C   . THR C 1 192 ? -18.807 20.265  23.821  1.00 19.76 ? 235  THR C C   1 
ATOM   6751  O  O   . THR C 1 192 ? -18.163 20.549  24.840  1.00 20.09 ? 235  THR C O   1 
ATOM   6752  C  CB  . THR C 1 192 ? -17.326 20.399  22.094  1.00 19.01 ? 235  THR C CB  1 
ATOM   6753  O  OG1 . THR C 1 192 ? -16.324 19.732  21.318  1.00 17.96 ? 235  THR C OG1 1 
ATOM   6754  C  CG2 . THR C 1 192 ? -16.652 21.259  23.150  1.00 19.64 ? 235  THR C CG2 1 
ATOM   6755  N  N   . THR C 1 193 ? -19.961 20.753  23.572  1.00 20.58 ? 236  THR C N   1 
ATOM   6756  C  CA  . THR C 1 193 ? -20.562 21.677  24.469  1.00 22.74 ? 236  THR C CA  1 
ATOM   6757  C  C   . THR C 1 193 ? -21.420 21.003  25.484  1.00 23.67 ? 236  THR C C   1 
ATOM   6758  O  O   . THR C 1 193 ? -21.636 21.449  26.603  1.00 22.81 ? 236  THR C O   1 
ATOM   6759  C  CB  . THR C 1 193 ? -21.372 22.638  23.637  1.00 23.75 ? 236  THR C CB  1 
ATOM   6760  O  OG1 . THR C 1 193 ? -20.509 23.252  22.681  1.00 25.35 ? 236  THR C OG1 1 
ATOM   6761  C  CG2 . THR C 1 193 ? -21.998 23.721  24.510  1.00 22.55 ? 236  THR C CG2 1 
ATOM   6762  N  N   . ALA C 1 194 ? -21.909 19.914  24.975  1.00 24.88 ? 237  ALA C N   1 
ATOM   6763  C  CA  . ALA C 1 194 ? -22.697 19.028  25.750  1.00 25.08 ? 237  ALA C CA  1 
ATOM   6764  C  C   . ALA C 1 194 ? -21.797 18.321  26.724  1.00 25.22 ? 237  ALA C C   1 
ATOM   6765  O  O   . ALA C 1 194 ? -21.868 18.556  27.939  1.00 27.08 ? 237  ALA C O   1 
ATOM   6766  C  CB  . ALA C 1 194 ? -23.424 18.034  24.861  1.00 25.34 ? 237  ALA C CB  1 
ATOM   6767  N  N   . ASP C 1 195 ? -20.920 17.454  26.217  1.00 24.67 ? 238  ASP C N   1 
ATOM   6768  C  CA  . ASP C 1 195 ? -20.023 16.701  27.093  1.00 23.89 ? 238  ASP C CA  1 
ATOM   6769  C  C   . ASP C 1 195 ? -19.379 17.529  28.199  1.00 23.05 ? 238  ASP C C   1 
ATOM   6770  O  O   . ASP C 1 195 ? -19.419 17.135  29.375  1.00 21.98 ? 238  ASP C O   1 
ATOM   6771  C  CB  . ASP C 1 195 ? -18.957 15.948  26.283  1.00 23.65 ? 238  ASP C CB  1 
ATOM   6772  C  CG  . ASP C 1 195 ? -19.419 14.537  25.882  1.00 23.57 ? 238  ASP C CG  1 
ATOM   6773  O  OD1 . ASP C 1 195 ? -18.617 13.796  25.271  1.00 22.15 ? 238  ASP C OD1 1 
ATOM   6774  O  OD2 . ASP C 1 195 ? -20.582 14.175  26.184  1.00 22.29 ? 238  ASP C OD2 1 
ATOM   6775  N  N   . GLU C 1 196 ? -18.803 18.670  27.826  1.00 22.02 ? 239  GLU C N   1 
ATOM   6776  C  CA  . GLU C 1 196 ? -18.189 19.569  28.795  1.00 18.73 ? 239  GLU C CA  1 
ATOM   6777  C  C   . GLU C 1 196 ? -19.176 19.759  29.959  1.00 18.21 ? 239  GLU C C   1 
ATOM   6778  O  O   . GLU C 1 196 ? -18.841 19.552  31.121  1.00 19.59 ? 239  GLU C O   1 
ATOM   6779  C  CB  . GLU C 1 196 ? -17.898 20.929  28.139  1.00 16.56 ? 239  GLU C CB  1 
ATOM   6780  C  CG  . GLU C 1 196 ? -16.794 20.940  27.054  1.00 13.04 ? 239  GLU C CG  1 
ATOM   6781  C  CD  . GLU C 1 196 ? -16.529 22.349  26.495  1.00 9.33  ? 239  GLU C CD  1 
ATOM   6782  O  OE1 . GLU C 1 196 ? -15.759 22.472  25.513  1.00 6.33  ? 239  GLU C OE1 1 
ATOM   6783  O  OE2 . GLU C 1 196 ? -17.098 23.322  27.047  1.00 3.95  ? 239  GLU C OE2 1 
ATOM   6784  N  N   . ILE C 1 197 ? -20.400 20.144  29.621  1.00 16.77 ? 240  ILE C N   1 
ATOM   6785  C  CA  . ILE C 1 197 ? -21.464 20.373  30.598  1.00 15.27 ? 240  ILE C CA  1 
ATOM   6786  C  C   . ILE C 1 197 ? -21.761 19.178  31.510  1.00 15.64 ? 240  ILE C C   1 
ATOM   6787  O  O   . ILE C 1 197 ? -21.836 19.315  32.729  1.00 15.09 ? 240  ILE C O   1 
ATOM   6788  C  CB  . ILE C 1 197 ? -22.790 20.763  29.879  1.00 13.08 ? 240  ILE C CB  1 
ATOM   6789  C  CG1 . ILE C 1 197 ? -22.728 22.211  29.411  1.00 11.38 ? 240  ILE C CG1 1 
ATOM   6790  C  CG2 . ILE C 1 197 ? -23.974 20.541  30.808  1.00 12.60 ? 240  ILE C CG2 1 
ATOM   6791  C  CD1 . ILE C 1 197 ? -23.871 22.597  28.556  1.00 10.98 ? 240  ILE C CD1 1 
ATOM   6792  N  N   . LEU C 1 198 ? -21.966 18.017  30.898  1.00 16.83 ? 241  LEU C N   1 
ATOM   6793  C  CA  . LEU C 1 198 ? -22.283 16.808  31.633  1.00 17.49 ? 241  LEU C CA  1 
ATOM   6794  C  C   . LEU C 1 198 ? -21.120 16.396  32.486  1.00 17.42 ? 241  LEU C C   1 
ATOM   6795  O  O   . LEU C 1 198 ? -21.278 15.562  33.376  1.00 19.35 ? 241  LEU C O   1 
ATOM   6796  C  CB  . LEU C 1 198 ? -22.598 15.644  30.692  1.00 18.98 ? 241  LEU C CB  1 
ATOM   6797  C  CG  . LEU C 1 198 ? -23.858 15.522  29.839  1.00 19.54 ? 241  LEU C CG  1 
ATOM   6798  C  CD1 . LEU C 1 198 ? -23.804 14.162  29.145  1.00 18.45 ? 241  LEU C CD1 1 
ATOM   6799  C  CD2 . LEU C 1 198 ? -25.118 15.631  30.695  1.00 20.12 ? 241  LEU C CD2 1 
ATOM   6800  N  N   . GLN C 1 199 ? -19.945 16.948  32.202  1.00 17.27 ? 242  GLN C N   1 
ATOM   6801  C  CA  . GLN C 1 199 ? -18.773 16.589  32.975  1.00 16.91 ? 242  GLN C CA  1 
ATOM   6802  C  C   . GLN C 1 199 ? -18.624 17.490  34.168  1.00 18.46 ? 242  GLN C C   1 
ATOM   6803  O  O   . GLN C 1 199 ? -18.494 17.009  35.293  1.00 19.50 ? 242  GLN C O   1 
ATOM   6804  C  CB  . GLN C 1 199 ? -17.514 16.648  32.128  1.00 17.11 ? 242  GLN C CB  1 
ATOM   6805  C  CG  . GLN C 1 199 ? -16.648 15.424  32.336  1.00 18.04 ? 242  GLN C CG  1 
ATOM   6806  C  CD  . GLN C 1 199 ? -15.319 15.749  32.961  1.00 16.86 ? 242  GLN C CD  1 
ATOM   6807  O  OE1 . GLN C 1 199 ? -15.196 16.734  33.683  1.00 17.66 ? 242  GLN C OE1 1 
ATOM   6808  N  NE2 . GLN C 1 199 ? -14.312 14.919  32.697  1.00 16.12 ? 242  GLN C NE2 1 
ATOM   6809  N  N   . GLN C 1 200 ? -18.668 18.797  33.937  1.00 19.78 ? 243  GLN C N   1 
ATOM   6810  C  CA  . GLN C 1 200 ? -18.520 19.742  35.033  1.00 20.48 ? 243  GLN C CA  1 
ATOM   6811  C  C   . GLN C 1 200 ? -19.609 19.504  36.061  1.00 21.45 ? 243  GLN C C   1 
ATOM   6812  O  O   . GLN C 1 200 ? -19.411 19.775  37.240  1.00 23.45 ? 243  GLN C O   1 
ATOM   6813  C  CB  . GLN C 1 200 ? -18.547 21.176  34.505  1.00 19.72 ? 243  GLN C CB  1 
ATOM   6814  C  CG  . GLN C 1 200 ? -17.477 21.412  33.449  1.00 18.17 ? 243  GLN C CG  1 
ATOM   6815  C  CD  . GLN C 1 200 ? -17.471 22.815  32.901  1.00 18.69 ? 243  GLN C CD  1 
ATOM   6816  O  OE1 . GLN C 1 200 ? -18.527 23.389  32.633  1.00 19.47 ? 243  GLN C OE1 1 
ATOM   6817  N  NE2 . GLN C 1 200 ? -16.276 23.374  32.712  1.00 17.47 ? 243  GLN C NE2 1 
ATOM   6818  N  N   . CYS C 1 201 ? -20.746 18.975  35.615  1.00 22.04 ? 244  CYS C N   1 
ATOM   6819  C  CA  . CYS C 1 201 ? -21.860 18.660  36.514  1.00 24.40 ? 244  CYS C CA  1 
ATOM   6820  C  C   . CYS C 1 201 ? -21.776 17.237  37.069  1.00 25.47 ? 244  CYS C C   1 
ATOM   6821  O  O   . CYS C 1 201 ? -22.669 16.807  37.811  1.00 24.78 ? 244  CYS C O   1 
ATOM   6822  C  CB  . CYS C 1 201 ? -23.200 18.817  35.804  1.00 23.65 ? 244  CYS C CB  1 
ATOM   6823  S  SG  . CYS C 1 201 ? -23.617 20.498  35.434  1.00 22.85 ? 244  CYS C SG  1 
ATOM   6824  N  N   . ASP C 1 202 ? -20.711 16.520  36.708  1.00 26.20 ? 245  ASP C N   1 
ATOM   6825  C  CA  . ASP C 1 202 ? -20.500 15.143  37.165  1.00 28.81 ? 245  ASP C CA  1 
ATOM   6826  C  C   . ASP C 1 202 ? -21.566 14.202  36.617  1.00 29.27 ? 245  ASP C C   1 
ATOM   6827  O  O   . ASP C 1 202 ? -21.718 13.078  37.087  1.00 30.17 ? 245  ASP C O   1 
ATOM   6828  C  CB  . ASP C 1 202 ? -20.492 15.073  38.707  1.00 29.33 ? 245  ASP C CB  1 
ATOM   6829  C  CG  . ASP C 1 202 ? -19.079 15.021  39.293  1.00 30.20 ? 245  ASP C CG  1 
ATOM   6830  O  OD1 . ASP C 1 202 ? -18.516 13.905  39.423  1.00 28.89 ? 245  ASP C OD1 1 
ATOM   6831  O  OD2 . ASP C 1 202 ? -18.531 16.100  39.616  1.00 29.16 ? 245  ASP C OD2 1 
ATOM   6832  N  N   . GLY C 1 203 ? -22.304 14.668  35.620  1.00 29.68 ? 246  GLY C N   1 
ATOM   6833  C  CA  . GLY C 1 203 ? -23.341 13.840  35.035  1.00 29.23 ? 246  GLY C CA  1 
ATOM   6834  C  C   . GLY C 1 203 ? -24.680 14.055  35.700  1.00 28.19 ? 246  GLY C C   1 
ATOM   6835  O  O   . GLY C 1 203 ? -25.723 13.796  35.116  1.00 28.64 ? 246  GLY C O   1 
ATOM   6836  N  N   . LYS C 1 204 ? -24.642 14.546  36.929  1.00 27.34 ? 247  LYS C N   1 
ATOM   6837  C  CA  . LYS C 1 204 ? -25.850 14.793  37.696  1.00 27.07 ? 247  LYS C CA  1 
ATOM   6838  C  C   . LYS C 1 204 ? -26.399 16.170  37.384  1.00 26.15 ? 247  LYS C C   1 
ATOM   6839  O  O   . LYS C 1 204 ? -26.074 17.149  38.058  1.00 28.30 ? 247  LYS C O   1 
ATOM   6840  C  CB  . LYS C 1 204 ? -25.552 14.674  39.197  1.00 26.67 ? 247  LYS C CB  1 
ATOM   6841  C  CG  . LYS C 1 204 ? -25.143 13.274  39.657  1.00 25.98 ? 247  LYS C CG  1 
ATOM   6842  C  CD  . LYS C 1 204 ? -23.961 12.709  38.861  1.00 27.26 ? 247  LYS C CD  1 
ATOM   6843  C  CE  . LYS C 1 204 ? -23.849 11.194  39.022  1.00 28.40 ? 247  LYS C CE  1 
ATOM   6844  N  NZ  . LYS C 1 204 ? -22.746 10.581  38.220  1.00 28.69 ? 247  LYS C NZ  1 
ATOM   6845  N  N   . LEU C 1 205 ? -27.232 16.237  36.354  1.00 24.90 ? 248  LEU C N   1 
ATOM   6846  C  CA  . LEU C 1 205 ? -27.850 17.489  35.932  1.00 23.27 ? 248  LEU C CA  1 
ATOM   6847  C  C   . LEU C 1 205 ? -29.359 17.306  36.097  1.00 22.30 ? 248  LEU C C   1 
ATOM   6848  O  O   . LEU C 1 205 ? -29.839 16.173  36.104  1.00 21.26 ? 248  LEU C O   1 
ATOM   6849  C  CB  . LEU C 1 205 ? -27.517 17.757  34.460  1.00 21.99 ? 248  LEU C CB  1 
ATOM   6850  C  CG  . LEU C 1 205 ? -27.296 19.190  33.986  1.00 21.62 ? 248  LEU C CG  1 
ATOM   6851  C  CD1 . LEU C 1 205 ? -27.688 19.270  32.523  1.00 22.20 ? 248  LEU C CD1 1 
ATOM   6852  C  CD2 . LEU C 1 205 ? -28.134 20.174  34.790  1.00 22.84 ? 248  LEU C CD2 1 
ATOM   6853  N  N   . ASP C 1 206 ? -30.106 18.400  36.224  1.00 21.87 ? 249  ASP C N   1 
ATOM   6854  C  CA  . ASP C 1 206 ? -31.555 18.293  36.371  1.00 23.23 ? 249  ASP C CA  1 
ATOM   6855  C  C   . ASP C 1 206 ? -32.414 19.197  35.483  1.00 23.09 ? 249  ASP C C   1 
ATOM   6856  O  O   . ASP C 1 206 ? -33.587 18.906  35.245  1.00 23.02 ? 249  ASP C O   1 
ATOM   6857  C  CB  . ASP C 1 206 ? -31.940 18.489  37.836  1.00 24.34 ? 249  ASP C CB  1 
ATOM   6858  C  CG  . ASP C 1 206 ? -31.637 17.265  38.678  1.00 27.60 ? 249  ASP C CG  1 
ATOM   6859  O  OD1 . ASP C 1 206 ? -32.541 16.400  38.828  1.00 26.37 ? 249  ASP C OD1 1 
ATOM   6860  O  OD2 . ASP C 1 206 ? -30.484 17.163  39.167  1.00 26.80 ? 249  ASP C OD2 1 
ATOM   6861  N  N   . MET C 1 207 ? -31.843 20.289  34.991  1.00 23.54 ? 250  MET C N   1 
ATOM   6862  C  CA  . MET C 1 207 ? -32.589 21.210  34.134  1.00 23.21 ? 250  MET C CA  1 
ATOM   6863  C  C   . MET C 1 207 ? -31.626 22.120  33.382  1.00 22.90 ? 250  MET C C   1 
ATOM   6864  O  O   . MET C 1 207 ? -30.613 22.554  33.923  1.00 22.33 ? 250  MET C O   1 
ATOM   6865  C  CB  . MET C 1 207 ? -33.574 22.044  34.974  1.00 23.08 ? 250  MET C CB  1 
ATOM   6866  C  CG  . MET C 1 207 ? -34.397 23.077  34.188  1.00 22.25 ? 250  MET C CG  1 
ATOM   6867  S  SD  . MET C 1 207 ? -35.702 23.896  35.200  1.00 25.00 ? 250  MET C SD  1 
ATOM   6868  C  CE  . MET C 1 207 ? -37.197 23.284  34.421  1.00 26.42 ? 250  MET C CE  1 
ATOM   6869  N  N   . LEU C 1 208 ? -31.934 22.377  32.117  1.00 23.27 ? 251  LEU C N   1 
ATOM   6870  C  CA  . LEU C 1 208 ? -31.100 23.232  31.293  1.00 22.30 ? 251  LEU C CA  1 
ATOM   6871  C  C   . LEU C 1 208 ? -31.999 24.186  30.513  1.00 22.01 ? 251  LEU C C   1 
ATOM   6872  O  O   . LEU C 1 208 ? -32.908 23.769  29.806  1.00 22.98 ? 251  LEU C O   1 
ATOM   6873  C  CB  . LEU C 1 208 ? -30.250 22.382  30.348  1.00 21.72 ? 251  LEU C CB  1 
ATOM   6874  C  CG  . LEU C 1 208 ? -29.303 23.129  29.405  1.00 23.89 ? 251  LEU C CG  1 
ATOM   6875  C  CD1 . LEU C 1 208 ? -28.274 22.163  28.876  1.00 24.53 ? 251  LEU C CD1 1 
ATOM   6876  C  CD2 . LEU C 1 208 ? -30.071 23.760  28.252  1.00 22.24 ? 251  LEU C CD2 1 
ATOM   6877  N  N   . VAL C 1 209 ? -31.751 25.476  30.673  1.00 20.46 ? 252  VAL C N   1 
ATOM   6878  C  CA  . VAL C 1 209 ? -32.530 26.482  29.992  1.00 19.86 ? 252  VAL C CA  1 
ATOM   6879  C  C   . VAL C 1 209 ? -31.639 26.975  28.864  1.00 19.84 ? 252  VAL C C   1 
ATOM   6880  O  O   . VAL C 1 209 ? -30.433 27.083  29.040  1.00 20.85 ? 252  VAL C O   1 
ATOM   6881  C  CB  . VAL C 1 209 ? -32.857 27.638  30.947  1.00 19.78 ? 252  VAL C CB  1 
ATOM   6882  C  CG1 . VAL C 1 209 ? -33.840 28.592  30.298  1.00 19.89 ? 252  VAL C CG1 1 
ATOM   6883  C  CG2 . VAL C 1 209 ? -33.414 27.091  32.239  1.00 18.72 ? 252  VAL C CG2 1 
ATOM   6884  N  N   . ALA C 1 210 ? -32.217 27.258  27.705  1.00 19.03 ? 253  ALA C N   1 
ATOM   6885  C  CA  . ALA C 1 210 ? -31.414 27.723  26.587  1.00 19.95 ? 253  ALA C CA  1 
ATOM   6886  C  C   . ALA C 1 210 ? -32.149 28.691  25.680  1.00 21.19 ? 253  ALA C C   1 
ATOM   6887  O  O   . ALA C 1 210 ? -33.363 28.616  25.503  1.00 24.06 ? 253  ALA C O   1 
ATOM   6888  C  CB  . ALA C 1 210 ? -30.919 26.545  25.778  1.00 19.43 ? 253  ALA C CB  1 
ATOM   6889  N  N   . SER C 1 211 ? -31.388 29.611  25.116  1.00 20.60 ? 254  SER C N   1 
ATOM   6890  C  CA  . SER C 1 211 ? -31.911 30.607  24.216  1.00 20.28 ? 254  SER C CA  1 
ATOM   6891  C  C   . SER C 1 211 ? -31.790 29.951  22.861  1.00 21.39 ? 254  SER C C   1 
ATOM   6892  O  O   . SER C 1 211 ? -30.862 29.165  22.638  1.00 20.77 ? 254  SER C O   1 
ATOM   6893  C  CB  . SER C 1 211 ? -31.025 31.821  24.298  1.00 20.95 ? 254  SER C CB  1 
ATOM   6894  O  OG  . SER C 1 211 ? -29.720 31.384  24.661  1.00 22.64 ? 254  SER C OG  1 
ATOM   6895  N  N   . VAL C 1 212 ? -32.714 30.268  21.955  1.00 21.85 ? 255  VAL C N   1 
ATOM   6896  C  CA  . VAL C 1 212 ? -32.693 29.643  20.640  1.00 19.89 ? 255  VAL C CA  1 
ATOM   6897  C  C   . VAL C 1 212 ? -32.665 30.568  19.442  1.00 18.82 ? 255  VAL C C   1 
ATOM   6898  O  O   . VAL C 1 212 ? -33.478 31.483  19.318  1.00 16.65 ? 255  VAL C O   1 
ATOM   6899  C  CB  . VAL C 1 212 ? -33.892 28.672  20.449  1.00 20.48 ? 255  VAL C CB  1 
ATOM   6900  C  CG1 . VAL C 1 212 ? -33.524 27.620  19.415  1.00 20.77 ? 255  VAL C CG1 1 
ATOM   6901  C  CG2 . VAL C 1 212 ? -34.274 28.016  21.768  1.00 19.63 ? 255  VAL C CG2 1 
ATOM   6902  N  N   . GLY C 1 213 ? -31.702 30.294  18.567  1.00 18.61 ? 256  GLY C N   1 
ATOM   6903  C  CA  . GLY C 1 213 ? -31.519 31.032  17.330  1.00 18.48 ? 256  GLY C CA  1 
ATOM   6904  C  C   . GLY C 1 213 ? -31.536 29.985  16.226  1.00 18.70 ? 256  GLY C C   1 
ATOM   6905  O  O   . GLY C 1 213 ? -32.605 29.566  15.785  1.00 18.11 ? 256  GLY C O   1 
ATOM   6906  N  N   . THR C 1 214 ? -30.368 29.540  15.773  1.00 18.40 ? 257  THR C N   1 
ATOM   6907  C  CA  . THR C 1 214 ? -30.358 28.500  14.753  1.00 18.68 ? 257  THR C CA  1 
ATOM   6908  C  C   . THR C 1 214 ? -30.974 27.269  15.404  1.00 19.67 ? 257  THR C C   1 
ATOM   6909  O  O   . THR C 1 214 ? -31.473 26.371  14.735  1.00 20.38 ? 257  THR C O   1 
ATOM   6910  C  CB  . THR C 1 214 ? -28.914 28.131  14.263  1.00 17.69 ? 257  THR C CB  1 
ATOM   6911  O  OG1 . THR C 1 214 ? -28.049 27.948  15.387  1.00 17.50 ? 257  THR C OG1 1 
ATOM   6912  C  CG2 . THR C 1 214 ? -28.348 29.207  13.368  1.00 15.16 ? 257  THR C CG2 1 
ATOM   6913  N  N   . GLY C 1 215 ? -30.953 27.249  16.731  1.00 21.37 ? 258  GLY C N   1 
ATOM   6914  C  CA  . GLY C 1 215 ? -31.472 26.114  17.475  1.00 21.13 ? 258  GLY C CA  1 
ATOM   6915  C  C   . GLY C 1 215 ? -30.297 25.254  17.898  1.00 21.26 ? 258  GLY C C   1 
ATOM   6916  O  O   . GLY C 1 215 ? -30.419 24.408  18.771  1.00 21.51 ? 258  GLY C O   1 
ATOM   6917  N  N   . GLY C 1 216 ? -29.148 25.506  17.271  1.00 21.39 ? 259  GLY C N   1 
ATOM   6918  C  CA  . GLY C 1 216 ? -27.927 24.775  17.552  1.00 21.21 ? 259  GLY C CA  1 
ATOM   6919  C  C   . GLY C 1 216 ? -27.643 24.353  18.983  1.00 21.68 ? 259  GLY C C   1 
ATOM   6920  O  O   . GLY C 1 216 ? -27.950 23.235  19.374  1.00 22.19 ? 259  GLY C O   1 
ATOM   6921  N  N   . THR C 1 217 ? -27.045 25.241  19.767  1.00 22.77 ? 260  THR C N   1 
ATOM   6922  C  CA  . THR C 1 217 ? -26.699 24.925  21.151  1.00 22.72 ? 260  THR C CA  1 
ATOM   6923  C  C   . THR C 1 217 ? -27.713 24.037  21.893  1.00 22.03 ? 260  THR C C   1 
ATOM   6924  O  O   . THR C 1 217 ? -27.325 23.079  22.567  1.00 21.76 ? 260  THR C O   1 
ATOM   6925  C  CB  . THR C 1 217 ? -26.443 26.224  21.967  1.00 23.60 ? 260  THR C CB  1 
ATOM   6926  O  OG1 . THR C 1 217 ? -27.680 26.916  22.207  1.00 26.95 ? 260  THR C OG1 1 
ATOM   6927  C  CG2 . THR C 1 217 ? -25.497 27.132  21.209  1.00 19.63 ? 260  THR C CG2 1 
ATOM   6928  N  N   . ILE C 1 218 ? -29.002 24.334  21.754  1.00 21.01 ? 261  ILE C N   1 
ATOM   6929  C  CA  . ILE C 1 218 ? -30.029 23.549  22.436  1.00 21.79 ? 261  ILE C CA  1 
ATOM   6930  C  C   . ILE C 1 218 ? -30.309 22.194  21.770  1.00 21.77 ? 261  ILE C C   1 
ATOM   6931  O  O   . ILE C 1 218 ? -30.370 21.174  22.443  1.00 23.04 ? 261  ILE C O   1 
ATOM   6932  C  CB  . ILE C 1 218 ? -31.341 24.369  22.573  1.00 21.92 ? 261  ILE C CB  1 
ATOM   6933  C  CG1 . ILE C 1 218 ? -32.339 23.625  23.461  1.00 19.19 ? 261  ILE C CG1 1 
ATOM   6934  C  CG2 . ILE C 1 218 ? -31.915 24.696  21.191  1.00 21.22 ? 261  ILE C CG2 1 
ATOM   6935  C  CD1 . ILE C 1 218 ? -33.446 24.528  23.980  1.00 18.44 ? 261  ILE C CD1 1 
ATOM   6936  N  N   . THR C 1 219 ? -30.484 22.182  20.455  1.00 20.95 ? 262  THR C N   1 
ATOM   6937  C  CA  . THR C 1 219 ? -30.713 20.935  19.739  1.00 19.37 ? 262  THR C CA  1 
ATOM   6938  C  C   . THR C 1 219 ? -29.529 20.025  20.068  1.00 20.22 ? 262  THR C C   1 
ATOM   6939  O  O   . THR C 1 219 ? -29.695 18.869  20.459  1.00 19.71 ? 262  THR C O   1 
ATOM   6940  C  CB  . THR C 1 219 ? -30.740 21.156  18.202  1.00 18.82 ? 262  THR C CB  1 
ATOM   6941  O  OG1 . THR C 1 219 ? -31.848 21.986  17.840  1.00 16.48 ? 262  THR C OG1 1 
ATOM   6942  C  CG2 . THR C 1 219 ? -30.859 19.836  17.482  1.00 20.15 ? 262  THR C CG2 1 
ATOM   6943  N  N   . GLY C 1 220 ? -28.326 20.570  19.925  1.00 20.68 ? 263  GLY C N   1 
ATOM   6944  C  CA  . GLY C 1 220 ? -27.125 19.799  20.186  1.00 19.99 ? 263  GLY C CA  1 
ATOM   6945  C  C   . GLY C 1 220 ? -26.975 19.273  21.598  1.00 19.42 ? 263  GLY C C   1 
ATOM   6946  O  O   . GLY C 1 220 ? -26.715 18.082  21.814  1.00 18.68 ? 263  GLY C O   1 
ATOM   6947  N  N   . ILE C 1 221 ? -27.144 20.156  22.573  1.00 19.84 ? 264  ILE C N   1 
ATOM   6948  C  CA  . ILE C 1 221 ? -26.990 19.752  23.959  1.00 18.68 ? 264  ILE C CA  1 
ATOM   6949  C  C   . ILE C 1 221 ? -28.152 18.922  24.481  1.00 17.24 ? 264  ILE C C   1 
ATOM   6950  O  O   . ILE C 1 221 ? -27.977 18.141  25.411  1.00 17.74 ? 264  ILE C O   1 
ATOM   6951  C  CB  . ILE C 1 221 ? -26.790 20.969  24.870  1.00 18.37 ? 264  ILE C CB  1 
ATOM   6952  C  CG1 . ILE C 1 221 ? -25.566 21.765  24.423  1.00 13.99 ? 264  ILE C CG1 1 
ATOM   6953  C  CG2 . ILE C 1 221 ? -26.578 20.510  26.298  1.00 20.18 ? 264  ILE C CG2 1 
ATOM   6954  C  CD1 . ILE C 1 221 ? -25.433 23.028  25.168  1.00 12.10 ? 264  ILE C CD1 1 
ATOM   6955  N  N   . ALA C 1 222 ? -29.330 19.078  23.884  1.00 15.74 ? 265  ALA C N   1 
ATOM   6956  C  CA  . ALA C 1 222 ? -30.497 18.309  24.320  1.00 15.40 ? 265  ALA C CA  1 
ATOM   6957  C  C   . ALA C 1 222 ? -30.437 16.850  23.861  1.00 16.59 ? 265  ALA C C   1 
ATOM   6958  O  O   . ALA C 1 222 ? -30.796 15.947  24.623  1.00 16.47 ? 265  ALA C O   1 
ATOM   6959  C  CB  . ALA C 1 222 ? -31.777 18.956  23.822  1.00 12.49 ? 265  ALA C CB  1 
ATOM   6960  N  N   . ARG C 1 223 ? -29.983 16.624  22.625  1.00 17.13 ? 266  ARG C N   1 
ATOM   6961  C  CA  . ARG C 1 223 ? -29.881 15.276  22.078  1.00 17.61 ? 266  ARG C CA  1 
ATOM   6962  C  C   . ARG C 1 223 ? -28.904 14.417  22.847  1.00 18.23 ? 266  ARG C C   1 
ATOM   6963  O  O   . ARG C 1 223 ? -29.106 13.215  22.983  1.00 18.35 ? 266  ARG C O   1 
ATOM   6964  C  CB  . ARG C 1 223 ? -29.463 15.316  20.615  1.00 18.63 ? 266  ARG C CB  1 
ATOM   6965  C  CG  . ARG C 1 223 ? -30.566 15.772  19.700  1.00 21.97 ? 266  ARG C CG  1 
ATOM   6966  C  CD  . ARG C 1 223 ? -30.164 15.611  18.260  1.00 23.61 ? 266  ARG C CD  1 
ATOM   6967  N  NE  . ARG C 1 223 ? -31.271 15.880  17.347  1.00 24.02 ? 266  ARG C NE  1 
ATOM   6968  C  CZ  . ARG C 1 223 ? -31.237 15.595  16.049  1.00 25.10 ? 266  ARG C CZ  1 
ATOM   6969  N  NH1 . ARG C 1 223 ? -30.147 15.045  15.523  1.00 23.18 ? 266  ARG C NH1 1 
ATOM   6970  N  NH2 . ARG C 1 223 ? -32.302 15.817  15.286  1.00 25.27 ? 266  ARG C NH2 1 
ATOM   6971  N  N   . LYS C 1 224 ? -27.833 15.033  23.340  1.00 19.74 ? 267  LYS C N   1 
ATOM   6972  C  CA  . LYS C 1 224 ? -26.823 14.317  24.128  1.00 19.52 ? 267  LYS C CA  1 
ATOM   6973  C  C   . LYS C 1 224 ? -27.277 14.168  25.585  1.00 19.71 ? 267  LYS C C   1 
ATOM   6974  O  O   . LYS C 1 224 ? -27.045 13.143  26.237  1.00 17.99 ? 267  LYS C O   1 
ATOM   6975  C  CB  . LYS C 1 224 ? -25.499 15.069  24.098  1.00 18.36 ? 267  LYS C CB  1 
ATOM   6976  C  CG  . LYS C 1 224 ? -24.456 14.417  24.956  1.00 18.69 ? 267  LYS C CG  1 
ATOM   6977  C  CD  . LYS C 1 224 ? -24.179 13.007  24.492  1.00 16.58 ? 267  LYS C CD  1 
ATOM   6978  C  CE  . LYS C 1 224 ? -23.451 13.013  23.159  1.00 17.59 ? 267  LYS C CE  1 
ATOM   6979  N  NZ  . LYS C 1 224 ? -22.087 13.611  23.223  1.00 16.57 ? 267  LYS C NZ  1 
ATOM   6980  N  N   . LEU C 1 225 ? -27.924 15.216  26.077  1.00 19.52 ? 268  LEU C N   1 
ATOM   6981  C  CA  . LEU C 1 225 ? -28.431 15.252  27.435  1.00 20.81 ? 268  LEU C CA  1 
ATOM   6982  C  C   . LEU C 1 225 ? -29.581 14.262  27.618  1.00 21.91 ? 268  LEU C C   1 
ATOM   6983  O  O   . LEU C 1 225 ? -29.709 13.656  28.678  1.00 22.34 ? 268  LEU C O   1 
ATOM   6984  C  CB  . LEU C 1 225 ? -28.907 16.673  27.770  1.00 20.93 ? 268  LEU C CB  1 
ATOM   6985  C  CG  . LEU C 1 225 ? -28.196 17.542  28.813  1.00 21.51 ? 268  LEU C CG  1 
ATOM   6986  C  CD1 . LEU C 1 225 ? -26.709 17.639  28.536  1.00 19.97 ? 268  LEU C CD1 1 
ATOM   6987  C  CD2 . LEU C 1 225 ? -28.827 18.922  28.784  1.00 21.29 ? 268  LEU C CD2 1 
ATOM   6988  N  N   . LYS C 1 226 ? -30.419 14.092  26.595  1.00 21.87 ? 269  LYS C N   1 
ATOM   6989  C  CA  . LYS C 1 226 ? -31.549 13.176  26.719  1.00 21.55 ? 269  LYS C CA  1 
ATOM   6990  C  C   . LYS C 1 226 ? -31.170 11.729  26.503  1.00 21.14 ? 269  LYS C C   1 
ATOM   6991  O  O   . LYS C 1 226 ? -31.961 10.844  26.764  1.00 20.71 ? 269  LYS C O   1 
ATOM   6992  C  CB  . LYS C 1 226 ? -32.689 13.561  25.766  1.00 21.31 ? 269  LYS C CB  1 
ATOM   6993  C  CG  . LYS C 1 226 ? -33.445 14.815  26.203  1.00 18.95 ? 269  LYS C CG  1 
ATOM   6994  C  CD  . LYS C 1 226 ? -34.843 14.867  25.625  1.00 18.48 ? 269  LYS C CD  1 
ATOM   6995  C  CE  . LYS C 1 226 ? -35.792 15.610  26.556  1.00 16.68 ? 269  LYS C CE  1 
ATOM   6996  N  NZ  . LYS C 1 226 ? -35.849 14.988  27.923  1.00 16.49 ? 269  LYS C NZ  1 
ATOM   6997  N  N   . GLU C 1 227 ? -29.964 11.488  26.011  1.00 22.22 ? 270  GLU C N   1 
ATOM   6998  C  CA  . GLU C 1 227 ? -29.506 10.120  25.808  1.00 22.73 ? 270  GLU C CA  1 
ATOM   6999  C  C   . GLU C 1 227 ? -28.739 9.771   27.067  1.00 24.40 ? 270  GLU C C   1 
ATOM   7000  O  O   . GLU C 1 227 ? -28.832 8.689   27.639  1.00 25.16 ? 270  GLU C O   1 
ATOM   7001  C  CB  . GLU C 1 227 ? -28.571 10.000  24.600  1.00 20.66 ? 270  GLU C CB  1 
ATOM   7002  C  CG  . GLU C 1 227 ? -29.253 10.175  23.266  1.00 18.55 ? 270  GLU C CG  1 
ATOM   7003  C  CD  . GLU C 1 227 ? -28.267 10.376  22.128  1.00 18.11 ? 270  GLU C CD  1 
ATOM   7004  O  OE1 . GLU C 1 227 ? -28.708 10.344  20.968  1.00 19.09 ? 270  GLU C OE1 1 
ATOM   7005  O  OE2 . GLU C 1 227 ? -27.061 10.572  22.410  1.00 15.39 ? 270  GLU C OE2 1 
ATOM   7006  N  N   . LYS C 1 228 ? -27.972 10.810  27.490  1.00 25.55 ? 271  LYS C N   1 
ATOM   7007  C  CA  . LYS C 1 228 ? -27.147 10.681  28.667  1.00 24.56 ? 271  LYS C CA  1 
ATOM   7008  C  C   . LYS C 1 228 ? -27.798 11.279  29.917  1.00 25.80 ? 271  LYS C C   1 
ATOM   7009  O  O   . LYS C 1 228 ? -27.479 10.864  31.034  1.00 27.01 ? 271  LYS C O   1 
ATOM   7010  C  CB  . LYS C 1 228 ? -25.720 11.197  28.343  1.00 21.07 ? 271  LYS C CB  1 
ATOM   7011  C  CG  . LYS C 1 228 ? -25.085 10.550  27.102  1.00 19.62 ? 271  LYS C CG  1 
ATOM   7012  C  CD  . LYS C 1 228 ? -24.089 9.447   27.433  1.00 18.87 ? 271  LYS C CD  1 
ATOM   7013  C  CE  . LYS C 1 228 ? -23.406 8.924   26.185  1.00 20.48 ? 271  LYS C CE  1 
ATOM   7014  N  NZ  . LYS C 1 228 ? -22.463 7.818   26.495  1.00 20.40 ? 271  LYS C NZ  1 
ATOM   7015  N  N   . CYS C 1 229 ? -28.705 12.243  29.800  1.00 26.74 ? 272  CYS C N   1 
ATOM   7016  C  CA  . CYS C 1 229 ? -29.370 12.697  31.008  1.00 28.27 ? 272  CYS C CA  1 
ATOM   7017  C  C   . CYS C 1 229 ? -30.890 12.591  30.775  1.00 27.92 ? 272  CYS C C   1 
ATOM   7018  O  O   . CYS C 1 229 ? -31.575 13.588  31.030  1.00 26.96 ? 272  CYS C O   1 
ATOM   7019  C  CB  . CYS C 1 229 ? -28.983 14.139  31.399  1.00 29.62 ? 272  CYS C CB  1 
ATOM   7020  S  SG  . CYS C 1 229 ? -29.117 14.503  33.180  1.00 29.26 ? 272  CYS C SG  1 
ATOM   7021  N  N   . PRO C 1 230 ? -31.526 11.476  30.304  1.00 29.50 ? 273  PRO C N   1 
ATOM   7022  C  CA  . PRO C 1 230 ? -32.992 11.676  30.126  1.00 29.80 ? 273  PRO C CA  1 
ATOM   7023  C  C   . PRO C 1 230 ? -33.614 12.519  31.206  1.00 29.48 ? 273  PRO C C   1 
ATOM   7024  O  O   . PRO C 1 230 ? -34.460 13.387  30.966  1.00 28.49 ? 273  PRO C O   1 
ATOM   7025  C  CB  . PRO C 1 230 ? -33.488 10.295  29.819  1.00 29.43 ? 273  PRO C CB  1 
ATOM   7026  C  CG  . PRO C 1 230 ? -32.368 9.773   28.951  1.00 30.00 ? 273  PRO C CG  1 
ATOM   7027  C  CD  . PRO C 1 230 ? -31.090 10.474  29.305  1.00 30.64 ? 273  PRO C CD  1 
ATOM   7028  N  N   . GLY C 1 231 ? -33.177 12.244  32.417  1.00 29.24 ? 274  GLY C N   1 
ATOM   7029  C  CA  . GLY C 1 231 ? -33.657 12.872  33.616  1.00 29.90 ? 274  GLY C CA  1 
ATOM   7030  C  C   . GLY C 1 231 ? -33.595 14.401  33.594  1.00 30.29 ? 274  GLY C C   1 
ATOM   7031  O  O   . GLY C 1 231 ? -34.056 15.061  34.532  1.00 30.26 ? 274  GLY C O   1 
ATOM   7032  N  N   . CYS C 1 232 ? -33.028 14.985  32.543  1.00 28.88 ? 275  CYS C N   1 
ATOM   7033  C  CA  . CYS C 1 232 ? -32.930 16.424  32.504  1.00 28.61 ? 275  CYS C CA  1 
ATOM   7034  C  C   . CYS C 1 232 ? -33.954 17.075  31.595  1.00 28.61 ? 275  CYS C C   1 
ATOM   7035  O  O   . CYS C 1 232 ? -34.178 16.637  30.466  1.00 28.45 ? 275  CYS C O   1 
ATOM   7036  C  CB  . CYS C 1 232 ? -31.519 16.851  32.100  1.00 29.69 ? 275  CYS C CB  1 
ATOM   7037  S  SG  . CYS C 1 232 ? -31.200 18.609  32.419  1.00 29.08 ? 275  CYS C SG  1 
ATOM   7038  N  N   . ARG C 1 233 ? -34.568 18.134  32.119  1.00 27.59 ? 276  ARG C N   1 
ATOM   7039  C  CA  . ARG C 1 233 ? -35.569 18.913  31.403  1.00 26.01 ? 276  ARG C CA  1 
ATOM   7040  C  C   . ARG C 1 233 ? -34.892 19.887  30.434  1.00 25.43 ? 276  ARG C C   1 
ATOM   7041  O  O   . ARG C 1 233 ? -33.866 20.495  30.763  1.00 26.36 ? 276  ARG C O   1 
ATOM   7042  C  CB  . ARG C 1 233 ? -36.415 19.696  32.393  1.00 25.39 ? 276  ARG C CB  1 
ATOM   7043  C  CG  . ARG C 1 233 ? -37.092 18.844  33.428  1.00 26.94 ? 276  ARG C CG  1 
ATOM   7044  C  CD  . ARG C 1 233 ? -38.549 19.194  33.475  1.00 29.24 ? 276  ARG C CD  1 
ATOM   7045  N  NE  . ARG C 1 233 ? -39.228 18.738  32.268  1.00 32.85 ? 276  ARG C NE  1 
ATOM   7046  C  CZ  . ARG C 1 233 ? -40.207 19.402  31.659  1.00 35.91 ? 276  ARG C CZ  1 
ATOM   7047  N  NH1 . ARG C 1 233 ? -40.623 20.569  32.138  1.00 37.52 ? 276  ARG C NH1 1 
ATOM   7048  N  NH2 . ARG C 1 233 ? -40.787 18.888  30.583  1.00 35.63 ? 276  ARG C NH2 1 
ATOM   7049  N  N   . ILE C 1 234 ? -35.472 20.048  29.247  1.00 22.75 ? 277  ILE C N   1 
ATOM   7050  C  CA  . ILE C 1 234 ? -34.897 20.925  28.242  1.00 19.30 ? 277  ILE C CA  1 
ATOM   7051  C  C   . ILE C 1 234 ? -35.794 22.103  27.930  1.00 18.78 ? 277  ILE C C   1 
ATOM   7052  O  O   . ILE C 1 234 ? -36.708 21.969  27.130  1.00 20.29 ? 277  ILE C O   1 
ATOM   7053  C  CB  . ILE C 1 234 ? -34.690 20.183  26.932  1.00 17.51 ? 277  ILE C CB  1 
ATOM   7054  C  CG1 . ILE C 1 234 ? -34.013 18.840  27.180  1.00 16.53 ? 277  ILE C CG1 1 
ATOM   7055  C  CG2 . ILE C 1 234 ? -33.883 21.040  26.001  1.00 18.41 ? 277  ILE C CG2 1 
ATOM   7056  C  CD1 . ILE C 1 234 ? -32.569 18.927  27.541  1.00 16.40 ? 277  ILE C CD1 1 
ATOM   7057  N  N   . ILE C 1 235 ? -35.534 23.256  28.536  1.00 17.68 ? 278  ILE C N   1 
ATOM   7058  C  CA  . ILE C 1 235 ? -36.345 24.442  28.276  1.00 14.65 ? 278  ILE C CA  1 
ATOM   7059  C  C   . ILE C 1 235 ? -35.687 25.271  27.177  1.00 15.59 ? 278  ILE C C   1 
ATOM   7060  O  O   . ILE C 1 235 ? -34.494 25.105  26.913  1.00 14.68 ? 278  ILE C O   1 
ATOM   7061  C  CB  . ILE C 1 235 ? -36.467 25.305  29.521  1.00 13.87 ? 278  ILE C CB  1 
ATOM   7062  C  CG1 . ILE C 1 235 ? -36.784 24.423  30.740  1.00 14.21 ? 278  ILE C CG1 1 
ATOM   7063  C  CG2 . ILE C 1 235 ? -37.513 26.384  29.291  1.00 12.62 ? 278  ILE C CG2 1 
ATOM   7064  C  CD1 . ILE C 1 235 ? -38.164 23.797  30.749  1.00 12.67 ? 278  ILE C CD1 1 
ATOM   7065  N  N   . GLY C 1 236 ? -36.458 26.156  26.538  1.00 15.28 ? 279  GLY C N   1 
ATOM   7066  C  CA  . GLY C 1 236 ? -35.927 26.991  25.464  1.00 15.94 ? 279  GLY C CA  1 
ATOM   7067  C  C   . GLY C 1 236 ? -36.453 28.408  25.550  1.00 17.48 ? 279  GLY C C   1 
ATOM   7068  O  O   . GLY C 1 236 ? -37.626 28.619  25.856  1.00 18.03 ? 279  GLY C O   1 
ATOM   7069  N  N   . VAL C 1 237 ? -35.614 29.395  25.282  1.00 18.60 ? 280  VAL C N   1 
ATOM   7070  C  CA  . VAL C 1 237 ? -36.077 30.770  25.389  1.00 21.10 ? 280  VAL C CA  1 
ATOM   7071  C  C   . VAL C 1 237 ? -36.259 31.337  23.997  1.00 21.87 ? 280  VAL C C   1 
ATOM   7072  O  O   . VAL C 1 237 ? -35.351 31.257  23.178  1.00 21.57 ? 280  VAL C O   1 
ATOM   7073  C  CB  . VAL C 1 237 ? -35.069 31.635  26.192  1.00 22.64 ? 280  VAL C CB  1 
ATOM   7074  C  CG1 . VAL C 1 237 ? -35.671 33.001  26.507  1.00 22.86 ? 280  VAL C CG1 1 
ATOM   7075  C  CG2 . VAL C 1 237 ? -34.696 30.936  27.481  1.00 21.98 ? 280  VAL C CG2 1 
ATOM   7076  N  N   . ASP C 1 238 ? -37.440 31.899  23.736  1.00 23.30 ? 281  ASP C N   1 
ATOM   7077  C  CA  . ASP C 1 238 ? -37.778 32.466  22.421  1.00 23.84 ? 281  ASP C CA  1 
ATOM   7078  C  C   . ASP C 1 238 ? -38.411 33.863  22.527  1.00 23.99 ? 281  ASP C C   1 
ATOM   7079  O  O   . ASP C 1 238 ? -39.384 34.067  23.248  1.00 24.01 ? 281  ASP C O   1 
ATOM   7080  C  CB  . ASP C 1 238 ? -38.740 31.519  21.679  1.00 23.84 ? 281  ASP C CB  1 
ATOM   7081  C  CG  . ASP C 1 238 ? -39.049 31.976  20.249  1.00 25.75 ? 281  ASP C CG  1 
ATOM   7082  O  OD1 . ASP C 1 238 ? -40.235 32.235  19.933  1.00 26.72 ? 281  ASP C OD1 1 
ATOM   7083  O  OD2 . ASP C 1 238 ? -38.104 32.073  19.437  1.00 26.11 ? 281  ASP C OD2 1 
ATOM   7084  N  N   . PRO C 1 239 ? -37.862 34.838  21.795  1.00 23.45 ? 282  PRO C N   1 
ATOM   7085  C  CA  . PRO C 1 239 ? -38.336 36.225  21.774  1.00 25.85 ? 282  PRO C CA  1 
ATOM   7086  C  C   . PRO C 1 239 ? -39.707 36.501  21.126  1.00 28.18 ? 282  PRO C C   1 
ATOM   7087  O  O   . PRO C 1 239 ? -40.052 35.925  20.087  1.00 27.55 ? 282  PRO C O   1 
ATOM   7088  C  CB  . PRO C 1 239 ? -37.210 36.957  21.038  1.00 26.29 ? 282  PRO C CB  1 
ATOM   7089  C  CG  . PRO C 1 239 ? -36.680 35.914  20.109  1.00 23.79 ? 282  PRO C CG  1 
ATOM   7090  C  CD  . PRO C 1 239 ? -36.636 34.690  20.993  1.00 23.89 ? 282  PRO C CD  1 
ATOM   7091  N  N   . GLU C 1 240 ? -40.474 37.402  21.747  1.00 28.41 ? 283  GLU C N   1 
ATOM   7092  C  CA  . GLU C 1 240 ? -41.780 37.796  21.221  1.00 28.37 ? 283  GLU C CA  1 
ATOM   7093  C  C   . GLU C 1 240 ? -41.571 38.260  19.778  1.00 28.95 ? 283  GLU C C   1 
ATOM   7094  O  O   . GLU C 1 240 ? -40.568 38.907  19.471  1.00 29.20 ? 283  GLU C O   1 
ATOM   7095  C  CB  . GLU C 1 240 ? -42.375 38.953  22.042  1.00 28.54 ? 283  GLU C CB  1 
ATOM   7096  C  CG  . GLU C 1 240 ? -42.660 38.616  23.503  1.00 30.54 ? 283  GLU C CG  1 
ATOM   7097  C  CD  . GLU C 1 240 ? -43.910 39.313  24.055  1.00 30.03 ? 283  GLU C CD  1 
ATOM   7098  O  OE1 . GLU C 1 240 ? -44.314 39.006  25.200  1.00 27.80 ? 283  GLU C OE1 1 
ATOM   7099  O  OE2 . GLU C 1 240 ? -44.491 40.161  23.341  1.00 31.16 ? 283  GLU C OE2 1 
ATOM   7100  N  N   . GLY C 1 241 ? -42.513 37.936  18.897  1.00 28.50 ? 284  GLY C N   1 
ATOM   7101  C  CA  . GLY C 1 241 ? -42.381 38.334  17.506  1.00 27.35 ? 284  GLY C CA  1 
ATOM   7102  C  C   . GLY C 1 241 ? -41.585 37.309  16.716  1.00 26.23 ? 284  GLY C C   1 
ATOM   7103  O  O   . GLY C 1 241 ? -41.272 37.506  15.541  1.00 27.08 ? 284  GLY C O   1 
ATOM   7104  N  N   . SER C 1 242 ? -41.277 36.213  17.384  1.00 24.73 ? 285  SER C N   1 
ATOM   7105  C  CA  . SER C 1 242 ? -40.528 35.151  16.814  1.00 22.62 ? 285  SER C CA  1 
ATOM   7106  C  C   . SER C 1 242 ? -41.383 33.923  16.724  1.00 22.25 ? 285  SER C C   1 
ATOM   7107  O  O   . SER C 1 242 ? -42.473 33.861  17.270  1.00 22.66 ? 285  SER C O   1 
ATOM   7108  C  CB  . SER C 1 242 ? -39.270 34.810  17.637  1.00 21.39 ? 285  SER C CB  1 
ATOM   7109  O  OG  . SER C 1 242 ? -38.536 33.756  17.034  1.00 19.31 ? 285  SER C OG  1 
ATOM   7110  N  N   . ILE C 1 243 ? -40.863 32.920  16.009  1.00 21.95 ? 286  ILE C N   1 
ATOM   7111  C  CA  . ILE C 1 243 ? -41.586 31.676  15.867  1.00 21.58 ? 286  ILE C CA  1 
ATOM   7112  C  C   . ILE C 1 243 ? -40.754 30.376  16.125  1.00 21.15 ? 286  ILE C C   1 
ATOM   7113  O  O   . ILE C 1 243 ? -41.338 29.285  16.014  1.00 21.26 ? 286  ILE C O   1 
ATOM   7114  C  CB  . ILE C 1 243 ? -42.295 31.674  14.495  1.00 20.31 ? 286  ILE C CB  1 
ATOM   7115  C  CG1 . ILE C 1 243 ? -41.255 31.714  13.372  1.00 20.03 ? 286  ILE C CG1 1 
ATOM   7116  C  CG2 . ILE C 1 243 ? -43.235 32.858  14.378  1.00 19.72 ? 286  ILE C CG2 1 
ATOM   7117  C  CD1 . ILE C 1 243 ? -40.658 30.362  13.054  1.00 19.96 ? 286  ILE C CD1 1 
ATOM   7118  N  N   . LEU C 1 244 ? -39.473 30.364  16.507  1.00 21.56 ? 287  LEU C N   1 
ATOM   7119  C  CA  . LEU C 1 244 ? -38.911 29.023  16.810  1.00 22.34 ? 287  LEU C CA  1 
ATOM   7120  C  C   . LEU C 1 244 ? -39.451 28.605  18.201  1.00 22.67 ? 287  LEU C C   1 
ATOM   7121  O  O   . LEU C 1 244 ? -38.711 28.314  19.150  1.00 24.13 ? 287  LEU C O   1 
ATOM   7122  C  CB  . LEU C 1 244 ? -37.357 28.986  16.741  1.00 23.24 ? 287  LEU C CB  1 
ATOM   7123  C  CG  . LEU C 1 244 ? -36.459 29.700  17.771  1.00 22.18 ? 287  LEU C CG  1 
ATOM   7124  C  CD1 . LEU C 1 244 ? -35.354 28.783  18.281  1.00 20.50 ? 287  LEU C CD1 1 
ATOM   7125  C  CD2 . LEU C 1 244 ? -35.867 30.955  17.142  1.00 21.70 ? 287  LEU C CD2 1 
ATOM   7126  N  N   . ALA C 1 245 ? -40.788 28.543  18.188  1.00 23.63 ? 288  ALA C N   1 
ATOM   7127  C  CA  . ALA C 1 245 ? -41.579 28.195  19.351  1.00 24.74 ? 288  ALA C CA  1 
ATOM   7128  C  C   . ALA C 1 245 ? -42.691 27.182  19.163  1.00 25.55 ? 288  ALA C C   1 
ATOM   7129  O  O   . ALA C 1 245 ? -43.160 26.885  18.076  1.00 25.12 ? 288  ALA C O   1 
ATOM   7130  C  CB  . ALA C 1 245 ? -42.159 29.475  19.948  1.00 23.57 ? 288  ALA C CB  1 
ATOM   7131  N  N   . GLU C 1 246 ? -43.064 26.673  20.363  1.00 26.73 ? 289  GLU C N   1 
ATOM   7132  C  CA  . GLU C 1 246 ? -44.026 25.594  20.647  1.00 28.02 ? 289  GLU C CA  1 
ATOM   7133  C  C   . GLU C 1 246 ? -44.724 25.517  22.033  1.00 28.31 ? 289  GLU C C   1 
ATOM   7134  O  O   . GLU C 1 246 ? -44.196 25.372  23.137  1.00 28.19 ? 289  GLU C O   1 
ATOM   7135  C  CB  . GLU C 1 246 ? -43.342 24.241  20.350  1.00 26.84 ? 289  GLU C CB  1 
ATOM   7136  C  CG  . GLU C 1 246 ? -43.802 23.649  19.017  1.00 26.24 ? 289  GLU C CG  1 
ATOM   7137  C  CD  . GLU C 1 246 ? -43.004 22.472  18.475  1.00 26.76 ? 289  GLU C CD  1 
ATOM   7138  O  OE1 . GLU C 1 246 ? -42.390 21.750  19.294  1.00 27.92 ? 289  GLU C OE1 1 
ATOM   7139  O  OE2 . GLU C 1 246 ? -42.979 22.271  17.240  1.00 28.20 ? 289  GLU C OE2 1 
ATOM   7140  N  N   . PRO C 1 247 ? -46.015 25.633  21.753  1.00 29.17 ? 290  PRO C N   1 
ATOM   7141  C  CA  . PRO C 1 247 ? -47.508 25.747  21.625  1.00 30.52 ? 290  PRO C CA  1 
ATOM   7142  C  C   . PRO C 1 247 ? -47.703 26.756  20.557  1.00 32.31 ? 290  PRO C C   1 
ATOM   7143  O  O   . PRO C 1 247 ? -48.056 27.913  20.834  1.00 34.07 ? 290  PRO C O   1 
ATOM   7144  C  CB  . PRO C 1 247 ? -48.347 25.774  22.888  1.00 28.68 ? 290  PRO C CB  1 
ATOM   7145  C  CG  . PRO C 1 247 ? -47.588 24.788  23.620  1.00 29.06 ? 290  PRO C CG  1 
ATOM   7146  C  CD  . PRO C 1 247 ? -46.240 25.107  23.140  1.00 29.84 ? 290  PRO C CD  1 
ATOM   7147  N  N   . GLU C 1 248 ? -47.509 26.339  19.324  1.00 33.96 ? 291  GLU C N   1 
ATOM   7148  C  CA  . GLU C 1 248 ? -47.640 27.361  18.336  1.00 33.98 ? 291  GLU C CA  1 
ATOM   7149  C  C   . GLU C 1 248 ? -48.296 28.577  18.979  1.00 34.15 ? 291  GLU C C   1 
ATOM   7150  O  O   . GLU C 1 248 ? -47.794 29.685  18.884  1.00 35.22 ? 291  GLU C O   1 
ATOM   7151  C  CB  . GLU C 1 248 ? -48.452 26.919  17.134  1.00 33.76 ? 291  GLU C CB  1 
ATOM   7152  C  CG  . GLU C 1 248 ? -48.132 27.834  15.982  1.00 34.38 ? 291  GLU C CG  1 
ATOM   7153  C  CD  . GLU C 1 248 ? -47.441 29.095  16.470  1.00 34.26 ? 291  GLU C CD  1 
ATOM   7154  O  OE1 . GLU C 1 248 ? -46.261 29.020  16.861  1.00 32.88 ? 291  GLU C OE1 1 
ATOM   7155  O  OE2 . GLU C 1 248 ? -48.092 30.152  16.472  1.00 31.65 ? 291  GLU C OE2 1 
ATOM   7156  N  N   . GLU C 1 249 ? -49.429 28.342  19.635  1.00 33.79 ? 292  GLU C N   1 
ATOM   7157  C  CA  . GLU C 1 249 ? -50.253 29.343  20.269  1.00 33.84 ? 292  GLU C CA  1 
ATOM   7158  C  C   . GLU C 1 249 ? -49.459 30.416  21.042  1.00 33.26 ? 292  GLU C C   1 
ATOM   7159  O  O   . GLU C 1 249 ? -49.895 31.558  21.121  1.00 31.84 ? 292  GLU C O   1 
ATOM   7160  C  CB  . GLU C 1 249 ? -51.370 28.585  21.013  1.00 35.59 ? 292  GLU C CB  1 
ATOM   7161  C  CG  . GLU C 1 249 ? -52.142 27.659  20.060  1.00 36.33 ? 292  GLU C CG  1 
ATOM   7162  C  CD  . GLU C 1 249 ? -53.035 26.636  20.734  1.00 37.49 ? 292  GLU C CD  1 
ATOM   7163  O  OE1 . GLU C 1 249 ? -52.676 26.149  21.829  1.00 37.24 ? 292  GLU C OE1 1 
ATOM   7164  O  OE2 . GLU C 1 249 ? -54.097 26.316  20.165  1.00 37.64 ? 292  GLU C OE2 1 
ATOM   7165  N  N   . LEU C 1 250 ? -48.314 30.056  21.595  1.00 32.89 ? 293  LEU C N   1 
ATOM   7166  C  CA  . LEU C 1 250 ? -47.402 31.071  22.163  1.00 32.60 ? 293  LEU C CA  1 
ATOM   7167  C  C   . LEU C 1 250 ? -46.777 32.199  21.357  1.00 33.74 ? 293  LEU C C   1 
ATOM   7168  O  O   . LEU C 1 250 ? -46.110 33.055  21.933  1.00 33.54 ? 293  LEU C O   1 
ATOM   7169  C  CB  . LEU C 1 250 ? -46.262 30.333  22.857  1.00 31.52 ? 293  LEU C CB  1 
ATOM   7170  C  CG  . LEU C 1 250 ? -46.586 29.112  23.715  1.00 30.43 ? 293  LEU C CG  1 
ATOM   7171  C  CD1 . LEU C 1 250 ? -45.334 28.614  24.433  1.00 30.03 ? 293  LEU C CD1 1 
ATOM   7172  C  CD2 . LEU C 1 250 ? -47.696 29.415  24.720  1.00 30.55 ? 293  LEU C CD2 1 
ATOM   7173  N  N   . ASN C 1 251 ? -47.011 32.236  20.045  1.00 34.75 ? 294  ASN C N   1 
ATOM   7174  C  CA  . ASN C 1 251 ? -46.303 33.289  19.276  1.00 37.87 ? 294  ASN C CA  1 
ATOM   7175  C  C   . ASN C 1 251 ? -47.140 34.489  18.799  1.00 40.23 ? 294  ASN C C   1 
ATOM   7176  O  O   . ASN C 1 251 ? -46.752 35.167  17.847  1.00 40.97 ? 294  ASN C O   1 
ATOM   7177  C  CB  . ASN C 1 251 ? -45.612 32.665  18.095  1.00 37.93 ? 294  ASN C CB  1 
ATOM   7178  C  CG  . ASN C 1 251 ? -44.347 31.963  18.512  1.00 39.12 ? 294  ASN C CG  1 
ATOM   7179  O  OD1 . ASN C 1 251 ? -43.420 32.595  19.024  1.00 39.00 ? 294  ASN C OD1 1 
ATOM   7180  N  ND2 . ASN C 1 251 ? -44.295 30.650  18.306  1.00 38.70 ? 294  ASN C ND2 1 
ATOM   7181  N  N   . GLN C 1 252 ? -48.273 34.757  19.425  1.00 42.34 ? 295  GLN C N   1 
ATOM   7182  C  CA  . GLN C 1 252 ? -49.063 35.891  18.964  1.00 46.10 ? 295  GLN C CA  1 
ATOM   7183  C  C   . GLN C 1 252 ? -49.096 37.175  19.820  1.00 47.73 ? 295  GLN C C   1 
ATOM   7184  O  O   . GLN C 1 252 ? -50.016 37.381  20.624  1.00 48.97 ? 295  GLN C O   1 
ATOM   7185  C  CB  . GLN C 1 252 ? -50.495 35.431  18.673  1.00 47.90 ? 295  GLN C CB  1 
ATOM   7186  C  CG  . GLN C 1 252 ? -50.564 34.249  17.726  1.00 51.00 ? 295  GLN C CG  1 
ATOM   7187  C  CD  . GLN C 1 252 ? -51.964 34.012  17.179  1.00 52.87 ? 295  GLN C CD  1 
ATOM   7188  O  OE1 . GLN C 1 252 ? -52.528 34.835  16.450  1.00 53.51 ? 295  GLN C OE1 1 
ATOM   7189  N  NE2 . GLN C 1 252 ? -52.550 32.874  17.525  1.00 53.04 ? 295  GLN C NE2 1 
ATOM   7190  N  N   . THR C 1 253 ? -48.104 38.049  19.619  1.00 48.28 ? 296  THR C N   1 
ATOM   7191  C  CA  . THR C 1 253 ? -48.027 39.337  20.325  1.00 48.68 ? 296  THR C CA  1 
ATOM   7192  C  C   . THR C 1 253 ? -47.501 40.412  19.365  1.00 48.33 ? 296  THR C C   1 
ATOM   7193  O  O   . THR C 1 253 ? -46.497 40.215  18.672  1.00 47.51 ? 296  THR C O   1 
ATOM   7194  C  CB  . THR C 1 253 ? -47.102 39.301  21.600  1.00 49.47 ? 296  THR C CB  1 
ATOM   7195  O  OG1 . THR C 1 253 ? -47.630 38.377  22.566  1.00 48.03 ? 296  THR C OG1 1 
ATOM   7196  C  CG2 . THR C 1 253 ? -47.024 40.693  22.250  1.00 48.42 ? 296  THR C CG2 1 
ATOM   7197  N  N   . GLU C 1 254 ? -48.201 41.546  19.357  1.00 47.98 ? 297  GLU C N   1 
ATOM   7198  C  CA  . GLU C 1 254 ? -47.918 42.711  18.518  1.00 47.15 ? 297  GLU C CA  1 
ATOM   7199  C  C   . GLU C 1 254 ? -46.490 42.856  18.001  1.00 46.35 ? 297  GLU C C   1 
ATOM   7200  O  O   . GLU C 1 254 ? -46.281 43.260  16.858  1.00 46.12 ? 297  GLU C O   1 
ATOM   7201  C  CB  . GLU C 1 254 ? -48.319 43.984  19.278  1.00 48.13 ? 297  GLU C CB  1 
ATOM   7202  C  CG  . GLU C 1 254 ? -48.806 45.119  18.386  1.00 49.35 ? 297  GLU C CG  1 
ATOM   7203  C  CD  . GLU C 1 254 ? -47.720 45.671  17.476  1.00 50.23 ? 297  GLU C CD  1 
ATOM   7204  O  OE1 . GLU C 1 254 ? -46.860 46.445  17.960  1.00 51.36 ? 297  GLU C OE1 1 
ATOM   7205  O  OE2 . GLU C 1 254 ? -47.725 45.319  16.275  1.00 49.88 ? 297  GLU C OE2 1 
ATOM   7206  N  N   . GLN C 1 255 ? -45.509 42.529  18.833  1.00 45.92 ? 298  GLN C N   1 
ATOM   7207  C  CA  . GLN C 1 255 ? -44.110 42.663  18.435  1.00 45.64 ? 298  GLN C CA  1 
ATOM   7208  C  C   . GLN C 1 255 ? -43.809 41.994  17.086  1.00 44.93 ? 298  GLN C C   1 
ATOM   7209  O  O   . GLN C 1 255 ? -44.006 40.787  16.913  1.00 45.64 ? 298  GLN C O   1 
ATOM   7210  C  CB  . GLN C 1 255 ? -43.182 42.084  19.522  1.00 46.21 ? 298  GLN C CB  1 
ATOM   7211  C  CG  . GLN C 1 255 ? -43.572 42.420  20.977  1.00 46.82 ? 298  GLN C CG  1 
ATOM   7212  C  CD  . GLN C 1 255 ? -43.654 43.915  21.267  1.00 47.21 ? 298  GLN C CD  1 
ATOM   7213  O  OE1 . GLN C 1 255 ? -42.653 44.638  21.200  1.00 47.26 ? 298  GLN C OE1 1 
ATOM   7214  N  NE2 . GLN C 1 255 ? -44.856 44.384  21.595  1.00 45.97 ? 298  GLN C NE2 1 
ATOM   7215  N  N   . THR C 1 256 ? -43.344 42.789  16.127  1.00 43.43 ? 299  THR C N   1 
ATOM   7216  C  CA  . THR C 1 256 ? -42.994 42.266  14.811  1.00 41.81 ? 299  THR C CA  1 
ATOM   7217  C  C   . THR C 1 256 ? -41.493 41.974  14.832  1.00 39.90 ? 299  THR C C   1 
ATOM   7218  O  O   . THR C 1 256 ? -41.043 40.935  14.345  1.00 39.32 ? 299  THR C O   1 
ATOM   7219  C  CB  . THR C 1 256 ? -43.327 43.283  13.682  1.00 43.15 ? 299  THR C CB  1 
ATOM   7220  O  OG1 . THR C 1 256 ? -44.740 43.538  13.662  1.00 43.23 ? 299  THR C OG1 1 
ATOM   7221  C  CG2 . THR C 1 256 ? -42.914 42.730  12.321  1.00 43.63 ? 299  THR C CG2 1 
ATOM   7222  N  N   . THR C 1 257 ? -40.728 42.899  15.407  1.00 37.98 ? 300  THR C N   1 
ATOM   7223  C  CA  . THR C 1 257 ? -39.282 42.738  15.549  1.00 36.17 ? 300  THR C CA  1 
ATOM   7224  C  C   . THR C 1 257 ? -38.920 42.989  17.012  1.00 35.40 ? 300  THR C C   1 
ATOM   7225  O  O   . THR C 1 257 ? -39.810 43.089  17.859  1.00 35.23 ? 300  THR C O   1 
ATOM   7226  C  CB  . THR C 1 257 ? -38.496 43.725  14.668  1.00 35.17 ? 300  THR C CB  1 
ATOM   7227  O  OG1 . THR C 1 257 ? -39.025 45.045  14.840  1.00 34.52 ? 300  THR C OG1 1 
ATOM   7228  C  CG2 . THR C 1 257 ? -38.569 43.312  13.203  1.00 35.25 ? 300  THR C CG2 1 
ATOM   7229  N  N   . TYR C 1 258 ? -37.622 43.079  17.304  1.00 34.48 ? 301  TYR C N   1 
ATOM   7230  C  CA  . TYR C 1 258 ? -37.143 43.319  18.667  1.00 33.48 ? 301  TYR C CA  1 
ATOM   7231  C  C   . TYR C 1 258 ? -35.667 43.733  18.715  1.00 33.05 ? 301  TYR C C   1 
ATOM   7232  O  O   . TYR C 1 258 ? -34.964 43.692  17.700  1.00 33.22 ? 301  TYR C O   1 
ATOM   7233  C  CB  . TYR C 1 258 ? -37.387 42.084  19.544  1.00 32.67 ? 301  TYR C CB  1 
ATOM   7234  C  CG  . TYR C 1 258 ? -36.987 40.754  18.924  1.00 34.04 ? 301  TYR C CG  1 
ATOM   7235  C  CD1 . TYR C 1 258 ? -35.652 40.345  18.883  1.00 33.13 ? 301  TYR C CD1 1 
ATOM   7236  C  CD2 . TYR C 1 258 ? -37.955 39.891  18.398  1.00 34.65 ? 301  TYR C CD2 1 
ATOM   7237  C  CE1 . TYR C 1 258 ? -35.299 39.117  18.343  1.00 32.93 ? 301  TYR C CE1 1 
ATOM   7238  C  CE2 . TYR C 1 258 ? -37.609 38.661  17.853  1.00 32.50 ? 301  TYR C CE2 1 
ATOM   7239  C  CZ  . TYR C 1 258 ? -36.284 38.278  17.830  1.00 32.90 ? 301  TYR C CZ  1 
ATOM   7240  O  OH  . TYR C 1 258 ? -35.943 37.052  17.303  1.00 30.12 ? 301  TYR C OH  1 
ATOM   7241  N  N   . GLU C 1 259 ? -35.201 44.123  19.899  1.00 31.51 ? 302  GLU C N   1 
ATOM   7242  C  CA  . GLU C 1 259 ? -33.828 44.586  20.062  1.00 30.24 ? 302  GLU C CA  1 
ATOM   7243  C  C   . GLU C 1 259 ? -32.792 43.517  20.419  1.00 28.76 ? 302  GLU C C   1 
ATOM   7244  O  O   . GLU C 1 259 ? -31.594 43.725  20.202  1.00 29.41 ? 302  GLU C O   1 
ATOM   7245  C  CB  . GLU C 1 259 ? -33.783 45.694  21.123  1.00 32.02 ? 302  GLU C CB  1 
ATOM   7246  C  CG  . GLU C 1 259 ? -34.814 46.828  20.959  1.00 32.23 ? 302  GLU C CG  1 
ATOM   7247  C  CD  . GLU C 1 259 ? -34.490 47.805  19.830  1.00 32.54 ? 302  GLU C CD  1 
ATOM   7248  O  OE1 . GLU C 1 259 ? -33.301 48.176  19.664  1.00 31.40 ? 302  GLU C OE1 1 
ATOM   7249  O  OE2 . GLU C 1 259 ? -35.438 48.214  19.121  1.00 32.62 ? 302  GLU C OE2 1 
ATOM   7250  N  N   . VAL C 1 260 ? -33.234 42.389  20.973  1.00 26.40 ? 303  VAL C N   1 
ATOM   7251  C  CA  . VAL C 1 260 ? -32.299 41.331  21.355  1.00 23.04 ? 303  VAL C CA  1 
ATOM   7252  C  C   . VAL C 1 260 ? -31.702 40.716  20.109  1.00 22.47 ? 303  VAL C C   1 
ATOM   7253  O  O   . VAL C 1 260 ? -32.336 40.711  19.056  1.00 22.70 ? 303  VAL C O   1 
ATOM   7254  C  CB  . VAL C 1 260 ? -32.973 40.205  22.141  1.00 22.26 ? 303  VAL C CB  1 
ATOM   7255  C  CG1 . VAL C 1 260 ? -31.914 39.405  22.844  1.00 21.71 ? 303  VAL C CG1 1 
ATOM   7256  C  CG2 . VAL C 1 260 ? -33.983 40.755  23.122  1.00 20.69 ? 303  VAL C CG2 1 
ATOM   7257  N  N   . GLU C 1 261 ? -30.497 40.174  20.227  1.00 21.22 ? 304  GLU C N   1 
ATOM   7258  C  CA  . GLU C 1 261 ? -29.839 39.582  19.071  1.00 20.54 ? 304  GLU C CA  1 
ATOM   7259  C  C   . GLU C 1 261 ? -29.415 38.132  19.275  1.00 20.89 ? 304  GLU C C   1 
ATOM   7260  O  O   . GLU C 1 261 ? -29.290 37.670  20.405  1.00 23.25 ? 304  GLU C O   1 
ATOM   7261  C  CB  . GLU C 1 261 ? -28.647 40.450  18.684  1.00 19.33 ? 304  GLU C CB  1 
ATOM   7262  C  CG  . GLU C 1 261 ? -29.071 41.852  18.287  1.00 18.47 ? 304  GLU C CG  1 
ATOM   7263  C  CD  . GLU C 1 261 ? -28.000 42.904  18.532  1.00 18.50 ? 304  GLU C CD  1 
ATOM   7264  O  OE1 . GLU C 1 261 ? -28.380 44.023  18.953  1.00 21.64 ? 304  GLU C OE1 1 
