data_1M7N
# 
_entry.id   1M7N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1M7N         
RCSB  RCSB016697   
WWPDB D_1000016697 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1M7N 
_pdbx_database_status.recvd_initial_deposition_date   2002-07-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Munshi, S.' 1 
'Kuo, L.'    2 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of the Apo, unactivated insulin-like 
growth factor-1 receptor kinase. Implication 
for inhibitor specificity.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            277 
_citation.page_first                38797 
_citation.page_last                 38802 
_citation.year                      2002 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12138114 
_citation.pdbx_database_id_DOI      10.1074/jbc.M205580200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Munshi, S.'       1 
primary 'Kornienko, M.'    2 
primary 'Hall, D.L.'       3 
primary 'Reid, J.C.'       4 
primary 'Waxman, L.'       5 
primary 'Stirdivant, S.M.' 6 
primary 'Darke, P.L.'      7 
primary 'Kuo, L.C.'        8 
# 
_cell.entry_id           1M7N 
_cell.length_a           52.88 
_cell.length_b           78.06 
_cell.length_c           78.97 
_cell.angle_alpha        90 
_cell.angle_beta         99.17 
_cell.angle_gamma        90 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
# 
_symmetry.entry_id                         1M7N 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Insulin-like growth factor I receptor' 36773.031 2   2.7.1.112 ? 'kinase domain (residues 974-1286)' ? 
2 water   nat water                                   18.015    219 ?         ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CD221 antigen' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEAS
VMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFV
HRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQP
YQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEE
LD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEAS
VMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFV
HRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQP
YQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEE
LD
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   VAL n 
1 5   ASN n 
1 6   PRO n 
1 7   GLU n 
1 8   TYR n 
1 9   PHE n 
1 10  SER n 
1 11  ALA n 
1 12  ALA n 
1 13  ASP n 
1 14  VAL n 
1 15  TYR n 
1 16  VAL n 
1 17  PRO n 
1 18  ASP n 
1 19  GLU n 
1 20  TRP n 
1 21  GLU n 
1 22  VAL n 
1 23  ALA n 
1 24  ARG n 
1 25  GLU n 
1 26  LYS n 
1 27  ILE n 
1 28  THR n 
1 29  MET n 
1 30  SER n 
1 31  ARG n 
1 32  GLU n 
1 33  LEU n 
1 34  GLY n 
1 35  GLN n 
1 36  GLY n 
1 37  SER n 
1 38  PHE n 
1 39  GLY n 
1 40  MET n 
1 41  VAL n 
1 42  TYR n 
1 43  GLU n 
1 44  GLY n 
1 45  VAL n 
1 46  ALA n 
1 47  LYS n 
1 48  GLY n 
1 49  VAL n 
1 50  VAL n 
1 51  LYS n 
1 52  ASP n 
1 53  GLU n 
1 54  PRO n 
1 55  GLU n 
1 56  THR n 
1 57  ARG n 
1 58  VAL n 
1 59  ALA n 
1 60  ILE n 
1 61  LYS n 
1 62  THR n 
1 63  VAL n 
1 64  ASN n 
1 65  GLU n 
1 66  ALA n 
1 67  ALA n 
1 68  SER n 
1 69  MET n 
1 70  ARG n 
1 71  GLU n 
1 72  ARG n 
1 73  ILE n 
1 74  GLU n 
1 75  PHE n 
1 76  LEU n 
1 77  ASN n 
1 78  GLU n 
1 79  ALA n 
1 80  SER n 
1 81  VAL n 
1 82  MET n 
1 83  LYS n 
1 84  GLU n 
1 85  PHE n 
1 86  ASN n 
1 87  CYS n 
1 88  HIS n 
1 89  HIS n 
1 90  VAL n 
1 91  VAL n 
1 92  ARG n 
1 93  LEU n 
1 94  LEU n 
1 95  GLY n 
1 96  VAL n 
1 97  VAL n 
1 98  SER n 
1 99  GLN n 
1 100 GLY n 
1 101 GLN n 
1 102 PRO n 
1 103 THR n 
1 104 LEU n 
1 105 VAL n 
1 106 ILE n 
1 107 MET n 
1 108 GLU n 
1 109 LEU n 
1 110 MET n 
1 111 THR n 
1 112 ARG n 
1 113 GLY n 
1 114 ASP n 
1 115 LEU n 
1 116 LYS n 
1 117 SER n 
1 118 TYR n 
1 119 LEU n 
1 120 ARG n 
1 121 SER n 
1 122 LEU n 
1 123 ARG n 
1 124 PRO n 
1 125 GLU n 
1 126 MET n 
1 127 GLU n 
1 128 ASN n 
1 129 ASN n 
1 130 PRO n 
1 131 VAL n 
1 132 LEU n 
1 133 ALA n 
1 134 PRO n 
1 135 PRO n 
1 136 SER n 
1 137 LEU n 
1 138 SER n 
1 139 LYS n 
1 140 MET n 
1 141 ILE n 
1 142 GLN n 
1 143 MET n 
1 144 ALA n 
1 145 GLY n 
1 146 GLU n 
1 147 ILE n 
1 148 ALA n 
1 149 ASP n 
1 150 GLY n 
1 151 MET n 
1 152 ALA n 
1 153 TYR n 
1 154 LEU n 
1 155 ASN n 
1 156 ALA n 
1 157 ASN n 
1 158 LYS n 
1 159 PHE n 
1 160 VAL n 
1 161 HIS n 
1 162 ARG n 
1 163 ASP n 
1 164 LEU n 
1 165 ALA n 
1 166 ALA n 
1 167 ARG n 
1 168 ASN n 
1 169 CYS n 
1 170 MET n 
1 171 VAL n 
1 172 ALA n 
1 173 GLU n 
1 174 ASP n 
1 175 PHE n 
1 176 THR n 
1 177 VAL n 
1 178 LYS n 
1 179 ILE n 
1 180 GLY n 
1 181 ASP n 
1 182 PHE n 
1 183 GLY n 
1 184 MET n 
1 185 THR n 
1 186 ARG n 
1 187 ASP n 
1 188 ILE n 
1 189 TYR n 
1 190 GLU n 
1 191 THR n 
1 192 ASP n 
1 193 TYR n 
1 194 TYR n 
1 195 ARG n 
1 196 LYS n 
1 197 GLY n 
1 198 GLY n 
1 199 LYS n 
1 200 GLY n 
1 201 LEU n 
1 202 LEU n 
1 203 PRO n 
1 204 VAL n 
1 205 ARG n 
1 206 TRP n 
1 207 MET n 
1 208 SER n 
1 209 PRO n 
1 210 GLU n 
1 211 SER n 
1 212 LEU n 
1 213 LYS n 
1 214 ASP n 
1 215 GLY n 
1 216 VAL n 
1 217 PHE n 
1 218 THR n 
1 219 THR n 
1 220 TYR n 
1 221 SER n 
1 222 ASP n 
1 223 VAL n 
1 224 TRP n 
1 225 SER n 
1 226 PHE n 
1 227 GLY n 
1 228 VAL n 
1 229 VAL n 
1 230 LEU n 
1 231 TRP n 
1 232 GLU n 
1 233 ILE n 
1 234 ALA n 
1 235 THR n 
1 236 LEU n 
1 237 ALA n 
1 238 GLU n 
1 239 GLN n 
1 240 PRO n 
1 241 TYR n 
1 242 GLN n 
1 243 GLY n 
1 244 LEU n 
1 245 SER n 
1 246 ASN n 
1 247 GLU n 
1 248 GLN n 
1 249 VAL n 
1 250 LEU n 
1 251 ARG n 
1 252 PHE n 
1 253 VAL n 
1 254 MET n 
1 255 GLU n 
1 256 GLY n 
1 257 GLY n 
1 258 LEU n 
1 259 LEU n 
1 260 ASP n 
1 261 LYS n 
1 262 PRO n 
1 263 ASP n 
1 264 ASN n 
1 265 CYS n 
1 266 PRO n 
1 267 ASP n 
1 268 MET n 
1 269 LEU n 
1 270 PHE n 
1 271 GLU n 
1 272 LEU n 
1 273 MET n 
1 274 ARG n 
1 275 MET n 
1 276 CYS n 
1 277 TRP n 
1 278 GLN n 
1 279 TYR n 
1 280 ASN n 
1 281 PRO n 
1 282 LYS n 
1 283 MET n 
1 284 ARG n 
1 285 PRO n 
1 286 SER n 
1 287 PHE n 
1 288 LEU n 
1 289 GLU n 
1 290 ILE n 
1 291 ILE n 
1 292 SER n 
1 293 SER n 
1 294 ILE n 
1 295 LYS n 
1 296 GLU n 
1 297 GLU n 
1 298 MET n 
1 299 GLU n 
1 300 PRO n 
1 301 GLY n 
1 302 PHE n 
1 303 ARG n 
1 304 GLU n 
1 305 VAL n 
1 306 SER n 
1 307 PHE n 
1 308 TYR n 
1 309 TYR n 
1 310 SER n 
1 311 GLU n 
1 312 GLU n 
1 313 ASN n 
1 314 LYS n 
1 315 LEU n 
1 316 PRO n 
1 317 GLU n 
1 318 PRO n 
1 319 GLU n 
1 320 GLU n 
1 321 LEU n 
1 322 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            SF9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IGF1R_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASV
MKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVH
RDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPY
QGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEEL
D
;
_struct_ref.pdbx_align_begin           974 
_struct_ref.pdbx_db_accession          P08069 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1M7N A 2 ? 322 ? P08069 974 ? 1294 ? 971 1291 
2 1 1M7N B 2 ? 322 ? P08069 974 ? 1294 ? 971 1291 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1M7N MET A 1 ? UNP P08069 ? ? 'CLONING ARTIFACT' 970 1 
2 1M7N MET B 1 ? UNP P08069 ? ? 'CLONING ARTIFACT' 970 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1M7N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.19 
_exptl_crystal.density_percent_sol   43.75 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'0.1M Tris-HCl, 0.2M MgCl2, 29% PEG 8000, 2% Ethylene glycol, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1M7N 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            2.7 
_reflns.d_resolution_low             20.0 
_reflns.number_all                   ? 
_reflns.number_obs                   17255 
_reflns.percent_possible_obs         98 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.089 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1M7N 
_refine.ls_d_res_high                            2.7 
_refine.ls_d_res_low                             20 
_refine.pdbx_ls_sigma_F                          1 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     16172 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.229 
_refine.ls_R_factor_R_free                       0.294 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4768 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             219 
_refine_hist.number_atoms_total               4987 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        20 
# 
_struct.entry_id                  1M7N 
_struct.title                     'Crystal Structure of Unactivated APO Insulin-like Growth Factor-1 Receptor Kinase Domain' 
_struct.pdbx_descriptor           'Insulin-like growth factor I receptor (E.C.2.7.1.112)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1M7N 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 23  ? GLU A 25  ? ALA A 992  GLU A 994  5 ? 3  
HELX_P HELX_P2  2  SER A 68  ? MET A 82  ? SER A 1037 MET A 1051 1 ? 15 
HELX_P HELX_P3  3  ASP A 114 ? SER A 121 ? ASP A 1083 SER A 1090 1 ? 8  
HELX_P HELX_P4  4  SER A 136 ? ASN A 157 ? SER A 1105 ASN A 1126 1 ? 22 
HELX_P HELX_P5  5  ALA A 165 ? ARG A 167 ? ALA A 1134 ARG A 1136 5 ? 3  
HELX_P HELX_P6  6  ARG A 186 ? TYR A 193 ? ARG A 1155 TYR A 1162 5 ? 8  
HELX_P HELX_P7  7  GLY A 197 ? LYS A 199 ? GLY A 1166 LYS A 1168 5 ? 3  
HELX_P HELX_P8  8  PRO A 203 ? MET A 207 ? PRO A 1172 MET A 1176 5 ? 5  
HELX_P HELX_P9  9  SER A 208 ? GLY A 215 ? SER A 1177 GLY A 1184 1 ? 8  
HELX_P HELX_P10 10 THR A 218 ? THR A 235 ? THR A 1187 THR A 1204 1 ? 18 
HELX_P HELX_P11 11 SER A 245 ? GLU A 255 ? SER A 1214 GLU A 1224 1 ? 11 
HELX_P HELX_P12 12 PRO A 266 ? TRP A 277 ? PRO A 1235 TRP A 1246 1 ? 12 
HELX_P HELX_P13 13 ASN A 280 ? ARG A 284 ? ASN A 1249 ARG A 1253 5 ? 5  
HELX_P HELX_P14 14 SER A 286 ? ILE A 294 ? SER A 1255 ILE A 1263 1 ? 9  
HELX_P HELX_P15 15 GLU A 299 ? SER A 306 ? GLU A 1268 SER A 1275 1 ? 8  
HELX_P HELX_P16 16 ALA B 23  ? GLU B 25  ? ALA B 992  GLU B 994  5 ? 3  
HELX_P HELX_P17 17 SER B 68  ? MET B 82  ? SER B 1037 MET B 1051 1 ? 15 
HELX_P HELX_P18 18 LYS B 83  ? PHE B 85  ? LYS B 1052 PHE B 1054 5 ? 3  
HELX_P HELX_P19 19 ASP B 114 ? SER B 121 ? ASP B 1083 SER B 1090 1 ? 8  
HELX_P HELX_P20 20 SER B 136 ? ASN B 157 ? SER B 1105 ASN B 1126 1 ? 22 
HELX_P HELX_P21 21 ALA B 165 ? ARG B 167 ? ALA B 1134 ARG B 1136 5 ? 3  
HELX_P HELX_P22 22 ARG B 186 ? TYR B 193 ? ARG B 1155 TYR B 1162 5 ? 8  
HELX_P HELX_P23 23 PRO B 203 ? MET B 207 ? PRO B 1172 MET B 1176 5 ? 5  
HELX_P HELX_P24 24 SER B 208 ? GLY B 215 ? SER B 1177 GLY B 1184 1 ? 8  
HELX_P HELX_P25 25 THR B 218 ? THR B 235 ? THR B 1187 THR B 1204 1 ? 18 
HELX_P HELX_P26 26 SER B 245 ? GLU B 255 ? SER B 1214 GLU B 1224 1 ? 11 
HELX_P HELX_P27 27 PRO B 266 ? TRP B 277 ? PRO B 1235 TRP B 1246 1 ? 12 
HELX_P HELX_P28 28 ASN B 280 ? ARG B 284 ? ASN B 1249 ARG B 1253 5 ? 5  
HELX_P HELX_P29 29 SER B 286 ? SER B 293 ? SER B 1255 SER B 1262 1 ? 8  
HELX_P HELX_P30 30 GLY B 301 ? SER B 306 ? GLY B 1270 SER B 1275 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 101 A . ? GLN 1070 A PRO 102 A ? PRO 1071 A 1 0.02  
2 GLN 101 B . ? GLN 1070 B PRO 102 B ? PRO 1071 B 1 -0.13 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 2 ? 
D ? 5 ? 
E ? 2 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 27  ? GLN A 35  ? ILE A 996  GLN A 1004 
A 2 MET A 40  ? ALA A 46  ? MET A 1009 ALA A 1015 
A 3 ARG A 57  ? THR A 62  ? ARG A 1026 THR A 1031 
A 4 LEU A 104 ? GLU A 108 ? LEU A 1073 GLU A 1077 
A 5 LEU A 93  ? VAL A 97  ? LEU A 1062 VAL A 1066 
B 1 CYS A 169 ? VAL A 171 ? CYS A 1138 VAL A 1140 
B 2 VAL A 177 ? ILE A 179 ? VAL A 1146 ILE A 1148 
C 1 TYR A 194 ? ARG A 195 ? TYR A 1163 ARG A 1164 
C 2 LEU A 201 ? LEU A 202 ? LEU A 1170 LEU A 1171 
D 1 ILE B 27  ? GLN B 35  ? ILE B 996  GLN B 1004 
D 2 MET B 40  ? LYS B 47  ? MET B 1009 LYS B 1016 
D 3 GLU B 55  ? THR B 62  ? GLU B 1024 THR B 1031 
D 4 LEU B 104 ? GLU B 108 ? LEU B 1073 GLU B 1077 
D 5 LEU B 93  ? VAL B 97  ? LEU B 1062 VAL B 1066 
E 1 CYS B 169 ? VAL B 171 ? CYS B 1138 VAL B 1140 
E 2 VAL B 177 ? ILE B 179 ? VAL B 1146 ILE B 1148 
F 1 TYR B 194 ? ARG B 195 ? TYR B 1163 ARG B 1164 
F 2 LEU B 201 ? LEU B 202 ? LEU B 1170 LEU B 1171 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 28  ? N THR A 997  O VAL A 45  ? O VAL A 1014 
A 2 3 N TYR A 42  ? N TYR A 1011 O ILE A 60  ? O ILE A 1029 
A 3 4 N ALA A 59  ? N ALA A 1028 O MET A 107 ? O MET A 1076 
A 4 5 O ILE A 106 ? O ILE A 1075 N GLY A 95  ? N GLY A 1064 
B 1 2 N MET A 170 ? N MET A 1139 O LYS A 178 ? O LYS A 1147 
C 1 2 N TYR A 194 ? N TYR A 1163 O LEU A 202 ? O LEU A 1171 
D 1 2 N THR B 28  ? N THR B 997  O VAL B 45  ? O VAL B 1014 
D 2 3 N TYR B 42  ? N TYR B 1011 O ILE B 60  ? O ILE B 1029 
D 3 4 N ALA B 59  ? N ALA B 1028 O MET B 107 ? O MET B 1076 
D 4 5 O LEU B 104 ? O LEU B 1073 N VAL B 97  ? N VAL B 1066 
E 1 2 N MET B 170 ? N MET B 1139 O LYS B 178 ? O LYS B 1147 
F 1 2 N TYR B 194 ? N TYR B 1163 O LEU B 202 ? O LEU B 1171 
# 
_database_PDB_matrix.entry_id          1M7N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1M7N 
_atom_sites.fract_transf_matrix[1][1]   0.018911 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003053 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012811 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012827 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 10  ? 10.886  15.740 41.951  1.00 31.75 ? 979  SER A N   1 
ATOM   2    C CA  . SER A 1 10  ? 10.475  15.846 43.383  1.00 32.31 ? 979  SER A CA  1 
ATOM   3    C C   . SER A 1 10  ? 9.137   15.157 43.618  1.00 32.48 ? 979  SER A C   1 
ATOM   4    O O   . SER A 1 10  ? 8.483   14.710 42.676  1.00 34.02 ? 979  SER A O   1 
ATOM   5    C CB  . SER A 1 10  ? 10.360  17.313 43.794  1.00 29.95 ? 979  SER A CB  1 
ATOM   6    O OG  . SER A 1 10  ? 9.251   17.916 43.166  1.00 29.25 ? 979  SER A OG  1 
ATOM   7    N N   . ALA A 1 11  ? 8.739   15.066 44.881  1.00 33.45 ? 980  ALA A N   1 
ATOM   8    C CA  . ALA A 1 11  ? 7.466   14.438 45.241  1.00 33.89 ? 980  ALA A CA  1 
ATOM   9    C C   . ALA A 1 11  ? 6.320   15.408 44.956  1.00 32.91 ? 980  ALA A C   1 
ATOM   10   O O   . ALA A 1 11  ? 6.507   16.626 44.965  1.00 32.41 ? 980  ALA A O   1 
ATOM   11   C CB  . ALA A 1 11  ? 7.469   14.041 46.721  1.00 33.38 ? 980  ALA A CB  1 
ATOM   12   N N   . ALA A 1 12  ? 5.136   14.862 44.708  1.00 32.20 ? 981  ALA A N   1 
ATOM   13   C CA  . ALA A 1 12  ? 3.978   15.686 44.399  1.00 32.58 ? 981  ALA A CA  1 
ATOM   14   C C   . ALA A 1 12  ? 3.392   16.337 45.632  1.00 33.14 ? 981  ALA A C   1 
ATOM   15   O O   . ALA A 1 12  ? 3.709   15.968 46.765  1.00 33.92 ? 981  ALA A O   1 
ATOM   16   C CB  . ALA A 1 12  ? 2.905   14.849 43.701  1.00 32.17 ? 981  ALA A CB  1 
ATOM   17   N N   . ASP A 1 13  ? 2.533   17.320 45.398  1.00 32.96 ? 982  ASP A N   1 
ATOM   18   C CA  . ASP A 1 13  ? 1.872   18.007 46.484  1.00 32.42 ? 982  ASP A CA  1 
ATOM   19   C C   . ASP A 1 13  ? 0.503   17.363 46.667  1.00 33.41 ? 982  ASP A C   1 
ATOM   20   O O   . ASP A 1 13  ? -0.526  17.953 46.317  1.00 33.29 ? 982  ASP A O   1 
ATOM   21   C CB  . ASP A 1 13  ? 1.723   19.499 46.173  1.00 31.72 ? 982  ASP A CB  1 
ATOM   22   C CG  . ASP A 1 13  ? 3.059   20.181 45.941  1.00 30.31 ? 982  ASP A CG  1 
ATOM   23   O OD1 . ASP A 1 13  ? 4.057   19.740 46.538  1.00 28.38 ? 982  ASP A OD1 1 
ATOM   24   O OD2 . ASP A 1 13  ? 3.112   21.166 45.174  1.00 29.98 ? 982  ASP A OD2 1 
ATOM   25   N N   . VAL A 1 14  ? 0.511   16.141 47.201  1.00 33.37 ? 983  VAL A N   1 
ATOM   26   C CA  . VAL A 1 14  ? -0.711  15.379 47.465  1.00 34.12 ? 983  VAL A CA  1 
ATOM   27   C C   . VAL A 1 14  ? -0.506  14.493 48.684  1.00 33.07 ? 983  VAL A C   1 
ATOM   28   O O   . VAL A 1 14  ? 0.624   14.283 49.112  1.00 34.70 ? 983  VAL A O   1 
ATOM   29   C CB  . VAL A 1 14  ? -1.089  14.453 46.281  1.00 34.92 ? 983  VAL A CB  1 
ATOM   30   C CG1 . VAL A 1 14  ? -1.438  15.281 45.050  1.00 35.55 ? 983  VAL A CG1 1 
ATOM   31   C CG2 . VAL A 1 14  ? 0.063   13.506 45.978  1.00 34.78 ? 983  VAL A CG2 1 
ATOM   32   N N   . TYR A 1 15  ? -1.599  13.986 49.243  1.00 32.04 ? 984  TYR A N   1 
ATOM   33   C CA  . TYR A 1 15  ? -1.525  13.087 50.395  1.00 30.62 ? 984  TYR A CA  1 
ATOM   34   C C   . TYR A 1 15  ? -2.462  11.900 50.211  1.00 30.44 ? 984  TYR A C   1 
ATOM   35   O O   . TYR A 1 15  ? -3.688  12.043 50.140  1.00 28.86 ? 984  TYR A O   1 
ATOM   36   C CB  . TYR A 1 15  ? -1.861  13.810 51.708  1.00 29.20 ? 984  TYR A CB  1 
ATOM   37   C CG  . TYR A 1 15  ? -1.875  12.890 52.913  1.00 26.06 ? 984  TYR A CG  1 
ATOM   38   C CD1 . TYR A 1 15  ? -3.076  12.399 53.425  1.00 26.38 ? 984  TYR A CD1 1 
ATOM   39   C CD2 . TYR A 1 15  ? -0.688  12.466 53.507  1.00 25.65 ? 984  TYR A CD2 1 
ATOM   40   C CE1 . TYR A 1 15  ? -3.100  11.501 54.498  1.00 23.54 ? 984  TYR A CE1 1 
ATOM   41   C CE2 . TYR A 1 15  ? -0.695  11.569 54.581  1.00 24.52 ? 984  TYR A CE2 1 
ATOM   42   C CZ  . TYR A 1 15  ? -1.906  11.091 55.067  1.00 24.52 ? 984  TYR A CZ  1 
ATOM   43   O OH  . TYR A 1 15  ? -1.923  10.188 56.103  1.00 22.75 ? 984  TYR A OH  1 
ATOM   44   N N   . VAL A 1 16  ? -1.864  10.722 50.119  1.00 30.83 ? 985  VAL A N   1 
ATOM   45   C CA  . VAL A 1 16  ? -2.624  9.501  49.946  1.00 30.59 ? 985  VAL A CA  1 
ATOM   46   C C   . VAL A 1 16  ? -2.891  8.908  51.319  1.00 30.38 ? 985  VAL A C   1 
ATOM   47   O O   . VAL A 1 16  ? -1.963  8.539  52.038  1.00 31.16 ? 985  VAL A O   1 
ATOM   48   C CB  . VAL A 1 16  ? -1.847  8.473  49.098  1.00 29.98 ? 985  VAL A CB  1 
ATOM   49   C CG1 . VAL A 1 16  ? -2.733  7.280  48.797  1.00 29.67 ? 985  VAL A CG1 1 
ATOM   50   C CG2 . VAL A 1 16  ? -1.354  9.122  47.820  1.00 28.33 ? 985  VAL A CG2 1 
ATOM   51   N N   . PRO A 1 17  ? -4.168  8.825  51.709  1.00 30.35 ? 986  PRO A N   1 
ATOM   52   C CA  . PRO A 1 17  ? -4.529  8.266  53.015  1.00 30.85 ? 986  PRO A CA  1 
ATOM   53   C C   . PRO A 1 17  ? -4.122  6.797  53.170  1.00 31.73 ? 986  PRO A C   1 
ATOM   54   O O   . PRO A 1 17  ? -4.493  5.956  52.358  1.00 32.76 ? 986  PRO A O   1 
ATOM   55   C CB  . PRO A 1 17  ? -6.044  8.435  53.048  1.00 29.20 ? 986  PRO A CB  1 
ATOM   56   C CG  . PRO A 1 17  ? -6.268  9.643  52.183  1.00 28.45 ? 986  PRO A CG  1 
ATOM   57   C CD  . PRO A 1 17  ? -5.349  9.390  51.035  1.00 28.81 ? 986  PRO A CD  1 
ATOM   58   N N   . ASP A 1 18  ? -3.349  6.499  54.209  1.00 32.58 ? 987  ASP A N   1 
ATOM   59   C CA  . ASP A 1 18  ? -2.933  5.132  54.490  1.00 32.07 ? 987  ASP A CA  1 
ATOM   60   C C   . ASP A 1 18  ? -3.599  4.682  55.787  1.00 31.51 ? 987  ASP A C   1 
ATOM   61   O O   . ASP A 1 18  ? -4.657  5.189  56.151  1.00 30.17 ? 987  ASP A O   1 
ATOM   62   C CB  . ASP A 1 18  ? -1.420  5.047  54.633  1.00 33.02 ? 987  ASP A CB  1 
ATOM   63   C CG  . ASP A 1 18  ? -0.872  6.124  55.512  1.00 34.89 ? 987  ASP A CG  1 
ATOM   64   O OD1 . ASP A 1 18  ? -1.598  6.532  56.442  1.00 37.03 ? 987  ASP A OD1 1 
ATOM   65   O OD2 . ASP A 1 18  ? 0.280   6.556  55.281  1.00 36.34 ? 987  ASP A OD2 1 
ATOM   66   N N   . GLU A 1 19  ? -2.976  3.742  56.487  1.00 32.37 ? 988  GLU A N   1 
ATOM   67   C CA  . GLU A 1 19  ? -3.529  3.224  57.740  1.00 33.88 ? 988  GLU A CA  1 
ATOM   68   C C   . GLU A 1 19  ? -3.270  4.087  58.974  1.00 32.47 ? 988  GLU A C   1 
ATOM   69   O O   . GLU A 1 19  ? -3.427  3.621  60.093  1.00 33.11 ? 988  GLU A O   1 
ATOM   70   C CB  . GLU A 1 19  ? -3.011  1.808  58.001  1.00 36.22 ? 988  GLU A CB  1 
ATOM   71   C CG  . GLU A 1 19  ? -1.508  1.709  58.049  1.00 41.72 ? 988  GLU A CG  1 
ATOM   72   C CD  . GLU A 1 19  ? -0.863  2.338  56.828  1.00 44.97 ? 988  GLU A CD  1 
ATOM   73   O OE1 . GLU A 1 19  ? -1.236  1.957  55.694  1.00 45.42 ? 988  GLU A OE1 1 
ATOM   74   O OE2 . GLU A 1 19  ? 0.007   3.218  57.005  1.00 46.85 ? 988  GLU A OE2 1 
ATOM   75   N N   . TRP A 1 20  ? -2.857  5.333  58.773  1.00 32.13 ? 989  TRP A N   1 
ATOM   76   C CA  . TRP A 1 20  ? -2.622  6.245  59.890  1.00 30.80 ? 989  TRP A CA  1 
ATOM   77   C C   . TRP A 1 20  ? -3.864  7.120  60.020  1.00 30.13 ? 989  TRP A C   1 
ATOM   78   O O   . TRP A 1 20  ? -4.119  7.724  61.060  1.00 28.96 ? 989  TRP A O   1 
ATOM   79   C CB  . TRP A 1 20  ? -1.404  7.131  59.631  1.00 32.12 ? 989  TRP A CB  1 
ATOM   80   C CG  . TRP A 1 20  ? -0.089  6.483  59.936  1.00 32.69 ? 989  TRP A CG  1 
ATOM   81   C CD1 . TRP A 1 20  ? 0.773   5.910  59.045  1.00 32.78 ? 989  TRP A CD1 1 
ATOM   82   C CD2 . TRP A 1 20  ? 0.514   6.341  61.227  1.00 32.71 ? 989  TRP A CD2 1 
ATOM   83   N NE1 . TRP A 1 20  ? 1.878   5.421  59.702  1.00 33.28 ? 989  TRP A NE1 1 
ATOM   84   C CE2 . TRP A 1 20  ? 1.744   5.672  61.043  1.00 33.73 ? 989  TRP A CE2 1 
ATOM   85   C CE3 . TRP A 1 20  ? 0.133   6.716  62.525  1.00 33.97 ? 989  TRP A CE3 1 
ATOM   86   C CZ2 . TRP A 1 20  ? 2.600   5.366  62.109  1.00 34.40 ? 989  TRP A CZ2 1 
ATOM   87   C CZ3 . TRP A 1 20  ? 0.982   6.414  63.587  1.00 34.27 ? 989  TRP A CZ3 1 
ATOM   88   C CH2 . TRP A 1 20  ? 2.204   5.744  63.370  1.00 35.09 ? 989  TRP A CH2 1 
ATOM   89   N N   . GLU A 1 21  ? -4.630  7.170  58.937  1.00 29.45 ? 990  GLU A N   1 
ATOM   90   C CA  . GLU A 1 21  ? -5.860  7.941  58.877  1.00 28.20 ? 990  GLU A CA  1 
ATOM   91   C C   . GLU A 1 21  ? -6.784  7.498  60.012  1.00 27.52 ? 990  GLU A C   1 
ATOM   92   O O   . GLU A 1 21  ? -7.055  6.308  60.193  1.00 27.44 ? 990  GLU A O   1 
ATOM   93   C CB  . GLU A 1 21  ? -6.539  7.717  57.522  1.00 26.79 ? 990  GLU A CB  1 
ATOM   94   C CG  . GLU A 1 21  ? -7.657  8.684  57.181  1.00 26.11 ? 990  GLU A CG  1 
ATOM   95   C CD  . GLU A 1 21  ? -7.175  10.114 57.049  1.00 28.02 ? 990  GLU A CD  1 
ATOM   96   O OE1 . GLU A 1 21  ? -6.066  10.321 56.518  1.00 27.27 ? 990  GLU A OE1 1 
ATOM   97   O OE2 . GLU A 1 21  ? -7.914  11.033 57.466  1.00 27.21 ? 990  GLU A OE2 1 
ATOM   98   N N   . VAL A 1 22  ? -7.256  8.470  60.779  1.00 26.58 ? 991  VAL A N   1 
ATOM   99   C CA  . VAL A 1 22  ? -8.145  8.205  61.890  1.00 26.06 ? 991  VAL A CA  1 
ATOM   100  C C   . VAL A 1 22  ? -9.482  8.890  61.658  1.00 25.47 ? 991  VAL A C   1 
ATOM   101  O O   . VAL A 1 22  ? -9.537  10.030 61.196  1.00 25.24 ? 991  VAL A O   1 
ATOM   102  C CB  . VAL A 1 22  ? -7.537  8.728  63.214  1.00 27.49 ? 991  VAL A CB  1 
ATOM   103  C CG1 . VAL A 1 22  ? -8.511  8.516  64.361  1.00 26.19 ? 991  VAL A CG1 1 
ATOM   104  C CG2 . VAL A 1 22  ? -6.219  8.021  63.492  1.00 26.17 ? 991  VAL A CG2 1 
ATOM   105  N N   . ALA A 1 23  ? -10.559 8.186  61.981  1.00 25.63 ? 992  ALA A N   1 
ATOM   106  C CA  . ALA A 1 23  ? -11.903 8.735  61.827  1.00 26.24 ? 992  ALA A CA  1 
ATOM   107  C C   . ALA A 1 23  ? -12.098 9.917  62.778  1.00 25.85 ? 992  ALA A C   1 
ATOM   108  O O   . ALA A 1 23  ? -12.020 9.771  63.999  1.00 25.54 ? 992  ALA A O   1 
ATOM   109  C CB  . ALA A 1 23  ? -12.951 7.654  62.114  1.00 27.10 ? 992  ALA A CB  1 
ATOM   110  N N   . ARG A 1 24  ? -12.355 11.083 62.209  1.00 24.76 ? 993  ARG A N   1 
ATOM   111  C CA  . ARG A 1 24  ? -12.549 12.276 62.996  1.00 26.05 ? 993  ARG A CA  1 
ATOM   112  C C   . ARG A 1 24  ? -13.491 12.056 64.166  1.00 27.60 ? 993  ARG A C   1 
ATOM   113  O O   . ARG A 1 24  ? -13.297 12.638 65.234  1.00 29.93 ? 993  ARG A O   1 
ATOM   114  C CB  . ARG A 1 24  ? -13.076 13.407 62.115  1.00 25.88 ? 993  ARG A CB  1 
ATOM   115  C CG  . ARG A 1 24  ? -13.420 14.666 62.889  1.00 29.39 ? 993  ARG A CG  1 
ATOM   116  C CD  . ARG A 1 24  ? -13.359 15.888 62.005  1.00 30.49 ? 993  ARG A CD  1 
ATOM   117  N NE  . ARG A 1 24  ? -12.020 16.073 61.461  1.00 30.96 ? 993  ARG A NE  1 
ATOM   118  C CZ  . ARG A 1 24  ? -11.694 17.019 60.590  1.00 31.18 ? 993  ARG A CZ  1 
ATOM   119  N NH1 . ARG A 1 24  ? -12.612 17.872 60.163  1.00 31.49 ? 993  ARG A NH1 1 
ATOM   120  N NH2 . ARG A 1 24  ? -10.456 17.100 60.133  1.00 31.18 ? 993  ARG A NH2 1 
ATOM   121  N N   . GLU A 1 25  ? -14.508 11.221 63.980  1.00 26.99 ? 994  GLU A N   1 
ATOM   122  C CA  . GLU A 1 25  ? -15.454 10.975 65.061  1.00 25.98 ? 994  GLU A CA  1 
ATOM   123  C C   . GLU A 1 25  ? -14.856 10.271 66.283  1.00 25.13 ? 994  GLU A C   1 
ATOM   124  O O   . GLU A 1 25  ? -15.530 10.097 67.297  1.00 25.52 ? 994  GLU A O   1 
ATOM   125  C CB  . GLU A 1 25  ? -16.686 10.212 64.552  1.00 23.95 ? 994  GLU A CB  1 
ATOM   126  C CG  . GLU A 1 25  ? -16.466 9.338  63.341  1.00 23.64 ? 994  GLU A CG  1 
ATOM   127  C CD  . GLU A 1 25  ? -16.880 10.010 62.050  1.00 20.80 ? 994  GLU A CD  1 
ATOM   128  O OE1 . GLU A 1 25  ? -16.001 10.237 61.194  1.00 19.26 ? 994  GLU A OE1 1 
ATOM   129  O OE2 . GLU A 1 25  ? -18.083 10.300 61.893  1.00 16.82 ? 994  GLU A OE2 1 
ATOM   130  N N   . LYS A 1 26  ? -13.586 9.890  66.197  1.00 25.47 ? 995  LYS A N   1 
ATOM   131  C CA  . LYS A 1 26  ? -12.907 9.230  67.313  1.00 25.44 ? 995  LYS A CA  1 
ATOM   132  C C   . LYS A 1 26  ? -12.107 10.224 68.140  1.00 24.50 ? 995  LYS A C   1 
ATOM   133  O O   . LYS A 1 26  ? -11.409 9.836  69.077  1.00 25.06 ? 995  LYS A O   1 
ATOM   134  C CB  . LYS A 1 26  ? -11.969 8.130  66.799  1.00 26.59 ? 995  LYS A CB  1 
ATOM   135  C CG  . LYS A 1 26  ? -12.659 6.783  66.604  1.00 29.63 ? 995  LYS A CG  1 
ATOM   136  C CD  . LYS A 1 26  ? -11.738 5.726  66.021  1.00 31.34 ? 995  LYS A CD  1 
ATOM   137  C CE  . LYS A 1 26  ? -12.444 4.379  65.958  1.00 32.43 ? 995  LYS A CE  1 
ATOM   138  N NZ  . LYS A 1 26  ? -13.794 4.484  65.320  1.00 34.39 ? 995  LYS A NZ  1 
ATOM   139  N N   . ILE A 1 27  ? -12.239 11.504 67.802  1.00 23.70 ? 996  ILE A N   1 
ATOM   140  C CA  . ILE A 1 27  ? -11.509 12.585 68.467  1.00 23.25 ? 996  ILE A CA  1 
ATOM   141  C C   . ILE A 1 27  ? -12.375 13.640 69.161  1.00 24.03 ? 996  ILE A C   1 
ATOM   142  O O   . ILE A 1 27  ? -13.510 13.891 68.759  1.00 22.35 ? 996  ILE A O   1 
ATOM   143  C CB  . ILE A 1 27  ? -10.615 13.332 67.438  1.00 21.81 ? 996  ILE A CB  1 
ATOM   144  C CG1 . ILE A 1 27  ? -9.605  12.372 66.826  1.00 20.93 ? 996  ILE A CG1 1 
ATOM   145  C CG2 . ILE A 1 27  ? -9.889  14.491 68.096  1.00 19.72 ? 996  ILE A CG2 1 
ATOM   146  C CD1 . ILE A 1 27  ? -8.971  12.918 65.577  1.00 21.47 ? 996  ILE A CD1 1 
ATOM   147  N N   . THR A 1 28  ? -11.816 14.248 70.209  1.00 26.27 ? 997  THR A N   1 
ATOM   148  C CA  . THR A 1 28  ? -12.464 15.329 70.951  1.00 29.00 ? 997  THR A CA  1 
ATOM   149  C C   . THR A 1 28  ? -11.416 16.367 71.349  1.00 29.84 ? 997  THR A C   1 
ATOM   150  O O   . THR A 1 28  ? -10.283 16.020 71.678  1.00 30.30 ? 997  THR A O   1 
ATOM   151  C CB  . THR A 1 28  ? -13.169 14.843 72.239  1.00 29.28 ? 997  THR A CB  1 
ATOM   152  O OG1 . THR A 1 28  ? -12.259 14.075 73.032  1.00 32.20 ? 997  THR A OG1 1 
ATOM   153  C CG2 . THR A 1 28  ? -14.384 14.010 71.900  1.00 32.31 ? 997  THR A CG2 1 
ATOM   154  N N   . MET A 1 29  ? -11.802 17.639 71.301  1.00 31.32 ? 998  MET A N   1 
ATOM   155  C CA  . MET A 1 29  ? -10.917 18.746 71.669  1.00 32.42 ? 998  MET A CA  1 
ATOM   156  C C   . MET A 1 29  ? -11.297 19.157 73.084  1.00 33.05 ? 998  MET A C   1 
ATOM   157  O O   . MET A 1 29  ? -12.473 19.329 73.383  1.00 33.49 ? 998  MET A O   1 
ATOM   158  C CB  . MET A 1 29  ? -11.144 19.943 70.749  1.00 32.64 ? 998  MET A CB  1 
ATOM   159  C CG  . MET A 1 29  ? -11.458 19.582 69.325  1.00 33.74 ? 998  MET A CG  1 
ATOM   160  S SD  . MET A 1 29  ? -10.020 18.967 68.504  1.00 37.28 ? 998  MET A SD  1 
ATOM   161  C CE  . MET A 1 29  ? -9.377  20.505 67.862  1.00 35.62 ? 998  MET A CE  1 
ATOM   162  N N   . SER A 1 30  ? -10.317 19.327 73.957  1.00 33.90 ? 999  SER A N   1 
ATOM   163  C CA  . SER A 1 30  ? -10.633 19.716 75.321  1.00 35.34 ? 999  SER A CA  1 
ATOM   164  C C   . SER A 1 30  ? -10.324 21.183 75.581  1.00 35.47 ? 999  SER A C   1 
ATOM   165  O O   . SER A 1 30  ? -11.057 21.852 76.310  1.00 35.16 ? 999  SER A O   1 
ATOM   166  C CB  . SER A 1 30  ? -9.877  18.829 76.304  1.00 37.38 ? 999  SER A CB  1 
ATOM   167  O OG  . SER A 1 30  ? -10.262 17.477 76.135  1.00 40.66 ? 999  SER A OG  1 
ATOM   168  N N   . ARG A 1 31  ? -9.245  21.681 74.980  1.00 35.25 ? 1000 ARG A N   1 
ATOM   169  C CA  . ARG A 1 31  ? -8.866  23.077 75.144  1.00 36.41 ? 1000 ARG A CA  1 
ATOM   170  C C   . ARG A 1 31  ? -7.679  23.466 74.271  1.00 37.99 ? 1000 ARG A C   1 
ATOM   171  O O   . ARG A 1 31  ? -7.014  22.602 73.694  1.00 38.22 ? 1000 ARG A O   1 
ATOM   172  C CB  . ARG A 1 31  ? -8.534  23.350 76.608  1.00 36.39 ? 1000 ARG A CB  1 
ATOM   173  C CG  . ARG A 1 31  ? -7.322  22.608 77.122  1.00 35.78 ? 1000 ARG A CG  1 
ATOM   174  C CD  . ARG A 1 31  ? -7.304  22.614 78.635  1.00 33.95 ? 1000 ARG A CD  1 
ATOM   175  N NE  . ARG A 1 31  ? -6.094  22.001 79.160  1.00 33.41 ? 1000 ARG A NE  1 
ATOM   176  C CZ  . ARG A 1 31  ? -4.892  22.562 79.108  1.00 34.49 ? 1000 ARG A CZ  1 
ATOM   177  N NH1 . ARG A 1 31  ? -4.732  23.757 78.556  1.00 35.47 ? 1000 ARG A NH1 1 
ATOM   178  N NH2 . ARG A 1 31  ? -3.845  21.925 79.610  1.00 36.38 ? 1000 ARG A NH2 1 
ATOM   179  N N   . GLU A 1 32  ? -7.421  24.771 74.171  1.00 39.00 ? 1001 GLU A N   1 
ATOM   180  C CA  . GLU A 1 32  ? -6.295  25.269 73.381  1.00 40.11 ? 1001 GLU A CA  1 
ATOM   181  C C   . GLU A 1 32  ? -5.005  25.182 74.203  1.00 39.65 ? 1001 GLU A C   1 
ATOM   182  O O   . GLU A 1 32  ? -5.047  25.163 75.439  1.00 40.66 ? 1001 GLU A O   1 
ATOM   183  C CB  . GLU A 1 32  ? -6.523  26.721 72.970  1.00 41.87 ? 1001 GLU A CB  1 
ATOM   184  C CG  . GLU A 1 32  ? -7.756  26.961 72.130  1.00 44.71 ? 1001 GLU A CG  1 
ATOM   185  C CD  . GLU A 1 32  ? -7.804  28.381 71.581  1.00 47.27 ? 1001 GLU A CD  1 
ATOM   186  O OE1 . GLU A 1 32  ? -8.796  28.725 70.902  1.00 48.85 ? 1001 GLU A OE1 1 
ATOM   187  O OE2 . GLU A 1 32  ? -6.845  29.151 71.824  1.00 47.43 ? 1001 GLU A OE2 1 
ATOM   188  N N   . LEU A 1 33  ? -3.865  25.131 73.514  1.00 38.33 ? 1002 LEU A N   1 
ATOM   189  C CA  . LEU A 1 33  ? -2.553  25.042 74.161  1.00 36.05 ? 1002 LEU A CA  1 
ATOM   190  C C   . LEU A 1 33  ? -1.632  26.161 73.681  1.00 36.93 ? 1002 LEU A C   1 
ATOM   191  O O   . LEU A 1 33  ? -0.532  26.328 74.200  1.00 37.64 ? 1002 LEU A O   1 
ATOM   192  C CB  . LEU A 1 33  ? -1.890  23.700 73.845  1.00 32.62 ? 1002 LEU A CB  1 
ATOM   193  C CG  . LEU A 1 33  ? -2.599  22.420 74.269  1.00 30.28 ? 1002 LEU A CG  1 
ATOM   194  C CD1 . LEU A 1 33  ? -1.880  21.221 73.665  1.00 27.95 ? 1002 LEU A CD1 1 
ATOM   195  C CD2 . LEU A 1 33  ? -2.643  22.336 75.785  1.00 30.10 ? 1002 LEU A CD2 1 
ATOM   196  N N   . GLY A 1 34  ? -2.082  26.914 72.681  1.00 37.97 ? 1003 GLY A N   1 
ATOM   197  C CA  . GLY A 1 34  ? -1.289  28.006 72.144  1.00 38.44 ? 1003 GLY A CA  1 
ATOM   198  C C   . GLY A 1 34  ? -1.042  27.799 70.666  1.00 39.99 ? 1003 GLY A C   1 
ATOM   199  O O   . GLY A 1 34  ? -0.701  26.693 70.247  1.00 41.72 ? 1003 GLY A O   1 
ATOM   200  N N   . GLN A 1 35  ? -1.217  28.854 69.875  1.00 40.33 ? 1004 GLN A N   1 
ATOM   201  C CA  . GLN A 1 35  ? -1.020  28.792 68.426  1.00 40.08 ? 1004 GLN A CA  1 
ATOM   202  C C   . GLN A 1 35  ? 0.325   28.144 68.075  1.00 39.77 ? 1004 GLN A C   1 
ATOM   203  O O   . GLN A 1 35  ? 1.305   28.280 68.813  1.00 40.29 ? 1004 GLN A O   1 
ATOM   204  C CB  . GLN A 1 35  ? -1.087  30.204 67.831  1.00 38.95 ? 1004 GLN A CB  1 
ATOM   205  C CG  . GLN A 1 35  ? -1.282  30.268 66.319  1.00 40.15 ? 1004 GLN A CG  1 
ATOM   206  C CD  . GLN A 1 35  ? -2.725  30.014 65.870  1.00 42.15 ? 1004 GLN A CD  1 
ATOM   207  O OE1 . GLN A 1 35  ? -3.672  30.125 66.656  1.00 42.27 ? 1004 GLN A OE1 1 
ATOM   208  N NE2 . GLN A 1 35  ? -2.895  29.699 64.588  1.00 41.72 ? 1004 GLN A NE2 1 
ATOM   209  N N   . GLY A 1 36  ? 0.357   27.429 66.951  1.00 39.13 ? 1005 GLY A N   1 
ATOM   210  C CA  . GLY A 1 36  ? 1.574   26.770 66.504  1.00 36.22 ? 1005 GLY A CA  1 
ATOM   211  C C   . GLY A 1 36  ? 1.902   27.159 65.072  1.00 35.57 ? 1005 GLY A C   1 
ATOM   212  O O   . GLY A 1 36  ? 1.177   27.929 64.444  1.00 34.82 ? 1005 GLY A O   1 
ATOM   213  N N   . SER A 1 37  ? 2.998   26.621 64.551  1.00 34.71 ? 1006 SER A N   1 
ATOM   214  C CA  . SER A 1 37  ? 3.434   26.913 63.192  1.00 32.48 ? 1006 SER A CA  1 
ATOM   215  C C   . SER A 1 37  ? 2.301   26.973 62.174  1.00 32.11 ? 1006 SER A C   1 
ATOM   216  O O   . SER A 1 37  ? 2.108   27.994 61.510  1.00 32.04 ? 1006 SER A O   1 
ATOM   217  C CB  . SER A 1 37  ? 4.455   25.869 62.730  1.00 31.50 ? 1006 SER A CB  1 
ATOM   218  O OG  . SER A 1 37  ? 5.688   26.005 63.406  1.00 28.32 ? 1006 SER A OG  1 
ATOM   219  N N   . PHE A 1 38  ? 1.559   25.876 62.055  1.00 31.00 ? 1007 PHE A N   1 
ATOM   220  C CA  . PHE A 1 38  ? 0.463   25.771 61.089  1.00 30.12 ? 1007 PHE A CA  1 
ATOM   221  C C   . PHE A 1 38  ? -0.888  26.231 61.624  1.00 29.67 ? 1007 PHE A C   1 
ATOM   222  O O   . PHE A 1 38  ? -1.842  26.415 60.865  1.00 30.01 ? 1007 PHE A O   1 
ATOM   223  C CB  . PHE A 1 38  ? 0.347   24.320 60.605  1.00 29.33 ? 1007 PHE A CB  1 
ATOM   224  C CG  . PHE A 1 38  ? 1.508   23.865 59.757  1.00 28.48 ? 1007 PHE A CG  1 
ATOM   225  C CD1 . PHE A 1 38  ? 1.481   24.026 58.371  1.00 26.58 ? 1007 PHE A CD1 1 
ATOM   226  C CD2 . PHE A 1 38  ? 2.637   23.292 60.346  1.00 27.95 ? 1007 PHE A CD2 1 
ATOM   227  C CE1 . PHE A 1 38  ? 2.557   23.624 57.579  1.00 26.11 ? 1007 PHE A CE1 1 
ATOM   228  C CE2 . PHE A 1 38  ? 3.724   22.888 59.563  1.00 28.13 ? 1007 PHE A CE2 1 
ATOM   229  C CZ  . PHE A 1 38  ? 3.680   23.056 58.172  1.00 26.25 ? 1007 PHE A CZ  1 
ATOM   230  N N   . GLY A 1 39  ? -0.970  26.411 62.935  1.00 28.40 ? 1008 GLY A N   1 
ATOM   231  C CA  . GLY A 1 39  ? -2.222  26.830 63.523  1.00 27.10 ? 1008 GLY A CA  1 
ATOM   232  C C   . GLY A 1 39  ? -2.365  26.389 64.964  1.00 26.21 ? 1008 GLY A C   1 
ATOM   233  O O   . GLY A 1 39  ? -1.432  25.870 65.565  1.00 24.46 ? 1008 GLY A O   1 
ATOM   234  N N   . MET A 1 40  ? -3.555  26.608 65.509  1.00 26.10 ? 1009 MET A N   1 
ATOM   235  C CA  . MET A 1 40  ? -3.888  26.260 66.881  1.00 25.63 ? 1009 MET A CA  1 
ATOM   236  C C   . MET A 1 40  ? -3.639  24.775 67.181  1.00 24.89 ? 1009 MET A C   1 
ATOM   237  O O   . MET A 1 40  ? -3.977  23.898 66.386  1.00 22.94 ? 1009 MET A O   1 
ATOM   238  C CB  . MET A 1 40  ? -5.362  26.606 67.127  1.00 26.41 ? 1009 MET A CB  1 
ATOM   239  C CG  . MET A 1 40  ? -5.843  26.483 68.558  1.00 29.13 ? 1009 MET A CG  1 
ATOM   240  S SD  . MET A 1 40  ? -5.148  27.719 69.649  1.00 35.62 ? 1009 MET A SD  1 
ATOM   241  C CE  . MET A 1 40  ? -3.995  26.744 70.581  1.00 34.54 ? 1009 MET A CE  1 
ATOM   242  N N   . VAL A 1 41  ? -3.029  24.512 68.332  1.00 25.24 ? 1010 VAL A N   1 
ATOM   243  C CA  . VAL A 1 41  ? -2.753  23.153 68.785  1.00 25.75 ? 1010 VAL A CA  1 
ATOM   244  C C   . VAL A 1 41  ? -3.743  22.923 69.913  1.00 26.33 ? 1010 VAL A C   1 
ATOM   245  O O   . VAL A 1 41  ? -4.104  23.868 70.613  1.00 25.74 ? 1010 VAL A O   1 
ATOM   246  C CB  . VAL A 1 41  ? -1.327  23.005 69.360  1.00 25.73 ? 1010 VAL A CB  1 
ATOM   247  C CG1 . VAL A 1 41  ? -1.093  21.566 69.782  1.00 24.54 ? 1010 VAL A CG1 1 
ATOM   248  C CG2 . VAL A 1 41  ? -0.293  23.439 68.332  1.00 25.29 ? 1010 VAL A CG2 1 
ATOM   249  N N   . TYR A 1 42  ? -4.185  21.683 70.089  1.00 26.32 ? 1011 TYR A N   1 
ATOM   250  C CA  . TYR A 1 42  ? -5.145  21.381 71.140  1.00 27.10 ? 1011 TYR A CA  1 
ATOM   251  C C   . TYR A 1 42  ? -4.763  20.179 71.990  1.00 26.88 ? 1011 TYR A C   1 
ATOM   252  O O   . TYR A 1 42  ? -3.790  19.474 71.714  1.00 26.80 ? 1011 TYR A O   1 
ATOM   253  C CB  . TYR A 1 42  ? -6.538  21.119 70.551  1.00 28.83 ? 1011 TYR A CB  1 
ATOM   254  C CG  . TYR A 1 42  ? -7.229  22.312 69.926  1.00 30.67 ? 1011 TYR A CG  1 
ATOM   255  C CD1 . TYR A 1 42  ? -6.875  22.765 68.653  1.00 30.54 ? 1011 TYR A CD1 1 
ATOM   256  C CD2 . TYR A 1 42  ? -8.256  22.977 70.600  1.00 30.55 ? 1011 TYR A CD2 1 
ATOM   257  C CE1 . TYR A 1 42  ? -7.529  23.847 68.071  1.00 29.34 ? 1011 TYR A CE1 1 
ATOM   258  C CE2 . TYR A 1 42  ? -8.916  24.059 70.025  1.00 29.15 ? 1011 TYR A CE2 1 
ATOM   259  C CZ  . TYR A 1 42  ? -8.546  24.489 68.765  1.00 29.32 ? 1011 TYR A CZ  1 
ATOM   260  O OH  . TYR A 1 42  ? -9.170  25.582 68.212  1.00 30.03 ? 1011 TYR A OH  1 
ATOM   261  N N   . GLU A 1 43  ? -5.546  19.973 73.042  1.00 25.37 ? 1012 GLU A N   1 
ATOM   262  C CA  . GLU A 1 43  ? -5.372  18.853 73.945  1.00 25.19 ? 1012 GLU A CA  1 
ATOM   263  C C   . GLU A 1 43  ? -6.724  18.168 73.885  1.00 25.80 ? 1012 GLU A C   1 
ATOM   264  O O   . GLU A 1 43  ? -7.757  18.829 73.761  1.00 23.78 ? 1012 GLU A O   1 
ATOM   265  C CB  . GLU A 1 43  ? -5.085  19.326 75.380  1.00 24.80 ? 1012 GLU A CB  1 
ATOM   266  C CG  . GLU A 1 43  ? -5.167  18.205 76.415  1.00 25.76 ? 1012 GLU A CG  1 
ATOM   267  C CD  . GLU A 1 43  ? -4.841  18.642 77.838  1.00 26.04 ? 1012 GLU A CD  1 
ATOM   268  O OE1 . GLU A 1 43  ? -3.736  19.161 78.085  1.00 29.06 ? 1012 GLU A OE1 1 
ATOM   269  O OE2 . GLU A 1 43  ? -5.688  18.454 78.725  1.00 27.74 ? 1012 GLU A OE2 1 
ATOM   270  N N   . GLY A 1 44  ? -6.729  16.846 73.955  1.00 26.68 ? 1013 GLY A N   1 
ATOM   271  C CA  . GLY A 1 44  ? -7.995  16.147 73.899  1.00 27.52 ? 1013 GLY A CA  1 
ATOM   272  C C   . GLY A 1 44  ? -7.879  14.652 74.076  1.00 26.64 ? 1013 GLY A C   1 
ATOM   273  O O   . GLY A 1 44  ? -6.931  14.159 74.678  1.00 26.00 ? 1013 GLY A O   1 
ATOM   274  N N   . VAL A 1 45  ? -8.860  13.930 73.557  1.00 26.14 ? 1014 VAL A N   1 
ATOM   275  C CA  . VAL A 1 45  ? -8.855  12.486 73.667  1.00 26.29 ? 1014 VAL A CA  1 
ATOM   276  C C   . VAL A 1 45  ? -9.085  11.923 72.279  1.00 27.03 ? 1014 VAL A C   1 
ATOM   277  O O   . VAL A 1 45  ? -9.701  12.574 71.434  1.00 25.86 ? 1014 VAL A O   1 
ATOM   278  C CB  . VAL A 1 45  ? -9.961  12.001 74.631  1.00 25.20 ? 1014 VAL A CB  1 
ATOM   279  C CG1 . VAL A 1 45  ? -9.946  10.495 74.730  1.00 25.98 ? 1014 VAL A CG1 1 
ATOM   280  C CG2 . VAL A 1 45  ? -9.736  12.590 76.008  1.00 24.41 ? 1014 VAL A CG2 1 
ATOM   281  N N   . ALA A 1 46  ? -8.568  10.724 72.041  1.00 28.47 ? 1015 ALA A N   1 
ATOM   282  C CA  . ALA A 1 46  ? -8.725  10.066 70.750  1.00 31.58 ? 1015 ALA A CA  1 
ATOM   283  C C   . ALA A 1 46  ? -8.845  8.563  70.958  1.00 33.44 ? 1015 ALA A C   1 
ATOM   284  O O   . ALA A 1 46  ? -7.962  7.956  71.561  1.00 35.44 ? 1015 ALA A O   1 
ATOM   285  C CB  . ALA A 1 46  ? -7.534  10.367 69.876  1.00 31.46 ? 1015 ALA A CB  1 
ATOM   286  N N   . LYS A 1 47  ? -9.934  7.965  70.479  1.00 33.91 ? 1016 LYS A N   1 
ATOM   287  C CA  . LYS A 1 47  ? -10.121 6.522  70.627  1.00 34.42 ? 1016 LYS A CA  1 
ATOM   288  C C   . LYS A 1 47  ? -9.329  5.774  69.569  1.00 34.93 ? 1016 LYS A C   1 
ATOM   289  O O   . LYS A 1 47  ? -8.992  6.332  68.528  1.00 36.24 ? 1016 LYS A O   1 
ATOM   290  C CB  . LYS A 1 47  ? -11.590 6.129  70.473  1.00 34.13 ? 1016 LYS A CB  1 
ATOM   291  C CG  . LYS A 1 47  ? -12.527 6.643  71.543  1.00 36.06 ? 1016 LYS A CG  1 
ATOM   292  C CD  . LYS A 1 47  ? -13.897 5.984  71.391  1.00 37.45 ? 1016 LYS A CD  1 
ATOM   293  C CE  . LYS A 1 47  ? -14.437 6.115  69.962  1.00 36.77 ? 1016 LYS A CE  1 
ATOM   294  N NZ  . LYS A 1 47  ? -15.702 5.353  69.749  1.00 37.01 ? 1016 LYS A NZ  1 
ATOM   295  N N   . GLY A 1 48  ? -9.046  4.505  69.840  1.00 34.51 ? 1017 GLY A N   1 
ATOM   296  C CA  . GLY A 1 48  ? -8.313  3.681  68.897  1.00 36.03 ? 1017 GLY A CA  1 
ATOM   297  C C   . GLY A 1 48  ? -6.974  4.205  68.405  1.00 37.01 ? 1017 GLY A C   1 
ATOM   298  O O   . GLY A 1 48  ? -6.687  4.139  67.213  1.00 38.32 ? 1017 GLY A O   1 
ATOM   299  N N   . VAL A 1 49  ? -6.143  4.719  69.302  1.00 37.49 ? 1018 VAL A N   1 
ATOM   300  C CA  . VAL A 1 49  ? -4.841  5.223  68.886  1.00 38.68 ? 1018 VAL A CA  1 
ATOM   301  C C   . VAL A 1 49  ? -3.721  4.382  69.482  1.00 39.68 ? 1018 VAL A C   1 
ATOM   302  O O   . VAL A 1 49  ? -2.701  4.149  68.850  1.00 39.71 ? 1018 VAL A O   1 
ATOM   303  C CB  . VAL A 1 49  ? -4.656  6.693  69.300  1.00 38.78 ? 1018 VAL A CB  1 
ATOM   304  C CG1 . VAL A 1 49  ? -4.682  7.583  68.068  1.00 38.96 ? 1018 VAL A CG1 1 
ATOM   305  C CG2 . VAL A 1 49  ? -5.751  7.098  70.261  1.00 36.80 ? 1018 VAL A CG2 1 
ATOM   306  N N   . VAL A 1 50  ? -3.916  3.934  70.710  1.00 42.13 ? 1019 VAL A N   1 
ATOM   307  C CA  . VAL A 1 50  ? -2.933  3.102  71.378  1.00 45.59 ? 1019 VAL A CA  1 
ATOM   308  C C   . VAL A 1 50  ? -3.501  1.695  71.354  1.00 48.56 ? 1019 VAL A C   1 
ATOM   309  O O   . VAL A 1 50  ? -4.702  1.510  71.544  1.00 49.50 ? 1019 VAL A O   1 
ATOM   310  C CB  . VAL A 1 50  ? -2.738  3.539  72.839  1.00 45.54 ? 1019 VAL A CB  1 
ATOM   311  C CG1 . VAL A 1 50  ? -1.849  2.545  73.564  1.00 45.23 ? 1019 VAL A CG1 1 
ATOM   312  C CG2 . VAL A 1 50  ? -2.145  4.943  72.886  1.00 46.14 ? 1019 VAL A CG2 1 
ATOM   313  N N   . LYS A 1 51  ? -2.657  0.700  71.124  1.00 51.12 ? 1020 LYS A N   1 
ATOM   314  C CA  . LYS A 1 51  ? -3.152  -0.666 71.079  1.00 54.29 ? 1020 LYS A CA  1 
ATOM   315  C C   . LYS A 1 51  ? -3.619  -1.104 72.467  1.00 55.87 ? 1020 LYS A C   1 
ATOM   316  O O   . LYS A 1 51  ? -3.041  -0.714 73.487  1.00 55.36 ? 1020 LYS A O   1 
ATOM   317  C CB  . LYS A 1 51  ? -2.067  -1.613 70.552  1.00 55.33 ? 1020 LYS A CB  1 
ATOM   318  C CG  . LYS A 1 51  ? -2.604  -2.880 69.882  1.00 56.00 ? 1020 LYS A CG  1 
ATOM   319  C CD  . LYS A 1 51  ? -1.471  -3.692 69.255  1.00 57.27 ? 1020 LYS A CD  1 
ATOM   320  C CE  . LYS A 1 51  ? -1.985  -4.935 68.544  1.00 56.45 ? 1020 LYS A CE  1 
ATOM   321  N NZ  . LYS A 1 51  ? -2.890  -4.591 67.417  1.00 57.32 ? 1020 LYS A NZ  1 
ATOM   322  N N   . ASP A 1 52  ? -4.687  -1.900 72.485  1.00 57.92 ? 1021 ASP A N   1 
ATOM   323  C CA  . ASP A 1 52  ? -5.281  -2.421 73.712  1.00 59.95 ? 1021 ASP A CA  1 
ATOM   324  C C   . ASP A 1 52  ? -5.696  -1.336 74.697  1.00 60.86 ? 1021 ASP A C   1 
ATOM   325  O O   . ASP A 1 52  ? -6.069  -1.643 75.834  1.00 61.59 ? 1021 ASP A O   1 
ATOM   326  C CB  . ASP A 1 52  ? -4.321  -3.378 74.426  1.00 61.03 ? 1021 ASP A CB  1 
ATOM   327  C CG  . ASP A 1 52  ? -3.800  -4.469 73.522  1.00 61.15 ? 1021 ASP A CG  1 
ATOM   328  O OD1 . ASP A 1 52  ? -4.591  -4.999 72.713  1.00 60.94 ? 1021 ASP A OD1 1 
ATOM   329  O OD2 . ASP A 1 52  ? -2.598  -4.799 73.637  1.00 61.57 ? 1021 ASP A OD2 1 
ATOM   330  N N   . GLU A 1 53  ? -5.626  -0.075 74.274  1.00 60.87 ? 1022 GLU A N   1 
ATOM   331  C CA  . GLU A 1 53  ? -6.010  1.035  75.146  1.00 60.27 ? 1022 GLU A CA  1 
ATOM   332  C C   . GLU A 1 53  ? -7.334  1.666  74.704  1.00 58.32 ? 1022 GLU A C   1 
ATOM   333  O O   . GLU A 1 53  ? -7.566  1.884  73.514  1.00 58.48 ? 1022 GLU A O   1 
ATOM   334  C CB  . GLU A 1 53  ? -4.897  2.090  75.184  1.00 60.69 ? 1022 GLU A CB  1 
ATOM   335  C CG  . GLU A 1 53  ? -5.214  3.291  76.059  1.00 61.05 ? 1022 GLU A CG  1 
ATOM   336  C CD  . GLU A 1 53  ? -3.970  4.045  76.492  1.00 61.90 ? 1022 GLU A CD  1 
ATOM   337  O OE1 . GLU A 1 53  ? -3.232  4.561  75.623  1.00 61.40 ? 1022 GLU A OE1 1 
ATOM   338  O OE2 . GLU A 1 53  ? -3.731  4.118  77.714  1.00 61.86 ? 1022 GLU A OE2 1 
ATOM   339  N N   . PRO A 1 54  ? -8.218  1.969  75.667  1.00 56.52 ? 1023 PRO A N   1 
ATOM   340  C CA  . PRO A 1 54  ? -9.531  2.570  75.406  1.00 54.95 ? 1023 PRO A CA  1 
ATOM   341  C C   . PRO A 1 54  ? -9.452  3.952  74.762  1.00 52.67 ? 1023 PRO A C   1 
ATOM   342  O O   . PRO A 1 54  ? -9.738  4.116  73.577  1.00 51.65 ? 1023 PRO A O   1 
ATOM   343  C CB  . PRO A 1 54  ? -10.159 2.616  76.793  1.00 55.25 ? 1023 PRO A CB  1 
ATOM   344  C CG  . PRO A 1 54  ? -8.962  2.898  77.670  1.00 55.31 ? 1023 PRO A CG  1 
ATOM   345  C CD  . PRO A 1 54  ? -7.947  1.924  77.117  1.00 56.33 ? 1023 PRO A CD  1 
ATOM   346  N N   . GLU A 1 55  ? -9.075  4.942  75.564  1.00 50.71 ? 1024 GLU A N   1 
ATOM   347  C CA  . GLU A 1 55  ? -8.943  6.320  75.099  1.00 48.79 ? 1024 GLU A CA  1 
ATOM   348  C C   . GLU A 1 55  ? -7.506  6.766  75.343  1.00 46.36 ? 1024 GLU A C   1 
ATOM   349  O O   . GLU A 1 55  ? -6.750  6.086  76.044  1.00 47.10 ? 1024 GLU A O   1 
ATOM   350  C CB  . GLU A 1 55  ? -9.870  7.256  75.889  1.00 48.97 ? 1024 GLU A CB  1 
ATOM   351  C CG  . GLU A 1 55  ? -11.364 7.043  75.722  1.00 49.01 ? 1024 GLU A CG  1 
ATOM   352  C CD  . GLU A 1 55  ? -12.161 8.018  76.577  1.00 50.01 ? 1024 GLU A CD  1 
ATOM   353  O OE1 . GLU A 1 55  ? -13.403 8.095  76.431  1.00 51.27 ? 1024 GLU A OE1 1 
ATOM   354  O OE2 . GLU A 1 55  ? -11.537 8.714  77.405  1.00 49.54 ? 1024 GLU A OE2 1 
ATOM   355  N N   . THR A 1 56  ? -7.128  7.901  74.762  1.00 41.71 ? 1025 THR A N   1 
ATOM   356  C CA  . THR A 1 56  ? -5.795  8.434  74.981  1.00 38.63 ? 1025 THR A CA  1 
ATOM   357  C C   . THR A 1 56  ? -5.821  9.944  75.006  1.00 36.99 ? 1025 THR A C   1 
ATOM   358  O O   . THR A 1 56  ? -6.513  10.564 74.206  1.00 37.73 ? 1025 THR A O   1 
ATOM   359  C CB  . THR A 1 56  ? -4.812  8.001  73.905  1.00 37.26 ? 1025 THR A CB  1 
ATOM   360  O OG1 . THR A 1 56  ? -4.675  6.577  73.926  1.00 37.57 ? 1025 THR A OG1 1 
ATOM   361  C CG2 . THR A 1 56  ? -3.461  8.619  74.171  1.00 37.36 ? 1025 THR A CG2 1 
ATOM   362  N N   . ARG A 1 57  ? -5.098  10.537 75.950  1.00 35.13 ? 1026 ARG A N   1 
ATOM   363  C CA  . ARG A 1 57  ? -5.034  11.987 76.018  1.00 33.39 ? 1026 ARG A CA  1 
ATOM   364  C C   . ARG A 1 57  ? -4.058  12.294 74.909  1.00 32.95 ? 1026 ARG A C   1 
ATOM   365  O O   . ARG A 1 57  ? -3.050  11.601 74.780  1.00 34.97 ? 1026 ARG A O   1 
ATOM   366  C CB  . ARG A 1 57  ? -4.484  12.462 77.361  1.00 32.98 ? 1026 ARG A CB  1 
ATOM   367  C CG  . ARG A 1 57  ? -5.474  12.360 78.505  1.00 33.14 ? 1026 ARG A CG  1 
ATOM   368  C CD  . ARG A 1 57  ? -4.900  12.945 79.789  1.00 36.30 ? 1026 ARG A CD  1 
ATOM   369  N NE  . ARG A 1 57  ? -4.551  14.353 79.624  1.00 38.59 ? 1026 ARG A NE  1 
ATOM   370  C CZ  . ARG A 1 57  ? -4.066  15.130 80.585  1.00 38.96 ? 1026 ARG A CZ  1 
ATOM   371  N NH1 . ARG A 1 57  ? -3.781  16.398 80.321  1.00 40.44 ? 1026 ARG A NH1 1 
ATOM   372  N NH2 . ARG A 1 57  ? -3.868  14.648 81.805  1.00 39.75 ? 1026 ARG A NH2 1 
ATOM   373  N N   . VAL A 1 58  ? -4.350  13.312 74.104  1.00 30.85 ? 1027 VAL A N   1 
ATOM   374  C CA  . VAL A 1 58  ? -3.489  13.647 72.980  1.00 29.21 ? 1027 VAL A CA  1 
ATOM   375  C C   . VAL A 1 58  ? -3.387  15.136 72.666  1.00 28.78 ? 1027 VAL A C   1 
ATOM   376  O O   . VAL A 1 58  ? -4.165  15.968 73.157  1.00 28.43 ? 1027 VAL A O   1 
ATOM   377  C CB  . VAL A 1 58  ? -3.989  12.951 71.689  1.00 30.00 ? 1027 VAL A CB  1 
ATOM   378  C CG1 . VAL A 1 58  ? -3.906  11.444 71.827  1.00 29.67 ? 1027 VAL A CG1 1 
ATOM   379  C CG2 . VAL A 1 58  ? -5.436  13.358 71.412  1.00 28.44 ? 1027 VAL A CG2 1 
ATOM   380  N N   . ALA A 1 59  ? -2.404  15.455 71.834  1.00 26.23 ? 1028 ALA A N   1 
ATOM   381  C CA  . ALA A 1 59  ? -2.198  16.813 71.383  1.00 24.25 ? 1028 ALA A CA  1 
ATOM   382  C C   . ALA A 1 59  ? -2.756  16.791 69.964  1.00 24.21 ? 1028 ALA A C   1 
ATOM   383  O O   . ALA A 1 59  ? -2.559  15.817 69.236  1.00 24.67 ? 1028 ALA A O   1 
ATOM   384  C CB  . ALA A 1 59  ? -0.734  17.136 71.370  1.00 22.88 ? 1028 ALA A CB  1 
ATOM   385  N N   . ILE A 1 60  ? -3.466  17.843 69.574  1.00 22.82 ? 1029 ILE A N   1 
ATOM   386  C CA  . ILE A 1 60  ? -4.048  17.901 68.242  1.00 21.98 ? 1029 ILE A CA  1 
ATOM   387  C C   . ILE A 1 60  ? -3.625  19.190 67.533  1.00 23.04 ? 1029 ILE A C   1 
ATOM   388  O O   . ILE A 1 60  ? -4.108  20.285 67.849  1.00 23.80 ? 1029 ILE A O   1 
ATOM   389  C CB  . ILE A 1 60  ? -5.596  17.821 68.321  1.00 21.05 ? 1029 ILE A CB  1 
ATOM   390  C CG1 . ILE A 1 60  ? -6.010  16.625 69.168  1.00 20.70 ? 1029 ILE A CG1 1 
ATOM   391  C CG2 . ILE A 1 60  ? -6.191  17.629 66.945  1.00 21.00 ? 1029 ILE A CG2 1 
ATOM   392  C CD1 . ILE A 1 60  ? -7.457  16.654 69.575  1.00 22.55 ? 1029 ILE A CD1 1 
ATOM   393  N N   . LYS A 1 61  ? -2.711  19.051 66.577  1.00 22.89 ? 1030 LYS A N   1 
ATOM   394  C CA  . LYS A 1 61  ? -2.217  20.188 65.808  1.00 22.76 ? 1030 LYS A CA  1 
ATOM   395  C C   . LYS A 1 61  ? -3.121  20.420 64.614  1.00 22.19 ? 1030 LYS A C   1 
ATOM   396  O O   . LYS A 1 61  ? -3.446  19.488 63.890  1.00 23.74 ? 1030 LYS A O   1 
ATOM   397  C CB  . LYS A 1 61  ? -0.801  19.915 65.318  1.00 22.22 ? 1030 LYS A CB  1 
ATOM   398  C CG  . LYS A 1 61  ? 0.147   19.581 66.428  1.00 26.21 ? 1030 LYS A CG  1 
ATOM   399  C CD  . LYS A 1 61  ? 1.585   19.571 65.953  1.00 29.79 ? 1030 LYS A CD  1 
ATOM   400  C CE  . LYS A 1 61  ? 1.830   18.476 64.941  1.00 31.37 ? 1030 LYS A CE  1 
ATOM   401  N NZ  . LYS A 1 61  ? 3.260   18.486 64.540  1.00 35.68 ? 1030 LYS A NZ  1 
ATOM   402  N N   . THR A 1 62  ? -3.525  21.661 64.401  1.00 22.08 ? 1031 THR A N   1 
ATOM   403  C CA  . THR A 1 62  ? -4.393  21.967 63.277  1.00 21.26 ? 1031 THR A CA  1 
ATOM   404  C C   . THR A 1 62  ? -3.721  22.934 62.314  1.00 24.20 ? 1031 THR A C   1 
ATOM   405  O O   . THR A 1 62  ? -2.639  23.461 62.588  1.00 23.56 ? 1031 THR A O   1 
ATOM   406  C CB  . THR A 1 62  ? -5.698  22.602 63.745  1.00 20.26 ? 1031 THR A CB  1 
ATOM   407  O OG1 . THR A 1 62  ? -5.446  23.953 64.155  1.00 16.64 ? 1031 THR A OG1 1 
ATOM   408  C CG2 . THR A 1 62  ? -6.283  21.811 64.909  1.00 16.40 ? 1031 THR A CG2 1 
ATOM   409  N N   . VAL A 1 63  ? -4.380  23.153 61.181  1.00 28.25 ? 1032 VAL A N   1 
ATOM   410  C CA  . VAL A 1 63  ? -3.910  24.063 60.141  1.00 30.99 ? 1032 VAL A CA  1 
ATOM   411  C C   . VAL A 1 63  ? -4.995  25.110 59.920  1.00 33.44 ? 1032 VAL A C   1 
ATOM   412  O O   . VAL A 1 63  ? -6.141  24.750 59.650  1.00 34.40 ? 1032 VAL A O   1 
ATOM   413  C CB  . VAL A 1 63  ? -3.709  23.315 58.830  1.00 31.13 ? 1032 VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 63  ? -3.319  24.282 57.730  1.00 32.71 ? 1032 VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 63  ? -2.666  22.251 59.014  1.00 31.08 ? 1032 VAL A CG2 1 
ATOM   416  N N   . ASN A 1 64  ? -4.652  26.390 60.034  1.00 35.94 ? 1033 ASN A N   1 
ATOM   417  C CA  . ASN A 1 64  ? -5.637  27.460 59.829  1.00 40.53 ? 1033 ASN A CA  1 
ATOM   418  C C   . ASN A 1 64  ? -6.545  27.239 58.617  1.00 42.21 ? 1033 ASN A C   1 
ATOM   419  O O   . ASN A 1 64  ? -6.189  26.539 57.667  1.00 42.28 ? 1033 ASN A O   1 
ATOM   420  C CB  . ASN A 1 64  ? -4.936  28.808 59.666  1.00 42.41 ? 1033 ASN A CB  1 
ATOM   421  C CG  . ASN A 1 64  ? -4.301  29.295 60.952  1.00 46.25 ? 1033 ASN A CG  1 
ATOM   422  O OD1 . ASN A 1 64  ? -3.527  30.260 60.952  1.00 47.93 ? 1033 ASN A OD1 1 
ATOM   423  N ND2 . ASN A 1 64  ? -4.629  28.638 62.061  1.00 47.47 ? 1033 ASN A ND2 1 
ATOM   424  N N   . GLU A 1 65  ? -7.726  27.841 58.656  1.00 44.11 ? 1034 GLU A N   1 
ATOM   425  C CA  . GLU A 1 65  ? -8.668  27.722 57.550  1.00 46.29 ? 1034 GLU A CA  1 
ATOM   426  C C   . GLU A 1 65  ? -8.140  28.547 56.375  1.00 45.88 ? 1034 GLU A C   1 
ATOM   427  O O   . GLU A 1 65  ? -8.394  28.229 55.213  1.00 45.30 ? 1034 GLU A O   1 
ATOM   428  C CB  . GLU A 1 65  ? -10.048 28.249 57.971  1.00 48.38 ? 1034 GLU A CB  1 
ATOM   429  C CG  . GLU A 1 65  ? -11.034 28.419 56.812  1.00 52.01 ? 1034 GLU A CG  1 
ATOM   430  C CD  . GLU A 1 65  ? -12.290 29.192 57.198  1.00 53.66 ? 1034 GLU A CD  1 
ATOM   431  O OE1 . GLU A 1 65  ? -13.147 28.632 57.921  1.00 53.41 ? 1034 GLU A OE1 1 
ATOM   432  O OE2 . GLU A 1 65  ? -12.415 30.367 56.775  1.00 54.03 ? 1034 GLU A OE2 1 
ATOM   433  N N   . ALA A 1 66  ? -7.396  29.603 56.702  1.00 45.80 ? 1035 ALA A N   1 
ATOM   434  C CA  . ALA A 1 66  ? -6.827  30.521 55.719  1.00 45.37 ? 1035 ALA A CA  1 
ATOM   435  C C   . ALA A 1 66  ? -5.523  30.014 55.110  1.00 45.89 ? 1035 ALA A C   1 
ATOM   436  O O   . ALA A 1 66  ? -4.735  30.794 54.560  1.00 47.15 ? 1035 ALA A O   1 
ATOM   437  C CB  . ALA A 1 66  ? -6.598  31.887 56.369  1.00 44.18 ? 1035 ALA A CB  1 
ATOM   438  N N   . ALA A 1 67  ? -5.293  28.710 55.201  1.00 45.12 ? 1036 ALA A N   1 
ATOM   439  C CA  . ALA A 1 67  ? -4.071  28.132 54.659  1.00 44.04 ? 1036 ALA A CA  1 
ATOM   440  C C   . ALA A 1 67  ? -4.243  27.582 53.249  1.00 43.96 ? 1036 ALA A C   1 
ATOM   441  O O   . ALA A 1 67  ? -5.317  27.125 52.850  1.00 43.52 ? 1036 ALA A O   1 
ATOM   442  C CB  . ALA A 1 67  ? -3.556  27.036 55.582  1.00 44.24 ? 1036 ALA A CB  1 
ATOM   443  N N   . SER A 1 68  ? -3.156  27.633 52.498  1.00 43.42 ? 1037 SER A N   1 
ATOM   444  C CA  . SER A 1 68  ? -3.138  27.143 51.141  1.00 42.12 ? 1037 SER A CA  1 
ATOM   445  C C   . SER A 1 68  ? -3.159  25.611 51.149  1.00 41.57 ? 1037 SER A C   1 
ATOM   446  O O   . SER A 1 68  ? -2.622  24.975 52.058  1.00 40.36 ? 1037 SER A O   1 
ATOM   447  C CB  . SER A 1 68  ? -1.870  27.650 50.463  1.00 41.76 ? 1037 SER A CB  1 
ATOM   448  O OG  . SER A 1 68  ? -1.891  27.396 49.071  1.00 46.58 ? 1037 SER A OG  1 
ATOM   449  N N   . MET A 1 69  ? -3.789  25.016 50.143  1.00 42.65 ? 1038 MET A N   1 
ATOM   450  C CA  . MET A 1 69  ? -3.829  23.562 50.042  1.00 43.38 ? 1038 MET A CA  1 
ATOM   451  C C   . MET A 1 69  ? -2.391  23.083 50.117  1.00 42.90 ? 1038 MET A C   1 
ATOM   452  O O   . MET A 1 69  ? -2.098  22.023 50.663  1.00 43.45 ? 1038 MET A O   1 
ATOM   453  C CB  . MET A 1 69  ? -4.436  23.119 48.706  1.00 45.71 ? 1038 MET A CB  1 
ATOM   454  C CG  . MET A 1 69  ? -5.943  23.301 48.604  1.00 48.79 ? 1038 MET A CG  1 
ATOM   455  S SD  . MET A 1 69  ? -6.827  22.652 50.063  1.00 55.41 ? 1038 MET A SD  1 
ATOM   456  C CE  . MET A 1 69  ? -6.620  20.844 49.854  1.00 51.85 ? 1038 MET A CE  1 
ATOM   457  N N   . ARG A 1 70  ? -1.499  23.895 49.566  1.00 41.86 ? 1039 ARG A N   1 
ATOM   458  C CA  . ARG A 1 70  ? -0.084  23.595 49.543  1.00 41.70 ? 1039 ARG A CA  1 
ATOM   459  C C   . ARG A 1 70  ? 0.519   23.530 50.956  1.00 42.66 ? 1039 ARG A C   1 
ATOM   460  O O   . ARG A 1 70  ? 1.215   22.571 51.287  1.00 43.30 ? 1039 ARG A O   1 
ATOM   461  C CB  . ARG A 1 70  ? 0.631   24.641 48.678  1.00 40.13 ? 1039 ARG A CB  1 
ATOM   462  C CG  . ARG A 1 70  ? 2.111   24.402 48.492  1.00 39.92 ? 1039 ARG A CG  1 
ATOM   463  C CD  . ARG A 1 70  ? 2.401   23.004 47.949  1.00 39.69 ? 1039 ARG A CD  1 
ATOM   464  N NE  . ARG A 1 70  ? 3.834   22.725 47.986  1.00 40.39 ? 1039 ARG A NE  1 
ATOM   465  C CZ  . ARG A 1 70  ? 4.734   23.293 47.186  1.00 40.52 ? 1039 ARG A CZ  1 
ATOM   466  N NH1 . ARG A 1 70  ? 6.020   22.981 47.309  1.00 39.85 ? 1039 ARG A NH1 1 
ATOM   467  N NH2 . ARG A 1 70  ? 4.351   24.154 46.249  1.00 39.26 ? 1039 ARG A NH2 1 
ATOM   468  N N   . GLU A 1 71  ? 0.253   24.538 51.787  1.00 43.31 ? 1040 GLU A N   1 
ATOM   469  C CA  . GLU A 1 71  ? 0.774   24.565 53.161  1.00 43.70 ? 1040 GLU A CA  1 
ATOM   470  C C   . GLU A 1 71  ? 0.172   23.395 53.919  1.00 42.91 ? 1040 GLU A C   1 
ATOM   471  O O   . GLU A 1 71  ? 0.807   22.785 54.784  1.00 41.40 ? 1040 GLU A O   1 
ATOM   472  C CB  . GLU A 1 71  ? 0.366   25.854 53.876  1.00 44.76 ? 1040 GLU A CB  1 
ATOM   473  C CG  . GLU A 1 71  ? 0.935   27.116 53.287  1.00 48.06 ? 1040 GLU A CG  1 
ATOM   474  C CD  . GLU A 1 71  ? 0.336   28.352 53.921  1.00 51.22 ? 1040 GLU A CD  1 
ATOM   475  O OE1 . GLU A 1 71  ? -0.246  29.180 53.180  1.00 53.15 ? 1040 GLU A OE1 1 
ATOM   476  O OE2 . GLU A 1 71  ? 0.444   28.492 55.161  1.00 52.35 ? 1040 GLU A OE2 1 
ATOM   477  N N   . ARG A 1 72  ? -1.080  23.118 53.581  1.00 41.75 ? 1041 ARG A N   1 
ATOM   478  C CA  . ARG A 1 72  ? -1.846  22.041 54.177  1.00 41.26 ? 1041 ARG A CA  1 
ATOM   479  C C   . ARG A 1 72  ? -1.254  20.701 53.746  1.00 40.83 ? 1041 ARG A C   1 
ATOM   480  O O   . ARG A 1 72  ? -1.303  19.722 54.488  1.00 40.02 ? 1041 ARG A O   1 
ATOM   481  C CB  . ARG A 1 72  ? -3.300  22.176 53.716  1.00 40.52 ? 1041 ARG A CB  1 
ATOM   482  C CG  . ARG A 1 72  ? -4.255  21.090 54.155  1.00 40.56 ? 1041 ARG A CG  1 
ATOM   483  C CD  . ARG A 1 72  ? -5.665  21.501 53.757  1.00 41.16 ? 1041 ARG A CD  1 
ATOM   484  N NE  . ARG A 1 72  ? -6.021  22.767 54.395  1.00 41.82 ? 1041 ARG A NE  1 
ATOM   485  C CZ  . ARG A 1 72  ? -6.649  23.777 53.798  1.00 43.09 ? 1041 ARG A CZ  1 
ATOM   486  N NH1 . ARG A 1 72  ? -6.916  24.878 54.489  1.00 43.94 ? 1041 ARG A NH1 1 
ATOM   487  N NH2 . ARG A 1 72  ? -7.007  23.700 52.522  1.00 40.20 ? 1041 ARG A NH2 1 
ATOM   488  N N   . ILE A 1 73  ? -0.685  20.666 52.544  1.00 40.96 ? 1042 ILE A N   1 
ATOM   489  C CA  . ILE A 1 73  ? -0.095  19.440 52.029  1.00 40.67 ? 1042 ILE A CA  1 
ATOM   490  C C   . ILE A 1 73  ? 1.251   19.202 52.683  1.00 40.59 ? 1042 ILE A C   1 
ATOM   491  O O   . ILE A 1 73  ? 1.610   18.059 52.971  1.00 40.59 ? 1042 ILE A O   1 
ATOM   492  C CB  . ILE A 1 73  ? 0.099   19.495 50.492  1.00 41.09 ? 1042 ILE A CB  1 
ATOM   493  C CG1 . ILE A 1 73  ? -0.036  18.092 49.910  1.00 42.29 ? 1042 ILE A CG1 1 
ATOM   494  C CG2 . ILE A 1 73  ? 1.481   20.016 50.136  1.00 40.85 ? 1042 ILE A CG2 1 
ATOM   495  C CD1 . ILE A 1 73  ? -1.424  17.498 50.082  1.00 44.49 ? 1042 ILE A CD1 1 
ATOM   496  N N   . GLU A 1 74  ? 1.984   20.291 52.920  1.00 40.99 ? 1043 GLU A N   1 
ATOM   497  C CA  . GLU A 1 74  ? 3.309   20.218 53.532  1.00 41.74 ? 1043 GLU A CA  1 
ATOM   498  C C   . GLU A 1 74  ? 3.203   20.005 55.028  1.00 41.28 ? 1043 GLU A C   1 
ATOM   499  O O   . GLU A 1 74  ? 4.206   19.890 55.722  1.00 41.32 ? 1043 GLU A O   1 
ATOM   500  C CB  . GLU A 1 74  ? 4.110   21.495 53.254  1.00 43.46 ? 1043 GLU A CB  1 
ATOM   501  C CG  . GLU A 1 74  ? 3.759   22.685 54.127  1.00 45.50 ? 1043 GLU A CG  1 
ATOM   502  C CD  . GLU A 1 74  ? 4.680   23.872 53.871  1.00 48.95 ? 1043 GLU A CD  1 
ATOM   503  O OE1 . GLU A 1 74  ? 4.558   24.886 54.595  1.00 49.28 ? 1043 GLU A OE1 1 
ATOM   504  O OE2 . GLU A 1 74  ? 5.526   23.793 52.945  1.00 49.44 ? 1043 GLU A OE2 1 
ATOM   505  N N   . PHE A 1 75  ? 1.970   19.965 55.516  1.00 41.33 ? 1044 PHE A N   1 
ATOM   506  C CA  . PHE A 1 75  ? 1.696   19.749 56.930  1.00 39.77 ? 1044 PHE A CA  1 
ATOM   507  C C   . PHE A 1 75  ? 1.618   18.238 57.162  1.00 39.36 ? 1044 PHE A C   1 
ATOM   508  O O   . PHE A 1 75  ? 2.198   17.714 58.114  1.00 39.06 ? 1044 PHE A O   1 
ATOM   509  C CB  . PHE A 1 75  ? 0.371   20.416 57.300  1.00 38.16 ? 1044 PHE A CB  1 
ATOM   510  C CG  . PHE A 1 75  ? -0.042  20.193 58.711  1.00 35.50 ? 1044 PHE A CG  1 
ATOM   511  C CD1 . PHE A 1 75  ? 0.735   20.669 59.757  1.00 35.99 ? 1044 PHE A CD1 1 
ATOM   512  C CD2 . PHE A 1 75  ? -1.210  19.506 58.999  1.00 35.09 ? 1044 PHE A CD2 1 
ATOM   513  C CE1 . PHE A 1 75  ? 0.356   20.469 61.074  1.00 35.77 ? 1044 PHE A CE1 1 
ATOM   514  C CE2 . PHE A 1 75  ? -1.603  19.298 60.311  1.00 35.39 ? 1044 PHE A CE2 1 
ATOM   515  C CZ  . PHE A 1 75  ? -0.817  19.781 61.354  1.00 35.39 ? 1044 PHE A CZ  1 
ATOM   516  N N   . LEU A 1 76  ? 0.904   17.552 56.272  1.00 38.30 ? 1045 LEU A N   1 
ATOM   517  C CA  . LEU A 1 76  ? 0.744   16.103 56.341  1.00 37.99 ? 1045 LEU A CA  1 
ATOM   518  C C   . LEU A 1 76  ? 2.053   15.416 55.941  1.00 38.48 ? 1045 LEU A C   1 
ATOM   519  O O   . LEU A 1 76  ? 2.353   14.309 56.393  1.00 37.55 ? 1045 LEU A O   1 
ATOM   520  C CB  . LEU A 1 76  ? -0.385  15.653 55.403  1.00 37.32 ? 1045 LEU A CB  1 
ATOM   521  C CG  . LEU A 1 76  ? -1.774  16.278 55.608  1.00 36.01 ? 1045 LEU A CG  1 
ATOM   522  C CD1 . LEU A 1 76  ? -2.748  15.685 54.604  1.00 33.28 ? 1045 LEU A CD1 1 
ATOM   523  C CD2 . LEU A 1 76  ? -2.258  16.031 57.027  1.00 33.49 ? 1045 LEU A CD2 1 
ATOM   524  N N   . ASN A 1 77  ? 2.830   16.076 55.087  1.00 38.36 ? 1046 ASN A N   1 
ATOM   525  C CA  . ASN A 1 77  ? 4.106   15.522 54.650  1.00 38.77 ? 1046 ASN A CA  1 
ATOM   526  C C   . ASN A 1 77  ? 5.095   15.506 55.812  1.00 38.69 ? 1046 ASN A C   1 
ATOM   527  O O   . ASN A 1 77  ? 5.832   14.539 56.001  1.00 37.83 ? 1046 ASN A O   1 
ATOM   528  C CB  . ASN A 1 77  ? 4.693   16.351 53.505  1.00 39.62 ? 1046 ASN A CB  1 
ATOM   529  C CG  . ASN A 1 77  ? 3.907   16.220 52.218  1.00 40.23 ? 1046 ASN A CG  1 
ATOM   530  O OD1 . ASN A 1 77  ? 4.251   16.835 51.209  1.00 40.98 ? 1046 ASN A OD1 1 
ATOM   531  N ND2 . ASN A 1 77  ? 2.848   15.422 52.243  1.00 41.56 ? 1046 ASN A ND2 1 
ATOM   532  N N   . GLU A 1 78  ? 5.109   16.589 56.585  1.00 38.66 ? 1047 GLU A N   1 
ATOM   533  C CA  . GLU A 1 78  ? 6.010   16.700 57.723  1.00 39.41 ? 1047 GLU A CA  1 
ATOM   534  C C   . GLU A 1 78  ? 5.634   15.661 58.777  1.00 38.61 ? 1047 GLU A C   1 
ATOM   535  O O   . GLU A 1 78  ? 6.488   14.993 59.360  1.00 38.39 ? 1047 GLU A O   1 
ATOM   536  C CB  . GLU A 1 78  ? 5.920   18.103 58.325  1.00 40.93 ? 1047 GLU A CB  1 
ATOM   537  C CG  . GLU A 1 78  ? 7.197   18.562 59.001  1.00 45.27 ? 1047 GLU A CG  1 
ATOM   538  C CD  . GLU A 1 78  ? 8.361   18.688 58.024  1.00 48.07 ? 1047 GLU A CD  1 
ATOM   539  O OE1 . GLU A 1 78  ? 8.719   17.674 57.383  1.00 48.70 ? 1047 GLU A OE1 1 
ATOM   540  O OE2 . GLU A 1 78  ? 8.922   19.800 57.896  1.00 49.56 ? 1047 GLU A OE2 1 
ATOM   541  N N   . ALA A 1 79  ? 4.338   15.532 59.012  1.00 37.63 ? 1048 ALA A N   1 
ATOM   542  C CA  . ALA A 1 79  ? 3.837   14.585 59.984  1.00 36.26 ? 1048 ALA A CA  1 
ATOM   543  C C   . ALA A 1 79  ? 4.143   13.169 59.529  1.00 35.63 ? 1048 ALA A C   1 
