data_1M9H
# 
_entry.id   1M9H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1M9H         
RCSB  RCSB016763   
WWPDB D_1000016763 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1A80 
_pdbx_database_related.details        'Corynebacterium 2,5-DKGR A in presence of NADPH' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1M9H 
_pdbx_database_status.recvd_initial_deposition_date   2002-07-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sanli, G.'  1 
'Blaber, M.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structural alteration of cofactor specificity in Corynebacterium 2,5-diketo-D-gluconic acid reductase' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            13 
_citation.page_first                504 
_citation.page_last                 512 
_citation.year                      2004 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14718658 
_citation.pdbx_database_id_DOI      10.1110/ps.03450704 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sanli, G.'    1 
primary 'Banta, S.'    2 
primary 'Anderson, S.' 3 
primary 'Blaber, M.'   4 
# 
_cell.entry_id           1M9H 
_cell.length_a           111.950 
_cell.length_b           55.240 
_cell.length_c           51.540 
_cell.angle_alpha        90.00 
_cell.angle_beta         111.66 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1M9H 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                5 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '2,5-diketo-D-gluconic acid reductase A' 30062.465 1   1.1.1.- 'F22Y, K232G, R238H, A272G' ? ? 
2 non-polymer syn 'SULFATE ION'                            96.063    1   ?       ?                           ? ? 
3 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE        663.425   1   ?       ?                           ? ? 
4 water       nat water                                    18.015    146 ?       ?                           ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        '2,5-DKG reductase A, 2,5-DKGR A, 25DKGR-A, AKR5C' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTVPSIVLNDGNSIPQLGYGVYKVPPADTQRAVEEALEVGYRHIDTAAIYGNEEGVGAAIAASGIARDDLFITTKLWNDR
HDGDEPAAAIAESLAKLALDQVDLYLVHWPTPAADNYVHAWEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVN
QIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAAHGKTPAQAVLRWHLQKGFVVFPGSVRREHLE
ENLDVFDFDLTDTEIAAIDAMDPGDGSGRVSGHPDEVD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTVPSIVLNDGNSIPQLGYGVYKVPPADTQRAVEEALEVGYRHIDTAAIYGNEEGVGAAIAASGIARDDLFITTKLWNDR
HDGDEPAAAIAESLAKLALDQVDLYLVHWPTPAADNYVHAWEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVN
QIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAAHGKTPAQAVLRWHLQKGFVVFPGSVRREHLE
ENLDVFDFDLTDTEIAAIDAMDPGDGSGRVSGHPDEVD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   VAL n 
1 4   PRO n 
1 5   SER n 
1 6   ILE n 
1 7   VAL n 
1 8   LEU n 
1 9   ASN n 
1 10  ASP n 
1 11  GLY n 
1 12  ASN n 
1 13  SER n 
1 14  ILE n 
1 15  PRO n 
1 16  GLN n 
1 17  LEU n 
1 18  GLY n 
1 19  TYR n 
1 20  GLY n 
1 21  VAL n 
1 22  TYR n 
1 23  LYS n 
1 24  VAL n 
1 25  PRO n 
1 26  PRO n 
1 27  ALA n 
1 28  ASP n 
1 29  THR n 
1 30  GLN n 
1 31  ARG n 
1 32  ALA n 
1 33  VAL n 
1 34  GLU n 
1 35  GLU n 
1 36  ALA n 
1 37  LEU n 
1 38  GLU n 
1 39  VAL n 
1 40  GLY n 
1 41  TYR n 
1 42  ARG n 
1 43  HIS n 
1 44  ILE n 
1 45  ASP n 
1 46  THR n 
1 47  ALA n 
1 48  ALA n 
1 49  ILE n 
1 50  TYR n 
1 51  GLY n 
1 52  ASN n 
1 53  GLU n 
1 54  GLU n 
1 55  GLY n 
1 56  VAL n 
1 57  GLY n 
1 58  ALA n 
1 59  ALA n 
1 60  ILE n 
1 61  ALA n 
1 62  ALA n 
1 63  SER n 
1 64  GLY n 
1 65  ILE n 
1 66  ALA n 
1 67  ARG n 
1 68  ASP n 
1 69  ASP n 
1 70  LEU n 
1 71  PHE n 
1 72  ILE n 
1 73  THR n 
1 74  THR n 
1 75  LYS n 
1 76  LEU n 
1 77  TRP n 
1 78  ASN n 
1 79  ASP n 
1 80  ARG n 
1 81  HIS n 
1 82  ASP n 
1 83  GLY n 
1 84  ASP n 
1 85  GLU n 
1 86  PRO n 
1 87  ALA n 
1 88  ALA n 
1 89  ALA n 
1 90  ILE n 
1 91  ALA n 
1 92  GLU n 
1 93  SER n 
1 94  LEU n 
1 95  ALA n 
1 96  LYS n 
1 97  LEU n 
1 98  ALA n 
1 99  LEU n 
1 100 ASP n 
1 101 GLN n 
1 102 VAL n 
1 103 ASP n 
1 104 LEU n 
1 105 TYR n 
1 106 LEU n 
1 107 VAL n 
1 108 HIS n 
1 109 TRP n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 ALA n 
1 114 ALA n 
1 115 ASP n 
1 116 ASN n 
1 117 TYR n 
1 118 VAL n 
1 119 HIS n 
1 120 ALA n 
1 121 TRP n 
1 122 GLU n 
1 123 LYS n 
1 124 MET n 
1 125 ILE n 
1 126 GLU n 
1 127 LEU n 
1 128 ARG n 
1 129 ALA n 
1 130 ALA n 
1 131 GLY n 
1 132 LEU n 
1 133 THR n 
1 134 ARG n 
1 135 SER n 
1 136 ILE n 
1 137 GLY n 
1 138 VAL n 
1 139 SER n 
1 140 ASN n 
1 141 HIS n 
1 142 LEU n 
1 143 VAL n 
1 144 PRO n 
1 145 HIS n 
1 146 LEU n 
1 147 GLU n 
1 148 ARG n 
1 149 ILE n 
1 150 VAL n 
1 151 ALA n 
1 152 ALA n 
1 153 THR n 
1 154 GLY n 
1 155 VAL n 
1 156 VAL n 
1 157 PRO n 
1 158 ALA n 
1 159 VAL n 
1 160 ASN n 
1 161 GLN n 
1 162 ILE n 
1 163 GLU n 
1 164 LEU n 
1 165 HIS n 
1 166 PRO n 
1 167 ALA n 
1 168 TYR n 
1 169 GLN n 
1 170 GLN n 
1 171 ARG n 
1 172 GLU n 
1 173 ILE n 
1 174 THR n 
1 175 ASP n 
1 176 TRP n 
1 177 ALA n 
1 178 ALA n 
1 179 ALA n 
1 180 HIS n 
1 181 ASP n 
1 182 VAL n 
1 183 LYS n 
1 184 ILE n 
1 185 GLU n 
1 186 SER n 
1 187 TRP n 
1 188 GLY n 
1 189 PRO n 
1 190 LEU n 
1 191 GLY n 
1 192 GLN n 
1 193 GLY n 
1 194 LYS n 
1 195 TYR n 
1 196 ASP n 
1 197 LEU n 
1 198 PHE n 
1 199 GLY n 
1 200 ALA n 
1 201 GLU n 
1 202 PRO n 
1 203 VAL n 
1 204 THR n 
1 205 ALA n 
1 206 ALA n 
1 207 ALA n 
1 208 ALA n 
1 209 ALA n 
1 210 HIS n 
1 211 GLY n 
1 212 LYS n 
1 213 THR n 
1 214 PRO n 
1 215 ALA n 
1 216 GLN n 
1 217 ALA n 
1 218 VAL n 
1 219 LEU n 
1 220 ARG n 
1 221 TRP n 
1 222 HIS n 
1 223 LEU n 
1 224 GLN n 
1 225 LYS n 
1 226 GLY n 
1 227 PHE n 
1 228 VAL n 
1 229 VAL n 
1 230 PHE n 
1 231 PRO n 
1 232 GLY n 
1 233 SER n 
1 234 VAL n 
1 235 ARG n 
1 236 ARG n 
1 237 GLU n 
1 238 HIS n 
1 239 LEU n 
1 240 GLU n 
1 241 GLU n 
1 242 ASN n 
1 243 LEU n 
1 244 ASP n 
1 245 VAL n 
1 246 PHE n 
1 247 ASP n 
1 248 PHE n 
1 249 ASP n 
1 250 LEU n 
1 251 THR n 
1 252 ASP n 
1 253 THR n 
1 254 GLU n 
1 255 ILE n 
1 256 ALA n 
1 257 ALA n 
1 258 ILE n 
1 259 ASP n 
1 260 ALA n 
1 261 MET n 
1 262 ASP n 
1 263 PRO n 
1 264 GLY n 
1 265 ASP n 
1 266 GLY n 
1 267 SER n 
1 268 GLY n 
1 269 ARG n 
1 270 VAL n 
1 271 SER n 
1 272 GLY n 
1 273 HIS n 
1 274 PRO n 
1 275 ASP n 
1 276 GLU n 
1 277 VAL n 
1 278 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Corynebacterium 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Corynebacterium sp.' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1720 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET-21a(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DKGA_CORSC 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTVPSIVLNDGNSIPQLGYGVFKVPPADTQRAVEEALEVGYRHIDTAAIYGNEEGVGAAIAASGIARDDLFITTKLWNDR
HDGDEPAAAIAESLAKLALDQVDLYLVHWPTPAADNYVHAWEKMIELRAAGLTRSIGVSNHLVPHLERIVAATGVVPAVN
QIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAAHGKTPAQAVLRWHLQKGFVVFPKSVRRERLE
ENLDVFDFDLTDTEIAAIDAMDPGDGSGRVSAHPDEVD
;