ATOM   7265  O  OE2 . GLU C 1 261 ? -26.800 42.626  18.301  1.00 16.53 ? 304  GLU C OE2 1 
ATOM   7266  N  N   . GLY C 1 262 ? -29.215 37.414  18.172  1.00 20.07 ? 305  GLY C N   1 
ATOM   7267  C  CA  . GLY C 1 262 ? -28.818 36.017  18.251  1.00 21.07 ? 305  GLY C CA  1 
ATOM   7268  C  C   . GLY C 1 262 ? -29.953 35.010  18.419  1.00 21.90 ? 305  GLY C C   1 
ATOM   7269  O  O   . GLY C 1 262 ? -29.800 33.847  18.049  1.00 20.63 ? 305  GLY C O   1 
ATOM   7270  N  N   . ILE C 1 263 ? -31.086 35.443  18.971  1.00 22.29 ? 306  ILE C N   1 
ATOM   7271  C  CA  . ILE C 1 263 ? -32.221 34.552  19.199  1.00 23.17 ? 306  ILE C CA  1 
ATOM   7272  C  C   . ILE C 1 263 ? -33.452 34.940  18.405  1.00 25.62 ? 306  ILE C C   1 
ATOM   7273  O  O   . ILE C 1 263 ? -33.680 36.118  18.154  1.00 25.57 ? 306  ILE C O   1 
ATOM   7274  C  CB  . ILE C 1 263 ? -32.668 34.534  20.683  1.00 21.80 ? 306  ILE C CB  1 
ATOM   7275  C  CG1 . ILE C 1 263 ? -32.859 35.964  21.182  1.00 21.07 ? 306  ILE C CG1 1 
ATOM   7276  C  CG2 . ILE C 1 263 ? -31.688 33.770  21.536  1.00 20.11 ? 306  ILE C CG2 1 
ATOM   7277  C  CD1 . ILE C 1 263 ? -33.461 36.048  22.575  1.00 20.03 ? 306  ILE C CD1 1 
ATOM   7278  N  N   . GLY C 1 264 ? -34.251 33.938  18.036  1.00 26.97 ? 307  GLY C N   1 
ATOM   7279  C  CA  . GLY C 1 264 ? -35.478 34.183  17.297  1.00 28.26 ? 307  GLY C CA  1 
ATOM   7280  C  C   . GLY C 1 264 ? -35.362 34.171  15.786  1.00 29.37 ? 307  GLY C C   1 
ATOM   7281  O  O   . GLY C 1 264 ? -34.426 34.722  15.218  1.00 30.35 ? 307  GLY C O   1 
ATOM   7282  N  N   . TYR C 1 265 ? -36.329 33.549  15.125  1.00 30.27 ? 308  TYR C N   1 
ATOM   7283  C  CA  . TYR C 1 265 ? -36.333 33.472  13.670  1.00 31.17 ? 308  TYR C CA  1 
ATOM   7284  C  C   . TYR C 1 265 ? -37.773 33.460  13.176  1.00 31.64 ? 308  TYR C C   1 
ATOM   7285  O  O   . TYR C 1 265 ? -38.691 33.153  13.936  1.00 31.49 ? 308  TYR C O   1 
ATOM   7286  C  CB  . TYR C 1 265 ? -35.630 32.194  13.224  1.00 31.80 ? 308  TYR C CB  1 
ATOM   7287  C  CG  . TYR C 1 265 ? -34.791 32.336  11.973  1.00 32.73 ? 308  TYR C CG  1 
ATOM   7288  C  CD1 . TYR C 1 265 ? -33.782 33.289  11.897  1.00 33.12 ? 308  TYR C CD1 1 
ATOM   7289  C  CD2 . TYR C 1 265 ? -34.965 31.474  10.885  1.00 33.37 ? 308  TYR C CD2 1 
ATOM   7290  C  CE1 . TYR C 1 265 ? -32.968 33.380  10.782  1.00 34.26 ? 308  TYR C CE1 1 
ATOM   7291  C  CE2 . TYR C 1 265 ? -34.150 31.555  9.763   1.00 33.30 ? 308  TYR C CE2 1 
ATOM   7292  C  CZ  . TYR C 1 265 ? -33.152 32.510  9.719   1.00 34.49 ? 308  TYR C CZ  1 
ATOM   7293  O  OH  . TYR C 1 265 ? -32.324 32.594  8.622   1.00 34.64 ? 308  TYR C OH  1 
ATOM   7294  N  N   . ASP C 1 266 ? -37.970 33.806  11.909  1.00 32.27 ? 309  ASP C N   1 
ATOM   7295  C  CA  . ASP C 1 266 ? -39.303 33.801  11.313  1.00 32.33 ? 309  ASP C CA  1 
ATOM   7296  C  C   . ASP C 1 266 ? -39.518 32.520  10.494  1.00 31.77 ? 309  ASP C C   1 
ATOM   7297  O  O   . ASP C 1 266 ? -40.528 32.361  9.811   1.00 31.18 ? 309  ASP C O   1 
ATOM   7298  C  CB  . ASP C 1 266 ? -39.494 35.033  10.431  1.00 32.57 ? 309  ASP C CB  1 
ATOM   7299  C  CG  . ASP C 1 266 ? -38.252 35.381  9.640   1.00 36.06 ? 309  ASP C CG  1 
ATOM   7300  O  OD1 . ASP C 1 266 ? -37.605 34.456  9.092   1.00 35.58 ? 309  ASP C OD1 1 
ATOM   7301  O  OD2 . ASP C 1 266 ? -37.928 36.587  9.559   1.00 37.57 ? 309  ASP C OD2 1 
ATOM   7302  N  N   . PHE C 1 267 ? -38.547 31.615  10.579  1.00 31.23 ? 310  PHE C N   1 
ATOM   7303  C  CA  . PHE C 1 267 ? -38.575 30.329  9.894   1.00 31.47 ? 310  PHE C CA  1 
ATOM   7304  C  C   . PHE C 1 267 ? -38.119 29.281  10.892  1.00 31.61 ? 310  PHE C C   1 
ATOM   7305  O  O   . PHE C 1 267 ? -37.282 29.561  11.745  1.00 32.97 ? 310  PHE C O   1 
ATOM   7306  C  CB  . PHE C 1 267 ? -37.598 30.306  8.711   1.00 31.15 ? 310  PHE C CB  1 
ATOM   7307  C  CG  . PHE C 1 267 ? -38.152 30.875  7.441   1.00 32.97 ? 310  PHE C CG  1 
ATOM   7308  C  CD1 . PHE C 1 267 ? -37.370 30.913  6.292   1.00 33.74 ? 310  PHE C CD1 1 
ATOM   7309  C  CD2 . PHE C 1 267 ? -39.450 31.368  7.380   1.00 33.37 ? 310  PHE C CD2 1 
ATOM   7310  C  CE1 . PHE C 1 267 ? -37.874 31.437  5.099   1.00 34.12 ? 310  PHE C CE1 1 
ATOM   7311  C  CE2 . PHE C 1 267 ? -39.962 31.893  6.195   1.00 33.87 ? 310  PHE C CE2 1 
ATOM   7312  C  CZ  . PHE C 1 267 ? -39.176 31.928  5.055   1.00 33.21 ? 310  PHE C CZ  1 
ATOM   7313  N  N   . ILE C 1 268 ? -38.660 28.073  10.796  1.00 31.42 ? 311  ILE C N   1 
ATOM   7314  C  CA  . ILE C 1 268 ? -38.246 27.015  11.700  1.00 30.32 ? 311  ILE C CA  1 
ATOM   7315  C  C   . ILE C 1 268 ? -36.884 26.541  11.204  1.00 30.28 ? 311  ILE C C   1 
ATOM   7316  O  O   . ILE C 1 268 ? -36.757 26.000  10.111  1.00 29.47 ? 311  ILE C O   1 
ATOM   7317  C  CB  . ILE C 1 268 ? -39.252 25.848  11.705  1.00 30.78 ? 311  ILE C CB  1 
ATOM   7318  C  CG1 . ILE C 1 268 ? -40.609 26.334  12.219  1.00 31.18 ? 311  ILE C CG1 1 
ATOM   7319  C  CG2 . ILE C 1 268 ? -38.762 24.741  12.606  1.00 29.57 ? 311  ILE C CG2 1 
ATOM   7320  C  CD1 . ILE C 1 268 ? -41.735 25.334  12.013  1.00 32.08 ? 311  ILE C CD1 1 
ATOM   7321  N  N   . PRO C 1 269 ? -35.836 26.775  12.002  1.00 30.39 ? 312  PRO C N   1 
ATOM   7322  C  CA  . PRO C 1 269 ? -34.473 26.378  11.650  1.00 28.89 ? 312  PRO C CA  1 
ATOM   7323  C  C   . PRO C 1 269 ? -34.389 24.914  11.280  1.00 26.81 ? 312  PRO C C   1 
ATOM   7324  O  O   . PRO C 1 269 ? -34.763 24.032  12.048  1.00 26.79 ? 312  PRO C O   1 
ATOM   7325  C  CB  . PRO C 1 269 ? -33.687 26.711  12.907  1.00 30.37 ? 312  PRO C CB  1 
ATOM   7326  C  CG  . PRO C 1 269 ? -34.408 27.913  13.430  1.00 31.79 ? 312  PRO C CG  1 
ATOM   7327  C  CD  . PRO C 1 269 ? -35.855 27.492  13.290  1.00 30.59 ? 312  PRO C CD  1 
ATOM   7328  N  N   . THR C 1 270 ? -33.883 24.663  10.085  1.00 25.69 ? 313  THR C N   1 
ATOM   7329  C  CA  . THR C 1 270 ? -33.766 23.305  9.594   1.00 24.24 ? 313  THR C CA  1 
ATOM   7330  C  C   . THR C 1 270 ? -32.929 22.406  10.520  1.00 24.25 ? 313  THR C C   1 
ATOM   7331  O  O   . THR C 1 270 ? -33.080 21.185  10.507  1.00 24.21 ? 313  THR C O   1 
ATOM   7332  C  CB  . THR C 1 270 ? -33.198 23.326  8.149   1.00 23.01 ? 313  THR C CB  1 
ATOM   7333  O  OG1 . THR C 1 270 ? -31.953 22.620  8.097   1.00 20.59 ? 313  THR C OG1 1 
ATOM   7334  C  CG2 . THR C 1 270 ? -33.007 24.780  7.680   1.00 19.55 ? 313  THR C CG2 1 
ATOM   7335  N  N   . VAL C 1 271 ? -32.075 23.008  11.343  1.00 22.67 ? 314  VAL C N   1 
ATOM   7336  C  CA  . VAL C 1 271 ? -31.229 22.244  12.255  1.00 22.43 ? 314  VAL C CA  1 
ATOM   7337  C  C   . VAL C 1 271 ? -31.744 22.192  13.685  1.00 23.37 ? 314  VAL C C   1 
ATOM   7338  O  O   . VAL C 1 271 ? -31.063 21.695  14.595  1.00 23.46 ? 314  VAL C O   1 
ATOM   7339  C  CB  . VAL C 1 271 ? -29.821 22.810  12.297  1.00 22.00 ? 314  VAL C CB  1 
ATOM   7340  C  CG1 . VAL C 1 271 ? -29.138 22.557  10.978  1.00 22.60 ? 314  VAL C CG1 1 
ATOM   7341  C  CG2 . VAL C 1 271 ? -29.877 24.305  12.600  1.00 23.87 ? 314  VAL C CG2 1 
ATOM   7342  N  N   . LEU C 1 272 ? -32.952 22.697  13.889  1.00 23.19 ? 315  LEU C N   1 
ATOM   7343  C  CA  . LEU C 1 272 ? -33.540 22.695  15.216  1.00 23.57 ? 315  LEU C CA  1 
ATOM   7344  C  C   . LEU C 1 272 ? -34.541 21.558  15.418  1.00 23.69 ? 315  LEU C C   1 
ATOM   7345  O  O   . LEU C 1 272 ? -35.641 21.563  14.874  1.00 23.96 ? 315  LEU C O   1 
ATOM   7346  C  CB  . LEU C 1 272 ? -34.211 24.046  15.479  1.00 22.96 ? 315  LEU C CB  1 
ATOM   7347  C  CG  . LEU C 1 272 ? -35.155 24.174  16.676  1.00 21.63 ? 315  LEU C CG  1 
ATOM   7348  C  CD1 . LEU C 1 272 ? -34.431 23.804  17.955  1.00 20.68 ? 315  LEU C CD1 1 
ATOM   7349  C  CD2 . LEU C 1 272 ? -35.685 25.598  16.740  1.00 21.89 ? 315  LEU C CD2 1 
ATOM   7350  N  N   . ASP C 1 273 ? -34.150 20.577  16.213  1.00 24.32 ? 316  ASP C N   1 
ATOM   7351  C  CA  . ASP C 1 273 ? -35.030 19.460  16.487  1.00 24.78 ? 316  ASP C CA  1 
ATOM   7352  C  C   . ASP C 1 273 ? -35.889 19.786  17.691  1.00 24.79 ? 316  ASP C C   1 
ATOM   7353  O  O   . ASP C 1 273 ? -35.612 19.409  18.837  1.00 25.21 ? 316  ASP C O   1 
ATOM   7354  C  CB  . ASP C 1 273 ? -34.225 18.183  16.755  1.00 26.89 ? 316  ASP C CB  1 
ATOM   7355  C  CG  . ASP C 1 273 ? -35.108 16.946  16.814  1.00 27.48 ? 316  ASP C CG  1 
ATOM   7356  O  OD1 . ASP C 1 273 ? -34.578 15.810  16.724  1.00 27.93 ? 316  ASP C OD1 1 
ATOM   7357  O  OD2 . ASP C 1 273 ? -36.334 17.099  16.947  1.00 25.01 ? 316  ASP C OD2 1 
ATOM   7358  N  N   . ARG C 1 274 ? -36.966 20.498  17.400  1.00 23.65 ? 317  ARG C N   1 
ATOM   7359  C  CA  . ARG C 1 274 ? -37.870 20.897  18.411  1.00 23.84 ? 317  ARG C CA  1 
ATOM   7360  C  C   . ARG C 1 274 ? -38.331 19.708  19.242  1.00 24.81 ? 317  ARG C C   1 
ATOM   7361  O  O   . ARG C 1 274 ? -38.881 19.875  20.314  1.00 25.10 ? 317  ARG C O   1 
ATOM   7362  C  CB  . ARG C 1 274 ? -38.977 21.685  17.756  1.00 22.18 ? 317  ARG C CB  1 
ATOM   7363  C  CG  . ARG C 1 274 ? -38.389 22.685  16.782  1.00 21.47 ? 317  ARG C CG  1 
ATOM   7364  C  CD  . ARG C 1 274 ? -39.392 23.059  15.718  1.00 20.38 ? 317  ARG C CD  1 
ATOM   7365  N  NE  . ARG C 1 274 ? -40.182 24.185  16.167  1.00 17.95 ? 317  ARG C NE  1 
ATOM   7366  C  CZ  . ARG C 1 274 ? -41.340 24.527  15.636  1.00 18.32 ? 317  ARG C CZ  1 
ATOM   7367  N  NH1 . ARG C 1 274 ? -41.837 23.799  14.649  1.00 19.30 ? 317  ARG C NH1 1 
ATOM   7368  N  NH2 . ARG C 1 274 ? -41.997 25.600  16.074  1.00 18.05 ? 317  ARG C NH2 1 
ATOM   7369  N  N   . THR C 1 275 ? -38.101 18.493  18.760  1.00 24.79 ? 318  THR C N   1 
ATOM   7370  C  CA  . THR C 1 275 ? -38.504 17.235  19.424  1.00 25.19 ? 318  THR C CA  1 
ATOM   7371  C  C   . THR C 1 275 ? -38.103 17.151  20.884  1.00 25.70 ? 318  THR C C   1 
ATOM   7372  O  O   . THR C 1 275 ? -38.922 16.921  21.769  1.00 24.26 ? 318  THR C O   1 
ATOM   7373  C  CB  . THR C 1 275 ? -37.903 16.020  18.717  1.00 24.45 ? 318  THR C CB  1 
ATOM   7374  O  OG1 . THR C 1 275 ? -38.311 16.046  17.351  1.00 25.48 ? 318  THR C OG1 1 
ATOM   7375  C  CG2 . THR C 1 275 ? -38.381 14.734  19.360  1.00 22.54 ? 318  THR C CG2 1 
ATOM   7376  N  N   . VAL C 1 276 ? -36.810 17.354  21.100  1.00 26.44 ? 319  VAL C N   1 
ATOM   7377  C  CA  . VAL C 1 276 ? -36.186 17.295  22.407  1.00 26.26 ? 319  VAL C CA  1 
ATOM   7378  C  C   . VAL C 1 276 ? -36.634 18.382  23.387  1.00 27.12 ? 319  VAL C C   1 
ATOM   7379  O  O   . VAL C 1 276 ? -36.727 18.144  24.594  1.00 28.41 ? 319  VAL C O   1 
ATOM   7380  C  CB  . VAL C 1 276 ? -34.683 17.358  22.228  1.00 26.56 ? 319  VAL C CB  1 
ATOM   7381  C  CG1 . VAL C 1 276 ? -34.160 16.141  21.499  1.00 27.63 ? 319  VAL C CG1 1 
ATOM   7382  C  CG2 . VAL C 1 276 ? -34.285 18.617  21.470  1.00 25.99 ? 319  VAL C CG2 1 
ATOM   7383  N  N   . VAL C 1 277 ? -36.918 19.574  22.877  1.00 25.51 ? 320  VAL C N   1 
ATOM   7384  C  CA  . VAL C 1 277 ? -37.354 20.650  23.743  1.00 23.85 ? 320  VAL C CA  1 
ATOM   7385  C  C   . VAL C 1 277 ? -38.683 20.335  24.414  1.00 22.76 ? 320  VAL C C   1 
ATOM   7386  O  O   . VAL C 1 277 ? -39.734 20.356  23.770  1.00 22.23 ? 320  VAL C O   1 
ATOM   7387  C  CB  . VAL C 1 277 ? -37.480 21.963  22.976  1.00 24.80 ? 320  VAL C CB  1 
ATOM   7388  C  CG1 . VAL C 1 277 ? -38.032 23.033  23.886  1.00 26.06 ? 320  VAL C CG1 1 
ATOM   7389  C  CG2 . VAL C 1 277 ? -36.110 22.394  22.466  1.00 24.76 ? 320  VAL C CG2 1 
ATOM   7390  N  N   . ASP C 1 278 ? -38.611 20.068  25.719  1.00 21.77 ? 321  ASP C N   1 
ATOM   7391  C  CA  . ASP C 1 278 ? -39.766 19.735  26.555  1.00 22.17 ? 321  ASP C CA  1 
ATOM   7392  C  C   . ASP C 1 278 ? -40.787 20.861  26.768  1.00 22.12 ? 321  ASP C C   1 
ATOM   7393  O  O   . ASP C 1 278 ? -41.991 20.598  26.896  1.00 21.46 ? 321  ASP C O   1 
ATOM   7394  C  CB  . ASP C 1 278 ? -39.280 19.223  27.912  1.00 23.64 ? 321  ASP C CB  1 
ATOM   7395  C  CG  . ASP C 1 278 ? -38.447 17.954  27.792  1.00 27.66 ? 321  ASP C CG  1 
ATOM   7396  O  OD1 . ASP C 1 278 ? -38.144 17.344  28.843  1.00 27.06 ? 321  ASP C OD1 1 
ATOM   7397  O  OD2 . ASP C 1 278 ? -38.090 17.568  26.648  1.00 28.92 ? 321  ASP C OD2 1 
ATOM   7398  N  N   . LYS C 1 279 ? -40.298 22.103  26.829  1.00 22.64 ? 322  LYS C N   1 
ATOM   7399  C  CA  . LYS C 1 279 ? -41.138 23.298  26.995  1.00 21.23 ? 322  LYS C CA  1 
ATOM   7400  C  C   . LYS C 1 279 ? -40.428 24.523  26.422  1.00 20.94 ? 322  LYS C C   1 
ATOM   7401  O  O   . LYS C 1 279 ? -39.231 24.488  26.175  1.00 20.98 ? 322  LYS C O   1 
ATOM   7402  C  CB  . LYS C 1 279 ? -41.471 23.538  28.467  1.00 20.83 ? 322  LYS C CB  1 
ATOM   7403  C  CG  . LYS C 1 279 ? -42.441 24.701  28.675  1.00 23.32 ? 322  LYS C CG  1 
ATOM   7404  C  CD  . LYS C 1 279 ? -43.074 24.715  30.066  1.00 24.74 ? 322  LYS C CD  1 
ATOM   7405  C  CE  . LYS C 1 279 ? -43.918 25.972  30.269  1.00 26.43 ? 322  LYS C CE  1 
ATOM   7406  N  NZ  . LYS C 1 279 ? -44.370 26.160  31.687  1.00 27.50 ? 322  LYS C NZ  1 
ATOM   7407  N  N   . TRP C 1 280 ? -41.172 25.598  26.191  1.00 20.36 ? 323  TRP C N   1 
ATOM   7408  C  CA  . TRP C 1 280 ? -40.606 26.837  25.642  1.00 20.23 ? 323  TRP C CA  1 
ATOM   7409  C  C   . TRP C 1 280 ? -41.140 28.037  26.414  1.00 20.29 ? 323  TRP C C   1 
ATOM   7410  O  O   . TRP C 1 280 ? -42.249 27.999  26.932  1.00 19.09 ? 323  TRP C O   1 
ATOM   7411  C  CB  . TRP C 1 280 ? -40.999 27.034  24.161  1.00 20.88 ? 323  TRP C CB  1 
ATOM   7412  C  CG  . TRP C 1 280 ? -40.553 25.978  23.227  1.00 19.44 ? 323  TRP C CG  1 
ATOM   7413  C  CD1 . TRP C 1 280 ? -41.047 24.715  23.120  1.00 19.12 ? 323  TRP C CD1 1 
ATOM   7414  C  CD2 . TRP C 1 280 ? -39.483 26.076  22.289  1.00 18.82 ? 323  TRP C CD2 1 
ATOM   7415  N  NE1 . TRP C 1 280 ? -40.344 24.012  22.174  1.00 19.60 ? 323  TRP C NE1 1 
ATOM   7416  C  CE2 . TRP C 1 280 ? -39.377 24.824  21.646  1.00 18.76 ? 323  TRP C CE2 1 
ATOM   7417  C  CE3 . TRP C 1 280 ? -38.598 27.100  21.931  1.00 17.59 ? 323  TRP C CE3 1 
ATOM   7418  C  CZ2 . TRP C 1 280 ? -38.418 24.563  20.661  1.00 18.62 ? 323  TRP C CZ2 1 
ATOM   7419  C  CZ3 . TRP C 1 280 ? -37.639 26.841  20.948  1.00 18.43 ? 323  TRP C CZ3 1 
ATOM   7420  C  CH2 . TRP C 1 280 ? -37.559 25.581  20.327  1.00 17.87 ? 323  TRP C CH2 1 
ATOM   7421  N  N   . PHE C 1 281 ? -40.356 29.106  26.479  1.00 21.40 ? 324  PHE C N   1 
ATOM   7422  C  CA  . PHE C 1 281 ? -40.798 30.314  27.164  1.00 23.81 ? 324  PHE C CA  1 
ATOM   7423  C  C   . PHE C 1 281 ? -40.610 31.504  26.241  1.00 25.25 ? 324  PHE C C   1 
ATOM   7424  O  O   . PHE C 1 281 ? -39.599 31.600  25.537  1.00 27.61 ? 324  PHE C O   1 
ATOM   7425  C  CB  . PHE C 1 281 ? -40.008 30.553  28.467  1.00 22.99 ? 324  PHE C CB  1 
ATOM   7426  C  CG  . PHE C 1 281 ? -40.520 29.771  29.656  1.00 22.62 ? 324  PHE C CG  1 
ATOM   7427  C  CD1 . PHE C 1 281 ? -40.082 28.469  29.900  1.00 23.20 ? 324  PHE C CD1 1 
ATOM   7428  C  CD2 . PHE C 1 281 ? -41.440 30.341  30.534  1.00 23.62 ? 324  PHE C CD2 1 
ATOM   7429  C  CE1 . PHE C 1 281 ? -40.551 27.744  31.003  1.00 22.65 ? 324  PHE C CE1 1 
ATOM   7430  C  CE2 . PHE C 1 281 ? -41.917 29.626  31.641  1.00 23.66 ? 324  PHE C CE2 1 
ATOM   7431  C  CZ  . PHE C 1 281 ? -41.468 28.324  31.873  1.00 23.40 ? 324  PHE C CZ  1 
ATOM   7432  N  N   . LYS C 1 282 ? -41.586 32.405  26.242  1.00 25.67 ? 325  LYS C N   1 
ATOM   7433  C  CA  . LYS C 1 282 ? -41.514 33.605  25.418  1.00 27.68 ? 325  LYS C CA  1 
ATOM   7434  C  C   . LYS C 1 282 ? -41.173 34.811  26.282  1.00 28.81 ? 325  LYS C C   1 
ATOM   7435  O  O   . LYS C 1 282 ? -41.934 35.182  27.179  1.00 28.49 ? 325  LYS C O   1 
ATOM   7436  C  CB  . LYS C 1 282 ? -42.840 33.848  24.691  1.00 26.74 ? 325  LYS C CB  1 
ATOM   7437  C  CG  . LYS C 1 282 ? -43.123 32.848  23.587  1.00 26.79 ? 325  LYS C CG  1 
ATOM   7438  C  CD  . LYS C 1 282 ? -42.243 33.081  22.372  1.00 25.03 ? 325  LYS C CD  1 
ATOM   7439  C  CE  . LYS C 1 282 ? -42.678 34.328  21.625  1.00 24.98 ? 325  LYS C CE  1 
ATOM   7440  N  NZ  . LYS C 1 282 ? -41.918 34.493  20.364  1.00 23.37 ? 325  LYS C NZ  1 
ATOM   7441  N  N   . SER C 1 283 ? -40.023 35.417  26.009  1.00 30.70 ? 326  SER C N   1 
ATOM   7442  C  CA  . SER C 1 283 ? -39.585 36.578  26.768  1.00 33.76 ? 326  SER C CA  1 
ATOM   7443  C  C   . SER C 1 283 ? -39.624 37.841  25.913  1.00 35.44 ? 326  SER C C   1 
ATOM   7444  O  O   . SER C 1 283 ? -39.937 37.777  24.722  1.00 36.58 ? 326  SER C O   1 
ATOM   7445  C  CB  . SER C 1 283 ? -38.161 36.364  27.281  1.00 33.88 ? 326  SER C CB  1 
ATOM   7446  O  OG  . SER C 1 283 ? -37.212 36.697  26.281  1.00 33.66 ? 326  SER C OG  1 
ATOM   7447  N  N   . ASN C 1 284 ? -39.306 38.984  26.528  1.00 37.11 ? 327  ASN C N   1 
ATOM   7448  C  CA  . ASN C 1 284 ? -39.285 40.268  25.823  1.00 38.03 ? 327  ASN C CA  1 
ATOM   7449  C  C   . ASN C 1 284 ? -37.963 41.018  26.035  1.00 37.56 ? 327  ASN C C   1 
ATOM   7450  O  O   . ASN C 1 284 ? -37.123 40.618  26.840  1.00 36.78 ? 327  ASN C O   1 
ATOM   7451  C  CB  . ASN C 1 284 ? -40.467 41.151  26.254  1.00 39.16 ? 327  ASN C CB  1 
ATOM   7452  C  CG  . ASN C 1 284 ? -40.256 41.806  27.606  1.00 40.40 ? 327  ASN C CG  1 
ATOM   7453  O  OD1 . ASN C 1 284 ? -39.344 42.619  27.783  1.00 40.70 ? 327  ASN C OD1 1 
ATOM   7454  N  ND2 . ASN C 1 284 ? -41.109 41.463  28.568  1.00 40.60 ? 327  ASN C ND2 1 
ATOM   7455  N  N   . ASP C 1 285 ? -37.796 42.113  25.305  1.00 37.55 ? 328  ASP C N   1 
ATOM   7456  C  CA  . ASP C 1 285 ? -36.582 42.910  25.368  1.00 36.63 ? 328  ASP C CA  1 
ATOM   7457  C  C   . ASP C 1 285 ? -36.311 43.568  26.715  1.00 35.10 ? 328  ASP C C   1 
ATOM   7458  O  O   . ASP C 1 285 ? -35.190 43.539  27.207  1.00 35.21 ? 328  ASP C O   1 
ATOM   7459  C  CB  . ASP C 1 285 ? -36.627 43.980  24.278  1.00 39.01 ? 328  ASP C CB  1 
ATOM   7460  C  CG  . ASP C 1 285 ? -36.821 43.395  22.895  1.00 40.91 ? 328  ASP C CG  1 
ATOM   7461  O  OD1 . ASP C 1 285 ? -36.954 44.179  21.931  1.00 42.26 ? 328  ASP C OD1 1 
ATOM   7462  O  OD2 . ASP C 1 285 ? -36.839 42.150  22.775  1.00 41.99 ? 328  ASP C OD2 1 
ATOM   7463  N  N   . GLU C 1 286 ? -37.336 44.164  27.307  1.00 34.14 ? 329  GLU C N   1 
ATOM   7464  C  CA  . GLU C 1 286 ? -37.189 44.843  28.590  1.00 33.61 ? 329  GLU C CA  1 
ATOM   7465  C  C   . GLU C 1 286 ? -36.974 43.828  29.713  1.00 32.25 ? 329  GLU C C   1 
ATOM   7466  O  O   . GLU C 1 286 ? -36.824 44.190  30.877  1.00 31.85 ? 329  GLU C O   1 
ATOM   7467  C  CB  . GLU C 1 286 ? -38.448 45.672  28.872  1.00 35.26 ? 329  GLU C CB  1 
ATOM   7468  C  CG  . GLU C 1 286 ? -38.319 46.694  29.997  1.00 36.42 ? 329  GLU C CG  1 
ATOM   7469  C  CD  . GLU C 1 286 ? -39.620 47.441  30.244  1.00 37.63 ? 329  GLU C CD  1 
ATOM   7470  O  OE1 . GLU C 1 286 ? -40.582 46.817  30.744  1.00 37.41 ? 329  GLU C OE1 1 
ATOM   7471  O  OE2 . GLU C 1 286 ? -39.685 48.650  29.928  1.00 38.59 ? 329  GLU C OE2 1 
ATOM   7472  N  N   . GLU C 1 287 ? -36.947 42.559  29.344  1.00 31.71 ? 330  GLU C N   1 
ATOM   7473  C  CA  . GLU C 1 287 ? -36.785 41.464  30.282  1.00 31.07 ? 330  GLU C CA  1 
ATOM   7474  C  C   . GLU C 1 287 ? -35.346 40.961  30.317  1.00 30.48 ? 330  GLU C C   1 
ATOM   7475  O  O   . GLU C 1 287 ? -34.698 40.951  31.362  1.00 28.97 ? 330  GLU C O   1 
ATOM   7476  C  CB  . GLU C 1 287 ? -37.741 40.343  29.859  1.00 31.99 ? 330  GLU C CB  1 
ATOM   7477  C  CG  . GLU C 1 287 ? -37.615 39.033  30.589  1.00 33.68 ? 330  GLU C CG  1 
ATOM   7478  C  CD  . GLU C 1 287 ? -38.802 38.128  30.290  1.00 36.44 ? 330  GLU C CD  1 
ATOM   7479  O  OE1 . GLU C 1 287 ? -38.780 36.929  30.640  1.00 37.14 ? 330  GLU C OE1 1 
ATOM   7480  O  OE2 . GLU C 1 287 ? -39.779 38.626  29.699  1.00 36.73 ? 330  GLU C OE2 1 
ATOM   7481  N  N   . ALA C 1 288 ? -34.860 40.527  29.160  1.00 30.14 ? 331  ALA C N   1 
ATOM   7482  C  CA  . ALA C 1 288 ? -33.496 40.017  29.022  1.00 29.99 ? 331  ALA C CA  1 
ATOM   7483  C  C   . ALA C 1 288 ? -32.460 41.098  29.347  1.00 29.98 ? 331  ALA C C   1 
ATOM   7484  O  O   . ALA C 1 288 ? -31.315 40.785  29.682  1.00 29.58 ? 331  ALA C O   1 
ATOM   7485  C  CB  . ALA C 1 288 ? -33.273 39.545  27.625  1.00 30.53 ? 331  ALA C CB  1 
ATOM   7486  N  N   . PHE C 1 289 ? -32.850 42.365  29.234  1.00 28.41 ? 332  PHE C N   1 
ATOM   7487  C  CA  . PHE C 1 289 ? -31.941 43.463  29.510  1.00 26.74 ? 332  PHE C CA  1 
ATOM   7488  C  C   . PHE C 1 289 ? -31.760 43.721  30.988  1.00 26.52 ? 332  PHE C C   1 
ATOM   7489  O  O   . PHE C 1 289 ? -30.630 43.810  31.460  1.00 26.11 ? 332  PHE C O   1 
ATOM   7490  C  CB  . PHE C 1 289 ? -32.419 44.695  28.760  1.00 24.05 ? 332  PHE C CB  1 
ATOM   7491  C  CG  . PHE C 1 289 ? -31.957 44.716  27.333  1.00 21.70 ? 332  PHE C CG  1 
ATOM   7492  C  CD1 . PHE C 1 289 ? -32.513 45.587  26.415  1.00 19.93 ? 332  PHE C CD1 1 
ATOM   7493  C  CD2 . PHE C 1 289 ? -30.951 43.852  26.908  1.00 21.03 ? 332  PHE C CD2 1 
ATOM   7494  C  CE1 . PHE C 1 289 ? -32.076 45.596  25.094  1.00 20.38 ? 332  PHE C CE1 1 
ATOM   7495  C  CE2 . PHE C 1 289 ? -30.513 43.859  25.592  1.00 21.41 ? 332  PHE C CE2 1 
ATOM   7496  C  CZ  . PHE C 1 289 ? -31.077 44.734  24.684  1.00 19.02 ? 332  PHE C CZ  1 
ATOM   7497  N  N   . THR C 1 290 ? -32.857 43.815  31.727  1.00 26.00 ? 333  THR C N   1 
ATOM   7498  C  CA  . THR C 1 290 ? -32.750 44.042  33.164  1.00 25.99 ? 333  THR C CA  1 
ATOM   7499  C  C   . THR C 1 290 ? -31.822 42.963  33.723  1.00 25.62 ? 333  THR C C   1 
ATOM   7500  O  O   . THR C 1 290 ? -30.830 43.254  34.390  1.00 25.92 ? 333  THR C O   1 
ATOM   7501  C  CB  . THR C 1 290 ? -34.105 43.905  33.849  1.00 26.14 ? 333  THR C CB  1 
ATOM   7502  O  OG1 . THR C 1 290 ? -34.504 42.533  33.810  1.00 28.66 ? 333  THR C OG1 1 
ATOM   7503  C  CG2 . THR C 1 290 ? -35.152 44.754  33.148  1.00 25.34 ? 333  THR C CG2 1 
ATOM   7504  N  N   . PHE C 1 291 ? -32.162 41.711  33.434  1.00 24.76 ? 334  PHE C N   1 
ATOM   7505  C  CA  . PHE C 1 291 ? -31.373 40.580  33.882  1.00 22.78 ? 334  PHE C CA  1 
ATOM   7506  C  C   . PHE C 1 291 ? -29.986 40.657  33.293  1.00 22.67 ? 334  PHE C C   1 
ATOM   7507  O  O   . PHE C 1 291 ? -29.003 40.314  33.943  1.00 22.81 ? 334  PHE C O   1 
ATOM   7508  C  CB  . PHE C 1 291 ? -32.022 39.266  33.453  1.00 21.19 ? 334  PHE C CB  1 
ATOM   7509  C  CG  . PHE C 1 291 ? -33.112 38.804  34.365  1.00 20.27 ? 334  PHE C CG  1 
ATOM   7510  C  CD1 . PHE C 1 291 ? -34.362 39.399  34.331  1.00 19.01 ? 334  PHE C CD1 1 
ATOM   7511  C  CD2 . PHE C 1 291 ? -32.888 37.757  35.261  1.00 19.35 ? 334  PHE C CD2 1 
ATOM   7512  C  CE1 . PHE C 1 291 ? -35.380 38.955  35.177  1.00 19.96 ? 334  PHE C CE1 1 
ATOM   7513  C  CE2 . PHE C 1 291 ? -33.900 37.310  36.110  1.00 18.43 ? 334  PHE C CE2 1 
ATOM   7514  C  CZ  . PHE C 1 291 ? -35.146 37.908  36.066  1.00 18.73 ? 334  PHE C CZ  1 
ATOM   7515  N  N   . ALA C 1 292 ? -29.906 41.095  32.049  1.00 22.17 ? 335  ALA C N   1 
ATOM   7516  C  CA  . ALA C 1 292 ? -28.615 41.201  31.406  1.00 22.43 ? 335  ALA C CA  1 
ATOM   7517  C  C   . ALA C 1 292 ? -27.761 42.135  32.260  1.00 22.23 ? 335  ALA C C   1 
ATOM   7518  O  O   . ALA C 1 292 ? -26.537 42.022  32.303  1.00 20.69 ? 335  ALA C O   1 
ATOM   7519  C  CB  . ALA C 1 292 ? -28.788 41.730  30.021  1.00 22.33 ? 335  ALA C CB  1 
ATOM   7520  N  N   . ARG C 1 293 ? -28.429 43.041  32.970  1.00 22.83 ? 336  ARG C N   1 
ATOM   7521  C  CA  . ARG C 1 293 ? -27.741 43.968  33.855  1.00 22.32 ? 336  ARG C CA  1 
ATOM   7522  C  C   . ARG C 1 293 ? -27.610 43.348  35.241  1.00 21.57 ? 336  ARG C C   1 
ATOM   7523  O  O   . ARG C 1 293 ? -26.650 43.604  35.965  1.00 21.86 ? 336  ARG C O   1 
ATOM   7524  C  CB  . ARG C 1 293 ? -28.490 45.293  33.908  1.00 22.15 ? 336  ARG C CB  1 
ATOM   7525  C  CG  . ARG C 1 293 ? -28.455 46.028  32.579  1.00 22.22 ? 336  ARG C CG  1 
ATOM   7526  C  CD  . ARG C 1 293 ? -28.949 47.450  32.710  1.00 23.51 ? 336  ARG C CD  1 
ATOM   7527  N  NE  . ARG C 1 293 ? -28.449 48.284  31.619  1.00 26.21 ? 336  ARG C NE  1 
ATOM   7528  C  CZ  . ARG C 1 293 ? -28.535 49.615  31.582  1.00 28.74 ? 336  ARG C CZ  1 
ATOM   7529  N  NH1 . ARG C 1 293 ? -28.046 50.292  30.544  1.00 28.28 ? 336  ARG C NH1 1 
ATOM   7530  N  NH2 . ARG C 1 293 ? -29.112 50.274  32.585  1.00 27.39 ? 336  ARG C NH2 1 
ATOM   7531  N  N   . MET C 1 294 ? -28.576 42.512  35.594  1.00 20.83 ? 337  MET C N   1 
ATOM   7532  C  CA  . MET C 1 294 ? -28.547 41.827  36.874  1.00 21.10 ? 337  MET C CA  1 
ATOM   7533  C  C   . MET C 1 294 ? -27.316 40.963  36.906  1.00 20.33 ? 337  MET C C   1 
ATOM   7534  O  O   . MET C 1 294 ? -26.637 40.877  37.910  1.00 19.33 ? 337  MET C O   1 
ATOM   7535  C  CB  . MET C 1 294 ? -29.774 40.925  37.053  1.00 22.52 ? 337  MET C CB  1 
ATOM   7536  C  CG  . MET C 1 294 ? -31.032 41.617  37.553  1.00 23.50 ? 337  MET C CG  1 
ATOM   7537  S  SD  . MET C 1 294 ? -32.197 40.405  38.203  1.00 26.12 ? 337  MET C SD  1 
ATOM   7538  C  CE  . MET C 1 294 ? -31.515 40.129  39.880  1.00 25.81 ? 337  MET C CE  1 
ATOM   7539  N  N   . LEU C 1 295 ? -27.040 40.309  35.790  1.00 20.82 ? 338  LEU C N   1 
ATOM   7540  C  CA  . LEU C 1 295 ? -25.884 39.434  35.693  1.00 20.61 ? 338  LEU C CA  1 
ATOM   7541  C  C   . LEU C 1 295 ? -24.591 40.219  35.703  1.00 20.49 ? 338  LEU C C   1 
ATOM   7542  O  O   . LEU C 1 295 ? -23.598 39.799  36.293  1.00 19.80 ? 338  LEU C O   1 
ATOM   7543  C  CB  . LEU C 1 295 ? -25.975 38.596  34.421  1.00 19.45 ? 338  LEU C CB  1 
ATOM   7544  C  CG  . LEU C 1 295 ? -27.054 37.524  34.504  1.00 17.63 ? 338  LEU C CG  1 
ATOM   7545  C  CD1 . LEU C 1 295 ? -27.229 36.850  33.166  1.00 17.94 ? 338  LEU C CD1 1 
ATOM   7546  C  CD2 . LEU C 1 295 ? -26.662 36.526  35.571  1.00 16.78 ? 338  LEU C CD2 1 
ATOM   7547  N  N   . ILE C 1 296 ? -24.597 41.368  35.044  1.00 20.77 ? 339  ILE C N   1 
ATOM   7548  C  CA  . ILE C 1 296 ? -23.394 42.172  35.012  1.00 21.65 ? 339  ILE C CA  1 
ATOM   7549  C  C   . ILE C 1 296 ? -23.153 42.767  36.392  1.00 21.78 ? 339  ILE C C   1 
ATOM   7550  O  O   . ILE C 1 296 ? -22.008 43.050  36.750  1.00 22.67 ? 339  ILE C O   1 
ATOM   7551  C  CB  . ILE C 1 296 ? -23.481 43.303  33.938  1.00 20.54 ? 339  ILE C CB  1 
ATOM   7552  C  CG1 . ILE C 1 296 ? -23.612 42.699  32.526  1.00 20.02 ? 339  ILE C CG1 1 
ATOM   7553  C  CG2 . ILE C 1 296 ? -22.224 44.146  33.990  1.00 19.10 ? 339  ILE C CG2 1 
ATOM   7554  C  CD1 . ILE C 1 296 ? -24.002 43.693  31.419  1.00 15.21 ? 339  ILE C CD1 1 
ATOM   7555  N  N   . ALA C 1 297 ? -24.217 42.918  37.181  1.00 21.46 ? 340  ALA C N   1 
ATOM   7556  C  CA  . ALA C 1 297 ? -24.012 43.505  38.513  1.00 21.62 ? 340  ALA C CA  1 
ATOM   7557  C  C   . ALA C 1 297 ? -24.631 42.764  39.738  1.00 21.29 ? 340  ALA C C   1 
ATOM   7558  O  O   . ALA C 1 297 ? -25.348 43.369  40.539  1.00 21.87 ? 340  ALA C O   1 
ATOM   7559  C  CB  . ALA C 1 297 ? -24.527 44.942  38.508  1.00 22.10 ? 340  ALA C CB  1 
ATOM   7560  N  N   . GLN C 1 298 ? -24.362 41.506  39.854  1.00 22.54 ? 341  GLN C N   1 
ATOM   7561  C  CA  . GLN C 1 298 ? -24.785 40.645  40.919  1.00 22.25 ? 341  GLN C CA  1 
ATOM   7562  C  C   . GLN C 1 298 ? -23.906 39.525  40.513  1.00 21.64 ? 341  GLN C C   1 
ATOM   7563  O  O   . GLN C 1 298 ? -23.743 39.382  39.307  1.00 21.76 ? 341  GLN C O   1 
ATOM   7564  C  CB  . GLN C 1 298 ? -26.186 40.053  40.771  1.00 21.81 ? 341  GLN C CB  1 
ATOM   7565  C  CG  . GLN C 1 298 ? -27.277 41.060  40.539  1.00 23.35 ? 341  GLN C CG  1 
ATOM   7566  C  CD  . GLN C 1 298 ? -28.183 41.137  41.751  1.00 26.72 ? 341  GLN C CD  1 
ATOM   7567  O  OE1 . GLN C 1 298 ? -28.635 40.127  42.286  1.00 28.74 ? 341  GLN C OE1 1 
ATOM   7568  N  NE2 . GLN C 1 298 ? -28.569 42.255  42.366  1.00 26.41 ? 341  GLN C NE2 1 
ATOM   7569  N  N   . GLU C 1 299 ? -23.275 38.753  41.301  1.00 19.91 ? 342  GLU C N   1 
ATOM   7570  C  CA  . GLU C 1 299 ? -22.663 37.714  40.474  1.00 18.65 ? 342  GLU C CA  1 
ATOM   7571  C  C   . GLU C 1 299 ? -21.838 38.172  39.199  1.00 18.32 ? 342  GLU C C   1 
ATOM   7572  O  O   . GLU C 1 299 ? -21.919 37.506  38.166  1.00 19.21 ? 342  GLU C O   1 
ATOM   7573  C  CB  . GLU C 1 299 ? -23.795 36.876  39.926  1.00 18.92 ? 342  GLU C CB  1 
ATOM   7574  C  CG  . GLU C 1 299 ? -23.372 35.537  39.409  1.00 15.82 ? 342  GLU C CG  1 
ATOM   7575  C  CD  . GLU C 1 299 ? -23.496 34.553  40.543  1.00 17.66 ? 342  GLU C CD  1 
ATOM   7576  O  OE1 . GLU C 1 299 ? -22.459 33.962  40.931  1.00 16.77 ? 342  GLU C OE1 1 
ATOM   7577  O  OE2 . GLU C 1 299 ? -24.615 34.352  41.057  1.00 14.27 ? 342  GLU C OE2 1 
ATOM   7578  N  N   . GLY C 1 300 ? -21.075 39.269  39.203  1.00 17.97 ? 343  GLY C N   1 
ATOM   7579  C  CA  . GLY C 1 300 ? -20.250 39.834  38.077  1.00 16.86 ? 343  GLY C CA  1 
ATOM   7580  C  C   . GLY C 1 300 ? -19.965 39.144  36.730  1.00 17.28 ? 343  GLY C C   1 
ATOM   7581  O  O   . GLY C 1 300 ? -18.824 38.793  36.446  1.00 16.36 ? 343  GLY C O   1 
ATOM   7582  N  N   . LEU C 1 301 ? -20.988 38.956  35.885  1.00 17.99 ? 344  LEU C N   1 
ATOM   7583  C  CA  . LEU C 1 301 ? -20.914 38.388  34.528  1.00 18.47 ? 344  LEU C CA  1 
ATOM   7584  C  C   . LEU C 1 301 ? -21.191 39.418  33.418  1.00 18.43 ? 344  LEU C C   1 
ATOM   7585  O  O   . LEU C 1 301 ? -22.252 40.037  33.383  1.00 18.28 ? 344  LEU C O   1 
ATOM   7586  C  CB  . LEU C 1 301 ? -21.881 37.214  34.408  1.00 18.21 ? 344  LEU C CB  1 
ATOM   7587  C  CG  . LEU C 1 301 ? -21.502 35.998  35.254  1.00 19.14 ? 344  LEU C CG  1 
ATOM   7588  C  CD1 . LEU C 1 301 ? -22.698 35.090  35.383  1.00 19.98 ? 344  LEU C CD1 1 
ATOM   7589  C  CD2 . LEU C 1 301 ? -20.331 35.265  34.627  1.00 17.75 ? 344  LEU C CD2 1 
ATOM   7590  N  N   . LEU C 1 302 ? -20.230 39.590  32.513  1.00 17.42 ? 345  LEU C N   1 
ATOM   7591  C  CA  . LEU C 1 302 ? -20.356 40.560  31.434  1.00 18.09 ? 345  LEU C CA  1 
ATOM   7592  C  C   . LEU C 1 302 ? -20.842 39.939  30.125  1.00 19.95 ? 345  LEU C C   1 
ATOM   7593  O  O   . LEU C 1 302 ? -20.088 39.828  29.144  1.00 20.58 ? 345  LEU C O   1 
ATOM   7594  C  CB  . LEU C 1 302 ? -19.016 41.240  31.234  1.00 17.04 ? 345  LEU C CB  1 
ATOM   7595  C  CG  . LEU C 1 302 ? -18.576 42.002  32.468  1.00 15.02 ? 345  LEU C CG  1 
ATOM   7596  C  CD1 . LEU C 1 302 ? -17.236 42.680  32.224  1.00 13.16 ? 345  LEU C CD1 1 
ATOM   7597  C  CD2 . LEU C 1 302 ? -19.642 43.012  32.797  1.00 15.76 ? 345  LEU C CD2 1 
ATOM   7598  N  N   . CYS C 1 303 ? -22.128 39.594  30.115  1.00 20.21 ? 346  CYS C N   1 
ATOM   7599  C  CA  . CYS C 1 303 ? -22.782 38.916  29.000  1.00 20.79 ? 346  CYS C CA  1 
ATOM   7600  C  C   . CYS C 1 303 ? -23.748 39.765  28.192  1.00 20.70 ? 346  CYS C C   1 
ATOM   7601  O  O   . CYS C 1 303 ? -24.097 40.880  28.589  1.00 21.11 ? 346  CYS C O   1 
ATOM   7602  C  CB  . CYS C 1 303 ? -23.531 37.715  29.560  1.00 21.85 ? 346  CYS C CB  1 
ATOM   7603  S  SG  . CYS C 1 303 ? -24.410 38.166  31.092  1.00 23.72 ? 346  CYS C SG  1 
ATOM   7604  N  N   . GLY C 1 304 ? -24.196 39.208  27.066  1.00 19.56 ? 347  GLY C N   1 
ATOM   7605  C  CA  . GLY C 1 304 ? -25.129 39.909  26.204  1.00 18.10 ? 347  GLY C CA  1 
ATOM   7606  C  C   . GLY C 1 304 ? -26.570 39.712  26.632  1.00 16.92 ? 347  GLY C C   1 
ATOM   7607  O  O   . GLY C 1 304 ? -26.851 38.925  27.528  1.00 15.60 ? 347  GLY C O   1 
ATOM   7608  N  N   . GLY C 1 305 ? -27.485 40.432  25.990  1.00 16.53 ? 348  GLY C N   1 
ATOM   7609  C  CA  . GLY C 1 305 ? -28.896 40.310  26.321  1.00 15.77 ? 348  GLY C CA  1 
ATOM   7610  C  C   . GLY C 1 305 ? -29.379 38.875  26.234  1.00 14.26 ? 348  GLY C C   1 
ATOM   7611  O  O   . GLY C 1 305 ? -30.295 38.466  26.932  1.00 13.13 ? 348  GLY C O   1 
ATOM   7612  N  N   . SER C 1 306 ? -28.763 38.105  25.353  1.00 15.04 ? 349  SER C N   1 
ATOM   7613  C  CA  . SER C 1 306 ? -29.128 36.706  25.204  1.00 17.25 ? 349  SER C CA  1 
ATOM   7614  C  C   . SER C 1 306 ? -29.194 36.093  26.600  1.00 18.80 ? 349  SER C C   1 
ATOM   7615  O  O   . SER C 1 306 ? -30.171 35.432  26.975  1.00 18.08 ? 349  SER C O   1 
ATOM   7616  C  CB  . SER C 1 306 ? -28.057 35.994  24.396  1.00 16.85 ? 349  SER C CB  1 
ATOM   7617  O  OG  . SER C 1 306 ? -26.793 36.201  25.005  1.00 15.46 ? 349  SER C OG  1 
ATOM   7618  N  N   . ALA C 1 307 ? -28.128 36.344  27.357  1.00 20.12 ? 350  ALA C N   1 
ATOM   7619  C  CA  . ALA C 1 307 ? -27.961 35.854  28.719  1.00 20.78 ? 350  ALA C CA  1 
ATOM   7620  C  C   . ALA C 1 307 ? -29.018 36.426  29.641  1.00 22.06 ? 350  ALA C C   1 
ATOM   7621  O  O   . ALA C 1 307 ? -29.443 35.781  30.607  1.00 23.33 ? 350  ALA C O   1 
ATOM   7622  C  CB  . ALA C 1 307 ? -26.563 36.167  29.219  1.00 21.32 ? 350  ALA C CB  1 
ATOM   7623  N  N   . GLY C 1 308 ? -29.430 37.650  29.347  1.00 21.68 ? 351  GLY C N   1 
ATOM   7624  C  CA  . GLY C 1 308 ? -30.447 38.273  30.158  1.00 23.10 ? 351  GLY C CA  1 
ATOM   7625  C  C   . GLY C 1 308 ? -31.702 37.465  29.971  1.00 23.49 ? 351  GLY C C   1 
ATOM   7626  O  O   . GLY C 1 308 ? -32.422 37.182  30.927  1.00 22.77 ? 351  GLY C O   1 
ATOM   7627  N  N   . SER C 1 309 ? -31.948 37.077  28.718  1.00 24.19 ? 352  SER C N   1 
ATOM   7628  C  CA  . SER C 1 309 ? -33.159 36.327  28.387  1.00 24.95 ? 352  SER C CA  1 
ATOM   7629  C  C   . SER C 1 309 ? -33.287 34.996  29.083  1.00 25.06 ? 352  SER C C   1 
ATOM   7630  O  O   . SER C 1 309 ? -34.213 34.772  29.847  1.00 24.67 ? 352  SER C O   1 
ATOM   7631  C  CB  . SER C 1 309 ? -33.223 36.101  26.868  1.00 24.57 ? 352  SER C CB  1 
ATOM   7632  O  OG  . SER C 1 309 ? -33.783 37.229  26.222  1.00 21.40 ? 352  SER C OG  1 
ATOM   7633  N  N   . THR C 1 310 ? -32.334 34.095  28.816  1.00 23.87 ? 353  THR C N   1 
ATOM   7634  C  CA  . THR C 1 310 ? -32.370 32.772  29.415  1.00 23.45 ? 353  THR C CA  1 
ATOM   7635  C  C   . THR C 1 310 ? -32.661 32.832  30.919  1.00 22.87 ? 353  THR C C   1 
ATOM   7636  O  O   . THR C 1 310 ? -33.618 32.223  31.407  1.00 21.54 ? 353  THR C O   1 
ATOM   7637  C  CB  . THR C 1 310 ? -31.019 32.026  29.199  1.00 24.34 ? 353  THR C CB  1 
ATOM   7638  O  OG1 . THR C 1 310 ? -30.724 31.980  27.802  1.00 23.18 ? 353  THR C OG1 1 
ATOM   7639  C  CG2 . THR C 1 310 ? -31.092 30.612  29.765  1.00 23.01 ? 353  THR C CG2 1 
ATOM   7640  N  N   . VAL C 1 311 ? -31.840 33.574  31.652  1.00 22.02 ? 354  VAL C N   1 
ATOM   7641  C  CA  . VAL C 1 311 ? -32.020 33.665  33.096  1.00 22.23 ? 354  VAL C CA  1 
ATOM   7642  C  C   . VAL C 1 311 ? -33.407 34.214  33.481  1.00 23.01 ? 354  VAL C C   1 
ATOM   7643  O  O   . VAL C 1 311 ? -34.045 33.720  34.415  1.00 22.45 ? 354  VAL C O   1 
ATOM   7644  C  CB  . VAL C 1 311 ? -30.888 34.516  33.738  1.00 21.38 ? 354  VAL C CB  1 
ATOM   7645  C  CG1 . VAL C 1 311 ? -31.053 34.549  35.235  1.00 18.81 ? 354  VAL C CG1 1 
ATOM   7646  C  CG2 . VAL C 1 311 ? -29.523 33.932  33.378  1.00 18.35 ? 354  VAL C CG2 1 
ATOM   7647  N  N   . ALA C 1 312 ? -33.880 35.219  32.749  1.00 22.61 ? 355  ALA C N   1 
ATOM   7648  C  CA  . ALA C 1 312 ? -35.191 35.794  33.021  1.00 21.50 ? 355  ALA C CA  1 
ATOM   7649  C  C   . ALA C 1 312 ? -36.259 34.710  32.861  1.00 21.88 ? 355  ALA C C   1 
ATOM   7650  O  O   . ALA C 1 312 ? -37.426 34.903  33.217  1.00 22.23 ? 355  ALA C O   1 
ATOM   7651  C  CB  . ALA C 1 312 ? -35.459 36.944  32.071  1.00 21.13 ? 355  ALA C CB  1 
ATOM   7652  N  N   . VAL C 1 313 ? -35.854 33.573  32.305  1.00 21.52 ? 356  VAL C N   1 
ATOM   7653  C  CA  . VAL C 1 313 ? -36.762 32.454  32.114  1.00 21.76 ? 356  VAL C CA  1 
ATOM   7654  C  C   . VAL C 1 313 ? -36.408 31.399  33.165  1.00 23.34 ? 356  VAL C C   1 
ATOM   7655  O  O   . VAL C 1 313 ? -37.300 30.742  33.732  1.00 22.81 ? 356  VAL C O   1 
ATOM   7656  C  CB  . VAL C 1 313 ? -36.637 31.856  30.680  1.00 19.89 ? 356  VAL C CB  1 
ATOM   7657  C  CG1 . VAL C 1 313 ? -37.362 30.539  30.592  1.00 17.80 ? 356  VAL C CG1 1 
ATOM   7658  C  CG2 . VAL C 1 313 ? -37.227 32.810  29.662  1.00 18.18 ? 356  VAL C CG2 1 
ATOM   7659  N  N   . ALA C 1 314 ? -35.106 31.267  33.440  1.00 23.66 ? 357  ALA C N   1 
ATOM   7660  C  CA  . ALA C 1 314 ? -34.603 30.300  34.418  1.00 23.98 ? 357  ALA C CA  1 
ATOM   7661  C  C   . ALA C 1 314 ? -35.241 30.484  35.783  1.00 24.15 ? 357  ALA C C   1 
ATOM   7662  O  O   . ALA C 1 314 ? -35.643 29.510  36.418  1.00 24.40 ? 357  ALA C O   1 
ATOM   7663  C  CB  . ALA C 1 314 ? -33.093 30.407  34.539  1.00 23.48 ? 357  ALA C CB  1 
ATOM   7664  N  N   . VAL C 1 315 ? -35.333 31.732  36.235  1.00 23.70 ? 358  VAL C N   1 
ATOM   7665  C  CA  . VAL C 1 315 ? -35.934 32.024  37.534  1.00 23.05 ? 358  VAL C CA  1 
ATOM   7666  C  C   . VAL C 1 315 ? -37.401 31.627  37.523  1.00 24.56 ? 358  VAL C C   1 
ATOM   7667  O  O   . VAL C 1 315 ? -38.081 31.694  38.552  1.00 24.36 ? 358  VAL C O   1 
ATOM   7668  C  CB  . VAL C 1 315 ? -35.859 33.512  37.865  1.00 22.87 ? 358  VAL C CB  1 
ATOM   7669  C  CG1 . VAL C 1 315 ? -34.405 33.920  38.121  1.00 21.89 ? 358  VAL C CG1 1 
ATOM   7670  C  CG2 . VAL C 1 315 ? -36.471 34.312  36.729  1.00 20.90 ? 358  VAL C CG2 1 
ATOM   7671  N  N   . LYS C 1 316 ? -37.883 31.228  36.344  1.00 25.17 ? 359  LYS C N   1 
ATOM   7672  C  CA  . LYS C 1 316 ? -39.268 30.815  36.161  1.00 23.23 ? 359  LYS C CA  1 
ATOM   7673  C  C   . LYS C 1 316 ? -39.367 29.304  36.056  1.00 21.83 ? 359  LYS C C   1 
ATOM   7674  O  O   . LYS C 1 316 ? -40.043 28.679  36.860  1.00 20.28 ? 359  LYS C O   1 
ATOM   7675  C  CB  . LYS C 1 316 ? -39.855 31.434  34.893  1.00 23.28 ? 359  LYS C CB  1 
ATOM   7676  C  CG  . LYS C 1 316 ? -39.931 32.944  34.841  1.00 22.32 ? 359  LYS C CG  1 
ATOM   7677  C  CD  . LYS C 1 316 ? -40.773 33.375  33.643  1.00 22.03 ? 359  LYS C CD  1 
ATOM   7678  C  CE  . LYS C 1 316 ? -40.625 34.865  33.354  1.00 21.63 ? 359  LYS C CE  1 
ATOM   7679  N  NZ  . LYS C 1 316 ? -41.277 35.244  32.073  1.00 21.63 ? 359  LYS C NZ  1 
ATOM   7680  N  N   . ALA C 1 317 ? -38.699 28.724  35.086  1.00 22.13 ? 360  ALA C N   1 
ATOM   7681  C  CA  . ALA C 1 317 ? -38.758 27.282  34.920  1.00 23.17 ? 360  ALA C CA  1 
ATOM   7682  C  C   . ALA C 1 317 ? -38.281 26.544  36.147  1.00 23.96 ? 360  ALA C C   1 
ATOM   7683  O  O   . ALA C 1 317 ? -38.826 25.497  36.511  1.00 23.49 ? 360  ALA C O   1 
ATOM   7684  C  CB  . ALA C 1 317 ? -37.954 26.858  33.693  1.00 22.97 ? 360  ALA C CB  1 
ATOM   7685  N  N   . ALA C 1 318 ? -37.285 27.087  36.785  1.00 25.52 ? 361  ALA C N   1 
ATOM   7686  C  CA  . ALA C 1 318 ? -36.705 26.455  37.949  1.00 27.57 ? 361  ALA C CA  1 
ATOM   7687  C  C   . ALA C 1 318 ? -37.418 26.656  39.263  1.00 28.75 ? 361  ALA C C   1 
ATOM   7688  O  O   . ALA C 1 318 ? -37.191 25.878  40.188  1.00 29.80 ? 361  ALA C O   1 
ATOM   7689  C  CB  . ALA C 1 318 ? -35.264 26.929  38.093  1.00 27.42 ? 361  ALA C CB  1 
ATOM   7690  N  N   . GLN C 1 319 ? -38.265 27.628  39.441  1.00 29.83 ? 362  GLN C N   1 
ATOM   7691  C  CA  . GLN C 1 319 ? -38.749 27.613  40.783  1.00 31.32 ? 362  GLN C CA  1 
ATOM   7692  C  C   . GLN C 1 319 ? -39.328 26.221  41.125  1.00 32.25 ? 362  GLN C C   1 
ATOM   7693  O  O   . GLN C 1 319 ? -39.664 25.991  42.298  1.00 32.86 ? 362  GLN C O   1 
ATOM   7694  C  CB  . GLN C 1 319 ? -39.628 28.831  41.076  1.00 31.95 ? 362  GLN C CB  1 
ATOM   7695  C  CG  . GLN C 1 319 ? -38.866 29.946  41.802  1.00 33.04 ? 362  GLN C CG  1 
ATOM   7696  C  CD  . GLN C 1 319 ? -38.496 29.629  43.256  1.00 35.25 ? 362  GLN C CD  1 
ATOM   7697  O  OE1 . GLN C 1 319 ? -39.381 29.358  44.063  1.00 35.23 ? 362  GLN C OE1 1 
ATOM   7698  N  NE2 . GLN C 1 319 ? -37.286 29.603  43.786  1.00 35.54 ? 362  GLN C NE2 1 
ATOM   7699  N  N   . GLU C 1 320 ? -39.463 25.315  40.164  1.00 33.25 ? 363  GLU C N   1 
ATOM   7700  C  CA  . GLU C 1 320 ? -40.062 24.007  40.507  1.00 33.88 ? 363  GLU C CA  1 
ATOM   7701  C  C   . GLU C 1 320 ? -39.035 22.941  40.851  1.00 34.23 ? 363  GLU C C   1 
ATOM   7702  O  O   . GLU C 1 320 ? -39.380 21.753  40.898  1.00 33.78 ? 363  GLU C O   1 
ATOM   7703  C  CB  . GLU C 1 320 ? -40.978 23.528  39.393  1.00 33.54 ? 363  GLU C CB  1 
ATOM   7704  C  CG  . GLU C 1 320 ? -40.331 23.615  38.017  1.00 36.15 ? 363  GLU C CG  1 
ATOM   7705  C  CD  . GLU C 1 320 ? -39.428 22.431  37.769  1.00 37.78 ? 363  GLU C CD  1 
ATOM   7706  O  OE1 . GLU C 1 320 ? -39.794 21.317  38.193  1.00 39.45 ? 363  GLU C OE1 1 
ATOM   7707  O  OE2 . GLU C 1 320 ? -38.356 22.607  37.160  1.00 38.49 ? 363  GLU C OE2 1 
ATOM   7708  N  N   . LEU C 1 321 ? -37.799 23.328  41.082  1.00 35.31 ? 364  LEU C N   1 
ATOM   7709  C  CA  . LEU C 1 321 ? -36.760 22.382  41.402  1.00 35.58 ? 364  LEU C CA  1 
ATOM   7710  C  C   . LEU C 1 321 ? -36.541 22.356  42.906  1.00 35.70 ? 364  LEU C C   1 
ATOM   7711  O  O   . LEU C 1 321 ? -36.805 23.360  43.572  1.00 36.00 ? 364  LEU C O   1 
ATOM   7712  C  CB  . LEU C 1 321 ? -35.456 22.751  40.704  1.00 35.39 ? 364  LEU C CB  1 
ATOM   7713  C  CG  . LEU C 1 321 ? -35.326 22.444  39.194  1.00 34.86 ? 364  LEU C CG  1 
ATOM   7714  C  CD1 . LEU C 1 321 ? -35.036 20.961  38.973  1.00 34.58 ? 364  LEU C CD1 1 
ATOM   7715  C  CD2 . LEU C 1 321 ? -36.598 22.848  38.449  1.00 34.27 ? 364  LEU C CD2 1 
ATOM   7716  N  N   . GLN C 1 322 ? -36.085 21.251  43.476  1.00 36.51 ? 365  GLN C N   1 
ATOM   7717  C  CA  . GLN C 1 322 ? -35.804 21.226  44.910  1.00 37.97 ? 365  GLN C CA  1 
ATOM   7718  C  C   . GLN C 1 322 ? -34.316 21.259  45.246  1.00 38.49 ? 365  GLN C C   1 
ATOM   7719  O  O   . GLN C 1 322 ? -33.459 21.272  44.352  1.00 39.59 ? 365  GLN C O   1 
ATOM   7720  C  CB  . GLN C 1 322 ? -36.449 19.994  45.550  1.00 38.49 ? 365  GLN C CB  1 
ATOM   7721  C  CG  . GLN C 1 322 ? -37.850 20.239  46.107  1.00 40.75 ? 365  GLN C CG  1 
ATOM   7722  C  CD  . GLN C 1 322 ? -38.702 18.970  46.180  1.00 42.67 ? 365  GLN C CD  1 
ATOM   7723  O  OE1 . GLN C 1 322 ? -38.286 17.944  46.740  1.00 42.69 ? 365  GLN C OE1 1 
ATOM   7724  N  NE2 . GLN C 1 322 ? -39.910 19.041  45.615  1.00 42.78 ? 365  GLN C NE2 1 
ATOM   7725  N  N   . GLU C 1 323 ? -34.011 21.284  46.540  1.00 37.76 ? 366  GLU C N   1 
ATOM   7726  C  CA  . GLU C 1 323 ? -32.626 21.296  46.971  1.00 36.82 ? 366  GLU C CA  1 
ATOM   7727  C  C   . GLU C 1 323 ? -31.957 20.025  46.478  1.00 35.43 ? 366  GLU C C   1 
ATOM   7728  O  O   . GLU C 1 323 ? -32.550 18.950  46.493  1.00 34.75 ? 366  GLU C O   1 
ATOM   7729  C  CB  . GLU C 1 323 ? -32.519 21.411  48.498  1.00 39.06 ? 366  GLU C CB  1 
ATOM   7730  C  CG  . GLU C 1 323 ? -33.446 20.507  49.288  1.00 42.18 ? 366  GLU C CG  1 
ATOM   7731  C  CD  . GLU C 1 323 ? -34.915 20.841  49.074  1.00 44.14 ? 366  GLU C CD  1 
ATOM   7732  O  OE1 . GLU C 1 323 ? -35.226 22.035  48.856  1.00 44.34 ? 366  GLU C OE1 1 
ATOM   7733  O  OE2 . GLU C 1 323 ? -35.756 19.917  49.136  1.00 43.83 ? 366  GLU C OE2 1 
ATOM   7734  N  N   . GLY C 1 324 ? -30.721 20.168  46.019  1.00 34.52 ? 367  GLY C N   1 
ATOM   7735  C  CA  . GLY C 1 324 ? -29.978 19.035  45.504  1.00 32.23 ? 367  GLY C CA  1 
ATOM   7736  C  C   . GLY C 1 324 ? -29.999 19.067  43.992  1.00 30.71 ? 367  GLY C C   1 
ATOM   7737  O  O   . GLY C 1 324 ? -28.997 18.818  43.320  1.00 30.84 ? 367  GLY C O   1 
ATOM   7738  N  N   . GLN C 1 325 ? -31.160 19.387  43.450  1.00 29.00 ? 368  GLN C N   1 
ATOM   7739  C  CA  . GLN C 1 325 ? -31.308 19.443  42.017  1.00 28.02 ? 368  GLN C CA  1 
ATOM   7740  C  C   . GLN C 1 325 ? -30.430 20.557  41.511  1.00 27.13 ? 368  GLN C C   1 
ATOM   7741  O  O   . GLN C 1 325 ? -30.258 21.555  42.201  1.00 28.55 ? 368  GLN C O   1 
ATOM   7742  C  CB  . GLN C 1 325 ? -32.762 19.713  41.669  1.00 29.31 ? 368  GLN C CB  1 
ATOM   7743  C  CG  . GLN C 1 325 ? -33.696 18.732  42.330  1.00 27.76 ? 368  GLN C CG  1 
ATOM   7744  C  CD  . GLN C 1 325 ? -34.910 18.458  41.501  1.00 26.72 ? 368  GLN C CD  1 
ATOM   7745  O  OE1 . GLN C 1 325 ? -35.829 19.269  41.428  1.00 26.83 ? 368  GLN C OE1 1 
ATOM   7746  N  NE2 . GLN C 1 325 ? -34.915 17.312  40.848  1.00 25.72 ? 368  GLN C NE2 1 
ATOM   7747  N  N   . ARG C 1 326 ? -29.886 20.385  40.311  1.00 25.07 ? 369  ARG C N   1 
ATOM   7748  C  CA  . ARG C 1 326 ? -29.005 21.368  39.694  1.00 24.14 ? 369  ARG C CA  1 
ATOM   7749  C  C   . ARG C 1 326 ? -29.532 21.845  38.334  1.00 23.85 ? 369  ARG C C   1 
ATOM   7750  O  O   . ARG C 1 326 ? -29.941 21.036  37.504  1.00 24.92 ? 369  ARG C O   1 
ATOM   7751  C  CB  . ARG C 1 326 ? -27.621 20.744  39.533  1.00 25.69 ? 369  ARG C CB  1 
ATOM   7752  C  CG  . ARG C 1 326 ? -26.569 21.649  38.917  1.00 28.12 ? 369  ARG C CG  1 
ATOM   7753  C  CD  . ARG C 1 326 ? -25.229 21.518  39.653  1.00 25.18 ? 369  ARG C CD  1 
ATOM   7754  N  NE  . ARG C 1 326 ? -24.886 20.128  39.913  1.00 26.19 ? 369  ARG C NE  1 
ATOM   7755  C  CZ  . ARG C 1 326 ? -23.749 19.728  40.468  1.00 27.67 ? 369  ARG C CZ  1 
ATOM   7756  N  NH1 . ARG C 1 326 ? -22.833 20.618  40.825  1.00 27.65 ? 369  ARG C NH1 1 
ATOM   7757  N  NH2 . ARG C 1 326 ? -23.525 18.431  40.662  1.00 27.36 ? 369  ARG C NH2 1 
ATOM   7758  N  N   . CYS C 1 327 ? -29.532 23.156  38.111  1.00 22.63 ? 370  CYS C N   1 
ATOM   7759  C  CA  . CYS C 1 327 ? -30.002 23.715  36.848  1.00 22.36 ? 370  CYS C CA  1 
ATOM   7760  C  C   . CYS C 1 327 ? -28.912 24.506  36.117  1.00 23.46 ? 370  CYS C C   1 
ATOM   7761  O  O   . CYS C 1 327 ? -28.440 25.536  36.612  1.00 22.70 ? 370  CYS C O   1 
ATOM   7762  C  CB  . CYS C 1 327 ? -31.203 24.622  37.074  1.00 22.48 ? 370  CYS C CB  1 
ATOM   7763  S  SG  . CYS C 1 327 ? -31.763 25.428  35.547  1.00 24.94 ? 370  CYS C SG  1 
ATOM   7764  N  N   . VAL C 1 328 ? -28.527 24.025  34.931  1.00 24.22 ? 371  VAL C N   1 
ATOM   7765  C  CA  . VAL C 1 328 ? -27.490 24.675  34.122  1.00 24.57 ? 371  VAL C CA  1 
ATOM   7766  C  C   . VAL C 1 328 ? -28.008 25.600  33.029  1.00 23.98 ? 371  VAL C C   1 
ATOM   7767  O  O   . VAL C 1 328 ? -28.962 25.280  32.320  1.00 26.02 ? 371  VAL C O   1 
ATOM   7768  C  CB  . VAL C 1 328 ? -26.584 23.649  33.467  1.00 24.51 ? 371  VAL C CB  1 
ATOM   7769  C  CG1 . VAL C 1 328 ? -25.411 24.355  32.791  1.00 25.84 ? 371  VAL C CG1 1 
ATOM   7770  C  CG2 . VAL C 1 328 ? -26.103 22.665  34.515  1.00 25.28 ? 371  VAL C CG2 1 
ATOM   7771  N  N   . VAL C 1 329 ? -27.339 26.739  32.882  1.00 22.78 ? 372  VAL C N   1 
ATOM   7772  C  CA  . VAL C 1 329 ? -27.726 27.753  31.907  1.00 21.21 ? 372  VAL C CA  1 
ATOM   7773  C  C   . VAL C 1 329 ? -26.638 28.078  30.874  1.00 19.82 ? 372  VAL C C   1 
ATOM   7774  O  O   . VAL C 1 329 ? -25.444 27.994  31.177  1.00 20.11 ? 372  VAL C O   1 
ATOM   7775  C  CB  . VAL C 1 329 ? -28.132 29.042  32.652  1.00 20.64 ? 372  VAL C CB  1 
ATOM   7776  C  CG1 . VAL C 1 329 ? -28.352 30.161  31.686  1.00 21.68 ? 372  VAL C CG1 1 
ATOM   7777  C  CG2 . VAL C 1 329 ? -29.399 28.793  33.437  1.00 19.03 ? 372  VAL C CG2 1 
ATOM   7778  N  N   . ILE C 1 330 ? -27.052 28.425  29.655  1.00 17.23 ? 373  ILE C N   1 