ATOM   544  O O   . ALA A 1 79  ? 4.365   12.283 60.345  1.00 36.32 ? 1048 ALA A O   1 
ATOM   545  C CB  . ALA A 1 79  ? 2.341   14.768 60.154  1.00 37.15 ? 1048 ALA A CB  1 
ATOM   546  N N   . SER A 1 80  ? 4.156   12.958 58.220  1.00 35.28 ? 1049 SER A N   1 
ATOM   547  C CA  . SER A 1 80  ? 4.426   11.631 57.682  1.00 35.23 ? 1049 SER A CA  1 
ATOM   548  C C   . SER A 1 80  ? 5.870   11.168 57.896  1.00 34.08 ? 1049 SER A C   1 
ATOM   549  O O   . SER A 1 80  ? 6.129   9.963  58.017  1.00 34.57 ? 1049 SER A O   1 
ATOM   550  C CB  . SER A 1 80  ? 4.066   11.578 56.191  1.00 35.05 ? 1049 SER A CB  1 
ATOM   551  O OG  . SER A 1 80  ? 2.664   11.671 56.011  1.00 34.27 ? 1049 SER A OG  1 
ATOM   552  N N   . VAL A 1 81  ? 6.810   12.110 57.939  1.00 31.97 ? 1050 VAL A N   1 
ATOM   553  C CA  . VAL A 1 81  ? 8.206   11.748 58.163  1.00 30.52 ? 1050 VAL A CA  1 
ATOM   554  C C   . VAL A 1 81  ? 8.240   10.943 59.454  1.00 31.64 ? 1050 VAL A C   1 
ATOM   555  O O   . VAL A 1 81  ? 8.956   9.951  59.574  1.00 31.70 ? 1050 VAL A O   1 
ATOM   556  C CB  . VAL A 1 81  ? 9.107   12.995 58.336  1.00 28.05 ? 1050 VAL A CB  1 
ATOM   557  C CG1 . VAL A 1 81  ? 10.479  12.577 58.832  1.00 28.07 ? 1050 VAL A CG1 1 
ATOM   558  C CG2 . VAL A 1 81  ? 9.236   13.735 57.024  1.00 25.65 ? 1050 VAL A CG2 1 
ATOM   559  N N   . MET A 1 82  ? 7.430   11.383 60.409  1.00 33.27 ? 1051 MET A N   1 
ATOM   560  C CA  . MET A 1 82  ? 7.335   10.748 61.710  1.00 35.79 ? 1051 MET A CA  1 
ATOM   561  C C   . MET A 1 82  ? 6.572   9.422  61.697  1.00 36.18 ? 1051 MET A C   1 
ATOM   562  O O   . MET A 1 82  ? 6.538   8.710  62.703  1.00 37.29 ? 1051 MET A O   1 
ATOM   563  C CB  . MET A 1 82  ? 6.686   11.713 62.705  1.00 36.92 ? 1051 MET A CB  1 
ATOM   564  C CG  . MET A 1 82  ? 7.500   12.964 62.960  1.00 37.50 ? 1051 MET A CG  1 
ATOM   565  S SD  . MET A 1 82  ? 6.656   14.039 64.111  1.00 38.48 ? 1051 MET A SD  1 
ATOM   566  C CE  . MET A 1 82  ? 6.996   13.168 65.625  1.00 38.50 ? 1051 MET A CE  1 
ATOM   567  N N   . LYS A 1 83  ? 5.947   9.089  60.577  1.00 35.09 ? 1052 LYS A N   1 
ATOM   568  C CA  . LYS A 1 83  ? 5.235   7.828  60.508  1.00 34.70 ? 1052 LYS A CA  1 
ATOM   569  C C   . LYS A 1 83  ? 6.274   6.714  60.660  1.00 34.81 ? 1052 LYS A C   1 
ATOM   570  O O   . LYS A 1 83  ? 5.961   5.607  61.091  1.00 34.04 ? 1052 LYS A O   1 
ATOM   571  C CB  . LYS A 1 83  ? 4.521   7.697  59.165  1.00 33.84 ? 1052 LYS A CB  1 
ATOM   572  C CG  . LYS A 1 83  ? 3.407   8.697  58.954  1.00 33.07 ? 1052 LYS A CG  1 
ATOM   573  C CD  . LYS A 1 83  ? 2.735   8.483  57.595  1.00 33.31 ? 1052 LYS A CD  1 
ATOM   574  C CE  . LYS A 1 83  ? 1.454   9.290  57.463  1.00 31.63 ? 1052 LYS A CE  1 
ATOM   575  N NZ  . LYS A 1 83  ? 0.693   8.924  56.238  1.00 33.12 ? 1052 LYS A NZ  1 
ATOM   576  N N   . GLU A 1 84  ? 7.520   7.027  60.320  1.00 35.83 ? 1053 GLU A N   1 
ATOM   577  C CA  . GLU A 1 84  ? 8.599   6.050  60.403  1.00 37.22 ? 1053 GLU A CA  1 
ATOM   578  C C   . GLU A 1 84  ? 9.175   5.837  61.803  1.00 36.92 ? 1053 GLU A C   1 
ATOM   579  O O   . GLU A 1 84  ? 9.601   4.733  62.133  1.00 37.49 ? 1053 GLU A O   1 
ATOM   580  C CB  . GLU A 1 84  ? 9.744   6.434  59.457  1.00 38.72 ? 1053 GLU A CB  1 
ATOM   581  C CG  . GLU A 1 84  ? 9.369   6.545  57.975  1.00 43.58 ? 1053 GLU A CG  1 
ATOM   582  C CD  . GLU A 1 84  ? 8.450   5.425  57.487  1.00 46.25 ? 1053 GLU A CD  1 
ATOM   583  O OE1 . GLU A 1 84  ? 7.214   5.563  57.635  1.00 47.81 ? 1053 GLU A OE1 1 
ATOM   584  O OE2 . GLU A 1 84  ? 8.958   4.408  56.959  1.00 47.58 ? 1053 GLU A OE2 1 
ATOM   585  N N   . PHE A 1 85  ? 9.185   6.880  62.627  1.00 36.06 ? 1054 PHE A N   1 
ATOM   586  C CA  . PHE A 1 85  ? 9.753   6.777  63.967  1.00 34.56 ? 1054 PHE A CA  1 
ATOM   587  C C   . PHE A 1 85  ? 8.920   6.004  64.983  1.00 33.55 ? 1054 PHE A C   1 
ATOM   588  O O   . PHE A 1 85  ? 7.692   6.009  64.954  1.00 33.87 ? 1054 PHE A O   1 
ATOM   589  C CB  . PHE A 1 85  ? 10.052  8.171  64.530  1.00 35.65 ? 1054 PHE A CB  1 
ATOM   590  C CG  . PHE A 1 85  ? 10.818  9.067  63.586  1.00 35.86 ? 1054 PHE A CG  1 
ATOM   591  C CD1 . PHE A 1 85  ? 11.620  8.530  62.580  1.00 35.95 ? 1054 PHE A CD1 1 
ATOM   592  C CD2 . PHE A 1 85  ? 10.730  10.452 63.703  1.00 35.16 ? 1054 PHE A CD2 1 
ATOM   593  C CE1 . PHE A 1 85  ? 12.316  9.358  61.705  1.00 36.33 ? 1054 PHE A CE1 1 
ATOM   594  C CE2 . PHE A 1 85  ? 11.420  11.288 62.835  1.00 35.70 ? 1054 PHE A CE2 1 
ATOM   595  C CZ  . PHE A 1 85  ? 12.216  10.741 61.831  1.00 36.66 ? 1054 PHE A CZ  1 
ATOM   596  N N   . ASN A 1 86  ? 9.621   5.344  65.894  1.00 31.59 ? 1055 ASN A N   1 
ATOM   597  C CA  . ASN A 1 86  ? 9.005   4.555  66.946  1.00 30.25 ? 1055 ASN A CA  1 
ATOM   598  C C   . ASN A 1 86  ? 10.021  4.450  68.077  1.00 28.06 ? 1055 ASN A C   1 
ATOM   599  O O   . ASN A 1 86  ? 10.538  3.373  68.363  1.00 27.97 ? 1055 ASN A O   1 
ATOM   600  C CB  . ASN A 1 86  ? 8.636   3.167  66.407  1.00 30.93 ? 1055 ASN A CB  1 
ATOM   601  C CG  . ASN A 1 86  ? 8.234   2.196  67.504  1.00 33.15 ? 1055 ASN A CG  1 
ATOM   602  O OD1 . ASN A 1 86  ? 7.546   2.565  68.457  1.00 32.00 ? 1055 ASN A OD1 1 
ATOM   603  N ND2 . ASN A 1 86  ? 8.653   0.941  67.366  1.00 34.16 ? 1055 ASN A ND2 1 
ATOM   604  N N   . CYS A 1 87  ? 10.300  5.587  68.709  1.00 25.70 ? 1056 CYS A N   1 
ATOM   605  C CA  . CYS A 1 87  ? 11.273  5.671  69.795  1.00 24.41 ? 1056 CYS A CA  1 
ATOM   606  C C   . CYS A 1 87  ? 10.682  6.334  71.018  1.00 23.68 ? 1056 CYS A C   1 
ATOM   607  O O   . CYS A 1 87  ? 10.020  7.358  70.921  1.00 24.30 ? 1056 CYS A O   1 
ATOM   608  C CB  . CYS A 1 87  ? 12.498  6.468  69.344  1.00 24.28 ? 1056 CYS A CB  1 
ATOM   609  S SG  . CYS A 1 87  ? 13.687  6.837  70.647  1.00 27.56 ? 1056 CYS A SG  1 
ATOM   610  N N   . HIS A 1 88  ? 10.956  5.764  72.178  1.00 23.09 ? 1057 HIS A N   1 
ATOM   611  C CA  . HIS A 1 88  ? 10.422  6.293  73.413  1.00 21.30 ? 1057 HIS A CA  1 
ATOM   612  C C   . HIS A 1 88  ? 10.815  7.734  73.700  1.00 21.06 ? 1057 HIS A C   1 
ATOM   613  O O   . HIS A 1 88  ? 10.073  8.453  74.370  1.00 19.98 ? 1057 HIS A O   1 
ATOM   614  C CB  . HIS A 1 88  ? 10.830  5.397  74.577  1.00 21.58 ? 1057 HIS A CB  1 
ATOM   615  C CG  . HIS A 1 88  ? 10.052  5.652  75.827  1.00 21.33 ? 1057 HIS A CG  1 
ATOM   616  N ND1 . HIS A 1 88  ? 10.625  6.164  76.971  1.00 22.00 ? 1057 HIS A ND1 1 
ATOM   617  C CD2 . HIS A 1 88  ? 8.741   5.480  76.108  1.00 21.12 ? 1057 HIS A CD2 1 
ATOM   618  C CE1 . HIS A 1 88  ? 9.701   6.295  77.903  1.00 20.05 ? 1057 HIS A CE1 1 
ATOM   619  N NE2 . HIS A 1 88  ? 8.548   5.887  77.405  1.00 20.69 ? 1057 HIS A NE2 1 
ATOM   620  N N   . HIS A 1 89  ? 11.964  8.175  73.201  1.00 20.98 ? 1058 HIS A N   1 
ATOM   621  C CA  . HIS A 1 89  ? 12.375  9.550  73.462  1.00 21.58 ? 1058 HIS A CA  1 
ATOM   622  C C   . HIS A 1 89  ? 12.165  10.502 72.292  1.00 21.96 ? 1058 HIS A C   1 
ATOM   623  O O   . HIS A 1 89  ? 12.969  11.392 72.042  1.00 23.24 ? 1058 HIS A O   1 
ATOM   624  C CB  . HIS A 1 89  ? 13.824  9.585  73.949  1.00 22.82 ? 1058 HIS A CB  1 
ATOM   625  C CG  . HIS A 1 89  ? 14.033  8.844  75.233  1.00 25.88 ? 1058 HIS A CG  1 
ATOM   626  N ND1 . HIS A 1 89  ? 14.380  7.511  75.274  1.00 27.47 ? 1058 HIS A ND1 1 
ATOM   627  C CD2 . HIS A 1 89  ? 13.832  9.219  76.520  1.00 27.32 ? 1058 HIS A CD2 1 
ATOM   628  C CE1 . HIS A 1 89  ? 14.378  7.095  76.529  1.00 27.67 ? 1058 HIS A CE1 1 
ATOM   629  N NE2 . HIS A 1 89  ? 14.047  8.113  77.304  1.00 26.97 ? 1058 HIS A NE2 1 
ATOM   630  N N   . VAL A 1 90  ? 11.067  10.296 71.574  1.00 22.70 ? 1059 VAL A N   1 
ATOM   631  C CA  . VAL A 1 90  ? 10.689  11.151 70.456  1.00 23.31 ? 1059 VAL A CA  1 
ATOM   632  C C   . VAL A 1 90  ? 9.161   11.220 70.426  1.00 23.91 ? 1059 VAL A C   1 
ATOM   633  O O   . VAL A 1 90  ? 8.497   10.233 70.113  1.00 24.05 ? 1059 VAL A O   1 
ATOM   634  C CB  . VAL A 1 90  ? 11.214  10.614 69.086  1.00 22.42 ? 1059 VAL A CB  1 
ATOM   635  C CG1 . VAL A 1 90  ? 10.545  11.358 67.946  1.00 20.56 ? 1059 VAL A CG1 1 
ATOM   636  C CG2 . VAL A 1 90  ? 12.727  10.807 68.983  1.00 21.47 ? 1059 VAL A CG2 1 
ATOM   637  N N   . VAL A 1 91  ? 8.619   12.385 70.787  1.00 25.05 ? 1060 VAL A N   1 
ATOM   638  C CA  . VAL A 1 91  ? 7.170   12.620 70.799  1.00 25.99 ? 1060 VAL A CA  1 
ATOM   639  C C   . VAL A 1 91  ? 6.544   11.878 69.622  1.00 26.75 ? 1060 VAL A C   1 
ATOM   640  O O   . VAL A 1 91  ? 6.838   12.196 68.477  1.00 27.36 ? 1060 VAL A O   1 
ATOM   641  C CB  . VAL A 1 91  ? 6.877   14.134 70.681  1.00 24.68 ? 1060 VAL A CB  1 
ATOM   642  C CG1 . VAL A 1 91  ? 5.439   14.369 70.296  1.00 24.11 ? 1060 VAL A CG1 1 
ATOM   643  C CG2 . VAL A 1 91  ? 7.192   14.817 71.999  1.00 24.09 ? 1060 VAL A CG2 1 
ATOM   644  N N   . ARG A 1 92  ? 5.678   10.907 69.904  1.00 27.65 ? 1061 ARG A N   1 
ATOM   645  C CA  . ARG A 1 92  ? 5.069   10.097 68.848  1.00 30.07 ? 1061 ARG A CA  1 
ATOM   646  C C   . ARG A 1 92  ? 3.801   10.556 68.136  1.00 29.78 ? 1061 ARG A C   1 
ATOM   647  O O   . ARG A 1 92  ? 2.930   11.199 68.725  1.00 29.97 ? 1061 ARG A O   1 
ATOM   648  C CB  . ARG A 1 92  ? 4.820   8.681  69.366  1.00 33.04 ? 1061 ARG A CB  1 
ATOM   649  C CG  . ARG A 1 92  ? 6.056   7.796  69.370  1.00 37.76 ? 1061 ARG A CG  1 
ATOM   650  C CD  . ARG A 1 92  ? 5.720   6.396  69.876  1.00 41.87 ? 1061 ARG A CD  1 
ATOM   651  N NE  . ARG A 1 92  ? 6.902   5.549  70.001  1.00 43.08 ? 1061 ARG A NE  1 
ATOM   652  C CZ  . ARG A 1 92  ? 6.913   4.375  70.623  1.00 44.63 ? 1061 ARG A CZ  1 
ATOM   653  N NH1 . ARG A 1 92  ? 8.038   3.673  70.686  1.00 46.65 ? 1061 ARG A NH1 1 
ATOM   654  N NH2 . ARG A 1 92  ? 5.804   3.904  71.186  1.00 43.50 ? 1061 ARG A NH2 1 
ATOM   655  N N   . LEU A 1 93  ? 3.718   10.201 66.853  1.00 29.09 ? 1062 LEU A N   1 
ATOM   656  C CA  . LEU A 1 93  ? 2.560   10.503 66.021  1.00 28.85 ? 1062 LEU A CA  1 
ATOM   657  C C   . LEU A 1 93  ? 1.602   9.338  66.212  1.00 30.45 ? 1062 LEU A C   1 
ATOM   658  O O   . LEU A 1 93  ? 1.975   8.183  66.007  1.00 31.84 ? 1062 LEU A O   1 
ATOM   659  C CB  . LEU A 1 93  ? 2.936   10.574 64.540  1.00 28.37 ? 1062 LEU A CB  1 
ATOM   660  C CG  . LEU A 1 93  ? 1.757   10.372 63.570  1.00 27.41 ? 1062 LEU A CG  1 
ATOM   661  C CD1 . LEU A 1 93  ? 1.012   11.684 63.382  1.00 26.44 ? 1062 LEU A CD1 1 
ATOM   662  C CD2 . LEU A 1 93  ? 2.259   9.859  62.237  1.00 26.19 ? 1062 LEU A CD2 1 
ATOM   663  N N   . LEU A 1 94  ? 0.367   9.641  66.587  1.00 30.52 ? 1063 LEU A N   1 
ATOM   664  C CA  . LEU A 1 94  ? -0.622  8.607  66.818  1.00 30.35 ? 1063 LEU A CA  1 
ATOM   665  C C   . LEU A 1 94  ? -1.577  8.463  65.653  1.00 31.59 ? 1063 LEU A C   1 
ATOM   666  O O   . LEU A 1 94  ? -2.054  7.364  65.370  1.00 32.52 ? 1063 LEU A O   1 
ATOM   667  C CB  . LEU A 1 94  ? -1.393  8.914  68.101  1.00 29.09 ? 1063 LEU A CB  1 
ATOM   668  C CG  . LEU A 1 94  ? -0.457  9.096  69.301  1.00 28.61 ? 1063 LEU A CG  1 
ATOM   669  C CD1 . LEU A 1 94  ? -1.266  9.364  70.559  1.00 27.18 ? 1063 LEU A CD1 1 
ATOM   670  C CD2 . LEU A 1 94  ? 0.412   7.854  69.461  1.00 26.76 ? 1063 LEU A CD2 1 
ATOM   671  N N   . GLY A 1 95  ? -1.849  9.568  64.966  1.00 31.89 ? 1064 GLY A N   1 
ATOM   672  C CA  . GLY A 1 95  ? -2.762  9.511  63.843  1.00 30.57 ? 1064 GLY A CA  1 
ATOM   673  C C   . GLY A 1 95  ? -2.774  10.755 62.978  1.00 30.20 ? 1064 GLY A C   1 
ATOM   674  O O   . GLY A 1 95  ? -2.059  11.726 63.245  1.00 31.69 ? 1064 GLY A O   1 
ATOM   675  N N   . VAL A 1 96  ? -3.605  10.713 61.940  1.00 28.11 ? 1065 VAL A N   1 
ATOM   676  C CA  . VAL A 1 96  ? -3.752  11.805 60.994  1.00 26.97 ? 1065 VAL A CA  1 
ATOM   677  C C   . VAL A 1 96  ? -5.216  11.886 60.540  1.00 27.87 ? 1065 VAL A C   1 
ATOM   678  O O   . VAL A 1 96  ? -5.907  10.868 60.456  1.00 26.86 ? 1065 VAL A O   1 
ATOM   679  C CB  . VAL A 1 96  ? -2.867  11.564 59.750  1.00 26.54 ? 1065 VAL A CB  1 
ATOM   680  C CG1 . VAL A 1 96  ? -2.941  12.749 58.815  1.00 25.52 ? 1065 VAL A CG1 1 
ATOM   681  C CG2 . VAL A 1 96  ? -1.437  11.307 60.167  1.00 25.81 ? 1065 VAL A CG2 1 
ATOM   682  N N   . VAL A 1 97  ? -5.694  13.102 60.280  1.00 28.12 ? 1066 VAL A N   1 
ATOM   683  C CA  . VAL A 1 97  ? -7.059  13.304 59.791  1.00 27.36 ? 1066 VAL A CA  1 
ATOM   684  C C   . VAL A 1 97  ? -7.006  14.205 58.552  1.00 28.66 ? 1066 VAL A C   1 
ATOM   685  O O   . VAL A 1 97  ? -7.146  15.427 58.639  1.00 28.22 ? 1066 VAL A O   1 
ATOM   686  C CB  . VAL A 1 97  ? -7.978  13.936 60.861  1.00 25.13 ? 1066 VAL A CB  1 
ATOM   687  C CG1 . VAL A 1 97  ? -9.363  14.181 60.277  1.00 22.23 ? 1066 VAL A CG1 1 
ATOM   688  C CG2 . VAL A 1 97  ? -8.083  13.011 62.060  1.00 23.86 ? 1066 VAL A CG2 1 
ATOM   689  N N   . SER A 1 98  ? -6.793  13.575 57.398  1.00 30.72 ? 1067 SER A N   1 
ATOM   690  C CA  . SER A 1 98  ? -6.696  14.284 56.129  1.00 31.77 ? 1067 SER A CA  1 
ATOM   691  C C   . SER A 1 98  ? -8.033  14.682 55.545  1.00 32.24 ? 1067 SER A C   1 
ATOM   692  O O   . SER A 1 98  ? -8.142  15.740 54.947  1.00 34.02 ? 1067 SER A O   1 
ATOM   693  C CB  . SER A 1 98  ? -5.952  13.434 55.104  1.00 31.24 ? 1067 SER A CB  1 
ATOM   694  O OG  . SER A 1 98  ? -6.699  12.285 54.756  1.00 31.06 ? 1067 SER A OG  1 
ATOM   695  N N   . GLN A 1 99  ? -9.047  13.838 55.712  1.00 33.99 ? 1068 GLN A N   1 
ATOM   696  C CA  . GLN A 1 99  ? -10.378 14.116 55.169  1.00 35.58 ? 1068 GLN A CA  1 
ATOM   697  C C   . GLN A 1 99  ? -11.119 15.200 55.958  1.00 36.02 ? 1068 GLN A C   1 
ATOM   698  O O   . GLN A 1 99  ? -11.229 15.127 57.181  1.00 37.01 ? 1068 GLN A O   1 
ATOM   699  C CB  . GLN A 1 99  ? -11.230 12.838 55.165  1.00 36.90 ? 1068 GLN A CB  1 
ATOM   700  C CG  . GLN A 1 99  ? -10.522 11.563 54.670  1.00 38.58 ? 1068 GLN A CG  1 
ATOM   701  C CD  . GLN A 1 99  ? -9.960  11.688 53.264  1.00 40.49 ? 1068 GLN A CD  1 
ATOM   702  O OE1 . GLN A 1 99  ? -8.892  12.262 53.056  1.00 38.98 ? 1068 GLN A OE1 1 
ATOM   703  N NE2 . GLN A 1 99  ? -10.688 11.156 52.287  1.00 42.63 ? 1068 GLN A NE2 1 
ATOM   704  N N   . GLY A 1 100 ? -11.619 16.212 55.260  1.00 35.53 ? 1069 GLY A N   1 
ATOM   705  C CA  . GLY A 1 100 ? -12.361 17.258 55.939  1.00 35.74 ? 1069 GLY A CA  1 
ATOM   706  C C   . GLY A 1 100 ? -11.600 18.495 56.365  1.00 36.49 ? 1069 GLY A C   1 
ATOM   707  O O   . GLY A 1 100 ? -10.469 18.721 55.928  1.00 37.48 ? 1069 GLY A O   1 
ATOM   708  N N   . GLN A 1 101 ? -12.233 19.294 57.226  1.00 35.98 ? 1070 GLN A N   1 
ATOM   709  C CA  . GLN A 1 101 ? -11.655 20.537 57.729  1.00 37.12 ? 1070 GLN A CA  1 
ATOM   710  C C   . GLN A 1 101 ? -11.984 20.796 59.200  1.00 37.22 ? 1070 GLN A C   1 
ATOM   711  O O   . GLN A 1 101 ? -13.132 20.672 59.620  1.00 37.99 ? 1070 GLN A O   1 
ATOM   712  C CB  . GLN A 1 101 ? -12.161 21.715 56.892  1.00 38.81 ? 1070 GLN A CB  1 
ATOM   713  C CG  . GLN A 1 101 ? -11.459 21.890 55.566  1.00 40.93 ? 1070 GLN A CG  1 
ATOM   714  C CD  . GLN A 1 101 ? -10.015 22.312 55.745  1.00 43.51 ? 1070 GLN A CD  1 
ATOM   715  O OE1 . GLN A 1 101 ? -9.733  23.359 56.334  1.00 44.72 ? 1070 GLN A OE1 1 
ATOM   716  N NE2 . GLN A 1 101 ? -9.089  21.498 55.241  1.00 44.82 ? 1070 GLN A NE2 1 
ATOM   717  N N   . PRO A 1 102 ? -10.983 21.195 60.002  1.00 37.10 ? 1071 PRO A N   1 
ATOM   718  C CA  . PRO A 1 102 ? -9.575  21.424 59.651  1.00 35.98 ? 1071 PRO A CA  1 
ATOM   719  C C   . PRO A 1 102 ? -8.827  20.114 59.468  1.00 34.15 ? 1071 PRO A C   1 
ATOM   720  O O   . PRO A 1 102 ? -9.372  19.046 59.717  1.00 34.85 ? 1071 PRO A O   1 
ATOM   721  C CB  . PRO A 1 102 ? -9.034  22.201 60.856  1.00 36.42 ? 1071 PRO A CB  1 
ATOM   722  C CG  . PRO A 1 102 ? -10.270 22.768 61.510  1.00 38.12 ? 1071 PRO A CG  1 
ATOM   723  C CD  . PRO A 1 102 ? -11.246 21.646 61.376  1.00 37.29 ? 1071 PRO A CD  1 
ATOM   724  N N   . THR A 1 103 ? -7.577  20.204 59.026  1.00 32.22 ? 1072 THR A N   1 
ATOM   725  C CA  . THR A 1 103 ? -6.743  19.024 58.858  1.00 29.31 ? 1072 THR A CA  1 
ATOM   726  C C   . THR A 1 103 ? -6.042  18.843 60.194  1.00 29.58 ? 1072 THR A C   1 
ATOM   727  O O   . THR A 1 103 ? -5.436  19.779 60.716  1.00 29.70 ? 1072 THR A O   1 
ATOM   728  C CB  . THR A 1 103 ? -5.696  19.226 57.770  1.00 28.60 ? 1072 THR A CB  1 
ATOM   729  O OG1 . THR A 1 103 ? -6.352  19.575 56.543  1.00 29.63 ? 1072 THR A OG1 1 
ATOM   730  C CG2 . THR A 1 103 ? -4.900  17.948 57.572  1.00 27.84 ? 1072 THR A CG2 1 
ATOM   731  N N   . LEU A 1 104 ? -6.131  17.642 60.755  1.00 28.61 ? 1073 LEU A N   1 
ATOM   732  C CA  . LEU A 1 104 ? -5.531  17.377 62.051  1.00 25.29 ? 1073 LEU A CA  1 
ATOM   733  C C   . LEU A 1 104 ? -4.311  16.495 62.011  1.00 24.46 ? 1073 LEU A C   1 
ATOM   734  O O   . LEU A 1 104 ? -4.008  15.861 61.010  1.00 25.50 ? 1073 LEU A O   1 
ATOM   735  C CB  . LEU A 1 104 ? -6.546  16.704 62.967  1.00 24.23 ? 1073 LEU A CB  1 
ATOM   736  C CG  . LEU A 1 104 ? -7.913  17.346 63.148  1.00 23.64 ? 1073 LEU A CG  1 
ATOM   737  C CD1 . LEU A 1 104 ? -8.816  16.347 63.829  1.00 22.70 ? 1073 LEU A CD1 1 
ATOM   738  C CD2 . LEU A 1 104 ? -7.795  18.624 63.968  1.00 23.29 ? 1073 LEU A CD2 1 
ATOM   739  N N   . VAL A 1 105 ? -3.623  16.481 63.143  1.00 24.82 ? 1074 VAL A N   1 
ATOM   740  C CA  . VAL A 1 105 ? -2.456  15.655 63.393  1.00 24.51 ? 1074 VAL A CA  1 
ATOM   741  C C   . VAL A 1 105 ? -2.513  15.379 64.906  1.00 25.19 ? 1074 VAL A C   1 
ATOM   742  O O   . VAL A 1 105 ? -2.377  16.296 65.731  1.00 23.25 ? 1074 VAL A O   1 
ATOM   743  C CB  . VAL A 1 105 ? -1.149  16.366 62.992  1.00 24.82 ? 1074 VAL A CB  1 
ATOM   744  C CG1 . VAL A 1 105 ? 0.029   15.697 63.660  1.00 26.24 ? 1074 VAL A CG1 1 
ATOM   745  C CG2 . VAL A 1 105 ? -0.966  16.284 61.483  1.00 24.31 ? 1074 VAL A CG2 1 
ATOM   746  N N   . ILE A 1 106 ? -2.776  14.116 65.249  1.00 25.10 ? 1075 ILE A N   1 
ATOM   747  C CA  . ILE A 1 106 ? -2.885  13.670 66.642  1.00 24.41 ? 1075 ILE A CA  1 
ATOM   748  C C   . ILE A 1 106 ? -1.518  13.220 67.123  1.00 24.95 ? 1075 ILE A C   1 
ATOM   749  O O   . ILE A 1 106 ? -0.933  12.305 66.558  1.00 25.42 ? 1075 ILE A O   1 
ATOM   750  C CB  . ILE A 1 106 ? -3.857  12.483 66.766  1.00 24.04 ? 1075 ILE A CB  1 
ATOM   751  C CG1 . ILE A 1 106 ? -5.221  12.867 66.197  1.00 21.87 ? 1075 ILE A CG1 1 
ATOM   752  C CG2 . ILE A 1 106 ? -3.976  12.046 68.218  1.00 21.89 ? 1075 ILE A CG2 1 
ATOM   753  C CD1 . ILE A 1 106 ? -6.150  11.694 66.100  1.00 23.47 ? 1075 ILE A CD1 1 
ATOM   754  N N   . MET A 1 107 ? -1.012  13.869 68.164  1.00 25.79 ? 1076 MET A N   1 
ATOM   755  C CA  . MET A 1 107 ? 0.306   13.550 68.707  1.00 25.43 ? 1076 MET A CA  1 
ATOM   756  C C   . MET A 1 107 ? 0.222   13.026 70.132  1.00 24.97 ? 1076 MET A C   1 
ATOM   757  O O   . MET A 1 107 ? -0.846  13.021 70.748  1.00 25.72 ? 1076 MET A O   1 
ATOM   758  C CB  . MET A 1 107 ? 1.188   14.808 68.712  1.00 24.70 ? 1076 MET A CB  1 
ATOM   759  C CG  . MET A 1 107 ? 1.492   15.401 67.349  1.00 26.23 ? 1076 MET A CG  1 
ATOM   760  S SD  . MET A 1 107 ? 2.453   14.267 66.295  1.00 26.96 ? 1076 MET A SD  1 
ATOM   761  C CE  . MET A 1 107 ? 3.928   14.121 67.247  1.00 25.65 ? 1076 MET A CE  1 
ATOM   762  N N   . GLU A 1 108 ? 1.366   12.578 70.640  1.00 24.29 ? 1077 GLU A N   1 
ATOM   763  C CA  . GLU A 1 108 ? 1.484   12.111 72.015  1.00 22.51 ? 1077 GLU A CA  1 
ATOM   764  C C   . GLU A 1 108 ? 1.420   13.431 72.777  1.00 23.39 ? 1077 GLU A C   1 
ATOM   765  O O   . GLU A 1 108 ? 2.052   14.411 72.377  1.00 23.21 ? 1077 GLU A O   1 
ATOM   766  C CB  . GLU A 1 108 ? 2.848   11.462 72.221  1.00 21.30 ? 1077 GLU A CB  1 
ATOM   767  C CG  . GLU A 1 108 ? 3.126   10.840 73.576  1.00 19.71 ? 1077 GLU A CG  1 
ATOM   768  C CD  . GLU A 1 108 ? 4.554   10.268 73.662  1.00 22.01 ? 1077 GLU A CD  1 
ATOM   769  O OE1 . GLU A 1 108 ? 4.904   9.653  74.684  1.00 21.62 ? 1077 GLU A OE1 1 
ATOM   770  O OE2 . GLU A 1 108 ? 5.340   10.434 72.702  1.00 24.86 ? 1077 GLU A OE2 1 
ATOM   771  N N   . LEU A 1 109 ? 0.630   13.467 73.843  1.00 23.54 ? 1078 LEU A N   1 
ATOM   772  C CA  . LEU A 1 109 ? 0.478   14.667 74.659  1.00 22.16 ? 1078 LEU A CA  1 
ATOM   773  C C   . LEU A 1 109 ? 1.616   14.738 75.675  1.00 21.73 ? 1078 LEU A C   1 
ATOM   774  O O   . LEU A 1 109 ? 1.973   13.726 76.278  1.00 20.08 ? 1078 LEU A O   1 
ATOM   775  C CB  . LEU A 1 109 ? -0.872  14.623 75.377  1.00 20.23 ? 1078 LEU A CB  1 
ATOM   776  C CG  . LEU A 1 109 ? -1.278  15.790 76.272  1.00 19.33 ? 1078 LEU A CG  1 
ATOM   777  C CD1 . LEU A 1 109 ? -1.290  17.084 75.466  1.00 15.79 ? 1078 LEU A CD1 1 
ATOM   778  C CD2 . LEU A 1 109 ? -2.650  15.500 76.876  1.00 15.27 ? 1078 LEU A CD2 1 
ATOM   779  N N   . MET A 1 110 ? 2.193   15.927 75.841  1.00 21.84 ? 1079 MET A N   1 
ATOM   780  C CA  . MET A 1 110 ? 3.294   16.139 76.786  1.00 22.66 ? 1079 MET A CA  1 
ATOM   781  C C   . MET A 1 110 ? 2.853   17.232 77.747  1.00 23.27 ? 1079 MET A C   1 
ATOM   782  O O   . MET A 1 110 ? 3.161   18.413 77.577  1.00 23.12 ? 1079 MET A O   1 
ATOM   783  C CB  . MET A 1 110 ? 4.586   16.556 76.055  1.00 22.28 ? 1079 MET A CB  1 
ATOM   784  C CG  . MET A 1 110 ? 5.170   15.490 75.108  1.00 21.18 ? 1079 MET A CG  1 
ATOM   785  S SD  . MET A 1 110 ? 5.863   14.003 75.909  1.00 20.33 ? 1079 MET A SD  1 
ATOM   786  C CE  . MET A 1 110 ? 7.589   14.398 75.902  1.00 15.69 ? 1079 MET A CE  1 
ATOM   787  N N   . THR A 1 111 ? 2.113   16.800 78.758  1.00 24.65 ? 1080 THR A N   1 
ATOM   788  C CA  . THR A 1 111 ? 1.545   17.665 79.781  1.00 24.71 ? 1080 THR A CA  1 
ATOM   789  C C   . THR A 1 111 ? 2.433   18.771 80.335  1.00 24.70 ? 1080 THR A C   1 
ATOM   790  O O   . THR A 1 111 ? 1.940   19.848 80.660  1.00 23.11 ? 1080 THR A O   1 
ATOM   791  C CB  . THR A 1 111 ? 1.033   16.812 80.959  1.00 24.84 ? 1080 THR A CB  1 
ATOM   792  O OG1 . THR A 1 111 ? 2.110   16.016 81.474  1.00 23.87 ? 1080 THR A OG1 1 
ATOM   793  C CG2 . THR A 1 111 ? -0.107  15.905 80.503  1.00 21.22 ? 1080 THR A CG2 1 
ATOM   794  N N   . ARG A 1 112 ? 3.734   18.509 80.434  1.00 26.27 ? 1081 ARG A N   1 
ATOM   795  C CA  . ARG A 1 112 ? 4.671   19.487 80.988  1.00 27.07 ? 1081 ARG A CA  1 
ATOM   796  C C   . ARG A 1 112 ? 5.352   20.426 79.990  1.00 26.89 ? 1081 ARG A C   1 
ATOM   797  O O   . ARG A 1 112 ? 6.289   21.135 80.353  1.00 27.64 ? 1081 ARG A O   1 
ATOM   798  C CB  . ARG A 1 112 ? 5.724   18.764 81.847  1.00 27.87 ? 1081 ARG A CB  1 
ATOM   799  C CG  . ARG A 1 112 ? 5.087   18.044 83.051  1.00 30.04 ? 1081 ARG A CG  1 
ATOM   800  C CD  . ARG A 1 112 ? 6.077   17.413 84.033  1.00 29.38 ? 1081 ARG A CD  1 
ATOM   801  N NE  . ARG A 1 112 ? 5.370   16.717 85.113  1.00 30.66 ? 1081 ARG A NE  1 
ATOM   802  C CZ  . ARG A 1 112 ? 4.681   17.324 86.082  1.00 32.36 ? 1081 ARG A CZ  1 
ATOM   803  N NH1 . ARG A 1 112 ? 4.066   16.605 87.015  1.00 31.21 ? 1081 ARG A NH1 1 
ATOM   804  N NH2 . ARG A 1 112 ? 4.620   18.650 86.135  1.00 31.87 ? 1081 ARG A NH2 1 
ATOM   805  N N   . GLY A 1 113 ? 4.882   20.427 78.744  1.00 25.44 ? 1082 GLY A N   1 
ATOM   806  C CA  . GLY A 1 113 ? 5.428   21.314 77.726  1.00 25.72 ? 1082 GLY A CA  1 
ATOM   807  C C   . GLY A 1 113 ? 6.898   21.230 77.324  1.00 25.80 ? 1082 GLY A C   1 
ATOM   808  O O   . GLY A 1 113 ? 7.556   20.204 77.524  1.00 24.64 ? 1082 GLY A O   1 
ATOM   809  N N   . ASP A 1 114 ? 7.406   22.323 76.743  1.00 24.59 ? 1083 ASP A N   1 
ATOM   810  C CA  . ASP A 1 114 ? 8.792   22.384 76.291  1.00 24.58 ? 1083 ASP A CA  1 
ATOM   811  C C   . ASP A 1 114 ? 9.781   22.568 77.439  1.00 25.54 ? 1083 ASP A C   1 
ATOM   812  O O   . ASP A 1 114 ? 9.501   23.265 78.427  1.00 23.79 ? 1083 ASP A O   1 
ATOM   813  C CB  . ASP A 1 114 ? 8.978   23.510 75.278  1.00 24.18 ? 1083 ASP A CB  1 
ATOM   814  C CG  . ASP A 1 114 ? 8.781   24.879 75.888  1.00 25.37 ? 1083 ASP A CG  1 
ATOM   815  O OD1 . ASP A 1 114 ? 7.613   25.298 76.047  1.00 26.41 ? 1083 ASP A OD1 1 
ATOM   816  O OD2 . ASP A 1 114 ? 9.797   25.531 76.223  1.00 24.51 ? 1083 ASP A OD2 1 
ATOM   817  N N   . LEU A 1 115 ? 10.948  21.941 77.285  1.00 25.62 ? 1084 LEU A N   1 
ATOM   818  C CA  . LEU A 1 115 ? 12.016  21.971 78.286  1.00 25.06 ? 1084 LEU A CA  1 
ATOM   819  C C   . LEU A 1 115 ? 12.502  23.360 78.698  1.00 24.94 ? 1084 LEU A C   1 
ATOM   820  O O   . LEU A 1 115 ? 12.862  23.572 79.860  1.00 25.10 ? 1084 LEU A O   1 
ATOM   821  C CB  . LEU A 1 115 ? 13.211  21.143 77.797  1.00 23.36 ? 1084 LEU A CB  1 
ATOM   822  C CG  . LEU A 1 115 ? 14.321  20.894 78.825  1.00 24.32 ? 1084 LEU A CG  1 
ATOM   823  C CD1 . LEU A 1 115 ? 13.765  20.138 80.030  1.00 21.44 ? 1084 LEU A CD1 1 
ATOM   824  C CD2 . LEU A 1 115 ? 15.441  20.094 78.170  1.00 23.13 ? 1084 LEU A CD2 1 
ATOM   825  N N   . LYS A 1 116 ? 12.513  24.300 77.756  1.00 25.36 ? 1085 LYS A N   1 
ATOM   826  C CA  . LYS A 1 116 ? 12.974  25.657 78.047  1.00 26.26 ? 1085 LYS A CA  1 
ATOM   827  C C   . LYS A 1 116 ? 12.014  26.396 78.967  1.00 26.43 ? 1085 LYS A C   1 
ATOM   828  O O   . LYS A 1 116 ? 12.440  27.114 79.870  1.00 24.33 ? 1085 LYS A O   1 
ATOM   829  C CB  . LYS A 1 116 ? 13.169  26.447 76.757  1.00 26.90 ? 1085 LYS A CB  1 
ATOM   830  C CG  . LYS A 1 116 ? 13.829  27.788 76.975  1.00 27.63 ? 1085 LYS A CG  1 
ATOM   831  C CD  . LYS A 1 116 ? 14.113  28.476 75.656  1.00 28.13 ? 1085 LYS A CD  1 
ATOM   832  C CE  . LYS A 1 116 ? 14.819  29.788 75.886  1.00 26.80 ? 1085 LYS A CE  1 
ATOM   833  N NZ  . LYS A 1 116 ? 15.263  30.371 74.609  1.00 29.39 ? 1085 LYS A NZ  1 
ATOM   834  N N   . SER A 1 117 ? 10.717  26.221 78.729  1.00 27.34 ? 1086 SER A N   1 
ATOM   835  C CA  . SER A 1 117 ? 9.707   26.847 79.566  1.00 27.63 ? 1086 SER A CA  1 
ATOM   836  C C   . SER A 1 117 ? 9.802   26.169 80.939  1.00 29.29 ? 1086 SER A C   1 
ATOM   837  O O   . SER A 1 117 ? 9.963   26.829 81.980  1.00 29.47 ? 1086 SER A O   1 
ATOM   838  C CB  . SER A 1 117 ? 8.312   26.630 78.964  1.00 28.64 ? 1086 SER A CB  1 
ATOM   839  O OG  . SER A 1 117 ? 8.169   27.265 77.700  1.00 30.71 ? 1086 SER A OG  1 
ATOM   840  N N   . TYR A 1 118 ? 9.715   24.839 80.926  1.00 28.74 ? 1087 TYR A N   1 
ATOM   841  C CA  . TYR A 1 118 ? 9.788   24.057 82.149  1.00 28.24 ? 1087 TYR A CA  1 
ATOM   842  C C   . TYR A 1 118 ? 11.002  24.470 82.976  1.00 31.24 ? 1087 TYR A C   1 
ATOM   843  O O   . TYR A 1 118 ? 10.905  24.657 84.192  1.00 31.43 ? 1087 TYR A O   1 
ATOM   844  C CB  . TYR A 1 118 ? 9.881   22.561 81.824  1.00 24.81 ? 1087 TYR A CB  1 
ATOM   845  C CG  . TYR A 1 118 ? 10.314  21.733 83.013  1.00 22.73 ? 1087 TYR A CG  1 
ATOM   846  C CD1 . TYR A 1 118 ? 9.415   21.379 84.020  1.00 20.26 ? 1087 TYR A CD1 1 
ATOM   847  C CD2 . TYR A 1 118 ? 11.656  21.376 83.174  1.00 22.95 ? 1087 TYR A CD2 1 
ATOM   848  C CE1 . TYR A 1 118 ? 9.840   20.696 85.156  1.00 19.68 ? 1087 TYR A CE1 1 
ATOM   849  C CE2 . TYR A 1 118 ? 12.091  20.699 84.303  1.00 21.16 ? 1087 TYR A CE2 1 
ATOM   850  C CZ  . TYR A 1 118 ? 11.184  20.362 85.286  1.00 21.33 ? 1087 TYR A CZ  1 
ATOM   851  O OH  . TYR A 1 118 ? 11.647  19.690 86.386  1.00 21.11 ? 1087 TYR A OH  1 
ATOM   852  N N   . LEU A 1 119 ? 12.152  24.588 82.317  1.00 32.10 ? 1088 LEU A N   1 
ATOM   853  C CA  . LEU A 1 119 ? 13.369  24.965 83.014  1.00 33.26 ? 1088 LEU A CA  1 
ATOM   854  C C   . LEU A 1 119 ? 13.264  26.358 83.624  1.00 34.60 ? 1088 LEU A C   1 
ATOM   855  O O   . LEU A 1 119 ? 13.502  26.532 84.812  1.00 35.30 ? 1088 LEU A O   1 
ATOM   856  C CB  . LEU A 1 119 ? 14.564  24.909 82.063  1.00 32.97 ? 1088 LEU A CB  1 
ATOM   857  C CG  . LEU A 1 119 ? 15.018  23.514 81.648  1.00 32.13 ? 1088 LEU A CG  1 
ATOM   858  C CD1 . LEU A 1 119 ? 15.927  23.603 80.431  1.00 31.63 ? 1088 LEU A CD1 1 
ATOM   859  C CD2 . LEU A 1 119 ? 15.716  22.856 82.812  1.00 30.18 ? 1088 LEU A CD2 1 
ATOM   860  N N   . ARG A 1 120 ? 12.909  27.351 82.818  1.00 35.28 ? 1089 ARG A N   1 
ATOM   861  C CA  . ARG A 1 120 ? 12.805  28.705 83.335  1.00 36.08 ? 1089 ARG A CA  1 
ATOM   862  C C   . ARG A 1 120 ? 11.773  28.814 84.440  1.00 36.86 ? 1089 ARG A C   1 
ATOM   863  O O   . ARG A 1 120 ? 11.876  29.680 85.308  1.00 37.45 ? 1089 ARG A O   1 
ATOM   864  C CB  . ARG A 1 120 ? 12.483  29.688 82.212  1.00 36.22 ? 1089 ARG A CB  1 
ATOM   865  C CG  . ARG A 1 120 ? 13.658  29.922 81.277  1.00 37.25 ? 1089 ARG A CG  1 
ATOM   866  C CD  . ARG A 1 120 ? 13.343  30.939 80.200  1.00 37.75 ? 1089 ARG A CD  1 
ATOM   867  N NE  . ARG A 1 120 ? 14.539  31.323 79.455  1.00 38.24 ? 1089 ARG A NE  1 
ATOM   868  C CZ  . ARG A 1 120 ? 14.556  32.256 78.509  1.00 38.48 ? 1089 ARG A CZ  1 
ATOM   869  N NH1 . ARG A 1 120 ? 13.441  32.901 78.191  1.00 37.50 ? 1089 ARG A NH1 1 
ATOM   870  N NH2 . ARG A 1 120 ? 15.688  32.540 77.877  1.00 39.12 ? 1089 ARG A NH2 1 
ATOM   871  N N   . SER A 1 121 ? 10.782  27.934 84.427  1.00 37.23 ? 1090 SER A N   1 
ATOM   872  C CA  . SER A 1 121 ? 9.767   27.980 85.471  1.00 38.64 ? 1090 SER A CA  1 
ATOM   873  C C   . SER A 1 121 ? 10.335  27.547 86.834  1.00 38.07 ? 1090 SER A C   1 
ATOM   874  O O   . SER A 1 121 ? 9.697   27.739 87.870  1.00 38.83 ? 1090 SER A O   1 
ATOM   875  C CB  . SER A 1 121 ? 8.563   27.109 85.088  1.00 39.57 ? 1090 SER A CB  1 
ATOM   876  O OG  . SER A 1 121 ? 8.914   25.742 84.958  1.00 41.77 ? 1090 SER A OG  1 
ATOM   877  N N   . LEU A 1 122 ? 11.534  26.971 86.828  1.00 36.74 ? 1091 LEU A N   1 
ATOM   878  C CA  . LEU A 1 122 ? 12.194  26.532 88.058  1.00 36.48 ? 1091 LEU A CA  1 
ATOM   879  C C   . LEU A 1 122 ? 12.994  27.667 88.692  1.00 37.57 ? 1091 LEU A C   1 
ATOM   880  O O   . LEU A 1 122 ? 13.308  27.625 89.878  1.00 36.58 ? 1091 LEU A O   1 
ATOM   881  C CB  . LEU A 1 122 ? 13.134  25.354 87.774  1.00 34.17 ? 1091 LEU A CB  1 
ATOM   882  C CG  . LEU A 1 122 ? 12.613  23.915 87.848  1.00 33.11 ? 1091 LEU A CG  1 
ATOM   883  C CD1 . LEU A 1 122 ? 11.106  23.852 87.702  1.00 32.06 ? 1091 LEU A CD1 1 
ATOM   884  C CD2 . LEU A 1 122 ? 13.299  23.109 86.764  1.00 31.94 ? 1091 LEU A CD2 1 
ATOM   885  N N   . ARG A 1 123 ? 13.327  28.678 87.896  1.00 39.74 ? 1092 ARG A N   1 
ATOM   886  C CA  . ARG A 1 123 ? 14.079  29.817 88.400  1.00 42.05 ? 1092 ARG A CA  1 
ATOM   887  C C   . ARG A 1 123 ? 13.412  30.414 89.638  1.00 44.57 ? 1092 ARG A C   1 
ATOM   888  O O   . ARG A 1 123 ? 14.006  30.445 90.719  1.00 44.96 ? 1092 ARG A O   1 
ATOM   889  C CB  . ARG A 1 123 ? 14.222  30.880 87.307  1.00 41.41 ? 1092 ARG A CB  1 
ATOM   890  C CG  . ARG A 1 123 ? 15.463  30.709 86.456  1.00 43.71 ? 1092 ARG A CG  1 
ATOM   891  C CD  . ARG A 1 123 ? 16.698  31.079 87.265  1.00 46.02 ? 1092 ARG A CD  1 
ATOM   892  N NE  . ARG A 1 123 ? 17.903  30.364 86.847  1.00 46.90 ? 1092 ARG A NE  1 
ATOM   893  C CZ  . ARG A 1 123 ? 19.114  30.599 87.344  1.00 46.20 ? 1092 ARG A CZ  1 
ATOM   894  N NH1 . ARG A 1 123 ? 20.159  29.902 86.920  1.00 45.25 ? 1092 ARG A NH1 1 
ATOM   895  N NH2 . ARG A 1 123 ? 19.282  31.547 88.256  1.00 45.78 ? 1092 ARG A NH2 1 
ATOM   896  N N   . PRO A 1 124 ? 12.158  30.878 89.505  1.00 46.68 ? 1093 PRO A N   1 
ATOM   897  C CA  . PRO A 1 124 ? 11.455  31.468 90.652  1.00 48.47 ? 1093 PRO A CA  1 
ATOM   898  C C   . PRO A 1 124 ? 11.332  30.516 91.844  1.00 50.47 ? 1093 PRO A C   1 
ATOM   899  O O   . PRO A 1 124 ? 11.703  30.933 92.969  1.00 51.14 ? 1093 PRO A O   1 
ATOM   900  C CB  . PRO A 1 124 ? 10.098  31.852 90.063  1.00 48.26 ? 1093 PRO A CB  1 
ATOM   901  C CG  . PRO A 1 124 ? 9.894   30.815 88.996  1.00 47.81 ? 1093 PRO A CG  1 
ATOM   902  C CD  . PRO A 1 124 ? 11.253  30.745 88.347  1.00 46.73 ? 1093 PRO A CD  1 
ATOM   903  N N   . VAL A 1 131 ? 14.763  25.881 100.932 1.00 39.45 ? 1100 VAL A N   1 
ATOM   904  C CA  . VAL A 1 131 ? 13.993  24.607 100.910 1.00 39.92 ? 1100 VAL A CA  1 
ATOM   905  C C   . VAL A 1 131 ? 14.136  23.927 99.552  1.00 40.64 ? 1100 VAL A C   1 
ATOM   906  O O   . VAL A 1 131 ? 14.887  22.966 99.415  1.00 41.62 ? 1100 VAL A O   1 
ATOM   907  C CB  . VAL A 1 131 ? 12.505  24.867 101.195 1.00 40.69 ? 1100 VAL A CB  1 
ATOM   908  C CG1 . VAL A 1 131 ? 11.788  23.563 101.487 1.00 40.48 ? 1100 VAL A CG1 1 
ATOM   909  C CG2 . VAL A 1 131 ? 12.371  25.813 102.366 1.00 41.74 ? 1100 VAL A CG2 1 
ATOM   910  N N   . LEU A 1 132 ? 13.410  24.418 98.550  1.00 41.83 ? 1101 LEU A N   1 
ATOM   911  C CA  . LEU A 1 132 ? 13.486  23.857 97.194  1.00 42.50 ? 1101 LEU A CA  1 
ATOM   912  C C   . LEU A 1 132 ? 14.861  24.122 96.587  1.00 41.53 ? 1101 LEU A C   1 
ATOM   913  O O   . LEU A 1 132 ? 15.372  25.238 96.669  1.00 41.76 ? 1101 LEU A O   1 
ATOM   914  C CB  . LEU A 1 132 ? 12.422  24.491 96.288  1.00 42.95 ? 1101 LEU A CB  1 
ATOM   915  C CG  . LEU A 1 132 ? 10.960  24.054 96.410  1.00 44.02 ? 1101 LEU A CG  1 
ATOM   916  C CD1 . LEU A 1 132 ? 10.073  25.075 95.706  1.00 43.58 ? 1101 LEU A CD1 1 
ATOM   917  C CD2 . LEU A 1 132 ? 10.777  22.664 95.806  1.00 43.30 ? 1101 LEU A CD2 1 
ATOM   918  N N   . ALA A 1 133 ? 15.458  23.109 95.970  1.00 41.03 ? 1102 ALA A N   1 
ATOM   919  C CA  . ALA A 1 133 ? 16.772  23.288 95.363  1.00 41.27 ? 1102 ALA A CA  1 
ATOM   920  C C   . ALA A 1 133 ? 16.715  23.048 93.859  1.00 41.85 ? 1102 ALA A C   1 
ATOM   921  O O   . ALA A 1 133 ? 15.798  22.395 93.371  1.00 43.78 ? 1102 ALA A O   1 
ATOM   922  C CB  . ALA A 1 133 ? 17.767  22.351 96.003  1.00 40.47 ? 1102 ALA A CB  1 
ATOM   923  N N   . PRO A 1 134 ? 17.695  23.579 93.103  1.00 41.93 ? 1103 PRO A N   1 
ATOM   924  C CA  . PRO A 1 134 ? 17.734  23.406 91.648  1.00 40.34 ? 1103 PRO A CA  1 
ATOM   925  C C   . PRO A 1 134 ? 17.992  21.948 91.275  1.00 38.56 ? 1103 PRO A C   1 
ATOM   926  O O   . PRO A 1 134 ? 18.446  21.164 92.108  1.00 37.77 ? 1103 PRO A O   1 
ATOM   927  C CB  . PRO A 1 134 ? 18.882  24.318 91.230  1.00 40.90 ? 1103 PRO A CB  1 
ATOM   928  C CG  . PRO A 1 134 ? 19.834  24.165 92.375  1.00 41.36 ? 1103 PRO A CG  1 
ATOM   929  C CD  . PRO A 1 134 ? 18.900  24.296 93.567  1.00 42.64 ? 1103 PRO A CD  1 
ATOM   930  N N   . PRO A 1 135 ? 17.724  21.577 90.011  1.00 37.37 ? 1104 PRO A N   1 
ATOM   931  C CA  . PRO A 1 135 ? 17.910  20.218 89.485  1.00 35.84 ? 1104 PRO A CA  1 
ATOM   932  C C   . PRO A 1 135 ? 19.258  19.552 89.819  1.00 33.43 ? 1104 PRO A C   1 
ATOM   933  O O   . PRO A 1 135 ? 20.330  20.135 89.630  1.00 32.74 ? 1104 PRO A O   1 
ATOM   934  C CB  . PRO A 1 135 ? 17.704  20.403 87.978  1.00 36.62 ? 1104 PRO A CB  1 
ATOM   935  C CG  . PRO A 1 135 ? 16.731  21.519 87.914  1.00 36.57 ? 1104 PRO A CG  1 
ATOM   936  C CD  . PRO A 1 135 ? 17.271  22.485 88.939  1.00 37.54 ? 1104 PRO A CD  1 
ATOM   937  N N   . SER A 1 136 ? 19.173  18.315 90.303  1.00 31.07 ? 1105 SER A N   1 
ATOM   938  C CA  . SER A 1 136 ? 20.334  17.523 90.684  1.00 28.78 ? 1105 SER A CA  1 
ATOM   939  C C   . SER A 1 136 ? 21.022  16.900 89.476  1.00 28.64 ? 1105 SER A C   1 
ATOM   940  O O   . SER A 1 136 ? 20.377  16.582 88.473  1.00 27.94 ? 1105 SER A O   1 
ATOM   941  C CB  . SER A 1 136 ? 19.911  16.398 91.617  1.00 27.57 ? 1105 SER A CB  1 
ATOM   942  O OG  . SER A 1 136 ? 19.133  15.445 90.914  1.00 25.06 ? 1105 SER A OG  1 
ATOM   943  N N   . LEU A 1 137 ? 22.335  16.712 89.598  1.00 28.21 ? 1106 LEU A N   1 
ATOM   944  C CA  . LEU A 1 137 ? 23.142  16.109 88.544  1.00 26.92 ? 1106 LEU A CA  1 
ATOM   945  C C   . LEU A 1 137 ? 22.497  14.816 88.043  1.00 26.13 ? 1106 LEU A C   1 
ATOM   946  O O   . LEU A 1 137 ? 22.511  14.527 86.844  1.00 26.32 ? 1106 LEU A O   1 
ATOM   947  C CB  . LEU A 1 137 ? 24.558  15.813 89.063  1.00 25.21 ? 1106 LEU A CB  1 
ATOM   948  C CG  . LEU A 1 137 ? 25.407  14.936 88.134  1.00 23.76 ? 1106 LEU A CG  1 
ATOM   949  C CD1 . LEU A 1 137 ? 25.485  15.564 86.738  1.00 20.42 ? 1106 LEU A CD1 1 
ATOM   950  C CD2 . LEU A 1 137 ? 26.794  14.767 88.725  1.00 22.04 ? 1106 LEU A CD2 1 
ATOM   951  N N   . SER A 1 138 ? 21.937  14.041 88.966  1.00 24.87 ? 1107 SER A N   1 
ATOM   952  C CA  . SER A 1 138 ? 21.283  12.792 88.606  1.00 24.99 ? 1107 SER A CA  1 
ATOM   953  C C   . SER A 1 138 ? 20.109  13.033 87.664  1.00 23.57 ? 1107 SER A C   1 
ATOM   954  O O   . SER A 1 138 ? 19.908  12.293 86.704  1.00 23.41 ? 1107 SER A O   1 
ATOM   955  C CB  . SER A 1 138 ? 20.785  12.068 89.850  1.00 24.88 ? 1107 SER A CB  1 
ATOM   956  O OG  . SER A 1 138 ? 19.977  10.969 89.469  1.00 27.50 ? 1107 SER A OG  1 
ATOM   957  N N   . LYS A 1 139 ? 19.336  14.072 87.953  1.00 23.68 ? 1108 LYS A N   1 
ATOM   958  C CA  . LYS A 1 139 ? 18.189  14.423 87.133  1.00 23.24 ? 1108 LYS A CA  1 
ATOM   959  C C   . LYS A 1 139 ? 18.645  15.019 85.799  1.00 23.23 ? 1108 LYS A C   1 
ATOM   960  O O   . LYS A 1 139 ? 18.015  14.810 84.751  1.00 21.02 ? 1108 LYS A O   1 
ATOM   961  C CB  . LYS A 1 139 ? 17.299  15.404 87.894  1.00 22.34 ? 1108 LYS A CB  1 
ATOM   962  C CG  . LYS A 1 139 ? 16.606  14.777 89.089  1.00 22.52 ? 1108 LYS A CG  1 
ATOM   963  C CD  . LYS A 1 139 ? 15.576  15.715 89.698  1.00 23.29 ? 1108 LYS A CD  1 
ATOM   964  C CE  . LYS A 1 139 ? 14.668  14.970 90.662  1.00 22.09 ? 1108 LYS A CE  1 
ATOM   965  N NZ  . LYS A 1 139 ? 13.601  15.837 91.225  1.00 20.39 ? 1108 LYS A NZ  1 
ATOM   966  N N   . MET A 1 140 ? 19.751  15.756 85.837  1.00 22.73 ? 1109 MET A N   1 
ATOM   967  C CA  . MET A 1 140 ? 20.277  16.347 84.620  1.00 23.14 ? 1109 MET A CA  1 
ATOM   968  C C   . MET A 1 140 ? 20.800  15.257 83.706  1.00 22.99 ? 1109 MET A C   1 
ATOM   969  O O   . MET A 1 140 ? 20.427  15.202 82.537  1.00 23.54 ? 1109 MET A O   1 
ATOM   970  C CB  . MET A 1 140 ? 21.367  17.360 84.946  1.00 21.67 ? 1109 MET A CB  1 
ATOM   971  C CG  . MET A 1 140 ? 20.807  18.503 85.748  1.00 23.28 ? 1109 MET A CG  1 
ATOM   972  S SD  . MET A 1 140 ? 21.717  20.025 85.590  1.00 27.62 ? 1109 MET A SD  1 
ATOM   973  C CE  . MET A 1 140 ? 22.822  19.879 87.050  1.00 24.46 ? 1109 MET A CE  1 
ATOM   974  N N   . ILE A 1 141 ? 21.653  14.386 84.240  1.00 21.77 ? 1110 ILE A N   1 
ATOM   975  C CA  . ILE A 1 141 ? 22.199  13.285 83.460  1.00 20.63 ? 1110 ILE A CA  1 
ATOM   976  C C   . ILE A 1 141 ? 21.039  12.541 82.780  1.00 20.91 ? 1110 ILE A C   1 
ATOM   977  O O   . ILE A 1 141 ? 21.140  12.097 81.625  1.00 16.22 ? 1110 ILE A O   1 
ATOM   978  C CB  . ILE A 1 141 ? 22.978  12.313 84.369  1.00 21.06 ? 1110 ILE A CB  1 
ATOM   979  C CG1 . ILE A 1 141 ? 24.269  12.977 84.847  1.00 21.90 ? 1110 ILE A CG1 1 
ATOM   980  C CG2 . ILE A 1 141 ? 23.288  11.022 83.620  1.00 21.26 ? 1110 ILE A CG2 1 
ATOM   981  C CD1 . ILE A 1 141 ? 25.060  12.158 85.876  1.00 18.79 ? 1110 ILE A CD1 1 
ATOM   982  N N   . GLN A 1 142 ? 19.936  12.424 83.519  1.00 22.35 ? 1111 GLN A N   1 
ATOM   983  C CA  . GLN A 1 142 ? 18.725  11.759 83.050  1.00 23.15 ? 1111 GLN A CA  1 
ATOM   984  C C   . GLN A 1 142 ? 18.240  12.449 81.781  1.00 23.85 ? 1111 GLN A C   1 
ATOM   985  O O   . GLN A 1 142 ? 18.102  11.812 80.735  1.00 23.89 ? 1111 GLN A O   1 
ATOM   986  C CB  . GLN A 1 142 ? 17.647  11.832 84.135  1.00 24.59 ? 1111 GLN A CB  1 
ATOM   987  C CG  . GLN A 1 142 ? 16.767  10.613 84.183  1.00 29.61 ? 1111 GLN A CG  1 
ATOM   988  C CD  . GLN A 1 142 ? 17.591  9.339  84.272  1.00 34.11 ? 1111 GLN A CD  1 
ATOM   989  O OE1 . GLN A 1 142 ? 18.342  9.130  85.241  1.00 32.10 ? 1111 GLN A OE1 1 
ATOM   990  N NE2 . GLN A 1 142 ? 17.466  8.478  83.254  1.00 33.72 ? 1111 GLN A NE2 1 
ATOM   991  N N   . MET A 1 143 ? 17.987  13.757 81.877  1.00 24.78 ? 1112 MET A N   1 
ATOM   992  C CA  . MET A 1 143 ? 17.543  14.541 80.724  1.00 24.52 ? 1112 MET A CA  1 
ATOM   993  C C   . MET A 1 143 ? 18.581  14.470 79.598  1.00 22.55 ? 1112 MET A C   1 
ATOM   994  O O   . MET A 1 143 ? 18.235  14.272 78.439  1.00 22.21 ? 1112 MET A O   1 
ATOM   995  C CB  . MET A 1 143 ? 17.299  15.998 81.130  1.00 25.18 ? 1112 MET A CB  1 
ATOM   996  C CG  . MET A 1 143 ? 16.151  16.168 82.113  1.00 29.12 ? 1112 MET A CG  1 
ATOM   997  S SD  . MET A 1 143 ? 15.824  17.873 82.624  1.00 33.48 ? 1112 MET A SD  1 
ATOM   998  C CE  . MET A 1 143 ? 17.091  18.087 83.890  1.00 30.75 ? 1112 MET A CE  1 
ATOM   999  N N   . ALA A 1 144 ? 19.851  14.620 79.948  1.00 20.44 ? 1113 ALA A N   1 
ATOM   1000 C CA  . ALA A 1 144 ? 20.916  14.555 78.964  1.00 20.99 ? 1113 ALA A CA  1 
ATOM   1001 C C   . ALA A 1 144 ? 20.870  13.211 78.238  1.00 21.13 ? 1113 ALA A C   1 
ATOM   1002 O O   . ALA A 1 144 ? 20.853  13.160 77.009  1.00 22.94 ? 1113 ALA A O   1 
ATOM   1003 C CB  . ALA A 1 144 ? 22.265  14.737 79.647  1.00 21.04 ? 1113 ALA A CB  1 
ATOM   1004 N N   . GLY A 1 145 ? 20.850  12.125 79.005  1.00 20.06 ? 1114 GLY A N   1 
ATOM   1005 C CA  . GLY A 1 145 ? 20.807  10.803 78.411  1.00 17.74 ? 1114 GLY A CA  1 
ATOM   1006 C C   . GLY A 1 145 ? 19.548  10.579 77.604  1.00 18.24 ? 1114 GLY A C   1 
ATOM   1007 O O   . GLY A 1 145 ? 19.600  10.031 76.506  1.00 17.97 ? 1114 GLY A O   1 
ATOM   1008 N N   . GLU A 1 146 ? 18.409  11.010 78.136  1.00 19.41 ? 1115 GLU A N   1 
ATOM   1009 C CA  . GLU A 1 146 ? 17.143  10.846 77.430  1.00 19.96 ? 1115 GLU A CA  1 
ATOM   1010 C C   . GLU A 1 146 ? 17.080  11.619 76.114  1.00 19.82 ? 1115 GLU A C   1 
ATOM   1011 O O   . GLU A 1 146 ? 16.489  11.156 75.147  1.00 20.05 ? 1115 GLU A O   1 
ATOM   1012 C CB  . GLU A 1 146 ? 15.990  11.264 78.330  1.00 21.64 ? 1115 GLU A CB  1 
ATOM   1013 C CG  . GLU A 1 146 ? 15.717  10.289 79.439  1.00 24.33 ? 1115 GLU A CG  1 
ATOM   1014 C CD  . GLU A 1 146 ? 14.560  10.717 80.308  1.00 27.78 ? 1115 GLU A CD  1 
ATOM   1015 O OE1 . GLU A 1 146 ? 14.260  10.007 81.289  1.00 29.39 ? 1115 GLU A OE1 1 
ATOM   1016 O OE2 . GLU A 1 146 ? 13.951  11.768 80.013  1.00 31.67 ? 1115 GLU A OE2 1 
ATOM   1017 N N   . ILE A 1 147 ? 17.684  12.803 76.087  1.00 21.37 ? 1116 ILE A N   1 
ATOM   1018 C CA  . ILE A 1 147 ? 17.720  13.631 74.886  1.00 21.00 ? 1116 ILE A CA  1 
ATOM   1019 C C   . ILE A 1 147 ? 18.720  13.030 73.903  1.00 22.62 ? 1116 ILE A C   1 
ATOM   1020 O O   . ILE A 1 147 ? 18.467  12.968 72.699  1.00 21.95 ? 1116 ILE A O   1 
ATOM   1021 C CB  . ILE A 1 147 ? 18.181  15.070 75.200  1.00 19.70 ? 1116 ILE A CB  1 
ATOM   1022 C CG1 . ILE A 1 147 ? 17.203  15.740 76.165  1.00 17.87 ? 1116 ILE A CG1 1 
ATOM   1023 C CG2 . ILE A 1 147 ? 18.284  15.869 73.908  1.00 18.69 ? 1116 ILE A CG2 1 
ATOM   1024 C CD1 . ILE A 1 147 ? 17.650  17.101 76.612  1.00 16.04 ? 1116 ILE A CD1 1 
ATOM   1025 N N   . ALA A 1 148 ? 19.868  12.599 74.420  1.00 23.15 ? 1117 ALA A N   1 
ATOM   1026 C CA  . ALA A 1 148 ? 20.896  12.003 73.569  1.00 24.03 ? 1117 ALA A CA  1 
ATOM   1027 C C   . ALA A 1 148 ? 20.350  10.739 72.924  1.00 24.44 ? 1117 ALA A C   1 
ATOM   1028 O O   . ALA A 1 148 ? 20.759  10.360 71.825  1.00 26.13 ? 1117 ALA A O   1 
ATOM   1029 C CB  . ALA A 1 148 ? 22.143  11.677 74.392  1.00 22.06 ? 1117 ALA A CB  1 
ATOM   1030 N N   . ASP A 1 149 ? 19.420  10.088 73.617  1.00 24.14 ? 1118 ASP A N   1 
ATOM   1031 C CA  . ASP A 1 149 ? 18.836  8.868  73.109  1.00 23.40 ? 1118 ASP A CA  1 
ATOM   1032 C C   . ASP A 1 149 ? 17.953  9.123  71.902  1.00 22.63 ? 1118 ASP A C   1 
ATOM   1033 O O   . ASP A 1 149 ? 18.020  8.384  70.930  1.00 24.07 ? 1118 ASP A O   1 
ATOM   1034 C CB  . ASP A 1 149 ? 18.024  8.162  74.186  1.00 23.20 ? 1118 ASP A CB  1 
ATOM   1035 C CG  . ASP A 1 149 ? 17.769  6.720  73.838  1.00 23.51 ? 1118 ASP A CG  1 
ATOM   1036 O OD1 . ASP A 1 149 ? 18.734  5.937  73.888  1.00 23.71 ? 1118 ASP A OD1 1 
ATOM   1037 O OD2 . ASP A 1 149 ? 16.622  6.370  73.489  1.00 26.63 ? 1118 ASP A OD2 1 
ATOM   1038 N N   . GLY A 1 150 ? 17.113  10.150 71.969  1.00 22.17 ? 1119 GLY A N   1 
ATOM   1039 C CA  . GLY A 1 150 ? 16.257  10.472 70.837  1.00 22.92 ? 1119 GLY A CA  1 
ATOM   1040 C C   . GLY A 1 150 ? 17.094  10.851 69.618  1.00 23.31 ? 1119 GLY A C   1 
ATOM   1041 O O   . GLY A 1 150 ? 16.905  10.324 68.520  1.00 22.64 ? 1119 GLY A O   1 
ATOM   1042 N N   . MET A 1 151 ? 18.040  11.762 69.813  1.00 23.19 ? 1120 MET A N   1 
ATOM   1043 C CA  . MET A 1 151 ? 18.907  12.192 68.726  1.00 23.66 ? 1120 MET A CA  1 
ATOM   1044 C C   . MET A 1 151 ? 19.699  11.037 68.147  1.00 23.62 ? 1120 MET A C   1 
ATOM   1045 O O   . MET A 1 151 ? 19.867  10.956 66.939  1.00 24.04 ? 1120 MET A O   1 
ATOM   1046 C CB  . MET A 1 151 ? 19.853  13.288 69.207  1.00 23.35 ? 1120 MET A CB  1 
ATOM   1047 C CG  . MET A 1 151 ? 19.127  14.568 69.548  1.00 22.12 ? 1120 MET A CG  1 
ATOM   1048 S SD  . MET A 1 151 ? 17.997  14.954 68.199  1.00 25.40 ? 1120 MET A SD  1 
ATOM   1049 C CE  . MET A 1 151 ? 19.169  15.158 66.800  1.00 16.99 ? 1120 MET A CE  1 
ATOM   1050 N N   . ALA A 1 152 ? 20.189  10.145 69.000  1.00 24.26 ? 1121 ALA A N   1 
ATOM   1051 C CA  . ALA A 1 152 ? 20.948  8.993  68.517  1.00 25.05 ? 1121 ALA A CA  1 
ATOM   1052 C C   . ALA A 1 152 ? 20.025  8.135  67.650  1.00 25.70 ? 1121 ALA A C   1 
ATOM   1053 O O   . ALA A 1 152 ? 20.439  7.606  66.617  1.00 26.47 ? 1121 ALA A O   1 
ATOM   1054 C CB  . ALA A 1 152 ? 21.484  8.179  69.688  1.00 25.33 ? 1121 ALA A CB  1 
ATOM   1055 N N   . TYR A 1 153 ? 18.770  8.006  68.064  1.00 24.85 ? 1122 TYR A N   1 
ATOM   1056 C CA  . TYR A 1 153 ? 17.811  7.227  67.291  1.00 26.22 ? 1122 TYR A CA  1 
ATOM   1057 C C   . TYR A 1 153 ? 17.593  7.875  65.913  1.00 25.91 ? 1122 TYR A C   1 
ATOM   1058 O O   . TYR A 1 153 ? 17.703  7.221  64.884  1.00 26.94 ? 1122 TYR A O   1 
ATOM   1059 C CB  . TYR A 1 153 ? 16.475  7.132  68.036  1.00 25.59 ? 1122 TYR A CB  1 
ATOM   1060 C CG  . TYR A 1 153 ? 15.360  6.552  67.199  1.00 24.64 ? 1122 TYR A CG  1 
ATOM   1061 C CD1 . TYR A 1 153 ? 15.237  5.180  67.016  1.00 25.21 ? 1122 TYR A CD1 1 
ATOM   1062 C CD2 . TYR A 1 153 ? 14.453  7.384  66.552  1.00 25.26 ? 1122 TYR A CD2 1 
ATOM   1063 C CE1 . TYR A 1 153 ? 14.237  4.651  66.205  1.00 24.18 ? 1122 TYR A CE1 1 
ATOM   1064 C CE2 . TYR A 1 153 ? 13.455  6.867  65.743  1.00 25.29 ? 1122 TYR A CE2 1 
ATOM   1065 C CZ  . TYR A 1 153 ? 13.352  5.501  65.573  1.00 24.62 ? 1122 TYR A CZ  1 
ATOM   1066 O OH  . TYR A 1 153 ? 12.360  4.999  64.765  1.00 26.21 ? 1122 TYR A OH  1 
ATOM   1067 N N   . LEU A 1 154 ? 17.275  9.165  65.905  1.00 26.53 ? 1123 LEU A N   1 
ATOM   1068 C CA  . LEU A 1 154 ? 17.052  9.893  64.663  1.00 25.47 ? 1123 LEU A CA  1 
ATOM   1069 C C   . LEU A 1 154 ? 18.272  9.841  63.748  1.00 25.94 ? 1123 LEU A C   1 
ATOM   1070 O O   . LEU A 1 154 ? 18.146  9.517  62.568  1.00 27.48 ? 1123 LEU A O   1 
ATOM   1071 C CB  . LEU A 1 154 ? 16.690  11.340 64.972  1.00 23.76 ? 1123 LEU A CB  1 
ATOM   1072 C CG  . LEU A 1 154 ? 15.349  11.453 65.680  1.00 23.62 ? 1123 LEU A CG  1 
ATOM   1073 C CD1 . LEU A 1 154 ? 15.213  12.800 66.325  1.00 26.12 ? 1123 LEU A CD1 1 
ATOM   1074 C CD2 . LEU A 1 154 ? 14.249  11.209 64.689  1.00 23.87 ? 1123 LEU A CD2 1 
ATOM   1075 N N   . ASN A 1 155 ? 19.449  10.159 64.280  1.00 26.10 ? 1124 ASN A N   1 
ATOM   1076 C CA  . ASN A 1 155 ? 20.662  10.110 63.471  1.00 26.36 ? 1124 ASN A CA  1 
ATOM   1077 C C   . ASN A 1 155 ? 20.824  8.709  62.889  1.00 26.61 ? 1124 ASN A C   1 
ATOM   1078 O O   . ASN A 1 155 ? 21.234  8.559  61.741  1.00 27.74 ? 1124 ASN A O   1 
ATOM   1079 C CB  . ASN A 1 155 ? 21.904  10.464 64.300  1.00 24.87 ? 1124 ASN A CB  1 
ATOM   1080 C CG  . ASN A 1 155 ? 21.993  11.951 64.639  1.00 25.65 ? 1124 ASN A CG  1 
ATOM   1081 O OD1 . ASN A 1 155 ? 22.980  12.398 65.239  1.00 23.47 ? 1124 ASN A OD1 1 
ATOM   1082 N ND2 . ASN A 1 155 ? 20.964  12.722 64.263  1.00 21.12 ? 1124 ASN A ND2 1 
ATOM   1083 N N   . ALA A 1 156 ? 20.494  7.687  63.677  1.00 26.15 ? 1125 ALA A N   1 
ATOM   1084 C CA  . ALA A 1 156 ? 20.606  6.307  63.207  1.00 26.35 ? 1125 ALA A CA  1 
ATOM   1085 C C   . ALA A 1 156 ? 19.729  6.129  61.982  1.00 27.84 ? 1125 ALA A C   1 
ATOM   1086 O O   . ALA A 1 156 ? 20.116  5.467  61.025  1.00 29.29 ? 1125 ALA A O   1 
ATOM   1087 C CB  . ALA A 1 156 ? 20.191  5.338  64.291  1.00 26.26 ? 1125 ALA A CB  1 
ATOM   1088 N N   . ASN A 1 157 ? 18.543  6.724  62.006  1.00 28.30 ? 1126 ASN A N   1 
ATOM   1089 C CA  . ASN A 1 157 ? 17.648  6.635  60.860  1.00 29.22 ? 1126 ASN A CA  1 
ATOM   1090 C C   . ASN A 1 157 ? 18.024  7.657  59.779  1.00 27.82 ? 1126 ASN A C   1 
ATOM   1091 O O   . ASN A 1 157 ? 17.218  7.999  58.916  1.00 27.17 ? 1126 ASN A O   1 
ATOM   1092 C CB  . ASN A 1 157 ? 16.201  6.835  61.309  1.00 31.10 ? 1126 ASN A CB  1 
ATOM   1093 C CG  . ASN A 1 157 ? 15.704  5.693  62.161  1.00 33.41 ? 1126 ASN A CG  1 
ATOM   1094 O OD1 . ASN A 1 157 ? 15.454  4.600  61.659  1.00 34.69 ? 1126 ASN A OD1 1 
ATOM   1095 N ND2 . ASN A 1 157 ? 15.573  5.933  63.462  1.00 34.39 ? 1126 ASN A ND2 1 
ATOM   1096 N N   . LYS A 1 158 ? 19.263  8.131  59.833  1.00 26.07 ? 1127 LYS A N   1 
ATOM   1097 C CA  . LYS A 1 158 ? 19.762  9.093  58.862  1.00 27.46 ? 1127 LYS A CA  1 
ATOM   1098 C C   . LYS A 1 158 ? 19.017  10.425 58.925  1.00 27.60 ? 1127 LYS A C   1 
ATOM   1099 O O   . LYS A 1 158 ? 18.730  11.018 57.883  1.00 27.51 ? 1127 LYS A O   1 
ATOM   1100 C CB  . LYS A 1 158 ? 19.645  8.525  57.443  1.00 26.41 ? 1127 LYS A CB  1 
ATOM   1101 C CG  . LYS A 1 158 ? 19.886  7.023  57.330  1.00 28.61 ? 1127 LYS A CG  1 
ATOM   1102 C CD  . LYS A 1 158 ? 21.271  6.617  57.793  1.00 30.85 ? 1127 LYS A CD  1 
ATOM   1103 C CE  . LYS A 1 158 ? 22.338  7.038  56.800  1.00 34.56 ? 1127 LYS A CE  1 
ATOM   1104 N NZ  . LYS A 1 158 ? 22.167  6.373  55.468  1.00 36.55 ? 1127 LYS A NZ  1 
ATOM   1105 N N   . PHE A 1 159 ? 18.714  10.898 60.136  1.00 26.85 ? 1128 PHE A N   1 
ATOM   1106 C CA  . PHE A 1 159 ? 17.997  12.166 60.310  1.00 26.73 ? 1128 PHE A CA  1 
ATOM   1107 C C   . PHE A 1 159 ? 18.683  13.167 61.228  1.00 25.26 ? 1128 PHE A C   1 
ATOM   1108 O O   . PHE A 1 159 ? 18.945  12.867 62.391  1.00 26.26 ? 1128 PHE A O   1 
ATOM   1109 C CB  . PHE A 1 159 ? 16.593  11.938 60.885  1.00 28.00 ? 1128 PHE A CB  1 
ATOM   1110 C CG  . PHE A 1 159 ? 15.569  11.472 59.885  1.00 30.03 ? 1128 PHE A CG  1 
ATOM   1111 C CD1 . PHE A 1 159 ? 15.181  10.133 59.835  1.00 30.09 ? 1128 PHE A CD1 1 
ATOM   1112 C CD2 . PHE A 1 159 ? 14.947  12.379 59.036  1.00 29.34 ? 1128 PHE A CD2 1 
ATOM   1113 C CE1 . PHE A 1 159 ? 14.180  9.704  58.954  1.00 30.06 ? 1128 PHE A CE1 1 
ATOM   1114 C CE2 . PHE A 1 159 ? 13.946  11.961 58.150  1.00 30.43 ? 1128 PHE A CE2 1 
ATOM   1115 C CZ  . PHE A 1 159 ? 13.561  10.620 58.111  1.00 30.06 ? 1128 PHE A CZ  1 
ATOM   1116 N N   . VAL A 1 160 ? 18.950  14.363 60.717  1.00 24.37 ? 1129 VAL A N   1 
ATOM   1117 C CA  . VAL A 1 160 ? 19.552  15.415 61.537  1.00 25.44 ? 1129 VAL A CA  1 
ATOM   1118 C C   . VAL A 1 160 ? 18.431  16.328 62.026  1.00 24.67 ? 1129 VAL A C   1 
ATOM   1119 O O   . VAL A 1 160 ? 17.397  16.445 61.368  1.00 24.90 ? 1129 VAL A O   1 
ATOM   1120 C CB  . VAL A 1 160 ? 20.550  16.275 60.740  1.00 26.00 ? 1129 VAL A CB  1 
ATOM   1121 C CG1 . VAL A 1 160 ? 21.711  15.418 60.278  1.00 26.81 ? 1129 VAL A CG1 1 
ATOM   1122 C CG2 . VAL A 1 160 ? 19.844  16.927 59.556  1.00 25.16 ? 1129 VAL A CG2 1 
ATOM   1123 N N   . HIS A 1 161 ? 18.632  16.977 63.168  1.00 24.96 ? 1130 HIS A N   1 
ATOM   1124 C CA  . HIS A 1 161 ? 17.609  17.864 63.715  1.00 25.32 ? 1130 HIS A CA  1 
ATOM   1125 C C   . HIS A 1 161 ? 17.619  19.279 63.127  1.00 26.23 ? 1130 HIS A C   1 
ATOM   1126 O O   . HIS A 1 161 ? 16.563  19.840 62.839  1.00 27.58 ? 1130 HIS A O   1 
ATOM   1127 C CB  . HIS A 1 161 ? 17.732  17.950 65.235  1.00 24.67 ? 1130 HIS A CB  1 
ATOM   1128 C CG  . HIS A 1 161 ? 16.483  18.430 65.899  1.00 23.50 ? 1130 HIS A CG  1 
ATOM   1129 N ND1 . HIS A 1 161 ? 15.955  19.681 65.670  1.00 22.94 ? 1130 HIS A ND1 1 
ATOM   1130 C CD2 . HIS A 1 161 ? 15.608  17.796 66.716  1.00 23.77 ? 1130 HIS A CD2 1 
ATOM   1131 C CE1 . HIS A 1 161 ? 14.806  19.795 66.312  1.00 23.87 ? 1130 HIS A CE1 1 
ATOM   1132 N NE2 . HIS A 1 161 ? 14.572  18.665 66.954  1.00 21.78 ? 1130 HIS A NE2 1 
ATOM   1133 N N   . ARG A 1 162 ? 18.805  19.854 62.955  1.00 26.76 ? 1131 ARG A N   1 
ATOM   1134 C CA  . ARG A 1 162 ? 18.949  21.203 62.398  1.00 27.77 ? 1131 ARG A CA  1 
ATOM   1135 C C   . ARG A 1 162 ? 18.456  22.299 63.340  1.00 28.23 ? 1131 ARG A C   1 
ATOM   1136 O O   . ARG A 1 162 ? 18.785  23.475 63.150  1.00 28.73 ? 1131 ARG A O   1 
ATOM   1137 C CB  . ARG A 1 162 ? 18.226  21.322 61.041  1.00 26.53 ? 1131 ARG A CB  1 
ATOM   1138 C CG  . ARG A 1 162 ? 19.161  21.321 59.821  1.00 24.85 ? 1131 ARG A CG  1 
ATOM   1139 C CD  . ARG A 1 162 ? 18.395  21.214 58.489  1.00 25.26 ? 1131 ARG A CD  1 
ATOM   1140 N NE  . ARG A 1 162 ? 18.954  20.174 57.618  1.00 22.20 ? 1131 ARG A NE  1 
ATOM   1141 C CZ  . ARG A 1 162 ? 19.931  20.363 56.735  1.00 22.54 ? 1131 ARG A CZ  1 
ATOM   1142 N NH1 . ARG A 1 162 ? 20.473  21.567 56.574  1.00 22.49 ? 1131 ARG A NH1 1 
ATOM   1143 N NH2 . ARG A 1 162 ? 20.390  19.336 56.034  1.00 18.19 ? 1131 ARG A NH2 1 
ATOM   1144 N N   . ASP A 1 163 ? 17.670  21.922 64.350  1.00 27.45 ? 1132 ASP A N   1 
ATOM   1145 C CA  . ASP A 1 163 ? 17.172  22.904 65.313  1.00 25.67 ? 1132 ASP A CA  1 
ATOM   1146 C C   . ASP A 1 163 ? 17.016  22.369 66.745  1.00 24.83 ? 1132 ASP A C   1 
ATOM   1147 O O   . ASP A 1 163 ? 16.025  22.657 67.421  1.00 25.02 ? 1132 ASP A O   1 
ATOM   1148 C CB  . ASP A 1 163 ? 15.846  23.492 64.829  1.00 22.36 ? 1132 ASP A CB  1 
ATOM   1149 C CG  . ASP A 1 163 ? 15.520  24.825 65.498  1.00 22.66 ? 1132 ASP A CG  1 
ATOM   1150 O OD1 . ASP A 1 163 ? 16.407  25.403 66.171  1.00 20.97 ? 1132 ASP A OD1 1 
ATOM   1151 O OD2 . ASP A 1 163 ? 14.377  25.304 65.340  1.00 21.77 ? 1132 ASP A OD2 1 
ATOM   1152 N N   . LEU A 1 164 ? 17.998  21.601 67.210  1.00 23.13 ? 1133 LEU A N   1 
ATOM   1153 C CA  . LEU A 1 164 ? 17.952  21.049 68.563  1.00 22.55 ? 1133 LEU A CA  1 
ATOM   1154 C C   . LEU A 1 164 ? 18.220  22.141 69.585  1.00 20.70 ? 1133 LEU A C   1 
ATOM   1155 O O   . LEU A 1 164 ? 19.191  22.879 69.475  1.00 21.02 ? 1133 LEU A O   1 
ATOM   1156 C CB  . LEU A 1 164 ? 18.987  19.926 68.742  1.00 23.12 ? 1133 LEU A CB  1 
ATOM   1157 C CG  . LEU A 1 164 ? 19.078  19.318 70.148  1.00 23.20 ? 1133 LEU A CG  1 
ATOM   1158 C CD1 . LEU A 1 164 ? 17.787  18.573 70.460  1.00 23.06 ? 1133 LEU A CD1 1 
ATOM   1159 C CD2 . LEU A 1 164 ? 20.273  18.373 70.244  1.00 23.17 ? 1133 LEU A CD2 1 
ATOM   1160 N N   . ALA A 1 165 ? 17.349  22.230 70.580  1.00 20.83 ? 1134 ALA A N   1 
ATOM   1161 C CA  . ALA A 1 165 ? 17.459  23.229 71.639  1.00 21.13 ? 1134 ALA A CA  1 
ATOM   1162 C C   . ALA A 1 165 ? 16.489  22.878 72.763  1.00 20.56 ? 1134 ALA A C   1 
ATOM   1163 O O   . ALA A 1 165 ? 15.666  21.969 72.628  1.00 20.64 ? 1134 ALA A O   1 
ATOM   1164 C CB  . ALA A 1 165 ? 17.136  24.605 71.089  1.00 20.64 ? 1134 ALA A CB  1 
ATOM   1165 N N   . ALA A 1 166 ? 16.574  23.591 73.875  1.00 18.72 ? 1135 ALA A N   1 
ATOM   1166 C CA  . ALA A 1 166 ? 15.665  23.292 74.971  1.00 19.18 ? 1135 ALA A CA  1 
ATOM   1167 C C   . ALA A 1 166 ? 14.218  23.541 74.537  1.00 18.47 ? 1135 ALA A C   1 
ATOM   1168 O O   . ALA A 1 166 ? 13.324  22.782 74.885  1.00 19.71 ? 1135 ALA A O   1 
ATOM   1169 C CB  . ALA A 1 166 ? 16.011  24.131 76.184  1.00 18.20 ? 1135 ALA A CB  1 
ATOM   1170 N N   . ARG A 1 167 ? 14.006  24.591 73.749  1.00 19.41 ? 1136 ARG A N   1 
ATOM   1171 C CA  . ARG A 1 167 ? 12.674  24.953 73.266  1.00 18.91 ? 1136 ARG A CA  1 
ATOM   1172 C C   . ARG A 1 167 ? 12.027  23.909 72.381  1.00 19.06 ? 1136 ARG A C   1 
ATOM   1173 O O   . ARG A 1 167 ? 10.819  23.957 72.177  1.00 18.52 ? 1136 ARG A O   1 
ATOM   1174 C CB  . ARG A 1 167 ? 12.708  26.285 72.506  1.00 18.74 ? 1136 ARG A CB  1 
ATOM   1175 C CG  . ARG A 1 167 ? 13.633  26.288 71.309  1.00 17.91 ? 1136 ARG A CG  1 
ATOM   1176 C CD  . ARG A 1 167 ? 13.699  27.647 70.636  1.00 15.05 ? 1136 ARG A CD  1 
ATOM   1177 N NE  . ARG A 1 167 ? 14.661  27.607 69.546  1.00 15.80 ? 1136 ARG A NE  1 
ATOM   1178 C CZ  . ARG A 1 167 ? 15.974  27.764 69.693  1.00 16.82 ? 1136 ARG A CZ  1 
ATOM   1179 N NH1 . ARG A 1 167 ? 16.489  27.994 70.891  1.00 18.89 ? 1136 ARG A NH1 1 
ATOM   1180 N NH2 . ARG A 1 167 ? 16.784  27.638 68.649  1.00 18.03 ? 1136 ARG A NH2 1 
ATOM   1181 N N   . ASN A 1 168 ? 12.812  22.978 71.843  1.00 18.71 ? 1137 ASN A N   1 
ATOM   1182 C CA  . ASN A 1 168 ? 12.233  21.939 70.995  1.00 18.70 ? 1137 ASN A CA  1 
ATOM   1183 C C   . ASN A 1 168 ? 12.314  20.534 71.594  1.00 19.81 ? 1137 ASN A C   1 
ATOM   1184 O O   . ASN A 1 168 ? 12.374  19.521 70.895  1.00 18.03 ? 1137 ASN A O   1 
ATOM   1185 C CB  . ASN A 1 168 ? 12.853  21.986 69.606  1.00 17.32 ? 1137 ASN A CB  1 
ATOM   1186 C CG  . ASN A 1 168 ? 12.399  23.190 68.831  1.00 16.27 ? 1137 ASN A CG  1 
ATOM   1187 O OD1 . ASN A 1 168 ? 11.228  23.543 68.864  1.00 14.42 ? 1137 ASN A OD1 1 
ATOM   1188 N ND2 . ASN A 1 168 ? 13.314  23.824 68.124  1.00 17.46 ? 1137 ASN A ND2 1 
ATOM   1189 N N   . CYS A 1 169 ? 12.297  20.503 72.916  1.00 21.37 ? 1138 CYS A N   1 
ATOM   1190 C CA  . CYS A 1 169 ? 12.328  19.273 73.669  1.00 22.00 ? 1138 CYS A CA  1 
ATOM   1191 C C   . CYS A 1 169 ? 11.076  19.340 74.522  1.00 23.52 ? 1138 CYS A C   1 
ATOM   1192 O O   . CYS A 1 169 ? 10.680  20.418 74.978  1.00 24.37 ? 1138 CYS A O   1 
ATOM   1193 C CB  . CYS A 1 169 ? 13.581  19.220 74.547  1.00 21.35 ? 1138 CYS A CB  1 
ATOM   1194 S SG  . CYS A 1 169 ? 15.130  18.926 73.638  1.00 22.51 ? 1138 CYS A SG  1 
ATOM   1195 N N   . MET A 1 170 ? 10.435  18.200 74.725  1.00 24.79 ? 1139 MET A N   1 
ATOM   1196 C CA  . MET A 1 170 ? 9.226   18.171 75.528  1.00 26.31 ? 1139 MET A CA  1 
ATOM   1197 C C   . MET A 1 170 ? 9.447   17.415 76.835  1.00 27.12 ? 1139 MET A C   1 
ATOM   1198 O O   . MET A 1 170 ? 10.284  16.515 76.916  1.00 25.36 ? 1139 MET A O   1 
ATOM   1199 C CB  . MET A 1 170 ? 8.075   17.526 74.745  1.00 27.68 ? 1139 MET A CB  1 
ATOM   1200 C CG  . MET A 1 170 ? 7.651   18.290 73.503  1.00 30.10 ? 1139 MET A CG  1 
ATOM   1201 S SD  . MET A 1 170 ? 7.327   20.030 73.873  1.00 36.90 ? 1139 MET A SD  1 
ATOM   1202 C CE  . MET A 1 170 ? 5.517   20.036 74.064  1.00 33.28 ? 1139 MET A CE  1 
ATOM   1203 N N   . VAL A 1 171 ? 8.697   17.816 77.857  1.00 28.32 ? 1140 VAL A N   1 
ATOM   1204 C CA  . VAL A 1 171 ? 8.749   17.191 79.173  1.00 28.66 ? 1140 VAL A CA  1 
ATOM   1205 C C   . VAL A 1 171 ? 7.425   16.441 79.304  1.00 28.30 ? 1140 VAL A C   1 
ATOM   1206 O O   . VAL A 1 171 ? 6.349   17.042 79.251  1.00 28.12 ? 1140 VAL A O   1 
ATOM   1207 C CB  . VAL A 1 171 ? 8.856   18.256 80.309  1.00 30.94 ? 1140 VAL A CB  1 
ATOM   1208 C CG1 . VAL A 1 171 ? 8.909   17.570 81.675  1.00 29.63 ? 1140 VAL A CG1 1 
ATOM   1209 C CG2 . VAL A 1 171 ? 10.098  19.131 80.100  1.00 30.78 ? 1140 VAL A CG2 1 
ATOM   1210 N N   . ALA A 1 172 ? 7.508   15.127 79.449  1.00 26.93 ? 1141 ALA A N   1 
ATOM   1211 C CA  . ALA A 1 172 ? 6.322   14.301 79.578  1.00 26.69 ? 1141 ALA A CA  1 
ATOM   1212 C C   . ALA A 1 172 ? 5.704   14.410 80.973  1.00 27.45 ? 1141 ALA A C   1 
ATOM   1213 O O   . ALA A 1 172 ? 6.322   14.936 81.895  1.00 27.05 ? 1141 ALA A O   1 
ATOM   1214 C CB  . ALA A 1 172 ? 6.682   12.861 79.285  1.00 28.69 ? 1141 ALA A CB  1 
ATOM   1215 N N   . GLU A 1 173 ? 4.480   13.908 81.119  1.00 27.99 ? 1142 GLU A N   1 
ATOM   1216 C CA  . GLU A 1 173 ? 3.782   13.922 82.397  1.00 29.57 ? 1142 GLU A CA  1 
ATOM   1217 C C   . GLU A 1 173 ? 4.681   13.449 83.546  1.00 31.19 ? 1142 GLU A C   1 
ATOM   1218 O O   . GLU A 1 173 ? 4.788   14.107 84.588  1.00 30.97 ? 1142 GLU A O   1 
ATOM   1219 C CB  . GLU A 1 173 ? 2.550   13.026 82.319  1.00 29.02 ? 1142 GLU A CB  1 
ATOM   1220 C CG  . GLU A 1 173 ? 1.908   12.764 83.662  1.00 30.78 ? 1142 GLU A CG  1 
ATOM   1221 C CD  . GLU A 1 173 ? 1.244   13.992 84.247  1.00 32.16 ? 1142 GLU A CD  1 
ATOM   1222 O OE1 . GLU A 1 173 ? 0.988   14.004 85.469  1.00 32.34 ? 1142 GLU A OE1 1 
ATOM   1223 O OE2 . GLU A 1 173 ? 0.965   14.940 83.483  1.00 34.07 ? 1142 GLU A OE2 1 
ATOM   1224 N N   . ASP A 1 174 ? 5.326   12.303 83.349  1.00 32.05 ? 1143 ASP A N   1 
ATOM   1225 C CA  . ASP A 1 174 ? 6.208   11.738 84.365  1.00 32.42 ? 1143 ASP A CA  1 
ATOM   1226 C C   . ASP A 1 174 ? 7.621   12.323 84.326  1.00 32.37 ? 1143 ASP A C   1 
ATOM   1227 O O   . ASP A 1 174 ? 8.557   11.710 84.850  1.00 30.67 ? 1143 ASP A O   1 
ATOM   1228 C CB  . ASP A 1 174 ? 6.289   10.227 84.194  1.00 33.65 ? 1143 ASP A CB  1 
ATOM   1229 C CG  . ASP A 1 174 ? 6.927   9.829  82.886  1.00 35.13 ? 1143 ASP A CG  1 
ATOM   1230 O OD1 . ASP A 1 174 ? 6.916   8.616  82.580  1.00 35.16 ? 1143 ASP A OD1 1 
ATOM   1231 O OD2 . ASP A 1 174 ? 7.440   10.727 82.173  1.00 35.53 ? 1143 ASP A OD2 1 
ATOM   1232 N N   . PHE A 1 175 ? 7.761   13.487 83.681  1.00 32.12 ? 1144 PHE A N   1 
ATOM   1233 C CA  . PHE A 1 175 ? 9.029   14.225 83.571  1.00 30.70 ? 1144 PHE A CA  1 
ATOM   1234 C C   . PHE A 1 175 ? 10.065  13.731 82.566  1.00 30.26 ? 1144 PHE A C   1 
ATOM   1235 O O   . PHE A 1 175 ? 11.164  14.279 82.503  1.00 29.49 ? 1144 PHE A O   1 