_struct_ref.pdbx_align_begin           0 
_struct_ref.pdbx_db_accession          P06632 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1M9H 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 278 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P06632 
_struct_ref_seq.db_align_beg                  0 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  277 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       278 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1M9H TYR A 22  ? UNP P06632 PHE 21  ENGINEERED 22  1 
1 1M9H GLY A 232 ? UNP P06632 LYS 231 ENGINEERED 232 2 
1 1M9H HIS A 238 ? UNP P06632 ARG 237 ENGINEERED 238 3 
1 1M9H GLY A 272 ? UNP P06632 ALA 271 ENGINEERED 272 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'        133.103 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                             ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                     ? 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1M9H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   50.07 
_exptl_crystal.density_Matthews      2.46 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'lithium sulfate monohydrate, hepes-sodium, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1   103 ? 1 
2   103 ? 1 
1,2 ?   ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 'IMAGE PLATE' 'RIGAKU RAXIS IIC' 2002-04-04 'Osmic Blue confocal mirrors' 
2 CCD           MARRESEARCH        2002-04-11 'Osmic Blue confocal mirrors' 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'osmic mirrors' 'SINGLE WAVELENGTH' x-ray 
2 1 M 'osmic mirrors' 'SINGLE WAVELENGTH' x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 'ROTATING ANODE' RIGAKU         ? ? ? 1.5418 
2 'ROTATING ANODE' 'RIGAKU RUH2R' ? ? ? 1.5418 
# 
_reflns.entry_id                     1M9H 
_reflns.observed_criterion_sigma_F   3.0 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.d_resolution_high            2.0 
_reflns.d_resolution_low             40.00 
_reflns.number_all                   20178 
_reflns.number_obs                   17803 
_reflns.percent_possible_obs         88.2 
_reflns.pdbx_Rmerge_I_obs            0.114 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.6 
_reflns.B_iso_Wilson_estimate        15.0 
_reflns.pdbx_redundancy              4.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.05 
_reflns_shell.percent_possible_all   83.3 
_reflns_shell.Rmerge_I_obs           0.276 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.2 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2 
# 
_refine.entry_id                                 1M9H 
_refine.ls_d_res_high                            2.0 
_refine.ls_d_res_low                             40.0 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_ls_sigma_I                          3.0 
_refine.ls_number_reflns_all                     20178 
_refine.ls_number_reflns_obs                     17803 
_refine.ls_number_reflns_R_free                  561 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.214 
_refine.ls_R_factor_obs                          0.214 
_refine.ls_R_factor_R_work                       0.213 
_refine.ls_R_factor_R_free                       0.261 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1A80' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       TRONRUD 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2106 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         49 
_refine_hist.number_atoms_solvent             146 
_refine_hist.number_atoms_total               2301 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        40.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_angle_deg        1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
t_bond_d           0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d 14.9  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.0 
_refine_ls_shell.d_res_low                        2.05 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.31 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.52 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             46 
_refine_ls_shell.number_reflns_obs                1102 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1M9H 
_struct.title                     
;Corynebacterium 2,5-DKGR A and Phe 22 replaced with Tyr (F22Y), Lys 232 replaced with Gly (K232G), Arg 238 replaced with His (R238H)and Ala 272 replaced with Gly (A272G)in presence of NADH cofactor
;
_struct.pdbx_descriptor           '2,5-diketo-D-gluconic acid reductase A (E.C.1.1.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1M9H 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'TIM-barrel, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 25  ? GLY A 40  ? PRO A 25  GLY A 40  1 ? 16 
HELX_P HELX_P2  2  ALA A 47  ? GLY A 51  ? ALA A 47  GLY A 51  5 ? 5  
HELX_P HELX_P3  3  ASN A 52  ? SER A 63  ? ASN A 52  SER A 63  1 ? 12 
HELX_P HELX_P4  4  ALA A 66  ? LEU A 70  ? ALA A 66  LEU A 70  5 ? 5  
HELX_P HELX_P5  5  TRP A 77  ? HIS A 81  ? TRP A 77  HIS A 81  5 ? 5  
HELX_P HELX_P6  6  ASP A 84  ? ALA A 98  ? ASP A 84  ALA A 98  1 ? 15 
HELX_P HELX_P7  7  THR A 111 ? ASP A 115 ? THR A 111 ASP A 115 5 ? 5  
HELX_P HELX_P8  8  ASN A 116 ? ALA A 130 ? ASN A 116 ALA A 130 1 ? 15 
HELX_P HELX_P9  9  LEU A 142 ? GLY A 154 ? LEU A 142 GLY A 154 1 ? 13 
HELX_P HELX_P10 10 GLN A 170 ? ASP A 181 ? GLN A 170 ASP A 181 1 ? 12 
HELX_P HELX_P11 11 LEU A 190 ? LYS A 194 ? LEU A 190 LYS A 194 5 ? 5  
HELX_P HELX_P12 12 ALA A 200 ? ALA A 209 ? ALA A 200 ALA A 209 1 ? 10 
HELX_P HELX_P13 13 THR A 213 ? LYS A 225 ? THR A 213 LYS A 225 1 ? 13 
HELX_P HELX_P14 14 ARG A 235 ? ASP A 244 ? ARG A 235 ASP A 244 1 ? 10 
HELX_P HELX_P15 15 THR A 251 ? ALA A 260 ? THR A 251 ALA A 260 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
B 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 5   ? VAL A 7   ? SER A 5   VAL A 7   
A 2 SER A 13  ? PRO A 15  ? SER A 13  PRO A 15  
B 1 TYR A 19  ? GLY A 20  ? TYR A 19  GLY A 20  
B 2 HIS A 43  ? ASP A 45  ? HIS A 43  ASP A 45  
B 3 PHE A 71  ? LEU A 76  ? PHE A 71  LEU A 76  
B 4 VAL A 102 ? VAL A 107 ? VAL A 102 VAL A 107 
B 5 THR A 133 ? SER A 139 ? THR A 133 SER A 139 
B 6 VAL A 159 ? GLU A 163 ? VAL A 159 GLU A 163 
B 7 LYS A 183 ? TRP A 187 ? LYS A 183 TRP A 187 
B 8 VAL A 228 ? VAL A 229 ? VAL A 228 VAL A 229 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 6   ? N ILE A 6   O ILE A 14  ? O ILE A 14  
B 1 2 N TYR A 19  ? N TYR A 19  O HIS A 43  ? O HIS A 43  
B 2 3 N ILE A 44  ? N ILE A 44  O PHE A 71  ? O PHE A 71  
B 3 4 N LEU A 76  ? N LEU A 76  O LEU A 106 ? O LEU A 106 
B 4 5 N TYR A 105 ? N TYR A 105 O GLY A 137 ? O GLY A 137 
B 5 6 N VAL A 138 ? N VAL A 138 O VAL A 159 ? O VAL A 159 
B 6 7 N ILE A 162 ? N ILE A 162 O TRP A 187 ? O TRP A 187 
B 7 8 N SER A 186 ? N SER A 186 O VAL A 228 ? O VAL A 228 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 A 301' 
AC2 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE NAD A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ILE A 6   ? ILE A 6   . ? 2_656 ? 