ATOM   7779  C  CA  . ILE C 1 330 ? -26.099 28.780  28.616  1.00 17.83 ? 373  ILE C CA  1 
ATOM   7780  C  C   . ILE C 1 330 ? -26.172 30.283  28.465  1.00 17.27 ? 373  ILE C C   1 
ATOM   7781  O  O   . ILE C 1 330 ? -27.256 30.845  28.474  1.00 16.68 ? 373  ILE C O   1 
ATOM   7782  C  CB  . ILE C 1 330 ? -26.436 28.148  27.234  1.00 19.15 ? 373  ILE C CB  1 
ATOM   7783  C  CG1 . ILE C 1 330 ? -26.403 26.623  27.305  1.00 20.03 ? 373  ILE C CG1 1 
ATOM   7784  C  CG2 . ILE C 1 330 ? -25.425 28.598  26.193  1.00 15.79 ? 373  ILE C CG2 1 
ATOM   7785  C  CD1 . ILE C 1 330 ? -26.713 25.948  25.975  1.00 21.97 ? 373  ILE C CD1 1 
ATOM   7786  N  N   . LEU C 1 331 ? -25.017 30.926  28.343  1.00 17.76 ? 374  LEU C N   1 
ATOM   7787  C  CA  . LEU C 1 331 ? -24.918 32.365  28.156  1.00 19.86 ? 374  LEU C CA  1 
ATOM   7788  C  C   . LEU C 1 331 ? -24.045 32.577  26.950  1.00 21.23 ? 374  LEU C C   1 
ATOM   7789  O  O   . LEU C 1 331 ? -22.831 32.570  27.027  1.00 22.17 ? 374  LEU C O   1 
ATOM   7790  C  CB  . LEU C 1 331 ? -24.364 33.038  29.410  1.00 20.26 ? 374  LEU C CB  1 
ATOM   7791  C  CG  . LEU C 1 331 ? -25.110 32.788  30.732  1.00 20.53 ? 374  LEU C CG  1 
ATOM   7792  C  CD1 . LEU C 1 331 ? -24.356 33.395  31.902  1.00 21.32 ? 374  LEU C CD1 1 
ATOM   7793  C  CD2 . LEU C 1 331 ? -26.515 33.345  30.658  1.00 20.21 ? 374  LEU C CD2 1 
ATOM   7794  N  N   . PRO C 1 332 ? -24.733 32.781  25.812  1.00 21.65 ? 375  PRO C N   1 
ATOM   7795  C  CA  . PRO C 1 332 ? -24.081 32.910  24.491  1.00 23.01 ? 375  PRO C CA  1 
ATOM   7796  C  C   . PRO C 1 332 ? -22.807 33.697  24.154  1.00 22.39 ? 375  PRO C C   1 
ATOM   7797  O  O   . PRO C 1 332 ? -21.857 33.154  23.577  1.00 21.35 ? 375  PRO C O   1 
ATOM   7798  C  CB  . PRO C 1 332 ? -25.267 33.244  23.596  1.00 23.05 ? 375  PRO C CB  1 
ATOM   7799  C  CG  . PRO C 1 332 ? -26.331 32.368  24.161  1.00 21.68 ? 375  PRO C CG  1 
ATOM   7800  C  CD  . PRO C 1 332 ? -26.062 32.194  25.623  1.00 21.42 ? 375  PRO C CD  1 
ATOM   7801  N  N   . ASP C 1 333 ? -22.896 35.008  24.299  1.00 22.66 ? 376  ASP C N   1 
ATOM   7802  C  CA  . ASP C 1 333 ? -21.784 35.883  23.908  1.00 23.96 ? 376  ASP C CA  1 
ATOM   7803  C  C   . ASP C 1 333 ? -21.586 36.891  25.001  1.00 24.52 ? 376  ASP C C   1 
ATOM   7804  O  O   . ASP C 1 333 ? -22.339 36.909  25.973  1.00 24.73 ? 376  ASP C O   1 
ATOM   7805  C  CB  . ASP C 1 333 ? -22.042 36.537  22.540  1.00 22.75 ? 376  ASP C CB  1 
ATOM   7806  C  CG  . ASP C 1 333 ? -23.177 37.529  22.513  1.00 22.35 ? 376  ASP C CG  1 
ATOM   7807  O  OD1 . ASP C 1 333 ? -23.412 38.172  21.473  1.00 21.83 ? 376  ASP C OD1 1 
ATOM   7808  O  OD2 . ASP C 1 333 ? -23.846 37.654  23.567  1.00 20.07 ? 376  ASP C OD2 1 
ATOM   7809  N  N   . SER C 1 334 ? -20.583 37.738  24.857  1.00 24.41 ? 377  SER C N   1 
ATOM   7810  C  CA  . SER C 1 334 ? -20.263 38.716  25.904  1.00 23.77 ? 377  SER C CA  1 
ATOM   7811  C  C   . SER C 1 334 ? -20.905 40.081  25.689  1.00 23.82 ? 377  SER C C   1 
ATOM   7812  O  O   . SER C 1 334 ? -21.812 40.218  24.872  1.00 25.16 ? 377  SER C O   1 
ATOM   7813  C  CB  . SER C 1 334 ? -18.755 38.903  25.996  1.00 24.28 ? 377  SER C CB  1 
ATOM   7814  O  OG  . SER C 1 334 ? -18.322 39.905  25.096  1.00 23.06 ? 377  SER C OG  1 
ATOM   7815  N  N   . VAL C 1 335 ? -20.438 41.090  26.425  1.00 24.13 ? 378  VAL C N   1 
ATOM   7816  C  CA  . VAL C 1 335 ? -20.982 42.449  26.306  1.00 23.77 ? 378  VAL C CA  1 
ATOM   7817  C  C   . VAL C 1 335 ? -20.245 43.351  25.330  1.00 23.24 ? 378  VAL C C   1 
ATOM   7818  O  O   . VAL C 1 335 ? -20.615 44.513  25.153  1.00 23.18 ? 378  VAL C O   1 
ATOM   7819  C  CB  . VAL C 1 335 ? -20.980 43.167  27.632  1.00 23.60 ? 378  VAL C CB  1 
ATOM   7820  C  CG1 . VAL C 1 335 ? -21.813 42.408  28.618  1.00 26.03 ? 378  VAL C CG1 1 
ATOM   7821  C  CG2 . VAL C 1 335 ? -19.562 43.324  28.119  1.00 24.59 ? 378  VAL C CG2 1 
ATOM   7822  N  N   . ARG C 1 336 ? -19.209 42.824  24.693  1.00 22.77 ? 379  ARG C N   1 
ATOM   7823  C  CA  . ARG C 1 336 ? -18.458 43.630  23.751  1.00 23.80 ? 379  ARG C CA  1 
ATOM   7824  C  C   . ARG C 1 336 ? -19.258 44.009  22.521  1.00 24.06 ? 379  ARG C C   1 
ATOM   7825  O  O   . ARG C 1 336 ? -18.812 44.833  21.732  1.00 24.26 ? 379  ARG C O   1 
ATOM   7826  C  CB  . ARG C 1 336 ? -17.200 42.911  23.303  1.00 23.80 ? 379  ARG C CB  1 
ATOM   7827  C  CG  . ARG C 1 336 ? -16.310 43.786  22.466  1.00 24.68 ? 379  ARG C CG  1 
ATOM   7828  C  CD  . ARG C 1 336 ? -15.657 42.957  21.404  1.00 26.35 ? 379  ARG C CD  1 
ATOM   7829  N  NE  . ARG C 1 336 ? -16.670 42.307  20.581  1.00 25.19 ? 379  ARG C NE  1 
ATOM   7830  C  CZ  . ARG C 1 336 ? -16.667 41.018  20.271  1.00 24.26 ? 379  ARG C CZ  1 
ATOM   7831  N  NH1 . ARG C 1 336 ? -15.698 40.222  20.718  1.00 21.74 ? 379  ARG C NH1 1 
ATOM   7832  N  NH2 . ARG C 1 336 ? -17.637 40.528  19.510  1.00 24.51 ? 379  ARG C NH2 1 
ATOM   7833  N  N   . ASN C 1 337 ? -20.432 43.412  22.349  1.00 24.71 ? 380  ASN C N   1 
ATOM   7834  C  CA  . ASN C 1 337 ? -21.258 43.715  21.182  1.00 25.71 ? 380  ASN C CA  1 
ATOM   7835  C  C   . ASN C 1 337 ? -22.425 44.597  21.549  1.00 27.22 ? 380  ASN C C   1 
ATOM   7836  O  O   . ASN C 1 337 ? -23.332 44.811  20.737  1.00 27.10 ? 380  ASN C O   1 
ATOM   7837  C  CB  . ASN C 1 337 ? -21.803 42.434  20.540  1.00 25.45 ? 380  ASN C CB  1 
ATOM   7838  C  CG  . ASN C 1 337 ? -20.761 41.693  19.728  1.00 26.20 ? 380  ASN C CG  1 
ATOM   7839  O  OD1 . ASN C 1 337 ? -20.103 42.270  18.853  1.00 25.63 ? 380  ASN C OD1 1 
ATOM   7840  N  ND2 . ASN C 1 337 ? -20.607 40.401  20.008  1.00 23.57 ? 380  ASN C ND2 1 
ATOM   7841  N  N   . TYR C 1 338 ? -22.396 45.118  22.772  1.00 27.77 ? 381  TYR C N   1 
ATOM   7842  C  CA  . TYR C 1 338 ? -23.485 45.951  23.248  1.00 27.37 ? 381  TYR C CA  1 
ATOM   7843  C  C   . TYR C 1 338 ? -23.023 47.185  23.997  1.00 27.10 ? 381  TYR C C   1 
ATOM   7844  O  O   . TYR C 1 338 ? -23.819 47.850  24.663  1.00 27.44 ? 381  TYR C O   1 
ATOM   7845  C  CB  . TYR C 1 338 ? -24.432 45.107  24.128  1.00 26.65 ? 381  TYR C CB  1 
ATOM   7846  C  CG  . TYR C 1 338 ? -24.672 43.751  23.495  1.00 26.21 ? 381  TYR C CG  1 
ATOM   7847  C  CD1 . TYR C 1 338 ? -23.785 42.690  23.691  1.00 26.16 ? 381  TYR C CD1 1 
ATOM   7848  C  CD2 . TYR C 1 338 ? -25.780 43.544  22.697  1.00 26.93 ? 381  TYR C CD2 1 
ATOM   7849  C  CE1 . TYR C 1 338 ? -23.991 41.454  23.103  1.00 27.44 ? 381  TYR C CE1 1 
ATOM   7850  C  CE2 . TYR C 1 338 ? -25.999 42.315  22.069  1.00 27.69 ? 381  TYR C CE2 1 
ATOM   7851  C  CZ  . TYR C 1 338 ? -25.100 41.274  22.271  1.00 28.70 ? 381  TYR C CZ  1 
ATOM   7852  O  OH  . TYR C 1 338 ? -25.294 40.073  21.643  1.00 29.09 ? 381  TYR C OH  1 
ATOM   7853  N  N   . MET C 1 339 ? -21.741 47.505  23.865  1.00 27.06 ? 382  MET C N   1 
ATOM   7854  C  CA  . MET C 1 339 ? -21.175 48.662  24.547  1.00 27.57 ? 382  MET C CA  1 
ATOM   7855  C  C   . MET C 1 339 ? -21.919 49.978  24.373  1.00 27.59 ? 382  MET C C   1 
ATOM   7856  O  O   . MET C 1 339 ? -21.822 50.863  25.220  1.00 27.52 ? 382  MET C O   1 
ATOM   7857  C  CB  . MET C 1 339 ? -19.721 48.847  24.134  1.00 28.48 ? 382  MET C CB  1 
ATOM   7858  C  CG  . MET C 1 339 ? -18.759 47.918  24.865  1.00 30.74 ? 382  MET C CG  1 
ATOM   7859  S  SD  . MET C 1 339 ? -18.935 47.996  26.661  1.00 31.68 ? 382  MET C SD  1 
ATOM   7860  C  CE  . MET C 1 339 ? -19.228 49.745  26.904  1.00 30.28 ? 382  MET C CE  1 
ATOM   7861  N  N   . THR C 1 340 ? -22.663 50.109  23.282  1.00 28.19 ? 383  THR C N   1 
ATOM   7862  C  CA  . THR C 1 340 ? -23.404 51.334  23.023  1.00 27.93 ? 383  THR C CA  1 
ATOM   7863  C  C   . THR C 1 340 ? -24.911 51.095  22.983  1.00 28.79 ? 383  THR C C   1 
ATOM   7864  O  O   . THR C 1 340 ? -25.657 52.008  22.607  1.00 28.95 ? 383  THR C O   1 
ATOM   7865  C  CB  . THR C 1 340 ? -23.017 51.960  21.688  1.00 27.04 ? 383  THR C CB  1 
ATOM   7866  O  OG1 . THR C 1 340 ? -23.315 51.042  20.632  1.00 25.91 ? 383  THR C OG1 1 
ATOM   7867  C  CG2 . THR C 1 340 ? -21.543 52.302  21.677  1.00 26.52 ? 383  THR C CG2 1 
ATOM   7868  N  N   . LYS C 1 341 ? -25.403 49.912  23.322  1.00 30.91 ? 384  LYS C N   1 
ATOM   7869  C  CA  . LYS C 1 341 ? -26.808 49.667  23.399  1.00 32.55 ? 384  LYS C CA  1 
ATOM   7870  C  C   . LYS C 1 341 ? -26.983 49.336  24.875  1.00 33.52 ? 384  LYS C C   1 
ATOM   7871  O  O   . LYS C 1 341 ? -26.033 49.534  25.627  1.00 33.89 ? 384  LYS C O   1 
ATOM   7872  C  CB  . LYS C 1 341 ? -27.216 48.483  22.515  1.00 32.37 ? 384  LYS C CB  1 
ATOM   7873  C  CG  . LYS C 1 341 ? -26.537 48.474  21.163  1.00 33.99 ? 384  LYS C CG  1 
ATOM   7874  C  CD  . LYS C 1 341 ? -27.341 49.288  20.149  1.00 35.77 ? 384  LYS C CD  1 
ATOM   7875  C  CE  . LYS C 1 341 ? -28.522 48.486  19.655  1.00 34.10 ? 384  LYS C CE  1 
ATOM   7876  N  NZ  . LYS C 1 341 ? -28.097 47.249  18.952  1.00 32.06 ? 384  LYS C NZ  1 
ATOM   7877  N  N   . PHE C 1 342 ? -28.104 48.874  25.351  1.00 33.25 ? 385  PHE C N   1 
ATOM   7878  C  CA  . PHE C 1 342 ? -28.235 48.504  26.776  1.00 31.36 ? 385  PHE C CA  1 
ATOM   7879  C  C   . PHE C 1 342 ? -27.083 48.707  27.817  1.00 30.47 ? 385  PHE C C   1 
ATOM   7880  O  O   . PHE C 1 342 ? -27.405 49.146  28.926  1.00 31.00 ? 385  PHE C O   1 
ATOM   7881  C  CB  . PHE C 1 342 ? -28.857 47.135  26.703  1.00 30.75 ? 385  PHE C CB  1 
ATOM   7882  C  CG  . PHE C 1 342 ? -28.210 45.901  27.255  1.00 30.50 ? 385  PHE C CG  1 
ATOM   7883  C  CD1 . PHE C 1 342 ? -28.572 45.463  28.521  1.00 29.80 ? 385  PHE C CD1 1 
ATOM   7884  C  CD2 . PHE C 1 342 ? -27.308 45.145  26.535  1.00 30.75 ? 385  PHE C CD2 1 
ATOM   7885  C  CE1 . PHE C 1 342 ? -28.125 44.267  29.038  1.00 31.34 ? 385  PHE C CE1 1 
ATOM   7886  C  CE2 . PHE C 1 342 ? -26.878 43.933  27.046  1.00 30.12 ? 385  PHE C CE2 1 
ATOM   7887  C  CZ  . PHE C 1 342 ? -27.286 43.475  28.277  1.00 30.93 ? 385  PHE C CZ  1 
ATOM   7888  N  N   . LEU C 1 343 ? -25.795 48.446  27.594  1.00 28.20 ? 386  LEU C N   1 
ATOM   7889  C  CA  . LEU C 1 343 ? -24.836 48.737  28.679  1.00 25.88 ? 386  LEU C CA  1 
ATOM   7890  C  C   . LEU C 1 343 ? -24.929 50.225  29.076  1.00 24.95 ? 386  LEU C C   1 
ATOM   7891  O  O   . LEU C 1 343 ? -24.808 50.589  30.254  1.00 25.51 ? 386  LEU C O   1 
ATOM   7892  C  CB  . LEU C 1 343 ? -23.404 48.340  28.264  1.00 24.59 ? 386  LEU C CB  1 
ATOM   7893  C  CG  . LEU C 1 343 ? -22.826 47.137  29.004  1.00 23.70 ? 386  LEU C CG  1 
ATOM   7894  C  CD1 . LEU C 1 343 ? -21.431 46.820  28.505  1.00 23.58 ? 386  LEU C CD1 1 
ATOM   7895  C  CD2 . LEU C 1 343 ? -22.807 47.415  30.489  1.00 23.38 ? 386  LEU C CD2 1 
ATOM   7896  N  N   . SER C 1 344 ? -25.152 51.088  28.098  1.00 24.61 ? 387  SER C N   1 
ATOM   7897  C  CA  . SER C 1 344 ? -25.225 52.521  28.353  1.00 24.90 ? 387  SER C CA  1 
ATOM   7898  C  C   . SER C 1 344 ? -26.622 52.950  28.740  1.00 26.76 ? 387  SER C C   1 
ATOM   7899  O  O   . SER C 1 344 ? -27.569 52.703  27.997  1.00 29.51 ? 387  SER C O   1 
ATOM   7900  C  CB  . SER C 1 344 ? -24.781 53.326  27.123  1.00 23.31 ? 387  SER C CB  1 
ATOM   7901  O  OG  . SER C 1 344 ? -23.428 53.053  26.808  1.00 23.15 ? 387  SER C OG  1 
ATOM   7902  N  N   . ASP C 1 345 ? -26.753 53.605  29.893  1.00 26.72 ? 388  ASP C N   1 
ATOM   7903  C  CA  . ASP C 1 345 ? -28.063 54.053  30.342  1.00 27.44 ? 388  ASP C CA  1 
ATOM   7904  C  C   . ASP C 1 345 ? -28.685 54.983  29.303  1.00 28.18 ? 388  ASP C C   1 
ATOM   7905  O  O   . ASP C 1 345 ? -29.904 55.074  29.195  1.00 26.51 ? 388  ASP C O   1 
ATOM   7906  C  CB  . ASP C 1 345 ? -27.975 54.781  31.684  1.00 27.77 ? 388  ASP C CB  1 
ATOM   7907  C  CG  . ASP C 1 345 ? -27.445 53.905  32.798  1.00 28.37 ? 388  ASP C CG  1 
ATOM   7908  O  OD1 . ASP C 1 345 ? -27.575 54.317  33.971  1.00 27.98 ? 388  ASP C OD1 1 
ATOM   7909  O  OD2 . ASP C 1 345 ? -26.893 52.822  32.513  1.00 29.02 ? 388  ASP C OD2 1 
ATOM   7910  N  N   . ARG C 1 346 ? -27.842 55.682  28.547  1.00 29.11 ? 389  ARG C N   1 
ATOM   7911  C  CA  . ARG C 1 346 ? -28.339 56.546  27.505  1.00 30.87 ? 389  ARG C CA  1 
ATOM   7912  C  C   . ARG C 1 346 ? -29.269 55.749  26.624  1.00 31.76 ? 389  ARG C C   1 
ATOM   7913  O  O   . ARG C 1 346 ? -30.460 56.059  26.499  1.00 32.27 ? 389  ARG C O   1 
ATOM   7914  C  CB  . ARG C 1 346 ? -27.178 57.108  26.654  1.00 31.82 ? 389  ARG C CB  1 
ATOM   7915  C  CG  . ARG C 1 346 ? -26.346 58.222  27.276  1.00 32.48 ? 389  ARG C CG  1 
ATOM   7916  C  CD  . ARG C 1 346 ? -24.975 58.315  26.616  1.00 33.00 ? 389  ARG C CD  1 
ATOM   7917  N  NE  . ARG C 1 346 ? -24.171 57.128  26.921  1.00 34.21 ? 389  ARG C NE  1 
ATOM   7918  C  CZ  . ARG C 1 346 ? -22.971 56.864  26.404  1.00 32.63 ? 389  ARG C CZ  1 
ATOM   7919  N  NH1 . ARG C 1 346 ? -22.410 57.705  25.543  1.00 32.57 ? 389  ARG C NH1 1 
ATOM   7920  N  NH2 . ARG C 1 346 ? -22.336 55.750  26.744  1.00 30.66 ? 389  ARG C NH2 1 
ATOM   7921  N  N   . TRP C 1 347 ? -28.704 54.712  26.025  1.00 32.01 ? 390  TRP C N   1 
ATOM   7922  C  CA  . TRP C 1 347 ? -29.452 53.824  25.151  1.00 32.33 ? 390  TRP C CA  1 
ATOM   7923  C  C   . TRP C 1 347 ? -30.590 53.162  25.927  1.00 31.42 ? 390  TRP C C   1 
ATOM   7924  O  O   . TRP C 1 347 ? -31.756 53.258  25.542  1.00 31.04 ? 390  TRP C O   1 
ATOM   7925  C  CB  . TRP C 1 347 ? -28.499 52.761  24.589  1.00 34.60 ? 390  TRP C CB  1 
ATOM   7926  C  CG  . TRP C 1 347 ? -29.061 51.847  23.530  1.00 33.63 ? 390  TRP C CG  1 
ATOM   7927  C  CD1 . TRP C 1 347 ? -28.895 51.970  22.192  1.00 33.79 ? 390  TRP C CD1 1 
ATOM   7928  C  CD2 . TRP C 1 347 ? -29.863 50.669  23.729  1.00 32.85 ? 390  TRP C CD2 1 
ATOM   7929  N  NE1 . TRP C 1 347 ? -29.538 50.951  21.537  1.00 33.80 ? 390  TRP C NE1 1 
ATOM   7930  C  CE2 . TRP C 1 347 ? -30.140 50.139  22.456  1.00 32.58 ? 390  TRP C CE2 1 
ATOM   7931  C  CE3 . TRP C 1 347 ? -30.372 50.015  24.858  1.00 32.23 ? 390  TRP C CE3 1 
ATOM   7932  C  CZ2 . TRP C 1 347 ? -30.902 48.989  22.273  1.00 32.90 ? 390  TRP C CZ2 1 
ATOM   7933  C  CZ3 . TRP C 1 347 ? -31.130 48.872  24.675  1.00 32.33 ? 390  TRP C CZ3 1 
ATOM   7934  C  CH2 . TRP C 1 347 ? -31.388 48.371  23.389  1.00 32.06 ? 390  TRP C CH2 1 
ATOM   7935  N  N   . MET C 1 348 ? -30.246 52.487  27.019  1.00 29.96 ? 391  MET C N   1 
ATOM   7936  C  CA  . MET C 1 348 ? -31.241 51.806  27.839  1.00 29.98 ? 391  MET C CA  1 
ATOM   7937  C  C   . MET C 1 348 ? -32.353 52.740  28.291  1.00 29.76 ? 391  MET C C   1 
ATOM   7938  O  O   . MET C 1 348 ? -33.465 52.296  28.554  1.00 28.38 ? 391  MET C O   1 
ATOM   7939  C  CB  . MET C 1 348 ? -30.567 51.164  29.053  1.00 30.24 ? 391  MET C CB  1 
ATOM   7940  C  CG  . MET C 1 348 ? -30.313 49.662  28.896  1.00 28.87 ? 391  MET C CG  1 
ATOM   7941  S  SD  . MET C 1 348 ? -31.825 48.703  28.999  1.00 24.20 ? 391  MET C SD  1 
ATOM   7942  C  CE  . MET C 1 348 ? -31.700 48.025  30.657  1.00 25.43 ? 391  MET C CE  1 
ATOM   7943  N  N   . LEU C 1 349 ? -32.030 54.028  28.392  1.00 30.92 ? 392  LEU C N   1 
ATOM   7944  C  CA  . LEU C 1 349 ? -32.881 55.160  28.853  1.00 32.71 ? 392  LEU C CA  1 
ATOM   7945  C  C   . LEU C 1 349 ? -33.629 55.862  27.742  1.00 33.49 ? 392  LEU C C   1 
ATOM   7946  O  O   . LEU C 1 349 ? -34.781 56.279  27.916  1.00 33.79 ? 392  LEU C O   1 
ATOM   7947  C  CB  . LEU C 1 349 ? -32.046 56.335  29.383  1.00 34.41 ? 392  LEU C CB  1 
ATOM   7948  C  CG  . LEU C 1 349 ? -31.416 56.362  30.757  1.00 36.59 ? 392  LEU C CG  1 
ATOM   7949  C  CD1 . LEU C 1 349 ? -30.131 57.180  30.736  1.00 35.68 ? 392  LEU C CD1 1 
ATOM   7950  C  CD2 . LEU C 1 349 ? -32.403 56.901  31.778  1.00 35.14 ? 392  LEU C CD2 1 
ATOM   7951  N  N   . GLN C 1 350 ? -33.000 56.056  26.590  1.00 33.22 ? 393  GLN C N   1 
ATOM   7952  C  CA  . GLN C 1 350 ? -33.630 56.731  25.446  1.00 33.84 ? 393  GLN C CA  1 
ATOM   7953  C  C   . GLN C 1 350 ? -34.714 55.827  24.843  1.00 34.94 ? 393  GLN C C   1 
ATOM   7954  O  O   . GLN C 1 350 ? -35.753 56.286  24.376  1.00 35.30 ? 393  GLN C O   1 
ATOM   7955  C  CB  . GLN C 1 350 ? -32.569 57.095  24.392  1.00 33.64 ? 393  GLN C CB  1 
ATOM   7956  C  CG  . GLN C 1 350 ? -31.740 55.926  23.875  1.00 33.20 ? 393  GLN C CG  1 
ATOM   7957  C  CD  . GLN C 1 350 ? -30.876 56.316  22.686  1.00 31.86 ? 393  GLN C CD  1 
ATOM   7958  O  OE1 . GLN C 1 350 ? -30.508 55.477  21.881  1.00 30.65 ? 393  GLN C OE1 1 
ATOM   7959  N  NE2 . GLN C 1 350 ? -30.432 57.525  22.381  1.00 30.42 ? 393  GLN C NE2 1 
ATOM   7960  N  N   . LYS C 1 351 ? -34.454 54.521  24.822  1.00 35.00 ? 394  LYS C N   1 
ATOM   7961  C  CA  . LYS C 1 351 ? -35.420 53.496  24.393  1.00 34.88 ? 394  LYS C CA  1 
ATOM   7962  C  C   . LYS C 1 351 ? -36.288 53.336  25.584  1.00 36.97 ? 394  LYS C C   1 
ATOM   7963  O  O   . LYS C 1 351 ? -36.153 54.142  26.499  1.00 38.97 ? 394  LYS C O   1 
ATOM   7964  C  CB  . LYS C 1 351 ? -34.794 52.139  24.075  1.00 32.46 ? 394  LYS C CB  1 
ATOM   7965  C  CG  . LYS C 1 351 ? -33.505 52.235  23.288  1.00 30.25 ? 394  LYS C CG  1 
ATOM   7966  C  CD  . LYS C 1 351 ? -33.759 52.205  21.789  1.00 27.17 ? 394  LYS C CD  1 
ATOM   7967  C  CE  . LYS C 1 351 ? -33.138 53.390  21.087  1.00 24.13 ? 394  LYS C CE  1 
ATOM   7968  N  NZ  . LYS C 1 351 ? -33.589 54.687  21.663  1.00 20.83 ? 394  LYS C NZ  1 
ATOM   7969  N  N   . GLY C 1 352 ? -37.176 52.376  25.658  1.00 38.47 ? 395  GLY C N   1 
ATOM   7970  C  CA  . GLY C 1 352 ? -38.047 52.436  26.836  1.00 39.87 ? 395  GLY C CA  1 
ATOM   7971  C  C   . GLY C 1 352 ? -37.835 51.418  27.942  1.00 41.34 ? 395  GLY C C   1 
ATOM   7972  O  O   . GLY C 1 352 ? -38.776 50.710  28.301  1.00 40.60 ? 395  GLY C O   1 
ATOM   7973  N  N   . PHE C 1 353 ? -36.603 51.317  28.490  1.00 42.01 ? 396  PHE C N   1 
ATOM   7974  C  CA  . PHE C 1 353 ? -36.276 50.305  29.520  1.00 44.05 ? 396  PHE C CA  1 
ATOM   7975  C  C   . PHE C 1 353 ? -35.979 50.802  30.928  1.00 45.35 ? 396  PHE C C   1 
ATOM   7976  O  O   . PHE C 1 353 ? -36.709 50.480  31.869  1.00 45.78 ? 396  PHE C O   1 
ATOM   7977  C  CB  . PHE C 1 353 ? -35.087 49.483  29.084  1.00 44.25 ? 396  PHE C CB  1 
ATOM   7978  C  CG  . PHE C 1 353 ? -35.204 48.911  27.710  1.00 43.70 ? 396  PHE C CG  1 
ATOM   7979  C  CD1 . PHE C 1 353 ? -34.194 49.091  26.765  1.00 44.12 ? 396  PHE C CD1 1 
ATOM   7980  C  CD2 . PHE C 1 353 ? -36.331 48.178  27.351  1.00 43.13 ? 396  PHE C CD2 1 
ATOM   7981  C  CE1 . PHE C 1 353 ? -34.306 48.549  25.480  1.00 43.59 ? 396  PHE C CE1 1 
ATOM   7982  C  CE2 . PHE C 1 353 ? -36.452 47.633  26.071  1.00 43.18 ? 396  PHE C CE2 1 
ATOM   7983  C  CZ  . PHE C 1 353 ? -35.434 47.821  25.134  1.00 43.07 ? 396  PHE C CZ  1 
ATOM   7984  N  N   . LEU C 1 354 ? -34.930 51.595  31.077  1.00 47.32 ? 397  LEU C N   1 
ATOM   7985  C  CA  . LEU C 1 354 ? -34.618 52.170  32.359  1.00 49.02 ? 397  LEU C CA  1 
ATOM   7986  C  C   . LEU C 1 354 ? -35.693 53.188  32.720  1.00 50.41 ? 397  LEU C C   1 
ATOM   7987  O  O   . LEU C 1 354 ? -36.306 53.132  33.776  1.00 50.58 ? 397  LEU C O   1 
ATOM   7988  C  CB  . LEU C 1 354 ? -33.272 52.893  32.326  1.00 48.49 ? 397  LEU C CB  1 
ATOM   7989  C  CG  . LEU C 1 354 ? -31.995 52.101  32.585  1.00 48.67 ? 397  LEU C CG  1 
ATOM   7990  C  CD1 . LEU C 1 354 ? -30.767 52.861  32.084  1.00 47.76 ? 397  LEU C CD1 1 
ATOM   7991  C  CD2 . LEU C 1 354 ? -31.848 51.801  34.073  1.00 48.06 ? 397  LEU C CD2 1 
ATOM   7992  N  N   . LYS C 1 355 ? -35.888 54.126  31.796  1.00 51.63 ? 398  LYS C N   1 
ATOM   7993  C  CA  . LYS C 1 355 ? -36.872 55.188  31.876  1.00 53.22 ? 398  LYS C CA  1 
ATOM   7994  C  C   . LYS C 1 355 ? -37.007 55.814  30.492  1.00 54.41 ? 398  LYS C C   1 
ATOM   7995  O  O   . LYS C 1 355 ? -36.352 55.389  29.532  1.00 54.54 ? 398  LYS C O   1 
ATOM   7996  C  CB  . LYS C 1 355 ? -36.458 56.297  32.836  1.00 52.04 ? 398  LYS C CB  1 
ATOM   7997  C  CG  . LYS C 1 355 ? -35.918 55.802  34.144  1.00 50.70 ? 398  LYS C CG  1 
ATOM   7998  C  CD  . LYS C 1 355 ? -36.944 54.937  34.837  1.00 48.20 ? 398  LYS C CD  1 
ATOM   7999  C  CE  . LYS C 1 355 ? -36.404 54.408  36.151  1.00 46.56 ? 398  LYS C CE  1 
ATOM   8000  N  NZ  . LYS C 1 355 ? -36.116 55.495  37.117  1.00 44.16 ? 398  LYS C NZ  1 
ATOM   8001  N  N   . GLU C 1 356 ? -37.868 56.796  30.386  1.00 56.06 ? 399  GLU C N   1 
ATOM   8002  C  CA  . GLU C 1 356 ? -38.021 57.501  29.122  1.00 57.75 ? 399  GLU C CA  1 
ATOM   8003  C  C   . GLU C 1 356 ? -39.286 58.355  29.122  1.00 58.15 ? 399  GLU C C   1 
ATOM   8004  O  O   . GLU C 1 356 ? -40.069 58.215  30.040  1.00 59.02 ? 399  GLU C O   1 
ATOM   8005  C  CB  . GLU C 1 356 ? -38.034 56.529  27.932  1.00 59.06 ? 399  GLU C CB  1 
ATOM   8006  C  CG  . GLU C 1 356 ? -39.415 55.944  27.647  1.00 60.66 ? 399  GLU C CG  1 
ATOM   8007  C  CD  . GLU C 1 356 ? -39.995 56.343  26.293  1.00 61.71 ? 399  GLU C CD  1 
ATOM   8008  O  OE1 . GLU C 1 356 ? -39.293 56.148  25.288  1.00 62.32 ? 399  GLU C OE1 1 
ATOM   8009  O  OE2 . GLU C 1 356 ? -41.142 56.846  26.263  1.00 62.45 ? 399  GLU C OE2 1 
ATOM   8010  N  N   . ASP D 1 4   ? 4.198   55.714  44.777  1.00 29.47 ? 47   ASP D N   1 
ATOM   8011  C  CA  . ASP D 1 4   ? 4.170   57.160  44.906  1.00 29.93 ? 47   ASP D CA  1 
ATOM   8012  C  C   . ASP D 1 4   ? 5.534   57.695  45.344  1.00 30.05 ? 47   ASP D C   1 
ATOM   8013  O  O   . ASP D 1 4   ? 5.871   58.851  45.054  1.00 29.96 ? 47   ASP D O   1 
ATOM   8014  C  CB  . ASP D 1 4   ? 3.072   57.576  45.890  1.00 30.57 ? 47   ASP D CB  1 
ATOM   8015  C  CG  . ASP D 1 4   ? 2.256   58.779  45.459  1.00 29.88 ? 47   ASP D CG  1 
ATOM   8016  O  OD1 . ASP D 1 4   ? 1.130   58.955  45.991  1.00 29.80 ? 47   ASP D OD1 1 
ATOM   8017  O  OD2 . ASP D 1 4   ? 2.718   59.553  44.586  1.00 29.94 ? 47   ASP D OD2 1 
ATOM   8018  N  N   . ALA D 1 5   ? 6.319   56.893  46.042  1.00 26.23 ? 48   ALA D N   1 
ATOM   8019  C  CA  . ALA D 1 5   ? 7.604   57.318  46.545  1.00 26.62 ? 48   ALA D CA  1 
ATOM   8020  C  C   . ALA D 1 5   ? 8.463   56.123  47.030  1.00 27.58 ? 48   ALA D C   1 
ATOM   8021  O  O   . ALA D 1 5   ? 8.061   54.960  46.875  1.00 28.65 ? 48   ALA D O   1 
ATOM   8022  C  CB  . ALA D 1 5   ? 7.433   58.311  47.677  1.00 24.49 ? 48   ALA D CB  1 
ATOM   8023  N  N   . PRO D 1 6   ? 9.630   56.390  47.645  1.00 25.06 ? 49   PRO D N   1 
ATOM   8024  C  CA  . PRO D 1 6   ? 10.570  55.236  47.875  1.00 24.01 ? 49   PRO D CA  1 
ATOM   8025  C  C   . PRO D 1 6   ? 10.033  53.859  48.327  1.00 22.97 ? 49   PRO D C   1 
ATOM   8026  O  O   . PRO D 1 6   ? 8.926   53.772  48.871  1.00 23.68 ? 49   PRO D O   1 
ATOM   8027  C  CB  . PRO D 1 6   ? 11.668  55.902  48.658  1.00 24.63 ? 49   PRO D CB  1 
ATOM   8028  C  CG  . PRO D 1 6   ? 11.734  57.250  47.996  1.00 23.57 ? 49   PRO D CG  1 
ATOM   8029  C  CD  . PRO D 1 6   ? 10.381  57.631  47.442  1.00 24.07 ? 49   PRO D CD  1 
ATOM   8030  N  N   . SER D 1 7   ? 10.821  52.798  48.090  1.00 23.96 ? 50   SER D N   1 
ATOM   8031  C  CA  . SER D 1 7   ? 10.500  51.437  48.510  1.00 23.62 ? 50   SER D CA  1 
ATOM   8032  C  C   . SER D 1 7   ? 11.326  51.103  49.744  1.00 23.71 ? 50   SER D C   1 
ATOM   8033  O  O   . SER D 1 7   ? 12.554  51.174  49.704  1.00 24.68 ? 50   SER D O   1 
ATOM   8034  C  CB  . SER D 1 7   ? 10.823  50.449  47.384  1.00 24.50 ? 50   SER D CB  1 
ATOM   8035  O  OG  . SER D 1 7   ? 11.953  50.869  46.632  1.00 17.23 ? 50   SER D OG  1 
ATOM   8036  N  N   . ARG D 1 8   ? 10.667  50.747  50.841  1.00 22.73 ? 51   ARG D N   1 
ATOM   8037  C  CA  . ARG D 1 8   ? 11.404  50.396  52.042  1.00 21.75 ? 51   ARG D CA  1 
ATOM   8038  C  C   . ARG D 1 8   ? 11.851  48.958  51.944  1.00 23.35 ? 51   ARG D C   1 
ATOM   8039  O  O   . ARG D 1 8   ? 12.754  48.515  52.650  1.00 22.53 ? 51   ARG D O   1 
ATOM   8040  C  CB  . ARG D 1 8   ? 10.530  50.566  53.278  1.00 19.64 ? 51   ARG D CB  1 
ATOM   8041  C  CG  . ARG D 1 8   ? 10.303  52.000  53.705  1.00 17.72 ? 51   ARG D CG  1 
ATOM   8042  C  CD  . ARG D 1 8   ? 8.900   52.449  53.371  1.00 15.12 ? 51   ARG D CD  1 
ATOM   8043  N  NE  . ARG D 1 8   ? 8.035   52.367  54.538  1.00 10.13 ? 51   ARG D NE  1 
ATOM   8044  C  CZ  . ARG D 1 8   ? 6.791   52.830  54.550  1.00 10.86 ? 51   ARG D CZ  1 
ATOM   8045  N  NH1 . ARG D 1 8   ? 6.288   53.393  53.459  1.00 11.67 ? 51   ARG D NH1 1 
ATOM   8046  N  NH2 . ARG D 1 8   ? 6.052   52.743  55.645  1.00 8.65  ? 51   ARG D NH2 1 
ATOM   8047  N  N   . CYS D 1 9   ? 11.216  48.239  51.032  1.00 27.08 ? 52   CYS D N   1 
ATOM   8048  C  CA  . CYS D 1 9   ? 11.488  46.822  50.831  1.00 31.05 ? 52   CYS D CA  1 
ATOM   8049  C  C   . CYS D 1 9   ? 12.942  46.373  50.887  1.00 32.75 ? 52   CYS D C   1 
ATOM   8050  O  O   . CYS D 1 9   ? 13.814  46.960  50.243  1.00 33.18 ? 52   CYS D O   1 
ATOM   8051  C  CB  . CYS D 1 9   ? 10.890  46.349  49.507  1.00 31.85 ? 52   CYS D CB  1 
ATOM   8052  S  SG  . CYS D 1 9   ? 10.817  44.552  49.369  1.00 33.55 ? 52   CYS D SG  1 
ATOM   8053  N  N   . THR D 1 10  ? 13.180  45.310  51.652  1.00 33.85 ? 53   THR D N   1 
ATOM   8054  C  CA  . THR D 1 10  ? 14.509  44.728  51.797  1.00 35.42 ? 53   THR D CA  1 
ATOM   8055  C  C   . THR D 1 10  ? 14.550  43.402  51.022  1.00 37.21 ? 53   THR D C   1 
ATOM   8056  O  O   . THR D 1 10  ? 14.365  42.317  51.582  1.00 36.42 ? 53   THR D O   1 
ATOM   8057  C  CB  . THR D 1 10  ? 14.849  44.497  53.288  1.00 33.45 ? 53   THR D CB  1 
ATOM   8058  O  OG1 . THR D 1 10  ? 13.989  43.495  53.843  1.00 31.72 ? 53   THR D OG1 1 
ATOM   8059  C  CG2 . THR D 1 10  ? 14.651  45.783  54.054  1.00 32.82 ? 53   THR D CG2 1 
ATOM   8060  N  N   . TRP D 1 11  ? 14.777  43.511  49.717  1.00 38.50 ? 54   TRP D N   1 
ATOM   8061  C  CA  . TRP D 1 11  ? 14.832  42.349  48.839  1.00 39.99 ? 54   TRP D CA  1 
ATOM   8062  C  C   . TRP D 1 11  ? 16.117  42.413  48.021  1.00 40.62 ? 54   TRP D C   1 
ATOM   8063  O  O   . TRP D 1 11  ? 16.600  43.491  47.689  1.00 41.32 ? 54   TRP D O   1 
ATOM   8064  C  CB  . TRP D 1 11  ? 13.607  42.348  47.904  1.00 40.33 ? 54   TRP D CB  1 
ATOM   8065  C  CG  . TRP D 1 11  ? 13.500  41.172  46.957  1.00 39.13 ? 54   TRP D CG  1 
ATOM   8066  C  CD1 . TRP D 1 11  ? 12.981  39.945  47.228  1.00 38.60 ? 54   TRP D CD1 1 
ATOM   8067  C  CD2 . TRP D 1 11  ? 13.948  41.123  45.598  1.00 38.56 ? 54   TRP D CD2 1 
ATOM   8068  N  NE1 . TRP D 1 11  ? 13.074  39.130  46.128  1.00 37.86 ? 54   TRP D NE1 1 
ATOM   8069  C  CE2 . TRP D 1 11  ? 13.665  39.829  45.112  1.00 38.32 ? 54   TRP D CE2 1 
ATOM   8070  C  CE3 . TRP D 1 11  ? 14.564  42.048  44.744  1.00 37.28 ? 54   TRP D CE3 1 
ATOM   8071  C  CZ2 . TRP D 1 11  ? 13.977  39.435  43.814  1.00 37.76 ? 54   TRP D CZ2 1 
ATOM   8072  C  CZ3 . TRP D 1 11  ? 14.874  41.655  43.452  1.00 36.45 ? 54   TRP D CZ3 1 
ATOM   8073  C  CH2 . TRP D 1 11  ? 14.579  40.357  43.001  1.00 36.83 ? 54   TRP D CH2 1 
ATOM   8074  N  N   . GLN D 1 12  ? 16.678  41.249  47.728  1.00 40.98 ? 55   GLN D N   1 
ATOM   8075  C  CA  . GLN D 1 12  ? 17.888  41.150  46.922  1.00 40.42 ? 55   GLN D CA  1 
ATOM   8076  C  C   . GLN D 1 12  ? 17.886  39.768  46.281  1.00 39.54 ? 55   GLN D C   1 
ATOM   8077  O  O   . GLN D 1 12  ? 17.376  38.802  46.857  1.00 39.08 ? 55   GLN D O   1 
ATOM   8078  C  CB  . GLN D 1 12  ? 19.154  41.348  47.771  1.00 41.67 ? 55   GLN D CB  1 
ATOM   8079  C  CG  . GLN D 1 12  ? 19.484  42.808  48.086  1.00 42.07 ? 55   GLN D CG  1 
ATOM   8080  C  CD  . GLN D 1 12  ? 20.996  43.083  48.164  1.00 43.20 ? 55   GLN D CD  1 
ATOM   8081  O  OE1 . GLN D 1 12  ? 21.430  44.241  48.283  1.00 42.83 ? 55   GLN D OE1 1 
ATOM   8082  N  NE2 . GLN D 1 12  ? 21.799  42.019  48.091  1.00 41.94 ? 55   GLN D NE2 1 
ATOM   8083  N  N   . LEU D 1 13  ? 18.436  39.668  45.080  1.00 38.06 ? 56   LEU D N   1 
ATOM   8084  C  CA  . LEU D 1 13  ? 18.449  38.383  44.404  1.00 37.09 ? 56   LEU D CA  1 
ATOM   8085  C  C   . LEU D 1 13  ? 19.456  37.452  45.044  1.00 35.07 ? 56   LEU D C   1 
ATOM   8086  O  O   . LEU D 1 13  ? 20.581  37.308  44.561  1.00 34.78 ? 56   LEU D O   1 
ATOM   8087  C  CB  . LEU D 1 13  ? 18.777  38.555  42.922  1.00 38.98 ? 56   LEU D CB  1 
ATOM   8088  C  CG  . LEU D 1 13  ? 18.713  37.272  42.093  1.00 40.07 ? 56   LEU D CG  1 
ATOM   8089  C  CD1 . LEU D 1 13  ? 17.391  36.580  42.350  1.00 39.25 ? 56   LEU D CD1 1 
ATOM   8090  C  CD2 . LEU D 1 13  ? 18.886  37.595  40.617  1.00 40.34 ? 56   LEU D CD2 1 
ATOM   8091  N  N   . GLY D 1 14  ? 19.040  36.812  46.129  1.00 32.28 ? 57   GLY D N   1 
ATOM   8092  C  CA  . GLY D 1 14  ? 19.926  35.905  46.823  1.00 29.86 ? 57   GLY D CA  1 
ATOM   8093  C  C   . GLY D 1 14  ? 19.435  35.676  48.232  1.00 27.31 ? 57   GLY D C   1 
ATOM   8094  O  O   . GLY D 1 14  ? 20.107  35.052  49.038  1.00 26.83 ? 57   GLY D O   1 
ATOM   8095  N  N   . ARG D 1 15  ? 18.257  36.198  48.522  1.00 25.74 ? 58   ARG D N   1 
ATOM   8096  C  CA  . ARG D 1 15  ? 17.653  36.039  49.825  1.00 25.33 ? 58   ARG D CA  1 
ATOM   8097  C  C   . ARG D 1 15  ? 16.635  34.884  49.772  1.00 25.31 ? 58   ARG D C   1 
ATOM   8098  O  O   . ARG D 1 15  ? 15.710  34.888  48.974  1.00 25.49 ? 58   ARG D O   1 
ATOM   8099  C  CB  . ARG D 1 15  ? 16.951  37.350  50.242  1.00 24.61 ? 58   ARG D CB  1 
ATOM   8100  C  CG  . ARG D 1 15  ? 17.871  38.540  50.498  1.00 22.39 ? 58   ARG D CG  1 
ATOM   8101  C  CD  . ARG D 1 15  ? 17.709  39.015  51.932  1.00 19.38 ? 58   ARG D CD  1 
ATOM   8102  N  NE  . ARG D 1 15  ? 16.596  39.947  52.103  1.00 19.91 ? 58   ARG D NE  1 
ATOM   8103  C  CZ  . ARG D 1 15  ? 16.112  40.304  53.288  1.00 19.93 ? 58   ARG D CZ  1 
ATOM   8104  N  NH1 . ARG D 1 15  ? 16.646  39.797  54.387  1.00 19.53 ? 58   ARG D NH1 1 
ATOM   8105  N  NH2 . ARG D 1 15  ? 15.106  41.159  53.382  1.00 18.69 ? 58   ARG D NH2 1 
ATOM   8106  N  N   . PRO D 1 16  ? 16.825  33.858  50.596  1.00 25.56 ? 59   PRO D N   1 
ATOM   8107  C  CA  . PRO D 1 16  ? 15.890  32.732  50.613  1.00 26.13 ? 59   PRO D CA  1 
ATOM   8108  C  C   . PRO D 1 16  ? 14.402  33.121  50.707  1.00 25.31 ? 59   PRO D C   1 
ATOM   8109  O  O   . PRO D 1 16  ? 14.035  34.057  51.415  1.00 23.47 ? 59   PRO D O   1 
ATOM   8110  C  CB  . PRO D 1 16  ? 16.359  31.951  51.827  1.00 25.89 ? 59   PRO D CB  1 
ATOM   8111  C  CG  . PRO D 1 16  ? 17.867  32.033  51.661  1.00 25.69 ? 59   PRO D CG  1 
ATOM   8112  C  CD  . PRO D 1 16  ? 18.140  33.435  51.111  1.00 25.91 ? 59   PRO D CD  1 
ATOM   8113  N  N   . ALA D 1 17  ? 13.548  32.389  50.009  1.00 25.27 ? 60   ALA D N   1 
ATOM   8114  C  CA  . ALA D 1 17  ? 12.126  32.667  50.060  1.00 26.90 ? 60   ALA D CA  1 
ATOM   8115  C  C   . ALA D 1 17  ? 11.638  32.814  51.519  1.00 27.86 ? 60   ALA D C   1 
ATOM   8116  O  O   . ALA D 1 17  ? 10.967  33.791  51.857  1.00 28.98 ? 60   ALA D O   1 
ATOM   8117  C  CB  . ALA D 1 17  ? 11.363  31.550  49.354  1.00 25.74 ? 60   ALA D CB  1 
ATOM   8118  N  N   . SER D 1 18  ? 11.990  31.860  52.380  1.00 27.76 ? 61   SER D N   1 
ATOM   8119  C  CA  . SER D 1 18  ? 11.552  31.886  53.777  1.00 27.57 ? 61   SER D CA  1 
ATOM   8120  C  C   . SER D 1 18  ? 11.846  33.210  54.466  1.00 27.37 ? 61   SER D C   1 
ATOM   8121  O  O   . SER D 1 18  ? 11.224  33.531  55.480  1.00 27.44 ? 61   SER D O   1 
ATOM   8122  C  CB  . SER D 1 18  ? 12.253  30.758  54.547  1.00 27.85 ? 61   SER D CB  1 
ATOM   8123  O  OG  . SER D 1 18  ? 13.650  30.778  54.312  1.00 29.04 ? 61   SER D OG  1 
ATOM   8124  N  N   . GLU D 1 19  ? 12.791  33.980  53.921  1.00 26.44 ? 62   GLU D N   1 
ATOM   8125  C  CA  . GLU D 1 19  ? 13.242  35.218  54.568  1.00 25.26 ? 62   GLU D CA  1 
ATOM   8126  C  C   . GLU D 1 19  ? 12.314  36.445  54.397  1.00 25.82 ? 62   GLU D C   1 
ATOM   8127  O  O   . GLU D 1 19  ? 12.696  37.565  54.781  1.00 25.68 ? 62   GLU D O   1 
ATOM   8128  C  CB  . GLU D 1 19  ? 14.647  35.542  54.071  1.00 24.77 ? 62   GLU D CB  1 
ATOM   8129  C  CG  . GLU D 1 19  ? 15.481  36.385  55.017  1.00 22.52 ? 62   GLU D CG  1 
ATOM   8130  C  CD  . GLU D 1 19  ? 16.977  36.219  54.843  1.00 21.93 ? 62   GLU D CD  1 
ATOM   8131  O  OE1 . GLU D 1 19  ? 17.495  36.694  53.812  1.00 20.59 ? 62   GLU D OE1 1 
ATOM   8132  O  OE2 . GLU D 1 19  ? 17.622  35.617  55.741  1.00 22.15 ? 62   GLU D OE2 1 
ATOM   8133  N  N   . SER D 1 20  ? 11.126  36.275  53.805  1.00 25.95 ? 63   SER D N   1 
ATOM   8134  C  CA  . SER D 1 20  ? 10.154  37.364  53.502  1.00 26.08 ? 63   SER D CA  1 
ATOM   8135  C  C   . SER D 1 20  ? 8.957   37.487  54.457  1.00 26.89 ? 63   SER D C   1 
ATOM   8136  O  O   . SER D 1 20  ? 8.367   36.480  54.859  1.00 27.20 ? 63   SER D O   1 
ATOM   8137  C  CB  . SER D 1 20  ? 9.665   37.206  52.066  1.00 24.97 ? 63   SER D CB  1 
ATOM   8138  O  OG  . SER D 1 20  ? 10.588  36.450  51.299  1.00 25.62 ? 63   SER D OG  1 
ATOM   8139  N  N   . PRO D 1 21  ? 8.606   38.726  54.794  1.00 27.38 ? 64   PRO D N   1 
ATOM   8140  C  CA  . PRO D 1 21  ? 7.474   39.095  55.652  1.00 28.60 ? 64   PRO D CA  1 
ATOM   8141  C  C   . PRO D 1 21  ? 6.169   38.807  54.934  1.00 30.22 ? 64   PRO D C   1 
ATOM   8142  O  O   . PRO D 1 21  ? 5.125   38.484  55.515  1.00 31.40 ? 64   PRO D O   1 
ATOM   8143  C  CB  . PRO D 1 21  ? 7.608   40.590  55.763  1.00 28.18 ? 64   PRO D CB  1 
ATOM   8144  C  CG  . PRO D 1 21  ? 8.996   40.829  55.712  1.00 26.78 ? 64   PRO D CG  1 
ATOM   8145  C  CD  . PRO D 1 21  ? 9.648   39.756  54.879  1.00 26.36 ? 64   PRO D CD  1 
ATOM   8146  N  N   . HIS D 1 22  ? 6.239   39.036  53.632  1.00 30.96 ? 65   HIS D N   1 
ATOM   8147  C  CA  . HIS D 1 22  ? 5.113   38.875  52.733  1.00 32.26 ? 65   HIS D CA  1 
ATOM   8148  C  C   . HIS D 1 22  ? 4.556   37.475  52.680  1.00 33.93 ? 65   HIS D C   1 
ATOM   8149  O  O   . HIS D 1 22  ? 5.245   36.506  52.353  1.00 33.88 ? 65   HIS D O   1 
ATOM   8150  C  CB  . HIS D 1 22  ? 5.532   39.314  51.357  1.00 30.91 ? 65   HIS D CB  1 
ATOM   8151  C  CG  . HIS D 1 22  ? 6.200   40.646  51.347  1.00 28.41 ? 65   HIS D CG  1 
ATOM   8152  N  ND1 . HIS D 1 22  ? 5.624   41.774  51.889  1.00 26.87 ? 65   HIS D ND1 1 
ATOM   8153  C  CD2 . HIS D 1 22  ? 7.364   41.045  50.798  1.00 26.02 ? 65   HIS D CD2 1 
ATOM   8154  C  CE1 . HIS D 1 22  ? 6.404   42.815  51.660  1.00 25.99 ? 65   HIS D CE1 1 
ATOM   8155  N  NE2 . HIS D 1 22  ? 7.465   42.398  50.993  1.00 24.16 ? 65   HIS D NE2 1 
ATOM   8156  N  N   . HIS D 1 23  ? 3.301   37.400  53.060  1.00 36.15 ? 66   HIS D N   1 
ATOM   8157  C  CA  . HIS D 1 23  ? 2.568   36.179  53.091  1.00 38.93 ? 66   HIS D CA  1 
ATOM   8158  C  C   . HIS D 1 23  ? 2.284   35.927  51.615  1.00 38.25 ? 66   HIS D C   1 
ATOM   8159  O  O   . HIS D 1 23  ? 1.330   36.447  51.031  1.00 38.24 ? 66   HIS D O   1 
ATOM   8160  C  CB  . HIS D 1 23  ? 1.343   36.427  53.977  1.00 42.99 ? 66   HIS D CB  1 
ATOM   8161  C  CG  . HIS D 1 23  ? 0.137   35.633  53.607  1.00 48.44 ? 66   HIS D CG  1 
ATOM   8162  N  ND1 . HIS D 1 23  ? 0.170   34.281  53.343  1.00 50.65 ? 66   HIS D ND1 1 
ATOM   8163  C  CD2 . HIS D 1 23  ? -1.158  36.003  53.511  1.00 50.05 ? 66   HIS D CD2 1 
ATOM   8164  C  CE1 . HIS D 1 23  ? -1.056  33.852  53.104  1.00 49.85 ? 66   HIS D CE1 1 
ATOM   8165  N  NE2 . HIS D 1 23  ? -1.880  34.879  53.200  1.00 49.81 ? 66   HIS D NE2 1 
ATOM   8166  N  N   . HIS D 1 24  ? 3.217   35.182  51.017  1.00 37.60 ? 67   HIS D N   1 
ATOM   8167  C  CA  . HIS D 1 24  ? 3.199   34.802  49.607  1.00 36.22 ? 67   HIS D CA  1 
ATOM   8168  C  C   . HIS D 1 24  ? 2.077   33.801  49.396  1.00 35.76 ? 67   HIS D C   1 
ATOM   8169  O  O   . HIS D 1 24  ? 1.715   33.075  50.316  1.00 36.63 ? 67   HIS D O   1 
ATOM   8170  C  CB  . HIS D 1 24  ? 4.547   34.170  49.211  1.00 36.06 ? 67   HIS D CB  1 
ATOM   8171  C  CG  . HIS D 1 24  ? 5.700   35.140  49.166  1.00 35.80 ? 67   HIS D CG  1 
ATOM   8172  N  ND1 . HIS D 1 24  ? 5.542   36.469  48.843  1.00 34.27 ? 67   HIS D ND1 1 
ATOM   8173  C  CD2 . HIS D 1 24  ? 7.037   34.945  49.291  1.00 36.43 ? 67   HIS D CD2 1 
ATOM   8174  C  CE1 . HIS D 1 24  ? 6.727   37.049  48.763  1.00 35.49 ? 67   HIS D CE1 1 
ATOM   8175  N  NE2 . HIS D 1 24  ? 7.653   36.146  49.030  1.00 35.04 ? 67   HIS D NE2 1 
ATOM   8176  N  N   . THR D 1 25  ? 1.547   33.746  48.178  1.00 35.02 ? 68   THR D N   1 
ATOM   8177  C  CA  . THR D 1 25  ? 0.433   32.848  47.855  1.00 33.38 ? 68   THR D CA  1 
ATOM   8178  C  C   . THR D 1 25  ? 0.701   31.913  46.667  1.00 32.78 ? 68   THR D C   1 
ATOM   8179  O  O   . THR D 1 25  ? 1.324   32.308  45.679  1.00 32.28 ? 68   THR D O   1 
ATOM   8180  C  CB  . THR D 1 25  ? -0.817  33.681  47.540  1.00 31.29 ? 68   THR D CB  1 
ATOM   8181  O  OG1 . THR D 1 25  ? -1.098  34.526  48.661  1.00 20.44 ? 68   THR D OG1 1 
ATOM   8182  C  CG2 . THR D 1 25  ? -2.015  32.794  47.249  1.00 20.44 ? 68   THR D CG2 1 
ATOM   8183  N  N   . ALA D 1 26  ? 0.218   30.677  46.764  1.00 31.02 ? 69   ALA D N   1 
ATOM   8184  C  CA  . ALA D 1 26  ? 0.400   29.703  45.690  1.00 27.17 ? 69   ALA D CA  1 
ATOM   8185  C  C   . ALA D 1 26  ? -0.650  29.952  44.611  1.00 25.19 ? 69   ALA D C   1 
ATOM   8186  O  O   . ALA D 1 26  ? -1.636  30.641  44.857  1.00 25.07 ? 69   ALA D O   1 
ATOM   8187  C  CB  . ALA D 1 26  ? 0.265   28.293  46.248  1.00 26.49 ? 69   ALA D CB  1 
ATOM   8188  N  N   . PRO D 1 27  ? -0.443  29.422  43.398  1.00 24.00 ? 70   PRO D N   1 
ATOM   8189  C  CA  . PRO D 1 27  ? -1.443  29.643  42.348  1.00 24.44 ? 70   PRO D CA  1 
ATOM   8190  C  C   . PRO D 1 27  ? -2.664  28.737  42.549  1.00 25.62 ? 70   PRO D C   1 
ATOM   8191  O  O   . PRO D 1 27  ? -2.698  27.899  43.453  1.00 23.90 ? 70   PRO D O   1 
ATOM   8192  C  CB  . PRO D 1 27  ? -0.692  29.305  41.062  1.00 23.72 ? 70   PRO D CB  1 
ATOM   8193  C  CG  . PRO D 1 27  ? 0.742   29.501  41.425  1.00 25.27 ? 70   PRO D CG  1 
ATOM   8194  C  CD  . PRO D 1 27  ? 0.811   28.927  42.822  1.00 24.06 ? 70   PRO D CD  1 
ATOM   8195  N  N   . ALA D 1 28  ? -3.673  28.899  41.706  1.00 26.59 ? 71   ALA D N   1 
ATOM   8196  C  CA  . ALA D 1 28  ? -4.857  28.075  41.851  1.00 28.23 ? 71   ALA D CA  1 
ATOM   8197  C  C   . ALA D 1 28  ? -5.282  27.428  40.542  1.00 29.94 ? 71   ALA D C   1 
ATOM   8198  O  O   . ALA D 1 28  ? -5.490  28.120  39.531  1.00 28.92 ? 71   ALA D O   1 
ATOM   8199  C  CB  . ALA D 1 28  ? -5.990  28.900  42.421  1.00 28.82 ? 71   ALA D CB  1 
ATOM   8200  N  N   . LYS D 1 29  ? -5.409  26.097  40.577  1.00 30.61 ? 72   LYS D N   1 
ATOM   8201  C  CA  . LYS D 1 29  ? -5.815  25.313  39.411  1.00 31.03 ? 72   LYS D CA  1 
ATOM   8202  C  C   . LYS D 1 29  ? -7.306  25.555  39.120  1.00 31.07 ? 72   LYS D C   1 
ATOM   8203  O  O   . LYS D 1 29  ? -8.123  25.692  40.042  1.00 29.40 ? 72   LYS D O   1 
ATOM   8204  C  CB  . LYS D 1 29  ? -5.590  23.818  39.662  1.00 31.33 ? 72   LYS D CB  1 
ATOM   8205  C  CG  . LYS D 1 29  ? -4.386  23.447  40.511  1.00 30.14 ? 72   LYS D CG  1 
ATOM   8206  C  CD  . LYS D 1 29  ? -3.109  23.742  39.776  1.00 30.76 ? 72   LYS D CD  1 
ATOM   8207  C  CE  . LYS D 1 29  ? -1.923  23.036  40.397  1.00 29.71 ? 72   LYS D CE  1 
ATOM   8208  N  NZ  . LYS D 1 29  ? -2.013  21.570  40.199  1.00 26.87 ? 72   LYS D NZ  1 
ATOM   8209  N  N   . SER D 1 30  ? -7.665  25.609  37.843  1.00 31.31 ? 73   SER D N   1 
ATOM   8210  C  CA  . SER D 1 30  ? -9.061  25.851  37.491  1.00 32.84 ? 73   SER D CA  1 
ATOM   8211  C  C   . SER D 1 30  ? -9.966  24.735  38.001  1.00 32.11 ? 73   SER D C   1 
ATOM   8212  O  O   . SER D 1 30  ? -9.688  23.550  37.810  1.00 33.07 ? 73   SER D O   1 
ATOM   8213  C  CB  . SER D 1 30  ? -9.225  25.998  35.977  1.00 33.76 ? 73   SER D CB  1 
ATOM   8214  O  OG  . SER D 1 30  ? -10.567 26.316  35.651  1.00 35.14 ? 73   SER D OG  1 
ATOM   8215  N  N   . PRO D 1 31  ? -11.130 25.167  38.600  1.00 30.97 ? 74   PRO D N   1 
ATOM   8216  C  CA  . PRO D 1 31  ? -12.267 24.289  39.147  1.00 29.84 ? 74   PRO D CA  1 
ATOM   8217  C  C   . PRO D 1 31  ? -13.094 23.603  38.085  1.00 28.56 ? 74   PRO D C   1 
ATOM   8218  O  O   . PRO D 1 31  ? -13.132 24.026  36.942  1.00 28.72 ? 74   PRO D O   1 
ATOM   8219  C  CB  . PRO D 1 31  ? -13.157 25.225  39.903  1.00 30.94 ? 74   PRO D CB  1 
ATOM   8220  C  CG  . PRO D 1 31  ? -12.164 26.095  40.554  1.00 30.88 ? 74   PRO D CG  1 
ATOM   8221  C  CD  . PRO D 1 31  ? -10.905 26.062  39.756  1.00 30.44 ? 74   PRO D CD  1 
ATOM   8222  N  N   . LYS D 1 32  ? -13.813 22.597  38.483  1.00 26.18 ? 75   LYS D N   1 
ATOM   8223  C  CA  . LYS D 1 32  ? -14.750 22.127  37.522  1.00 23.08 ? 75   LYS D CA  1 
ATOM   8224  C  C   . LYS D 1 32  ? -15.818 23.212  37.475  1.00 21.92 ? 75   LYS D C   1 
ATOM   8225  O  O   . LYS D 1 32  ? -16.028 23.836  36.445  1.00 21.84 ? 75   LYS D O   1 
ATOM   8226  C  CB  . LYS D 1 32  ? -15.435 20.826  37.938  1.00 23.32 ? 75   LYS D CB  1 
ATOM   8227  C  CG  . LYS D 1 32  ? -14.545 19.601  37.992  1.00 22.60 ? 75   LYS D CG  1 
ATOM   8228  C  CD  . LYS D 1 32  ? -15.412 18.378  38.233  1.00 22.02 ? 75   LYS D CD  1 
ATOM   8229  C  CE  . LYS D 1 32  ? -16.139 18.472  39.562  1.00 23.09 ? 75   LYS D CE  1 
ATOM   8230  N  NZ  . LYS D 1 32  ? -15.229 18.229  40.716  1.00 21.93 ? 75   LYS D NZ  1 
ATOM   8231  N  N   . ILE D 1 33  ? -16.479 23.407  38.616  1.00 21.67 ? 76   ILE D N   1 
ATOM   8232  C  CA  . ILE D 1 33  ? -17.435 24.471  38.764  1.00 22.61 ? 76   ILE D CA  1 
ATOM   8233  C  C   . ILE D 1 33  ? -16.674 25.594  39.456  1.00 23.36 ? 76   ILE D C   1 
ATOM   8234  O  O   . ILE D 1 33  ? -15.537 25.399  39.864  1.00 24.33 ? 76   ILE D O   1 
ATOM   8235  C  CB  . ILE D 1 33  ? -18.640 24.031  39.602  1.00 22.32 ? 76   ILE D CB  1 
ATOM   8236  C  CG1 . ILE D 1 33  ? -19.331 22.853  38.903  1.00 21.51 ? 76   ILE D CG1 1 
ATOM   8237  C  CG2 . ILE D 1 33  ? -19.623 25.170  39.808  1.00 21.71 ? 76   ILE D CG2 1 
ATOM   8238  C  CD1 . ILE D 1 33  ? -20.457 22.241  39.708  1.00 22.52 ? 76   ILE D CD1 1 
ATOM   8239  N  N   . LEU D 1 34  ? -17.282 26.764  39.580  1.00 23.47 ? 77   LEU D N   1 
ATOM   8240  C  CA  . LEU D 1 34  ? -16.620 27.892  40.223  1.00 24.31 ? 77   LEU D CA  1 
ATOM   8241  C  C   . LEU D 1 34  ? -17.582 28.524  41.228  1.00 25.08 ? 77   LEU D C   1 
ATOM   8242  O  O   . LEU D 1 34  ? -18.751 28.731  40.912  1.00 26.97 ? 77   LEU D O   1 
ATOM   8243  C  CB  . LEU D 1 34  ? -16.241 28.933  39.167  1.00 25.55 ? 77   LEU D CB  1 
ATOM   8244  C  CG  . LEU D 1 34  ? -15.778 28.437  37.787  1.00 27.00 ? 77   LEU D CG  1 
ATOM   8245  C  CD1 . LEU D 1 34  ? -16.508 29.229  36.730  1.00 27.33 ? 77   LEU D CD1 1 
ATOM   8246  C  CD2 . LEU D 1 34  ? -14.280 28.576  37.604  1.00 27.13 ? 77   LEU D CD2 1 
ATOM   8247  N  N   . PRO D 1 35  ? -17.111 28.839  42.452  1.00 24.78 ? 78   PRO D N   1 
ATOM   8248  C  CA  . PRO D 1 35  ? -18.017 29.452  43.437  1.00 23.37 ? 78   PRO D CA  1 
ATOM   8249  C  C   . PRO D 1 35  ? -18.602 30.768  42.916  1.00 22.19 ? 78   PRO D C   1 
ATOM   8250  O  O   . PRO D 1 35  ? -19.812 30.991  43.008  1.00 21.69 ? 78   PRO D O   1 
ATOM   8251  C  CB  . PRO D 1 35  ? -17.125 29.625  44.668  1.00 24.33 ? 78   PRO D CB  1 
ATOM   8252  C  CG  . PRO D 1 35  ? -15.751 29.747  44.088  1.00 24.28 ? 78   PRO D CG  1 
ATOM   8253  C  CD  . PRO D 1 35  ? -15.758 28.693  43.014  1.00 24.10 ? 78   PRO D CD  1 
ATOM   8254  N  N   . ASP D 1 36  ? -17.740 31.633  42.381  1.00 20.20 ? 79   ASP D N   1 
ATOM   8255  C  CA  . ASP D 1 36  ? -18.174 32.901  41.791  1.00 19.13 ? 79   ASP D CA  1 
ATOM   8256  C  C   . ASP D 1 36  ? -17.251 33.177  40.615  1.00 19.00 ? 79   ASP D C   1 
ATOM   8257  O  O   . ASP D 1 36  ? -16.309 32.422  40.397  1.00 19.35 ? 79   ASP D O   1 
ATOM   8258  C  CB  . ASP D 1 36  ? -18.192 34.057  42.821  1.00 17.82 ? 79   ASP D CB  1 
ATOM   8259  C  CG  . ASP D 1 36  ? -16.848 34.322  43.462  1.00 16.36 ? 79   ASP D CG  1 
ATOM   8260  O  OD1 . ASP D 1 36  ? -15.958 34.860  42.773  1.00 15.61 ? 79   ASP D OD1 1 
ATOM   8261  O  OD2 . ASP D 1 36  ? -16.690 34.003  44.660  1.00 16.29 ? 79   ASP D OD2 1 
ATOM   8262  N  N   . ILE D 1 37  ? -17.506 34.225  39.841  1.00 18.29 ? 80   ILE D N   1 
ATOM   8263  C  CA  . ILE D 1 37  ? -16.664 34.467  38.674  1.00 17.85 ? 80   ILE D CA  1 
ATOM   8264  C  C   . ILE D 1 37  ? -15.270 34.965  38.977  1.00 18.45 ? 80   ILE D C   1 
ATOM   8265  O  O   . ILE D 1 37  ? -14.489 35.183  38.053  1.00 18.49 ? 80   ILE D O   1 
ATOM   8266  C  CB  . ILE D 1 37  ? -17.302 35.466  37.696  1.00 18.09 ? 80   ILE D CB  1 
ATOM   8267  C  CG1 . ILE D 1 37  ? -16.693 35.293  36.311  1.00 19.91 ? 80   ILE D CG1 1 
ATOM   8268  C  CG2 . ILE D 1 37  ? -16.997 36.875  38.111  1.00 17.00 ? 80   ILE D CG2 1 
ATOM   8269  C  CD1 . ILE D 1 37  ? -16.898 33.907  35.707  1.00 19.59 ? 80   ILE D CD1 1 
ATOM   8270  N  N   . LEU D 1 38  ? -14.951 35.157  40.257  1.00 18.68 ? 81   LEU D N   1 
ATOM   8271  C  CA  . LEU D 1 38  ? -13.617 35.630  40.641  1.00 18.17 ? 81   LEU D CA  1 
ATOM   8272  C  C   . LEU D 1 38  ? -12.540 34.534  40.616  1.00 17.57 ? 81   LEU D C   1 
ATOM   8273  O  O   . LEU D 1 38  ? -11.348 34.840  40.616  1.00 18.04 ? 81   LEU D O   1 
ATOM   8274  C  CB  . LEU D 1 38  ? -13.671 36.305  42.017  1.00 17.63 ? 81   LEU D CB  1 
ATOM   8275  C  CG  . LEU D 1 38  ? -14.506 37.587  42.030  1.00 18.52 ? 81   LEU D CG  1 
ATOM   8276  C  CD1 . LEU D 1 38  ? -14.528 38.188  43.424  1.00 17.03 ? 81   LEU D CD1 1 
ATOM   8277  C  CD2 . LEU D 1 38  ? -13.920 38.580  41.035  1.00 16.46 ? 81   LEU D CD2 1 
ATOM   8278  N  N   . LYS D 1 39  ? -12.959 33.265  40.606  1.00 15.65 ? 82   LYS D N   1 
ATOM   8279  C  CA  . LYS D 1 39  ? -12.027 32.139  40.508  1.00 14.75 ? 82   LYS D CA  1 
ATOM   8280  C  C   . LYS D 1 39  ? -11.563 32.049  39.085  1.00 14.26 ? 82   LYS D C   1 
ATOM   8281  O  O   . LYS D 1 39  ? -10.835 31.145  38.693  1.00 12.10 ? 82   LYS D O   1 
ATOM   8282  C  CB  . LYS D 1 39  ? -12.696 30.848  40.930  1.00 14.61 ? 82   LYS D CB  1 
ATOM   8283  C  CG  . LYS D 1 39  ? -13.548 30.972  42.183  1.00 17.74 ? 82   LYS D CG  1 
ATOM   8284  C  CD  . LYS D 1 39  ? -12.699 31.180  43.427  1.00 18.45 ? 82   LYS D CD  1 
ATOM   8285  C  CE  . LYS D 1 39  ? -11.915 29.930  43.771  1.00 18.52 ? 82   LYS D CE  1 
ATOM   8286  N  NZ  . LYS D 1 39  ? -12.821 28.816  44.162  1.00 18.80 ? 82   LYS D NZ  1 
ATOM   8287  N  N   . LYS D 1 40  ? -12.051 33.011  38.296  1.00 14.85 ? 83   LYS D N   1 
ATOM   8288  C  CA  . LYS D 1 40  ? -11.710 33.167  36.893  1.00 17.14 ? 83   LYS D CA  1 
ATOM   8289  C  C   . LYS D 1 40  ? -10.747 34.304  36.697  1.00 19.29 ? 83   LYS D C   1 
ATOM   8290  O  O   . LYS D 1 40  ? -10.720 34.904  35.613  1.00 20.04 ? 83   LYS D O   1 
ATOM   8291  C  CB  . LYS D 1 40  ? -12.954 33.334  36.037  1.00 17.47 ? 83   LYS D CB  1 
ATOM   8292  C  CG  . LYS D 1 40  ? -12.719 33.163  34.525  1.00 17.71 ? 83   LYS D CG  1 
ATOM   8293  C  CD  . LYS D 1 40  ? -11.989 31.878  34.194  1.00 19.34 ? 83   LYS D CD  1 