ATOM   1236 C CB  . PHE A 1 175 ? 9.690   14.333 84.950  1.00 30.04 ? 1144 PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 175 ? 8.826   15.002 85.976  1.00 30.31 ? 1144 PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 175 ? 8.719   16.387 86.016  1.00 31.47 ? 1144 PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 175 ? 8.082   14.246 86.870  1.00 30.64 ? 1144 PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 175 ? 7.882   17.008 86.929  1.00 31.79 ? 1144 PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 175 ? 7.235   14.855 87.792  1.00 31.28 ? 1144 PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 175 ? 7.134   16.238 87.822  1.00 31.96 ? 1144 PHE A CZ  1 
ATOM   1243 N N   . THR A 1 176 ? 9.740   12.705 81.786  1.00 30.69 ? 1145 THR A N   1 
ATOM   1244 C CA  . THR A 1 176 ? 10.699  12.207 80.798  1.00 30.32 ? 1145 THR A CA  1 
ATOM   1245 C C   . THR A 1 176 ? 10.796  13.225 79.673  1.00 29.71 ? 1145 THR A C   1 
ATOM   1246 O O   . THR A 1 176 ? 9.796   13.855 79.298  1.00 28.27 ? 1145 THR A O   1 
ATOM   1247 C CB  . THR A 1 176 ? 10.275  10.831 80.192  1.00 32.08 ? 1145 THR A CB  1 
ATOM   1248 O OG1 . THR A 1 176 ? 10.447  9.794  81.171  1.00 34.06 ? 1145 THR A OG1 1 
ATOM   1249 C CG2 . THR A 1 176 ? 11.120  10.497 78.957  1.00 30.31 ? 1145 THR A CG2 1 
ATOM   1250 N N   . VAL A 1 177 ? 12.005  13.396 79.146  1.00 27.76 ? 1146 VAL A N   1 
ATOM   1251 C CA  . VAL A 1 177 ? 12.216  14.337 78.063  1.00 25.20 ? 1146 VAL A CA  1 
ATOM   1252 C C   . VAL A 1 177 ? 12.303  13.596 76.741  1.00 23.93 ? 1146 VAL A C   1 
ATOM   1253 O O   . VAL A 1 177 ? 13.029  12.611 76.613  1.00 22.88 ? 1146 VAL A O   1 
ATOM   1254 C CB  . VAL A 1 177 ? 13.502  15.163 78.281  1.00 26.18 ? 1146 VAL A CB  1 
ATOM   1255 C CG1 . VAL A 1 177 ? 13.591  16.298 77.245  1.00 22.64 ? 1146 VAL A CG1 1 
ATOM   1256 C CG2 . VAL A 1 177 ? 13.521  15.717 79.699  1.00 25.72 ? 1146 VAL A CG2 1 
ATOM   1257 N N   . LYS A 1 178 ? 11.537  14.073 75.765  1.00 23.88 ? 1147 LYS A N   1 
ATOM   1258 C CA  . LYS A 1 178 ? 11.515  13.481 74.432  1.00 22.75 ? 1147 LYS A CA  1 
ATOM   1259 C C   . LYS A 1 178 ? 11.823  14.534 73.347  1.00 22.86 ? 1147 LYS A C   1 
ATOM   1260 O O   . LYS A 1 178 ? 11.625  15.736 73.550  1.00 22.41 ? 1147 LYS A O   1 
ATOM   1261 C CB  . LYS A 1 178 ? 10.144  12.860 74.162  1.00 20.32 ? 1147 LYS A CB  1 
ATOM   1262 C CG  . LYS A 1 178 ? 9.701   11.768 75.132  1.00 19.62 ? 1147 LYS A CG  1 
ATOM   1263 C CD  . LYS A 1 178 ? 8.283   11.308 74.761  1.00 19.61 ? 1147 LYS A CD  1 
ATOM   1264 C CE  . LYS A 1 178 ? 7.650   10.386 75.789  1.00 20.12 ? 1147 LYS A CE  1 
ATOM   1265 N NZ  . LYS A 1 178 ? 8.029   8.955  75.641  1.00 19.75 ? 1147 LYS A NZ  1 
ATOM   1266 N N   . ILE A 1 179 ? 12.320  14.084 72.200  1.00 22.34 ? 1148 ILE A N   1 
ATOM   1267 C CA  . ILE A 1 179 ? 12.607  15.006 71.111  1.00 21.96 ? 1148 ILE A CA  1 
ATOM   1268 C C   . ILE A 1 179 ? 11.256  15.465 70.577  1.00 22.99 ? 1148 ILE A C   1 
ATOM   1269 O O   . ILE A 1 179 ? 10.471  14.655 70.075  1.00 21.00 ? 1148 ILE A O   1 
ATOM   1270 C CB  . ILE A 1 179 ? 13.390  14.322 69.977  1.00 21.27 ? 1148 ILE A CB  1 
ATOM   1271 C CG1 . ILE A 1 179 ? 14.696  13.739 70.522  1.00 18.29 ? 1148 ILE A CG1 1 
ATOM   1272 C CG2 . ILE A 1 179 ? 13.653  15.320 68.862  1.00 19.82 ? 1148 ILE A CG2 1 
ATOM   1273 C CD1 . ILE A 1 179 ? 15.612  14.761 71.124  1.00 16.96 ? 1148 ILE A CD1 1 
ATOM   1274 N N   . GLY A 1 180 ? 10.993  16.763 70.696  1.00 24.18 ? 1149 GLY A N   1 
ATOM   1275 C CA  . GLY A 1 180 ? 9.726   17.319 70.256  1.00 26.42 ? 1149 GLY A CA  1 
ATOM   1276 C C   . GLY A 1 180 ? 9.419   17.230 68.774  1.00 28.67 ? 1149 GLY A C   1 
ATOM   1277 O O   . GLY A 1 180 ? 10.331  17.241 67.939  1.00 28.87 ? 1149 GLY A O   1 
ATOM   1278 N N   . ASP A 1 181 ? 8.128   17.152 68.448  1.00 28.64 ? 1150 ASP A N   1 
ATOM   1279 C CA  . ASP A 1 181 ? 7.692   17.077 67.064  1.00 30.34 ? 1150 ASP A CA  1 
ATOM   1280 C C   . ASP A 1 181 ? 7.603   18.471 66.435  1.00 32.00 ? 1150 ASP A C   1 
ATOM   1281 O O   . ASP A 1 181 ? 7.554   19.484 67.136  1.00 33.22 ? 1150 ASP A O   1 
ATOM   1282 C CB  . ASP A 1 181 ? 6.343   16.340 66.964  1.00 30.36 ? 1150 ASP A CB  1 
ATOM   1283 C CG  . ASP A 1 181 ? 5.249   16.965 67.832  1.00 31.76 ? 1150 ASP A CG  1 
ATOM   1284 O OD1 . ASP A 1 181 ? 5.504   17.198 69.033  1.00 32.38 ? 1150 ASP A OD1 1 
ATOM   1285 O OD2 . ASP A 1 181 ? 4.129   17.209 67.319  1.00 29.51 ? 1150 ASP A OD2 1 
ATOM   1286 N N   . PHE A 1 182 ? 7.582   18.497 65.104  1.00 33.56 ? 1151 PHE A N   1 
ATOM   1287 C CA  . PHE A 1 182 ? 7.531   19.718 64.291  1.00 34.85 ? 1151 PHE A CA  1 
ATOM   1288 C C   . PHE A 1 182 ? 6.346   20.655 64.544  1.00 35.27 ? 1151 PHE A C   1 
ATOM   1289 O O   . PHE A 1 182 ? 5.262   20.216 64.944  1.00 34.82 ? 1151 PHE A O   1 
ATOM   1290 C CB  . PHE A 1 182 ? 7.512   19.327 62.813  1.00 37.26 ? 1151 PHE A CB  1 
ATOM   1291 C CG  . PHE A 1 182 ? 6.161   18.848 62.343  1.00 39.73 ? 1151 PHE A CG  1 
ATOM   1292 C CD1 . PHE A 1 182 ? 5.309   19.701 61.644  1.00 40.04 ? 1151 PHE A CD1 1 
ATOM   1293 C CD2 . PHE A 1 182 ? 5.716   17.565 62.655  1.00 39.93 ? 1151 PHE A CD2 1 
ATOM   1294 C CE1 . PHE A 1 182 ? 4.036   19.289 61.264  1.00 39.75 ? 1151 PHE A CE1 1 
ATOM   1295 C CE2 . PHE A 1 182 ? 4.446   17.141 62.282  1.00 39.49 ? 1151 PHE A CE2 1 
ATOM   1296 C CZ  . PHE A 1 182 ? 3.602   18.007 61.584  1.00 40.46 ? 1151 PHE A CZ  1 
ATOM   1297 N N   . GLY A 1 183 ? 6.568   21.942 64.270  1.00 34.68 ? 1152 GLY A N   1 
ATOM   1298 C CA  . GLY A 1 183 ? 5.542   22.964 64.423  1.00 34.24 ? 1152 GLY A CA  1 
ATOM   1299 C C   . GLY A 1 183 ? 5.026   23.255 65.821  1.00 33.94 ? 1152 GLY A C   1 
ATOM   1300 O O   . GLY A 1 183 ? 3.873   23.652 65.973  1.00 32.78 ? 1152 GLY A O   1 
ATOM   1301 N N   . MET A 1 184 ? 5.877   23.092 66.833  1.00 34.44 ? 1153 MET A N   1 
ATOM   1302 C CA  . MET A 1 184 ? 5.479   23.318 68.224  1.00 33.96 ? 1153 MET A CA  1 
ATOM   1303 C C   . MET A 1 184 ? 6.258   24.409 68.955  1.00 32.87 ? 1153 MET A C   1 
ATOM   1304 O O   . MET A 1 184 ? 5.868   24.811 70.045  1.00 32.59 ? 1153 MET A O   1 
ATOM   1305 C CB  . MET A 1 184 ? 5.610   22.012 69.020  1.00 35.60 ? 1153 MET A CB  1 
ATOM   1306 C CG  . MET A 1 184 ? 4.696   20.875 68.576  1.00 36.36 ? 1153 MET A CG  1 
ATOM   1307 S SD  . MET A 1 184 ? 2.954   21.196 68.939  1.00 36.46 ? 1153 MET A SD  1 
ATOM   1308 C CE  . MET A 1 184 ? 2.944   21.016 70.708  1.00 35.64 ? 1153 MET A CE  1 
ATOM   1309 N N   . THR A 1 185 ? 7.362   24.878 68.378  1.00 32.80 ? 1154 THR A N   1 
ATOM   1310 C CA  . THR A 1 185 ? 8.162   25.915 69.033  1.00 31.71 ? 1154 THR A CA  1 
ATOM   1311 C C   . THR A 1 185 ? 7.259   27.065 69.455  1.00 32.33 ? 1154 THR A C   1 
ATOM   1312 O O   . THR A 1 185 ? 6.517   27.584 68.638  1.00 31.40 ? 1154 THR A O   1 
ATOM   1313 C CB  . THR A 1 185 ? 9.240   26.495 68.104  1.00 29.07 ? 1154 THR A CB  1 
ATOM   1314 O OG1 . THR A 1 185 ? 9.930   25.439 67.433  1.00 29.29 ? 1154 THR A OG1 1 
ATOM   1315 C CG2 . THR A 1 185 ? 10.237  27.288 68.907  1.00 27.87 ? 1154 THR A CG2 1 
ATOM   1316 N N   . ARG A 1 186 ? 7.316   27.463 70.723  1.00 34.59 ? 1155 ARG A N   1 
ATOM   1317 C CA  . ARG A 1 186 ? 6.481   28.568 71.198  1.00 35.36 ? 1155 ARG A CA  1 
ATOM   1318 C C   . ARG A 1 186 ? 6.866   29.890 70.562  1.00 36.32 ? 1155 ARG A C   1 
ATOM   1319 O O   . ARG A 1 186 ? 8.046   30.236 70.485  1.00 35.99 ? 1155 ARG A O   1 
ATOM   1320 C CB  . ARG A 1 186 ? 6.565   28.724 72.713  1.00 33.85 ? 1155 ARG A CB  1 
ATOM   1321 C CG  . ARG A 1 186 ? 5.740   27.734 73.478  1.00 33.34 ? 1155 ARG A CG  1 
ATOM   1322 C CD  . ARG A 1 186 ? 5.581   28.227 74.883  1.00 34.15 ? 1155 ARG A CD  1 
ATOM   1323 N NE  . ARG A 1 186 ? 4.917   29.525 74.889  1.00 35.14 ? 1155 ARG A NE  1 
ATOM   1324 C CZ  . ARG A 1 186 ? 4.716   30.256 75.980  1.00 35.94 ? 1155 ARG A CZ  1 
ATOM   1325 N NH1 . ARG A 1 186 ? 4.100   31.428 75.889  1.00 36.78 ? 1155 ARG A NH1 1 
ATOM   1326 N NH2 . ARG A 1 186 ? 5.141   29.820 77.160  1.00 35.73 ? 1155 ARG A NH2 1 
ATOM   1327 N N   . ASP A 1 187 ? 5.845   30.621 70.124  1.00 37.75 ? 1156 ASP A N   1 
ATOM   1328 C CA  . ASP A 1 187 ? 5.990   31.923 69.479  1.00 38.36 ? 1156 ASP A CA  1 
ATOM   1329 C C   . ASP A 1 187 ? 6.739   32.964 70.302  1.00 36.33 ? 1156 ASP A C   1 
ATOM   1330 O O   . ASP A 1 187 ? 7.189   33.973 69.764  1.00 35.52 ? 1156 ASP A O   1 
ATOM   1331 C CB  . ASP A 1 187 ? 4.602   32.466 69.133  1.00 43.44 ? 1156 ASP A CB  1 
ATOM   1332 C CG  . ASP A 1 187 ? 3.610   32.331 70.295  1.00 47.48 ? 1156 ASP A CG  1 
ATOM   1333 O OD1 . ASP A 1 187 ? 3.888   32.883 71.388  1.00 50.25 ? 1156 ASP A OD1 1 
ATOM   1334 O OD2 . ASP A 1 187 ? 2.553   31.674 70.113  1.00 48.71 ? 1156 ASP A OD2 1 
ATOM   1335 N N   . ILE A 1 188 ? 6.873   32.716 71.601  1.00 35.01 ? 1157 ILE A N   1 
ATOM   1336 C CA  . ILE A 1 188 ? 7.548   33.646 72.496  1.00 34.23 ? 1157 ILE A CA  1 
ATOM   1337 C C   . ILE A 1 188 ? 9.071   33.560 72.436  1.00 34.18 ? 1157 ILE A C   1 
ATOM   1338 O O   . ILE A 1 188 ? 9.768   34.440 72.948  1.00 34.90 ? 1157 ILE A O   1 
ATOM   1339 C CB  . ILE A 1 188 ? 7.117   33.417 73.966  1.00 35.18 ? 1157 ILE A CB  1 
ATOM   1340 C CG1 . ILE A 1 188 ? 7.698   32.092 74.482  1.00 33.24 ? 1157 ILE A CG1 1 
ATOM   1341 C CG2 . ILE A 1 188 ? 5.582   33.416 74.066  1.00 34.57 ? 1157 ILE A CG2 1 
ATOM   1342 C CD1 . ILE A 1 188 ? 7.609   31.914 75.990  1.00 30.80 ? 1157 ILE A CD1 1 
ATOM   1343 N N   . TYR A 1 189 ? 9.591   32.500 71.827  1.00 32.56 ? 1158 TYR A N   1 
ATOM   1344 C CA  . TYR A 1 189 ? 11.035  32.334 71.738  1.00 30.85 ? 1158 TYR A CA  1 
ATOM   1345 C C   . TYR A 1 189 ? 11.553  32.817 70.392  1.00 31.50 ? 1158 TYR A C   1 
ATOM   1346 O O   . TYR A 1 189 ? 12.689  32.531 69.998  1.00 31.09 ? 1158 TYR A O   1 
ATOM   1347 C CB  . TYR A 1 189 ? 11.414  30.870 71.982  1.00 28.16 ? 1158 TYR A CB  1 
ATOM   1348 C CG  . TYR A 1 189 ? 11.119  30.391 73.398  1.00 24.73 ? 1158 TYR A CG  1 
ATOM   1349 C CD1 . TYR A 1 189 ? 11.641  31.063 74.505  1.00 22.73 ? 1158 TYR A CD1 1 
ATOM   1350 C CD2 . TYR A 1 189 ? 10.330  29.260 73.624  1.00 22.20 ? 1158 TYR A CD2 1 
ATOM   1351 C CE1 . TYR A 1 189 ? 11.387  30.626 75.804  1.00 22.13 ? 1158 TYR A CE1 1 
ATOM   1352 C CE2 . TYR A 1 189 ? 10.067  28.811 74.913  1.00 21.92 ? 1158 TYR A CE2 1 
ATOM   1353 C CZ  . TYR A 1 189 ? 10.596  29.498 76.005  1.00 22.97 ? 1158 TYR A CZ  1 
ATOM   1354 O OH  . TYR A 1 189 ? 10.307  29.076 77.288  1.00 17.90 ? 1158 TYR A OH  1 
ATOM   1355 N N   . GLU A 1 190 ? 10.692  33.560 69.705  1.00 31.74 ? 1159 GLU A N   1 
ATOM   1356 C CA  . GLU A 1 190 ? 10.974  34.159 68.402  1.00 33.54 ? 1159 GLU A CA  1 
ATOM   1357 C C   . GLU A 1 190 ? 12.378  34.779 68.341  1.00 32.68 ? 1159 GLU A C   1 
ATOM   1358 O O   . GLU A 1 190 ? 13.004  34.817 67.284  1.00 31.29 ? 1159 GLU A O   1 
ATOM   1359 C CB  . GLU A 1 190 ? 9.908   35.225 68.134  1.00 35.96 ? 1159 GLU A CB  1 
ATOM   1360 C CG  . GLU A 1 190 ? 10.064  36.069 66.894  1.00 37.86 ? 1159 GLU A CG  1 
ATOM   1361 C CD  . GLU A 1 190 ? 8.898   37.043 66.736  1.00 41.06 ? 1159 GLU A CD  1 
ATOM   1362 O OE1 . GLU A 1 190 ? 8.877   37.812 65.752  1.00 42.09 ? 1159 GLU A OE1 1 
ATOM   1363 O OE2 . GLU A 1 190 ? 7.994   37.037 67.602  1.00 40.88 ? 1159 GLU A OE2 1 
ATOM   1364 N N   . THR A 1 191 ? 12.855  35.253 69.489  1.00 32.54 ? 1160 THR A N   1 
ATOM   1365 C CA  . THR A 1 191 ? 14.168  35.882 69.613  1.00 32.75 ? 1160 THR A CA  1 
ATOM   1366 C C   . THR A 1 191 ? 15.299  34.881 69.419  1.00 32.36 ? 1160 THR A C   1 
ATOM   1367 O O   . THR A 1 191 ? 16.416  35.257 69.072  1.00 32.48 ? 1160 THR A O   1 
ATOM   1368 C CB  . THR A 1 191 ? 14.330  36.559 71.013  1.00 33.95 ? 1160 THR A CB  1 
ATOM   1369 O OG1 . THR A 1 191 ? 13.509  37.730 71.081  1.00 32.89 ? 1160 THR A OG1 1 
ATOM   1370 C CG2 . THR A 1 191 ? 15.780  36.955 71.271  1.00 35.53 ? 1160 THR A CG2 1 
ATOM   1371 N N   . ASP A 1 192 ? 15.010  33.606 69.648  1.00 32.67 ? 1161 ASP A N   1 
ATOM   1372 C CA  . ASP A 1 192 ? 16.018  32.563 69.499  1.00 32.36 ? 1161 ASP A CA  1 
ATOM   1373 C C   . ASP A 1 192 ? 16.460  32.398 68.055  1.00 32.72 ? 1161 ASP A C   1 
ATOM   1374 O O   . ASP A 1 192 ? 17.271  31.526 67.750  1.00 33.85 ? 1161 ASP A O   1 
ATOM   1375 C CB  . ASP A 1 192 ? 15.490  31.231 70.034  1.00 31.04 ? 1161 ASP A CB  1 
ATOM   1376 C CG  . ASP A 1 192 ? 15.445  31.191 71.550  1.00 30.14 ? 1161 ASP A CG  1 
ATOM   1377 O OD1 . ASP A 1 192 ? 15.685  32.239 72.182  1.00 29.79 ? 1161 ASP A OD1 1 
ATOM   1378 O OD2 . ASP A 1 192 ? 15.164  30.111 72.111  1.00 30.50 ? 1161 ASP A OD2 1 
ATOM   1379 N N   . TYR A 1 193 ? 15.925  33.234 67.171  1.00 33.28 ? 1162 TYR A N   1 
ATOM   1380 C CA  . TYR A 1 193 ? 16.282  33.183 65.758  1.00 35.01 ? 1162 TYR A CA  1 
ATOM   1381 C C   . TYR A 1 193 ? 16.797  34.545 65.273  1.00 37.04 ? 1162 TYR A C   1 
ATOM   1382 O O   . TYR A 1 193 ? 16.533  35.587 65.889  1.00 36.45 ? 1162 TYR A O   1 
ATOM   1383 C CB  . TYR A 1 193 ? 15.082  32.695 64.919  1.00 34.48 ? 1162 TYR A CB  1 
ATOM   1384 C CG  . TYR A 1 193 ? 14.605  31.309 65.331  1.00 32.19 ? 1162 TYR A CG  1 
ATOM   1385 C CD1 . TYR A 1 193 ? 13.761  31.139 66.435  1.00 30.70 ? 1162 TYR A CD1 1 
ATOM   1386 C CD2 . TYR A 1 193 ? 15.097  30.159 64.696  1.00 29.86 ? 1162 TYR A CD2 1 
ATOM   1387 C CE1 . TYR A 1 193 ? 13.429  29.857 66.903  1.00 29.69 ? 1162 TYR A CE1 1 
ATOM   1388 C CE2 . TYR A 1 193 ? 14.772  28.877 65.154  1.00 27.17 ? 1162 TYR A CE2 1 
ATOM   1389 C CZ  . TYR A 1 193 ? 13.942  28.729 66.259  1.00 28.15 ? 1162 TYR A CZ  1 
ATOM   1390 O OH  . TYR A 1 193 ? 13.645  27.468 66.744  1.00 22.63 ? 1162 TYR A OH  1 
ATOM   1391 N N   . TYR A 1 194 ? 17.549  34.525 64.176  1.00 38.61 ? 1163 TYR A N   1 
ATOM   1392 C CA  . TYR A 1 194 ? 18.147  35.736 63.624  1.00 40.00 ? 1163 TYR A CA  1 
ATOM   1393 C C   . TYR A 1 194 ? 18.363  35.583 62.115  1.00 41.98 ? 1163 TYR A C   1 
ATOM   1394 O O   . TYR A 1 194 ? 18.666  34.489 61.626  1.00 42.24 ? 1163 TYR A O   1 
ATOM   1395 C CB  . TYR A 1 194 ? 19.485  35.992 64.336  1.00 39.78 ? 1163 TYR A CB  1 
ATOM   1396 C CG  . TYR A 1 194 ? 20.327  37.110 63.772  1.00 40.42 ? 1163 TYR A CG  1 
ATOM   1397 C CD1 . TYR A 1 194 ? 19.926  38.442 63.888  1.00 40.97 ? 1163 TYR A CD1 1 
ATOM   1398 C CD2 . TYR A 1 194 ? 21.531  36.836 63.115  1.00 41.25 ? 1163 TYR A CD2 1 
ATOM   1399 C CE1 . TYR A 1 194 ? 20.706  39.482 63.359  1.00 42.41 ? 1163 TYR A CE1 1 
ATOM   1400 C CE2 . TYR A 1 194 ? 22.321  37.864 62.582  1.00 42.21 ? 1163 TYR A CE2 1 
ATOM   1401 C CZ  . TYR A 1 194 ? 21.902  39.186 62.709  1.00 42.87 ? 1163 TYR A CZ  1 
ATOM   1402 O OH  . TYR A 1 194 ? 22.679  40.207 62.203  1.00 42.44 ? 1163 TYR A OH  1 
ATOM   1403 N N   . ARG A 1 195 ? 18.203  36.680 61.380  1.00 43.17 ? 1164 ARG A N   1 
ATOM   1404 C CA  . ARG A 1 195 ? 18.382  36.651 59.935  1.00 44.49 ? 1164 ARG A CA  1 
ATOM   1405 C C   . ARG A 1 195 ? 19.828  36.898 59.541  1.00 46.06 ? 1164 ARG A C   1 
ATOM   1406 O O   . ARG A 1 195 ? 20.195  37.998 59.121  1.00 48.13 ? 1164 ARG A O   1 
ATOM   1407 C CB  . ARG A 1 195 ? 17.467  37.680 59.270  1.00 44.56 ? 1164 ARG A CB  1 
ATOM   1408 C CG  . ARG A 1 195 ? 16.017  37.270 59.318  1.00 44.65 ? 1164 ARG A CG  1 
ATOM   1409 C CD  . ARG A 1 195 ? 15.077  38.335 58.811  1.00 44.47 ? 1164 ARG A CD  1 
ATOM   1410 N NE  . ARG A 1 195 ? 13.714  37.814 58.817  1.00 45.33 ? 1164 ARG A NE  1 
ATOM   1411 C CZ  . ARG A 1 195 ? 13.273  36.872 57.987  1.00 45.17 ? 1164 ARG A CZ  1 
ATOM   1412 N NH1 . ARG A 1 195 ? 14.081  36.353 57.074  1.00 43.08 ? 1164 ARG A NH1 1 
ATOM   1413 N NH2 . ARG A 1 195 ? 12.027  36.430 58.087  1.00 45.90 ? 1164 ARG A NH2 1 
ATOM   1414 N N   . LYS A 1 196 ? 20.645  35.859 59.685  1.00 45.74 ? 1165 LYS A N   1 
ATOM   1415 C CA  . LYS A 1 196 ? 22.061  35.924 59.352  1.00 45.11 ? 1165 LYS A CA  1 
ATOM   1416 C C   . LYS A 1 196 ? 22.237  36.461 57.938  1.00 45.65 ? 1165 LYS A C   1 
ATOM   1417 O O   . LYS A 1 196 ? 21.659  35.931 56.987  1.00 45.53 ? 1165 LYS A O   1 
ATOM   1418 C CB  . LYS A 1 196 ? 22.672  34.528 59.458  1.00 44.26 ? 1165 LYS A CB  1 
ATOM   1419 C CG  . LYS A 1 196 ? 24.163  34.467 59.261  1.00 41.49 ? 1165 LYS A CG  1 
ATOM   1420 C CD  . LYS A 1 196 ? 24.638  33.049 59.460  1.00 41.56 ? 1165 LYS A CD  1 
ATOM   1421 C CE  . LYS A 1 196 ? 26.145  32.972 59.450  1.00 40.66 ? 1165 LYS A CE  1 
ATOM   1422 N NZ  . LYS A 1 196 ? 26.704  33.405 58.154  1.00 41.27 ? 1165 LYS A NZ  1 
ATOM   1423 N N   . GLY A 1 197 ? 23.035  37.517 57.808  1.00 46.37 ? 1166 GLY A N   1 
ATOM   1424 C CA  . GLY A 1 197 ? 23.269  38.117 56.504  1.00 46.72 ? 1166 GLY A CA  1 
ATOM   1425 C C   . GLY A 1 197 ? 21.988  38.647 55.889  1.00 46.15 ? 1166 GLY A C   1 
ATOM   1426 O O   . GLY A 1 197 ? 21.832  38.660 54.667  1.00 45.75 ? 1166 GLY A O   1 
ATOM   1427 N N   . GLY A 1 198 ? 21.066  39.079 56.744  1.00 45.35 ? 1167 GLY A N   1 
ATOM   1428 C CA  . GLY A 1 198 ? 19.798  39.607 56.272  1.00 44.89 ? 1167 GLY A CA  1 
ATOM   1429 C C   . GLY A 1 198 ? 18.946  38.595 55.524  1.00 44.06 ? 1167 GLY A C   1 
ATOM   1430 O O   . GLY A 1 198 ? 17.917  38.947 54.948  1.00 42.66 ? 1167 GLY A O   1 
ATOM   1431 N N   . LYS A 1 199 ? 19.368  37.335 55.535  1.00 43.43 ? 1168 LYS A N   1 
ATOM   1432 C CA  . LYS A 1 199 ? 18.631  36.285 54.852  1.00 42.34 ? 1168 LYS A CA  1 
ATOM   1433 C C   . LYS A 1 199 ? 17.701  35.546 55.821  1.00 41.98 ? 1168 LYS A C   1 
ATOM   1434 O O   . LYS A 1 199 ? 17.093  36.164 56.697  1.00 43.19 ? 1168 LYS A O   1 
ATOM   1435 C CB  . LYS A 1 199 ? 19.612  35.316 54.204  1.00 43.09 ? 1168 LYS A CB  1 
ATOM   1436 C CG  . LYS A 1 199 ? 20.730  36.010 53.440  1.00 44.43 ? 1168 LYS A CG  1 
ATOM   1437 C CD  . LYS A 1 199 ? 21.796  35.016 53.004  1.00 45.52 ? 1168 LYS A CD  1 
ATOM   1438 C CE  . LYS A 1 199 ? 23.020  35.717 52.430  1.00 47.99 ? 1168 LYS A CE  1 
ATOM   1439 N NZ  . LYS A 1 199 ? 23.689  36.610 53.421  1.00 49.00 ? 1168 LYS A NZ  1 
ATOM   1440 N N   . GLY A 1 200 ? 17.608  34.227 55.679  1.00 40.84 ? 1169 GLY A N   1 
ATOM   1441 C CA  . GLY A 1 200 ? 16.722  33.435 56.523  1.00 37.73 ? 1169 GLY A CA  1 
ATOM   1442 C C   . GLY A 1 200 ? 16.944  33.355 58.025  1.00 36.36 ? 1169 GLY A C   1 
ATOM   1443 O O   . GLY A 1 200 ? 18.064  33.494 58.519  1.00 35.82 ? 1169 GLY A O   1 
ATOM   1444 N N   . LEU A 1 201 ? 15.844  33.118 58.743  1.00 35.96 ? 1170 LEU A N   1 
ATOM   1445 C CA  . LEU A 1 201 ? 15.828  32.980 60.203  1.00 33.76 ? 1170 LEU A CA  1 
ATOM   1446 C C   . LEU A 1 201 ? 16.577  31.728 60.672  1.00 32.47 ? 1170 LEU A C   1 
ATOM   1447 O O   . LEU A 1 201 ? 16.141  30.609 60.411  1.00 30.27 ? 1170 LEU A O   1 
ATOM   1448 C CB  . LEU A 1 201 ? 14.385  32.889 60.716  1.00 33.12 ? 1170 LEU A CB  1 
ATOM   1449 C CG  . LEU A 1 201 ? 13.506  34.132 60.820  1.00 32.28 ? 1170 LEU A CG  1 
ATOM   1450 C CD1 . LEU A 1 201 ? 12.125  33.726 61.281  1.00 29.42 ? 1170 LEU A CD1 1 
ATOM   1451 C CD2 . LEU A 1 201 ? 14.120  35.122 61.792  1.00 31.85 ? 1170 LEU A CD2 1 
ATOM   1452 N N   . LEU A 1 202 ? 17.688  31.930 61.379  1.00 32.04 ? 1171 LEU A N   1 
ATOM   1453 C CA  . LEU A 1 202 ? 18.496  30.830 61.892  1.00 30.72 ? 1171 LEU A CA  1 
ATOM   1454 C C   . LEU A 1 202 ? 18.764  30.977 63.381  1.00 30.15 ? 1171 LEU A C   1 
ATOM   1455 O O   . LEU A 1 202 ? 18.911  32.087 63.893  1.00 29.20 ? 1171 LEU A O   1 
ATOM   1456 C CB  . LEU A 1 202 ? 19.842  30.753 61.163  1.00 31.03 ? 1171 LEU A CB  1 
ATOM   1457 C CG  . LEU A 1 202 ? 19.941  30.289 59.704  1.00 31.20 ? 1171 LEU A CG  1 
ATOM   1458 C CD1 . LEU A 1 202 ? 21.380  30.434 59.247  1.00 30.81 ? 1171 LEU A CD1 1 
ATOM   1459 C CD2 . LEU A 1 202 ? 19.498  28.840 59.564  1.00 31.54 ? 1171 LEU A CD2 1 
ATOM   1460 N N   . PRO A 1 203 ? 18.820  29.844 64.099  1.00 30.85 ? 1172 PRO A N   1 
ATOM   1461 C CA  . PRO A 1 203 ? 19.078  29.811 65.545  1.00 29.86 ? 1172 PRO A CA  1 
ATOM   1462 C C   . PRO A 1 203 ? 20.583  29.852 65.768  1.00 28.63 ? 1172 PRO A C   1 
ATOM   1463 O O   . PRO A 1 203 ? 21.185  28.894 66.258  1.00 28.88 ? 1172 PRO A O   1 
ATOM   1464 C CB  . PRO A 1 203 ? 18.463  28.485 65.970  1.00 30.16 ? 1172 PRO A CB  1 
ATOM   1465 C CG  . PRO A 1 203 ? 18.764  27.612 64.793  1.00 30.81 ? 1172 PRO A CG  1 
ATOM   1466 C CD  . PRO A 1 203 ? 18.435  28.507 63.607  1.00 30.50 ? 1172 PRO A CD  1 
ATOM   1467 N N   . VAL A 1 204 ? 21.179  30.974 65.389  1.00 26.84 ? 1173 VAL A N   1 
ATOM   1468 C CA  . VAL A 1 204 ? 22.613  31.174 65.504  1.00 25.15 ? 1173 VAL A CA  1 
ATOM   1469 C C   . VAL A 1 204 ? 23.231  30.848 66.868  1.00 24.10 ? 1173 VAL A C   1 
ATOM   1470 O O   . VAL A 1 204 ? 24.375  30.394 66.928  1.00 23.19 ? 1173 VAL A O   1 
ATOM   1471 C CB  . VAL A 1 204 ? 22.979  32.621 65.113  1.00 24.19 ? 1173 VAL A CB  1 
ATOM   1472 C CG1 . VAL A 1 204 ? 22.297  32.969 63.803  1.00 22.25 ? 1173 VAL A CG1 1 
ATOM   1473 C CG2 . VAL A 1 204 ? 22.566  33.601 66.215  1.00 23.17 ? 1173 VAL A CG2 1 
ATOM   1474 N N   . ARG A 1 205 ? 22.489  31.063 67.954  1.00 22.56 ? 1174 ARG A N   1 
ATOM   1475 C CA  . ARG A 1 205 ? 23.024  30.795 69.289  1.00 23.95 ? 1174 ARG A CA  1 
ATOM   1476 C C   . ARG A 1 205 ? 23.130  29.316 69.666  1.00 23.27 ? 1174 ARG A C   1 
ATOM   1477 O O   . ARG A 1 205 ? 23.614  28.986 70.739  1.00 23.85 ? 1174 ARG A O   1 
ATOM   1478 C CB  . ARG A 1 205 ? 22.211  31.548 70.350  1.00 24.54 ? 1174 ARG A CB  1 
ATOM   1479 C CG  . ARG A 1 205 ? 22.482  33.041 70.376  1.00 25.83 ? 1174 ARG A CG  1 
ATOM   1480 C CD  . ARG A 1 205 ? 21.488  33.809 71.236  1.00 26.42 ? 1174 ARG A CD  1 
ATOM   1481 N NE  . ARG A 1 205 ? 21.570  35.241 70.947  1.00 29.09 ? 1174 ARG A NE  1 
ATOM   1482 C CZ  . ARG A 1 205 ? 22.462  36.073 71.481  1.00 29.02 ? 1174 ARG A CZ  1 
ATOM   1483 N NH1 . ARG A 1 205 ? 23.350  35.627 72.361  1.00 30.54 ? 1174 ARG A NH1 1 
ATOM   1484 N NH2 . ARG A 1 205 ? 22.496  37.344 71.102  1.00 27.06 ? 1174 ARG A NH2 1 
ATOM   1485 N N   . TRP A 1 206 ? 22.702  28.430 68.777  1.00 22.49 ? 1175 TRP A N   1 
ATOM   1486 C CA  . TRP A 1 206 ? 22.765  26.993 69.026  1.00 23.48 ? 1175 TRP A CA  1 
ATOM   1487 C C   . TRP A 1 206 ? 23.527  26.284 67.905  1.00 23.18 ? 1175 TRP A C   1 
ATOM   1488 O O   . TRP A 1 206 ? 23.710  25.065 67.937  1.00 23.30 ? 1175 TRP A O   1 
ATOM   1489 C CB  . TRP A 1 206 ? 21.338  26.420 69.116  1.00 25.37 ? 1175 TRP A CB  1 
ATOM   1490 C CG  . TRP A 1 206 ? 20.654  26.711 70.415  1.00 26.72 ? 1175 TRP A CG  1 
ATOM   1491 C CD1 . TRP A 1 206 ? 20.582  25.890 71.501  1.00 26.81 ? 1175 TRP A CD1 1 
ATOM   1492 C CD2 . TRP A 1 206 ? 20.021  27.937 70.798  1.00 28.22 ? 1175 TRP A CD2 1 
ATOM   1493 N NE1 . TRP A 1 206 ? 19.950  26.526 72.539  1.00 27.59 ? 1175 TRP A NE1 1 
ATOM   1494 C CE2 . TRP A 1 206 ? 19.595  27.785 72.138  1.00 28.20 ? 1175 TRP A CE2 1 
ATOM   1495 C CE3 . TRP A 1 206 ? 19.776  29.151 70.144  1.00 28.90 ? 1175 TRP A CE3 1 
ATOM   1496 C CZ2 . TRP A 1 206 ? 18.941  28.801 72.838  1.00 28.66 ? 1175 TRP A CZ2 1 
ATOM   1497 C CZ3 . TRP A 1 206 ? 19.125  30.165 70.839  1.00 29.43 ? 1175 TRP A CZ3 1 
ATOM   1498 C CH2 . TRP A 1 206 ? 18.716  29.981 72.176  1.00 30.41 ? 1175 TRP A CH2 1 
ATOM   1499 N N   . MET A 1 207 ? 23.972  27.062 66.921  1.00 22.53 ? 1176 MET A N   1 
ATOM   1500 C CA  . MET A 1 207 ? 24.670  26.538 65.751  1.00 20.75 ? 1176 MET A CA  1 
ATOM   1501 C C   . MET A 1 207 ? 26.190  26.369 65.842  1.00 21.52 ? 1176 MET A C   1 
ATOM   1502 O O   . MET A 1 207 ? 26.915  27.198 66.406  1.00 19.40 ? 1176 MET A O   1 
ATOM   1503 C CB  . MET A 1 207 ? 24.337  27.411 64.547  1.00 20.03 ? 1176 MET A CB  1 
ATOM   1504 C CG  . MET A 1 207 ? 22.868  27.474 64.216  1.00 19.82 ? 1176 MET A CG  1 
ATOM   1505 S SD  . MET A 1 207 ? 22.590  28.652 62.901  1.00 21.43 ? 1176 MET A SD  1 
ATOM   1506 C CE  . MET A 1 207 ? 23.339  27.786 61.528  1.00 22.90 ? 1176 MET A CE  1 
ATOM   1507 N N   . SER A 1 208 ? 26.661  25.286 65.240  1.00 21.77 ? 1177 SER A N   1 
ATOM   1508 C CA  . SER A 1 208 ? 28.074  24.963 65.231  1.00 20.98 ? 1177 SER A CA  1 
ATOM   1509 C C   . SER A 1 208 ? 28.882  25.927 64.366  1.00 22.59 ? 1177 SER A C   1 
ATOM   1510 O O   . SER A 1 208 ? 28.351  26.560 63.441  1.00 22.19 ? 1177 SER A O   1 
ATOM   1511 C CB  . SER A 1 208 ? 28.270  23.536 64.728  1.00 20.97 ? 1177 SER A CB  1 
ATOM   1512 O OG  . SER A 1 208 ? 27.699  23.362 63.444  1.00 18.51 ? 1177 SER A OG  1 
ATOM   1513 N N   . PRO A 1 209 ? 30.188  26.057 64.669  1.00 21.58 ? 1178 PRO A N   1 
ATOM   1514 C CA  . PRO A 1 209 ? 31.080  26.938 63.922  1.00 20.14 ? 1178 PRO A CA  1 
ATOM   1515 C C   . PRO A 1 209 ? 31.020  26.665 62.422  1.00 21.00 ? 1178 PRO A C   1 
ATOM   1516 O O   . PRO A 1 209 ? 30.950  27.603 61.631  1.00 23.43 ? 1178 PRO A O   1 
ATOM   1517 C CB  . PRO A 1 209 ? 32.444  26.615 64.513  1.00 20.25 ? 1178 PRO A CB  1 
ATOM   1518 C CG  . PRO A 1 209 ? 32.114  26.319 65.943  1.00 20.91 ? 1178 PRO A CG  1 
ATOM   1519 C CD  . PRO A 1 209 ? 30.891  25.452 65.816  1.00 20.83 ? 1178 PRO A CD  1 
ATOM   1520 N N   . GLU A 1 210 ? 31.040  25.389 62.032  1.00 19.43 ? 1179 GLU A N   1 
ATOM   1521 C CA  . GLU A 1 210 ? 31.004  25.023 60.617  1.00 19.48 ? 1179 GLU A CA  1 
ATOM   1522 C C   . GLU A 1 210 ? 29.646  25.264 59.951  1.00 20.84 ? 1179 GLU A C   1 
ATOM   1523 O O   . GLU A 1 210 ? 29.595  25.620 58.779  1.00 19.31 ? 1179 GLU A O   1 
ATOM   1524 C CB  . GLU A 1 210 ? 31.429  23.559 60.415  1.00 19.40 ? 1179 GLU A CB  1 
ATOM   1525 C CG  . GLU A 1 210 ? 30.420  22.522 60.846  1.00 20.61 ? 1179 GLU A CG  1 
ATOM   1526 C CD  . GLU A 1 210 ? 30.496  22.208 62.323  1.00 21.01 ? 1179 GLU A CD  1 
ATOM   1527 O OE1 . GLU A 1 210 ? 30.843  23.106 63.113  1.00 19.87 ? 1179 GLU A OE1 1 
ATOM   1528 O OE2 . GLU A 1 210 ? 30.190  21.060 62.697  1.00 23.39 ? 1179 GLU A OE2 1 
ATOM   1529 N N   . SER A 1 211 ? 28.557  25.069 60.692  1.00 22.35 ? 1180 SER A N   1 
ATOM   1530 C CA  . SER A 1 211 ? 27.214  25.299 60.149  1.00 24.98 ? 1180 SER A CA  1 
ATOM   1531 C C   . SER A 1 211 ? 27.074  26.787 59.872  1.00 25.14 ? 1180 SER A C   1 
ATOM   1532 O O   . SER A 1 211 ? 26.470  27.196 58.876  1.00 23.76 ? 1180 SER A O   1 
ATOM   1533 C CB  . SER A 1 211 ? 26.114  24.888 61.144  1.00 24.94 ? 1180 SER A CB  1 
ATOM   1534 O OG  . SER A 1 211 ? 26.077  23.492 61.369  1.00 26.36 ? 1180 SER A OG  1 
ATOM   1535 N N   . LEU A 1 212 ? 27.628  27.588 60.774  1.00 24.57 ? 1181 LEU A N   1 
ATOM   1536 C CA  . LEU A 1 212 ? 27.576  29.028 60.628  1.00 26.78 ? 1181 LEU A CA  1 
ATOM   1537 C C   . LEU A 1 212 ? 28.360  29.460 59.404  1.00 27.70 ? 1181 LEU A C   1 
ATOM   1538 O O   . LEU A 1 212 ? 27.864  30.218 58.581  1.00 29.79 ? 1181 LEU A O   1 
ATOM   1539 C CB  . LEU A 1 212 ? 28.163  29.716 61.864  1.00 27.63 ? 1181 LEU A CB  1 
ATOM   1540 C CG  . LEU A 1 212 ? 27.232  30.015 63.042  1.00 29.09 ? 1181 LEU A CG  1 
ATOM   1541 C CD1 . LEU A 1 212 ? 28.040  30.348 64.300  1.00 26.96 ? 1181 LEU A CD1 1 
ATOM   1542 C CD2 . LEU A 1 212 ? 26.311  31.163 62.654  1.00 27.44 ? 1181 LEU A CD2 1 
ATOM   1543 N N   . LYS A 1 213 ? 29.580  28.956 59.273  1.00 28.13 ? 1182 LYS A N   1 
ATOM   1544 C CA  . LYS A 1 213 ? 30.437  29.344 58.165  1.00 28.01 ? 1182 LYS A CA  1 
ATOM   1545 C C   . LYS A 1 213 ? 30.172  28.705 56.813  1.00 27.28 ? 1182 LYS A C   1 
ATOM   1546 O O   . LYS A 1 213 ? 30.366  29.347 55.794  1.00 27.14 ? 1182 LYS A O   1 
ATOM   1547 C CB  . LYS A 1 213 ? 31.897  29.116 58.540  1.00 28.34 ? 1182 LYS A CB  1 
ATOM   1548 C CG  . LYS A 1 213 ? 32.844  29.944 57.711  1.00 31.40 ? 1182 LYS A CG  1 
ATOM   1549 C CD  . LYS A 1 213 ? 34.255  29.938 58.278  1.00 34.60 ? 1182 LYS A CD  1 
ATOM   1550 C CE  . LYS A 1 213 ? 35.085  31.088 57.696  1.00 36.06 ? 1182 LYS A CE  1 
ATOM   1551 N NZ  . LYS A 1 213 ? 35.057  31.130 56.198  1.00 35.71 ? 1182 LYS A NZ  1 
ATOM   1552 N N   . ASP A 1 214 ? 29.744  27.447 56.791  1.00 27.00 ? 1183 ASP A N   1 
ATOM   1553 C CA  . ASP A 1 214 ? 29.495  26.760 55.528  1.00 25.66 ? 1183 ASP A CA  1 
ATOM   1554 C C   . ASP A 1 214 ? 28.021  26.496 55.254  1.00 26.72 ? 1183 ASP A C   1 
ATOM   1555 O O   . ASP A 1 214 ? 27.657  26.028 54.177  1.00 28.23 ? 1183 ASP A O   1 
ATOM   1556 C CB  . ASP A 1 214 ? 30.246  25.431 55.497  1.00 27.26 ? 1183 ASP A CB  1 
ATOM   1557 C CG  . ASP A 1 214 ? 31.730  25.592 55.745  1.00 29.95 ? 1183 ASP A CG  1 
ATOM   1558 O OD1 . ASP A 1 214 ? 32.213  25.134 56.805  1.00 30.52 ? 1183 ASP A OD1 1 
ATOM   1559 O OD2 . ASP A 1 214 ? 32.414  26.182 54.880  1.00 30.10 ? 1183 ASP A OD2 1 
ATOM   1560 N N   . GLY A 1 215 ? 27.170  26.783 56.229  1.00 26.33 ? 1184 GLY A N   1 
ATOM   1561 C CA  . GLY A 1 215 ? 25.755  26.550 56.040  1.00 26.22 ? 1184 GLY A CA  1 
ATOM   1562 C C   . GLY A 1 215 ? 25.348  25.088 56.085  1.00 25.75 ? 1184 GLY A C   1 
ATOM   1563 O O   . GLY A 1 215 ? 24.178  24.770 55.864  1.00 26.39 ? 1184 GLY A O   1 
ATOM   1564 N N   . VAL A 1 216 ? 26.289  24.195 56.379  1.00 23.34 ? 1185 VAL A N   1 
ATOM   1565 C CA  . VAL A 1 216 ? 25.967  22.775 56.444  1.00 23.63 ? 1185 VAL A CA  1 
ATOM   1566 C C   . VAL A 1 216 ? 25.511  22.295 57.829  1.00 23.68 ? 1185 VAL A C   1 
ATOM   1567 O O   . VAL A 1 216 ? 25.920  22.829 58.850  1.00 21.74 ? 1185 VAL A O   1 
ATOM   1568 C CB  . VAL A 1 216 ? 27.171  21.904 55.985  1.00 24.10 ? 1185 VAL A CB  1 
ATOM   1569 C CG1 . VAL A 1 216 ? 27.582  22.282 54.553  1.00 23.14 ? 1185 VAL A CG1 1 
ATOM   1570 C CG2 . VAL A 1 216 ? 28.328  22.073 56.935  1.00 22.57 ? 1185 VAL A CG2 1 
ATOM   1571 N N   . PHE A 1 217 ? 24.638  21.292 57.844  1.00 25.12 ? 1186 PHE A N   1 
ATOM   1572 C CA  . PHE A 1 217 ? 24.133  20.705 59.085  1.00 26.79 ? 1186 PHE A CA  1 
ATOM   1573 C C   . PHE A 1 217 ? 24.317  19.198 58.997  1.00 26.69 ? 1186 PHE A C   1 
ATOM   1574 O O   . PHE A 1 217 ? 23.811  18.563 58.077  1.00 29.27 ? 1186 PHE A O   1 
ATOM   1575 C CB  . PHE A 1 217 ? 22.645  21.014 59.289  1.00 26.80 ? 1186 PHE A CB  1 
ATOM   1576 C CG  . PHE A 1 217 ? 22.366  22.434 59.677  1.00 29.23 ? 1186 PHE A CG  1 
ATOM   1577 C CD1 . PHE A 1 217 ? 22.457  23.457 58.744  1.00 30.28 ? 1186 PHE A CD1 1 
ATOM   1578 C CD2 . PHE A 1 217 ? 22.025  22.754 60.991  1.00 32.12 ? 1186 PHE A CD2 1 
ATOM   1579 C CE1 . PHE A 1 217 ? 22.214  24.782 59.108  1.00 30.64 ? 1186 PHE A CE1 1 
ATOM   1580 C CE2 . PHE A 1 217 ? 21.780  24.078 61.371  1.00 31.52 ? 1186 PHE A CE2 1 
ATOM   1581 C CZ  . PHE A 1 217 ? 21.875  25.093 60.426  1.00 32.35 ? 1186 PHE A CZ  1 
ATOM   1582 N N   . THR A 1 218 ? 25.029  18.623 59.956  1.00 25.57 ? 1187 THR A N   1 
ATOM   1583 C CA  . THR A 1 218 ? 25.285  17.188 59.947  1.00 24.31 ? 1187 THR A CA  1 
ATOM   1584 C C   . THR A 1 218 ? 24.979  16.571 61.298  1.00 24.36 ? 1187 THR A C   1 
ATOM   1585 O O   . THR A 1 218 ? 24.490  17.247 62.197  1.00 25.34 ? 1187 THR A O   1 
ATOM   1586 C CB  . THR A 1 218 ? 26.761  16.904 59.654  1.00 24.21 ? 1187 THR A CB  1 
ATOM   1587 O OG1 . THR A 1 218 ? 27.550  17.317 60.777  1.00 21.33 ? 1187 THR A OG1 1 
ATOM   1588 C CG2 . THR A 1 218 ? 27.217  17.665 58.426  1.00 22.40 ? 1187 THR A CG2 1 
ATOM   1589 N N   . THR A 1 219 ? 25.276  15.286 61.446  1.00 23.11 ? 1188 THR A N   1 
ATOM   1590 C CA  . THR A 1 219 ? 25.048  14.633 62.726  1.00 22.37 ? 1188 THR A CA  1 
ATOM   1591 C C   . THR A 1 219 ? 25.882  15.422 63.751  1.00 21.30 ? 1188 THR A C   1 
ATOM   1592 O O   . THR A 1 219 ? 25.432  15.671 64.877  1.00 17.64 ? 1188 THR A O   1 
ATOM   1593 C CB  . THR A 1 219 ? 25.516  13.143 62.694  1.00 23.91 ? 1188 THR A CB  1 
ATOM   1594 O OG1 . THR A 1 219 ? 24.842  12.405 63.720  1.00 26.24 ? 1188 THR A OG1 1 
ATOM   1595 C CG2 . THR A 1 219 ? 27.019  13.035 62.936  1.00 20.95 ? 1188 THR A CG2 1 
ATOM   1596 N N   . TYR A 1 220 ? 27.084  15.828 63.319  1.00 19.98 ? 1189 TYR A N   1 
ATOM   1597 C CA  . TYR A 1 220 ? 28.040  16.591 64.135  1.00 20.40 ? 1189 TYR A CA  1 
ATOM   1598 C C   . TYR A 1 220 ? 27.494  17.917 64.674  1.00 20.01 ? 1189 TYR A C   1 
ATOM   1599 O O   . TYR A 1 220 ? 27.721  18.258 65.837  1.00 21.46 ? 1189 TYR A O   1 
ATOM   1600 C CB  . TYR A 1 220 ? 29.316  16.894 63.338  1.00 19.12 ? 1189 TYR A CB  1 
ATOM   1601 C CG  . TYR A 1 220 ? 29.949  15.693 62.695  1.00 18.67 ? 1189 TYR A CG  1 
ATOM   1602 C CD1 . TYR A 1 220 ? 30.513  15.784 61.428  1.00 16.28 ? 1189 TYR A CD1 1 
ATOM   1603 C CD2 . TYR A 1 220 ? 29.958  14.458 63.336  1.00 17.32 ? 1189 TYR A CD2 1 
ATOM   1604 C CE1 . TYR A 1 220 ? 31.060  14.678 60.816  1.00 17.83 ? 1189 TYR A CE1 1 
ATOM   1605 C CE2 . TYR A 1 220 ? 30.505  13.343 62.735  1.00 15.84 ? 1189 TYR A CE2 1 
ATOM   1606 C CZ  . TYR A 1 220 ? 31.056  13.452 61.475  1.00 17.86 ? 1189 TYR A CZ  1 
ATOM   1607 O OH  . TYR A 1 220 ? 31.615  12.339 60.873  1.00 18.82 ? 1189 TYR A OH  1 
ATOM   1608 N N   . SER A 1 221 ? 26.799  18.672 63.831  1.00 18.09 ? 1190 SER A N   1 
ATOM   1609 C CA  . SER A 1 221 ? 26.251  19.944 64.269  1.00 19.72 ? 1190 SER A CA  1 
ATOM   1610 C C   . SER A 1 221 ? 25.132  19.725 65.293  1.00 18.76 ? 1190 SER A C   1 
ATOM   1611 O O   . SER A 1 221 ? 24.758  20.642 66.021  1.00 16.48 ? 1190 SER A O   1 
ATOM   1612 C CB  . SER A 1 221 ? 25.751  20.764 63.064  1.00 21.28 ? 1190 SER A CB  1 
ATOM   1613 O OG  . SER A 1 221 ? 24.897  20.011 62.223  1.00 23.00 ? 1190 SER A OG  1 
ATOM   1614 N N   . ASP A 1 222 ? 24.612  18.502 65.344  1.00 18.74 ? 1191 ASP A N   1 
ATOM   1615 C CA  . ASP A 1 222 ? 23.567  18.153 66.295  1.00 19.62 ? 1191 ASP A CA  1 
ATOM   1616 C C   . ASP A 1 222 ? 24.207  17.942 67.654  1.00 18.70 ? 1191 ASP A C   1 
ATOM   1617 O O   . ASP A 1 222 ? 23.671  18.357 68.676  1.00 19.54 ? 1191 ASP A O   1 
ATOM   1618 C CB  . ASP A 1 222 ? 22.840  16.881 65.860  1.00 23.32 ? 1191 ASP A CB  1 
ATOM   1619 C CG  . ASP A 1 222 ? 21.667  17.167 64.936  1.00 26.58 ? 1191 ASP A CG  1 
ATOM   1620 O OD1 . ASP A 1 222 ? 21.145  16.214 64.320  1.00 28.76 ? 1191 ASP A OD1 1 
ATOM   1621 O OD2 . ASP A 1 222 ? 21.261  18.345 64.833  1.00 27.25 ? 1191 ASP A OD2 1 
ATOM   1622 N N   . VAL A 1 223 ? 25.356  17.287 67.670  1.00 16.96 ? 1192 VAL A N   1 
ATOM   1623 C CA  . VAL A 1 223 ? 26.043  17.075 68.926  1.00 16.00 ? 1192 VAL A CA  1 
ATOM   1624 C C   . VAL A 1 223 ? 26.410  18.457 69.459  1.00 16.27 ? 1192 VAL A C   1 
ATOM   1625 O O   . VAL A 1 223 ? 26.294  18.725 70.660  1.00 16.06 ? 1192 VAL A O   1 
ATOM   1626 C CB  . VAL A 1 223 ? 27.308  16.212 68.731  1.00 15.01 ? 1192 VAL A CB  1 
ATOM   1627 C CG1 . VAL A 1 223 ? 28.208  16.295 69.957  1.00 10.95 ? 1192 VAL A CG1 1 
ATOM   1628 C CG2 . VAL A 1 223 ? 26.894  14.770 68.482  1.00 13.57 ? 1192 VAL A CG2 1 
ATOM   1629 N N   . TRP A 1 224 ? 26.830  19.342 68.561  1.00 14.18 ? 1193 TRP A N   1 
ATOM   1630 C CA  . TRP A 1 224 ? 27.188  20.681 68.977  1.00 15.22 ? 1193 TRP A CA  1 
ATOM   1631 C C   . TRP A 1 224 ? 26.011  21.346 69.704  1.00 16.34 ? 1193 TRP A C   1 
ATOM   1632 O O   . TRP A 1 224 ? 26.169  21.879 70.806  1.00 16.67 ? 1193 TRP A O   1 
ATOM   1633 C CB  . TRP A 1 224 ? 27.619  21.536 67.774  1.00 15.43 ? 1193 TRP A CB  1 
ATOM   1634 C CG  . TRP A 1 224 ? 27.853  22.967 68.179  1.00 18.96 ? 1193 TRP A CG  1 
ATOM   1635 C CD1 . TRP A 1 224 ? 26.894  23.895 68.493  1.00 17.94 ? 1193 TRP A CD1 1 
ATOM   1636 C CD2 . TRP A 1 224 ? 29.114  23.577 68.497  1.00 19.64 ? 1193 TRP A CD2 1 
ATOM   1637 N NE1 . TRP A 1 224 ? 27.476  25.027 69.000  1.00 19.35 ? 1193 TRP A NE1 1 
ATOM   1638 C CE2 . TRP A 1 224 ? 28.837  24.864 69.014  1.00 18.71 ? 1193 TRP A CE2 1 
ATOM   1639 C CE3 . TRP A 1 224 ? 30.447  23.159 68.400  1.00 20.27 ? 1193 TRP A CE3 1 
ATOM   1640 C CZ2 . TRP A 1 224 ? 29.842  25.738 69.434  1.00 17.85 ? 1193 TRP A CZ2 1 
ATOM   1641 C CZ3 . TRP A 1 224 ? 31.450  24.030 68.816  1.00 22.87 ? 1193 TRP A CZ3 1 
ATOM   1642 C CH2 . TRP A 1 224 ? 31.136  25.309 69.328  1.00 21.74 ? 1193 TRP A CH2 1 
ATOM   1643 N N   . SER A 1 225 ? 24.834  21.308 69.081  1.00 16.82 ? 1194 SER A N   1 
ATOM   1644 C CA  . SER A 1 225 ? 23.633  21.905 69.650  1.00 15.73 ? 1194 SER A CA  1 
ATOM   1645 C C   . SER A 1 225 ? 23.303  21.231 70.959  1.00 16.16 ? 1194 SER A C   1 
ATOM   1646 O O   . SER A 1 225 ? 22.907  21.896 71.916  1.00 17.21 ? 1194 SER A O   1 
ATOM   1647 C CB  . SER A 1 225 ? 22.465  21.753 68.681  1.00 14.68 ? 1194 SER A CB  1 
ATOM   1648 O OG  . SER A 1 225 ? 22.818  22.293 67.423  1.00 16.43 ? 1194 SER A OG  1 
ATOM   1649 N N   . PHE A 1 226 ? 23.466  19.908 70.988  1.00 15.85 ? 1195 PHE A N   1 
ATOM   1650 C CA  . PHE A 1 226 ? 23.212  19.102 72.184  1.00 14.98 ? 1195 PHE A CA  1 
ATOM   1651 C C   . PHE A 1 226 ? 23.959  19.748 73.332  1.00 14.00 ? 1195 PHE A C   1 
ATOM   1652 O O   . PHE A 1 226 ? 23.409  19.940 74.419  1.00 13.36 ? 1195 PHE A O   1 
ATOM   1653 C CB  . PHE A 1 226 ? 23.723  17.668 71.984  1.00 14.90 ? 1195 PHE A CB  1 
ATOM   1654 C CG  . PHE A 1 226 ? 23.589  16.789 73.202  1.00 13.73 ? 1195 PHE A CG  1 
ATOM   1655 C CD1 . PHE A 1 226 ? 22.342  16.388 73.657  1.00 13.22 ? 1195 PHE A CD1 1 
ATOM   1656 C CD2 . PHE A 1 226 ? 24.717  16.370 73.902  1.00 13.16 ? 1195 PHE A CD2 1 
ATOM   1657 C CE1 . PHE A 1 226 ? 22.224  15.583 74.789  1.00 12.05 ? 1195 PHE A CE1 1 
ATOM   1658 C CE2 . PHE A 1 226 ? 24.600  15.569 75.034  1.00 10.14 ? 1195 PHE A CE2 1 
ATOM   1659 C CZ  . PHE A 1 226 ? 23.358  15.177 75.474  1.00 9.62  ? 1195 PHE A CZ  1 
ATOM   1660 N N   . GLY A 1 227 ? 25.216  20.086 73.067  1.00 12.46 ? 1196 GLY A N   1 
ATOM   1661 C CA  . GLY A 1 227 ? 26.046  20.721 74.071  1.00 15.66 ? 1196 GLY A CA  1 
ATOM   1662 C C   . GLY A 1 227 ? 25.495  22.051 74.559  1.00 16.76 ? 1196 GLY A C   1 
ATOM   1663 O O   . GLY A 1 227 ? 25.588  22.359 75.742  1.00 17.03 ? 1196 GLY A O   1 
ATOM   1664 N N   . VAL A 1 228 ? 24.934  22.853 73.660  1.00 17.45 ? 1197 VAL A N   1 
ATOM   1665 C CA  . VAL A 1 228 ? 24.375  24.130 74.071  1.00 18.46 ? 1197 VAL A CA  1 
ATOM   1666 C C   . VAL A 1 228 ? 23.128  23.833 74.907  1.00 20.52 ? 1197 VAL A C   1 
ATOM   1667 O O   . VAL A 1 228 ? 22.768  24.618 75.792  1.00 22.63 ? 1197 VAL A O   1 
ATOM   1668 C CB  . VAL A 1 228 ? 24.001  25.021 72.852  1.00 18.07 ? 1197 VAL A CB  1 
ATOM   1669 C CG1 . VAL A 1 228 ? 23.482  26.380 73.324  1.00 14.89 ? 1197 VAL A CG1 1 
ATOM   1670 C CG2 . VAL A 1 228 ? 25.217  25.208 71.956  1.00 16.68 ? 1197 VAL A CG2 1 
ATOM   1671 N N   . VAL A 1 229 ? 22.476  22.699 74.644  1.00 19.80 ? 1198 VAL A N   1 
ATOM   1672 C CA  . VAL A 1 229 ? 21.288  22.323 75.419  1.00 19.52 ? 1198 VAL A CA  1 
ATOM   1673 C C   . VAL A 1 229 ? 21.686  21.871 76.822  1.00 20.48 ? 1198 VAL A C   1 
ATOM   1674 O O   . VAL A 1 229 ? 20.984  22.167 77.787  1.00 21.09 ? 1198 VAL A O   1 
ATOM   1675 C CB  . VAL A 1 229 ? 20.476  21.184 74.764  1.00 17.00 ? 1198 VAL A CB  1 
ATOM   1676 C CG1 . VAL A 1 229 ? 19.386  20.754 75.695  1.00 18.52 ? 1198 VAL A CG1 1 
ATOM   1677 C CG2 . VAL A 1 229 ? 19.845  21.654 73.466  1.00 18.21 ? 1198 VAL A CG2 1 
ATOM   1678 N N   . LEU A 1 230 ? 22.800  21.145 76.938  1.00 21.79 ? 1199 LEU A N   1 
ATOM   1679 C CA  . LEU A 1 230 ? 23.272  20.694 78.251  1.00 22.54 ? 1199 LEU A CA  1 
ATOM   1680 C C   . LEU A 1 230 ? 23.519  21.940 79.078  1.00 23.26 ? 1199 LEU A C   1 
ATOM   1681 O O   . LEU A 1 230 ? 23.298  21.969 80.292  1.00 23.25 ? 1199 LEU A O   1 
ATOM   1682 C CB  . LEU A 1 230 ? 24.572  19.896 78.131  1.00 20.39 ? 1199 LEU A CB  1 
ATOM   1683 C CG  . LEU A 1 230 ? 24.416  18.423 77.752  1.00 21.89 ? 1199 LEU A CG  1 
ATOM   1684 C CD1 . LEU A 1 230 ? 25.776  17.724 77.778  1.00 21.06 ? 1199 LEU A CD1 1 
ATOM   1685 C CD2 . LEU A 1 230 ? 23.449  17.761 78.727  1.00 19.31 ? 1199 LEU A CD2 1 
ATOM   1686 N N   . TRP A 1 231 ? 23.984  22.972 78.386  1.00 24.19 ? 1200 TRP A N   1 
ATOM   1687 C CA  . TRP A 1 231 ? 24.251  24.261 78.994  1.00 24.70 ? 1200 TRP A CA  1 
ATOM   1688 C C   . TRP A 1 231 ? 22.905  24.801 79.501  1.00 24.14 ? 1200 TRP A C   1 
ATOM   1689 O O   . TRP A 1 231 ? 22.763  25.114 80.681  1.00 24.67 ? 1200 TRP A O   1 
ATOM   1690 C CB  . TRP A 1 231 ? 24.849  25.199 77.946  1.00 25.89 ? 1200 TRP A CB  1 
ATOM   1691 C CG  . TRP A 1 231 ? 25.448  26.431 78.522  1.00 25.74 ? 1200 TRP A CG  1 
ATOM   1692 C CD1 . TRP A 1 231 ? 26.651  26.538 79.144  1.00 25.27 ? 1200 TRP A CD1 1 
ATOM   1693 C CD2 . TRP A 1 231 ? 24.856  27.731 78.549  1.00 25.90 ? 1200 TRP A CD2 1 
ATOM   1694 N NE1 . TRP A 1 231 ? 26.852  27.830 79.558  1.00 27.48 ? 1200 TRP A NE1 1 
ATOM   1695 C CE2 . TRP A 1 231 ? 25.766  28.586 79.207  1.00 26.57 ? 1200 TRP A CE2 1 
ATOM   1696 C CE3 . TRP A 1 231 ? 23.642  28.257 78.082  1.00 26.06 ? 1200 TRP A CE3 1 
ATOM   1697 C CZ2 . TRP A 1 231 ? 25.508  29.939 79.412  1.00 25.66 ? 1200 TRP A CZ2 1 
ATOM   1698 C CZ3 . TRP A 1 231 ? 23.379  29.602 78.283  1.00 27.31 ? 1200 TRP A CZ3 1 
ATOM   1699 C CH2 . TRP A 1 231 ? 24.313  30.431 78.945  1.00 29.32 ? 1200 TRP A CH2 1 
ATOM   1700 N N   . GLU A 1 232 ? 21.918  24.898 78.611  1.00 22.35 ? 1201 GLU A N   1 
ATOM   1701 C CA  . GLU A 1 232 ? 20.593  25.364 79.002  1.00 21.72 ? 1201 GLU A CA  1 
ATOM   1702 C C   . GLU A 1 232 ? 20.077  24.644 80.257  1.00 22.05 ? 1201 GLU A C   1 
ATOM   1703 O O   . GLU A 1 232 ? 19.606  25.287 81.194  1.00 23.62 ? 1201 GLU A O   1 
ATOM   1704 C CB  . GLU A 1 232 ? 19.588  25.149 77.876  1.00 20.21 ? 1201 GLU A CB  1 
ATOM   1705 C CG  . GLU A 1 232 ? 19.568  26.213 76.799  1.00 21.16 ? 1201 GLU A CG  1 
ATOM   1706 C CD  . GLU A 1 232 ? 18.563  25.891 75.696  1.00 21.19 ? 1201 GLU A CD  1 
ATOM   1707 O OE1 . GLU A 1 232 ? 18.823  24.950 74.913  1.00 21.33 ? 1201 GLU A OE1 1 
ATOM   1708 O OE2 . GLU A 1 232 ? 17.505  26.564 75.622  1.00 19.23 ? 1201 GLU A OE2 1 
ATOM   1709 N N   . ILE A 1 233 ? 20.157  23.318 80.283  1.00 20.24 ? 1202 ILE A N   1 
ATOM   1710 C CA  . ILE A 1 233 ? 19.672  22.577 81.438  1.00 20.22 ? 1202 ILE A CA  1 
ATOM   1711 C C   . ILE A 1 233 ? 20.300  23.080 82.739  1.00 22.07 ? 1202 ILE A C   1 
ATOM   1712 O O   . ILE A 1 233 ? 19.597  23.299 83.727  1.00 22.46 ? 1202 ILE A O   1 
ATOM   1713 C CB  . ILE A 1 233 ? 19.955  21.061 81.286  1.00 19.38 ? 1202 ILE A CB  1 
ATOM   1714 C CG1 . ILE A 1 233 ? 19.075  20.476 80.183  1.00 19.11 ? 1202 ILE A CG1 1 
ATOM   1715 C CG2 . ILE A 1 233 ? 19.676  20.325 82.591  1.00 16.59 ? 1202 ILE A CG2 1 
ATOM   1716 C CD1 . ILE A 1 233 ? 19.379  19.024 79.872  1.00 18.44 ? 1202 ILE A CD1 1 
ATOM   1717 N N   . ALA A 1 234 ? 21.617  23.285 82.717  1.00 23.32 ? 1203 ALA A N   1 
ATOM   1718 C CA  . ALA A 1 234 ? 22.394  23.729 83.878  1.00 23.94 ? 1203 ALA A CA  1 
ATOM   1719 C C   . ALA A 1 234 ? 22.250  25.198 84.301  1.00 25.93 ? 1203 ALA A C   1 
ATOM   1720 O O   . ALA A 1 234 ? 22.352  25.519 85.487  1.00 28.52 ? 1203 ALA A O   1 
ATOM   1721 C CB  . ALA A 1 234 ? 23.853  23.422 83.635  1.00 24.52 ? 1203 ALA A CB  1 
ATOM   1722 N N   . THR A 1 235 ? 22.040  26.092 83.339  1.00 25.92 ? 1204 THR A N   1 
ATOM   1723 C CA  . THR A 1 235 ? 21.880  27.523 83.622  1.00 24.03 ? 1204 THR A CA  1 
ATOM   1724 C C   . THR A 1 235 ? 20.396  27.831 83.737  1.00 25.59 ? 1204 THR A C   1 
ATOM   1725 O O   . THR A 1 235 ? 19.982  28.992 83.648  1.00 26.94 ? 1204 THR A O   1 
ATOM   1726 C CB  . THR A 1 235 ? 22.404  28.390 82.468  1.00 20.77 ? 1204 THR A CB  1 
ATOM   1727 O OG1 . THR A 1 235 ? 21.622  28.118 81.298  1.00 17.64 ? 1204 THR A OG1 1 
ATOM   1728 C CG2 . THR A 1 235 ? 23.863  28.105 82.186  1.00 16.03 ? 1204 THR A CG2 1 
ATOM   1729 N N   . LEU A 1 236 ? 19.601  26.788 83.930  1.00 25.40 ? 1205 LEU A N   1 
ATOM   1730 C CA  . LEU A 1 236 ? 18.156  26.930 83.991  1.00 26.71 ? 1205 LEU A CA  1 
ATOM   1731 C C   . LEU A 1 236 ? 17.634  27.749 82.807  1.00 27.45 ? 1205 LEU A C   1 
ATOM   1732 O O   . LEU A 1 236 ? 16.769  28.607 82.944  1.00 28.69 ? 1205 LEU A O   1 
ATOM   1733 C CB  . LEU A 1 236 ? 17.719  27.532 85.328  1.00 25.64 ? 1205 LEU A CB  1 
ATOM   1734 C CG  . LEU A 1 236 ? 17.831  26.507 86.466  1.00 26.10 ? 1205 LEU A CG  1 
ATOM   1735 C CD1 . LEU A 1 236 ? 17.302  27.100 87.747  1.00 26.00 ? 1205 LEU A CD1 1 
ATOM   1736 C CD2 . LEU A 1 236 ? 17.058  25.243 86.111  1.00 24.17 ? 1205 LEU A CD2 1 
ATOM   1737 N N   . ALA A 1 237 ? 18.190  27.458 81.637  1.00 28.51 ? 1206 ALA A N   1 
ATOM   1738 C CA  . ALA A 1 237 ? 17.799  28.081 80.379  1.00 30.76 ? 1206 ALA A CA  1 
ATOM   1739 C C   . ALA A 1 237 ? 18.088  29.562 80.239  1.00 32.42 ? 1206 ALA A C   1 
ATOM   1740 O O   . ALA A 1 237 ? 17.176  30.384 80.089  1.00 32.37 ? 1206 ALA A O   1 
ATOM   1741 C CB  . ALA A 1 237 ? 16.317  27.809 80.090  1.00 29.55 ? 1206 ALA A CB  1 
ATOM   1742 N N   . GLU A 1 238 ? 19.372  29.888 80.281  1.00 33.27 ? 1207 GLU A N   1 
ATOM   1743 C CA  . GLU A 1 238 ? 19.823  31.252 80.100  1.00 34.16 ? 1207 GLU A CA  1 
ATOM   1744 C C   . GLU A 1 238 ? 20.101  31.380 78.605  1.00 34.90 ? 1207 GLU A C   1 
ATOM   1745 O O   . GLU A 1 238 ? 20.495  30.401 77.969  1.00 36.60 ? 1207 GLU A O   1 
ATOM   1746 C CB  . GLU A 1 238 ? 21.106  31.489 80.895  1.00 34.71 ? 1207 GLU A CB  1 
ATOM   1747 C CG  . GLU A 1 238 ? 20.869  31.956 82.314  1.00 37.10 ? 1207 GLU A CG  1 
ATOM   1748 C CD  . GLU A 1 238 ? 20.122  33.276 82.347  1.00 39.94 ? 1207 GLU A CD  1 
ATOM   1749 O OE1 . GLU A 1 238 ? 20.592  34.230 81.688  1.00 40.89 ? 1207 GLU A OE1 1 
ATOM   1750 O OE2 . GLU A 1 238 ? 19.070  33.362 83.023  1.00 40.36 ? 1207 GLU A OE2 1 
ATOM   1751 N N   . GLN A 1 239 ? 19.870  32.560 78.032  1.00 34.48 ? 1208 GLN A N   1 
ATOM   1752 C CA  . GLN A 1 239 ? 20.142  32.760 76.612  1.00 33.53 ? 1208 GLN A CA  1 
ATOM   1753 C C   . GLN A 1 239 ? 21.644  32.580 76.430  1.00 32.52 ? 1208 GLN A C   1 
ATOM   1754 O O   . GLN A 1 239 ? 22.443  33.176 77.159  1.00 32.31 ? 1208 GLN A O   1 
ATOM   1755 C CB  . GLN A 1 239 ? 19.737  34.170 76.166  1.00 35.56 ? 1208 GLN A CB  1 
ATOM   1756 C CG  . GLN A 1 239 ? 18.244  34.367 75.833  1.00 37.89 ? 1208 GLN A CG  1 
ATOM   1757 C CD  . GLN A 1 239 ? 17.854  33.849 74.442  1.00 38.68 ? 1208 GLN A CD  1 
ATOM   1758 O OE1 . GLN A 1 239 ? 17.294  32.756 74.302  1.00 37.77 ? 1208 GLN A OE1 1 
ATOM   1759 N NE2 . GLN A 1 239 ? 18.153  34.640 73.410  1.00 37.38 ? 1208 GLN A NE2 1 
ATOM   1760 N N   . PRO A 1 240 ? 22.053  31.730 75.474  1.00 30.11 ? 1209 PRO A N   1 
ATOM   1761 C CA  . PRO A 1 240 ? 23.486  31.529 75.266  1.00 27.70 ? 1209 PRO A CA  1 
ATOM   1762 C C   . PRO A 1 240 ? 24.139  32.790 74.706  1.00 27.02 ? 1209 PRO A C   1 
ATOM   1763 O O   . PRO A 1 240 ? 23.566  33.456 73.837  1.00 24.21 ? 1209 PRO A O   1 
ATOM   1764 C CB  . PRO A 1 240 ? 23.529  30.364 74.281  1.00 26.88 ? 1209 PRO A CB  1 
ATOM   1765 C CG  . PRO A 1 240 ? 22.287  29.612 74.582  1.00 27.54 ? 1209 PRO A CG  1 
ATOM   1766 C CD  . PRO A 1 240 ? 21.275  30.719 74.738  1.00 29.25 ? 1209 PRO A CD  1 
ATOM   1767 N N   . TYR A 1 241 ? 25.335  33.105 75.210  1.00 27.09 ? 1210 TYR A N   1 
ATOM   1768 C CA  . TYR A 1 241 ? 26.098  34.277 74.774  1.00 29.14 ? 1210 TYR A CA  1 
ATOM   1769 C C   . TYR A 1 241 ? 25.317  35.558 75.090  1.00 32.14 ? 1210 TYR A C   1 
ATOM   1770 O O   . TYR A 1 241 ? 25.372  36.547 74.356  1.00 31.54 ? 1210 TYR A O   1 
ATOM   1771 C CB  . TYR A 1 241 ? 26.392  34.175 73.271  1.00 25.94 ? 1210 TYR A CB  1 
ATOM   1772 C CG  . TYR A 1 241 ? 26.952  32.829 72.856  1.00 23.26 ? 1210 TYR A CG  1 
ATOM   1773 C CD1 . TYR A 1 241 ? 28.328  32.605 72.777  1.00 20.74 ? 1210 TYR A CD1 1 
ATOM   1774 C CD2 . TYR A 1 241 ? 26.095  31.757 72.582  1.00 21.44 ? 1210 TYR A CD2 1 
ATOM   1775 C CE1 . TYR A 1 241 ? 28.828  31.333 72.431  1.00 20.83 ? 1210 TYR A CE1 1 
ATOM   1776 C CE2 . TYR A 1 241 ? 26.579  30.503 72.246  1.00 18.25 ? 1210 TYR A CE2 1 
ATOM   1777 C CZ  . TYR A 1 241 ? 27.937  30.291 72.169  1.00 18.72 ? 1210 TYR A CZ  1 
ATOM   1778 O OH  . TYR A 1 241 ? 28.384  29.038 71.827  1.00 18.71 ? 1210 TYR A OH  1 
ATOM   1779 N N   . GLN A 1 242 ? 24.594  35.501 76.203  1.00 35.95 ? 1211 GLN A N   1 
ATOM   1780 C CA  . GLN A 1 242 ? 23.759  36.586 76.723  1.00 39.86 ? 1211 GLN A CA  1 
ATOM   1781 C C   . GLN A 1 242 ? 24.317  37.988 76.437  1.00 40.86 ? 1211 GLN A C   1 
ATOM   1782 O O   . GLN A 1 242 ? 23.627  38.847 75.878  1.00 40.55 ? 1211 GLN A O   1 
ATOM   1783 C CB  . GLN A 1 242 ? 23.591  36.370 78.231  1.00 41.03 ? 1211 GLN A CB  1 
ATOM   1784 C CG  . GLN A 1 242 ? 22.612  37.262 78.942  1.00 42.16 ? 1211 GLN A CG  1 
ATOM   1785 C CD  . GLN A 1 242 ? 22.510  36.895 80.412  1.00 44.62 ? 1211 GLN A CD  1 
ATOM   1786 O OE1 . GLN A 1 242 ? 23.520  36.828 81.116  1.00 46.02 ? 1211 GLN A OE1 1 
ATOM   1787 N NE2 . GLN A 1 242 ? 21.293  36.651 80.883  1.00 45.73 ? 1211 GLN A NE2 1 
ATOM   1788 N N   . GLY A 1 243 ? 25.567  38.213 76.821  1.00 41.05 ? 1212 GLY A N   1 
ATOM   1789 C CA  . GLY A 1 243 ? 26.177  39.507 76.585  1.00 40.97 ? 1212 GLY A CA  1 
ATOM   1790 C C   . GLY A 1 243 ? 26.291  39.826 75.106  1.00 40.36 ? 1212 GLY A C   1 
ATOM   1791 O O   . GLY A 1 243 ? 25.888  40.901 74.672  1.00 41.75 ? 1212 GLY A O   1 
ATOM   1792 N N   . LEU A 1 244 ? 26.825  38.883 74.334  1.00 38.53 ? 1213 LEU A N   1 
ATOM   1793 C CA  . LEU A 1 244 ? 27.015  39.058 72.897  1.00 35.77 ? 1213 LEU A CA  1 
ATOM   1794 C C   . LEU A 1 244 ? 25.723  39.166 72.116  1.00 34.73 ? 1213 LEU A C   1 
ATOM   1795 O O   . LEU A 1 244 ? 24.750  38.485 72.415  1.00 35.81 ? 1213 LEU A O   1 
ATOM   1796 C CB  . LEU A 1 244 ? 27.814  37.888 72.331  1.00 36.18 ? 1213 LEU A CB  1 
ATOM   1797 C CG  . LEU A 1 244 ? 29.053  37.452 73.116  1.00 38.01 ? 1213 LEU A CG  1 
ATOM   1798 C CD1 . LEU A 1 244 ? 29.829  36.408 72.313  1.00 37.50 ? 1213 LEU A CD1 1 
ATOM   1799 C CD2 . LEU A 1 244 ? 29.926  38.659 73.410  1.00 37.37 ? 1213 LEU A CD2 1 
ATOM   1800 N N   . SER A 1 245 ? 25.713  40.022 71.104  1.00 33.96 ? 1214 SER A N   1 
ATOM   1801 C CA  . SER A 1 245 ? 24.533  40.160 70.263  1.00 33.91 ? 1214 SER A CA  1 
ATOM   1802 C C   . SER A 1 245 ? 24.615  39.063 69.203  1.00 34.12 ? 1214 SER A C   1 
ATOM   1803 O O   . SER A 1 245 ? 25.652  38.407 69.070  1.00 33.20 ? 1214 SER A O   1 
ATOM   1804 C CB  . SER A 1 245 ? 24.494  41.542 69.595  1.00 33.85 ? 1214 SER A CB  1 
ATOM   1805 O OG  . SER A 1 245 ? 25.640  41.783 68.798  1.00 33.55 ? 1214 SER A OG  1 
ATOM   1806 N N   . ASN A 1 246 ? 23.534  38.865 68.450  1.00 34.45 ? 1215 ASN A N   1 
ATOM   1807 C CA  . ASN A 1 246 ? 23.511  37.835 67.416  1.00 34.21 ? 1215 ASN A CA  1 
ATOM   1808 C C   . ASN A 1 246 ? 24.698  37.901 66.476  1.00 35.45 ? 1215 ASN A C   1 
ATOM   1809 O O   . ASN A 1 246 ? 25.308  36.878 66.155  1.00 35.69 ? 1215 ASN A O   1 
ATOM   1810 C CB  . ASN A 1 246 ? 22.236  37.923 66.586  1.00 32.63 ? 1215 ASN A CB  1 
ATOM   1811 C CG  . ASN A 1 246 ? 21.005  37.561 67.376  1.00 32.19 ? 1215 ASN A CG  1 
ATOM   1812 O OD1 . ASN A 1 246 ? 21.057  36.732 68.285  1.00 29.25 ? 1215 ASN A OD1 1 
ATOM   1813 N ND2 . ASN A 1 246 ? 19.878  38.164 67.019  1.00 31.73 ? 1215 ASN A ND2 1 
ATOM   1814 N N   . GLU A 1 247 ? 25.033  39.106 66.037  1.00 36.78 ? 1216 GLU A N   1 
ATOM   1815 C CA  . GLU A 1 247 ? 26.137  39.268 65.111  1.00 38.05 ? 1216 GLU A CA  1 
ATOM   1816 C C   . GLU A 1 247 ? 27.485  39.027 65.761  1.00 37.10 ? 1216 GLU A C   1 
ATOM   1817 O O   . GLU A 1 247 ? 28.430  38.592 65.107  1.00 36.64 ? 1216 GLU A O   1 
ATOM   1818 C CB  . GLU A 1 247 ? 26.110  40.662 64.495  1.00 40.30 ? 1216 GLU A CB  1 
ATOM   1819 C CG  . GLU A 1 247 ? 27.004  40.777 63.284  1.00 45.72 ? 1216 GLU A CG  1 
ATOM   1820 C CD  . GLU A 1 247 ? 26.643  39.775 62.188  1.00 49.59 ? 1216 GLU A CD  1 
ATOM   1821 O OE1 . GLU A 1 247 ? 25.478  39.801 61.723  1.00 51.70 ? 1216 GLU A OE1 1 
ATOM   1822 O OE2 . GLU A 1 247 ? 27.524  38.969 61.789  1.00 50.29 ? 1216 GLU A OE2 1 
ATOM   1823 N N   . GLN A 1 248 ? 27.572  39.303 67.054  1.00 36.39 ? 1217 GLN A N   1 
ATOM   1824 C CA  . GLN A 1 248 ? 28.826  39.119 67.762  1.00 35.58 ? 1217 GLN A CA  1 
ATOM   1825 C C   . GLN A 1 248 ? 29.060  37.642 68.032  1.00 33.93 ? 1217 GLN A C   1 
ATOM   1826 O O   . GLN A 1 248 ? 30.202  37.199 68.144  1.00 33.39 ? 1217 GLN A O   1 
ATOM   1827 C CB  . GLN A 1 248 ? 28.811  39.918 69.069  1.00 36.16 ? 1217 GLN A CB  1 
ATOM   1828 C CG  . GLN A 1 248 ? 28.441  41.378 68.864  1.00 36.81 ? 1217 GLN A CG  1 
ATOM   1829 C CD  . GLN A 1 248 ? 28.465  42.182 70.143  1.00 37.94 ? 1217 GLN A CD  1 
ATOM   1830 O OE1 . GLN A 1 248 ? 27.987  41.730 71.183  1.00 38.76 ? 1217 GLN A OE1 1 
ATOM   1831 N NE2 . GLN A 1 248 ? 29.009  43.394 70.070  1.00 38.03 ? 1217 GLN A NE2 1 
ATOM   1832 N N   . VAL A 1 249 ? 27.971  36.883 68.125  1.00 32.91 ? 1218 VAL A N   1 
ATOM   1833 C CA  . VAL A 1 249 ? 28.060  35.445 68.372  1.00 31.70 ? 1218 VAL A CA  1 
ATOM   1834 C C   . VAL A 1 249 ? 28.752  34.748 67.197  1.00 31.46 ? 1218 VAL A C   1 
ATOM   1835 O O   . VAL A 1 249 ? 29.664  33.937 67.395  1.00 30.65 ? 1218 VAL A O   1 
ATOM   1836 C CB  . VAL A 1 249 ? 26.660  34.818 68.576  1.00 30.03 ? 1218 VAL A CB  1 
ATOM   1837 C CG1 . VAL A 1 249 ? 26.781  33.316 68.807  1.00 27.57 ? 1218 VAL A CG1 1 
ATOM   1838 C CG2 . VAL A 1 249 ? 25.972  35.474 69.750  1.00 29.45 ? 1218 VAL A CG2 1 
ATOM   1839 N N   . LEU A 1 250 ? 28.320  35.078 65.981  1.00 30.16 ? 1219 LEU A N   1 
ATOM   1840 C CA  . LEU A 1 250 ? 28.888  34.499 64.771  1.00 29.02 ? 1219 LEU A CA  1 
ATOM   1841 C C   . LEU A 1 250 ? 30.410  34.619 64.699  1.00 30.16 ? 1219 LEU A C   1 
ATOM   1842 O O   . LEU A 1 250 ? 31.091  33.710 64.212  1.00 30.92 ? 1219 LEU A O   1 
ATOM   1843 C CB  . LEU A 1 250 ? 28.268  35.153 63.543  1.00 27.52 ? 1219 LEU A CB  1 
ATOM   1844 C CG  . LEU A 1 250 ? 26.901  34.642 63.105  1.00 26.27 ? 1219 LEU A CG  1 
ATOM   1845 C CD1 . LEU A 1 250 ? 25.928  34.610 64.259  1.00 25.88 ? 1219 LEU A CD1 1 
ATOM   1846 C CD2 . LEU A 1 250 ? 26.404  35.543 62.016  1.00 27.18 ? 1219 LEU A CD2 1 
ATOM   1847 N N   . ARG A 1 251 ? 30.955  35.737 65.164  1.00 29.55 ? 1220 ARG A N   1 
ATOM   1848 C CA  . ARG A 1 251 ? 32.396  35.885 65.133  1.00 30.71 ? 1220 ARG A CA  1 
ATOM   1849 C C   . ARG A 1 251 ? 32.975  35.007 66.241  1.00 30.75 ? 1220 ARG A C   1 
ATOM   1850 O O   . ARG A 1 251 ? 33.745  34.076 65.988  1.00 32.34 ? 1220 ARG A O   1 
ATOM   1851 C CB  . ARG A 1 251 ? 32.808  37.343 65.356  1.00 32.47 ? 1220 ARG A CB  1 
ATOM   1852 C CG  . ARG A 1 251 ? 34.315  37.535 65.216  1.00 35.58 ? 1220 ARG A CG  1 
ATOM   1853 C CD  . ARG A 1 251 ? 34.831  38.727 65.995  1.00 37.62 ? 1220 ARG A CD  1 
ATOM   1854 N NE  . ARG A 1 251 ? 34.479  40.009 65.391  1.00 39.50 ? 1220 ARG A NE  1 
ATOM   1855 C CZ  . ARG A 1 251 ? 34.844  40.385 64.173  1.00 37.63 ? 1220 ARG A CZ  1 
ATOM   1856 N NH1 . ARG A 1 251 ? 35.571  39.574 63.417  1.00 39.20 ? 1220 ARG A NH1 1 
ATOM   1857 N NH2 . ARG A 1 251 ? 34.499  41.579 63.720  1.00 37.22 ? 1220 ARG A NH2 1 
ATOM   1858 N N   . PHE A 1 252 ? 32.579  35.309 67.472  1.00 29.95 ? 1221 PHE A N   1 
ATOM   1859 C CA  . PHE A 1 252 ? 33.020  34.584 68.662  1.00 28.27 ? 1221 PHE A CA  1 
ATOM   1860 C C   . PHE A 1 252 ? 33.124  33.066 68.465  1.00 28.26 ? 1221 PHE A C   1 
ATOM   1861 O O   . PHE A 1 252 ? 34.187  32.479 68.629  1.00 28.27 ? 1221 PHE A O   1 
ATOM   1862 C CB  . PHE A 1 252 ? 32.053  34.889 69.807  1.00 26.30 ? 1221 PHE A CB  1 
ATOM   1863 C CG  . PHE A 1 252 ? 32.423  34.246 71.103  1.00 25.08 ? 1221 PHE A CG  1 
ATOM   1864 C CD1 . PHE A 1 252 ? 33.588  34.603 71.762  1.00 26.94 ? 1221 PHE A CD1 1 
ATOM   1865 C CD2 . PHE A 1 252 ? 31.593  33.297 71.680  1.00 24.75 ? 1221 PHE A CD2 1 
ATOM   1866 C CE1 . PHE A 1 252 ? 33.923  34.023 72.985  1.00 26.19 ? 1221 PHE A CE1 1 
ATOM   1867 C CE2 . PHE A 1 252 ? 31.915  32.713 72.897  1.00 23.93 ? 1221 PHE A CE2 1 
ATOM   1868 C CZ  . PHE A 1 252 ? 33.079  33.076 73.552  1.00 25.40 ? 1221 PHE A CZ  1 
ATOM   1869 N N   . VAL A 1 253 ? 32.012  32.439 68.108  1.00 28.54 ? 1222 VAL A N   1 
ATOM   1870 C CA  . VAL A 1 253 ? 31.979  30.999 67.920  1.00 28.79 ? 1222 VAL A CA  1 
ATOM   1871 C C   . VAL A 1 253 ? 32.869  30.529 66.775  1.00 29.02 ? 1222 VAL A C   1 
ATOM   1872 O O   . VAL A 1 253 ? 33.699  29.623 66.947  1.00 27.53 ? 1222 VAL A O   1 
ATOM   1873 C CB  . VAL A 1 253 ? 30.524  30.517 67.692  1.00 28.75 ? 1222 VAL A CB  1 
ATOM   1874 C CG1 . VAL A 1 253 ? 30.486  29.012 67.479  1.00 28.11 ? 1222 VAL A CG1 1 
ATOM   1875 C CG2 . VAL A 1 253 ? 29.670  30.893 68.895  1.00 29.28 ? 1222 VAL A CG2 1 
ATOM   1876 N N   . MET A 1 254 ? 32.700  31.141 65.609  1.00 29.23 ? 1223 MET A N   1 
ATOM   1877 C CA  . MET A 1 254 ? 33.497  30.766 64.450  1.00 29.64 ? 1223 MET A CA  1 
ATOM   1878 C C   . MET A 1 254 ? 34.995  30.875 64.723  1.00 29.99 ? 1223 MET A C   1 
ATOM   1879 O O   . MET A 1 254 ? 35.790  30.113 64.173  1.00 28.95 ? 1223 MET A O   1 
ATOM   1880 C CB  . MET A 1 254 ? 33.130  31.629 63.243  1.00 29.39 ? 1223 MET A CB  1 
ATOM   1881 C CG  . MET A 1 254 ? 31.777  31.318 62.649  1.00 27.77 ? 1223 MET A CG  1 
ATOM   1882 S SD  . MET A 1 254 ? 31.675  31.940 60.971  1.00 30.08 ? 1223 MET A SD  1 
ATOM   1883 C CE  . MET A 1 254 ? 31.241  33.635 61.293  1.00 29.94 ? 1223 MET A CE  1 
ATOM   1884 N N   . GLU A 1 255 ? 35.380  31.814 65.579  1.00 30.48 ? 1224 GLU A N   1 
ATOM   1885 C CA  . GLU A 1 255 ? 36.787  31.985 65.896  1.00 31.96 ? 1224 GLU A CA  1 
ATOM   1886 C C   . GLU A 1 255 ? 37.303  31.062 67.000  1.00 32.10 ? 1224 GLU A C   1 
ATOM   1887 O O   . GLU A 1 255 ? 38.485  31.095 67.341  1.00 31.82 ? 1224 GLU A O   1 
ATOM   1888 C CB  . GLU A 1 255 ? 37.072  33.446 66.234  1.00 33.20 ? 1224 GLU A CB  1 
ATOM   1889 C CG  . GLU A 1 255 ? 37.033  34.332 65.001  1.00 36.92 ? 1224 GLU A CG  1 
ATOM   1890 C CD  . GLU A 1 255 ? 37.648  35.695 65.229  1.00 39.99 ? 1224 GLU A CD  1 
ATOM   1891 O OE1 . GLU A 1 255 ? 37.842  36.430 64.234  1.00 41.71 ? 1224 GLU A OE1 1 
ATOM   1892 O OE2 . GLU A 1 255 ? 37.935  36.028 66.401  1.00 41.11 ? 1224 GLU A OE2 1 
ATOM   1893 N N   . GLY A 1 256 ? 36.423  30.230 67.550  1.00 31.64 ? 1225 GLY A N   1 
ATOM   1894 C CA  . GLY A 1 256 ? 36.852  29.302 68.581  1.00 30.33 ? 1225 GLY A CA  1 
ATOM   1895 C C   . GLY A 1 256 ? 36.398  29.618 69.991  1.00 29.83 ? 1225 GLY A C   1 
ATOM   1896 O O   . GLY A 1 256 ? 36.816  28.952 70.938  1.00 28.78 ? 1225 GLY A O   1 
ATOM   1897 N N   . GLY A 1 257 ? 35.546  30.628 70.137  1.00 29.31 ? 1226 GLY A N   1 
ATOM   1898 C CA  . GLY A 1 257 ? 35.058  30.996 71.452  1.00 29.12 ? 1226 GLY A CA  1 
ATOM   1899 C C   . GLY A 1 257 ? 33.997  30.036 71.961  1.00 29.75 ? 1226 GLY A C   1 
ATOM   1900 O O   . GLY A 1 257 ? 33.076  29.669 71.231  1.00 29.16 ? 1226 GLY A O   1 
ATOM   1901 N N   . LEU A 1 258 ? 34.122  29.619 73.216  1.00 29.14 ? 1227 LEU A N   1 
ATOM   1902 C CA  . LEU A 1 258 ? 33.149  28.705 73.783  1.00 29.84 ? 1227 LEU A CA  1 
ATOM   1903 C C   . LEU A 1 258 ? 32.286  29.406 74.819  1.00 31.45 ? 1227 LEU A C   1 
ATOM   1904 O O   . LEU A 1 258 ? 32.449  30.603 75.085  1.00 31.78 ? 1227 LEU A O   1 
ATOM   1905 C CB  . LEU A 1 258 ? 33.853  27.505 74.425  1.00 28.04 ? 1227 LEU A CB  1 
ATOM   1906 C CG  . LEU A 1 258 ? 34.729  26.676 73.479  1.00 27.33 ? 1227 LEU A CG  1 
ATOM   1907 C CD1 . LEU A 1 258 ? 35.379  25.553 74.262  1.00 26.30 ? 1227 LEU A CD1 1 
ATOM   1908 C CD2 . LEU A 1 258 ? 33.903  26.125 72.328  1.00 23.68 ? 1227 LEU A CD2 1 
ATOM   1909 N N   . LEU A 1 259 ? 31.348  28.657 75.386  1.00 31.56 ? 1228 LEU A N   1 
ATOM   1910 C CA  . LEU A 1 259 ? 30.480  29.191 76.415  1.00 31.56 ? 1228 LEU A CA  1 
ATOM   1911 C C   . LEU A 1 259 ? 31.204  28.931 77.721  1.00 32.20 ? 1228 LEU A C   1 
ATOM   1912 O O   . LEU A 1 259 ? 31.966  27.980 77.827  1.00 33.39 ? 1228 LEU A O   1 
ATOM   1913 C CB  . LEU A 1 259 ? 29.129  28.485 76.381  1.00 30.76 ? 1228 LEU A CB  1 
ATOM   1914 C CG  . LEU A 1 259 ? 28.240  28.936 75.220  1.00 29.16 ? 1228 LEU A CG  1 
ATOM   1915 C CD1 . LEU A 1 259 ? 27.336  27.800 74.797  1.00 28.73 ? 1228 LEU A CD1 1 
ATOM   1916 C CD2 . LEU A 1 259 ? 27.437  30.165 75.633  1.00 27.91 ? 1228 LEU A CD2 1 
ATOM   1917 N N   . ASP A 1 260 ? 30.985  29.779 78.712  1.00 32.76 ? 1229 ASP A N   1 
ATOM   1918 C CA  . ASP A 1 260 ? 31.663  29.615 79.986  1.00 33.29 ? 1229 ASP A CA  1 
ATOM   1919 C C   . ASP A 1 260 ? 30.985  28.574 80.867  1.00 32.50 ? 1229 ASP A C   1 
ATOM   1920 O O   . ASP A 1 260 ? 29.769  28.428 80.846  1.00 31.80 ? 1229 ASP A O   1 
ATOM   1921 C CB  . ASP A 1 260 ? 31.694  30.955 80.717  1.00 35.40 ? 1229 ASP A CB  1 
ATOM   1922 C CG  . ASP A 1 260 ? 31.885  32.124 79.775  1.00 37.73 ? 1229 ASP A CG  1 
ATOM   1923 O OD1 . ASP A 1 260 ? 32.986  32.247 79.196  1.00 37.32 ? 1229 ASP A OD1 1 
ATOM   1924 O OD2 . ASP A 1 260 ? 30.924  32.913 79.608  1.00 38.70 ? 1229 ASP A OD2 1 
ATOM   1925 N N   . LYS A 1 261 ? 31.777  27.845 81.639  1.00 33.28 ? 1230 LYS A N   1 
ATOM   1926 C CA  . LYS A 1 261 ? 31.213  26.859 82.550  1.00 35.00 ? 1230 LYS A CA  1 
ATOM   1927 C C   . LYS A 1 261 ? 30.248  27.617 83.464  1.00 35.46 ? 1230 LYS A C   1 
ATOM   1928 O O   . LYS A 1 261 ? 30.656  28.513 84.208  1.00 34.95 ? 1230 LYS A O   1 
ATOM   1929 C CB  . LYS A 1 261 ? 32.324  26.220 83.385  1.00 34.62 ? 1230 LYS A CB  1 
ATOM   1930 C CG  . LYS A 1 261 ? 31.867  25.123 84.332  1.00 35.12 ? 1230 LYS A CG  1 