2  AC1 8  VAL A 7   ? VAL A 7   . ? 2_656 ? 
3  AC1 8  LYS A 183 ? LYS A 183 . ? 2_656 ? 
4  AC1 8  ARG A 220 ? ARG A 220 . ? 1_555 ? 
5  AC1 8  PHE A 246 ? PHE A 246 . ? 1_555 ? 
6  AC1 8  HOH D .   ? HOH A 325 . ? 1_555 ? 
7  AC1 8  HOH D .   ? HOH A 337 . ? 1_555 ? 
8  AC1 8  HOH D .   ? HOH A 338 . ? 1_555 ? 
9  AC2 25 GLY A 20  ? GLY A 20  . ? 1_555 ? 
10 AC2 25 VAL A 21  ? VAL A 21  . ? 1_555 ? 
11 AC2 25 TYR A 22  ? TYR A 22  . ? 1_555 ? 
12 AC2 25 ASP A 45  ? ASP A 45  . ? 1_555 ? 
13 AC2 25 TYR A 50  ? TYR A 50  . ? 1_555 ? 
14 AC2 25 HIS A 108 ? HIS A 108 . ? 1_555 ? 
15 AC2 25 SER A 139 ? SER A 139 . ? 1_555 ? 
16 AC2 25 ASN A 140 ? ASN A 140 . ? 1_555 ? 
17 AC2 25 GLN A 161 ? GLN A 161 . ? 1_555 ? 
18 AC2 25 TRP A 187 ? TRP A 187 . ? 1_555 ? 
19 AC2 25 GLY A 188 ? GLY A 188 . ? 1_555 ? 
20 AC2 25 PRO A 189 ? PRO A 189 . ? 1_555 ? 
21 AC2 25 LEU A 190 ? LEU A 190 . ? 1_555 ? 
22 AC2 25 GLY A 191 ? GLY A 191 . ? 1_555 ? 
23 AC2 25 GLN A 192 ? GLN A 192 . ? 1_555 ? 
24 AC2 25 PHE A 198 ? PHE A 198 . ? 1_555 ? 
25 AC2 25 ALA A 215 ? ALA A 215 . ? 1_555 ? 
26 AC2 25 PHE A 230 ? PHE A 230 . ? 1_555 ? 
27 AC2 25 PRO A 231 ? PRO A 231 . ? 1_555 ? 
28 AC2 25 GLY A 232 ? GLY A 232 . ? 1_555 ? 
29 AC2 25 SER A 233 ? SER A 233 . ? 1_555 ? 
30 AC2 25 HIS A 238 ? HIS A 238 . ? 1_555 ? 
31 AC2 25 GLU A 241 ? GLU A 241 . ? 1_555 ? 
32 AC2 25 ASN A 242 ? ASN A 242 . ? 1_555 ? 
33 AC2 25 HOH D .   ? HOH A 382 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1M9H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1M9H 
_atom_sites.fract_transf_matrix[1][1]   0.008933 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003547 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018103 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020876 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 2   ? 50.795 3.444   15.174 1.00 39.52  ? 2   THR A N   1 
ATOM   2    C CA  . THR A 1 2   ? 50.178 3.684   16.467 1.00 37.51  ? 2   THR A CA  1 
ATOM   3    C C   . THR A 1 2   ? 49.311 4.938   16.467 1.00 36.94  ? 2   THR A C   1 
ATOM   4    O O   . THR A 1 2   ? 49.786 6.041   16.190 1.00 36.35  ? 2   THR A O   1 
ATOM   5    C CB  . THR A 1 2   ? 51.213 3.813   17.624 1.00 42.97  ? 2   THR A CB  1 
ATOM   6    O OG1 . THR A 1 2   ? 52.254 2.858   17.528 1.00 47.66  ? 2   THR A OG1 1 
ATOM   7    C CG2 . THR A 1 2   ? 50.515 3.710   18.977 1.00 39.36  ? 2   THR A CG2 1 
ATOM   8    N N   . VAL A 1 3   ? 48.046 4.768   16.814 1.00 26.27  ? 3   VAL A N   1 
ATOM   9    C CA  . VAL A 1 3   ? 47.137 5.890   16.934 1.00 20.56  ? 3   VAL A CA  1 
ATOM   10   C C   . VAL A 1 3   ? 46.720 5.971   18.376 1.00 20.41  ? 3   VAL A C   1 
ATOM   11   O O   . VAL A 1 3   ? 46.079 5.065   18.891 1.00 20.43  ? 3   VAL A O   1 
ATOM   12   C CB  . VAL A 1 3   ? 45.885 5.791   16.068 1.00 19.88  ? 3   VAL A CB  1 
ATOM   13   C CG1 . VAL A 1 3   ? 44.925 6.940   16.409 1.00 17.24  ? 3   VAL A CG1 1 
ATOM   14   C CG2 . VAL A 1 3   ? 46.260 5.828   14.595 1.00 18.63  ? 3   VAL A CG2 1 
ATOM   15   N N   . PRO A 1 4   ? 47.093 7.041   19.036 1.00 14.88  ? 4   PRO A N   1 
ATOM   16   C CA  . PRO A 1 4   ? 46.711 7.215   20.417 1.00 14.94  ? 4   PRO A CA  1 
ATOM   17   C C   . PRO A 1 4   ? 45.179 7.380   20.566 1.00 18.37  ? 4   PRO A C   1 
ATOM   18   O O   . PRO A 1 4   ? 44.476 7.777   19.636 1.00 18.71  ? 4   PRO A O   1 
ATOM   19   C CB  . PRO A 1 4   ? 47.382 8.519   20.865 1.00 15.59  ? 4   PRO A CB  1 
ATOM   20   C CG  . PRO A 1 4   ? 47.737 9.288   19.598 1.00 19.95  ? 4   PRO A CG  1 
ATOM   21   C CD  . PRO A 1 4   ? 47.714 8.269   18.467 1.00 15.86  ? 4   PRO A CD  1 
ATOM   22   N N   . SER A 1 5   ? 44.684 7.079   21.772 1.00 13.05  ? 5   SER A N   1 
ATOM   23   C CA  . SER A 1 5   ? 43.279 7.198   22.150 1.00 11.49  ? 5   SER A CA  1 
ATOM   24   C C   . SER A 1 5   ? 43.122 8.294   23.191 1.00 18.84  ? 5   SER A C   1 
ATOM   25   O O   . SER A 1 5   ? 44.084 8.658   23.873 1.00 17.79  ? 5   SER A O   1 
ATOM   26   C CB  . SER A 1 5   ? 42.794 5.919   22.851 1.00 12.81  ? 5   SER A CB  1 
ATOM   27   O OG  . SER A 1 5   ? 42.590 4.850   21.952 1.00 17.45  ? 5   SER A OG  1 
ATOM   28   N N   . ILE A 1 6   ? 41.892 8.781   23.350 1.00 16.95  ? 6   ILE A N   1 
ATOM   29   C CA  . ILE A 1 6   ? 41.566 9.745   24.387 1.00 16.26  ? 6   ILE A CA  1 
ATOM   30   C C   . ILE A 1 6   ? 40.485 9.126   25.248 1.00 18.88  ? 6   ILE A C   1 
ATOM   31   O O   . ILE A 1 6   ? 39.745 8.247   24.789 1.00 16.06  ? 6   ILE A O   1 
ATOM   32   C CB  . ILE A 1 6   ? 41.244 11.189  23.940 1.00 19.72  ? 6   ILE A CB  1 
ATOM   33   C CG1 . ILE A 1 6   ? 39.964 11.270  23.112 1.00 19.58  ? 6   ILE A CG1 1 
ATOM   34   C CG2 . ILE A 1 6   ? 42.426 11.791  23.180 1.00 18.43  ? 6   ILE A CG2 1 
ATOM   35   C CD1 . ILE A 1 6   ? 39.508 12.705  22.850 1.00 15.13  ? 6   ILE A CD1 1 
ATOM   36   N N   . VAL A 1 7   ? 40.417 9.538   26.504 1.00 15.66  ? 7   VAL A N   1 
ATOM   37   C CA  . VAL A 1 7   ? 39.429 8.984   27.412 1.00 14.18  ? 7   VAL A CA  1 
ATOM   38   C C   . VAL A 1 7   ? 38.189 9.880   27.548 1.00 15.72  ? 7   VAL A C   1 
ATOM   39   O O   . VAL A 1 7   ? 38.295 11.097  27.752 1.00 11.10  ? 7   VAL A O   1 
ATOM   40   C CB  . VAL A 1 7   ? 40.039 8.596   28.760 1.00 15.94  ? 7   VAL A CB  1 
ATOM   41   C CG1 . VAL A 1 7   ? 38.992 7.899   29.624 1.00 15.09  ? 7   VAL A CG1 1 
ATOM   42   C CG2 . VAL A 1 7   ? 41.233 7.665   28.551 1.00 14.89  ? 7   VAL A CG2 1 
ATOM   43   N N   . LEU A 1 8   ? 37.013 9.246   27.430 1.00 12.92  ? 8   LEU A N   1 
ATOM   44   C CA  . LEU A 1 8   ? 35.711 9.917   27.523 1.00 12.86  ? 8   LEU A CA  1 
ATOM   45   C C   . LEU A 1 8   ? 35.266 10.145  28.971 1.00 14.40  ? 8   LEU A C   1 
ATOM   46   O O   . LEU A 1 8   ? 35.792 9.528   29.898 1.00 12.94  ? 8   LEU A O   1 
ATOM   47   C CB  . LEU A 1 8   ? 34.625 9.165   26.718 1.00 12.54  ? 8   LEU A CB  1 
ATOM   48   C CG  . LEU A 1 8   ? 35.012 8.938   25.256 1.00 15.91  ? 8   LEU A CG  1 
ATOM   49   C CD1 . LEU A 1 8   ? 34.036 7.961   24.596 1.00 17.14  ? 8   LEU A CD1 1 
ATOM   50   C CD2 . LEU A 1 8   ? 35.022 10.267  24.505 1.00 13.01  ? 8   LEU A CD2 1 