ATOM   8294  C  CE  . LYS D 1 40  ? -10.483 32.055  34.277  1.00 20.98 ? 83   LYS D CE  1 
ATOM   8295  N  NZ  . LYS D 1 40  ? -9.761  30.753  34.224  1.00 23.15 ? 83   LYS D NZ  1 
ATOM   8296  N  N   . ILE D 1 41  ? -9.972  34.601  37.708  1.00 19.29 ? 84   ILE D N   1 
ATOM   8297  C  CA  . ILE D 1 41  ? -8.819  35.514  37.468  1.00 20.24 ? 84   ILE D CA  1 
ATOM   8298  C  C   . ILE D 1 41  ? -7.438  34.870  37.569  1.00 20.12 ? 84   ILE D C   1 
ATOM   8299  O  O   . ILE D 1 41  ? -7.112  34.218  38.565  1.00 19.84 ? 84   ILE D O   1 
ATOM   8300  C  CB  . ILE D 1 41  ? -9.054  36.525  38.623  1.00 20.77 ? 84   ILE D CB  1 
ATOM   8301  C  CG1 . ILE D 1 41  ? -10.414 37.203  38.447  1.00 20.07 ? 84   ILE D CG1 1 
ATOM   8302  C  CG2 . ILE D 1 41  ? -7.951  37.557  38.651  1.00 18.96 ? 84   ILE D CG2 1 
ATOM   8303  C  CD1 . ILE D 1 41  ? -10.736 38.212  39.519  1.00 22.63 ? 84   ILE D CD1 1 
ATOM   8304  N  N   . GLY D 1 42  ? -6.635  35.036  36.527  1.00 19.20 ? 85   GLY D N   1 
ATOM   8305  C  CA  . GLY D 1 42  ? -5.321  34.432  36.528  1.00 20.87 ? 85   GLY D CA  1 
ATOM   8306  C  C   . GLY D 1 42  ? -5.407  33.127  35.772  1.00 21.76 ? 85   GLY D C   1 
ATOM   8307  O  O   . GLY D 1 42  ? -6.439  32.837  35.167  1.00 22.81 ? 85   GLY D O   1 
ATOM   8308  N  N   . ASP D 1 43  ? -4.347  32.328  35.816  1.00 21.77 ? 86   ASP D N   1 
ATOM   8309  C  CA  . ASP D 1 43  ? -4.321  31.060  35.089  1.00 20.78 ? 86   ASP D CA  1 
ATOM   8310  C  C   . ASP D 1 43  ? -4.623  31.378  33.632  1.00 19.49 ? 86   ASP D C   1 
ATOM   8311  O  O   . ASP D 1 43  ? -5.080  30.522  32.878  1.00 20.14 ? 86   ASP D O   1 
ATOM   8312  C  CB  . ASP D 1 43  ? -5.372  30.085  35.641  1.00 21.89 ? 86   ASP D CB  1 
ATOM   8313  C  CG  . ASP D 1 43  ? -5.058  28.622  35.305  1.00 24.55 ? 86   ASP D CG  1 
ATOM   8314  O  OD1 . ASP D 1 43  ? -3.872  28.246  35.400  1.00 26.83 ? 86   ASP D OD1 1 
ATOM   8315  O  OD2 . ASP D 1 43  ? -5.983  27.845  34.974  1.00 23.85 ? 86   ASP D OD2 1 
ATOM   8316  N  N   . THR D 1 44  ? -4.369  32.625  33.249  1.00 16.66 ? 87   THR D N   1 
ATOM   8317  C  CA  . THR D 1 44  ? -4.611  33.068  31.894  1.00 15.99 ? 87   THR D CA  1 
ATOM   8318  C  C   . THR D 1 44  ? -3.809  32.234  30.924  1.00 13.96 ? 87   THR D C   1 
ATOM   8319  O  O   . THR D 1 44  ? -2.860  31.564  31.308  1.00 12.95 ? 87   THR D O   1 
ATOM   8320  C  CB  . THR D 1 44  ? -4.197  34.519  31.703  1.00 17.41 ? 87   THR D CB  1 
ATOM   8321  O  OG1 . THR D 1 44  ? -2.859  34.690  32.187  1.00 19.22 ? 87   THR D OG1 1 
ATOM   8322  C  CG2 . THR D 1 44  ? -5.134  35.439  32.432  1.00 17.98 ? 87   THR D CG2 1 
ATOM   8323  N  N   . PRO D 1 45  ? -4.176  32.277  29.640  1.00 13.81 ? 88   PRO D N   1 
ATOM   8324  C  CA  . PRO D 1 45  ? -3.474  31.514  28.611  1.00 15.99 ? 88   PRO D CA  1 
ATOM   8325  C  C   . PRO D 1 45  ? -2.243  32.161  27.960  1.00 16.81 ? 88   PRO D C   1 
ATOM   8326  O  O   . PRO D 1 45  ? -2.114  33.385  27.881  1.00 16.97 ? 88   PRO D O   1 
ATOM   8327  C  CB  . PRO D 1 45  ? -4.574  31.236  27.601  1.00 15.73 ? 88   PRO D CB  1 
ATOM   8328  C  CG  . PRO D 1 45  ? -5.376  32.471  27.669  1.00 14.11 ? 88   PRO D CG  1 
ATOM   8329  C  CD  . PRO D 1 45  ? -5.484  32.732  29.143  1.00 14.59 ? 88   PRO D CD  1 
ATOM   8330  N  N   . MET D 1 46  ? -1.341  31.299  27.505  1.00 17.68 ? 89   MET D N   1 
ATOM   8331  C  CA  . MET D 1 46  ? -0.116  31.688  26.815  1.00 18.72 ? 89   MET D CA  1 
ATOM   8332  C  C   . MET D 1 46  ? -0.349  31.199  25.370  1.00 17.85 ? 89   MET D C   1 
ATOM   8333  O  O   . MET D 1 46  ? -0.398  30.004  25.104  1.00 18.61 ? 89   MET D O   1 
ATOM   8334  C  CB  . MET D 1 46  ? 1.086   30.968  27.455  1.00 19.06 ? 89   MET D CB  1 
ATOM   8335  C  CG  . MET D 1 46  ? 2.463   31.242  26.819  1.00 18.88 ? 89   MET D CG  1 
ATOM   8336  S  SD  . MET D 1 46  ? 3.192   32.847  27.221  1.00 18.69 ? 89   MET D SD  1 
ATOM   8337  C  CE  . MET D 1 46  ? 3.952   32.473  28.783  1.00 13.48 ? 89   MET D CE  1 
ATOM   8338  N  N   . VAL D 1 47  ? -0.505  32.126  24.442  1.00 16.77 ? 90   VAL D N   1 
ATOM   8339  C  CA  . VAL D 1 47  ? -0.763  31.773  23.051  1.00 16.00 ? 90   VAL D CA  1 
ATOM   8340  C  C   . VAL D 1 47  ? 0.318   32.215  22.061  1.00 16.49 ? 90   VAL D C   1 
ATOM   8341  O  O   . VAL D 1 47  ? 0.663   33.395  21.986  1.00 16.25 ? 90   VAL D O   1 
ATOM   8342  C  CB  . VAL D 1 47  ? -2.092  32.380  22.620  1.00 15.70 ? 90   VAL D CB  1 
ATOM   8343  C  CG1 . VAL D 1 47  ? -2.301  32.189  21.129  1.00 14.00 ? 90   VAL D CG1 1 
ATOM   8344  C  CG2 . VAL D 1 47  ? -3.211  31.782  23.465  1.00 12.42 ? 90   VAL D CG2 1 
ATOM   8345  N  N   . ARG D 1 48  ? 0.827   31.261  21.290  1.00 16.40 ? 91   ARG D N   1 
ATOM   8346  C  CA  . ARG D 1 48  ? 1.865   31.525  20.300  1.00 16.10 ? 91   ARG D CA  1 
ATOM   8347  C  C   . ARG D 1 48  ? 1.451   32.496  19.197  1.00 17.25 ? 91   ARG D C   1 
ATOM   8348  O  O   . ARG D 1 48  ? 0.325   32.468  18.699  1.00 17.31 ? 91   ARG D O   1 
ATOM   8349  C  CB  . ARG D 1 48  ? 2.304   30.210  19.657  1.00 17.03 ? 91   ARG D CB  1 
ATOM   8350  C  CG  . ARG D 1 48  ? 3.327   30.353  18.525  1.00 17.41 ? 91   ARG D CG  1 
ATOM   8351  C  CD  . ARG D 1 48  ? 3.522   29.047  17.783  1.00 16.16 ? 91   ARG D CD  1 
ATOM   8352  N  NE  . ARG D 1 48  ? 3.756   27.964  18.723  1.00 21.43 ? 91   ARG D NE  1 
ATOM   8353  C  CZ  . ARG D 1 48  ? 3.251   26.740  18.607  1.00 23.34 ? 91   ARG D CZ  1 
ATOM   8354  N  NH1 . ARG D 1 48  ? 2.470   26.427  17.573  1.00 23.21 ? 91   ARG D NH1 1 
ATOM   8355  N  NH2 . ARG D 1 48  ? 3.529   25.834  19.538  1.00 21.46 ? 91   ARG D NH2 1 
ATOM   8356  N  N   . ILE D 1 49  ? 2.386   33.359  18.821  1.00 17.50 ? 92   ILE D N   1 
ATOM   8357  C  CA  . ILE D 1 49  ? 2.181   34.335  17.754  1.00 16.79 ? 92   ILE D CA  1 
ATOM   8358  C  C   . ILE D 1 49  ? 2.795   33.683  16.524  1.00 16.59 ? 92   ILE D C   1 
ATOM   8359  O  O   . ILE D 1 49  ? 3.897   33.141  16.602  1.00 15.12 ? 92   ILE D O   1 
ATOM   8360  C  CB  . ILE D 1 49  ? 2.949   35.640  18.045  1.00 17.47 ? 92   ILE D CB  1 
ATOM   8361  C  CG1 . ILE D 1 49  ? 2.494   36.234  19.379  1.00 18.03 ? 92   ILE D CG1 1 
ATOM   8362  C  CG2 . ILE D 1 49  ? 2.743   36.629  16.917  1.00 17.17 ? 92   ILE D CG2 1 
ATOM   8363  C  CD1 . ILE D 1 49  ? 1.100   36.822  19.360  1.00 17.82 ? 92   ILE D CD1 1 
ATOM   8364  N  N   . ASN D 1 50  ? 2.117   33.747  15.384  1.00 17.59 ? 93   ASN D N   1 
ATOM   8365  C  CA  . ASN D 1 50  ? 2.667   33.106  14.190  1.00 19.49 ? 93   ASN D CA  1 
ATOM   8366  C  C   . ASN D 1 50  ? 2.843   33.946  12.910  1.00 20.46 ? 93   ASN D C   1 
ATOM   8367  O  O   . ASN D 1 50  ? 3.694   33.630  12.071  1.00 21.25 ? 93   ASN D O   1 
ATOM   8368  C  CB  . ASN D 1 50  ? 1.846   31.852  13.914  1.00 19.93 ? 93   ASN D CB  1 
ATOM   8369  C  CG  . ASN D 1 50  ? 1.815   30.929  15.110  1.00 22.18 ? 93   ASN D CG  1 
ATOM   8370  O  OD1 . ASN D 1 50  ? 0.759   30.480  15.550  1.00 21.86 ? 93   ASN D OD1 1 
ATOM   8371  N  ND2 . ASN D 1 50  ? 2.989   30.652  15.653  1.00 21.37 ? 93   ASN D ND2 1 
ATOM   8372  N  N   . LYS D 1 51  ? 2.064   35.013  12.753  1.00 19.96 ? 94   LYS D N   1 
ATOM   8373  C  CA  . LYS D 1 51  ? 2.180   35.854  11.560  1.00 19.64 ? 94   LYS D CA  1 
ATOM   8374  C  C   . LYS D 1 51  ? 3.104   37.053  11.791  1.00 19.79 ? 94   LYS D C   1 
ATOM   8375  O  O   . LYS D 1 51  ? 4.032   37.297  11.005  1.00 19.84 ? 94   LYS D O   1 
ATOM   8376  C  CB  . LYS D 1 51  ? 0.800   36.357  11.116  1.00 18.76 ? 94   LYS D CB  1 
ATOM   8377  C  CG  . LYS D 1 51  ? -0.011  35.364  10.307  1.00 18.91 ? 94   LYS D CG  1 
ATOM   8378  C  CD  . LYS D 1 51  ? -0.561  34.207  11.133  1.00 15.52 ? 94   LYS D CD  1 
ATOM   8379  C  CE  . LYS D 1 51  ? -1.375  33.255  10.261  1.00 15.20 ? 94   LYS D CE  1 
ATOM   8380  N  NZ  . LYS D 1 51  ? -2.561  33.897  9.600   1.00 10.49 ? 94   LYS D NZ  1 
ATOM   8381  N  N   . ILE D 1 52  ? 2.833   37.801  12.866  1.00 18.58 ? 95   ILE D N   1 
ATOM   8382  C  CA  . ILE D 1 52  ? 3.615   38.985  13.234  1.00 16.61 ? 95   ILE D CA  1 
ATOM   8383  C  C   . ILE D 1 52  ? 5.056   38.620  13.582  1.00 15.28 ? 95   ILE D C   1 
ATOM   8384  O  O   . ILE D 1 52  ? 5.975   39.397  13.361  1.00 13.70 ? 95   ILE D O   1 
ATOM   8385  C  CB  . ILE D 1 52  ? 2.995   39.711  14.458  1.00 16.77 ? 95   ILE D CB  1 
ATOM   8386  C  CG1 . ILE D 1 52  ? 1.684   40.397  14.053  1.00 15.77 ? 95   ILE D CG1 1 
ATOM   8387  C  CG2 . ILE D 1 52  ? 4.014   40.705  15.047  1.00 16.68 ? 95   ILE D CG2 1 
ATOM   8388  C  CD1 . ILE D 1 52  ? 0.957   41.089  15.198  1.00 13.95 ? 95   ILE D CD1 1 
ATOM   8389  N  N   . GLY D 1 53  ? 5.245   37.436  14.142  1.00 14.78 ? 96   GLY D N   1 
ATOM   8390  C  CA  . GLY D 1 53  ? 6.584   37.018  14.482  1.00 15.79 ? 96   GLY D CA  1 
ATOM   8391  C  C   . GLY D 1 53  ? 7.497   36.977  13.263  1.00 16.07 ? 96   GLY D C   1 
ATOM   8392  O  O   . GLY D 1 53  ? 8.144   37.954  12.934  1.00 18.20 ? 96   GLY D O   1 
ATOM   8393  N  N   . LYS D 1 54  ? 7.541   35.837  12.595  1.00 16.22 ? 97   LYS D N   1 
ATOM   8394  C  CA  . LYS D 1 54  ? 8.379   35.626  11.437  1.00 16.78 ? 97   LYS D CA  1 
ATOM   8395  C  C   . LYS D 1 54  ? 8.368   36.774  10.376  1.00 18.48 ? 97   LYS D C   1 
ATOM   8396  O  O   . LYS D 1 54  ? 9.336   36.955  9.633   1.00 18.75 ? 97   LYS D O   1 
ATOM   8397  C  CB  . LYS D 1 54  ? 7.978   34.269  10.821  1.00 16.06 ? 97   LYS D CB  1 
ATOM   8398  C  CG  . LYS D 1 54  ? 7.567   33.152  11.858  1.00 11.61 ? 97   LYS D CG  1 
ATOM   8399  C  CD  . LYS D 1 54  ? 8.707   32.290  12.437  1.00 8.90  ? 97   LYS D CD  1 
ATOM   8400  C  CE  . LYS D 1 54  ? 8.183   31.402  13.564  1.00 4.59  ? 97   LYS D CE  1 
ATOM   8401  N  NZ  . LYS D 1 54  ? 9.267   30.878  14.425  1.00 3.95  ? 97   LYS D NZ  1 
ATOM   8402  N  N   . LYS D 1 55  ? 7.291   37.548  10.295  1.00 18.79 ? 98   LYS D N   1 
ATOM   8403  C  CA  . LYS D 1 55  ? 7.238   38.658  9.336   1.00 19.05 ? 98   LYS D CA  1 
ATOM   8404  C  C   . LYS D 1 55  ? 8.270   39.757  9.647   1.00 21.59 ? 98   LYS D C   1 
ATOM   8405  O  O   . LYS D 1 55  ? 8.413   40.717  8.892   1.00 23.20 ? 98   LYS D O   1 
ATOM   8406  C  CB  . LYS D 1 55  ? 5.843   39.293  9.346   1.00 18.03 ? 98   LYS D CB  1 
ATOM   8407  C  CG  . LYS D 1 55  ? 5.586   40.359  8.278   1.00 15.87 ? 98   LYS D CG  1 
ATOM   8408  C  CD  . LYS D 1 55  ? 5.618   39.743  6.864   1.00 15.21 ? 98   LYS D CD  1 
ATOM   8409  C  CE  . LYS D 1 55  ? 5.213   40.722  5.755   1.00 12.77 ? 98   LYS D CE  1 
ATOM   8410  N  NZ  . LYS D 1 55  ? 3.765   41.102  5.816   1.00 12.97 ? 98   LYS D NZ  1 
ATOM   8411  N  N   . PHE D 1 56  ? 8.972   39.636  10.769  1.00 22.13 ? 99   PHE D N   1 
ATOM   8412  C  CA  . PHE D 1 56  ? 9.967   40.637  11.158  1.00 22.80 ? 99   PHE D CA  1 
ATOM   8413  C  C   . PHE D 1 56  ? 11.379  40.067  11.273  1.00 24.34 ? 99   PHE D C   1 
ATOM   8414  O  O   . PHE D 1 56  ? 12.349  40.810  11.527  1.00 24.99 ? 99   PHE D O   1 
ATOM   8415  C  CB  . PHE D 1 56  ? 9.609   41.277  12.496  1.00 20.40 ? 99   PHE D CB  1 
ATOM   8416  C  CG  . PHE D 1 56  ? 8.466   42.237  12.439  1.00 18.53 ? 99   PHE D CG  1 
ATOM   8417  C  CD1 . PHE D 1 56  ? 7.170   41.784  12.328  1.00 17.39 ? 99   PHE D CD1 1 
ATOM   8418  C  CD2 . PHE D 1 56  ? 8.687   43.605  12.550  1.00 18.49 ? 99   PHE D CD2 1 
ATOM   8419  C  CE1 . PHE D 1 56  ? 6.106   42.684  12.339  1.00 18.92 ? 99   PHE D CE1 1 
ATOM   8420  C  CE2 . PHE D 1 56  ? 7.622   44.509  12.558  1.00 17.89 ? 99   PHE D CE2 1 
ATOM   8421  C  CZ  . PHE D 1 56  ? 6.337   44.048  12.456  1.00 16.14 ? 99   PHE D CZ  1 
ATOM   8422  N  N   . GLY D 1 57  ? 11.498  38.752  11.114  1.00 24.04 ? 100  GLY D N   1 
ATOM   8423  C  CA  . GLY D 1 57  ? 12.809  38.126  11.187  1.00 23.75 ? 100  GLY D CA  1 
ATOM   8424  C  C   . GLY D 1 57  ? 12.982  37.141  12.320  1.00 22.79 ? 100  GLY D C   1 
ATOM   8425  O  O   . GLY D 1 57  ? 13.459  36.026  12.111  1.00 22.42 ? 100  GLY D O   1 
ATOM   8426  N  N   . LEU D 1 58  ? 12.589  37.563  13.517  1.00 22.93 ? 101  LEU D N   1 
ATOM   8427  C  CA  . LEU D 1 58  ? 12.688  36.750  14.725  1.00 23.09 ? 101  LEU D CA  1 
ATOM   8428  C  C   . LEU D 1 58  ? 12.923  35.274  14.463  1.00 24.15 ? 101  LEU D C   1 
ATOM   8429  O  O   . LEU D 1 58  ? 12.178  34.640  13.724  1.00 25.59 ? 101  LEU D O   1 
ATOM   8430  C  CB  . LEU D 1 58  ? 11.417  36.913  15.558  1.00 21.90 ? 101  LEU D CB  1 
ATOM   8431  C  CG  . LEU D 1 58  ? 11.315  37.982  16.645  1.00 22.28 ? 101  LEU D CG  1 
ATOM   8432  C  CD1 . LEU D 1 58  ? 11.954  39.303  16.247  1.00 22.57 ? 101  LEU D CD1 1 
ATOM   8433  C  CD2 . LEU D 1 58  ? 9.854   38.170  16.927  1.00 23.24 ? 101  LEU D CD2 1 
ATOM   8434  N  N   . LYS D 1 59  ? 13.971  34.729  15.062  1.00 24.48 ? 102  LYS D N   1 
ATOM   8435  C  CA  . LYS D 1 59  ? 14.261  33.310  14.913  1.00 25.68 ? 102  LYS D CA  1 
ATOM   8436  C  C   . LYS D 1 59  ? 13.595  32.599  16.091  1.00 24.71 ? 102  LYS D C   1 
ATOM   8437  O  O   . LYS D 1 59  ? 13.259  31.415  16.029  1.00 23.79 ? 102  LYS D O   1 
ATOM   8438  C  CB  . LYS D 1 59  ? 15.779  33.066  14.946  1.00 26.91 ? 102  LYS D CB  1 
ATOM   8439  C  CG  . LYS D 1 59  ? 16.497  33.508  13.673  1.00 27.15 ? 102  LYS D CG  1 
ATOM   8440  C  CD  . LYS D 1 59  ? 18.023  33.432  13.782  1.00 27.61 ? 102  LYS D CD  1 
ATOM   8441  C  CE  . LYS D 1 59  ? 18.548  32.017  13.996  1.00 27.79 ? 102  LYS D CE  1 
ATOM   8442  N  NZ  . LYS D 1 59  ? 19.546  31.608  12.950  1.00 30.12 ? 102  LYS D NZ  1 
ATOM   8443  N  N   . CYS D 1 60  ? 13.387  33.361  17.158  1.00 23.41 ? 103  CYS D N   1 
ATOM   8444  C  CA  . CYS D 1 60  ? 12.800  32.844  18.379  1.00 23.41 ? 103  CYS D CA  1 
ATOM   8445  C  C   . CYS D 1 60  ? 11.297  32.673  18.318  1.00 23.50 ? 103  CYS D C   1 
ATOM   8446  O  O   . CYS D 1 60  ? 10.648  33.019  17.326  1.00 22.88 ? 103  CYS D O   1 
ATOM   8447  C  CB  . CYS D 1 60  ? 13.132  33.774  19.548  1.00 22.83 ? 103  CYS D CB  1 
ATOM   8448  S  SG  . CYS D 1 60  ? 12.169  35.325  19.559  1.00 21.88 ? 103  CYS D SG  1 
ATOM   8449  N  N   . GLU D 1 61  ? 10.771  32.145  19.421  1.00 23.02 ? 104  GLU D N   1 
ATOM   8450  C  CA  . GLU D 1 61  ? 9.346   31.918  19.623  1.00 24.33 ? 104  GLU D CA  1 
ATOM   8451  C  C   . GLU D 1 61  ? 8.781   33.100  20.425  1.00 24.88 ? 104  GLU D C   1 
ATOM   8452  O  O   . GLU D 1 61  ? 9.506   33.720  21.212  1.00 26.22 ? 104  GLU D O   1 
ATOM   8453  C  CB  . GLU D 1 61  ? 9.141   30.608  20.394  1.00 24.52 ? 104  GLU D CB  1 
ATOM   8454  C  CG  . GLU D 1 61  ? 7.730   30.370  20.927  1.00 23.67 ? 104  GLU D CG  1 
ATOM   8455  C  CD  . GLU D 1 61  ? 7.583   28.998  21.554  1.00 24.90 ? 104  GLU D CD  1 
ATOM   8456  O  OE1 . GLU D 1 61  ? 8.503   28.581  22.300  1.00 25.84 ? 104  GLU D OE1 1 
ATOM   8457  O  OE2 . GLU D 1 61  ? 6.548   28.339  21.307  1.00 24.76 ? 104  GLU D OE2 1 
ATOM   8458  N  N   . LEU D 1 62  ? 7.498   33.406  20.228  1.00 23.60 ? 105  LEU D N   1 
ATOM   8459  C  CA  . LEU D 1 62  ? 6.874   34.512  20.936  1.00 22.64 ? 105  LEU D CA  1 
ATOM   8460  C  C   . LEU D 1 62  ? 5.570   34.131  21.681  1.00 23.70 ? 105  LEU D C   1 
ATOM   8461  O  O   . LEU D 1 62  ? 4.468   34.268  21.152  1.00 24.21 ? 105  LEU D O   1 
ATOM   8462  C  CB  . LEU D 1 62  ? 6.624   35.664  19.952  1.00 20.54 ? 105  LEU D CB  1 
ATOM   8463  C  CG  . LEU D 1 62  ? 6.120   36.978  20.562  1.00 19.66 ? 105  LEU D CG  1 
ATOM   8464  C  CD1 . LEU D 1 62  ? 7.131   37.449  21.576  1.00 17.93 ? 105  LEU D CD1 1 
ATOM   8465  C  CD2 . LEU D 1 62  ? 5.877   38.031  19.487  1.00 17.50 ? 105  LEU D CD2 1 
ATOM   8466  N  N   . LEU D 1 63  ? 5.706   33.665  22.918  1.00 23.42 ? 106  LEU D N   1 
ATOM   8467  C  CA  . LEU D 1 63  ? 4.554   33.274  23.723  1.00 23.80 ? 106  LEU D CA  1 
ATOM   8468  C  C   . LEU D 1 63  ? 3.941   34.452  24.471  1.00 24.28 ? 106  LEU D C   1 
ATOM   8469  O  O   . LEU D 1 63  ? 4.514   34.946  25.432  1.00 26.20 ? 106  LEU D O   1 
ATOM   8470  C  CB  . LEU D 1 63  ? 4.960   32.219  24.744  1.00 23.79 ? 106  LEU D CB  1 
ATOM   8471  C  CG  . LEU D 1 63  ? 5.629   30.948  24.233  1.00 23.29 ? 106  LEU D CG  1 
ATOM   8472  C  CD1 . LEU D 1 63  ? 5.584   29.943  25.331  1.00 23.30 ? 106  LEU D CD1 1 
ATOM   8473  C  CD2 . LEU D 1 63  ? 4.902   30.381  23.041  1.00 23.11 ? 106  LEU D CD2 1 
ATOM   8474  N  N   . ALA D 1 64  ? 2.760   34.879  24.048  1.00 22.75 ? 107  ALA D N   1 
ATOM   8475  C  CA  . ALA D 1 64  ? 2.095   35.998  24.678  1.00 20.85 ? 107  ALA D CA  1 
ATOM   8476  C  C   . ALA D 1 64  ? 1.019   35.606  25.693  1.00 21.33 ? 107  ALA D C   1 
ATOM   8477  O  O   . ALA D 1 64  ? -0.016  35.039  25.342  1.00 21.96 ? 107  ALA D O   1 
ATOM   8478  C  CB  . ALA D 1 64  ? 1.504   36.880  23.614  1.00 21.32 ? 107  ALA D CB  1 
ATOM   8479  N  N   . LYS D 1 65  ? 1.278   35.920  26.959  1.00 21.37 ? 108  LYS D N   1 
ATOM   8480  C  CA  . LYS D 1 65  ? 0.346   35.654  28.056  1.00 20.18 ? 108  LYS D CA  1 
ATOM   8481  C  C   . LYS D 1 65  ? -0.919  36.443  27.812  1.00 21.21 ? 108  LYS D C   1 
ATOM   8482  O  O   . LYS D 1 65  ? -0.943  37.653  28.026  1.00 20.23 ? 108  LYS D O   1 
ATOM   8483  C  CB  . LYS D 1 65  ? 0.924   36.120  29.393  1.00 19.52 ? 108  LYS D CB  1 
ATOM   8484  C  CG  . LYS D 1 65  ? 1.881   35.168  30.075  1.00 17.57 ? 108  LYS D CG  1 
ATOM   8485  C  CD  . LYS D 1 65  ? 1.139   34.007  30.690  1.00 17.69 ? 108  LYS D CD  1 
ATOM   8486  C  CE  . LYS D 1 65  ? 0.055   34.464  31.623  1.00 13.71 ? 108  LYS D CE  1 
ATOM   8487  N  NZ  . LYS D 1 65  ? -0.582  33.279  32.222  1.00 14.59 ? 108  LYS D NZ  1 
ATOM   8488  N  N   . CYS D 1 66  ? -1.975  35.772  27.366  1.00 22.88 ? 109  CYS D N   1 
ATOM   8489  C  CA  . CYS D 1 66  ? -3.226  36.474  27.123  1.00 22.39 ? 109  CYS D CA  1 
ATOM   8490  C  C   . CYS D 1 66  ? -3.885  36.818  28.431  1.00 21.59 ? 109  CYS D C   1 
ATOM   8491  O  O   . CYS D 1 66  ? -4.511  35.989  29.098  1.00 21.99 ? 109  CYS D O   1 
ATOM   8492  C  CB  . CYS D 1 66  ? -4.142  35.650  26.236  1.00 22.13 ? 109  CYS D CB  1 
ATOM   8493  S  SG  . CYS D 1 66  ? -3.501  35.648  24.572  1.00 26.81 ? 109  CYS D SG  1 
ATOM   8494  N  N   . GLU D 1 67  ? -3.712  38.078  28.792  1.00 20.38 ? 110  GLU D N   1 
ATOM   8495  C  CA  . GLU D 1 67  ? -4.236  38.583  30.028  1.00 17.59 ? 110  GLU D CA  1 
ATOM   8496  C  C   . GLU D 1 67  ? -5.576  39.219  29.816  1.00 15.87 ? 110  GLU D C   1 
ATOM   8497  O  O   . GLU D 1 67  ? -6.180  39.683  30.764  1.00 16.96 ? 110  GLU D O   1 
ATOM   8498  C  CB  . GLU D 1 67  ? -3.272  39.594  30.603  1.00 17.12 ? 110  GLU D CB  1 
ATOM   8499  C  CG  . GLU D 1 67  ? -3.206  39.552  32.091  1.00 16.11 ? 110  GLU D CG  1 
ATOM   8500  C  CD  . GLU D 1 67  ? -2.632  38.273  32.604  1.00 14.01 ? 110  GLU D CD  1 
ATOM   8501  O  OE1 . GLU D 1 67  ? -1.679  37.765  31.978  1.00 13.05 ? 110  GLU D OE1 1 
ATOM   8502  O  OE2 . GLU D 1 67  ? -3.134  37.794  33.638  1.00 13.12 ? 110  GLU D OE2 1 
ATOM   8503  N  N   . PHE D 1 68  ? -6.055  39.251  28.578  1.00 14.82 ? 111  PHE D N   1 
ATOM   8504  C  CA  . PHE D 1 68  ? -7.370  39.836  28.339  1.00 14.24 ? 111  PHE D CA  1 
ATOM   8505  C  C   . PHE D 1 68  ? -8.474  38.805  28.570  1.00 13.00 ? 111  PHE D C   1 
ATOM   8506  O  O   . PHE D 1 68  ? -9.631  39.014  28.202  1.00 12.47 ? 111  PHE D O   1 
ATOM   8507  C  CB  . PHE D 1 68  ? -7.461  40.440  26.918  1.00 14.66 ? 111  PHE D CB  1 
ATOM   8508  C  CG  . PHE D 1 68  ? -6.842  39.598  25.829  1.00 12.90 ? 111  PHE D CG  1 
ATOM   8509  C  CD1 . PHE D 1 68  ? -7.349  38.342  25.513  1.00 12.44 ? 111  PHE D CD1 1 
ATOM   8510  C  CD2 . PHE D 1 68  ? -5.741  40.069  25.123  1.00 12.00 ? 111  PHE D CD2 1 
ATOM   8511  C  CE1 . PHE D 1 68  ? -6.762  37.565  24.514  1.00 11.03 ? 111  PHE D CE1 1 
ATOM   8512  C  CE2 . PHE D 1 68  ? -5.145  39.301  24.117  1.00 10.67 ? 111  PHE D CE2 1 
ATOM   8513  C  CZ  . PHE D 1 68  ? -5.653  38.048  23.814  1.00 10.07 ? 111  PHE D CZ  1 
ATOM   8514  N  N   . PHE D 1 69  ? -8.100  37.701  29.215  1.00 12.36 ? 112  PHE D N   1 
ATOM   8515  C  CA  . PHE D 1 69  ? -9.012  36.602  29.505  1.00 12.93 ? 112  PHE D CA  1 
ATOM   8516  C  C   . PHE D 1 69  ? -9.425  36.445  30.980  1.00 13.30 ? 112  PHE D C   1 
ATOM   8517  O  O   . PHE D 1 69  ? -9.727  35.350  31.447  1.00 14.01 ? 112  PHE D O   1 
ATOM   8518  C  CB  . PHE D 1 69  ? -8.392  35.306  28.992  1.00 11.97 ? 112  PHE D CB  1 
ATOM   8519  C  CG  . PHE D 1 69  ? -8.542  35.118  27.516  1.00 11.85 ? 112  PHE D CG  1 
ATOM   8520  C  CD1 . PHE D 1 69  ? -7.565  34.472  26.783  1.00 11.05 ? 112  PHE D CD1 1 
ATOM   8521  C  CD2 . PHE D 1 69  ? -9.657  35.621  26.849  1.00 12.71 ? 112  PHE D CD2 1 
ATOM   8522  C  CE1 . PHE D 1 69  ? -7.687  34.334  25.411  1.00 13.02 ? 112  PHE D CE1 1 
ATOM   8523  C  CE2 . PHE D 1 69  ? -9.786  35.486  25.479  1.00 12.33 ? 112  PHE D CE2 1 
ATOM   8524  C  CZ  . PHE D 1 69  ? -8.799  34.843  24.757  1.00 12.19 ? 112  PHE D CZ  1 
ATOM   8525  N  N   . ASN D 1 70  ? -9.461  37.544  31.710  1.00 13.01 ? 113  ASN D N   1 
ATOM   8526  C  CA  . ASN D 1 70  ? -9.834  37.497  33.116  1.00 13.28 ? 113  ASN D CA  1 
ATOM   8527  C  C   . ASN D 1 70  ? -11.267 37.920  33.312  1.00 13.70 ? 113  ASN D C   1 
ATOM   8528  O  O   . ASN D 1 70  ? -11.798 38.657  32.494  1.00 14.13 ? 113  ASN D O   1 
ATOM   8529  C  CB  . ASN D 1 70  ? -8.923  38.424  33.906  1.00 14.91 ? 113  ASN D CB  1 
ATOM   8530  C  CG  . ASN D 1 70  ? -7.542  37.885  34.018  1.00 14.49 ? 113  ASN D CG  1 
ATOM   8531  O  OD1 . ASN D 1 70  ? -7.357  36.809  34.565  1.00 17.57 ? 113  ASN D OD1 1 
ATOM   8532  N  ND2 . ASN D 1 70  ? -6.560  38.609  33.503  1.00 12.13 ? 113  ASN D ND2 1 
ATOM   8533  N  N   . ALA D 1 71  ? -11.881 37.478  34.398  1.00 13.39 ? 114  ALA D N   1 
ATOM   8534  C  CA  . ALA D 1 71  ? -13.255 37.852  34.673  1.00 14.87 ? 114  ALA D CA  1 
ATOM   8535  C  C   . ALA D 1 71  ? -13.507 39.278  34.199  1.00 15.73 ? 114  ALA D C   1 
ATOM   8536  O  O   . ALA D 1 71  ? -14.419 39.518  33.412  1.00 15.54 ? 114  ALA D O   1 
ATOM   8537  C  CB  . ALA D 1 71  ? -13.528 37.739  36.143  1.00 17.66 ? 114  ALA D CB  1 
ATOM   8538  N  N   . GLY D 1 72  ? -12.677 40.215  34.653  1.00 16.22 ? 115  GLY D N   1 
ATOM   8539  C  CA  . GLY D 1 72  ? -12.827 41.606  34.252  1.00 15.77 ? 115  GLY D CA  1 
ATOM   8540  C  C   . GLY D 1 72  ? -12.204 41.996  32.917  1.00 15.74 ? 115  GLY D C   1 
ATOM   8541  O  O   . GLY D 1 72  ? -12.649 42.945  32.288  1.00 17.41 ? 115  GLY D O   1 
ATOM   8542  N  N   . GLY D 1 73  ? -11.173 41.292  32.477  1.00 15.66 ? 116  GLY D N   1 
ATOM   8543  C  CA  . GLY D 1 73  ? -10.563 41.629  31.203  1.00 17.43 ? 116  GLY D CA  1 
ATOM   8544  C  C   . GLY D 1 73  ? -9.227  42.334  31.338  1.00 19.38 ? 116  GLY D C   1 
ATOM   8545  O  O   . GLY D 1 73  ? -8.442  42.414  30.385  1.00 21.40 ? 116  GLY D O   1 
ATOM   8546  N  N   . SER D 1 74  ? -8.963  42.842  32.534  1.00 19.04 ? 117  SER D N   1 
ATOM   8547  C  CA  . SER D 1 74  ? -7.727  43.551  32.789  1.00 16.70 ? 117  SER D CA  1 
ATOM   8548  C  C   . SER D 1 74  ? -6.796  42.725  33.624  1.00 14.82 ? 117  SER D C   1 
ATOM   8549  O  O   . SER D 1 74  ? -7.204  42.126  34.611  1.00 13.95 ? 117  SER D O   1 
ATOM   8550  C  CB  . SER D 1 74  ? -8.010  44.866  33.513  1.00 16.69 ? 117  SER D CB  1 
ATOM   8551  O  OG  . SER D 1 74  ? -8.796  44.661  34.674  1.00 17.01 ? 117  SER D OG  1 
ATOM   8552  N  N   . VAL D 1 75  ? -5.537  42.689  33.211  1.00 15.45 ? 118  VAL D N   1 
ATOM   8553  C  CA  . VAL D 1 75  ? -4.513  41.969  33.951  1.00 17.03 ? 118  VAL D CA  1 
ATOM   8554  C  C   . VAL D 1 75  ? -4.604  42.471  35.399  1.00 18.52 ? 118  VAL D C   1 
ATOM   8555  O  O   . VAL D 1 75  ? -4.158  41.807  36.340  1.00 19.15 ? 118  VAL D O   1 
ATOM   8556  C  CB  . VAL D 1 75  ? -3.109  42.282  33.385  1.00 16.92 ? 118  VAL D CB  1 
ATOM   8557  C  CG1 . VAL D 1 75  ? -2.876  43.785  33.362  1.00 17.72 ? 118  VAL D CG1 1 
ATOM   8558  C  CG2 . VAL D 1 75  ? -2.036  41.588  34.217  1.00 17.68 ? 118  VAL D CG2 1 
ATOM   8559  N  N   . LYS D 1 76  ? -5.206  43.649  35.559  1.00 18.85 ? 119  LYS D N   1 
ATOM   8560  C  CA  . LYS D 1 76  ? -5.370  44.265  36.867  1.00 17.38 ? 119  LYS D CA  1 
ATOM   8561  C  C   . LYS D 1 76  ? -6.537  43.705  37.660  1.00 16.61 ? 119  LYS D C   1 
ATOM   8562  O  O   . LYS D 1 76  ? -6.979  44.299  38.637  1.00 14.41 ? 119  LYS D O   1 
ATOM   8563  C  CB  . LYS D 1 76  ? -5.502  45.781  36.724  1.00 18.18 ? 119  LYS D CB  1 
ATOM   8564  C  CG  . LYS D 1 76  ? -4.185  46.476  36.388  1.00 17.93 ? 119  LYS D CG  1 
ATOM   8565  C  CD  . LYS D 1 76  ? -4.304  47.968  36.631  1.00 19.29 ? 119  LYS D CD  1 
ATOM   8566  C  CE  . LYS D 1 76  ? -3.031  48.698  36.327  1.00 18.36 ? 119  LYS D CE  1 
ATOM   8567  N  NZ  . LYS D 1 76  ? -2.803  48.801  34.894  1.00 17.57 ? 119  LYS D NZ  1 
ATOM   8568  N  N   . ASP D 1 77  ? -7.047  42.566  37.219  1.00 15.66 ? 120  ASP D N   1 
ATOM   8569  C  CA  . ASP D 1 77  ? -8.113  41.913  37.947  1.00 15.72 ? 120  ASP D CA  1 
ATOM   8570  C  C   . ASP D 1 77  ? -7.332  41.103  38.973  1.00 15.94 ? 120  ASP D C   1 
ATOM   8571  O  O   . ASP D 1 77  ? -7.850  40.735  40.029  1.00 14.80 ? 120  ASP D O   1 
ATOM   8572  C  CB  . ASP D 1 77  ? -8.901  40.996  37.028  1.00 16.69 ? 120  ASP D CB  1 
ATOM   8573  C  CG  . ASP D 1 77  ? -9.724  41.758  36.017  1.00 17.23 ? 120  ASP D CG  1 
ATOM   8574  O  OD1 . ASP D 1 77  ? -9.634  43.005  35.950  1.00 15.83 ? 120  ASP D OD1 1 
ATOM   8575  O  OD2 . ASP D 1 77  ? -10.465 41.088  35.287  1.00 18.00 ? 120  ASP D OD2 1 
ATOM   8576  N  N   . ARG D 1 78  ? -6.063  40.861  38.638  1.00 15.27 ? 121  ARG D N   1 
ATOM   8577  C  CA  . ARG D 1 78  ? -5.136  40.124  39.487  1.00 15.61 ? 121  ARG D CA  1 
ATOM   8578  C  C   . ARG D 1 78  ? -4.767  40.947  40.714  1.00 16.81 ? 121  ARG D C   1 
ATOM   8579  O  O   . ARG D 1 78  ? -4.653  40.397  41.809  1.00 18.69 ? 121  ARG D O   1 
ATOM   8580  C  CB  . ARG D 1 78  ? -3.844  39.803  38.737  1.00 16.46 ? 121  ARG D CB  1 
ATOM   8581  C  CG  . ARG D 1 78  ? -3.835  38.560  37.867  1.00 15.72 ? 121  ARG D CG  1 
ATOM   8582  C  CD  . ARG D 1 78  ? -2.450  38.422  37.252  1.00 15.83 ? 121  ARG D CD  1 
ATOM   8583  N  NE  . ARG D 1 78  ? -2.323  37.344  36.268  1.00 18.08 ? 121  ARG D NE  1 
ATOM   8584  C  CZ  . ARG D 1 78  ? -2.270  36.042  36.550  1.00 18.19 ? 121  ARG D CZ  1 
ATOM   8585  N  NH1 . ARG D 1 78  ? -2.335  35.610  37.800  1.00 17.07 ? 121  ARG D NH1 1 
ATOM   8586  N  NH2 . ARG D 1 78  ? -2.129  35.164  35.569  1.00 19.27 ? 121  ARG D NH2 1 
ATOM   8587  N  N   . ILE D 1 79  ? -4.542  42.251  40.536  1.00 14.97 ? 122  ILE D N   1 
ATOM   8588  C  CA  . ILE D 1 79  ? -4.198  43.098  41.677  1.00 13.10 ? 122  ILE D CA  1 
ATOM   8589  C  C   . ILE D 1 79  ? -5.467  43.601  42.347  1.00 11.94 ? 122  ILE D C   1 
ATOM   8590  O  O   . ILE D 1 79  ? -5.452  43.964  43.510  1.00 10.74 ? 122  ILE D O   1 
ATOM   8591  C  CB  . ILE D 1 79  ? -3.344  44.313  41.272  1.00 11.55 ? 122  ILE D CB  1 
ATOM   8592  C  CG1 . ILE D 1 79  ? -4.193  45.307  40.489  1.00 9.59  ? 122  ILE D CG1 1 
ATOM   8593  C  CG2 . ILE D 1 79  ? -2.166  43.852  40.440  1.00 12.26 ? 122  ILE D CG2 1 
ATOM   8594  C  CD1 . ILE D 1 79  ? -3.573  46.656  40.337  1.00 5.20  ? 122  ILE D CD1 1 
ATOM   8595  N  N   . SER D 1 80  ? -6.567  43.634  41.606  1.00 10.94 ? 123  SER D N   1 
ATOM   8596  C  CA  . SER D 1 80  ? -7.831  44.072  42.180  1.00 13.35 ? 123  SER D CA  1 
ATOM   8597  C  C   . SER D 1 80  ? -8.274  43.081  43.254  1.00 15.91 ? 123  SER D C   1 
ATOM   8598  O  O   . SER D 1 80  ? -9.000  43.430  44.190  1.00 16.88 ? 123  SER D O   1 
ATOM   8599  C  CB  . SER D 1 80  ? -8.923  44.128  41.118  1.00 13.09 ? 123  SER D CB  1 
ATOM   8600  O  OG  . SER D 1 80  ? -8.782  45.243  40.274  1.00 13.56 ? 123  SER D OG  1 
ATOM   8601  N  N   . LEU D 1 81  ? -7.837  41.837  43.100  1.00 16.33 ? 124  LEU D N   1 
ATOM   8602  C  CA  . LEU D 1 81  ? -8.196  40.770  44.014  1.00 16.27 ? 124  LEU D CA  1 
ATOM   8603  C  C   . LEU D 1 81  ? -7.138  40.533  45.083  1.00 17.26 ? 124  LEU D C   1 
ATOM   8604  O  O   . LEU D 1 81  ? -7.465  40.429  46.260  1.00 18.54 ? 124  LEU D O   1 
ATOM   8605  C  CB  . LEU D 1 81  ? -8.445  39.491  43.204  1.00 14.32 ? 124  LEU D CB  1 
ATOM   8606  C  CG  . LEU D 1 81  ? -8.586  38.128  43.874  1.00 10.50 ? 124  LEU D CG  1 
ATOM   8607  C  CD1 . LEU D 1 81  ? -9.701  38.128  44.903  1.00 7.35  ? 124  LEU D CD1 1 
ATOM   8608  C  CD2 . LEU D 1 81  ? -8.837  37.127  42.796  1.00 8.53  ? 124  LEU D CD2 1 
ATOM   8609  N  N   . ARG D 1 82  ? -5.875  40.431  44.685  1.00 17.98 ? 125  ARG D N   1 
ATOM   8610  C  CA  . ARG D 1 82  ? -4.816  40.209  45.661  1.00 17.49 ? 125  ARG D CA  1 
ATOM   8611  C  C   . ARG D 1 82  ? -4.940  41.257  46.750  1.00 17.60 ? 125  ARG D C   1 
ATOM   8612  O  O   . ARG D 1 82  ? -4.695  40.981  47.914  1.00 18.70 ? 125  ARG D O   1 
ATOM   8613  C  CB  . ARG D 1 82  ? -3.436  40.307  45.017  1.00 17.59 ? 125  ARG D CB  1 
ATOM   8614  C  CG  . ARG D 1 82  ? -2.314  39.957  45.964  1.00 18.96 ? 125  ARG D CG  1 
ATOM   8615  C  CD  . ARG D 1 82  ? -2.486  38.550  46.524  1.00 20.81 ? 125  ARG D CD  1 
ATOM   8616  N  NE  . ARG D 1 82  ? -1.628  38.284  47.679  1.00 21.60 ? 125  ARG D NE  1 
ATOM   8617  C  CZ  . ARG D 1 82  ? -0.307  38.146  47.626  1.00 22.52 ? 125  ARG D CZ  1 
ATOM   8618  N  NH1 . ARG D 1 82  ? 0.325   38.245  46.474  1.00 23.94 ? 125  ARG D NH1 1 
ATOM   8619  N  NH2 . ARG D 1 82  ? 0.385   37.916  48.729  1.00 23.14 ? 125  ARG D NH2 1 
ATOM   8620  N  N   . MET D 1 83  ? -5.331  42.466  46.375  1.00 17.09 ? 126  MET D N   1 
ATOM   8621  C  CA  . MET D 1 83  ? -5.491  43.510  47.367  1.00 17.58 ? 126  MET D CA  1 
ATOM   8622  C  C   . MET D 1 83  ? -6.732  43.258  48.224  1.00 17.39 ? 126  MET D C   1 
ATOM   8623  O  O   . MET D 1 83  ? -6.601  42.995  49.413  1.00 17.96 ? 126  MET D O   1 
ATOM   8624  C  CB  . MET D 1 83  ? -5.544  44.884  46.695  1.00 17.99 ? 126  MET D CB  1 
ATOM   8625  C  CG  . MET D 1 83  ? -4.220  45.285  46.057  1.00 17.34 ? 126  MET D CG  1 
ATOM   8626  S  SD  . MET D 1 83  ? -4.119  47.029  45.664  1.00 15.68 ? 126  MET D SD  1 
ATOM   8627  C  CE  . MET D 1 83  ? -4.850  47.104  44.048  1.00 16.71 ? 126  MET D CE  1 
ATOM   8628  N  N   . ILE D 1 84  ? -7.922  43.321  47.638  1.00 15.50 ? 127  ILE D N   1 
ATOM   8629  C  CA  . ILE D 1 84  ? -9.127  43.068  48.405  1.00 15.01 ? 127  ILE D CA  1 
ATOM   8630  C  C   . ILE D 1 84  ? -9.023  41.774  49.230  1.00 19.11 ? 127  ILE D C   1 
ATOM   8631  O  O   . ILE D 1 84  ? -9.680  41.632  50.255  1.00 21.28 ? 127  ILE D O   1 
ATOM   8632  C  CB  . ILE D 1 84  ? -10.369 42.952  47.496  1.00 12.51 ? 127  ILE D CB  1 
ATOM   8633  C  CG1 . ILE D 1 84  ? -10.607 44.255  46.744  1.00 10.26 ? 127  ILE D CG1 1 
ATOM   8634  C  CG2 . ILE D 1 84  ? -11.589 42.643  48.328  1.00 10.38 ? 127  ILE D CG2 1 
ATOM   8635  C  CD1 . ILE D 1 84  ? -11.795 44.219  45.843  1.00 3.95  ? 127  ILE D CD1 1 
ATOM   8636  N  N   . GLU D 1 85  ? -8.200  40.823  48.803  1.00 21.98 ? 128  GLU D N   1 
ATOM   8637  C  CA  . GLU D 1 85  ? -8.085  39.570  49.546  1.00 23.72 ? 128  GLU D CA  1 
ATOM   8638  C  C   . GLU D 1 85  ? -6.931  39.576  50.538  1.00 25.01 ? 128  GLU D C   1 
ATOM   8639  O  O   . GLU D 1 85  ? -6.770  38.643  51.326  1.00 25.59 ? 128  GLU D O   1 
ATOM   8640  C  CB  . GLU D 1 85  ? -7.954  38.384  48.584  1.00 24.37 ? 128  GLU D CB  1 
ATOM   8641  C  CG  . GLU D 1 85  ? -9.173  37.454  48.599  1.00 27.81 ? 128  GLU D CG  1 
ATOM   8642  C  CD  . GLU D 1 85  ? -9.000  36.203  47.733  1.00 29.04 ? 128  GLU D CD  1 
ATOM   8643  O  OE1 . GLU D 1 85  ? -9.845  35.275  47.835  1.00 26.63 ? 128  GLU D OE1 1 
ATOM   8644  O  OE2 . GLU D 1 85  ? -8.021  36.157  46.950  1.00 29.40 ? 128  GLU D OE2 1 
ATOM   8645  N  N   . ASP D 1 86  ? -6.117  40.623  50.490  1.00 26.35 ? 129  ASP D N   1 
ATOM   8646  C  CA  . ASP D 1 86  ? -5.006  40.757  51.425  1.00 26.58 ? 129  ASP D CA  1 
ATOM   8647  C  C   . ASP D 1 86  ? -5.453  41.768  52.469  1.00 26.90 ? 129  ASP D C   1 
ATOM   8648  O  O   . ASP D 1 86  ? -4.906  41.823  53.568  1.00 28.53 ? 129  ASP D O   1 
ATOM   8649  C  CB  . ASP D 1 86  ? -3.736  41.247  50.718  1.00 25.78 ? 129  ASP D CB  1 
ATOM   8650  C  CG  . ASP D 1 86  ? -2.981  40.120  50.019  1.00 26.85 ? 129  ASP D CG  1 
ATOM   8651  O  OD1 . ASP D 1 86  ? -1.873  40.369  49.488  1.00 24.20 ? 129  ASP D OD1 1 
ATOM   8652  O  OD2 . ASP D 1 86  ? -3.499  38.982  50.003  1.00 27.77 ? 129  ASP D OD2 1 
ATOM   8653  N  N   . ALA D 1 87  ? -6.458  42.565  52.118  1.00 26.23 ? 130  ALA D N   1 
ATOM   8654  C  CA  . ALA D 1 87  ? -6.999  43.565  53.027  1.00 26.62 ? 130  ALA D CA  1 
ATOM   8655  C  C   . ALA D 1 87  ? -8.028  42.902  53.932  1.00 27.58 ? 130  ALA D C   1 
ATOM   8656  O  O   . ALA D 1 87  ? -8.254  43.338  55.054  1.00 28.65 ? 130  ALA D O   1 
ATOM   8657  C  CB  . ALA D 1 87  ? -7.645  44.686  52.249  1.00 24.49 ? 130  ALA D CB  1 
ATOM   8658  N  N   . GLU D 1 88  ? -8.669  41.857  53.427  1.00 28.55 ? 131  GLU D N   1 
ATOM   8659  C  CA  . GLU D 1 88  ? -9.659  41.125  54.202  1.00 27.23 ? 131  GLU D CA  1 
ATOM   8660  C  C   . GLU D 1 88  ? -8.836  40.201  55.066  1.00 26.69 ? 131  GLU D C   1 
ATOM   8661  O  O   . GLU D 1 88  ? -9.200  39.857  56.187  1.00 25.70 ? 131  GLU D O   1 
ATOM   8662  C  CB  . GLU D 1 88  ? -10.551 40.287  53.291  1.00 28.46 ? 131  GLU D CB  1 
ATOM   8663  C  CG  . GLU D 1 88  ? -11.518 41.057  52.430  1.00 30.69 ? 131  GLU D CG  1 
ATOM   8664  C  CD  . GLU D 1 88  ? -12.338 40.149  51.516  1.00 34.70 ? 131  GLU D CD  1 
ATOM   8665  O  OE1 . GLU D 1 88  ? -13.198 40.677  50.774  1.00 35.49 ? 131  GLU D OE1 1 
ATOM   8666  O  OE2 . GLU D 1 88  ? -12.131 38.910  51.528  1.00 36.71 ? 131  GLU D OE2 1 
ATOM   8667  N  N   . ARG D 1 89  ? -7.706  39.805  54.508  1.00 27.96 ? 132  ARG D N   1 
ATOM   8668  C  CA  . ARG D 1 89  ? -6.790  38.903  55.173  1.00 29.85 ? 132  ARG D CA  1 
ATOM   8669  C  C   . ARG D 1 89  ? -6.333  39.559  56.464  1.00 29.37 ? 132  ARG D C   1 
ATOM   8670  O  O   . ARG D 1 89  ? -6.283  38.919  57.512  1.00 28.31 ? 132  ARG D O   1 
ATOM   8671  C  CB  . ARG D 1 89  ? -5.607  38.641  54.238  1.00 31.91 ? 132  ARG D CB  1 
ATOM   8672  C  CG  . ARG D 1 89  ? -4.818  37.372  54.495  1.00 33.50 ? 132  ARG D CG  1 
ATOM   8673  C  CD  . ARG D 1 89  ? -4.033  37.016  53.235  1.00 35.10 ? 132  ARG D CD  1 
ATOM   8674  N  NE  . ARG D 1 89  ? -4.530  35.790  52.614  1.00 35.42 ? 132  ARG D NE  1 
ATOM   8675  C  CZ  . ARG D 1 89  ? -4.158  35.334  51.418  1.00 34.41 ? 132  ARG D CZ  1 
ATOM   8676  N  NH1 . ARG D 1 89  ? -3.272  36.009  50.688  1.00 33.58 ? 132  ARG D NH1 1 
ATOM   8677  N  NH2 . ARG D 1 89  ? -4.675  34.194  50.960  1.00 33.44 ? 132  ARG D NH2 1 
ATOM   8678  N  N   . ASP D 1 90  ? -6.032  40.854  56.367  1.00 29.89 ? 133  ASP D N   1 
ATOM   8679  C  CA  . ASP D 1 90  ? -5.557  41.654  57.488  1.00 29.26 ? 133  ASP D CA  1 
ATOM   8680  C  C   . ASP D 1 90  ? -6.613  42.251  58.394  1.00 28.91 ? 133  ASP D C   1 
ATOM   8681  O  O   . ASP D 1 90  ? -6.305  43.138  59.176  1.00 30.00 ? 133  ASP D O   1 
ATOM   8682  C  CB  . ASP D 1 90  ? -4.664  42.773  56.980  1.00 30.23 ? 133  ASP D CB  1 
ATOM   8683  C  CG  . ASP D 1 90  ? -3.223  42.384  56.973  1.00 32.31 ? 133  ASP D CG  1 
ATOM   8684  O  OD1 . ASP D 1 90  ? -2.718  42.033  58.063  1.00 34.94 ? 133  ASP D OD1 1 
ATOM   8685  O  OD2 . ASP D 1 90  ? -2.600  42.428  55.892  1.00 31.85 ? 133  ASP D OD2 1 
ATOM   8686  N  N   . GLY D 1 91  ? -7.852  41.781  58.283  1.00 28.65 ? 134  GLY D N   1 
ATOM   8687  C  CA  . GLY D 1 91  ? -8.921  42.264  59.147  1.00 27.12 ? 134  GLY D CA  1 
ATOM   8688  C  C   . GLY D 1 91  ? -9.295  43.724  59.028  1.00 26.20 ? 134  GLY D C   1 
ATOM   8689  O  O   . GLY D 1 91  ? -10.169 44.213  59.766  1.00 25.66 ? 134  GLY D O   1 
ATOM   8690  N  N   . THR D 1 92  ? -8.632  44.415  58.100  1.00 24.33 ? 135  THR D N   1 
ATOM   8691  C  CA  . THR D 1 92  ? -8.881  45.835  57.860  1.00 23.43 ? 135  THR D CA  1 
ATOM   8692  C  C   . THR D 1 92  ? -9.930  46.065  56.777  1.00 22.72 ? 135  THR D C   1 
ATOM   8693  O  O   . THR D 1 92  ? -10.459 47.175  56.632  1.00 24.50 ? 135  THR D O   1 
ATOM   8694  C  CB  . THR D 1 92  ? -7.570  46.605  57.509  1.00 24.64 ? 135  THR D CB  1 
ATOM   8695  O  OG1 . THR D 1 92  ? -6.663  45.740  56.815  1.00 24.86 ? 135  THR D OG1 1 
ATOM   8696  C  CG2 . THR D 1 92  ? -6.904  47.139  58.785  1.00 22.36 ? 135  THR D CG2 1 
ATOM   8697  N  N   . LEU D 1 93  ? -10.215 45.014  56.011  1.00 20.32 ? 136  LEU D N   1 
ATOM   8698  C  CA  . LEU D 1 93  ? -11.250 45.087  54.986  1.00 17.06 ? 136  LEU D CA  1 
ATOM   8699  C  C   . LEU D 1 93  ? -12.596 44.581  55.553  1.00 15.01 ? 136  LEU D C   1 
ATOM   8700  O  O   . LEU D 1 93  ? -13.090 43.517  55.175  1.00 12.48 ? 136  LEU D O   1 
ATOM   8701  C  CB  . LEU D 1 93  ? -10.843 44.266  53.770  1.00 15.54 ? 136  LEU D CB  1 
ATOM   8702  C  CG  . LEU D 1 93  ? -11.698 44.411  52.513  1.00 15.63 ? 136  LEU D CG  1 
ATOM   8703  C  CD1 . LEU D 1 93  ? -12.421 45.762  52.493  1.00 11.97 ? 136  LEU D CD1 1 
ATOM   8704  C  CD2 . LEU D 1 93  ? -10.775 44.233  51.291  1.00 12.48 ? 136  LEU D CD2 1 
ATOM   8705  N  N   . LYS D 1 94  ? -13.174 45.316  56.496  1.00 14.29 ? 137  LYS D N   1 
ATOM   8706  C  CA  . LYS D 1 94  ? -14.447 44.879  57.069  1.00 15.05 ? 137  LYS D CA  1 
ATOM   8707  C  C   . LYS D 1 94  ? -15.507 44.545  55.967  1.00 15.15 ? 137  LYS D C   1 
ATOM   8708  O  O   . LYS D 1 94  ? -15.563 45.183  54.885  1.00 12.48 ? 137  LYS D O   1 
ATOM   8709  C  CB  . LYS D 1 94  ? -14.993 45.939  58.052  1.00 15.42 ? 137  LYS D CB  1 
ATOM   8710  C  CG  . LYS D 1 94  ? -14.181 46.010  59.368  1.00 15.80 ? 137  LYS D CG  1 
ATOM   8711  C  CD  . LYS D 1 94  ? -13.911 47.454  59.797  1.00 13.04 ? 137  LYS D CD  1 
ATOM   8712  C  CE  . LYS D 1 94  ? -12.523 47.968  59.311  1.00 13.68 ? 137  LYS D CE  1 
ATOM   8713  N  NZ  . LYS D 1 94  ? -11.311 47.185  59.765  1.00 8.31  ? 137  LYS D NZ  1 
ATOM   8714  N  N   . PRO D 1 95  ? -16.322 43.498  56.237  1.00 15.50 ? 138  PRO D N   1 
ATOM   8715  C  CA  . PRO D 1 95  ? -17.363 43.162  55.286  1.00 16.11 ? 138  PRO D CA  1 
ATOM   8716  C  C   . PRO D 1 95  ? -18.187 44.358  54.858  1.00 16.57 ? 138  PRO D C   1 
ATOM   8717  O  O   . PRO D 1 95  ? -18.324 45.306  55.620  1.00 18.73 ? 138  PRO D O   1 
ATOM   8718  C  CB  . PRO D 1 95  ? -18.121 42.023  55.947  1.00 14.92 ? 138  PRO D CB  1 
ATOM   8719  C  CG  . PRO D 1 95  ? -16.991 41.285  56.585  1.00 15.17 ? 138  PRO D CG  1 
ATOM   8720  C  CD  . PRO D 1 95  ? -15.854 42.239  56.812  1.00 16.57 ? 138  PRO D CD  1 
ATOM   8721  N  N   . GLY D 1 96  ? -18.742 44.336  53.635  1.00 16.53 ? 139  GLY D N   1 
ATOM   8722  C  CA  . GLY D 1 96  ? -19.595 45.401  53.108  1.00 16.91 ? 139  GLY D CA  1 
ATOM   8723  C  C   . GLY D 1 96  ? -19.014 46.792  53.282  1.00 17.09 ? 139  GLY D C   1 
ATOM   8724  O  O   . GLY D 1 96  ? -19.749 47.762  53.394  1.00 14.73 ? 139  GLY D O   1 
ATOM   8725  N  N   . ASP D 1 97  ? -17.714 46.876  53.271  1.00 18.62 ? 140  ASP D N   1 
ATOM   8726  C  CA  . ASP D 1 97  ? -17.047 48.154  53.438  1.00 20.54 ? 140  ASP D CA  1 
ATOM   8727  C  C   . ASP D 1 97  ? -16.973 48.931  52.154  1.00 20.74 ? 140  ASP D C   1 
ATOM   8728  O  O   . ASP D 1 97  ? -17.643 48.611  51.182  1.00 21.87 ? 140  ASP D O   1 
ATOM   8729  C  CB  . ASP D 1 97  ? -15.716 47.950  54.062  1.00 22.36 ? 140  ASP D CB  1 
ATOM   8730  C  CG  . ASP D 1 97  ? -15.872 48.316  55.495  1.00 25.93 ? 140  ASP D CG  1 
ATOM   8731  O  OD1 . ASP D 1 97  ? -16.944 48.033  56.083  1.00 24.60 ? 140  ASP D OD1 1 
ATOM   8732  O  OD2 . ASP D 1 97  ? -14.908 48.893  56.051  1.00 25.93 ? 140  ASP D OD2 1 
ATOM   8733  N  N   . THR D 1 98  ? -16.172 49.927  52.123  1.00 20.57 ? 141  THR D N   1 
ATOM   8734  C  CA  . THR D 1 98  ? -16.177 50.691  50.929  1.00 18.85 ? 141  THR D CA  1 
ATOM   8735  C  C   . THR D 1 98  ? -14.786 50.718  50.340  1.00 20.08 ? 141  THR D C   1 
ATOM   8736  O  O   . THR D 1 98  ? -13.806 50.909  51.053  1.00 20.95 ? 141  THR D O   1 
ATOM   8737  C  CB  . THR D 1 98  ? -16.670 52.112  51.226  1.00 18.58 ? 141  THR D CB  1 
ATOM   8738  O  OG1 . THR D 1 98  ? -17.930 52.041  51.901  1.00 16.35 ? 141  THR D OG1 1 
ATOM   8739  C  CG2 . THR D 1 98  ? -16.807 52.914  49.942  1.00 18.53 ? 141  THR D CG2 1 
ATOM   8740  N  N   . ILE D 1 99  ? -14.721 50.518  49.036  1.00 19.86 ? 142  ILE D N   1 
ATOM   8741  C  CA  . ILE D 1 99  ? -13.430 50.593  48.399  1.00 19.14 ? 142  ILE D CA  1 
ATOM   8742  C  C   . ILE D 1 99  ? -13.366 51.853  47.563  1.00 20.26 ? 142  ILE D C   1 
ATOM   8743  O  O   . ILE D 1 99  ? -14.235 52.116  46.723  1.00 20.61 ? 142  ILE D O   1 
ATOM   8744  C  CB  . ILE D 1 99  ? -13.170 49.348  47.545  1.00 18.63 ? 142  ILE D CB  1 
ATOM   8745  C  CG1 . ILE D 1 99  ? -13.064 48.133  48.471  1.00 16.53 ? 142  ILE D CG1 1 
ATOM   8746  C  CG2 . ILE D 1 99  ? -11.913 49.538  46.689  1.00 17.68 ? 142  ILE D CG2 1 
ATOM   8747  C  CD1 . ILE D 1 99  ? -12.813 46.837  47.762  1.00 18.02 ? 142  ILE D CD1 1 
ATOM   8748  N  N   . ILE D 1 100 ? -12.352 52.657  47.845  1.00 19.83 ? 143  ILE D N   1 
ATOM   8749  C  CA  . ILE D 1 100 ? -12.134 53.889  47.141  1.00 19.92 ? 143  ILE D CA  1 
ATOM   8750  C  C   . ILE D 1 100 ? -10.753 53.789  46.543  1.00 22.27 ? 143  ILE D C   1 
ATOM   8751  O  O   . ILE D 1 100 ? -9.803  53.406  47.218  1.00 22.18 ? 143  ILE D O   1 
ATOM   8752  C  CB  . ILE D 1 100 ? -12.179 55.110  48.089  1.00 19.12 ? 143  ILE D CB  1 
ATOM   8753  C  CG1 . ILE D 1 100 ? -13.597 55.324  48.619  1.00 19.13 ? 143  ILE D CG1 1 
ATOM   8754  C  CG2 . ILE D 1 100 ? -11.718 56.354  47.356  1.00 19.99 ? 143  ILE D CG2 1 
ATOM   8755  C  CD1 . ILE D 1 100 ? -13.811 56.664  49.309  1.00 15.56 ? 143  ILE D CD1 1 
ATOM   8756  N  N   . GLU D 1 101 ? -10.683 54.135  45.261  1.00 25.11 ? 144  GLU D N   1 
ATOM   8757  C  CA  . GLU D 1 101 ? -9.436  54.126  44.509  1.00 26.66 ? 144  GLU D CA  1 
ATOM   8758  C  C   . GLU D 1 101 ? -9.410  55.211  43.395  1.00 27.63 ? 144  GLU D C   1 
ATOM   8759  O  O   . GLU D 1 101 ? -10.326 55.359  42.587  1.00 26.78 ? 144  GLU D O   1 
ATOM   8760  C  CB  . GLU D 1 101 ? -9.096  52.747  43.905  1.00 28.76 ? 144  GLU D CB  1 
ATOM   8761  C  CG  . GLU D 1 101 ? -7.682  52.634  43.318  1.00 29.55 ? 144  GLU D CG  1 
ATOM   8762  C  CD  . GLU D 1 101 ? -6.639  52.219  44.356  1.00 31.48 ? 144  GLU D CD  1 
ATOM   8763  O  OE1 . GLU D 1 101 ? -5.419  52.322  44.069  1.00 29.81 ? 144  GLU D OE1 1 
ATOM   8764  O  OE2 . GLU D 1 101 ? -7.049  51.778  45.457  1.00 30.66 ? 144  GLU D OE2 1 
ATOM   8765  N  N   . PRO D 1 102 ? -8.276  55.982  43.462  1.00 28.89 ? 145  PRO D N   1 
ATOM   8766  C  CA  . PRO D 1 102 ? -8.038  57.075  42.521  1.00 30.72 ? 145  PRO D CA  1 
ATOM   8767  C  C   . PRO D 1 102 ? -8.210  56.648  41.076  1.00 31.53 ? 145  PRO D C   1 
ATOM   8768  O  O   . PRO D 1 102 ? -8.395  57.472  40.186  1.00 31.83 ? 145  PRO D O   1 
ATOM   8769  C  CB  . PRO D 1 102 ? -6.726  57.709  42.953  1.00 30.10 ? 145  PRO D CB  1 
ATOM   8770  C  CG  . PRO D 1 102 ? -6.859  57.648  44.417  1.00 30.81 ? 145  PRO D CG  1 
ATOM   8771  C  CD  . PRO D 1 102 ? -7.796  56.535  44.742  1.00 29.69 ? 145  PRO D CD  1 
ATOM   8772  N  N   . THR D 1 103 ? -8.190  55.391  40.844  1.00 31.89 ? 146  THR D N   1 
ATOM   8773  C  CA  . THR D 1 103 ? -8.197  54.817  39.518  1.00 32.60 ? 146  THR D CA  1 
ATOM   8774  C  C   . THR D 1 103 ? -9.425  54.978  38.585  1.00 32.26 ? 146  THR D C   1 
ATOM   8775  O  O   . THR D 1 103 ? -10.592 54.762  38.932  1.00 33.91 ? 146  THR D O   1 
ATOM   8776  C  CB  . THR D 1 103 ? -7.880  53.332  39.720  1.00 32.54 ? 146  THR D CB  1 
ATOM   8777  O  OG1 . THR D 1 103 ? -7.814  52.641  38.466  1.00 31.74 ? 146  THR D OG1 1 
ATOM   8778  C  CG2 . THR D 1 103 ? -8.940  52.681  40.597  1.00 33.67 ? 146  THR D CG2 1 
ATOM   8779  N  N   . SER D 1 104 ? -9.029  55.364  37.350  1.00 31.37 ? 147  SER D N   1 
ATOM   8780  C  CA  . SER D 1 104 ? -9.944  55.540  36.237  1.00 30.40 ? 147  SER D CA  1 
ATOM   8781  C  C   . SER D 1 104 ? -9.706  54.352  35.296  1.00 28.79 ? 147  SER D C   1 
ATOM   8782  O  O   . SER D 1 104 ? -10.640 53.879  34.640  1.00 27.17 ? 147  SER D O   1 
ATOM   8783  C  CB  . SER D 1 104 ? -9.687  56.848  35.501  1.00 30.45 ? 147  SER D CB  1 
ATOM   8784  O  OG  . SER D 1 104 ? -8.314  57.005  35.197  1.00 29.46 ? 147  SER D OG  1 
ATOM   8785  N  N   . GLY D 1 105 ? -8.469  53.865  35.233  1.00 28.27 ? 148  GLY D N   1 
ATOM   8786  C  CA  . GLY D 1 105 ? -8.124  52.772  34.343  1.00 26.44 ? 148  GLY D CA  1 
ATOM   8787  C  C   . GLY D 1 105 ? -8.685  51.407  34.696  1.00 25.19 ? 148  GLY D C   1 
ATOM   8788  O  O   . GLY D 1 105 ? -9.749  51.286  35.304  1.00 23.88 ? 148  GLY D O   1 
ATOM   8789  N  N   . ASN D 1 106 ? -7.954  50.371  34.309  1.00 24.70 ? 149  ASN D N   1 
ATOM   8790  C  CA  . ASN D 1 106 ? -8.379  49.007  34.555  1.00 25.67 ? 149  ASN D CA  1 
ATOM   8791  C  C   . ASN D 1 106 ? -8.555  48.670  36.026  1.00 26.59 ? 149  ASN D C   1 
ATOM   8792  O  O   . ASN D 1 106 ? -9.537  48.011  36.411  1.00 25.57 ? 149  ASN D O   1 
ATOM   8793  C  CB  . ASN D 1 106 ? -7.404  48.029  33.891  1.00 25.63 ? 149  ASN D CB  1 
ATOM   8794  C  CG  . ASN D 1 106 ? -7.719  47.827  32.419  1.00 27.91 ? 149  ASN D CG  1 
ATOM   8795  O  OD1 . ASN D 1 106 ? -8.886  47.664  32.060  1.00 28.78 ? 149  ASN D OD1 1 
ATOM   8796  N  ND2 . ASN D 1 106 ? -6.699  47.835  31.563  1.00 27.94 ? 149  ASN D ND2 1 
ATOM   8797  N  N   . THR D 1 107 ? -7.621  49.124  36.854  1.00 25.79 ? 150  THR D N   1 
ATOM   8798  C  CA  . THR D 1 107 ? -7.717  48.844  38.276  1.00 25.23 ? 150  THR D CA  1 
ATOM   8799  C  C   . THR D 1 107 ? -9.128  49.133  38.799  1.00 24.97 ? 150  THR D C   1 
ATOM   8800  O  O   . THR D 1 107 ? -9.630  48.425  39.684  1.00 24.24 ? 150  THR D O   1 
ATOM   8801  C  CB  . THR D 1 107 ? -6.714  49.668  39.075  1.00 25.22 ? 150  THR D CB  1 
ATOM   8802  O  OG1 . THR D 1 107 ? -5.392  49.447  38.563  1.00 25.19 ? 150  THR D OG1 1 
ATOM   8803  C  CG2 . THR D 1 107 ? -6.767  49.266  40.531  1.00 22.85 ? 150  THR D CG2 1 
ATOM   8804  N  N   . GLY D 1 108 ? -9.765  50.160  38.237  1.00 24.11 ? 151  GLY D N   1 
ATOM   8805  C  CA  . GLY D 1 108 ? -11.106 50.525  38.662  1.00 24.62 ? 151  GLY D CA  1 
ATOM   8806  C  C   . GLY D 1 108 ? -12.128 49.440  38.377  1.00 24.57 ? 151  GLY D C   1 
ATOM   8807  O  O   . GLY D 1 108 ? -12.923 49.059  39.243  1.00 24.88 ? 151  GLY D O   1 