ATOM   1931 C CD  . LYS A 1 261 ? 32.907  24.908 85.431  1.00 37.11 ? 1230 LYS A CD  1 
ATOM   1932 C CE  . LYS A 1 261 ? 32.557  23.745 86.335  1.00 36.87 ? 1230 LYS A CE  1 
ATOM   1933 N NZ  . LYS A 1 261 ? 32.625  22.460 85.576  1.00 39.98 ? 1230 LYS A NZ  1 
ATOM   1934 N N   . PRO A 1 262 ? 28.954  27.275 83.416  1.00 35.75 ? 1231 PRO A N   1 
ATOM   1935 C CA  . PRO A 1 262 ? 27.990  27.971 84.271  1.00 37.71 ? 1231 PRO A CA  1 
ATOM   1936 C C   . PRO A 1 262 ? 28.253  27.741 85.768  1.00 39.63 ? 1231 PRO A C   1 
ATOM   1937 O O   . PRO A 1 262 ? 28.866  26.745 86.164  1.00 39.16 ? 1231 PRO A O   1 
ATOM   1938 C CB  . PRO A 1 262 ? 26.651  27.403 83.809  1.00 36.09 ? 1231 PRO A CB  1 
ATOM   1939 C CG  . PRO A 1 262 ? 27.000  26.007 83.438  1.00 35.68 ? 1231 PRO A CG  1 
ATOM   1940 C CD  . PRO A 1 262 ? 28.317  26.156 82.704  1.00 36.08 ? 1231 PRO A CD  1 
ATOM   1941 N N   . ASP A 1 263 ? 27.776  28.668 86.593  1.00 41.49 ? 1232 ASP A N   1 
ATOM   1942 C CA  . ASP A 1 263 ? 27.969  28.587 88.034  1.00 42.22 ? 1232 ASP A CA  1 
ATOM   1943 C C   . ASP A 1 263 ? 27.385  27.322 88.666  1.00 41.56 ? 1232 ASP A C   1 
ATOM   1944 O O   . ASP A 1 263 ? 26.225  26.958 88.447  1.00 40.58 ? 1232 ASP A O   1 
ATOM   1945 C CB  . ASP A 1 263 ? 27.372  29.826 88.708  1.00 45.04 ? 1232 ASP A CB  1 
ATOM   1946 C CG  . ASP A 1 263 ? 27.732  31.115 87.983  1.00 48.54 ? 1232 ASP A CG  1 
ATOM   1947 O OD1 . ASP A 1 263 ? 28.884  31.240 87.505  1.00 48.39 ? 1232 ASP A OD1 1 
ATOM   1948 O OD2 . ASP A 1 263 ? 26.861  32.009 87.897  1.00 51.16 ? 1232 ASP A OD2 1 
ATOM   1949 N N   . ASN A 1 264 ? 28.211  26.651 89.456  1.00 39.97 ? 1233 ASN A N   1 
ATOM   1950 C CA  . ASN A 1 264 ? 27.785  25.446 90.132  1.00 38.75 ? 1233 ASN A CA  1 
ATOM   1951 C C   . ASN A 1 264 ? 27.475  24.340 89.144  1.00 37.57 ? 1233 ASN A C   1 
ATOM   1952 O O   . ASN A 1 264 ? 26.761  23.397 89.477  1.00 39.67 ? 1233 ASN A O   1 
ATOM   1953 C CB  . ASN A 1 264 ? 26.541  25.723 90.980  1.00 40.23 ? 1233 ASN A CB  1 
ATOM   1954 C CG  . ASN A 1 264 ? 26.730  26.881 91.936  1.00 40.53 ? 1233 ASN A CG  1 
ATOM   1955 O OD1 . ASN A 1 264 ? 27.695  26.925 92.696  1.00 42.37 ? 1233 ASN A OD1 1 
ATOM   1956 N ND2 . ASN A 1 264 ? 25.799  27.826 91.906  1.00 40.72 ? 1233 ASN A ND2 1 
ATOM   1957 N N   . CYS A 1 265 ? 27.988  24.441 87.924  1.00 34.84 ? 1234 CYS A N   1 
ATOM   1958 C CA  . CYS A 1 265 ? 27.726  23.388 86.956  1.00 31.53 ? 1234 CYS A CA  1 
ATOM   1959 C C   . CYS A 1 265 ? 28.642  22.214 87.210  1.00 28.99 ? 1234 CYS A C   1 
ATOM   1960 O O   . CYS A 1 265 ? 29.854  22.338 87.083  1.00 29.23 ? 1234 CYS A O   1 
ATOM   1961 C CB  . CYS A 1 265 ? 27.950  23.866 85.528  1.00 32.47 ? 1234 CYS A CB  1 
ATOM   1962 S SG  . CYS A 1 265 ? 27.676  22.542 84.312  1.00 32.30 ? 1234 CYS A SG  1 
ATOM   1963 N N   . PRO A 1 266 ? 28.075  21.056 87.569  1.00 27.26 ? 1235 PRO A N   1 
ATOM   1964 C CA  . PRO A 1 266 ? 28.878  19.858 87.835  1.00 26.36 ? 1235 PRO A CA  1 
ATOM   1965 C C   . PRO A 1 266 ? 29.995  19.675 86.794  1.00 26.04 ? 1235 PRO A C   1 
ATOM   1966 O O   . PRO A 1 266 ? 29.785  19.895 85.600  1.00 23.81 ? 1235 PRO A O   1 
ATOM   1967 C CB  . PRO A 1 266 ? 27.843  18.740 87.784  1.00 27.38 ? 1235 PRO A CB  1 
ATOM   1968 C CG  . PRO A 1 266 ? 26.607  19.406 88.318  1.00 27.43 ? 1235 PRO A CG  1 
ATOM   1969 C CD  . PRO A 1 266 ? 26.633  20.759 87.644  1.00 27.06 ? 1235 PRO A CD  1 
ATOM   1970 N N   . ASP A 1 267 ? 31.182  19.284 87.252  1.00 25.71 ? 1236 ASP A N   1 
ATOM   1971 C CA  . ASP A 1 267 ? 32.321  19.080 86.353  1.00 26.92 ? 1236 ASP A CA  1 
ATOM   1972 C C   . ASP A 1 267 ? 31.999  18.219 85.127  1.00 26.47 ? 1236 ASP A C   1 
ATOM   1973 O O   . ASP A 1 267 ? 32.339  18.557 83.993  1.00 25.52 ? 1236 ASP A O   1 
ATOM   1974 C CB  . ASP A 1 267 ? 33.485  18.427 87.108  1.00 26.27 ? 1236 ASP A CB  1 
ATOM   1975 C CG  . ASP A 1 267 ? 34.179  19.382 88.057  1.00 27.10 ? 1236 ASP A CG  1 
ATOM   1976 O OD1 . ASP A 1 267 ? 34.211  20.597 87.760  1.00 25.98 ? 1236 ASP A OD1 1 
ATOM   1977 O OD2 . ASP A 1 267 ? 34.711  18.911 89.088  1.00 28.28 ? 1236 ASP A OD2 1 
ATOM   1978 N N   . MET A 1 268 ? 31.344  17.097 85.392  1.00 27.59 ? 1237 MET A N   1 
ATOM   1979 C CA  . MET A 1 268 ? 30.962  16.120 84.390  1.00 28.16 ? 1237 MET A CA  1 
ATOM   1980 C C   . MET A 1 268 ? 30.211  16.680 83.192  1.00 27.84 ? 1237 MET A C   1 
ATOM   1981 O O   . MET A 1 268 ? 30.566  16.394 82.049  1.00 27.43 ? 1237 MET A O   1 
ATOM   1982 C CB  . MET A 1 268 ? 30.107  15.044 85.048  1.00 31.07 ? 1237 MET A CB  1 
ATOM   1983 C CG  . MET A 1 268 ? 29.719  13.930 84.114  1.00 34.57 ? 1237 MET A CG  1 
ATOM   1984 S SD  . MET A 1 268 ? 28.207  13.191 84.657  1.00 39.20 ? 1237 MET A SD  1 
ATOM   1985 C CE  . MET A 1 268 ? 28.758  12.389 86.252  1.00 38.52 ? 1237 MET A CE  1 
ATOM   1986 N N   . LEU A 1 269 ? 29.154  17.444 83.462  1.00 26.64 ? 1238 LEU A N   1 
ATOM   1987 C CA  . LEU A 1 269 ? 28.346  18.045 82.409  1.00 24.75 ? 1238 LEU A CA  1 
ATOM   1988 C C   . LEU A 1 269 ? 29.131  19.023 81.548  1.00 24.04 ? 1238 LEU A C   1 
ATOM   1989 O O   . LEU A 1 269 ? 29.036  18.982 80.328  1.00 23.24 ? 1238 LEU A O   1 
ATOM   1990 C CB  . LEU A 1 269 ? 27.131  18.772 82.992  1.00 24.13 ? 1238 LEU A CB  1 
ATOM   1991 C CG  . LEU A 1 269 ? 25.941  17.986 83.538  1.00 23.99 ? 1238 LEU A CG  1 
ATOM   1992 C CD1 . LEU A 1 269 ? 24.796  18.956 83.779  1.00 23.66 ? 1238 LEU A CD1 1 
ATOM   1993 C CD2 . LEU A 1 269 ? 25.510  16.914 82.549  1.00 25.12 ? 1238 LEU A CD2 1 
ATOM   1994 N N   . PHE A 1 270 ? 29.896  19.911 82.168  1.00 24.44 ? 1239 PHE A N   1 
ATOM   1995 C CA  . PHE A 1 270 ? 30.665  20.865 81.382  1.00 26.98 ? 1239 PHE A CA  1 
ATOM   1996 C C   . PHE A 1 270 ? 31.743  20.091 80.643  1.00 27.81 ? 1239 PHE A C   1 
ATOM   1997 O O   . PHE A 1 270 ? 32.141  20.462 79.537  1.00 27.76 ? 1239 PHE A O   1 
ATOM   1998 C CB  . PHE A 1 270 ? 31.286  21.943 82.273  1.00 27.23 ? 1239 PHE A CB  1 
ATOM   1999 C CG  . PHE A 1 270 ? 32.039  22.994 81.511  1.00 27.04 ? 1239 PHE A CG  1 
ATOM   2000 C CD1 . PHE A 1 270 ? 33.429  22.955 81.430  1.00 27.70 ? 1239 PHE A CD1 1 
ATOM   2001 C CD2 . PHE A 1 270 ? 31.360  24.010 80.848  1.00 27.75 ? 1239 PHE A CD2 1 
ATOM   2002 C CE1 . PHE A 1 270 ? 34.135  23.916 80.696  1.00 28.18 ? 1239 PHE A CE1 1 
ATOM   2003 C CE2 . PHE A 1 270 ? 32.055  24.975 80.110  1.00 27.35 ? 1239 PHE A CE2 1 
ATOM   2004 C CZ  . PHE A 1 270 ? 33.442  24.927 80.034  1.00 27.70 ? 1239 PHE A CZ  1 
ATOM   2005 N N   . GLU A 1 271 ? 32.203  19.008 81.261  1.00 27.56 ? 1240 GLU A N   1 
ATOM   2006 C CA  . GLU A 1 271 ? 33.208  18.142 80.655  1.00 28.07 ? 1240 GLU A CA  1 
ATOM   2007 C C   . GLU A 1 271 ? 32.590  17.567 79.377  1.00 27.62 ? 1240 GLU A C   1 
ATOM   2008 O O   . GLU A 1 271 ? 33.236  17.488 78.327  1.00 27.10 ? 1240 GLU A O   1 
ATOM   2009 C CB  . GLU A 1 271 ? 33.565  17.028 81.643  1.00 31.26 ? 1240 GLU A CB  1 
ATOM   2010 C CG  . GLU A 1 271 ? 34.389  15.868 81.102  1.00 34.99 ? 1240 GLU A CG  1 
ATOM   2011 C CD  . GLU A 1 271 ? 34.636  14.799 82.178  1.00 38.73 ? 1240 GLU A CD  1 
ATOM   2012 O OE1 . GLU A 1 271 ? 35.067  13.674 81.830  1.00 39.63 ? 1240 GLU A OE1 1 
ATOM   2013 O OE2 . GLU A 1 271 ? 34.400  15.088 83.377  1.00 38.72 ? 1240 GLU A OE2 1 
ATOM   2014 N N   . LEU A 1 272 ? 31.318  17.191 79.475  1.00 26.11 ? 1241 LEU A N   1 
ATOM   2015 C CA  . LEU A 1 272 ? 30.581  16.639 78.356  1.00 24.60 ? 1241 LEU A CA  1 
ATOM   2016 C C   . LEU A 1 272 ? 30.419  17.750 77.306  1.00 26.69 ? 1241 LEU A C   1 
ATOM   2017 O O   . LEU A 1 272 ? 30.646  17.539 76.110  1.00 27.20 ? 1241 LEU A O   1 
ATOM   2018 C CB  . LEU A 1 272 ? 29.225  16.149 78.858  1.00 22.58 ? 1241 LEU A CB  1 
ATOM   2019 C CG  . LEU A 1 272 ? 28.513  14.974 78.184  1.00 22.08 ? 1241 LEU A CG  1 
ATOM   2020 C CD1 . LEU A 1 272 ? 27.194  14.718 78.905  1.00 19.56 ? 1241 LEU A CD1 1 
ATOM   2021 C CD2 . LEU A 1 272 ? 28.251  15.270 76.713  1.00 21.05 ? 1241 LEU A CD2 1 
ATOM   2022 N N   . MET A 1 273 ? 30.045  18.941 77.766  1.00 28.83 ? 1242 MET A N   1 
ATOM   2023 C CA  . MET A 1 273 ? 29.855  20.103 76.892  1.00 29.17 ? 1242 MET A CA  1 
ATOM   2024 C C   . MET A 1 273 ? 31.112  20.389 76.092  1.00 29.43 ? 1242 MET A C   1 
ATOM   2025 O O   . MET A 1 273 ? 31.070  20.538 74.874  1.00 30.87 ? 1242 MET A O   1 
ATOM   2026 C CB  . MET A 1 273 ? 29.505  21.350 77.718  1.00 29.03 ? 1242 MET A CB  1 
ATOM   2027 C CG  . MET A 1 273 ? 28.093  21.368 78.293  1.00 27.45 ? 1242 MET A CG  1 
ATOM   2028 S SD  . MET A 1 273 ? 27.745  22.859 79.271  1.00 29.84 ? 1242 MET A SD  1 
ATOM   2029 C CE  . MET A 1 273 ? 27.576  22.183 80.914  1.00 25.74 ? 1242 MET A CE  1 
ATOM   2030 N N   . ARG A 1 274 ? 32.232  20.470 76.793  1.00 30.82 ? 1243 ARG A N   1 
ATOM   2031 C CA  . ARG A 1 274 ? 33.515  20.748 76.168  1.00 32.68 ? 1243 ARG A CA  1 
ATOM   2032 C C   . ARG A 1 274 ? 33.772  19.837 74.969  1.00 33.16 ? 1243 ARG A C   1 
ATOM   2033 O O   . ARG A 1 274 ? 34.231  20.291 73.926  1.00 34.40 ? 1243 ARG A O   1 
ATOM   2034 C CB  . ARG A 1 274 ? 34.631  20.589 77.202  1.00 34.30 ? 1243 ARG A CB  1 
ATOM   2035 C CG  . ARG A 1 274 ? 35.941  21.188 76.785  1.00 37.56 ? 1243 ARG A CG  1 
ATOM   2036 C CD  . ARG A 1 274 ? 36.916  21.247 77.945  1.00 41.56 ? 1243 ARG A CD  1 
ATOM   2037 N NE  . ARG A 1 274 ? 38.055  22.099 77.609  1.00 46.15 ? 1243 ARG A NE  1 
ATOM   2038 C CZ  . ARG A 1 274 ? 37.982  23.417 77.419  1.00 46.09 ? 1243 ARG A CZ  1 
ATOM   2039 N NH1 . ARG A 1 274 ? 39.078  24.103 77.108  1.00 45.57 ? 1243 ARG A NH1 1 
ATOM   2040 N NH2 . ARG A 1 274 ? 36.824  24.056 77.558  1.00 44.45 ? 1243 ARG A NH2 1 
ATOM   2041 N N   . MET A 1 275 ? 33.472  18.552 75.115  1.00 33.72 ? 1244 MET A N   1 
ATOM   2042 C CA  . MET A 1 275 ? 33.675  17.603 74.031  1.00 32.99 ? 1244 MET A CA  1 
ATOM   2043 C C   . MET A 1 275 ? 32.686  17.839 72.892  1.00 32.72 ? 1244 MET A C   1 
ATOM   2044 O O   . MET A 1 275 ? 33.038  17.732 71.714  1.00 33.67 ? 1244 MET A O   1 
ATOM   2045 C CB  . MET A 1 275 ? 33.542  16.179 74.562  1.00 34.41 ? 1244 MET A CB  1 
ATOM   2046 C CG  . MET A 1 275 ? 34.687  15.781 75.472  1.00 37.57 ? 1244 MET A CG  1 
ATOM   2047 S SD  . MET A 1 275 ? 36.317  15.889 74.652  1.00 42.33 ? 1244 MET A SD  1 
ATOM   2048 C CE  . MET A 1 275 ? 37.125  14.355 75.258  1.00 38.97 ? 1244 MET A CE  1 
ATOM   2049 N N   . CYS A 1 276 ? 31.445  18.158 73.236  1.00 30.11 ? 1245 CYS A N   1 
ATOM   2050 C CA  . CYS A 1 276 ? 30.445  18.420 72.210  1.00 28.38 ? 1245 CYS A CA  1 
ATOM   2051 C C   . CYS A 1 276 ? 30.885  19.594 71.351  1.00 27.04 ? 1245 CYS A C   1 
ATOM   2052 O O   . CYS A 1 276 ? 30.571  19.667 70.159  1.00 26.96 ? 1245 CYS A O   1 
ATOM   2053 C CB  . CYS A 1 276 ? 29.089  18.728 72.850  1.00 27.98 ? 1245 CYS A CB  1 
ATOM   2054 S SG  . CYS A 1 276 ? 28.280  17.283 73.581  1.00 26.45 ? 1245 CYS A SG  1 
ATOM   2055 N N   . TRP A 1 277 ? 31.628  20.511 71.958  1.00 25.11 ? 1246 TRP A N   1 
ATOM   2056 C CA  . TRP A 1 277 ? 32.093  21.681 71.235  1.00 22.32 ? 1246 TRP A CA  1 
ATOM   2057 C C   . TRP A 1 277 ? 33.517  21.609 70.679  1.00 22.01 ? 1246 TRP A C   1 
ATOM   2058 O O   . TRP A 1 277 ? 34.225  22.624 70.650  1.00 20.84 ? 1246 TRP A O   1 
ATOM   2059 C CB  . TRP A 1 277 ? 31.954  22.929 72.102  1.00 20.02 ? 1246 TRP A CB  1 
ATOM   2060 C CG  . TRP A 1 277 ? 30.578  23.171 72.576  1.00 15.98 ? 1246 TRP A CG  1 
ATOM   2061 C CD1 . TRP A 1 277 ? 29.426  23.022 71.857  1.00 16.76 ? 1246 TRP A CD1 1 
ATOM   2062 C CD2 . TRP A 1 277 ? 30.190  23.626 73.877  1.00 13.34 ? 1246 TRP A CD2 1 
ATOM   2063 N NE1 . TRP A 1 277 ? 28.342  23.354 72.633  1.00 16.68 ? 1246 TRP A NE1 1 
ATOM   2064 C CE2 . TRP A 1 277 ? 28.781  23.728 73.879  1.00 14.60 ? 1246 TRP A CE2 1 
ATOM   2065 C CE3 . TRP A 1 277 ? 30.895  23.958 75.041  1.00 12.25 ? 1246 TRP A CE3 1 
ATOM   2066 C CZ2 . TRP A 1 277 ? 28.057  24.150 75.009  1.00 12.86 ? 1246 TRP A CZ2 1 
ATOM   2067 C CZ3 . TRP A 1 277 ? 30.174  24.380 76.164  1.00 14.35 ? 1246 TRP A CZ3 1 
ATOM   2068 C CH2 . TRP A 1 277 ? 28.766  24.471 76.136  1.00 11.37 ? 1246 TRP A CH2 1 
ATOM   2069 N N   . GLN A 1 278 ? 33.953  20.421 70.260  1.00 21.04 ? 1247 GLN A N   1 
ATOM   2070 C CA  . GLN A 1 278 ? 35.271  20.320 69.640  1.00 22.34 ? 1247 GLN A CA  1 
ATOM   2071 C C   . GLN A 1 278 ? 35.079  21.139 68.353  1.00 22.98 ? 1247 GLN A C   1 
ATOM   2072 O O   . GLN A 1 278 ? 34.061  20.983 67.660  1.00 21.83 ? 1247 GLN A O   1 
ATOM   2073 C CB  . GLN A 1 278 ? 35.614  18.866 69.277  1.00 20.34 ? 1247 GLN A CB  1 
ATOM   2074 C CG  . GLN A 1 278 ? 35.966  17.965 70.452  1.00 21.78 ? 1247 GLN A CG  1 
ATOM   2075 C CD  . GLN A 1 278 ? 37.254  18.381 71.160  1.00 23.10 ? 1247 GLN A CD  1 
ATOM   2076 O OE1 . GLN A 1 278 ? 38.283  18.596 70.521  1.00 22.85 ? 1247 GLN A OE1 1 
ATOM   2077 N NE2 . GLN A 1 278 ? 37.202  18.483 72.489  1.00 22.42 ? 1247 GLN A NE2 1 
ATOM   2078 N N   . TYR A 1 279 ? 36.012  22.025 68.030  1.00 22.28 ? 1248 TYR A N   1 
ATOM   2079 C CA  . TYR A 1 279 ? 35.842  22.805 66.808  1.00 23.68 ? 1248 TYR A CA  1 
ATOM   2080 C C   . TYR A 1 279 ? 35.719  21.880 65.584  1.00 24.62 ? 1248 TYR A C   1 
ATOM   2081 O O   . TYR A 1 279 ? 34.813  22.048 64.771  1.00 25.52 ? 1248 TYR A O   1 
ATOM   2082 C CB  . TYR A 1 279 ? 37.001  23.765 66.623  1.00 22.99 ? 1248 TYR A CB  1 
ATOM   2083 C CG  . TYR A 1 279 ? 36.727  24.830 65.600  1.00 23.59 ? 1248 TYR A CG  1 
ATOM   2084 C CD1 . TYR A 1 279 ? 36.135  26.033 65.968  1.00 24.94 ? 1248 TYR A CD1 1 
ATOM   2085 C CD2 . TYR A 1 279 ? 37.085  24.652 64.267  1.00 22.92 ? 1248 TYR A CD2 1 
ATOM   2086 C CE1 . TYR A 1 279 ? 35.913  27.042 65.039  1.00 24.07 ? 1248 TYR A CE1 1 
ATOM   2087 C CE2 . TYR A 1 279 ? 36.866  25.653 63.328  1.00 24.11 ? 1248 TYR A CE2 1 
ATOM   2088 C CZ  . TYR A 1 279 ? 36.281  26.847 63.725  1.00 24.33 ? 1248 TYR A CZ  1 
ATOM   2089 O OH  . TYR A 1 279 ? 36.074  27.854 62.813  1.00 27.47 ? 1248 TYR A OH  1 
ATOM   2090 N N   . ASN A 1 280 ? 36.629  20.917 65.443  1.00 24.83 ? 1249 ASN A N   1 
ATOM   2091 C CA  . ASN A 1 280 ? 36.545  19.976 64.334  1.00 28.63 ? 1249 ASN A CA  1 
ATOM   2092 C C   . ASN A 1 280 ? 35.340  19.095 64.656  1.00 30.84 ? 1249 ASN A C   1 
ATOM   2093 O O   . ASN A 1 280 ? 35.299  18.465 65.716  1.00 32.07 ? 1249 ASN A O   1 
ATOM   2094 C CB  . ASN A 1 280 ? 37.798  19.104 64.255  1.00 29.72 ? 1249 ASN A CB  1 
ATOM   2095 C CG  . ASN A 1 280 ? 39.062  19.912 64.041  1.00 31.29 ? 1249 ASN A CG  1 
ATOM   2096 O OD1 . ASN A 1 280 ? 39.497  20.645 64.929  1.00 32.95 ? 1249 ASN A OD1 1 
ATOM   2097 N ND2 . ASN A 1 280 ? 39.663  19.781 62.858  1.00 29.46 ? 1249 ASN A ND2 1 
ATOM   2098 N N   . PRO A 1 281 ? 34.343  19.036 63.753  1.00 31.09 ? 1250 PRO A N   1 
ATOM   2099 C CA  . PRO A 1 281 ? 33.142  18.222 63.985  1.00 31.11 ? 1250 PRO A CA  1 
ATOM   2100 C C   . PRO A 1 281 ? 33.386  16.731 64.216  1.00 31.38 ? 1250 PRO A C   1 
ATOM   2101 O O   . PRO A 1 281 ? 32.739  16.121 65.062  1.00 32.85 ? 1250 PRO A O   1 
ATOM   2102 C CB  . PRO A 1 281 ? 32.282  18.509 62.749  1.00 30.13 ? 1250 PRO A CB  1 
ATOM   2103 C CG  . PRO A 1 281 ? 33.275  18.800 61.705  1.00 30.01 ? 1250 PRO A CG  1 
ATOM   2104 C CD  . PRO A 1 281 ? 34.306  19.652 62.419  1.00 30.12 ? 1250 PRO A CD  1 
ATOM   2105 N N   . LYS A 1 282 ? 34.326  16.145 63.481  1.00 31.39 ? 1251 LYS A N   1 
ATOM   2106 C CA  . LYS A 1 282 ? 34.629  14.724 63.647  1.00 30.28 ? 1251 LYS A CA  1 
ATOM   2107 C C   . LYS A 1 282 ? 35.253  14.391 65.002  1.00 28.53 ? 1251 LYS A C   1 
ATOM   2108 O O   . LYS A 1 282 ? 35.306  13.222 65.392  1.00 28.50 ? 1251 LYS A O   1 
ATOM   2109 C CB  . LYS A 1 282 ? 35.564  14.237 62.536  1.00 29.21 ? 1251 LYS A CB  1 
ATOM   2110 C CG  . LYS A 1 282 ? 34.864  14.012 61.217  1.00 32.23 ? 1251 LYS A CG  1 
ATOM   2111 C CD  . LYS A 1 282 ? 35.699  13.157 60.278  1.00 32.99 ? 1251 LYS A CD  1 
ATOM   2112 C CE  . LYS A 1 282 ? 34.906  12.782 59.033  1.00 32.81 ? 1251 LYS A CE  1 
ATOM   2113 N NZ  . LYS A 1 282 ? 35.674  11.851 58.167  1.00 33.84 ? 1251 LYS A NZ  1 
ATOM   2114 N N   . MET A 1 283 ? 35.731  15.406 65.717  1.00 25.04 ? 1252 MET A N   1 
ATOM   2115 C CA  . MET A 1 283 ? 36.356  15.166 67.008  1.00 22.71 ? 1252 MET A CA  1 
ATOM   2116 C C   . MET A 1 283 ? 35.355  15.121 68.146  1.00 22.87 ? 1252 MET A C   1 
ATOM   2117 O O   . MET A 1 283 ? 35.664  14.597 69.206  1.00 24.93 ? 1252 MET A O   1 
ATOM   2118 C CB  . MET A 1 283 ? 37.437  16.213 67.290  1.00 20.02 ? 1252 MET A CB  1 
ATOM   2119 C CG  . MET A 1 283 ? 38.679  16.013 66.433  1.00 19.50 ? 1252 MET A CG  1 
ATOM   2120 S SD  . MET A 1 283 ? 40.057  17.120 66.776  1.00 17.95 ? 1252 MET A SD  1 
ATOM   2121 C CE  . MET A 1 283 ? 41.117  16.721 65.428  1.00 16.77 ? 1252 MET A CE  1 
ATOM   2122 N N   . ARG A 1 284 ? 34.158  15.656 67.922  1.00 21.24 ? 1253 ARG A N   1 
ATOM   2123 C CA  . ARG A 1 284 ? 33.114  15.653 68.939  1.00 19.65 ? 1253 ARG A CA  1 
ATOM   2124 C C   . ARG A 1 284 ? 32.512  14.248 69.033  1.00 18.59 ? 1253 ARG A C   1 
ATOM   2125 O O   . ARG A 1 284 ? 32.471  13.515 68.047  1.00 16.18 ? 1253 ARG A O   1 
ATOM   2126 C CB  . ARG A 1 284 ? 32.022  16.643 68.557  1.00 20.84 ? 1253 ARG A CB  1 
ATOM   2127 C CG  . ARG A 1 284 ? 32.529  18.011 68.147  1.00 22.08 ? 1253 ARG A CG  1 
ATOM   2128 C CD  . ARG A 1 284 ? 31.442  18.778 67.399  1.00 22.44 ? 1253 ARG A CD  1 
ATOM   2129 N NE  . ARG A 1 284 ? 31.938  20.030 66.831  1.00 21.85 ? 1253 ARG A NE  1 
ATOM   2130 C CZ  . ARG A 1 284 ? 31.347  20.687 65.840  1.00 18.87 ? 1253 ARG A CZ  1 
ATOM   2131 N NH1 . ARG A 1 284 ? 30.233  20.213 65.298  1.00 16.04 ? 1253 ARG A NH1 1 
ATOM   2132 N NH2 . ARG A 1 284 ? 31.874  21.818 65.390  1.00 16.44 ? 1253 ARG A NH2 1 
ATOM   2133 N N   . PRO A 1 285 ? 32.035  13.852 70.222  1.00 18.52 ? 1254 PRO A N   1 
ATOM   2134 C CA  . PRO A 1 285 ? 31.455  12.512 70.324  1.00 19.43 ? 1254 PRO A CA  1 
ATOM   2135 C C   . PRO A 1 285 ? 30.146  12.421 69.548  1.00 20.18 ? 1254 PRO A C   1 
ATOM   2136 O O   . PRO A 1 285 ? 29.531  13.441 69.249  1.00 20.85 ? 1254 PRO A O   1 
ATOM   2137 C CB  . PRO A 1 285 ? 31.247  12.340 71.830  1.00 17.80 ? 1254 PRO A CB  1 
ATOM   2138 C CG  . PRO A 1 285 ? 30.937  13.738 72.280  1.00 18.55 ? 1254 PRO A CG  1 
ATOM   2139 C CD  . PRO A 1 285 ? 31.986  14.543 71.524  1.00 18.83 ? 1254 PRO A CD  1 
ATOM   2140 N N   . SER A 1 286 ? 29.749  11.201 69.196  1.00 19.02 ? 1255 SER A N   1 
ATOM   2141 C CA  . SER A 1 286 ? 28.498  10.975 68.497  1.00 19.03 ? 1255 SER A CA  1 
ATOM   2142 C C   . SER A 1 286 ? 27.505  10.815 69.648  1.00 19.79 ? 1255 SER A C   1 
ATOM   2143 O O   . SER A 1 286 ? 27.927  10.780 70.806  1.00 19.56 ? 1255 SER A O   1 
ATOM   2144 C CB  . SER A 1 286 ? 28.586  9.690  67.686  1.00 18.45 ? 1255 SER A CB  1 
ATOM   2145 O OG  . SER A 1 286 ? 28.872  8.588  68.527  1.00 20.25 ? 1255 SER A OG  1 
ATOM   2146 N N   . PHE A 1 287 ? 26.207  10.715 69.362  1.00 19.45 ? 1256 PHE A N   1 
ATOM   2147 C CA  . PHE A 1 287 ? 25.223  10.566 70.440  1.00 21.59 ? 1256 PHE A CA  1 
ATOM   2148 C C   . PHE A 1 287 ? 25.333  9.268  71.253  1.00 23.77 ? 1256 PHE A C   1 
ATOM   2149 O O   . PHE A 1 287 ? 25.126  9.290  72.469  1.00 23.56 ? 1256 PHE A O   1 
ATOM   2150 C CB  . PHE A 1 287 ? 23.791  10.726 69.899  1.00 20.17 ? 1256 PHE A CB  1 
ATOM   2151 C CG  . PHE A 1 287 ? 23.427  12.145 69.595  1.00 19.45 ? 1256 PHE A CG  1 
ATOM   2152 C CD1 . PHE A 1 287 ? 23.183  13.046 70.628  1.00 17.15 ? 1256 PHE A CD1 1 
ATOM   2153 C CD2 . PHE A 1 287 ? 23.428  12.615 68.278  1.00 19.06 ? 1256 PHE A CD2 1 
ATOM   2154 C CE1 . PHE A 1 287 ? 22.956  14.395 70.359  1.00 16.71 ? 1256 PHE A CE1 1 
ATOM   2155 C CE2 . PHE A 1 287 ? 23.202  13.964 68.001  1.00 18.09 ? 1256 PHE A CE2 1 
ATOM   2156 C CZ  . PHE A 1 287 ? 22.968  14.858 69.046  1.00 16.07 ? 1256 PHE A CZ  1 
ATOM   2157 N N   . LEU A 1 288 ? 25.661  8.148  70.600  1.00 25.70 ? 1257 LEU A N   1 
ATOM   2158 C CA  . LEU A 1 288 ? 25.793  6.871  71.311  1.00 27.67 ? 1257 LEU A CA  1 
ATOM   2159 C C   . LEU A 1 288 ? 26.937  6.885  72.319  1.00 28.52 ? 1257 LEU A C   1 
ATOM   2160 O O   . LEU A 1 288 ? 26.817  6.332  73.407  1.00 29.64 ? 1257 LEU A O   1 
ATOM   2161 C CB  . LEU A 1 288 ? 25.997  5.717  70.326  1.00 28.40 ? 1257 LEU A CB  1 
ATOM   2162 C CG  . LEU A 1 288 ? 24.776  5.299  69.503  1.00 29.79 ? 1257 LEU A CG  1 
ATOM   2163 C CD1 . LEU A 1 288 ? 25.163  4.179  68.560  1.00 31.69 ? 1257 LEU A CD1 1 
ATOM   2164 C CD2 . LEU A 1 288 ? 23.662  4.845  70.420  1.00 28.21 ? 1257 LEU A CD2 1 
ATOM   2165 N N   . GLU A 1 289 ? 28.044  7.523  71.955  1.00 29.78 ? 1258 GLU A N   1 
ATOM   2166 C CA  . GLU A 1 289 ? 29.194  7.615  72.839  1.00 30.55 ? 1258 GLU A CA  1 
ATOM   2167 C C   . GLU A 1 289 ? 28.869  8.457  74.064  1.00 30.25 ? 1258 GLU A C   1 
ATOM   2168 O O   . GLU A 1 289 ? 29.309  8.134  75.165  1.00 29.90 ? 1258 GLU A O   1 
ATOM   2169 C CB  . GLU A 1 289 ? 30.365  8.245  72.107  1.00 33.94 ? 1258 GLU A CB  1 
ATOM   2170 C CG  . GLU A 1 289 ? 30.724  7.547  70.832  1.00 39.29 ? 1258 GLU A CG  1 
ATOM   2171 C CD  . GLU A 1 289 ? 31.887  8.207  70.141  1.00 42.68 ? 1258 GLU A CD  1 
ATOM   2172 O OE1 . GLU A 1 289 ? 31.744  9.377  69.723  1.00 45.14 ? 1258 GLU A OE1 1 
ATOM   2173 O OE2 . GLU A 1 289 ? 32.947  7.556  70.024  1.00 46.22 ? 1258 GLU A OE2 1 
ATOM   2174 N N   . ILE A 1 290 ? 28.117  9.542  73.867  1.00 28.97 ? 1259 ILE A N   1 
ATOM   2175 C CA  . ILE A 1 290 ? 27.730  10.431 74.964  1.00 28.53 ? 1259 ILE A CA  1 
ATOM   2176 C C   . ILE A 1 290 ? 26.952  9.622  75.987  1.00 28.45 ? 1259 ILE A C   1 
ATOM   2177 O O   . ILE A 1 290 ? 27.181  9.723  77.199  1.00 29.16 ? 1259 ILE A O   1 
ATOM   2178 C CB  . ILE A 1 290 ? 26.829  11.586 74.473  1.00 29.24 ? 1259 ILE A CB  1 
ATOM   2179 C CG1 . ILE A 1 290 ? 27.603  12.488 73.513  1.00 28.60 ? 1259 ILE A CG1 1 
ATOM   2180 C CG2 . ILE A 1 290 ? 26.337  12.404 75.656  1.00 28.69 ? 1259 ILE A CG2 1 
ATOM   2181 C CD1 . ILE A 1 290 ? 26.718  13.430 72.752  1.00 27.82 ? 1259 ILE A CD1 1 
ATOM   2182 N N   . ILE A 1 291 ? 26.027  8.817  75.485  1.00 28.70 ? 1260 ILE A N   1 
ATOM   2183 C CA  . ILE A 1 291 ? 25.215  7.963  76.335  1.00 28.61 ? 1260 ILE A CA  1 
ATOM   2184 C C   . ILE A 1 291 ? 26.149  7.004  77.087  1.00 29.08 ? 1260 ILE A C   1 
ATOM   2185 O O   . ILE A 1 291 ? 26.044  6.857  78.311  1.00 27.15 ? 1260 ILE A O   1 
ATOM   2186 C CB  . ILE A 1 291 ? 24.178  7.186  75.479  1.00 27.59 ? 1260 ILE A CB  1 
ATOM   2187 C CG1 . ILE A 1 291 ? 23.258  8.196  74.780  1.00 26.45 ? 1260 ILE A CG1 1 
ATOM   2188 C CG2 . ILE A 1 291 ? 23.376  6.214  76.351  1.00 25.06 ? 1260 ILE A CG2 1 
ATOM   2189 C CD1 . ILE A 1 291 ? 22.245  7.594  73.827  1.00 27.81 ? 1260 ILE A CD1 1 
ATOM   2190 N N   . SER A 1 292 ? 27.077  6.385  76.350  1.00 28.91 ? 1261 SER A N   1 
ATOM   2191 C CA  . SER A 1 292 ? 28.049  5.448  76.930  1.00 29.66 ? 1261 SER A CA  1 
ATOM   2192 C C   . SER A 1 292 ? 28.789  6.005  78.140  1.00 28.36 ? 1261 SER A C   1 
ATOM   2193 O O   . SER A 1 292 ? 28.928  5.326  79.151  1.00 29.03 ? 1261 SER A O   1 
ATOM   2194 C CB  . SER A 1 292 ? 29.090  5.021  75.889  1.00 28.84 ? 1261 SER A CB  1 
ATOM   2195 O OG  . SER A 1 292 ? 28.526  4.169  74.914  1.00 31.46 ? 1261 SER A OG  1 
ATOM   2196 N N   . SER A 1 293 ? 29.272  7.237  78.034  1.00 27.62 ? 1262 SER A N   1 
ATOM   2197 C CA  . SER A 1 293 ? 30.002  7.840  79.134  1.00 25.89 ? 1262 SER A CA  1 
ATOM   2198 C C   . SER A 1 293 ? 29.093  8.182  80.306  1.00 25.86 ? 1262 SER A C   1 
ATOM   2199 O O   . SER A 1 293 ? 29.581  8.494  81.385  1.00 25.40 ? 1262 SER A O   1 
ATOM   2200 C CB  . SER A 1 293 ? 30.738  9.091  78.663  1.00 24.62 ? 1262 SER A CB  1 
ATOM   2201 O OG  . SER A 1 293 ? 29.822  10.085 78.265  1.00 26.17 ? 1262 SER A OG  1 
ATOM   2202 N N   . ILE A 1 294 ? 27.777  8.123  80.101  1.00 26.09 ? 1263 ILE A N   1 
ATOM   2203 C CA  . ILE A 1 294 ? 26.835  8.421  81.181  1.00 26.07 ? 1263 ILE A CA  1 
ATOM   2204 C C   . ILE A 1 294 ? 25.760  7.342  81.389  1.00 28.45 ? 1263 ILE A C   1 
ATOM   2205 O O   . ILE A 1 294 ? 24.697  7.630  81.934  1.00 27.59 ? 1263 ILE A O   1 
ATOM   2206 C CB  . ILE A 1 294 ? 26.092  9.762  80.952  1.00 23.97 ? 1263 ILE A CB  1 
ATOM   2207 C CG1 . ILE A 1 294 ? 25.161  9.643  79.743  1.00 21.57 ? 1263 ILE A CG1 1 
ATOM   2208 C CG2 . ILE A 1 294 ? 27.083  10.882 80.749  1.00 22.76 ? 1263 ILE A CG2 1 
ATOM   2209 C CD1 . ILE A 1 294 ? 23.987  10.578 79.796  1.00 16.90 ? 1263 ILE A CD1 1 
ATOM   2210 N N   . LYS A 1 295 ? 26.020  6.107  80.970  1.00 31.39 ? 1264 LYS A N   1 
ATOM   2211 C CA  . LYS A 1 295 ? 25.021  5.049  81.128  1.00 34.70 ? 1264 LYS A CA  1 
ATOM   2212 C C   . LYS A 1 295 ? 24.917  4.497  82.556  1.00 35.39 ? 1264 LYS A C   1 
ATOM   2213 O O   . LYS A 1 295 ? 23.864  3.993  82.956  1.00 35.32 ? 1264 LYS A O   1 
ATOM   2214 C CB  . LYS A 1 295 ? 25.285  3.901  80.135  1.00 36.41 ? 1264 LYS A CB  1 
ATOM   2215 C CG  . LYS A 1 295 ? 26.506  3.035  80.436  1.00 38.61 ? 1264 LYS A CG  1 
ATOM   2216 C CD  . LYS A 1 295 ? 26.702  1.971  79.354  1.00 39.25 ? 1264 LYS A CD  1 
ATOM   2217 C CE  . LYS A 1 295 ? 27.937  1.102  79.618  1.00 39.19 ? 1264 LYS A CE  1 
ATOM   2218 N NZ  . LYS A 1 295 ? 29.214  1.871  79.554  1.00 37.70 ? 1264 LYS A NZ  1 
ATOM   2219 N N   . GLU A 1 296 ? 25.999  4.605  83.320  1.00 36.17 ? 1265 GLU A N   1 
ATOM   2220 C CA  . GLU A 1 296 ? 26.022  4.122  84.701  1.00 38.53 ? 1265 GLU A CA  1 
ATOM   2221 C C   . GLU A 1 296 ? 25.261  5.090  85.612  1.00 38.20 ? 1265 GLU A C   1 
ATOM   2222 O O   . GLU A 1 296 ? 25.014  4.794  86.777  1.00 38.46 ? 1265 GLU A O   1 
ATOM   2223 C CB  . GLU A 1 296 ? 27.468  3.998  85.195  1.00 40.35 ? 1265 GLU A CB  1 
ATOM   2224 C CG  . GLU A 1 296 ? 28.404  3.282  84.232  1.00 46.22 ? 1265 GLU A CG  1 
ATOM   2225 C CD  . GLU A 1 296 ? 28.284  1.765  84.297  1.00 48.94 ? 1265 GLU A CD  1 
ATOM   2226 O OE1 . GLU A 1 296 ? 27.155  1.263  84.500  1.00 50.36 ? 1265 GLU A OE1 1 
ATOM   2227 O OE2 . GLU A 1 296 ? 29.320  1.078  84.129  1.00 50.05 ? 1265 GLU A OE2 1 
ATOM   2228 N N   . GLU A 1 297 ? 24.899  6.250  85.075  1.00 38.06 ? 1266 GLU A N   1 
ATOM   2229 C CA  . GLU A 1 297 ? 24.173  7.264  85.837  1.00 36.77 ? 1266 GLU A CA  1 
ATOM   2230 C C   . GLU A 1 297 ? 22.691  7.248  85.495  1.00 34.86 ? 1266 GLU A C   1 
ATOM   2231 O O   . GLU A 1 297 ? 21.869  7.794  86.225  1.00 34.61 ? 1266 GLU A O   1 
ATOM   2232 C CB  . GLU A 1 297 ? 24.734  8.652  85.533  1.00 38.52 ? 1266 GLU A CB  1 
ATOM   2233 C CG  . GLU A 1 297 ? 26.225  8.788  85.767  1.00 41.70 ? 1266 GLU A CG  1 
ATOM   2234 C CD  . GLU A 1 297 ? 26.585  8.739  87.235  1.00 44.82 ? 1266 GLU A CD  1 
ATOM   2235 O OE1 . GLU A 1 297 ? 27.794  8.814  87.547  1.00 47.13 ? 1266 GLU A OE1 1 
ATOM   2236 O OE2 . GLU A 1 297 ? 25.661  8.634  88.077  1.00 44.28 ? 1266 GLU A OE2 1 
ATOM   2237 N N   . MET A 1 298 ? 22.351  6.619  84.381  1.00 32.94 ? 1267 MET A N   1 
ATOM   2238 C CA  . MET A 1 298 ? 20.970  6.564  83.955  1.00 33.55 ? 1267 MET A CA  1 
ATOM   2239 C C   . MET A 1 298 ? 20.125  5.598  84.782  1.00 34.35 ? 1267 MET A C   1 
ATOM   2240 O O   . MET A 1 298 ? 20.614  4.573  85.254  1.00 35.96 ? 1267 MET A O   1 
ATOM   2241 C CB  . MET A 1 298 ? 20.911  6.181  82.477  1.00 34.21 ? 1267 MET A CB  1 
ATOM   2242 C CG  . MET A 1 298 ? 21.557  7.208  81.548  1.00 34.90 ? 1267 MET A CG  1 
ATOM   2243 S SD  . MET A 1 298 ? 20.777  8.835  81.653  1.00 34.85 ? 1267 MET A SD  1 
ATOM   2244 C CE  . MET A 1 298 ? 19.374  8.613  80.482  1.00 32.33 ? 1267 MET A CE  1 
ATOM   2245 N N   . GLU A 1 299 ? 18.851  5.934  84.963  1.00 33.72 ? 1268 GLU A N   1 
ATOM   2246 C CA  . GLU A 1 299 ? 17.944  5.074  85.707  1.00 33.04 ? 1268 GLU A CA  1 
ATOM   2247 C C   . GLU A 1 299 ? 17.709  3.769  84.947  1.00 32.34 ? 1268 GLU A C   1 
ATOM   2248 O O   . GLU A 1 299 ? 17.712  3.743  83.708  1.00 31.56 ? 1268 GLU A O   1 
ATOM   2249 C CB  . GLU A 1 299 ? 16.624  5.796  85.949  1.00 34.00 ? 1268 GLU A CB  1 
ATOM   2250 C CG  . GLU A 1 299 ? 16.571  6.486  87.298  1.00 37.03 ? 1268 GLU A CG  1 
ATOM   2251 C CD  . GLU A 1 299 ? 15.829  7.798  87.253  1.00 38.11 ? 1268 GLU A CD  1 
ATOM   2252 O OE1 . GLU A 1 299 ? 14.733  7.845  86.654  1.00 40.84 ? 1268 GLU A OE1 1 
ATOM   2253 O OE2 . GLU A 1 299 ? 16.341  8.784  87.824  1.00 38.78 ? 1268 GLU A OE2 1 
ATOM   2254 N N   . PRO A 1 300 ? 17.498  2.665  85.684  1.00 30.79 ? 1269 PRO A N   1 
ATOM   2255 C CA  . PRO A 1 300 ? 17.262  1.328  85.120  1.00 29.33 ? 1269 PRO A CA  1 
ATOM   2256 C C   . PRO A 1 300 ? 16.176  1.219  84.052  1.00 29.67 ? 1269 PRO A C   1 
ATOM   2257 O O   . PRO A 1 300 ? 16.311  0.432  83.112  1.00 30.44 ? 1269 PRO A O   1 
ATOM   2258 C CB  . PRO A 1 300 ? 16.976  0.473  86.352  1.00 29.40 ? 1269 PRO A CB  1 
ATOM   2259 C CG  . PRO A 1 300 ? 16.480  1.474  87.364  1.00 31.34 ? 1269 PRO A CG  1 
ATOM   2260 C CD  . PRO A 1 300 ? 17.379  2.647  87.150  1.00 29.42 ? 1269 PRO A CD  1 
ATOM   2261 N N   . GLY A 1 301 ? 15.108  2.001  84.190  1.00 28.84 ? 1270 GLY A N   1 
ATOM   2262 C CA  . GLY A 1 301 ? 14.043  1.957  83.207  1.00 28.01 ? 1270 GLY A CA  1 
ATOM   2263 C C   . GLY A 1 301 ? 14.566  2.323  81.830  1.00 29.32 ? 1270 GLY A C   1 
ATOM   2264 O O   . GLY A 1 301 ? 14.078  1.832  80.815  1.00 30.22 ? 1270 GLY A O   1 
ATOM   2265 N N   . PHE A 1 302 ? 15.561  3.199  81.794  1.00 29.18 ? 1271 PHE A N   1 
ATOM   2266 C CA  . PHE A 1 302 ? 16.161  3.625  80.540  1.00 30.50 ? 1271 PHE A CA  1 
ATOM   2267 C C   . PHE A 1 302 ? 16.631  2.378  79.789  1.00 30.99 ? 1271 PHE A C   1 
ATOM   2268 O O   . PHE A 1 302 ? 16.579  2.314  78.560  1.00 29.89 ? 1271 PHE A O   1 
ATOM   2269 C CB  . PHE A 1 302 ? 17.353  4.546  80.831  1.00 31.58 ? 1271 PHE A CB  1 
ATOM   2270 C CG  . PHE A 1 302 ? 18.015  5.104  79.604  1.00 31.01 ? 1271 PHE A CG  1 
ATOM   2271 C CD1 . PHE A 1 302 ? 17.418  6.130  78.878  1.00 31.53 ? 1271 PHE A CD1 1 
ATOM   2272 C CD2 . PHE A 1 302 ? 19.251  4.614  79.182  1.00 31.74 ? 1271 PHE A CD2 1 
ATOM   2273 C CE1 . PHE A 1 302 ? 18.043  6.665  77.751  1.00 30.17 ? 1271 PHE A CE1 1 
ATOM   2274 C CE2 . PHE A 1 302 ? 19.880  5.140  78.060  1.00 31.37 ? 1271 PHE A CE2 1 
ATOM   2275 C CZ  . PHE A 1 302 ? 19.273  6.172  77.342  1.00 29.92 ? 1271 PHE A CZ  1 
ATOM   2276 N N   . ARG A 1 303 ? 17.094  1.384  80.542  1.00 31.41 ? 1272 ARG A N   1 
ATOM   2277 C CA  . ARG A 1 303 ? 17.569  0.144  79.943  1.00 30.63 ? 1272 ARG A CA  1 
ATOM   2278 C C   . ARG A 1 303 ? 16.443  -0.532 79.198  1.00 28.60 ? 1272 ARG A C   1 
ATOM   2279 O O   . ARG A 1 303 ? 16.671  -1.199 78.198  1.00 27.47 ? 1272 ARG A O   1 
ATOM   2280 C CB  . ARG A 1 303 ? 18.099  -0.816 81.014  1.00 32.88 ? 1272 ARG A CB  1 
ATOM   2281 C CG  . ARG A 1 303 ? 19.614  -0.973 81.033  1.00 35.87 ? 1272 ARG A CG  1 
ATOM   2282 C CD  . ARG A 1 303 ? 20.026  -2.273 81.720  1.00 40.43 ? 1272 ARG A CD  1 
ATOM   2283 N NE  . ARG A 1 303 ? 21.471  -2.498 81.653  1.00 44.17 ? 1272 ARG A NE  1 
ATOM   2284 C CZ  . ARG A 1 303 ? 22.371  -1.876 82.414  1.00 45.56 ? 1272 ARG A CZ  1 
ATOM   2285 N NH1 . ARG A 1 303 ? 23.665  -2.146 82.268  1.00 45.75 ? 1272 ARG A NH1 1 
ATOM   2286 N NH2 . ARG A 1 303 ? 21.982  -0.996 83.331  1.00 44.48 ? 1272 ARG A NH2 1 
ATOM   2287 N N   . GLU A 1 304 ? 15.225  -0.332 79.693  1.00 28.25 ? 1273 GLU A N   1 
ATOM   2288 C CA  . GLU A 1 304 ? 14.027  -0.939 79.135  1.00 28.10 ? 1273 GLU A CA  1 
ATOM   2289 C C   . GLU A 1 304 ? 13.335  -0.170 78.010  1.00 29.25 ? 1273 GLU A C   1 
ATOM   2290 O O   . GLU A 1 304 ? 12.667  -0.774 77.169  1.00 29.33 ? 1273 GLU A O   1 
ATOM   2291 C CB  . GLU A 1 304 ? 13.032  -1.196 80.269  1.00 28.09 ? 1273 GLU A CB  1 
ATOM   2292 C CG  . GLU A 1 304 ? 11.890  -2.132 79.920  1.00 31.91 ? 1273 GLU A CG  1 
ATOM   2293 C CD  . GLU A 1 304 ? 12.373  -3.429 79.287  1.00 35.37 ? 1273 GLU A CD  1 
ATOM   2294 O OE1 . GLU A 1 304 ? 13.275  -4.080 79.854  1.00 36.81 ? 1273 GLU A OE1 1 
ATOM   2295 O OE2 . GLU A 1 304 ? 11.848  -3.800 78.217  1.00 37.01 ? 1273 GLU A OE2 1 
ATOM   2296 N N   . VAL A 1 305 ? 13.491  1.150  77.977  1.00 29.94 ? 1274 VAL A N   1 
ATOM   2297 C CA  . VAL A 1 305 ? 12.831  1.945  76.944  1.00 29.53 ? 1274 VAL A CA  1 
ATOM   2298 C C   . VAL A 1 305 ? 13.735  2.620  75.930  1.00 30.44 ? 1274 VAL A C   1 
ATOM   2299 O O   . VAL A 1 305 ? 13.259  3.042  74.880  1.00 31.29 ? 1274 VAL A O   1 
ATOM   2300 C CB  . VAL A 1 305 ? 11.951  3.051  77.561  1.00 29.99 ? 1274 VAL A CB  1 
ATOM   2301 C CG1 . VAL A 1 305 ? 10.836  2.427  78.386  1.00 29.13 ? 1274 VAL A CG1 1 
ATOM   2302 C CG2 . VAL A 1 305 ? 12.812  3.999  78.412  1.00 27.37 ? 1274 VAL A CG2 1 
ATOM   2303 N N   . SER A 1 306 ? 15.029  2.715  76.224  1.00 31.71 ? 1275 SER A N   1 
ATOM   2304 C CA  . SER A 1 306 ? 15.962  3.397  75.322  1.00 32.43 ? 1275 SER A CA  1 
ATOM   2305 C C   . SER A 1 306 ? 16.295  2.691  74.020  1.00 32.99 ? 1275 SER A C   1 
ATOM   2306 O O   . SER A 1 306 ? 16.259  1.468  73.924  1.00 34.63 ? 1275 SER A O   1 
ATOM   2307 C CB  . SER A 1 306 ? 17.283  3.711  76.039  1.00 32.46 ? 1275 SER A CB  1 
ATOM   2308 O OG  . SER A 1 306 ? 18.136  2.581  76.090  1.00 32.19 ? 1275 SER A OG  1 
ATOM   2309 N N   . PHE A 1 307 ? 16.620  3.492  73.017  1.00 33.56 ? 1276 PHE A N   1 
ATOM   2310 C CA  . PHE A 1 307 ? 17.013  2.990  71.719  1.00 33.78 ? 1276 PHE A CA  1 
ATOM   2311 C C   . PHE A 1 307 ? 18.413  2.450  71.934  1.00 33.48 ? 1276 PHE A C   1 
ATOM   2312 O O   . PHE A 1 307 ? 18.825  1.473  71.315  1.00 33.19 ? 1276 PHE A O   1 
ATOM   2313 C CB  . PHE A 1 307 ? 17.052  4.139  70.708  1.00 36.00 ? 1276 PHE A CB  1 
ATOM   2314 C CG  . PHE A 1 307 ? 17.889  3.854  69.489  1.00 38.75 ? 1276 PHE A CG  1 
ATOM   2315 C CD1 . PHE A 1 307 ? 17.519  2.858  68.583  1.00 39.81 ? 1276 PHE A CD1 1 
ATOM   2316 C CD2 . PHE A 1 307 ? 19.055  4.578  69.249  1.00 39.72 ? 1276 PHE A CD2 1 
ATOM   2317 C CE1 . PHE A 1 307 ? 18.297  2.587  67.456  1.00 40.25 ? 1276 PHE A CE1 1 
ATOM   2318 C CE2 . PHE A 1 307 ? 19.842  4.317  68.128  1.00 40.96 ? 1276 PHE A CE2 1 
ATOM   2319 C CZ  . PHE A 1 307 ? 19.461  3.318  67.228  1.00 41.44 ? 1276 PHE A CZ  1 
ATOM   2320 N N   . TYR A 1 308 ? 19.137  3.097  72.839  1.00 33.61 ? 1277 TYR A N   1 
ATOM   2321 C CA  . TYR A 1 308 ? 20.502  2.703  73.139  1.00 35.23 ? 1277 TYR A CA  1 
ATOM   2322 C C   . TYR A 1 308 ? 20.651  1.207  73.403  1.00 37.50 ? 1277 TYR A C   1 
ATOM   2323 O O   . TYR A 1 308 ? 21.495  0.553  72.789  1.00 38.24 ? 1277 TYR A O   1 
ATOM   2324 C CB  . TYR A 1 308 ? 21.042  3.481  74.340  1.00 32.45 ? 1277 TYR A CB  1 
ATOM   2325 C CG  . TYR A 1 308 ? 22.509  3.215  74.585  1.00 30.53 ? 1277 TYR A CG  1 
ATOM   2326 C CD1 . TYR A 1 308 ? 23.489  3.772  73.762  1.00 29.25 ? 1277 TYR A CD1 1 
ATOM   2327 C CD2 . TYR A 1 308 ? 22.914  2.355  75.600  1.00 29.29 ? 1277 TYR A CD2 1 
ATOM   2328 C CE1 . TYR A 1 308 ? 24.836  3.472  73.943  1.00 29.57 ? 1277 TYR A CE1 1 
ATOM   2329 C CE2 . TYR A 1 308 ? 24.246  2.047  75.789  1.00 29.76 ? 1277 TYR A CE2 1 
ATOM   2330 C CZ  . TYR A 1 308 ? 25.205  2.605  74.961  1.00 30.24 ? 1277 TYR A CZ  1 
ATOM   2331 O OH  . TYR A 1 308 ? 26.523  2.277  75.158  1.00 30.01 ? 1277 TYR A OH  1 
ATOM   2332 N N   . TYR A 1 309 ? 19.848  0.671  74.321  1.00 38.75 ? 1278 TYR A N   1 
ATOM   2333 C CA  . TYR A 1 309 ? 19.923  -0.749 74.641  1.00 40.30 ? 1278 TYR A CA  1 
ATOM   2334 C C   . TYR A 1 309 ? 18.958  -1.554 73.797  1.00 42.13 ? 1278 TYR A C   1 
ATOM   2335 O O   . TYR A 1 309 ? 18.921  -2.776 73.899  1.00 43.13 ? 1278 TYR A O   1 
ATOM   2336 C CB  . TYR A 1 309 ? 19.593  -1.010 76.109  1.00 39.28 ? 1278 TYR A CB  1 
ATOM   2337 C CG  . TYR A 1 309 ? 20.555  -0.421 77.108  1.00 39.49 ? 1278 TYR A CG  1 
ATOM   2338 C CD1 . TYR A 1 309 ? 20.550  0.941  77.395  1.00 39.83 ? 1278 TYR A CD1 1 
ATOM   2339 C CD2 . TYR A 1 309 ? 21.447  -1.236 77.801  1.00 39.85 ? 1278 TYR A CD2 1 
ATOM   2340 C CE1 . TYR A 1 309 ? 21.411  1.479  78.358  1.00 40.96 ? 1278 TYR A CE1 1 
ATOM   2341 C CE2 . TYR A 1 309 ? 22.313  -0.711 78.760  1.00 40.01 ? 1278 TYR A CE2 1 
ATOM   2342 C CZ  . TYR A 1 309 ? 22.286  0.645  79.035  1.00 40.51 ? 1278 TYR A CZ  1 
ATOM   2343 O OH  . TYR A 1 309 ? 23.123  1.160  79.995  1.00 41.37 ? 1278 TYR A OH  1 
ATOM   2344 N N   . SER A 1 310 ? 18.176  -0.877 72.966  1.00 44.03 ? 1279 SER A N   1 
ATOM   2345 C CA  . SER A 1 310 ? 17.198  -1.569 72.141  1.00 45.82 ? 1279 SER A CA  1 
ATOM   2346 C C   . SER A 1 310 ? 17.865  -2.435 71.093  1.00 48.40 ? 1279 SER A C   1 
ATOM   2347 O O   . SER A 1 310 ? 19.026  -2.220 70.739  1.00 49.75 ? 1279 SER A O   1 
ATOM   2348 C CB  . SER A 1 310 ? 16.272  -0.573 71.440  1.00 44.78 ? 1279 SER A CB  1 
ATOM   2349 O OG  . SER A 1 310 ? 16.883  -0.039 70.281  1.00 43.18 ? 1279 SER A OG  1 
ATOM   2350 N N   . GLU A 1 311 ? 17.113  -3.420 70.609  1.00 50.55 ? 1280 GLU A N   1 
ATOM   2351 C CA  . GLU A 1 311 ? 17.572  -4.341 69.575  1.00 51.63 ? 1280 GLU A CA  1 
ATOM   2352 C C   . GLU A 1 311 ? 18.245  -3.521 68.484  1.00 50.91 ? 1280 GLU A C   1 
ATOM   2353 O O   . GLU A 1 311 ? 19.451  -3.611 68.266  1.00 50.83 ? 1280 GLU A O   1 
ATOM   2354 C CB  . GLU A 1 311 ? 16.361  -5.069 68.982  1.00 54.68 ? 1280 GLU A CB  1 
ATOM   2355 C CG  . GLU A 1 311 ? 15.226  -4.103 68.585  1.00 58.63 ? 1280 GLU A CG  1 
ATOM   2356 C CD  . GLU A 1 311 ? 14.150  -4.736 67.717  1.00 60.37 ? 1280 GLU A CD  1 
ATOM   2357 O OE1 . GLU A 1 311 ? 13.332  -5.517 68.248  1.00 61.39 ? 1280 GLU A OE1 1 
ATOM   2358 O OE2 . GLU A 1 311 ? 14.127  -4.450 66.499  1.00 61.06 ? 1280 GLU A OE2 1 
ATOM   2359 N N   . GLU A 1 312 ? 17.420  -2.709 67.832  1.00 50.54 ? 1281 GLU A N   1 
ATOM   2360 C CA  . GLU A 1 312 ? 17.780  -1.822 66.740  1.00 50.08 ? 1281 GLU A CA  1 
ATOM   2361 C C   . GLU A 1 312 ? 19.197  -1.247 66.722  1.00 50.70 ? 1281 GLU A C   1 
ATOM   2362 O O   . GLU A 1 312 ? 19.772  -1.072 65.641  1.00 51.19 ? 1281 GLU A O   1 
ATOM   2363 C CB  . GLU A 1 312 ? 16.774  -0.675 66.691  1.00 49.29 ? 1281 GLU A CB  1 
ATOM   2364 C CG  . GLU A 1 312 ? 15.329  -1.117 66.614  1.00 50.14 ? 1281 GLU A CG  1 
ATOM   2365 C CD  . GLU A 1 312 ? 14.370  -0.015 67.039  1.00 53.67 ? 1281 GLU A CD  1 
ATOM   2366 O OE1 . GLU A 1 312 ? 14.420  0.391  68.225  1.00 53.53 ? 1281 GLU A OE1 1 
ATOM   2367 O OE2 . GLU A 1 312 ? 13.570  0.452  66.192  1.00 54.14 ? 1281 GLU A OE2 1 
ATOM   2368 N N   . ASN A 1 313 ? 19.766  -0.933 67.884  1.00 50.08 ? 1282 ASN A N   1 
ATOM   2369 C CA  . ASN A 1 313 ? 21.117  -0.373 67.887  1.00 50.74 ? 1282 ASN A CA  1 
ATOM   2370 C C   . ASN A 1 313 ? 22.092  -1.419 67.356  1.00 52.20 ? 1282 ASN A C   1 
ATOM   2371 O O   . ASN A 1 313 ? 22.368  -2.424 68.020  1.00 52.34 ? 1282 ASN A O   1 
ATOM   2372 C CB  . ASN A 1 313 ? 21.546  0.059  69.293  1.00 48.97 ? 1282 ASN A CB  1 
ATOM   2373 C CG  . ASN A 1 313 ? 22.776  0.960  69.279  1.00 46.47 ? 1282 ASN A CG  1 
ATOM   2374 O OD1 . ASN A 1 313 ? 23.670  0.801  68.452  1.00 44.70 ? 1282 ASN A OD1 1 
ATOM   2375 N ND2 . ASN A 1 313 ? 22.830  1.900  70.211  1.00 45.34 ? 1282 ASN A ND2 1 
ATOM   2376 N N   . LYS A 1 314 ? 22.601  -1.177 66.151  1.00 53.44 ? 1283 LYS A N   1 
ATOM   2377 C CA  . LYS A 1 314 ? 23.540  -2.091 65.513  1.00 54.54 ? 1283 LYS A CA  1 
ATOM   2378 C C   . LYS A 1 314 ? 24.823  -1.348 65.171  1.00 55.75 ? 1283 LYS A C   1 
ATOM   2379 O O   . LYS A 1 314 ? 25.853  -1.620 65.826  1.00 56.47 ? 1283 LYS A O   1 
ATOM   2380 C CB  . LYS A 1 314 ? 22.926  -2.655 64.234  1.00 54.59 ? 1283 LYS A CB  1 
ATOM   2381 C CG  . LYS A 1 314 ? 21.516  -3.180 64.420  1.00 53.72 ? 1283 LYS A CG  1 
ATOM   2382 C CD  . LYS A 1 314 ? 20.887  -3.618 63.117  1.00 51.08 ? 1283 LYS A CD  1 
ATOM   2383 C CE  . LYS A 1 314 ? 19.466  -4.055 63.362  1.00 50.31 ? 1283 LYS A CE  1 
ATOM   2384 N NZ  . LYS A 1 314 ? 18.688  -2.952 63.985  1.00 48.96 ? 1283 LYS A NZ  1 
ATOM   2385 N N   . SER B 1 10  ? 15.225  16.057 58.500  1.00 26.30 ? 979  SER B N   1 
ATOM   2386 C CA  . SER B 1 10  ? 15.899  16.266 57.181  1.00 27.91 ? 979  SER B CA  1 
ATOM   2387 C C   . SER B 1 10  ? 17.201  15.483 57.057  1.00 28.47 ? 979  SER B C   1 
ATOM   2388 O O   . SER B 1 10  ? 17.726  14.959 58.044  1.00 29.59 ? 979  SER B O   1 
ATOM   2389 C CB  . SER B 1 10  ? 16.180  17.758 56.949  1.00 26.40 ? 979  SER B CB  1 
ATOM   2390 O OG  . SER B 1 10  ? 17.015  18.297 57.958  1.00 27.57 ? 979  SER B OG  1 
ATOM   2391 N N   . ALA B 1 11  ? 17.718  15.408 55.836  1.00 28.73 ? 980  ALA B N   1 
ATOM   2392 C CA  . ALA B 1 11  ? 18.954  14.689 55.568  1.00 29.04 ? 980  ALA B CA  1 
ATOM   2393 C C   . ALA B 1 11  ? 20.163  15.516 55.987  1.00 29.26 ? 980  ALA B C   1 
ATOM   2394 O O   . ALA B 1 11  ? 20.059  16.724 56.192  1.00 28.39 ? 980  ALA B O   1 
ATOM   2395 C CB  . ALA B 1 11  ? 19.041  14.347 54.091  1.00 29.70 ? 980  ALA B CB  1 
ATOM   2396 N N   . ALA B 1 12  ? 21.310  14.855 56.114  1.00 30.03 ? 981  ALA B N   1 
ATOM   2397 C CA  . ALA B 1 12  ? 22.542  15.525 56.511  1.00 30.44 ? 981  ALA B CA  1 
ATOM   2398 C C   . ALA B 1 12  ? 23.160  16.192 55.303  1.00 30.97 ? 981  ALA B C   1 
ATOM   2399 O O   . ALA B 1 12  ? 23.090  15.664 54.196  1.00 32.29 ? 981  ALA B O   1 
ATOM   2400 C CB  . ALA B 1 12  ? 23.512  14.525 57.100  1.00 29.58 ? 981  ALA B CB  1 
ATOM   2401 N N   . ASP B 1 13  ? 23.758  17.358 55.514  1.00 30.97 ? 982  ASP B N   1 
ATOM   2402 C CA  . ASP B 1 13  ? 24.385  18.084 54.423  1.00 31.51 ? 982  ASP B CA  1 
ATOM   2403 C C   . ASP B 1 13  ? 25.749  17.489 54.120  1.00 32.38 ? 982  ASP B C   1 
ATOM   2404 O O   . ASP B 1 13  ? 26.768  18.175 54.205  1.00 33.20 ? 982  ASP B O   1 
ATOM   2405 C CB  . ASP B 1 13  ? 24.534  19.570 54.766  1.00 31.67 ? 982  ASP B CB  1 
ATOM   2406 C CG  . ASP B 1 13  ? 23.197  20.270 54.932  1.00 33.46 ? 982  ASP B CG  1 
ATOM   2407 O OD1 . ASP B 1 13  ? 23.169  21.388 55.500  1.00 33.99 ? 982  ASP B OD1 1 
ATOM   2408 O OD2 . ASP B 1 13  ? 22.174  19.706 54.490  1.00 31.74 ? 982  ASP B OD2 1 
ATOM   2409 N N   . VAL B 1 14  ? 25.764  16.205 53.778  1.00 31.85 ? 983  VAL B N   1 
ATOM   2410 C CA  . VAL B 1 14  ? 27.005  15.530 53.426  1.00 32.89 ? 983  VAL B CA  1 
ATOM   2411 C C   . VAL B 1 14  ? 26.747  14.707 52.179  1.00 32.49 ? 983  VAL B C   1 
ATOM   2412 O O   . VAL B 1 14  ? 25.596  14.508 51.796  1.00 33.15 ? 983  VAL B O   1 
ATOM   2413 C CB  . VAL B 1 14  ? 27.481  14.576 54.539  1.00 33.52 ? 983  VAL B CB  1 
ATOM   2414 C CG1 . VAL B 1 14  ? 27.434  15.289 55.881  1.00 34.89 ? 983  VAL B CG1 1 
ATOM   2415 C CG2 . VAL B 1 14  ? 26.629  13.319 54.553  1.00 32.72 ? 983  VAL B CG2 1 
ATOM   2416 N N   . TYR B 1 15  ? 27.813  14.245 51.537  1.00 31.44 ? 984  TYR B N   1 
ATOM   2417 C CA  . TYR B 1 15  ? 27.668  13.410 50.355  1.00 30.67 ? 984  TYR B CA  1 
ATOM   2418 C C   . TYR B 1 15  ? 28.569  12.215 50.507  1.00 30.81 ? 984  TYR B C   1 
ATOM   2419 O O   . TYR B 1 15  ? 29.785  12.359 50.607  1.00 31.12 ? 984  TYR B O   1 
ATOM   2420 C CB  . TYR B 1 15  ? 28.043  14.153 49.071  1.00 30.70 ? 984  TYR B CB  1 
ATOM   2421 C CG  . TYR B 1 15  ? 28.022  13.256 47.853  1.00 28.60 ? 984  TYR B CG  1 
ATOM   2422 C CD1 . TYR B 1 15  ? 29.130  12.466 47.525  1.00 29.21 ? 984  TYR B CD1 1 
ATOM   2423 C CD2 . TYR B 1 15  ? 26.873  13.133 47.078  1.00 27.07 ? 984  TYR B CD2 1 
ATOM   2424 C CE1 . TYR B 1 15  ? 29.092  11.567 46.461  1.00 28.23 ? 984  TYR B CE1 1 
ATOM   2425 C CE2 . TYR B 1 15  ? 26.816  12.239 46.011  1.00 28.72 ? 984  TYR B CE2 1 
ATOM   2426 C CZ  . TYR B 1 15  ? 27.929  11.454 45.710  1.00 28.69 ? 984  TYR B CZ  1 
ATOM   2427 O OH  . TYR B 1 15  ? 27.863  10.531 44.693  1.00 25.88 ? 984  TYR B OH  1 
ATOM   2428 N N   . VAL B 1 16  ? 27.976  11.031 50.527  1.00 30.36 ? 985  VAL B N   1 
ATOM   2429 C CA  . VAL B 1 16  ? 28.770  9.830  50.667  1.00 30.17 ? 985  VAL B CA  1 
ATOM   2430 C C   . VAL B 1 16  ? 28.963  9.170  49.307  1.00 30.04 ? 985  VAL B C   1 
ATOM   2431 O O   . VAL B 1 16  ? 28.003  8.807  48.635  1.00 30.80 ? 985  VAL B O   1 
ATOM   2432 C CB  . VAL B 1 16  ? 28.114  8.862  51.659  1.00 30.05 ? 985  VAL B CB  1 
ATOM   2433 C CG1 . VAL B 1 16  ? 28.910  7.572  51.724  1.00 30.24 ? 985  VAL B CG1 1 
ATOM   2434 C CG2 . VAL B 1 16  ? 28.050  9.518  53.041  1.00 27.66 ? 985  VAL B CG2 1 
ATOM   2435 N N   . PRO B 1 17  ? 30.222  9.031  48.878  1.00 29.77 ? 986  PRO B N   1 
ATOM   2436 C CA  . PRO B 1 17  ? 30.577  8.422  47.597  1.00 29.78 ? 986  PRO B CA  1 
ATOM   2437 C C   . PRO B 1 17  ? 30.041  7.005  47.460  1.00 30.52 ? 986  PRO B C   1 
ATOM   2438 O O   . PRO B 1 17  ? 30.303  6.156  48.318  1.00 31.14 ? 986  PRO B O   1 
ATOM   2439 C CB  . PRO B 1 17  ? 32.104  8.432  47.621  1.00 28.77 ? 986  PRO B CB  1 
ATOM   2440 C CG  . PRO B 1 17  ? 32.423  9.613  48.466  1.00 28.70 ? 986  PRO B CG  1 
ATOM   2441 C CD  . PRO B 1 17  ? 31.434  9.467  49.592  1.00 30.01 ? 986  PRO B CD  1 
ATOM   2442 N N   . ASP B 1 18  ? 29.294  6.762  46.383  1.00 29.65 ? 987  ASP B N   1 
ATOM   2443 C CA  . ASP B 1 18  ? 28.753  5.440  46.091  1.00 28.84 ? 987  ASP B CA  1 
ATOM   2444 C C   . ASP B 1 18  ? 29.523  4.872  44.892  1.00 28.14 ? 987  ASP B C   1 
ATOM   2445 O O   . ASP B 1 18  ? 30.675  5.239  44.669  1.00 28.44 ? 987  ASP B O   1 
ATOM   2446 C CB  . ASP B 1 18  ? 27.257  5.526  45.781  1.00 27.48 ? 987  ASP B CB  1 
ATOM   2447 C CG  . ASP B 1 18  ? 26.922  6.698  44.908  1.00 27.50 ? 987  ASP B CG  1 
ATOM   2448 O OD1 . ASP B 1 18  ? 27.752  7.046  44.046  1.00 27.47 ? 987  ASP B OD1 1 
ATOM   2449 O OD2 . ASP B 1 18  ? 25.829  7.271  45.074  1.00 28.26 ? 987  ASP B OD2 1 
ATOM   2450 N N   . GLU B 1 19  ? 28.901  3.987  44.121  1.00 28.76 ? 988  GLU B N   1 
ATOM   2451 C CA  . GLU B 1 19  ? 29.573  3.393  42.966  1.00 30.26 ? 988  GLU B CA  1 
ATOM   2452 C C   . GLU B 1 19  ? 29.476  4.235  41.699  1.00 29.03 ? 988  GLU B C   1 
ATOM   2453 O O   . GLU B 1 19  ? 29.800  3.764  40.613  1.00 28.64 ? 988  GLU B O   1 
ATOM   2454 C CB  . GLU B 1 19  ? 29.021  1.995  42.673  1.00 32.49 ? 988  GLU B CB  1 
ATOM   2455 C CG  . GLU B 1 19  ? 27.622  1.986  42.082  1.00 37.43 ? 988  GLU B CG  1 
ATOM   2456 C CD  . GLU B 1 19  ? 26.555  2.362  43.089  1.00 40.93 ? 988  GLU B CD  1 
ATOM   2457 O OE1 . GLU B 1 19  ? 26.606  3.485  43.635  1.00 42.60 ? 988  GLU B OE1 1 
ATOM   2458 O OE2 . GLU B 1 19  ? 25.659  1.527  43.336  1.00 43.70 ? 988  GLU B OE2 1 
ATOM   2459 N N   . TRP B 1 20  ? 29.012  5.472  41.834  1.00 28.87 ? 989  TRP B N   1 
ATOM   2460 C CA  . TRP B 1 20  ? 28.903  6.367  40.688  1.00 27.54 ? 989  TRP B CA  1 
ATOM   2461 C C   . TRP B 1 20  ? 30.145  7.229  40.632  1.00 26.94 ? 989  TRP B C   1 
ATOM   2462 O O   . TRP B 1 20  ? 30.456  7.813  39.603  1.00 28.17 ? 989  TRP B O   1 
ATOM   2463 C CB  . TRP B 1 20  ? 27.685  7.284  40.796  1.00 27.43 ? 989  TRP B CB  1 
ATOM   2464 C CG  . TRP B 1 20  ? 26.369  6.599  40.654  1.00 26.75 ? 989  TRP B CG  1 
ATOM   2465 C CD1 . TRP B 1 20  ? 25.624  6.050  41.647  1.00 26.45 ? 989  TRP B CD1 1 
ATOM   2466 C CD2 . TRP B 1 20  ? 25.631  6.409  39.443  1.00 27.88 ? 989  TRP B CD2 1 
ATOM   2467 N NE1 . TRP B 1 20  ? 24.461  5.533  41.137  1.00 27.60 ? 989  TRP B NE1 1 
ATOM   2468 C CE2 . TRP B 1 20  ? 24.440  5.738  39.783  1.00 28.44 ? 989  TRP B CE2 1 
ATOM   2469 C CE3 . TRP B 1 20  ? 25.860  6.745  38.098  1.00 30.13 ? 989  TRP B CE3 1 
ATOM   2470 C CZ2 . TRP B 1 20  ? 23.473  5.391  38.830  1.00 30.34 ? 989  TRP B CZ2 1 
ATOM   2471 C CZ3 . TRP B 1 20  ? 24.897  6.402  37.143  1.00 30.47 ? 989  TRP B CZ3 1 
ATOM   2472 C CH2 . TRP B 1 20  ? 23.718  5.731  37.518  1.00 31.48 ? 989  TRP B CH2 1 
ATOM   2473 N N   . GLU B 1 21  ? 30.853  7.313  41.750  1.00 25.92 ? 990  GLU B N   1 
ATOM   2474 C CA  . GLU B 1 21  ? 32.066  8.111  41.805  1.00 25.33 ? 990  GLU B CA  1 
ATOM   2475 C C   . GLU B 1 21  ? 32.962  7.685  40.651  1.00 24.54 ? 990  GLU B C   1 
ATOM   2476 O O   . GLU B 1 21  ? 32.987  6.522  40.263  1.00 26.32 ? 990  GLU B O   1 
ATOM   2477 C CB  . GLU B 1 21  ? 32.786  7.895  43.140  1.00 23.64 ? 990  GLU B CB  1 
ATOM   2478 C CG  . GLU B 1 21  ? 33.871  8.920  43.460  1.00 24.80 ? 990  GLU B CG  1 
ATOM   2479 C CD  . GLU B 1 21  ? 33.322  10.321 43.748  1.00 25.15 ? 990  GLU B CD  1 
ATOM   2480 O OE1 . GLU B 1 21  ? 32.213  10.420 44.312  1.00 24.65 ? 990  GLU B OE1 1 
ATOM   2481 O OE2 . GLU B 1 21  ? 34.007  11.319 43.430  1.00 23.63 ? 990  GLU B OE2 1 
ATOM   2482 N N   . VAL B 1 22  ? 33.685  8.635  40.087  1.00 24.10 ? 991  VAL B N   1 
ATOM   2483 C CA  . VAL B 1 22  ? 34.571  8.324  38.988  1.00 23.45 ? 991  VAL B CA  1 
ATOM   2484 C C   . VAL B 1 22  ? 35.861  9.115  39.154  1.00 23.32 ? 991  VAL B C   1 
ATOM   2485 O O   . VAL B 1 22  ? 35.825  10.306 39.482  1.00 24.23 ? 991  VAL B O   1 
ATOM   2486 C CB  . VAL B 1 22  ? 33.924  8.692  37.635  1.00 24.24 ? 991  VAL B CB  1 
ATOM   2487 C CG1 . VAL B 1 22  ? 34.804  8.203  36.485  1.00 23.51 ? 991  VAL B CG1 1 
ATOM   2488 C CG2 . VAL B 1 22  ? 32.534  8.096  37.544  1.00 22.25 ? 991  VAL B CG2 1 
ATOM   2489 N N   . ALA B 1 23  ? 36.992  8.447  38.936  1.00 21.97 ? 992  ALA B N   1 
ATOM   2490 C CA  . ALA B 1 23  ? 38.304  9.081  39.039  1.00 21.13 ? 992  ALA B CA  1 
ATOM   2491 C C   . ALA B 1 23  ? 38.416  10.271 38.084  1.00 20.60 ? 992  ALA B C   1 
ATOM   2492 O O   . ALA B 1 23  ? 38.202  10.153 36.880  1.00 22.31 ? 992  ALA B O   1 
ATOM   2493 C CB  . ALA B 1 23  ? 39.404  8.064  38.735  1.00 19.98 ? 992  ALA B CB  1 
ATOM   2494 N N   . ARG B 1 24  ? 38.759  11.422 38.634  1.00 20.70 ? 993  ARG B N   1 
ATOM   2495 C CA  . ARG B 1 24  ? 38.887  12.627 37.843  1.00 23.41 ? 993  ARG B CA  1 
ATOM   2496 C C   . ARG B 1 24  ? 39.781  12.428 36.615  1.00 24.23 ? 993  ARG B C   1 
ATOM   2497 O O   . ARG B 1 24  ? 39.667  13.172 35.641  1.00 23.73 ? 993  ARG B O   1 
ATOM   2498 C CB  . ARG B 1 24  ? 39.430  13.761 38.724  1.00 23.60 ? 993  ARG B CB  1 
ATOM   2499 C CG  . ARG B 1 24  ? 39.361  15.127 38.083  1.00 27.27 ? 993  ARG B CG  1 
ATOM   2500 C CD  . ARG B 1 24  ? 39.864  16.199 39.029  1.00 31.00 ? 993  ARG B CD  1 
ATOM   2501 N NE  . ARG B 1 24  ? 38.918  16.503 40.103  1.00 33.66 ? 993  ARG B NE  1 
ATOM   2502 C CZ  . ARG B 1 24  ? 37.869  17.310 39.975  1.00 33.16 ? 993  ARG B CZ  1 
ATOM   2503 N NH1 . ARG B 1 24  ? 37.621  17.905 38.818  1.00 33.98 ? 993  ARG B NH1 1 
ATOM   2504 N NH2 . ARG B 1 24  ? 37.067  17.526 41.007  1.00 33.36 ? 993  ARG B NH2 1 
ATOM   2505 N N   . GLU B 1 25  ? 40.647  11.416 36.649  1.00 25.53 ? 994  GLU B N   1 
ATOM   2506 C CA  . GLU B 1 25  ? 41.560  11.165 35.533  1.00 27.65 ? 994  GLU B CA  1 
ATOM   2507 C C   . GLU B 1 25  ? 40.971  10.450 34.304  1.00 28.04 ? 994  GLU B C   1 
ATOM   2508 O O   . GLU B 1 25  ? 41.644  10.278 33.282  1.00 28.23 ? 994  GLU B O   1 
ATOM   2509 C CB  . GLU B 1 25  ? 42.823  10.430 36.022  1.00 26.85 ? 994  GLU B CB  1 
ATOM   2510 C CG  . GLU B 1 25  ? 42.635  9.466  37.174  1.00 27.08 ? 994  GLU B CG  1 
ATOM   2511 C CD  . GLU B 1 25  ? 42.916  10.102 38.528  1.00 27.08 ? 994  GLU B CD  1 
ATOM   2512 O OE1 . GLU B 1 25  ? 41.969  10.614 39.156  1.00 24.74 ? 994  GLU B OE1 1 
ATOM   2513 O OE2 . GLU B 1 25  ? 44.091  10.096 38.962  1.00 25.42 ? 994  GLU B OE2 1 
ATOM   2514 N N   . LYS B 1 26  ? 39.709  10.054 34.390  1.00 29.12 ? 995  LYS B N   1 
ATOM   2515 C CA  . LYS B 1 26  ? 39.059  9.390  33.268  1.00 28.39 ? 995  LYS B CA  1 
ATOM   2516 C C   . LYS B 1 26  ? 38.255  10.426 32.487  1.00 28.04 ? 995  LYS B C   1 
ATOM   2517 O O   . LYS B 1 26  ? 37.617  10.123 31.472  1.00 26.84 ? 995  LYS B O   1 
ATOM   2518 C CB  . LYS B 1 26  ? 38.146  8.279  33.785  1.00 28.46 ? 995  LYS B CB  1 
ATOM   2519 C CG  . LYS B 1 26  ? 38.895  7.162  34.482  1.00 28.65 ? 995  LYS B CG  1 
ATOM   2520 C CD  . LYS B 1 26  ? 37.964  6.028  34.853  1.00 31.47 ? 995  LYS B CD  1 
ATOM   2521 C CE  . LYS B 1 26  ? 38.728  4.918  35.543  1.00 32.27 ? 995  LYS B CE  1 
ATOM   2522 N NZ  . LYS B 1 26  ? 39.874  4.480  34.711  1.00 31.84 ? 995  LYS B NZ  1 
ATOM   2523 N N   . ILE B 1 27  ? 38.318  11.660 32.970  1.00 27.85 ? 996  ILE B N   1 
ATOM   2524 C CA  . ILE B 1 27  ? 37.597  12.769 32.370  1.00 28.10 ? 996  ILE B CA  1 
ATOM   2525 C C   . ILE B 1 27  ? 38.495  13.706 31.562  1.00 28.77 ? 996  ILE B C   1 
ATOM   2526 O O   . ILE B 1 27  ? 39.683  13.864 31.850  1.00 27.99 ? 996  ILE B O   1 
ATOM   2527 C CB  . ILE B 1 27  ? 36.874  13.597 33.475  1.00 28.07 ? 996  ILE B CB  1 
ATOM   2528 C CG1 . ILE B 1 27  ? 35.942  12.689 34.277  1.00 27.80 ? 996  ILE B CG1 1 
ATOM   2529 C CG2 . ILE B 1 27  ? 36.105  14.758 32.863  1.00 26.05 ? 996  ILE B CG2 1 
ATOM   2530 C CD1 . ILE B 1 27  ? 34.955  11.929 33.420  1.00 29.23 ? 996  ILE B CD1 1 
ATOM   2531 N N   . THR B 1 28  ? 37.899  14.315 30.540  1.00 29.94 ? 997  THR B N   1 
ATOM   2532 C CA  . THR B 1 28  ? 38.569  15.288 29.682  1.00 28.95 ? 997  THR B CA  1 
ATOM   2533 C C   . THR B 1 28  ? 37.610  16.432 29.397  1.00 28.13 ? 997  THR B C   1 
ATOM   2534 O O   . THR B 1 28  ? 36.432  16.214 29.134  1.00 25.21 ? 997  THR B O   1 
ATOM   2535 C CB  . THR B 1 28  ? 38.988  14.683 28.345  1.00 29.00 ? 997  THR B CB  1 
ATOM   2536 O OG1 . THR B 1 28  ? 40.202  13.956 28.525  1.00 34.32 ? 997  THR B OG1 1 
ATOM   2537 C CG2 . THR B 1 28  ? 39.207  15.770 27.303  1.00 29.68 ? 997  THR B CG2 1 
ATOM   2538 N N   . MET B 1 29  ? 38.116  17.653 29.477  1.00 29.84 ? 998  MET B N   1 
ATOM   2539 C CA  . MET B 1 29  ? 37.304  18.821 29.194  1.00 31.51 ? 998  MET B CA  1 
ATOM   2540 C C   . MET B 1 29  ? 37.683  19.265 27.794  1.00 32.13 ? 998  MET B C   1 
ATOM   2541 O O   . MET B 1 29  ? 38.868  19.396 27.477  1.00 30.67 ? 998  MET B O   1 
ATOM   2542 C CB  . MET B 1 29  ? 37.593  19.943 30.190  1.00 33.81 ? 998  MET B CB  1 
ATOM   2543 C CG  . MET B 1 29  ? 36.407  20.308 31.062  1.00 37.51 ? 998  MET B CG  1 
ATOM   2544 S SD  . MET B 1 29  ? 36.393  19.450 32.642  1.00 42.45 ? 998  MET B SD  1 
ATOM   2545 C CE  . MET B 1 29  ? 36.102  20.835 33.769  1.00 39.79 ? 998  MET B CE  1 
ATOM   2546 N N   . SER B 1 30  ? 36.675  19.482 26.954  1.00 33.86 ? 999  SER B N   1 
ATOM   2547 C CA  . SER B 1 30  ? 36.902  19.905 25.577  1.00 33.05 ? 999  SER B CA  1 
ATOM   2548 C C   . SER B 1 30  ? 36.606  21.390 25.380  1.00 33.42 ? 999  SER B C   1 
ATOM   2549 O O   . SER B 1 30  ? 37.469  22.136 24.919  1.00 34.05 ? 999  SER B O   1 
ATOM   2550 C CB  . SER B 1 30  ? 36.042  19.072 24.648  1.00 32.68 ? 999  SER B CB  1 
ATOM   2551 O OG  . SER B 1 30  ? 36.144  17.709 25.009  1.00 34.03 ? 999  SER B OG  1 
ATOM   2552 N N   . ARG B 1 31  ? 35.402  21.831 25.732  1.00 32.49 ? 1000 ARG B N   1 
ATOM   2553 C CA  . ARG B 1 31  ? 35.070  23.244 25.562  1.00 33.32 ? 1000 ARG B CA  1 
ATOM   2554 C C   . ARG B 1 31  ? 33.969  23.736 26.485  1.00 33.78 ? 1000 ARG B C   1 
ATOM   2555 O O   . ARG B 1 31  ? 33.205  22.942 27.038  1.00 33.82 ? 1000 ARG B O   1 
ATOM   2556 C CB  . ARG B 1 31  ? 34.660  23.522 24.108  1.00 32.88 ? 1000 ARG B CB  1 
ATOM   2557 C CG  . ARG B 1 31  ? 33.339  22.903 23.696  1.00 31.50 ? 1000 ARG B CG  1 
ATOM   2558 C CD  . ARG B 1 31  ? 33.159  22.939 22.174  1.00 32.82 ? 1000 ARG B CD  1 
ATOM   2559 N NE  . ARG B 1 31  ? 32.017  22.125 21.764  1.00 32.16 ? 1000 ARG B NE  1 
ATOM   2560 C CZ  . ARG B 1 31  ? 30.748  22.517 21.829  1.00 32.35 ? 1000 ARG B CZ  1 
ATOM   2561 N NH1 . ARG B 1 31  ? 30.436  23.731 22.275  1.00 31.23 ? 1000 ARG B NH1 1 
ATOM   2562 N NH2 . ARG B 1 31  ? 29.783  21.672 21.490  1.00 33.72 ? 1000 ARG B NH2 1 
ATOM   2563 N N   . GLU B 1 32  ? 33.895  25.054 26.648  1.00 33.94 ? 1001 GLU B N   1 
ATOM   2564 C CA  . GLU B 1 32  ? 32.859  25.656 27.478  1.00 35.36 ? 1001 GLU B CA  1 
ATOM   2565 C C   . GLU B 1 32  ? 31.526  25.450 26.761  1.00 35.07 ? 1001 GLU B C   1 
ATOM   2566 O O   . GLU B 1 32  ? 31.395  25.758 25.575  1.00 34.90 ? 1001 GLU B O   1 
ATOM   2567 C CB  . GLU B 1 32  ? 33.108  27.149 27.650  1.00 36.85 ? 1001 GLU B CB  1 
ATOM   2568 C CG  . GLU B 1 32  ? 34.409  27.488 28.304  1.00 38.28 ? 1001 GLU B CG  1 
ATOM   2569 C CD  . GLU B 1 32  ? 34.219  28.464 29.431  1.00 40.91 ? 1001 GLU B CD  1 
ATOM   2570 O OE1 . GLU B 1 32  ? 33.552  29.500 29.208  1.00 40.93 ? 1001 GLU B OE1 1 
ATOM   2571 O OE2 . GLU B 1 32  ? 34.736  28.194 30.538  1.00 42.45 ? 1001 GLU B OE2 1 
ATOM   2572 N N   . LEU B 1 33  ? 30.538  24.935 27.482  1.00 34.97 ? 1002 LEU B N   1 
ATOM   2573 C CA  . LEU B 1 33  ? 29.227  24.667 26.898  1.00 34.69 ? 1002 LEU B CA  1 
ATOM   2574 C C   . LEU B 1 33  ? 28.231  25.772 27.216  1.00 35.38 ? 1002 LEU B C   1 
ATOM   2575 O O   . LEU B 1 33  ? 27.295  26.010 26.463  1.00 35.09 ? 1002 LEU B O   1 
ATOM   2576 C CB  . LEU B 1 33  ? 28.712  23.330 27.420  1.00 32.76 ? 1002 LEU B CB  1 
ATOM   2577 C CG  . LEU B 1 33  ? 28.148  22.355 26.400  1.00 31.65 ? 1002 LEU B CG  1 
ATOM   2578 C CD1 . LEU B 1 33  ? 28.837  22.532 25.058  1.00 32.23 ? 1002 LEU B CD1 1 
ATOM   2579 C CD2 . LEU B 1 33  ? 28.323  20.945 26.938  1.00 32.28 ? 1002 LEU B CD2 1 
ATOM   2580 N N   . GLY B 1 34  ? 28.444  26.445 28.341  1.00 36.95 ? 1003 GLY B N   1 
ATOM   2581 C CA  . GLY B 1 34  ? 27.564  27.525 28.739  1.00 37.78 ? 1003 GLY B CA  1 
ATOM   2582 C C   . GLY B 1 34  ? 27.722  27.831 30.211  1.00 38.85 ? 1003 GLY B C   1 
ATOM   2583 O O   . GLY B 1 34  ? 28.782  27.626 30.787  1.00 39.76 ? 1003 GLY B O   1 
ATOM   2584 N N   . GLN B 1 35  ? 26.659  28.322 30.827  1.00 39.56 ? 1004 GLN B N   1 
ATOM   2585 C CA  . GLN B 1 35  ? 26.687  28.649 32.241  1.00 40.37 ? 1004 GLN B CA  1 
ATOM   2586 C C   . GLN B 1 35  ? 25.393  28.093 32.815  1.00 40.47 ? 1004 GLN B C   1 
ATOM   2587 O O   . GLN B 1 35  ? 24.309  28.441 32.337  1.00 40.61 ? 1004 GLN B O   1 
ATOM   2588 C CB  . GLN B 1 35  ? 26.747  30.169 32.424  1.00 40.98 ? 1004 GLN B CB  1 
ATOM   2589 C CG  . GLN B 1 35  ? 26.842  30.644 33.864  1.00 42.06 ? 1004 GLN B CG  1 
ATOM   2590 C CD  . GLN B 1 35  ? 28.168  30.301 34.515  1.00 43.45 ? 1004 GLN B CD  1 
ATOM   2591 O OE1 . GLN B 1 35  ? 29.221  30.353 33.875  1.00 44.84 ? 1004 GLN B OE1 1 
ATOM   2592 N NE2 . GLN B 1 35  ? 28.127  29.969 35.802  1.00 43.14 ? 1004 GLN B NE2 1 
ATOM   2593 N N   . GLY B 1 36  ? 25.513  27.216 33.813  1.00 38.96 ? 1005 GLY B N   1 
ATOM   2594 C CA  . GLY B 1 36  ? 24.345  26.617 34.434  1.00 37.00 ? 1005 GLY B CA  1 
ATOM   2595 C C   . GLY B 1 36  ? 24.048  27.199 35.805  1.00 36.89 ? 1005 GLY B C   1 
ATOM   2596 O O   . GLY B 1 36  ? 24.744  28.102 36.267  1.00 38.14 ? 1005 GLY B O   1 
ATOM   2597 N N   . SER B 1 37  ? 23.014  26.679 36.456  1.00 35.29 ? 1006 SER B N   1 
ATOM   2598 C CA  . SER B 1 37  ? 22.611  27.140 37.780  1.00 33.49 ? 1006 SER B CA  1 
ATOM   2599 C C   . SER B 1 37  ? 23.774  27.221 38.754  1.00 32.88 ? 1006 SER B C   1 
ATOM   2600 O O   . SER B 1 37  ? 24.037  28.267 39.347  1.00 31.03 ? 1006 SER B O   1 
ATOM   2601 C CB  . SER B 1 37  ? 21.570  26.191 38.373  1.00 33.64 ? 1006 SER B CB  1 
ATOM   2602 O OG  . SER B 1 37  ? 20.401  26.147 37.588  1.00 36.18 ? 1006 SER B OG  1 
ATOM   2603 N N   . PHE B 1 38  ? 24.456  26.090 38.911  1.00 32.82 ? 1007 PHE B N   1 
ATOM   2604 C CA  . PHE B 1 38  ? 25.576  25.945 39.836  1.00 32.26 ? 1007 PHE B CA  1 
ATOM   2605 C C   . PHE B 1 38  ? 26.940  26.351 39.286  1.00 31.85 ? 1007 PHE B C   1 
ATOM   2606 O O   . PHE B 1 38  ? 27.875  26.577 40.056  1.00 32.60 ? 1007 PHE B O   1 
ATOM   2607 C CB  . PHE B 1 38  ? 25.653  24.491 40.318  1.00 32.83 ? 1007 PHE B CB  1 
ATOM   2608 C CG  . PHE B 1 38  ? 24.562  24.096 41.289  1.00 32.51 ? 1007 PHE B CG  1 
ATOM   2609 C CD1 . PHE B 1 38  ? 24.765  24.191 42.662  1.00 32.05 ? 1007 PHE B CD1 1 
ATOM   2610 C CD2 . PHE B 1 38  ? 23.349  23.587 40.829  1.00 32.40 ? 1007 PHE B CD2 1 
ATOM   2611 C CE1 . PHE B 1 38  ? 23.778  23.779 43.559  1.00 32.17 ? 1007 PHE B CE1 1 
ATOM   2612 C CE2 . PHE B 1 38  ? 22.360  23.175 41.718  1.00 30.99 ? 1007 PHE B CE2 1 
ATOM   2613 C CZ  . PHE B 1 38  ? 22.575  23.270 43.083  1.00 31.57 ? 1007 PHE B CZ  1 
ATOM   2614 N N   . GLY B 1 39  ? 27.070  26.430 37.967  1.00 30.35 ? 1008 GLY B N   1 
ATOM   2615 C CA  . GLY B 1 39  ? 28.356  26.793 37.403  1.00 29.10 ? 1008 GLY B CA  1 
ATOM   2616 C C   . GLY B 1 39  ? 28.480  26.521 35.918  1.00 29.20 ? 1008 GLY B C   1 
ATOM   2617 O O   . GLY B 1 39  ? 27.481  26.338 35.222  1.00 28.83 ? 1008 GLY B O   1 
ATOM   2618 N N   . MET B 1 40  ? 29.717  26.504 35.435  1.00 29.34 ? 1009 MET B N   1 
ATOM   2619 C CA  . MET B 1 40  ? 30.006  26.266 34.024  1.00 29.60 ? 1009 MET B CA  1 
ATOM   2620 C C   . MET B 1 40  ? 29.790  24.793 33.648  1.00 28.67 ? 1009 MET B C   1 
ATOM   2621 O O   . MET B 1 40  ? 30.125  23.884 34.412  1.00 25.37 ? 1009 MET B O   1 
ATOM   2622 C CB  . MET B 1 40  ? 31.457  26.681 33.725  1.00 30.77 ? 1009 MET B CB  1 
ATOM   2623 C CG  . MET B 1 40  ? 31.924  26.506 32.274  1.00 32.43 ? 1009 MET B CG  1 
ATOM   2624 S SD  . MET B 1 40  ? 31.345  27.749 31.080  1.00 35.19 ? 1009 MET B SD  1 