ATOM   51   N N   . ASN A 1 9   ? 34.281 11.038  29.144 1.00 11.30  ? 9   ASN A N   1 
ATOM   52   C CA  . ASN A 1 9   ? 33.730 11.386  30.452 1.00 11.92  ? 9   ASN A CA  1 
ATOM   53   C C   . ASN A 1 9   ? 33.130 10.190  31.146 1.00 18.57  ? 9   ASN A C   1 
ATOM   54   O O   . ASN A 1 9   ? 32.877 10.210  32.344 1.00 21.36  ? 9   ASN A O   1 
ATOM   55   C CB  . ASN A 1 9   ? 32.687 12.526  30.375 1.00 10.52  ? 9   ASN A CB  1 
ATOM   56   C CG  . ASN A 1 9   ? 31.466 12.216  29.520 1.00 19.28  ? 9   ASN A CG  1 
ATOM   57   O OD1 . ASN A 1 9   ? 31.305 11.106  28.997 1.00 15.12  ? 9   ASN A OD1 1 
ATOM   58   N ND2 . ASN A 1 9   ? 30.597 13.213  29.360 1.00 12.65  ? 9   ASN A ND2 1 
ATOM   59   N N   . ASP A 1 10  ? 32.902 9.150   30.363 1.00 13.84  ? 10  ASP A N   1 
ATOM   60   C CA  . ASP A 1 10  ? 32.344 7.922   30.871 1.00 13.97  ? 10  ASP A CA  1 
ATOM   61   C C   . ASP A 1 10  ? 33.425 6.866   31.086 1.00 19.68  ? 10  ASP A C   1 
ATOM   62   O O   . ASP A 1 10  ? 33.134 5.719   31.432 1.00 16.51  ? 10  ASP A O   1 
ATOM   63   C CB  . ASP A 1 10  ? 31.173 7.392   30.016 1.00 14.15  ? 10  ASP A CB  1 
ATOM   64   C CG  . ASP A 1 10  ? 31.592 6.806   28.692 1.00 21.02  ? 10  ASP A CG  1 
ATOM   65   O OD1 . ASP A 1 10  ? 32.744 6.803   28.294 1.00 19.45  ? 10  ASP A OD1 1 
ATOM   66   O OD2 . ASP A 1 10  ? 30.580 6.329   28.000 1.00 18.27  ? 10  ASP A OD2 1 
ATOM   67   N N   . GLY A 1 11  ? 34.680 7.252   30.878 1.00 16.69  ? 11  GLY A N   1 
ATOM   68   C CA  . GLY A 1 11  ? 35.780 6.328   31.090 1.00 16.57  ? 11  GLY A CA  1 
ATOM   69   C C   . GLY A 1 11  ? 36.128 5.450   29.899 1.00 16.67  ? 11  GLY A C   1 
ATOM   70   O O   . GLY A 1 11  ? 37.155 4.776   29.908 1.00 15.17  ? 11  GLY A O   1 
ATOM   71   N N   . ASN A 1 12  ? 35.290 5.433   28.875 1.00 12.62  ? 12  ASN A N   1 
ATOM   72   C CA  . ASN A 1 12  ? 35.626 4.624   27.715 1.00 12.25  ? 12  ASN A CA  1 
ATOM   73   C C   . ASN A 1 12  ? 36.672 5.360   26.884 1.00 16.43  ? 12  ASN A C   1 
ATOM   74   O O   . ASN A 1 12  ? 36.756 6.592   26.924 1.00 14.46  ? 12  ASN A O   1 
ATOM   75   C CB  . ASN A 1 12  ? 34.400 4.208   26.872 1.00 12.53  ? 12  ASN A CB  1 
ATOM   76   C CG  . ASN A 1 12  ? 33.531 3.190   27.593 1.00 22.66  ? 12  ASN A CG  1 
ATOM   77   O OD1 . ASN A 1 12  ? 34.027 2.383   28.387 1.00 26.84  ? 12  ASN A OD1 1 
ATOM   78   N ND2 . ASN A 1 12  ? 32.222 3.269   27.378 1.00 22.55  ? 12  ASN A ND2 1 
ATOM   79   N N   . SER A 1 13  ? 37.496 4.639   26.157 1.00 11.96  ? 13  SER A N   1 
ATOM   80   C CA  . SER A 1 13  ? 38.485 5.331   25.365 1.00 13.05  ? 13  SER A CA  1 
ATOM   81   C C   . SER A 1 13  ? 38.158 5.260   23.892 1.00 17.76  ? 13  SER A C   1 
ATOM   82   O O   . SER A 1 13  ? 37.442 4.371   23.448 1.00 14.74  ? 13  SER A O   1 
ATOM   83   C CB  . SER A 1 13  ? 39.908 4.925   25.671 1.00 15.12  ? 13  SER A CB  1 
ATOM   84   O OG  . SER A 1 13  ? 40.106 3.595   25.256 1.00 23.10  ? 13  SER A OG  1 
ATOM   85   N N   . ILE A 1 14  ? 38.670 6.229   23.150 1.00 14.97  ? 14  ILE A N   1 
ATOM   86   C CA  . ILE A 1 14  ? 38.428 6.323   21.728 1.00 14.05  ? 14  ILE A CA  1 
ATOM   87   C C   . ILE A 1 14  ? 39.707 6.722   21.007 1.00 18.51  ? 14  ILE A C   1 
ATOM   88   O O   . ILE A 1 14  ? 40.423 7.612   21.462 1.00 19.74  ? 14  ILE A O   1 
ATOM   89   C CB  . ILE A 1 14  ? 37.310 7.361   21.472 1.00 15.37  ? 14  ILE A CB  1 
ATOM   90   C CG1 . ILE A 1 14  ? 36.883 7.393   20.006 1.00 12.53  ? 14  ILE A CG1 1 
ATOM   91   C CG2 . ILE A 1 14  ? 37.762 8.749   21.905 1.00 13.87  ? 14  ILE A CG2 1 
ATOM   92   C CD1 . ILE A 1 14  ? 35.704 8.331   19.745 1.00 15.42  ? 14  ILE A CD1 1 
ATOM   93   N N   . PRO A 1 15  ? 40.011 6.061   19.889 1.00 12.97  ? 15  PRO A N   1 
ATOM   94   C CA  . PRO A 1 15  ? 41.193 6.421   19.141 1.00 9.11   ? 15  PRO A CA  1 
ATOM   95   C C   . PRO A 1 15  ? 40.992 7.826   18.598 1.00 15.32  ? 15  PRO A C   1 
ATOM   96   O O   . PRO A 1 15  ? 39.953 8.138   18.016 1.00 12.70  ? 15  PRO A O   1 
ATOM   97   C CB  . PRO A 1 15  ? 41.335 5.404   18.014 1.00 10.08  ? 15  PRO A CB  1 
ATOM   98   C CG  . PRO A 1 15  ? 40.364 4.272   18.320 1.00 17.19  ? 15  PRO A CG  1 
ATOM   99   C CD  . PRO A 1 15  ? 39.428 4.783   19.411 1.00 14.12  ? 15  PRO A CD  1 
ATOM   100  N N   . GLN A 1 16  ? 41.975 8.674   18.830 1.00 12.43  ? 16  GLN A N   1 
ATOM   101  C CA  . GLN A 1 16  ? 41.888 10.065  18.437 1.00 12.01  ? 16  GLN A CA  1 
ATOM   102  C C   . GLN A 1 16  ? 41.742 10.345  16.957 1.00 16.79  ? 16  GLN A C   1 
ATOM   103  O O   . GLN A 1 16  ? 41.260 11.412  16.560 1.00 15.02  ? 16  GLN A O   1 
ATOM   104  C CB  . GLN A 1 16  ? 42.943 10.938  19.103 1.00 12.80  ? 16  GLN A CB  1 
ATOM   105  C CG  . GLN A 1 16  ? 42.413 12.345  19.434 1.00 10.75  ? 16  GLN A CG  1 
ATOM   106  C CD  . GLN A 1 16  ? 43.506 13.243  19.982 1.00 24.69  ? 16  GLN A CD  1 
ATOM   107  O OE1 . GLN A 1 16  ? 44.600 12.767  20.322 1.00 14.99  ? 16  GLN A OE1 1 
ATOM   108  N NE2 . GLN A 1 16  ? 43.225 14.549  20.029 1.00 14.59  ? 16  GLN A NE2 1 
ATOM   109  N N   . LEU A 1 17  ? 42.171 9.393   16.147 1.00 16.14  ? 17  LEU A N   1 
ATOM   110  C CA  . LEU A 1 17  ? 42.037 9.505   14.708 1.00 16.66  ? 17  LEU A CA  1 
ATOM   111  C C   . LEU A 1 17  ? 41.354 8.268   14.192 1.00 17.74  ? 17  LEU A C   1 
ATOM   112  O O   . LEU A 1 17  ? 41.681 7.153   14.589 1.00 17.85  ? 17  LEU A O   1 
ATOM   113  C CB  . LEU A 1 17  ? 43.333 9.770   13.916 1.00 17.51  ? 17  LEU A CB  1 
ATOM   114  C CG  . LEU A 1 17  ? 43.039 9.929   12.420 1.00 25.10  ? 17  LEU A CG  1 
ATOM   115  C CD1 . LEU A 1 17  ? 43.291 11.364  11.977 1.00 27.35  ? 17  LEU A CD1 1 
ATOM   116  C CD2 . LEU A 1 17  ? 43.870 8.960   11.589 1.00 25.30  ? 17  LEU A CD2 1 
ATOM   117  N N   . GLY A 1 18  ? 40.395 8.461   13.305 1.00 12.86  ? 18  GLY A N   1 
ATOM   118  C CA  . GLY A 1 18  ? 39.691 7.329   12.758 1.00 12.94  ? 18  GLY A CA  1 
ATOM   119  C C   . GLY A 1 18  ? 39.411 7.493   11.282 1.00 17.85  ? 18  GLY A C   1 
ATOM   120  O O   . GLY A 1 18  ? 39.869 8.446   10.650 1.00 18.78  ? 18  GLY A O   1 
ATOM   121  N N   . TYR A 1 19  ? 38.652 6.535   10.753 1.00 15.27  ? 19  TYR A N   1 