ATOM   8808  N  N   . ILE D 1 109 ? -12.090 48.937  37.147  1.00 24.31 ? 152  ILE D N   1 
ATOM   8809  C  CA  . ILE D 1 109 ? -13.000 47.902  36.681  1.00 22.61 ? 152  ILE D CA  1 
ATOM   8810  C  C   . ILE D 1 109 ? -12.795 46.608  37.466  1.00 23.44 ? 152  ILE D C   1 
ATOM   8811  O  O   . ILE D 1 109 ? -13.753 45.880  37.751  1.00 24.50 ? 152  ILE D O   1 
ATOM   8812  C  CB  . ILE D 1 109 ? -12.778 47.640  35.165  1.00 21.03 ? 152  ILE D CB  1 
ATOM   8813  C  CG1 . ILE D 1 109 ? -12.840 48.972  34.399  1.00 19.32 ? 152  ILE D CG1 1 
ATOM   8814  C  CG2 . ILE D 1 109 ? -13.828 46.653  34.637  1.00 18.67 ? 152  ILE D CG2 1 
ATOM   8815  C  CD1 . ILE D 1 109 ? -12.229 48.930  33.016  1.00 15.99 ? 152  ILE D CD1 1 
ATOM   8816  N  N   . GLY D 1 110 ? -11.546 46.321  37.819  1.00 23.31 ? 153  GLY D N   1 
ATOM   8817  C  CA  . GLY D 1 110 ? -11.268 45.117  38.581  1.00 23.02 ? 153  GLY D CA  1 
ATOM   8818  C  C   . GLY D 1 110 ? -11.772 45.252  40.004  1.00 24.06 ? 153  GLY D C   1 
ATOM   8819  O  O   . GLY D 1 110 ? -12.260 44.287  40.606  1.00 23.97 ? 153  GLY D O   1 
ATOM   8820  N  N   . LEU D 1 111 ? -11.657 46.462  40.547  1.00 25.02 ? 154  LEU D N   1 
ATOM   8821  C  CA  . LEU D 1 111 ? -12.114 46.725  41.907  1.00 26.41 ? 154  LEU D CA  1 
ATOM   8822  C  C   . LEU D 1 111 ? -13.622 46.578  42.033  1.00 27.23 ? 154  LEU D C   1 
ATOM   8823  O  O   . LEU D 1 111 ? -14.116 46.060  43.035  1.00 27.97 ? 154  LEU D O   1 
ATOM   8824  C  CB  . LEU D 1 111 ? -11.705 48.129  42.344  1.00 26.30 ? 154  LEU D CB  1 
ATOM   8825  C  CG  . LEU D 1 111 ? -10.209 48.332  42.610  1.00 28.06 ? 154  LEU D CG  1 
ATOM   8826  C  CD1 . LEU D 1 111 ? -9.911  49.812  42.879  1.00 25.54 ? 154  LEU D CD1 1 
ATOM   8827  C  CD2 . LEU D 1 111 ? -9.788  47.455  43.783  1.00 26.88 ? 154  LEU D CD2 1 
ATOM   8828  N  N   . ALA D 1 112 ? -14.344 47.031  41.008  1.00 27.43 ? 155  ALA D N   1 
ATOM   8829  C  CA  . ALA D 1 112 ? -15.811 46.983  40.974  1.00 26.63 ? 155  ALA D CA  1 
ATOM   8830  C  C   . ALA D 1 112 ? -16.410 45.630  40.549  1.00 27.46 ? 155  ALA D C   1 
ATOM   8831  O  O   . ALA D 1 112 ? -17.509 45.264  40.991  1.00 27.42 ? 155  ALA D O   1 
ATOM   8832  C  CB  . ALA D 1 112 ? -16.334 48.094  40.073  1.00 24.03 ? 155  ALA D CB  1 
ATOM   8833  N  N   . LEU D 1 113 ? -15.706 44.895  39.688  1.00 26.93 ? 156  LEU D N   1 
ATOM   8834  C  CA  . LEU D 1 113 ? -16.191 43.586  39.248  1.00 25.89 ? 156  LEU D CA  1 
ATOM   8835  C  C   . LEU D 1 113 ? -16.225 42.672  40.467  1.00 25.72 ? 156  LEU D C   1 
ATOM   8836  O  O   . LEU D 1 113 ? -17.090 41.805  40.590  1.00 26.74 ? 156  LEU D O   1 
ATOM   8837  C  CB  . LEU D 1 113 ? -15.261 42.993  38.175  1.00 23.74 ? 156  LEU D CB  1 
ATOM   8838  C  CG  . LEU D 1 113 ? -15.582 41.607  37.594  1.00 21.27 ? 156  LEU D CG  1 
ATOM   8839  C  CD1 . LEU D 1 113 ? -15.172 40.520  38.532  1.00 22.62 ? 156  LEU D CD1 1 
ATOM   8840  C  CD2 . LEU D 1 113 ? -17.048 41.506  37.324  1.00 23.42 ? 156  LEU D CD2 1 
ATOM   8841  N  N   . ALA D 1 114 ? -15.273 42.894  41.370  1.00 25.09 ? 157  ALA D N   1 
ATOM   8842  C  CA  . ALA D 1 114 ? -15.143 42.112  42.592  1.00 24.23 ? 157  ALA D CA  1 
ATOM   8843  C  C   . ALA D 1 114 ? -15.972 42.661  43.770  1.00 22.35 ? 157  ALA D C   1 
ATOM   8844  O  O   . ALA D 1 114 ? -16.444 41.912  44.619  1.00 21.82 ? 157  ALA D O   1 
ATOM   8845  C  CB  . ALA D 1 114 ? -13.669 42.030  43.000  1.00 23.30 ? 157  ALA D CB  1 
ATOM   8846  N  N   . ALA D 1 115 ? -16.141 43.972  43.817  1.00 21.74 ? 158  ALA D N   1 
ATOM   8847  C  CA  . ALA D 1 115 ? -16.906 44.594  44.879  1.00 22.34 ? 158  ALA D CA  1 
ATOM   8848  C  C   . ALA D 1 115 ? -18.358 44.132  44.804  1.00 22.74 ? 158  ALA D C   1 
ATOM   8849  O  O   . ALA D 1 115 ? -19.023 43.923  45.826  1.00 20.88 ? 158  ALA D O   1 
ATOM   8850  C  CB  . ALA D 1 115 ? -16.830 46.113  44.804  1.00 23.66 ? 158  ALA D CB  1 
ATOM   8851  N  N   . ALA D 1 116 ? -18.842 43.977  43.577  1.00 23.11 ? 159  ALA D N   1 
ATOM   8852  C  CA  . ALA D 1 116 ? -20.209 43.554  43.349  1.00 22.72 ? 159  ALA D CA  1 
ATOM   8853  C  C   . ALA D 1 116 ? -20.368 42.052  43.573  1.00 22.60 ? 159  ALA D C   1 
ATOM   8854  O  O   . ALA D 1 116 ? -21.486 41.517  43.502  1.00 23.09 ? 159  ALA D O   1 
ATOM   8855  C  CB  . ALA D 1 116 ? -20.663 43.940  41.946  1.00 22.56 ? 159  ALA D CB  1 
ATOM   8856  N  N   . VAL D 1 117 ? -19.247 41.375  43.914  1.00 21.62 ? 160  VAL D N   1 
ATOM   8857  C  CA  . VAL D 1 117 ? -19.299 39.904  44.162  1.00 21.65 ? 160  VAL D CA  1 
ATOM   8858  C  C   . VAL D 1 117 ? -19.020 39.409  45.540  1.00 21.19 ? 160  VAL D C   1 
ATOM   8859  O  O   . VAL D 1 117 ? -19.558 38.396  45.974  1.00 20.40 ? 160  VAL D O   1 
ATOM   8860  C  CB  . VAL D 1 117 ? -18.294 39.116  43.331  1.00 22.86 ? 160  VAL D CB  1 
ATOM   8861  C  CG1 . VAL D 1 117 ? -18.190 37.682  43.845  1.00 22.03 ? 160  VAL D CG1 1 
ATOM   8862  C  CG2 . VAL D 1 117 ? -18.678 39.135  41.849  1.00 21.58 ? 160  VAL D CG2 1 
ATOM   8863  N  N   . ARG D 1 118 ? -18.177 40.104  46.266  1.00 21.40 ? 161  ARG D N   1 
ATOM   8864  C  CA  . ARG D 1 118 ? -17.886 39.777  47.610  1.00 21.83 ? 161  ARG D CA  1 
ATOM   8865  C  C   . ARG D 1 118 ? -18.917 40.430  48.506  1.00 23.34 ? 161  ARG D C   1 
ATOM   8866  O  O   . ARG D 1 118 ? -19.387 39.833  49.474  1.00 22.66 ? 161  ARG D O   1 
ATOM   8867  C  CB  . ARG D 1 118 ? -16.468 40.241  47.986  1.00 21.71 ? 161  ARG D CB  1 
ATOM   8868  C  CG  . ARG D 1 118 ? -15.379 39.671  47.113  1.00 21.27 ? 161  ARG D CG  1 
ATOM   8869  C  CD  . ARG D 1 118 ? -14.281 39.053  47.959  1.00 16.81 ? 161  ARG D CD  1 
ATOM   8870  N  NE  . ARG D 1 118 ? -13.416 38.212  47.174  1.00 15.39 ? 161  ARG D NE  1 
ATOM   8871  C  CZ  . ARG D 1 118 ? -12.404 37.514  47.684  1.00 17.08 ? 161  ARG D CZ  1 
ATOM   8872  N  NH1 . ARG D 1 118 ? -12.149 37.553  48.992  1.00 16.39 ? 161  ARG D NH1 1 
ATOM   8873  N  NH2 . ARG D 1 118 ? -11.647 36.770  46.885  1.00 15.06 ? 161  ARG D NH2 1 
ATOM   8874  N  N   . GLY D 1 119 ? -19.247 41.685  48.189  1.00 24.83 ? 162  GLY D N   1 
ATOM   8875  C  CA  . GLY D 1 119 ? -20.270 42.424  48.961  1.00 26.35 ? 162  GLY D CA  1 
ATOM   8876  C  C   . GLY D 1 119 ? -19.873 43.852  49.344  1.00 26.65 ? 162  GLY D C   1 
ATOM   8877  O  O   . GLY D 1 119 ? -20.413 44.395  50.296  1.00 26.07 ? 162  GLY D O   1 
ATOM   8878  N  N   . TYR D 1 120 ? -18.950 44.452  48.610  1.00 27.57 ? 163  TYR D N   1 
ATOM   8879  C  CA  . TYR D 1 120 ? -18.496 45.794  48.940  1.00 28.54 ? 163  TYR D CA  1 
ATOM   8880  C  C   . TYR D 1 120 ? -19.051 46.905  48.081  1.00 28.43 ? 163  TYR D C   1 
ATOM   8881  O  O   . TYR D 1 120 ? -19.597 46.684  47.006  1.00 29.05 ? 163  TYR D O   1 
ATOM   8882  C  CB  . TYR D 1 120 ? -16.966 45.832  48.887  1.00 29.21 ? 163  TYR D CB  1 
ATOM   8883  C  CG  . TYR D 1 120 ? -16.313 44.863  49.850  1.00 29.96 ? 163  TYR D CG  1 
ATOM   8884  C  CD1 . TYR D 1 120 ? -15.055 44.335  49.593  1.00 29.15 ? 163  TYR D CD1 1 
ATOM   8885  C  CD2 . TYR D 1 120 ? -16.961 44.470  51.022  1.00 30.36 ? 163  TYR D CD2 1 
ATOM   8886  C  CE1 . TYR D 1 120 ? -14.462 43.445  50.473  1.00 28.74 ? 163  TYR D CE1 1 
ATOM   8887  C  CE2 . TYR D 1 120 ? -16.372 43.585  51.900  1.00 29.84 ? 163  TYR D CE2 1 
ATOM   8888  C  CZ  . TYR D 1 120 ? -15.125 43.078  51.620  1.00 28.93 ? 163  TYR D CZ  1 
ATOM   8889  O  OH  . TYR D 1 120 ? -14.538 42.210  52.505  1.00 32.54 ? 163  TYR D OH  1 
ATOM   8890  N  N   . ARG D 1 121 ? -18.892 48.135  48.579  1.00 27.84 ? 164  ARG D N   1 
ATOM   8891  C  CA  . ARG D 1 121 ? -19.330 49.355  47.903  1.00 26.17 ? 164  ARG D CA  1 
ATOM   8892  C  C   . ARG D 1 121 ? -18.117 49.874  47.165  1.00 26.12 ? 164  ARG D C   1 
ATOM   8893  O  O   . ARG D 1 121 ? -17.010 49.843  47.699  1.00 26.14 ? 164  ARG D O   1 
ATOM   8894  C  CB  . ARG D 1 121 ? -19.793 50.392  48.914  1.00 24.87 ? 164  ARG D CB  1 
ATOM   8895  C  CG  . ARG D 1 121 ? -20.175 51.704  48.290  1.00 26.09 ? 164  ARG D CG  1 
ATOM   8896  C  CD  . ARG D 1 121 ? -20.626 52.694  49.340  1.00 27.85 ? 164  ARG D CD  1 
ATOM   8897  N  NE  . ARG D 1 121 ? -20.952 53.984  48.744  1.00 32.10 ? 164  ARG D NE  1 
ATOM   8898  C  CZ  . ARG D 1 121 ? -20.969 55.136  49.407  1.00 34.57 ? 164  ARG D CZ  1 
ATOM   8899  N  NH1 . ARG D 1 121 ? -20.676 55.170  50.701  1.00 35.31 ? 164  ARG D NH1 1 
ATOM   8900  N  NH2 . ARG D 1 121 ? -21.270 56.260  48.770  1.00 35.66 ? 164  ARG D NH2 1 
ATOM   8901  N  N   . CYS D 1 122 ? -18.321 50.353  45.942  1.00 25.44 ? 165  CYS D N   1 
ATOM   8902  C  CA  . CYS D 1 122 ? -17.205 50.830  45.134  1.00 24.41 ? 165  CYS D CA  1 
ATOM   8903  C  C   . CYS D 1 122 ? -17.344 52.240  44.598  1.00 25.25 ? 165  CYS D C   1 
ATOM   8904  O  O   . CYS D 1 122 ? -18.381 52.614  44.053  1.00 24.64 ? 165  CYS D O   1 
ATOM   8905  C  CB  . CYS D 1 122 ? -16.963 49.882  43.965  1.00 22.66 ? 165  CYS D CB  1 
ATOM   8906  S  SG  . CYS D 1 122 ? -15.300 50.011  43.328  1.00 20.35 ? 165  CYS D SG  1 
ATOM   8907  N  N   . ILE D 1 123 ? -16.274 53.014  44.748  1.00 25.84 ? 166  ILE D N   1 
ATOM   8908  C  CA  . ILE D 1 123 ? -16.251 54.390  44.290  1.00 26.67 ? 166  ILE D CA  1 
ATOM   8909  C  C   . ILE D 1 123 ? -14.976 54.652  43.501  1.00 28.76 ? 166  ILE D C   1 
ATOM   8910  O  O   . ILE D 1 123 ? -13.877 54.348  43.963  1.00 29.01 ? 166  ILE D O   1 
ATOM   8911  C  CB  . ILE D 1 123 ? -16.309 55.362  45.482  1.00 26.38 ? 166  ILE D CB  1 
ATOM   8912  C  CG1 . ILE D 1 123 ? -17.594 55.126  46.287  1.00 26.98 ? 166  ILE D CG1 1 
ATOM   8913  C  CG2 . ILE D 1 123 ? -16.234 56.792  44.981  1.00 27.22 ? 166  ILE D CG2 1 
ATOM   8914  C  CD1 . ILE D 1 123 ? -17.733 55.983  47.528  1.00 25.06 ? 166  ILE D CD1 1 
ATOM   8915  N  N   . ILE D 1 124 ? -15.130 55.195  42.299  1.00 30.43 ? 167  ILE D N   1 
ATOM   8916  C  CA  . ILE D 1 124 ? -13.991 55.524  41.446  1.00 32.15 ? 167  ILE D CA  1 
ATOM   8917  C  C   . ILE D 1 124 ? -13.942 57.036  41.211  1.00 34.77 ? 167  ILE D C   1 
ATOM   8918  O  O   . ILE D 1 124 ? -14.844 57.628  40.604  1.00 34.20 ? 167  ILE D O   1 
ATOM   8919  C  CB  . ILE D 1 124 ? -14.045 54.770  40.074  1.00 30.42 ? 167  ILE D CB  1 
ATOM   8920  C  CG1 . ILE D 1 124 ? -13.420 53.377  40.207  1.00 29.52 ? 167  ILE D CG1 1 
ATOM   8921  C  CG2 . ILE D 1 124 ? -13.285 55.536  39.010  1.00 30.97 ? 167  ILE D CG2 1 
ATOM   8922  C  CD1 . ILE D 1 124 ? -14.236 52.408  41.018  1.00 26.20 ? 167  ILE D CD1 1 
ATOM   8923  N  N   . VAL D 1 125 ? -12.878 57.652  41.717  1.00 37.50 ? 168  VAL D N   1 
ATOM   8924  C  CA  . VAL D 1 125 ? -12.669 59.092  41.587  1.00 39.85 ? 168  VAL D CA  1 
ATOM   8925  C  C   . VAL D 1 125 ? -11.844 59.358  40.317  1.00 41.78 ? 168  VAL D C   1 
ATOM   8926  O  O   . VAL D 1 125 ? -10.618 59.247  40.318  1.00 42.24 ? 168  VAL D O   1 
ATOM   8927  C  CB  . VAL D 1 125 ? -11.948 59.647  42.858  1.00 38.85 ? 168  VAL D CB  1 
ATOM   8928  C  CG1 . VAL D 1 125 ? -11.629 61.123  42.680  1.00 41.43 ? 168  VAL D CG1 1 
ATOM   8929  C  CG2 . VAL D 1 125 ? -12.837 59.453  44.093  1.00 36.37 ? 168  VAL D CG2 1 
ATOM   8930  N  N   . MET D 1 126 ? -12.527 59.709  39.232  1.00 43.38 ? 169  MET D N   1 
ATOM   8931  C  CA  . MET D 1 126 ? -11.845 59.941  37.963  1.00 45.58 ? 169  MET D CA  1 
ATOM   8932  C  C   . MET D 1 126 ? -11.967 61.347  37.393  1.00 46.58 ? 169  MET D C   1 
ATOM   8933  O  O   . MET D 1 126 ? -12.948 62.047  37.617  1.00 46.99 ? 169  MET D O   1 
ATOM   8934  C  CB  . MET D 1 126 ? -12.355 58.915  36.936  1.00 46.60 ? 169  MET D CB  1 
ATOM   8935  C  CG  . MET D 1 126 ? -13.859 58.912  36.750  1.00 44.64 ? 169  MET D CG  1 
ATOM   8936  S  SD  . MET D 1 126 ? -14.366 58.250  35.152  1.00 41.52 ? 169  MET D SD  1 
ATOM   8937  C  CE  . MET D 1 126 ? -15.370 59.603  34.550  1.00 39.19 ? 169  MET D CE  1 
ATOM   8938  N  N   . PRO D 1 127 ? -10.929 61.744  36.634  1.00 47.72 ? 170  PRO D N   1 
ATOM   8939  C  CA  . PRO D 1 127 ? -10.976 63.036  35.974  1.00 47.85 ? 170  PRO D CA  1 
ATOM   8940  C  C   . PRO D 1 127 ? -12.299 63.248  35.198  1.00 48.88 ? 170  PRO D C   1 
ATOM   8941  O  O   . PRO D 1 127 ? -13.277 62.556  35.486  1.00 48.77 ? 170  PRO D O   1 
ATOM   8942  C  CB  . PRO D 1 127 ? -9.625  63.122  35.292  1.00 48.32 ? 170  PRO D CB  1 
ATOM   8943  C  CG  . PRO D 1 127 ? -8.710  62.469  36.281  1.00 48.20 ? 170  PRO D CG  1 
ATOM   8944  C  CD  . PRO D 1 127 ? -9.536  61.502  37.105  1.00 47.89 ? 170  PRO D CD  1 
ATOM   8945  N  N   . GLU D 1 128 ? -12.351 64.166  34.228  1.00 49.76 ? 171  GLU D N   1 
ATOM   8946  C  CA  . GLU D 1 128 ? -13.575 64.362  33.467  1.00 50.22 ? 171  GLU D CA  1 
ATOM   8947  C  C   . GLU D 1 128 ? -13.484 63.805  32.029  1.00 49.71 ? 171  GLU D C   1 
ATOM   8948  O  O   . GLU D 1 128 ? -14.314 64.186  31.212  1.00 47.88 ? 171  GLU D O   1 
ATOM   8949  C  CB  . GLU D 1 128 ? -13.972 65.856  33.399  1.00 50.72 ? 171  GLU D CB  1 
ATOM   8950  C  CG  . GLU D 1 128 ? -14.005 66.622  34.724  1.00 50.66 ? 171  GLU D CG  1 
ATOM   8951  C  CD  . GLU D 1 128 ? -15.327 66.511  35.472  1.00 51.00 ? 171  GLU D CD  1 
ATOM   8952  O  OE1 . GLU D 1 128 ? -15.511 65.489  36.175  1.00 50.44 ? 171  GLU D OE1 1 
ATOM   8953  O  OE2 . GLU D 1 128 ? -16.155 67.418  35.348  1.00 50.15 ? 171  GLU D OE2 1 
ATOM   8954  N  N   . LYS D 1 129 ? -12.526 62.930  31.688  1.00 50.16 ? 172  LYS D N   1 
ATOM   8955  C  CA  . LYS D 1 129 ? -12.431 62.554  30.240  1.00 49.63 ? 172  LYS D CA  1 
ATOM   8956  C  C   . LYS D 1 129 ? -12.746 61.117  29.859  1.00 48.70 ? 172  LYS D C   1 
ATOM   8957  O  O   . LYS D 1 129 ? -13.566 60.879  28.964  1.00 47.99 ? 172  LYS D O   1 
ATOM   8958  C  CB  . LYS D 1 129 ? -11.028 62.895  29.732  1.00 49.88 ? 172  LYS D CB  1 
ATOM   8959  C  CG  . LYS D 1 129 ? -10.538 64.245  30.226  1.00 50.16 ? 172  LYS D CG  1 
ATOM   8960  C  CD  . LYS D 1 129 ? -11.564 64.936  31.116  1.00 49.21 ? 172  LYS D CD  1 
ATOM   8961  C  CE  . LYS D 1 129 ? -11.462 66.438  30.990  1.00 49.51 ? 172  LYS D CE  1 
ATOM   8962  N  NZ  . LYS D 1 129 ? -12.425 66.978  29.995  1.00 47.96 ? 172  LYS D NZ  1 
ATOM   8963  N  N   . MET D 1 130 ? -12.098 60.161  30.511  1.00 48.06 ? 173  MET D N   1 
ATOM   8964  C  CA  . MET D 1 130 ? -12.368 58.795  30.150  1.00 47.32 ? 173  MET D CA  1 
ATOM   8965  C  C   . MET D 1 130 ? -13.366 58.758  29.006  1.00 45.60 ? 173  MET D C   1 
ATOM   8966  O  O   . MET D 1 130 ? -14.075 59.736  28.736  1.00 45.58 ? 173  MET D O   1 
ATOM   8967  C  CB  . MET D 1 130 ? -12.934 58.019  31.341  1.00 49.32 ? 173  MET D CB  1 
ATOM   8968  C  CG  . MET D 1 130 ? -12.101 56.840  31.819  1.00 51.03 ? 173  MET D CG  1 
ATOM   8969  S  SD  . MET D 1 130 ? -10.400 56.923  31.201  1.00 55.10 ? 173  MET D SD  1 
ATOM   8970  C  CE  . MET D 1 130 ? -10.681 57.238  29.459  1.00 53.51 ? 173  MET D CE  1 
ATOM   8971  N  N   . SER D 1 131 ? -13.426 57.625  28.328  1.00 43.48 ? 174  SER D N   1 
ATOM   8972  C  CA  . SER D 1 131 ? -14.380 57.264  27.253  1.00 41.52 ? 174  SER D CA  1 
ATOM   8973  C  C   . SER D 1 131 ? -15.623 56.600  27.853  1.00 39.98 ? 174  SER D C   1 
ATOM   8974  O  O   . SER D 1 131 ? -15.550 56.065  28.960  1.00 39.27 ? 174  SER D O   1 
ATOM   8975  C  CB  . SER D 1 131 ? -13.733 56.273  26.288  1.00 41.42 ? 174  SER D CB  1 
ATOM   8976  O  OG  . SER D 1 131 ? -13.481 55.031  26.933  1.00 41.12 ? 174  SER D OG  1 
ATOM   8977  N  N   . SER D 1 132 ? -16.745 56.641  27.164  1.00 38.78 ? 175  SER D N   1 
ATOM   8978  C  CA  . SER D 1 132 ? -18.010 56.080  27.660  1.00 37.47 ? 175  SER D CA  1 
ATOM   8979  C  C   . SER D 1 132 ? -17.902 54.602  27.924  1.00 36.55 ? 175  SER D C   1 
ATOM   8980  O  O   . SER D 1 132 ? -18.294 54.090  28.987  1.00 35.16 ? 175  SER D O   1 
ATOM   8981  C  CB  . SER D 1 132 ? -19.146 56.405  26.691  1.00 37.68 ? 175  SER D CB  1 
ATOM   8982  O  OG  . SER D 1 132 ? -20.080 55.344  26.613  1.00 38.60 ? 175  SER D OG  1 
ATOM   8983  N  N   . GLU D 1 133 ? -17.365 53.924  26.941  1.00 35.29 ? 176  GLU D N   1 
ATOM   8984  C  CA  . GLU D 1 133 ? -17.264 52.482  27.048  1.00 33.64 ? 176  GLU D CA  1 
ATOM   8985  C  C   . GLU D 1 133 ? -16.516 52.122  28.315  1.00 32.08 ? 176  GLU D C   1 
ATOM   8986  O  O   . GLU D 1 133 ? -16.554 50.976  28.760  1.00 30.98 ? 176  GLU D O   1 
ATOM   8987  C  CB  . GLU D 1 133 ? -16.778 51.915  25.706  1.00 33.68 ? 176  GLU D CB  1 
ATOM   8988  C  CG  . GLU D 1 133 ? -17.925 51.510  24.754  1.00 33.59 ? 176  GLU D CG  1 
ATOM   8989  C  CD  . GLU D 1 133 ? -18.518 52.628  23.903  1.00 32.75 ? 176  GLU D CD  1 
ATOM   8990  O  OE1 . GLU D 1 133 ? -18.085 52.792  22.757  1.00 30.35 ? 176  GLU D OE1 1 
ATOM   8991  O  OE2 . GLU D 1 133 ? -19.426 53.346  24.398  1.00 31.13 ? 176  GLU D OE2 1 
ATOM   8992  N  N   . LYS D 1 134 ? -15.865 53.077  28.951  1.00 31.81 ? 177  LYS D N   1 
ATOM   8993  C  CA  . LYS D 1 134 ? -15.286 52.715  30.209  1.00 31.10 ? 177  LYS D CA  1 
ATOM   8994  C  C   . LYS D 1 134 ? -16.351 52.863  31.299  1.00 29.99 ? 177  LYS D C   1 
ATOM   8995  O  O   . LYS D 1 134 ? -16.744 51.889  31.936  1.00 30.10 ? 177  LYS D O   1 
ATOM   8996  C  CB  . LYS D 1 134 ? -14.058 53.586  30.528  1.00 30.12 ? 177  LYS D CB  1 
ATOM   8997  C  CG  . LYS D 1 134 ? -12.837 53.291  29.651  1.00 30.35 ? 177  LYS D CG  1 
ATOM   8998  C  CD  . LYS D 1 134 ? -11.559 53.438  30.467  1.00 31.52 ? 177  LYS D CD  1 
ATOM   8999  C  CE  . LYS D 1 134 ? -10.321 53.430  29.567  1.00 32.92 ? 177  LYS D CE  1 
ATOM   9000  N  NZ  . LYS D 1 134 ? -10.441 54.393  28.437  1.00 33.27 ? 177  LYS D NZ  1 
ATOM   9001  N  N   . VAL D 1 135 ? -16.815 54.136  31.481  1.00 28.41 ? 178  VAL D N   1 
ATOM   9002  C  CA  . VAL D 1 135 ? -17.729 54.640  32.584  1.00 26.52 ? 178  VAL D CA  1 
ATOM   9003  C  C   . VAL D 1 135 ? -18.945 53.722  32.635  1.00 26.28 ? 178  VAL D C   1 
ATOM   9004  O  O   . VAL D 1 135 ? -19.481 53.408  33.685  1.00 24.13 ? 178  VAL D O   1 
ATOM   9005  C  CB  . VAL D 1 135 ? -18.191 56.070  32.200  1.00 25.29 ? 178  VAL D CB  1 
ATOM   9006  C  CG1 . VAL D 1 135 ? -18.923 56.726  33.371  1.00 23.84 ? 178  VAL D CG1 1 
ATOM   9007  C  CG2 . VAL D 1 135 ? -17.002 56.918  31.781  1.00 22.96 ? 178  VAL D CG2 1 
ATOM   9008  N  N   . ASP D 1 136 ? -19.367 53.295  31.452  1.00 27.64 ? 179  ASP D N   1 
ATOM   9009  C  CA  . ASP D 1 136 ? -20.501 52.387  31.336  1.00 28.82 ? 179  ASP D CA  1 
ATOM   9010  C  C   . ASP D 1 136 ? -20.174 51.001  31.887  1.00 28.73 ? 179  ASP D C   1 
ATOM   9011  O  O   . ASP D 1 136 ? -21.070 50.187  32.105  1.00 27.48 ? 179  ASP D O   1 
ATOM   9012  C  CB  . ASP D 1 136 ? -20.935 52.260  29.870  1.00 28.79 ? 179  ASP D CB  1 
ATOM   9013  C  CG  . ASP D 1 136 ? -21.694 53.477  29.378  1.00 29.42 ? 179  ASP D CG  1 
ATOM   9014  O  OD1 . ASP D 1 136 ? -22.770 53.782  29.941  1.00 27.63 ? 179  ASP D OD1 1 
ATOM   9015  O  OD2 . ASP D 1 136 ? -21.215 54.124  28.424  1.00 29.10 ? 179  ASP D OD2 1 
ATOM   9016  N  N   . VAL D 1 137 ? -18.888 50.742  32.099  1.00 28.06 ? 180  VAL D N   1 
ATOM   9017  C  CA  . VAL D 1 137 ? -18.433 49.463  32.626  1.00 26.47 ? 180  VAL D CA  1 
ATOM   9018  C  C   . VAL D 1 137 ? -18.775 49.370  34.106  1.00 25.77 ? 180  VAL D C   1 
ATOM   9019  O  O   . VAL D 1 137 ? -19.551 48.519  34.542  1.00 24.18 ? 180  VAL D O   1 
ATOM   9020  C  CB  . VAL D 1 137 ? -16.911 49.322  32.489  1.00 26.71 ? 180  VAL D CB  1 
ATOM   9021  C  CG1 . VAL D 1 137 ? -16.438 47.993  33.065  1.00 27.51 ? 180  VAL D CG1 1 
ATOM   9022  C  CG2 . VAL D 1 137 ? -16.495 49.458  31.043  1.00 26.77 ? 180  VAL D CG2 1 
ATOM   9023  N  N   . LEU D 1 138 ? -18.172 50.271  34.871  1.00 26.42 ? 181  LEU D N   1 
ATOM   9024  C  CA  . LEU D 1 138 ? -18.376 50.341  36.307  1.00 25.77 ? 181  LEU D CA  1 
ATOM   9025  C  C   . LEU D 1 138 ? -19.853 50.579  36.641  1.00 26.30 ? 181  LEU D C   1 
ATOM   9026  O  O   . LEU D 1 138 ? -20.384 49.981  37.576  1.00 26.86 ? 181  LEU D O   1 
ATOM   9027  C  CB  . LEU D 1 138 ? -17.520 51.469  36.866  1.00 23.83 ? 181  LEU D CB  1 
ATOM   9028  C  CG  . LEU D 1 138 ? -16.093 51.447  36.346  1.00 21.25 ? 181  LEU D CG  1 
ATOM   9029  C  CD1 . LEU D 1 138 ? -15.597 52.849  36.233  1.00 18.09 ? 181  LEU D CD1 1 
ATOM   9030  C  CD2 . LEU D 1 138 ? -15.224 50.601  37.259  1.00 21.47 ? 181  LEU D CD2 1 
ATOM   9031  N  N   . ARG D 1 139 ? -20.514 51.451  35.885  1.00 26.15 ? 182  ARG D N   1 
ATOM   9032  C  CA  . ARG D 1 139 ? -21.923 51.725  36.138  1.00 27.90 ? 182  ARG D CA  1 
ATOM   9033  C  C   . ARG D 1 139 ? -22.710 50.420  36.125  1.00 29.41 ? 182  ARG D C   1 
ATOM   9034  O  O   . ARG D 1 139 ? -23.753 50.306  36.761  1.00 30.00 ? 182  ARG D O   1 
ATOM   9035  C  CB  . ARG D 1 139 ? -22.496 52.664  35.078  1.00 28.40 ? 182  ARG D CB  1 
ATOM   9036  C  CG  . ARG D 1 139 ? -21.833 54.030  35.003  1.00 29.01 ? 182  ARG D CG  1 
ATOM   9037  C  CD  . ARG D 1 139 ? -22.582 54.922  34.022  1.00 29.05 ? 182  ARG D CD  1 
ATOM   9038  N  NE  . ARG D 1 139 ? -23.910 55.277  34.520  1.00 27.84 ? 182  ARG D NE  1 
ATOM   9039  C  CZ  . ARG D 1 139 ? -24.127 56.196  35.451  1.00 27.97 ? 182  ARG D CZ  1 
ATOM   9040  N  NH1 . ARG D 1 139 ? -23.105 56.859  35.977  1.00 27.30 ? 182  ARG D NH1 1 
ATOM   9041  N  NH2 . ARG D 1 139 ? -25.362 56.445  35.865  1.00 27.42 ? 182  ARG D NH2 1 
ATOM   9042  N  N   . ALA D 1 140 ? -22.197 49.436  35.390  1.00 30.86 ? 183  ALA D N   1 
ATOM   9043  C  CA  . ALA D 1 140 ? -22.837 48.130  35.283  1.00 30.91 ? 183  ALA D CA  1 
ATOM   9044  C  C   . ALA D 1 140 ? -22.420 47.228  36.437  1.00 32.32 ? 183  ALA D C   1 
ATOM   9045  O  O   . ALA D 1 140 ? -23.117 46.275  36.761  1.00 33.82 ? 183  ALA D O   1 
ATOM   9046  C  CB  . ALA D 1 140 ? -22.479 47.481  33.959  1.00 29.36 ? 183  ALA D CB  1 
ATOM   9047  N  N   . LEU D 1 141 ? -21.282 47.523  37.056  1.00 32.65 ? 184  LEU D N   1 
ATOM   9048  C  CA  . LEU D 1 141 ? -20.810 46.728  38.184  1.00 32.60 ? 184  LEU D CA  1 
ATOM   9049  C  C   . LEU D 1 141 ? -21.212 47.359  39.528  1.00 32.40 ? 184  LEU D C   1 
ATOM   9050  O  O   . LEU D 1 141 ? -20.702 46.976  40.590  1.00 32.19 ? 184  LEU D O   1 
ATOM   9051  C  CB  . LEU D 1 141 ? -19.294 46.573  38.115  1.00 33.02 ? 184  LEU D CB  1 
ATOM   9052  C  CG  . LEU D 1 141 ? -18.722 45.980  36.826  1.00 35.21 ? 184  LEU D CG  1 
ATOM   9053  C  CD1 . LEU D 1 141 ? -17.218 45.811  37.005  1.00 36.13 ? 184  LEU D CD1 1 
ATOM   9054  C  CD2 . LEU D 1 141 ? -19.370 44.637  36.503  1.00 35.33 ? 184  LEU D CD2 1 
ATOM   9055  N  N   . GLY D 1 142 ? -22.118 48.335  39.470  1.00 31.46 ? 185  GLY D N   1 
ATOM   9056  C  CA  . GLY D 1 142 ? -22.594 48.988  40.676  1.00 30.27 ? 185  GLY D CA  1 
ATOM   9057  C  C   . GLY D 1 142 ? -21.634 49.968  41.318  1.00 29.05 ? 185  GLY D C   1 
ATOM   9058  O  O   . GLY D 1 142 ? -21.958 50.597  42.330  1.00 26.97 ? 185  GLY D O   1 
ATOM   9059  N  N   . ALA D 1 143 ? -20.447 50.093  40.737  1.00 28.51 ? 186  ALA D N   1 
ATOM   9060  C  CA  . ALA D 1 143 ? -19.448 51.018  41.255  1.00 29.25 ? 186  ALA D CA  1 
ATOM   9061  C  C   . ALA D 1 143 ? -19.831 52.452  40.874  1.00 29.13 ? 186  ALA D C   1 
ATOM   9062  O  O   . ALA D 1 143 ? -20.205 52.721  39.728  1.00 28.64 ? 186  ALA D O   1 
ATOM   9063  C  CB  . ALA D 1 143 ? -18.088 50.671  40.694  1.00 28.55 ? 186  ALA D CB  1 
ATOM   9064  N  N   . GLU D 1 144 ? -19.750 53.369  41.833  1.00 28.28 ? 187  GLU D N   1 
ATOM   9065  C  CA  . GLU D 1 144 ? -20.102 54.752  41.560  1.00 27.98 ? 187  GLU D CA  1 
ATOM   9066  C  C   . GLU D 1 144 ? -18.867 55.570  41.211  1.00 27.72 ? 187  GLU D C   1 
ATOM   9067  O  O   . GLU D 1 144 ? -17.796 55.357  41.779  1.00 26.21 ? 187  GLU D O   1 
ATOM   9068  C  CB  . GLU D 1 144 ? -20.809 55.354  42.765  1.00 28.04 ? 187  GLU D CB  1 
ATOM   9069  C  CG  . GLU D 1 144 ? -22.015 54.571  43.200  1.00 27.60 ? 187  GLU D CG  1 
ATOM   9070  C  CD  . GLU D 1 144 ? -22.008 54.326  44.689  1.00 30.00 ? 187  GLU D CD  1 
ATOM   9071  O  OE1 . GLU D 1 144 ? -22.070 55.314  45.454  1.00 33.38 ? 187  GLU D OE1 1 
ATOM   9072  O  OE2 . GLU D 1 144 ? -21.929 53.147  45.102  1.00 30.95 ? 187  GLU D OE2 1 
ATOM   9073  N  N   . ILE D 1 145 ? -19.037 56.509  40.280  1.00 27.93 ? 188  ILE D N   1 
ATOM   9074  C  CA  . ILE D 1 145 ? -17.957 57.376  39.797  1.00 29.28 ? 188  ILE D CA  1 
ATOM   9075  C  C   . ILE D 1 145 ? -18.051 58.849  40.254  1.00 29.98 ? 188  ILE D C   1 
ATOM   9076  O  O   . ILE D 1 145 ? -19.121 59.460  40.224  1.00 28.84 ? 188  ILE D O   1 
ATOM   9077  C  CB  . ILE D 1 145 ? -17.894 57.316  38.239  1.00 27.79 ? 188  ILE D CB  1 
ATOM   9078  C  CG1 . ILE D 1 145 ? -16.696 56.483  37.802  1.00 26.35 ? 188  ILE D CG1 1 
ATOM   9079  C  CG2 . ILE D 1 145 ? -17.835 58.705  37.644  1.00 28.97 ? 188  ILE D CG2 1 
ATOM   9080  C  CD1 . ILE D 1 145 ? -16.644 56.260  36.324  1.00 26.27 ? 188  ILE D CD1 1 
ATOM   9081  N  N   . VAL D 1 146 ? -16.919 59.413  40.667  1.00 31.52 ? 189  VAL D N   1 
ATOM   9082  C  CA  . VAL D 1 146 ? -16.892 60.804  41.113  1.00 33.93 ? 189  VAL D CA  1 
ATOM   9083  C  C   . VAL D 1 146 ? -16.252 61.731  40.074  1.00 35.36 ? 189  VAL D C   1 
ATOM   9084  O  O   . VAL D 1 146 ? -15.225 61.405  39.472  1.00 35.61 ? 189  VAL D O   1 
ATOM   9085  C  CB  . VAL D 1 146 ? -16.135 60.949  42.463  1.00 33.37 ? 189  VAL D CB  1 
ATOM   9086  C  CG1 . VAL D 1 146 ? -16.195 62.388  42.938  1.00 32.59 ? 189  VAL D CG1 1 
ATOM   9087  C  CG2 . VAL D 1 146 ? -16.740 60.024  43.509  1.00 31.41 ? 189  VAL D CG2 1 
ATOM   9088  N  N   . ARG D 1 147 ? -16.882 62.881  39.862  1.00 37.87 ? 190  ARG D N   1 
ATOM   9089  C  CA  . ARG D 1 147 ? -16.401 63.875  38.907  1.00 40.91 ? 190  ARG D CA  1 
ATOM   9090  C  C   . ARG D 1 147 ? -15.212 64.522  39.549  1.00 41.47 ? 190  ARG D C   1 
ATOM   9091  O  O   . ARG D 1 147 ? -15.363 65.062  40.636  1.00 41.87 ? 190  ARG D O   1 
ATOM   9092  C  CB  . ARG D 1 147 ? -17.467 64.954  38.678  1.00 42.08 ? 190  ARG D CB  1 
ATOM   9093  C  CG  . ARG D 1 147 ? -18.586 64.541  37.737  1.00 42.83 ? 190  ARG D CG  1 
ATOM   9094  C  CD  . ARG D 1 147 ? -18.257 64.920  36.306  1.00 42.68 ? 190  ARG D CD  1 
ATOM   9095  N  NE  . ARG D 1 147 ? -18.754 63.956  35.328  1.00 44.89 ? 190  ARG D NE  1 
ATOM   9096  C  CZ  . ARG D 1 147 ? -18.392 62.675  35.280  1.00 45.92 ? 190  ARG D CZ  1 
ATOM   9097  N  NH1 . ARG D 1 147 ? -17.532 62.190  36.167  1.00 46.61 ? 190  ARG D NH1 1 
ATOM   9098  N  NH2 . ARG D 1 147 ? -18.860 61.885  34.319  1.00 45.52 ? 190  ARG D NH2 1 
ATOM   9099  N  N   . THR D 1 148 ? -14.045 64.490  38.877  1.00 42.57 ? 191  THR D N   1 
ATOM   9100  C  CA  . THR D 1 148 ? -12.852 65.081  39.471  1.00 44.48 ? 191  THR D CA  1 
ATOM   9101  C  C   . THR D 1 148 ? -12.836 66.583  39.357  1.00 44.18 ? 191  THR D C   1 
ATOM   9102  O  O   . THR D 1 148 ? -12.562 67.149  38.292  1.00 43.98 ? 191  THR D O   1 
ATOM   9103  C  CB  . THR D 1 148 ? -11.553 64.514  38.861  1.00 44.32 ? 191  THR D CB  1 
ATOM   9104  O  OG1 . THR D 1 148 ? -11.189 63.310  39.552  1.00 43.99 ? 191  THR D OG1 1 
ATOM   9105  C  CG2 . THR D 1 148 ? -10.425 65.532  38.983  1.00 42.05 ? 191  THR D CG2 1 
ATOM   9106  N  N   . PRO D 1 149 ? -13.153 67.218  40.499  1.00 46.15 ? 192  PRO D N   1 
ATOM   9107  C  CA  . PRO D 1 149 ? -13.026 68.670  40.452  1.00 47.80 ? 192  PRO D CA  1 
ATOM   9108  C  C   . PRO D 1 149 ? -11.637 68.955  39.955  1.00 47.42 ? 192  PRO D C   1 
ATOM   9109  O  O   . PRO D 1 149 ? -10.694 68.607  40.657  1.00 47.72 ? 192  PRO D O   1 
ATOM   9110  C  CB  . PRO D 1 149 ? -13.488 69.083  41.841  1.00 47.04 ? 192  PRO D CB  1 
ATOM   9111  C  CG  . PRO D 1 149 ? -14.612 68.122  42.116  1.00 46.30 ? 192  PRO D CG  1 
ATOM   9112  C  CD  . PRO D 1 149 ? -14.388 66.914  41.245  1.00 46.91 ? 192  PRO D CD  1 
ATOM   9113  N  N   . THR D 1 150 ? -11.395 69.534  38.817  1.00 47.81 ? 193  THR D N   1 
ATOM   9114  C  CA  . THR D 1 150 ? -10.023 69.765  38.460  1.00 46.02 ? 193  THR D CA  1 
ATOM   9115  C  C   . THR D 1 150 ? -9.175  68.575  38.880  1.00 45.53 ? 193  THR D C   1 
ATOM   9116  O  O   . THR D 1 150 ? -8.234  68.180  38.188  1.00 45.89 ? 193  THR D O   1 
ATOM   9117  C  CB  . THR D 1 150 ? -9.545  71.031  39.151  1.00 45.21 ? 193  THR D CB  1 
ATOM   9118  O  OG1 . THR D 1 150 ? -10.572 72.022  39.050  1.00 44.10 ? 193  THR D OG1 1 
ATOM   9119  C  CG2 . THR D 1 150 ? -8.256  71.534  38.523  1.00 43.04 ? 193  THR D CG2 1 
ATOM   9120  N  N   . GLU D 1 158 ? -8.766  68.542  42.779  1.00 43.60 ? 201  GLU D N   1 
ATOM   9121  C  CA  . GLU D 1 158 ? -7.359  68.868  42.937  1.00 44.04 ? 201  GLU D CA  1 
ATOM   9122  C  C   . GLU D 1 158 ? -6.503  67.600  43.065  1.00 45.07 ? 201  GLU D C   1 
ATOM   9123  O  O   . GLU D 1 158 ? -6.138  67.129  44.157  1.00 46.01 ? 201  GLU D O   1 
ATOM   9124  C  CB  . GLU D 1 158 ? -7.158  69.808  44.124  1.00 43.54 ? 201  GLU D CB  1 
ATOM   9125  C  CG  . GLU D 1 158 ? -7.216  69.129  45.472  1.00 43.60 ? 201  GLU D CG  1 
ATOM   9126  C  CD  . GLU D 1 158 ? -5.959  68.365  45.809  1.00 44.75 ? 201  GLU D CD  1 
ATOM   9127  O  OE1 . GLU D 1 158 ? -4.845  68.927  45.628  1.00 46.42 ? 201  GLU D OE1 1 
ATOM   9128  O  OE2 . GLU D 1 158 ? -6.072  67.205  46.260  1.00 44.81 ? 201  GLU D OE2 1 
ATOM   9129  N  N   . SER D 1 159 ? -6.208  67.086  41.856  1.00 45.78 ? 202  SER D N   1 
ATOM   9130  C  CA  . SER D 1 159 ? -5.369  65.904  41.549  1.00 45.45 ? 202  SER D CA  1 
ATOM   9131  C  C   . SER D 1 159 ? -6.128  64.566  41.476  1.00 45.24 ? 202  SER D C   1 
ATOM   9132  O  O   . SER D 1 159 ? -5.484  63.521  41.311  1.00 45.00 ? 202  SER D O   1 
ATOM   9133  C  CB  . SER D 1 159 ? -4.202  65.803  42.539  1.00 45.24 ? 202  SER D CB  1 
ATOM   9134  O  OG  . SER D 1 159 ? -2.985  66.201  41.936  1.00 45.09 ? 202  SER D OG  1 
ATOM   9135  N  N   . HIS D 1 160 ? -7.442  64.535  41.598  1.00 45.65 ? 203  HIS D N   1 
ATOM   9136  C  CA  . HIS D 1 160 ? -8.121  63.224  41.437  1.00 45.50 ? 203  HIS D CA  1 
ATOM   9137  C  C   . HIS D 1 160 ? -7.444  62.028  42.131  1.00 44.71 ? 203  HIS D C   1 
ATOM   9138  O  O   . HIS D 1 160 ? -7.479  60.902  41.642  1.00 43.83 ? 203  HIS D O   1 
ATOM   9139  C  CB  . HIS D 1 160 ? -8.053  62.755  40.008  1.00 45.73 ? 203  HIS D CB  1 
ATOM   9140  C  CG  . HIS D 1 160 ? -6.792  61.843  39.986  1.00 46.11 ? 203  HIS D CG  1 
ATOM   9141  N  ND1 . HIS D 1 160 ? -5.597  62.308  40.510  1.00 46.10 ? 203  HIS D ND1 1 
ATOM   9142  C  CD2 . HIS D 1 160 ? -6.536  60.589  39.538  1.00 45.90 ? 203  HIS D CD2 1 
ATOM   9143  C  CE1 . HIS D 1 160 ? -4.692  61.359  40.432  1.00 46.40 ? 203  HIS D CE1 1 
ATOM   9144  N  NE2 . HIS D 1 160 ? -5.230  60.296  39.844  1.00 46.49 ? 203  HIS D NE2 1 
ATOM   9145  N  N   . VAL D 1 161 ? -6.830  62.318  43.233  1.00 44.27 ? 204  VAL D N   1 
ATOM   9146  C  CA  . VAL D 1 161 ? -6.174  61.390  44.167  1.00 43.63 ? 204  VAL D CA  1 
ATOM   9147  C  C   . VAL D 1 161 ? -6.147  62.365  45.322  1.00 43.54 ? 204  VAL D C   1 
ATOM   9148  O  O   . VAL D 1 161 ? -5.611  63.456  45.165  1.00 43.89 ? 204  VAL D O   1 
ATOM   9149  C  CB  . VAL D 1 161 ? -4.758  60.951  43.750  1.00 43.58 ? 204  VAL D CB  1 
ATOM   9150  C  CG1 . VAL D 1 161 ? -4.492  61.293  42.295  1.00 41.15 ? 204  VAL D CG1 1 
ATOM   9151  C  CG2 . VAL D 1 161 ? -3.714  61.588  44.647  1.00 43.24 ? 204  VAL D CG2 1 
ATOM   9152  N  N   . GLY D 1 162 ? -6.722  62.056  46.450  1.00 43.71 ? 205  GLY D N   1 
ATOM   9153  C  CA  . GLY D 1 162 ? -6.813  63.126  47.392  1.00 43.20 ? 205  GLY D CA  1 
ATOM   9154  C  C   . GLY D 1 162 ? -8.210  63.651  47.145  1.00 43.14 ? 205  GLY D C   1 
ATOM   9155  O  O   . GLY D 1 162 ? -8.974  63.757  48.094  1.00 43.01 ? 205  GLY D O   1 
ATOM   9156  N  N   . VAL D 1 163 ? -8.589  64.005  45.903  1.00 43.15 ? 206  VAL D N   1 
ATOM   9157  C  CA  . VAL D 1 163 ? -9.992  64.253  45.882  1.00 44.49 ? 206  VAL D CA  1 
ATOM   9158  C  C   . VAL D 1 163 ? -10.403 62.881  46.416  1.00 45.90 ? 206  VAL D C   1 
ATOM   9159  O  O   . VAL D 1 163 ? -11.480 62.694  46.969  1.00 45.44 ? 206  VAL D O   1 
ATOM   9160  C  CB  . VAL D 1 163 ? -10.653 64.534  44.523  1.00 43.65 ? 206  VAL D CB  1 
ATOM   9161  C  CG1 . VAL D 1 163 ? -12.161 64.463  44.638  1.00 43.22 ? 206  VAL D CG1 1 
ATOM   9162  C  CG2 . VAL D 1 163 ? -10.224 65.903  44.014  1.00 42.34 ? 206  VAL D CG2 1 
ATOM   9163  N  N   . ALA D 1 164 ? -9.493  61.896  46.242  1.00 46.78 ? 207  ALA D N   1 
ATOM   9164  C  CA  . ALA D 1 164 ? -9.733  60.544  46.730  1.00 48.01 ? 207  ALA D CA  1 
ATOM   9165  C  C   . ALA D 1 164 ? -9.270  60.413  48.177  1.00 49.30 ? 207  ALA D C   1 
ATOM   9166  O  O   . ALA D 1 164 ? -9.820  59.617  48.942  1.00 49.37 ? 207  ALA D O   1 
ATOM   9167  C  CB  . ALA D 1 164 ? -9.039  59.507  45.857  1.00 47.55 ? 207  ALA D CB  1 
ATOM   9168  N  N   . TRP D 1 165 ? -8.253  61.187  48.551  1.00 50.57 ? 208  TRP D N   1 
ATOM   9169  C  CA  . TRP D 1 165 ? -7.753  61.158  49.923  1.00 52.42 ? 208  TRP D CA  1 
ATOM   9170  C  C   . TRP D 1 165 ? -8.725  61.883  50.867  1.00 50.99 ? 208  TRP D C   1 
ATOM   9171  O  O   . TRP D 1 165 ? -8.719  61.638  52.072  1.00 50.75 ? 208  TRP D O   1 
ATOM   9172  C  CB  . TRP D 1 165 ? -6.367  61.815  50.028  1.00 56.29 ? 208  TRP D CB  1 
ATOM   9173  C  CG  . TRP D 1 165 ? -5.198  61.000  49.499  1.00 61.07 ? 208  TRP D CG  1 
ATOM   9174  C  CD1 . TRP D 1 165 ? -5.203  59.677  49.135  1.00 62.33 ? 208  TRP D CD1 1 
ATOM   9175  C  CD2 . TRP D 1 165 ? -3.846  61.463  49.303  1.00 63.10 ? 208  TRP D CD2 1 
ATOM   9176  N  NE1 . TRP D 1 165 ? -3.943  59.293  48.727  1.00 62.97 ? 208  TRP D NE1 1 
ATOM   9177  C  CE2 . TRP D 1 165 ? -3.093  60.367  48.820  1.00 63.08 ? 208  TRP D CE2 1 
ATOM   9178  C  CE3 . TRP D 1 165 ? -3.200  62.697  49.489  1.00 63.58 ? 208  TRP D CE3 1 
ATOM   9179  C  CZ2 . TRP D 1 165 ? -1.727  60.470  48.522  1.00 63.05 ? 208  TRP D CZ2 1 
ATOM   9180  C  CZ3 . TRP D 1 165 ? -1.841  62.795  49.192  1.00 63.27 ? 208  TRP D CZ3 1 
ATOM   9181  C  CH2 . TRP D 1 165 ? -1.123  61.688  48.715  1.00 63.44 ? 208  TRP D CH2 1 
ATOM   9182  N  N   . ARG D 1 166 ? -9.557  62.771  50.324  1.00 48.84 ? 209  ARG D N   1 
ATOM   9183  C  CA  . ARG D 1 166 ? -10.515 63.509  51.149  1.00 46.79 ? 209  ARG D CA  1 
ATOM   9184  C  C   . ARG D 1 166 ? -11.881 62.821  51.235  1.00 45.96 ? 209  ARG D C   1 
ATOM   9185  O  O   . ARG D 1 166 ? -12.694 63.137  52.108  1.00 45.85 ? 209  ARG D O   1 
ATOM   9186  C  CB  . ARG D 1 166 ? -10.701 64.935  50.622  1.00 46.79 ? 209  ARG D CB  1 
ATOM   9187  C  CG  . ARG D 1 166 ? -11.414 65.864  51.603  1.00 45.23 ? 209  ARG D CG  1 
ATOM   9188  C  CD  . ARG D 1 166 ? -11.897 67.153  50.941  1.00 44.79 ? 209  ARG D CD  1 
ATOM   9189  N  NE  . ARG D 1 166 ? -12.986 66.916  49.990  1.00 44.74 ? 209  ARG D NE  1 
ATOM   9190  C  CZ  . ARG D 1 166 ? -12.861 66.954  48.664  1.00 43.98 ? 209  ARG D CZ  1 
ATOM   9191  N  NH1 . ARG D 1 166 ? -11.685 67.227  48.104  1.00 43.74 ? 209  ARG D NH1 1 
ATOM   9192  N  NH2 . ARG D 1 166 ? -13.917 66.711  47.897  1.00 42.82 ? 209  ARG D NH2 1 
ATOM   9193  N  N   . LEU D 1 167 ? -12.146 61.893  50.324  1.00 43.96 ? 210  LEU D N   1 
ATOM   9194  C  CA  . LEU D 1 167 ? -13.411 61.186  50.358  1.00 41.94 ? 210  LEU D CA  1 
ATOM   9195  C  C   . LEU D 1 167 ? -13.333 60.161  51.465  1.00 41.85 ? 210  LEU D C   1 
ATOM   9196  O  O   . LEU D 1 167 ? -14.297 59.955  52.203  1.00 41.78 ? 210  LEU D O   1 
ATOM   9197  C  CB  . LEU D 1 167 ? -13.678 60.498  49.026  1.00 40.58 ? 210  LEU D CB  1 
ATOM   9198  C  CG  . LEU D 1 167 ? -14.508 61.340  48.061  1.00 38.75 ? 210  LEU D CG  1 
ATOM   9199  C  CD1 . LEU D 1 167 ? -14.596 60.654  46.723  1.00 39.38 ? 210  LEU D CD1 1 
ATOM   9200  C  CD2 . LEU D 1 167 ? -15.886 61.547  48.639  1.00 39.01 ? 210  LEU D CD2 1 
ATOM   9201  N  N   . LYS D 1 168 ? -12.164 59.539  51.587  1.00 41.12 ? 211  LYS D N   1 
ATOM   9202  C  CA  . LYS D 1 168 ? -11.921 58.517  52.602  1.00 40.82 ? 211  LYS D CA  1 
ATOM   9203  C  C   . LYS D 1 168 ? -12.273 58.974  54.024  1.00 41.19 ? 211  LYS D C   1 
ATOM   9204  O  O   . LYS D 1 168 ? -12.757 58.183  54.843  1.00 41.02 ? 211  LYS D O   1 
ATOM   9205  C  CB  . LYS D 1 168 ? -10.457 58.101  52.553  1.00 39.34 ? 211  LYS D CB  1 
ATOM   9206  C  CG  . LYS D 1 168 ? -10.082 57.009  53.534  1.00 40.26 ? 211  LYS D CG  1 
ATOM   9207  C  CD  . LYS D 1 168 ? -8.571  57.009  53.803  1.00 42.09 ? 211  LYS D CD  1 
ATOM   9208  C  CE  . LYS D 1 168 ? -7.763  57.006  52.506  1.00 42.66 ? 211  LYS D CE  1 
ATOM   9209  N  NZ  . LYS D 1 168 ? -6.301  57.177  52.730  1.00 42.94 ? 211  LYS D NZ  1 
ATOM   9210  N  N   . ASN D 1 169 ? -12.018 60.248  54.314  1.00 41.29 ? 212  ASN D N   1 
ATOM   9211  C  CA  . ASN D 1 169 ? -12.298 60.812  55.632  1.00 40.98 ? 212  ASN D CA  1 
ATOM   9212  C  C   . ASN D 1 169 ? -13.792 60.912  55.855  1.00 41.17 ? 212  ASN D C   1 
ATOM   9213  O  O   . ASN D 1 169 ? -14.325 60.401  56.845  1.00 40.14 ? 212  ASN D O   1 
ATOM   9214  C  CB  . ASN D 1 169 ? -11.690 62.202  55.743  1.00 40.37 ? 212  ASN D CB  1 
ATOM   9215  C  CG  . ASN D 1 169 ? -10.252 62.231  55.311  1.00 40.56 ? 212  ASN D CG  1 
ATOM   9216  O  OD1 . ASN D 1 169 ? -9.428  61.456  55.800  1.00 39.81 ? 212  ASN D OD1 1 
ATOM   9217  N  ND2 . ASN D 1 169 ? -9.935  63.128  54.385  1.00 41.00 ? 212  ASN D ND2 1 
ATOM   9218  N  N   . GLU D 1 170 ? -14.454 61.593  54.925  1.00 41.78 ? 213  GLU D N   1 
ATOM   9219  C  CA  . GLU D 1 170 ? -15.897 61.769  54.976  1.00 41.63 ? 213  GLU D CA  1 
ATOM   9220  C  C   . GLU D 1 170 ? -16.587 60.414  54.870  1.00 41.18 ? 213  GLU D C   1 
ATOM   9221  O  O   . GLU D 1 170 ? -17.422 60.073  55.707  1.00 41.50 ? 213  GLU D O   1 
ATOM   9222  C  CB  . GLU D 1 170 ? -16.355 62.699  53.846  1.00 41.47 ? 213  GLU D CB  1 
ATOM   9223  C  CG  . GLU D 1 170 ? -15.915 64.149  54.052  1.00 41.83 ? 213  GLU D CG  1 
ATOM   9224  C  CD  . GLU D 1 170 ? -16.453 65.104  53.001  1.00 41.28 ? 213  GLU D CD  1 
ATOM   9225  O  OE1 . GLU D 1 170 ? -15.837 65.198  51.919  1.00 41.94 ? 213  GLU D OE1 1 
ATOM   9226  O  OE2 . GLU D 1 170 ? -17.494 65.754  53.260  1.00 40.83 ? 213  GLU D OE2 1 
ATOM   9227  N  N   . ILE D 1 171 ? -16.232 59.639  53.846  1.00 40.63 ? 214  ILE D N   1 
ATOM   9228  C  CA  . ILE D 1 171 ? -16.819 58.314  53.662  1.00 39.26 ? 214  ILE D CA  1 
ATOM   9229  C  C   . ILE D 1 171 ? -16.198 57.389  54.701  1.00 37.44 ? 214  ILE D C   1 
ATOM   9230  O  O   . ILE D 1 171 ? -14.999 57.135  54.671  1.00 35.73 ? 214  ILE D O   1 
ATOM   9231  C  CB  . ILE D 1 171 ? -16.524 57.748  52.250  1.00 40.37 ? 214  ILE D CB  1 
ATOM   9232  C  CG1 . ILE D 1 171 ? -16.987 58.741  51.181  1.00 40.29 ? 214  ILE D CG1 1 
ATOM   9233  C  CG2 . ILE D 1 171 ? -17.236 56.414  52.058  1.00 38.80 ? 214  ILE D CG2 1 
ATOM   9234  C  CD1 . ILE D 1 171 ? -16.685 58.288  49.763  1.00 42.23 ? 214  ILE D CD1 1 
ATOM   9235  N  N   . PRO D 1 172 ? -17.008 56.899  55.652  1.00 35.89 ? 215  PRO D N   1 
ATOM   9236  C  CA  . PRO D 1 172 ? -16.551 56.001  56.716  1.00 35.51 ? 215  PRO D CA  1 
ATOM   9237  C  C   . PRO D 1 172 ? -16.485 54.563  56.232  1.00 34.45 ? 215  PRO D C   1 
ATOM   9238  O  O   . PRO D 1 172 ? -17.023 54.242  55.188  1.00 34.90 ? 215  PRO D O   1 
ATOM   9239  C  CB  . PRO D 1 172 ? -17.614 56.179  57.805  1.00 35.93 ? 215  PRO D CB  1 
ATOM   9240  C  CG  . PRO D 1 172 ? -18.264 57.504  57.475  1.00 36.73 ? 215  PRO D CG  1 
ATOM   9241  C  CD  . PRO D 1 172 ? -18.332 57.445  55.981  1.00 36.74 ? 215  PRO D CD  1 
ATOM   9242  N  N   . ASN D 1 173 ? -15.831 53.700  56.998  1.00 33.90 ? 216  ASN D N   1 
ATOM   9243  C  CA  . ASN D 1 173 ? -15.724 52.293  56.635  1.00 35.40 ? 216  ASN D CA  1 
ATOM   9244  C  C   . ASN D 1 173 ? -15.179 52.094  55.236  1.00 35.32 ? 216  ASN D C   1 
ATOM   9245  O  O   . ASN D 1 173 ? -15.470 51.085  54.595  1.00 35.74 ? 216  ASN D O   1 
ATOM   9246  C  CB  . ASN D 1 173 ? -17.094 51.616  56.737  1.00 37.09 ? 216  ASN D CB  1 
ATOM   9247  C  CG  . ASN D 1 173 ? -17.321 50.961  58.081  1.00 37.88 ? 216  ASN D CG  1 
ATOM   9248  O  OD1 . ASN D 1 173 ? -16.792 49.885  58.356  1.00 38.69 ? 216  ASN D OD1 1 
ATOM   9249  N  ND2 . ASN D 1 173 ? -18.098 51.613  58.933  1.00 38.82 ? 216  ASN D ND2 1 
ATOM   9250  N  N   . SER D 1 174 ? -14.391 53.054  54.769  1.00 34.69 ? 217  SER D N   1 
ATOM   9251  C  CA  . SER D 1 174 ? -13.808 52.989  53.438  1.00 33.89 ? 217  SER D CA  1 
ATOM   9252  C  C   . SER D 1 174 ? -12.291 52.861  53.489  1.00 32.99 ? 217  SER D C   1 
ATOM   9253  O  O   . SER D 1 174 ? -11.663 53.108  54.519  1.00 32.74 ? 217  SER D O   1 
ATOM   9254  C  CB  . SER D 1 174 ? -14.168 54.240  52.642  1.00 34.63 ? 217  SER D CB  1 
ATOM   9255  O  OG  . SER D 1 174 ? -13.508 55.377  53.173  1.00 35.82 ? 217  SER D OG  1 
ATOM   9256  N  N   . HIS D 1 175 ? -11.707 52.479  52.362  1.00 31.94 ? 218  HIS D N   1 
ATOM   9257  C  CA  . HIS D 1 175 ? -10.267 52.314  52.269  1.00 31.72 ? 218  HIS D CA  1 
ATOM   9258  C  C   . HIS D 1 175 ? -9.842  52.681  50.869  1.00 30.84 ? 218  HIS D C   1 
ATOM   9259  O  O   . HIS D 1 175 ? -10.625 53.229  50.107  1.00 32.01 ? 218  HIS D O   1 
ATOM   9260  C  CB  . HIS D 1 175 ? -9.887  50.857  52.559  1.00 33.03 ? 218  HIS D CB  1 
ATOM   9261  C  CG  . HIS D 1 175 ? -10.554 50.290  53.784  1.00 34.46 ? 218  HIS D CG  1 
ATOM   9262  N  ND1 . HIS D 1 175 ? -10.246 50.711  55.060  1.00 35.35 ? 218  HIS D ND1 1 
ATOM   9263  C  CD2 . HIS D 1 175 ? -11.547 49.379  53.921  1.00 35.52 ? 218  HIS D CD2 1 
ATOM   9264  C  CE1 . HIS D 1 175 ? -11.021 50.086  55.929  1.00 35.50 ? 218  HIS D CE1 1 
ATOM   9265  N  NE2 . HIS D 1 175 ? -11.821 49.272  55.264  1.00 35.15 ? 218  HIS D NE2 1 
ATOM   9266  N  N   . ILE D 1 176 ? -8.623  52.376  50.559  1.00 29.63 ? 219  ILE D N   1 
ATOM   9267  C  CA  . ILE D 1 176 ? -8.010  52.591  49.282  1.00 28.45 ? 219  ILE D CA  1 
ATOM   9268  C  C   . ILE D 1 176 ? -7.282  51.335  49.046  1.00 27.75 ? 219  ILE D C   1 
ATOM   9269  O  O   . ILE D 1 176 ? -7.065  50.562  49.975  1.00 27.60 ? 219  ILE D O   1 
ATOM   9270  C  CB  . ILE D 1 176 ? -6.871  53.655  49.307  1.00 28.86 ? 219  ILE D CB  1 
ATOM   9271  C  CG1 . ILE D 1 176 ? -7.408  55.053  49.589  1.00 29.32 ? 219  ILE D CG1 1 
ATOM   9272  C  CG2 . ILE D 1 176 ? -6.130  53.653  47.983  1.00 28.91 ? 219  ILE D CG2 1 
ATOM   9273  C  CD1 . ILE D 1 176 ? -6.593  56.151  48.945  1.00 30.26 ? 219  ILE D CD1 1 
ATOM   9274  N  N   . LEU D 1 177 ? -6.864  51.129  47.840  1.00 25.96 ? 220  LEU D N   1 
ATOM   9275  C  CA  . LEU D 1 177 ? -5.983  50.003  47.648  1.00 25.23 ? 220  LEU D CA  1 
ATOM   9276  C  C   . LEU D 1 177 ? -4.843  50.478  46.712  1.00 25.37 ? 220  LEU D C   1 
ATOM   9277  O  O   . LEU D 1 177 ? -4.624  49.886  45.653  1.00 27.18 ? 220  LEU D O   1 
ATOM   9278  C  CB  . LEU D 1 177 ? -6.776  48.758  47.168  1.00 23.46 ? 220  LEU D CB  1 
ATOM   9279  C  CG  . LEU D 1 177 ? -7.940  48.232  48.027  1.00 20.61 ? 220  LEU D CG  1 
ATOM   9280  C  CD1 . LEU D 1 177 ? -9.089  47.764  47.141  1.00 17.77 ? 220  LEU D CD1 1 
ATOM   9281  C  CD2 . LEU D 1 177 ? -7.478  47.093  48.938  1.00 19.85 ? 220  LEU D CD2 1 
ATOM   9282  N  N   . ASP D 1 178 ? -4.127  51.596  47.092  1.00 25.02 ? 221  ASP D N   1 
ATOM   9283  C  CA  . ASP D 1 178 ? -3.098  52.236  46.199  1.00 24.55 ? 221  ASP D CA  1 
ATOM   9284  C  C   . ASP D 1 178 ? -2.201  51.179  45.657  1.00 23.73 ? 221  ASP D C   1 
ATOM   9285  O  O   . ASP D 1 178 ? -1.521  50.375  46.304  1.00 23.43 ? 221  ASP D O   1 
ATOM   9286  C  CB  . ASP D 1 178 ? -2.298  53.394  46.739  1.00 24.34 ? 221  ASP D CB  1 
ATOM   9287  C  CG  . ASP D 1 178 ? -1.434  53.961  45.615  1.00 24.23 ? 221  ASP D CG  1 
ATOM   9288  O  OD1 . ASP D 1 178 ? -1.007  55.121  45.721  1.00 23.71 ? 221  ASP D OD1 1 
ATOM   9289  O  OD2 . ASP D 1 178 ? -1.174  53.236  44.640  1.00 25.14 ? 221  ASP D OD2 1 
ATOM   9290  N  N   . GLN D 1 179 ? -2.328  51.318  44.395  1.00 23.99 ? 222  GLN D N   1 
ATOM   9291  C  CA  . GLN D 1 179 ? -2.125  50.288  43.342  1.00 23.20 ? 222  GLN D CA  1 
ATOM   9292  C  C   . GLN D 1 179 ? -0.717  50.736  43.118  1.00 21.84 ? 222  GLN D C   1 
ATOM   9293  O  O   . GLN D 1 179 ? 0.142   49.946  42.726  1.00 21.15 ? 222  GLN D O   1 
ATOM   9294  C  CB  . GLN D 1 179 ? -3.052  50.474  42.095  1.00 23.80 ? 222  GLN D CB  1 
ATOM   9295  C  CG  . GLN D 1 179 ? -2.773  51.627  41.102  1.00 24.75 ? 222  GLN D CG  1 
ATOM   9296  C  CD  . GLN D 1 179 ? -3.634  51.620  39.834  1.00 25.86 ? 222  GLN D CD  1 
ATOM   9297  O  OE1 . GLN D 1 179 ? -3.307  50.964  38.855  1.00 25.05 ? 222  GLN D OE1 1 
ATOM   9298  N  NE2 . GLN D 1 179 ? -4.771  52.276  39.652  1.00 25.86 ? 222  GLN D NE2 1 
ATOM   9299  N  N   . TYR D 1 180 ? -0.458  52.016  43.352  1.00 21.08 ? 223  TYR D N   1 
ATOM   9300  C  CA  . TYR D 1 180 ? 0.876   52.507  43.160  1.00 20.27 ? 223  TYR D CA  1 
ATOM   9301  C  C   . TYR D 1 180 ? 1.763   52.264  44.362  1.00 19.34 ? 223  TYR D C   1 
ATOM   9302  O  O   . TYR D 1 180 ? 2.970   52.144  44.209  1.00 18.19 ? 223  TYR D O   1 
ATOM   9303  C  CB  . TYR D 1 180 ? 0.870   54.002  42.834  1.00 21.01 ? 223  TYR D CB  1 
ATOM   9304  C  CG  . TYR D 1 180 ? 0.465   54.301  41.412  1.00 23.30 ? 223  TYR D CG  1 
ATOM   9305  C  CD1 . TYR D 1 180 ? 1.332   54.035  40.350  1.00 24.45 ? 223  TYR D CD1 1 
ATOM   9306  C  CD2 . TYR D 1 180 ? -0.800  54.798  41.118  1.00 24.24 ? 223  TYR D CD2 1 
ATOM   9307  C  CE1 . TYR D 1 180 ? 0.944   54.256  39.022  1.00 26.19 ? 223  TYR D CE1 1 
ATOM   9308  C  CE2 . TYR D 1 180 ? -1.204  55.023  39.795  1.00 25.09 ? 223  TYR D CE2 1 
ATOM   9309  C  CZ  . TYR D 1 180 ? -0.329  54.749  38.745  1.00 26.21 ? 223  TYR D CZ  1 
ATOM   9310  O  OH  . TYR D 1 180 ? -0.722  54.984  37.456  1.00 26.25 ? 223  TYR D OH  1 
ATOM   9311  N  N   . ARG D 1 181 ? 1.181   52.172  45.552  1.00 20.09 ? 224  ARG D N   1 
ATOM   9312  C  CA  . ARG D 1 181 ? 1.993   51.986  46.751  1.00 20.16 ? 224  ARG D CA  1 
ATOM   9313  C  C   . ARG D 1 181 ? 1.812   50.653  47.460  1.00 18.82 ? 224  ARG D C   1 
ATOM   9314  O  O   . ARG D 1 181 ? 2.771   50.097  47.996  1.00 18.07 ? 224  ARG D O   1 
ATOM   9315  C  CB  . ARG D 1 181 ? 1.734   53.139  47.741  1.00 22.88 ? 224  ARG D CB  1 
ATOM   9316  C  CG  . ARG D 1 181 ? 2.894   53.408  48.702  1.00 23.93 ? 224  ARG D CG  1 
ATOM   9317  C  CD  . ARG D 1 181 ? 2.453   54.153  49.953  1.00 24.70 ? 224  ARG D CD  1 
ATOM   9318  N  NE  . ARG D 1 181 ? 1.536   53.370  50.784  1.00 26.71 ? 224  ARG D NE  1 
ATOM   9319  C  CZ  . ARG D 1 181 ? 0.220   53.287  50.591  1.00 27.99 ? 224  ARG D CZ  1 
ATOM   9320  N  NH1 . ARG D 1 181 ? -0.351  53.942  49.586  1.00 28.86 ? 224  ARG D NH1 1 
ATOM   9321  N  NH2 . ARG D 1 181 ? -0.530  52.564  51.414  1.00 26.92 ? 224  ARG D NH2 1 
ATOM   9322  N  N   . ASN D 1 182 ? 0.589   50.140  47.462  1.00 19.02 ? 225  ASN D N   1 