ATOM   2625 C CE  . MET B 1 40  ? 31.917  29.270 31.835  1.00 34.44 ? 1009 MET B CE  1 
ATOM   2626 N N   . VAL B 1 41  ? 29.211  24.576 32.470  1.00 28.33 ? 1010 VAL B N   1 
ATOM   2627 C CA  . VAL B 1 41  ? 28.956  23.234 31.961  1.00 28.86 ? 1010 VAL B CA  1 
ATOM   2628 C C   . VAL B 1 41  ? 29.960  23.060 30.833  1.00 28.41 ? 1010 VAL B C   1 
ATOM   2629 O O   . VAL B 1 41  ? 30.289  24.028 30.159  1.00 28.07 ? 1010 VAL B O   1 
ATOM   2630 C CB  . VAL B 1 41  ? 27.500  23.089 31.422  1.00 28.53 ? 1010 VAL B CB  1 
ATOM   2631 C CG1 . VAL B 1 41  ? 27.264  21.664 30.889  1.00 26.08 ? 1010 VAL B CG1 1 
ATOM   2632 C CG2 . VAL B 1 41  ? 26.506  23.413 32.537  1.00 25.25 ? 1010 VAL B CG2 1 
ATOM   2633 N N   . TYR B 1 42  ? 30.458  21.840 30.641  1.00 28.58 ? 1011 TYR B N   1 
ATOM   2634 C CA  . TYR B 1 42  ? 31.461  21.584 29.607  1.00 28.85 ? 1011 TYR B CA  1 
ATOM   2635 C C   . TYR B 1 42  ? 31.137  20.363 28.766  1.00 27.87 ? 1011 TYR B C   1 
ATOM   2636 O O   . TYR B 1 42  ? 30.272  19.560 29.120  1.00 27.95 ? 1011 TYR B O   1 
ATOM   2637 C CB  . TYR B 1 42  ? 32.843  21.343 30.242  1.00 29.16 ? 1011 TYR B CB  1 
ATOM   2638 C CG  . TYR B 1 42  ? 33.484  22.522 30.935  1.00 29.35 ? 1011 TYR B CG  1 
ATOM   2639 C CD1 . TYR B 1 42  ? 34.216  23.469 30.219  1.00 29.89 ? 1011 TYR B CD1 1 
ATOM   2640 C CD2 . TYR B 1 42  ? 33.380  22.677 32.315  1.00 30.15 ? 1011 TYR B CD2 1 
ATOM   2641 C CE1 . TYR B 1 42  ? 34.834  24.539 30.867  1.00 30.82 ? 1011 TYR B CE1 1 
ATOM   2642 C CE2 . TYR B 1 42  ? 33.988  23.741 32.972  1.00 30.29 ? 1011 TYR B CE2 1 
ATOM   2643 C CZ  . TYR B 1 42  ? 34.714  24.668 32.249  1.00 30.76 ? 1011 TYR B CZ  1 
ATOM   2644 O OH  . TYR B 1 42  ? 35.319  25.713 32.914  1.00 30.39 ? 1011 TYR B OH  1 
ATOM   2645 N N   . GLU B 1 43  ? 31.838  20.241 27.644  1.00 26.46 ? 1012 GLU B N   1 
ATOM   2646 C CA  . GLU B 1 43  ? 31.699  19.074 26.786  1.00 27.19 ? 1012 GLU B CA  1 
ATOM   2647 C C   . GLU B 1 43  ? 33.038  18.373 26.963  1.00 26.96 ? 1012 GLU B C   1 
ATOM   2648 O O   . GLU B 1 43  ? 34.099  18.996 26.848  1.00 24.71 ? 1012 GLU B O   1 
ATOM   2649 C CB  . GLU B 1 43  ? 31.501  19.427 25.293  1.00 26.43 ? 1012 GLU B CB  1 
ATOM   2650 C CG  . GLU B 1 43  ? 31.306  18.162 24.421  1.00 27.45 ? 1012 GLU B CG  1 
ATOM   2651 C CD  . GLU B 1 43  ? 31.036  18.424 22.932  1.00 29.20 ? 1012 GLU B CD  1 
ATOM   2652 O OE1 . GLU B 1 43  ? 30.258  19.342 22.588  1.00 29.21 ? 1012 GLU B OE1 1 
ATOM   2653 O OE2 . GLU B 1 43  ? 31.592  17.680 22.099  1.00 28.09 ? 1012 GLU B OE2 1 
ATOM   2654 N N   . GLY B 1 44  ? 32.993  17.086 27.273  1.00 27.33 ? 1013 GLY B N   1 
ATOM   2655 C CA  . GLY B 1 44  ? 34.233  16.364 27.440  1.00 27.47 ? 1013 GLY B CA  1 
ATOM   2656 C C   . GLY B 1 44  ? 34.135  14.896 27.112  1.00 26.54 ? 1013 GLY B C   1 
ATOM   2657 O O   . GLY B 1 44  ? 33.188  14.435 26.487  1.00 26.03 ? 1013 GLY B O   1 
ATOM   2658 N N   . VAL B 1 45  ? 35.148  14.157 27.528  1.00 26.69 ? 1014 VAL B N   1 
ATOM   2659 C CA  . VAL B 1 45  ? 35.171  12.731 27.299  1.00 26.13 ? 1014 VAL B CA  1 
ATOM   2660 C C   . VAL B 1 45  ? 35.315  12.070 28.656  1.00 26.59 ? 1014 VAL B C   1 
ATOM   2661 O O   . VAL B 1 45  ? 36.042  12.554 29.522  1.00 25.76 ? 1014 VAL B O   1 
ATOM   2662 C CB  . VAL B 1 45  ? 36.346  12.335 26.378  1.00 25.67 ? 1014 VAL B CB  1 
ATOM   2663 C CG1 . VAL B 1 45  ? 36.408  10.825 26.231  1.00 24.91 ? 1014 VAL B CG1 1 
ATOM   2664 C CG2 . VAL B 1 45  ? 36.173  12.996 25.007  1.00 23.67 ? 1014 VAL B CG2 1 
ATOM   2665 N N   . ALA B 1 46  ? 34.580  10.988 28.849  1.00 28.04 ? 1015 ALA B N   1 
ATOM   2666 C CA  . ALA B 1 46  ? 34.632  10.238 30.089  1.00 30.37 ? 1015 ALA B CA  1 
ATOM   2667 C C   . ALA B 1 46  ? 35.045  8.827  29.687  1.00 33.57 ? 1015 ALA B C   1 
ATOM   2668 O O   . ALA B 1 46  ? 34.602  8.322  28.651  1.00 35.34 ? 1015 ALA B O   1 
ATOM   2669 C CB  . ALA B 1 46  ? 33.267  10.226 30.741  1.00 29.48 ? 1015 ALA B CB  1 
ATOM   2670 N N   . LYS B 1 47  ? 35.905  8.197  30.482  1.00 35.91 ? 1016 LYS B N   1 
ATOM   2671 C CA  . LYS B 1 47  ? 36.359  6.841  30.180  1.00 37.24 ? 1016 LYS B CA  1 
ATOM   2672 C C   . LYS B 1 47  ? 35.676  5.801  31.063  1.00 38.19 ? 1016 LYS B C   1 
ATOM   2673 O O   . LYS B 1 47  ? 35.664  5.922  32.286  1.00 38.98 ? 1016 LYS B O   1 
ATOM   2674 C CB  . LYS B 1 47  ? 37.876  6.739  30.357  1.00 37.66 ? 1016 LYS B CB  1 
ATOM   2675 C CG  . LYS B 1 47  ? 38.634  6.413  29.083  1.00 40.08 ? 1016 LYS B CG  1 
ATOM   2676 C CD  . LYS B 1 47  ? 38.539  7.533  28.052  1.00 40.81 ? 1016 LYS B CD  1 
ATOM   2677 C CE  . LYS B 1 47  ? 39.302  7.173  26.778  1.00 41.73 ? 1016 LYS B CE  1 
ATOM   2678 N NZ  . LYS B 1 47  ? 39.563  8.355  25.901  1.00 41.23 ? 1016 LYS B NZ  1 
ATOM   2679 N N   . GLY B 1 48  ? 35.094  4.789  30.430  1.00 39.39 ? 1017 GLY B N   1 
ATOM   2680 C CA  . GLY B 1 48  ? 34.433  3.723  31.163  1.00 41.31 ? 1017 GLY B CA  1 
ATOM   2681 C C   . GLY B 1 48  ? 33.072  4.007  31.775  1.00 42.91 ? 1017 GLY B C   1 
ATOM   2682 O O   . GLY B 1 48  ? 32.620  3.252  32.635  1.00 44.20 ? 1017 GLY B O   1 
ATOM   2683 N N   . VAL B 1 49  ? 32.396  5.068  31.350  1.00 43.05 ? 1018 VAL B N   1 
ATOM   2684 C CA  . VAL B 1 49  ? 31.093  5.368  31.934  1.00 43.09 ? 1018 VAL B CA  1 
ATOM   2685 C C   . VAL B 1 49  ? 29.943  4.581  31.315  1.00 44.36 ? 1018 VAL B C   1 
ATOM   2686 O O   . VAL B 1 49  ? 28.961  4.281  31.984  1.00 44.05 ? 1018 VAL B O   1 
ATOM   2687 C CB  . VAL B 1 49  ? 30.767  6.875  31.847  1.00 42.41 ? 1018 VAL B CB  1 
ATOM   2688 C CG1 . VAL B 1 49  ? 31.643  7.650  32.813  1.00 41.70 ? 1018 VAL B CG1 1 
ATOM   2689 C CG2 . VAL B 1 49  ? 30.978  7.373  30.431  1.00 42.65 ? 1018 VAL B CG2 1 
ATOM   2690 N N   . VAL B 1 50  ? 30.065  4.240  30.038  1.00 46.96 ? 1019 VAL B N   1 
ATOM   2691 C CA  . VAL B 1 50  ? 29.011  3.501  29.358  1.00 49.09 ? 1019 VAL B CA  1 
ATOM   2692 C C   . VAL B 1 50  ? 29.365  2.042  29.074  1.00 50.75 ? 1019 VAL B C   1 
ATOM   2693 O O   . VAL B 1 50  ? 30.485  1.721  28.681  1.00 51.26 ? 1019 VAL B O   1 
ATOM   2694 C CB  . VAL B 1 50  ? 28.622  4.206  28.037  1.00 49.55 ? 1019 VAL B CB  1 
ATOM   2695 C CG1 . VAL B 1 50  ? 27.716  3.307  27.198  1.00 49.72 ? 1019 VAL B CG1 1 
ATOM   2696 C CG2 . VAL B 1 50  ? 27.912  5.522  28.349  1.00 49.25 ? 1019 VAL B CG2 1 
ATOM   2697 N N   . LYS B 1 51  ? 28.384  1.167  29.275  1.00 52.34 ? 1020 LYS B N   1 
ATOM   2698 C CA  . LYS B 1 51  ? 28.533  -0.270 29.056  1.00 54.14 ? 1020 LYS B CA  1 
ATOM   2699 C C   . LYS B 1 51  ? 29.008  -0.598 27.629  1.00 54.92 ? 1020 LYS B C   1 
ATOM   2700 O O   . LYS B 1 51  ? 28.321  -0.294 26.649  1.00 54.39 ? 1020 LYS B O   1 
ATOM   2701 C CB  . LYS B 1 51  ? 27.186  -0.954 29.332  1.00 54.91 ? 1020 LYS B CB  1 
ATOM   2702 C CG  . LYS B 1 51  ? 27.263  -2.305 30.040  1.00 55.52 ? 1020 LYS B CG  1 
ATOM   2703 C CD  . LYS B 1 51  ? 25.862  -2.856 30.291  1.00 55.55 ? 1020 LYS B CD  1 
ATOM   2704 C CE  . LYS B 1 51  ? 25.888  -4.186 31.035  1.00 57.23 ? 1020 LYS B CE  1 
ATOM   2705 N NZ  . LYS B 1 51  ? 26.584  -5.264 30.280  1.00 56.98 ? 1020 LYS B NZ  1 
ATOM   2706 N N   . ASP B 1 52  ? 30.188  -1.213 27.532  1.00 56.21 ? 1021 ASP B N   1 
ATOM   2707 C CA  . ASP B 1 52  ? 30.790  -1.607 26.253  1.00 57.96 ? 1021 ASP B CA  1 
ATOM   2708 C C   . ASP B 1 52  ? 31.438  -0.483 25.426  1.00 58.45 ? 1021 ASP B C   1 
ATOM   2709 O O   . ASP B 1 52  ? 32.442  -0.715 24.741  1.00 59.12 ? 1021 ASP B O   1 
ATOM   2710 C CB  . ASP B 1 52  ? 29.763  -2.352 25.387  1.00 59.09 ? 1021 ASP B CB  1 
ATOM   2711 C CG  . ASP B 1 52  ? 29.569  -3.802 25.820  1.00 60.26 ? 1021 ASP B CG  1 
ATOM   2712 O OD1 . ASP B 1 52  ? 30.510  -4.609 25.641  1.00 59.08 ? 1021 ASP B OD1 1 
ATOM   2713 O OD2 . ASP B 1 52  ? 28.478  -4.131 26.341  1.00 60.77 ? 1021 ASP B OD2 1 
ATOM   2714 N N   . GLU B 1 53  ? 30.867  0.721  25.474  1.00 57.11 ? 1022 GLU B N   1 
ATOM   2715 C CA  . GLU B 1 53  ? 31.417  1.865  24.738  1.00 55.29 ? 1022 GLU B CA  1 
ATOM   2716 C C   . GLU B 1 53  ? 32.809  2.224  25.296  1.00 53.73 ? 1022 GLU B C   1 
ATOM   2717 O O   . GLU B 1 53  ? 32.958  2.494  26.488  1.00 53.24 ? 1022 GLU B O   1 
ATOM   2718 C CB  . GLU B 1 53  ? 30.444  3.047  24.859  1.00 56.13 ? 1022 GLU B CB  1 
ATOM   2719 C CG  . GLU B 1 53  ? 30.982  4.407  24.444  1.00 57.35 ? 1022 GLU B CG  1 
ATOM   2720 C CD  . GLU B 1 53  ? 29.897  5.486  24.439  1.00 58.78 ? 1022 GLU B CD  1 
ATOM   2721 O OE1 . GLU B 1 53  ? 29.038  5.485  25.349  1.00 58.09 ? 1022 GLU B OE1 1 
ATOM   2722 O OE2 . GLU B 1 53  ? 29.909  6.344  23.528  1.00 60.17 ? 1022 GLU B OE2 1 
ATOM   2723 N N   . PRO B 1 54  ? 33.848  2.216  24.440  1.00 52.19 ? 1023 PRO B N   1 
ATOM   2724 C CA  . PRO B 1 54  ? 35.209  2.538  24.889  1.00 50.96 ? 1023 PRO B CA  1 
ATOM   2725 C C   . PRO B 1 54  ? 35.267  3.785  25.767  1.00 49.50 ? 1023 PRO B C   1 
ATOM   2726 O O   . PRO B 1 54  ? 35.663  3.726  26.930  1.00 48.97 ? 1023 PRO B O   1 
ATOM   2727 C CB  . PRO B 1 54  ? 35.969  2.708  23.579  1.00 50.30 ? 1023 PRO B CB  1 
ATOM   2728 C CG  . PRO B 1 54  ? 35.295  1.732  22.686  1.00 51.02 ? 1023 PRO B CG  1 
ATOM   2729 C CD  . PRO B 1 54  ? 33.828  1.982  22.986  1.00 52.62 ? 1023 PRO B CD  1 
ATOM   2730 N N   . GLU B 1 55  ? 34.873  4.915  25.201  1.00 48.01 ? 1024 GLU B N   1 
ATOM   2731 C CA  . GLU B 1 55  ? 34.865  6.161  25.945  1.00 47.23 ? 1024 GLU B CA  1 
ATOM   2732 C C   . GLU B 1 55  ? 33.659  6.946  25.472  1.00 45.52 ? 1024 GLU B C   1 
ATOM   2733 O O   . GLU B 1 55  ? 33.295  6.883  24.299  1.00 46.62 ? 1024 GLU B O   1 
ATOM   2734 C CB  . GLU B 1 55  ? 36.145  6.947  25.681  1.00 49.89 ? 1024 GLU B CB  1 
ATOM   2735 C CG  . GLU B 1 55  ? 36.232  7.575  24.305  1.00 50.99 ? 1024 GLU B CG  1 
ATOM   2736 C CD  . GLU B 1 55  ? 37.662  7.871  23.920  1.00 53.30 ? 1024 GLU B CD  1 
ATOM   2737 O OE1 . GLU B 1 55  ? 38.406  6.900  23.660  1.00 54.46 ? 1024 GLU B OE1 1 
ATOM   2738 O OE2 . GLU B 1 55  ? 38.045  9.062  23.891  1.00 54.15 ? 1024 GLU B OE2 1 
ATOM   2739 N N   . THR B 1 56  ? 33.041  7.692  26.373  1.00 42.10 ? 1025 THR B N   1 
ATOM   2740 C CA  . THR B 1 56  ? 31.861  8.448  26.007  1.00 38.81 ? 1025 THR B CA  1 
ATOM   2741 C C   . THR B 1 56  ? 32.111  9.940  25.919  1.00 37.40 ? 1025 THR B C   1 
ATOM   2742 O O   . THR B 1 56  ? 32.980  10.461 26.614  1.00 37.73 ? 1025 THR B O   1 
ATOM   2743 C CB  . THR B 1 56  ? 30.762  8.200  27.026  1.00 38.75 ? 1025 THR B CB  1 
ATOM   2744 O OG1 . THR B 1 56  ? 30.673  6.791  27.275  1.00 38.11 ? 1025 THR B OG1 1 
ATOM   2745 C CG2 . THR B 1 56  ? 29.429  8.723  26.512  1.00 38.79 ? 1025 THR B CG2 1 
ATOM   2746 N N   . ARG B 1 57  ? 31.372  10.622 25.042  1.00 35.63 ? 1026 ARG B N   1 
ATOM   2747 C CA  . ARG B 1 57  ? 31.495  12.073 24.932  1.00 33.76 ? 1026 ARG B CA  1 
ATOM   2748 C C   . ARG B 1 57  ? 30.371  12.587 25.810  1.00 32.02 ? 1026 ARG B C   1 
ATOM   2749 O O   . ARG B 1 57  ? 29.207  12.279 25.585  1.00 33.15 ? 1026 ARG B O   1 
ATOM   2750 C CB  . ARG B 1 57  ? 31.329  12.579 23.496  1.00 33.03 ? 1026 ARG B CB  1 
ATOM   2751 C CG  . ARG B 1 57  ? 31.610  14.078 23.415  1.00 32.96 ? 1026 ARG B CG  1 
ATOM   2752 C CD  . ARG B 1 57  ? 31.834  14.582 22.006  1.00 33.66 ? 1026 ARG B CD  1 
ATOM   2753 N NE  . ARG B 1 57  ? 30.619  14.561 21.201  1.00 34.44 ? 1026 ARG B NE  1 
ATOM   2754 C CZ  . ARG B 1 57  ? 30.474  15.225 20.063  1.00 31.81 ? 1026 ARG B CZ  1 
ATOM   2755 N NH1 . ARG B 1 57  ? 31.463  15.964 19.595  1.00 33.79 ? 1026 ARG B NH1 1 
ATOM   2756 N NH2 . ARG B 1 57  ? 29.345  15.147 19.390  1.00 33.94 ? 1026 ARG B NH2 1 
ATOM   2757 N N   . VAL B 1 58  ? 30.728  13.376 26.814  1.00 31.30 ? 1027 VAL B N   1 
ATOM   2758 C CA  . VAL B 1 58  ? 29.757  13.853 27.783  1.00 28.75 ? 1027 VAL B CA  1 
ATOM   2759 C C   . VAL B 1 58  ? 29.668  15.349 28.008  1.00 28.70 ? 1027 VAL B C   1 
ATOM   2760 O O   . VAL B 1 58  ? 30.383  16.147 27.393  1.00 28.41 ? 1027 VAL B O   1 
ATOM   2761 C CB  . VAL B 1 58  ? 30.056  13.226 29.148  1.00 28.05 ? 1027 VAL B CB  1 
ATOM   2762 C CG1 . VAL B 1 58  ? 30.020  11.701 29.053  1.00 25.86 ? 1027 VAL B CG1 1 
ATOM   2763 C CG2 . VAL B 1 58  ? 31.428  13.688 29.614  1.00 25.90 ? 1027 VAL B CG2 1 
ATOM   2764 N N   . ALA B 1 59  ? 28.765  15.699 28.921  1.00 27.05 ? 1028 ALA B N   1 
ATOM   2765 C CA  . ALA B 1 59  ? 28.529  17.070 29.339  1.00 25.99 ? 1028 ALA B CA  1 
ATOM   2766 C C   . ALA B 1 59  ? 28.960  17.091 30.802  1.00 25.75 ? 1028 ALA B C   1 
ATOM   2767 O O   . ALA B 1 59  ? 28.546  16.232 31.589  1.00 26.78 ? 1028 ALA B O   1 
ATOM   2768 C CB  . ALA B 1 59  ? 27.062  17.413 29.216  1.00 23.78 ? 1028 ALA B CB  1 
ATOM   2769 N N   . ILE B 1 60  ? 29.795  18.059 31.164  1.00 24.26 ? 1029 ILE B N   1 
ATOM   2770 C CA  . ILE B 1 60  ? 30.295  18.159 32.528  1.00 22.05 ? 1029 ILE B CA  1 
ATOM   2771 C C   . ILE B 1 60  ? 29.776  19.408 33.248  1.00 21.75 ? 1029 ILE B C   1 
ATOM   2772 O O   . ILE B 1 60  ? 30.165  20.533 32.940  1.00 20.26 ? 1029 ILE B O   1 
ATOM   2773 C CB  . ILE B 1 60  ? 31.850  18.133 32.511  1.00 22.18 ? 1029 ILE B CB  1 
ATOM   2774 C CG1 . ILE B 1 60  ? 32.324  16.833 31.858  1.00 21.35 ? 1029 ILE B CG1 1 
ATOM   2775 C CG2 . ILE B 1 60  ? 32.416  18.206 33.923  1.00 23.62 ? 1029 ILE B CG2 1 
ATOM   2776 C CD1 . ILE B 1 60  ? 33.730  16.884 31.347  1.00 22.89 ? 1029 ILE B CD1 1 
ATOM   2777 N N   . LYS B 1 61  ? 28.865  19.196 34.192  1.00 21.99 ? 1030 LYS B N   1 
ATOM   2778 C CA  . LYS B 1 61  ? 28.296  20.288 34.977  1.00 21.80 ? 1030 LYS B CA  1 
ATOM   2779 C C   . LYS B 1 61  ? 29.197  20.470 36.187  1.00 23.21 ? 1030 LYS B C   1 
ATOM   2780 O O   . LYS B 1 61  ? 29.443  19.518 36.924  1.00 26.95 ? 1030 LYS B O   1 
ATOM   2781 C CB  . LYS B 1 61  ? 26.877  19.943 35.430  1.00 18.14 ? 1030 LYS B CB  1 
ATOM   2782 C CG  . LYS B 1 61  ? 25.868  19.856 34.301  1.00 19.05 ? 1030 LYS B CG  1 
ATOM   2783 C CD  . LYS B 1 61  ? 24.451  19.547 34.798  1.00 21.74 ? 1030 LYS B CD  1 
ATOM   2784 C CE  . LYS B 1 61  ? 24.357  18.146 35.404  1.00 24.28 ? 1030 LYS B CE  1 
ATOM   2785 N NZ  . LYS B 1 61  ? 22.976  17.737 35.798  1.00 24.24 ? 1030 LYS B NZ  1 
ATOM   2786 N N   . THR B 1 62  ? 29.697  21.682 36.390  1.00 23.79 ? 1031 THR B N   1 
ATOM   2787 C CA  . THR B 1 62  ? 30.589  21.968 37.507  1.00 23.06 ? 1031 THR B CA  1 
ATOM   2788 C C   . THR B 1 62  ? 29.990  22.978 38.483  1.00 25.33 ? 1031 THR B C   1 
ATOM   2789 O O   . THR B 1 62  ? 29.014  23.654 38.165  1.00 23.64 ? 1031 THR B O   1 
ATOM   2790 C CB  . THR B 1 62  ? 31.910  22.524 36.988  1.00 22.56 ? 1031 THR B CB  1 
ATOM   2791 O OG1 . THR B 1 62  ? 31.676  23.796 36.370  1.00 20.72 ? 1031 THR B OG1 1 
ATOM   2792 C CG2 . THR B 1 62  ? 32.509  21.577 35.962  1.00 20.43 ? 1031 THR B CG2 1 
ATOM   2793 N N   . VAL B 1 63  ? 30.591  23.074 39.669  1.00 28.67 ? 1032 VAL B N   1 
ATOM   2794 C CA  . VAL B 1 63  ? 30.150  24.002 40.717  1.00 31.89 ? 1032 VAL B CA  1 
ATOM   2795 C C   . VAL B 1 63  ? 31.213  25.085 40.924  1.00 34.70 ? 1032 VAL B C   1 
ATOM   2796 O O   . VAL B 1 63  ? 32.367  24.757 41.203  1.00 35.51 ? 1032 VAL B O   1 
ATOM   2797 C CB  . VAL B 1 63  ? 29.979  23.271 42.063  1.00 31.81 ? 1032 VAL B CB  1 
ATOM   2798 C CG1 . VAL B 1 63  ? 29.421  24.219 43.106  1.00 31.00 ? 1032 VAL B CG1 1 
ATOM   2799 C CG2 . VAL B 1 63  ? 29.087  22.065 41.891  1.00 32.47 ? 1032 VAL B CG2 1 
ATOM   2800 N N   . ASN B 1 64  ? 30.836  26.360 40.801  1.00 37.17 ? 1033 ASN B N   1 
ATOM   2801 C CA  . ASN B 1 64  ? 31.782  27.474 40.987  1.00 40.96 ? 1033 ASN B CA  1 
ATOM   2802 C C   . ASN B 1 64  ? 32.691  27.323 42.214  1.00 42.50 ? 1033 ASN B C   1 
ATOM   2803 O O   . ASN B 1 64  ? 32.296  26.713 43.208  1.00 42.73 ? 1033 ASN B O   1 
ATOM   2804 C CB  . ASN B 1 64  ? 31.025  28.799 41.098  1.00 42.66 ? 1033 ASN B CB  1 
ATOM   2805 C CG  . ASN B 1 64  ? 31.144  29.645 39.849  1.00 43.98 ? 1033 ASN B CG  1 
ATOM   2806 O OD1 . ASN B 1 64  ? 32.249  29.992 39.423  1.00 45.18 ? 1033 ASN B OD1 1 
ATOM   2807 N ND2 . ASN B 1 64  ? 30.006  29.987 39.253  1.00 45.07 ? 1033 ASN B ND2 1 
ATOM   2808 N N   . GLU B 1 65  ? 33.899  27.885 42.146  1.00 43.81 ? 1034 GLU B N   1 
ATOM   2809 C CA  . GLU B 1 65  ? 34.858  27.798 43.258  1.00 46.61 ? 1034 GLU B CA  1 
ATOM   2810 C C   . GLU B 1 65  ? 34.344  28.465 44.532  1.00 46.83 ? 1034 GLU B C   1 
ATOM   2811 O O   . GLU B 1 65  ? 34.514  27.949 45.640  1.00 45.27 ? 1034 GLU B O   1 
ATOM   2812 C CB  . GLU B 1 65  ? 36.183  28.480 42.908  1.00 48.40 ? 1034 GLU B CB  1 
ATOM   2813 C CG  . GLU B 1 65  ? 37.021  27.835 41.829  1.00 51.98 ? 1034 GLU B CG  1 
ATOM   2814 C CD  . GLU B 1 65  ? 38.417  28.442 41.771  1.00 53.83 ? 1034 GLU B CD  1 
ATOM   2815 O OE1 . GLU B 1 65  ? 39.148  28.324 42.777  1.00 55.35 ? 1034 GLU B OE1 1 
ATOM   2816 O OE2 . GLU B 1 65  ? 38.784  29.042 40.735  1.00 54.69 ? 1034 GLU B OE2 1 
ATOM   2817 N N   . ALA B 1 66  ? 33.737  29.634 44.349  1.00 47.00 ? 1035 ALA B N   1 
ATOM   2818 C CA  . ALA B 1 66  ? 33.213  30.438 45.443  1.00 46.07 ? 1035 ALA B CA  1 
ATOM   2819 C C   . ALA B 1 66  ? 32.057  29.792 46.206  1.00 45.42 ? 1035 ALA B C   1 
ATOM   2820 O O   . ALA B 1 66  ? 31.930  29.986 47.417  1.00 45.96 ? 1035 ALA B O   1 
ATOM   2821 C CB  . ALA B 1 66  ? 32.790  31.801 44.906  1.00 45.52 ? 1035 ALA B CB  1 
ATOM   2822 N N   . ALA B 1 67  ? 31.213  29.038 45.502  1.00 44.05 ? 1036 ALA B N   1 
ATOM   2823 C CA  . ALA B 1 67  ? 30.074  28.370 46.131  1.00 42.45 ? 1036 ALA B CA  1 
ATOM   2824 C C   . ALA B 1 67  ? 30.475  27.781 47.485  1.00 41.81 ? 1036 ALA B C   1 
ATOM   2825 O O   . ALA B 1 67  ? 31.627  27.394 47.690  1.00 42.24 ? 1036 ALA B O   1 
ATOM   2826 C CB  . ALA B 1 67  ? 29.545  27.271 45.217  1.00 42.20 ? 1036 ALA B CB  1 
ATOM   2827 N N   . SER B 1 68  ? 29.529  27.716 48.413  1.00 39.93 ? 1037 SER B N   1 
ATOM   2828 C CA  . SER B 1 68  ? 29.819  27.173 49.729  1.00 39.31 ? 1037 SER B CA  1 
ATOM   2829 C C   . SER B 1 68  ? 29.654  25.657 49.759  1.00 38.74 ? 1037 SER B C   1 
ATOM   2830 O O   . SER B 1 68  ? 29.116  25.055 48.828  1.00 37.73 ? 1037 SER B O   1 
ATOM   2831 C CB  . SER B 1 68  ? 28.883  27.780 50.764  1.00 39.86 ? 1037 SER B CB  1 
ATOM   2832 O OG  . SER B 1 68  ? 27.560  27.327 50.544  1.00 40.54 ? 1037 SER B OG  1 
ATOM   2833 N N   . MET B 1 69  ? 30.113  25.054 50.849  1.00 38.80 ? 1038 MET B N   1 
ATOM   2834 C CA  . MET B 1 69  ? 30.013  23.618 51.031  1.00 38.62 ? 1038 MET B CA  1 
ATOM   2835 C C   . MET B 1 69  ? 28.554  23.199 50.933  1.00 37.85 ? 1038 MET B C   1 
ATOM   2836 O O   . MET B 1 69  ? 28.237  22.147 50.388  1.00 37.52 ? 1038 MET B O   1 
ATOM   2837 C CB  . MET B 1 69  ? 30.583  23.214 52.398  1.00 41.50 ? 1038 MET B CB  1 
ATOM   2838 C CG  . MET B 1 69  ? 32.097  23.395 52.541  1.00 44.69 ? 1038 MET B CG  1 
ATOM   2839 S SD  . MET B 1 69  ? 33.070  22.706 51.138  1.00 52.83 ? 1038 MET B SD  1 
ATOM   2840 C CE  . MET B 1 69  ? 32.891  20.899 51.382  1.00 50.06 ? 1038 MET B CE  1 
ATOM   2841 N N   . ARG B 1 70  ? 27.668  24.034 51.461  1.00 37.45 ? 1039 ARG B N   1 
ATOM   2842 C CA  . ARG B 1 70  ? 26.238  23.757 51.431  1.00 37.99 ? 1039 ARG B CA  1 
ATOM   2843 C C   . ARG B 1 70  ? 25.771  23.593 49.979  1.00 38.98 ? 1039 ARG B C   1 
ATOM   2844 O O   . ARG B 1 70  ? 25.151  22.591 49.615  1.00 38.60 ? 1039 ARG B O   1 
ATOM   2845 C CB  . ARG B 1 70  ? 25.476  24.908 52.113  1.00 38.08 ? 1039 ARG B CB  1 
ATOM   2846 C CG  . ARG B 1 70  ? 23.974  24.678 52.319  1.00 37.46 ? 1039 ARG B CG  1 
ATOM   2847 C CD  . ARG B 1 70  ? 23.709  23.542 53.309  1.00 38.00 ? 1039 ARG B CD  1 
ATOM   2848 N NE  . ARG B 1 70  ? 22.305  23.125 53.352  1.00 37.73 ? 1039 ARG B NE  1 
ATOM   2849 C CZ  . ARG B 1 70  ? 21.294  23.885 53.768  1.00 38.05 ? 1039 ARG B CZ  1 
ATOM   2850 N NH1 . ARG B 1 70  ? 20.058  23.402 53.765  1.00 37.17 ? 1039 ARG B NH1 1 
ATOM   2851 N NH2 . ARG B 1 70  ? 21.512  25.125 54.185  1.00 39.26 ? 1039 ARG B NH2 1 
ATOM   2852 N N   . GLU B 1 71  ? 26.094  24.580 49.150  1.00 40.38 ? 1040 GLU B N   1 
ATOM   2853 C CA  . GLU B 1 71  ? 25.705  24.571 47.749  1.00 41.77 ? 1040 GLU B CA  1 
ATOM   2854 C C   . GLU B 1 71  ? 26.283  23.377 47.008  1.00 42.37 ? 1040 GLU B C   1 
ATOM   2855 O O   . GLU B 1 71  ? 25.643  22.848 46.090  1.00 41.35 ? 1040 GLU B O   1 
ATOM   2856 C CB  . GLU B 1 71  ? 26.149  25.871 47.084  1.00 43.16 ? 1040 GLU B CB  1 
ATOM   2857 C CG  . GLU B 1 71  ? 25.832  27.102 47.922  1.00 46.62 ? 1040 GLU B CG  1 
ATOM   2858 C CD  . GLU B 1 71  ? 26.294  28.386 47.267  1.00 49.22 ? 1040 GLU B CD  1 
ATOM   2859 O OE1 . GLU B 1 71  ? 26.340  29.432 47.960  1.00 49.04 ? 1040 GLU B OE1 1 
ATOM   2860 O OE2 . GLU B 1 71  ? 26.606  28.345 46.055  1.00 50.32 ? 1040 GLU B OE2 1 
ATOM   2861 N N   . ARG B 1 72  ? 27.488  22.953 47.395  1.00 42.52 ? 1041 ARG B N   1 
ATOM   2862 C CA  . ARG B 1 72  ? 28.114  21.798 46.749  1.00 44.12 ? 1041 ARG B CA  1 
ATOM   2863 C C   . ARG B 1 72  ? 27.318  20.542 47.085  1.00 43.56 ? 1041 ARG B C   1 
ATOM   2864 O O   . ARG B 1 72  ? 27.171  19.650 46.246  1.00 43.94 ? 1041 ARG B O   1 
ATOM   2865 C CB  . ARG B 1 72  ? 29.553  21.581 47.220  1.00 46.76 ? 1041 ARG B CB  1 
ATOM   2866 C CG  . ARG B 1 72  ? 30.548  22.681 46.914  1.00 50.35 ? 1041 ARG B CG  1 
ATOM   2867 C CD  . ARG B 1 72  ? 31.923  22.248 47.425  1.00 54.62 ? 1041 ARG B CD  1 
ATOM   2868 N NE  . ARG B 1 72  ? 32.819  23.374 47.656  1.00 57.40 ? 1041 ARG B NE  1 
ATOM   2869 C CZ  . ARG B 1 72  ? 33.224  24.202 46.703  1.00 59.76 ? 1041 ARG B CZ  1 
ATOM   2870 N NH1 . ARG B 1 72  ? 34.041  25.205 46.996  1.00 60.46 ? 1041 ARG B NH1 1 
ATOM   2871 N NH2 . ARG B 1 72  ? 32.810  24.021 45.454  1.00 61.38 ? 1041 ARG B NH2 1 
ATOM   2872 N N   . ILE B 1 73  ? 26.813  20.469 48.316  1.00 41.35 ? 1042 ILE B N   1 
ATOM   2873 C CA  . ILE B 1 73  ? 26.038  19.313 48.728  1.00 39.55 ? 1042 ILE B CA  1 
ATOM   2874 C C   . ILE B 1 73  ? 24.715  19.250 47.991  1.00 40.12 ? 1042 ILE B C   1 
ATOM   2875 O O   . ILE B 1 73  ? 24.227  18.159 47.703  1.00 40.19 ? 1042 ILE B O   1 
ATOM   2876 C CB  . ILE B 1 73  ? 25.753  19.317 50.235  1.00 37.97 ? 1042 ILE B CB  1 
ATOM   2877 C CG1 . ILE B 1 73  ? 27.042  19.033 51.010  1.00 37.54 ? 1042 ILE B CG1 1 
ATOM   2878 C CG2 . ILE B 1 73  ? 24.705  18.268 50.566  1.00 35.94 ? 1042 ILE B CG2 1 
ATOM   2879 C CD1 . ILE B 1 73  ? 27.624  17.666 50.753  1.00 36.06 ? 1042 ILE B CD1 1 
ATOM   2880 N N   . GLU B 1 74  ? 24.138  20.410 47.677  1.00 40.55 ? 1043 GLU B N   1 
ATOM   2881 C CA  . GLU B 1 74  ? 22.854  20.444 46.973  1.00 41.86 ? 1043 GLU B CA  1 
ATOM   2882 C C   . GLU B 1 74  ? 22.982  20.040 45.504  1.00 40.80 ? 1043 GLU B C   1 
ATOM   2883 O O   . GLU B 1 74  ? 22.103  19.372 44.957  1.00 40.65 ? 1043 GLU B O   1 
ATOM   2884 C CB  . GLU B 1 74  ? 22.205  21.830 47.080  1.00 43.31 ? 1043 GLU B CB  1 
ATOM   2885 C CG  . GLU B 1 74  ? 20.759  21.795 47.625  1.00 47.00 ? 1043 GLU B CG  1 
ATOM   2886 C CD  . GLU B 1 74  ? 19.791  21.013 46.732  1.00 48.15 ? 1043 GLU B CD  1 
ATOM   2887 O OE1 . GLU B 1 74  ? 19.544  21.468 45.593  1.00 48.94 ? 1043 GLU B OE1 1 
ATOM   2888 O OE2 . GLU B 1 74  ? 19.284  19.947 47.163  1.00 47.48 ? 1043 GLU B OE2 1 
ATOM   2889 N N   . PHE B 1 75  ? 24.080  20.444 44.875  1.00 40.24 ? 1044 PHE B N   1 
ATOM   2890 C CA  . PHE B 1 75  ? 24.345  20.113 43.475  1.00 38.10 ? 1044 PHE B CA  1 
ATOM   2891 C C   . PHE B 1 75  ? 24.459  18.594 43.367  1.00 38.20 ? 1044 PHE B C   1 
ATOM   2892 O O   . PHE B 1 75  ? 23.981  17.979 42.406  1.00 37.77 ? 1044 PHE B O   1 
ATOM   2893 C CB  . PHE B 1 75  ? 25.659  20.754 43.035  1.00 36.10 ? 1044 PHE B CB  1 
ATOM   2894 C CG  . PHE B 1 75  ? 26.021  20.475 41.621  1.00 33.10 ? 1044 PHE B CG  1 
ATOM   2895 C CD1 . PHE B 1 75  ? 25.321  21.074 40.583  1.00 33.06 ? 1044 PHE B CD1 1 
ATOM   2896 C CD2 . PHE B 1 75  ? 27.067  19.613 41.321  1.00 33.51 ? 1044 PHE B CD2 1 
ATOM   2897 C CE1 . PHE B 1 75  ? 25.655  20.824 39.254  1.00 32.81 ? 1044 PHE B CE1 1 
ATOM   2898 C CE2 . PHE B 1 75  ? 27.413  19.351 39.997  1.00 33.77 ? 1044 PHE B CE2 1 
ATOM   2899 C CZ  . PHE B 1 75  ? 26.706  19.959 38.958  1.00 32.04 ? 1044 PHE B CZ  1 
ATOM   2900 N N   . LEU B 1 76  ? 25.100  18.001 44.372  1.00 37.45 ? 1045 LEU B N   1 
ATOM   2901 C CA  . LEU B 1 76  ? 25.288  16.559 44.429  1.00 35.32 ? 1045 LEU B CA  1 
ATOM   2902 C C   . LEU B 1 76  ? 23.979  15.858 44.781  1.00 35.27 ? 1045 LEU B C   1 
ATOM   2903 O O   . LEU B 1 76  ? 23.666  14.814 44.222  1.00 35.90 ? 1045 LEU B O   1 
ATOM   2904 C CB  . LEU B 1 76  ? 26.366  16.205 45.460  1.00 31.69 ? 1045 LEU B CB  1 
ATOM   2905 C CG  . LEU B 1 76  ? 27.785  16.672 45.126  1.00 29.98 ? 1045 LEU B CG  1 
ATOM   2906 C CD1 . LEU B 1 76  ? 28.741  16.282 46.245  1.00 27.09 ? 1045 LEU B CD1 1 
ATOM   2907 C CD2 . LEU B 1 76  ? 28.226  16.056 43.808  1.00 27.40 ? 1045 LEU B CD2 1 
ATOM   2908 N N   . ASN B 1 77  ? 23.209  16.435 45.695  1.00 35.56 ? 1046 ASN B N   1 
ATOM   2909 C CA  . ASN B 1 77  ? 21.950  15.820 46.089  1.00 37.75 ? 1046 ASN B CA  1 
ATOM   2910 C C   . ASN B 1 77  ? 20.962  15.739 44.949  1.00 37.36 ? 1046 ASN B C   1 
ATOM   2911 O O   . ASN B 1 77  ? 20.214  14.767 44.853  1.00 36.61 ? 1046 ASN B O   1 
ATOM   2912 C CB  . ASN B 1 77  ? 21.307  16.567 47.260  1.00 40.39 ? 1046 ASN B CB  1 
ATOM   2913 C CG  . ASN B 1 77  ? 21.943  16.213 48.596  1.00 41.74 ? 1046 ASN B CG  1 
ATOM   2914 O OD1 . ASN B 1 77  ? 22.216  15.044 48.872  1.00 41.61 ? 1046 ASN B OD1 1 
ATOM   2915 N ND2 . ASN B 1 77  ? 22.168  17.222 49.435  1.00 42.53 ? 1046 ASN B ND2 1 
ATOM   2916 N N   . GLU B 1 78  ? 20.956  16.761 44.094  1.00 38.42 ? 1047 GLU B N   1 
ATOM   2917 C CA  . GLU B 1 78  ? 20.050  16.803 42.941  1.00 38.64 ? 1047 GLU B CA  1 
ATOM   2918 C C   . GLU B 1 78  ? 20.503  15.759 41.932  1.00 38.08 ? 1047 GLU B C   1 
ATOM   2919 O O   . GLU B 1 78  ? 19.693  15.037 41.343  1.00 38.47 ? 1047 GLU B O   1 
ATOM   2920 C CB  . GLU B 1 78  ? 20.061  18.190 42.291  1.00 39.62 ? 1047 GLU B CB  1 
ATOM   2921 C CG  . GLU B 1 78  ? 19.567  19.299 43.200  1.00 42.53 ? 1047 GLU B CG  1 
ATOM   2922 C CD  . GLU B 1 78  ? 19.354  20.610 42.468  1.00 44.96 ? 1047 GLU B CD  1 
ATOM   2923 O OE1 . GLU B 1 78  ? 18.342  20.731 41.738  1.00 47.65 ? 1047 GLU B OE1 1 
ATOM   2924 O OE2 . GLU B 1 78  ? 20.203  21.517 42.616  1.00 44.30 ? 1047 GLU B OE2 1 
ATOM   2925 N N   . ALA B 1 79  ? 21.813  15.692 41.735  1.00 36.35 ? 1048 ALA B N   1 
ATOM   2926 C CA  . ALA B 1 79  ? 22.380  14.719 40.827  1.00 34.90 ? 1048 ALA B CA  1 
ATOM   2927 C C   . ALA B 1 79  ? 21.969  13.331 41.323  1.00 34.42 ? 1048 ALA B C   1 
ATOM   2928 O O   . ALA B 1 79  ? 21.498  12.497 40.556  1.00 34.65 ? 1048 ALA B O   1 
ATOM   2929 C CB  . ALA B 1 79  ? 23.894  14.847 40.823  1.00 34.05 ? 1048 ALA B CB  1 
ATOM   2930 N N   . SER B 1 80  ? 22.139  13.110 42.623  1.00 34.11 ? 1049 SER B N   1 
ATOM   2931 C CA  . SER B 1 80  ? 21.825  11.839 43.261  1.00 32.49 ? 1049 SER B CA  1 
ATOM   2932 C C   . SER B 1 80  ? 20.399  11.346 43.087  1.00 31.31 ? 1049 SER B C   1 
ATOM   2933 O O   . SER B 1 80  ? 20.143  10.151 43.234  1.00 32.54 ? 1049 SER B O   1 
ATOM   2934 C CB  . SER B 1 80  ? 22.157  11.914 44.749  1.00 31.85 ? 1049 SER B CB  1 
ATOM   2935 O OG  . SER B 1 80  ? 23.547  12.095 44.936  1.00 33.33 ? 1049 SER B OG  1 
ATOM   2936 N N   . VAL B 1 81  ? 19.469  12.245 42.791  1.00 29.31 ? 1050 VAL B N   1 
ATOM   2937 C CA  . VAL B 1 81  ? 18.085  11.828 42.595  1.00 28.16 ? 1050 VAL B CA  1 
ATOM   2938 C C   . VAL B 1 81  ? 18.022  11.037 41.292  1.00 29.32 ? 1050 VAL B C   1 
ATOM   2939 O O   . VAL B 1 81  ? 17.302  10.040 41.173  1.00 29.11 ? 1050 VAL B O   1 
ATOM   2940 C CB  . VAL B 1 81  ? 17.129  13.038 42.494  1.00 25.59 ? 1050 VAL B CB  1 
ATOM   2941 C CG1 . VAL B 1 81  ? 15.740  12.570 42.120  1.00 24.66 ? 1050 VAL B CG1 1 
ATOM   2942 C CG2 . VAL B 1 81  ? 17.083  13.776 43.814  1.00 24.60 ? 1050 VAL B CG2 1 
ATOM   2943 N N   . MET B 1 82  ? 18.810  11.484 40.323  1.00 31.15 ? 1051 MET B N   1 
ATOM   2944 C CA  . MET B 1 82  ? 18.859  10.852 39.017  1.00 33.35 ? 1051 MET B CA  1 
ATOM   2945 C C   . MET B 1 82  ? 19.576  9.506  38.991  1.00 33.35 ? 1051 MET B C   1 
ATOM   2946 O O   . MET B 1 82  ? 19.583  8.818  37.969  1.00 34.10 ? 1051 MET B O   1 
ATOM   2947 C CB  . MET B 1 82  ? 19.492  11.812 38.007  1.00 35.67 ? 1051 MET B CB  1 
ATOM   2948 C CG  . MET B 1 82  ? 18.625  13.027 37.726  1.00 37.79 ? 1051 MET B CG  1 
ATOM   2949 S SD  . MET B 1 82  ? 19.245  14.039 36.382  1.00 42.48 ? 1051 MET B SD  1 
ATOM   2950 C CE  . MET B 1 82  ? 20.238  15.213 37.300  1.00 41.69 ? 1051 MET B CE  1 
ATOM   2951 N N   . LYS B 1 83  ? 20.165  9.115  40.112  1.00 32.26 ? 1052 LYS B N   1 
ATOM   2952 C CA  . LYS B 1 83  ? 20.859  7.842  40.162  1.00 31.97 ? 1052 LYS B CA  1 
ATOM   2953 C C   . LYS B 1 83  ? 19.862  6.681  40.039  1.00 32.64 ? 1052 LYS B C   1 
ATOM   2954 O O   . LYS B 1 83  ? 20.191  5.620  39.515  1.00 32.91 ? 1052 LYS B O   1 
ATOM   2955 C CB  . LYS B 1 83  ? 21.658  7.743  41.462  1.00 29.97 ? 1052 LYS B CB  1 
ATOM   2956 C CG  . LYS B 1 83  ? 22.768  8.758  41.549  1.00 28.79 ? 1052 LYS B CG  1 
ATOM   2957 C CD  . LYS B 1 83  ? 23.528  8.675  42.859  1.00 28.72 ? 1052 LYS B CD  1 
ATOM   2958 C CE  . LYS B 1 83  ? 24.710  9.637  42.847  1.00 26.60 ? 1052 LYS B CE  1 
ATOM   2959 N NZ  . LYS B 1 83  ? 25.397  9.714  44.162  1.00 26.36 ? 1052 LYS B NZ  1 
ATOM   2960 N N   . GLU B 1 84  ? 18.638  6.889  40.509  1.00 33.42 ? 1053 GLU B N   1 
ATOM   2961 C CA  . GLU B 1 84  ? 17.618  5.845  40.443  1.00 34.60 ? 1053 GLU B CA  1 
ATOM   2962 C C   . GLU B 1 84  ? 16.909  5.790  39.087  1.00 34.79 ? 1053 GLU B C   1 
ATOM   2963 O O   . GLU B 1 84  ? 16.014  4.974  38.875  1.00 35.62 ? 1053 GLU B O   1 
ATOM   2964 C CB  . GLU B 1 84  ? 16.596  6.049  41.569  1.00 34.97 ? 1053 GLU B CB  1 
ATOM   2965 C CG  . GLU B 1 84  ? 17.104  5.608  42.943  1.00 38.06 ? 1053 GLU B CG  1 
ATOM   2966 C CD  . GLU B 1 84  ? 17.130  4.087  43.105  1.00 40.93 ? 1053 GLU B CD  1 
ATOM   2967 O OE1 . GLU B 1 84  ? 16.085  3.494  43.464  1.00 39.69 ? 1053 GLU B OE1 1 
ATOM   2968 O OE2 . GLU B 1 84  ? 18.196  3.477  42.860  1.00 43.06 ? 1053 GLU B OE2 1 
ATOM   2969 N N   . PHE B 1 85  ? 17.323  6.646  38.163  1.00 34.67 ? 1054 PHE B N   1 
ATOM   2970 C CA  . PHE B 1 85  ? 16.706  6.693  36.846  1.00 34.54 ? 1054 PHE B CA  1 
ATOM   2971 C C   . PHE B 1 85  ? 17.387  5.792  35.817  1.00 34.98 ? 1054 PHE B C   1 
ATOM   2972 O O   . PHE B 1 85  ? 18.535  5.376  35.995  1.00 35.16 ? 1054 PHE B O   1 
ATOM   2973 C CB  . PHE B 1 85  ? 16.700  8.132  36.322  1.00 35.03 ? 1054 PHE B CB  1 
ATOM   2974 C CG  . PHE B 1 85  ? 15.891  9.098  37.161  1.00 34.49 ? 1054 PHE B CG  1 
ATOM   2975 C CD1 . PHE B 1 85  ? 14.863  8.645  37.990  1.00 34.75 ? 1054 PHE B CD1 1 
ATOM   2976 C CD2 . PHE B 1 85  ? 16.123  10.474 37.071  1.00 32.95 ? 1054 PHE B CD2 1 
ATOM   2977 C CE1 . PHE B 1 85  ? 14.078  9.552  38.713  1.00 33.89 ? 1054 PHE B CE1 1 
ATOM   2978 C CE2 . PHE B 1 85  ? 15.347  11.381 37.784  1.00 31.58 ? 1054 PHE B CE2 1 
ATOM   2979 C CZ  . PHE B 1 85  ? 14.322  10.920 38.606  1.00 32.80 ? 1054 PHE B CZ  1 
ATOM   2980 N N   . ASN B 1 86  ? 16.659  5.496  34.743  1.00 34.28 ? 1055 ASN B N   1 
ATOM   2981 C CA  . ASN B 1 86  ? 17.147  4.664  33.643  1.00 34.92 ? 1055 ASN B CA  1 
ATOM   2982 C C   . ASN B 1 86  ? 16.072  4.655  32.563  1.00 34.77 ? 1055 ASN B C   1 
ATOM   2983 O O   . ASN B 1 86  ? 15.439  3.632  32.291  1.00 35.56 ? 1055 ASN B O   1 
ATOM   2984 C CB  . ASN B 1 86  ? 17.415  3.234  34.115  1.00 36.96 ? 1055 ASN B CB  1 
ATOM   2985 C CG  . ASN B 1 86  ? 17.964  2.343  33.005  1.00 39.92 ? 1055 ASN B CG  1 
ATOM   2986 O OD1 . ASN B 1 86  ? 19.048  2.587  32.463  1.00 40.13 ? 1055 ASN B OD1 1 
ATOM   2987 N ND2 . ASN B 1 86  ? 17.210  1.304  32.660  1.00 41.36 ? 1055 ASN B ND2 1 
ATOM   2988 N N   . CYS B 1 87  ? 15.869  5.814  31.953  1.00 33.37 ? 1056 CYS B N   1 
ATOM   2989 C CA  . CYS B 1 87  ? 14.860  5.967  30.926  1.00 31.11 ? 1056 CYS B CA  1 
ATOM   2990 C C   . CYS B 1 87  ? 15.451  6.636  29.701  1.00 29.89 ? 1056 CYS B C   1 
ATOM   2991 O O   . CYS B 1 87  ? 15.948  7.759  29.768  1.00 29.71 ? 1056 CYS B O   1 
ATOM   2992 C CB  . CYS B 1 87  ? 13.696  6.803  31.464  1.00 31.35 ? 1056 CYS B CB  1 
ATOM   2993 S SG  . CYS B 1 87  ? 12.331  7.074  30.303  1.00 34.15 ? 1056 CYS B SG  1 
ATOM   2994 N N   . HIS B 1 88  ? 15.379  5.924  28.584  1.00 28.25 ? 1057 HIS B N   1 
ATOM   2995 C CA  . HIS B 1 88  ? 15.874  6.390  27.306  1.00 26.30 ? 1057 HIS B CA  1 
ATOM   2996 C C   . HIS B 1 88  ? 15.444  7.821  27.009  1.00 25.60 ? 1057 HIS B C   1 
ATOM   2997 O O   . HIS B 1 88  ? 16.187  8.571  26.375  1.00 24.55 ? 1057 HIS B O   1 
ATOM   2998 C CB  . HIS B 1 88  ? 15.363  5.468  26.201  1.00 26.75 ? 1057 HIS B CB  1 
ATOM   2999 C CG  . HIS B 1 88  ? 15.925  5.772  24.850  1.00 26.18 ? 1057 HIS B CG  1 
ATOM   3000 N ND1 . HIS B 1 88  ? 17.247  5.556  24.529  1.00 25.76 ? 1057 HIS B ND1 1 
ATOM   3001 C CD2 . HIS B 1 88  ? 15.344  6.271  23.735  1.00 26.41 ? 1057 HIS B CD2 1 
ATOM   3002 C CE1 . HIS B 1 88  ? 17.455  5.906  23.273  1.00 25.35 ? 1057 HIS B CE1 1 
ATOM   3003 N NE2 . HIS B 1 88  ? 16.316  6.343  22.769  1.00 26.21 ? 1057 HIS B NE2 1 
ATOM   3004 N N   . HIS B 1 89  ? 14.252  8.202  27.467  1.00 25.31 ? 1058 HIS B N   1 
ATOM   3005 C CA  . HIS B 1 89  ? 13.758  9.554  27.212  1.00 25.74 ? 1058 HIS B CA  1 
ATOM   3006 C C   . HIS B 1 89  ? 13.922  10.568 28.351  1.00 24.85 ? 1058 HIS B C   1 
ATOM   3007 O O   . HIS B 1 89  ? 13.157  11.519 28.464  1.00 24.89 ? 1058 HIS B O   1 
ATOM   3008 C CB  . HIS B 1 89  ? 12.301  9.497  26.737  1.00 25.93 ? 1058 HIS B CB  1 
ATOM   3009 C CG  . HIS B 1 89  ? 12.122  8.739  25.457  1.00 27.98 ? 1058 HIS B CG  1 
ATOM   3010 N ND1 . HIS B 1 89  ? 11.890  7.379  25.421  1.00 29.65 ? 1058 HIS B ND1 1 
ATOM   3011 C CD2 . HIS B 1 89  ? 12.228  9.134  24.165  1.00 28.48 ? 1058 HIS B CD2 1 
ATOM   3012 C CE1 . HIS B 1 89  ? 11.865  6.969  24.164  1.00 28.34 ? 1058 HIS B CE1 1 
ATOM   3013 N NE2 . HIS B 1 89  ? 12.068  8.015  23.383  1.00 28.16 ? 1058 HIS B NE2 1 
ATOM   3014 N N   . VAL B 1 90  ? 14.922  10.349 29.195  1.00 24.42 ? 1059 VAL B N   1 
ATOM   3015 C CA  . VAL B 1 90  ? 15.248  11.269 30.279  1.00 24.93 ? 1059 VAL B CA  1 
ATOM   3016 C C   . VAL B 1 90  ? 16.783  11.336 30.252  1.00 26.99 ? 1059 VAL B C   1 
ATOM   3017 O O   . VAL B 1 90  ? 17.432  10.287 30.220  1.00 26.57 ? 1059 VAL B O   1 
ATOM   3018 C CB  . VAL B 1 90  ? 14.761  10.746 31.653  1.00 23.91 ? 1059 VAL B CB  1 
ATOM   3019 C CG1 . VAL B 1 90  ? 15.287  11.641 32.771  1.00 22.90 ? 1059 VAL B CG1 1 
ATOM   3020 C CG2 . VAL B 1 90  ? 13.239  10.735 31.700  1.00 23.30 ? 1059 VAL B CG2 1 
ATOM   3021 N N   . VAL B 1 91  ? 17.361  12.543 30.234  1.00 27.48 ? 1060 VAL B N   1 
ATOM   3022 C CA  . VAL B 1 91  ? 18.822  12.676 30.185  1.00 28.49 ? 1060 VAL B CA  1 
ATOM   3023 C C   . VAL B 1 91  ? 19.479  11.900 31.311  1.00 30.43 ? 1060 VAL B C   1 
ATOM   3024 O O   . VAL B 1 91  ? 19.216  12.150 32.483  1.00 33.16 ? 1060 VAL B O   1 
ATOM   3025 C CB  . VAL B 1 91  ? 19.275  14.133 30.253  1.00 27.56 ? 1060 VAL B CB  1 
ATOM   3026 C CG1 . VAL B 1 91  ? 20.768  14.186 30.519  1.00 27.00 ? 1060 VAL B CG1 1 
ATOM   3027 C CG2 . VAL B 1 91  ? 18.967  14.830 28.931  1.00 26.34 ? 1060 VAL B CG2 1 
ATOM   3028 N N   . ARG B 1 92  ? 20.364  10.981 30.934  1.00 32.21 ? 1061 ARG B N   1 
ATOM   3029 C CA  . ARG B 1 92  ? 21.033  10.078 31.865  1.00 33.15 ? 1061 ARG B CA  1 
ATOM   3030 C C   . ARG B 1 92  ? 22.265  10.568 32.654  1.00 33.21 ? 1061 ARG B C   1 
ATOM   3031 O O   . ARG B 1 92  ? 23.110  11.309 32.140  1.00 33.29 ? 1061 ARG B O   1 
ATOM   3032 C CB  . ARG B 1 92  ? 21.391  8.801  31.095  1.00 34.13 ? 1061 ARG B CB  1 
ATOM   3033 C CG  . ARG B 1 92  ? 21.622  7.580  31.960  1.00 38.87 ? 1061 ARG B CG  1 
ATOM   3034 C CD  . ARG B 1 92  ? 20.562  6.511  31.713  1.00 40.72 ? 1061 ARG B CD  1 
ATOM   3035 N NE  . ARG B 1 92  ? 20.483  6.143  30.300  1.00 42.61 ? 1061 ARG B NE  1 
ATOM   3036 C CZ  . ARG B 1 92  ? 19.775  5.118  29.830  1.00 43.70 ? 1061 ARG B CZ  1 
ATOM   3037 N NH1 . ARG B 1 92  ? 19.083  4.350  30.664  1.00 43.98 ? 1061 ARG B NH1 1 
ATOM   3038 N NH2 . ARG B 1 92  ? 19.753  4.865  28.524  1.00 42.84 ? 1061 ARG B NH2 1 
ATOM   3039 N N   . LEU B 1 93  ? 22.353  10.136 33.913  1.00 32.43 ? 1062 LEU B N   1 
ATOM   3040 C CA  . LEU B 1 93  ? 23.482  10.474 34.779  1.00 30.61 ? 1062 LEU B CA  1 
ATOM   3041 C C   . LEU B 1 93  ? 24.505  9.373  34.553  1.00 31.03 ? 1062 LEU B C   1 
ATOM   3042 O O   . LEU B 1 93  ? 24.174  8.188  34.630  1.00 31.90 ? 1062 LEU B O   1 
ATOM   3043 C CB  . LEU B 1 93  ? 23.070  10.493 36.257  1.00 28.69 ? 1062 LEU B CB  1 
ATOM   3044 C CG  . LEU B 1 93  ? 24.244  10.467 37.246  1.00 28.07 ? 1062 LEU B CG  1 
ATOM   3045 C CD1 . LEU B 1 93  ? 24.985  11.802 37.224  1.00 26.74 ? 1062 LEU B CD1 1 
ATOM   3046 C CD2 . LEU B 1 93  ? 23.739  10.164 38.636  1.00 27.91 ? 1062 LEU B CD2 1 
ATOM   3047 N N   . LEU B 1 94  ? 25.746  9.769  34.288  1.00 30.94 ? 1063 LEU B N   1 
ATOM   3048 C CA  . LEU B 1 94  ? 26.816  8.823  34.010  1.00 30.60 ? 1063 LEU B CA  1 
ATOM   3049 C C   . LEU B 1 94  ? 27.854  8.730  35.099  1.00 30.76 ? 1063 LEU B C   1 
ATOM   3050 O O   . LEU B 1 94  ? 28.524  7.705  35.233  1.00 33.04 ? 1063 LEU B O   1 
ATOM   3051 C CB  . LEU B 1 94  ? 27.496  9.201  32.697  1.00 29.21 ? 1063 LEU B CB  1 
ATOM   3052 C CG  . LEU B 1 94  ? 26.469  9.176  31.577  1.00 28.20 ? 1063 LEU B CG  1 
ATOM   3053 C CD1 . LEU B 1 94  ? 27.017  9.821  30.324  1.00 28.28 ? 1063 LEU B CD1 1 
ATOM   3054 C CD2 . LEU B 1 94  ? 26.061  7.724  31.348  1.00 27.77 ? 1063 LEU B CD2 1 
ATOM   3055 N N   . GLY B 1 95  ? 27.998  9.801  35.869  1.00 30.10 ? 1064 GLY B N   1 
ATOM   3056 C CA  . GLY B 1 95  ? 28.974  9.798  36.938  1.00 28.50 ? 1064 GLY B CA  1 
ATOM   3057 C C   . GLY B 1 95  ? 28.952  11.037 37.807  1.00 27.26 ? 1064 GLY B C   1 
ATOM   3058 O O   . GLY B 1 95  ? 28.312  12.035 37.489  1.00 28.27 ? 1064 GLY B O   1 
ATOM   3059 N N   . VAL B 1 96  ? 29.671  10.958 38.916  1.00 25.62 ? 1065 VAL B N   1 
ATOM   3060 C CA  . VAL B 1 96  ? 29.770  12.048 39.865  1.00 25.21 ? 1065 VAL B CA  1 
ATOM   3061 C C   . VAL B 1 96  ? 31.223  12.119 40.289  1.00 26.41 ? 1065 VAL B C   1 
ATOM   3062 O O   . VAL B 1 96  ? 31.881  11.084 40.438  1.00 26.41 ? 1065 VAL B O   1 
ATOM   3063 C CB  . VAL B 1 96  ? 28.913  11.773 41.134  1.00 25.30 ? 1065 VAL B CB  1 
ATOM   3064 C CG1 . VAL B 1 96  ? 29.213  12.803 42.211  1.00 23.13 ? 1065 VAL B CG1 1 
ATOM   3065 C CG2 . VAL B 1 96  ? 27.438  11.795 40.785  1.00 25.03 ? 1065 VAL B CG2 1 
ATOM   3066 N N   . VAL B 1 97  ? 31.729  13.335 40.468  1.00 25.68 ? 1066 VAL B N   1 
ATOM   3067 C CA  . VAL B 1 97  ? 33.098  13.516 40.925  1.00 24.45 ? 1066 VAL B CA  1 
ATOM   3068 C C   . VAL B 1 97  ? 33.006  14.453 42.115  1.00 26.05 ? 1066 VAL B C   1 
ATOM   3069 O O   . VAL B 1 97  ? 32.909  15.670 41.958  1.00 26.23 ? 1066 VAL B O   1 
ATOM   3070 C CB  . VAL B 1 97  ? 33.982  14.110 39.832  1.00 22.70 ? 1066 VAL B CB  1 
ATOM   3071 C CG1 . VAL B 1 97  ? 35.434  14.132 40.284  1.00 20.87 ? 1066 VAL B CG1 1 
ATOM   3072 C CG2 . VAL B 1 97  ? 33.836  13.285 38.575  1.00 21.34 ? 1066 VAL B CG2 1 
ATOM   3073 N N   . SER B 1 98  ? 33.015  13.853 43.304  1.00 26.87 ? 1067 SER B N   1 
ATOM   3074 C CA  . SER B 1 98  ? 32.886  14.569 44.564  1.00 28.76 ? 1067 SER B CA  1 
ATOM   3075 C C   . SER B 1 98  ? 34.187  14.765 45.320  1.00 31.29 ? 1067 SER B C   1 
ATOM   3076 O O   . SER B 1 98  ? 34.189  15.338 46.401  1.00 31.82 ? 1067 SER B O   1 
ATOM   3077 C CB  . SER B 1 98  ? 31.914  13.823 45.467  1.00 28.36 ? 1067 SER B CB  1 
ATOM   3078 O OG  . SER B 1 98  ? 32.412  12.527 45.751  1.00 28.88 ? 1067 SER B OG  1 
ATOM   3079 N N   . GLN B 1 99  ? 35.289  14.268 44.776  1.00 33.90 ? 1068 GLN B N   1 
ATOM   3080 C CA  . GLN B 1 99  ? 36.576  14.425 45.440  1.00 35.14 ? 1068 GLN B CA  1 
ATOM   3081 C C   . GLN B 1 99  ? 37.373  15.469 44.678  1.00 34.30 ? 1068 GLN B C   1 
ATOM   3082 O O   . GLN B 1 99  ? 37.517  15.381 43.462  1.00 34.09 ? 1068 GLN B O   1 
ATOM   3083 C CB  . GLN B 1 99  ? 37.361  13.103 45.460  1.00 37.95 ? 1068 GLN B CB  1 
ATOM   3084 C CG  . GLN B 1 99  ? 36.686  11.925 46.175  1.00 42.76 ? 1068 GLN B CG  1 
ATOM   3085 C CD  . GLN B 1 99  ? 36.025  12.310 47.495  1.00 45.67 ? 1068 GLN B CD  1 
ATOM   3086 O OE1 . GLN B 1 99  ? 34.814  12.542 47.546  1.00 46.41 ? 1068 GLN B OE1 1 
ATOM   3087 N NE2 . GLN B 1 99  ? 36.819  12.387 48.568  1.00 46.20 ? 1068 GLN B NE2 1 
ATOM   3088 N N   . GLY B 1 100 ? 37.882  16.463 45.391  1.00 33.54 ? 1069 GLY B N   1 
ATOM   3089 C CA  . GLY B 1 100 ? 38.665  17.488 44.735  1.00 33.16 ? 1069 GLY B CA  1 
ATOM   3090 C C   . GLY B 1 100 ? 37.815  18.605 44.185  1.00 32.34 ? 1069 GLY B C   1 
ATOM   3091 O O   . GLY B 1 100 ? 36.617  18.645 44.435  1.00 33.30 ? 1069 GLY B O   1 
ATOM   3092 N N   . GLN B 1 101 ? 38.434  19.509 43.434  1.00 31.64 ? 1070 GLN B N   1 
ATOM   3093 C CA  . GLN B 1 101 ? 37.727  20.643 42.866  1.00 32.73 ? 1070 GLN B CA  1 
ATOM   3094 C C   . GLN B 1 101 ? 37.989  20.773 41.377  1.00 33.85 ? 1070 GLN B C   1 
ATOM   3095 O O   . GLN B 1 101 ? 39.097  20.550 40.906  1.00 36.54 ? 1070 GLN B O   1 
ATOM   3096 C CB  . GLN B 1 101 ? 38.163  21.938 43.540  1.00 33.72 ? 1070 GLN B CB  1 
ATOM   3097 C CG  . GLN B 1 101 ? 37.985  21.982 45.041  1.00 36.09 ? 1070 GLN B CG  1 
ATOM   3098 C CD  . GLN B 1 101 ? 36.538  22.093 45.453  1.00 38.50 ? 1070 GLN B CD  1 
ATOM   3099 O OE1 . GLN B 1 101 ? 35.805  21.101 45.459  1.00 40.87 ? 1070 GLN B OE1 1 
ATOM   3100 N NE2 . GLN B 1 101 ? 36.108  23.308 45.794  1.00 38.36 ? 1070 GLN B NE2 1 
ATOM   3101 N N   . PRO B 1 102 ? 36.961  21.146 40.614  1.00 33.91 ? 1071 PRO B N   1 
ATOM   3102 C CA  . PRO B 1 102 ? 35.663  21.403 41.228  1.00 33.31 ? 1071 PRO B CA  1 
ATOM   3103 C C   . PRO B 1 102 ? 34.832  20.124 41.265  1.00 33.31 ? 1071 PRO B C   1 
ATOM   3104 O O   . PRO B 1 102 ? 35.237  19.089 40.731  1.00 32.84 ? 1071 PRO B O   1 
ATOM   3105 C CB  . PRO B 1 102 ? 35.068  22.467 40.313  1.00 32.81 ? 1071 PRO B CB  1 
ATOM   3106 C CG  . PRO B 1 102 ? 35.553  22.027 38.976  1.00 33.40 ? 1071 PRO B CG  1 
ATOM   3107 C CD  . PRO B 1 102 ? 37.001  21.643 39.226  1.00 33.39 ? 1071 PRO B CD  1 
ATOM   3108 N N   . THR B 1 103 ? 33.676  20.209 41.916  1.00 33.23 ? 1072 THR B N   1 
ATOM   3109 C CA  . THR B 1 103 ? 32.750  19.094 42.010  1.00 31.86 ? 1072 THR B CA  1 
ATOM   3110 C C   . THR B 1 103 ? 32.094  18.943 40.635  1.00 31.32 ? 1072 THR B C   1 
ATOM   3111 O O   . THR B 1 103 ? 31.474  19.876 40.122  1.00 31.66 ? 1072 THR B O   1 
ATOM   3112 C CB  . THR B 1 103 ? 31.691  19.383 43.078  1.00 32.62 ? 1072 THR B CB  1 
ATOM   3113 O OG1 . THR B 1 103 ? 32.343  19.521 44.347  1.00 34.57 ? 1072 THR B OG1 1 
ATOM   3114 C CG2 . THR B 1 103 ? 30.666  18.270 43.150  1.00 32.65 ? 1072 THR B CG2 1 
ATOM   3115 N N   . LEU B 1 104 ? 32.245  17.764 40.041  1.00 30.58 ? 1073 LEU B N   1 
ATOM   3116 C CA  . LEU B 1 104 ? 31.699  17.497 38.720  1.00 28.17 ? 1073 LEU B CA  1 
ATOM   3117 C C   . LEU B 1 104 ? 30.578  16.459 38.725  1.00 29.07 ? 1073 LEU B C   1 
ATOM   3118 O O   . LEU B 1 104 ? 30.466  15.619 39.626  1.00 29.28 ? 1073 LEU B O   1 
ATOM   3119 C CB  . LEU B 1 104 ? 32.812  16.991 37.801  1.00 26.39 ? 1073 LEU B CB  1 
ATOM   3120 C CG  . LEU B 1 104 ? 34.189  17.654 37.873  1.00 25.12 ? 1073 LEU B CG  1 
ATOM   3121 C CD1 . LEU B 1 104 ? 35.198  16.771 37.176  1.00 23.77 ? 1073 LEU B CD1 1 
ATOM   3122 C CD2 . LEU B 1 104 ? 34.151  19.028 37.237  1.00 22.83 ? 1073 LEU B CD2 1 
ATOM   3123 N N   . VAL B 1 105 ? 29.756  16.533 37.688  1.00 29.89 ? 1074 VAL B N   1 
ATOM   3124 C CA  . VAL B 1 105 ? 28.657  15.605 37.469  1.00 29.08 ? 1074 VAL B CA  1 
ATOM   3125 C C   . VAL B 1 105 ? 28.756  15.258 35.986  1.00 28.45 ? 1074 VAL B C   1 
ATOM   3126 O O   . VAL B 1 105 ? 28.830  16.152 35.141  1.00 27.65 ? 1074 VAL B O   1 
ATOM   3127 C CB  . VAL B 1 105 ? 27.298  16.263 37.784  1.00 29.02 ? 1074 VAL B CB  1 
ATOM   3128 C CG1 . VAL B 1 105 ? 26.202  15.625 36.972  1.00 29.10 ? 1074 VAL B CG1 1 
ATOM   3129 C CG2 . VAL B 1 105 ? 26.991  16.104 39.262  1.00 29.84 ? 1074 VAL B CG2 1 
ATOM   3130 N N   . ILE B 1 106 ? 28.807  13.966 35.677  1.00 28.95 ? 1075 ILE B N   1 
ATOM   3131 C CA  . ILE B 1 106 ? 28.904  13.523 34.286  1.00 29.81 ? 1075 ILE B CA  1 
ATOM   3132 C C   . ILE B 1 106 ? 27.527  13.185 33.734  1.00 29.52 ? 1075 ILE B C   1 
ATOM   3133 O O   . ILE B 1 106 ? 26.851  12.284 34.231  1.00 28.79 ? 1075 ILE B O   1 
ATOM   3134 C CB  . ILE B 1 106 ? 29.784  12.273 34.138  1.00 30.14 ? 1075 ILE B CB  1 
ATOM   3135 C CG1 . ILE B 1 106 ? 31.187  12.537 34.690  1.00 29.82 ? 1075 ILE B CG1 1 
ATOM   3136 C CG2 . ILE B 1 106 ? 29.865  11.890 32.669  1.00 30.96 ? 1075 ILE B CG2 1 
ATOM   3137 C CD1 . ILE B 1 106 ? 32.083  11.310 34.689  1.00 29.83 ? 1075 ILE B CD1 1 
ATOM   3138 N N   . MET B 1 107 ? 27.125  13.905 32.694  1.00 29.38 ? 1076 MET B N   1 
ATOM   3139 C CA  . MET B 1 107 ? 25.819  13.694 32.084  1.00 28.32 ? 1076 MET B CA  1 
ATOM   3140 C C   . MET B 1 107 ? 25.898  13.204 30.641  1.00 28.48 ? 1076 MET B C   1 
ATOM   3141 O O   . MET B 1 107 ? 26.951  13.225 30.005  1.00 27.70 ? 1076 MET B O   1 
ATOM   3142 C CB  . MET B 1 107 ? 25.025  14.995 32.119  1.00 26.83 ? 1076 MET B CB  1 
ATOM   3143 C CG  . MET B 1 107 ? 24.878  15.588 33.503  1.00 27.29 ? 1076 MET B CG  1 
ATOM   3144 S SD  . MET B 1 107 ? 23.942  14.511 34.614  1.00 27.04 ? 1076 MET B SD  1 
ATOM   3145 C CE  . MET B 1 107 ? 22.376  14.461 33.789  1.00 24.02 ? 1076 MET B CE  1 
ATOM   3146 N N   . GLU B 1 108 ? 24.763  12.751 30.136  1.00 28.45 ? 1077 GLU B N   1 
ATOM   3147 C CA  . GLU B 1 108 ? 24.678  12.294 28.769  1.00 27.00 ? 1077 GLU B CA  1 
ATOM   3148 C C   . GLU B 1 108 ? 24.762  13.585 27.971  1.00 27.73 ? 1077 GLU B C   1 
ATOM   3149 O O   . GLU B 1 108 ? 24.169  14.594 28.358  1.00 28.09 ? 1077 GLU B O   1 
ATOM   3150 C CB  . GLU B 1 108 ? 23.328  11.618 28.549  1.00 27.69 ? 1077 GLU B CB  1 
ATOM   3151 C CG  . GLU B 1 108 ? 23.049  11.148 27.137  1.00 27.37 ? 1077 GLU B CG  1 
ATOM   3152 C CD  . GLU B 1 108 ? 21.585  10.762 26.941  1.00 29.11 ? 1077 GLU B CD  1 
ATOM   3153 O OE1 . GLU B 1 108 ? 21.200  10.477 25.787  1.00 30.17 ? 1077 GLU B OE1 1 
ATOM   3154 O OE2 . GLU B 1 108 ? 20.821  10.751 27.935  1.00 25.68 ? 1077 GLU B OE2 1 
ATOM   3155 N N   . LEU B 1 109 ? 25.514  13.570 26.876  1.00 27.94 ? 1078 LEU B N   1 
ATOM   3156 C CA  . LEU B 1 109 ? 25.642  14.756 26.038  1.00 26.63 ? 1078 LEU B CA  1 
ATOM   3157 C C   . LEU B 1 109 ? 24.465  14.850 25.069  1.00 26.21 ? 1078 LEU B C   1 
ATOM   3158 O O   . LEU B 1 109 ? 24.142  13.885 24.382  1.00 25.76 ? 1078 LEU B O   1 
ATOM   3159 C CB  . LEU B 1 109 ? 26.954  14.711 25.247  1.00 26.23 ? 1078 LEU B CB  1 
ATOM   3160 C CG  . LEU B 1 109 ? 27.235  15.887 24.293  1.00 26.85 ? 1078 LEU B CG  1 
ATOM   3161 C CD1 . LEU B 1 109 ? 27.346  17.200 25.070  1.00 24.14 ? 1078 LEU B CD1 1 
ATOM   3162 C CD2 . LEU B 1 109 ? 28.526  15.614 23.528  1.00 26.41 ? 1078 LEU B CD2 1 
ATOM   3163 N N   . MET B 1 110 ? 23.809  16.005 25.040  1.00 25.74 ? 1079 MET B N   1 
ATOM   3164 C CA  . MET B 1 110 ? 22.690  16.227 24.130  1.00 24.68 ? 1079 MET B CA  1 
ATOM   3165 C C   . MET B 1 110 ? 23.211  17.319 23.202  1.00 25.09 ? 1079 MET B C   1 
ATOM   3166 O O   . MET B 1 110 ? 23.072  18.514 23.463  1.00 25.72 ? 1079 MET B O   1 
ATOM   3167 C CB  . MET B 1 110 ? 21.445  16.694 24.891  1.00 23.46 ? 1079 MET B CB  1 
ATOM   3168 C CG  . MET B 1 110 ? 20.914  15.696 25.935  1.00 23.78 ? 1079 MET B CG  1 
ATOM   3169 S SD  . MET B 1 110 ? 20.346  14.078 25.292  1.00 23.50 ? 1079 MET B SD  1 
ATOM   3170 C CE  . MET B 1 110 ? 18.591  14.450 24.832  1.00 19.11 ? 1079 MET B CE  1 
ATOM   3171 N N   . THR B 1 111 ? 23.829  16.880 22.117  1.00 25.03 ? 1080 THR B N   1 
ATOM   3172 C CA  . THR B 1 111 ? 24.451  17.766 21.145  1.00 24.13 ? 1080 THR B CA  1 
ATOM   3173 C C   . THR B 1 111 ? 23.610  18.860 20.496  1.00 23.79 ? 1080 THR B C   1 
ATOM   3174 O O   . THR B 1 111 ? 24.168  19.858 20.028  1.00 21.44 ? 1080 THR B O   1 
ATOM   3175 C CB  . THR B 1 111 ? 25.114  16.930 20.036  1.00 24.27 ? 1080 THR B CB  1 
ATOM   3176 O OG1 . THR B 1 111 ? 24.116  16.134 19.379  1.00 24.62 ? 1080 THR B OG1 1 
ATOM   3177 C CG2 . THR B 1 111 ? 26.194  16.008 20.640  1.00 20.61 ? 1080 THR B CG2 1 
ATOM   3178 N N   . ARG B 1 112 ? 22.287  18.688 20.476  1.00 24.01 ? 1081 ARG B N   1 
ATOM   3179 C CA  . ARG B 1 112 ? 21.405  19.673 19.843  1.00 23.77 ? 1081 ARG B CA  1 
ATOM   3180 C C   . ARG B 1 112 ? 20.707  20.663 20.786  1.00 24.26 ? 1081 ARG B C   1 
ATOM   3181 O O   . ARG B 1 112 ? 19.736  21.323 20.400  1.00 24.69 ? 1081 ARG B O   1 
ATOM   3182 C CB  . ARG B 1 112 ? 20.376  18.954 18.959  1.00 24.31 ? 1081 ARG B CB  1 
ATOM   3183 C CG  . ARG B 1 112 ? 21.034  18.139 17.839  1.00 25.71 ? 1081 ARG B CG  1 
ATOM   3184 C CD  . ARG B 1 112 ? 20.033  17.475 16.901  1.00 25.98 ? 1081 ARG B CD  1 
ATOM   3185 N NE  . ARG B 1 112 ? 20.690  16.569 15.957  1.00 25.91 ? 1081 ARG B NE  1 
ATOM   3186 C CZ  . ARG B 1 112 ? 21.572  16.948 15.031  1.00 27.62 ? 1081 ARG B CZ  1 
ATOM   3187 N NH1 . ARG B 1 112 ? 22.117  16.049 14.219  1.00 24.79 ? 1081 ARG B NH1 1 
ATOM   3188 N NH2 . ARG B 1 112 ? 21.909  18.227 14.904  1.00 28.23 ? 1081 ARG B NH2 1 
ATOM   3189 N N   . GLY B 1 113 ? 21.209  20.761 22.015  1.00 22.23 ? 1082 GLY B N   1 
ATOM   3190 C CA  . GLY B 1 113 ? 20.678  21.704 22.980  1.00 20.34 ? 1082 GLY B CA  1 
ATOM   3191 C C   . GLY B 1 113 ? 19.262  21.495 23.461  1.00 21.79 ? 1082 GLY B C   1 
ATOM   3192 O O   . GLY B 1 113 ? 18.733  20.379 23.434  1.00 20.64 ? 1082 GLY B O   1 
ATOM   3193 N N   . ASP B 1 114 ? 18.656  22.584 23.928  1.00 21.97 ? 1083 ASP B N   1 
ATOM   3194 C CA  . ASP B 1 114 ? 17.288  22.546 24.420  1.00 23.64 ? 1083 ASP B CA  1 
ATOM   3195 C C   . ASP B 1 114 ? 16.277  22.638 23.281  1.00 25.27 ? 1083 ASP B C   1 
ATOM   3196 O O   . ASP B 1 114 ? 16.549  23.185 22.201  1.00 24.05 ? 1083 ASP B O   1 
ATOM   3197 C CB  . ASP B 1 114 ? 17.046  23.683 25.404  1.00 25.44 ? 1083 ASP B CB  1 
ATOM   3198 C CG  . ASP B 1 114 ? 17.426  25.032 24.833  1.00 27.94 ? 1083 ASP B CG  1 
ATOM   3199 O OD1 . ASP B 1 114 ? 18.606  25.197 24.464  1.00 30.80 ? 1083 ASP B OD1 1 
ATOM   3200 O OD2 . ASP B 1 114 ? 16.555  25.924 24.750  1.00 28.45 ? 1083 ASP B OD2 1 
ATOM   3201 N N   . LEU B 1 115 ? 15.099  22.090 23.541  1.00 24.96 ? 1084 LEU B N   1 
ATOM   3202 C CA  . LEU B 1 115 ? 14.026  22.080 22.572  1.00 23.45 ? 1084 LEU B CA  1 
ATOM   3203 C C   . LEU B 1 115 ? 13.534  23.490 22.242  1.00 24.25 ? 1084 LEU B C   1 
ATOM   3204 O O   . LEU B 1 115 ? 13.016  23.721 21.148  1.00 25.60 ? 1084 LEU B O   1 
ATOM   3205 C CB  . LEU B 1 115 ? 12.877  21.223 23.104  1.00 22.23 ? 1084 LEU B CB  1 
ATOM   3206 C CG  . LEU B 1 115 ? 11.647  21.102 22.212  1.00 22.61 ? 1084 LEU B CG  1 
ATOM   3207 C CD1 . LEU B 1 115 ? 12.041  20.526 20.850  1.00 22.68 ? 1084 LEU B CD1 1 
ATOM   3208 C CD2 . LEU B 1 115 ? 10.631  20.235 22.898  1.00 19.92 ? 1084 LEU B CD2 1 
ATOM   3209 N N   . LYS B 1 116 ? 13.689  24.437 23.168  1.00 23.95 ? 1085 LYS B N   1 
ATOM   3210 C CA  . LYS B 1 116 ? 13.229  25.791 22.888  1.00 24.66 ? 1085 LYS B CA  1 
ATOM   3211 C C   . LYS B 1 116 ? 14.191  26.474 21.929  1.00 24.67 ? 1085 LYS B C   1 
ATOM   3212 O O   . LYS B 1 116 ? 13.782  26.955 20.873  1.00 24.59 ? 1085 LYS B O   1 
ATOM   3213 C CB  . LYS B 1 116 ? 13.079  26.614 24.170  1.00 25.78 ? 1085 LYS B CB  1 
ATOM   3214 C CG  . LYS B 1 116 ? 12.207  27.868 23.977  1.00 25.98 ? 1085 LYS B CG  1 
ATOM   3215 C CD  . LYS B 1 116 ? 12.188  28.737 25.223  1.00 25.67 ? 1085 LYS B CD  1 
ATOM   3216 C CE  . LYS B 1 116 ? 11.587  30.117 24.959  1.00 25.55 ? 1085 LYS B CE  1 
ATOM   3217 N NZ  . LYS B 1 116 ? 10.094  30.157 24.981  1.00 26.05 ? 1085 LYS B NZ  1 
ATOM   3218 N N   . SER B 1 117 ? 15.469  26.508 22.287  1.00 25.04 ? 1086 SER B N   1 
ATOM   3219 C CA  . SER B 1 117 ? 16.478  27.105 21.416  1.00 26.09 ? 1086 SER B CA  1 
ATOM   3220 C C   . SER B 1 117 ? 16.395  26.448 20.035  1.00 26.95 ? 1086 SER B C   1 
ATOM   3221 O O   . SER B 1 117 ? 16.351  27.137 19.012  1.00 28.50 ? 1086 SER B O   1 
ATOM   3222 C CB  . SER B 1 117 ? 17.882  26.893 21.995  1.00 26.27 ? 1086 SER B CB  1 
ATOM   3223 O OG  . SER B 1 117 ? 18.029  27.536 23.254  1.00 30.22 ? 1086 SER B OG  1 
ATOM   3224 N N   . TYR B 1 118 ? 16.374  25.114 20.022  1.00 26.82 ? 1087 TYR B N   1 
ATOM   3225 C CA  . TYR B 1 118 ? 16.293  24.329 18.792  1.00 26.46 ? 1087 TYR B CA  1 
ATOM   3226 C C   . TYR B 1 118 ? 15.113  24.748 17.911  1.00 29.38 ? 1087 TYR B C   1 
ATOM   3227 O O   . TYR B 1 118 ? 15.280  25.079 16.730  1.00 30.05 ? 1087 TYR B O   1 
ATOM   3228 C CB  . TYR B 1 118 ? 16.153  22.840 19.128  1.00 25.35 ? 1087 TYR B CB  1 
ATOM   3229 C CG  . TYR B 1 118 ? 15.722  22.006 17.944  1.00 23.36 ? 1087 TYR B CG  1 
ATOM   3230 C CD1 . TYR B 1 118 ? 16.595  21.750 16.889  1.00 22.12 ? 1087 TYR B CD1 1 
ATOM   3231 C CD2 . TYR B 1 118 ? 14.408  21.554 17.836  1.00 23.49 ? 1087 TYR B CD2 1 
ATOM   3232 C CE1 . TYR B 1 118 ? 16.167  21.070 15.747  1.00 23.07 ? 1087 TYR B CE1 1 
ATOM   3233 C CE2 . TYR B 1 118 ? 13.965  20.879 16.707  1.00 23.25 ? 1087 TYR B CE2 1 
ATOM   3234 C CZ  . TYR B 1 118 ? 14.844  20.640 15.662  1.00 25.65 ? 1087 TYR B CZ  1 
ATOM   3235 O OH  . TYR B 1 118 ? 14.382  19.993 14.530  1.00 26.59 ? 1087 TYR B OH  1 
ATOM   3236 N N   . LEU B 1 119 ? 13.918  24.705 18.493  1.00 29.25 ? 1088 LEU B N   1 
ATOM   3237 C CA  . LEU B 1 119 ? 12.700  25.070 17.794  1.00 29.40 ? 1088 LEU B CA  1 
ATOM   3238 C C   . LEU B 1 119 ? 12.778  26.453 17.151  1.00 31.23 ? 1088 LEU B C   1 
ATOM   3239 O O   . LEU B 1 119 ? 12.460  26.620 15.970  1.00 31.86 ? 1088 LEU B O   1 
ATOM   3240 C CB  . LEU B 1 119 ? 11.525  25.036 18.769  1.00 28.70 ? 1088 LEU B CB  1 
ATOM   3241 C CG  . LEU B 1 119 ? 10.851  23.698 19.062  1.00 27.18 ? 1088 LEU B CG  1 
ATOM   3242 C CD1 . LEU B 1 119 ? 10.098  23.773 20.389  1.00 24.51 ? 1088 LEU B CD1 1 
ATOM   3243 C CD2 . LEU B 1 119 ? 9.921   23.361 17.913  1.00 24.08 ? 1088 LEU B CD2 1 
ATOM   3244 N N   . ARG B 1 120 ? 13.186  27.444 17.935  1.00 31.92 ? 1089 ARG B N   1 
ATOM   3245 C CA  . ARG B 1 120 ? 13.277  28.809 17.439  1.00 32.73 ? 1089 ARG B CA  1 
ATOM   3246 C C   . ARG B 1 120 ? 14.243  28.939 16.275  1.00 33.36 ? 1089 ARG B C   1 
ATOM   3247 O O   . ARG B 1 120 ? 14.100  29.828 15.434  1.00 32.41 ? 1089 ARG B O   1 
ATOM   3248 C CB  . ARG B 1 120 ? 13.691  29.757 18.567  1.00 33.39 ? 1089 ARG B CB  1 
ATOM   3249 C CG  . ARG B 1 120 ? 12.578  30.075 19.545  1.00 33.40 ? 1089 ARG B CG  1 
ATOM   3250 C CD  . ARG B 1 120 ? 12.978  31.176 20.495  1.00 35.84 ? 1089 ARG B CD  1 
ATOM   3251 N NE  . ARG B 1 120 ? 11.871  31.560 21.369  1.00 40.54 ? 1089 ARG B NE  1 
ATOM   3252 C CZ  . ARG B 1 120 ? 11.950  32.481 22.333  1.00 41.84 ? 1089 ARG B CZ  1 
ATOM   3253 N NH1 . ARG B 1 120 ? 13.096  33.123 22.555  1.00 39.84 ? 1089 ARG B NH1 1 
ATOM   3254 N NH2 . ARG B 1 120 ? 10.881  32.761 23.077  1.00 41.21 ? 1089 ARG B NH2 1 
ATOM   3255 N N   . SER B 1 121 ? 15.221  28.043 16.225  1.00 34.67 ? 1090 SER B N   1 
ATOM   3256 C CA  . SER B 1 121 ? 16.217  28.063 15.165  1.00 35.81 ? 1090 SER B CA  1 
ATOM   3257 C C   . SER B 1 121 ? 15.616  27.564 13.856  1.00 37.16 ? 1090 SER B C   1 
ATOM   3258 O O   . SER B 1 121 ? 16.299  27.506 12.836  1.00 38.97 ? 1090 SER B O   1 
ATOM   3259 C CB  . SER B 1 121 ? 17.397  27.174 15.536  1.00 35.63 ? 1090 SER B CB  1 
ATOM   3260 O OG  . SER B 1 121 ? 17.079  25.805 15.320  1.00 36.27 ? 1090 SER B OG  1 
ATOM   3261 N N   . LEU B 1 122 ? 14.340  27.196 13.897  1.00 38.29 ? 1091 LEU B N   1 
ATOM   3262 C CA  . LEU B 1 122 ? 13.634  26.691 12.721  1.00 38.73 ? 1091 LEU B CA  1 
ATOM   3263 C C   . LEU B 1 122 ? 12.773  27.742 12.016  1.00 40.36 ? 1091 LEU B C   1 
ATOM   3264 O O   . LEU B 1 122 ? 12.272  27.493 10.919  1.00 40.32 ? 1091 LEU B O   1 
ATOM   3265 C CB  . LEU B 1 122 ? 12.756  25.493 13.118  1.00 36.22 ? 1091 LEU B CB  1 
ATOM   3266 C CG  . LEU B 1 122 ? 13.381  24.095 13.129  1.00 34.22 ? 1091 LEU B CG  1 
ATOM   3267 C CD1 . LEU B 1 122 ? 14.765  24.127 13.743  1.00 35.17 ? 1091 LEU B CD1 1 
ATOM   3268 C CD2 . LEU B 1 122 ? 12.472  23.160 13.892  1.00 32.24 ? 1091 LEU B CD2 1 
ATOM   3269 N N   . ARG B 1 123 ? 12.612  28.909 12.640  1.00 42.33 ? 1092 ARG B N   1 
ATOM   3270 C CA  . ARG B 1 123 ? 11.792  29.989 12.082  1.00 44.47 ? 1092 ARG B CA  1 
ATOM   3271 C C   . ARG B 1 123 ? 12.335  30.692 10.827  1.00 46.15 ? 1092 ARG B C   1 
ATOM   3272 O O   . ARG B 1 123 ? 11.640  30.772 9.809   1.00 45.97 ? 1092 ARG B O   1 
ATOM   3273 C CB  . ARG B 1 123 ? 11.522  31.038 13.163  1.00 44.52 ? 1092 ARG B CB  1 
ATOM   3274 C CG  . ARG B 1 123 ? 10.798  30.499 14.381  1.00 45.62 ? 1092 ARG B CG  1 
ATOM   3275 C CD  . ARG B 1 123 ? 11.422  31.034 15.652  1.00 44.80 ? 1092 ARG B CD  1 
ATOM   3276 N NE  . ARG B 1 123 ? 11.205  32.464 15.816  1.00 45.48 ? 1092 ARG B NE  1 
ATOM   3277 C CZ  . ARG B 1 123 ? 10.221  32.990 16.536  1.00 45.48 ? 1092 ARG B CZ  1 
ATOM   3278 N NH1 . ARG B 1 123 ? 10.097  34.309 16.626  1.00 45.01 ? 1092 ARG B NH1 1 
ATOM   3279 N NH2 . ARG B 1 123 ? 9.370   32.197 17.173  1.00 43.94 ? 1092 ARG B NH2 1 
ATOM   3280 N N   . PRO B 1 124 ? 13.578  31.216 10.886  1.00 48.04 ? 1093 PRO B N   1 
ATOM   3281 C CA  . PRO B 1 124 ? 14.234  31.924 9.775   1.00 49.65 ? 1093 PRO B CA  1 
ATOM   3282 C C   . PRO B 1 124 ? 13.882  31.489 8.340   1.00 51.65 ? 1093 PRO B C   1 
ATOM   3283 O O   . PRO B 1 124 ? 12.997  32.138 7.735   1.00 52.36 ? 1093 PRO B O   1 
ATOM   3284 C CB  . PRO B 1 124 ? 15.709  31.738 10.097  1.00 48.71 ? 1093 PRO B CB  1 
ATOM   3285 C CG  . PRO B 1 124 ? 15.708  31.891 11.588  1.00 48.33 ? 1093 PRO B CG  1 
ATOM   3286 C CD  . PRO B 1 124 ? 14.519  31.046 12.012  1.00 47.86 ? 1093 PRO B CD  1 
ATOM   3287 N N   . VAL B 1 131 ? 11.799  25.997 0.080   1.00 31.80 ? 1100 VAL B N   1 
ATOM   3288 C CA  . VAL B 1 131 ? 12.140  24.548 0.020   1.00 33.93 ? 1100 VAL B CA  1 
ATOM   3289 C C   . VAL B 1 131 ? 11.902  23.866 1.358   1.00 35.61 ? 1100 VAL B C   1 
ATOM   3290 O O   . VAL B 1 131 ? 11.059  22.978 1.463   1.00 36.51 ? 1100 VAL B O   1 
ATOM   3291 C CB  . VAL B 1 131 ? 13.615  24.317 -0.356  1.00 35.00 ? 1100 VAL B CB  1 
ATOM   3292 C CG1 . VAL B 1 131 ? 13.882  22.817 -0.479  1.00 33.88 ? 1100 VAL B CG1 1 
ATOM   3293 C CG2 . VAL B 1 131 ? 13.949  25.033 -1.657  1.00 34.54 ? 1100 VAL B CG2 1 
ATOM   3294 N N   . LEU B 1 132 ? 12.660  24.261 2.376   1.00 36.69 ? 1101 LEU B N   1 
ATOM   3295 C CA  . LEU B 1 132 ? 12.491  23.674 3.707   1.00 38.11 ? 1101 LEU B CA  1 
ATOM   3296 C C   . LEU B 1 132 ? 11.083  23.951 4.229   1.00 38.68 ? 1101 LEU B C   1 
ATOM   3297 O O   . LEU B 1 132 ? 10.322  24.697 3.615   1.00 39.54 ? 1101 LEU B O   1 
ATOM   3298 C CB  . LEU B 1 132 ? 13.520  24.242 4.688   1.00 37.60 ? 1101 LEU B CB  1 
ATOM   3299 C CG  . LEU B 1 132 ? 14.983  23.858 4.444   1.00 37.21 ? 1101 LEU B CG  1 
ATOM   3300 C CD1 . LEU B 1 132 ? 15.864  24.484 5.526   1.00 34.12 ? 1101 LEU B CD1 1 
ATOM   3301 C CD2 . LEU B 1 132 ? 15.115  22.340 4.437   1.00 34.65 ? 1101 LEU B CD2 1 
ATOM   3302 N N   . ALA B 1 133 ? 10.728  23.355 5.361   1.00 38.60 ? 1102 ALA B N   1 
ATOM   3303 C CA  . ALA B 1 133 ? 9.395   23.575 5.898   1.00 38.57 ? 1102 ALA B CA  1 
ATOM   3304 C C   . ALA B 1 133 ? 9.293   23.242 7.378   1.00 38.62 ? 1102 ALA B C   1 
ATOM   3305 O O   . ALA B 1 133 ? 10.071  22.446 7.902   1.00 38.28 ? 1102 ALA B O   1 
ATOM   3306 C CB  . ALA B 1 133 ? 8.390   22.756 5.113   1.00 37.72 ? 1102 ALA B CB  1 
ATOM   3307 N N   . PRO B 1 134 ? 8.330   23.861 8.079   1.00 38.33 ? 1103 PRO B N   1 
ATOM   3308 C CA  . PRO B 1 134 ? 8.185   23.571 9.505   1.00 37.65 ? 1103 PRO B CA  1 
ATOM   3309 C C   . PRO B 1 134 ? 8.012   22.072 9.715   1.00 36.32 ? 1103 PRO B C   1 
ATOM   3310 O O   . PRO B 1 134 ? 7.617   21.348 8.803   1.00 35.92 ? 1103 PRO B O   1 
ATOM   3311 C CB  . PRO B 1 134 ? 6.939   24.361 9.895   1.00 37.90 ? 1103 PRO B CB  1 
ATOM   3312 C CG  . PRO B 1 134 ? 6.153   24.405 8.613   1.00 37.80 ? 1103 PRO B CG  1 
ATOM   3313 C CD  . PRO B 1 134 ? 7.229   24.718 7.607   1.00 37.87 ? 1103 PRO B CD  1 
ATOM   3314 N N   . PRO B 1 135 ? 8.320   21.586 10.920  1.00 34.96 ? 1104 PRO B N   1 
ATOM   3315 C CA  . PRO B 1 135 ? 8.183   20.160 11.206  1.00 34.06 ? 1104 PRO B CA  1 
ATOM   3316 C C   . PRO B 1 135 ? 6.824   19.575 10.807  1.00 33.16 ? 1104 PRO B C   1 
ATOM   3317 O O   . PRO B 1 135 ? 5.798   20.254 10.856  1.00 32.50 ? 1104 PRO B O   1 
ATOM   3318 C CB  . PRO B 1 135 ? 8.437   20.096 12.709  1.00 33.64 ? 1104 PRO B CB  1 