ATOM   122  C CA  . TYR A 1 19  ? 38.249 6.525   9.363  1.00 15.10  ? 19  TYR A CA  1 
ATOM   123  C C   . TYR A 1 19  ? 36.737 6.696   9.236  1.00 19.42  ? 19  TYR A C   1 
ATOM   124  O O   . TYR A 1 19  ? 35.964 5.843   9.660  1.00 16.20  ? 19  TYR A O   1 
ATOM   125  C CB  . TYR A 1 19  ? 38.768 5.284   8.597  1.00 16.50  ? 19  TYR A CB  1 
ATOM   126  C CG  . TYR A 1 19  ? 38.526 5.316   7.092  1.00 19.08  ? 19  TYR A CG  1 
ATOM   127  C CD1 . TYR A 1 19  ? 39.209 6.199   6.254  1.00 21.44  ? 19  TYR A CD1 1 
ATOM   128  C CD2 . TYR A 1 19  ? 37.629 4.418   6.514  1.00 19.08  ? 19  TYR A CD2 1 
ATOM   129  C CE1 . TYR A 1 19  ? 38.978 6.213   4.878  1.00 23.20  ? 19  TYR A CE1 1 
ATOM   130  C CE2 . TYR A 1 19  ? 37.390 4.408   5.141  1.00 19.19  ? 19  TYR A CE2 1 
ATOM   131  C CZ  . TYR A 1 19  ? 38.071 5.311   4.325  1.00 25.07  ? 19  TYR A CZ  1 
ATOM   132  O OH  . TYR A 1 19  ? 37.845 5.315   2.979  1.00 30.98  ? 19  TYR A OH  1 
ATOM   133  N N   . GLY A 1 20  ? 36.340 7.841   8.671  1.00 18.77  ? 20  GLY A N   1 
ATOM   134  C CA  . GLY A 1 20  ? 34.950 8.170   8.445  1.00 20.42  ? 20  GLY A CA  1 
ATOM   135  C C   . GLY A 1 20  ? 34.551 7.717   7.051  1.00 21.35  ? 20  GLY A C   1 
ATOM   136  O O   . GLY A 1 20  ? 35.267 7.962   6.086  1.00 21.56  ? 20  GLY A O   1 
ATOM   137  N N   . VAL A 1 21  ? 33.433 7.026   6.940  1.00 17.06  ? 21  VAL A N   1 
ATOM   138  C CA  . VAL A 1 21  ? 33.019 6.536   5.636  1.00 17.02  ? 21  VAL A CA  1 
ATOM   139  C C   . VAL A 1 21  ? 31.878 7.311   5.036  1.00 23.54  ? 21  VAL A C   1 
ATOM   140  O O   . VAL A 1 21  ? 31.125 6.821   4.189  1.00 23.29  ? 21  VAL A O   1 
ATOM   141  C CB  . VAL A 1 21  ? 32.745 5.048   5.603  1.00 16.27  ? 21  VAL A CB  1 
ATOM   142  C CG1 . VAL A 1 21  ? 34.019 4.284   5.925  1.00 15.05  ? 21  VAL A CG1 1 
ATOM   143  C CG2 . VAL A 1 21  ? 31.642 4.710   6.589  1.00 15.50  ? 21  VAL A CG2 1 
ATOM   144  N N   . TYR A 1 22  ? 31.757 8.513   5.476  1.00 21.77  ? 22  TYR A N   1 
ATOM   145  C CA  . TYR A 1 22  ? 30.741 9.318   4.920  1.00 23.09  ? 22  TYR A CA  1 
ATOM   146  C C   . TYR A 1 22  ? 31.099 9.537   3.466  1.00 27.07  ? 22  TYR A C   1 
ATOM   147  O O   . TYR A 1 22  ? 32.279 9.682   3.148  1.00 29.99  ? 22  TYR A O   1 
ATOM   148  C CB  . TYR A 1 22  ? 30.759 10.641  5.633  1.00 24.98  ? 22  TYR A CB  1 
ATOM   149  C CG  . TYR A 1 22  ? 29.981 11.628  4.881  1.00 29.41  ? 22  TYR A CG  1 
ATOM   150  C CD1 . TYR A 1 22  ? 28.686 11.303  4.489  1.00 33.11  ? 22  TYR A CD1 1 
ATOM   151  C CD2 . TYR A 1 22  ? 30.508 12.870  4.539  1.00 29.65  ? 22  TYR A CD2 1 
ATOM   152  C CE1 . TYR A 1 22  ? 27.901 12.201  3.773  1.00 38.28  ? 22  TYR A CE1 1 
ATOM   153  C CE2 . TYR A 1 22  ? 29.734 13.788  3.831  1.00 31.92  ? 22  TYR A CE2 1 
ATOM   154  C CZ  . TYR A 1 22  ? 28.436 13.447  3.445  1.00 44.41  ? 22  TYR A CZ  1 
ATOM   155  O OH  . TYR A 1 22  ? 27.681 14.345  2.738  1.00 49.05  ? 22  TYR A OH  1 
ATOM   156  N N   . LYS A 1 23  ? 30.109 9.551   2.587  1.00 21.42  ? 23  LYS A N   1 
ATOM   157  C CA  . LYS A 1 23  ? 30.355 9.757   1.167  1.00 21.26  ? 23  LYS A CA  1 
ATOM   158  C C   . LYS A 1 23  ? 30.851 8.528   0.438  1.00 24.57  ? 23  LYS A C   1 
ATOM   159  O O   . LYS A 1 23  ? 30.873 8.520   -0.789 1.00 27.19  ? 23  LYS A O   1 
ATOM   160  C CB  . LYS A 1 23  ? 31.269 10.935  0.858  1.00 26.34  ? 23  LYS A CB  1 
ATOM   161  C CG  . LYS A 1 23  ? 30.764 12.246  1.417  1.00 39.64  ? 23  LYS A CG  1 
ATOM   162  C CD  . LYS A 1 23  ? 29.519 12.742  0.707  1.00 55.39  ? 23  LYS A CD  1 
ATOM   163  C CE  . LYS A 1 23  ? 29.808 13.835  -0.311 1.00 74.14  ? 23  LYS A CE  1 
ATOM   164  N NZ  . LYS A 1 23  ? 28.588 14.381  -0.931 1.00 86.49  ? 23  LYS A NZ  1 
ATOM   165  N N   . VAL A 1 24  ? 31.277 7.492   1.156  1.00 16.69  ? 24  VAL A N   1 
ATOM   166  C CA  . VAL A 1 24  ? 31.727 6.308   0.445  1.00 16.33  ? 24  VAL A CA  1 
ATOM   167  C C   . VAL A 1 24  ? 30.519 5.526   -0.070 1.00 19.64  ? 24  VAL A C   1 
ATOM   168  O O   . VAL A 1 24  ? 29.633 5.190   0.708  1.00 17.90  ? 24  VAL A O   1 
ATOM   169  C CB  . VAL A 1 24  ? 32.652 5.404   1.271  1.00 17.87  ? 24  VAL A CB  1 
ATOM   170  C CG1 . VAL A 1 24  ? 33.212 4.288   0.400  1.00 17.41  ? 24  VAL A CG1 1 
ATOM   171  C CG2 . VAL A 1 24  ? 33.796 6.215   1.861  1.00 17.70  ? 24  VAL A CG2 1 
ATOM   172  N N   . PRO A 1 25  ? 30.463 5.262   -1.382 1.00 19.53  ? 25  PRO A N   1 
ATOM   173  C CA  . PRO A 1 25  ? 29.353 4.502   -1.886 1.00 18.78  ? 25  PRO A CA  1 
ATOM   174  C C   . PRO A 1 25  ? 29.307 3.166   -1.204 1.00 19.21  ? 25  PRO A C   1 
ATOM   175  O O   . PRO A 1 25  ? 30.323 2.513   -0.956 1.00 17.16  ? 25  PRO A O   1 
ATOM   176  C CB  . PRO A 1 25  ? 29.553 4.303   -3.390 1.00 20.39  ? 25  PRO A CB  1 
ATOM   177  C CG  . PRO A 1 25  ? 30.699 5.214   -3.791 1.00 25.70  ? 25  PRO A CG  1 
ATOM   178  C CD  . PRO A 1 25  ? 31.308 5.764   -2.505 1.00 20.71  ? 25  PRO A CD  1 
ATOM   179  N N   . PRO A 1 26  ? 28.104 2.785   -0.891 1.00 20.48  ? 26  PRO A N   1 
ATOM   180  C CA  . PRO A 1 26  ? 27.845 1.540   -0.234 1.00 20.12  ? 26  PRO A CA  1 
ATOM   181  C C   . PRO A 1 26  ? 28.535 0.347   -0.890 1.00 24.84  ? 26  PRO A C   1 
ATOM   182  O O   . PRO A 1 26  ? 29.132 -0.470  -0.195 1.00 25.23  ? 26  PRO A O   1 
ATOM   183  C CB  . PRO A 1 26  ? 26.322 1.393   -0.191 1.00 20.77  ? 26  PRO A CB  1 
ATOM   184  C CG  . PRO A 1 26  ? 25.750 2.785   -0.461 1.00 25.98  ? 26  PRO A CG  1 
ATOM   185  C CD  . PRO A 1 26  ? 26.891 3.636   -0.995 1.00 21.05  ? 26  PRO A CD  1 
ATOM   186  N N   . ALA A 1 27  ? 28.473 0.251   -2.226 1.00 21.32  ? 27  ALA A N   1 
ATOM   187  C CA  . ALA A 1 27  ? 29.102 -0.859  -2.937 1.00 19.84  ? 27  ALA A CA  1 
ATOM   188  C C   . ALA A 1 27  ? 30.634 -0.847  -2.862 1.00 25.27  ? 27  ALA A C   1 
ATOM   189  O O   . ALA A 1 27  ? 31.295 -1.809  -3.251 1.00 26.52  ? 27  ALA A O   1 
ATOM   190  C CB  . ALA A 1 27  ? 28.602 -0.958  -4.367 1.00 19.52  ? 27  ALA A CB  1 
ATOM   191  N N   . ASP A 1 28  ? 31.200 0.240   -2.347 1.00 20.50  ? 28  ASP A N   1 
ATOM   192  C CA  . ASP A 1 28  ? 32.648 0.336   -2.239 1.00 19.59  ? 28  ASP A CA  1 