ATOM   9323  C  CA  . ASN D 1 182 ? 0.304   48.867  48.117  1.00 20.33 ? 225  ASN D CA  1 
ATOM   9324  C  C   . ASN D 1 182 ? 0.989   47.666  47.469  1.00 19.27 ? 225  ASN D C   1 
ATOM   9325  O  O   . ASN D 1 182 ? 0.720   47.331  46.324  1.00 18.82 ? 225  ASN D O   1 
ATOM   9326  C  CB  . ASN D 1 182 ? -1.205  48.620  48.180  1.00 22.30 ? 225  ASN D CB  1 
ATOM   9327  C  CG  . ASN D 1 182 ? -1.544  47.260  48.754  1.00 24.40 ? 225  ASN D CG  1 
ATOM   9328  O  OD1 . ASN D 1 182 ? -1.067  46.883  49.829  1.00 25.77 ? 225  ASN D OD1 1 
ATOM   9329  N  ND2 . ASN D 1 182 ? -2.374  46.514  48.039  1.00 26.71 ? 225  ASN D ND2 1 
ATOM   9330  N  N   . ALA D 1 183 ? 1.864   47.026  48.241  1.00 18.91 ? 226  ALA D N   1 
ATOM   9331  C  CA  . ALA D 1 183 ? 2.640   45.870  47.817  1.00 18.84 ? 226  ALA D CA  1 
ATOM   9332  C  C   . ALA D 1 183 ? 1.872   44.820  47.047  1.00 20.21 ? 226  ALA D C   1 
ATOM   9333  O  O   . ALA D 1 183 ? 2.351   44.298  46.033  1.00 21.50 ? 226  ALA D O   1 
ATOM   9334  C  CB  . ALA D 1 183 ? 3.302   45.234  49.029  1.00 16.20 ? 226  ALA D CB  1 
ATOM   9335  N  N   . SER D 1 184 ? 0.670   44.483  47.500  1.00 20.85 ? 227  SER D N   1 
ATOM   9336  C  CA  . SER D 1 184 ? -0.069  43.450  46.866  1.00 19.57 ? 227  SER D CA  1 
ATOM   9337  C  C   . SER D 1 184 ? 0.023   43.497  45.307  1.00 18.37 ? 227  SER D C   1 
ATOM   9338  O  O   . SER D 1 184 ? -0.064  42.440  44.669  1.00 18.85 ? 227  SER D O   1 
ATOM   9339  C  CB  . SER D 1 184 ? -1.487  43.455  47.447  1.00 19.92 ? 227  SER D CB  1 
ATOM   9340  O  OG  . SER D 1 184 ? -1.452  43.293  48.854  1.00 18.50 ? 227  SER D OG  1 
ATOM   9341  N  N   . ASN D 1 185 ? 0.201   44.657  44.660  1.00 16.28 ? 228  ASN D N   1 
ATOM   9342  C  CA  . ASN D 1 185 ? 0.222   44.596  43.184  1.00 13.75 ? 228  ASN D CA  1 
ATOM   9343  C  C   . ASN D 1 185 ? 1.398   43.813  42.628  1.00 13.19 ? 228  ASN D C   1 
ATOM   9344  O  O   . ASN D 1 185 ? 1.209   42.971  41.753  1.00 12.45 ? 228  ASN D O   1 
ATOM   9345  C  CB  . ASN D 1 185 ? 0.199   45.986  42.571  1.00 11.12 ? 228  ASN D CB  1 
ATOM   9346  C  CG  . ASN D 1 185 ? 0.402   45.948  41.070  1.00 12.57 ? 228  ASN D CG  1 
ATOM   9347  O  OD1 . ASN D 1 185 ? 1.320   45.282  40.583  1.00 12.30 ? 228  ASN D OD1 1 
ATOM   9348  N  ND2 . ASN D 1 185 ? -0.457  46.654  40.352  1.00 14.78 ? 228  ASN D ND2 1 
ATOM   9349  N  N   . PRO D 1 186 ? 2.617   44.074  43.131  1.00 13.41 ? 229  PRO D N   1 
ATOM   9350  C  CA  . PRO D 1 186 ? 3.772   43.267  42.650  1.00 15.02 ? 229  PRO D CA  1 
ATOM   9351  C  C   . PRO D 1 186 ? 3.611   41.773  42.883  1.00 15.55 ? 229  PRO D C   1 
ATOM   9352  O  O   . PRO D 1 186 ? 3.809   40.931  42.011  1.00 15.16 ? 229  PRO D O   1 
ATOM   9353  C  CB  . PRO D 1 186 ? 4.955   43.908  43.326  1.00 13.48 ? 229  PRO D CB  1 
ATOM   9354  C  CG  . PRO D 1 186 ? 4.603   45.361  43.271  1.00 12.81 ? 229  PRO D CG  1 
ATOM   9355  C  CD  . PRO D 1 186 ? 3.105   45.467  43.151  1.00 13.26 ? 229  PRO D CD  1 
ATOM   9356  N  N   . LEU D 1 187 ? 3.225   41.511  44.123  1.00 15.86 ? 230  LEU D N   1 
ATOM   9357  C  CA  . LEU D 1 187 ? 3.098   40.173  44.671  1.00 16.58 ? 230  LEU D CA  1 
ATOM   9358  C  C   . LEU D 1 187 ? 2.185   39.255  43.887  1.00 16.86 ? 230  LEU D C   1 
ATOM   9359  O  O   . LEU D 1 187 ? 2.562   38.134  43.570  1.00 16.12 ? 230  LEU D O   1 
ATOM   9360  C  CB  . LEU D 1 187 ? 2.635   40.266  46.128  1.00 17.79 ? 230  LEU D CB  1 
ATOM   9361  C  CG  . LEU D 1 187 ? 3.802   40.506  47.092  1.00 19.83 ? 230  LEU D CG  1 
ATOM   9362  C  CD1 . LEU D 1 187 ? 3.329   40.475  48.566  1.00 17.03 ? 230  LEU D CD1 1 
ATOM   9363  C  CD2 . LEU D 1 187 ? 4.865   39.414  46.835  1.00 20.29 ? 230  LEU D CD2 1 
ATOM   9364  N  N   . ALA D 1 188 ? 0.990   39.727  43.557  1.00 16.92 ? 231  ALA D N   1 
ATOM   9365  C  CA  . ALA D 1 188 ? 0.067   38.914  42.799  1.00 17.02 ? 231  ALA D CA  1 
ATOM   9366  C  C   . ALA D 1 188 ? 0.791   38.482  41.522  1.00 17.84 ? 231  ALA D C   1 
ATOM   9367  O  O   . ALA D 1 188 ? 0.767   37.313  41.138  1.00 18.49 ? 231  ALA D O   1 
ATOM   9368  C  CB  . ALA D 1 188 ? -1.161  39.719  42.475  1.00 15.52 ? 231  ALA D CB  1 
ATOM   9369  N  N   . HIS D 1 189 ? 1.450   39.424  40.868  1.00 17.89 ? 232  HIS D N   1 
ATOM   9370  C  CA  . HIS D 1 189 ? 2.161   39.090  39.659  1.00 19.40 ? 232  HIS D CA  1 
ATOM   9371  C  C   . HIS D 1 189 ? 3.378   38.246  39.992  1.00 19.58 ? 232  HIS D C   1 
ATOM   9372  O  O   . HIS D 1 189 ? 3.913   37.554  39.126  1.00 20.52 ? 232  HIS D O   1 
ATOM   9373  C  CB  . HIS D 1 189 ? 2.579   40.361  38.905  1.00 21.68 ? 232  HIS D CB  1 
ATOM   9374  C  CG  . HIS D 1 189 ? 1.426   41.152  38.381  1.00 21.29 ? 232  HIS D CG  1 
ATOM   9375  N  ND1 . HIS D 1 189 ? 0.346   40.566  37.763  1.00 22.52 ? 232  HIS D ND1 1 
ATOM   9376  C  CD2 . HIS D 1 189 ? 1.172   42.479  38.405  1.00 21.97 ? 232  HIS D CD2 1 
ATOM   9377  C  CE1 . HIS D 1 189 ? -0.528  41.498  37.431  1.00 22.34 ? 232  HIS D CE1 1 
ATOM   9378  N  NE2 . HIS D 1 189 ? -0.050  42.668  37.809  1.00 22.65 ? 232  HIS D NE2 1 
ATOM   9379  N  N   . TYR D 1 190 ? 3.819   38.297  41.243  1.00 19.27 ? 233  TYR D N   1 
ATOM   9380  C  CA  . TYR D 1 190 ? 4.983   37.518  41.659  1.00 19.66 ? 233  TYR D CA  1 
ATOM   9381  C  C   . TYR D 1 190 ? 4.605   36.089  42.076  1.00 20.99 ? 233  TYR D C   1 
ATOM   9382  O  O   . TYR D 1 190 ? 5.270   35.119  41.703  1.00 21.95 ? 233  TYR D O   1 
ATOM   9383  C  CB  . TYR D 1 190 ? 5.674   38.201  42.824  1.00 17.74 ? 233  TYR D CB  1 
ATOM   9384  C  CG  . TYR D 1 190 ? 6.861   37.437  43.349  1.00 16.84 ? 233  TYR D CG  1 
ATOM   9385  C  CD1 . TYR D 1 190 ? 8.080   37.457  42.672  1.00 16.34 ? 233  TYR D CD1 1 
ATOM   9386  C  CD2 . TYR D 1 190 ? 6.770   36.692  44.527  1.00 16.99 ? 233  TYR D CD2 1 
ATOM   9387  C  CE1 . TYR D 1 190 ? 9.181   36.761  43.154  1.00 15.24 ? 233  TYR D CE1 1 
ATOM   9388  C  CE2 . TYR D 1 190 ? 7.873   35.985  45.015  1.00 15.96 ? 233  TYR D CE2 1 
ATOM   9389  C  CZ  . TYR D 1 190 ? 9.074   36.027  44.320  1.00 15.13 ? 233  TYR D CZ  1 
ATOM   9390  O  OH  . TYR D 1 190 ? 10.168  35.334  44.780  1.00 13.54 ? 233  TYR D OH  1 
ATOM   9391  N  N   . ASP D 1 191 ? 3.538   35.974  42.858  1.00 20.77 ? 234  ASP D N   1 
ATOM   9392  C  CA  . ASP D 1 191 ? 3.062   34.688  43.334  1.00 20.61 ? 234  ASP D CA  1 
ATOM   9393  C  C   . ASP D 1 191 ? 2.370   33.871  42.236  1.00 21.21 ? 234  ASP D C   1 
ATOM   9394  O  O   . ASP D 1 191 ? 2.661   32.698  42.047  1.00 22.45 ? 234  ASP D O   1 
ATOM   9395  C  CB  . ASP D 1 191 ? 2.029   34.871  44.458  1.00 21.32 ? 234  ASP D CB  1 
ATOM   9396  C  CG  . ASP D 1 191 ? 2.631   35.385  45.749  1.00 20.23 ? 234  ASP D CG  1 
ATOM   9397  O  OD1 . ASP D 1 191 ? 3.715   34.907  46.149  1.00 17.81 ? 234  ASP D OD1 1 
ATOM   9398  O  OD2 . ASP D 1 191 ? 2.023   36.285  46.373  1.00 20.43 ? 234  ASP D OD2 1 
ATOM   9399  N  N   . THR D 1 192 ? 1.494   34.533  41.469  1.00 21.85 ? 235  THR D N   1 
ATOM   9400  C  CA  . THR D 1 192 ? 0.650   33.853  40.444  1.00 21.66 ? 235  THR D CA  1 
ATOM   9401  C  C   . THR D 1 192 ? 0.973   33.976  38.949  1.00 21.48 ? 235  THR D C   1 
ATOM   9402  O  O   . THR D 1 192 ? 1.166   32.981  38.247  1.00 21.89 ? 235  THR D O   1 
ATOM   9403  C  CB  . THR D 1 192 ? -0.778  34.370  40.522  1.00 22.18 ? 235  THR D CB  1 
ATOM   9404  O  OG1 . THR D 1 192 ? -0.773  35.799  40.615  1.00 23.31 ? 235  THR D OG1 1 
ATOM   9405  C  CG2 . THR D 1 192 ? -1.495  33.777  41.722  1.00 22.31 ? 235  THR D CG2 1 
ATOM   9406  N  N   . THR D 1 193 ? 1.040   35.249  38.509  1.00 20.91 ? 236  THR D N   1 
ATOM   9407  C  CA  . THR D 1 193 ? 1.337   35.560  37.110  1.00 20.32 ? 236  THR D CA  1 
ATOM   9408  C  C   . THR D 1 193 ? 2.655   34.964  36.695  1.00 19.54 ? 236  THR D C   1 
ATOM   9409  O  O   . THR D 1 193 ? 2.783   34.242  35.704  1.00 18.40 ? 236  THR D O   1 
ATOM   9410  C  CB  . THR D 1 193 ? 1.392   37.094  36.866  1.00 21.16 ? 236  THR D CB  1 
ATOM   9411  O  OG1 . THR D 1 193 ? 0.088   37.666  37.072  1.00 20.55 ? 236  THR D OG1 1 
ATOM   9412  C  CG2 . THR D 1 193 ? 1.860   37.384  35.443  1.00 22.20 ? 236  THR D CG2 1 
ATOM   9413  N  N   . ALA D 1 194 ? 3.627   35.301  37.498  1.00 19.77 ? 237  ALA D N   1 
ATOM   9414  C  CA  . ALA D 1 194 ? 4.999   34.872  37.289  1.00 18.53 ? 237  ALA D CA  1 
ATOM   9415  C  C   . ALA D 1 194 ? 5.227   33.424  37.645  1.00 18.19 ? 237  ALA D C   1 
ATOM   9416  O  O   . ALA D 1 194 ? 6.318   32.899  37.463  1.00 18.27 ? 237  ALA D O   1 
ATOM   9417  C  CB  . ALA D 1 194 ? 5.951   35.769  38.092  1.00 18.62 ? 237  ALA D CB  1 
ATOM   9418  N  N   . ASP D 1 195 ? 4.218   32.765  38.181  1.00 17.83 ? 238  ASP D N   1 
ATOM   9419  C  CA  . ASP D 1 195 ? 4.421   31.358  38.488  1.00 19.75 ? 238  ASP D CA  1 
ATOM   9420  C  C   . ASP D 1 195 ? 3.884   30.555  37.285  1.00 19.07 ? 238  ASP D C   1 
ATOM   9421  O  O   . ASP D 1 195 ? 4.506   29.586  36.845  1.00 18.74 ? 238  ASP D O   1 
ATOM   9422  C  CB  . ASP D 1 195 ? 3.729   30.971  39.828  1.00 18.70 ? 238  ASP D CB  1 
ATOM   9423  C  CG  . ASP D 1 195 ? 4.747   30.657  40.987  1.00 17.27 ? 238  ASP D CG  1 
ATOM   9424  O  OD1 . ASP D 1 195 ? 4.305   30.572  42.156  1.00 15.66 ? 238  ASP D OD1 1 
ATOM   9425  O  OD2 . ASP D 1 195 ? 5.968   30.482  40.743  1.00 14.98 ? 238  ASP D OD2 1 
ATOM   9426  N  N   . GLU D 1 196 ? 2.752   31.001  36.735  1.00 18.70 ? 239  GLU D N   1 
ATOM   9427  C  CA  . GLU D 1 196 ? 2.122   30.341  35.586  1.00 16.62 ? 239  GLU D CA  1 
ATOM   9428  C  C   . GLU D 1 196 ? 3.069   30.451  34.401  1.00 17.01 ? 239  GLU D C   1 
ATOM   9429  O  O   . GLU D 1 196 ? 3.284   29.476  33.690  1.00 19.07 ? 239  GLU D O   1 
ATOM   9430  C  CB  . GLU D 1 196 ? 0.783   31.009  35.234  1.00 13.98 ? 239  GLU D CB  1 
ATOM   9431  C  CG  . GLU D 1 196 ? -0.129  31.301  36.429  1.00 8.41  ? 239  GLU D CG  1 
ATOM   9432  C  CD  . GLU D 1 196 ? -1.294  32.229  36.070  1.00 8.27  ? 239  GLU D CD  1 
ATOM   9433  O  OE1 . GLU D 1 196 ? -2.102  32.571  36.971  1.00 8.42  ? 239  GLU D OE1 1 
ATOM   9434  O  OE2 . GLU D 1 196 ? -1.402  32.615  34.884  1.00 4.33  ? 239  GLU D OE2 1 
ATOM   9435  N  N   . ILE D 1 197 ? 3.638   31.639  34.203  1.00 15.88 ? 240  ILE D N   1 
ATOM   9436  C  CA  . ILE D 1 197 ? 4.574   31.888  33.107  1.00 13.64 ? 240  ILE D CA  1 
ATOM   9437  C  C   . ILE D 1 197 ? 5.747   30.926  33.117  1.00 14.02 ? 240  ILE D C   1 
ATOM   9438  O  O   . ILE D 1 197 ? 6.231   30.543  32.057  1.00 13.92 ? 240  ILE D O   1 
ATOM   9439  C  CB  . ILE D 1 197 ? 5.156   33.310  33.166  1.00 12.71 ? 240  ILE D CB  1 
ATOM   9440  C  CG1 . ILE D 1 197 ? 4.038   34.340  33.045  1.00 11.27 ? 240  ILE D CG1 1 
ATOM   9441  C  CG2 . ILE D 1 197 ? 6.187   33.499  32.062  1.00 13.77 ? 240  ILE D CG2 1 
ATOM   9442  C  CD1 . ILE D 1 197 ? 4.540   35.785  33.037  1.00 8.23  ? 240  ILE D CD1 1 
ATOM   9443  N  N   . LEU D 1 198 ? 6.221   30.569  34.310  1.00 14.51 ? 241  LEU D N   1 
ATOM   9444  C  CA  . LEU D 1 198 ? 7.333   29.633  34.456  1.00 16.27 ? 241  LEU D CA  1 
ATOM   9445  C  C   . LEU D 1 198 ? 6.808   28.245  34.175  1.00 17.02 ? 241  LEU D C   1 
ATOM   9446  O  O   . LEU D 1 198 ? 7.533   27.389  33.674  1.00 17.03 ? 241  LEU D O   1 
ATOM   9447  C  CB  . LEU D 1 198 ? 7.865   29.595  35.885  1.00 16.62 ? 241  LEU D CB  1 
ATOM   9448  C  CG  . LEU D 1 198 ? 8.687   30.676  36.570  1.00 17.33 ? 241  LEU D CG  1 
ATOM   9449  C  CD1 . LEU D 1 198 ? 8.926   30.180  37.995  1.00 15.72 ? 241  LEU D CD1 1 
ATOM   9450  C  CD2 . LEU D 1 198 ? 10.018  30.952  35.839  1.00 13.98 ? 241  LEU D CD2 1 
ATOM   9451  N  N   . GLN D 1 199 ? 5.542   28.039  34.539  1.00 17.28 ? 242  GLN D N   1 
ATOM   9452  C  CA  . GLN D 1 199 ? 4.855   26.759  34.400  1.00 17.97 ? 242  GLN D CA  1 
ATOM   9453  C  C   . GLN D 1 199 ? 4.598   26.337  32.957  1.00 18.40 ? 242  GLN D C   1 
ATOM   9454  O  O   . GLN D 1 199 ? 5.054   25.271  32.516  1.00 17.20 ? 242  GLN D O   1 
ATOM   9455  C  CB  . GLN D 1 199 ? 3.535   26.802  35.191  1.00 17.08 ? 242  GLN D CB  1 
ATOM   9456  C  CG  . GLN D 1 199 ? 2.678   25.578  35.078  1.00 18.52 ? 242  GLN D CG  1 
ATOM   9457  C  CD  . GLN D 1 199 ? 3.418   24.313  35.411  1.00 20.95 ? 242  GLN D CD  1 
ATOM   9458  O  OE1 . GLN D 1 199 ? 4.529   24.078  34.944  1.00 22.33 ? 242  GLN D OE1 1 
ATOM   9459  N  NE2 . GLN D 1 199 ? 2.809   23.455  36.214  1.00 22.77 ? 242  GLN D NE2 1 
ATOM   9460  N  N   . GLN D 1 200 ? 3.859   27.167  32.232  1.00 18.86 ? 243  GLN D N   1 
ATOM   9461  C  CA  . GLN D 1 200 ? 3.524   26.894  30.838  1.00 20.15 ? 243  GLN D CA  1 
ATOM   9462  C  C   . GLN D 1 200 ? 4.820   26.798  30.059  1.00 21.26 ? 243  GLN D C   1 
ATOM   9463  O  O   . GLN D 1 200 ? 5.107   25.794  29.409  1.00 23.00 ? 243  GLN D O   1 
ATOM   9464  C  CB  . GLN D 1 200 ? 2.624   27.971  30.287  1.00 17.33 ? 243  GLN D CB  1 
ATOM   9465  C  CG  . GLN D 1 200 ? 1.498   28.300  31.246  1.00 17.02 ? 243  GLN D CG  1 
ATOM   9466  C  CD  . GLN D 1 200 ? 0.645   29.451  30.746  1.00 19.72 ? 243  GLN D CD  1 
ATOM   9467  O  OE1 . GLN D 1 200 ? 0.964   30.611  30.988  1.00 20.94 ? 243  GLN D OE1 1 
ATOM   9468  N  NE2 . GLN D 1 200 ? -0.471  29.367  30.036  1.00 21.60 ? 243  GLN D NE2 1 
ATOM   9469  N  N   . CYS D 1 201 ? 5.616   27.858  30.138  1.00 21.61 ? 244  CYS D N   1 
ATOM   9470  C  CA  . CYS D 1 201 ? 6.896   27.811  29.456  1.00 22.29 ? 244  CYS D CA  1 
ATOM   9471  C  C   . CYS D 1 201 ? 7.672   26.853  30.268  1.00 21.08 ? 244  CYS D C   1 
ATOM   9472  O  O   . CYS D 1 201 ? 8.720   27.128  30.841  1.00 20.92 ? 244  CYS D O   1 
ATOM   9473  C  CB  . CYS D 1 201 ? 7.543   29.186  29.365  1.00 23.92 ? 244  CYS D CB  1 
ATOM   9474  S  SG  . CYS D 1 201 ? 6.604   30.386  28.360  1.00 28.82 ? 244  CYS D SG  1 
ATOM   9475  N  N   . ASP D 1 202 ? 7.072   25.681  30.295  1.00 21.45 ? 245  ASP D N   1 
ATOM   9476  C  CA  . ASP D 1 202 ? 7.635   24.615  31.058  1.00 22.42 ? 245  ASP D CA  1 
ATOM   9477  C  C   . ASP D 1 202 ? 8.769   25.126  31.890  1.00 21.86 ? 245  ASP D C   1 
ATOM   9478  O  O   . ASP D 1 202 ? 9.436   24.295  32.517  1.00 22.06 ? 245  ASP D O   1 
ATOM   9479  C  CB  . ASP D 1 202 ? 8.313   23.531  30.227  1.00 21.51 ? 245  ASP D CB  1 
ATOM   9480  C  CG  . ASP D 1 202 ? 7.541   23.004  29.042  1.00 21.08 ? 245  ASP D CG  1 
ATOM   9481  O  OD1 . ASP D 1 202 ? 6.388   23.438  28.858  1.00 20.31 ? 245  ASP D OD1 1 
ATOM   9482  O  OD2 . ASP D 1 202 ? 8.078   22.149  28.306  1.00 20.21 ? 245  ASP D OD2 1 
ATOM   9483  N  N   . GLY D 1 203 ? 9.097   26.392  32.016  1.00 21.18 ? 246  GLY D N   1 
ATOM   9484  C  CA  . GLY D 1 203 ? 10.258  26.642  32.867  1.00 21.65 ? 246  GLY D CA  1 
ATOM   9485  C  C   . GLY D 1 203 ? 11.390  27.264  32.040  1.00 21.49 ? 246  GLY D C   1 
ATOM   9486  O  O   . GLY D 1 203 ? 11.752  28.424  32.288  1.00 20.86 ? 246  GLY D O   1 
ATOM   9487  N  N   . LYS D 1 204 ? 11.950  26.545  31.076  1.00 20.74 ? 247  LYS D N   1 
ATOM   9488  C  CA  . LYS D 1 204 ? 12.954  27.141  30.221  1.00 21.17 ? 247  LYS D CA  1 
ATOM   9489  C  C   . LYS D 1 204 ? 12.361  28.353  29.545  1.00 20.36 ? 247  LYS D C   1 
ATOM   9490  O  O   . LYS D 1 204 ? 11.440  28.244  28.727  1.00 20.52 ? 247  LYS D O   1 
ATOM   9491  C  CB  . LYS D 1 204 ? 13.468  26.157  29.147  1.00 22.39 ? 247  LYS D CB  1 
ATOM   9492  C  CG  . LYS D 1 204 ? 14.510  25.165  29.633  1.00 23.08 ? 247  LYS D CG  1 
ATOM   9493  C  CD  . LYS D 1 204 ? 14.069  24.473  30.909  1.00 27.07 ? 247  LYS D CD  1 
ATOM   9494  C  CE  . LYS D 1 204 ? 15.247  24.115  31.799  1.00 27.88 ? 247  LYS D CE  1 
ATOM   9495  N  NZ  . LYS D 1 204 ? 16.188  23.188  31.127  1.00 30.36 ? 247  LYS D NZ  1 
ATOM   9496  N  N   . LEU D 1 205 ? 12.891  29.503  29.903  1.00 20.34 ? 248  LEU D N   1 
ATOM   9497  C  CA  . LEU D 1 205 ? 12.426  30.761  29.321  1.00 21.37 ? 248  LEU D CA  1 
ATOM   9498  C  C   . LEU D 1 205 ? 13.604  31.483  28.747  1.00 22.86 ? 248  LEU D C   1 
ATOM   9499  O  O   . LEU D 1 205 ? 14.698  30.924  28.639  1.00 24.92 ? 248  LEU D O   1 
ATOM   9500  C  CB  . LEU D 1 205 ? 11.667  31.606  30.371  1.00 20.64 ? 248  LEU D CB  1 
ATOM   9501  C  CG  . LEU D 1 205 ? 10.573  32.528  29.827  1.00 21.91 ? 248  LEU D CG  1 
ATOM   9502  C  CD1 . LEU D 1 205 ? 10.122  33.498  30.914  1.00 20.60 ? 248  LEU D CD1 1 
ATOM   9503  C  CD2 . LEU D 1 205 ? 11.061  33.287  28.601  1.00 21.34 ? 248  LEU D CD2 1 
ATOM   9504  N  N   . ASP D 1 206 ? 13.399  32.729  28.361  1.00 22.32 ? 249  ASP D N   1 
ATOM   9505  C  CA  . ASP D 1 206 ? 14.380  33.538  27.701  1.00 24.27 ? 249  ASP D CA  1 
ATOM   9506  C  C   . ASP D 1 206 ? 13.696  34.888  27.786  1.00 24.17 ? 249  ASP D C   1 
ATOM   9507  O  O   . ASP D 1 206 ? 12.563  34.917  28.261  1.00 24.29 ? 249  ASP D O   1 
ATOM   9508  C  CB  . ASP D 1 206 ? 14.492  33.143  26.225  1.00 27.13 ? 249  ASP D CB  1 
ATOM   9509  C  CG  . ASP D 1 206 ? 15.868  32.883  25.757  1.00 30.42 ? 249  ASP D CG  1 
ATOM   9510  O  OD1 . ASP D 1 206 ? 16.802  33.261  26.479  1.00 31.75 ? 249  ASP D OD1 1 
ATOM   9511  O  OD2 . ASP D 1 206 ? 16.034  32.298  24.674  1.00 32.44 ? 249  ASP D OD2 1 
ATOM   9512  N  N   . MET D 1 207 ? 14.234  35.999  27.368  1.00 22.51 ? 250  MET D N   1 
ATOM   9513  C  CA  . MET D 1 207 ? 13.227  37.130  27.330  1.00 20.44 ? 250  MET D CA  1 
ATOM   9514  C  C   . MET D 1 207 ? 11.752  37.107  27.836  1.00 20.00 ? 250  MET D C   1 
ATOM   9515  O  O   . MET D 1 207 ? 11.086  36.079  27.882  1.00 20.63 ? 250  MET D O   1 
ATOM   9516  C  CB  . MET D 1 207 ? 13.156  37.445  25.858  1.00 20.05 ? 250  MET D CB  1 
ATOM   9517  C  CG  . MET D 1 207 ? 12.805  38.893  25.544  1.00 18.36 ? 250  MET D CG  1 
ATOM   9518  S  SD  . MET D 1 207 ? 14.158  39.782  24.740  1.00 16.81 ? 250  MET D SD  1 
ATOM   9519  C  CE  . MET D 1 207 ? 15.450  39.614  25.965  1.00 16.27 ? 250  MET D CE  1 
ATOM   9520  N  N   . LEU D 1 208 ? 11.278  38.341  28.178  1.00 18.96 ? 251  LEU D N   1 
ATOM   9521  C  CA  . LEU D 1 208 ? 9.920   38.723  28.636  1.00 17.34 ? 251  LEU D CA  1 
ATOM   9522  C  C   . LEU D 1 208 ? 9.758   40.232  28.388  1.00 18.34 ? 251  LEU D C   1 
ATOM   9523  O  O   . LEU D 1 208 ? 10.521  41.030  28.927  1.00 20.85 ? 251  LEU D O   1 
ATOM   9524  C  CB  . LEU D 1 208 ? 9.615   38.351  30.127  1.00 13.96 ? 251  LEU D CB  1 
ATOM   9525  C  CG  . LEU D 1 208 ? 8.218   38.600  30.726  1.00 10.89 ? 251  LEU D CG  1 
ATOM   9526  C  CD1 . LEU D 1 208 ? 7.896   37.559  31.788  1.00 12.18 ? 251  LEU D CD1 1 
ATOM   9527  C  CD2 . LEU D 1 208 ? 8.140   40.005  31.316  1.00 8.57  ? 251  LEU D CD2 1 
ATOM   9528  N  N   . VAL D 1 209 ? 8.769   40.634  27.586  1.00 18.12 ? 252  VAL D N   1 
ATOM   9529  C  CA  . VAL D 1 209 ? 8.581   42.073  27.343  1.00 17.69 ? 252  VAL D CA  1 
ATOM   9530  C  C   . VAL D 1 209 ? 7.208   42.439  27.862  1.00 19.95 ? 252  VAL D C   1 
ATOM   9531  O  O   . VAL D 1 209 ? 6.192   41.888  27.419  1.00 20.70 ? 252  VAL D O   1 
ATOM   9532  C  CB  . VAL D 1 209 ? 8.700   42.444  25.842  1.00 15.59 ? 252  VAL D CB  1 
ATOM   9533  C  CG1 . VAL D 1 209 ? 8.222   43.869  25.606  1.00 16.61 ? 252  VAL D CG1 1 
ATOM   9534  C  CG2 . VAL D 1 209 ? 10.121  42.271  25.354  1.00 14.89 ? 252  VAL D CG2 1 
ATOM   9535  N  N   . ALA D 1 210 ? 7.154   43.384  28.797  1.00 21.75 ? 253  ALA D N   1 
ATOM   9536  C  CA  . ALA D 1 210 ? 5.890   43.839  29.367  1.00 23.72 ? 253  ALA D CA  1 
ATOM   9537  C  C   . ALA D 1 210 ? 5.958   45.357  29.473  1.00 23.36 ? 253  ALA D C   1 
ATOM   9538  O  O   . ALA D 1 210 ? 7.044   45.913  29.607  1.00 24.02 ? 253  ALA D O   1 
ATOM   9539  C  CB  . ALA D 1 210 ? 5.645   43.219  30.742  1.00 25.05 ? 253  ALA D CB  1 
ATOM   9540  N  N   . SER D 1 211 ? 4.812   46.027  29.425  1.00 22.32 ? 254  SER D N   1 
ATOM   9541  C  CA  . SER D 1 211 ? 4.793   47.480  29.543  1.00 23.11 ? 254  SER D CA  1 
ATOM   9542  C  C   . SER D 1 211 ? 4.762   47.927  31.025  1.00 24.47 ? 254  SER D C   1 
ATOM   9543  O  O   . SER D 1 211 ? 4.501   47.122  31.923  1.00 23.62 ? 254  SER D O   1 
ATOM   9544  C  CB  . SER D 1 211 ? 3.612   48.063  28.777  1.00 22.32 ? 254  SER D CB  1 
ATOM   9545  O  OG  . SER D 1 211 ? 2.392   47.479  29.194  1.00 22.01 ? 254  SER D OG  1 
ATOM   9546  N  N   . VAL D 1 212 ? 5.028   49.209  31.280  1.00 24.93 ? 255  VAL D N   1 
ATOM   9547  C  CA  . VAL D 1 212 ? 5.081   49.702  32.685  1.00 26.17 ? 255  VAL D CA  1 
ATOM   9548  C  C   . VAL D 1 212 ? 4.111   50.811  33.062  1.00 28.13 ? 255  VAL D C   1 
ATOM   9549  O  O   . VAL D 1 212 ? 4.355   51.997  32.810  1.00 27.80 ? 255  VAL D O   1 
ATOM   9550  C  CB  . VAL D 1 212 ? 6.508   50.188  33.001  1.00 25.74 ? 255  VAL D CB  1 
ATOM   9551  C  CG1 . VAL D 1 212 ? 6.620   50.642  34.450  1.00 24.72 ? 255  VAL D CG1 1 
ATOM   9552  C  CG2 . VAL D 1 212 ? 7.504   49.088  32.689  1.00 21.96 ? 255  VAL D CG2 1 
ATOM   9553  N  N   . GLY D 1 213 ? 2.990   50.412  33.655  1.00 29.65 ? 256  GLY D N   1 
ATOM   9554  C  CA  . GLY D 1 213 ? 2.031   51.365  34.151  1.00 29.68 ? 256  GLY D CA  1 
ATOM   9555  C  C   . GLY D 1 213 ? 2.466   51.676  35.585  1.00 29.91 ? 256  GLY D C   1 
ATOM   9556  O  O   . GLY D 1 213 ? 3.164   52.667  35.845  1.00 31.22 ? 256  GLY D O   1 
ATOM   9557  N  N   . THR D 1 214 ? 2.035   50.841  36.519  1.00 29.53 ? 257  THR D N   1 
ATOM   9558  C  CA  . THR D 1 214 ? 2.404   50.989  37.920  1.00 28.98 ? 257  THR D CA  1 
ATOM   9559  C  C   . THR D 1 214 ? 3.765   50.329  38.105  1.00 29.00 ? 257  THR D C   1 
ATOM   9560  O  O   . THR D 1 214 ? 4.512   50.678  39.022  1.00 28.52 ? 257  THR D O   1 
ATOM   9561  C  CB  . THR D 1 214 ? 1.422   50.258  38.839  1.00 29.51 ? 257  THR D CB  1 
ATOM   9562  O  OG1 . THR D 1 214 ? 1.406   48.869  38.483  1.00 28.86 ? 257  THR D OG1 1 
ATOM   9563  C  CG2 . THR D 1 214 ? 0.021   50.836  38.684  1.00 27.49 ? 257  THR D CG2 1 
ATOM   9564  N  N   . GLY D 1 215 ? 4.080   49.391  37.227  1.00 29.27 ? 258  GLY D N   1 
ATOM   9565  C  CA  . GLY D 1 215 ? 5.348   48.695  37.337  1.00 29.83 ? 258  GLY D CA  1 
ATOM   9566  C  C   . GLY D 1 215 ? 5.192   47.491  38.245  1.00 30.60 ? 258  GLY D C   1 
ATOM   9567  O  O   . GLY D 1 215 ? 6.163   46.820  38.585  1.00 29.85 ? 258  GLY D O   1 
ATOM   9568  N  N   . GLY D 1 216 ? 3.953   47.218  38.638  1.00 31.44 ? 259  GLY D N   1 
ATOM   9569  C  CA  . GLY D 1 216 ? 3.704   46.089  39.509  1.00 31.09 ? 259  GLY D CA  1 
ATOM   9570  C  C   . GLY D 1 216 ? 3.647   44.783  38.751  1.00 31.92 ? 259  GLY D C   1 
ATOM   9571  O  O   . GLY D 1 216 ? 3.691   43.713  39.348  1.00 33.19 ? 259  GLY D O   1 
ATOM   9572  N  N   . THR D 1 217 ? 3.561   44.857  37.429  1.00 32.21 ? 260  THR D N   1 
ATOM   9573  C  CA  . THR D 1 217 ? 3.483   43.637  36.642  1.00 31.94 ? 260  THR D CA  1 
ATOM   9574  C  C   . THR D 1 217 ? 4.840   43.025  36.393  1.00 30.90 ? 260  THR D C   1 
ATOM   9575  O  O   . THR D 1 217 ? 5.097   41.889  36.793  1.00 30.84 ? 260  THR D O   1 
ATOM   9576  C  CB  . THR D 1 217 ? 2.798   43.869  35.268  1.00 32.46 ? 260  THR D CB  1 
ATOM   9577  O  OG1 . THR D 1 217 ? 1.416   44.227  35.460  1.00 32.52 ? 260  THR D OG1 1 
ATOM   9578  C  CG2 . THR D 1 217 ? 2.887   42.616  34.416  1.00 32.24 ? 260  THR D CG2 1 
ATOM   9579  N  N   . ILE D 1 218 ? 5.705   43.784  35.733  1.00 29.99 ? 261  ILE D N   1 
ATOM   9580  C  CA  . ILE D 1 218 ? 7.037   43.301  35.394  1.00 29.36 ? 261  ILE D CA  1 
ATOM   9581  C  C   . ILE D 1 218 ? 7.915   43.144  36.626  1.00 28.38 ? 261  ILE D C   1 
ATOM   9582  O  O   . ILE D 1 218 ? 8.809   42.306  36.642  1.00 27.13 ? 261  ILE D O   1 
ATOM   9583  C  CB  . ILE D 1 218 ? 7.739   44.251  34.404  1.00 29.84 ? 261  ILE D CB  1 
ATOM   9584  C  CG1 . ILE D 1 218 ? 9.092   43.670  33.956  1.00 29.42 ? 261  ILE D CG1 1 
ATOM   9585  C  CG2 . ILE D 1 218 ? 7.919   45.640  35.014  1.00 27.57 ? 261  ILE D CG2 1 
ATOM   9586  C  CD1 . ILE D 1 218 ? 9.857   44.568  33.007  1.00 30.37 ? 261  ILE D CD1 1 
ATOM   9587  N  N   . THR D 1 219 ? 7.643   43.941  37.659  1.00 27.07 ? 262  THR D N   1 
ATOM   9588  C  CA  . THR D 1 219 ? 8.432   43.896  38.894  1.00 25.91 ? 262  THR D CA  1 
ATOM   9589  C  C   . THR D 1 219 ? 8.264   42.568  39.613  1.00 24.55 ? 262  THR D C   1 
ATOM   9590  O  O   . THR D 1 219 ? 9.248   41.946  40.010  1.00 23.00 ? 262  THR D O   1 
ATOM   9591  C  CB  . THR D 1 219 ? 8.055   45.060  39.860  1.00 26.50 ? 262  THR D CB  1 
ATOM   9592  O  OG1 . THR D 1 219 ? 8.205   46.313  39.188  1.00 23.22 ? 262  THR D OG1 1 
ATOM   9593  C  CG2 . THR D 1 219 ? 8.969   45.043  41.082  1.00 26.05 ? 262  THR D CG2 1 
ATOM   9594  N  N   . GLY D 1 220 ? 7.017   42.138  39.777  1.00 24.14 ? 263  GLY D N   1 
ATOM   9595  C  CA  . GLY D 1 220 ? 6.760   40.869  40.436  1.00 23.29 ? 263  GLY D CA  1 
ATOM   9596  C  C   . GLY D 1 220 ? 7.310   39.724  39.610  1.00 22.02 ? 263  GLY D C   1 
ATOM   9597  O  O   . GLY D 1 220 ? 8.052   38.861  40.091  1.00 20.54 ? 263  GLY D O   1 
ATOM   9598  N  N   . ILE D 1 221 ? 6.944   39.727  38.339  1.00 20.76 ? 264  ILE D N   1 
ATOM   9599  C  CA  . ILE D 1 221 ? 7.399   38.689  37.449  1.00 20.53 ? 264  ILE D CA  1 
ATOM   9600  C  C   . ILE D 1 221 ? 8.908   38.714  37.360  1.00 21.05 ? 264  ILE D C   1 
ATOM   9601  O  O   . ILE D 1 221 ? 9.542   37.671  37.376  1.00 21.47 ? 264  ILE D O   1 
ATOM   9602  C  CB  . ILE D 1 221 ? 6.802   38.864  36.052  1.00 18.30 ? 264  ILE D CB  1 
ATOM   9603  C  CG1 . ILE D 1 221 ? 5.285   38.847  36.134  1.00 18.35 ? 264  ILE D CG1 1 
ATOM   9604  C  CG2 . ILE D 1 221 ? 7.324   37.783  35.118  1.00 15.29 ? 264  ILE D CG2 1 
ATOM   9605  C  CD1 . ILE D 1 221 ? 4.592   39.091  34.813  1.00 19.66 ? 264  ILE D CD1 1 
ATOM   9606  N  N   . ALA D 1 222 ? 9.481   39.911  37.281  1.00 21.80 ? 265  ALA D N   1 
ATOM   9607  C  CA  . ALA D 1 222 ? 10.930  40.054  37.169  1.00 22.74 ? 265  ALA D CA  1 
ATOM   9608  C  C   . ALA D 1 222 ? 11.682  39.575  38.406  1.00 23.06 ? 265  ALA D C   1 
ATOM   9609  O  O   . ALA D 1 222 ? 12.736  38.947  38.297  1.00 24.20 ? 265  ALA D O   1 
ATOM   9610  C  CB  . ALA D 1 222 ? 11.280  41.510  36.885  1.00 24.30 ? 265  ALA D CB  1 
ATOM   9611  N  N   . ARG D 1 223 ? 11.161  39.863  39.606  1.00 22.42 ? 266  ARG D N   1 
ATOM   9612  C  CA  . ARG D 1 223 ? 11.835  39.425  40.832  1.00 19.51 ? 266  ARG D CA  1 
ATOM   9613  C  C   . ARG D 1 223 ? 11.796  37.920  40.929  1.00 17.64 ? 266  ARG D C   1 
ATOM   9614  O  O   . ARG D 1 223 ? 12.753  37.317  41.388  1.00 18.20 ? 266  ARG D O   1 
ATOM   9615  C  CB  . ARG D 1 223 ? 11.158  40.039  42.054  1.00 18.95 ? 266  ARG D CB  1 
ATOM   9616  C  CG  . ARG D 1 223 ? 11.290  41.546  42.176  1.00 21.67 ? 266  ARG D CG  1 
ATOM   9617  C  CD  . ARG D 1 223 ? 11.448  41.967  43.630  1.00 22.01 ? 266  ARG D CD  1 
ATOM   9618  N  NE  . ARG D 1 223 ? 11.028  43.344  43.884  1.00 21.63 ? 266  ARG D NE  1 
ATOM   9619  C  CZ  . ARG D 1 223 ? 11.004  43.884  45.100  1.00 23.50 ? 266  ARG D CZ  1 
ATOM   9620  N  NH1 . ARG D 1 223 ? 11.384  43.157  46.143  1.00 23.40 ? 266  ARG D NH1 1 
ATOM   9621  N  NH2 . ARG D 1 223 ? 10.608  45.130  45.256  1.00 23.76 ? 266  ARG D NH2 1 
ATOM   9622  N  N   . LYS D 1 224 ? 10.700  37.301  40.503  1.00 15.83 ? 267  LYS D N   1 
ATOM   9623  C  CA  . LYS D 1 224 ? 10.644  35.848  40.532  1.00 13.65 ? 267  LYS D CA  1 
ATOM   9624  C  C   . LYS D 1 224 ? 11.549  35.303  39.430  1.00 13.10 ? 267  LYS D C   1 
ATOM   9625  O  O   . LYS D 1 224 ? 12.342  34.396  39.664  1.00 12.12 ? 267  LYS D O   1 
ATOM   9626  C  CB  . LYS D 1 224 ? 9.219   35.318  40.375  1.00 12.45 ? 267  LYS D CB  1 
ATOM   9627  C  CG  . LYS D 1 224 ? 9.136   33.826  40.164  1.00 10.15 ? 267  LYS D CG  1 
ATOM   9628  C  CD  . LYS D 1 224 ? 9.303   33.057  41.458  1.00 6.81  ? 267  LYS D CD  1 
ATOM   9629  C  CE  . LYS D 1 224 ? 8.211   33.416  42.450  1.00 7.18  ? 267  LYS D CE  1 
ATOM   9630  N  NZ  . LYS D 1 224 ? 6.845   33.280  41.866  1.00 3.95  ? 267  LYS D NZ  1 
ATOM   9631  N  N   . LEU D 1 225 ? 11.437  35.883  38.232  1.00 13.67 ? 268  LEU D N   1 
ATOM   9632  C  CA  . LEU D 1 225 ? 12.178  35.416  37.076  1.00 16.31 ? 268  LEU D CA  1 
ATOM   9633  C  C   . LEU D 1 225 ? 13.700  35.368  37.228  1.00 18.40 ? 268  LEU D C   1 
ATOM   9634  O  O   . LEU D 1 225 ? 14.301  34.336  36.959  1.00 19.93 ? 268  LEU D O   1 
ATOM   9635  C  CB  . LEU D 1 225 ? 11.811  36.271  35.863  1.00 16.05 ? 268  LEU D CB  1 
ATOM   9636  C  CG  . LEU D 1 225 ? 11.247  35.530  34.653  1.00 15.23 ? 268  LEU D CG  1 
ATOM   9637  C  CD1 . LEU D 1 225 ? 10.208  34.511  35.068  1.00 16.82 ? 268  LEU D CD1 1 
ATOM   9638  C  CD2 . LEU D 1 225 ? 10.656  36.528  33.673  1.00 15.07 ? 268  LEU D CD2 1 
ATOM   9639  N  N   . LYS D 1 226 ? 14.326  36.468  37.667  1.00 20.33 ? 269  LYS D N   1 
ATOM   9640  C  CA  . LYS D 1 226 ? 15.784  36.514  37.848  1.00 20.31 ? 269  LYS D CA  1 
ATOM   9641  C  C   . LYS D 1 226 ? 16.271  35.486  38.857  1.00 20.56 ? 269  LYS D C   1 
ATOM   9642  O  O   . LYS D 1 226 ? 17.450  35.133  38.918  1.00 19.38 ? 269  LYS D O   1 
ATOM   9643  C  CB  . LYS D 1 226 ? 16.231  37.906  38.287  1.00 20.22 ? 269  LYS D CB  1 
ATOM   9644  C  CG  . LYS D 1 226 ? 16.228  38.928  37.164  1.00 18.43 ? 269  LYS D CG  1 
ATOM   9645  C  CD  . LYS D 1 226 ? 17.560  39.658  37.065  1.00 14.10 ? 269  LYS D CD  1 
ATOM   9646  C  CE  . LYS D 1 226 ? 17.568  40.614  35.875  1.00 12.74 ? 269  LYS D CE  1 
ATOM   9647  N  NZ  . LYS D 1 226 ? 16.448  41.597  35.944  1.00 12.01 ? 269  LYS D NZ  1 
ATOM   9648  N  N   . GLU D 1 227 ? 15.307  35.018  39.641  1.00 21.48 ? 270  GLU D N   1 
ATOM   9649  C  CA  . GLU D 1 227 ? 15.574  34.040  40.669  1.00 22.74 ? 270  GLU D CA  1 
ATOM   9650  C  C   . GLU D 1 227 ? 15.467  32.598  40.200  1.00 24.22 ? 270  GLU D C   1 
ATOM   9651  O  O   . GLU D 1 227 ? 16.427  31.824  40.284  1.00 25.92 ? 270  GLU D O   1 
ATOM   9652  C  CB  . GLU D 1 227 ? 14.538  34.080  41.797  1.00 22.28 ? 270  GLU D CB  1 
ATOM   9653  C  CG  . GLU D 1 227 ? 14.326  35.412  42.469  1.00 21.07 ? 270  GLU D CG  1 
ATOM   9654  C  CD  . GLU D 1 227 ? 13.853  35.235  43.895  1.00 20.97 ? 270  GLU D CD  1 
ATOM   9655  O  OE1 . GLU D 1 227 ? 14.641  34.729  44.731  1.00 21.81 ? 270  GLU D OE1 1 
ATOM   9656  O  OE2 . GLU D 1 227 ? 12.690  35.612  44.179  1.00 18.28 ? 270  GLU D OE2 1 
ATOM   9657  N  N   . LYS D 1 228 ? 14.263  32.247  39.718  1.00 25.48 ? 271  LYS D N   1 
ATOM   9658  C  CA  . LYS D 1 228 ? 13.940  30.903  39.312  1.00 26.67 ? 271  LYS D CA  1 
ATOM   9659  C  C   . LYS D 1 228 ? 14.217  30.584  37.828  1.00 26.97 ? 271  LYS D C   1 
ATOM   9660  O  O   . LYS D 1 228 ? 13.915  29.496  37.356  1.00 26.60 ? 271  LYS D O   1 
ATOM   9661  C  CB  . LYS D 1 228 ? 12.498  30.583  39.702  1.00 26.99 ? 271  LYS D CB  1 
ATOM   9662  C  CG  . LYS D 1 228 ? 12.274  30.367  41.205  1.00 30.23 ? 271  LYS D CG  1 
ATOM   9663  C  CD  . LYS D 1 228 ? 12.676  28.965  41.639  1.00 32.08 ? 271  LYS D CD  1 
ATOM   9664  C  CE  . LYS D 1 228 ? 12.116  28.576  43.013  1.00 30.77 ? 271  LYS D CE  1 
ATOM   9665  N  NZ  . LYS D 1 228 ? 12.768  27.345  43.550  1.00 27.93 ? 271  LYS D NZ  1 
ATOM   9666  N  N   . CYS D 1 229 ? 14.776  31.550  37.094  1.00 26.66 ? 272  CYS D N   1 
ATOM   9667  C  CA  . CYS D 1 229 ? 15.196  31.476  35.681  1.00 26.59 ? 272  CYS D CA  1 
ATOM   9668  C  C   . CYS D 1 229 ? 16.418  32.428  35.525  1.00 25.83 ? 272  CYS D C   1 
ATOM   9669  O  O   . CYS D 1 229 ? 16.197  33.575  35.162  1.00 24.43 ? 272  CYS D O   1 
ATOM   9670  C  CB  . CYS D 1 229 ? 14.056  31.916  34.773  1.00 27.47 ? 272  CYS D CB  1 
ATOM   9671  S  SG  . CYS D 1 229 ? 14.023  31.071  33.153  1.00 24.04 ? 272  CYS D SG  1 
ATOM   9672  N  N   . PRO D 1 230 ? 17.664  32.019  35.785  1.00 27.82 ? 273  PRO D N   1 
ATOM   9673  C  CA  . PRO D 1 230 ? 18.748  33.064  35.758  1.00 29.53 ? 273  PRO D CA  1 
ATOM   9674  C  C   . PRO D 1 230 ? 18.909  33.869  34.513  1.00 28.91 ? 273  PRO D C   1 
ATOM   9675  O  O   . PRO D 1 230 ? 19.053  35.078  34.501  1.00 29.40 ? 273  PRO D O   1 
ATOM   9676  C  CB  . PRO D 1 230 ? 19.997  32.269  36.149  1.00 28.73 ? 273  PRO D CB  1 
ATOM   9677  C  CG  . PRO D 1 230 ? 19.433  31.331  37.181  1.00 29.07 ? 273  PRO D CG  1 
ATOM   9678  C  CD  . PRO D 1 230 ? 17.963  31.125  36.928  1.00 28.98 ? 273  PRO D CD  1 
ATOM   9679  N  N   . GLY D 1 231 ? 18.890  33.065  33.460  1.00 28.69 ? 274  GLY D N   1 
ATOM   9680  C  CA  . GLY D 1 231 ? 19.143  33.520  32.115  1.00 28.50 ? 274  GLY D CA  1 
ATOM   9681  C  C   . GLY D 1 231 ? 18.045  34.269  31.406  1.00 27.21 ? 274  GLY D C   1 
ATOM   9682  O  O   . GLY D 1 231 ? 18.201  34.527  30.218  1.00 27.50 ? 274  GLY D O   1 
ATOM   9683  N  N   . CYS D 1 232 ? 16.953  34.662  32.030  1.00 24.89 ? 275  CYS D N   1 
ATOM   9684  C  CA  . CYS D 1 232 ? 15.959  35.418  31.288  1.00 22.48 ? 275  CYS D CA  1 
ATOM   9685  C  C   . CYS D 1 232 ? 16.064  36.950  31.368  1.00 21.05 ? 275  CYS D C   1 
ATOM   9686  O  O   . CYS D 1 232 ? 15.825  37.548  32.419  1.00 20.73 ? 275  CYS D O   1 
ATOM   9687  C  CB  . CYS D 1 232 ? 14.557  34.963  31.710  1.00 22.45 ? 275  CYS D CB  1 
ATOM   9688  S  SG  . CYS D 1 232 ? 13.237  35.743  30.754  1.00 21.39 ? 275  CYS D SG  1 
ATOM   9689  N  N   . ARG D 1 233 ? 16.423  37.570  30.244  1.00 19.27 ? 276  ARG D N   1 
ATOM   9690  C  CA  . ARG D 1 233 ? 16.531  39.026  30.134  1.00 17.86 ? 276  ARG D CA  1 
ATOM   9691  C  C   . ARG D 1 233 ? 15.173  39.602  30.507  1.00 16.78 ? 276  ARG D C   1 
ATOM   9692  O  O   . ARG D 1 233 ? 14.192  38.877  30.516  1.00 18.76 ? 276  ARG D O   1 
ATOM   9693  C  CB  . ARG D 1 233 ? 16.867  39.438  28.691  1.00 19.87 ? 276  ARG D CB  1 
ATOM   9694  C  CG  . ARG D 1 233 ? 18.304  39.204  28.236  1.00 22.34 ? 276  ARG D CG  1 
ATOM   9695  C  CD  . ARG D 1 233 ? 19.265  40.151  28.951  1.00 26.54 ? 276  ARG D CD  1 
ATOM   9696  N  NE  . ARG D 1 233 ? 18.853  41.553  28.831  1.00 29.30 ? 276  ARG D NE  1 
ATOM   9697  C  CZ  . ARG D 1 233 ? 19.244  42.391  27.872  1.00 29.56 ? 276  ARG D CZ  1 
ATOM   9698  N  NH1 . ARG D 1 233 ? 20.082  41.990  26.922  1.00 29.22 ? 276  ARG D NH1 1 
ATOM   9699  N  NH2 . ARG D 1 233 ? 18.777  43.635  27.851  1.00 30.11 ? 276  ARG D NH2 1 
ATOM   9700  N  N   . ILE D 1 234 ? 15.105  40.898  30.795  1.00 14.50 ? 277  ILE D N   1 
ATOM   9701  C  CA  . ILE D 1 234 ? 13.843  41.524  31.175  1.00 12.96 ? 277  ILE D CA  1 
ATOM   9702  C  C   . ILE D 1 234 ? 13.651  42.871  30.513  1.00 13.88 ? 277  ILE D C   1 
ATOM   9703  O  O   . ILE D 1 234 ? 14.117  43.865  31.034  1.00 15.50 ? 277  ILE D O   1 
ATOM   9704  C  CB  . ILE D 1 234 ? 13.766  41.769  32.701  1.00 11.41 ? 277  ILE D CB  1 
ATOM   9705  C  CG1 . ILE D 1 234 ? 13.809  40.447  33.459  1.00 10.22 ? 277  ILE D CG1 1 
ATOM   9706  C  CG2 . ILE D 1 234 ? 12.489  42.544  33.039  1.00 8.62  ? 277  ILE D CG2 1 
ATOM   9707  C  CD1 . ILE D 1 234 ? 12.521  39.671  33.400  1.00 13.00 ? 277  ILE D CD1 1 
ATOM   9708  N  N   . ILE D 1 235 ? 12.953  42.928  29.390  1.00 12.60 ? 278  ILE D N   1 
ATOM   9709  C  CA  . ILE D 1 235 ? 12.743  44.204  28.733  1.00 11.83 ? 278  ILE D CA  1 
ATOM   9710  C  C   . ILE D 1 235 ? 11.580  44.922  29.400  1.00 11.16 ? 278  ILE D C   1 
ATOM   9711  O  O   . ILE D 1 235 ? 10.842  44.307  30.143  1.00 12.18 ? 278  ILE D O   1 
ATOM   9712  C  CB  . ILE D 1 235 ? 12.463  44.010  27.247  1.00 13.04 ? 278  ILE D CB  1 
ATOM   9713  C  CG1 . ILE D 1 235 ? 13.412  42.953  26.680  1.00 13.16 ? 278  ILE D CG1 1 
ATOM   9714  C  CG2 . ILE D 1 235 ? 12.690  45.308  26.498  1.00 13.47 ? 278  ILE D CG2 1 
ATOM   9715  C  CD1 . ILE D 1 235 ? 14.869  43.237  26.912  1.00 13.72 ? 278  ILE D CD1 1 
ATOM   9716  N  N   . GLY D 1 236 ? 11.432  46.224  29.157  1.00 11.52 ? 279  GLY D N   1 
ATOM   9717  C  CA  . GLY D 1 236 ? 10.358  47.003  29.762  1.00 11.10 ? 279  GLY D CA  1 
ATOM   9718  C  C   . GLY D 1 236 ? 9.890   48.034  28.757  1.00 12.96 ? 279  GLY D C   1 
ATOM   9719  O  O   . GLY D 1 236 ? 10.701  48.524  27.973  1.00 13.74 ? 279  GLY D O   1 
ATOM   9720  N  N   . VAL D 1 237 ? 8.602   48.374  28.754  1.00 13.00 ? 280  VAL D N   1 
ATOM   9721  C  CA  . VAL D 1 237 ? 8.096   49.330  27.773  1.00 15.68 ? 280  VAL D CA  1 
ATOM   9722  C  C   . VAL D 1 237 ? 7.508   50.577  28.405  1.00 18.44 ? 280  VAL D C   1 
ATOM   9723  O  O   . VAL D 1 237 ? 6.614   50.503  29.251  1.00 17.64 ? 280  VAL D O   1 
ATOM   9724  C  CB  . VAL D 1 237 ? 7.026   48.694  26.850  1.00 16.58 ? 280  VAL D CB  1 
ATOM   9725  C  CG1 . VAL D 1 237 ? 6.454   49.753  25.922  1.00 15.67 ? 280  VAL D CG1 1 
ATOM   9726  C  CG2 . VAL D 1 237 ? 7.634   47.541  26.031  1.00 15.21 ? 280  VAL D CG2 1 
ATOM   9727  N  N   . ASP D 1 238 ? 8.019   51.727  27.968  1.00 20.43 ? 281  ASP D N   1 
ATOM   9728  C  CA  . ASP D 1 238 ? 7.595   53.030  28.476  1.00 21.85 ? 281  ASP D CA  1 
ATOM   9729  C  C   . ASP D 1 238 ? 7.231   53.923  27.293  1.00 22.59 ? 281  ASP D C   1 
ATOM   9730  O  O   . ASP D 1 238 ? 8.009   54.050  26.357  1.00 22.39 ? 281  ASP D O   1 
ATOM   9731  C  CB  . ASP D 1 238 ? 8.749   53.674  29.265  1.00 22.33 ? 281  ASP D CB  1 
ATOM   9732  C  CG  . ASP D 1 238 ? 8.293   54.818  30.171  1.00 22.81 ? 281  ASP D CG  1 
ATOM   9733  O  OD1 . ASP D 1 238 ? 9.167   55.549  30.673  1.00 20.95 ? 281  ASP D OD1 1 
ATOM   9734  O  OD2 . ASP D 1 238 ? 7.075   54.981  30.399  1.00 23.11 ? 281  ASP D OD2 1 
ATOM   9735  N  N   . PRO D 1 239 ? 6.036   54.536  27.312  1.00 23.44 ? 282  PRO D N   1 
ATOM   9736  C  CA  . PRO D 1 239 ? 5.640   55.411  26.203  1.00 25.02 ? 282  PRO D CA  1 
ATOM   9737  C  C   . PRO D 1 239 ? 6.330   56.772  26.280  1.00 26.75 ? 282  PRO D C   1 
ATOM   9738  O  O   . PRO D 1 239 ? 6.489   57.316  27.375  1.00 26.30 ? 282  PRO D O   1 
ATOM   9739  C  CB  . PRO D 1 239 ? 4.123   55.511  26.370  1.00 24.74 ? 282  PRO D CB  1 
ATOM   9740  C  CG  . PRO D 1 239 ? 3.932   55.367  27.840  1.00 22.03 ? 282  PRO D CG  1 
ATOM   9741  C  CD  . PRO D 1 239 ? 4.887   54.256  28.194  1.00 22.72 ? 282  PRO D CD  1 
ATOM   9742  N  N   . GLU D 1 240 ? 6.746   57.310  25.128  1.00 28.69 ? 283  GLU D N   1 
ATOM   9743  C  CA  . GLU D 1 240 ? 7.420   58.610  25.088  1.00 28.87 ? 283  GLU D CA  1 
ATOM   9744  C  C   . GLU D 1 240 ? 6.558   59.667  25.742  1.00 29.15 ? 283  GLU D C   1 
ATOM   9745  O  O   . GLU D 1 240 ? 5.394   59.848  25.389  1.00 28.10 ? 283  GLU D O   1 
ATOM   9746  C  CB  . GLU D 1 240 ? 7.762   59.023  23.652  1.00 28.73 ? 283  GLU D CB  1 
ATOM   9747  C  CG  . GLU D 1 240 ? 9.003   58.316  23.096  1.00 31.27 ? 283  GLU D CG  1 
ATOM   9748  C  CD  . GLU D 1 240 ? 9.526   58.922  21.791  1.00 32.05 ? 283  GLU D CD  1 
ATOM   9749  O  OE1 . GLU D 1 240 ? 10.508  58.381  21.230  1.00 31.70 ? 283  GLU D OE1 1 
ATOM   9750  O  OE2 . GLU D 1 240 ? 8.960   59.936  21.329  1.00 32.67 ? 283  GLU D OE2 1 
ATOM   9751  N  N   . GLY D 1 241 ? 7.147   60.360  26.706  1.00 29.33 ? 284  GLY D N   1 
ATOM   9752  C  CA  . GLY D 1 241 ? 6.418   61.377  27.427  1.00 29.00 ? 284  GLY D CA  1 
ATOM   9753  C  C   . GLY D 1 241 ? 5.988   60.797  28.758  1.00 28.70 ? 284  GLY D C   1 
ATOM   9754  O  O   . GLY D 1 241 ? 4.887   61.055  29.220  1.00 27.99 ? 284  GLY D O   1 
ATOM   9755  N  N   . SER D 1 242 ? 6.864   59.998  29.363  1.00 29.33 ? 285  SER D N   1 
ATOM   9756  C  CA  . SER D 1 242 ? 6.619   59.356  30.627  1.00 28.85 ? 285  SER D CA  1 
ATOM   9757  C  C   . SER D 1 242 ? 7.981   58.993  31.223  1.00 29.99 ? 285  SER D C   1 
ATOM   9758  O  O   . SER D 1 242 ? 8.664   58.132  30.680  1.00 30.46 ? 285  SER D O   1 
ATOM   9759  C  CB  . SER D 1 242 ? 5.781   58.077  30.485  1.00 28.56 ? 285  SER D CB  1 
ATOM   9760  O  OG  . SER D 1 242 ? 6.030   57.181  31.549  1.00 25.63 ? 285  SER D OG  1 
ATOM   9761  N  N   . ILE D 1 243 ? 8.350   59.643  32.307  1.00 30.94 ? 286  ILE D N   1 
ATOM   9762  C  CA  . ILE D 1 243 ? 9.652   59.361  32.920  1.00 31.35 ? 286  ILE D CA  1 
ATOM   9763  C  C   . ILE D 1 243 ? 9.521   58.217  33.930  1.00 31.34 ? 286  ILE D C   1 
ATOM   9764  O  O   . ILE D 1 243 ? 9.036   58.382  35.047  1.00 31.06 ? 286  ILE D O   1 
ATOM   9765  C  CB  . ILE D 1 243 ? 10.241  60.572  33.659  1.00 32.46 ? 286  ILE D CB  1 
ATOM   9766  C  CG1 . ILE D 1 243 ? 9.959   61.869  32.892  1.00 32.62 ? 286  ILE D CG1 1 
ATOM   9767  C  CG2 . ILE D 1 243 ? 11.743  60.388  33.875  1.00 31.74 ? 286  ILE D CG2 1 
ATOM   9768  C  CD1 . ILE D 1 243 ? 8.554   62.395  33.067  1.00 36.02 ? 286  ILE D CD1 1 
ATOM   9769  N  N   . LEU D 1 244 ? 9.981   57.070  33.494  1.00 31.32 ? 287  LEU D N   1 
ATOM   9770  C  CA  . LEU D 1 244 ? 10.069  55.756  34.120  1.00 30.57 ? 287  LEU D CA  1 
ATOM   9771  C  C   . LEU D 1 244 ? 10.964  55.254  33.075  1.00 29.75 ? 287  LEU D C   1 
ATOM   9772  O  O   . LEU D 1 244 ? 10.646  55.479  31.919  1.00 30.88 ? 287  LEU D O   1 
ATOM   9773  C  CB  . LEU D 1 244 ? 8.789   54.897  34.077  1.00 30.97 ? 287  LEU D CB  1 
ATOM   9774  C  CG  . LEU D 1 244 ? 7.584   55.474  34.796  1.00 32.93 ? 287  LEU D CG  1 
ATOM   9775  C  CD1 . LEU D 1 244 ? 6.301   55.118  34.063  1.00 32.81 ? 287  LEU D CD1 1 
ATOM   9776  C  CD2 . LEU D 1 244 ? 7.521   54.991  36.230  1.00 31.71 ? 287  LEU D CD2 1 
ATOM   9777  N  N   . ALA D 1 245 ? 12.010  54.633  33.322  1.00 29.70 ? 288  ALA D N   1 
ATOM   9778  C  CA  . ALA D 1 245 ? 12.601  54.402  32.056  1.00 30.18 ? 288  ALA D CA  1 
ATOM   9779  C  C   . ALA D 1 245 ? 14.022  54.790  32.187  1.00 30.34 ? 288  ALA D C   1 
ATOM   9780  O  O   . ALA D 1 245 ? 14.376  55.877  32.653  1.00 29.60 ? 288  ALA D O   1 
ATOM   9781  C  CB  . ALA D 1 245 ? 11.908  55.174  30.954  1.00 31.92 ? 288  ALA D CB  1 
ATOM   9782  N  N   . GLU D 1 246 ? 14.834  53.912  31.652  1.00 28.57 ? 289  GLU D N   1 
ATOM   9783  C  CA  . GLU D 1 246 ? 16.080  54.208  32.162  1.00 27.59 ? 289  GLU D CA  1 
ATOM   9784  C  C   . GLU D 1 246 ? 17.198  54.903  31.541  1.00 27.96 ? 289  GLU D C   1 
ATOM   9785  O  O   . GLU D 1 246 ? 17.760  55.563  32.415  1.00 28.95 ? 289  GLU D O   1 
ATOM   9786  C  CB  . GLU D 1 246 ? 16.559  52.947  32.882  1.00 26.64 ? 289  GLU D CB  1 
ATOM   9787  C  CG  . GLU D 1 246 ? 15.905  52.788  34.287  1.00 25.99 ? 289  GLU D CG  1 
ATOM   9788  C  CD  . GLU D 1 246 ? 16.850  52.905  35.500  1.00 26.83 ? 289  GLU D CD  1 
ATOM   9789  O  OE1 . GLU D 1 246 ? 17.640  53.857  35.544  1.00 27.80 ? 289  GLU D OE1 1 
ATOM   9790  O  OE2 . GLU D 1 246 ? 16.791  52.019  36.379  1.00 26.21 ? 289  GLU D OE2 1 
ATOM   9791  N  N   . PRO D 1 247 ? 17.855  54.993  30.467  1.00 27.25 ? 290  PRO D N   1 
ATOM   9792  C  CA  . PRO D 1 247 ? 18.796  56.043  30.796  1.00 26.13 ? 290  PRO D CA  1 
ATOM   9793  C  C   . PRO D 1 247 ? 17.889  57.220  30.816  1.00 26.95 ? 290  PRO D C   1 
ATOM   9794  O  O   . PRO D 1 247 ? 17.094  57.367  29.903  1.00 27.09 ? 290  PRO D O   1 
ATOM   9795  C  CB  . PRO D 1 247 ? 19.781  56.028  29.653  1.00 24.98 ? 290  PRO D CB  1 
ATOM   9796  C  CG  . PRO D 1 247 ? 19.863  54.550  29.338  1.00 24.66 ? 290  PRO D CG  1 
ATOM   9797  C  CD  . PRO D 1 247 ? 18.713  53.886  30.032  1.00 26.37 ? 290  PRO D CD  1 
ATOM   9798  N  N   . GLU D 1 248 ? 17.968  58.078  31.760  1.00 27.34 ? 291  GLU D N   1 
ATOM   9799  C  CA  . GLU D 1 248 ? 17.039  59.146  31.756  1.00 27.97 ? 291  GLU D CA  1 
ATOM   9800  C  C   . GLU D 1 248 ? 16.917  59.849  30.401  1.00 28.29 ? 291  GLU D C   1 
ATOM   9801  O  O   . GLU D 1 248 ? 15.884  60.418  30.057  1.00 26.27 ? 291  GLU D O   1 
ATOM   9802  C  CB  . GLU D 1 248 ? 17.418  60.120  32.855  1.00 27.43 ? 291  GLU D CB  1 
ATOM   9803  C  CG  . GLU D 1 248 ? 16.512  61.329  32.909  1.00 26.23 ? 291  GLU D CG  1 
ATOM   9804  C  CD  . GLU D 1 248 ? 15.077  60.890  33.013  1.00 25.89 ? 291  GLU D CD  1 
ATOM   9805  O  OE1 . GLU D 1 248 ? 14.784  60.034  33.869  1.00 26.01 ? 291  GLU D OE1 1 
ATOM   9806  O  OE2 . GLU D 1 248 ? 14.245  61.401  32.236  1.00 26.29 ? 291  GLU D OE2 1 
ATOM   9807  N  N   . GLU D 1 249 ? 18.008  59.809  29.639  1.00 29.42 ? 292  GLU D N   1 
ATOM   9808  C  CA  . GLU D 1 249 ? 18.061  60.474  28.338  1.00 30.86 ? 292  GLU D CA  1 
ATOM   9809  C  C   . GLU D 1 249 ? 17.076  59.888  27.339  1.00 33.08 ? 292  GLU D C   1 
ATOM   9810  O  O   . GLU D 1 249 ? 16.816  60.507  26.305  1.00 33.65 ? 292  GLU D O   1 
ATOM   9811  C  CB  . GLU D 1 249 ? 19.465  60.375  27.765  1.00 28.86 ? 292  GLU D CB  1 
ATOM   9812  C  CG  . GLU D 1 249 ? 20.555  60.434  28.805  1.00 27.94 ? 292  GLU D CG  1 
ATOM   9813  C  CD  . GLU D 1 249 ? 21.349  59.157  28.827  1.00 27.81 ? 292  GLU D CD  1 
ATOM   9814  O  OE1 . GLU D 1 249 ? 21.908  58.807  27.763  1.00 27.55 ? 292  GLU D OE1 1 
ATOM   9815  O  OE2 . GLU D 1 249 ? 21.408  58.501  29.891  1.00 27.47 ? 292  GLU D OE2 1 
ATOM   9816  N  N   . LEU D 1 250 ? 16.547  58.692  27.631  1.00 33.43 ? 293  LEU D N   1 
ATOM   9817  C  CA  . LEU D 1 250 ? 15.571  58.044  26.744  1.00 33.12 ? 293  LEU D CA  1 
ATOM   9818  C  C   . LEU D 1 250 ? 14.278  58.830  26.842  1.00 34.21 ? 293  LEU D C   1 
ATOM   9819  O  O   . LEU D 1 250 ? 13.471  58.854  25.912  1.00 35.00 ? 293  LEU D O   1 
ATOM   9820  C  CB  . LEU D 1 250 ? 15.313  56.585  27.158  1.00 30.48 ? 293  LEU D CB  1 
ATOM   9821  C  CG  . LEU D 1 250 ? 16.231  55.477  26.630  1.00 27.10 ? 293  LEU D CG  1 
ATOM   9822  C  CD1 . LEU D 1 250 ? 15.788  54.106  27.144  1.00 25.52 ? 293  LEU D CD1 1 
ATOM   9823  C  CD2 . LEU D 1 250 ? 16.253  55.479  25.095  1.00 23.97 ? 293  LEU D CD2 1 
ATOM   9824  N  N   . ASN D 1 251 ? 14.134  59.453  27.984  1.00 35.64 ? 294  ASN D N   1 
ATOM   9825  C  CA  . ASN D 1 251 ? 12.984  60.288  28.252  1.00 37.13 ? 294  ASN D CA  1 
ATOM   9826  C  C   . ASN D 1 251 ? 13.273  61.706  27.758  1.00 39.71 ? 294  ASN D C   1 
ATOM   9827  O  O   . ASN D 1 251 ? 13.295  62.653  28.542  1.00 40.38 ? 294  ASN D O   1 
ATOM   9828  C  CB  . ASN D 1 251 ? 12.619  60.271  29.755  1.00 33.87 ? 294  ASN D CB  1 
ATOM   9829  C  CG  . ASN D 1 251 ? 12.345  58.872  30.276  1.00 29.99 ? 294  ASN D CG  1 
ATOM   9830  O  OD1 . ASN D 1 251 ? 13.241  58.038  30.328  1.00 26.97 ? 294  ASN D OD1 1 
ATOM   9831  N  ND2 . ASN D 1 251 ? 11.097  58.609  30.645  1.00 29.33 ? 294  ASN D ND2 1 
ATOM   9832  N  N   . GLN D 1 252 ? 13.522  61.834  26.475  1.00 42.20 ? 295  GLN D N   1 
ATOM   9833  C  CA  . GLN D 1 252 ? 13.832  63.158  25.939  1.00 44.72 ? 295  GLN D CA  1 
ATOM   9834  C  C   . GLN D 1 252 ? 13.037  63.450  24.655  1.00 45.59 ? 295  GLN D C   1 
ATOM   9835  O  O   . GLN D 1 252 ? 13.565  63.312  23.549  1.00 46.15 ? 295  GLN D O   1 
ATOM   9836  C  CB  . GLN D 1 252 ? 15.336  63.281  25.629  1.00 45.43 ? 295  GLN D CB  1 
ATOM   9837  C  CG  . GLN D 1 252 ? 16.265  63.466  26.829  1.00 47.44 ? 295  GLN D CG  1 