ATOM   3319 C CG  . PRO B 1 135 ? 9.463   21.164 12.899  1.00 34.33 ? 1104 PRO B CG  1 
ATOM   3320 C CD  . PRO B 1 135 ? 8.918   22.298 12.064  1.00 34.26 ? 1104 PRO B CD  1 
ATOM   3321 N N   . SER B 1 136 ? 6.842   18.306 10.408  1.00 32.10 ? 1105 SER B N   1 
ATOM   3322 C CA  . SER B 1 136 ? 5.644   17.585 10.008  1.00 30.63 ? 1105 SER B CA  1 
ATOM   3323 C C   . SER B 1 136 ? 4.939   17.012 11.229  1.00 31.12 ? 1105 SER B C   1 
ATOM   3324 O O   . SER B 1 136 ? 5.556   16.798 12.278  1.00 30.96 ? 1105 SER B O   1 
ATOM   3325 C CB  . SER B 1 136 ? 6.008   16.428 9.083   1.00 30.15 ? 1105 SER B CB  1 
ATOM   3326 O OG  . SER B 1 136 ? 6.619   15.374 9.811   1.00 27.74 ? 1105 SER B OG  1 
ATOM   3327 N N   . LEU B 1 137 ? 3.643   16.760 11.078  1.00 30.83 ? 1106 LEU B N   1 
ATOM   3328 C CA  . LEU B 1 137 ? 2.836   16.189 12.148  1.00 31.31 ? 1106 LEU B CA  1 
ATOM   3329 C C   . LEU B 1 137 ? 3.541   14.943 12.694  1.00 31.71 ? 1106 LEU B C   1 
ATOM   3330 O O   . LEU B 1 137 ? 3.566   14.703 13.906  1.00 31.25 ? 1106 LEU B O   1 
ATOM   3331 C CB  . LEU B 1 137 ? 1.445   15.819 11.606  1.00 30.16 ? 1106 LEU B CB  1 
ATOM   3332 C CG  . LEU B 1 137 ? 0.454   15.079 12.513  1.00 28.99 ? 1106 LEU B CG  1 
ATOM   3333 C CD1 . LEU B 1 137 ? 0.200   15.876 13.787  1.00 28.75 ? 1106 LEU B CD1 1 
ATOM   3334 C CD2 . LEU B 1 137 ? -0.843  14.859 11.759  1.00 26.69 ? 1106 LEU B CD2 1 
ATOM   3335 N N   . SER B 1 138 ? 4.122   14.161 11.788  1.00 31.42 ? 1107 SER B N   1 
ATOM   3336 C CA  . SER B 1 138 ? 4.828   12.943 12.160  1.00 30.38 ? 1107 SER B CA  1 
ATOM   3337 C C   . SER B 1 138 ? 6.000   13.240 13.084  1.00 30.45 ? 1107 SER B C   1 
ATOM   3338 O O   . SER B 1 138 ? 6.242   12.496 14.034  1.00 32.01 ? 1107 SER B O   1 
ATOM   3339 C CB  . SER B 1 138 ? 5.335   12.225 10.909  1.00 29.43 ? 1107 SER B CB  1 
ATOM   3340 O OG  . SER B 1 138 ? 5.988   11.021 11.254  1.00 28.36 ? 1107 SER B OG  1 
ATOM   3341 N N   . LYS B 1 139 ? 6.729   14.317 12.799  1.00 29.20 ? 1108 LYS B N   1 
ATOM   3342 C CA  . LYS B 1 139 ? 7.879   14.716 13.611  1.00 28.24 ? 1108 LYS B CA  1 
ATOM   3343 C C   . LYS B 1 139 ? 7.420   15.167 14.996  1.00 27.28 ? 1108 LYS B C   1 
ATOM   3344 O O   . LYS B 1 139 ? 7.988   14.779 16.019  1.00 26.70 ? 1108 LYS B O   1 
ATOM   3345 C CB  . LYS B 1 139 ? 8.626   15.868 12.939  1.00 27.51 ? 1108 LYS B CB  1 
ATOM   3346 C CG  . LYS B 1 139 ? 9.314   15.516 11.645  1.00 26.70 ? 1108 LYS B CG  1 
ATOM   3347 C CD  . LYS B 1 139 ? 10.616  14.787 11.877  1.00 26.01 ? 1108 LYS B CD  1 
ATOM   3348 C CE  . LYS B 1 139 ? 11.445  14.758 10.605  1.00 25.35 ? 1108 LYS B CE  1 
ATOM   3349 N NZ  . LYS B 1 139 ? 11.723  16.128 10.081  1.00 22.45 ? 1108 LYS B NZ  1 
ATOM   3350 N N   . MET B 1 140 ? 6.385   16.000 15.007  1.00 26.22 ? 1109 MET B N   1 
ATOM   3351 C CA  . MET B 1 140 ? 5.815   16.531 16.240  1.00 25.01 ? 1109 MET B CA  1 
ATOM   3352 C C   . MET B 1 140 ? 5.213   15.460 17.145  1.00 23.15 ? 1109 MET B C   1 
ATOM   3353 O O   . MET B 1 140 ? 5.232   15.586 18.356  1.00 22.74 ? 1109 MET B O   1 
ATOM   3354 C CB  . MET B 1 140 ? 4.752   17.573 15.892  1.00 24.08 ? 1109 MET B CB  1 
ATOM   3355 C CG  . MET B 1 140 ? 5.293   18.641 14.971  1.00 25.69 ? 1109 MET B CG  1 
ATOM   3356 S SD  . MET B 1 140 ? 4.383   20.172 15.058  1.00 29.56 ? 1109 MET B SD  1 
ATOM   3357 C CE  . MET B 1 140 ? 3.366   20.013 13.583  1.00 28.61 ? 1109 MET B CE  1 
ATOM   3358 N N   . ILE B 1 141 ? 4.667   14.411 16.550  1.00 22.89 ? 1110 ILE B N   1 
ATOM   3359 C CA  . ILE B 1 141 ? 4.059   13.347 17.319  1.00 22.88 ? 1110 ILE B CA  1 
ATOM   3360 C C   . ILE B 1 141 ? 5.145   12.570 18.039  1.00 22.41 ? 1110 ILE B C   1 
ATOM   3361 O O   . ILE B 1 141 ? 4.948   12.079 19.154  1.00 18.39 ? 1110 ILE B O   1 
ATOM   3362 C CB  . ILE B 1 141 ? 3.254   12.415 16.397  1.00 24.57 ? 1110 ILE B CB  1 
ATOM   3363 C CG1 . ILE B 1 141 ? 1.950   13.105 15.991  1.00 26.05 ? 1110 ILE B CG1 1 
ATOM   3364 C CG2 . ILE B 1 141 ? 2.984   11.094 17.087  1.00 25.94 ? 1110 ILE B CG2 1 
ATOM   3365 C CD1 . ILE B 1 141 ? 1.046   12.267 15.091  1.00 27.47 ? 1110 ILE B CD1 1 
ATOM   3366 N N   . GLN B 1 142 ? 6.298   12.485 17.381  1.00 24.00 ? 1111 GLN B N   1 
ATOM   3367 C CA  . GLN B 1 142 ? 7.468   11.779 17.901  1.00 24.30 ? 1111 GLN B CA  1 
ATOM   3368 C C   . GLN B 1 142 ? 7.938   12.487 19.173  1.00 24.64 ? 1111 GLN B C   1 
ATOM   3369 O O   . GLN B 1 142 ? 8.115   11.865 20.221  1.00 24.76 ? 1111 GLN B O   1 
ATOM   3370 C CB  . GLN B 1 142 ? 8.579   11.786 16.839  1.00 24.89 ? 1111 GLN B CB  1 
ATOM   3371 C CG  . GLN B 1 142 ? 9.566   10.644 16.942  1.00 27.60 ? 1111 GLN B CG  1 
ATOM   3372 C CD  . GLN B 1 142 ? 8.865   9.304  17.037  1.00 30.84 ? 1111 GLN B CD  1 
ATOM   3373 O OE1 . GLN B 1 142 ? 7.940   9.019  16.263  1.00 30.08 ? 1111 GLN B OE1 1 
ATOM   3374 N NE2 . GLN B 1 142 ? 9.299   8.466  17.987  1.00 31.02 ? 1111 GLN B NE2 1 
ATOM   3375 N N   . MET B 1 143 ? 8.125   13.799 19.070  1.00 24.18 ? 1112 MET B N   1 
ATOM   3376 C CA  . MET B 1 143 ? 8.560   14.601 20.199  1.00 24.80 ? 1112 MET B CA  1 
ATOM   3377 C C   . MET B 1 143 ? 7.523   14.506 21.300  1.00 24.40 ? 1112 MET B C   1 
ATOM   3378 O O   . MET B 1 143 ? 7.866   14.348 22.470  1.00 26.44 ? 1112 MET B O   1 
ATOM   3379 C CB  . MET B 1 143 ? 8.731   16.056 19.771  1.00 24.56 ? 1112 MET B CB  1 
ATOM   3380 C CG  . MET B 1 143 ? 9.620   16.205 18.569  1.00 26.50 ? 1112 MET B CG  1 
ATOM   3381 S SD  . MET B 1 143 ? 9.777   17.890 18.029  1.00 29.87 ? 1112 MET B SD  1 
ATOM   3382 C CE  . MET B 1 143 ? 11.480  18.170 18.362  1.00 29.79 ? 1112 MET B CE  1 
ATOM   3383 N N   . ALA B 1 144 ? 6.257   14.603 20.909  1.00 22.93 ? 1113 ALA B N   1 
ATOM   3384 C CA  . ALA B 1 144 ? 5.140   14.524 21.836  1.00 21.12 ? 1113 ALA B CA  1 
ATOM   3385 C C   . ALA B 1 144 ? 5.244   13.239 22.633  1.00 20.95 ? 1113 ALA B C   1 
ATOM   3386 O O   . ALA B 1 144 ? 5.311   13.263 23.866  1.00 19.38 ? 1113 ALA B O   1 
ATOM   3387 C CB  . ALA B 1 144 ? 3.832   14.546 21.067  1.00 20.18 ? 1113 ALA B CB  1 
ATOM   3388 N N   . GLY B 1 145 ? 5.266   12.122 21.904  1.00 20.65 ? 1114 GLY B N   1 
ATOM   3389 C CA  . GLY B 1 145 ? 5.353   10.812 22.515  1.00 18.97 ? 1114 GLY B CA  1 
ATOM   3390 C C   . GLY B 1 145 ? 6.644   10.592 23.269  1.00 20.69 ? 1114 GLY B C   1 
ATOM   3391 O O   . GLY B 1 145 ? 6.658   9.904  24.293  1.00 21.78 ? 1114 GLY B O   1 
ATOM   3392 N N   . GLU B 1 146 ? 7.732   11.170 22.771  1.00 21.08 ? 1115 GLU B N   1 
ATOM   3393 C CA  . GLU B 1 146 ? 9.026   11.026 23.418  1.00 21.26 ? 1115 GLU B CA  1 
ATOM   3394 C C   . GLU B 1 146 ? 9.103   11.788 24.729  1.00 22.07 ? 1115 GLU B C   1 
ATOM   3395 O O   . GLU B 1 146 ? 9.767   11.350 25.662  1.00 24.34 ? 1115 GLU B O   1 
ATOM   3396 C CB  . GLU B 1 146 ? 10.140  11.491 22.486  1.00 23.78 ? 1115 GLU B CB  1 
ATOM   3397 C CG  . GLU B 1 146 ? 10.641  10.412 21.547  1.00 26.29 ? 1115 GLU B CG  1 
ATOM   3398 C CD  . GLU B 1 146 ? 11.634  10.931 20.528  1.00 28.19 ? 1115 GLU B CD  1 
ATOM   3399 O OE1 . GLU B 1 146 ? 12.223  10.104 19.806  1.00 30.36 ? 1115 GLU B OE1 1 
ATOM   3400 O OE2 . GLU B 1 146 ? 11.822  12.162 20.440  1.00 31.05 ? 1115 GLU B OE2 1 
ATOM   3401 N N   . ILE B 1 147 ? 8.431   12.930 24.807  1.00 21.49 ? 1116 ILE B N   1 
ATOM   3402 C CA  . ILE B 1 147 ? 8.442   13.718 26.028  1.00 20.25 ? 1116 ILE B CA  1 
ATOM   3403 C C   . ILE B 1 147 ? 7.509   13.073 27.042  1.00 21.01 ? 1116 ILE B C   1 
ATOM   3404 O O   . ILE B 1 147 ? 7.836   12.947 28.221  1.00 21.68 ? 1116 ILE B O   1 
ATOM   3405 C CB  . ILE B 1 147 ? 7.960   15.156 25.777  1.00 19.33 ? 1116 ILE B CB  1 
ATOM   3406 C CG1 . ILE B 1 147 ? 8.803   15.812 24.682  1.00 19.69 ? 1116 ILE B CG1 1 
ATOM   3407 C CG2 . ILE B 1 147 ? 8.068   15.962 27.058  1.00 19.54 ? 1116 ILE B CG2 1 
ATOM   3408 C CD1 . ILE B 1 147 ? 8.409   17.261 24.366  1.00 17.56 ? 1116 ILE B CD1 1 
ATOM   3409 N N   . ALA B 1 148 ? 6.342   12.661 26.563  1.00 22.51 ? 1117 ALA B N   1 
ATOM   3410 C CA  . ALA B 1 148 ? 5.325   12.032 27.400  1.00 23.01 ? 1117 ALA B CA  1 
ATOM   3411 C C   . ALA B 1 148 ? 5.817   10.735 28.030  1.00 23.49 ? 1117 ALA B C   1 
ATOM   3412 O O   . ALA B 1 148 ? 5.326   10.326 29.078  1.00 24.19 ? 1117 ALA B O   1 
ATOM   3413 C CB  . ALA B 1 148 ? 4.071   11.763 26.568  1.00 21.51 ? 1117 ALA B CB  1 
ATOM   3414 N N   . ASP B 1 149 ? 6.776   10.085 27.376  1.00 23.30 ? 1118 ASP B N   1 
ATOM   3415 C CA  . ASP B 1 149 ? 7.323   8.836  27.874  1.00 21.44 ? 1118 ASP B CA  1 
ATOM   3416 C C   . ASP B 1 149 ? 8.253   9.101  29.040  1.00 21.03 ? 1118 ASP B C   1 
ATOM   3417 O O   . ASP B 1 149 ? 8.271   8.350  30.013  1.00 22.29 ? 1118 ASP B O   1 
ATOM   3418 C CB  . ASP B 1 149 ? 8.083   8.097  26.772  1.00 21.53 ? 1118 ASP B CB  1 
ATOM   3419 C CG  . ASP B 1 149 ? 8.437   6.686  27.176  1.00 20.23 ? 1118 ASP B CG  1 
ATOM   3420 O OD1 . ASP B 1 149 ? 7.505   5.917  27.467  1.00 21.06 ? 1118 ASP B OD1 1 
ATOM   3421 O OD2 . ASP B 1 149 ? 9.635   6.345  27.218  1.00 20.81 ? 1118 ASP B OD2 1 
ATOM   3422 N N   . GLY B 1 150 ? 9.047   10.155 28.928  1.00 19.35 ? 1119 GLY B N   1 
ATOM   3423 C CA  . GLY B 1 150 ? 9.936   10.495 30.013  1.00 19.84 ? 1119 GLY B CA  1 
ATOM   3424 C C   . GLY B 1 150 ? 9.070   10.911 31.191  1.00 22.07 ? 1119 GLY B C   1 
ATOM   3425 O O   . GLY B 1 150 ? 9.287   10.480 32.326  1.00 21.07 ? 1119 GLY B O   1 
ATOM   3426 N N   . MET B 1 151 ? 8.068   11.743 30.924  1.00 23.12 ? 1120 MET B N   1 
ATOM   3427 C CA  . MET B 1 151 ? 7.183   12.198 31.988  1.00 24.71 ? 1120 MET B CA  1 
ATOM   3428 C C   . MET B 1 151 ? 6.458   11.039 32.669  1.00 25.65 ? 1120 MET B C   1 
ATOM   3429 O O   . MET B 1 151 ? 6.343   11.023 33.896  1.00 27.86 ? 1120 MET B O   1 
ATOM   3430 C CB  . MET B 1 151 ? 6.172   13.215 31.456  1.00 25.37 ? 1120 MET B CB  1 
ATOM   3431 C CG  . MET B 1 151 ? 6.781   14.572 31.168  1.00 24.80 ? 1120 MET B CG  1 
ATOM   3432 S SD  . MET B 1 151 ? 7.844   15.046 32.520  1.00 26.91 ? 1120 MET B SD  1 
ATOM   3433 C CE  . MET B 1 151 ? 6.633   15.475 33.786  1.00 26.97 ? 1120 MET B CE  1 
ATOM   3434 N N   . ALA B 1 152 ? 5.976   10.070 31.889  1.00 24.87 ? 1121 ALA B N   1 
ATOM   3435 C CA  . ALA B 1 152 ? 5.293   8.913  32.468  1.00 25.13 ? 1121 ALA B CA  1 
ATOM   3436 C C   . ALA B 1 152 ? 6.290   8.135  33.334  1.00 24.96 ? 1121 ALA B C   1 
ATOM   3437 O O   . ALA B 1 152 ? 5.958   7.708  34.444  1.00 24.15 ? 1121 ALA B O   1 
ATOM   3438 C CB  . ALA B 1 152 ? 4.725   8.018  31.377  1.00 24.70 ? 1121 ALA B CB  1 
ATOM   3439 N N   . TYR B 1 153 ? 7.509   7.961  32.833  1.00 24.11 ? 1122 TYR B N   1 
ATOM   3440 C CA  . TYR B 1 153 ? 8.533   7.264  33.605  1.00 25.28 ? 1122 TYR B CA  1 
ATOM   3441 C C   . TYR B 1 153 ? 8.635   7.929  34.979  1.00 25.25 ? 1122 TYR B C   1 
ATOM   3442 O O   . TYR B 1 153 ? 8.430   7.290  36.011  1.00 25.09 ? 1122 TYR B O   1 
ATOM   3443 C CB  . TYR B 1 153 ? 9.900   7.349  32.920  1.00 25.26 ? 1122 TYR B CB  1 
ATOM   3444 C CG  . TYR B 1 153 ? 10.982  6.672  33.730  1.00 27.08 ? 1122 TYR B CG  1 
ATOM   3445 C CD1 . TYR B 1 153 ? 11.065  5.278  33.783  1.00 26.94 ? 1122 TYR B CD1 1 
ATOM   3446 C CD2 . TYR B 1 153 ? 11.866  7.416  34.521  1.00 28.19 ? 1122 TYR B CD2 1 
ATOM   3447 C CE1 . TYR B 1 153 ? 11.986  4.639  34.604  1.00 25.77 ? 1122 TYR B CE1 1 
ATOM   3448 C CE2 . TYR B 1 153 ? 12.800  6.778  35.355  1.00 27.92 ? 1122 TYR B CE2 1 
ATOM   3449 C CZ  . TYR B 1 153 ? 12.846  5.389  35.390  1.00 26.57 ? 1122 TYR B CZ  1 
ATOM   3450 O OH  . TYR B 1 153 ? 13.726  4.742  36.226  1.00 25.27 ? 1122 TYR B OH  1 
ATOM   3451 N N   . LEU B 1 154 ? 8.951   9.223  34.975  1.00 25.08 ? 1123 LEU B N   1 
ATOM   3452 C CA  . LEU B 1 154 ? 9.080   10.005 36.202  1.00 21.78 ? 1123 LEU B CA  1 
ATOM   3453 C C   . LEU B 1 154 ? 7.852   9.886  37.082  1.00 22.34 ? 1123 LEU B C   1 
ATOM   3454 O O   . LEU B 1 154 ? 7.958   9.565  38.263  1.00 22.42 ? 1123 LEU B O   1 
ATOM   3455 C CB  . LEU B 1 154 ? 9.312   11.476 35.866  1.00 18.46 ? 1123 LEU B CB  1 
ATOM   3456 C CG  . LEU B 1 154 ? 10.593  11.745 35.082  1.00 18.97 ? 1123 LEU B CG  1 
ATOM   3457 C CD1 . LEU B 1 154 ? 10.589  13.178 34.580  1.00 18.97 ? 1123 LEU B CD1 1 
ATOM   3458 C CD2 . LEU B 1 154 ? 11.800  11.460 35.950  1.00 16.22 ? 1123 LEU B CD2 1 
ATOM   3459 N N   . ASN B 1 155 ? 6.682   10.153 36.509  1.00 22.90 ? 1124 ASN B N   1 
ATOM   3460 C CA  . ASN B 1 155 ? 5.454   10.076 37.280  1.00 23.91 ? 1124 ASN B CA  1 
ATOM   3461 C C   . ASN B 1 155 ? 5.271   8.687  37.870  1.00 24.41 ? 1124 ASN B C   1 
ATOM   3462 O O   . ASN B 1 155 ? 4.735   8.535  38.966  1.00 23.59 ? 1124 ASN B O   1 
ATOM   3463 C CB  . ASN B 1 155 ? 4.244   10.435 36.412  1.00 25.18 ? 1124 ASN B CB  1 
ATOM   3464 C CG  . ASN B 1 155 ? 4.121   11.936 36.156  1.00 25.15 ? 1124 ASN B CG  1 
ATOM   3465 O OD1 . ASN B 1 155 ? 3.094   12.405 35.654  1.00 26.01 ? 1124 ASN B OD1 1 
ATOM   3466 N ND2 . ASN B 1 155 ? 5.167   12.692 36.495  1.00 20.64 ? 1124 ASN B ND2 1 
ATOM   3467 N N   . ALA B 1 156 ? 5.720   7.670  37.142  1.00 25.15 ? 1125 ALA B N   1 
ATOM   3468 C CA  . ALA B 1 156 ? 5.596   6.306  37.626  1.00 25.14 ? 1125 ALA B CA  1 
ATOM   3469 C C   . ALA B 1 156 ? 6.402   6.172  38.901  1.00 26.77 ? 1125 ALA B C   1 
ATOM   3470 O O   . ALA B 1 156 ? 5.901   5.659  39.902  1.00 28.68 ? 1125 ALA B O   1 
ATOM   3471 C CB  . ALA B 1 156 ? 6.100   5.329  36.589  1.00 25.97 ? 1125 ALA B CB  1 
ATOM   3472 N N   . ASN B 1 157 ? 7.648   6.641  38.866  1.00 27.11 ? 1126 ASN B N   1 
ATOM   3473 C CA  . ASN B 1 157 ? 8.520   6.571  40.033  1.00 27.10 ? 1126 ASN B CA  1 
ATOM   3474 C C   . ASN B 1 157 ? 8.143   7.585  41.096  1.00 27.19 ? 1126 ASN B C   1 
ATOM   3475 O O   . ASN B 1 157 ? 8.873   7.780  42.065  1.00 27.50 ? 1126 ASN B O   1 
ATOM   3476 C CB  . ASN B 1 157 ? 9.982   6.776  39.646  1.00 27.58 ? 1126 ASN B CB  1 
ATOM   3477 C CG  . ASN B 1 157 ? 10.625  5.519  39.114  1.00 29.70 ? 1126 ASN B CG  1 
ATOM   3478 O OD1 . ASN B 1 157 ? 11.798  5.257  39.385  1.00 34.87 ? 1126 ASN B OD1 1 
ATOM   3479 N ND2 . ASN B 1 157 ? 9.873   4.737  38.344  1.00 29.58 ? 1126 ASN B ND2 1 
ATOM   3480 N N   . LYS B 1 158 ? 7.005   8.237  40.913  1.00 26.30 ? 1127 LYS B N   1 
ATOM   3481 C CA  . LYS B 1 158 ? 6.534   9.200  41.893  1.00 28.12 ? 1127 LYS B CA  1 
ATOM   3482 C C   . LYS B 1 158 ? 7.339   10.499 41.914  1.00 27.61 ? 1127 LYS B C   1 
ATOM   3483 O O   . LYS B 1 158 ? 7.720   10.990 42.978  1.00 26.78 ? 1127 LYS B O   1 
ATOM   3484 C CB  . LYS B 1 158 ? 6.528   8.543  43.279  1.00 27.84 ? 1127 LYS B CB  1 
ATOM   3485 C CG  . LYS B 1 158 ? 5.801   7.202  43.289  1.00 31.01 ? 1127 LYS B CG  1 
ATOM   3486 C CD  . LYS B 1 158 ? 5.992   6.446  44.593  1.00 35.78 ? 1127 LYS B CD  1 
ATOM   3487 C CE  . LYS B 1 158 ? 5.378   7.180  45.783  1.00 37.90 ? 1127 LYS B CE  1 
ATOM   3488 N NZ  . LYS B 1 158 ? 5.745   6.527  47.076  1.00 38.71 ? 1127 LYS B NZ  1 
ATOM   3489 N N   . PHE B 1 159 ? 7.588   11.048 40.728  1.00 28.50 ? 1128 PHE B N   1 
ATOM   3490 C CA  . PHE B 1 159 ? 8.312   12.312 40.584  1.00 29.77 ? 1128 PHE B CA  1 
ATOM   3491 C C   . PHE B 1 159 ? 7.559   13.251 39.639  1.00 28.65 ? 1128 PHE B C   1 
ATOM   3492 O O   . PHE B 1 159 ? 7.178   12.853 38.544  1.00 28.77 ? 1128 PHE B O   1 
ATOM   3493 C CB  . PHE B 1 159 ? 9.728   12.090 40.020  1.00 30.51 ? 1128 PHE B CB  1 
ATOM   3494 C CG  . PHE B 1 159 ? 10.734  11.581 41.034  1.00 31.17 ? 1128 PHE B CG  1 
ATOM   3495 C CD1 . PHE B 1 159 ? 11.118  10.242 41.050  1.00 30.31 ? 1128 PHE B CD1 1 
ATOM   3496 C CD2 . PHE B 1 159 ? 11.314  12.448 41.960  1.00 30.59 ? 1128 PHE B CD2 1 
ATOM   3497 C CE1 . PHE B 1 159 ? 12.068  9.777  41.974  1.00 29.57 ? 1128 PHE B CE1 1 
ATOM   3498 C CE2 . PHE B 1 159 ? 12.260  11.988 42.883  1.00 29.22 ? 1128 PHE B CE2 1 
ATOM   3499 C CZ  . PHE B 1 159 ? 12.635  10.653 42.888  1.00 28.38 ? 1128 PHE B CZ  1 
ATOM   3500 N N   . VAL B 1 160 ? 7.331   14.486 40.071  1.00 27.49 ? 1129 VAL B N   1 
ATOM   3501 C CA  . VAL B 1 160 ? 6.662   15.475 39.228  1.00 27.05 ? 1129 VAL B CA  1 
ATOM   3502 C C   . VAL B 1 160 ? 7.763   16.403 38.699  1.00 25.88 ? 1129 VAL B C   1 
ATOM   3503 O O   . VAL B 1 160 ? 8.902   16.305 39.154  1.00 25.52 ? 1129 VAL B O   1 
ATOM   3504 C CB  . VAL B 1 160 ? 5.639   16.294 40.036  1.00 27.96 ? 1129 VAL B CB  1 
ATOM   3505 C CG1 . VAL B 1 160 ? 4.564   15.382 40.578  1.00 28.72 ? 1129 VAL B CG1 1 
ATOM   3506 C CG2 . VAL B 1 160 ? 6.333   17.015 41.177  1.00 29.28 ? 1129 VAL B CG2 1 
ATOM   3507 N N   . HIS B 1 161 ? 7.443   17.296 37.759  1.00 25.71 ? 1130 HIS B N   1 
ATOM   3508 C CA  . HIS B 1 161 ? 8.458   18.206 37.204  1.00 22.74 ? 1130 HIS B CA  1 
ATOM   3509 C C   . HIS B 1 161 ? 8.460   19.626 37.743  1.00 21.84 ? 1130 HIS B C   1 
ATOM   3510 O O   . HIS B 1 161 ? 9.518   20.183 37.992  1.00 23.81 ? 1130 HIS B O   1 
ATOM   3511 C CB  . HIS B 1 161 ? 8.362   18.290 35.683  1.00 23.09 ? 1130 HIS B CB  1 
ATOM   3512 C CG  . HIS B 1 161 ? 9.631   18.744 35.033  1.00 24.05 ? 1130 HIS B CG  1 
ATOM   3513 N ND1 . HIS B 1 161 ? 10.356  19.824 35.492  1.00 25.11 ? 1130 HIS B ND1 1 
ATOM   3514 C CD2 . HIS B 1 161 ? 10.335  18.236 33.997  1.00 23.35 ? 1130 HIS B CD2 1 
ATOM   3515 C CE1 . HIS B 1 161 ? 11.452  19.957 34.770  1.00 22.20 ? 1130 HIS B CE1 1 
ATOM   3516 N NE2 . HIS B 1 161 ? 11.464  19.006 33.856  1.00 22.86 ? 1130 HIS B NE2 1 
ATOM   3517 N N   . ARG B 1 162 ? 7.290   20.224 37.907  1.00 22.03 ? 1131 ARG B N   1 
ATOM   3518 C CA  . ARG B 1 162 ? 7.205   21.594 38.415  1.00 23.46 ? 1131 ARG B CA  1 
ATOM   3519 C C   . ARG B 1 162 ? 7.788   22.641 37.468  1.00 26.39 ? 1131 ARG B C   1 
ATOM   3520 O O   . ARG B 1 162 ? 7.579   23.843 37.672  1.00 29.38 ? 1131 ARG B O   1 
ATOM   3521 C CB  . ARG B 1 162 ? 7.886   21.712 39.785  1.00 21.93 ? 1131 ARG B CB  1 
ATOM   3522 C CG  . ARG B 1 162 ? 7.062   21.146 40.934  1.00 21.56 ? 1131 ARG B CG  1 
ATOM   3523 C CD  . ARG B 1 162 ? 7.917   20.808 42.138  1.00 20.27 ? 1131 ARG B CD  1 
ATOM   3524 N NE  . ARG B 1 162 ? 7.237   19.857 43.003  1.00 20.24 ? 1131 ARG B NE  1 
ATOM   3525 C CZ  . ARG B 1 162 ? 6.379   20.201 43.956  1.00 24.28 ? 1131 ARG B CZ  1 
ATOM   3526 N NH1 . ARG B 1 162 ? 6.107   21.484 44.170  1.00 24.33 ? 1131 ARG B NH1 1 
ATOM   3527 N NH2 . ARG B 1 162 ? 5.777   19.264 44.681  1.00 22.49 ? 1131 ARG B NH2 1 
ATOM   3528 N N   . ASP B 1 163 ? 8.530   22.209 36.448  1.00 25.73 ? 1132 ASP B N   1 
ATOM   3529 C CA  . ASP B 1 163 ? 9.078   23.160 35.488  1.00 25.16 ? 1132 ASP B CA  1 
ATOM   3530 C C   . ASP B 1 163 ? 9.185   22.600 34.058  1.00 26.15 ? 1132 ASP B C   1 
ATOM   3531 O O   . ASP B 1 163 ? 10.133  22.903 33.315  1.00 25.43 ? 1132 ASP B O   1 
ATOM   3532 C CB  . ASP B 1 163 ? 10.436  23.677 35.961  1.00 23.31 ? 1132 ASP B CB  1 
ATOM   3533 C CG  . ASP B 1 163 ? 10.803  25.018 35.320  1.00 24.56 ? 1132 ASP B CG  1 
ATOM   3534 O OD1 . ASP B 1 163 ? 9.988   25.558 34.537  1.00 19.96 ? 1132 ASP B OD1 1 
ATOM   3535 O OD2 . ASP B 1 163 ? 11.907  25.533 35.601  1.00 25.49 ? 1132 ASP B OD2 1 
ATOM   3536 N N   . LEU B 1 164 ? 8.199   21.793 33.669  1.00 25.37 ? 1133 LEU B N   1 
ATOM   3537 C CA  . LEU B 1 164 ? 8.193   21.206 32.330  1.00 24.86 ? 1133 LEU B CA  1 
ATOM   3538 C C   . LEU B 1 164 ? 7.964   22.295 31.301  1.00 24.10 ? 1133 LEU B C   1 
ATOM   3539 O O   . LEU B 1 164 ? 6.969   23.014 31.360  1.00 24.67 ? 1133 LEU B O   1 
ATOM   3540 C CB  . LEU B 1 164 ? 7.096   20.144 32.203  1.00 24.73 ? 1133 LEU B CB  1 
ATOM   3541 C CG  . LEU B 1 164 ? 7.070   19.316 30.914  1.00 23.68 ? 1133 LEU B CG  1 
ATOM   3542 C CD1 . LEU B 1 164 ? 8.404   18.607 30.694  1.00 22.04 ? 1133 LEU B CD1 1 
ATOM   3543 C CD2 . LEU B 1 164 ? 5.955   18.307 31.008  1.00 23.26 ? 1133 LEU B CD2 1 
ATOM   3544 N N   . ALA B 1 165 ? 8.896   22.417 30.363  1.00 24.28 ? 1134 ALA B N   1 
ATOM   3545 C CA  . ALA B 1 165 ? 8.813   23.423 29.308  1.00 24.11 ? 1134 ALA B CA  1 
ATOM   3546 C C   . ALA B 1 165 ? 9.808   23.040 28.240  1.00 24.69 ? 1134 ALA B C   1 
ATOM   3547 O O   . ALA B 1 165 ? 10.796  22.349 28.523  1.00 24.92 ? 1134 ALA B O   1 
ATOM   3548 C CB  . ALA B 1 165 ? 9.151   24.800 29.851  1.00 20.70 ? 1134 ALA B CB  1 
ATOM   3549 N N   . ALA B 1 166 ? 9.552   23.487 27.013  1.00 24.34 ? 1135 ALA B N   1 
ATOM   3550 C CA  . ALA B 1 166 ? 10.449  23.175 25.912  1.00 23.94 ? 1135 ALA B CA  1 
ATOM   3551 C C   . ALA B 1 166 ? 11.882  23.519 26.310  1.00 23.92 ? 1135 ALA B C   1 
ATOM   3552 O O   . ALA B 1 166 ? 12.804  22.760 26.038  1.00 25.20 ? 1135 ALA B O   1 
ATOM   3553 C CB  . ALA B 1 166 ? 10.043  23.945 24.674  1.00 22.49 ? 1135 ALA B CB  1 
ATOM   3554 N N   . ARG B 1 167 ? 12.058  24.655 26.979  1.00 23.60 ? 1136 ARG B N   1 
ATOM   3555 C CA  . ARG B 1 167 ? 13.380  25.086 27.407  1.00 22.83 ? 1136 ARG B CA  1 
ATOM   3556 C C   . ARG B 1 167 ? 14.046  24.080 28.333  1.00 21.98 ? 1136 ARG B C   1 
ATOM   3557 O O   . ARG B 1 167 ? 15.252  24.155 28.549  1.00 21.37 ? 1136 ARG B O   1 
ATOM   3558 C CB  . ARG B 1 167 ? 13.313  26.455 28.100  1.00 22.89 ? 1136 ARG B CB  1 
ATOM   3559 C CG  . ARG B 1 167 ? 12.438  26.478 29.336  1.00 24.07 ? 1136 ARG B CG  1 
ATOM   3560 C CD  . ARG B 1 167 ? 12.512  27.801 30.081  1.00 21.88 ? 1136 ARG B CD  1 
ATOM   3561 N NE  . ARG B 1 167 ? 11.578  27.819 31.203  1.00 21.61 ? 1136 ARG B NE  1 
ATOM   3562 C CZ  . ARG B 1 167 ? 10.261  27.955 31.080  1.00 22.94 ? 1136 ARG B CZ  1 
ATOM   3563 N NH1 . ARG B 1 167 ? 9.713   28.097 29.880  1.00 22.92 ? 1136 ARG B NH1 1 
ATOM   3564 N NH2 . ARG B 1 167 ? 9.485   27.931 32.157  1.00 22.82 ? 1136 ARG B NH2 1 
ATOM   3565 N N   . ASN B 1 168 ? 13.282  23.140 28.884  1.00 21.01 ? 1137 ASN B N   1 
ATOM   3566 C CA  . ASN B 1 168 ? 13.897  22.151 29.766  1.00 22.96 ? 1137 ASN B CA  1 
ATOM   3567 C C   . ASN B 1 168 ? 13.904  20.723 29.219  1.00 22.75 ? 1137 ASN B C   1 
ATOM   3568 O O   . ASN B 1 168 ? 14.146  19.761 29.945  1.00 21.17 ? 1137 ASN B O   1 
ATOM   3569 C CB  . ASN B 1 168 ? 13.262  22.200 31.156  1.00 23.92 ? 1137 ASN B CB  1 
ATOM   3570 C CG  . ASN B 1 168 ? 13.490  23.534 31.843  1.00 24.81 ? 1137 ASN B CG  1 
ATOM   3571 O OD1 . ASN B 1 168 ? 14.603  24.053 31.862  1.00 20.81 ? 1137 ASN B OD1 1 
ATOM   3572 N ND2 . ASN B 1 168 ? 12.432  24.094 32.412  1.00 28.64 ? 1137 ASN B ND2 1 
ATOM   3573 N N   . CYS B 1 169 ? 13.643  20.612 27.920  1.00 24.11 ? 1138 CYS B N   1 
ATOM   3574 C CA  . CYS B 1 169 ? 13.655  19.346 27.201  1.00 23.55 ? 1138 CYS B CA  1 
ATOM   3575 C C   . CYS B 1 169 ? 14.934  19.378 26.377  1.00 23.92 ? 1138 CYS B C   1 
ATOM   3576 O O   . CYS B 1 169 ? 15.415  20.457 26.041  1.00 25.76 ? 1138 CYS B O   1 
ATOM   3577 C CB  . CYS B 1 169 ? 12.448  19.259 26.270  1.00 22.91 ? 1138 CYS B CB  1 
ATOM   3578 S SG  . CYS B 1 169 ? 10.872  19.086 27.126  1.00 23.16 ? 1138 CYS B SG  1 
ATOM   3579 N N   . MET B 1 170 ? 15.499  18.221 26.059  1.00 24.08 ? 1139 MET B N   1 
ATOM   3580 C CA  . MET B 1 170 ? 16.724  18.197 25.262  1.00 25.90 ? 1139 MET B CA  1 
ATOM   3581 C C   . MET B 1 170 ? 16.549  17.467 23.939  1.00 26.93 ? 1139 MET B C   1 
ATOM   3582 O O   . MET B 1 170 ? 15.575  16.740 23.737  1.00 26.91 ? 1139 MET B O   1 
ATOM   3583 C CB  . MET B 1 170 ? 17.880  17.556 26.038  1.00 25.97 ? 1139 MET B CB  1 
ATOM   3584 C CG  . MET B 1 170 ? 18.340  18.357 27.237  1.00 28.38 ? 1139 MET B CG  1 
ATOM   3585 S SD  . MET B 1 170 ? 18.644  20.081 26.824  1.00 31.97 ? 1139 MET B SD  1 
ATOM   3586 C CE  . MET B 1 170 ? 20.430  20.090 26.599  1.00 28.94 ? 1139 MET B CE  1 
ATOM   3587 N N   . VAL B 1 171 ? 17.507  17.684 23.042  1.00 27.41 ? 1140 VAL B N   1 
ATOM   3588 C CA  . VAL B 1 171 ? 17.511  17.076 21.719  1.00 27.35 ? 1140 VAL B CA  1 
ATOM   3589 C C   . VAL B 1 171 ? 18.854  16.371 21.481  1.00 28.08 ? 1140 VAL B C   1 
ATOM   3590 O O   . VAL B 1 171 ? 19.912  17.015 21.403  1.00 28.15 ? 1140 VAL B O   1 
ATOM   3591 C CB  . VAL B 1 171 ? 17.304  18.143 20.626  1.00 27.83 ? 1140 VAL B CB  1 
ATOM   3592 C CG1 . VAL B 1 171 ? 17.280  17.486 19.254  1.00 28.71 ? 1140 VAL B CG1 1 
ATOM   3593 C CG2 . VAL B 1 171 ? 16.017  18.906 20.881  1.00 27.06 ? 1140 VAL B CG2 1 
ATOM   3594 N N   . ALA B 1 172 ? 18.798  15.046 21.377  1.00 26.48 ? 1141 ALA B N   1 
ATOM   3595 C CA  . ALA B 1 172 ? 19.983  14.239 21.153  1.00 26.09 ? 1141 ALA B CA  1 
ATOM   3596 C C   . ALA B 1 172 ? 20.450  14.346 19.707  1.00 26.48 ? 1141 ALA B C   1 
ATOM   3597 O O   . ALA B 1 172 ? 19.773  14.929 18.864  1.00 26.40 ? 1141 ALA B O   1 
ATOM   3598 C CB  . ALA B 1 172 ? 19.692  12.794 21.499  1.00 27.73 ? 1141 ALA B CB  1 
ATOM   3599 N N   . GLU B 1 173 ? 21.612  13.763 19.433  1.00 27.13 ? 1142 GLU B N   1 
ATOM   3600 C CA  . GLU B 1 173 ? 22.221  13.777 18.104  1.00 27.34 ? 1142 GLU B CA  1 
ATOM   3601 C C   . GLU B 1 173 ? 21.281  13.283 16.985  1.00 26.85 ? 1142 GLU B C   1 
ATOM   3602 O O   . GLU B 1 173 ? 21.233  13.869 15.908  1.00 23.77 ? 1142 GLU B O   1 
ATOM   3603 C CB  . GLU B 1 173 ? 23.514  12.945 18.147  1.00 26.52 ? 1142 GLU B CB  1 
ATOM   3604 C CG  . GLU B 1 173 ? 24.294  12.847 16.833  1.00 28.66 ? 1142 GLU B CG  1 
ATOM   3605 C CD  . GLU B 1 173 ? 24.770  14.189 16.309  1.00 28.83 ? 1142 GLU B CD  1 
ATOM   3606 O OE1 . GLU B 1 173 ? 25.236  15.020 17.115  1.00 28.54 ? 1142 GLU B OE1 1 
ATOM   3607 O OE2 . GLU B 1 173 ? 24.691  14.402 15.082  1.00 29.02 ? 1142 GLU B OE2 1 
ATOM   3608 N N   . ASP B 1 174 ? 20.530  12.214 17.254  1.00 29.00 ? 1143 ASP B N   1 
ATOM   3609 C CA  . ASP B 1 174 ? 19.596  11.647 16.276  1.00 28.82 ? 1143 ASP B CA  1 
ATOM   3610 C C   . ASP B 1 174 ? 18.228  12.312 16.359  1.00 28.98 ? 1143 ASP B C   1 
ATOM   3611 O O   . ASP B 1 174 ? 17.234  11.760 15.879  1.00 28.67 ? 1143 ASP B O   1 
ATOM   3612 C CB  . ASP B 1 174 ? 19.423  10.146 16.503  1.00 28.05 ? 1143 ASP B CB  1 
ATOM   3613 C CG  . ASP B 1 174 ? 18.898  9.832  17.876  1.00 29.58 ? 1143 ASP B CG  1 
ATOM   3614 O OD1 . ASP B 1 174 ? 18.218  10.705 18.453  1.00 28.39 ? 1143 ASP B OD1 1 
ATOM   3615 O OD2 . ASP B 1 174 ? 19.157  8.714  18.373  1.00 30.14 ? 1143 ASP B OD2 1 
ATOM   3616 N N   . PHE B 1 175 ? 18.189  13.479 17.002  1.00 28.88 ? 1144 PHE B N   1 
ATOM   3617 C CA  . PHE B 1 175 ? 16.971  14.268 17.164  1.00 27.55 ? 1144 PHE B CA  1 
ATOM   3618 C C   . PHE B 1 175 ? 15.928  13.743 18.148  1.00 25.97 ? 1144 PHE B C   1 
ATOM   3619 O O   . PHE B 1 175 ? 14.809  14.246 18.194  1.00 24.66 ? 1144 PHE B O   1 
ATOM   3620 C CB  . PHE B 1 175 ? 16.333  14.497 15.799  1.00 28.45 ? 1144 PHE B CB  1 
ATOM   3621 C CG  . PHE B 1 175 ? 17.167  15.347 14.888  1.00 30.02 ? 1144 PHE B CG  1 
ATOM   3622 C CD1 . PHE B 1 175 ? 17.319  16.712 15.135  1.00 30.30 ? 1144 PHE B CD1 1 
ATOM   3623 C CD2 . PHE B 1 175 ? 17.799  14.790 13.784  1.00 29.69 ? 1144 PHE B CD2 1 
ATOM   3624 C CE1 . PHE B 1 175 ? 18.083  17.506 14.297  1.00 30.22 ? 1144 PHE B CE1 1 
ATOM   3625 C CE2 . PHE B 1 175 ? 18.569  15.576 12.935  1.00 30.28 ? 1144 PHE B CE2 1 
ATOM   3626 C CZ  . PHE B 1 175 ? 18.711  16.938 13.190  1.00 31.38 ? 1144 PHE B CZ  1 
ATOM   3627 N N   . THR B 1 176 ? 16.296  12.734 18.932  1.00 26.04 ? 1145 THR B N   1 
ATOM   3628 C CA  . THR B 1 176 ? 15.394  12.176 19.939  1.00 24.40 ? 1145 THR B CA  1 
ATOM   3629 C C   . THR B 1 176 ? 15.293  13.249 21.003  1.00 23.88 ? 1145 THR B C   1 
ATOM   3630 O O   . THR B 1 176 ? 16.257  13.982 21.227  1.00 22.38 ? 1145 THR B O   1 
ATOM   3631 C CB  . THR B 1 176 ? 15.980  10.894 20.608  1.00 23.80 ? 1145 THR B CB  1 
ATOM   3632 O OG1 . THR B 1 176 ? 16.051  9.828  19.648  1.00 25.43 ? 1145 THR B OG1 1 
ATOM   3633 C CG2 . THR B 1 176 ? 15.118  10.461 21.779  1.00 20.54 ? 1145 THR B CG2 1 
ATOM   3634 N N   . VAL B 1 177 ? 14.138  13.352 21.654  1.00 23.68 ? 1146 VAL B N   1 
ATOM   3635 C CA  . VAL B 1 177 ? 13.976  14.349 22.696  1.00 24.50 ? 1146 VAL B CA  1 
ATOM   3636 C C   . VAL B 1 177 ? 13.856  13.731 24.086  1.00 25.03 ? 1146 VAL B C   1 
ATOM   3637 O O   . VAL B 1 177 ? 13.227  12.687 24.270  1.00 24.26 ? 1146 VAL B O   1 
ATOM   3638 C CB  . VAL B 1 177 ? 12.772  15.246 22.410  1.00 25.10 ? 1146 VAL B CB  1 
ATOM   3639 C CG1 . VAL B 1 177 ? 12.632  16.319 23.527  1.00 23.50 ? 1146 VAL B CG1 1 
ATOM   3640 C CG2 . VAL B 1 177 ? 12.948  15.886 21.038  1.00 21.29 ? 1146 VAL B CG2 1 
ATOM   3641 N N   . LYS B 1 178 ? 14.462  14.396 25.065  1.00 26.58 ? 1147 LYS B N   1 
ATOM   3642 C CA  . LYS B 1 178 ? 14.469  13.897 26.439  1.00 27.52 ? 1147 LYS B CA  1 
ATOM   3643 C C   . LYS B 1 178 ? 14.237  14.941 27.540  1.00 27.16 ? 1147 LYS B C   1 
ATOM   3644 O O   . LYS B 1 178 ? 14.545  16.128 27.378  1.00 25.95 ? 1147 LYS B O   1 
ATOM   3645 C CB  . LYS B 1 178 ? 15.809  13.201 26.710  1.00 28.28 ? 1147 LYS B CB  1 
ATOM   3646 C CG  . LYS B 1 178 ? 16.284  12.310 25.579  1.00 28.71 ? 1147 LYS B CG  1 
ATOM   3647 C CD  . LYS B 1 178 ? 17.500  11.517 25.985  1.00 27.68 ? 1147 LYS B CD  1 
ATOM   3648 C CE  . LYS B 1 178 ? 17.884  10.553 24.890  1.00 27.05 ? 1147 LYS B CE  1 
ATOM   3649 N NZ  . LYS B 1 178 ? 18.761  9.489  25.424  1.00 28.20 ? 1147 LYS B NZ  1 
ATOM   3650 N N   . ILE B 1 179 ? 13.700  14.486 28.670  1.00 26.55 ? 1148 ILE B N   1 
ATOM   3651 C CA  . ILE B 1 179 ? 13.484  15.383 29.794  1.00 25.63 ? 1148 ILE B CA  1 
ATOM   3652 C C   . ILE B 1 179 ? 14.887  15.657 30.307  1.00 25.02 ? 1148 ILE B C   1 
ATOM   3653 O O   . ILE B 1 179 ? 15.594  14.733 30.718  1.00 23.06 ? 1148 ILE B O   1 
ATOM   3654 C CB  . ILE B 1 179 ? 12.684  14.724 30.919  1.00 25.62 ? 1148 ILE B CB  1 
ATOM   3655 C CG1 . ILE B 1 179 ? 11.455  13.994 30.350  1.00 26.38 ? 1148 ILE B CG1 1 
ATOM   3656 C CG2 . ILE B 1 179 ? 12.285  15.787 31.933  1.00 25.10 ? 1148 ILE B CG2 1 
ATOM   3657 C CD1 . ILE B 1 179 ? 10.458  14.870 29.608  1.00 23.81 ? 1148 ILE B CD1 1 
ATOM   3658 N N   . GLY B 1 180 ? 15.289  16.922 30.265  1.00 24.85 ? 1149 GLY B N   1 
ATOM   3659 C CA  . GLY B 1 180 ? 16.621  17.294 30.703  1.00 28.62 ? 1149 GLY B CA  1 
ATOM   3660 C C   . GLY B 1 180 ? 16.881  17.284 32.202  1.00 31.49 ? 1149 GLY B C   1 
ATOM   3661 O O   . GLY B 1 180 ? 15.952  17.193 33.014  1.00 30.87 ? 1149 GLY B O   1 
ATOM   3662 N N   . ASP B 1 181 ? 18.161  17.380 32.563  1.00 31.76 ? 1150 ASP B N   1 
ATOM   3663 C CA  . ASP B 1 181 ? 18.571  17.398 33.958  1.00 32.98 ? 1150 ASP B CA  1 
ATOM   3664 C C   . ASP B 1 181 ? 18.577  18.811 34.549  1.00 33.39 ? 1150 ASP B C   1 
ATOM   3665 O O   . ASP B 1 181 ? 18.477  19.802 33.830  1.00 32.08 ? 1150 ASP B O   1 
ATOM   3666 C CB  . ASP B 1 181 ? 19.955  16.749 34.109  1.00 35.25 ? 1150 ASP B CB  1 
ATOM   3667 C CG  . ASP B 1 181 ? 20.898  17.092 32.962  1.00 35.20 ? 1150 ASP B CG  1 
ATOM   3668 O OD1 . ASP B 1 181 ? 20.560  16.772 31.806  1.00 36.53 ? 1150 ASP B OD1 1 
ATOM   3669 O OD2 . ASP B 1 181 ? 21.975  17.671 33.212  1.00 34.40 ? 1150 ASP B OD2 1 
ATOM   3670 N N   . PHE B 1 182 ? 18.706  18.885 35.869  1.00 35.15 ? 1151 PHE B N   1 
ATOM   3671 C CA  . PHE B 1 182 ? 18.694  20.150 36.598  1.00 36.71 ? 1151 PHE B CA  1 
ATOM   3672 C C   . PHE B 1 182 ? 19.832  21.094 36.247  1.00 37.37 ? 1151 PHE B C   1 
ATOM   3673 O O   . PHE B 1 182 ? 20.891  20.663 35.787  1.00 38.21 ? 1151 PHE B O   1 
ATOM   3674 C CB  . PHE B 1 182 ? 18.744  19.882 38.105  1.00 38.68 ? 1151 PHE B CB  1 
ATOM   3675 C CG  . PHE B 1 182 ? 20.133  19.603 38.630  1.00 40.56 ? 1151 PHE B CG  1 
ATOM   3676 C CD1 . PHE B 1 182 ? 20.666  20.369 39.665  1.00 41.26 ? 1151 PHE B CD1 1 
ATOM   3677 C CD2 . PHE B 1 182 ? 20.913  18.583 38.085  1.00 40.91 ? 1151 PHE B CD2 1 
ATOM   3678 C CE1 . PHE B 1 182 ? 21.957  20.122 40.150  1.00 40.54 ? 1151 PHE B CE1 1 
ATOM   3679 C CE2 . PHE B 1 182 ? 22.201  18.333 38.566  1.00 39.71 ? 1151 PHE B CE2 1 
ATOM   3680 C CZ  . PHE B 1 182 ? 22.721  19.104 39.598  1.00 38.67 ? 1151 PHE B CZ  1 
ATOM   3681 N N   . GLY B 1 183 ? 19.602  22.382 36.494  1.00 37.19 ? 1152 GLY B N   1 
ATOM   3682 C CA  . GLY B 1 183 ? 20.606  23.407 36.246  1.00 37.50 ? 1152 GLY B CA  1 
ATOM   3683 C C   . GLY B 1 183 ? 21.207  23.512 34.856  1.00 37.18 ? 1152 GLY B C   1 
ATOM   3684 O O   . GLY B 1 183 ? 22.425  23.616 34.720  1.00 36.91 ? 1152 GLY B O   1 
ATOM   3685 N N   . MET B 1 184 ? 20.364  23.497 33.827  1.00 37.04 ? 1153 MET B N   1 
ATOM   3686 C CA  . MET B 1 184 ? 20.827  23.593 32.445  1.00 36.19 ? 1153 MET B CA  1 
ATOM   3687 C C   . MET B 1 184 ? 19.995  24.599 31.662  1.00 36.83 ? 1153 MET B C   1 
ATOM   3688 O O   . MET B 1 184 ? 20.298  24.891 30.507  1.00 36.98 ? 1153 MET B O   1 
ATOM   3689 C CB  . MET B 1 184 ? 20.749  22.226 31.760  1.00 35.08 ? 1153 MET B CB  1 
ATOM   3690 C CG  . MET B 1 184 ? 21.715  21.201 32.311  1.00 33.01 ? 1153 MET B CG  1 
ATOM   3691 S SD  . MET B 1 184 ? 23.396  21.482 31.728  1.00 34.07 ? 1153 MET B SD  1 
ATOM   3692 C CE  . MET B 1 184 ? 23.905  19.779 31.371  1.00 31.59 ? 1153 MET B CE  1 
ATOM   3693 N N   . THR B 1 185 ? 18.940  25.119 32.287  1.00 38.28 ? 1154 THR B N   1 
ATOM   3694 C CA  . THR B 1 185 ? 18.077  26.100 31.629  1.00 37.93 ? 1154 THR B CA  1 
ATOM   3695 C C   . THR B 1 185 ? 18.953  27.255 31.197  1.00 38.61 ? 1154 THR B C   1 
ATOM   3696 O O   . THR B 1 185 ? 19.670  27.832 32.014  1.00 38.88 ? 1154 THR B O   1 
ATOM   3697 C CB  . THR B 1 185 ? 17.007  26.673 32.575  1.00 36.91 ? 1154 THR B CB  1 
ATOM   3698 O OG1 . THR B 1 185 ? 16.321  25.606 33.231  1.00 37.90 ? 1154 THR B OG1 1 
ATOM   3699 C CG2 . THR B 1 185 ? 16.002  27.499 31.791  1.00 37.16 ? 1154 THR B CG2 1 
ATOM   3700 N N   . ARG B 1 186 ? 18.897  27.589 29.915  1.00 39.50 ? 1155 ARG B N   1 
ATOM   3701 C CA  . ARG B 1 186 ? 19.697  28.687 29.394  1.00 40.22 ? 1155 ARG B CA  1 
ATOM   3702 C C   . ARG B 1 186 ? 19.331  29.991 30.077  1.00 40.22 ? 1155 ARG B C   1 
ATOM   3703 O O   . ARG B 1 186 ? 18.155  30.287 30.286  1.00 39.60 ? 1155 ARG B O   1 
ATOM   3704 C CB  . ARG B 1 186 ? 19.500  28.834 27.882  1.00 40.35 ? 1155 ARG B CB  1 
ATOM   3705 C CG  . ARG B 1 186 ? 20.107  27.711 27.067  1.00 40.64 ? 1155 ARG B CG  1 
ATOM   3706 C CD  . ARG B 1 186 ? 20.088  28.065 25.603  1.00 40.85 ? 1155 ARG B CD  1 
ATOM   3707 N NE  . ARG B 1 186 ? 20.653  29.391 25.402  1.00 42.45 ? 1155 ARG B NE  1 
ATOM   3708 C CZ  . ARG B 1 186 ? 20.946  29.909 24.217  1.00 42.63 ? 1155 ARG B CZ  1 
ATOM   3709 N NH1 . ARG B 1 186 ? 20.730  29.205 23.117  1.00 42.53 ? 1155 ARG B NH1 1 
ATOM   3710 N NH2 . ARG B 1 186 ? 21.456  31.131 24.137  1.00 42.98 ? 1155 ARG B NH2 1 
ATOM   3711 N N   . ASP B 1 187 ? 20.357  30.764 30.423  1.00 41.01 ? 1156 ASP B N   1 
ATOM   3712 C CA  . ASP B 1 187 ? 20.174  32.052 31.077  1.00 40.73 ? 1156 ASP B CA  1 
ATOM   3713 C C   . ASP B 1 187 ? 19.367  33.033 30.215  1.00 39.61 ? 1156 ASP B C   1 
ATOM   3714 O O   . ASP B 1 187 ? 18.812  33.998 30.733  1.00 39.14 ? 1156 ASP B O   1 
ATOM   3715 C CB  . ASP B 1 187 ? 21.545  32.663 31.420  1.00 42.52 ? 1156 ASP B CB  1 
ATOM   3716 C CG  . ASP B 1 187 ? 22.517  32.672 30.226  1.00 44.65 ? 1156 ASP B CG  1 
ATOM   3717 O OD1 . ASP B 1 187 ? 22.116  33.092 29.119  1.00 46.52 ? 1156 ASP B OD1 1 
ATOM   3718 O OD2 . ASP B 1 187 ? 23.693  32.271 30.396  1.00 45.67 ? 1156 ASP B OD2 1 
ATOM   3719 N N   . ILE B 1 188 ? 19.291  32.778 28.910  1.00 38.12 ? 1157 ILE B N   1 
ATOM   3720 C CA  . ILE B 1 188 ? 18.563  33.664 28.007  1.00 38.56 ? 1157 ILE B CA  1 
ATOM   3721 C C   . ILE B 1 188 ? 17.042  33.565 28.111  1.00 38.91 ? 1157 ILE B C   1 
ATOM   3722 O O   . ILE B 1 188 ? 16.321  34.352 27.495  1.00 39.76 ? 1157 ILE B O   1 
ATOM   3723 C CB  . ILE B 1 188 ? 18.945  33.423 26.507  1.00 37.31 ? 1157 ILE B CB  1 
ATOM   3724 C CG1 . ILE B 1 188 ? 18.344  32.106 26.002  1.00 34.92 ? 1157 ILE B CG1 1 
ATOM   3725 C CG2 . ILE B 1 188 ? 20.457  33.417 26.349  1.00 37.95 ? 1157 ILE B CG2 1 
ATOM   3726 C CD1 . ILE B 1 188 ? 18.476  31.912 24.498  1.00 29.99 ? 1157 ILE B CD1 1 
ATOM   3727 N N   . TYR B 1 189 ? 16.545  32.608 28.883  1.00 39.02 ? 1158 TYR B N   1 
ATOM   3728 C CA  . TYR B 1 189 ? 15.101  32.444 29.000  1.00 39.42 ? 1158 TYR B CA  1 
ATOM   3729 C C   . TYR B 1 189 ? 14.542  32.904 30.341  1.00 40.82 ? 1158 TYR B C   1 
ATOM   3730 O O   . TYR B 1 189 ? 13.404  32.590 30.695  1.00 40.06 ? 1158 TYR B O   1 
ATOM   3731 C CB  . TYR B 1 189 ? 14.730  30.987 28.719  1.00 37.44 ? 1158 TYR B CB  1 
ATOM   3732 C CG  . TYR B 1 189 ? 15.083  30.543 27.310  1.00 35.10 ? 1158 TYR B CG  1 
ATOM   3733 C CD1 . TYR B 1 189 ? 14.521  31.174 26.198  1.00 32.07 ? 1158 TYR B CD1 1 
ATOM   3734 C CD2 . TYR B 1 189 ? 15.952  29.475 27.091  1.00 33.24 ? 1158 TYR B CD2 1 
ATOM   3735 C CE1 . TYR B 1 189 ? 14.810  30.750 24.906  1.00 30.29 ? 1158 TYR B CE1 1 
ATOM   3736 C CE2 . TYR B 1 189 ? 16.245  29.040 25.798  1.00 31.91 ? 1158 TYR B CE2 1 
ATOM   3737 C CZ  . TYR B 1 189 ? 15.669  29.680 24.711  1.00 30.53 ? 1158 TYR B CZ  1 
ATOM   3738 O OH  . TYR B 1 189 ? 15.931  29.231 23.435  1.00 26.85 ? 1158 TYR B OH  1 
ATOM   3739 N N   . GLU B 1 190 ? 15.362  33.654 31.073  1.00 42.80 ? 1159 GLU B N   1 
ATOM   3740 C CA  . GLU B 1 190 ? 14.992  34.226 32.365  1.00 44.72 ? 1159 GLU B CA  1 
ATOM   3741 C C   . GLU B 1 190 ? 13.615  34.870 32.191  1.00 43.91 ? 1159 GLU B C   1 
ATOM   3742 O O   . GLU B 1 190 ? 12.782  34.886 33.099  1.00 42.46 ? 1159 GLU B O   1 
ATOM   3743 C CB  . GLU B 1 190 ? 16.016  35.299 32.741  1.00 47.35 ? 1159 GLU B CB  1 
ATOM   3744 C CG  . GLU B 1 190 ? 16.148  36.389 31.663  1.00 51.02 ? 1159 GLU B CG  1 
ATOM   3745 C CD  . GLU B 1 190 ? 17.323  37.332 31.889  1.00 53.59 ? 1159 GLU B CD  1 
ATOM   3746 O OE1 . GLU B 1 190 ? 18.489  36.924 31.651  1.00 52.44 ? 1159 GLU B OE1 1 
ATOM   3747 O OE2 . GLU B 1 190 ? 17.072  38.486 32.309  1.00 55.53 ? 1159 GLU B OE2 1 
ATOM   3748 N N   . THR B 1 191 ? 13.407  35.404 30.995  1.00 43.71 ? 1160 THR B N   1 
ATOM   3749 C CA  . THR B 1 191 ? 12.167  36.057 30.623  1.00 43.24 ? 1160 THR B CA  1 
ATOM   3750 C C   . THR B 1 191 ? 10.971  35.132 30.842  1.00 42.84 ? 1160 THR B C   1 
ATOM   3751 O O   . THR B 1 191 ? 9.851   35.603 31.034  1.00 43.99 ? 1160 THR B O   1 
ATOM   3752 C CB  . THR B 1 191 ? 12.212  36.482 29.136  1.00 43.42 ? 1160 THR B CB  1 
ATOM   3753 O OG1 . THR B 1 191 ? 10.985  37.124 28.776  1.00 43.56 ? 1160 THR B OG1 1 
ATOM   3754 C CG2 . THR B 1 191 ? 12.423  35.260 28.238  1.00 44.84 ? 1160 THR B CG2 1 
ATOM   3755 N N   . ASP B 1 192 ? 11.206  33.821 30.813  1.00 41.67 ? 1161 ASP B N   1 
ATOM   3756 C CA  . ASP B 1 192 ? 10.130  32.847 30.999  1.00 40.42 ? 1161 ASP B CA  1 
ATOM   3757 C C   . ASP B 1 192 ? 9.682   32.671 32.447  1.00 40.47 ? 1161 ASP B C   1 
ATOM   3758 O O   . ASP B 1 192 ? 8.756   31.911 32.722  1.00 40.74 ? 1161 ASP B O   1 
ATOM   3759 C CB  . ASP B 1 192 ? 10.530  31.489 30.412  1.00 38.49 ? 1161 ASP B CB  1 
ATOM   3760 C CG  . ASP B 1 192 ? 10.411  31.452 28.891  1.00 38.88 ? 1161 ASP B CG  1 
ATOM   3761 O OD1 . ASP B 1 192 ? 10.046  32.488 28.293  1.00 38.45 ? 1161 ASP B OD1 1 
ATOM   3762 O OD2 . ASP B 1 192 ? 10.680  30.388 28.288  1.00 37.74 ? 1161 ASP B OD2 1 
ATOM   3763 N N   . TYR B 1 193 ? 10.332  33.378 33.370  1.00 40.59 ? 1162 TYR B N   1 
ATOM   3764 C CA  . TYR B 1 193 ? 9.975   33.296 34.782  1.00 40.46 ? 1162 TYR B CA  1 
ATOM   3765 C C   . TYR B 1 193 ? 9.488   34.639 35.338  1.00 43.17 ? 1162 TYR B C   1 
ATOM   3766 O O   . TYR B 1 193 ? 9.767   35.705 34.777  1.00 43.52 ? 1162 TYR B O   1 
ATOM   3767 C CB  . TYR B 1 193 ? 11.153  32.769 35.594  1.00 36.22 ? 1162 TYR B CB  1 
ATOM   3768 C CG  . TYR B 1 193 ? 11.568  31.387 35.162  1.00 33.63 ? 1162 TYR B CG  1 
ATOM   3769 C CD1 . TYR B 1 193 ? 12.374  31.200 34.042  1.00 31.46 ? 1162 TYR B CD1 1 
ATOM   3770 C CD2 . TYR B 1 193 ? 11.109  30.257 35.842  1.00 32.45 ? 1162 TYR B CD2 1 
ATOM   3771 C CE1 . TYR B 1 193 ? 12.712  29.921 33.605  1.00 30.57 ? 1162 TYR B CE1 1 
ATOM   3772 C CE2 . TYR B 1 193 ? 11.440  28.974 35.414  1.00 30.34 ? 1162 TYR B CE2 1 
ATOM   3773 C CZ  . TYR B 1 193 ? 12.241  28.810 34.293  1.00 30.20 ? 1162 TYR B CZ  1 
ATOM   3774 O OH  . TYR B 1 193 ? 12.557  27.539 33.852  1.00 27.96 ? 1162 TYR B OH  1 
ATOM   3775 N N   . TYR B 1 194 ? 8.762   34.574 36.449  1.00 45.37 ? 1163 TYR B N   1 
ATOM   3776 C CA  . TYR B 1 194 ? 8.180   35.759 37.065  1.00 46.99 ? 1163 TYR B CA  1 
ATOM   3777 C C   . TYR B 1 194 ? 8.031   35.578 38.567  1.00 48.30 ? 1163 TYR B C   1 
ATOM   3778 O O   . TYR B 1 194 ? 7.481   34.579 39.031  1.00 48.60 ? 1163 TYR B O   1 
ATOM   3779 C CB  . TYR B 1 194 ? 6.811   36.005 36.424  1.00 47.33 ? 1163 TYR B CB  1 
ATOM   3780 C CG  . TYR B 1 194 ? 5.924   37.030 37.090  1.00 48.50 ? 1163 TYR B CG  1 
ATOM   3781 C CD1 . TYR B 1 194 ? 6.229   38.391 37.040  1.00 49.03 ? 1163 TYR B CD1 1 
ATOM   3782 C CD2 . TYR B 1 194 ? 4.735   36.644 37.713  1.00 49.29 ? 1163 TYR B CD2 1 
ATOM   3783 C CE1 . TYR B 1 194 ? 5.362   39.347 37.585  1.00 49.75 ? 1163 TYR B CE1 1 
ATOM   3784 C CE2 . TYR B 1 194 ? 3.863   37.587 38.263  1.00 50.02 ? 1163 TYR B CE2 1 
ATOM   3785 C CZ  . TYR B 1 194 ? 4.179   38.938 38.192  1.00 49.99 ? 1163 TYR B CZ  1 
ATOM   3786 O OH  . TYR B 1 194 ? 3.298   39.873 38.693  1.00 49.15 ? 1163 TYR B OH  1 
ATOM   3787 N N   . ARG B 1 195 ? 8.531   36.548 39.326  1.00 49.65 ? 1164 ARG B N   1 
ATOM   3788 C CA  . ARG B 1 195 ? 8.433   36.497 40.777  1.00 50.41 ? 1164 ARG B CA  1 
ATOM   3789 C C   . ARG B 1 195 ? 7.033   36.890 41.230  1.00 51.55 ? 1164 ARG B C   1 
ATOM   3790 O O   . ARG B 1 195 ? 6.774   38.058 41.511  1.00 51.79 ? 1164 ARG B O   1 
ATOM   3791 C CB  . ARG B 1 195 ? 9.461   37.435 41.406  1.00 49.36 ? 1164 ARG B CB  1 
ATOM   3792 C CG  . ARG B 1 195 ? 10.871  36.890 41.367  1.00 50.51 ? 1164 ARG B CG  1 
ATOM   3793 C CD  . ARG B 1 195 ? 11.875  37.881 41.925  1.00 50.95 ? 1164 ARG B CD  1 
ATOM   3794 N NE  . ARG B 1 195 ? 13.190  37.272 42.103  1.00 51.73 ? 1164 ARG B NE  1 
ATOM   3795 C CZ  . ARG B 1 195 ? 13.455  36.318 42.992  1.00 52.41 ? 1164 ARG B CZ  1 
ATOM   3796 N NH1 . ARG B 1 195 ? 14.681  35.815 43.091  1.00 52.13 ? 1164 ARG B NH1 1 
ATOM   3797 N NH2 . ARG B 1 195 ? 12.493  35.872 43.790  1.00 51.89 ? 1164 ARG B NH2 1 
ATOM   3798 N N   . LYS B 1 196 ? 6.128   35.916 41.287  1.00 53.10 ? 1165 LYS B N   1 
ATOM   3799 C CA  . LYS B 1 196 ? 4.760   36.186 41.724  1.00 54.61 ? 1165 LYS B CA  1 
ATOM   3800 C C   . LYS B 1 196 ? 4.732   36.158 43.247  1.00 54.99 ? 1165 LYS B C   1 
ATOM   3801 O O   . LYS B 1 196 ? 5.756   35.899 43.883  1.00 54.71 ? 1165 LYS B O   1 
ATOM   3802 C CB  . LYS B 1 196 ? 3.791   35.132 41.187  1.00 55.11 ? 1165 LYS B CB  1 
ATOM   3803 C CG  . LYS B 1 196 ? 3.773   33.836 41.986  1.00 55.76 ? 1165 LYS B CG  1 
ATOM   3804 C CD  . LYS B 1 196 ? 2.686   32.902 41.482  1.00 56.55 ? 1165 LYS B CD  1 
ATOM   3805 C CE  . LYS B 1 196 ? 1.350   33.614 41.416  1.00 56.27 ? 1165 LYS B CE  1 
ATOM   3806 N NZ  . LYS B 1 196 ? 1.038   34.330 42.683  1.00 59.45 ? 1165 LYS B NZ  1 
ATOM   3807 N N   . GLY B 1 197 ? 3.563   36.409 43.830  1.00 54.97 ? 1166 GLY B N   1 
ATOM   3808 C CA  . GLY B 1 197 ? 3.466   36.419 45.278  1.00 55.96 ? 1166 GLY B CA  1 
ATOM   3809 C C   . GLY B 1 197 ? 4.616   37.233 45.843  1.00 56.68 ? 1166 GLY B C   1 
ATOM   3810 O O   . GLY B 1 197 ? 5.055   37.021 46.980  1.00 56.68 ? 1166 GLY B O   1 
ATOM   3811 N N   . GLY B 1 198 ? 5.108   38.165 45.026  1.00 56.51 ? 1167 GLY B N   1 
ATOM   3812 C CA  . GLY B 1 198 ? 6.215   39.014 45.416  1.00 55.63 ? 1167 GLY B CA  1 
ATOM   3813 C C   . GLY B 1 198 ? 7.426   38.245 45.915  1.00 55.40 ? 1167 GLY B C   1 
ATOM   3814 O O   . GLY B 1 198 ? 8.457   38.850 46.218  1.00 55.69 ? 1167 GLY B O   1 
ATOM   3815 N N   . LYS B 1 199 ? 7.319   36.919 45.988  1.00 53.95 ? 1168 LYS B N   1 
ATOM   3816 C CA  . LYS B 1 199 ? 8.419   36.097 46.484  1.00 52.90 ? 1168 LYS B CA  1 
ATOM   3817 C C   . LYS B 1 199 ? 9.173   35.328 45.402  1.00 51.78 ? 1168 LYS B C   1 
ATOM   3818 O O   . LYS B 1 199 ? 9.924   35.919 44.626  1.00 52.58 ? 1168 LYS B O   1 
ATOM   3819 C CB  . LYS B 1 199 ? 7.901   35.125 47.546  1.00 53.22 ? 1168 LYS B CB  1 
ATOM   3820 C CG  . LYS B 1 199 ? 8.986   34.535 48.436  1.00 53.33 ? 1168 LYS B CG  1 
ATOM   3821 C CD  . LYS B 1 199 ? 8.374   33.793 49.619  1.00 54.35 ? 1168 LYS B CD  1 
ATOM   3822 C CE  . LYS B 1 199 ? 7.515   34.718 50.481  1.00 55.37 ? 1168 LYS B CE  1 
ATOM   3823 N NZ  . LYS B 1 199 ? 6.851   34.015 51.618  1.00 55.36 ? 1168 LYS B NZ  1 
ATOM   3824 N N   . GLY B 1 200 ? 8.979   34.013 45.352  1.00 49.95 ? 1169 GLY B N   1 
ATOM   3825 C CA  . GLY B 1 200 ? 9.676   33.207 44.363  1.00 47.59 ? 1169 GLY B CA  1 
ATOM   3826 C C   . GLY B 1 200 ? 9.272   33.416 42.910  1.00 46.12 ? 1169 GLY B C   1 
ATOM   3827 O O   . GLY B 1 200 ? 8.113   33.718 42.602  1.00 47.21 ? 1169 GLY B O   1 
ATOM   3828 N N   . LEU B 1 201 ? 10.237  33.254 42.009  1.00 43.65 ? 1170 LEU B N   1 
ATOM   3829 C CA  . LEU B 1 201 ? 9.987   33.394 40.577  1.00 40.80 ? 1170 LEU B CA  1 
ATOM   3830 C C   . LEU B 1 201 ? 9.449   32.070 40.024  1.00 38.80 ? 1170 LEU B C   1 
ATOM   3831 O O   . LEU B 1 201 ? 10.078  31.020 40.169  1.00 37.71 ? 1170 LEU B O   1 
ATOM   3832 C CB  . LEU B 1 201 ? 11.280  33.798 39.850  1.00 41.35 ? 1170 LEU B CB  1 
ATOM   3833 C CG  . LEU B 1 201 ? 12.620  33.481 40.529  1.00 40.01 ? 1170 LEU B CG  1 
ATOM   3834 C CD1 . LEU B 1 201 ? 12.779  31.980 40.717  1.00 39.63 ? 1170 LEU B CD1 1 
ATOM   3835 C CD2 . LEU B 1 201 ? 13.756  34.044 39.694  1.00 38.73 ? 1170 LEU B CD2 1 
ATOM   3836 N N   . LEU B 1 202 ? 8.278   32.126 39.396  1.00 35.89 ? 1171 LEU B N   1 
ATOM   3837 C CA  . LEU B 1 202 ? 7.653   30.929 38.854  1.00 33.47 ? 1171 LEU B CA  1 
ATOM   3838 C C   . LEU B 1 202 ? 7.374   31.021 37.362  1.00 31.77 ? 1171 LEU B C   1 
ATOM   3839 O O   . LEU B 1 202 ? 7.124   32.105 36.837  1.00 31.65 ? 1171 LEU B O   1 
ATOM   3840 C CB  . LEU B 1 202 ? 6.340   30.657 39.586  1.00 33.84 ? 1171 LEU B CB  1 
ATOM   3841 C CG  . LEU B 1 202 ? 6.392   30.315 41.076  1.00 34.24 ? 1171 LEU B CG  1 
ATOM   3842 C CD1 . LEU B 1 202 ? 4.975   30.277 41.617  1.00 34.17 ? 1171 LEU B CD1 1 
ATOM   3843 C CD2 . LEU B 1 202 ? 7.089   28.973 41.290  1.00 34.36 ? 1171 LEU B CD2 1 
ATOM   3844 N N   . PRO B 1 203 ? 7.407   29.873 36.658  1.00 30.27 ? 1172 PRO B N   1 
ATOM   3845 C CA  . PRO B 1 203 ? 7.150   29.822 35.214  1.00 29.26 ? 1172 PRO B CA  1 
ATOM   3846 C C   . PRO B 1 203 ? 5.648   29.932 34.969  1.00 28.43 ? 1172 PRO B C   1 
ATOM   3847 O O   . PRO B 1 203 ? 5.031   29.040 34.387  1.00 27.95 ? 1172 PRO B O   1 
ATOM   3848 C CB  . PRO B 1 203 ? 7.699   28.461 34.823  1.00 27.94 ? 1172 PRO B CB  1 
ATOM   3849 C CG  . PRO B 1 203 ? 7.347   27.641 36.001  1.00 28.12 ? 1172 PRO B CG  1 
ATOM   3850 C CD  . PRO B 1 203 ? 7.744   28.530 37.164  1.00 29.76 ? 1172 PRO B CD  1 
ATOM   3851 N N   . VAL B 1 204 ? 5.074   31.039 35.423  1.00 25.69 ? 1173 VAL B N   1 
ATOM   3852 C CA  . VAL B 1 204 ? 3.652   31.269 35.293  1.00 25.56 ? 1173 VAL B CA  1 
ATOM   3853 C C   . VAL B 1 204 ? 3.018   30.843 33.967  1.00 23.38 ? 1173 VAL B C   1 
ATOM   3854 O O   . VAL B 1 204 ? 1.976   30.203 33.969  1.00 22.24 ? 1173 VAL B O   1 
ATOM   3855 C CB  . VAL B 1 204 ? 3.317   32.753 35.588  1.00 26.82 ? 1173 VAL B CB  1 
ATOM   3856 C CG1 . VAL B 1 204 ? 3.588   33.054 37.059  1.00 25.95 ? 1173 VAL B CG1 1 
ATOM   3857 C CG2 . VAL B 1 204 ? 4.152   33.666 34.704  1.00 27.64 ? 1173 VAL B CG2 1 
ATOM   3858 N N   . ARG B 1 205 ? 3.639   31.174 32.844  1.00 22.95 ? 1174 ARG B N   1 
ATOM   3859 C CA  . ARG B 1 205 ? 3.080   30.809 31.546  1.00 24.94 ? 1174 ARG B CA  1 
ATOM   3860 C C   . ARG B 1 205 ? 3.043   29.299 31.214  1.00 26.75 ? 1174 ARG B C   1 
ATOM   3861 O O   . ARG B 1 205 ? 2.695   28.915 30.098  1.00 28.19 ? 1174 ARG B O   1 
ATOM   3862 C CB  . ARG B 1 205 ? 3.817   31.562 30.439  1.00 24.16 ? 1174 ARG B CB  1 
ATOM   3863 C CG  . ARG B 1 205 ? 3.598   33.061 30.454  1.00 24.82 ? 1174 ARG B CG  1 
ATOM   3864 C CD  . ARG B 1 205 ? 4.434   33.758 29.382  1.00 23.78 ? 1174 ARG B CD  1 
ATOM   3865 N NE  . ARG B 1 205 ? 4.525   35.196 29.623  1.00 24.40 ? 1174 ARG B NE  1 
ATOM   3866 C CZ  . ARG B 1 205 ? 3.548   36.065 29.384  1.00 25.86 ? 1174 ARG B CZ  1 
ATOM   3867 N NH1 . ARG B 1 205 ? 2.391   35.655 28.880  1.00 29.34 ? 1174 ARG B NH1 1 
ATOM   3868 N NH2 . ARG B 1 205 ? 3.713   37.344 29.679  1.00 24.71 ? 1174 ARG B NH2 1 
ATOM   3869 N N   . TRP B 1 206 ? 3.384   28.447 32.175  1.00 27.26 ? 1175 TRP B N   1 
ATOM   3870 C CA  . TRP B 1 206 ? 3.368   26.991 31.968  1.00 28.13 ? 1175 TRP B CA  1 
ATOM   3871 C C   . TRP B 1 206 ? 2.597   26.303 33.095  1.00 27.32 ? 1175 TRP B C   1 
ATOM   3872 O O   . TRP B 1 206 ? 2.283   25.114 33.026  1.00 26.39 ? 1175 TRP B O   1 
ATOM   3873 C CB  . TRP B 1 206 ? 4.807   26.439 31.926  1.00 28.75 ? 1175 TRP B CB  1 
ATOM   3874 C CG  . TRP B 1 206 ? 5.491   26.635 30.601  1.00 29.08 ? 1175 TRP B CG  1 
ATOM   3875 C CD1 . TRP B 1 206 ? 5.618   25.716 29.604  1.00 27.16 ? 1175 TRP B CD1 1 
ATOM   3876 C CD2 . TRP B 1 206 ? 6.078   27.847 30.107  1.00 29.06 ? 1175 TRP B CD2 1 
ATOM   3877 N NE1 . TRP B 1 206 ? 6.243   26.274 28.518  1.00 27.18 ? 1175 TRP B NE1 1 
ATOM   3878 C CE2 . TRP B 1 206 ? 6.536   27.583 28.797  1.00 28.82 ? 1175 TRP B CE2 1 
ATOM   3879 C CE3 . TRP B 1 206 ? 6.258   29.131 30.642  1.00 28.43 ? 1175 TRP B CE3 1 
ATOM   3880 C CZ2 . TRP B 1 206 ? 7.165   28.559 28.009  1.00 27.52 ? 1175 TRP B CZ2 1 
ATOM   3881 C CZ3 . TRP B 1 206 ? 6.884   30.099 29.859  1.00 28.40 ? 1175 TRP B CZ3 1 
ATOM   3882 C CH2 . TRP B 1 206 ? 7.328   29.805 28.557  1.00 27.37 ? 1175 TRP B CH2 1 
ATOM   3883 N N   . MET B 1 207 ? 2.299   27.079 34.127  1.00 26.98 ? 1176 MET B N   1 
ATOM   3884 C CA  . MET B 1 207 ? 1.603   26.593 35.302  1.00 28.44 ? 1176 MET B CA  1 
ATOM   3885 C C   . MET B 1 207 ? 0.076   26.461 35.159  1.00 29.09 ? 1176 MET B C   1 
ATOM   3886 O O   . MET B 1 207 ? -0.589  27.284 34.524  1.00 29.66 ? 1176 MET B O   1 
ATOM   3887 C CB  . MET B 1 207 ? 1.959   27.501 36.478  1.00 28.20 ? 1176 MET B CB  1 
ATOM   3888 C CG  . MET B 1 207 ? 3.459   27.565 36.737  1.00 28.53 ? 1176 MET B CG  1 
ATOM   3889 S SD  . MET B 1 207 ? 3.905   28.780 37.993  1.00 30.62 ? 1176 MET B SD  1 
ATOM   3890 C CE  . MET B 1 207 ? 3.198   28.028 39.427  1.00 29.13 ? 1176 MET B CE  1 
ATOM   3891 N N   . SER B 1 208 ? -0.462  25.403 35.758  1.00 28.15 ? 1177 SER B N   1 
ATOM   3892 C CA  . SER B 1 208 ? -1.890  25.120 35.733  1.00 28.03 ? 1177 SER B CA  1 
ATOM   3893 C C   . SER B 1 208 ? -2.677  26.097 36.615  1.00 29.47 ? 1177 SER B C   1 
ATOM   3894 O O   . SER B 1 208 ? -2.115  26.769 37.491  1.00 29.57 ? 1177 SER B O   1 
ATOM   3895 C CB  . SER B 1 208 ? -2.133  23.695 36.239  1.00 28.12 ? 1177 SER B CB  1 
ATOM   3896 O OG  . SER B 1 208 ? -1.707  23.544 37.593  1.00 24.56 ? 1177 SER B OG  1 
ATOM   3897 N N   . PRO B 1 209 ? -3.997  26.182 36.399  1.00 28.63 ? 1178 PRO B N   1 
ATOM   3898 C CA  . PRO B 1 209 ? -4.800  27.089 37.216  1.00 28.89 ? 1178 PRO B CA  1 
ATOM   3899 C C   . PRO B 1 209 ? -4.634  26.795 38.716  1.00 30.60 ? 1178 PRO B C   1 
ATOM   3900 O O   . PRO B 1 209 ? -4.414  27.718 39.516  1.00 32.21 ? 1178 PRO B O   1 
ATOM   3901 C CB  . PRO B 1 209 ? -6.222  26.819 36.730  1.00 27.92 ? 1178 PRO B CB  1 
ATOM   3902 C CG  . PRO B 1 209 ? -6.019  26.484 35.290  1.00 28.09 ? 1178 PRO B CG  1 
ATOM   3903 C CD  . PRO B 1 209 ? -4.811  25.571 35.334  1.00 28.99 ? 1178 PRO B CD  1 
ATOM   3904 N N   . GLU B 1 210 ? -4.733  25.515 39.091  1.00 29.24 ? 1179 GLU B N   1 
ATOM   3905 C CA  . GLU B 1 210 ? -4.625  25.113 40.490  1.00 28.52 ? 1179 GLU B CA  1 
ATOM   3906 C C   . GLU B 1 210 ? -3.299  25.530 41.097  1.00 30.59 ? 1179 GLU B C   1 
ATOM   3907 O O   . GLU B 1 210 ? -3.266  26.081 42.192  1.00 30.11 ? 1179 GLU B O   1 
ATOM   3908 C CB  . GLU B 1 210 ? -4.803  23.599 40.643  1.00 27.71 ? 1179 GLU B CB  1 
ATOM   3909 C CG  . GLU B 1 210 ? -3.709  22.767 40.019  1.00 27.89 ? 1179 GLU B CG  1 
ATOM   3910 C CD  . GLU B 1 210 ? -4.153  22.081 38.750  1.00 28.59 ? 1179 GLU B CD  1 
ATOM   3911 O OE1 . GLU B 1 210 ? -4.943  22.691 37.991  1.00 28.99 ? 1179 GLU B OE1 1 
ATOM   3912 O OE2 . GLU B 1 210 ? -3.703  20.936 38.509  1.00 27.20 ? 1179 GLU B OE2 1 
ATOM   3913 N N   . SER B 1 211 ? -2.204  25.266 40.387  1.00 32.63 ? 1180 SER B N   1 
ATOM   3914 C CA  . SER B 1 211 ? -0.879  25.633 40.877  1.00 33.18 ? 1180 SER B CA  1 
ATOM   3915 C C   . SER B 1 211 ? -0.868  27.141 41.075  1.00 33.67 ? 1180 SER B C   1 
ATOM   3916 O O   . SER B 1 211 ? -0.514  27.640 42.139  1.00 34.53 ? 1180 SER B O   1 
ATOM   3917 C CB  . SER B 1 211 ? 0.202   25.227 39.868  1.00 32.71 ? 1180 SER B CB  1 
ATOM   3918 O OG  . SER B 1 211 ? 0.187   23.829 39.624  1.00 29.81 ? 1180 SER B OG  1 
ATOM   3919 N N   . LEU B 1 212 ? -1.266  27.866 40.042  1.00 34.08 ? 1181 LEU B N   1 
ATOM   3920 C CA  . LEU B 1 212 ? -1.319  29.315 40.132  1.00 35.34 ? 1181 LEU B CA  1 
ATOM   3921 C C   . LEU B 1 212 ? -2.134  29.732 41.357  1.00 36.17 ? 1181 LEU B C   1 
ATOM   3922 O O   . LEU B 1 212 ? -1.753  30.650 42.077  1.00 37.19 ? 1181 LEU B O   1 
ATOM   3923 C CB  . LEU B 1 212 ? -1.972  29.908 38.871  1.00 35.61 ? 1181 LEU B CB  1 
ATOM   3924 C CG  . LEU B 1 212 ? -1.127  30.093 37.605  1.00 35.64 ? 1181 LEU B CG  1 
ATOM   3925 C CD1 . LEU B 1 212 ? -2.014  30.416 36.404  1.00 34.02 ? 1181 LEU B CD1 1 
ATOM   3926 C CD2 . LEU B 1 212 ? -0.120  31.204 37.846  1.00 35.02 ? 1181 LEU B CD2 1 
ATOM   3927 N N   . LYS B 1 213 ? -3.243  29.041 41.605  1.00 36.20 ? 1182 LYS B N   1 
ATOM   3928 C CA  . LYS B 1 213 ? -4.112  29.397 42.712  1.00 35.51 ? 1182 LYS B CA  1 
ATOM   3929 C C   . LYS B 1 213 ? -3.908  28.727 44.072  1.00 35.63 ? 1182 LYS B C   1 
ATOM   3930 O O   . LYS B 1 213 ? -4.262  29.313 45.091  1.00 36.77 ? 1182 LYS B O   1 
ATOM   3931 C CB  . LYS B 1 213 ? -5.565  29.229 42.275  1.00 36.08 ? 1182 LYS B CB  1 
ATOM   3932 C CG  . LYS B 1 213 ? -6.571  29.906 43.197  1.00 37.39 ? 1182 LYS B CG  1 
ATOM   3933 C CD  . LYS B 1 213 ? -7.929  30.040 42.528  1.00 38.68 ? 1182 LYS B CD  1 
ATOM   3934 C CE  . LYS B 1 213 ? -8.898  30.841 43.380  1.00 38.69 ? 1182 LYS B CE  1 
ATOM   3935 N NZ  . LYS B 1 213 ? -10.173 31.096 42.641  1.00 39.71 ? 1182 LYS B NZ  1 
ATOM   3936 N N   . ASP B 1 214 ? -3.351  27.521 44.114  1.00 35.32 ? 1183 ASP B N   1 
ATOM   3937 C CA  . ASP B 1 214 ? -3.151  26.841 45.400  1.00 34.93 ? 1183 ASP B CA  1 
ATOM   3938 C C   . ASP B 1 214 ? -1.709  26.408 45.648  1.00 34.65 ? 1183 ASP B C   1 
ATOM   3939 O O   . ASP B 1 214 ? -1.421  25.685 46.605  1.00 34.40 ? 1183 ASP B O   1 
ATOM   3940 C CB  . ASP B 1 214 ? -4.061  25.616 45.507  1.00 35.61 ? 1183 ASP B CB  1 
ATOM   3941 C CG  . ASP B 1 214 ? -5.507  25.935 45.196  1.00 37.56 ? 1183 ASP B CG  1 
ATOM   3942 O OD1 . ASP B 1 214 ? -6.091  26.788 45.895  1.00 37.28 ? 1183 ASP B OD1 1 
ATOM   3943 O OD2 . ASP B 1 214 ? -6.060  25.331 44.249  1.00 37.74 ? 1183 ASP B OD2 1 
ATOM   3944 N N   . GLY B 1 215 ? -0.805  26.846 44.781  1.00 33.43 ? 1184 GLY B N   1 
ATOM   3945 C CA  . GLY B 1 215 ? 0.591   26.495 44.943  1.00 32.47 ? 1184 GLY B CA  1 
ATOM   3946 C C   . GLY B 1 215 ? 0.895   25.010 44.998  1.00 31.93 ? 1184 GLY B C   1 
ATOM   3947 O O   . GLY B 1 215 ? 1.919   24.614 45.544  1.00 34.49 ? 1184 GLY B O   1 
ATOM   3948 N N   . VAL B 1 216 ? 0.028   24.178 44.436  1.00 29.89 ? 1185 VAL B N   1 
ATOM   3949 C CA  . VAL B 1 216 ? 0.281   22.743 44.453  1.00 28.87 ? 1185 VAL B CA  1 
ATOM   3950 C C   . VAL B 1 216 ? 0.697   22.183 43.084  1.00 28.83 ? 1185 VAL B C   1 
ATOM   3951 O O   . VAL B 1 216 ? 0.165   22.578 42.044  1.00 28.45 ? 1185 VAL B O   1 
ATOM   3952 C CB  . VAL B 1 216 ? -0.950  21.966 44.969  1.00 27.78 ? 1185 VAL B CB  1 
ATOM   3953 C CG1 . VAL B 1 216 ? -1.335  22.476 46.337  1.00 29.01 ? 1185 VAL B CG1 1 
ATOM   3954 C CG2 . VAL B 1 216 ? -2.106  22.105 44.013  1.00 25.21 ? 1185 VAL B CG2 1 
ATOM   3955 N N   . PHE B 1 217 ? 1.664   21.270 43.095  1.00 28.12 ? 1186 PHE B N   1 
ATOM   3956 C CA  . PHE B 1 217 ? 2.144   20.641 41.869  1.00 27.87 ? 1186 PHE B CA  1 
ATOM   3957 C C   . PHE B 1 217 ? 1.917   19.136 41.917  1.00 27.14 ? 1186 PHE B C   1 
ATOM   3958 O O   . PHE B 1 217 ? 2.390   18.458 42.828  1.00 27.61 ? 1186 PHE B O   1 
ATOM   3959 C CB  . PHE B 1 217 ? 3.633   20.932 41.658  1.00 27.16 ? 1186 PHE B CB  1 
ATOM   3960 C CG  . PHE B 1 217 ? 3.926   22.357 41.291  1.00 27.17 ? 1186 PHE B CG  1 
ATOM   3961 C CD1 . PHE B 1 217 ? 3.855   23.363 42.240  1.00 27.49 ? 1186 PHE B CD1 1 
ATOM   3962 C CD2 . PHE B 1 217 ? 4.250   22.698 39.981  1.00 29.52 ? 1186 PHE B CD2 1 
ATOM   3963 C CE1 . PHE B 1 217 ? 4.104   24.691 41.892  1.00 27.31 ? 1186 PHE B CE1 1 
ATOM   3964 C CE2 . PHE B 1 217 ? 4.500   24.027 39.622  1.00 29.05 ? 1186 PHE B CE2 1 
ATOM   3965 C CZ  . PHE B 1 217 ? 4.426   25.022 40.583  1.00 27.36 ? 1186 PHE B CZ  1 
ATOM   3966 N N   . THR B 1 218 ? 1.186   18.617 40.938  1.00 25.63 ? 1187 THR B N   1 
ATOM   3967 C CA  . THR B 1 218 ? 0.904   17.187 40.887  1.00 26.69 ? 1187 THR B CA  1 
ATOM   3968 C C   . THR B 1 218 ? 1.214   16.684 39.489  1.00 27.11 ? 1187 THR B C   1 
ATOM   3969 O O   . THR B 1 218 ? 1.586   17.473 38.626  1.00 27.90 ? 1187 THR B O   1 
ATOM   3970 C CB  . THR B 1 218 ? -0.574  16.899 41.149  1.00 26.54 ? 1187 THR B CB  1 
ATOM   3971 O OG1 . THR B 1 218 ? -1.329  17.236 39.980  1.00 28.02 ? 1187 THR B OG1 1 
ATOM   3972 C CG2 . THR B 1 218 ? -1.084  17.713 42.324  1.00 26.09 ? 1187 THR B CG2 1 
ATOM   3973 N N   . THR B 1 219 ? 1.058   15.382 39.251  1.00 27.09 ? 1188 THR B N   1 
ATOM   3974 C CA  . THR B 1 219 ? 1.315   14.853 37.912  1.00 28.55 ? 1188 THR B CA  1 
ATOM   3975 C C   . THR B 1 219 ? 0.402   15.573 36.916  1.00 28.30 ? 1188 THR B C   1 
ATOM   3976 O O   . THR B 1 219 ? 0.783   15.804 35.765  1.00 27.27 ? 1188 THR B O   1 
ATOM   3977 C CB  . THR B 1 219 ? 1.052   13.324 37.816  1.00 29.01 ? 1188 THR B CB  1 
ATOM   3978 O OG1 . THR B 1 219 ? -0.257  13.026 38.311  1.00 28.38 ? 1188 THR B OG1 1 
ATOM   3979 C CG2 . THR B 1 219 ? 2.088   12.550 38.613  1.00 29.85 ? 1188 THR B CG2 1 
ATOM   3980 N N   . TYR B 1 220 ? -0.794  15.934 37.382  1.00 28.25 ? 1189 TYR B N   1 
ATOM   3981 C CA  . TYR B 1 220 ? -1.782  16.639 36.565  1.00 30.36 ? 1189 TYR B CA  1 
ATOM   3982 C C   . TYR B 1 220 ? -1.207  17.968 36.080  1.00 31.22 ? 1189 TYR B C   1 
ATOM   3983 O O   . TYR B 1 220 ? -1.348  18.323 34.900  1.00 32.38 ? 1189 TYR B O   1 
ATOM   3984 C CB  . TYR B 1 220 ? -3.051  16.925 37.370  1.00 29.10 ? 1189 TYR B CB  1 
ATOM   3985 C CG  . TYR B 1 220 ? -3.595  15.741 38.116  1.00 30.20 ? 1189 TYR B CG  1 
ATOM   3986 C CD1 . TYR B 1 220 ? -4.075  15.888 39.420  1.00 31.21 ? 1189 TYR B CD1 1 
ATOM   3987 C CD2 . TYR B 1 220 ? -3.627  14.472 37.536  1.00 29.52 ? 1189 TYR B CD2 1 
ATOM   3988 C CE1 . TYR B 1 220 ? -4.572  14.803 40.132  1.00 30.83 ? 1189 TYR B CE1 1 
ATOM   3989 C CE2 . TYR B 1 220 ? -4.124  13.376 38.237  1.00 30.37 ? 1189 TYR B CE2 1 
ATOM   3990 C CZ  . TYR B 1 220 ? -4.595  13.549 39.537  1.00 31.72 ? 1189 TYR B CZ  1 
ATOM   3991 O OH  . TYR B 1 220 ? -5.101  12.481 40.251  1.00 32.50 ? 1189 TYR B OH  1 
ATOM   3992 N N   . SER B 1 221 ? -0.575  18.712 36.987  1.00 30.29 ? 1190 SER B N   1 
ATOM   3993 C CA  . SER B 1 221 ? 0.012   19.985 36.596  1.00 30.38 ? 1190 SER B CA  1 
ATOM   3994 C C   . SER B 1 221 ? 1.106   19.732 35.543  1.00 29.87 ? 1190 SER B C   1 
ATOM   3995 O O   . SER B 1 221 ? 1.396   20.607 34.719  1.00 30.37 ? 1190 SER B O   1 
ATOM   3996 C CB  . SER B 1 221 ? 0.547   20.770 37.825  1.00 30.03 ? 1190 SER B CB  1 
ATOM   3997 O OG  . SER B 1 221 ? 1.421   20.025 38.657  1.00 29.35 ? 1190 SER B OG  1 
ATOM   3998 N N   . ASP B 1 222 ? 1.694   18.535 35.553  1.00 27.26 ? 1191 ASP B N   1 
ATOM   3999 C CA  . ASP B 1 222 ? 2.700   18.204 34.553  1.00 25.54 ? 1191 ASP B CA  1 
ATOM   4000 C C   . ASP B 1 222 ? 2.016   18.073 33.183  1.00 24.22 ? 1191 ASP B C   1 
ATOM   4001 O O   . ASP B 1 222 ? 2.496   18.610 32.179  1.00 21.36 ? 1191 ASP B O   1 
ATOM   4002 C CB  . ASP B 1 222 ? 3.418   16.901 34.912  1.00 28.22 ? 1191 ASP B CB  1 
ATOM   4003 C CG  . ASP B 1 222 ? 4.402   17.076 36.069  1.00 33.48 ? 1191 ASP B CG  1 
ATOM   4004 O OD1 . ASP B 1 222 ? 4.906   18.206 36.252  1.00 35.08 ? 1191 ASP B OD1 1 
ATOM   4005 O OD2 . ASP B 1 222 ? 4.689   16.090 36.791  1.00 34.99 ? 1191 ASP B OD2 1 
ATOM   4006 N N   . VAL B 1 223 ? 0.883   17.378 33.143  1.00 21.98 ? 1192 VAL B N   1 
ATOM   4007 C CA  . VAL B 1 223 ? 0.160   17.208 31.890  1.00 21.06 ? 1192 VAL B CA  1 
ATOM   4008 C C   . VAL B 1 223 ? -0.257  18.550 31.297  1.00 21.48 ? 1192 VAL B C   1 
ATOM   4009 O O   . VAL B 1 223 ? -0.203  18.751 30.074  1.00 19.75 ? 1192 VAL B O   1 
ATOM   4010 C CB  . VAL B 1 223 ? -1.078  16.316 32.075  1.00 20.99 ? 1192 VAL B CB  1 
ATOM   4011 C CG1 . VAL B 1 223 ? -2.039  16.479 30.890  1.00 15.58 ? 1192 VAL B CG1 1 
ATOM   4012 C CG2 . VAL B 1 223 ? -0.629  14.858 32.205  1.00 19.67 ? 1192 VAL B CG2 1 