ATOM   193  C C   . ASP A 1 28  ? 33.153 0.423   -0.812 1.00 21.28  ? 28  ASP A C   1 
ATOM   194  O O   . ASP A 1 28  ? 34.355 0.353   -0.579 1.00 21.77  ? 28  ASP A O   1 
ATOM   195  C CB  . ASP A 1 28  ? 33.192 1.599   -2.942 1.00 19.30  ? 28  ASP A CB  1 
ATOM   196  C CG  . ASP A 1 28  ? 32.809 1.712   -4.381 1.00 24.42  ? 28  ASP A CG  1 
ATOM   197  O OD1 . ASP A 1 28  ? 32.494 0.762   -5.074 1.00 22.62  ? 28  ASP A OD1 1 
ATOM   198  O OD2 . ASP A 1 28  ? 32.869 2.944   -4.808 1.00 36.80  ? 28  ASP A OD2 1 
ATOM   199  N N   . THR A 1 29  ? 32.243 0.528   0.129  1.00 17.53  ? 29  THR A N   1 
ATOM   200  C CA  . THR A 1 29  ? 32.607 0.676   1.524  1.00 14.51  ? 29  THR A CA  1 
ATOM   201  C C   . THR A 1 29  ? 33.433 -0.457  2.097  1.00 17.32  ? 29  THR A C   1 
ATOM   202  O O   . THR A 1 29  ? 34.353 -0.227  2.878  1.00 16.34  ? 29  THR A O   1 
ATOM   203  C CB  . THR A 1 29  ? 31.387 1.011   2.390  1.00 18.91  ? 29  THR A CB  1 
ATOM   204  O OG1 . THR A 1 29  ? 30.772 2.181   1.898  1.00 21.17  ? 29  THR A OG1 1 
ATOM   205  C CG2 . THR A 1 29  ? 31.814 1.201   3.830  1.00 13.24  ? 29  THR A CG2 1 
ATOM   206  N N   . GLN A 1 30  ? 33.102 -1.689  1.715  1.00 16.48  ? 30  GLN A N   1 
ATOM   207  C CA  . GLN A 1 30  ? 33.851 -2.822  2.224  1.00 17.61  ? 30  GLN A CA  1 
ATOM   208  C C   . GLN A 1 30  ? 35.327 -2.757  1.861  1.00 23.50  ? 30  GLN A C   1 
ATOM   209  O O   . GLN A 1 30  ? 36.180 -2.970  2.711  1.00 24.70  ? 30  GLN A O   1 
ATOM   210  C CB  . GLN A 1 30  ? 33.258 -4.208  1.908  1.00 18.63  ? 30  GLN A CB  1 
ATOM   211  C CG  . GLN A 1 30  ? 34.146 -5.330  2.497  1.00 16.14  ? 30  GLN A CG  1 
ATOM   212  C CD  . GLN A 1 30  ? 33.707 -6.744  2.156  1.00 23.92  ? 30  GLN A CD  1 
ATOM   213  O OE1 . GLN A 1 30  ? 34.405 -7.718  2.454  1.00 22.96  ? 30  GLN A OE1 1 
ATOM   214  N NE2 . GLN A 1 30  ? 32.543 -6.859  1.537  1.00 16.22  ? 30  GLN A NE2 1 
ATOM   215  N N   . ARG A 1 31  ? 35.636 -2.464  0.599  1.00 21.54  ? 31  ARG A N   1 
ATOM   216  C CA  . ARG A 1 31  ? 37.034 -2.367  0.196  1.00 21.06  ? 31  ARG A CA  1 
ATOM   217  C C   . ARG A 1 31  ? 37.740 -1.250  0.967  1.00 22.73  ? 31  ARG A C   1 
ATOM   218  O O   . ARG A 1 31  ? 38.801 -1.454  1.566  1.00 22.99  ? 31  ARG A O   1 
ATOM   219  C CB  . ARG A 1 31  ? 37.178 -2.186  -1.317 1.00 21.84  ? 31  ARG A CB  1 
ATOM   220  N N   . ALA A 1 32  ? 37.108 -0.059  0.946  1.00 16.15  ? 32  ALA A N   1 
ATOM   221  C CA  . ALA A 1 32  ? 37.602 1.135   1.625  1.00 15.29  ? 32  ALA A CA  1 
ATOM   222  C C   . ALA A 1 32  ? 37.971 0.852   3.078  1.00 23.23  ? 32  ALA A C   1 
ATOM   223  O O   . ALA A 1 32  ? 39.075 1.152   3.527  1.00 24.19  ? 32  ALA A O   1 
ATOM   224  C CB  . ALA A 1 32  ? 36.611 2.288   1.515  1.00 14.73  ? 32  ALA A CB  1 
ATOM   225  N N   . VAL A 1 33  ? 37.053 0.245   3.809  1.00 18.71  ? 33  VAL A N   1 
ATOM   226  C CA  . VAL A 1 33  ? 37.315 -0.073  5.196  1.00 17.14  ? 33  VAL A CA  1 
ATOM   227  C C   . VAL A 1 33  ? 38.397 -1.132  5.373  1.00 22.38  ? 33  VAL A C   1 
ATOM   228  O O   . VAL A 1 33  ? 39.190 -1.073  6.316  1.00 24.92  ? 33  VAL A O   1 
ATOM   229  C CB  . VAL A 1 33  ? 36.036 -0.475  5.912  1.00 18.59  ? 33  VAL A CB  1 
ATOM   230  C CG1 . VAL A 1 33  ? 36.335 -0.935  7.336  1.00 16.16  ? 33  VAL A CG1 1 
ATOM   231  C CG2 . VAL A 1 33  ? 35.029 0.679   5.911  1.00 16.23  ? 33  VAL A CG2 1 
ATOM   232  N N   . GLU A 1 34  ? 38.425 -2.117  4.483  1.00 17.80  ? 34  GLU A N   1 
ATOM   233  C CA  . GLU A 1 34  ? 39.431 -3.154  4.591  1.00 16.61  ? 34  GLU A CA  1 
ATOM   234  C C   . GLU A 1 34  ? 40.815 -2.548  4.426  1.00 21.17  ? 34  GLU A C   1 
ATOM   235  O O   . GLU A 1 34  ? 41.784 -2.992  5.028  1.00 22.16  ? 34  GLU A O   1 
ATOM   236  C CB  . GLU A 1 34  ? 39.211 -4.303  3.582  1.00 17.85  ? 34  GLU A CB  1 
ATOM   237  C CG  . GLU A 1 34  ? 38.103 -5.293  3.997  1.00 25.28  ? 34  GLU A CG  1 
ATOM   238  C CD  . GLU A 1 34  ? 37.643 -6.182  2.865  1.00 47.25  ? 34  GLU A CD  1 
ATOM   239  O OE1 . GLU A 1 34  ? 37.807 -5.908  1.688  1.00 56.41  ? 34  GLU A OE1 1 
ATOM   240  O OE2 . GLU A 1 34  ? 37.019 -7.258  3.275  1.00 23.06  ? 34  GLU A OE2 1 
ATOM   241  N N   . GLU A 1 35  ? 40.888 -1.521  3.586  1.00 17.65  ? 35  GLU A N   1 
ATOM   242  C CA  . GLU A 1 35  ? 42.136 -0.836  3.332  1.00 18.94  ? 35  GLU A CA  1 
ATOM   243  C C   . GLU A 1 35  ? 42.549 0.003   4.514  1.00 22.79  ? 35  GLU A C   1 
ATOM   244  O O   . GLU A 1 35  ? 43.720 0.047   4.876  1.00 23.35  ? 35  GLU A O   1 
ATOM   245  C CB  . GLU A 1 35  ? 42.080 0.026   2.062  1.00 19.75  ? 35  GLU A CB  1 
ATOM   246  C CG  . GLU A 1 35  ? 43.398 0.756   1.755  1.00 35.25  ? 35  GLU A CG  1 
ATOM   247  C CD  . GLU A 1 35  ? 43.489 1.163   0.313  1.00 70.30  ? 35  GLU A CD  1 
ATOM   248  O OE1 . GLU A 1 35  ? 43.433 0.368   -0.602 1.00 86.53  ? 35  GLU A OE1 1 
ATOM   249  O OE2 . GLU A 1 35  ? 43.595 2.459   0.149  1.00 70.26  ? 35  GLU A OE2 1 
ATOM   250  N N   . ALA A 1 36  ? 41.586 0.690   5.114  1.00 19.55  ? 36  ALA A N   1 
ATOM   251  C CA  . ALA A 1 36  ? 41.926 1.514   6.264  1.00 20.29  ? 36  ALA A CA  1 
ATOM   252  C C   . ALA A 1 36  ? 42.435 0.608   7.352  1.00 21.60  ? 36  ALA A C   1 
ATOM   253  O O   . ALA A 1 36  ? 43.467 0.834   7.986  1.00 21.32  ? 36  ALA A O   1 
ATOM   254  C CB  . ALA A 1 36  ? 40.722 2.321   6.743  1.00 20.59  ? 36  ALA A CB  1 
ATOM   255  N N   . LEU A 1 37  ? 41.672 -0.451  7.519  1.00 18.68  ? 37  LEU A N   1 
ATOM   256  C CA  . LEU A 1 37  ? 41.959 -1.456  8.489  1.00 19.54  ? 37  LEU A CA  1 
ATOM   257  C C   . LEU A 1 37  ? 43.375 -1.955  8.302  1.00 25.24  ? 37  LEU A C   1 
ATOM   258  O O   . LEU A 1 37  ? 44.158 -2.050  9.250  1.00 23.44  ? 37  LEU A O   1 
ATOM   259  C CB  . LEU A 1 37  ? 40.935 -2.612  8.396  1.00 19.16  ? 37  LEU A CB  1 
ATOM   260  C CG  . LEU A 1 37  ? 39.593 -2.327  9.082  1.00 24.08  ? 37  LEU A CG  1 
ATOM   261  C CD1 . LEU A 1 37  ? 38.800 -3.627  9.228  1.00 25.04  ? 37  LEU A CD1 1 
ATOM   262  C CD2 . LEU A 1 37  ? 39.807 -1.693  10.455 1.00 22.60  ? 37  LEU A CD2 1 
ATOM   263  N N   . GLU A 1 38  ? 43.695 -2.269  7.064  1.00 24.50  ? 38  GLU A N   1 