ATOM   9838  C  CD  . GLN D 1 252 ? 16.086  64.848  27.447  1.00 47.79 ? 295  GLN D CD  1 
ATOM   9839  O  OE1 . GLN D 1 252 ? 15.156  65.046  28.236  1.00 47.18 ? 295  GLN D OE1 1 
ATOM   9840  N  NE2 . GLN D 1 252 ? 16.834  65.912  27.242  1.00 46.80 ? 295  GLN D NE2 1 
ATOM   9841  N  N   . THR D 1 253 ? 11.777  63.859  24.792  1.00 45.95 ? 296  THR D N   1 
ATOM   9842  C  CA  . THR D 1 253 ? 10.958  64.175  23.619  1.00 46.74 ? 296  THR D CA  1 
ATOM   9843  C  C   . THR D 1 253 ? 10.051  65.353  23.937  1.00 46.48 ? 296  THR D C   1 
ATOM   9844  O  O   . THR D 1 253 ? 9.970   65.786  25.086  1.00 46.87 ? 296  THR D O   1 
ATOM   9845  C  CB  . THR D 1 253 ? 10.054  62.984  23.186  1.00 48.16 ? 296  THR D CB  1 
ATOM   9846  O  OG1 . THR D 1 253 ? 8.903   62.921  24.041  1.00 48.00 ? 296  THR D OG1 1 
ATOM   9847  C  CG2 . THR D 1 253 ? 10.827  61.653  23.250  1.00 47.67 ? 296  THR D CG2 1 
ATOM   9848  N  N   . GLU D 1 254 ? 9.371   65.870  22.919  1.00 46.32 ? 297  GLU D N   1 
ATOM   9849  C  CA  . GLU D 1 254 ? 8.465   66.990  23.116  1.00 45.90 ? 297  GLU D CA  1 
ATOM   9850  C  C   . GLU D 1 254 ? 7.037   66.497  23.112  1.00 46.57 ? 297  GLU D C   1 
ATOM   9851  O  O   . GLU D 1 254 ? 6.101   67.255  22.844  1.00 46.92 ? 297  GLU D O   1 
ATOM   9852  C  CB  . GLU D 1 254 ? 8.667   68.059  22.038  1.00 45.39 ? 297  GLU D CB  1 
ATOM   9853  C  CG  . GLU D 1 254 ? 9.401   69.288  22.557  1.00 45.06 ? 297  GLU D CG  1 
ATOM   9854  C  CD  . GLU D 1 254 ? 8.628   70.014  23.658  1.00 44.44 ? 297  GLU D CD  1 
ATOM   9855  O  OE1 . GLU D 1 254 ? 7.945   71.014  23.345  1.00 43.53 ? 297  GLU D OE1 1 
ATOM   9856  O  OE2 . GLU D 1 254 ? 8.694   69.582  24.834  1.00 42.92 ? 297  GLU D OE2 1 
ATOM   9857  N  N   . GLN D 1 255 ? 6.883   65.210  23.412  1.00 46.52 ? 298  GLN D N   1 
ATOM   9858  C  CA  . GLN D 1 255 ? 5.572   64.579  23.479  1.00 45.56 ? 298  GLN D CA  1 
ATOM   9859  C  C   . GLN D 1 255 ? 5.045   64.922  24.864  1.00 44.64 ? 298  GLN D C   1 
ATOM   9860  O  O   . GLN D 1 255 ? 5.623   64.514  25.872  1.00 44.32 ? 298  GLN D O   1 
ATOM   9861  C  CB  . GLN D 1 255 ? 5.707   63.057  23.325  1.00 46.44 ? 298  GLN D CB  1 
ATOM   9862  C  CG  . GLN D 1 255 ? 4.703   62.401  22.361  1.00 45.93 ? 298  GLN D CG  1 
ATOM   9863  C  CD  . GLN D 1 255 ? 5.378   61.776  21.140  1.00 45.10 ? 298  GLN D CD  1 
ATOM   9864  O  OE1 . GLN D 1 255 ? 6.076   62.459  20.390  1.00 45.46 ? 298  GLN D OE1 1 
ATOM   9865  N  NE2 . GLN D 1 255 ? 5.168   60.472  20.939  1.00 43.59 ? 298  GLN D NE2 1 
ATOM   9866  N  N   . THR D 1 256 ? 3.967   65.693  24.916  1.00 44.13 ? 299  THR D N   1 
ATOM   9867  C  CA  . THR D 1 256 ? 3.387   66.083  26.195  1.00 44.03 ? 299  THR D CA  1 
ATOM   9868  C  C   . THR D 1 256 ? 2.557   64.940  26.761  1.00 43.78 ? 299  THR D C   1 
ATOM   9869  O  O   . THR D 1 256 ? 2.809   64.468  27.874  1.00 43.72 ? 299  THR D O   1 
ATOM   9870  C  CB  . THR D 1 256 ? 2.493   67.339  26.045  1.00 44.44 ? 299  THR D CB  1 
ATOM   9871  O  OG1 . THR D 1 256 ? 3.311   68.472  25.720  1.00 44.19 ? 299  THR D OG1 1 
ATOM   9872  C  CG2 . THR D 1 256 ? 1.725   67.613  27.332  1.00 43.33 ? 299  THR D CG2 1 
ATOM   9873  N  N   . THR D 1 257 ? 1.571   64.494  25.985  1.00 43.54 ? 300  THR D N   1 
ATOM   9874  C  CA  . THR D 1 257 ? 0.701   63.398  26.398  1.00 43.33 ? 300  THR D CA  1 
ATOM   9875  C  C   . THR D 1 257 ? 0.718   62.254  25.373  1.00 43.09 ? 300  THR D C   1 
ATOM   9876  O  O   . THR D 1 257 ? 1.366   62.346  24.321  1.00 41.72 ? 300  THR D O   1 
ATOM   9877  C  CB  . THR D 1 257 ? -0.749  63.887  26.585  1.00 42.93 ? 300  THR D CB  1 
ATOM   9878  O  OG1 . THR D 1 257 ? -0.740  65.169  27.220  1.00 42.72 ? 300  THR D OG1 1 
ATOM   9879  C  CG2 . THR D 1 257 ? -1.527  62.920  27.470  1.00 43.80 ? 300  THR D CG2 1 
ATOM   9880  N  N   . TYR D 1 258 ? 0.009   61.173  25.691  1.00 42.20 ? 301  TYR D N   1 
ATOM   9881  C  CA  . TYR D 1 258 ? -0.059  60.012  24.812  1.00 41.19 ? 301  TYR D CA  1 
ATOM   9882  C  C   . TYR D 1 258 ? -1.431  59.346  24.873  1.00 40.75 ? 301  TYR D C   1 
ATOM   9883  O  O   . TYR D 1 258 ? -2.092  59.360  25.916  1.00 40.53 ? 301  TYR D O   1 
ATOM   9884  C  CB  . TYR D 1 258 ? 1.041   59.018  25.187  1.00 41.14 ? 301  TYR D CB  1 
ATOM   9885  C  CG  . TYR D 1 258 ? 1.107   58.672  26.659  1.00 41.21 ? 301  TYR D CG  1 
ATOM   9886  C  CD1 . TYR D 1 258 ? 0.101   57.926  27.267  1.00 42.02 ? 301  TYR D CD1 1 
ATOM   9887  C  CD2 . TYR D 1 258 ? 2.195   59.060  27.434  1.00 40.79 ? 301  TYR D CD2 1 
ATOM   9888  C  CE1 . TYR D 1 258 ? 0.182   57.571  28.607  1.00 42.27 ? 301  TYR D CE1 1 
ATOM   9889  C  CE2 . TYR D 1 258 ? 2.287   58.710  28.774  1.00 41.14 ? 301  TYR D CE2 1 
ATOM   9890  C  CZ  . TYR D 1 258 ? 1.281   57.965  29.354  1.00 41.74 ? 301  TYR D CZ  1 
ATOM   9891  O  OH  . TYR D 1 258 ? 1.380   57.593  30.672  1.00 41.14 ? 301  TYR D OH  1 
ATOM   9892  N  N   . GLU D 1 259 ? -1.845  58.752  23.754  1.00 39.98 ? 302  GLU D N   1 
ATOM   9893  C  CA  . GLU D 1 259 ? -3.158  58.107  23.644  1.00 38.63 ? 302  GLU D CA  1 
ATOM   9894  C  C   . GLU D 1 259 ? -3.336  56.697  24.222  1.00 37.05 ? 302  GLU D C   1 
ATOM   9895  O  O   . GLU D 1 259 ? -4.458  56.323  24.570  1.00 37.23 ? 302  GLU D O   1 
ATOM   9896  C  CB  . GLU D 1 259 ? -3.608  58.124  22.178  1.00 38.51 ? 302  GLU D CB  1 
ATOM   9897  C  CG  . GLU D 1 259 ? -4.070  59.498  21.704  1.00 39.87 ? 302  GLU D CG  1 
ATOM   9898  C  CD  . GLU D 1 259 ? -5.488  59.813  22.146  1.00 40.99 ? 302  GLU D CD  1 
ATOM   9899  O  OE1 . GLU D 1 259 ? -5.932  59.237  23.167  1.00 41.65 ? 302  GLU D OE1 1 
ATOM   9900  O  OE2 . GLU D 1 259 ? -6.157  60.635  21.480  1.00 40.18 ? 302  GLU D OE2 1 
ATOM   9901  N  N   . VAL D 1 260 ? -2.258  55.917  24.324  1.00 34.48 ? 303  VAL D N   1 
ATOM   9902  C  CA  . VAL D 1 260 ? -2.367  54.571  24.880  1.00 31.59 ? 303  VAL D CA  1 
ATOM   9903  C  C   . VAL D 1 260 ? -2.714  54.665  26.359  1.00 29.37 ? 303  VAL D C   1 
ATOM   9904  O  O   . VAL D 1 260 ? -2.345  55.632  27.026  1.00 29.48 ? 303  VAL D O   1 
ATOM   9905  C  CB  . VAL D 1 260 ? -1.064  53.774  24.712  1.00 32.13 ? 303  VAL D CB  1 
ATOM   9906  C  CG1 . VAL D 1 260 ? -1.079  52.551  25.616  1.00 31.40 ? 303  VAL D CG1 1 
ATOM   9907  C  CG2 . VAL D 1 260 ? -0.920  53.327  23.265  1.00 32.94 ? 303  VAL D CG2 1 
ATOM   9908  N  N   . GLU D 1 261 ? -3.416  53.661  26.873  1.00 25.72 ? 304  GLU D N   1 
ATOM   9909  C  CA  . GLU D 1 261 ? -3.831  53.686  28.263  1.00 22.75 ? 304  GLU D CA  1 
ATOM   9910  C  C   . GLU D 1 261 ? -3.261  52.554  29.100  1.00 22.19 ? 304  GLU D C   1 
ATOM   9911  O  O   . GLU D 1 261 ? -2.838  51.519  28.571  1.00 22.73 ? 304  GLU D O   1 
ATOM   9912  C  CB  . GLU D 1 261 ? -5.356  53.653  28.343  1.00 21.40 ? 304  GLU D CB  1 
ATOM   9913  C  CG  . GLU D 1 261 ? -6.031  54.352  27.191  1.00 19.91 ? 304  GLU D CG  1 
ATOM   9914  C  CD  . GLU D 1 261 ? -7.473  54.707  27.475  1.00 21.42 ? 304  GLU D CD  1 
ATOM   9915  O  OE1 . GLU D 1 261 ? -8.260  54.769  26.508  1.00 22.40 ? 304  GLU D OE1 1 
ATOM   9916  O  OE2 . GLU D 1 261 ? -7.824  54.946  28.652  1.00 21.74 ? 304  GLU D OE2 1 
ATOM   9917  N  N   . GLY D 1 262 ? -3.261  52.771  30.414  1.00 21.07 ? 305  GLY D N   1 
ATOM   9918  C  CA  . GLY D 1 262 ? -2.760  51.789  31.360  1.00 18.91 ? 305  GLY D CA  1 
ATOM   9919  C  C   . GLY D 1 262 ? -1.258  51.770  31.585  1.00 18.31 ? 305  GLY D C   1 
ATOM   9920  O  O   . GLY D 1 262 ? -0.791  51.231  32.589  1.00 16.21 ? 305  GLY D O   1 
ATOM   9921  N  N   . ILE D 1 263 ? -0.509  52.359  30.651  1.00 20.40 ? 306  ILE D N   1 
ATOM   9922  C  CA  . ILE D 1 263 ? 0.957   52.403  30.709  1.00 21.42 ? 306  ILE D CA  1 
ATOM   9923  C  C   . ILE D 1 263 ? 1.478   53.816  30.940  1.00 22.82 ? 306  ILE D C   1 
ATOM   9924  O  O   . ILE D 1 263 ? 0.750   54.784  30.753  1.00 24.43 ? 306  ILE D O   1 
ATOM   9925  C  CB  . ILE D 1 263 ? 1.597   51.896  29.387  1.00 20.94 ? 306  ILE D CB  1 
ATOM   9926  C  CG1 . ILE D 1 263 ? 1.338   52.884  28.256  1.00 18.25 ? 306  ILE D CG1 1 
ATOM   9927  C  CG2 . ILE D 1 263 ? 0.983   50.585  28.962  1.00 22.04 ? 306  ILE D CG2 1 
ATOM   9928  C  CD1 . ILE D 1 263 ? 2.085   52.522  27.007  1.00 16.43 ? 306  ILE D CD1 1 
ATOM   9929  N  N   . GLY D 1 264 ? 2.743   53.924  31.371  1.00 23.03 ? 307  GLY D N   1 
ATOM   9930  C  CA  . GLY D 1 264 ? 3.384   55.227  31.569  1.00 23.91 ? 307  GLY D CA  1 
ATOM   9931  C  C   . GLY D 1 264 ? 2.893   56.047  32.770  1.00 24.19 ? 307  GLY D C   1 
ATOM   9932  O  O   . GLY D 1 264 ? 1.692   56.198  33.000  1.00 23.67 ? 307  GLY D O   1 
ATOM   9933  N  N   . TYR D 1 265 ? 3.851   56.554  33.542  1.00 24.59 ? 308  TYR D N   1 
ATOM   9934  C  CA  . TYR D 1 265 ? 3.507   57.377  34.693  1.00 25.48 ? 308  TYR D CA  1 
ATOM   9935  C  C   . TYR D 1 265 ? 4.398   58.613  34.868  1.00 25.41 ? 308  TYR D C   1 
ATOM   9936  O  O   . TYR D 1 265 ? 5.600   58.589  34.565  1.00 24.09 ? 308  TYR D O   1 
ATOM   9937  C  CB  . TYR D 1 265 ? 3.525   56.543  35.971  1.00 26.09 ? 308  TYR D CB  1 
ATOM   9938  C  CG  . TYR D 1 265 ? 2.627   57.121  37.037  1.00 27.21 ? 308  TYR D CG  1 
ATOM   9939  C  CD1 . TYR D 1 265 ? 1.303   57.452  36.743  1.00 25.88 ? 308  TYR D CD1 1 
ATOM   9940  C  CD2 . TYR D 1 265 ? 3.091   57.333  38.344  1.00 28.46 ? 308  TYR D CD2 1 
ATOM   9941  C  CE1 . TYR D 1 265 ? 0.463   57.978  37.715  1.00 26.54 ? 308  TYR D CE1 1 
ATOM   9942  C  CE2 . TYR D 1 265 ? 2.253   57.858  39.301  1.00 25.68 ? 308  TYR D CE2 1 
ATOM   9943  C  CZ  . TYR D 1 265 ? 0.941   58.177  39.003  1.00 25.96 ? 308  TYR D CZ  1 
ATOM   9944  O  OH  . TYR D 1 265 ? 0.121   58.706  39.973  1.00 27.09 ? 308  TYR D OH  1 
ATOM   9945  N  N   . ASP D 1 266 ? 3.776   59.689  35.360  1.00 26.68 ? 309  ASP D N   1 
ATOM   9946  C  CA  . ASP D 1 266 ? 4.429   60.984  35.572  1.00 26.64 ? 309  ASP D CA  1 
ATOM   9947  C  C   . ASP D 1 266 ? 5.425   60.938  36.730  1.00 25.66 ? 309  ASP D C   1 
ATOM   9948  O  O   . ASP D 1 266 ? 6.285   61.811  36.872  1.00 24.46 ? 309  ASP D O   1 
ATOM   9949  C  CB  . ASP D 1 266 ? 3.374   62.050  35.901  1.00 27.30 ? 309  ASP D CB  1 
ATOM   9950  C  CG  . ASP D 1 266 ? 2.615   61.769  37.195  1.00 29.73 ? 309  ASP D CG  1 
ATOM   9951  O  OD1 . ASP D 1 266 ? 2.939   60.770  37.878  1.00 27.68 ? 309  ASP D OD1 1 
ATOM   9952  O  OD2 . ASP D 1 266 ? 1.699   62.551  37.536  1.00 29.91 ? 309  ASP D OD2 1 
ATOM   9953  N  N   . PHE D 1 267 ? 5.291   59.907  37.574  1.00 26.85 ? 310  PHE D N   1 
ATOM   9954  C  CA  . PHE D 1 267 ? 6.099   59.879  38.844  1.00 29.05 ? 310  PHE D CA  1 
ATOM   9955  C  C   . PHE D 1 267 ? 7.015   58.732  39.229  1.00 28.09 ? 310  PHE D C   1 
ATOM   9956  O  O   . PHE D 1 267 ? 7.838   58.972  40.129  1.00 28.82 ? 310  PHE D O   1 
ATOM   9957  C  CB  . PHE D 1 267 ? 5.207   59.854  40.101  1.00 30.70 ? 310  PHE D CB  1 
ATOM   9958  C  CG  . PHE D 1 267 ? 4.533   61.112  40.531  1.00 32.02 ? 310  PHE D CG  1 
ATOM   9959  C  CD1 . PHE D 1 267 ? 3.428   61.018  41.347  1.00 33.71 ? 310  PHE D CD1 1 
ATOM   9960  C  CD2 . PHE D 1 267 ? 4.948   62.361  40.131  1.00 32.18 ? 310  PHE D CD2 1 
ATOM   9961  C  CE1 . PHE D 1 267 ? 2.738   62.159  41.760  1.00 33.72 ? 310  PHE D CE1 1 
ATOM   9962  C  CE2 . PHE D 1 267 ? 4.272   63.502  40.503  1.00 32.82 ? 310  PHE D CE2 1 
ATOM   9963  C  CZ  . PHE D 1 267 ? 3.164   63.401  41.318  1.00 33.22 ? 310  PHE D CZ  1 
ATOM   9964  N  N   . ILE D 1 268 ? 6.976   57.527  38.721  1.00 26.90 ? 311  ILE D N   1 
ATOM   9965  C  CA  . ILE D 1 268 ? 7.927   56.564  39.332  1.00 27.02 ? 311  ILE D CA  1 
ATOM   9966  C  C   . ILE D 1 268 ? 7.345   55.948  40.586  1.00 26.66 ? 311  ILE D C   1 
ATOM   9967  O  O   . ILE D 1 268 ? 7.706   56.312  41.707  1.00 26.96 ? 311  ILE D O   1 
ATOM   9968  C  CB  . ILE D 1 268 ? 9.199   57.201  39.847  1.00 27.22 ? 311  ILE D CB  1 
ATOM   9969  C  CG1 . ILE D 1 268 ? 9.339   58.647  39.376  1.00 28.04 ? 311  ILE D CG1 1 
ATOM   9970  C  CG2 . ILE D 1 268 ? 10.401  56.378  39.424  1.00 24.99 ? 311  ILE D CG2 1 
ATOM   9971  C  CD1 . ILE D 1 268 ? 9.983   59.563  40.396  1.00 30.15 ? 311  ILE D CD1 1 
ATOM   9972  N  N   . PRO D 1 269 ? 6.391   54.993  40.403  1.00 25.06 ? 312  PRO D N   1 
ATOM   9973  C  CA  . PRO D 1 269 ? 5.822   54.209  41.539  1.00 24.01 ? 312  PRO D CA  1 
ATOM   9974  C  C   . PRO D 1 269 ? 6.771   53.418  42.440  1.00 22.97 ? 312  PRO D C   1 
ATOM   9975  O  O   . PRO D 1 269 ? 7.865   53.028  42.020  1.00 23.68 ? 312  PRO D O   1 
ATOM   9976  C  CB  . PRO D 1 269 ? 4.748   53.390  40.866  1.00 24.63 ? 312  PRO D CB  1 
ATOM   9977  C  CG  . PRO D 1 269 ? 4.221   54.384  39.885  1.00 23.57 ? 312  PRO D CG  1 
ATOM   9978  C  CD  . PRO D 1 269 ? 5.280   55.388  39.564  1.00 24.07 ? 312  PRO D CD  1 
ATOM   9979  N  N   . THR D 1 270 ? 6.347   53.200  43.695  1.00 22.20 ? 313  THR D N   1 
ATOM   9980  C  CA  . THR D 1 270 ? 7.153   52.450  44.650  1.00 22.64 ? 313  THR D CA  1 
ATOM   9981  C  C   . THR D 1 270 ? 7.127   50.946  44.383  1.00 23.38 ? 313  THR D C   1 
ATOM   9982  O  O   . THR D 1 270 ? 8.043   50.231  44.783  1.00 22.18 ? 313  THR D O   1 
ATOM   9983  C  CB  . THR D 1 270 ? 6.677   52.680  46.084  1.00 21.70 ? 313  THR D CB  1 
ATOM   9984  O  OG1 . THR D 1 270 ? 6.847   51.465  46.821  1.00 23.04 ? 313  THR D OG1 1 
ATOM   9985  C  CG2 . THR D 1 270 ? 5.224   53.105  46.085  1.00 21.82 ? 313  THR D CG2 1 
ATOM   9986  N  N   . VAL D 1 271 ? 6.066   50.499  43.721  1.00 22.50 ? 314  VAL D N   1 
ATOM   9987  C  CA  . VAL D 1 271 ? 5.960   49.097  43.392  1.00 21.98 ? 314  VAL D CA  1 
ATOM   9988  C  C   . VAL D 1 271 ? 6.852   48.821  42.192  1.00 21.64 ? 314  VAL D C   1 
ATOM   9989  O  O   . VAL D 1 271 ? 7.164   47.665  41.920  1.00 22.18 ? 314  VAL D O   1 
ATOM   9990  C  CB  . VAL D 1 271 ? 4.522   48.694  43.055  1.00 21.57 ? 314  VAL D CB  1 
ATOM   9991  C  CG1 . VAL D 1 271 ? 3.611   49.062  44.197  1.00 22.31 ? 314  VAL D CG1 1 
ATOM   9992  C  CG2 . VAL D 1 271 ? 4.077   49.372  41.780  1.00 22.78 ? 314  VAL D CG2 1 
ATOM   9993  N  N   . LEU D 1 272 ? 7.266   49.875  41.482  1.00 20.77 ? 315  LEU D N   1 
ATOM   9994  C  CA  . LEU D 1 272 ? 8.138   49.698  40.318  1.00 21.02 ? 315  LEU D CA  1 
ATOM   9995  C  C   . LEU D 1 272 ? 9.607   49.629  40.699  1.00 21.93 ? 315  LEU D C   1 
ATOM   9996  O  O   . LEU D 1 272 ? 10.157  50.560  41.281  1.00 22.58 ? 315  LEU D O   1 
ATOM   9997  C  CB  . LEU D 1 272 ? 7.961   50.808  39.274  1.00 19.64 ? 315  LEU D CB  1 
ATOM   9998  C  CG  . LEU D 1 272 ? 9.023   50.694  38.160  1.00 18.79 ? 315  LEU D CG  1 
ATOM   9999  C  CD1 . LEU D 1 272 ? 8.828   49.400  37.390  1.00 18.53 ? 315  LEU D CD1 1 
ATOM   10000 C  CD2 . LEU D 1 272 ? 8.965   51.895  37.227  1.00 18.66 ? 315  LEU D CD2 1 
ATOM   10001 N  N   . ASP D 1 273 ? 10.228  48.514  40.327  1.00 22.58 ? 316  ASP D N   1 
ATOM   10002 C  CA  . ASP D 1 273 ? 11.619  48.245  40.605  1.00 21.90 ? 316  ASP D CA  1 
ATOM   10003 C  C   . ASP D 1 273 ? 12.497  48.264  39.363  1.00 21.25 ? 316  ASP D C   1 
ATOM   10004 O  O   . ASP D 1 273 ? 12.679  47.255  38.690  1.00 21.95 ? 316  ASP D O   1 
ATOM   10005 C  CB  . ASP D 1 273 ? 11.733  46.896  41.293  1.00 22.38 ? 316  ASP D CB  1 
ATOM   10006 C  CG  . ASP D 1 273 ? 13.170  46.466  41.490  1.00 26.69 ? 316  ASP D CG  1 
ATOM   10007 O  OD1 . ASP D 1 273 ? 13.370  45.377  42.079  1.00 29.47 ? 316  ASP D OD1 1 
ATOM   10008 O  OD2 . ASP D 1 273 ? 14.095  47.209  41.063  1.00 25.52 ? 316  ASP D OD2 1 
ATOM   10009 N  N   . ARG D 1 274 ? 13.068  49.415  39.083  1.00 20.57 ? 317  ARG D N   1 
ATOM   10010 C  CA  . ARG D 1 274 ? 13.926  49.572  37.931  1.00 19.71 ? 317  ARG D CA  1 
ATOM   10011 C  C   . ARG D 1 274 ? 15.177  48.684  37.935  1.00 18.41 ? 317  ARG D C   1 
ATOM   10012 O  O   . ARG D 1 274 ? 15.954  48.707  36.990  1.00 18.35 ? 317  ARG D O   1 
ATOM   10013 C  CB  . ARG D 1 274 ? 14.307  51.046  37.854  1.00 21.02 ? 317  ARG D CB  1 
ATOM   10014 C  CG  . ARG D 1 274 ? 13.142  51.953  38.240  1.00 22.82 ? 317  ARG D CG  1 
ATOM   10015 C  CD  . ARG D 1 274 ? 12.725  52.883  37.099  1.00 25.02 ? 317  ARG D CD  1 
ATOM   10016 N  NE  . ARG D 1 274 ? 13.517  54.114  37.039  1.00 25.29 ? 317  ARG D NE  1 
ATOM   10017 C  CZ  . ARG D 1 274 ? 13.035  55.334  37.270  1.00 24.15 ? 317  ARG D CZ  1 
ATOM   10018 N  NH1 . ARG D 1 274 ? 11.760  55.521  37.569  1.00 24.77 ? 317  ARG D NH1 1 
ATOM   10019 N  NH2 . ARG D 1 274 ? 13.850  56.370  37.251  1.00 24.61 ? 317  ARG D NH2 1 
ATOM   10020 N  N   . THR D 1 275 ? 15.384  47.920  38.998  1.00 18.72 ? 318  THR D N   1 
ATOM   10021 C  CA  . THR D 1 275 ? 16.554  47.049  39.091  1.00 20.54 ? 318  THR D CA  1 
ATOM   10022 C  C   . THR D 1 275 ? 16.397  45.715  38.359  1.00 22.14 ? 318  THR D C   1 
ATOM   10023 O  O   . THR D 1 275 ? 17.302  45.293  37.642  1.00 22.94 ? 318  THR D O   1 
ATOM   10024 C  CB  . THR D 1 275 ? 16.879  46.708  40.540  1.00 20.90 ? 318  THR D CB  1 
ATOM   10025 O  OG1 . THR D 1 275 ? 16.841  47.901  41.317  1.00 23.44 ? 318  THR D OG1 1 
ATOM   10026 C  CG2 . THR D 1 275 ? 18.269  46.077  40.656  1.00 20.01 ? 318  THR D CG2 1 
ATOM   10027 N  N   . VAL D 1 276 ? 15.264  45.047  38.566  1.00 22.27 ? 319  VAL D N   1 
ATOM   10028 C  CA  . VAL D 1 276 ? 14.992  43.763  37.935  1.00 21.42 ? 319  VAL D CA  1 
ATOM   10029 C  C   . VAL D 1 276 ? 14.675  43.962  36.454  1.00 21.00 ? 319  VAL D C   1 
ATOM   10030 O  O   . VAL D 1 276 ? 14.296  43.014  35.758  1.00 20.20 ? 319  VAL D O   1 
ATOM   10031 C  CB  . VAL D 1 276 ? 13.816  43.076  38.630  1.00 21.99 ? 319  VAL D CB  1 
ATOM   10032 C  CG1 . VAL D 1 276 ? 14.232  42.608  40.003  1.00 19.04 ? 319  VAL D CG1 1 
ATOM   10033 C  CG2 . VAL D 1 276 ? 12.664  44.050  38.768  1.00 21.04 ? 319  VAL D CG2 1 
ATOM   10034 N  N   . VAL D 1 277 ? 14.825  45.211  35.997  1.00 19.07 ? 320  VAL D N   1 
ATOM   10035 C  CA  . VAL D 1 277 ? 14.605  45.597  34.600  1.00 17.56 ? 320  VAL D CA  1 
ATOM   10036 C  C   . VAL D 1 277 ? 15.964  45.887  33.958  1.00 18.03 ? 320  VAL D C   1 
ATOM   10037 O  O   . VAL D 1 277 ? 16.643  46.859  34.316  1.00 16.48 ? 320  VAL D O   1 
ATOM   10038 C  CB  . VAL D 1 277 ? 13.728  46.851  34.471  1.00 16.26 ? 320  VAL D CB  1 
ATOM   10039 C  CG1 . VAL D 1 277 ? 13.668  47.271  33.047  1.00 18.72 ? 320  VAL D CG1 1 
ATOM   10040 C  CG2 . VAL D 1 277 ? 12.333  46.567  34.925  1.00 16.83 ? 320  VAL D CG2 1 
ATOM   10041 N  N   . ASP D 1 278 ? 16.333  45.040  32.996  1.00 18.25 ? 321  ASP D N   1 
ATOM   10042 C  CA  . ASP D 1 278 ? 17.611  45.115  32.297  1.00 18.56 ? 321  ASP D CA  1 
ATOM   10043 C  C   . ASP D 1 278 ? 17.735  45.927  31.008  1.00 19.68 ? 321  ASP D C   1 
ATOM   10044 O  O   . ASP D 1 278 ? 18.836  46.079  30.493  1.00 21.21 ? 321  ASP D O   1 
ATOM   10045 C  CB  . ASP D 1 278 ? 18.089  43.698  32.036  1.00 18.72 ? 321  ASP D CB  1 
ATOM   10046 C  CG  . ASP D 1 278 ? 18.295  42.921  33.315  1.00 21.65 ? 321  ASP D CG  1 
ATOM   10047 O  OD1 . ASP D 1 278 ? 18.436  41.681  33.249  1.00 22.92 ? 321  ASP D OD1 1 
ATOM   10048 O  OD2 . ASP D 1 278 ? 18.321  43.552  34.395  1.00 22.52 ? 321  ASP D OD2 1 
ATOM   10049 N  N   . LYS D 1 279 ? 16.627  46.435  30.477  1.00 19.47 ? 322  LYS D N   1 
ATOM   10050 C  CA  . LYS D 1 279 ? 16.659  47.238  29.255  1.00 18.59 ? 322  LYS D CA  1 
ATOM   10051 C  C   . LYS D 1 279 ? 15.305  47.902  29.118  1.00 19.33 ? 322  LYS D C   1 
ATOM   10052 O  O   . LYS D 1 279 ? 14.304  47.373  29.593  1.00 20.91 ? 322  LYS D O   1 
ATOM   10053 C  CB  . LYS D 1 279 ? 16.943  46.356  28.038  1.00 18.96 ? 322  LYS D CB  1 
ATOM   10054 C  CG  . LYS D 1 279 ? 17.142  47.112  26.710  1.00 20.53 ? 322  LYS D CG  1 
ATOM   10055 C  CD  . LYS D 1 279 ? 18.008  46.290  25.744  1.00 18.17 ? 322  LYS D CD  1 
ATOM   10056 C  CE  . LYS D 1 279 ? 18.287  47.005  24.422  1.00 19.10 ? 322  LYS D CE  1 
ATOM   10057 N  NZ  . LYS D 1 279 ? 19.274  46.245  23.571  1.00 17.09 ? 322  LYS D NZ  1 
ATOM   10058 N  N   . TRP D 1 280 ? 15.274  49.083  28.512  1.00 18.82 ? 323  TRP D N   1 
ATOM   10059 C  CA  . TRP D 1 280 ? 14.012  49.794  28.336  1.00 18.26 ? 323  TRP D CA  1 
ATOM   10060 C  C   . TRP D 1 280 ? 13.910  50.235  26.902  1.00 18.61 ? 323  TRP D C   1 
ATOM   10061 O  O   . TRP D 1 280 ? 14.919  50.414  26.222  1.00 19.13 ? 323  TRP D O   1 
ATOM   10062 C  CB  . TRP D 1 280 ? 13.890  51.036  29.252  1.00 15.38 ? 323  TRP D CB  1 
ATOM   10063 C  CG  . TRP D 1 280 ? 13.673  50.736  30.718  1.00 13.94 ? 323  TRP D CG  1 
ATOM   10064 C  CD1 . TRP D 1 280 ? 14.584  50.211  31.588  1.00 13.71 ? 323  TRP D CD1 1 
ATOM   10065 C  CD2 . TRP D 1 280 ? 12.458  50.914  31.471  1.00 11.62 ? 323  TRP D CD2 1 
ATOM   10066 N  NE1 . TRP D 1 280 ? 14.015  50.045  32.834  1.00 14.45 ? 323  TRP D NE1 1 
ATOM   10067 C  CE2 . TRP D 1 280 ? 12.712  50.466  32.790  1.00 12.23 ? 323  TRP D CE2 1 
ATOM   10068 C  CE3 . TRP D 1 280 ? 11.184  51.400  31.160  1.00 10.30 ? 323  TRP D CE3 1 
ATOM   10069 C  CZ2 . TRP D 1 280 ? 11.740  50.490  33.795  1.00 10.86 ? 323  TRP D CZ2 1 
ATOM   10070 C  CZ3 . TRP D 1 280 ? 10.212  51.422  32.168  1.00 11.18 ? 323  TRP D CZ3 1 
ATOM   10071 C  CH2 . TRP D 1 280 ? 10.501  50.969  33.466  1.00 11.30 ? 323  TRP D CH2 1 
ATOM   10072 N  N   . PHE D 1 281 ? 12.674  50.390  26.450  1.00 19.15 ? 324  PHE D N   1 
ATOM   10073 C  CA  . PHE D 1 281 ? 12.390  50.826  25.102  1.00 19.88 ? 324  PHE D CA  1 
ATOM   10074 C  C   . PHE D 1 281 ? 11.295  51.853  25.220  1.00 22.43 ? 324  PHE D C   1 
ATOM   10075 O  O   . PHE D 1 281 ? 10.379  51.697  26.030  1.00 24.12 ? 324  PHE D O   1 
ATOM   10076 C  CB  . PHE D 1 281 ? 11.884  49.669  24.246  1.00 17.79 ? 324  PHE D CB  1 
ATOM   10077 C  CG  . PHE D 1 281 ? 12.970  48.873  23.586  1.00 15.05 ? 324  PHE D CG  1 
ATOM   10078 C  CD1 . PHE D 1 281 ? 13.407  47.676  24.139  1.00 14.26 ? 324  PHE D CD1 1 
ATOM   10079 C  CD2 . PHE D 1 281 ? 13.542  49.317  22.405  1.00 13.76 ? 324  PHE D CD2 1 
ATOM   10080 C  CE1 . PHE D 1 281 ? 14.387  46.945  23.528  1.00 13.82 ? 324  PHE D CE1 1 
ATOM   10081 C  CE2 . PHE D 1 281 ? 14.527  48.587  21.785  1.00 12.38 ? 324  PHE D CE2 1 
ATOM   10082 C  CZ  . PHE D 1 281 ? 14.951  47.399  22.345  1.00 14.13 ? 324  PHE D CZ  1 
ATOM   10083 N  N   . LYS D 1 282 ? 11.386  52.900  24.414  1.00 23.55 ? 325  LYS D N   1 
ATOM   10084 C  CA  . LYS D 1 282 ? 10.382  53.948  24.431  1.00 25.14 ? 325  LYS D CA  1 
ATOM   10085 C  C   . LYS D 1 282 ? 9.293   53.585  23.442  1.00 24.99 ? 325  LYS D C   1 
ATOM   10086 O  O   . LYS D 1 282 ? 9.584   53.310  22.292  1.00 26.94 ? 325  LYS D O   1 
ATOM   10087 C  CB  . LYS D 1 282 ? 11.023  55.283  24.051  1.00 26.66 ? 325  LYS D CB  1 
ATOM   10088 C  CG  . LYS D 1 282 ? 12.173  55.684  24.968  1.00 27.31 ? 325  LYS D CG  1 
ATOM   10089 C  CD  . LYS D 1 282 ? 11.738  55.746  26.428  1.00 27.45 ? 325  LYS D CD  1 
ATOM   10090 C  CE  . LYS D 1 282 ? 10.877  56.967  26.704  1.00 28.01 ? 325  LYS D CE  1 
ATOM   10091 N  NZ  . LYS D 1 282 ? 9.669   57.037  25.843  1.00 31.11 ? 325  LYS D NZ  1 
ATOM   10092 N  N   . SER D 1 283 ? 8.045   53.586  23.893  1.00 25.64 ? 326  SER D N   1 
ATOM   10093 C  CA  . SER D 1 283 ? 6.916   53.230  23.036  1.00 25.90 ? 326  SER D CA  1 
ATOM   10094 C  C   . SER D 1 283 ? 6.447   54.427  22.240  1.00 25.56 ? 326  SER D C   1 
ATOM   10095 O  O   . SER D 1 283 ? 7.001   55.511  22.346  1.00 25.41 ? 326  SER D O   1 
ATOM   10096 C  CB  . SER D 1 283 ? 5.734   52.717  23.874  1.00 28.21 ? 326  SER D CB  1 
ATOM   10097 O  OG  . SER D 1 283 ? 4.832   53.773  24.171  1.00 28.01 ? 326  SER D OG  1 
ATOM   10098 N  N   . ASN D 1 284 ? 5.405   54.223  21.449  1.00 25.31 ? 327  ASN D N   1 
ATOM   10099 C  CA  . ASN D 1 284 ? 4.855   55.300  20.656  1.00 26.28 ? 327  ASN D CA  1 
ATOM   10100 C  C   . ASN D 1 284 ? 3.413   55.002  20.298  1.00 26.51 ? 327  ASN D C   1 
ATOM   10101 O  O   . ASN D 1 284 ? 3.025   53.863  20.024  1.00 27.13 ? 327  ASN D O   1 
ATOM   10102 C  CB  . ASN D 1 284 ? 5.700   55.513  19.397  1.00 28.42 ? 327  ASN D CB  1 
ATOM   10103 C  CG  . ASN D 1 284 ? 4.933   56.219  18.291  1.00 29.88 ? 327  ASN D CG  1 
ATOM   10104 O  OD1 . ASN D 1 284 ? 4.182   57.166  18.537  1.00 31.22 ? 327  ASN D OD1 1 
ATOM   10105 N  ND2 . ASN D 1 284 ? 5.124   55.763  17.061  1.00 28.94 ? 327  ASN D ND2 1 
ATOM   10106 N  N   . ASP D 1 285 ? 2.621   56.043  20.291  1.00 26.67 ? 328  ASP D N   1 
ATOM   10107 C  CA  . ASP D 1 285 ? 1.202   56.010  20.018  1.00 26.03 ? 328  ASP D CA  1 
ATOM   10108 C  C   . ASP D 1 285 ? 0.782   55.285  18.745  1.00 26.71 ? 328  ASP D C   1 
ATOM   10109 O  O   . ASP D 1 285 ? 0.145   54.245  18.809  1.00 24.82 ? 328  ASP D O   1 
ATOM   10110 C  CB  . ASP D 1 285 ? 0.694   57.434  19.900  1.00 27.06 ? 328  ASP D CB  1 
ATOM   10111 C  CG  . ASP D 1 285 ? -0.453  57.721  20.841  1.00 28.81 ? 328  ASP D CG  1 
ATOM   10112 O  OD1 . ASP D 1 285 ? -1.256  58.634  20.539  1.00 31.40 ? 328  ASP D OD1 1 
ATOM   10113 O  OD2 . ASP D 1 285 ? -0.566  57.029  21.867  1.00 29.95 ? 328  ASP D OD2 1 
ATOM   10114 N  N   . GLU D 1 286 ? 1.144   55.845  17.614  1.00 28.52 ? 329  GLU D N   1 
ATOM   10115 C  CA  . GLU D 1 286 ? 0.794   55.316  16.298  1.00 30.01 ? 329  GLU D CA  1 
ATOM   10116 C  C   . GLU D 1 286 ? 1.237   53.876  16.092  1.00 28.56 ? 329  GLU D C   1 
ATOM   10117 O  O   . GLU D 1 286 ? 0.517   53.051  15.517  1.00 26.52 ? 329  GLU D O   1 
ATOM   10118 C  CB  . GLU D 1 286 ? 1.450   56.199  15.222  1.00 32.70 ? 329  GLU D CB  1 
ATOM   10119 C  CG  . GLU D 1 286 ? 0.792   56.139  13.854  1.00 35.17 ? 329  GLU D CG  1 
ATOM   10120 C  CD  . GLU D 1 286 ? 1.626   56.869  12.821  1.00 36.61 ? 329  GLU D CD  1 
ATOM   10121 O  OE1 . GLU D 1 286 ? 2.709   56.357  12.439  1.00 36.60 ? 329  GLU D OE1 1 
ATOM   10122 O  OE2 . GLU D 1 286 ? 1.196   57.961  12.399  1.00 36.84 ? 329  GLU D OE2 1 
ATOM   10123 N  N   . GLU D 1 287 ? 2.419   53.581  16.582  1.00 27.63 ? 330  GLU D N   1 
ATOM   10124 C  CA  . GLU D 1 287 ? 2.965   52.245  16.400  1.00 27.93 ? 330  GLU D CA  1 
ATOM   10125 C  C   . GLU D 1 287 ? 2.245   51.248  17.291  1.00 27.52 ? 330  GLU D C   1 
ATOM   10126 O  O   . GLU D 1 287 ? 1.849   50.179  16.841  1.00 27.73 ? 330  GLU D O   1 
ATOM   10127 C  CB  . GLU D 1 287 ? 4.469   52.229  16.668  1.00 28.26 ? 330  GLU D CB  1 
ATOM   10128 C  CG  . GLU D 1 287 ? 4.864   52.461  18.134  1.00 28.19 ? 330  GLU D CG  1 
ATOM   10129 C  CD  . GLU D 1 287 ? 6.334   52.179  18.363  1.00 28.64 ? 330  GLU D CD  1 
ATOM   10130 O  OE1 . GLU D 1 287 ? 6.824   52.420  19.486  1.00 29.44 ? 330  GLU D OE1 1 
ATOM   10131 O  OE2 . GLU D 1 287 ? 7.002   51.710  17.414  1.00 30.36 ? 330  GLU D OE2 1 
ATOM   10132 N  N   . ALA D 1 288 ? 2.072   51.599  18.555  1.00 26.89 ? 331  ALA D N   1 
ATOM   10133 C  CA  . ALA D 1 288 ? 1.388   50.720  19.487  1.00 26.94 ? 331  ALA D CA  1 
ATOM   10134 C  C   . ALA D 1 288 ? 0.020   50.327  18.929  1.00 26.18 ? 331  ALA D C   1 
ATOM   10135 O  O   . ALA D 1 288 ? -0.488  49.238  19.191  1.00 26.37 ? 331  ALA D O   1 
ATOM   10136 C  CB  . ALA D 1 288 ? 1.223   51.390  20.837  1.00 28.28 ? 331  ALA D CB  1 
ATOM   10137 N  N   . PHE D 1 289 ? -0.569  51.220  18.148  1.00 24.32 ? 332  PHE D N   1 
ATOM   10138 C  CA  . PHE D 1 289 ? -1.879  50.965  17.580  1.00 23.67 ? 332  PHE D CA  1 
ATOM   10139 C  C   . PHE D 1 289 ? -1.817  50.127  16.302  1.00 24.53 ? 332  PHE D C   1 
ATOM   10140 O  O   . PHE D 1 289 ? -2.603  49.190  16.121  1.00 24.33 ? 332  PHE D O   1 
ATOM   10141 C  CB  . PHE D 1 289 ? -2.592  52.299  17.336  1.00 22.12 ? 332  PHE D CB  1 
ATOM   10142 C  CG  . PHE D 1 289 ? -3.105  52.953  18.598  1.00 20.34 ? 332  PHE D CG  1 
ATOM   10143 C  CD1 . PHE D 1 289 ? -3.371  54.311  18.635  1.00 19.79 ? 332  PHE D CD1 1 
ATOM   10144 C  CD2 . PHE D 1 289 ? -3.353  52.199  19.745  1.00 19.94 ? 332  PHE D CD2 1 
ATOM   10145 C  CE1 . PHE D 1 289 ? -3.878  54.905  19.791  1.00 18.62 ? 332  PHE D CE1 1 
ATOM   10146 C  CE2 . PHE D 1 289 ? -3.858  52.793  20.899  1.00 17.85 ? 332  PHE D CE2 1 
ATOM   10147 C  CZ  . PHE D 1 289 ? -4.119  54.143  20.918  1.00 16.48 ? 332  PHE D CZ  1 
ATOM   10148 N  N   . THR D 1 290 ? -0.880  50.445  15.417  1.00 24.58 ? 333  THR D N   1 
ATOM   10149 C  CA  . THR D 1 290 ? -0.770  49.671  14.194  1.00 25.14 ? 333  THR D CA  1 
ATOM   10150 C  C   . THR D 1 290 ? -0.595  48.200  14.562  1.00 24.50 ? 333  THR D C   1 
ATOM   10151 O  O   . THR D 1 290 ? -1.113  47.318  13.887  1.00 25.30 ? 333  THR D O   1 
ATOM   10152 C  CB  . THR D 1 290 ? 0.419   50.143  13.315  1.00 26.13 ? 333  THR D CB  1 
ATOM   10153 O  OG1 . THR D 1 290 ? 1.567   50.373  14.140  1.00 28.39 ? 333  THR D OG1 1 
ATOM   10154 C  CG2 . THR D 1 290 ? 0.057   51.425  12.558  1.00 26.63 ? 333  THR D CG2 1 
ATOM   10155 N  N   . PHE D 1 291 ? 0.115   47.949  15.656  1.00 23.70 ? 334  PHE D N   1 
ATOM   10156 C  CA  . PHE D 1 291 ? 0.362   46.588  16.125  1.00 22.17 ? 334  PHE D CA  1 
ATOM   10157 C  C   . PHE D 1 291 ? -0.862  45.901  16.725  1.00 22.22 ? 334  PHE D C   1 
ATOM   10158 O  O   . PHE D 1 291 ? -1.022  44.681  16.605  1.00 23.32 ? 334  PHE D O   1 
ATOM   10159 C  CB  . PHE D 1 291 ? 1.507   46.569  17.147  1.00 19.83 ? 334  PHE D CB  1 
ATOM   10160 C  CG  . PHE D 1 291 ? 2.859   46.395  16.529  1.00 20.29 ? 334  PHE D CG  1 
ATOM   10161 C  CD1 . PHE D 1 291 ? 3.447   47.423  15.813  1.00 20.06 ? 334  PHE D CD1 1 
ATOM   10162 C  CD2 . PHE D 1 291 ? 3.530   45.179  16.621  1.00 20.44 ? 334  PHE D CD2 1 
ATOM   10163 C  CE1 . PHE D 1 291 ? 4.683   47.237  15.191  1.00 19.33 ? 334  PHE D CE1 1 
ATOM   10164 C  CE2 . PHE D 1 291 ? 4.762   44.989  16.006  1.00 20.09 ? 334  PHE D CE2 1 
ATOM   10165 C  CZ  . PHE D 1 291 ? 5.338   46.017  15.289  1.00 19.52 ? 334  PHE D CZ  1 
ATOM   10166 N  N   . ALA D 1 292 ? -1.727  46.666  17.377  1.00 21.25 ? 335  ALA D N   1 
ATOM   10167 C  CA  . ALA D 1 292 ? -2.891  46.041  17.971  1.00 20.30 ? 335  ALA D CA  1 
ATOM   10168 C  C   . ALA D 1 292 ? -3.635  45.391  16.833  1.00 19.64 ? 335  ALA D C   1 
ATOM   10169 O  O   . ALA D 1 292 ? -3.816  44.176  16.810  1.00 19.38 ? 335  ALA D O   1 
ATOM   10170 C  CB  . ALA D 1 292 ? -3.759  47.066  18.660  1.00 20.53 ? 335  ALA D CB  1 
ATOM   10171 N  N   . ARG D 1 293 ? -4.028  46.217  15.873  1.00 19.23 ? 336  ARG D N   1 
ATOM   10172 C  CA  . ARG D 1 293 ? -4.765  45.768  14.705  1.00 17.13 ? 336  ARG D CA  1 
ATOM   10173 C  C   . ARG D 1 293 ? -4.024  44.608  14.063  1.00 16.19 ? 336  ARG D C   1 
ATOM   10174 O  O   . ARG D 1 293 ? -4.600  43.567  13.772  1.00 16.09 ? 336  ARG D O   1 
ATOM   10175 C  CB  . ARG D 1 293 ? -4.922  46.938  13.740  1.00 17.92 ? 336  ARG D CB  1 
ATOM   10176 C  CG  . ARG D 1 293 ? -5.666  48.130  14.356  1.00 16.56 ? 336  ARG D CG  1 
ATOM   10177 C  CD  . ARG D 1 293 ? -6.011  49.155  13.307  1.00 18.40 ? 336  ARG D CD  1 
ATOM   10178 N  NE  . ARG D 1 293 ? -7.266  49.836  13.602  1.00 19.51 ? 336  ARG D NE  1 
ATOM   10179 C  CZ  . ARG D 1 293 ? -8.171  50.170  12.679  1.00 20.22 ? 336  ARG D CZ  1 
ATOM   10180 N  NH1 . ARG D 1 293 ? -9.291  50.792  13.045  1.00 17.18 ? 336  ARG D NH1 1 
ATOM   10181 N  NH2 . ARG D 1 293 ? -7.963  49.877  11.390  1.00 18.38 ? 336  ARG D NH2 1 
ATOM   10182 N  N   . MET D 1 294 ? -2.735  44.793  13.853  1.00 14.55 ? 337  MET D N   1 
ATOM   10183 C  CA  . MET D 1 294 ? -1.910  43.746  13.295  1.00 14.80 ? 337  MET D CA  1 
ATOM   10184 C  C   . MET D 1 294 ? -2.230  42.519  14.143  1.00 15.71 ? 337  MET D C   1 
ATOM   10185 O  O   . MET D 1 294 ? -2.541  41.454  13.623  1.00 17.09 ? 337  MET D O   1 
ATOM   10186 C  CB  . MET D 1 294 ? -0.446  44.142  13.449  1.00 14.49 ? 337  MET D CB  1 
ATOM   10187 C  CG  . MET D 1 294 ? 0.547   43.355  12.633  1.00 16.19 ? 337  MET D CG  1 
ATOM   10188 S  SD  . MET D 1 294 ? 2.125   44.255  12.504  1.00 15.99 ? 337  MET D SD  1 
ATOM   10189 C  CE  . MET D 1 294 ? 3.052   43.456  13.790  1.00 15.79 ? 337  MET D CE  1 
ATOM   10190 N  N   . LEU D 1 295 ? -2.184  42.693  15.460  1.00 16.88 ? 338  LEU D N   1 
ATOM   10191 C  CA  . LEU D 1 295 ? -2.467  41.615  16.397  1.00 17.75 ? 338  LEU D CA  1 
ATOM   10192 C  C   . LEU D 1 295 ? -3.866  41.034  16.271  1.00 18.53 ? 338  LEU D C   1 
ATOM   10193 O  O   . LEU D 1 295 ? -4.058  39.826  16.390  1.00 18.28 ? 338  LEU D O   1 
ATOM   10194 C  CB  . LEU D 1 295 ? -2.271  42.095  17.826  1.00 16.87 ? 338  LEU D CB  1 
ATOM   10195 C  CG  . LEU D 1 295 ? -0.986  41.619  18.494  1.00 17.91 ? 338  LEU D CG  1 
ATOM   10196 C  CD1 . LEU D 1 295 ? -1.062  41.955  19.969  1.00 15.83 ? 338  LEU D CD1 1 
ATOM   10197 C  CD2 . LEU D 1 295 ? -0.812  40.115  18.303  1.00 16.93 ? 338  LEU D CD2 1 
ATOM   10198 N  N   . ILE D 1 296 ? -4.850  41.889  16.043  1.00 19.17 ? 339  ILE D N   1 
ATOM   10199 C  CA  . ILE D 1 296 ? -6.216  41.410  15.914  1.00 19.78 ? 339  ILE D CA  1 
ATOM   10200 C  C   . ILE D 1 296 ? -6.447  40.749  14.565  1.00 21.16 ? 339  ILE D C   1 
ATOM   10201 O  O   . ILE D 1 296 ? -7.206  39.790  14.460  1.00 20.83 ? 339  ILE D O   1 
ATOM   10202 C  CB  . ILE D 1 296 ? -7.245  42.556  16.031  1.00 18.44 ? 339  ILE D CB  1 
ATOM   10203 C  CG1 . ILE D 1 296 ? -6.997  43.381  17.299  1.00 19.76 ? 339  ILE D CG1 1 
ATOM   10204 C  CG2 . ILE D 1 296 ? -8.651  41.979  16.061  1.00 17.69 ? 339  ILE D CG2 1 
ATOM   10205 C  CD1 . ILE D 1 296 ? -7.921  44.592  17.440  1.00 16.66 ? 339  ILE D CD1 1 
ATOM   10206 N  N   . ALA D 1 297 ? -5.777  41.258  13.536  1.00 22.44 ? 340  ALA D N   1 
ATOM   10207 C  CA  . ALA D 1 297 ? -5.970  40.761  12.183  1.00 21.94 ? 340  ALA D CA  1 
ATOM   10208 C  C   . ALA D 1 297 ? -4.956  39.782  11.630  1.00 21.95 ? 340  ALA D C   1 
ATOM   10209 O  O   . ALA D 1 297 ? -5.034  39.399  10.459  1.00 22.38 ? 340  ALA D O   1 
ATOM   10210 C  CB  . ALA D 1 297 ? -6.093  41.926  11.253  1.00 22.88 ? 340  ALA D CB  1 
ATOM   10211 N  N   . GLN D 1 298 ? -3.997  39.371  12.440  1.00 20.52 ? 341  GLN D N   1 
ATOM   10212 C  CA  . GLN D 1 298 ? -3.028  38.423  11.941  1.00 19.94 ? 341  GLN D CA  1 
ATOM   10213 C  C   . GLN D 1 298 ? -2.898  37.275  12.903  1.00 20.24 ? 341  GLN D C   1 
ATOM   10214 O  O   . GLN D 1 298 ? -2.489  36.181  12.515  1.00 20.77 ? 341  GLN D O   1 
ATOM   10215 C  CB  . GLN D 1 298 ? -1.676  39.096  11.726  1.00 21.69 ? 341  GLN D CB  1 
ATOM   10216 C  CG  . GLN D 1 298 ? -1.276  39.180  10.253  1.00 25.70 ? 341  GLN D CG  1 
ATOM   10217 C  CD  . GLN D 1 298 ? -0.727  40.549  9.848   1.00 27.59 ? 341  GLN D CD  1 
ATOM   10218 O  OE1 . GLN D 1 298 ? 0.335   40.984  10.316  1.00 26.06 ? 341  GLN D OE1 1 
ATOM   10219 N  NE2 . GLN D 1 298 ? -1.457  41.234  8.967   1.00 28.80 ? 341  GLN D NE2 1 
ATOM   10220 N  N   . GLU D 1 299 ? -3.269  37.524  14.160  1.00 20.02 ? 342  GLU D N   1 
ATOM   10221 C  CA  . GLU D 1 299 ? -3.196  36.518  15.223  1.00 17.03 ? 342  GLU D CA  1 
ATOM   10222 C  C   . GLU D 1 299 ? -4.566  36.341  15.850  1.00 16.48 ? 342  GLU D C   1 
ATOM   10223 O  O   . GLU D 1 299 ? -4.781  35.391  16.620  1.00 18.00 ? 342  GLU D O   1 
ATOM   10224 C  CB  . GLU D 1 299 ? -2.219  36.925  16.316  1.00 16.40 ? 342  GLU D CB  1 
ATOM   10225 C  CG  . GLU D 1 299 ? -0.862  37.384  15.824  1.00 17.30 ? 342  GLU D CG  1 
ATOM   10226 C  CD  . GLU D 1 299 ? 0.016   36.219  15.440  1.00 19.14 ? 342  GLU D CD  1 
ATOM   10227 O  OE1 . GLU D 1 299 ? 0.036   35.236  16.201  1.00 21.81 ? 342  GLU D OE1 1 
ATOM   10228 O  OE2 . GLU D 1 299 ? 0.678   36.285  14.389  1.00 19.92 ? 342  GLU D OE2 1 
ATOM   10229 N  N   . GLY D 1 300 ? -5.489  37.234  15.536  1.00 14.98 ? 343  GLY D N   1 
ATOM   10230 C  CA  . GLY D 1 300 ? -6.813  37.148  16.079  1.00 13.83 ? 343  GLY D CA  1 
ATOM   10231 C  C   . GLY D 1 300 ? -6.880  37.414  17.598  1.00 12.47 ? 343  GLY D C   1 
ATOM   10232 O  O   . GLY D 1 300 ? -7.850  37.038  18.244  1.00 13.97 ? 343  GLY D O   1 
ATOM   10233 N  N   . LEU D 1 301 ? -5.859  38.074  18.167  1.00 13.02 ? 344  LEU D N   1 
ATOM   10234 C  CA  . LEU D 1 301 ? -5.822  38.429  19.626  1.00 12.67 ? 344  LEU D CA  1 
ATOM   10235 C  C   . LEU D 1 301 ? -6.533  39.774  19.798  1.00 13.44 ? 344  LEU D C   1 
ATOM   10236 O  O   . LEU D 1 301 ? -6.031  40.804  19.329  1.00 15.89 ? 344  LEU D O   1 
ATOM   10237 C  CB  . LEU D 1 301 ? -4.383  38.402  20.109  1.00 9.18  ? 344  LEU D CB  1 
ATOM   10238 C  CG  . LEU D 1 301 ? -3.575  37.151  19.714  1.00 7.67  ? 344  LEU D CG  1 
ATOM   10239 C  CD1 . LEU D 1 301 ? -2.080  37.464  19.698  1.00 5.73  ? 344  LEU D CD1 1 
ATOM   10240 C  CD2 . LEU D 1 301 ? -3.890  36.008  20.659  1.00 6.34  ? 344  LEU D CD2 1 
ATOM   10241 N  N   . LEU D 1 302 ? -7.691  39.784  20.423  1.00 13.26 ? 345  LEU D N   1 
ATOM   10242 C  CA  . LEU D 1 302 ? -8.391  41.054  20.334  1.00 14.02 ? 345  LEU D CA  1 
ATOM   10243 C  C   . LEU D 1 302 ? -7.851  42.163  21.299  1.00 16.10 ? 345  LEU D C   1 
ATOM   10244 O  O   . LEU D 1 302 ? -8.380  43.283  21.361  1.00 14.20 ? 345  LEU D O   1 
ATOM   10245 C  CB  . LEU D 1 302 ? -9.838  40.766  20.296  1.00 11.43 ? 345  LEU D CB  1 
ATOM   10246 C  CG  . LEU D 1 302 ? -10.166 40.401  18.839  1.00 6.97  ? 345  LEU D CG  1 
ATOM   10247 C  CD1 . LEU D 1 302 ? -11.659 40.081  18.680  1.00 7.98  ? 345  LEU D CD1 1 
ATOM   10248 C  CD2 . LEU D 1 302 ? -9.761  41.519  17.887  1.00 5.12  ? 345  LEU D CD2 1 
ATOM   10249 N  N   . CYS D 1 303 ? -6.731  41.821  21.999  1.00 17.80 ? 346  CYS D N   1 
ATOM   10250 C  CA  . CYS D 1 303 ? -5.997  42.693  22.972  1.00 18.96 ? 346  CYS D CA  1 
ATOM   10251 C  C   . CYS D 1 303 ? -6.213  44.190  22.758  1.00 20.24 ? 346  CYS D C   1 
ATOM   10252 O  O   . CYS D 1 303 ? -7.146  44.602  22.070  1.00 21.48 ? 346  CYS D O   1 
ATOM   10253 C  CB  . CYS D 1 303 ? -4.506  42.373  22.899  1.00 17.70 ? 346  CYS D CB  1 
ATOM   10254 S  SG  . CYS D 1 303 ? -3.928  41.850  21.252  1.00 18.99 ? 346  CYS D SG  1 
ATOM   10255 N  N   . GLY D 1 304 ? -5.342  45.034  23.349  1.00 20.79 ? 347  GLY D N   1 
ATOM   10256 C  CA  . GLY D 1 304 ? -5.471  46.484  23.243  1.00 20.71 ? 347  GLY D CA  1 
ATOM   10257 C  C   . GLY D 1 304 ? -4.126  47.231  23.194  1.00 20.30 ? 347  GLY D C   1 
ATOM   10258 O  O   . GLY D 1 304 ? -3.061  46.619  23.120  1.00 19.96 ? 347  GLY D O   1 
ATOM   10259 N  N   . GLY D 1 305 ? -4.207  48.561  23.229  1.00 20.41 ? 348  GLY D N   1 
ATOM   10260 C  CA  . GLY D 1 305 ? -3.026  49.406  23.114  1.00 19.15 ? 348  GLY D CA  1 
ATOM   10261 C  C   . GLY D 1 305 ? -1.772  48.867  23.773  1.00 18.22 ? 348  GLY D C   1 
ATOM   10262 O  O   . GLY D 1 305 ? -0.753  48.654  23.124  1.00 17.02 ? 348  GLY D O   1 
ATOM   10263 N  N   . SER D 1 306 ? -1.846  48.661  25.079  1.00 18.32 ? 349  SER D N   1 
ATOM   10264 C  CA  . SER D 1 306 ? -0.721  48.145  25.835  1.00 18.06 ? 349  SER D CA  1 
ATOM   10265 C  C   . SER D 1 306 ? -0.062  47.024  25.066  1.00 18.03 ? 349  SER D C   1 
ATOM   10266 O  O   . SER D 1 306 ? 1.151   47.028  24.853  1.00 18.53 ? 349  SER D O   1 
ATOM   10267 C  CB  . SER D 1 306 ? -1.206  47.604  27.170  1.00 19.07 ? 349  SER D CB  1 
ATOM   10268 O  OG  . SER D 1 306 ? -2.198  46.604  26.981  1.00 19.19 ? 349  SER D OG  1 
ATOM   10269 N  N   . ALA D 1 307 ? -0.881  46.060  24.651  1.00 18.19 ? 350  ALA D N   1 
ATOM   10270 C  CA  . ALA D 1 307 ? -0.408  44.899  23.916  1.00 18.28 ? 350  ALA D CA  1 
ATOM   10271 C  C   . ALA D 1 307 ? 0.359   45.356  22.691  1.00 18.52 ? 350  ALA D C   1 
ATOM   10272 O  O   . ALA D 1 307 ? 1.289   44.684  22.233  1.00 17.49 ? 350  ALA D O   1 
ATOM   10273 C  CB  . ALA D 1 307 ? -1.577  44.040  23.519  1.00 19.94 ? 350  ALA D CB  1 
ATOM   10274 N  N   . GLY D 1 308 ? -0.033  46.518  22.179  1.00 18.33 ? 351  GLY D N   1 
ATOM   10275 C  CA  . GLY D 1 308 ? 0.617   47.078  21.012  1.00 19.13 ? 351  GLY D CA  1 
ATOM   10276 C  C   . GLY D 1 308 ? 2.062   47.387  21.312  1.00 19.34 ? 351  GLY D C   1 
ATOM   10277 O  O   . GLY D 1 308 ? 2.976   46.748  20.774  1.00 19.52 ? 351  GLY D O   1 
ATOM   10278 N  N   . SER D 1 309 ? 2.263   48.363  22.192  1.00 20.07 ? 352  SER D N   1 
ATOM   10279 C  CA  . SER D 1 309 ? 3.602   48.791  22.589  1.00 19.61 ? 352  SER D CA  1 
ATOM   10280 C  C   . SER D 1 309 ? 4.497   47.588  22.900  1.00 19.29 ? 352  SER D C   1 
ATOM   10281 O  O   . SER D 1 309 ? 5.627   47.498  22.417  1.00 18.14 ? 352  SER D O   1 
ATOM   10282 C  CB  . SER D 1 309 ? 3.517   49.726  23.816  1.00 19.36 ? 352  SER D CB  1 
ATOM   10283 O  OG  . SER D 1 309 ? 2.834   50.948  23.529  1.00 16.58 ? 352  SER D OG  1 
ATOM   10284 N  N   . THR D 1 310 ? 3.974   46.657  23.694  1.00 19.01 ? 353  THR D N   1 
ATOM   10285 C  CA  . THR D 1 310 ? 4.716   45.452  24.087  1.00 19.12 ? 353  THR D CA  1 
ATOM   10286 C  C   . THR D 1 310 ? 5.284   44.635  22.922  1.00 17.91 ? 353  THR D C   1 
ATOM   10287 O  O   . THR D 1 310 ? 6.437   44.204  22.957  1.00 15.14 ? 353  THR D O   1 
ATOM   10288 C  CB  . THR D 1 310 ? 3.827   44.508  24.956  1.00 18.84 ? 353  THR D CB  1 
ATOM   10289 O  OG1 . THR D 1 310 ? 3.345   45.220  26.106  1.00 17.59 ? 353  THR D OG1 1 
ATOM   10290 C  CG2 . THR D 1 310 ? 4.618   43.291  25.421  1.00 16.74 ? 353  THR D CG2 1 
ATOM   10291 N  N   . VAL D 1 311 ? 4.467   44.425  21.894  1.00 19.26 ? 354  VAL D N   1 
ATOM   10292 C  CA  . VAL D 1 311 ? 4.883   43.636  20.737  1.00 20.17 ? 354  VAL D CA  1 
ATOM   10293 C  C   . VAL D 1 311 ? 5.748   44.422  19.750  1.00 19.85 ? 354  VAL D C   1 
ATOM   10294 O  O   . VAL D 1 311 ? 6.599   43.852  19.066  1.00 18.09 ? 354  VAL D O   1 
ATOM   10295 C  CB  . VAL D 1 311 ? 3.655   43.031  20.022  1.00 20.65 ? 354  VAL D CB  1 
ATOM   10296 C  CG1 . VAL D 1 311 ? 4.089   42.321  18.776  1.00 21.49 ? 354  VAL D CG1 1 
ATOM   10297 C  CG2 . VAL D 1 311 ? 2.951   42.043  20.937  1.00 18.56 ? 354  VAL D CG2 1 
ATOM   10298 N  N   . ALA D 1 312 ? 5.536   45.733  19.684  1.00 21.06 ? 355  ALA D N   1 
ATOM   10299 C  CA  . ALA D 1 312 ? 6.339   46.583  18.805  1.00 20.51 ? 355  ALA D CA  1 
ATOM   10300 C  C   . ALA D 1 312 ? 7.768   46.602  19.361  1.00 20.13 ? 355  ALA D C   1 
ATOM   10301 O  O   . ALA D 1 312 ? 8.748   46.608  18.617  1.00 20.80 ? 355  ALA D O   1 
ATOM   10302 C  CB  . ALA D 1 312 ? 5.760   47.993  18.763  1.00 17.99 ? 355  ALA D CB  1 
ATOM   10303 N  N   . VAL D 1 313 ? 7.877   46.590  20.683  1.00 21.50 ? 356  VAL D N   1 
ATOM   10304 C  CA  . VAL D 1 313 ? 9.176   46.588  21.344  1.00 22.39 ? 356  VAL D CA  1 
ATOM   10305 C  C   . VAL D 1 313 ? 9.813   45.200  21.257  1.00 23.71 ? 356  VAL D C   1 
ATOM   10306 O  O   . VAL D 1 313 ? 11.044  45.071  21.236  1.00 23.62 ? 356  VAL D O   1 
ATOM   10307 C  CB  . VAL D 1 313 ? 9.031   46.998  22.830  1.00 21.03 ? 356  VAL D CB  1 
ATOM   10308 C  CG1 . VAL D 1 313 ? 10.303  46.701  23.584  1.00 19.70 ? 356  VAL D CG1 1 
ATOM   10309 C  CG2 . VAL D 1 313 ? 8.707   48.471  22.923  1.00 19.55 ? 356  VAL D CG2 1 
ATOM   10310 N  N   . ALA D 1 314 ? 8.960   44.173  21.183  1.00 24.33 ? 357  ALA D N   1 
ATOM   10311 C  CA  . ALA D 1 314 ? 9.391   42.776  21.118  1.00 23.70 ? 357  ALA D CA  1 
ATOM   10312 C  C   . ALA D 1 314 ? 9.974   42.338  19.774  1.00 24.24 ? 357  ALA D C   1 
ATOM   10313 O  O   . ALA D 1 314 ? 10.932  41.562  19.744  1.00 25.06 ? 357  ALA D O   1 
ATOM   10314 C  CB  . ALA D 1 314 ? 8.235   41.860  21.507  1.00 22.50 ? 357  ALA D CB  1 
ATOM   10315 N  N   . VAL D 1 315 ? 9.411   42.801  18.662  1.00 24.53 ? 358  VAL D N   1 
ATOM   10316 C  CA  . VAL D 1 315 ? 9.967   42.407  17.371  1.00 24.54 ? 358  VAL D CA  1 
ATOM   10317 C  C   . VAL D 1 315 ? 11.337  43.046  17.296  1.00 25.50 ? 358  VAL D C   1 
ATOM   10318 O  O   . VAL D 1 315 ? 12.218  42.597  16.563  1.00 25.83 ? 358  VAL D O   1 
ATOM   10319 C  CB  . VAL D 1 315 ? 9.143   42.932  16.195  1.00 23.27 ? 358  VAL D CB  1 
ATOM   10320 C  CG1 . VAL D 1 315 ? 7.812   42.236  16.140  1.00 20.09 ? 358  VAL D CG1 1 
ATOM   10321 C  CG2 . VAL D 1 315 ? 8.973   44.426  16.325  1.00 23.95 ? 358  VAL D CG2 1 
ATOM   10322 N  N   . LYS D 1 316 ? 11.500  44.103  18.083  1.00 27.00 ? 359  LYS D N   1 
ATOM   10323 C  CA  . LYS D 1 316 ? 12.750  44.861  18.137  1.00 29.16 ? 359  LYS D CA  1 
ATOM   10324 C  C   . LYS D 1 316 ? 13.706  44.309  19.189  1.00 28.03 ? 359  LYS D C   1 
ATOM   10325 O  O   . LYS D 1 316 ? 14.795  43.833  18.871  1.00 25.65 ? 359  LYS D O   1 
ATOM   10326 C  CB  . LYS D 1 316 ? 12.437  46.330  18.430  1.00 30.90 ? 359  LYS D CB  1 
ATOM   10327 C  CG  . LYS D 1 316 ? 13.210  47.315  17.577  1.00 34.13 ? 359  LYS D CG  1 
ATOM   10328 C  CD  . LYS D 1 316 ? 12.322  48.467  17.125  1.00 37.22 ? 359  LYS D CD  1 
ATOM   10329 C  CE  . LYS D 1 316 ? 11.738  49.237  18.300  1.00 37.16 ? 359  LYS D CE  1 
ATOM   10330 N  NZ  . LYS D 1 316 ? 10.949  50.426  17.852  1.00 35.67 ? 359  LYS D NZ  1 
ATOM   10331 N  N   . ALA D 1 317 ? 13.286  44.363  20.443  1.00 28.52 ? 360  ALA D N   1 
ATOM   10332 C  CA  . ALA D 1 317 ? 14.116  43.865  21.517  1.00 30.91 ? 360  ALA D CA  1 
ATOM   10333 C  C   . ALA D 1 317 ? 14.633  42.461  21.210  1.00 32.76 ? 360  ALA D C   1 
ATOM   10334 O  O   . ALA D 1 317 ? 15.841  42.250  21.080  1.00 33.73 ? 360  ALA D O   1 
ATOM   10335 C  CB  . ALA D 1 317 ? 13.330  43.859  22.811  1.00 31.14 ? 360  ALA D CB  1 
ATOM   10336 N  N   . ALA D 1 318 ? 13.706  41.513  21.074  1.00 33.46 ? 361  ALA D N   1 
ATOM   10337 C  CA  . ALA D 1 318 ? 14.021  40.109  20.814  1.00 33.15 ? 361  ALA D CA  1 
ATOM   10338 C  C   . ALA D 1 318 ? 14.775  39.781  19.524  1.00 32.38 ? 361  ALA D C   1 
ATOM   10339 O  O   . ALA D 1 318 ? 15.147  38.620  19.318  1.00 31.97 ? 361  ALA D O   1 
ATOM   10340 C  CB  . ALA D 1 318 ? 12.744  39.293  20.859  1.00 33.47 ? 361  ALA D CB  1 
ATOM   10341 N  N   . GLN D 1 319 ? 15.006  40.771  18.663  1.00 30.84 ? 362  GLN D N   1 
ATOM   10342 C  CA  . GLN D 1 319 ? 15.710  40.512  17.406  1.00 31.00 ? 362  GLN D CA  1 
ATOM   10343 C  C   . GLN D 1 319 ? 17.064  39.808  17.564  1.00 30.34 ? 362  GLN D C   1 
ATOM   10344 O  O   . GLN D 1 319 ? 17.649  39.348  16.582  1.00 30.77 ? 362  GLN D O   1 
ATOM   10345 C  CB  . GLN D 1 319 ? 15.888  41.817  16.622  1.00 31.95 ? 362  GLN D CB  1 
ATOM   10346 C  CG  . GLN D 1 319 ? 14.850  42.059  15.556  1.00 32.76 ? 362  GLN D CG  1 
ATOM   10347 C  CD  . GLN D 1 319 ? 14.826  40.949  14.527  1.00 33.65 ? 362  GLN D CD  1 
ATOM   10348 O  OE1 . GLN D 1 319 ? 15.856  40.554  13.984  1.00 31.74 ? 362  GLN D OE1 1 
ATOM   10349 N  NE2 . GLN D 1 319 ? 13.643  40.430  14.230  1.00 32.66 ? 362  GLN D NE2 1 
ATOM   10350 N  N   . GLU D 1 320 ? 17.537  39.681  18.798  1.00 30.05 ? 363  GLU D N   1 
ATOM   10351 C  CA  . GLU D 1 320 ? 18.824  39.051  19.064  1.00 30.06 ? 363  GLU D CA  1 