ATOM   4013 N N   . TRP B 1 224 ? -0.670  19.472 32.159  1.00 20.58 ? 1193 TRP B N   1 
ATOM   4014 C CA  . TRP B 1 224 ? -1.060  20.786 31.679  1.00 19.08 ? 1193 TRP B CA  1 
ATOM   4015 C C   . TRP B 1 224 ? 0.159   21.423 31.013  1.00 18.67 ? 1193 TRP B C   1 
ATOM   4016 O O   . TRP B 1 224 ? 0.088   21.892 29.879  1.00 17.83 ? 1193 TRP B O   1 
ATOM   4017 C CB  . TRP B 1 224 ? -1.553  21.658 32.838  1.00 18.77 ? 1193 TRP B CB  1 
ATOM   4018 C CG  . TRP B 1 224 ? -1.771  23.099 32.454  1.00 21.54 ? 1193 TRP B CG  1 
ATOM   4019 C CD1 . TRP B 1 224 ? -0.807  24.035 32.186  1.00 20.78 ? 1193 TRP B CD1 1 
ATOM   4020 C CD2 . TRP B 1 224 ? -3.028  23.764 32.289  1.00 22.49 ? 1193 TRP B CD2 1 
ATOM   4021 N NE1 . TRP B 1 224 ? -1.386  25.235 31.867  1.00 22.25 ? 1193 TRP B NE1 1 
ATOM   4022 C CE2 . TRP B 1 224 ? -2.748  25.101 31.924  1.00 21.60 ? 1193 TRP B CE2 1 
ATOM   4023 C CE3 . TRP B 1 224 ? -4.363  23.362 32.413  1.00 23.71 ? 1193 TRP B CE3 1 
ATOM   4024 C CZ2 . TRP B 1 224 ? -3.753  26.041 31.683  1.00 21.87 ? 1193 TRP B CZ2 1 
ATOM   4025 C CZ3 . TRP B 1 224 ? -5.366  24.298 32.172  1.00 26.29 ? 1193 TRP B CZ3 1 
ATOM   4026 C CH2 . TRP B 1 224 ? -5.051  25.627 31.810  1.00 24.33 ? 1193 TRP B CH2 1 
ATOM   4027 N N   . SER B 1 225 ? 1.288   21.427 31.714  1.00 18.07 ? 1194 SER B N   1 
ATOM   4028 C CA  . SER B 1 225 ? 2.489   22.020 31.162  1.00 16.71 ? 1194 SER B CA  1 
ATOM   4029 C C   . SER B 1 225 ? 2.877   21.301 29.895  1.00 17.03 ? 1194 SER B C   1 
ATOM   4030 O O   . SER B 1 225 ? 3.420   21.919 28.984  1.00 18.53 ? 1194 SER B O   1 
ATOM   4031 C CB  . SER B 1 225 ? 3.622   21.966 32.174  1.00 15.33 ? 1194 SER B CB  1 
ATOM   4032 O OG  . SER B 1 225 ? 3.219   22.629 33.355  1.00 19.03 ? 1194 SER B OG  1 
ATOM   4033 N N   . PHE B 1 226 ? 2.589   20.002 29.834  1.00 16.10 ? 1195 PHE B N   1 
ATOM   4034 C CA  . PHE B 1 226 ? 2.898   19.201 28.653  1.00 15.71 ? 1195 PHE B CA  1 
ATOM   4035 C C   . PHE B 1 226 ? 2.136   19.730 27.444  1.00 15.13 ? 1195 PHE B C   1 
ATOM   4036 O O   . PHE B 1 226 ? 2.661   19.756 26.325  1.00 11.98 ? 1195 PHE B O   1 
ATOM   4037 C CB  . PHE B 1 226 ? 2.515   17.741 28.877  1.00 17.71 ? 1195 PHE B CB  1 
ATOM   4038 C CG  . PHE B 1 226 ? 2.660   16.883 27.647  1.00 18.56 ? 1195 PHE B CG  1 
ATOM   4039 C CD1 . PHE B 1 226 ? 3.917   16.551 27.155  1.00 17.83 ? 1195 PHE B CD1 1 
ATOM   4040 C CD2 . PHE B 1 226 ? 1.533   16.413 26.973  1.00 18.37 ? 1195 PHE B CD2 1 
ATOM   4041 C CE1 . PHE B 1 226 ? 4.048   15.759 26.008  1.00 18.21 ? 1195 PHE B CE1 1 
ATOM   4042 C CE2 . PHE B 1 226 ? 1.662   15.624 25.831  1.00 16.22 ? 1195 PHE B CE2 1 
ATOM   4043 C CZ  . PHE B 1 226 ? 2.919   15.298 25.353  1.00 15.27 ? 1195 PHE B CZ  1 
ATOM   4044 N N   . GLY B 1 227 ? 0.888   20.122 27.689  1.00 15.93 ? 1196 GLY B N   1 
ATOM   4045 C CA  . GLY B 1 227 ? 0.039   20.670 26.647  1.00 17.90 ? 1196 GLY B CA  1 
ATOM   4046 C C   . GLY B 1 227 ? 0.579   22.004 26.147  1.00 20.09 ? 1196 GLY B C   1 
ATOM   4047 O O   . GLY B 1 227 ? 0.343   22.380 24.991  1.00 21.23 ? 1196 GLY B O   1 
ATOM   4048 N N   . VAL B 1 228 ? 1.292   22.730 27.007  1.00 19.54 ? 1197 VAL B N   1 
ATOM   4049 C CA  . VAL B 1 228 ? 1.883   23.999 26.604  1.00 21.43 ? 1197 VAL B CA  1 
ATOM   4050 C C   . VAL B 1 228 ? 3.194   23.747 25.847  1.00 21.94 ? 1197 VAL B C   1 
ATOM   4051 O O   . VAL B 1 228 ? 3.621   24.586 25.039  1.00 22.36 ? 1197 VAL B O   1 
ATOM   4052 C CB  . VAL B 1 228 ? 2.160   24.919 27.815  1.00 22.34 ? 1197 VAL B CB  1 
ATOM   4053 C CG1 . VAL B 1 228 ? 2.846   26.223 27.362  1.00 17.79 ? 1197 VAL B CG1 1 
ATOM   4054 C CG2 . VAL B 1 228 ? 0.846   25.232 28.513  1.00 24.40 ? 1197 VAL B CG2 1 
ATOM   4055 N N   . VAL B 1 229 ? 3.829   22.600 26.101  1.00 20.43 ? 1198 VAL B N   1 
ATOM   4056 C CA  . VAL B 1 229 ? 5.071   22.259 25.396  1.00 20.20 ? 1198 VAL B CA  1 
ATOM   4057 C C   . VAL B 1 229 ? 4.696   21.906 23.970  1.00 20.14 ? 1198 VAL B C   1 
ATOM   4058 O O   . VAL B 1 229 ? 5.431   22.222 23.039  1.00 20.80 ? 1198 VAL B O   1 
ATOM   4059 C CB  . VAL B 1 229 ? 5.827   21.044 26.022  1.00 18.82 ? 1198 VAL B CB  1 
ATOM   4060 C CG1 . VAL B 1 229 ? 6.952   20.611 25.094  1.00 16.65 ? 1198 VAL B CG1 1 
ATOM   4061 C CG2 . VAL B 1 229 ? 6.415   21.420 27.392  1.00 17.32 ? 1198 VAL B CG2 1 
ATOM   4062 N N   . LEU B 1 230 ? 3.549   21.245 23.812  1.00 20.83 ? 1199 LEU B N   1 
ATOM   4063 C CA  . LEU B 1 230 ? 3.040   20.865 22.494  1.00 21.09 ? 1199 LEU B CA  1 
ATOM   4064 C C   . LEU B 1 230 ? 2.751   22.147 21.744  1.00 21.10 ? 1199 LEU B C   1 
ATOM   4065 O O   . LEU B 1 230 ? 3.060   22.276 20.560  1.00 22.35 ? 1199 LEU B O   1 
ATOM   4066 C CB  . LEU B 1 230 ? 1.743   20.066 22.611  1.00 21.01 ? 1199 LEU B CB  1 
ATOM   4067 C CG  . LEU B 1 230 ? 1.765   18.710 23.316  1.00 22.79 ? 1199 LEU B CG  1 
ATOM   4068 C CD1 . LEU B 1 230 ? 0.376   18.127 23.234  1.00 23.74 ? 1199 LEU B CD1 1 
ATOM   4069 C CD2 . LEU B 1 230 ? 2.778   17.767 22.677  1.00 20.95 ? 1199 LEU B CD2 1 
ATOM   4070 N N   . TRP B 1 231 ? 2.143   23.092 22.451  1.00 21.39 ? 1200 TRP B N   1 
ATOM   4071 C CA  . TRP B 1 231 ? 1.819   24.393 21.891  1.00 20.56 ? 1200 TRP B CA  1 
ATOM   4072 C C   . TRP B 1 231 ? 3.109   24.980 21.323  1.00 19.13 ? 1200 TRP B C   1 
ATOM   4073 O O   . TRP B 1 231 ? 3.168   25.341 20.155  1.00 18.99 ? 1200 TRP B O   1 
ATOM   4074 C CB  . TRP B 1 231 ? 1.274   25.301 22.984  1.00 23.35 ? 1200 TRP B CB  1 
ATOM   4075 C CG  . TRP B 1 231 ? 0.669   26.542 22.451  1.00 26.83 ? 1200 TRP B CG  1 
ATOM   4076 C CD1 . TRP B 1 231 ? -0.588  26.688 21.954  1.00 28.38 ? 1200 TRP B CD1 1 
ATOM   4077 C CD2 . TRP B 1 231 ? 1.296   27.827 22.354  1.00 27.88 ? 1200 TRP B CD2 1 
ATOM   4078 N NE1 . TRP B 1 231 ? -0.791  27.989 21.559  1.00 30.51 ? 1200 TRP B NE1 1 
ATOM   4079 C CE2 . TRP B 1 231 ? 0.350   28.709 21.794  1.00 28.29 ? 1200 TRP B CE2 1 
ATOM   4080 C CE3 . TRP B 1 231 ? 2.565   28.316 22.686  1.00 27.91 ? 1200 TRP B CE3 1 
ATOM   4081 C CZ2 . TRP B 1 231 ? 0.628   30.054 21.559  1.00 27.10 ? 1200 TRP B CZ2 1 
ATOM   4082 C CZ3 . TRP B 1 231 ? 2.842   29.653 22.452  1.00 28.55 ? 1200 TRP B CZ3 1 
ATOM   4083 C CH2 . TRP B 1 231 ? 1.874   30.508 21.893  1.00 28.21 ? 1200 TRP B CH2 1 
ATOM   4084 N N   . GLU B 1 232 ? 4.142   25.069 22.155  1.00 18.28 ? 1201 GLU B N   1 
ATOM   4085 C CA  . GLU B 1 232 ? 5.436   25.571 21.704  1.00 19.62 ? 1201 GLU B CA  1 
ATOM   4086 C C   . GLU B 1 232 ? 5.857   24.850 20.422  1.00 19.38 ? 1201 GLU B C   1 
ATOM   4087 O O   . GLU B 1 232 ? 6.071   25.483 19.388  1.00 21.64 ? 1201 GLU B O   1 
ATOM   4088 C CB  . GLU B 1 232 ? 6.499   25.360 22.781  1.00 18.78 ? 1201 GLU B CB  1 
ATOM   4089 C CG  . GLU B 1 232 ? 6.379   26.303 23.951  1.00 20.00 ? 1201 GLU B CG  1 
ATOM   4090 C CD  . GLU B 1 232 ? 7.286   25.921 25.099  1.00 22.08 ? 1201 GLU B CD  1 
ATOM   4091 O OE1 . GLU B 1 232 ? 6.998   24.913 25.793  1.00 22.18 ? 1201 GLU B OE1 1 
ATOM   4092 O OE2 . GLU B 1 232 ? 8.297   26.627 25.297  1.00 21.07 ? 1201 GLU B OE2 1 
ATOM   4093 N N   . ILE B 1 233 ? 5.970   23.529 20.493  1.00 18.80 ? 1202 ILE B N   1 
ATOM   4094 C CA  . ILE B 1 233 ? 6.346   22.723 19.339  1.00 18.80 ? 1202 ILE B CA  1 
ATOM   4095 C C   . ILE B 1 233 ? 5.611   23.180 18.073  1.00 19.47 ? 1202 ILE B C   1 
ATOM   4096 O O   . ILE B 1 233 ? 6.227   23.319 17.018  1.00 19.40 ? 1202 ILE B O   1 
ATOM   4097 C CB  . ILE B 1 233 ? 6.059   21.214 19.621  1.00 18.52 ? 1202 ILE B CB  1 
ATOM   4098 C CG1 . ILE B 1 233 ? 7.130   20.659 20.563  1.00 17.53 ? 1202 ILE B CG1 1 
ATOM   4099 C CG2 . ILE B 1 233 ? 6.020   20.406 18.322  1.00 14.52 ? 1202 ILE B CG2 1 
ATOM   4100 C CD1 . ILE B 1 233 ? 6.784   19.308 21.144  1.00 17.34 ? 1202 ILE B CD1 1 
ATOM   4101 N N   . ALA B 1 234 ? 4.309   23.438 18.183  1.00 19.54 ? 1203 ALA B N   1 
ATOM   4102 C CA  . ALA B 1 234 ? 3.510   23.865 17.032  1.00 22.74 ? 1203 ALA B CA  1 
ATOM   4103 C C   . ALA B 1 234 ? 3.640   25.348 16.666  1.00 25.37 ? 1203 ALA B C   1 
ATOM   4104 O O   . ALA B 1 234 ? 3.112   25.779 15.638  1.00 25.31 ? 1203 ALA B O   1 
ATOM   4105 C CB  . ALA B 1 234 ? 2.042   23.531 17.265  1.00 23.10 ? 1203 ALA B CB  1 
ATOM   4106 N N   . THR B 1 235 ? 4.320   26.130 17.505  1.00 26.12 ? 1204 THR B N   1 
ATOM   4107 C CA  . THR B 1 235 ? 4.510   27.555 17.229  1.00 25.99 ? 1204 THR B CA  1 
ATOM   4108 C C   . THR B 1 235 ? 5.986   27.897 17.227  1.00 26.87 ? 1204 THR B C   1 
ATOM   4109 O O   . THR B 1 235 ? 6.353   29.066 17.308  1.00 28.29 ? 1204 THR B O   1 
ATOM   4110 C CB  . THR B 1 235 ? 3.851   28.462 18.288  1.00 25.04 ? 1204 THR B CB  1 
ATOM   4111 O OG1 . THR B 1 235 ? 4.514   28.283 19.547  1.00 22.50 ? 1204 THR B OG1 1 
ATOM   4112 C CG2 . THR B 1 235 ? 2.368   28.156 18.415  1.00 22.11 ? 1204 THR B CG2 1 
ATOM   4113 N N   . LEU B 1 236 ? 6.827   26.877 17.139  1.00 26.42 ? 1205 LEU B N   1 
ATOM   4114 C CA  . LEU B 1 236 ? 8.268   27.070 17.150  1.00 28.08 ? 1205 LEU B CA  1 
ATOM   4115 C C   . LEU B 1 236 ? 8.740   27.991 18.277  1.00 30.25 ? 1205 LEU B C   1 
ATOM   4116 O O   . LEU B 1 236 ? 9.415   28.994 18.035  1.00 33.07 ? 1205 LEU B O   1 
ATOM   4117 C CB  . LEU B 1 236 ? 8.746   27.596 15.798  1.00 24.95 ? 1205 LEU B CB  1 
ATOM   4118 C CG  . LEU B 1 236 ? 8.535   26.568 14.679  1.00 26.69 ? 1205 LEU B CG  1 
ATOM   4119 C CD1 . LEU B 1 236 ? 8.862   27.183 13.330  1.00 25.93 ? 1205 LEU B CD1 1 
ATOM   4120 C CD2 . LEU B 1 236 ? 9.390   25.341 14.939  1.00 23.77 ? 1205 LEU B CD2 1 
ATOM   4121 N N   . ALA B 1 237 ? 8.371   27.635 19.506  1.00 30.35 ? 1206 ALA B N   1 
ATOM   4122 C CA  . ALA B 1 237 ? 8.761   28.362 20.713  1.00 30.68 ? 1206 ALA B CA  1 
ATOM   4123 C C   . ALA B 1 237 ? 8.365   29.830 20.795  1.00 30.91 ? 1206 ALA B C   1 
ATOM   4124 O O   . ALA B 1 237 ? 9.215   30.710 20.886  1.00 30.29 ? 1206 ALA B O   1 
ATOM   4125 C CB  . ALA B 1 237 ? 10.265  28.216 20.937  1.00 29.74 ? 1206 ALA B CB  1 
ATOM   4126 N N   . GLU B 1 238 ? 7.061   30.078 20.766  1.00 32.36 ? 1207 GLU B N   1 
ATOM   4127 C CA  . GLU B 1 238 ? 6.501   31.418 20.883  1.00 33.07 ? 1207 GLU B CA  1 
ATOM   4128 C C   . GLU B 1 238 ? 6.199   31.582 22.372  1.00 33.15 ? 1207 GLU B C   1 
ATOM   4129 O O   . GLU B 1 238 ? 5.950   30.590 23.053  1.00 33.53 ? 1207 GLU B O   1 
ATOM   4130 C CB  . GLU B 1 238 ? 5.187   31.510 20.096  1.00 34.19 ? 1207 GLU B CB  1 
ATOM   4131 C CG  . GLU B 1 238 ? 5.339   31.658 18.609  1.00 37.92 ? 1207 GLU B CG  1 
ATOM   4132 C CD  . GLU B 1 238 ? 5.742   33.069 18.216  1.00 41.41 ? 1207 GLU B CD  1 
ATOM   4133 O OE1 . GLU B 1 238 ? 4.979   34.010 18.525  1.00 44.18 ? 1207 GLU B OE1 1 
ATOM   4134 O OE2 . GLU B 1 238 ? 6.817   33.244 17.602  1.00 42.80 ? 1207 GLU B OE2 1 
ATOM   4135 N N   . GLN B 1 239 ? 6.213   32.810 22.885  1.00 33.16 ? 1208 GLN B N   1 
ATOM   4136 C CA  . GLN B 1 239 ? 5.904   33.029 24.302  1.00 32.58 ? 1208 GLN B CA  1 
ATOM   4137 C C   . GLN B 1 239 ? 4.394   32.855 24.466  1.00 32.76 ? 1208 GLN B C   1 
ATOM   4138 O O   . GLN B 1 239 ? 3.616   33.571 23.838  1.00 32.40 ? 1208 GLN B O   1 
ATOM   4139 C CB  . GLN B 1 239 ? 6.281   34.446 24.727  1.00 32.47 ? 1208 GLN B CB  1 
ATOM   4140 C CG  . GLN B 1 239 ? 7.530   35.023 24.064  1.00 34.95 ? 1208 GLN B CG  1 
ATOM   4141 C CD  . GLN B 1 239 ? 8.832   34.454 24.613  1.00 37.11 ? 1208 GLN B CD  1 
ATOM   4142 O OE1 . GLN B 1 239 ? 9.918   34.970 24.312  1.00 36.77 ? 1208 GLN B OE1 1 
ATOM   4143 N NE2 . GLN B 1 239 ? 8.735   33.389 25.414  1.00 36.24 ? 1208 GLN B NE2 1 
ATOM   4144 N N   . PRO B 1 240 ? 3.952   31.904 25.309  1.00 33.12 ? 1209 PRO B N   1 
ATOM   4145 C CA  . PRO B 1 240 ? 2.505   31.721 25.478  1.00 31.84 ? 1209 PRO B CA  1 
ATOM   4146 C C   . PRO B 1 240 ? 1.871   32.967 26.093  1.00 33.02 ? 1209 PRO B C   1 
ATOM   4147 O O   . PRO B 1 240 ? 2.506   33.660 26.890  1.00 32.20 ? 1209 PRO B O   1 
ATOM   4148 C CB  . PRO B 1 240 ? 2.412   30.519 26.413  1.00 30.31 ? 1209 PRO B CB  1 
ATOM   4149 C CG  . PRO B 1 240 ? 3.701   29.789 26.185  1.00 31.56 ? 1209 PRO B CG  1 
ATOM   4150 C CD  . PRO B 1 240 ? 4.696   30.916 26.106  1.00 32.09 ? 1209 PRO B CD  1 
ATOM   4151 N N   . TYR B 1 241 ? 0.624   33.254 25.724  1.00 34.54 ? 1210 TYR B N   1 
ATOM   4152 C CA  . TYR B 1 241 ? -0.071  34.420 26.265  1.00 36.54 ? 1210 TYR B CA  1 
ATOM   4153 C C   . TYR B 1 241 ? 0.708   35.699 25.938  1.00 39.28 ? 1210 TYR B C   1 
ATOM   4154 O O   . TYR B 1 241 ? 0.892   36.563 26.795  1.00 38.52 ? 1210 TYR B O   1 
ATOM   4155 C CB  . TYR B 1 241 ? -0.222  34.255 27.781  1.00 33.94 ? 1210 TYR B CB  1 
ATOM   4156 C CG  . TYR B 1 241 ? -0.795  32.906 28.170  1.00 33.05 ? 1210 TYR B CG  1 
ATOM   4157 C CD1 . TYR B 1 241 ? -2.117  32.577 27.875  1.00 32.92 ? 1210 TYR B CD1 1 
ATOM   4158 C CD2 . TYR B 1 241 ? 0.002   31.933 28.775  1.00 32.89 ? 1210 TYR B CD2 1 
ATOM   4159 C CE1 . TYR B 1 241 ? -2.632  31.310 28.166  1.00 32.18 ? 1210 TYR B CE1 1 
ATOM   4160 C CE2 . TYR B 1 241 ? -0.501  30.666 29.071  1.00 31.51 ? 1210 TYR B CE2 1 
ATOM   4161 C CZ  . TYR B 1 241 ? -1.818  30.362 28.762  1.00 31.95 ? 1210 TYR B CZ  1 
ATOM   4162 O OH  . TYR B 1 241 ? -2.324  29.110 29.043  1.00 31.77 ? 1210 TYR B OH  1 
ATOM   4163 N N   . GLN B 1 242 ? 1.146   35.797 24.682  1.00 43.27 ? 1211 GLN B N   1 
ATOM   4164 C CA  . GLN B 1 242 ? 1.933   36.923 24.163  1.00 47.22 ? 1211 GLN B CA  1 
ATOM   4165 C C   . GLN B 1 242 ? 1.411   38.319 24.508  1.00 47.67 ? 1211 GLN B C   1 
ATOM   4166 O O   . GLN B 1 242 ? 2.107   39.116 25.138  1.00 46.57 ? 1211 GLN B O   1 
ATOM   4167 C CB  . GLN B 1 242 ? 2.059   36.803 22.635  1.00 49.84 ? 1211 GLN B CB  1 
ATOM   4168 C CG  . GLN B 1 242 ? 2.775   35.540 22.157  1.00 53.47 ? 1211 GLN B CG  1 
ATOM   4169 C CD  . GLN B 1 242 ? 2.671   35.312 20.651  1.00 54.77 ? 1211 GLN B CD  1 
ATOM   4170 O OE1 . GLN B 1 242 ? 3.151   36.118 19.847  1.00 56.06 ? 1211 GLN B OE1 1 
ATOM   4171 N NE2 . GLN B 1 242 ? 2.045   34.203 20.266  1.00 54.66 ? 1211 GLN B NE2 1 
ATOM   4172 N N   . GLY B 1 243 ? 0.191   38.615 24.072  1.00 48.96 ? 1212 GLY B N   1 
ATOM   4173 C CA  . GLY B 1 243 ? -0.387  39.917 24.341  1.00 50.42 ? 1212 GLY B CA  1 
ATOM   4174 C C   . GLY B 1 243 ? -0.838  40.060 25.781  1.00 51.38 ? 1212 GLY B C   1 
ATOM   4175 O O   . GLY B 1 243 ? -1.607  40.969 26.114  1.00 52.94 ? 1212 GLY B O   1 
ATOM   4176 N N   . LEU B 1 244 ? -0.363  39.162 26.641  1.00 50.49 ? 1213 LEU B N   1 
ATOM   4177 C CA  . LEU B 1 244 ? -0.730  39.199 28.050  1.00 48.52 ? 1213 LEU B CA  1 
ATOM   4178 C C   . LEU B 1 244 ? 0.494   39.268 28.937  1.00 47.64 ? 1213 LEU B C   1 
ATOM   4179 O O   . LEU B 1 244 ? 1.467   38.543 28.732  1.00 48.04 ? 1213 LEU B O   1 
ATOM   4180 C CB  . LEU B 1 244 ? -1.569  37.972 28.415  1.00 47.73 ? 1213 LEU B CB  1 
ATOM   4181 C CG  . LEU B 1 244 ? -2.959  37.926 27.777  1.00 46.71 ? 1213 LEU B CG  1 
ATOM   4182 C CD1 . LEU B 1 244 ? -3.675  36.651 28.167  1.00 47.62 ? 1213 LEU B CD1 1 
ATOM   4183 C CD2 . LEU B 1 244 ? -3.751  39.128 28.232  1.00 46.49 ? 1213 LEU B CD2 1 
ATOM   4184 N N   . SER B 1 245 ? 0.442   40.157 29.918  1.00 46.67 ? 1214 SER B N   1 
ATOM   4185 C CA  . SER B 1 245 ? 1.540   40.324 30.855  1.00 45.79 ? 1214 SER B CA  1 
ATOM   4186 C C   . SER B 1 245 ? 1.446   39.268 31.950  1.00 45.84 ? 1214 SER B C   1 
ATOM   4187 O O   . SER B 1 245 ? 0.381   38.691 32.188  1.00 44.70 ? 1214 SER B O   1 
ATOM   4188 C CB  . SER B 1 245 ? 1.489   41.722 31.472  1.00 45.08 ? 1214 SER B CB  1 
ATOM   4189 O OG  . SER B 1 245 ? 0.216   41.979 32.044  1.00 43.90 ? 1214 SER B OG  1 
ATOM   4190 N N   . ASN B 1 246 ? 2.567   39.021 32.615  1.00 46.53 ? 1215 ASN B N   1 
ATOM   4191 C CA  . ASN B 1 246 ? 2.622   38.036 33.685  1.00 47.04 ? 1215 ASN B CA  1 
ATOM   4192 C C   . ASN B 1 246 ? 1.316   37.983 34.467  1.00 46.95 ? 1215 ASN B C   1 
ATOM   4193 O O   . ASN B 1 246 ? 0.633   36.956 34.489  1.00 47.08 ? 1215 ASN B O   1 
ATOM   4194 C CB  . ASN B 1 246 ? 3.786   38.357 34.621  1.00 47.54 ? 1215 ASN B CB  1 
ATOM   4195 C CG  . ASN B 1 246 ? 5.136   38.274 33.919  1.00 48.94 ? 1215 ASN B CG  1 
ATOM   4196 O OD1 . ASN B 1 246 ? 5.545   37.205 33.456  1.00 48.40 ? 1215 ASN B OD1 1 
ATOM   4197 N ND2 . ASN B 1 246 ? 5.833   39.408 33.836  1.00 49.22 ? 1215 ASN B ND2 1 
ATOM   4198 N N   . GLU B 1 247 ? 0.966   39.102 35.091  1.00 47.53 ? 1216 GLU B N   1 
ATOM   4199 C CA  . GLU B 1 247 ? -0.258  39.197 35.881  1.00 46.79 ? 1216 GLU B CA  1 
ATOM   4200 C C   . GLU B 1 247 ? -1.529  38.859 35.111  1.00 45.72 ? 1216 GLU B C   1 
ATOM   4201 O O   . GLU B 1 247 ? -2.405  38.171 35.631  1.00 45.35 ? 1216 GLU B O   1 
ATOM   4202 C CB  . GLU B 1 247 ? -0.384  40.597 36.482  1.00 46.94 ? 1216 GLU B CB  1 
ATOM   4203 C CG  . GLU B 1 247 ? 0.483   40.803 37.699  1.00 50.17 ? 1216 GLU B CG  1 
ATOM   4204 C CD  . GLU B 1 247 ? 0.009   39.982 38.886  1.00 53.34 ? 1216 GLU B CD  1 
ATOM   4205 O OE1 . GLU B 1 247 ? 0.701   39.983 39.931  1.00 54.54 ? 1216 GLU B OE1 1 
ATOM   4206 O OE2 . GLU B 1 247 ? -1.063  39.340 38.776  1.00 54.65 ? 1216 GLU B OE2 1 
ATOM   4207 N N   . GLN B 1 248 ? -1.635  39.336 33.878  1.00 44.76 ? 1217 GLN B N   1 
ATOM   4208 C CA  . GLN B 1 248 ? -2.829  39.070 33.086  1.00 44.36 ? 1217 GLN B CA  1 
ATOM   4209 C C   . GLN B 1 248 ? -3.054  37.580 32.904  1.00 43.50 ? 1217 GLN B C   1 
ATOM   4210 O O   . GLN B 1 248 ? -4.195  37.116 32.897  1.00 43.61 ? 1217 GLN B O   1 
ATOM   4211 C CB  . GLN B 1 248 ? -2.727  39.743 31.717  1.00 45.02 ? 1217 GLN B CB  1 
ATOM   4212 C CG  . GLN B 1 248 ? -2.388  41.220 31.791  1.00 46.05 ? 1217 GLN B CG  1 
ATOM   4213 C CD  . GLN B 1 248 ? -2.467  41.898 30.448  1.00 46.21 ? 1217 GLN B CD  1 
ATOM   4214 O OE1 . GLN B 1 248 ? -3.537  42.338 30.025  1.00 46.79 ? 1217 GLN B OE1 1 
ATOM   4215 N NE2 . GLN B 1 248 ? -1.334  41.974 29.756  1.00 46.51 ? 1217 GLN B NE2 1 
ATOM   4216 N N   . VAL B 1 249 ? -1.962  36.834 32.760  1.00 42.77 ? 1218 VAL B N   1 
ATOM   4217 C CA  . VAL B 1 249 ? -2.037  35.384 32.572  1.00 41.31 ? 1218 VAL B CA  1 
ATOM   4218 C C   . VAL B 1 249 ? -2.672  34.717 33.802  1.00 41.03 ? 1218 VAL B C   1 
ATOM   4219 O O   . VAL B 1 249 ? -3.567  33.878 33.673  1.00 39.59 ? 1218 VAL B O   1 
ATOM   4220 C CB  . VAL B 1 249 ? -0.627  34.782 32.320  1.00 40.41 ? 1218 VAL B CB  1 
ATOM   4221 C CG1 . VAL B 1 249 ? -0.743  33.308 31.969  1.00 38.21 ? 1218 VAL B CG1 1 
ATOM   4222 C CG2 . VAL B 1 249 ? 0.073   35.541 31.198  1.00 38.39 ? 1218 VAL B CG2 1 
ATOM   4223 N N   . LEU B 1 250 ? -2.202  35.097 34.990  1.00 40.45 ? 1219 LEU B N   1 
ATOM   4224 C CA  . LEU B 1 250 ? -2.728  34.561 36.243  1.00 39.13 ? 1219 LEU B CA  1 
ATOM   4225 C C   . LEU B 1 250 ? -4.246  34.716 36.261  1.00 38.59 ? 1219 LEU B C   1 
ATOM   4226 O O   . LEU B 1 250 ? -4.985  33.750 36.458  1.00 38.24 ? 1219 LEU B O   1 
ATOM   4227 C CB  . LEU B 1 250 ? -2.121  35.314 37.427  1.00 37.96 ? 1219 LEU B CB  1 
ATOM   4228 C CG  . LEU B 1 250 ? -0.652  35.032 37.730  1.00 37.44 ? 1219 LEU B CG  1 
ATOM   4229 C CD1 . LEU B 1 250 ? 0.155   36.321 37.833  1.00 35.45 ? 1219 LEU B CD1 1 
ATOM   4230 C CD2 . LEU B 1 250 ? -0.599  34.259 39.019  1.00 36.76 ? 1219 LEU B CD2 1 
ATOM   4231 N N   . ARG B 1 251 ? -4.702  35.948 36.064  1.00 38.73 ? 1220 ARG B N   1 
ATOM   4232 C CA  . ARG B 1 251 ? -6.125  36.239 36.033  1.00 39.20 ? 1220 ARG B CA  1 
ATOM   4233 C C   . ARG B 1 251 ? -6.756  35.439 34.884  1.00 39.09 ? 1220 ARG B C   1 
ATOM   4234 O O   . ARG B 1 251 ? -7.771  34.756 35.067  1.00 39.78 ? 1220 ARG B O   1 
ATOM   4235 C CB  . ARG B 1 251 ? -6.337  37.749 35.832  1.00 39.11 ? 1220 ARG B CB  1 
ATOM   4236 C CG  . ARG B 1 251 ? -7.438  38.126 34.838  1.00 42.34 ? 1220 ARG B CG  1 
ATOM   4237 C CD  . ARG B 1 251 ? -8.695  38.656 35.513  1.00 45.80 ? 1220 ARG B CD  1 
ATOM   4238 N NE  . ARG B 1 251 ? -9.395  37.649 36.309  1.00 49.45 ? 1220 ARG B NE  1 
ATOM   4239 C CZ  . ARG B 1 251 ? -10.260 37.945 37.276  1.00 50.97 ? 1220 ARG B CZ  1 
ATOM   4240 N NH1 . ARG B 1 251 ? -10.863 36.981 37.958  1.00 49.99 ? 1220 ARG B NH1 1 
ATOM   4241 N NH2 . ARG B 1 251 ? -10.511 39.214 37.573  1.00 52.25 ? 1220 ARG B NH2 1 
ATOM   4242 N N   . PHE B 1 252 ? -6.137  35.507 33.707  1.00 37.29 ? 1221 PHE B N   1 
ATOM   4243 C CA  . PHE B 1 252 ? -6.649  34.809 32.536  1.00 35.39 ? 1221 PHE B CA  1 
ATOM   4244 C C   . PHE B 1 252 ? -6.792  33.297 32.714  1.00 35.65 ? 1221 PHE B C   1 
ATOM   4245 O O   . PHE B 1 252 ? -7.873  32.743 32.528  1.00 36.14 ? 1221 PHE B O   1 
ATOM   4246 C CB  . PHE B 1 252 ? -5.760  35.089 31.331  1.00 32.76 ? 1221 PHE B CB  1 
ATOM   4247 C CG  . PHE B 1 252 ? -6.261  34.473 30.064  1.00 32.67 ? 1221 PHE B CG  1 
ATOM   4248 C CD1 . PHE B 1 252 ? -7.556  34.729 29.617  1.00 32.95 ? 1221 PHE B CD1 1 
ATOM   4249 C CD2 . PHE B 1 252 ? -5.440  33.651 29.302  1.00 33.14 ? 1221 PHE B CD2 1 
ATOM   4250 C CE1 . PHE B 1 252 ? -8.026  34.178 28.427  1.00 32.79 ? 1221 PHE B CE1 1 
ATOM   4251 C CE2 . PHE B 1 252 ? -5.899  33.093 28.106  1.00 32.29 ? 1221 PHE B CE2 1 
ATOM   4252 C CZ  . PHE B 1 252 ? -7.193  33.357 27.668  1.00 32.86 ? 1221 PHE B CZ  1 
ATOM   4253 N N   . VAL B 1 253 ? -5.701  32.634 33.075  1.00 35.11 ? 1222 VAL B N   1 
ATOM   4254 C CA  . VAL B 1 253 ? -5.711  31.188 33.250  1.00 35.08 ? 1222 VAL B CA  1 
ATOM   4255 C C   . VAL B 1 253 ? -6.694  30.702 34.311  1.00 35.45 ? 1222 VAL B C   1 
ATOM   4256 O O   . VAL B 1 253 ? -7.525  29.827 34.051  1.00 35.26 ? 1222 VAL B O   1 
ATOM   4257 C CB  . VAL B 1 253 ? -4.290  30.654 33.604  1.00 34.41 ? 1222 VAL B CB  1 
ATOM   4258 C CG1 . VAL B 1 253 ? -4.304  29.139 33.690  1.00 32.55 ? 1222 VAL B CG1 1 
ATOM   4259 C CG2 . VAL B 1 253 ? -3.294  31.086 32.545  1.00 34.97 ? 1222 VAL B CG2 1 
ATOM   4260 N N   . MET B 1 254 ? -6.613  31.276 35.503  1.00 36.05 ? 1223 MET B N   1 
ATOM   4261 C CA  . MET B 1 254 ? -7.485  30.847 36.585  1.00 35.80 ? 1223 MET B CA  1 
ATOM   4262 C C   . MET B 1 254 ? -8.975  31.014 36.331  1.00 34.67 ? 1223 MET B C   1 
ATOM   4263 O O   . MET B 1 254 ? -9.781  30.279 36.897  1.00 34.16 ? 1223 MET B O   1 
ATOM   4264 C CB  . MET B 1 254 ? -7.087  31.555 37.876  1.00 36.47 ? 1223 MET B CB  1 
ATOM   4265 C CG  . MET B 1 254 ? -5.660  31.265 38.295  1.00 37.08 ? 1223 MET B CG  1 
ATOM   4266 S SD  . MET B 1 254 ? -5.268  31.996 39.882  1.00 39.63 ? 1223 MET B SD  1 
ATOM   4267 C CE  . MET B 1 254 ? -4.982  33.712 39.383  1.00 38.10 ? 1223 MET B CE  1 
ATOM   4268 N N   . GLU B 1 255 ? -9.348  31.963 35.480  1.00 34.66 ? 1224 GLU B N   1 
ATOM   4269 C CA  . GLU B 1 255 ? -10.766 32.183 35.188  1.00 35.58 ? 1224 GLU B CA  1 
ATOM   4270 C C   . GLU B 1 255 ? -11.238 31.326 34.014  1.00 34.47 ? 1224 GLU B C   1 
ATOM   4271 O O   . GLU B 1 255 ? -12.356 31.490 33.530  1.00 34.16 ? 1224 GLU B O   1 
ATOM   4272 C CB  . GLU B 1 255 ? -11.042 33.667 34.896  1.00 36.88 ? 1224 GLU B CB  1 
ATOM   4273 C CG  . GLU B 1 255 ? -10.545 34.621 35.981  1.00 40.34 ? 1224 GLU B CG  1 
ATOM   4274 C CD  . GLU B 1 255 ? -11.128 34.324 37.365  1.00 44.86 ? 1224 GLU B CD  1 
ATOM   4275 O OE1 . GLU B 1 255 ? -12.285 34.726 37.640  1.00 45.37 ? 1224 GLU B OE1 1 
ATOM   4276 O OE2 . GLU B 1 255 ? -10.425 33.683 38.181  1.00 46.21 ? 1224 GLU B OE2 1 
ATOM   4277 N N   . GLY B 1 256 ? -10.376 30.418 33.558  1.00 33.00 ? 1225 GLY B N   1 
ATOM   4278 C CA  . GLY B 1 256 ? -10.741 29.535 32.462  1.00 31.37 ? 1225 GLY B CA  1 
ATOM   4279 C C   . GLY B 1 256 ? -10.166 29.866 31.097  1.00 30.81 ? 1225 GLY B C   1 
ATOM   4280 O O   . GLY B 1 256 ? -10.571 29.276 30.089  1.00 29.49 ? 1225 GLY B O   1 
ATOM   4281 N N   . GLY B 1 257 ? -9.223  30.804 31.057  1.00 30.92 ? 1226 GLY B N   1 
ATOM   4282 C CA  . GLY B 1 257 ? -8.612  31.189 29.797  1.00 29.84 ? 1226 GLY B CA  1 
ATOM   4283 C C   . GLY B 1 257 ? -7.768  30.077 29.209  1.00 29.74 ? 1226 GLY B C   1 
ATOM   4284 O O   . GLY B 1 257 ? -7.129  29.329 29.943  1.00 29.56 ? 1226 GLY B O   1 
ATOM   4285 N N   . LEU B 1 258 ? -7.773  29.958 27.886  1.00 29.87 ? 1227 LEU B N   1 
ATOM   4286 C CA  . LEU B 1 258 ? -6.991  28.931 27.203  1.00 30.95 ? 1227 LEU B CA  1 
ATOM   4287 C C   . LEU B 1 258 ? -6.222  29.526 26.037  1.00 31.41 ? 1227 LEU B C   1 
ATOM   4288 O O   . LEU B 1 258 ? -6.510  30.637 25.588  1.00 31.69 ? 1227 LEU B O   1 
ATOM   4289 C CB  . LEU B 1 258 ? -7.892  27.799 26.690  1.00 30.30 ? 1227 LEU B CB  1 
ATOM   4290 C CG  . LEU B 1 258 ? -8.497  26.877 27.755  1.00 28.81 ? 1227 LEU B CG  1 
ATOM   4291 C CD1 . LEU B 1 258 ? -9.362  25.818 27.096  1.00 28.01 ? 1227 LEU B CD1 1 
ATOM   4292 C CD2 . LEU B 1 258 ? -7.383  26.233 28.549  1.00 26.80 ? 1227 LEU B CD2 1 
ATOM   4293 N N   . LEU B 1 259 ? -5.242  28.778 25.549  1.00 31.78 ? 1228 LEU B N   1 
ATOM   4294 C CA  . LEU B 1 259 ? -4.428  29.238 24.440  1.00 31.44 ? 1228 LEU B CA  1 
ATOM   4295 C C   . LEU B 1 259 ? -5.162  29.054 23.125  1.00 32.44 ? 1228 LEU B C   1 
ATOM   4296 O O   . LEU B 1 259 ? -5.836  28.042 22.920  1.00 31.65 ? 1228 LEU B O   1 
ATOM   4297 C CB  . LEU B 1 259 ? -3.105  28.476 24.415  1.00 30.74 ? 1228 LEU B CB  1 
ATOM   4298 C CG  . LEU B 1 259 ? -2.081  28.847 25.487  1.00 30.43 ? 1228 LEU B CG  1 
ATOM   4299 C CD1 . LEU B 1 259 ? -1.070  27.727 25.634  1.00 29.51 ? 1228 LEU B CD1 1 
ATOM   4300 C CD2 . LEU B 1 259 ? -1.391  30.158 25.109  1.00 30.72 ? 1228 LEU B CD2 1 
ATOM   4301 N N   . ASP B 1 260 ? -5.037  30.043 22.243  1.00 33.55 ? 1229 ASP B N   1 
ATOM   4302 C CA  . ASP B 1 260 ? -5.681  29.988 20.935  1.00 35.08 ? 1229 ASP B CA  1 
ATOM   4303 C C   . ASP B 1 260 ? -4.979  28.930 20.112  1.00 35.15 ? 1229 ASP B C   1 
ATOM   4304 O O   . ASP B 1 260 ? -3.783  28.720 20.270  1.00 34.72 ? 1229 ASP B O   1 
ATOM   4305 C CB  . ASP B 1 260 ? -5.556  31.327 20.205  1.00 35.76 ? 1229 ASP B CB  1 
ATOM   4306 C CG  . ASP B 1 260 ? -6.301  32.449 20.895  1.00 36.94 ? 1229 ASP B CG  1 
ATOM   4307 O OD1 . ASP B 1 260 ? -7.556  32.480 20.845  1.00 35.62 ? 1229 ASP B OD1 1 
ATOM   4308 O OD2 . ASP B 1 260 ? -5.615  33.302 21.490  1.00 38.21 ? 1229 ASP B OD2 1 
ATOM   4309 N N   . LYS B 1 261 ? -5.721  28.267 19.235  1.00 36.85 ? 1230 LYS B N   1 
ATOM   4310 C CA  . LYS B 1 261 ? -5.131  27.251 18.384  1.00 38.95 ? 1230 LYS B CA  1 
ATOM   4311 C C   . LYS B 1 261 ? -4.038  27.905 17.527  1.00 40.91 ? 1230 LYS B C   1 
ATOM   4312 O O   . LYS B 1 261 ? -4.286  28.876 16.813  1.00 40.08 ? 1230 LYS B O   1 
ATOM   4313 C CB  . LYS B 1 261 ? -6.200  26.618 17.486  1.00 36.78 ? 1230 LYS B CB  1 
ATOM   4314 C CG  . LYS B 1 261 ? -5.670  25.464 16.653  1.00 35.00 ? 1230 LYS B CG  1 
ATOM   4315 C CD  . LYS B 1 261 ? -6.772  24.764 15.892  1.00 35.31 ? 1230 LYS B CD  1 
ATOM   4316 C CE  . LYS B 1 261 ? -6.245  23.514 15.210  1.00 36.71 ? 1230 LYS B CE  1 
ATOM   4317 N NZ  . LYS B 1 261 ? -7.349  22.626 14.752  1.00 38.26 ? 1230 LYS B NZ  1 
ATOM   4318 N N   . PRO B 1 262 ? -2.805  27.385 17.601  1.00 43.14 ? 1231 PRO B N   1 
ATOM   4319 C CA  . PRO B 1 262 ? -1.725  27.969 16.807  1.00 45.20 ? 1231 PRO B CA  1 
ATOM   4320 C C   . PRO B 1 262 ? -1.977  27.857 15.305  1.00 47.25 ? 1231 PRO B C   1 
ATOM   4321 O O   . PRO B 1 262 ? -2.350  26.795 14.798  1.00 47.97 ? 1231 PRO B O   1 
ATOM   4322 C CB  . PRO B 1 262 ? -0.501  27.181 17.266  1.00 44.79 ? 1231 PRO B CB  1 
ATOM   4323 C CG  . PRO B 1 262 ? -1.074  25.851 17.620  1.00 44.35 ? 1231 PRO B CG  1 
ATOM   4324 C CD  . PRO B 1 262 ? -2.322  26.225 18.368  1.00 43.88 ? 1231 PRO B CD  1 
ATOM   4325 N N   . ASP B 1 263 ? -1.774  28.971 14.608  1.00 48.62 ? 1232 ASP B N   1 
ATOM   4326 C CA  . ASP B 1 263 ? -1.966  29.055 13.164  1.00 48.23 ? 1232 ASP B CA  1 
ATOM   4327 C C   . ASP B 1 263 ? -1.284  27.883 12.467  1.00 47.13 ? 1232 ASP B C   1 
ATOM   4328 O O   . ASP B 1 263 ? -0.103  27.625 12.679  1.00 47.76 ? 1232 ASP B O   1 
ATOM   4329 C CB  . ASP B 1 263 ? -1.401  30.385 12.660  1.00 48.97 ? 1232 ASP B CB  1 
ATOM   4330 C CG  . ASP B 1 263 ? -1.876  31.573 13.499  1.00 50.35 ? 1232 ASP B CG  1 
ATOM   4331 O OD1 . ASP B 1 263 ? -1.380  32.699 13.272  1.00 49.87 ? 1232 ASP B OD1 1 
ATOM   4332 O OD2 . ASP B 1 263 ? -2.744  31.379 14.385  1.00 49.19 ? 1232 ASP B OD2 1 
ATOM   4333 N N   . ASN B 1 264 ? -2.035  27.175 11.634  1.00 46.03 ? 1233 ASN B N   1 
ATOM   4334 C CA  . ASN B 1 264 ? -1.504  26.017 10.930  1.00 44.37 ? 1233 ASN B CA  1 
ATOM   4335 C C   . ASN B 1 264 ? -0.926  25.076 11.965  1.00 42.92 ? 1233 ASN B C   1 
ATOM   4336 O O   . ASN B 1 264 ? 0.268   25.093 12.239  1.00 44.08 ? 1233 ASN B O   1 
ATOM   4337 C CB  . ASN B 1 264 ? -0.426  26.437 9.930   1.00 45.97 ? 1233 ASN B CB  1 
ATOM   4338 C CG  . ASN B 1 264 ? -0.976  27.318 8.823   1.00 48.66 ? 1233 ASN B CG  1 
ATOM   4339 O OD1 . ASN B 1 264 ? -1.932  26.949 8.133   1.00 48.75 ? 1233 ASN B OD1 1 
ATOM   4340 N ND2 . ASN B 1 264 ? -0.378  28.491 8.649   1.00 50.04 ? 1233 ASN B ND2 1 
ATOM   4341 N N   . CYS B 1 265 ? -1.804  24.277 12.557  1.00 41.18 ? 1234 CYS B N   1 
ATOM   4342 C CA  . CYS B 1 265 ? -1.434  23.307 13.578  1.00 38.17 ? 1234 CYS B CA  1 
ATOM   4343 C C   . CYS B 1 265 ? -2.384  22.123 13.509  1.00 36.24 ? 1234 CYS B C   1 
ATOM   4344 O O   . CYS B 1 265 ? -3.588  22.275 13.698  1.00 35.17 ? 1234 CYS B O   1 
ATOM   4345 C CB  . CYS B 1 265 ? -1.528  23.925 14.965  1.00 38.17 ? 1234 CYS B CB  1 
ATOM   4346 S SG  . CYS B 1 265 ? -1.799  22.684 16.248  1.00 38.91 ? 1234 CYS B SG  1 
ATOM   4347 N N   . PRO B 1 266 ? -1.847  20.922 13.252  1.00 34.37 ? 1235 PRO B N   1 
ATOM   4348 C CA  . PRO B 1 266 ? -2.640  19.697 13.153  1.00 33.46 ? 1235 PRO B CA  1 
ATOM   4349 C C   . PRO B 1 266 ? -3.818  19.643 14.129  1.00 33.71 ? 1235 PRO B C   1 
ATOM   4350 O O   . PRO B 1 266 ? -3.740  20.138 15.252  1.00 33.39 ? 1235 PRO B O   1 
ATOM   4351 C CB  . PRO B 1 266 ? -1.602  18.610 13.415  1.00 33.80 ? 1235 PRO B CB  1 
ATOM   4352 C CG  . PRO B 1 266 ? -0.387  19.168 12.770  1.00 32.64 ? 1235 PRO B CG  1 
ATOM   4353 C CD  . PRO B 1 266 ? -0.407  20.614 13.225  1.00 33.32 ? 1235 PRO B CD  1 
ATOM   4354 N N   . ASP B 1 267 ? -4.910  19.032 13.691  1.00 33.65 ? 1236 ASP B N   1 
ATOM   4355 C CA  . ASP B 1 267 ? -6.102  18.919 14.518  1.00 33.47 ? 1236 ASP B CA  1 
ATOM   4356 C C   . ASP B 1 267 ? -5.934  18.070 15.774  1.00 34.21 ? 1236 ASP B C   1 
ATOM   4357 O O   . ASP B 1 267 ? -6.293  18.516 16.866  1.00 34.87 ? 1236 ASP B O   1 
ATOM   4358 C CB  . ASP B 1 267 ? -7.259  18.373 13.684  1.00 32.80 ? 1236 ASP B CB  1 
ATOM   4359 C CG  . ASP B 1 267 ? -7.951  19.451 12.876  1.00 33.43 ? 1236 ASP B CG  1 
ATOM   4360 O OD1 . ASP B 1 267 ? -7.484  20.611 12.910  1.00 33.19 ? 1236 ASP B OD1 1 
ATOM   4361 O OD2 . ASP B 1 267 ? -8.963  19.140 12.214  1.00 33.75 ? 1236 ASP B OD2 1 
ATOM   4362 N N   . MET B 1 268 ? -5.393  16.858 15.624  1.00 34.76 ? 1237 MET B N   1 
ATOM   4363 C CA  . MET B 1 268 ? -5.199  15.949 16.756  1.00 35.91 ? 1237 MET B CA  1 
ATOM   4364 C C   . MET B 1 268 ? -4.248  16.528 17.783  1.00 35.42 ? 1237 MET B C   1 
ATOM   4365 O O   . MET B 1 268 ? -4.377  16.278 18.981  1.00 34.98 ? 1237 MET B O   1 
ATOM   4366 C CB  . MET B 1 268 ? -4.631  14.601 16.301  1.00 38.33 ? 1237 MET B CB  1 
ATOM   4367 C CG  . MET B 1 268 ? -3.157  14.644 15.921  1.00 40.25 ? 1237 MET B CG  1 
ATOM   4368 S SD  . MET B 1 268 ? -2.302  13.066 16.168  1.00 44.45 ? 1237 MET B SD  1 
ATOM   4369 C CE  . MET B 1 268 ? -2.550  12.227 14.538  1.00 41.75 ? 1237 MET B CE  1 
ATOM   4370 N N   . LEU B 1 269 ? -3.276  17.286 17.297  1.00 35.20 ? 1238 LEU B N   1 
ATOM   4371 C CA  . LEU B 1 269 ? -2.290  17.904 18.161  1.00 34.78 ? 1238 LEU B CA  1 
ATOM   4372 C C   . LEU B 1 269 ? -2.981  18.917 19.061  1.00 34.44 ? 1238 LEU B C   1 
ATOM   4373 O O   . LEU B 1 269 ? -2.671  19.015 20.241  1.00 37.04 ? 1238 LEU B O   1 
ATOM   4374 C CB  . LEU B 1 269 ? -1.222  18.596 17.315  1.00 35.22 ? 1238 LEU B CB  1 
ATOM   4375 C CG  . LEU B 1 269 ? 0.127   18.879 17.969  1.00 35.06 ? 1238 LEU B CG  1 
ATOM   4376 C CD1 . LEU B 1 269 ? 0.857   17.565 18.218  1.00 34.81 ? 1238 LEU B CD1 1 
ATOM   4377 C CD2 . LEU B 1 269 ? 0.949   19.779 17.057  1.00 35.75 ? 1238 LEU B CD2 1 
ATOM   4378 N N   . PHE B 1 270 ? -3.928  19.668 18.513  1.00 33.78 ? 1239 PHE B N   1 
ATOM   4379 C CA  . PHE B 1 270 ? -4.630  20.658 19.317  1.00 33.17 ? 1239 PHE B CA  1 
ATOM   4380 C C   . PHE B 1 270 ? -5.598  19.977 20.261  1.00 33.92 ? 1239 PHE B C   1 
ATOM   4381 O O   . PHE B 1 270 ? -5.816  20.462 21.377  1.00 33.98 ? 1239 PHE B O   1 
ATOM   4382 C CB  . PHE B 1 270 ? -5.393  21.652 18.439  1.00 32.10 ? 1239 PHE B CB  1 
ATOM   4383 C CG  . PHE B 1 270 ? -6.038  22.763 19.214  1.00 30.43 ? 1239 PHE B CG  1 
ATOM   4384 C CD1 . PHE B 1 270 ? -5.270  23.607 20.012  1.00 29.81 ? 1239 PHE B CD1 1 
ATOM   4385 C CD2 . PHE B 1 270 ? -7.414  22.968 19.152  1.00 30.35 ? 1239 PHE B CD2 1 
ATOM   4386 C CE1 . PHE B 1 270 ? -5.861  24.644 20.741  1.00 29.62 ? 1239 PHE B CE1 1 
ATOM   4387 C CE2 . PHE B 1 270 ? -8.017  24.002 19.875  1.00 30.79 ? 1239 PHE B CE2 1 
ATOM   4388 C CZ  . PHE B 1 270 ? -7.235  24.842 20.673  1.00 30.06 ? 1239 PHE B CZ  1 
ATOM   4389 N N   . GLU B 1 271 ? -6.190  18.867 19.814  1.00 32.67 ? 1240 GLU B N   1 
ATOM   4390 C CA  . GLU B 1 271 ? -7.126  18.126 20.658  1.00 30.99 ? 1240 GLU B CA  1 
ATOM   4391 C C   . GLU B 1 271 ? -6.360  17.694 21.900  1.00 28.16 ? 1240 GLU B C   1 
ATOM   4392 O O   . GLU B 1 271 ? -6.918  17.635 22.992  1.00 27.24 ? 1240 GLU B O   1 
ATOM   4393 C CB  . GLU B 1 271 ? -7.663  16.878 19.953  1.00 33.82 ? 1240 GLU B CB  1 
ATOM   4394 C CG  . GLU B 1 271 ? -8.186  17.096 18.546  1.00 38.49 ? 1240 GLU B CG  1 
ATOM   4395 C CD  . GLU B 1 271 ? -8.480  15.781 17.831  1.00 41.07 ? 1240 GLU B CD  1 
ATOM   4396 O OE1 . GLU B 1 271 ? -8.469  15.760 16.580  1.00 41.35 ? 1240 GLU B OE1 1 
ATOM   4397 O OE2 . GLU B 1 271 ? -8.728  14.767 18.525  1.00 42.99 ? 1240 GLU B OE2 1 
ATOM   4398 N N   . LEU B 1 272 ? -5.076  17.391 21.726  1.00 25.68 ? 1241 LEU B N   1 
ATOM   4399 C CA  . LEU B 1 272 ? -4.253  16.988 22.852  1.00 25.48 ? 1241 LEU B CA  1 
ATOM   4400 C C   . LEU B 1 272 ? -4.135  18.129 23.877  1.00 26.47 ? 1241 LEU B C   1 
ATOM   4401 O O   . LEU B 1 272 ? -4.466  17.951 25.053  1.00 25.50 ? 1241 LEU B O   1 
ATOM   4402 C CB  . LEU B 1 272 ? -2.872  16.532 22.368  1.00 22.62 ? 1241 LEU B CB  1 
ATOM   4403 C CG  . LEU B 1 272 ? -2.695  15.009 22.384  1.00 20.24 ? 1241 LEU B CG  1 
ATOM   4404 C CD1 . LEU B 1 272 ? -1.378  14.609 21.775  1.00 17.90 ? 1241 LEU B CD1 1 
ATOM   4405 C CD2 . LEU B 1 272 ? -2.779  14.518 23.814  1.00 18.60 ? 1241 LEU B CD2 1 
ATOM   4406 N N   . MET B 1 273 ? -3.686  19.300 23.430  1.00 27.67 ? 1242 MET B N   1 
ATOM   4407 C CA  . MET B 1 273 ? -3.555  20.460 24.316  1.00 28.20 ? 1242 MET B CA  1 
ATOM   4408 C C   . MET B 1 273 ? -4.868  20.727 25.031  1.00 27.94 ? 1242 MET B C   1 
ATOM   4409 O O   . MET B 1 273 ? -4.887  21.014 26.227  1.00 29.40 ? 1242 MET B O   1 
ATOM   4410 C CB  . MET B 1 273 ? -3.171  21.712 23.521  1.00 30.09 ? 1242 MET B CB  1 
ATOM   4411 C CG  . MET B 1 273 ? -1.809  21.654 22.841  1.00 33.01 ? 1242 MET B CG  1 
ATOM   4412 S SD  . MET B 1 273 ? -1.466  23.142 21.873  1.00 39.13 ? 1242 MET B SD  1 
ATOM   4413 C CE  . MET B 1 273 ? -1.571  22.533 20.172  1.00 34.02 ? 1242 MET B CE  1 
ATOM   4414 N N   . ARG B 1 274 ? -5.966  20.627 24.289  1.00 27.82 ? 1243 ARG B N   1 
ATOM   4415 C CA  . ARG B 1 274 ? -7.298  20.870 24.828  1.00 27.98 ? 1243 ARG B CA  1 
ATOM   4416 C C   . ARG B 1 274 ? -7.643  19.922 25.972  1.00 28.97 ? 1243 ARG B C   1 
ATOM   4417 O O   . ARG B 1 274 ? -8.258  20.329 26.952  1.00 30.21 ? 1243 ARG B O   1 
ATOM   4418 C CB  . ARG B 1 274 ? -8.336  20.737 23.720  1.00 27.66 ? 1243 ARG B CB  1 
ATOM   4419 C CG  . ARG B 1 274 ? -9.684  21.302 24.062  1.00 31.04 ? 1243 ARG B CG  1 
ATOM   4420 C CD  . ARG B 1 274 ? -9.581  22.790 24.365  1.00 36.84 ? 1243 ARG B CD  1 
ATOM   4421 N NE  . ARG B 1 274 ? -10.849 23.508 24.194  1.00 40.04 ? 1243 ARG B NE  1 
ATOM   4422 C CZ  . ARG B 1 274 ? -11.984 23.224 24.834  1.00 42.30 ? 1243 ARG B CZ  1 
ATOM   4423 N NH1 . ARG B 1 274 ? -12.048 22.223 25.715  1.00 40.43 ? 1243 ARG B NH1 1 
ATOM   4424 N NH2 . ARG B 1 274 ? -13.068 23.947 24.580  1.00 43.08 ? 1243 ARG B NH2 1 
ATOM   4425 N N   . MET B 1 275 ? -7.270  18.652 25.843  1.00 28.72 ? 1244 MET B N   1 
ATOM   4426 C CA  . MET B 1 275 ? -7.543  17.687 26.896  1.00 27.69 ? 1244 MET B CA  1 
ATOM   4427 C C   . MET B 1 275 ? -6.535  17.952 28.017  1.00 26.88 ? 1244 MET B C   1 
ATOM   4428 O O   . MET B 1 275 ? -6.824  17.770 29.202  1.00 26.36 ? 1244 MET B O   1 
ATOM   4429 C CB  . MET B 1 275 ? -7.406  16.252 26.359  1.00 30.26 ? 1244 MET B CB  1 
ATOM   4430 C CG  . MET B 1 275 ? -8.475  15.857 25.344  1.00 30.84 ? 1244 MET B CG  1 
ATOM   4431 S SD  . MET B 1 275 ? -10.169 16.156 25.955  1.00 37.68 ? 1244 MET B SD  1 
ATOM   4432 C CE  . MET B 1 275 ? -11.020 14.628 25.476  1.00 34.51 ? 1244 MET B CE  1 
ATOM   4433 N N   . CYS B 1 276 ? -5.350  18.401 27.626  1.00 25.60 ? 1245 CYS B N   1 
ATOM   4434 C CA  . CYS B 1 276 ? -4.307  18.720 28.581  1.00 26.20 ? 1245 CYS B CA  1 
ATOM   4435 C C   . CYS B 1 276 ? -4.653  19.974 29.375  1.00 26.48 ? 1245 CYS B C   1 
ATOM   4436 O O   . CYS B 1 276 ? -4.089  20.211 30.446  1.00 28.18 ? 1245 CYS B O   1 
ATOM   4437 C CB  . CYS B 1 276 ? -2.972  18.920 27.864  1.00 27.02 ? 1245 CYS B CB  1 
ATOM   4438 S SG  . CYS B 1 276 ? -2.144  17.371 27.391  1.00 27.69 ? 1245 CYS B SG  1 
ATOM   4439 N N   . TRP B 1 277 ? -5.587  20.771 28.860  1.00 25.12 ? 1246 TRP B N   1 
ATOM   4440 C CA  . TRP B 1 277 ? -5.985  21.998 29.546  1.00 23.23 ? 1246 TRP B CA  1 
ATOM   4441 C C   . TRP B 1 277 ? -7.362  21.963 30.227  1.00 22.63 ? 1246 TRP B C   1 
ATOM   4442 O O   . TRP B 1 277 ? -7.963  23.013 30.526  1.00 20.11 ? 1246 TRP B O   1 
ATOM   4443 C CB  . TRP B 1 277 ? -5.883  23.181 28.585  1.00 22.63 ? 1246 TRP B CB  1 
ATOM   4444 C CG  . TRP B 1 277 ? -4.495  23.358 28.092  1.00 20.54 ? 1246 TRP B CG  1 
ATOM   4445 C CD1 . TRP B 1 277 ? -3.357  23.047 28.762  1.00 20.90 ? 1246 TRP B CD1 1 
ATOM   4446 C CD2 . TRP B 1 277 ? -4.087  23.907 26.834  1.00 20.58 ? 1246 TRP B CD2 1 
ATOM   4447 N NE1 . TRP B 1 277 ? -2.260  23.365 28.005  1.00 21.90 ? 1246 TRP B NE1 1 
ATOM   4448 C CE2 . TRP B 1 277 ? -2.678  23.897 26.816  1.00 21.09 ? 1246 TRP B CE2 1 
ATOM   4449 C CE3 . TRP B 1 277 ? -4.774  24.410 25.721  1.00 20.64 ? 1246 TRP B CE3 1 
ATOM   4450 C CZ2 . TRP B 1 277 ? -1.938  24.370 25.728  1.00 20.11 ? 1246 TRP B CZ2 1 
ATOM   4451 C CZ3 . TRP B 1 277 ? -4.039  24.880 24.643  1.00 20.69 ? 1246 TRP B CZ3 1 
ATOM   4452 C CH2 . TRP B 1 277 ? -2.633  24.856 24.655  1.00 19.77 ? 1246 TRP B CH2 1 
ATOM   4453 N N   . GLN B 1 278 ? -7.853  20.751 30.480  1.00 20.64 ? 1247 GLN B N   1 
ATOM   4454 C CA  . GLN B 1 278 ? -9.117  20.592 31.175  1.00 19.88 ? 1247 GLN B CA  1 
ATOM   4455 C C   . GLN B 1 278 ? -8.927  21.327 32.498  1.00 20.02 ? 1247 GLN B C   1 
ATOM   4456 O O   . GLN B 1 278 ? -8.000  21.014 33.247  1.00 18.18 ? 1247 GLN B O   1 
ATOM   4457 C CB  . GLN B 1 278 ? -9.392  19.109 31.453  1.00 21.02 ? 1247 GLN B CB  1 
ATOM   4458 C CG  . GLN B 1 278 ? -9.768  18.287 30.235  1.00 18.87 ? 1247 GLN B CG  1 
ATOM   4459 C CD  . GLN B 1 278 ? -11.064 18.763 29.587  1.00 18.58 ? 1247 GLN B CD  1 
ATOM   4460 O OE1 . GLN B 1 278 ? -12.134 18.697 30.195  1.00 15.27 ? 1247 GLN B OE1 1 
ATOM   4461 N NE2 . GLN B 1 278 ? -10.969 19.251 28.346  1.00 16.54 ? 1247 GLN B NE2 1 
ATOM   4462 N N   . TYR B 1 279 ? -9.788  22.301 32.787  1.00 21.23 ? 1248 TYR B N   1 
ATOM   4463 C CA  . TYR B 1 279 ? -9.677  23.050 34.038  1.00 21.99 ? 1248 TYR B CA  1 
ATOM   4464 C C   . TYR B 1 279 ? -9.593  22.124 35.267  1.00 22.68 ? 1248 TYR B C   1 
ATOM   4465 O O   . TYR B 1 279 ? -8.781  22.356 36.155  1.00 23.62 ? 1248 TYR B O   1 
ATOM   4466 C CB  . TYR B 1 279 ? -10.847 24.020 34.204  1.00 21.31 ? 1248 TYR B CB  1 
ATOM   4467 C CG  . TYR B 1 279 ? -10.562 25.086 35.241  1.00 21.71 ? 1248 TYR B CG  1 
ATOM   4468 C CD1 . TYR B 1 279 ? -9.840  26.234 34.907  1.00 21.12 ? 1248 TYR B CD1 1 
ATOM   4469 C CD2 . TYR B 1 279 ? -10.953 24.920 36.571  1.00 19.98 ? 1248 TYR B CD2 1 
ATOM   4470 C CE1 . TYR B 1 279 ? -9.515  27.186 35.871  1.00 20.80 ? 1248 TYR B CE1 1 
ATOM   4471 C CE2 . TYR B 1 279 ? -10.627 25.867 37.542  1.00 19.22 ? 1248 TYR B CE2 1 
ATOM   4472 C CZ  . TYR B 1 279 ? -9.909  26.991 37.182  1.00 19.84 ? 1248 TYR B CZ  1 
ATOM   4473 O OH  . TYR B 1 279 ? -9.564  27.910 38.130  1.00 20.93 ? 1248 TYR B OH  1 
ATOM   4474 N N   . ASN B 1 280 ? -10.432 21.090 35.326  1.00 23.40 ? 1249 ASN B N   1 
ATOM   4475 C CA  . ASN B 1 280 ? -10.389 20.140 36.437  1.00 25.75 ? 1249 ASN B CA  1 
ATOM   4476 C C   . ASN B 1 280 ? -9.226  19.183 36.187  1.00 26.51 ? 1249 ASN B C   1 
ATOM   4477 O O   . ASN B 1 280 ? -9.179  18.511 35.154  1.00 26.56 ? 1249 ASN B O   1 
ATOM   4478 C CB  . ASN B 1 280 ? -11.686 19.345 36.520  1.00 28.30 ? 1249 ASN B CB  1 
ATOM   4479 C CG  . ASN B 1 280 ? -12.888 20.225 36.734  1.00 32.02 ? 1249 ASN B CG  1 
ATOM   4480 O OD1 . ASN B 1 280 ? -13.967 19.745 37.078  1.00 34.59 ? 1249 ASN B OD1 1 
ATOM   4481 N ND2 . ASN B 1 280 ? -12.716 21.526 36.526  1.00 34.55 ? 1249 ASN B ND2 1 
ATOM   4482 N N   . PRO B 1 281 ? -8.279  19.097 37.137  1.00 26.87 ? 1250 PRO B N   1 
ATOM   4483 C CA  . PRO B 1 281 ? -7.102  18.229 37.022  1.00 27.34 ? 1250 PRO B CA  1 
ATOM   4484 C C   . PRO B 1 281 ? -7.386  16.771 36.686  1.00 28.72 ? 1250 PRO B C   1 
ATOM   4485 O O   . PRO B 1 281 ? -6.862  16.238 35.707  1.00 28.78 ? 1250 PRO B O   1 
ATOM   4486 C CB  . PRO B 1 281 ? -6.424  18.389 38.376  1.00 25.23 ? 1250 PRO B CB  1 
ATOM   4487 C CG  . PRO B 1 281 ? -6.800  19.761 38.778  1.00 24.84 ? 1250 PRO B CG  1 
ATOM   4488 C CD  . PRO B 1 281 ? -8.259  19.816 38.421  1.00 25.78 ? 1250 PRO B CD  1 
ATOM   4489 N N   . LYS B 1 282 ? -8.218  16.127 37.495  1.00 30.51 ? 1251 LYS B N   1 
ATOM   4490 C CA  . LYS B 1 282 ? -8.546  14.723 37.272  1.00 30.90 ? 1251 LYS B CA  1 
ATOM   4491 C C   . LYS B 1 282 ? -9.126  14.407 35.889  1.00 30.22 ? 1251 LYS B C   1 
ATOM   4492 O O   . LYS B 1 282 ? -9.082  13.252 35.450  1.00 30.78 ? 1251 LYS B O   1 
ATOM   4493 C CB  . LYS B 1 282 ? -9.518  14.225 38.341  1.00 30.45 ? 1251 LYS B CB  1 
ATOM   4494 C CG  . LYS B 1 282 ? -8.928  14.128 39.726  1.00 31.85 ? 1251 LYS B CG  1 
ATOM   4495 C CD  . LYS B 1 282 ? -9.855  13.325 40.630  1.00 34.45 ? 1251 LYS B CD  1 
ATOM   4496 C CE  . LYS B 1 282 ? -9.376  13.316 42.075  1.00 35.08 ? 1251 LYS B CE  1 
ATOM   4497 N NZ  . LYS B 1 282 ? -9.430  14.682 42.671  1.00 36.33 ? 1251 LYS B NZ  1 
ATOM   4498 N N   . MET B 1 283 ? -9.662  15.411 35.199  1.00 28.12 ? 1252 MET B N   1 
ATOM   4499 C CA  . MET B 1 283 ? -10.255 15.155 33.890  1.00 26.64 ? 1252 MET B CA  1 
ATOM   4500 C C   . MET B 1 283 ? -9.245  15.217 32.761  1.00 25.92 ? 1252 MET B C   1 
ATOM   4501 O O   . MET B 1 283 ? -9.587  14.922 31.623  1.00 25.39 ? 1252 MET B O   1 
ATOM   4502 C CB  . MET B 1 283 ? -11.412 16.120 33.610  1.00 27.11 ? 1252 MET B CB  1 
ATOM   4503 C CG  . MET B 1 283 ? -12.481 16.119 34.698  1.00 29.39 ? 1252 MET B CG  1 
ATOM   4504 S SD  . MET B 1 283 ? -14.027 16.917 34.241  1.00 31.86 ? 1252 MET B SD  1 
ATOM   4505 C CE  . MET B 1 283 ? -13.427 18.566 33.725  1.00 34.55 ? 1252 MET B CE  1 
ATOM   4506 N N   . ARG B 1 284 ? -8.006  15.595 33.077  1.00 25.65 ? 1253 ARG B N   1 
ATOM   4507 C CA  . ARG B 1 284 ? -6.935  15.665 32.079  1.00 24.68 ? 1253 ARG B CA  1 
ATOM   4508 C C   . ARG B 1 284 ? -6.355  14.265 31.897  1.00 25.24 ? 1253 ARG B C   1 
ATOM   4509 O O   . ARG B 1 284 ? -6.336  13.462 32.839  1.00 25.68 ? 1253 ARG B O   1 
ATOM   4510 C CB  . ARG B 1 284 ? -5.824  16.614 32.531  1.00 23.24 ? 1253 ARG B CB  1 
ATOM   4511 C CG  . ARG B 1 284 ? -6.242  18.067 32.669  1.00 23.62 ? 1253 ARG B CG  1 
ATOM   4512 C CD  . ARG B 1 284 ? -5.193  18.890 33.443  1.00 21.69 ? 1253 ARG B CD  1 
ATOM   4513 N NE  . ARG B 1 284 ? -5.783  20.094 34.022  1.00 20.31 ? 1253 ARG B NE  1 
ATOM   4514 C CZ  . ARG B 1 284 ? -5.195  20.850 34.939  1.00 18.61 ? 1253 ARG B CZ  1 
ATOM   4515 N NH1 . ARG B 1 284 ? -3.990  20.522 35.378  1.00 18.16 ? 1253 ARG B NH1 1 
ATOM   4516 N NH2 . ARG B 1 284 ? -5.815  21.918 35.427  1.00 14.24 ? 1253 ARG B NH2 1 
ATOM   4517 N N   . PRO B 1 285 ? -5.869  13.947 30.685  1.00 25.19 ? 1254 PRO B N   1 
ATOM   4518 C CA  . PRO B 1 285 ? -5.308  12.611 30.469  1.00 23.53 ? 1254 PRO B CA  1 
ATOM   4519 C C   . PRO B 1 285 ? -3.966  12.438 31.154  1.00 23.66 ? 1254 PRO B C   1 
ATOM   4520 O O   . PRO B 1 285 ? -3.264  13.414 31.429  1.00 23.05 ? 1254 PRO B O   1 
ATOM   4521 C CB  . PRO B 1 285 ? -5.188  12.532 28.950  1.00 22.91 ? 1254 PRO B CB  1 
ATOM   4522 C CG  . PRO B 1 285 ? -4.846  13.946 28.579  1.00 23.37 ? 1254 PRO B CG  1 
ATOM   4523 C CD  . PRO B 1 285 ? -5.791  14.759 29.453  1.00 24.69 ? 1254 PRO B CD  1 
ATOM   4524 N N   . SER B 1 286 ? -3.620  11.189 31.444  1.00 22.93 ? 1255 SER B N   1 
ATOM   4525 C CA  . SER B 1 286 ? -2.337  10.883 32.054  1.00 22.07 ? 1255 SER B CA  1 
ATOM   4526 C C   . SER B 1 286 ? -1.335  10.768 30.902  1.00 21.44 ? 1255 SER B C   1 
ATOM   4527 O O   . SER B 1 286 ? -1.725  10.697 29.738  1.00 19.19 ? 1255 SER B O   1 
ATOM   4528 C CB  . SER B 1 286 ? -2.423  9.564  32.805  1.00 22.45 ? 1255 SER B CB  1 
ATOM   4529 O OG  . SER B 1 286 ? -2.880  8.545  31.938  1.00 26.21 ? 1255 SER B OG  1 
ATOM   4530 N N   . PHE B 1 287 ? -0.046  10.758 31.215  1.00 22.02 ? 1256 PHE B N   1 
ATOM   4531 C CA  . PHE B 1 287 ? 0.967   10.648 30.172  1.00 21.86 ? 1256 PHE B CA  1 
ATOM   4532 C C   . PHE B 1 287 ? 0.860   9.330  29.404  1.00 22.00 ? 1256 PHE B C   1 
ATOM   4533 O O   . PHE B 1 287 ? 1.000   9.318  28.183  1.00 19.38 ? 1256 PHE B O   1 
ATOM   4534 C CB  . PHE B 1 287 ? 2.360   10.806 30.778  1.00 19.75 ? 1256 PHE B CB  1 
ATOM   4535 C CG  . PHE B 1 287 ? 2.651   12.198 31.232  1.00 18.87 ? 1256 PHE B CG  1 
ATOM   4536 C CD1 . PHE B 1 287 ? 2.964   13.191 30.307  1.00 19.38 ? 1256 PHE B CD1 1 
ATOM   4537 C CD2 . PHE B 1 287 ? 2.558   12.540 32.579  1.00 18.17 ? 1256 PHE B CD2 1 
ATOM   4538 C CE1 . PHE B 1 287 ? 3.179   14.507 30.717  1.00 17.51 ? 1256 PHE B CE1 1 
ATOM   4539 C CE2 . PHE B 1 287 ? 2.769   13.850 32.996  1.00 18.20 ? 1256 PHE B CE2 1 
ATOM   4540 C CZ  . PHE B 1 287 ? 3.080   14.835 32.061  1.00 18.15 ? 1256 PHE B CZ  1 
ATOM   4541 N N   . LEU B 1 288 ? 0.598   8.235  30.119  1.00 22.83 ? 1257 LEU B N   1 
ATOM   4542 C CA  . LEU B 1 288 ? 0.472   6.918  29.491  1.00 24.30 ? 1257 LEU B CA  1 
ATOM   4543 C C   . LEU B 1 288 ? -0.730  6.883  28.559  1.00 25.83 ? 1257 LEU B C   1 
ATOM   4544 O O   . LEU B 1 288 ? -0.736  6.175  27.542  1.00 27.45 ? 1257 LEU B O   1 
ATOM   4545 C CB  . LEU B 1 288 ? 0.356   5.821  30.563  1.00 24.24 ? 1257 LEU B CB  1 
ATOM   4546 C CG  . LEU B 1 288 ? 1.686   5.418  31.224  1.00 24.44 ? 1257 LEU B CG  1 
ATOM   4547 C CD1 . LEU B 1 288 ? 1.456   4.563  32.438  1.00 25.12 ? 1257 LEU B CD1 1 
ATOM   4548 C CD2 . LEU B 1 288 ? 2.527   4.667  30.226  1.00 24.52 ? 1257 LEU B CD2 1 
ATOM   4549 N N   . GLU B 1 289 ? -1.745  7.662  28.902  1.00 25.66 ? 1258 GLU B N   1 
ATOM   4550 C CA  . GLU B 1 289 ? -2.945  7.739  28.089  1.00 26.28 ? 1258 GLU B CA  1 
ATOM   4551 C C   . GLU B 1 289 ? -2.627  8.562  26.844  1.00 25.87 ? 1258 GLU B C   1 
ATOM   4552 O O   . GLU B 1 289 ? -3.130  8.271  25.761  1.00 27.27 ? 1258 GLU B O   1 
ATOM   4553 C CB  . GLU B 1 289 ? -4.055  8.410  28.883  1.00 29.30 ? 1258 GLU B CB  1 
ATOM   4554 C CG  . GLU B 1 289 ? -5.346  7.636  28.957  1.00 33.86 ? 1258 GLU B CG  1 
ATOM   4555 C CD  . GLU B 1 289 ? -6.168  8.052  30.160  1.00 36.65 ? 1258 GLU B CD  1 
ATOM   4556 O OE1 . GLU B 1 289 ? -6.371  9.271  30.355  1.00 36.76 ? 1258 GLU B OE1 1 
ATOM   4557 O OE2 . GLU B 1 289 ? -6.606  7.156  30.912  1.00 39.62 ? 1258 GLU B OE2 1 
ATOM   4558 N N   . ILE B 1 290 ? -1.792  9.591  27.003  1.00 24.01 ? 1259 ILE B N   1 
ATOM   4559 C CA  . ILE B 1 290 ? -1.408  10.446 25.881  1.00 21.60 ? 1259 ILE B CA  1 
ATOM   4560 C C   . ILE B 1 290 ? -0.586  9.646  24.888  1.00 21.27 ? 1259 ILE B C   1 
ATOM   4561 O O   . ILE B 1 290 ? -0.756  9.782  23.682  1.00 22.31 ? 1259 ILE B O   1 
ATOM   4562 C CB  . ILE B 1 290 ? -0.590  11.679 26.342  1.00 20.01 ? 1259 ILE B CB  1 
ATOM   4563 C CG1 . ILE B 1 290 ? -1.482  12.632 27.148  1.00 18.49 ? 1259 ILE B CG1 1 
ATOM   4564 C CG2 . ILE B 1 290 ? -0.016  12.397 25.141  1.00 15.39 ? 1259 ILE B CG2 1 
ATOM   4565 C CD1 . ILE B 1 290 ? -0.730  13.751 27.825  1.00 15.85 ? 1259 ILE B CD1 1 
ATOM   4566 N N   . ILE B 1 291 ? 0.305   8.810  25.404  1.00 21.92 ? 1260 ILE B N   1 
ATOM   4567 C CA  . ILE B 1 291 ? 1.144   7.964  24.561  1.00 23.40 ? 1260 ILE B CA  1 
ATOM   4568 C C   . ILE B 1 291 ? 0.226   6.951  23.893  1.00 23.71 ? 1260 ILE B C   1 
ATOM   4569 O O   . ILE B 1 291 ? 0.259   6.761  22.681  1.00 22.00 ? 1260 ILE B O   1 
ATOM   4570 C CB  . ILE B 1 291 ? 2.204   7.204  25.402  1.00 21.96 ? 1260 ILE B CB  1 
ATOM   4571 C CG1 . ILE B 1 291 ? 3.111   8.207  26.108  1.00 20.20 ? 1260 ILE B CG1 1 
ATOM   4572 C CG2 . ILE B 1 291 ? 3.009   6.257  24.508  1.00 20.83 ? 1260 ILE B CG2 1 
ATOM   4573 C CD1 . ILE B 1 291 ? 4.010   7.599  27.139  1.00 22.59 ? 1260 ILE B CD1 1 
ATOM   4574 N N   . SER B 1 292 ? -0.607  6.322  24.715  1.00 25.33 ? 1261 SER B N   1 
ATOM   4575 C CA  . SER B 1 292 ? -1.564  5.319  24.267  1.00 27.48 ? 1261 SER B CA  1 
ATOM   4576 C C   . SER B 1 292 ? -2.486  5.682  23.091  1.00 27.34 ? 1261 SER B C   1 
ATOM   4577 O O   . SER B 1 292 ? -2.943  4.790  22.374  1.00 28.78 ? 1261 SER B O   1 
ATOM   4578 C CB  . SER B 1 292 ? -2.434  4.897  25.441  1.00 27.54 ? 1261 SER B CB  1 
ATOM   4579 O OG  . SER B 1 292 ? -3.602  4.268  24.954  1.00 32.00 ? 1261 SER B OG  1 
ATOM   4580 N N   . SER B 1 293 ? -2.784  6.967  22.900  1.00 26.34 ? 1262 SER B N   1 
ATOM   4581 C CA  . SER B 1 293 ? -3.662  7.370  21.803  1.00 24.92 ? 1262 SER B CA  1 
ATOM   4582 C C   . SER B 1 293 ? -2.877  7.845  20.591  1.00 25.22 ? 1262 SER B C   1 
ATOM   4583 O O   . SER B 1 293 ? -3.471  8.295  19.613  1.00 25.71 ? 1262 SER B O   1 
ATOM   4584 C CB  . SER B 1 293 ? -4.600  8.488  22.239  1.00 25.21 ? 1262 SER B CB  1 
ATOM   4585 O OG  . SER B 1 293 ? -3.919  9.730  22.247  1.00 26.61 ? 1262 SER B OG  1 
ATOM   4586 N N   . ILE B 1 294 ? -1.548  7.762  20.659  1.00 24.17 ? 1263 ILE B N   1 
ATOM   4587 C CA  . ILE B 1 294 ? -0.703  8.177  19.547  1.00 23.75 ? 1263 ILE B CA  1 
ATOM   4588 C C   . ILE B 1 294 ? 0.416   7.162  19.244  1.00 26.33 ? 1263 ILE B C   1 
ATOM   4589 O O   . ILE B 1 294 ? 1.440   7.516  18.658  1.00 24.83 ? 1263 ILE B O   1 
ATOM   4590 C CB  . ILE B 1 294 ? -0.070  9.567  19.813  1.00 22.40 ? 1263 ILE B CB  1 
ATOM   4591 C CG1 . ILE B 1 294 ? 0.911   9.484  20.986  1.00 23.27 ? 1263 ILE B CG1 1 
ATOM   4592 C CG2 . ILE B 1 294 ? -1.153  10.592 20.117  1.00 16.93 ? 1263 ILE B CG2 1 
ATOM   4593 C CD1 . ILE B 1 294 ? 1.867   10.668 21.074  1.00 21.31 ? 1263 ILE B CD1 1 
ATOM   4594 N N   . LYS B 1 295 ? 0.207   5.905  19.641  1.00 29.41 ? 1264 LYS B N   1 
ATOM   4595 C CA  . LYS B 1 295 ? 1.176   4.819  19.428  1.00 32.97 ? 1264 LYS B CA  1 
ATOM   4596 C C   . LYS B 1 295 ? 1.406   4.519  17.947  1.00 35.30 ? 1264 LYS B C   1 
ATOM   4597 O O   . LYS B 1 295 ? 2.550   4.412  17.496  1.00 35.70 ? 1264 LYS B O   1 
ATOM   4598 C CB  . LYS B 1 295 ? 0.702   3.517  20.090  1.00 33.37 ? 1264 LYS B CB  1 
ATOM   4599 C CG  . LYS B 1 295 ? 0.296   3.628  21.547  1.00 37.28 ? 1264 LYS B CG  1 
ATOM   4600 C CD  . LYS B 1 295 ? 0.034   2.252  22.174  1.00 37.23 ? 1264 LYS B CD  1 
ATOM   4601 C CE  . LYS B 1 295 ? -1.138  1.513  21.537  1.00 39.37 ? 1264 LYS B CE  1 
ATOM   4602 N NZ  . LYS B 1 295 ? -2.460  2.163  21.769  1.00 39.57 ? 1264 LYS B NZ  1 
ATOM   4603 N N   . GLU B 1 296 ? 0.313   4.362  17.205  1.00 36.26 ? 1265 GLU B N   1 
ATOM   4604 C CA  . GLU B 1 296 ? 0.382   4.061  15.781  1.00 38.46 ? 1265 GLU B CA  1 
ATOM   4605 C C   . GLU B 1 296 ? 1.254   5.077  15.068  1.00 38.47 ? 1265 GLU B C   1 
ATOM   4606 O O   . GLU B 1 296 ? 1.988   4.731  14.152  1.00 39.81 ? 1265 GLU B O   1 
ATOM   4607 C CB  . GLU B 1 296 ? -1.014  4.089  15.157  1.00 41.30 ? 1265 GLU B CB  1 
ATOM   4608 C CG  . GLU B 1 296 ? -2.118  3.513  16.032  1.00 45.53 ? 1265 GLU B CG  1 
ATOM   4609 C CD  . GLU B 1 296 ? -1.964  2.028  16.290  1.00 48.50 ? 1265 GLU B CD  1 
ATOM   4610 O OE1 . GLU B 1 296 ? -0.873  1.608  16.737  1.00 50.64 ? 1265 GLU B OE1 1 
ATOM   4611 O OE2 . GLU B 1 296 ? -2.941  1.283  16.053  1.00 49.67 ? 1265 GLU B OE2 1 
ATOM   4612 N N   . GLU B 1 297 ? 1.172   6.332  15.500  1.00 39.08 ? 1266 GLU B N   1 
ATOM   4613 C CA  . GLU B 1 297 ? 1.942   7.423  14.899  1.00 38.80 ? 1266 GLU B CA  1 
ATOM   4614 C C   . GLU B 1 297 ? 3.400   7.491  15.352  1.00 38.17 ? 1266 GLU B C   1 
ATOM   4615 O O   . GLU B 1 297 ? 4.171   8.300  14.837  1.00 39.23 ? 1266 GLU B O   1 
ATOM   4616 C CB  . GLU B 1 297 ? 1.271   8.766  15.203  1.00 39.34 ? 1266 GLU B CB  1 
ATOM   4617 C CG  . GLU B 1 297 ? -0.197  8.820  14.840  1.00 40.46 ? 1266 GLU B CG  1 
ATOM   4618 C CD  . GLU B 1 297 ? -0.424  8.705  13.351  1.00 41.92 ? 1266 GLU B CD  1 
ATOM   4619 O OE1 . GLU B 1 297 ? -1.591  8.535  12.943  1.00 43.40 ? 1266 GLU B OE1 1 
ATOM   4620 O OE2 . GLU B 1 297 ? 0.562   8.795  12.589  1.00 42.55 ? 1266 GLU B OE2 1 
ATOM   4621 N N   . MET B 1 298 ? 3.783   6.651  16.307  1.00 37.47 ? 1267 MET B N   1 
ATOM   4622 C CA  . MET B 1 298 ? 5.153   6.668  16.802  1.00 37.78 ? 1267 MET B CA  1 
ATOM   4623 C C   . MET B 1 298 ? 6.123   5.861  15.960  1.00 38.01 ? 1267 MET B C   1 
ATOM   4624 O O   . MET B 1 298 ? 5.753   4.850  15.372  1.00 39.12 ? 1267 MET B O   1 
ATOM   4625 C CB  . MET B 1 298 ? 5.197   6.164  18.245  1.00 38.40 ? 1267 MET B CB  1 
ATOM   4626 C CG  . MET B 1 298 ? 4.544   7.116  19.248  1.00 39.50 ? 1267 MET B CG  1 
ATOM   4627 S SD  . MET B 1 298 ? 5.238   8.784  19.205  1.00 35.09 ? 1267 MET B SD  1 
ATOM   4628 C CE  . MET B 1 298 ? 6.653   8.595  20.354  1.00 34.84 ? 1267 MET B CE  1 
ATOM   4629 N N   . GLU B 1 299 ? 7.370   6.320  15.913  1.00 38.04 ? 1268 GLU B N   1 
ATOM   4630 C CA  . GLU B 1 299 ? 8.431   5.653  15.162  1.00 38.55 ? 1268 GLU B CA  1 
ATOM   4631 C C   . GLU B 1 299 ? 8.504   4.180  15.580  1.00 38.19 ? 1268 GLU B C   1 
ATOM   4632 O O   . GLU B 1 299 ? 8.200   3.833  16.720  1.00 38.52 ? 1268 GLU B O   1 
ATOM   4633 C CB  . GLU B 1 299 ? 9.766   6.336  15.455  1.00 40.41 ? 1268 GLU B CB  1 
ATOM   4634 C CG  . GLU B 1 299 ? 10.635  6.554  14.243  1.00 43.89 ? 1268 GLU B CG  1 
ATOM   4635 C CD  . GLU B 1 299 ? 10.043  7.563  13.282  1.00 46.93 ? 1268 GLU B CD  1 
ATOM   4636 O OE1 . GLU B 1 299 ? 8.849   7.425  12.943  1.00 49.67 ? 1268 GLU B OE1 1 
ATOM   4637 O OE2 . GLU B 1 299 ? 10.771  8.489  12.857  1.00 48.75 ? 1268 GLU B OE2 1 
ATOM   4638 N N   . PRO B 1 300 ? 8.914   3.291  14.665  1.00 37.60 ? 1269 PRO B N   1 
ATOM   4639 C CA  . PRO B 1 300 ? 8.992   1.872  15.026  1.00 36.56 ? 1269 PRO B CA  1 
ATOM   4640 C C   . PRO B 1 300 ? 9.939   1.589  16.182  1.00 36.45 ? 1269 PRO B C   1 
ATOM   4641 O O   . PRO B 1 300 ? 9.730   0.649  16.952  1.00 37.14 ? 1269 PRO B O   1 
ATOM   4642 C CB  . PRO B 1 300 ? 9.445   1.214  13.730  1.00 37.77 ? 1269 PRO B CB  1 
ATOM   4643 C CG  . PRO B 1 300 ? 8.836   2.101  12.677  1.00 37.82 ? 1269 PRO B CG  1 
ATOM   4644 C CD  . PRO B 1 300 ? 9.138   3.478  13.221  1.00 38.10 ? 1269 PRO B CD  1 
ATOM   4645 N N   . GLY B 1 301 ? 10.974  2.414  16.307  1.00 35.98 ? 1270 GLY B N   1 
ATOM   4646 C CA  . GLY B 1 301 ? 11.944  2.235  17.371  1.00 34.28 ? 1270 GLY B CA  1 
ATOM   4647 C C   . GLY B 1 301 ? 11.393  2.490  18.755  1.00 34.00 ? 1270 GLY B C   1 
ATOM   4648 O O   . GLY B 1 301 ? 11.804  1.844  19.713  1.00 35.06 ? 1270 GLY B O   1 
ATOM   4649 N N   . PHE B 1 302 ? 10.463  3.433  18.858  1.00 32.78 ? 1271 PHE B N   1 
ATOM   4650 C CA  . PHE B 1 302 ? 9.855   3.782  20.134  1.00 33.00 ? 1271 PHE B CA  1 
ATOM   4651 C C   . PHE B 1 302 ? 9.520   2.541  20.958  1.00 32.59 ? 1271 PHE B C   1 
ATOM   4652 O O   . PHE B 1 302 ? 9.661   2.541  22.175  1.00 32.63 ? 1271 PHE B O   1 
ATOM   4653 C CB  . PHE B 1 302 ? 8.582   4.611  19.900  1.00 32.51 ? 1271 PHE B CB  1 
ATOM   4654 C CG  . PHE B 1 302 ? 7.985   5.183  21.161  1.00 32.47 ? 1271 PHE B CG  1 
ATOM   4655 C CD1 . PHE B 1 302 ? 8.644   6.192  21.867  1.00 31.30 ? 1271 PHE B CD1 1 
ATOM   4656 C CD2 . PHE B 1 302 ? 6.761   4.715  21.647  1.00 31.79 ? 1271 PHE B CD2 1 
ATOM   4657 C CE1 . PHE B 1 302 ? 8.096   6.726  23.034  1.00 28.73 ? 1271 PHE B CE1 1 
ATOM   4658 C CE2 . PHE B 1 302 ? 6.208   5.243  22.813  1.00 29.82 ? 1271 PHE B CE2 1 
ATOM   4659 C CZ  . PHE B 1 302 ? 6.882   6.254  23.507  1.00 29.23 ? 1271 PHE B CZ  1 
ATOM   4660 N N   . ARG B 1 303 ? 9.085   1.478  20.293  1.00 33.15 ? 1272 ARG B N   1 
ATOM   4661 C CA  . ARG B 1 303 ? 8.726   0.256  21.003  1.00 34.22 ? 1272 ARG B CA  1 
ATOM   4662 C C   . ARG B 1 303 ? 9.927   -0.426 21.647  1.00 33.27 ? 1272 ARG B C   1 
ATOM   4663 O O   . ARG B 1 303 ? 9.782   -1.139 22.637  1.00 31.25 ? 1272 ARG B O   1 
ATOM   4664 C CB  . ARG B 1 303 ? 8.027   -0.728 20.058  1.00 35.91 ? 1272 ARG B CB  1 
ATOM   4665 C CG  . ARG B 1 303 ? 7.613   -2.024 20.732  1.00 38.99 ? 1272 ARG B CG  1 
ATOM   4666 C CD  . ARG B 1 303 ? 6.784   -2.924 19.814  1.00 43.41 ? 1272 ARG B CD  1 
ATOM   4667 N NE  . ARG B 1 303 ? 6.573   -4.243 20.414  1.00 45.99 ? 1272 ARG B NE  1 
ATOM   4668 C CZ  . ARG B 1 303 ? 7.546   -5.124 20.645  1.00 46.36 ? 1272 ARG B CZ  1 
ATOM   4669 N NH1 . ARG B 1 303 ? 7.267   -6.294 21.200  1.00 46.29 ? 1272 ARG B NH1 1 
ATOM   4670 N NH2 . ARG B 1 303 ? 8.799   -4.841 20.310  1.00 45.70 ? 1272 ARG B NH2 1 
ATOM   4671 N N   . GLU B 1 304 ? 11.109  -0.188 21.084  1.00 32.55 ? 1273 GLU B N   1 
ATOM   4672 C CA  . GLU B 1 304 ? 12.342  -0.790 21.567  1.00 32.11 ? 1273 GLU B CA  1 
ATOM   4673 C C   . GLU B 1 304 ? 13.045  -0.023 22.676  1.00 31.58 ? 1273 GLU B C   1 
ATOM   4674 O O   . GLU B 1 304 ? 13.903  -0.576 23.366  1.00 31.48 ? 1273 GLU B O   1 
ATOM   4675 C CB  . GLU B 1 304 ? 13.315  -0.965 20.399  1.00 33.63 ? 1273 GLU B CB  1 
ATOM   4676 C CG  . GLU B 1 304 ? 12.747  -1.797 19.279  1.00 38.03 ? 1273 GLU B CG  1 
ATOM   4677 C CD  . GLU B 1 304 ? 12.374  -3.182 19.753  1.00 40.39 ? 1273 GLU B CD  1 
ATOM   4678 O OE1 . GLU B 1 304 ? 11.553  -3.851 19.081  1.00 42.14 ? 1273 GLU B OE1 1 
ATOM   4679 O OE2 . GLU B 1 304 ? 12.911  -3.600 20.802  1.00 41.27 ? 1273 GLU B OE2 1 
ATOM   4680 N N   . VAL B 1 305 ? 12.682  1.241  22.861  1.00 30.46 ? 1274 VAL B N   1 
ATOM   4681 C CA  . VAL B 1 305 ? 13.341  2.055  23.869  1.00 29.92 ? 1274 VAL B CA  1 
ATOM   4682 C C   . VAL B 1 305 ? 12.456  2.635  24.954  1.00 29.31 ? 1274 VAL B C   1 
ATOM   4683 O O   . VAL B 1 305 ? 12.907  2.827  26.073  1.00 29.85 ? 1274 VAL B O   1 
ATOM   4684 C CB  . VAL B 1 305 ? 14.096  3.227  23.202  1.00 31.33 ? 1274 VAL B CB  1 
ATOM   4685 C CG1 . VAL B 1 305 ? 15.142  2.684  22.232  1.00 30.24 ? 1274 VAL B CG1 1 
ATOM   4686 C CG2 . VAL B 1 305 ? 13.107  4.143  22.466  1.00 30.56 ? 1274 VAL B CG2 1 
ATOM   4687 N N   . SER B 1 306 ? 11.199  2.902  24.621  1.00 29.30 ? 1275 SER B N   1 
ATOM   4688 C CA  . SER B 1 306 ? 10.239  3.513  25.544  1.00 29.09 ? 1275 SER B CA  1 
ATOM   4689 C C   . SER B 1 306 ? 9.947   2.800  26.860  1.00 29.94 ? 1275 SER B C   1 
ATOM   4690 O O   . SER B 1 306 ? 10.177  1.603  27.017  1.00 30.18 ? 1275 SER B O   1 
ATOM   4691 C CB  . SER B 1 306 ? 8.899   3.708  24.845  1.00 26.72 ? 1275 SER B CB  1 
ATOM   4692 O OG  . SER B 1 306 ? 8.209   2.475  24.803  1.00 25.95 ? 1275 SER B OG  1 
ATOM   4693 N N   . PHE B 1 307 ? 9.408   3.573  27.794  1.00 29.51 ? 1276 PHE B N   1 
ATOM   4694 C CA  . PHE B 1 307 ? 9.012   3.070  29.094  1.00 30.84 ? 1276 PHE B CA  1 
ATOM   4695 C C   . PHE B 1 307 ? 7.623   2.503  28.848  1.00 31.91 ? 1276 PHE B C   1 
ATOM   4696 O O   . PHE B 1 307 ? 7.215   1.501  29.439  1.00 31.89 ? 1276 PHE B O   1 
ATOM   4697 C CB  . PHE B 1 307 ? 8.947   4.225  30.113  1.00 31.22 ? 1276 PHE B CB  1 
ATOM   4698 C CG  . PHE B 1 307 ? 8.120   3.917  31.336  1.00 30.80 ? 1276 PHE B CG  1 
ATOM   4699 C CD1 . PHE B 1 307 ? 8.528   2.950  32.250  1.00 29.55 ? 1276 PHE B CD1 1 
ATOM   4700 C CD2 . PHE B 1 307 ? 6.909   4.565  31.550  1.00 30.52 ? 1276 PHE B CD2 1 
ATOM   4701 C CE1 . PHE B 1 307 ? 7.740   2.632  33.349  1.00 27.59 ? 1276 PHE B CE1 1 
ATOM   4702 C CE2 . PHE B 1 307 ? 6.114   4.248  32.652  1.00 29.58 ? 1276 PHE B CE2 1 
ATOM   4703 C CZ  . PHE B 1 307 ? 6.531   3.283  33.547  1.00 27.60 ? 1276 PHE B CZ  1 
ATOM   4704 N N   . TYR B 1 308 ? 6.903   3.149  27.945  1.00 32.08 ? 1277 TYR B N   1 
ATOM   4705 C CA  . TYR B 1 308 ? 5.562   2.712  27.626  1.00 33.72 ? 1277 TYR B CA  1 
ATOM   4706 C C   . TYR B 1 308 ? 5.513   1.203  27.416  1.00 35.01 ? 1277 TYR B C   1 