ATOM   264  C CA  . GLU A 1 38  ? 45.011 -2.739  6.746  1.00 24.82  ? 38  GLU A CA  1 
ATOM   265  C C   . GLU A 1 38  ? 46.029 -1.665  7.047  1.00 29.80  ? 38  GLU A C   1 
ATOM   266  O O   . GLU A 1 38  ? 47.109 -1.936  7.584  1.00 28.71  ? 38  GLU A O   1 
ATOM   267  C CB  . GLU A 1 38  ? 45.117 -3.178  5.288  1.00 27.36  ? 38  GLU A CB  1 
ATOM   268  C CG  . GLU A 1 38  ? 46.503 -3.737  4.962  1.00 49.87  ? 38  GLU A CG  1 
ATOM   269  C CD  . GLU A 1 38  ? 46.710 -3.929  3.494  1.00 110.75 ? 38  GLU A CD  1 
ATOM   270  O OE1 . GLU A 1 38  ? 45.795 -3.902  2.691  1.00 126.91 ? 38  GLU A OE1 1 
ATOM   271  O OE2 . GLU A 1 38  ? 47.966 -4.080  3.176  1.00 123.41 ? 38  GLU A OE2 1 
ATOM   272  N N   . VAL A 1 39  ? 45.683 -0.432  6.724  1.00 26.44  ? 39  VAL A N   1 
ATOM   273  C CA  . VAL A 1 39  ? 46.612 0.632   6.990  1.00 26.57  ? 39  VAL A CA  1 
ATOM   274  C C   . VAL A 1 39  ? 46.912 0.799   8.475  1.00 24.07  ? 39  VAL A C   1 
ATOM   275  O O   . VAL A 1 39  ? 47.964 1.302   8.854  1.00 24.85  ? 39  VAL A O   1 
ATOM   276  C CB  . VAL A 1 39  ? 46.248 1.937   6.300  1.00 34.65  ? 39  VAL A CB  1 
ATOM   277  C CG1 . VAL A 1 39  ? 47.076 3.081   6.883  1.00 35.30  ? 39  VAL A CG1 1 
ATOM   278  C CG2 . VAL A 1 39  ? 46.523 1.812   4.805  1.00 35.71  ? 39  VAL A CG2 1 
ATOM   279  N N   . GLY A 1 40  ? 45.986 0.354   9.316  1.00 17.13  ? 40  GLY A N   1 
ATOM   280  C CA  . GLY A 1 40  ? 46.160 0.459   10.745 1.00 16.73  ? 40  GLY A CA  1 
ATOM   281  C C   . GLY A 1 40  ? 45.040 1.246   11.418 1.00 23.35  ? 40  GLY A C   1 
ATOM   282  O O   . GLY A 1 40  ? 45.058 1.433   12.629 1.00 23.93  ? 40  GLY A O   1 
ATOM   283  N N   . TYR A 1 41  ? 44.061 1.719   10.634 1.00 20.76  ? 41  TYR A N   1 
ATOM   284  C CA  . TYR A 1 41  ? 42.934 2.445   11.217 1.00 19.66  ? 41  TYR A CA  1 
ATOM   285  C C   . TYR A 1 41  ? 42.129 1.455   12.077 1.00 21.49  ? 41  TYR A C   1 
ATOM   286  O O   . TYR A 1 41  ? 42.022 0.293   11.696 1.00 23.01  ? 41  TYR A O   1 
ATOM   287  C CB  . TYR A 1 41  ? 42.044 3.047   10.108 1.00 20.97  ? 41  TYR A CB  1 
ATOM   288  C CG  . TYR A 1 41  ? 42.638 4.252   9.416  1.00 19.83  ? 41  TYR A CG  1 
ATOM   289  C CD1 . TYR A 1 41  ? 43.516 4.111   8.339  1.00 20.87  ? 41  TYR A CD1 1 
ATOM   290  C CD2 . TYR A 1 41  ? 42.288 5.537   9.828  1.00 21.17  ? 41  TYR A CD2 1 
ATOM   291  C CE1 . TYR A 1 41  ? 44.053 5.231   7.703  1.00 20.92  ? 41  TYR A CE1 1 
ATOM   292  C CE2 . TYR A 1 41  ? 42.806 6.666   9.195  1.00 21.69  ? 41  TYR A CE2 1 
ATOM   293  C CZ  . TYR A 1 41  ? 43.692 6.510   8.132  1.00 27.71  ? 41  TYR A CZ  1 
ATOM   294  O OH  . TYR A 1 41  ? 44.189 7.625   7.506  1.00 24.88  ? 41  TYR A OH  1 
ATOM   295  N N   . ARG A 1 42  ? 41.588 1.883   13.251 1.00 17.78  ? 42  ARG A N   1 
ATOM   296  C CA  . ARG A 1 42  ? 40.814 0.998   14.170 1.00 16.46  ? 42  ARG A CA  1 
ATOM   297  C C   . ARG A 1 42  ? 39.447 1.577   14.568 1.00 20.29  ? 42  ARG A C   1 
ATOM   298  O O   . ARG A 1 42  ? 38.533 0.886   15.027 1.00 19.25  ? 42  ARG A O   1 
ATOM   299  C CB  . ARG A 1 42  ? 41.613 0.648   15.427 1.00 15.31  ? 42  ARG A CB  1 
ATOM   300  C CG  . ARG A 1 42  ? 42.779 -0.293  15.153 1.00 20.89  ? 42  ARG A CG  1 
ATOM   301  C CD  . ARG A 1 42  ? 42.346 -1.573  14.447 1.00 31.24  ? 42  ARG A CD  1 
ATOM   302  N NE  . ARG A 1 42  ? 43.485 -2.401  14.067 1.00 26.87  ? 42  ARG A NE  1 
ATOM   303  C CZ  . ARG A 1 42  ? 44.042 -2.402  12.862 1.00 36.51  ? 42  ARG A CZ  1 
ATOM   304  N NH1 . ARG A 1 42  ? 43.597 -1.634  11.866 1.00 20.25  ? 42  ARG A NH1 1 
ATOM   305  N NH2 . ARG A 1 42  ? 45.083 -3.204  12.646 1.00 41.93  ? 42  ARG A NH2 1 
ATOM   306  N N   . HIS A 1 43  ? 39.352 2.874   14.391 1.00 16.64  ? 43  HIS A N   1 
ATOM   307  C CA  . HIS A 1 43  ? 38.169 3.632   14.664 1.00 15.45  ? 43  HIS A CA  1 
ATOM   308  C C   . HIS A 1 43  ? 37.477 3.901   13.338 1.00 18.17  ? 43  HIS A C   1 
ATOM   309  O O   . HIS A 1 43  ? 38.028 4.563   12.465 1.00 18.09  ? 43  HIS A O   1 
ATOM   310  C CB  . HIS A 1 43  ? 38.561 4.943   15.387 1.00 14.85  ? 43  HIS A CB  1 
ATOM   311  C CG  . HIS A 1 43  ? 37.482 5.970   15.538 1.00 16.99  ? 43  HIS A CG  1 
ATOM   312  N ND1 . HIS A 1 43  ? 37.688 7.101   16.310 1.00 18.40  ? 43  HIS A ND1 1 
ATOM   313  C CD2 . HIS A 1 43  ? 36.223 6.044   15.012 1.00 17.53  ? 43  HIS A CD2 1 
ATOM   314  C CE1 . HIS A 1 43  ? 36.574 7.824   16.244 1.00 17.33  ? 43  HIS A CE1 1 
ATOM   315  N NE2 . HIS A 1 43  ? 35.676 7.215   15.469 1.00 17.10  ? 43  HIS A NE2 1 
ATOM   316  N N   . ILE A 1 44  ? 36.269 3.336   13.202 1.00 13.59  ? 44  ILE A N   1 
ATOM   317  C CA  . ILE A 1 44  ? 35.432 3.489   12.015 1.00 11.69  ? 44  ILE A CA  1 
ATOM   318  C C   . ILE A 1 44  ? 34.213 4.358   12.323 1.00 14.05  ? 44  ILE A C   1 
ATOM   319  O O   . ILE A 1 44  ? 33.460 4.095   13.266 1.00 14.30  ? 44  ILE A O   1 
ATOM   320  C CB  . ILE A 1 44  ? 34.990 2.145   11.389 1.00 12.77  ? 44  ILE A CB  1 
ATOM   321  C CG1 . ILE A 1 44  ? 36.174 1.208   11.200 1.00 12.13  ? 44  ILE A CG1 1 
ATOM   322  C CG2 . ILE A 1 44  ? 34.338 2.409   10.033 1.00 12.38  ? 44  ILE A CG2 1 
ATOM   323  C CD1 . ILE A 1 44  ? 37.382 1.898   10.582 1.00 14.89  ? 44  ILE A CD1 1 
ATOM   324  N N   . ASP A 1 45  ? 34.018 5.401   11.524 1.00 9.63   ? 45  ASP A N   1 
ATOM   325  C CA  . ASP A 1 45  ? 32.879 6.281   11.704 1.00 9.81   ? 45  ASP A CA  1 
ATOM   326  C C   . ASP A 1 45  ? 31.873 6.141   10.557 1.00 14.41  ? 45  ASP A C   1 
ATOM   327  O O   . ASP A 1 45  ? 32.152 6.501   9.405  1.00 11.97  ? 45  ASP A O   1 
ATOM   328  C CB  . ASP A 1 45  ? 33.286 7.762   11.991 1.00 9.57   ? 45  ASP A CB  1 
ATOM   329  C CG  . ASP A 1 45  ? 32.114 8.691   12.272 1.00 17.14  ? 45  ASP A CG  1 
ATOM   330  O OD1 . ASP A 1 45  ? 31.458 9.216   11.393 1.00 14.99  ? 45  ASP A OD1 1 
ATOM   331  O OD2 . ASP A 1 45  ? 31.867 8.866   13.552 1.00 17.73  ? 45  ASP A OD2 1 
ATOM   332  N N   . THR A 1 46  ? 30.702 5.587   10.890 1.00 13.56  ? 46  THR A N   1 
ATOM   333  C CA  . THR A 1 46  ? 29.639 5.413   9.915  1.00 12.70  ? 46  THR A CA  1 
ATOM   334  C C   . THR A 1 46  ? 28.354 6.032   10.409 1.00 19.69  ? 46  THR A C   1 