ATOM   10352 C  C   . GLU D 1 320 ? 18.716  37.590  19.466  1.00 29.90 ? 363  GLU D C   1 
ATOM   10353 O  O   . GLU D 1 320 ? 19.614  36.795  19.193  1.00 29.33 ? 363  GLU D O   1 
ATOM   10354 C  CB  . GLU D 1 320 ? 19.548  39.827  20.163  1.00 31.27 ? 363  GLU D CB  1 
ATOM   10355 C  CG  . GLU D 1 320 ? 18.771  39.928  21.480  1.00 29.83 ? 363  GLU D CG  1 
ATOM   10356 C  CD  . GLU D 1 320 ? 19.486  39.242  22.644  1.00 29.30 ? 363  GLU D CD  1 
ATOM   10357 O  OE1 . GLU D 1 320 ? 20.501  38.550  22.389  1.00 26.61 ? 363  GLU D OE1 1 
ATOM   10358 O  OE2 . GLU D 1 320 ? 19.028  39.388  23.807  1.00 28.49 ? 363  GLU D OE2 1 
ATOM   10359 N  N   . LEU D 1 321 ? 17.624  37.248  20.140  1.00 30.01 ? 364  LEU D N   1 
ATOM   10360 C  CA  . LEU D 1 321 ? 17.396  35.882  20.580  1.00 29.23 ? 364  LEU D CA  1 
ATOM   10361 C  C   . LEU D 1 321 ? 17.415  34.935  19.366  1.00 29.15 ? 364  LEU D C   1 
ATOM   10362 O  O   . LEU D 1 321 ? 17.094  35.339  18.247  1.00 28.84 ? 364  LEU D O   1 
ATOM   10363 C  CB  . LEU D 1 321 ? 16.059  35.769  21.330  1.00 28.57 ? 364  LEU D CB  1 
ATOM   10364 C  CG  . LEU D 1 321 ? 15.956  36.522  22.681  1.00 27.87 ? 364  LEU D CG  1 
ATOM   10365 C  CD1 . LEU D 1 321 ? 16.187  38.006  22.484  1.00 27.57 ? 364  LEU D CD1 1 
ATOM   10366 C  CD2 . LEU D 1 321 ? 14.601  36.286  23.345  1.00 28.50 ? 364  LEU D CD2 1 
ATOM   10367 N  N   . GLN D 1 322 ? 17.785  33.677  19.599  1.00 28.98 ? 365  GLN D N   1 
ATOM   10368 C  CA  . GLN D 1 322 ? 17.883  32.675  18.535  1.00 29.43 ? 365  GLN D CA  1 
ATOM   10369 C  C   . GLN D 1 322 ? 16.891  31.501  18.597  1.00 27.17 ? 365  GLN D C   1 
ATOM   10370 O  O   . GLN D 1 322 ? 16.201  31.328  19.595  1.00 26.42 ? 365  GLN D O   1 
ATOM   10371 C  CB  . GLN D 1 322 ? 19.311  32.121  18.511  1.00 32.79 ? 365  GLN D CB  1 
ATOM   10372 C  CG  . GLN D 1 322 ? 20.399  33.194  18.406  1.00 35.36 ? 365  GLN D CG  1 
ATOM   10373 C  CD  . GLN D 1 322 ? 21.525  32.988  19.409  1.00 36.22 ? 365  GLN D CD  1 
ATOM   10374 O  OE1 . GLN D 1 322 ? 21.364  33.150  20.621  1.00 35.72 ? 365  GLN D OE1 1 
ATOM   10375 N  NE2 . GLN D 1 322 ? 22.765  32.621  19.130  1.00 36.36 ? 365  GLN D NE2 1 
ATOM   10376 N  N   . GLU D 1 323 ? 16.858  30.701  17.511  1.00 25.63 ? 366  GLU D N   1 
ATOM   10377 C  CA  . GLU D 1 323 ? 15.983  29.500  17.316  1.00 23.72 ? 366  GLU D CA  1 
ATOM   10378 C  C   . GLU D 1 323 ? 16.081  28.596  18.495  1.00 21.49 ? 366  GLU D C   1 
ATOM   10379 O  O   . GLU D 1 323 ? 17.197  28.255  18.901  1.00 19.62 ? 366  GLU D O   1 
ATOM   10380 C  CB  . GLU D 1 323 ? 16.318  28.774  16.018  1.00 24.29 ? 366  GLU D CB  1 
ATOM   10381 C  CG  . GLU D 1 323 ? 16.628  29.699  14.871  1.00 24.47 ? 366  GLU D CG  1 
ATOM   10382 C  CD  . GLU D 1 323 ? 17.733  29.120  14.057  1.00 25.20 ? 366  GLU D CD  1 
ATOM   10383 O  OE1 . GLU D 1 323 ? 18.690  28.582  14.652  1.00 26.20 ? 366  GLU D OE1 1 
ATOM   10384 O  OE2 . GLU D 1 323 ? 17.666  29.213  12.813  1.00 26.75 ? 366  GLU D OE2 1 
ATOM   10385 N  N   . GLY D 1 324 ? 14.952  28.173  19.062  1.00 19.84 ? 367  GLY D N   1 
ATOM   10386 C  CA  . GLY D 1 324 ? 15.195  27.612  20.499  1.00 19.23 ? 367  GLY D CA  1 
ATOM   10387 C  C   . GLY D 1 324 ? 15.065  28.295  21.843  1.00 19.34 ? 367  GLY D C   1 
ATOM   10388 O  O   . GLY D 1 324 ? 15.084  27.656  22.895  1.00 19.96 ? 367  GLY D O   1 
ATOM   10389 N  N   . GLN D 1 325 ? 14.957  29.614  21.802  1.00 17.97 ? 368  GLN D N   1 
ATOM   10390 C  CA  . GLN D 1 325 ? 14.791  30.404  23.004  1.00 16.52 ? 368  GLN D CA  1 
ATOM   10391 C  C   . GLN D 1 325 ? 13.404  30.954  22.799  1.00 17.06 ? 368  GLN D C   1 
ATOM   10392 O  O   . GLN D 1 325 ? 12.947  31.028  21.655  1.00 17.57 ? 368  GLN D O   1 
ATOM   10393 C  CB  . GLN D 1 325 ? 15.803  31.545  23.041  1.00 15.48 ? 368  GLN D CB  1 
ATOM   10394 C  CG  . GLN D 1 325 ? 17.242  31.088  23.003  1.00 14.37 ? 368  GLN D CG  1 
ATOM   10395 C  CD  . GLN D 1 325 ? 18.207  32.246  22.963  1.00 12.64 ? 368  GLN D CD  1 
ATOM   10396 O  OE1 . GLN D 1 325 ? 17.995  33.195  22.239  1.00 13.27 ? 368  GLN D OE1 1 
ATOM   10397 N  NE2 . GLN D 1 325 ? 19.279  32.164  23.737  1.00 13.56 ? 368  GLN D NE2 1 
ATOM   10398 N  N   . ARG D 1 326 ? 12.732  31.325  23.883  1.00 16.34 ? 369  ARG D N   1 
ATOM   10399 C  CA  . ARG D 1 326 ? 11.384  31.865  23.789  1.00 16.61 ? 369  ARG D CA  1 
ATOM   10400 C  C   . ARG D 1 326 ? 11.365  33.306  24.225  1.00 17.94 ? 369  ARG D C   1 
ATOM   10401 O  O   . ARG D 1 326 ? 12.338  33.798  24.789  1.00 18.80 ? 369  ARG D O   1 
ATOM   10402 C  CB  . ARG D 1 326 ? 10.447  31.081  24.682  1.00 15.50 ? 369  ARG D CB  1 
ATOM   10403 C  CG  . ARG D 1 326 ? 10.766  29.631  24.665  1.00 16.45 ? 369  ARG D CG  1 
ATOM   10404 C  CD  . ARG D 1 326 ? 9.602   28.776  25.080  1.00 16.15 ? 369  ARG D CD  1 
ATOM   10405 N  NE  . ARG D 1 326 ? 10.087  27.429  25.311  1.00 15.63 ? 369  ARG D NE  1 
ATOM   10406 C  CZ  . ARG D 1 326 ? 9.350   26.447  25.796  1.00 18.92 ? 369  ARG D CZ  1 
ATOM   10407 N  NH1 . ARG D 1 326 ? 8.076   26.666  26.089  1.00 21.28 ? 369  ARG D NH1 1 
ATOM   10408 N  NH2 . ARG D 1 326 ? 9.901   25.262  26.019  1.00 19.34 ? 369  ARG D NH2 1 
ATOM   10409 N  N   . CYS D 1 327 ? 10.260  33.989  23.950  1.00 18.31 ? 370  CYS D N   1 
ATOM   10410 C  CA  . CYS D 1 327 ? 10.118  35.371  24.362  1.00 18.89 ? 370  CYS D CA  1 
ATOM   10411 C  C   . CYS D 1 327 ? 8.665   35.639  24.713  1.00 20.05 ? 370  CYS D C   1 
ATOM   10412 O  O   . CYS D 1 327 ? 7.797   35.731  23.841  1.00 20.06 ? 370  CYS D O   1 
ATOM   10413 C  CB  . CYS D 1 327 ? 10.593  36.329  23.271  1.00 18.66 ? 370  CYS D CB  1 
ATOM   10414 S  SG  . CYS D 1 327 ? 10.531  38.061  23.759  1.00 20.12 ? 370  CYS D SG  1 
ATOM   10415 N  N   . VAL D 1 328 ? 8.419   35.744  26.013  1.00 19.77 ? 371  VAL D N   1 
ATOM   10416 C  CA  . VAL D 1 328 ? 7.101   36.007  26.543  1.00 18.42 ? 371  VAL D CA  1 
ATOM   10417 C  C   . VAL D 1 328 ? 6.687   37.423  26.252  1.00 18.71 ? 371  VAL D C   1 
ATOM   10418 O  O   . VAL D 1 328 ? 7.489   38.342  26.351  1.00 20.17 ? 371  VAL D O   1 
ATOM   10419 C  CB  . VAL D 1 328 ? 7.079   35.852  28.054  1.00 18.91 ? 371  VAL D CB  1 
ATOM   10420 C  CG1 . VAL D 1 328 ? 5.852   36.536  28.616  1.00 19.83 ? 371  VAL D CG1 1 
ATOM   10421 C  CG2 . VAL D 1 328 ? 7.092   34.384  28.432  1.00 20.63 ? 371  VAL D CG2 1 
ATOM   10422 N  N   . VAL D 1 329 ? 5.422   37.602  25.915  1.00 18.66 ? 372  VAL D N   1 
ATOM   10423 C  CA  . VAL D 1 329 ? 4.909   38.926  25.656  1.00 17.90 ? 372  VAL D CA  1 
ATOM   10424 C  C   . VAL D 1 329 ? 3.541   39.115  26.298  1.00 18.81 ? 372  VAL D C   1 
ATOM   10425 O  O   . VAL D 1 329 ? 2.525   38.686  25.762  1.00 20.06 ? 372  VAL D O   1 
ATOM   10426 C  CB  . VAL D 1 329 ? 4.866   39.194  24.154  1.00 16.15 ? 372  VAL D CB  1 
ATOM   10427 C  CG1 . VAL D 1 329 ? 3.756   40.145  23.794  1.00 16.17 ? 372  VAL D CG1 1 
ATOM   10428 C  CG2 . VAL D 1 329 ? 6.167   39.804  23.749  1.00 16.35 ? 372  VAL D CG2 1 
ATOM   10429 N  N   . ILE D 1 330 ? 3.528   39.758  27.460  1.00 18.37 ? 373  ILE D N   1 
ATOM   10430 C  CA  . ILE D 1 330 ? 2.291   40.018  28.178  1.00 18.09 ? 373  ILE D CA  1 
ATOM   10431 C  C   . ILE D 1 330 ? 1.415   40.998  27.420  1.00 19.13 ? 373  ILE D C   1 
ATOM   10432 O  O   . ILE D 1 330 ? 1.909   41.966  26.840  1.00 18.29 ? 373  ILE D O   1 
ATOM   10433 C  CB  . ILE D 1 330 ? 2.567   40.630  29.543  1.00 18.66 ? 373  ILE D CB  1 
ATOM   10434 C  CG1 . ILE D 1 330 ? 3.606   39.793  30.277  1.00 21.79 ? 373  ILE D CG1 1 
ATOM   10435 C  CG2 . ILE D 1 330 ? 1.294   40.695  30.349  1.00 16.60 ? 373  ILE D CG2 1 
ATOM   10436 C  CD1 . ILE D 1 330 ? 4.119   40.447  31.543  1.00 23.93 ? 373  ILE D CD1 1 
ATOM   10437 N  N   . LEU D 1 331 ? 0.112   40.735  27.427  1.00 19.84 ? 374  LEU D N   1 
ATOM   10438 C  CA  . LEU D 1 331 ? -0.861  41.569  26.776  1.00 20.64 ? 374  LEU D CA  1 
ATOM   10439 C  C   . LEU D 1 331 ? -1.882  41.974  27.852  1.00 22.19 ? 374  LEU D C   1 
ATOM   10440 O  O   . LEU D 1 331 ? -2.746  41.193  28.250  1.00 24.07 ? 374  LEU D O   1 
ATOM   10441 C  CB  . LEU D 1 331 ? -1.551  40.843  25.618  1.00 20.99 ? 374  LEU D CB  1 
ATOM   10442 C  CG  . LEU D 1 331 ? -0.692  40.121  24.587  1.00 22.44 ? 374  LEU D CG  1 
ATOM   10443 C  CD1 . LEU D 1 331 ? -1.483  39.900  23.297  1.00 23.06 ? 374  LEU D CD1 1 
ATOM   10444 C  CD2 . LEU D 1 331 ? 0.582   40.902  24.301  1.00 22.28 ? 374  LEU D CD2 1 
ATOM   10445 N  N   . PRO D 1 332 ? -1.735  43.245  28.327  1.00 22.42 ? 375  PRO D N   1 
ATOM   10446 C  CA  . PRO D 1 332 ? -2.555  43.799  29.485  1.00 20.86 ? 375  PRO D CA  1 
ATOM   10447 C  C   . PRO D 1 332 ? -4.081  43.610  29.568  1.00 20.76 ? 375  PRO D C   1 
ATOM   10448 O  O   . PRO D 1 332 ? -4.606  42.868  30.406  1.00 21.40 ? 375  PRO D O   1 
ATOM   10449 C  CB  . PRO D 1 332 ? -2.017  45.202  29.581  1.00 21.08 ? 375  PRO D CB  1 
ATOM   10450 C  CG  . PRO D 1 332 ? -0.566  45.018  29.304  1.00 19.35 ? 375  PRO D CG  1 
ATOM   10451 C  CD  . PRO D 1 332 ? -0.388  43.803  28.435  1.00 21.68 ? 375  PRO D CD  1 
ATOM   10452 N  N   . ASP D 1 333 ? -4.763  44.280  28.670  1.00 21.57 ? 376  ASP D N   1 
ATOM   10453 C  CA  . ASP D 1 333 ? -6.211  44.191  28.584  1.00 20.29 ? 376  ASP D CA  1 
ATOM   10454 C  C   . ASP D 1 333 ? -6.625  43.899  27.128  1.00 20.05 ? 376  ASP D C   1 
ATOM   10455 O  O   . ASP D 1 333 ? -5.768  43.678  26.272  1.00 18.07 ? 376  ASP D O   1 
ATOM   10456 C  CB  . ASP D 1 333 ? -6.872  45.483  29.063  1.00 19.38 ? 376  ASP D CB  1 
ATOM   10457 C  CG  . ASP D 1 333 ? -6.635  46.628  28.112  1.00 19.78 ? 376  ASP D CG  1 
ATOM   10458 O  OD1 . ASP D 1 333 ? -7.188  47.726  28.312  1.00 17.02 ? 376  ASP D OD1 1 
ATOM   10459 O  OD2 . ASP D 1 333 ? -5.891  46.429  27.135  1.00 18.60 ? 376  ASP D OD2 1 
ATOM   10460 N  N   . SER D 1 334 ? -7.928  43.901  26.855  1.00 20.52 ? 377  SER D N   1 
ATOM   10461 C  CA  . SER D 1 334 ? -8.433  43.589  25.504  1.00 21.87 ? 377  SER D CA  1 
ATOM   10462 C  C   . SER D 1 334 ? -9.129  44.753  24.812  1.00 23.10 ? 377  SER D C   1 
ATOM   10463 O  O   . SER D 1 334 ? -9.144  45.871  25.318  1.00 23.73 ? 377  SER D O   1 
ATOM   10464 C  CB  . SER D 1 334 ? -9.433  42.437  25.561  1.00 22.66 ? 377  SER D CB  1 
ATOM   10465 O  OG  . SER D 1 334 ? -10.690 42.865  26.052  1.00 23.08 ? 377  SER D OG  1 
ATOM   10466 N  N   . VAL D 1 335 ? -9.712  44.471  23.666  1.00 24.34 ? 378  VAL D N   1 
ATOM   10467 C  CA  . VAL D 1 335 ? -10.385 45.501  22.880  1.00 25.08 ? 378  VAL D CA  1 
ATOM   10468 C  C   . VAL D 1 335 ? -11.571 46.173  23.532  1.00 24.74 ? 378  VAL D C   1 
ATOM   10469 O  O   . VAL D 1 335 ? -11.725 47.387  23.427  1.00 26.09 ? 378  VAL D O   1 
ATOM   10470 C  CB  . VAL D 1 335 ? -10.895 44.958  21.520  1.00 27.25 ? 378  VAL D CB  1 
ATOM   10471 C  CG1 . VAL D 1 335 ? -9.730  44.457  20.695  1.00 28.47 ? 378  VAL D CG1 1 
ATOM   10472 C  CG2 . VAL D 1 335 ? -11.921 43.848  21.731  1.00 26.53 ? 378  VAL D CG2 1 
ATOM   10473 N  N   . ARG D 1 336 ? -12.417 45.384  24.183  1.00 24.43 ? 379  ARG D N   1 
ATOM   10474 C  CA  . ARG D 1 336 ? -13.620 45.912  24.809  1.00 23.08 ? 379  ARG D CA  1 
ATOM   10475 C  C   . ARG D 1 336 ? -13.481 47.329  25.369  1.00 21.46 ? 379  ARG D C   1 
ATOM   10476 O  O   . ARG D 1 336 ? -14.396 48.139  25.211  1.00 20.80 ? 379  ARG D O   1 
ATOM   10477 C  CB  . ARG D 1 336 ? -14.111 44.950  25.891  1.00 24.62 ? 379  ARG D CB  1 
ATOM   10478 C  CG  . ARG D 1 336 ? -15.351 45.427  26.639  1.00 24.06 ? 379  ARG D CG  1 
ATOM   10479 C  CD  . ARG D 1 336 ? -14.945 45.847  28.038  1.00 24.37 ? 379  ARG D CD  1 
ATOM   10480 N  NE  . ARG D 1 336 ? -13.606 45.328  28.296  1.00 25.09 ? 379  ARG D NE  1 
ATOM   10481 C  CZ  . ARG D 1 336 ? -13.102 45.065  29.493  1.00 24.98 ? 379  ARG D CZ  1 
ATOM   10482 N  NH1 . ARG D 1 336 ? -13.828 45.278  30.581  1.00 26.56 ? 379  ARG D NH1 1 
ATOM   10483 N  NH2 . ARG D 1 336 ? -11.875 44.548  29.592  1.00 23.70 ? 379  ARG D NH2 1 
ATOM   10484 N  N   . ASN D 1 337 ? -12.350 47.652  25.994  1.00 20.86 ? 380  ASN D N   1 
ATOM   10485 C  CA  . ASN D 1 337 ? -12.198 49.009  26.527  1.00 19.47 ? 380  ASN D CA  1 
ATOM   10486 C  C   . ASN D 1 337 ? -12.140 50.022  25.421  1.00 16.49 ? 380  ASN D C   1 
ATOM   10487 O  O   . ASN D 1 337 ? -12.663 51.133  25.545  1.00 14.29 ? 380  ASN D O   1 
ATOM   10488 C  CB  . ASN D 1 337 ? -10.938 49.134  27.378  1.00 20.63 ? 380  ASN D CB  1 
ATOM   10489 C  CG  . ASN D 1 337 ? -11.260 49.719  28.745  1.00 21.38 ? 380  ASN D CG  1 
ATOM   10490 O  OD1 . ASN D 1 337 ? -12.225 50.461  28.916  1.00 21.58 ? 380  ASN D OD1 1 
ATOM   10491 N  ND2 . ASN D 1 337 ? -10.435 49.393  29.726  1.00 20.90 ? 380  ASN D ND2 1 
ATOM   10492 N  N   . TYR D 1 338 ? -11.481 49.615  24.328  1.00 16.02 ? 381  TYR D N   1 
ATOM   10493 C  CA  . TYR D 1 338 ? -11.267 50.554  23.230  1.00 17.25 ? 381  TYR D CA  1 
ATOM   10494 C  C   . TYR D 1 338 ? -12.249 50.500  22.027  1.00 16.58 ? 381  TYR D C   1 
ATOM   10495 O  O   . TYR D 1 338 ? -11.884 50.917  20.926  1.00 16.72 ? 381  TYR D O   1 
ATOM   10496 C  CB  . TYR D 1 338 ? -9.827  50.416  22.761  1.00 19.16 ? 381  TYR D CB  1 
ATOM   10497 C  CG  . TYR D 1 338 ? -8.796  50.347  23.876  1.00 21.89 ? 381  TYR D CG  1 
ATOM   10498 C  CD1 . TYR D 1 338 ? -8.623  49.208  24.667  1.00 23.21 ? 381  TYR D CD1 1 
ATOM   10499 C  CD2 . TYR D 1 338 ? -7.936  51.425  24.144  1.00 23.09 ? 381  TYR D CD2 1 
ATOM   10500 C  CE1 . TYR D 1 338 ? -7.676  49.128  25.659  1.00 25.24 ? 381  TYR D CE1 1 
ATOM   10501 C  CE2 . TYR D 1 338 ? -6.970  51.363  25.130  1.00 23.95 ? 381  TYR D CE2 1 
ATOM   10502 C  CZ  . TYR D 1 338 ? -6.841  50.213  25.900  1.00 26.67 ? 381  TYR D CZ  1 
ATOM   10503 O  OH  . TYR D 1 338 ? -5.900  50.136  26.884  1.00 25.73 ? 381  TYR D OH  1 
ATOM   10504 N  N   . MET D 1 339 ? -13.470 49.988  22.210  1.00 15.75 ? 382  MET D N   1 
ATOM   10505 C  CA  . MET D 1 339 ? -14.465 49.914  21.148  1.00 14.90 ? 382  MET D CA  1 
ATOM   10506 C  C   . MET D 1 339 ? -14.532 51.079  20.174  1.00 13.86 ? 382  MET D C   1 
ATOM   10507 O  O   . MET D 1 339 ? -14.281 50.867  18.990  1.00 12.69 ? 382  MET D O   1 
ATOM   10508 C  CB  . MET D 1 339 ? -15.828 49.709  21.781  1.00 16.91 ? 382  MET D CB  1 
ATOM   10509 C  CG  . MET D 1 339 ? -16.404 48.322  21.545  1.00 18.95 ? 382  MET D CG  1 
ATOM   10510 S  SD  . MET D 1 339 ? -15.113 47.060  21.370  1.00 22.40 ? 382  MET D SD  1 
ATOM   10511 C  CE  . MET D 1 339 ? -15.181 46.733  19.612  1.00 19.26 ? 382  MET D CE  1 
ATOM   10512 N  N   . THR D 1 340 ? -14.859 52.298  20.597  1.00 13.97 ? 383  THR D N   1 
ATOM   10513 C  CA  . THR D 1 340 ? -14.942 53.391  19.605  1.00 14.03 ? 383  THR D CA  1 
ATOM   10514 C  C   . THR D 1 340 ? -13.625 54.179  19.522  1.00 15.68 ? 383  THR D C   1 
ATOM   10515 O  O   . THR D 1 340 ? -13.618 55.317  19.068  1.00 16.67 ? 383  THR D O   1 
ATOM   10516 C  CB  . THR D 1 340 ? -16.083 54.341  19.971  1.00 13.53 ? 383  THR D CB  1 
ATOM   10517 O  OG1 . THR D 1 340 ? -15.837 54.913  21.258  1.00 13.79 ? 383  THR D OG1 1 
ATOM   10518 C  CG2 . THR D 1 340 ? -17.414 53.593  19.997  1.00 13.35 ? 383  THR D CG2 1 
ATOM   10519 N  N   . LYS D 1 341 ? -12.483 53.568  19.957  1.00 16.68 ? 384  LYS D N   1 
ATOM   10520 C  CA  . LYS D 1 341 ? -11.208 54.325  20.075  1.00 18.92 ? 384  LYS D CA  1 
ATOM   10521 C  C   . LYS D 1 341 ? -9.941  53.746  19.416  1.00 18.62 ? 384  LYS D C   1 
ATOM   10522 O  O   . LYS D 1 341 ? -8.980  53.575  20.172  1.00 18.87 ? 384  LYS D O   1 
ATOM   10523 C  CB  . LYS D 1 341 ? -10.759 54.381  21.541  1.00 20.85 ? 384  LYS D CB  1 
ATOM   10524 C  CG  . LYS D 1 341 ? -11.685 55.152  22.444  1.00 24.10 ? 384  LYS D CG  1 
ATOM   10525 C  CD  . LYS D 1 341 ? -11.308 56.625  22.407  1.00 24.55 ? 384  LYS D CD  1 
ATOM   10526 C  CE  . LYS D 1 341 ? -9.892  56.846  22.896  1.00 21.98 ? 384  LYS D CE  1 
ATOM   10527 N  NZ  . LYS D 1 341 ? -9.830  56.876  24.390  1.00 22.87 ? 384  LYS D NZ  1 
ATOM   10528 N  N   . PHE D 1 342 ? -9.795  53.404  18.129  1.00 19.43 ? 385  PHE D N   1 
ATOM   10529 C  CA  . PHE D 1 342 ? -8.438  52.809  17.816  1.00 20.63 ? 385  PHE D CA  1 
ATOM   10530 C  C   . PHE D 1 342 ? -8.892  51.625  17.073  1.00 20.80 ? 385  PHE D C   1 
ATOM   10531 O  O   . PHE D 1 342 ? -8.339  51.221  16.044  1.00 20.49 ? 385  PHE D O   1 
ATOM   10532 C  CB  . PHE D 1 342 ? -7.476  52.325  18.979  1.00 20.67 ? 385  PHE D CB  1 
ATOM   10533 C  CG  . PHE D 1 342 ? -7.154  50.809  19.215  1.00 22.85 ? 385  PHE D CG  1 
ATOM   10534 C  CD1 . PHE D 1 342 ? -7.170  49.832  18.212  1.00 22.88 ? 385  PHE D CD1 1 
ATOM   10535 C  CD2 . PHE D 1 342 ? -6.806  50.385  20.504  1.00 23.87 ? 385  PHE D CD2 1 
ATOM   10536 C  CE1 . PHE D 1 342 ? -6.938  48.504  18.485  1.00 21.73 ? 385  PHE D CE1 1 
ATOM   10537 C  CE2 . PHE D 1 342 ? -6.573  49.020  20.786  1.00 23.20 ? 385  PHE D CE2 1 
ATOM   10538 C  CZ  . PHE D 1 342 ? -6.656  48.096  19.771  1.00 22.02 ? 385  PHE D CZ  1 
ATOM   10539 N  N   . LEU D 1 343 ? -9.935  51.073  17.641  1.00 22.09 ? 386  LEU D N   1 
ATOM   10540 C  CA  . LEU D 1 343 ? -10.620 49.964  17.039  1.00 22.96 ? 386  LEU D CA  1 
ATOM   10541 C  C   . LEU D 1 343 ? -11.457 50.565  15.922  1.00 23.85 ? 386  LEU D C   1 
ATOM   10542 O  O   . LEU D 1 343 ? -11.902 49.856  15.017  1.00 23.87 ? 386  LEU D O   1 
ATOM   10543 C  CB  . LEU D 1 343 ? -11.478 49.195  18.065  1.00 23.47 ? 386  LEU D CB  1 
ATOM   10544 C  CG  . LEU D 1 343 ? -11.899 47.731  17.730  1.00 22.12 ? 386  LEU D CG  1 
ATOM   10545 C  CD1 . LEU D 1 343 ? -13.047 47.721  16.727  1.00 23.05 ? 386  LEU D CD1 1 
ATOM   10546 C  CD2 . LEU D 1 343 ? -10.717 46.926  17.211  1.00 20.51 ? 386  LEU D CD2 1 
ATOM   10547 N  N   . SER D 1 344 ? -11.680 51.907  15.990  1.00 24.06 ? 387  SER D N   1 
ATOM   10548 C  CA  . SER D 1 344 ? -12.480 52.616  14.994  1.00 25.64 ? 387  SER D CA  1 
ATOM   10549 C  C   . SER D 1 344 ? -11.627 53.355  13.961  1.00 27.73 ? 387  SER D C   1 
ATOM   10550 O  O   . SER D 1 344 ? -10.567 53.877  14.285  1.00 28.90 ? 387  SER D O   1 
ATOM   10551 C  CB  . SER D 1 344 ? -13.393 53.624  15.667  1.00 24.10 ? 387  SER D CB  1 
ATOM   10552 O  OG  . SER D 1 344 ? -13.970 54.460  14.683  1.00 26.08 ? 387  SER D OG  1 
ATOM   10553 N  N   . ASP D 1 345 ? -12.099 53.410  12.718  1.00 29.52 ? 388  ASP D N   1 
ATOM   10554 C  CA  . ASP D 1 345 ? -11.353 54.088  11.661  1.00 31.00 ? 388  ASP D CA  1 
ATOM   10555 C  C   . ASP D 1 345 ? -11.551 55.605  11.686  1.00 31.31 ? 388  ASP D C   1 
ATOM   10556 O  O   . ASP D 1 345 ? -10.611 56.362  11.441  1.00 30.85 ? 388  ASP D O   1 
ATOM   10557 C  CB  . ASP D 1 345 ? -11.749 53.537  10.282  1.00 31.74 ? 388  ASP D CB  1 
ATOM   10558 C  CG  . ASP D 1 345 ? -10.896 52.344  9.847   1.00 33.31 ? 388  ASP D CG  1 
ATOM   10559 O  OD1 . ASP D 1 345 ? -11.081 51.872  8.701   1.00 34.50 ? 388  ASP D OD1 1 
ATOM   10560 O  OD2 . ASP D 1 345 ? -10.043 51.880  10.637  1.00 32.36 ? 388  ASP D OD2 1 
ATOM   10561 N  N   . ARG D 1 346 ? -12.770 56.052  11.974  1.00 31.71 ? 389  ARG D N   1 
ATOM   10562 C  CA  . ARG D 1 346 ? -13.043 57.487  12.025  1.00 32.85 ? 389  ARG D CA  1 
ATOM   10563 C  C   . ARG D 1 346 ? -12.116 58.134  13.050  1.00 33.47 ? 389  ARG D C   1 
ATOM   10564 O  O   . ARG D 1 346 ? -11.497 59.174  12.795  1.00 34.08 ? 389  ARG D O   1 
ATOM   10565 C  CB  . ARG D 1 346 ? -14.491 57.750  12.443  1.00 33.26 ? 389  ARG D CB  1 
ATOM   10566 C  CG  . ARG D 1 346 ? -15.550 57.232  11.496  1.00 34.87 ? 389  ARG D CG  1 
ATOM   10567 C  CD  . ARG D 1 346 ? -16.566 56.384  12.247  1.00 36.09 ? 389  ARG D CD  1 
ATOM   10568 N  NE  . ARG D 1 346 ? -15.988 55.109  12.675  1.00 35.83 ? 389  ARG D NE  1 
ATOM   10569 C  CZ  . ARG D 1 346 ? -16.548 54.296  13.566  1.00 36.70 ? 389  ARG D CZ  1 
ATOM   10570 N  NH1 . ARG D 1 346 ? -17.701 54.625  14.133  1.00 37.50 ? 389  ARG D NH1 1 
ATOM   10571 N  NH2 . ARG D 1 346 ? -15.966 53.148  13.882  1.00 36.29 ? 389  ARG D NH2 1 
ATOM   10572 N  N   . TRP D 1 347 ? -12.044 57.501  14.217  1.00 32.73 ? 390  TRP D N   1 
ATOM   10573 C  CA  . TRP D 1 347 ? -11.226 57.968  15.328  1.00 30.60 ? 390  TRP D CA  1 
ATOM   10574 C  C   . TRP D 1 347 ? -9.761  58.091  14.898  1.00 30.03 ? 390  TRP D C   1 
ATOM   10575 O  O   . TRP D 1 347 ? -9.188  59.185  14.901  1.00 28.82 ? 390  TRP D O   1 
ATOM   10576 C  CB  . TRP D 1 347 ? -11.369 56.986  16.488  1.00 29.00 ? 390  TRP D CB  1 
ATOM   10577 C  CG  . TRP D 1 347 ? -10.679 57.385  17.756  1.00 29.60 ? 390  TRP D CG  1 
ATOM   10578 C  CD1 . TRP D 1 347 ? -11.246 57.981  18.844  1.00 29.65 ? 390  TRP D CD1 1 
ATOM   10579 C  CD2 . TRP D 1 347 ? -9.307  57.143  18.100  1.00 28.93 ? 390  TRP D CD2 1 
ATOM   10580 N  NE1 . TRP D 1 347 ? -10.319 58.114  19.845  1.00 29.76 ? 390  TRP D NE1 1 
ATOM   10581 C  CE2 . TRP D 1 347 ? -9.121  57.607  19.417  1.00 29.03 ? 390  TRP D CE2 1 
ATOM   10582 C  CE3 . TRP D 1 347 ? -8.220  56.574  17.422  1.00 27.62 ? 390  TRP D CE3 1 
ATOM   10583 C  CZ2 . TRP D 1 347 ? -7.894  57.519  20.075  1.00 29.71 ? 390  TRP D CZ2 1 
ATOM   10584 C  CZ3 . TRP D 1 347 ? -7.001  56.486  18.073  1.00 27.87 ? 390  TRP D CZ3 1 
ATOM   10585 C  CH2 . TRP D 1 347 ? -6.847  56.957  19.389  1.00 30.08 ? 390  TRP D CH2 1 
ATOM   10586 N  N   . MET D 1 348 ? -9.157  56.966  14.530  1.00 29.63 ? 391  MET D N   1 
ATOM   10587 C  CA  . MET D 1 348 ? -7.778  56.975  14.092  1.00 28.91 ? 391  MET D CA  1 
ATOM   10588 C  C   . MET D 1 348 ? -7.565  58.238  13.290  1.00 30.16 ? 391  MET D C   1 
ATOM   10589 O  O   . MET D 1 348 ? -6.796  59.101  13.681  1.00 32.47 ? 391  MET D O   1 
ATOM   10590 C  CB  . MET D 1 348 ? -7.493  55.763  13.221  1.00 27.22 ? 391  MET D CB  1 
ATOM   10591 C  CG  . MET D 1 348 ? -7.422  54.485  13.992  1.00 24.10 ? 391  MET D CG  1 
ATOM   10592 S  SD  . MET D 1 348 ? -5.960  54.469  15.001  1.00 23.30 ? 391  MET D SD  1 
ATOM   10593 C  CE  . MET D 1 348 ? -4.886  53.409  14.048  1.00 22.18 ? 391  MET D CE  1 
ATOM   10594 N  N   . LEU D 1 349 ? -8.281  58.359  12.180  1.00 30.52 ? 392  LEU D N   1 
ATOM   10595 C  CA  . LEU D 1 349 ? -8.156  59.527  11.318  1.00 30.72 ? 392  LEU D CA  1 
ATOM   10596 C  C   . LEU D 1 349 ? -8.089  60.842  12.120  1.00 30.67 ? 392  LEU D C   1 
ATOM   10597 O  O   . LEU D 1 349 ? -7.074  61.549  12.020  1.00 29.68 ? 392  LEU D O   1 
ATOM   10598 C  CB  . LEU D 1 349 ? -9.275  59.547  10.305  1.00 31.17 ? 392  LEU D CB  1 
ATOM   10599 C  CG  . LEU D 1 349 ? -9.181  58.396  9.297   1.00 31.61 ? 392  LEU D CG  1 
ATOM   10600 C  CD1 . LEU D 1 349 ? -10.367 58.394  8.360   1.00 33.11 ? 392  LEU D CD1 1 
ATOM   10601 C  CD2 . LEU D 1 349 ? -7.871  58.472  8.513   1.00 30.80 ? 392  LEU D CD2 1 
ATOM   10602 N  N   . GLN D 1 350 ? -9.146  61.157  12.873  1.00 30.70 ? 393  GLN D N   1 
ATOM   10603 C  CA  . GLN D 1 350 ? -9.112  62.288  13.725  1.00 30.34 ? 393  GLN D CA  1 
ATOM   10604 C  C   . GLN D 1 350 ? -8.221  61.922  14.904  1.00 30.19 ? 393  GLN D C   1 
ATOM   10605 O  O   . GLN D 1 350 ? -8.628  61.775  16.065  1.00 31.33 ? 393  GLN D O   1 
ATOM   10606 C  CB  . GLN D 1 350 ? -10.511 62.712  14.190  1.00 30.40 ? 393  GLN D CB  1 
ATOM   10607 C  CG  . GLN D 1 350 ? -11.011 62.028  15.439  1.00 29.85 ? 393  GLN D CG  1 
ATOM   10608 C  CD  . GLN D 1 350 ? -12.432 62.430  15.783  1.00 29.97 ? 393  GLN D CD  1 
ATOM   10609 O  OE1 . GLN D 1 350 ? -12.836 63.579  15.573  1.00 30.42 ? 393  GLN D OE1 1 
ATOM   10610 N  NE2 . GLN D 1 350 ? -13.360 61.643  16.314  1.00 30.20 ? 393  GLN D NE2 1 
ATOM   10611 N  N   . LYS D 1 351 ? -6.945  61.892  14.447  1.00 28.78 ? 394  LYS D N   1 
ATOM   10612 C  CA  . LYS D 1 351 ? -5.696  61.625  15.137  1.00 28.03 ? 394  LYS D CA  1 
ATOM   10613 C  C   . LYS D 1 351 ? -4.529  61.628  14.122  1.00 28.46 ? 394  LYS D C   1 
ATOM   10614 O  O   . LYS D 1 351 ? -3.733  62.554  14.059  1.00 28.78 ? 394  LYS D O   1 
ATOM   10615 C  CB  . LYS D 1 351 ? -5.746  60.289  15.874  1.00 26.91 ? 394  LYS D CB  1 
ATOM   10616 C  CG  . LYS D 1 351 ? -6.922  60.144  16.849  1.00 26.38 ? 394  LYS D CG  1 
ATOM   10617 C  CD  . LYS D 1 351 ? -6.667  60.803  18.193  1.00 25.47 ? 394  LYS D CD  1 
ATOM   10618 C  CE  . LYS D 1 351 ? -7.875  60.689  19.088  1.00 24.22 ? 394  LYS D CE  1 
ATOM   10619 N  NZ  . LYS D 1 351 ? -9.068  61.343  18.497  1.00 23.14 ? 394  LYS D NZ  1 
ATOM   10620 N  N   . GLY D 1 352 ? -4.470  60.566  13.337  1.00 29.11 ? 395  GLY D N   1 
ATOM   10621 C  CA  . GLY D 1 352 ? -3.420  60.495  12.352  1.00 30.05 ? 395  GLY D CA  1 
ATOM   10622 C  C   . GLY D 1 352 ? -2.671  59.175  12.437  1.00 32.09 ? 395  GLY D C   1 
ATOM   10623 O  O   . GLY D 1 352 ? -1.447  59.157  12.241  1.00 32.89 ? 395  GLY D O   1 
ATOM   10624 N  N   . PHE D 1 353 ? -3.365  58.096  12.709  1.00 33.81 ? 396  PHE D N   1 
ATOM   10625 C  CA  . PHE D 1 353 ? -2.760  56.778  12.792  1.00 37.32 ? 396  PHE D CA  1 
ATOM   10626 C  C   . PHE D 1 353 ? -3.338  55.983  11.614  1.00 39.56 ? 396  PHE D C   1 
ATOM   10627 O  O   . PHE D 1 353 ? -4.483  56.262  11.276  1.00 40.93 ? 396  PHE D O   1 
ATOM   10628 C  CB  . PHE D 1 353 ? -3.097  56.146  14.147  1.00 36.46 ? 396  PHE D CB  1 
ATOM   10629 C  CG  . PHE D 1 353 ? -2.864  57.083  15.295  1.00 36.41 ? 396  PHE D CG  1 
ATOM   10630 C  CD1 . PHE D 1 353 ? -3.808  57.227  16.289  1.00 36.03 ? 396  PHE D CD1 1 
ATOM   10631 C  CD2 . PHE D 1 353 ? -1.670  57.800  15.374  1.00 36.56 ? 396  PHE D CD2 1 
ATOM   10632 C  CE1 . PHE D 1 353 ? -3.572  58.067  17.348  1.00 35.79 ? 396  PHE D CE1 1 
ATOM   10633 C  CE2 . PHE D 1 353 ? -1.415  58.647  16.457  1.00 36.36 ? 396  PHE D CE2 1 
ATOM   10634 C  CZ  . PHE D 1 353 ? -2.373  58.781  17.452  1.00 37.13 ? 396  PHE D CZ  1 
ATOM   10635 N  N   . LEU D 1 354 ? -2.670  55.026  10.923  1.00 40.83 ? 397  LEU D N   1 
ATOM   10636 C  CA  . LEU D 1 354 ? -3.515  54.422  9.913   1.00 41.87 ? 397  LEU D CA  1 
ATOM   10637 C  C   . LEU D 1 354 ? -3.031  54.095  8.471   1.00 43.10 ? 397  LEU D C   1 
ATOM   10638 O  O   . LEU D 1 354 ? -3.432  53.032  8.025   1.00 43.64 ? 397  LEU D O   1 
ATOM   10639 C  CB  . LEU D 1 354 ? -4.792  55.302  9.855   1.00 40.89 ? 397  LEU D CB  1 
ATOM   10640 C  CG  . LEU D 1 354 ? -6.149  54.606  9.983   1.00 39.66 ? 397  LEU D CG  1 
ATOM   10641 C  CD1 . LEU D 1 354 ? -7.039  54.974  8.805   1.00 39.57 ? 397  LEU D CD1 1 
ATOM   10642 C  CD2 . LEU D 1 354 ? -5.992  53.100  10.088  1.00 39.17 ? 397  LEU D CD2 1 
ATOM   10643 N  N   . LYS D 1 355 ? -2.242  54.839  7.675   1.00 43.74 ? 398  LYS D N   1 
ATOM   10644 C  CA  . LYS D 1 355 ? -2.029  54.159  6.378   1.00 44.32 ? 398  LYS D CA  1 
ATOM   10645 C  C   . LYS D 1 355 ? -2.015  54.974  5.063   1.00 45.23 ? 398  LYS D C   1 
ATOM   10646 O  O   . LYS D 1 355 ? -3.023  55.051  4.371   1.00 46.18 ? 398  LYS D O   1 
ATOM   10647 C  CB  . LYS D 1 355 ? -3.172  53.194  6.159   1.00 42.94 ? 398  LYS D CB  1 
ATOM   10648 C  CG  . LYS D 1 355 ? -2.805  51.741  6.356   1.00 43.35 ? 398  LYS D CG  1 
ATOM   10649 C  CD  . LYS D 1 355 ? -4.060  51.023  6.793   1.00 41.64 ? 398  LYS D CD  1 
ATOM   10650 C  CE  . LYS D 1 355 ? -5.183  52.023  7.051   1.00 40.33 ? 398  LYS D CE  1 
ATOM   10651 N  NZ  . LYS D 1 355 ? -4.844  53.376  6.547   1.00 38.11 ? 398  LYS D NZ  1 
ATOM   10652 N  N   . GLU D 1 356 ? -0.904  55.578  4.710   1.00 45.66 ? 399  GLU D N   1 
ATOM   10653 C  CA  . GLU D 1 356 ? -0.695  56.302  3.482   1.00 45.67 ? 399  GLU D CA  1 
ATOM   10654 C  C   . GLU D 1 356 ? -1.984  56.950  3.003   1.00 46.10 ? 399  GLU D C   1 
ATOM   10655 O  O   . GLU D 1 356 ? -2.530  56.745  1.999   1.00 47.09 ? 399  GLU D O   1 
ATOM   10656 C  CB  . GLU D 1 356 ? -0.147  55.422  2.361   1.00 45.92 ? 399  GLU D CB  1 
ATOM   10657 C  CG  . GLU D 1 356 ? 0.797   56.146  1.402   1.00 47.35 ? 399  GLU D CG  1 
ATOM   10658 C  CD  . GLU D 1 356 ? 2.226   56.224  1.904   1.00 48.72 ? 399  GLU D CD  1 
ATOM   10659 O  OE1 . GLU D 1 356 ? 2.426   56.631  3.072   1.00 49.32 ? 399  GLU D OE1 1 
ATOM   10660 O  OE2 . GLU D 1 356 ? 3.150   55.867  1.150   1.00 48.41 ? 399  GLU D OE2 1 
ATOM   10661 N  N   . ASP E 1 4   ? -9.363  46.389  99.747  1.00 23.51 ? 47   ASP E N   1 
ATOM   10662 C  CA  . ASP E 1 4   ? -9.620  46.738  101.181 1.00 23.02 ? 47   ASP E CA  1 
ATOM   10663 C  C   . ASP E 1 4   ? -8.442  47.286  102.042 1.00 23.24 ? 47   ASP E C   1 
ATOM   10664 O  O   . ASP E 1 4   ? -8.197  46.822  103.164 1.00 25.34 ? 47   ASP E O   1 
ATOM   10665 C  CB  . ASP E 1 4   ? -10.193 45.502  101.854 1.00 22.58 ? 47   ASP E CB  1 
ATOM   10666 C  CG  . ASP E 1 4   ? -10.627 45.754  103.266 1.00 23.29 ? 47   ASP E CG  1 
ATOM   10667 O  OD1 . ASP E 1 4   ? -10.966 44.766  103.962 1.00 21.58 ? 47   ASP E OD1 1 
ATOM   10668 O  OD2 . ASP E 1 4   ? -10.634 46.943  103.671 1.00 21.89 ? 47   ASP E OD2 1 
ATOM   10669 N  N   . ALA E 1 5   ? -7.709  48.261  101.524 1.00 48.34 ? 48   ALA E N   1 
ATOM   10670 C  CA  . ALA E 1 5   ? -6.594  48.908  102.238 1.00 48.24 ? 48   ALA E CA  1 
ATOM   10671 C  C   . ALA E 1 5   ? -6.103  49.920  101.241 1.00 48.15 ? 48   ALA E C   1 
ATOM   10672 O  O   . ALA E 1 5   ? -5.063  50.505  101.423 1.00 47.44 ? 48   ALA E O   1 
ATOM   10673 C  CB  . ALA E 1 5   ? -5.532  47.920  102.544 1.00 47.15 ? 48   ALA E CB  1 
ATOM   10674 N  N   . PRO E 1 6   ? -6.965  50.233  100.256 1.00 29.21 ? 49   PRO E N   1 
ATOM   10675 C  CA  . PRO E 1 6   ? -7.161  51.003  99.025  1.00 30.92 ? 49   PRO E CA  1 
ATOM   10676 C  C   . PRO E 1 6   ? -6.191  51.874  98.309  1.00 30.93 ? 49   PRO E C   1 
ATOM   10677 O  O   . PRO E 1 6   ? -6.309  53.113  98.432  1.00 31.14 ? 49   PRO E O   1 
ATOM   10678 C  CB  . PRO E 1 6   ? -8.377  51.782  99.393  1.00 32.43 ? 49   PRO E CB  1 
ATOM   10679 C  CG  . PRO E 1 6   ? -9.159  50.762  99.921  1.00 31.05 ? 49   PRO E CG  1 
ATOM   10680 C  CD  . PRO E 1 6   ? -8.203  50.410  101.010 1.00 29.51 ? 49   PRO E CD  1 
ATOM   10681 N  N   . SER E 1 7   ? -5.237  51.241  97.623  1.00 31.61 ? 50   SER E N   1 
ATOM   10682 C  CA  . SER E 1 7   ? -4.247  51.945  96.808  1.00 32.93 ? 50   SER E CA  1 
ATOM   10683 C  C   . SER E 1 7   ? -4.199  53.416  97.085  1.00 33.92 ? 50   SER E C   1 
ATOM   10684 O  O   . SER E 1 7   ? -5.173  54.123  96.878  1.00 34.10 ? 50   SER E O   1 
ATOM   10685 C  CB  . SER E 1 7   ? -4.581  51.759  95.340  1.00 33.08 ? 50   SER E CB  1 
ATOM   10686 O  OG  . SER E 1 7   ? -3.911  52.724  94.547  1.00 17.23 ? 50   SER E OG  1 
ATOM   10687 N  N   . ARG E 1 8   ? -3.036  53.875  97.483  1.00 32.62 ? 51   ARG E N   1 
ATOM   10688 C  CA  . ARG E 1 8   ? -2.871  55.258  97.789  1.00 32.55 ? 51   ARG E CA  1 
ATOM   10689 C  C   . ARG E 1 8   ? -2.019  55.799  96.650  1.00 34.43 ? 51   ARG E C   1 
ATOM   10690 O  O   . ARG E 1 8   ? -1.424  56.866  96.755  1.00 34.23 ? 51   ARG E O   1 
ATOM   10691 C  CB  . ARG E 1 8   ? -2.169  55.336  99.146  1.00 30.86 ? 51   ARG E CB  1 
ATOM   10692 C  CG  . ARG E 1 8   ? -2.808  54.405  100.213 1.00 29.24 ? 51   ARG E CG  1 
ATOM   10693 C  CD  . ARG E 1 8   ? -1.815  53.836  101.239 1.00 27.22 ? 51   ARG E CD  1 
ATOM   10694 N  NE  . ARG E 1 8   ? -0.995  52.743  100.712 1.00 25.72 ? 51   ARG E NE  1 
ATOM   10695 C  CZ  . ARG E 1 8   ? -0.375  51.845  101.473 1.00 24.76 ? 51   ARG E CZ  1 
ATOM   10696 N  NH1 . ARG E 1 8   ? -0.483  51.913  102.794 1.00 26.25 ? 51   ARG E NH1 1 
ATOM   10697 N  NH2 . ARG E 1 8   ? 0.336   50.874  100.921 1.00 22.35 ? 51   ARG E NH2 1 
ATOM   10698 N  N   . CYS E 1 9   ? -1.961  55.023  95.567  1.00 35.38 ? 52   CYS E N   1 
ATOM   10699 C  CA  . CYS E 1 9   ? -1.178  55.362  94.383  1.00 33.81 ? 52   CYS E CA  1 
ATOM   10700 C  C   . CYS E 1 9   ? -1.377  56.797  93.932  1.00 32.34 ? 52   CYS E C   1 
ATOM   10701 O  O   . CYS E 1 9   ? -2.474  57.345  94.069  1.00 32.36 ? 52   CYS E O   1 
ATOM   10702 C  CB  . CYS E 1 9   ? -1.541  54.435  93.226  1.00 36.04 ? 52   CYS E CB  1 
ATOM   10703 S  SG  . CYS E 1 9   ? -0.617  54.756  91.690  1.00 38.61 ? 52   CYS E SG  1 
ATOM   10704 N  N   . THR E 1 10  ? -0.321  57.401  93.397  1.00 30.20 ? 53   THR E N   1 
ATOM   10705 C  CA  . THR E 1 10  ? -0.413  58.774  92.935  1.00 28.08 ? 53   THR E CA  1 
ATOM   10706 C  C   . THR E 1 10  ? -0.165  58.943  91.447  1.00 29.92 ? 53   THR E C   1 
ATOM   10707 O  O   . THR E 1 10  ? 0.593   59.805  91.021  1.00 31.93 ? 53   THR E O   1 
ATOM   10708 C  CB  . THR E 1 10  ? 0.526   59.675  93.743  1.00 25.30 ? 53   THR E CB  1 
ATOM   10709 O  OG1 . THR E 1 10  ? 1.856   59.145  93.702  1.00 22.53 ? 53   THR E OG1 1 
ATOM   10710 C  CG2 . THR E 1 10  ? 0.036   59.784  95.175  1.00 23.40 ? 53   THR E CG2 1 
ATOM   10711 N  N   . TRP E 1 11  ? -0.826  58.096  90.672  1.00 29.39 ? 54   TRP E N   1 
ATOM   10712 C  CA  . TRP E 1 11  ? -0.780  58.076  89.236  1.00 28.41 ? 54   TRP E CA  1 
ATOM   10713 C  C   . TRP E 1 11  ? -1.807  59.093  88.716  1.00 28.31 ? 54   TRP E C   1 
ATOM   10714 O  O   . TRP E 1 11  ? -2.854  59.266  89.340  1.00 28.94 ? 54   TRP E O   1 
ATOM   10715 C  CB  . TRP E 1 11  ? -1.169  56.671  88.676  1.00 26.92 ? 54   TRP E CB  1 
ATOM   10716 C  CG  . TRP E 1 11  ? -1.567  56.772  87.222  1.00 24.47 ? 54   TRP E CG  1 
ATOM   10717 C  CD1 . TRP E 1 11  ? -0.708  56.736  86.164  1.00 23.13 ? 54   TRP E CD1 1 
ATOM   10718 C  CD2 . TRP E 1 11  ? -2.877  56.934  86.667  1.00 23.12 ? 54   TRP E CD2 1 
ATOM   10719 N  NE1 . TRP E 1 11  ? -1.395  56.875  84.986  1.00 22.24 ? 54   TRP E NE1 1 
ATOM   10720 C  CE2 . TRP E 1 11  ? -2.727  57.022  85.264  1.00 21.82 ? 54   TRP E CE2 1 
ATOM   10721 C  CE3 . TRP E 1 11  ? -4.162  57.051  87.219  1.00 21.97 ? 54   TRP E CE3 1 
ATOM   10722 C  CZ2 . TRP E 1 11  ? -3.811  57.227  84.404  1.00 20.08 ? 54   TRP E CZ2 1 
ATOM   10723 C  CZ3 . TRP E 1 11  ? -5.243  57.256  86.358  1.00 21.42 ? 54   TRP E CZ3 1 
ATOM   10724 C  CH2 . TRP E 1 11  ? -5.055  57.343  84.965  1.00 18.93 ? 54   TRP E CH2 1 
ATOM   10725 N  N   . GLN E 1 12  ? -1.542  59.761  87.604  1.00 27.77 ? 55   GLN E N   1 
ATOM   10726 C  CA  . GLN E 1 12  ? -2.547  60.670  87.080  1.00 27.81 ? 55   GLN E CA  1 
ATOM   10727 C  C   . GLN E 1 12  ? -2.542  60.840  85.557  1.00 27.48 ? 55   GLN E C   1 
ATOM   10728 O  O   . GLN E 1 12  ? -1.522  60.680  84.884  1.00 26.98 ? 55   GLN E O   1 
ATOM   10729 C  CB  . GLN E 1 12  ? -2.450  62.028  87.776  1.00 28.19 ? 55   GLN E CB  1 
ATOM   10730 C  CG  . GLN E 1 12  ? -2.942  62.021  89.194  1.00 30.62 ? 55   GLN E CG  1 
ATOM   10731 C  CD  . GLN E 1 12  ? -4.396  61.620  89.316  1.00 31.71 ? 55   GLN E CD  1 
ATOM   10732 O  OE1 . GLN E 1 12  ? -4.834  60.579  88.813  1.00 31.08 ? 55   GLN E OE1 1 
ATOM   10733 N  NE2 . GLN E 1 12  ? -5.178  62.437  90.014  1.00 30.55 ? 55   GLN E NE2 1 
ATOM   10734 N  N   . LEU E 1 13  ? -3.708  61.130  85.007  1.00 26.59 ? 56   LEU E N   1 
ATOM   10735 C  CA  . LEU E 1 13  ? -3.788  61.328  83.581  1.00 27.32 ? 56   LEU E CA  1 
ATOM   10736 C  C   . LEU E 1 13  ? -2.879  62.511  83.242  1.00 28.65 ? 56   LEU E C   1 
ATOM   10737 O  O   . LEU E 1 13  ? -2.856  63.517  83.962  1.00 29.34 ? 56   LEU E O   1 
ATOM   10738 C  CB  . LEU E 1 13  ? -5.228  61.622  83.175  1.00 26.16 ? 56   LEU E CB  1 
ATOM   10739 C  CG  . LEU E 1 13  ? -5.453  61.679  81.667  1.00 25.41 ? 56   LEU E CG  1 
ATOM   10740 C  CD1 . LEU E 1 13  ? -4.879  60.434  81.010  1.00 22.34 ? 56   LEU E CD1 1 
ATOM   10741 C  CD2 . LEU E 1 13  ? -6.937  61.817  81.392  1.00 24.41 ? 56   LEU E CD2 1 
ATOM   10742 N  N   . GLY E 1 14  ? -2.128  62.392  82.152  1.00 28.78 ? 57   GLY E N   1 
ATOM   10743 C  CA  . GLY E 1 14  ? -1.229  63.467  81.778  1.00 28.70 ? 57   GLY E CA  1 
ATOM   10744 C  C   . GLY E 1 14  ? 0.039   63.391  82.608  1.00 28.25 ? 57   GLY E C   1 
ATOM   10745 O  O   . GLY E 1 14  ? 1.106   63.815  82.174  1.00 27.00 ? 57   GLY E O   1 
ATOM   10746 N  N   . ARG E 1 15  ? -0.070  62.848  83.813  1.00 27.86 ? 58   ARG E N   1 
ATOM   10747 C  CA  . ARG E 1 15  ? 1.097   62.710  84.670  1.00 28.63 ? 58   ARG E CA  1 
ATOM   10748 C  C   . ARG E 1 15  ? 2.250   62.112  83.861  1.00 27.87 ? 58   ARG E C   1 
ATOM   10749 O  O   . ARG E 1 15  ? 2.124   61.020  83.317  1.00 28.82 ? 58   ARG E O   1 
ATOM   10750 C  CB  . ARG E 1 15  ? 0.759   61.806  85.849  1.00 28.19 ? 58   ARG E CB  1 
ATOM   10751 C  CG  . ARG E 1 15  ? 0.589   62.527  87.167  1.00 26.95 ? 58   ARG E CG  1 
ATOM   10752 C  CD  . ARG E 1 15  ? 1.915   62.607  87.904  1.00 25.58 ? 58   ARG E CD  1 
ATOM   10753 N  NE  . ARG E 1 15  ? 1.789   62.146  89.278  1.00 24.81 ? 58   ARG E NE  1 
ATOM   10754 C  CZ  . ARG E 1 15  ? 2.815   61.842  90.058  1.00 24.11 ? 58   ARG E CZ  1 
ATOM   10755 N  NH1 . ARG E 1 15  ? 4.051   61.957  89.592  1.00 23.38 ? 58   ARG E NH1 1 
ATOM   10756 N  NH2 . ARG E 1 15  ? 2.598   61.399  91.292  1.00 21.74 ? 58   ARG E NH2 1 
ATOM   10757 N  N   . PRO E 1 16  ? 3.390   62.818  83.777  1.00 28.33 ? 59   PRO E N   1 
ATOM   10758 C  CA  . PRO E 1 16  ? 4.532   62.305  83.014  1.00 29.25 ? 59   PRO E CA  1 
ATOM   10759 C  C   . PRO E 1 16  ? 4.736   60.817  83.251  1.00 29.97 ? 59   PRO E C   1 
ATOM   10760 O  O   . PRO E 1 16  ? 5.036   60.378  84.364  1.00 31.17 ? 59   PRO E O   1 
ATOM   10761 C  CB  . PRO E 1 16  ? 5.698   63.133  83.536  1.00 28.36 ? 59   PRO E CB  1 
ATOM   10762 C  CG  . PRO E 1 16  ? 5.048   64.430  83.872  1.00 28.72 ? 59   PRO E CG  1 
ATOM   10763 C  CD  . PRO E 1 16  ? 3.780   64.002  84.561  1.00 27.67 ? 59   PRO E CD  1 
ATOM   10764 N  N   . ALA E 1 17  ? 4.559   60.031  82.202  1.00 29.74 ? 60   ALA E N   1 
ATOM   10765 C  CA  . ALA E 1 17  ? 4.730   58.605  82.349  1.00 29.10 ? 60   ALA E CA  1 
ATOM   10766 C  C   . ALA E 1 17  ? 6.092   58.350  82.986  1.00 28.50 ? 60   ALA E C   1 
ATOM   10767 O  O   . ALA E 1 17  ? 6.255   57.377  83.711  1.00 29.93 ? 60   ALA E O   1 
ATOM   10768 C  CB  . ALA E 1 17  ? 4.628   57.925  80.991  1.00 28.21 ? 60   ALA E CB  1 
ATOM   10769 N  N   . SER E 1 18  ? 7.056   59.237  82.734  1.00 28.10 ? 61   SER E N   1 
ATOM   10770 C  CA  . SER E 1 18  ? 8.415   59.094  83.275  1.00 27.47 ? 61   SER E CA  1 
ATOM   10771 C  C   . SER E 1 18  ? 8.428   59.032  84.796  1.00 26.94 ? 61   SER E C   1 
ATOM   10772 O  O   . SER E 1 18  ? 9.328   58.439  85.397  1.00 27.39 ? 61   SER E O   1 
ATOM   10773 C  CB  . SER E 1 18  ? 9.304   60.254  82.825  1.00 26.76 ? 61   SER E CB  1 
ATOM   10774 O  OG  . SER E 1 18  ? 8.818   61.479  83.336  1.00 26.41 ? 61   SER E OG  1 
ATOM   10775 N  N   . GLU E 1 19  ? 7.430   59.652  85.414  1.00 25.94 ? 62   GLU E N   1 
ATOM   10776 C  CA  . GLU E 1 19  ? 7.321   59.661  86.863  1.00 25.03 ? 62   GLU E CA  1 
ATOM   10777 C  C   . GLU E 1 19  ? 6.672   58.359  87.360  1.00 26.66 ? 62   GLU E C   1 
ATOM   10778 O  O   . GLU E 1 19  ? 5.448   58.249  87.367  1.00 28.75 ? 62   GLU E O   1 
ATOM   10779 C  CB  . GLU E 1 19  ? 6.454   60.840  87.318  1.00 22.03 ? 62   GLU E CB  1 
ATOM   10780 C  CG  . GLU E 1 19  ? 6.706   62.166  86.618  1.00 18.06 ? 62   GLU E CG  1 
ATOM   10781 C  CD  . GLU E 1 19  ? 5.793   63.261  87.145  1.00 17.33 ? 62   GLU E CD  1 
ATOM   10782 O  OE1 . GLU E 1 19  ? 4.593   62.990  87.305  1.00 15.85 ? 62   GLU E OE1 1 
ATOM   10783 O  OE2 . GLU E 1 19  ? 6.269   64.387  87.396  1.00 17.22 ? 62   GLU E OE2 1 
ATOM   10784 N  N   . SER E 1 20  ? 7.470   57.370  87.751  1.00 26.88 ? 63   SER E N   1 
ATOM   10785 C  CA  . SER E 1 20  ? 6.900   56.129  88.271  1.00 27.72 ? 63   SER E CA  1 
ATOM   10786 C  C   . SER E 1 20  ? 7.867   55.302  89.103  1.00 28.23 ? 63   SER E C   1 
ATOM   10787 O  O   . SER E 1 20  ? 9.035   55.158  88.780  1.00 28.13 ? 63   SER E O   1 
ATOM   10788 C  CB  . SER E 1 20  ? 6.335   55.255  87.145  1.00 28.27 ? 63   SER E CB  1 
ATOM   10789 O  OG  . SER E 1 20  ? 5.737   54.057  87.660  1.00 28.09 ? 63   SER E OG  1 
ATOM   10790 N  N   . PRO E 1 21  ? 7.373   54.733  90.193  1.00 29.21 ? 64   PRO E N   1 
ATOM   10791 C  CA  . PRO E 1 21  ? 8.178   53.912  91.086  1.00 30.92 ? 64   PRO E CA  1 
ATOM   10792 C  C   . PRO E 1 21  ? 7.961   52.475  90.654  1.00 30.93 ? 64   PRO E C   1 
ATOM   10793 O  O   . PRO E 1 21  ? 8.504   51.544  91.246  1.00 31.14 ? 64   PRO E O   1 
ATOM   10794 C  CB  . PRO E 1 21  ? 7.527   54.167  92.420  1.00 32.43 ? 64   PRO E CB  1 
ATOM   10795 C  CG  . PRO E 1 21  ? 6.058   54.053  92.015  1.00 31.05 ? 64   PRO E CG  1 
ATOM   10796 C  CD  . PRO E 1 21  ? 5.995   54.832  90.693  1.00 29.51 ? 64   PRO E CD  1 
ATOM   10797 N  N   . HIS E 1 22  ? 7.138   52.303  89.628  1.00 30.47 ? 65   HIS E N   1 
ATOM   10798 C  CA  . HIS E 1 22  ? 6.836   50.977  89.148  1.00 31.74 ? 65   HIS E CA  1 
ATOM   10799 C  C   . HIS E 1 22  ? 7.845   50.413  88.172  1.00 32.34 ? 65   HIS E C   1 
ATOM   10800 O  O   . HIS E 1 22  ? 8.547   51.157  87.502  1.00 33.08 ? 65   HIS E O   1 
ATOM   10801 C  CB  . HIS E 1 22  ? 5.438   50.976  88.568  1.00 32.44 ? 65   HIS E CB  1 
ATOM   10802 C  CG  . HIS E 1 22  ? 4.393   51.294  89.585  1.00 33.48 ? 65   HIS E CG  1 
ATOM   10803 N  ND1 . HIS E 1 22  ? 4.432   50.777  90.864  1.00 32.49 ? 65   HIS E ND1 1 
ATOM   10804 C  CD2 . HIS E 1 22  ? 3.304   52.095  89.535  1.00 31.80 ? 65   HIS E CD2 1 
ATOM   10805 C  CE1 . HIS E 1 22  ? 3.414   51.251  91.556  1.00 31.66 ? 65   HIS E CE1 1 
ATOM   10806 N  NE2 . HIS E 1 22  ? 2.714   52.053  90.778  1.00 30.28 ? 65   HIS E NE2 1 
ATOM   10807 N  N   . HIS E 1 23  ? 7.916   49.086  88.112  1.00 32.11 ? 66   HIS E N   1 
ATOM   10808 C  CA  . HIS E 1 23  ? 8.855   48.409  87.242  1.00 33.00 ? 66   HIS E CA  1 
ATOM   10809 C  C   . HIS E 1 23  ? 8.250   47.940  85.931  1.00 32.65 ? 66   HIS E C   1 
ATOM   10810 O  O   . HIS E 1 23  ? 8.194   46.751  85.652  1.00 33.36 ? 66   HIS E O   1 
ATOM   10811 C  CB  . HIS E 1 23  ? 9.439   47.217  87.938  1.00 36.09 ? 66   HIS E CB  1 
ATOM   10812 C  CG  . HIS E 1 23  ? 10.459  47.594  89.032  1.00 39.16 ? 66   HIS E CG  1 
ATOM   10813 N  ND1 . HIS E 1 23  ? 11.700  48.125  88.743  1.00 40.03 ? 66   HIS E ND1 1 
ATOM   10814 C  CD2 . HIS E 1 23  ? 10.399  47.494  90.383  1.00 39.57 ? 66   HIS E CD2 1 
ATOM   10815 C  CE1 . HIS E 1 23  ? 12.361  48.332  89.869  1.00 40.00 ? 66   HIS E CE1 1 
ATOM   10816 N  NE2 . HIS E 1 23  ? 11.594  47.956  90.878  1.00 40.30 ? 66   HIS E NE2 1 
ATOM   10817 N  N   . HIS E 1 24  ? 7.784   48.887  85.124  1.00 32.08 ? 67   HIS E N   1 
ATOM   10818 C  CA  . HIS E 1 24  ? 7.192   48.641  83.785  1.00 30.39 ? 67   HIS E CA  1 
ATOM   10819 C  C   . HIS E 1 24  ? 8.101   47.760  82.954  1.00 28.79 ? 67   HIS E C   1 
ATOM   10820 O  O   . HIS E 1 24  ? 9.280   47.628  83.239  1.00 28.90 ? 67   HIS E O   1 
ATOM   10821 C  CB  . HIS E 1 24  ? 6.888   49.936  83.042  1.00 30.86 ? 67   HIS E CB  1 
ATOM   10822 C  CG  . HIS E 1 24  ? 6.039   50.874  83.912  1.00 33.43 ? 67   HIS E CG  1 
ATOM   10823 N  ND1 . HIS E 1 24  ? 4.677   50.713  84.054  1.00 34.58 ? 67   HIS E ND1 1 
ATOM   10824 C  CD2 . HIS E 1 24  ? 6.371   51.948  84.671  1.00 34.44 ? 67   HIS E CD2 1 
ATOM   10825 C  CE1 . HIS E 1 24  ? 4.207   51.643  84.868  1.00 35.50 ? 67   HIS E CE1 1 
ATOM   10826 N  NE2 . HIS E 1 24  ? 5.214   52.405  85.257  1.00 35.07 ? 67   HIS E NE2 1 
ATOM   10827 N  N   . THR E 1 25  ? 7.533   47.146  81.904  1.00 27.25 ? 68   THR E N   1 
ATOM   10828 C  CA  . THR E 1 25  ? 8.286   46.274  80.992  1.00 25.70 ? 68   THR E CA  1 
ATOM   10829 C  C   . THR E 1 25  ? 7.645   46.396  79.619  1.00 25.17 ? 68   THR E C   1 
ATOM   10830 O  O   . THR E 1 25  ? 6.435   46.624  79.506  1.00 25.67 ? 68   THR E O   1 
ATOM   10831 C  CB  . THR E 1 25  ? 8.235   44.772  81.427  1.00 24.58 ? 68   THR E CB  1 
ATOM   10832 O  OG1 . THR E 1 25  ? 6.902   44.454  81.844  1.00 22.58 ? 68   THR E OG1 1 
ATOM   10833 C  CG2 . THR E 1 25  ? 9.227   44.504  82.550  1.00 24.33 ? 68   THR E CG2 1 
ATOM   10834 N  N   . ALA E 1 26  ? 8.452   46.254  78.577  1.00 22.89 ? 69   ALA E N   1 
ATOM   10835 C  CA  . ALA E 1 26  ? 7.936   46.362  77.222  1.00 22.02 ? 69   ALA E CA  1 
ATOM   10836 C  C   . ALA E 1 26  ? 7.223   45.066  76.839  1.00 22.63 ? 69   ALA E C   1 
ATOM   10837 O  O   . ALA E 1 26  ? 7.503   44.008  77.402  1.00 23.39 ? 69   ALA E O   1 
ATOM   10838 C  CB  . ALA E 1 26  ? 9.081   46.640  76.259  1.00 18.80 ? 69   ALA E CB  1 
ATOM   10839 N  N   . PRO E 1 27  ? 6.278   45.133  75.891  1.00 22.34 ? 70   PRO E N   1 
ATOM   10840 C  CA  . PRO E 1 27  ? 5.567   43.920  75.471  1.00 21.94 ? 70   PRO E CA  1 
ATOM   10841 C  C   . PRO E 1 27  ? 6.537   43.053  74.682  1.00 21.02 ? 70   PRO E C   1 
ATOM   10842 O  O   . PRO E 1 27  ? 7.650   43.479  74.367  1.00 19.96 ? 70   PRO E O   1 
ATOM   10843 C  CB  . PRO E 1 27  ? 4.448   44.446  74.567  1.00 22.16 ? 70   PRO E CB  1 
ATOM   10844 C  CG  . PRO E 1 27  ? 4.295   45.882  74.975  1.00 23.82 ? 70   PRO E CG  1 
ATOM   10845 C  CD  . PRO E 1 27  ? 5.712   46.324  75.244  1.00 23.07 ? 70   PRO E CD  1 
ATOM   10846 N  N   . ALA E 1 28  ? 6.102   41.851  74.337  1.00 20.18 ? 71   ALA E N   1 
ATOM   10847 C  CA  . ALA E 1 28  ? 6.940   40.944  73.583  1.00 21.18 ? 71   ALA E CA  1 
ATOM   10848 C  C   . ALA E 1 28  ? 6.091   40.197  72.586  1.00 23.45 ? 71   ALA E C   1 
ATOM   10849 O  O   . ALA E 1 28  ? 5.021   39.695  72.935  1.00 24.32 ? 71   ALA E O   1 
ATOM   10850 C  CB  . ALA E 1 28  ? 7.620   39.970  74.521  1.00 18.66 ? 71   ALA E CB  1 
ATOM   10851 N  N   . LYS E 1 29  ? 6.552   40.130  71.340  1.00 25.25 ? 72   LYS E N   1 
ATOM   10852 C  CA  . LYS E 1 29  ? 5.805   39.403  70.320  1.00 25.20 ? 72   LYS E CA  1 
ATOM   10853 C  C   . LYS E 1 29  ? 6.296   37.964  70.267  1.00 24.97 ? 72   LYS E C   1 
ATOM   10854 O  O   . LYS E 1 29  ? 7.080   37.539  71.114  1.00 23.79 ? 72   LYS E O   1 
ATOM   10855 C  CB  . LYS E 1 29  ? 5.928   40.077  68.951  1.00 26.07 ? 72   LYS E CB  1 
ATOM   10856 C  CG  . LYS E 1 29  ? 4.576   40.208  68.241  1.00 26.39 ? 72   LYS E CG  1 
ATOM   10857 C  CD  . LYS E 1 29  ? 4.546   41.370  67.261  1.00 28.11 ? 72   LYS E CD  1 
ATOM   10858 C  CE  . LYS E 1 29  ? 4.875   42.697  67.950  1.00 29.59 ? 72   LYS E CE  1 
ATOM   10859 N  NZ  . LYS E 1 29  ? 4.706   43.889  67.052  1.00 28.06 ? 72   LYS E NZ  1 
ATOM   10860 N  N   . SER E 1 30  ? 5.842   37.207  69.278  1.00 26.30 ? 73   SER E N   1 
ATOM   10861 C  CA  . SER E 1 30  ? 6.220   35.806  69.213  1.00 26.50 ? 73   SER E CA  1 
ATOM   10862 C  C   . SER E 1 30  ? 7.433   35.486  68.372  1.00 26.51 ? 73   SER E C   1 
ATOM   10863 O  O   . SER E 1 30  ? 7.628   36.043  67.294  1.00 26.01 ? 73   SER E O   1 
ATOM   10864 C  CB  . SER E 1 30  ? 5.037   34.950  68.734  1.00 26.24 ? 73   SER E CB  1 
ATOM   10865 O  OG  . SER E 1 30  ? 5.377   33.567  68.712  1.00 25.85 ? 73   SER E OG  1 
ATOM   10866 N  N   . PRO E 1 31  ? 8.281   34.588  68.888  1.00