ATOM   4707 O O   . TYR B 1 308 ? 4.716   0.517  28.048  1.00 35.11 ? 1277 TYR B O   1 
ATOM   4708 C CB  . TYR B 1 308 ? 5.050   3.420  26.369  1.00 32.45 ? 1277 TYR B CB  1 
ATOM   4709 C CG  . TYR B 1 308 ? 3.572   3.224  26.146  1.00 31.09 ? 1277 TYR B CG  1 
ATOM   4710 C CD1 . TYR B 1 308 ? 2.637   3.749  27.040  1.00 30.09 ? 1277 TYR B CD1 1 
ATOM   4711 C CD2 . TYR B 1 308 ? 3.106   2.495  25.056  1.00 32.55 ? 1277 TYR B CD2 1 
ATOM   4712 C CE1 . TYR B 1 308 ? 1.274   3.553  26.855  1.00 31.00 ? 1277 TYR B CE1 1 
ATOM   4713 C CE2 . TYR B 1 308 ? 1.747   2.290  24.859  1.00 32.45 ? 1277 TYR B CE2 1 
ATOM   4714 C CZ  . TYR B 1 308 ? 0.834   2.822  25.759  1.00 32.36 ? 1277 TYR B CZ  1 
ATOM   4715 O OH  . TYR B 1 308 ? -0.512  2.629  25.546  1.00 33.30 ? 1277 TYR B OH  1 
ATOM   4716 N N   . TYR B 1 309 ? 6.370   0.687  26.536  1.00 36.44 ? 1278 TYR B N   1 
ATOM   4717 C CA  . TYR B 1 309 ? 6.370   -0.744 26.256  1.00 37.23 ? 1278 TYR B CA  1 
ATOM   4718 C C   . TYR B 1 309 ? 7.335   -1.514 27.122  1.00 38.74 ? 1278 TYR B C   1 
ATOM   4719 O O   . TYR B 1 309 ? 7.369   -2.735 27.056  1.00 38.77 ? 1278 TYR B O   1 
ATOM   4720 C CB  . TYR B 1 309 ? 6.722   -1.032 24.798  1.00 36.57 ? 1278 TYR B CB  1 
ATOM   4721 C CG  . TYR B 1 309 ? 5.779   -0.457 23.771  1.00 35.26 ? 1278 TYR B CG  1 
ATOM   4722 C CD1 . TYR B 1 309 ? 5.907   0.859  23.344  1.00 35.29 ? 1278 TYR B CD1 1 
ATOM   4723 C CD2 . TYR B 1 309 ? 4.775   -1.241 23.204  1.00 35.49 ? 1278 TYR B CD2 1 
ATOM   4724 C CE1 . TYR B 1 309 ? 5.063   1.382  22.373  1.00 35.91 ? 1278 TYR B CE1 1 
ATOM   4725 C CE2 . TYR B 1 309 ? 3.924   -0.728 22.237  1.00 34.66 ? 1278 TYR B CE2 1 
ATOM   4726 C CZ  . TYR B 1 309 ? 4.076   0.584  21.827  1.00 36.01 ? 1278 TYR B CZ  1 
ATOM   4727 O OH  . TYR B 1 309 ? 3.245   1.103  20.865  1.00 39.47 ? 1278 TYR B OH  1 
ATOM   4728 N N   . SER B 1 310 ? 8.127   -0.810 27.923  1.00 41.55 ? 1279 SER B N   1 
ATOM   4729 C CA  . SER B 1 310 ? 9.093   -1.478 28.790  1.00 42.96 ? 1279 SER B CA  1 
ATOM   4730 C C   . SER B 1 310 ? 8.365   -2.423 29.723  1.00 46.42 ? 1279 SER B C   1 
ATOM   4731 O O   . SER B 1 310 ? 7.196   -2.209 30.060  1.00 46.86 ? 1279 SER B O   1 
ATOM   4732 C CB  . SER B 1 310 ? 9.879   -0.465 29.616  1.00 41.23 ? 1279 SER B CB  1 
ATOM   4733 O OG  . SER B 1 310 ? 9.029   0.223  30.510  1.00 39.26 ? 1279 SER B OG  1 
ATOM   4734 N N   . GLU B 1 311 ? 9.065   -3.469 30.141  1.00 49.48 ? 1280 GLU B N   1 
ATOM   4735 C CA  . GLU B 1 311 ? 8.497   -4.467 31.032  1.00 52.07 ? 1280 GLU B CA  1 
ATOM   4736 C C   . GLU B 1 311 ? 8.140   -3.894 32.400  1.00 53.05 ? 1280 GLU B C   1 
ATOM   4737 O O   . GLU B 1 311 ? 7.502   -4.568 33.205  1.00 54.49 ? 1280 GLU B O   1 
ATOM   4738 C CB  . GLU B 1 311 ? 9.485   -5.630 31.193  1.00 53.38 ? 1280 GLU B CB  1 
ATOM   4739 C CG  . GLU B 1 311 ? 9.540   -6.582 29.995  1.00 55.51 ? 1280 GLU B CG  1 
ATOM   4740 C CD  . GLU B 1 311 ? 10.768  -7.488 30.008  1.00 56.36 ? 1280 GLU B CD  1 
ATOM   4741 O OE1 . GLU B 1 311 ? 11.050  -8.096 31.064  1.00 57.16 ? 1280 GLU B OE1 1 
ATOM   4742 O OE2 . GLU B 1 311 ? 11.447  -7.597 28.961  1.00 55.61 ? 1280 GLU B OE2 1 
ATOM   4743 N N   . GLU B 1 312 ? 8.530   -2.649 32.662  1.00 53.48 ? 1281 GLU B N   1 
ATOM   4744 C CA  . GLU B 1 312 ? 8.256   -2.041 33.958  1.00 53.83 ? 1281 GLU B CA  1 
ATOM   4745 C C   . GLU B 1 312 ? 7.029   -1.148 34.063  1.00 54.47 ? 1281 GLU B C   1 
ATOM   4746 O O   . GLU B 1 312 ? 6.951   -0.309 34.953  1.00 55.30 ? 1281 GLU B O   1 
ATOM   4747 C CB  . GLU B 1 312 ? 9.482   -1.273 34.435  1.00 54.89 ? 1281 GLU B CB  1 
ATOM   4748 C CG  . GLU B 1 312 ? 10.695  -2.156 34.624  1.00 57.98 ? 1281 GLU B CG  1 
ATOM   4749 C CD  . GLU B 1 312 ? 11.815  -1.462 35.371  1.00 60.00 ? 1281 GLU B CD  1 
ATOM   4750 O OE1 . GLU B 1 312 ? 11.608  -1.099 36.550  1.00 61.15 ? 1281 GLU B OE1 1 
ATOM   4751 O OE2 . GLU B 1 312 ? 12.902  -1.280 34.781  1.00 61.67 ? 1281 GLU B OE2 1 
ATOM   4752 N N   . ASN B 1 313 ? 6.070   -1.323 33.163  1.00 55.53 ? 1282 ASN B N   1 
ATOM   4753 C CA  . ASN B 1 313 ? 4.838   -0.541 33.195  1.00 56.33 ? 1282 ASN B CA  1 
ATOM   4754 C C   . ASN B 1 313 ? 3.676   -1.531 33.235  1.00 58.26 ? 1282 ASN B C   1 
ATOM   4755 O O   . ASN B 1 313 ? 3.139   -1.916 32.193  1.00 59.56 ? 1282 ASN B O   1 
ATOM   4756 C CB  . ASN B 1 313 ? 4.734   0.361  31.956  1.00 54.06 ? 1282 ASN B CB  1 
ATOM   4757 C CG  . ASN B 1 313 ? 3.406   1.106  31.880  1.00 53.56 ? 1282 ASN B CG  1 
ATOM   4758 O OD1 . ASN B 1 313 ? 2.974   1.741  32.844  1.00 53.53 ? 1282 ASN B OD1 1 
ATOM   4759 N ND2 . ASN B 1 313 ? 2.758   1.033  30.727  1.00 52.07 ? 1282 ASN B ND2 1 
ATOM   4760 N N   . LYS B 1 314 ? 3.300   -1.946 34.442  1.00 59.48 ? 1283 LYS B N   1 
ATOM   4761 C CA  . LYS B 1 314 ? 2.220   -2.912 34.636  1.00 61.12 ? 1283 LYS B CA  1 
ATOM   4762 C C   . LYS B 1 314 ? 0.825   -2.439 34.215  1.00 62.24 ? 1283 LYS B C   1 
ATOM   4763 O O   . LYS B 1 314 ? 0.696   -1.286 33.751  1.00 64.13 ? 1283 LYS B O   1 
ATOM   4764 C CB  . LYS B 1 314 ? 2.187   -3.360 36.100  1.00 60.97 ? 1283 LYS B CB  1 
ATOM   4765 C CG  . LYS B 1 314 ? 3.399   -4.178 36.519  1.00 61.11 ? 1283 LYS B CG  1 
ATOM   4766 C CD  . LYS B 1 314 ? 3.254   -4.741 37.931  1.00 61.86 ? 1283 LYS B CD  1 
ATOM   4767 C CE  . LYS B 1 314 ? 2.042   -5.657 38.071  1.00 60.18 ? 1283 LYS B CE  1 
ATOM   4768 N NZ  . LYS B 1 314 ? 0.758   -4.910 37.989  1.00 58.28 ? 1283 LYS B NZ  1 
HETATM 4769 O O   . HOH C 2 .   ? 36.429  17.344 61.256  1.00 6.17  ? 1    HOH A O   1 
HETATM 4770 O O   . HOH C 2 .   ? 26.753  29.514 67.933  1.00 5.33  ? 2    HOH A O   1 
HETATM 4771 O O   . HOH C 2 .   ? 15.742  26.555 73.783  1.00 10.41 ? 3    HOH A O   1 
HETATM 4772 O O   . HOH C 2 .   ? 2.263   27.841 73.767  1.00 23.09 ? 7    HOH A O   1 
HETATM 4773 O O   . HOH C 2 .   ? 2.473   13.768 79.027  1.00 17.99 ? 10   HOH A O   1 
HETATM 4774 O O   . HOH C 2 .   ? -13.334 11.781 59.417  1.00 10.75 ? 14   HOH A O   1 
HETATM 4775 O O   . HOH C 2 .   ? -16.610 6.260  67.298  1.00 34.26 ? 15   HOH A O   1 
HETATM 4776 O O   . HOH C 2 .   ? 15.113  14.556 85.217  1.00 20.19 ? 17   HOH A O   1 
HETATM 4777 O O   . HOH C 2 .   ? 34.110  27.990 69.534  1.00 25.24 ? 21   HOH A O   1 
HETATM 4778 O O   . HOH C 2 .   ? 20.611  21.614 65.912  1.00 11.45 ? 22   HOH A O   1 
HETATM 4779 O O   . HOH C 2 .   ? 18.740  24.921 67.174  1.00 21.57 ? 23   HOH A O   1 
HETATM 4780 O O   . HOH C 2 .   ? 8.785   7.536  68.585  1.00 13.90 ? 24   HOH A O   1 
HETATM 4781 O O   . HOH C 2 .   ? 18.366  25.362 61.290  1.00 27.19 ? 27   HOH A O   1 
HETATM 4782 O O   . HOH C 2 .   ? 1.708   23.127 63.174  1.00 20.53 ? 28   HOH A O   1 
HETATM 4783 O O   . HOH C 2 .   ? 13.891  28.932 94.246  1.00 32.03 ? 32   HOH A O   1 
HETATM 4784 O O   . HOH C 2 .   ? 25.312  8.210  67.657  1.00 9.24  ? 33   HOH A O   1 
HETATM 4785 O O   . HOH C 2 .   ? -3.368  17.886 46.079  1.00 31.95 ? 34   HOH A O   1 
HETATM 4786 O O   . HOH C 2 .   ? 31.842  13.752 81.513  1.00 29.47 ? 35   HOH A O   1 
HETATM 4787 O O   . HOH C 2 .   ? 23.419  2.117  65.519  1.00 29.14 ? 36   HOH A O   1 
HETATM 4788 O O   . HOH C 2 .   ? -5.538  26.138 48.831  1.00 18.42 ? 37   HOH A O   1 
HETATM 4789 O O   . HOH C 2 .   ? 13.425  27.193 99.094  1.00 13.52 ? 38   HOH A O   1 
HETATM 4790 O O   . HOH C 2 .   ? 29.861  26.795 73.326  1.00 14.12 ? 40   HOH A O   1 
HETATM 4791 O O   . HOH C 2 .   ? 31.830  13.216 65.402  1.00 11.49 ? 41   HOH A O   1 
HETATM 4792 O O   . HOH C 2 .   ? -15.298 19.971 61.017  1.00 19.25 ? 42   HOH A O   1 
HETATM 4793 O O   . HOH C 2 .   ? 26.339  27.913 70.268  1.00 19.83 ? 43   HOH A O   1 
HETATM 4794 O O   . HOH C 2 .   ? -10.443 10.442 58.613  1.00 25.44 ? 47   HOH A O   1 
HETATM 4795 O O   . HOH C 2 .   ? 25.171  11.203 66.231  1.00 31.28 ? 49   HOH A O   1 
HETATM 4796 O O   . HOH C 2 .   ? 29.112  5.670  67.673  1.00 14.59 ? 50   HOH A O   1 
HETATM 4797 O O   . HOH C 2 .   ? -3.401  17.844 82.368  1.00 32.29 ? 51   HOH A O   1 
HETATM 4798 O O   . HOH C 2 .   ? -3.895  19.623 49.015  1.00 46.30 ? 53   HOH A O   1 
HETATM 4799 O O   . HOH C 2 .   ? 17.109  38.720 62.997  1.00 30.94 ? 54   HOH A O   1 
HETATM 4800 O O   . HOH C 2 .   ? 24.924  23.493 64.354  1.00 28.92 ? 55   HOH A O   1 
HETATM 4801 O O   . HOH C 2 .   ? 12.206  19.355 68.213  1.00 14.21 ? 57   HOH A O   1 
HETATM 4802 O O   . HOH C 2 .   ? 18.049  29.630 76.443  1.00 50.81 ? 59   HOH A O   1 
HETATM 4803 O O   . HOH C 2 .   ? 5.543   26.022 66.288  1.00 37.80 ? 60   HOH A O   1 
HETATM 4804 O O   . HOH C 2 .   ? 2.628   12.946 52.885  1.00 28.72 ? 63   HOH A O   1 
HETATM 4805 O O   . HOH C 2 .   ? 10.905  36.367 71.631  1.00 27.43 ? 66   HOH A O   1 
HETATM 4806 O O   . HOH C 2 .   ? 0.339   11.464 77.465  1.00 24.86 ? 69   HOH A O   1 
HETATM 4807 O O   . HOH C 2 .   ? -2.401  30.515 53.248  1.00 53.37 ? 71   HOH A O   1 
HETATM 4808 O O   . HOH C 2 .   ? -12.529 16.195 74.832  1.00 27.98 ? 76   HOH A O   1 
HETATM 4809 O O   . HOH C 2 .   ? 29.736  13.979 66.421  1.00 12.40 ? 78   HOH A O   1 
HETATM 4810 O O   . HOH C 2 .   ? -15.705 12.573 69.296  1.00 18.24 ? 79   HOH A O   1 
HETATM 4811 O O   . HOH C 2 .   ? 37.353  28.952 73.438  1.00 21.72 ? 80   HOH A O   1 
HETATM 4812 O O   . HOH C 2 .   ? 27.408  36.694 77.610  1.00 35.60 ? 82   HOH A O   1 
HETATM 4813 O O   . HOH C 2 .   ? 17.850  -4.340 77.468  1.00 32.45 ? 84   HOH A O   1 
HETATM 4814 O O   . HOH C 2 .   ? -4.002  15.761 48.732  1.00 31.77 ? 86   HOH A O   1 
HETATM 4815 O O   . HOH C 2 .   ? 8.026   25.655 72.359  1.00 34.92 ? 89   HOH A O   1 
HETATM 4816 O O   . HOH C 2 .   ? 19.923  32.171 68.383  1.00 15.14 ? 90   HOH A O   1 
HETATM 4817 O O   . HOH C 2 .   ? 2.373   29.299 70.888  1.00 40.33 ? 91   HOH A O   1 
HETATM 4818 O O   . HOH C 2 .   ? 2.973   30.584 73.341  1.00 28.66 ? 92   HOH A O   1 
HETATM 4819 O O   . HOH C 2 .   ? 25.624  1.569  70.353  1.00 29.37 ? 95   HOH A O   1 
HETATM 4820 O O   . HOH C 2 .   ? 23.814  41.563 66.555  1.00 44.56 ? 97   HOH A O   1 
HETATM 4821 O O   . HOH C 2 .   ? 13.944  13.438 82.492  1.00 15.40 ? 98   HOH A O   1 
HETATM 4822 O O   . HOH C 2 .   ? 5.331   21.506 86.629  1.00 44.77 ? 103  HOH A O   1 
HETATM 4823 O O   . HOH C 2 .   ? -13.715 12.142 74.186  1.00 23.79 ? 104  HOH A O   1 
HETATM 4824 O O   . HOH C 2 .   ? 38.417  19.758 67.564  1.00 17.06 ? 105  HOH A O   1 
HETATM 4825 O O   . HOH C 2 .   ? 35.188  22.031 89.699  1.00 43.45 ? 110  HOH A O   1 
HETATM 4826 O O   . HOH C 2 .   ? 20.701  27.408 87.384  1.00 42.01 ? 111  HOH A O   1 
HETATM 4827 O O   . HOH C 2 .   ? 38.730  22.711 69.364  1.00 32.46 ? 115  HOH A O   1 
HETATM 4828 O O   . HOH C 2 .   ? 31.249  22.468 89.071  1.00 23.67 ? 117  HOH A O   1 
HETATM 4829 O O   . HOH C 2 .   ? 7.242   8.611  72.487  1.00 31.46 ? 120  HOH A O   1 
HETATM 4830 O O   . HOH C 2 .   ? -0.700  23.147 64.329  1.00 49.58 ? 124  HOH A O   1 
HETATM 4831 O O   . HOH C 2 .   ? 8.966   23.428 70.202  1.00 14.86 ? 128  HOH A O   1 
HETATM 4832 O O   . HOH C 2 .   ? 19.497  35.009 79.440  1.00 27.70 ? 130  HOH A O   1 
HETATM 4833 O O   . HOH C 2 .   ? 6.907   23.446 79.525  1.00 31.57 ? 131  HOH A O   1 
HETATM 4834 O O   . HOH C 2 .   ? -5.730  27.264 64.013  1.00 10.51 ? 133  HOH A O   1 
HETATM 4835 O O   . HOH C 2 .   ? 23.201  7.171  66.524  1.00 33.22 ? 134  HOH A O   1 
HETATM 4836 O O   . HOH C 2 .   ? 13.895  7.903  80.143  1.00 24.72 ? 137  HOH A O   1 
HETATM 4837 O O   . HOH C 2 .   ? 0.206   10.206 74.786  1.00 24.95 ? 138  HOH A O   1 
HETATM 4838 O O   . HOH C 2 .   ? -3.896  8.685  56.401  1.00 26.08 ? 139  HOH A O   1 
HETATM 4839 O O   . HOH C 2 .   ? 6.885   9.285  65.956  1.00 36.63 ? 140  HOH A O   1 
HETATM 4840 O O   . HOH C 2 .   ? 36.538  31.259 53.853  1.00 37.63 ? 141  HOH A O   1 
HETATM 4841 O O   . HOH C 2 .   ? 0.720   7.674  74.340  1.00 16.91 ? 145  HOH A O   1 
HETATM 4842 O O   . HOH C 2 .   ? -10.492 5.494  62.304  1.00 36.24 ? 147  HOH A O   1 
HETATM 4843 O O   . HOH C 2 .   ? 11.406  28.544 94.032  1.00 26.22 ? 148  HOH A O   1 
HETATM 4844 O O   . HOH C 2 .   ? 3.380   7.215  73.890  1.00 22.03 ? 149  HOH A O   1 
HETATM 4845 O O   . HOH C 2 .   ? 19.190  35.213 69.249  1.00 37.76 ? 153  HOH A O   1 
HETATM 4846 O O   . HOH C 2 .   ? 25.098  4.897  64.880  1.00 40.48 ? 155  HOH A O   1 
HETATM 4847 O O   . HOH C 2 .   ? 12.167  8.781  84.907  1.00 29.10 ? 156  HOH A O   1 
HETATM 4848 O O   . HOH C 2 .   ? 30.854  33.095 77.005  1.00 33.01 ? 157  HOH A O   1 
HETATM 4849 O O   . HOH C 2 .   ? -10.885 6.052  78.491  1.00 37.09 ? 158  HOH A O   1 
HETATM 4850 O O   . HOH C 2 .   ? -7.626  26.567 50.263  1.00 32.49 ? 160  HOH A O   1 
HETATM 4851 O O   . HOH C 2 .   ? 14.147  19.364 86.890  1.00 17.37 ? 161  HOH A O   1 
HETATM 4852 O O   . HOH C 2 .   ? -5.519  15.770 77.761  1.00 33.47 ? 163  HOH A O   1 
HETATM 4853 O O   . HOH C 2 .   ? 20.168  9.660  87.103  1.00 33.30 ? 164  HOH A O   1 
HETATM 4854 O O   . HOH C 2 .   ? 35.918  7.480  71.917  1.00 28.86 ? 165  HOH A O   1 
HETATM 4855 O O   . HOH C 2 .   ? 14.010  16.364 86.595  1.00 23.85 ? 168  HOH A O   1 
HETATM 4856 O O   . HOH C 2 .   ? -6.597  22.808 57.039  1.00 39.66 ? 176  HOH A O   1 
HETATM 4857 O O   . HOH C 2 .   ? 32.248  10.130 61.966  1.00 33.89 ? 177  HOH A O   1 
HETATM 4858 O O   . HOH C 2 .   ? 17.242  -7.026 76.318  1.00 24.91 ? 178  HOH A O   1 
HETATM 4859 O O   . HOH C 2 .   ? -7.682  1.011  70.979  1.00 34.38 ? 179  HOH A O   1 
HETATM 4860 O O   . HOH C 2 .   ? -1.920  5.355  66.817  1.00 40.02 ? 180  HOH A O   1 
HETATM 4861 O O   . HOH C 2 .   ? 37.251  25.834 69.965  1.00 28.41 ? 183  HOH A O   1 
HETATM 4862 O O   . HOH C 2 .   ? 13.144  31.719 94.933  1.00 36.69 ? 184  HOH A O   1 
HETATM 4863 O O   . HOH C 2 .   ? -6.837  5.237  55.155  1.00 43.22 ? 186  HOH A O   1 
HETATM 4864 O O   . HOH C 2 .   ? -6.626  18.273 54.314  1.00 28.20 ? 188  HOH A O   1 
HETATM 4865 O O   . HOH C 2 .   ? -16.900 9.431  69.338  1.00 20.60 ? 189  HOH A O   1 
HETATM 4866 O O   . HOH C 2 .   ? 26.600  44.088 67.964  1.00 35.96 ? 190  HOH A O   1 
HETATM 4867 O O   . HOH C 2 .   ? 26.160  1.846  64.472  1.00 31.27 ? 191  HOH A O   1 
HETATM 4868 O O   . HOH C 2 .   ? -0.522  31.392 71.542  1.00 37.23 ? 193  HOH A O   1 
HETATM 4869 O O   . HOH C 2 .   ? 25.848  30.847 85.029  1.00 41.87 ? 197  HOH A O   1 
HETATM 4870 O O   . HOH C 2 .   ? 36.582  33.571 69.963  1.00 32.92 ? 198  HOH A O   1 
HETATM 4871 O O   . HOH C 2 .   ? 2.159   33.985 74.504  1.00 41.04 ? 200  HOH A O   1 
HETATM 4872 O O   . HOH C 2 .   ? 5.624   8.814  78.787  1.00 32.13 ? 201  HOH A O   1 
HETATM 4873 O O   . HOH C 2 .   ? 28.842  44.574 66.494  1.00 31.23 ? 202  HOH A O   1 
HETATM 4874 O O   . HOH C 2 .   ? 2.363   5.262  72.521  1.00 24.59 ? 203  HOH A O   1 
HETATM 4875 O O   . HOH C 2 .   ? 5.372   5.679  74.558  1.00 38.51 ? 204  HOH A O   1 
HETATM 4876 O O   . HOH C 2 .   ? -17.727 11.994 67.816  1.00 37.83 ? 205  HOH A O   1 
HETATM 4877 O O   . HOH C 2 .   ? 11.653  15.005 88.348  1.00 37.20 ? 207  HOH A O   1 
HETATM 4878 O O   . HOH C 2 .   ? 15.922  20.462 85.179  1.00 52.09 ? 208  HOH A O   1 
HETATM 4879 O O   . HOH C 2 .   ? 13.283  3.741  72.003  1.00 36.88 ? 209  HOH A O   1 
HETATM 4880 O O   . HOH C 2 .   ? 21.913  2.078  83.184  1.00 31.71 ? 213  HOH A O   1 
HETATM 4881 O O   . HOH C 2 .   ? 34.736  24.864 68.899  1.00 43.18 ? 214  HOH A O   1 
HETATM 4882 O O   . HOH C 2 .   ? 25.083  29.729 58.136  1.00 36.85 ? 216  HOH A O   1 
HETATM 4883 O O   . HOH C 2 .   ? 7.258   40.303 67.696  1.00 36.99 ? 217  HOH A O   1 
HETATM 4884 O O   . HOH D 2 .   ? -0.293  27.928 30.740  1.00 19.80 ? 4    HOH B O   1 
HETATM 4885 O O   . HOH D 2 .   ? -10.154 17.467 39.119  1.00 20.03 ? 5    HOH B O   1 
HETATM 4886 O O   . HOH D 2 .   ? 11.842  3.905  14.374  1.00 18.53 ? 6    HOH B O   1 
HETATM 4887 O O   . HOH D 2 .   ? -3.926  27.056 27.190  1.00 14.41 ? 8    HOH B O   1 
HETATM 4888 O O   . HOH D 2 .   ? 3.710   21.094 37.325  1.00 31.74 ? 9    HOH B O   1 
HETATM 4889 O O   . HOH D 2 .   ? -3.590  13.794 34.596  1.00 18.34 ? 11   HOH B O   1 
HETATM 4890 O O   . HOH D 2 .   ? 7.408   25.010 33.820  1.00 31.75 ? 12   HOH B O   1 
HETATM 4891 O O   . HOH D 2 .   ? 21.800  26.457 21.818  1.00 8.55  ? 13   HOH B O   1 
HETATM 4892 O O   . HOH D 2 .   ? -9.868  22.766 27.654  1.00 23.73 ? 16   HOH B O   1 
HETATM 4893 O O   . HOH D 2 .   ? 22.856  29.915 30.011  1.00 26.87 ? 18   HOH B O   1 
HETATM 4894 O O   . HOH D 2 .   ? -0.362  29.914 33.279  1.00 9.41  ? 19   HOH B O   1 
HETATM 4895 O O   . HOH D 2 .   ? 8.020   28.994 24.450  1.00 31.20 ? 20   HOH B O   1 
HETATM 4896 O O   . HOH D 2 .   ? 40.456  14.367 41.695  1.00 49.29 ? 25   HOH B O   1 
HETATM 4897 O O   . HOH D 2 .   ? 12.570  7.818  20.852  1.00 14.49 ? 26   HOH B O   1 
HETATM 4898 O O   . HOH D 2 .   ? 1.153   8.254  33.371  1.00 4.31  ? 29   HOH B O   1 
HETATM 4899 O O   . HOH D 2 .   ? 10.711  14.375 15.952  1.00 21.19 ? 30   HOH B O   1 
HETATM 4900 O O   . HOH D 2 .   ? 10.497  26.679 27.092  1.00 31.65 ? 31   HOH B O   1 
HETATM 4901 O O   . HOH D 2 .   ? 13.862  18.706 32.356  1.00 27.31 ? 39   HOH B O   1 
HETATM 4902 O O   . HOH D 2 .   ? -5.841  13.430 35.415  1.00 10.82 ? 44   HOH B O   1 
HETATM 4903 O O   . HOH D 2 .   ? 4.049   41.666 34.156  1.00 32.81 ? 45   HOH B O   1 
HETATM 4904 O O   . HOH D 2 .   ? 5.539   2.272  17.442  1.00 28.64 ? 46   HOH B O   1 
HETATM 4905 O O   . HOH D 2 .   ? 25.507  18.300 16.112  1.00 27.65 ? 48   HOH B O   1 
HETATM 4906 O O   . HOH D 2 .   ? 23.699  13.942 21.872  1.00 10.44 ? 52   HOH B O   1 
HETATM 4907 O O   . HOH D 2 .   ? 42.085  12.442 31.487  1.00 12.26 ? 56   HOH B O   1 
HETATM 4908 O O   . HOH D 2 .   ? 36.273  10.940 42.631  1.00 35.60 ? 58   HOH B O   1 
HETATM 4909 O O   . HOH D 2 .   ? -5.065  12.335 43.613  1.00 46.14 ? 61   HOH B O   1 
HETATM 4910 O O   . HOH D 2 .   ? 21.131  12.381 56.126  1.00 20.92 ? 62   HOH B O   1 
HETATM 4911 O O   . HOH D 2 .   ? 25.352  1.266  30.208  1.00 29.00 ? 64   HOH B O   1 
HETATM 4912 O O   . HOH D 2 .   ? 41.534  8.441  24.021  1.00 32.13 ? 65   HOH B O   1 
HETATM 4913 O O   . HOH D 2 .   ? 21.710  11.007 19.735  1.00 21.23 ? 67   HOH B O   1 
HETATM 4914 O O   . HOH D 2 .   ? -3.440  32.166 22.707  1.00 18.98 ? 68   HOH B O   1 
HETATM 4915 O O   . HOH D 2 .   ? 20.831  23.645 28.272  1.00 38.55 ? 70   HOH B O   1 
HETATM 4916 O O   . HOH D 2 .   ? -7.935  23.949 37.736  1.00 26.94 ? 72   HOH B O   1 
HETATM 4917 O O   . HOH D 2 .   ? 18.786  8.327  28.562  1.00 18.03 ? 73   HOH B O   1 
HETATM 4918 O O   . HOH D 2 .   ? 26.028  -1.214 43.950  1.00 43.87 ? 74   HOH B O   1 
HETATM 4919 O O   . HOH D 2 .   ? 29.754  8.990  43.964  1.00 21.36 ? 75   HOH B O   1 
HETATM 4920 O O   . HOH D 2 .   ? 36.271  5.526  38.220  1.00 41.28 ? 77   HOH B O   1 
HETATM 4921 O O   . HOH D 2 .   ? 35.682  18.983 21.745  1.00 42.34 ? 81   HOH B O   1 
HETATM 4922 O O   . HOH D 2 .   ? 24.517  15.103 49.070  1.00 40.63 ? 83   HOH B O   1 
HETATM 4923 O O   . HOH D 2 .   ? 5.966   32.174 32.601  1.00 10.01 ? 85   HOH B O   1 
HETATM 4924 O O   . HOH D 2 .   ? -6.393  10.470 38.855  1.00 29.27 ? 87   HOH B O   1 
HETATM 4925 O O   . HOH D 2 .   ? 23.621  26.965 30.151  1.00 36.06 ? 88   HOH B O   1 
HETATM 4926 O O   . HOH D 2 .   ? 27.049  7.693  23.124  1.00 17.11 ? 93   HOH B O   1 
HETATM 4927 O O   . HOH D 2 .   ? -9.505  25.259 43.492  1.00 35.45 ? 94   HOH B O   1 
HETATM 4928 O O   . HOH D 2 .   ? 6.977   35.993 53.221  1.00 38.20 ? 96   HOH B O   1 
HETATM 4929 O O   . HOH D 2 .   ? 21.992  29.596 39.642  1.00 39.77 ? 99   HOH B O   1 
HETATM 4930 O O   . HOH D 2 .   ? -0.982  32.672 23.022  1.00 23.92 ? 100  HOH B O   1 
HETATM 4931 O O   . HOH D 2 .   ? 1.113   23.647 36.810  1.00 43.14 ? 101  HOH B O   1 
HETATM 4932 O O   . HOH D 2 .   ? -9.293  17.034 10.777  1.00 29.64 ? 102  HOH B O   1 
HETATM 4933 O O   . HOH D 2 .   ? 5.613   21.175 35.075  1.00 52.22 ? 106  HOH B O   1 
HETATM 4934 O O   . HOH D 2 .   ? -1.719  35.150 13.734  1.00 62.31 ? 107  HOH B O   1 
HETATM 4935 O O   . HOH D 2 .   ? -10.878 16.245 44.839  1.00 31.48 ? 108  HOH B O   1 
HETATM 4936 O O   . HOH D 2 .   ? 27.023  20.484 19.414  1.00 20.77 ? 109  HOH B O   1 
HETATM 4937 O O   . HOH D 2 .   ? 33.251  0.968  28.893  1.00 37.13 ? 112  HOH B O   1 
HETATM 4938 O O   . HOH D 2 .   ? 29.381  18.068 19.004  1.00 25.84 ? 113  HOH B O   1 
HETATM 4939 O O   . HOH D 2 .   ? -11.158 29.630 40.520  1.00 40.83 ? 114  HOH B O   1 
HETATM 4940 O O   . HOH D 2 .   ? 18.615  8.166  20.842  1.00 29.04 ? 116  HOH B O   1 
HETATM 4941 O O   . HOH D 2 .   ? 30.169  15.721 52.175  1.00 24.32 ? 118  HOH B O   1 
HETATM 4942 O O   . HOH D 2 .   ? 26.371  10.657 26.804  1.00 24.60 ? 119  HOH B O   1 
HETATM 4943 O O   . HOH D 2 .   ? -2.557  5.388  18.002  1.00 33.23 ? 121  HOH B O   1 
HETATM 4944 O O   . HOH D 2 .   ? -1.056  12.544 35.882  1.00 56.74 ? 122  HOH B O   1 
HETATM 4945 O O   . HOH D 2 .   ? 11.285  -4.632 28.923  1.00 25.82 ? 123  HOH B O   1 
HETATM 4946 O O   . HOH D 2 .   ? 21.110  2.519  29.891  1.00 33.84 ? 125  HOH B O   1 
HETATM 4947 O O   . HOH D 2 .   ? 18.937  23.613 43.168  1.00 39.84 ? 126  HOH B O   1 
HETATM 4948 O O   . HOH D 2 .   ? 18.049  1.835  30.271  1.00 45.66 ? 127  HOH B O   1 
HETATM 4949 O O   . HOH D 2 .   ? 14.866  -4.072 22.600  1.00 37.47 ? 129  HOH B O   1 
HETATM 4950 O O   . HOH D 2 .   ? -12.294 21.619 32.629  1.00 42.35 ? 132  HOH B O   1 
HETATM 4951 O O   . HOH D 2 .   ? 38.611  12.223 41.900  1.00 31.10 ? 135  HOH B O   1 
HETATM 4952 O O   . HOH D 2 .   ? 6.222   -6.047 18.219  1.00 33.78 ? 136  HOH B O   1 
HETATM 4953 O O   . HOH D 2 .   ? 27.285  23.159 36.352  1.00 32.70 ? 142  HOH B O   1 
HETATM 4954 O O   . HOH D 2 .   ? 21.024  9.050  21.789  1.00 26.01 ? 143  HOH B O   1 
HETATM 4955 O O   . HOH D 2 .   ? 8.472   18.598 40.306  1.00 33.61 ? 144  HOH B O   1 
HETATM 4956 O O   . HOH D 2 .   ? 25.768  12.403 22.236  1.00 23.67 ? 146  HOH B O   1 
HETATM 4957 O O   . HOH D 2 .   ? 43.966  11.510 33.071  1.00 24.08 ? 150  HOH B O   1 
HETATM 4958 O O   . HOH D 2 .   ? 4.860   24.226 35.894  1.00 39.41 ? 151  HOH B O   1 
HETATM 4959 O O   . HOH D 2 .   ? 22.396  12.140 58.380  1.00 29.61 ? 152  HOH B O   1 
HETATM 4960 O O   . HOH D 2 .   ? 17.957  24.481 37.255  1.00 37.48 ? 154  HOH B O   1 
HETATM 4961 O O   . HOH D 2 .   ? 26.424  7.708  25.977  1.00 30.22 ? 159  HOH B O   1 
HETATM 4962 O O   . HOH D 2 .   ? 21.278  24.805 24.348  1.00 42.89 ? 162  HOH B O   1 
HETATM 4963 O O   . HOH D 2 .   ? 13.395  26.766 1.724   1.00 35.28 ? 166  HOH B O   1 
HETATM 4964 O O   . HOH D 2 .   ? 12.157  34.158 9.218   1.00 33.97 ? 167  HOH B O   1 
HETATM 4965 O O   . HOH D 2 .   ? 15.335  7.334  20.715  1.00 22.06 ? 169  HOH B O   1 
HETATM 4966 O O   . HOH D 2 .   ? 5.830   35.196 21.203  1.00 37.33 ? 170  HOH B O   1 
HETATM 4967 O O   . HOH D 2 .   ? 9.814   1.705  36.858  1.00 34.55 ? 171  HOH B O   1 
HETATM 4968 O O   . HOH D 2 .   ? -6.095  10.831 36.210  1.00 24.20 ? 172  HOH B O   1 
HETATM 4969 O O   . HOH D 2 .   ? 19.881  9.113  35.021  1.00 34.44 ? 173  HOH B O   1 
HETATM 4970 O O   . HOH D 2 .   ? -5.684  5.036  23.406  1.00 43.33 ? 174  HOH B O   1 
HETATM 4971 O O   . HOH D 2 .   ? -7.671  12.824 17.325  1.00 34.89 ? 175  HOH B O   1 
HETATM 4972 O O   . HOH D 2 .   ? 7.771   7.965  10.415  1.00 34.65 ? 181  HOH B O   1 
HETATM 4973 O O   . HOH D 2 .   ? 17.111  26.025 28.346  1.00 44.11 ? 182  HOH B O   1 
HETATM 4974 O O   . HOH D 2 .   ? 1.923   -0.015 35.729  1.00 35.15 ? 185  HOH B O   1 
HETATM 4975 O O   . HOH D 2 .   ? 14.553  32.883 42.969  1.00 33.35 ? 187  HOH B O   1 
HETATM 4976 O O   . HOH D 2 .   ? 44.566  11.004 30.656  1.00 11.34 ? 192  HOH B O   1 
HETATM 4977 O O   . HOH D 2 .   ? 37.515  8.838  43.149  1.00 27.81 ? 194  HOH B O   1 
HETATM 4978 O O   . HOH D 2 .   ? 34.085  26.054 50.193  1.00 42.57 ? 195  HOH B O   1 
HETATM 4979 O O   . HOH D 2 .   ? -11.225 16.599 16.555  1.00 43.77 ? 196  HOH B O   1 
HETATM 4980 O O   . HOH D 2 .   ? 12.232  14.284 18.219  1.00 30.75 ? 199  HOH B O   1 
HETATM 4981 O O   . HOH D 2 .   ? 18.926  24.324 13.675  1.00 38.56 ? 206  HOH B O   1 
HETATM 4982 O O   . HOH D 2 .   ? 1.661   32.788 44.872  1.00 32.17 ? 210  HOH B O   1 
HETATM 4983 O O   . HOH D 2 .   ? 16.447  26.823 1.512   1.00 21.89 ? 211  HOH B O   1 
HETATM 4984 O O   . HOH D 2 .   ? 24.052  25.826 27.837  1.00 48.25 ? 212  HOH B O   1 
HETATM 4985 O O   . HOH D 2 .   ? 12.582  32.098 5.098   1.00 40.87 ? 215  HOH B O   1 
HETATM 4986 O O   . HOH D 2 .   ? 17.813  8.101  32.466  1.00 37.45 ? 218  HOH B O   1 
HETATM 4987 O O   . HOH D 2 .   ? 30.766  15.809 17.071  1.00 30.08 ? 219  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   970  ?    ?   ?   A . n 
A 1 2   ALA 2   971  ?    ?   ?   A . n 
A 1 3   SER 3   972  ?    ?   ?   A . n 
A 1 4   VAL 4   973  ?    ?   ?   A . n 
A 1 5   ASN 5   974  ?    ?   ?   A . n 
A 1 6   PRO 6   975  ?    ?   ?   A . n 
A 1 7   GLU 7   976  ?    ?   ?   A . n 
A 1 8   TYR 8   977  ?    ?   ?   A . n 
A 1 9   PHE 9   978  ?    ?   ?   A . n 
A 1 10  SER 10  979  979  SER SER A . n 
A 1 11  ALA 11  980  980  ALA ALA A . n 
A 1 12  ALA 12  981  981  ALA ALA A . n 
A 1 13  ASP 13  982  982  ASP ASP A . n 
A 1 14  VAL 14  983  983  VAL VAL A . n 
A 1 15  TYR 15  984  984  TYR TYR A . n 
A 1 16  VAL 16  985  985  VAL VAL A . n 
A 1 17  PRO 17  986  986  PRO PRO A . n 
A 1 18  ASP 18  987  987  ASP ASP A . n 
A 1 19  GLU 19  988  988  GLU GLU A . n 
A 1 20  TRP 20  989  989  TRP TRP A . n 
A 1 21  GLU 21  990  990  GLU GLU A . n 
A 1 22  VAL 22  991  991  VAL VAL A . n 
A 1 23  ALA 23  992  992  ALA ALA A . n 
A 1 24  ARG 24  993  993  ARG ARG A . n 
A 1 25  GLU 25  994  994  GLU GLU A . n 
A 1 26  LYS 26  995  995  LYS LYS A . n 
A 1 27  ILE 27  996  996  ILE ILE A . n 
A 1 28  THR 28  997  997  THR THR A . n 
A 1 29  MET 29  998  998  MET MET A . n 
A 1 30  SER 30  999  999  SER SER A . n 
A 1 31  ARG 31  1000 1000 ARG ARG A . n 
A 1 32  GLU 32  1001 1001 GLU GLU A . n 
A 1 33  LEU 33  1002 1002 LEU LEU A . n 
A 1 34  GLY 34  1003 1003 GLY GLY A . n 
A 1 35  GLN 35  1004 1004 GLN GLN A . n 
A 1 36  GLY 36  1005 1005 GLY GLY A . n 
A 1 37  SER 37  1006 1006 SER SER A . n 
A 1 38  PHE 38  1007 1007 PHE PHE A . n 
A 1 39  GLY 39  1008 1008 GLY GLY A . n 
A 1 40  MET 40  1009 1009 MET MET A . n 
A 1 41  VAL 41  1010 1010 VAL VAL A . n 
A 1 42  TYR 42  1011 1011 TYR TYR A . n 
A 1 43  GLU 43  1012 1012 GLU GLU A . n 
A 1 44  GLY 44  1013 1013 GLY GLY A . n 
A 1 45  VAL 45  1014 1014 VAL VAL A . n 
A 1 46  ALA 46  1015 1015 ALA ALA A . n 
A 1 47  LYS 47  1016 1016 LYS LYS A . n 
A 1 48  GLY 48  1017 1017 GLY GLY A . n 
A 1 49  VAL 49  1018 1018 VAL VAL A . n 
A 1 50  VAL 50  1019 1019 VAL VAL A . n 
A 1 51  LYS 51  1020 1020 LYS LYS A . n 
A 1 52  ASP 52  1021 1021 ASP ASP A . n 
A 1 53  GLU 53  1022 1022 GLU GLU A . n 
A 1 54  PRO 54  1023 1023 PRO PRO A . n 
A 1 55  GLU 55  1024 1024 GLU GLU A . n 
A 1 56  THR 56  1025 1025 THR THR A . n 
A 1 57  ARG 57  1026 1026 ARG ARG A . n 
A 1 58  VAL 58  1027 1027 VAL VAL A . n 
A 1 59  ALA 59  1028 1028 ALA ALA A . n 
A 1 60  ILE 60  1029 1029 ILE ILE A . n 
A 1 61  LYS 61  1030 1030 LYS LYS A . n 
A 1 62  THR 62  1031 1031 THR THR A . n 
A 1 63  VAL 63  1032 1032 VAL VAL A . n 
A 1 64  ASN 64  1033 1033 ASN ASN A . n 
A 1 65  GLU 65  1034 1034 GLU GLU A . n 
A 1 66  ALA 66  1035 1035 ALA ALA A . n 
A 1 67  ALA 67  1036 1036 ALA ALA A . n 
A 1 68  SER 68  1037 1037 SER SER A . n 
A 1 69  MET 69  1038 1038 MET MET A . n 
A 1 70  ARG 70  1039 1039 ARG ARG A . n 
A 1 71  GLU 71  1040 1040 GLU GLU A . n 
A 1 72  ARG 72  1041 1041 ARG ARG A . n 
A 1 73  ILE 73  1042 1042 ILE ILE A . n 
A 1 74  GLU 74  1043 1043 GLU GLU A . n 
A 1 75  PHE 75  1044 1044 PHE PHE A . n 
A 1 76  LEU 76  1045 1045 LEU LEU A . n 
A 1 77  ASN 77  1046 1046 ASN ASN A . n 
A 1 78  GLU 78  1047 1047 GLU GLU A . n 
A 1 79  ALA 79  1048 1048 ALA ALA A . n 
A 1 80  SER 80  1049 1049 SER SER A . n 
A 1 81  VAL 81  1050 1050 VAL VAL A . n 
A 1 82  MET 82  1051 1051 MET MET A . n 
A 1 83  LYS 83  1052 1052 LYS LYS A . n 
A 1 84  GLU 84  1053 1053 GLU GLU A . n 
A 1 85  PHE 85  1054 1054 PHE PHE A . n 
A 1 86  ASN 86  1055 1055 ASN ASN A . n 
A 1 87  CYS 87  1056 1056 CYS CYS A . n 
A 1 88  HIS 88  1057 1057 HIS HIS A . n 
A 1 89  HIS 89  1058 1058 HIS HIS A . n 
A 1 90  VAL 90  1059 1059 VAL VAL A . n 
A 1 91  VAL 91  1060 1060 VAL VAL A . n 
A 1 92  ARG 92  1061 1061 ARG ARG A . n 
A 1 93  LEU 93  1062 1062 LEU LEU A . n 
A 1 94  LEU 94  1063 1063 LEU LEU A . n 
A 1 95  GLY 95  1064 1064 GLY GLY A . n 
A 1 96  VAL 96  1065 1065 VAL VAL A . n 
A 1 97  VAL 97  1066 1066 VAL VAL A . n 
A 1 98  SER 98  1067 1067 SER SER A . n 
A 1 99  GLN 99  1068 1068 GLN GLN A . n 
A 1 100 GLY 100 1069 1069 GLY GLY A . n 
A 1 101 GLN 101 1070 1070 GLN GLN A . n 
A 1 102 PRO 102 1071 1071 PRO PRO A . n 
A 1 103 THR 103 1072 1072 THR THR A . n 
A 1 104 LEU 104 1073 1073 LEU LEU A . n 
A 1 105 VAL 105 1074 1074 VAL VAL A . n 
A 1 106 ILE 106 1075 1075 ILE ILE A . n 
A 1 107 MET 107 1076 1076 MET MET A . n 
A 1 108 GLU 108 1077 1077 GLU GLU A . n 
A 1 109 LEU 109 1078 1078 LEU LEU A . n 
A 1 110 MET 110 1079 1079 MET MET A . n 
A 1 111 THR 111 1080 1080 THR THR A . n 
A 1 112 ARG 112 1081 1081 ARG ARG A . n 
A 1 113 GLY 113 1082 1082 GLY GLY A . n 
A 1 114 ASP 114 1083 1083 ASP ASP A . n 
A 1 115 LEU 115 1084 1084 LEU LEU A . n 
A 1 116 LYS 116 1085 1085 LYS LYS A . n 
A 1 117 SER 117 1086 1086 SER SER A . n 
A 1 118 TYR 118 1087 1087 TYR TYR A . n 
A 1 119 LEU 119 1088 1088 LEU LEU A . n 
A 1 120 ARG 120 1089 1089 ARG ARG A . n 
A 1 121 SER 121 1090 1090 SER SER A . n 
A 1 122 LEU 122 1091 1091 LEU LEU A . n 
A 1 123 ARG 123 1092 1092 ARG ARG A . n 
A 1 124 PRO 124 1093 1093 PRO PRO A . n 
A 1 125 GLU 125 1094 ?    ?   ?   A . n 
A 1 126 MET 126 1095 ?    ?   ?   A . n 
A 1 127 GLU 127 1096 ?    ?   ?   A . n 
A 1 128 ASN 128 1097 ?    ?   ?   A . n 
A 1 129 ASN 129 1098 ?    ?   ?   A . n 
A 1 130 PRO 130 1099 ?    ?   ?   A . n 
A 1 131 VAL 131 1100 1100 VAL VAL A . n 
A 1 132 LEU 132 1101 1101 LEU LEU A . n 
A 1 133 ALA 133 1102 1102 ALA ALA A . n 
A 1 134 PRO 134 1103 1103 PRO PRO A . n 
A 1 135 PRO 135 1104 1104 PRO PRO A . n 
A 1 136 SER 136 1105 1105 SER SER A . n 
A 1 137 LEU 137 1106 1106 LEU LEU A . n 
A 1 138 SER 138 1107 1107 SER SER A . n 
A 1 139 LYS 139 1108 1108 LYS LYS A . n 
A 1 140 MET 140 1109 1109 MET MET A . n 
A 1 141 ILE 141 1110 1110 ILE ILE A . n 
A 1 142 GLN 142 1111 1111 GLN GLN A . n 
A 1 143 MET 143 1112 1112 MET MET A . n 
A 1 144 ALA 144 1113 1113 ALA ALA A . n 
A 1 145 GLY 145 1114 1114 GLY GLY A . n 
A 1 146 GLU 146 1115 1115 GLU GLU A . n 
A 1 147 ILE 147 1116 1116 ILE ILE A . n 
A 1 148 ALA 148 1117 1117 ALA ALA A . n 
A 1 149 ASP 149 1118 1118 ASP ASP A . n 
A 1 150 GLY 150 1119 1119 GLY GLY A . n 
A 1 151 MET 151 1120 1120 MET MET A . n 
A 1 152 ALA 152 1121 1121 ALA ALA A . n 
A 1 153 TYR 153 1122 1122 TYR TYR A . n 
A 1 154 LEU 154 1123 1123 LEU LEU A . n 
A 1 155 ASN 155 1124 1124 ASN ASN A . n 
A 1 156 ALA 156 1125 1125 ALA ALA A . n 
A 1 157 ASN 157 1126 1126 ASN ASN A . n 
A 1 158 LYS 158 1127 1127 LYS LYS A . n 
A 1 159 PHE 159 1128 1128 PHE PHE A . n 
A 1 160 VAL 160 1129 1129 VAL VAL A . n 
A 1 161 HIS 161 1130 1130 HIS HIS A . n 
A 1 162 ARG 162 1131 1131 ARG ARG A . n 
A 1 163 ASP 163 1132 1132 ASP ASP A . n 
A 1 164 LEU 164 1133 1133 LEU LEU A . n 
A 1 165 ALA 165 1134 1134 ALA ALA A . n 
A 1 166 ALA 166 1135 1135 ALA ALA A . n 
A 1 167 ARG 167 1136 1136 ARG ARG A . n 
A 1 168 ASN 168 1137 1137 ASN ASN A . n 
A 1 169 CYS 169 1138 1138 CYS CYS A . n 
A 1 170 MET 170 1139 1139 MET MET A . n 
A 1 171 VAL 171 1140 1140 VAL VAL A . n 
A 1 172 ALA 172 1141 1141 ALA ALA A . n 
A 1 173 GLU 173 1142 1142 GLU GLU A . n 
A 1 174 ASP 174 1143 1143 ASP ASP A . n 
A 1 175 PHE 175 1144 1144 PHE PHE A . n 
A 1 176 THR 176 1145 1145 THR THR A . n 
A 1 177 VAL 177 1146 1146 VAL VAL A . n 
A 1 178 LYS 178 1147 1147 LYS LYS A . n 
A 1 179 ILE 179 1148 1148 ILE ILE A . n 
A 1 180 GLY 180 1149 1149 GLY GLY A . n 
A 1 181 ASP 181 1150 1150 ASP ASP A . n 
A 1 182 PHE 182 1151 1151 PHE PHE A . n 
A 1 183 GLY 183 1152 1152 GLY GLY A . n 
A 1 184 MET 184 1153 1153 MET MET A . n 
A 1 185 THR 185 1154 1154 THR THR A . n 
A 1 186 ARG 186 1155 1155 ARG ARG A . n 
A 1 187 ASP 187 1156 1156 ASP ASP A . n 
A 1 188 ILE 188 1157 1157 ILE ILE A . n 
A 1 189 TYR 189 1158 1158 TYR TYR A . n 
A 1 190 GLU 190 1159 1159 GLU GLU A . n 
A 1 191 THR 191 1160 1160 THR THR A . n 
A 1 192 ASP 192 1161 1161 ASP ASP A . n 
A 1 193 TYR 193 1162 1162 TYR TYR A . n 
A 1 194 TYR 194 1163 1163 TYR TYR A . n 
A 1 195 ARG 195 1164 1164 ARG ARG A . n 
A 1 196 LYS 196 1165 1165 LYS LYS A . n 
A 1 197 GLY 197 1166 1166 GLY GLY A . n 
A 1 198 GLY 198 1167 1167 GLY GLY A . n 
A 1 199 LYS 199 1168 1168 LYS LYS A . n 
A 1 200 GLY 200 1169 1169 GLY GLY A . n 
A 1 201 LEU 201 1170 1170 LEU LEU A . n 
A 1 202 LEU 202 1171 1171 LEU LEU A . n 
A 1 203 PRO 203 1172 1172 PRO PRO A . n 
A 1 204 VAL 204 1173 1173 VAL VAL A . n 
A 1 205 ARG 205 1174 1174 ARG ARG A . n 
A 1 206 TRP 206 1175 1175 TRP TRP A . n 
A 1 207 MET 207 1176 1176 MET MET A . n 
A 1 208 SER 208 1177 1177 SER SER A . n 
A 1 209 PRO 209 1178 1178 PRO PRO A . n 
A 1 210 GLU 210 1179 1179 GLU GLU A . n 
A 1 211 SER 211 1180 1180 SER SER A . n 
A 1 212 LEU 212 1181 1181 LEU LEU A . n 
A 1 213 LYS 213 1182 1182 LYS LYS A . n 
A 1 214 ASP 214 1183 1183 ASP ASP A . n 
A 1 215 GLY 215 1184 1184 GLY GLY A . n 
A 1 216 VAL 216 1185 1185 VAL VAL A . n 
A 1 217 PHE 217 1186 1186 PHE PHE A . n 
A 1 218 THR 218 1187 1187 THR THR A . n 
A 1 219 THR 219 1188 1188 THR THR A . n 
A 1 220 TYR 220 1189 1189 TYR TYR A . n 
A 1 221 SER 221 1190 1190 SER SER A . n 
A 1 222 ASP 222 1191 1191 ASP ASP A . n 
A 1 223 VAL 223 1192 1192 VAL VAL A . n 
A 1 224 TRP 224 1193 1193 TRP TRP A . n 
A 1 225 SER 225 1194 1194 SER SER A . n 
A 1 226 PHE 226 1195 1195 PHE PHE A . n 
A 1 227 GLY 227 1196 1196 GLY GLY A . n 
A 1 228 VAL 228 1197 1197 VAL VAL A . n 
A 1 229 VAL 229 1198 1198 VAL VAL A . n 
A 1 230 LEU 230 1199 1199 LEU LEU A . n 
A 1 231 TRP 231 1200 1200 TRP TRP A . n 
A 1 232 GLU 232 1201 1201 GLU GLU A . n 
A 1 233 ILE 233 1202 1202 ILE ILE A . n 
A 1 234 ALA 234 1203 1203 ALA ALA A . n 
A 1 235 THR 235 1204 1204 THR THR A . n 
A 1 236 LEU 236 1205 1205 LEU LEU A . n 
A 1 237 ALA 237 1206 1206 ALA ALA A . n 
A 1 238 GLU 238 1207 1207 GLU GLU A . n 
A 1 239 GLN 239 1208 1208 GLN GLN A . n 
A 1 240 PRO 240 1209 1209 PRO PRO A . n 
A 1 241 TYR 241 1210 1210 TYR TYR A . n 
A 1 242 GLN 242 1211 1211 GLN GLN A . n 
A 1 243 GLY 243 1212 1212 GLY GLY A . n 
A 1 244 LEU 244 1213 1213 LEU LEU A . n 
A 1 245 SER 245 1214 1214 SER SER A . n 
A 1 246 ASN 246 1215 1215 ASN ASN A . n 
A 1 247 GLU 247 1216 1216 GLU GLU A . n 
A 1 248 GLN 248 1217 1217 GLN GLN A . n 
A 1 249 VAL 249 1218 1218 VAL VAL A . n 
A 1 250 LEU 250 1219 1219 LEU LEU A . n 
A 1 251 ARG 251 1220 1220 ARG ARG A . n 
A 1 252 PHE 252 1221 1221 PHE PHE A . n 
A 1 253 VAL 253 1222 1222 VAL VAL A . n 
A 1 254 MET 254 1223 1223 MET MET A . n 
A 1 255 GLU 255 1224 1224 GLU GLU A . n 
A 1 256 GLY 256 1225 1225 GLY GLY A . n 
A 1 257 GLY 257 1226 1226 GLY GLY A . n 
A 1 258 LEU 258 1227 1227 LEU LEU A . n 
A 1 259 LEU 259 1228 1228 LEU LEU A . n 
A 1 260 ASP 260 1229 1229 ASP ASP A . n 
A 1 261 LYS 261 1230 1230 LYS LYS A . n 
A 1 262 PRO 262 1231 1231 PRO PRO A . n 
A 1 263 ASP 263 1232 1232 ASP ASP A . n 
A 1 264 ASN 264 1233 1233 ASN ASN A . n 
A 1 265 CYS 265 1234 1234 CYS CYS A . n 
A 1 266 PRO 266 1235 1235 PRO PRO A . n 
A 1 267 ASP 267 1236 1236 ASP ASP A . n 
A 1 268 MET 268 1237 1237 MET MET A . n 
A 1 269 LEU 269 1238 1238 LEU LEU A . n 
A 1 270 PHE 270 1239 1239 PHE PHE A . n 
A 1 271 GLU 271 1240 1240 GLU GLU A . n 
A 1 272 LEU 272 1241 1241 LEU LEU A . n 
A 1 273 MET 273 1242 1242 MET MET A . n 
A 1 274 ARG 274 1243 1243 ARG ARG A . n 
A 1 275 MET 275 1244 1244 MET MET A . n 
A 1 276 CYS 276 1245 1245 CYS CYS A . n 
A 1 277 TRP 277 1246 1246 TRP TRP A . n 
A 1 278 GLN 278 1247 1247 GLN GLN A . n 
A 1 279 TYR 279 1248 1248 TYR TYR A . n 
A 1 280 ASN 280 1249 1249 ASN ASN A . n 
A 1 281 PRO 281 1250 1250 PRO PRO A . n 
A 1 282 LYS 282 1251 1251 LYS LYS A . n 
A 1 283 MET 283 1252 1252 MET MET A . n 
A 1 284 ARG 284 1253 1253 ARG ARG A . n 
A 1 285 PRO 285 1254 1254 PRO PRO A . n 
A 1 286 SER 286 1255 1255 SER SER A . n 
A 1 287 PHE 287 1256 1256 PHE PHE A . n 
A 1 288 LEU 288 1257 1257 LEU LEU A . n 
A 1 289 GLU 289 1258 1258 GLU GLU A . n 
A 1 290 ILE 290 1259 1259 ILE ILE A . n 
A 1 291 ILE 291 1260 1260 ILE ILE A . n 
A 1 292 SER 292 1261 1261 SER SER A . n 
A 1 293 SER 293 1262 1262 SER SER A . n 
A 1 294 ILE 294 1263 1263 ILE ILE A . n 
A 1 295 LYS 295 1264 1264 LYS LYS A . n 
A 1 296 GLU 296 1265 1265 GLU GLU A . n 
A 1 297 GLU 297 1266 1266 GLU GLU A . n 
A 1 298 MET 298 1267 1267 MET MET A . n 
A 1 299 GLU 299 1268 1268 GLU GLU A . n 
A 1 300 PRO 300 1269 1269 PRO PRO A . n 
A 1 301 GLY 301 1270 1270 GLY GLY A . n 
A 1 302 PHE 302 1271 1271 PHE PHE A . n 
A 1 303 ARG 303 1272 1272 ARG ARG A . n 
A 1 304 GLU 304 1273 1273 GLU GLU A . n 
A 1 305 VAL 305 1274 1274 VAL VAL A . n 
A 1 306 SER 306 1275 1275 SER SER A . n 
A 1 307 PHE 307 1276 1276 PHE PHE A . n 
A 1 308 TYR 308 1277 1277 TYR TYR A . n 
A 1 309 TYR 309 1278 1278 TYR TYR A . n 
A 1 310 SER 310 1279 1279 SER SER A . n 
A 1 311 GLU 311 1280 1280 GLU GLU A . n 
A 1 312 GLU 312 1281 1281 GLU GLU A . n 
A 1 313 ASN 313 1282 1282 ASN ASN A . n 
A 1 314 LYS 314 1283 1283 LYS LYS A . n 
A 1 315 LEU 315 1284 ?    ?   ?   A . n 
A 1 316 PRO 316 1285 ?    ?   ?   A . n 
A 1 317 GLU 317 1286 ?    ?   ?   A . n 
A 1 318 PRO 318 1287 ?    ?   ?   A . n 
A 1 319 GLU 319 1288 ?    ?   ?   A . n 
A 1 320 GLU 320 1289 ?    ?   ?   A . n 
A 1 321 LEU 321 1290 ?    ?   ?   A . n 
A 1 322 ASP 322 1291 ?    ?   ?   A . n 
B 1 1   MET 1   970  ?    ?   ?   B . n 
B 1 2   ALA 2   971  ?    ?   ?   B . n 
B 1 3   SER 3   972  ?    ?   ?   B . n 
B 1 4   VAL 4   973  ?    ?   ?   B . n 
B 1 5   ASN 5   974  ?    ?   ?   B . n 
B 1 6   PRO 6   975  ?    ?   ?   B . n 
B 1 7   GLU 7   976  ?    ?   ?   B . n 
B 1 8   TYR 8   977  ?    ?   ?   B . n 
B 1 9   PHE 9   978  ?    ?   ?   B . n 
B 1 10  SER 10  979  979  SER SER B . n 
B 1 11  ALA 11  980  980  ALA ALA B . n 
B 1 12  ALA 12  981  981  ALA ALA B . n 
B 1 13  ASP 13  982  982  ASP ASP B . n 
B 1 14  VAL 14  983  983  VAL VAL B . n 
B 1 15  TYR 15  984  984  TYR TYR B . n 
B 1 16  VAL 16  985  985  VAL VAL B . n 
B 1 17  PRO 17  986  986  PRO PRO B . n 
B 1 18  ASP 18  987  987  ASP ASP B . n 
B 1 19  GLU 19  988  988  GLU GLU B . n 
B 1 20  TRP 20  989  989  TRP TRP B . n 
B 1 21  GLU 21  990  990  GLU GLU B . n 
B 1 22  VAL 22  991  991  VAL VAL B . n 
B 1 23  ALA 23  992  992  ALA ALA B . n 
B 1 24  ARG 24  993  993  ARG ARG B . n 
B 1 25  GLU 25  994  994  GLU GLU B . n 
B 1 26  LYS 26  995  995  LYS LYS B . n 
B 1 27  ILE 27  996  996  ILE ILE B . n 
B 1 28  THR 28  997  997  THR THR B . n 
B 1 29  MET 29  998  998  MET MET B . n 
B 1 30  SER 30  999  999  SER SER B . n 
B 1 31  ARG 31  1000 1000 ARG ARG B . n 
B 1 32  GLU 32  1001 1001 GLU GLU B . n 
B 1 33  LEU 33  1002 1002 LEU LEU B . n 
B 1 34  GLY 34  1003 1003 GLY GLY B . n 
B 1 35  GLN 35  1004 1004 GLN GLN B . n 
B 1 36  GLY 36  1005 1005 GLY GLY B . n 
B 1 37  SER 37  1006 1006 SER SER B . n 
B 1 38  PHE 38  1007 1007 PHE PHE B . n 
B 1 39  GLY 39  1008 1008 GLY GLY B . n 
B 1 40  MET 40  1009 1009 MET MET B . n 
B 1 41  VAL 41  1010 1010 VAL VAL B . n 
B 1 42  TYR 42  1011 1011 TYR TYR B . n 
B 1 43  GLU 43  1012 1012 GLU GLU B . n 
B 1 44  GLY 44  1013 1013 GLY GLY B . n 
B 1 45  VAL 45  1014 1014 VAL VAL B . n 
B 1 46  ALA 46  1015 1015 ALA ALA B . n 
B 1 47  LYS 47  1016 1016 LYS LYS B . n 
B 1 48  GLY 48  1017 1017 GLY GLY B . n 
B 1 49  VAL 49  1018 1018 VAL VAL B . n 
B 1 50  VAL 50  1019 1019 VAL VAL B . n 
B 1 51  LYS 51  1020 1020 LYS LYS B . n 
B 1 52  ASP 52  1021 1021 ASP ASP B . n 
B 1 53  GLU 53  1022 1022 GLU GLU B . n 
B 1 54  PRO 54  1023 1023 PRO PRO B . n 
B 1 55  GLU 55  1024 1024 GLU GLU B . n 
B 1 56  THR 56  1025 1025 THR THR B . n 
B 1 57  ARG 57  1026 1026 ARG ARG B . n 
B 1 58  VAL 58  1027 1027 VAL VAL B . n 
B 1 59  ALA 59  1028 1028 ALA ALA B . n 
B 1 60  ILE 60  1029 1029 ILE ILE B . n 
B 1 61  LYS 61  1030 1030 LYS LYS B . n 
B 1 62  THR 62  1031 1031 THR THR B . n 
B 1 63  VAL 63  1032 1032 VAL VAL B . n 
B 1 64  ASN 64  1033 1033 ASN ASN B . n 
B 1 65  GLU 65  1034 1034 GLU GLU B . n 
B 1 66  ALA 66  1035 1035 ALA ALA B . n 
B 1 67  ALA 67  1036 1036 ALA ALA B . n 
B 1 68  SER 68  1037 1037 SER SER B . n 
B 1 69  MET 69  1038 1038 MET MET B . n 
B 1 70  ARG 70  1039 1039 ARG ARG B . n 
B 1 71  GLU 71  1040 1040 GLU GLU B . n 
B 1 72  ARG 72  1041 1041 ARG ARG B . n 
B 1 73  ILE 73  1042 1042 ILE ILE B . n 
B 1 74  GLU 74  1043 1043 GLU GLU B . n 
B 1 75  PHE 75  1044 1044 PHE PHE B . n 
B 1 76  LEU 76  1045 1045 LEU LEU B . n 
B 1 77  ASN 77  1046 1046 ASN ASN B . n 
B 1 78  GLU 78  1047 1047 GLU GLU B . n 
B 1 79  ALA 79  1048 1048 ALA ALA B . n 
B 1 80  SER 80  1049 1049 SER SER B . n 
B 1 81  VAL 81  1050 1050 VAL VAL B . n 
B 1 82  MET 82  1051 1051 MET MET B . n 
B 1 83  LYS 83  1052 1052 LYS LYS B . n 
B 1 84  GLU 84  1053 1053 GLU GLU B . n 
B 1 85  PHE 85  1054 1054 PHE PHE B . n 
B 1 86  ASN 86  1055 1055 ASN ASN B . n 
B 1 87  CYS 87  1056 1056 CYS CYS B . n 
B 1 88  HIS 88  1057 1057 HIS HIS B . n 
B 1 89  HIS 89  1058 1058 HIS HIS B . n 
B 1 90  VAL 90  1059 1059 VAL VAL B . n 
B 1 91  VAL 91  1060 1060 VAL VAL B . n 
B 1 92  ARG 92  1061 1061 ARG ARG B . n 
B 1 93  LEU 93  1062 1062 LEU LEU B . n 
B 1 94  LEU 94  1063 1063 LEU LEU B . n 
B 1 95  GLY 95  1064 1064 GLY GLY B . n 
B 1 96  VAL 96  1065 1065 VAL VAL B . n 
B 1 97  VAL 97  1066 1066 VAL VAL B . n 
B 1 98  SER 98  1067 1067 SER SER B . n 
B 1 99  GLN 99  1068 1068 GLN GLN B . n 
B 1 100 GLY 100 1069 1069 GLY GLY B . n 
B 1 101 GLN 101 1070 1070 GLN GLN B . n 
B 1 102 PRO 102 1071 1071 PRO PRO B . n 
B 1 103 THR 103 1072 1072 THR THR B . n 
B 1 104 LEU 104 1073 1073 LEU LEU B . n 
B 1 105 VAL 105 1074 1074 VAL VAL B . n 
B 1 106 ILE 106 1075 1075 ILE ILE B . n 
B 1 107 MET 107 1076 1076 MET MET B . n 
B 1 108 GLU 108 1077 1077 GLU GLU B . n 
B 1 109 LEU 109 1078 1078 LEU LEU B . n 
B 1 110 MET 110 1079 1079 MET MET B . n 
B 1 111 THR 111 1080 1080 THR THR B . n 
B 1 112 ARG 112 1081 1081 ARG ARG B . n 
B 1 113 GLY 113 1082 1082 GLY GLY B . n 
B 1 114 ASP 114 1083 1083 ASP ASP B . n 
B 1 115 LEU 115 1084 1084 LEU LEU B . n 
B 1 116 LYS 116 1085 1085 LYS LYS B . n 
B 1 117 SER 117 1086 1086 SER SER B . n 
B 1 118 TYR 118 1087 1087 TYR TYR B . n 
B 1 119 LEU 119 1088 1088 LEU LEU B . n 
B 1 120 ARG 120 1089 1089 ARG ARG B . n 
B 1 121 SER 121 1090 1090 SER SER B . n 
B 1 122 LEU 122 1091 1091 LEU LEU B . n 
B 1 123 ARG 123 1092 1092 ARG ARG B . n 
B 1 124 PRO 124 1093 1093 PRO PRO B . n 
B 1 125 GLU 125 1094 ?    ?   ?   B . n 
B 1 126 MET 126 1095 ?    ?   ?   B . n 
B 1 127 GLU 127 1096 ?    ?   ?   B . n 
B 1 128 ASN 128 1097 ?    ?   ?   B . n 
B 1 129 ASN 129 1098 ?    ?   ?   B . n 
B 1 130 PRO 130 1099 ?    ?   ?   B . n 
B 1 131 VAL 131 1100 1100 VAL VAL B . n 
B 1 132 LEU 132 1101 1101 LEU LEU B . n 
B 1 133 ALA 133 1102 1102 ALA ALA B . n 
B 1 134 PRO 134 1103 1103 PRO PRO B . n 
B 1 135 PRO 135 1104 1104 PRO PRO B . n 
B 1 136 SER 136 1105 1105 SER SER B . n 
B 1 137 LEU 137 1106 1106 LEU LEU B . n 
B 1 138 SER 138 1107 1107 SER SER B . n 
B 1 139 LYS 139 1108 1108 LYS LYS B . n 
B 1 140 MET 140 1109 1109 MET MET B . n 
B 1 141 ILE 141 1110 1110 ILE ILE B . n 
B 1 142 GLN 142 1111 1111 GLN GLN B . n 
B 1 143 MET 143 1112 1112 MET MET B . n 
B 1 144 ALA 144 1113 1113 ALA ALA B . n 
B 1 145 GLY 145 1114 1114 GLY GLY B . n 
B 1 146 GLU 146 1115 1115 GLU GLU B . n 
B 1 147 ILE 147 1116 1116 ILE ILE B . n 
B 1 148 ALA 148 1117 1117 ALA ALA B . n 
B 1 149 ASP 149 1118 1118 ASP ASP B . n 
B 1 150 GLY 150 1119 1119 GLY GLY B . n 
B 1 151 MET 151 1120 1120 MET MET B . n 
B 1 152 ALA 152 1121 1121 ALA ALA B . n 
B 1 153 TYR 153 1122 1122 TYR TYR B . n 
B 1 154 LEU 154 1123 1123 LEU LEU B . n 
B 1 155 ASN 155 1124 1124 ASN ASN B . n 
B 1 156 ALA 156 1125 1125 ALA ALA B . n 
B 1 157 ASN 157 1126 1126 ASN ASN B . n 
B 1 158 LYS 158 1127 1127 LYS LYS B . n 
B 1 159 PHE 159 1128 1128 PHE PHE B . n 
B 1 160 VAL 160 1129 1129 VAL VAL B . n 
B 1 161 HIS 161 1130 1130 HIS HIS B . n 
B 1 162 ARG 162 1131 1131 ARG ARG B . n 
B 1 163 ASP 163 1132 1132 ASP ASP B . n 
B 1 164 LEU 164 1133 1133 LEU LEU B . n 
B 1 165 ALA 165 1134 1134 ALA ALA B . n 
B 1 166 ALA 166 1135 1135 ALA ALA B . n 
B 1 167 ARG 167 1136 1136 ARG ARG B . n 
B 1 168 ASN 168 1137 1137 ASN ASN B . n 
B 1 169 CYS 169 1138 1138 CYS CYS B . n 
B 1 170 MET 170 1139 1139 MET MET B . n 
B 1 171 VAL 171 1140 1140 VAL VAL B . n 
B 1 172 ALA 172 1141 1141 ALA ALA B . n 
B 1 173 GLU 173 1142 1142 GLU GLU B . n 
B 1 174 ASP 174 1143 1143 ASP ASP B . n 
B 1 175 PHE 175 1144 1144 PHE PHE B . n 
B 1 176 THR 176 1145 1145 THR THR B . n 
B 1 177 VAL 177 1146 1146 VAL VAL B . n 
B 1 178 LYS 178 1147 1147 LYS LYS B . n 
B 1 179 ILE 179 1148 1148 ILE ILE B . n 
B 1 180 GLY 180 1149 1149 GLY GLY B . n 
B 1 181 ASP 181 1150 1150 ASP ASP B . n 
B 1 182 PHE 182 1151 1151 PHE PHE B . n 
B 1 183 GLY 183 1152 1152 GLY GLY B . n 
B 1 184 MET 184 1153 1153 MET MET B . n 
B 1 185 THR 185 1154 1154 THR THR B . n 
B 1 186 ARG 186 1155 1155 ARG ARG B . n 
B 1 187 ASP 187 1156 1156 ASP ASP B . n 
B 1 188 ILE 188 1157 1157 ILE ILE B . n 
B 1 189 TYR 189 1158 1158 TYR TYR B . n 
B 1 190 GLU 190 1159 1159 GLU GLU B . n 
B 1 191 THR 191 1160 1160 THR THR B . n 
B 1 192 ASP 192 1161 1161 ASP ASP B . n 
B 1 193 TYR 193 1162 1162 TYR TYR B . n 
B 1 194 TYR 194 1163 1163 TYR TYR B . n 
B 1 195 ARG 195 1164 1164 ARG ARG B . n 
B 1 196 LYS 196 1165 1165 LYS LYS B . n 
B 1 197 GLY 197 1166 1166 GLY GLY B . n 
B 1 198 GLY 198 1167 1167 GLY GLY B . n 
B 1 199 LYS 199 1168 1168 LYS LYS B . n 
B 1 200 GLY 200 1169 1169 GLY GLY B . n 
B 1 201 LEU 201 1170 1170 LEU LEU B . n 
B 1 202 LEU 202 1171 1171 LEU LEU B . n 
B 1 203 PRO 203 1172 1172 PRO PRO B . n 
B 1 204 VAL 204 1173 1173 VAL VAL B . n 
B 1 205 ARG 205 1174 1174 ARG ARG B . n 
B 1 206 TRP 206 1175 1175 TRP TRP B . n 
B 1 207 MET 207 1176 1176 MET MET B . n 
B 1 208 SER 208 1177 1177 SER SER B . n 
B 1 209 PRO 209 1178 1178 PRO PRO B . n 
B 1 210 GLU 210 1179 1179 GLU GLU B . n 
B 1 211 SER 211 1180 1180 SER SER B . n 
B 1 212 LEU 212 1181 1181 LEU LEU B . n 
B 1 213 LYS 213 1182 1182 LYS LYS B . n 
B 1 214 ASP 214 1183 1183 ASP ASP B . n 
B 1 215 GLY 215 1184 1184 GLY GLY B . n 
B 1 216 VAL 216 1185 1185 VAL VAL B . n 
B 1 217 PHE 217 1186 1186 PHE PHE B . n 
B 1 218 THR 218 1187 1187 THR THR B . n 
B 1 219 THR 219 1188 1188 THR THR B . n 
B 1 220 TYR 220 1189 1189 TYR TYR B . n 
B 1 221 SER 221 1190 1190 SER SER B . n 
B 1 222 ASP 222 1191 1191 ASP ASP B . n 
B 1 223 VAL 223 1192 1192 VAL VAL B . n 
B 1 224 TRP 224 1193 1193 TRP TRP B . n 
B 1 225 SER 225 1194 1194 SER SER B . n 
B 1 226 PHE 226 1195 1195 PHE PHE B . n 
B 1 227 GLY 227 1196 1196 GLY GLY B . n 
B 1 228 VAL 228 1197 1197 VAL VAL B . n 
B 1 229 VAL 229 1198 1198 VAL VAL B . n 
B 1 230 LEU 230 1199 1199 LEU LEU B . n 
B 1 231 TRP 231 1200 1200 TRP TRP B . n 
B 1 232 GLU 232 1201 1201 GLU GLU B . n 
B 1 233 ILE 233 1202 1202 ILE ILE B . n 
B 1 234 ALA 234 1203 1203 ALA ALA B . n 
B 1 235 THR 235 1204 1204 THR THR B . n 
B 1 236 LEU 236 1205 1205 LEU LEU B . n 
B 1 237 ALA 237 1206 1206 ALA ALA B . n 
B 1 238 GLU 238 1207 1207 GLU GLU B . n 
B 1 239 GLN 239 1208 1208 GLN GLN B . n 
B 1 240 PRO 240 1209 1209 PRO PRO B . n 
B 1 241 TYR 241 1210 1210 TYR TYR B . n 
B 1 242 GLN 242 1211 1211 GLN GLN B . n 
B 1 243 GLY 243 1212 1212 GLY GLY B . n 
B 1 244 LEU 244 1213 1213 LEU LEU B . n 
B 1 245 SER 245 1214 1214 SER SER B . n 
B 1 246 ASN 246 1215 1215 ASN ASN B . n 
B 1 247 GLU 247 1216 1216 GLU GLU B . n 
B 1 248 GLN 248 1217 1217 GLN GLN B . n 
B 1 249 VAL 249 1218 1218 VAL VAL B . n 
B 1 250 LEU 250 1219 1219 LEU LEU B . n 
B 1 251 ARG 251 1220 1220 ARG ARG B . n 
B 1 252 PHE 252 1221 1221 PHE PHE B . n 
B 1 253 VAL 253 1222 1222 VAL VAL B . n 
B 1 254 MET 254 1223 1223 MET MET B . n 
B 1 255 GLU 255 1224 1224 GLU GLU B . n 
B 1 256 GLY 256 1225 1225 GLY GLY B . n 
B 1 257 GLY 257 1226 1226 GLY GLY B . n 
B 1 258 LEU 258 1227 1227 LEU LEU B . n 
B 1 259 LEU 259 1228 1228 LEU LEU B . n 
B 1 260 ASP 260 1229 1229 ASP ASP B . n 
B 1 261 LYS 261 1230 1230 LYS LYS B . n 
B 1 262 PRO 262 1231 1231 PRO PRO B . n 
B 1 263 ASP 263 1232 1232 ASP ASP B . n 
B 1 264 ASN 264 1233 1233 ASN ASN B . n 
B 1 265 CYS 265 1234 1234 CYS CYS B . n 
B 1 266 PRO 266 1235 1235 PRO PRO B . n 
B 1 267 ASP 267 1236 1236 ASP ASP B . n 
B 1 268 MET 268 1237 1237 MET MET B . n 
B 1 269 LEU 269 1238 1238 LEU LEU B . n 
B 1 270 PHE 270 1239 1239 PHE PHE B . n 
B 1 271 GLU 271 1240 1240 GLU GLU B . n 
B 1 272 LEU 272 1241 1241 LEU LEU B . n 
B 1 273 MET 273 1242 1242 MET MET B . n 
B 1 274 ARG 274 1243 1243 ARG ARG B . n 
B 1 275 MET 275 1244 1244 MET MET B . n 
B 1 276 CYS 276 1245 1245 CYS CYS B . n 
B 1 277 TRP 277 1246 1246 TRP TRP B . n 
B 1 278 GLN 278 1247 1247 GLN GLN B . n 
B 1 279 TYR 279 1248 1248 TYR TYR B . n 
B 1 280 ASN 280 1249 1249 ASN ASN B . n 
B 1 281 PRO 281 1250 1250 PRO PRO B . n 
B 1 282 LYS 282 1251 1251 LYS LYS B . n 
B 1 283 MET 283 1252 1252 MET MET B . n 
B 1 284 ARG 284 1253 1253 ARG ARG B . n 
B 1 285 PRO 285 1254 1254 PRO PRO B . n 
B 1 286 SER 286 1255 1255 SER SER B . n 
B 1 287 PHE 287 1256 1256 PHE PHE B . n 
B 1 288 LEU 288 1257 1257 LEU LEU B . n 
B 1 289 GLU 289 1258 1258 GLU GLU B . n 
B 1 290 ILE 290 1259 1259 ILE ILE B . n 
B 1 291 ILE 291 1260 1260 ILE ILE B . n 
B 1 292 SER 292 1261 1261 SER SER B . n 
B 1 293 SER 293 1262 1262 SER SER B . n 
B 1 294 ILE 294 1263 1263 ILE ILE B . n 
B 1 295 LYS 295 1264 1264 LYS LYS B . n 
B 1 296 GLU 296 1265 1265 GLU GLU B . n 
B 1 297 GLU 297 1266 1266 GLU GLU B . n 
B 1 298 MET 298 1267 1267 MET MET B . n 
B 1 299 GLU 299 1268 1268 GLU GLU B . n 
B 1 300 PRO 300 1269 1269 PRO PRO B . n 
B 1 301 GLY 301 1270 1270 GLY GLY B . n 
B 1 302 PHE 302 1271 1271 PHE PHE B . n 
B 1 303 ARG 303 1272 1272 ARG ARG B . n 
B 1 304 GLU 304 1273 1273 GLU GLU B . n 
B 1 305 VAL 305 1274 1274 VAL VAL B . n 
B 1 306 SER 306 1275 1275 SER SER B . n 
B 1 307 PHE 307 1276 1276 PHE PHE B . n 
B 1 308 TYR 308 1277 1277 TYR TYR B . n 
B 1 309 TYR 309 1278 1278 TYR TYR B . n 
B 1 310 SER 310 1279 1279 SER SER B . n 
B 1 311 GLU 311 1280 1280 GLU GLU B . n 
B 1 312 GLU 312 1281 1281 GLU GLU B . n 
B 1 313 ASN 313 1282 1282 ASN ASN B . n 
B 1 314 LYS 314 1283 1283 LYS LYS B . n 
B 1 315 LEU 315 1284 ?    ?   ?   B . n 
B 1 316 PRO 316 1285 ?    ?   ?   B . n 
B 1 317 GLU 317 1286 ?    ?   ?   B . n 
B 1 318 PRO 318 1287 ?    ?   ?   B . n 
B 1 319 GLU 319 1288 ?    ?   ?   B . n 
B 1 320 GLU 320 1289 ?    ?   ?   B . n 
B 1 321 LEU 321 1290 ?    ?   ?   B . n 
B 1 322 ASP 322 1291 ?    ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-01-07 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
AMoRE     phasing           . ? 3 
CNX       refinement        . ? 4 
HKL-2000  'data reduction'  . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 987  ? ? -112.62 -153.56 
2  1 ASP A 1021 ? ? 56.77   7.87    
3  1 PRO A 1023 ? ? -62.37  -73.85  
4  1 ASN A 1033 ? ? -43.56  155.28  
5  1 ASN A 1055 ? ? -156.88 67.06   
6  1 VAL A 1060 ? ? -36.35  116.84  
7  1 ARG A 1131 ? ? 69.80   -16.63  
8  1 ASP A 1132 ? ? -146.44 42.79   
9  1 ASP A 1161 ? ? -66.32  2.55    
10 1 LYS A 1168 ? ? -95.98  -140.24 
11 1 ALA A 1206 ? ? 66.19   62.81   
12 1 TRP A 1246 ? ? -97.29  34.07   
13 1 GLU A 1281 ? ? -30.55  -36.11  
14 1 ASP B 987  ? ? -108.41 -153.13 
15 1 ASP B 1021 ? ? 76.86   -34.64  
16 1 ASN B 1033 ? ? -44.78  150.56  
17 1 ASN B 1055 ? ? -175.44 67.37   
18 1 LYS B 1127 ? ? 72.10   46.75   
19 1 ARG B 1131 ? ? 66.40   -13.05  
20 1 ASP B 1132 ? ? -147.20 36.99   
21 1 LYS B 1168 ? ? -105.48 -107.66 
22 1 ARG B 1174 ? ? -67.03  6.96    
23 1 ASN B 1233 ? ? 54.50   82.83   
24 1 PRO B 1235 ? ? -36.08  145.53  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 970  ? A MET 1   
2  1 Y 1 A ALA 971  ? A ALA 2   
3  1 Y 1 A SER 972  ? A SER 3   
4  1 Y 1 A VAL 973  ? A VAL 4   
5  1 Y 1 A ASN 974  ? A ASN 5   
6  1 Y 1 A PRO 975  ? A PRO 6   
7  1 Y 1 A GLU 976  ? A GLU 7   
8  1 Y 1 A TYR 977  ? A TYR 8   
9  1 Y 1 A PHE 978  ? A PHE 9   
10 1 Y 1 A GLU 1094 ? A GLU 125 
11 1 Y 1 A MET 1095 ? A MET 126 
12 1 Y 1 A GLU 1096 ? A GLU 127 
13 1 Y 1 A ASN 1097 ? A ASN 128 
14 1 Y 1 A ASN 1098 ? A ASN 129 
15 1 Y 1 A PRO 1099 ? A PRO 130 
16 1 Y 1 A LEU 1284 ? A LEU 315 
17 1 Y 1 A PRO 1285 ? A PRO 316 
18 1 Y 1 A GLU 1286 ? A GLU 317 
19 1 Y 1 A PRO 1287 ? A PRO 318 
20 1 Y 1 A GLU 1288 ? A GLU 319 
21 1 Y 1 A GLU 1289 ? A GLU 320 
22 1 Y 1 A LEU 1290 ? A LEU 321 
23 1 Y 1 A ASP 1291 ? A ASP 322 
24 1 Y 1 B MET 970  ? B MET 1   
25 1 Y 1 B ALA 971  ? B ALA 2   
26 1 Y 1 B SER 972  ? B SER 3   
27 1 Y 1 B VAL 973  ? B VAL 4   
28 1 Y 1 B ASN 974  ? B ASN 5   
29 1 Y 1 B PRO 975  ? B PRO 6   
30 1 Y 1 B GLU 976  ? B GLU 7   
31 1 Y 1 B TYR 977  ? B TYR 8   
32 1 Y 1 B PHE 978  ? B PHE 9   
33 1 Y 1 B GLU 1094 ? B GLU 125 
34 1 Y 1 B MET 1095 ? B MET 126 
35 1 Y 1 B GLU 1096 ? B GLU 127 
36 1 Y 1 B ASN 1097 ? B ASN 128 
37 1 Y 1 B ASN 1098 ? B ASN 129 
38 1 Y 1 B PRO 1099 ? B PRO 130 
39 1 Y 1 B LEU 1284 ? B LEU 315 
40 1 Y 1 B PRO 1285 ? B PRO 316 
41 1 Y 1 B GLU 1286 ? B GLU 317 
42 1 Y 1 B PRO 1287 ? B PRO 318 
43 1 Y 1 B GLU 1288 ? B GLU 319 
44 1 Y 1 B GLU 1289 ? B GLU 320 
45 1 Y 1 B LEU 1290 ? B LEU 321 
46 1 Y 1 B ASP 1291 ? B ASP 322 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   1   1   HOH TIP A . 
C 2 HOH 2   2   2   HOH TIP A . 
C 2 HOH 3   3   3   HOH TIP A . 
C 2 HOH 4   7   7   HOH TIP A . 
C 2 HOH 5   10  10  HOH TIP A . 
C 2 HOH 6   14  14  HOH TIP A . 
C 2 HOH 7   15  15  HOH TIP A . 
C 2 HOH 8   17  17  HOH TIP A . 
C 2 HOH 9   21  21  HOH TIP A . 
C 2 HOH 10  22  22  HOH TIP A . 
C 2 HOH 11  23  23  HOH TIP A . 
C 2 HOH 12  24  24  HOH TIP A . 
C 2 HOH 13  27  27  HOH TIP A . 
C 2 HOH 14  28  28  HOH TIP A . 
C 2 HOH 15  32  32  HOH TIP A . 
C 2 HOH 16  33  33  HOH TIP A . 
C 2 HOH 17  34  34  HOH TIP A . 
C 2 HOH 18  35  35  HOH TIP A . 
C 2 HOH 19  36  36  HOH TIP A . 
C 2 HOH 20  37  37  HOH TIP A . 
C 2 HOH 21  38  38  HOH TIP A . 
C 2 HOH 22  40  40  HOH TIP A . 
C 2 HOH 23  41  41  HOH TIP A . 
C 2 HOH 24  42  42  HOH TIP A . 
C 2 HOH 25  43  43  HOH TIP A . 
C 2 HOH 26  47  47  HOH TIP A . 
C 2 HOH 27  49  49  HOH TIP A . 
C 2 HOH 28  50  50  HOH TIP A . 
C 2 HOH 29  51  51  HOH TIP A . 
C 2 HOH 30  53  53  HOH TIP A . 
C 2 HOH 31  54  54  HOH TIP A . 
C 2 HOH 32  55  55  HOH TIP A . 
C 2 HOH 33  57  57  HOH TIP A . 
C 2 HOH 34  59  59  HOH TIP A . 
C 2 HOH 35  60  60  HOH TIP A . 
C 2 HOH 36  63  63  HOH TIP A . 
C 2 HOH 37  66  66  HOH TIP A . 
C 2 HOH 38  69  69  HOH TIP A . 
C 2 HOH 39  71  71  HOH TIP A . 
C 2 HOH 40  76  76  HOH TIP A . 
C 2 HOH 41  78  78  HOH TIP A . 
C 2 HOH 42  79  79  HOH TIP A . 
C 2 HOH 43  80  80  HOH TIP A . 
C 2 HOH 44  82  82  HOH TIP A . 
C 2 HOH 45  84  84  HOH TIP A . 
C 2 HOH 46  86  86  HOH TIP A . 
C 2 HOH 47  89  89  HOH TIP A . 
C 2 HOH 48  90  90  HOH TIP A . 
C 2 HOH 49  91  91  HOH TIP A . 
C 2 HOH 50  92  92  HOH TIP A . 
C 2 HOH 51  95  95  HOH TIP A . 
C 2 HOH 52  97  97  HOH TIP A . 
C 2 HOH 53  98  98  HOH TIP A . 
C 2 HOH 54  103 103 HOH TIP A . 
C 2 HOH 55  104 104 HOH TIP A . 
C 2 HOH 56  105 105 HOH TIP A . 
C 2 HOH 57  110 110 HOH TIP A . 
C 2 HOH 58  111 111 HOH TIP A . 
C 2 HOH 59  115 115 HOH TIP A . 
C 2 HOH 60  117 117 HOH TIP A . 
C 2 HOH 61  120 120 HOH TIP A . 
C 2 HOH 62  124 124 HOH TIP A . 
C 2 HOH 63  128 128 HOH TIP A . 
C 2 HOH 64  130 130 HOH TIP A . 
C 2 HOH 65  131 131 HOH TIP A . 
C 2 HOH 66  133 133 HOH TIP A . 
C 2 HOH 67  134 134 HOH TIP A . 
C 2 HOH 68  137 137 HOH TIP A . 
C 2 HOH 69  138 138 HOH TIP A . 
C 2 HOH 70  139 139 HOH TIP A . 
C 2 HOH 71  140 140 HOH TIP A . 
C 2 HOH 72  141 141 HOH TIP A . 
C 2 HOH 73  145 145 HOH TIP A . 
C 2 HOH 74  147 147 HOH TIP A . 
C 2 HOH 75  148 148 HOH TIP A . 
C 2 HOH 76  149 149 HOH TIP A . 
C 2 HOH 77  153 153 HOH TIP A . 
C 2 HOH 78  155 155 HOH TIP A . 
C 2 HOH 79  156 156 HOH TIP A . 
C 2 HOH 80  157 157 HOH TIP A . 
C 2 HOH 81  158 158 HOH TIP A . 
C 2 HOH 82  160 160 HOH TIP A . 
C 2 HOH 83  161 161 HOH TIP A . 
C 2 HOH 84  163 163 HOH TIP A . 
C 2 HOH 85  164 164 HOH TIP A . 
C 2 HOH 86  165 165 HOH TIP A . 
C 2 HOH 87  168 168 HOH TIP A . 
C 2 HOH 88  176 176 HOH TIP A . 
C 2 HOH 89  177 177 HOH TIP A . 
C 2 HOH 90  178 178 HOH TIP A . 
C 2 HOH 91  179 179 HOH TIP A . 
C 2 HOH 92  180 180 HOH TIP A . 
C 2 HOH 93  183 183 HOH TIP A . 
C 2 HOH 94  184 184 HOH TIP A . 
C 2 HOH 95  186 186 HOH TIP A . 
C 2 HOH 96  188 188 HOH TIP A . 
C 2 HOH 97  189 189 HOH TIP A . 
C 2 HOH 98  190 190 HOH TIP A . 
C 2 HOH 99  191 191 HOH TIP A . 
C 2 HOH 100 193 193 HOH TIP A . 
C 2 HOH 101 197 197 HOH TIP A . 
C 2 HOH 102 198 198 HOH TIP A . 
C 2 HOH 103 200 200 HOH TIP A . 
C 2 HOH 104 201 201 HOH TIP A . 
C 2 HOH 105 202 202 HOH TIP A . 
C 2 HOH 106 203 203 HOH TIP A . 
C 2 HOH 107 204 204 HOH TIP A . 
C 2 HOH 108 205 205 HOH TIP A . 
C 2 HOH 109 207 207 HOH TIP A . 
C 2 HOH 110 208 208 HOH TIP A . 
C 2 HOH 111 209 209 HOH TIP A . 
C 2 HOH 112 213 213 HOH TIP A . 
C 2 HOH 113 214 214 HOH TIP A . 
C 2 HOH 114 216 216 HOH TIP A . 
C 2 HOH 115 217 217 HOH TIP A . 
D 2 HOH 1   4   4   HOH TIP B . 
D 2 HOH 2   5   5   HOH TIP B . 
D 2 HOH 3   6   6   HOH TIP B . 
D 2 HOH 4   8   8   HOH TIP B . 
D 2 HOH 5   9   9   HOH TIP B . 
D 2 HOH 6   11  11  HOH TIP B . 
D 2 HOH 7   12  12  HOH TIP B . 
D 2 HOH 8   13  13  HOH TIP B . 
D 2 HOH 9   16  16  HOH TIP B . 
D 2 HOH 10  18  18  HOH TIP B . 
D 2 HOH 11  19  19  HOH TIP B . 
D 2 HOH 12  20  20  HOH TIP B . 
D 2 HOH 13  25  25  HOH TIP B . 
D 2 HOH 14  26  26  HOH TIP B . 
D 2 HOH 15  29  29  HOH TIP B . 
D 2 HOH 16  30  30  HOH TIP B . 
D 2 HOH 17  31  31  HOH TIP B . 
D 2 HOH 18  39  39  HOH TIP B . 
D 2 HOH 19  44  44  HOH TIP B . 
D 2 HOH 20  45  45  HOH TIP B . 
D 2 HOH 21  46  46  HOH TIP B . 
D 2 HOH 22  48  48  HOH TIP B . 
D 2 HOH 23  52  52  HOH TIP B . 
D 2 HOH 24  56  56  HOH TIP B . 
D 2 HOH 25  58  58  HOH TIP B . 
D 2 HOH 26  61  61  HOH TIP B . 
D 2 HOH 27  62  62  HOH TIP B . 
D 2 HOH 28  64  64  HOH TIP B . 
D 2 HOH 29  65  65  HOH TIP B . 
D 2 HOH 30  67  67  HOH TIP B . 
D 2 HOH 31  68  68  HOH TIP B . 
D 2 HOH 32  70  70  HOH TIP B . 
D 2 HOH 33  72  72  HOH TIP B . 
D 2 HOH 34  73  73  HOH TIP B . 
D 2 HOH 35  74  74  HOH TIP B . 
D 2 HOH 36  75  75  HOH TIP B . 
D 2 HOH 37  77  77  HOH TIP B . 
D 2 HOH 38  81  81  HOH TIP B . 
D 2 HOH 39  83  83  HOH TIP B . 
D 2 HOH 40  85  85  HOH TIP B . 
D 2 HOH 41  87  87  HOH TIP B . 
D 2 HOH 42  88  88  HOH TIP B . 
D 2 HOH 43  93  93  HOH TIP B . 
D 2 HOH 44  94  94  HOH TIP B . 
D 2 HOH 45  96  96  HOH TIP B . 
D 2 HOH 46  99  99  HOH TIP B . 
D 2 HOH 47  100 100 HOH TIP B . 
D 2 HOH 48  101 101 HOH TIP B . 
D 2 HOH 49  102 102 HOH TIP B . 
D 2 HOH 50  106 106 HOH TIP B . 
D 2 HOH 51  107 107 HOH TIP B . 
D 2 HOH 52  108 108 HOH TIP B . 
D 2 HOH 53  109 109 HOH TIP B . 
D 2 HOH 54  112 112 HOH TIP B . 
D 2 HOH 55  113 113 HOH TIP B . 
D 2 HOH 56  114 114 HOH TIP B . 
D 2 HOH 57  116 116 HOH TIP B . 
D 2 HOH 58  118 118 HOH TIP B . 
D 2 HOH 59  119 119 HOH TIP B . 
D 2 HOH 60  121 121 HOH TIP B . 
D 2 HOH 61  122 122 HOH TIP B . 
D 2 HOH 62  123 123 HOH TIP B . 
D 2 HOH 63  125 125 HOH TIP B . 
D 2 HOH 64  126 126 HOH TIP B . 
D 2 HOH 65  127 127 HOH TIP B . 
D 2 HOH 66  129 129 HOH TIP B . 
D 2 HOH 67  132 132 HOH TIP B . 
D 2 HOH 68  135 135 HOH TIP B . 
D 2 HOH 69  136 136 HOH TIP B . 
D 2 HOH 70  142 142 HOH TIP B . 
D 2 HOH 71  143 143 HOH TIP B . 
D 2 HOH 72  144 144 HOH TIP B . 
D 2 HOH 73  146 146 HOH TIP B . 
D 2 HOH 74  150 150 HOH TIP B . 
D 2 HOH 75  151 151 HOH TIP B . 
D 2 HOH 76  152 152 HOH TIP B . 
D 2 HOH 77  154 154 HOH TIP B . 
D 2 HOH 78  159 159 HOH TIP B . 
D 2 HOH 79  162 162 HOH TIP B . 
D 2 HOH 80  166 166 HOH TIP B . 
D 2 HOH 81  167 167 HOH TIP B . 
D 2 HOH 82  169 169 HOH TIP B . 
D 2 HOH 83  170 170 HOH TIP B . 
D 2 HOH 84  171 171 HOH TIP B . 
D 2 HOH 85  172 172 HOH TIP B . 
D 2 HOH 86  173 173 HOH TIP B . 
D 2 HOH 87  174 174 HOH TIP B . 
D 2 HOH 88  175 175 HOH TIP B . 
D 2 HOH 89  181 181 HOH TIP B . 
D 2 HOH 90  182 182 HOH TIP B . 
D 2 HOH 91  185 185 HOH TIP B . 
D 2 HOH 92  187 187 HOH TIP B . 
D 2 HOH 93  192 192 HOH TIP B . 
D 2 HOH 94  194 194 HOH TIP B . 
D 2 HOH 95  195 195 HOH TIP B . 
D 2 HOH 96  196 196 HOH TIP B . 
D 2 HOH 97  199 199 HOH TIP B . 
D 2 HOH 98  206 206 HOH TIP B . 
D 2 HOH 99  210 210 HOH TIP B . 
D 2 HOH 100 211 211 HOH TIP B . 
D 2 HOH 101 212 212 HOH TIP B . 
D 2 HOH 102 215 215 HOH TIP B . 
D 2 HOH 103 218 218 HOH TIP B . 
D 2 HOH 104 219 219 HOH TIP B . 
#