ATOM   335  O O   . THR A 1 46  ? 28.330 6.762   11.405 1.00 21.95  ? 46  THR A O   1 
ATOM   336  C CB  . THR A 1 46  ? 29.445 3.972   9.373  1.00 21.41  ? 46  THR A CB  1 
ATOM   337  O OG1 . THR A 1 46  ? 28.390 3.952   8.422  1.00 20.86  ? 46  THR A OG1 1 
ATOM   338  C CG2 . THR A 1 46  ? 29.147 2.993   10.498 1.00 19.55  ? 46  THR A CG2 1 
ATOM   339  N N   . ALA A 1 47  ? 27.286 5.747   9.698  1.00 12.94  ? 47  ALA A N   1 
ATOM   340  C CA  . ALA A 1 47  ? 25.993 6.280   10.043 1.00 10.71  ? 47  ALA A CA  1 
ATOM   341  C C   . ALA A 1 47  ? 24.907 5.570   9.266  1.00 15.63  ? 47  ALA A C   1 
ATOM   342  O O   . ALA A 1 47  ? 25.117 5.136   8.132  1.00 14.91  ? 47  ALA A O   1 
ATOM   343  C CB  . ALA A 1 47  ? 25.944 7.778   9.798  1.00 10.89  ? 47  ALA A CB  1 
ATOM   344  N N   . ALA A 1 48  ? 23.740 5.434   9.879  1.00 12.71  ? 48  ALA A N   1 
ATOM   345  C CA  . ALA A 1 48  ? 22.651 4.776   9.196  1.00 11.58  ? 48  ALA A CA  1 
ATOM   346  C C   . ALA A 1 48  ? 22.304 5.507   7.911  1.00 15.91  ? 48  ALA A C   1 
ATOM   347  O O   . ALA A 1 48  ? 22.082 4.891   6.875  1.00 18.40  ? 48  ALA A O   1 
ATOM   348  C CB  . ALA A 1 48  ? 21.421 4.635   10.078 1.00 10.65  ? 48  ALA A CB  1 
ATOM   349  N N   . ILE A 1 49  ? 22.257 6.828   7.965  1.00 12.07  ? 49  ILE A N   1 
ATOM   350  C CA  . ILE A 1 49  ? 21.920 7.569   6.772  1.00 10.32  ? 49  ILE A CA  1 
ATOM   351  C C   . ILE A 1 49  ? 22.925 7.343   5.640  1.00 18.81  ? 49  ILE A C   1 
ATOM   352  O O   . ILE A 1 49  ? 22.574 7.465   4.470  1.00 22.43  ? 49  ILE A O   1 
ATOM   353  C CB  . ILE A 1 49  ? 21.628 9.048   7.033  1.00 13.99  ? 49  ILE A CB  1 
ATOM   354  C CG1 . ILE A 1 49  ? 20.943 9.708   5.833  1.00 12.76  ? 49  ILE A CG1 1 
ATOM   355  C CG2 . ILE A 1 49  ? 22.921 9.796   7.349  1.00 14.15  ? 49  ILE A CG2 1 
ATOM   356  C CD1 . ILE A 1 49  ? 19.517 9.227   5.608  1.00 13.85  ? 49  ILE A CD1 1 
ATOM   357  N N   . TYR A 1 50  ? 24.178 6.998   5.984  1.00 15.20  ? 50  TYR A N   1 
ATOM   358  C CA  . TYR A 1 50  ? 25.204 6.742   4.963  1.00 13.19  ? 50  TYR A CA  1 
ATOM   359  C C   . TYR A 1 50  ? 24.878 5.530   4.101  1.00 18.81  ? 50  TYR A C   1 
ATOM   360  O O   . TYR A 1 50  ? 25.412 5.362   3.002  1.00 18.58  ? 50  TYR A O   1 
ATOM   361  C CB  . TYR A 1 50  ? 26.642 6.624   5.515  1.00 14.08  ? 50  TYR A CB  1 
ATOM   362  C CG  . TYR A 1 50  ? 27.135 7.796   6.337  1.00 16.18  ? 50  TYR A CG  1 
ATOM   363  C CD1 . TYR A 1 50  ? 26.532 9.053   6.285  1.00 17.09  ? 50  TYR A CD1 1 
ATOM   364  C CD2 . TYR A 1 50  ? 28.246 7.635   7.164  1.00 18.01  ? 50  TYR A CD2 1 
ATOM   365  C CE1 . TYR A 1 50  ? 27.015 10.116  7.053  1.00 14.26  ? 50  TYR A CE1 1 
ATOM   366  C CE2 . TYR A 1 50  ? 28.737 8.682   7.945  1.00 19.22  ? 50  TYR A CE2 1 
ATOM   367  C CZ  . TYR A 1 50  ? 28.115 9.930   7.886  1.00 17.35  ? 50  TYR A CZ  1 
ATOM   368  O OH  . TYR A 1 50  ? 28.572 10.975  8.653  1.00 19.75  ? 50  TYR A OH  1 
ATOM   369  N N   . GLY A 1 51  ? 23.995 4.683   4.625  1.00 18.47  ? 51  GLY A N   1 
ATOM   370  C CA  . GLY A 1 51  ? 23.546 3.469   3.950  1.00 18.26  ? 51  GLY A CA  1 
ATOM   371  C C   . GLY A 1 51  ? 24.682 2.515   3.623  1.00 21.45  ? 51  GLY A C   1 
ATOM   372  O O   . GLY A 1 51  ? 24.596 1.747   2.671  1.00 21.66  ? 51  GLY A O   1 
ATOM   373  N N   . ASN A 1 52  ? 25.749 2.556   4.428  1.00 16.78  ? 52  ASN A N   1 
ATOM   374  C CA  . ASN A 1 52  ? 26.904 1.698   4.190  1.00 16.72  ? 52  ASN A CA  1 
ATOM   375  C C   . ASN A 1 52  ? 27.403 0.919   5.418  1.00 17.96  ? 52  ASN A C   1 
ATOM   376  O O   . ASN A 1 52  ? 28.553 0.472   5.461  1.00 17.40  ? 52  ASN A O   1 
ATOM   377  C CB  . ASN A 1 52  ? 28.045 2.456   3.475  1.00 14.81  ? 52  ASN A CB  1 
ATOM   378  C CG  . ASN A 1 52  ? 28.561 3.616   4.297  1.00 24.55  ? 52  ASN A CG  1 
ATOM   379  O OD1 . ASN A 1 52  ? 28.330 3.669   5.510  1.00 15.41  ? 52  ASN A OD1 1 
ATOM   380  N ND2 . ASN A 1 52  ? 29.263 4.545   3.647  1.00 13.97  ? 52  ASN A ND2 1 
ATOM   381  N N   . GLU A 1 53  ? 26.531 0.729   6.403  1.00 13.75  ? 53  GLU A N   1 
ATOM   382  C CA  . GLU A 1 53  ? 26.908 -0.009  7.593  1.00 13.13  ? 53  GLU A CA  1 
ATOM   383  C C   . GLU A 1 53  ? 27.287 -1.450  7.276  1.00 18.31  ? 53  GLU A C   1 
ATOM   384  O O   . GLU A 1 53  ? 28.182 -2.016  7.891  1.00 16.70  ? 53  GLU A O   1 
ATOM   385  C CB  . GLU A 1 53  ? 25.832 0.047   8.703  1.00 14.57  ? 53  GLU A CB  1 
ATOM   386  C CG  . GLU A 1 53  ? 25.690 1.439   9.364  1.00 10.99  ? 53  GLU A CG  1 
ATOM   387  C CD  . GLU A 1 53  ? 24.315 1.663   9.939  1.00 16.38  ? 53  GLU A CD  1 
ATOM   388  O OE1 . GLU A 1 53  ? 23.301 1.267   9.399  1.00 16.26  ? 53  GLU A OE1 1 
ATOM   389  O OE2 . GLU A 1 53  ? 24.320 2.293   11.088 1.00 14.27  ? 53  GLU A OE2 1 
ATOM   390  N N   . GLU A 1 54  ? 26.583 -2.026  6.304  1.00 18.01  ? 54  GLU A N   1 
ATOM   391  C CA  . GLU A 1 54  ? 26.818 -3.400  5.885  1.00 17.86  ? 54  GLU A CA  1 
ATOM   392  C C   . GLU A 1 54  ? 28.225 -3.618  5.421  1.00 15.46  ? 54  GLU A C   1 
ATOM   393  O O   . GLU A 1 54  ? 28.870 -4.585  5.814  1.00 17.14  ? 54  GLU A O   1 
ATOM   394  C CB  . GLU A 1 54  ? 25.842 -3.823  4.797  1.00 21.18  ? 54  GLU A CB  1 
ATOM   395  C CG  . GLU A 1 54  ? 24.460 -4.127  5.373  1.00 48.90  ? 54  GLU A CG  1 
ATOM   396  C CD  . GLU A 1 54  ? 23.597 -4.896  4.425  1.00 95.82  ? 54  GLU A CD  1 
ATOM   397  O OE1 . GLU A 1 54  ? 24.026 -5.761  3.681  1.00 95.54  ? 54  GLU A OE1 1 
ATOM   398  O OE2 . GLU A 1 54  ? 22.338 -4.531  4.480  1.00 88.09  ? 54  GLU A OE2 1 
ATOM   399  N N   . GLY A 1 55  ? 28.682 -2.706  4.575  1.00 11.04  ? 55  GLY A N   1 
ATOM   400  C CA  . GLY A 1 55  ? 30.031 -2.746  4.046  1.00 13.34  ? 55  GLY A CA  1 
ATOM   401  C C   . GLY A 1 55  ? 31.055 -2.709  5.166  1.00 20.32  ? 55  GLY A C   1 
ATOM   402  O O   . GLY A 1 55  ? 32.036 -3.457  5.170  1.00 21.08  ? 55  GLY A O   1 
ATOM   403  N N   . VAL A 1 56  ? 30.814 -1.828  6.139  1.00 21.01  ? 56  VAL A N   1 
ATOM   404  C CA  . VAL A 1 56  ? 31.694 -1.692  7.293  1.00 16.68  ? 56  VAL A CA  1 
ATOM   405  C C   . VAL A 1 56  ? 31.768 -3.008  8.047  1.00 19.32  ? 56  VAL A C   1 
ATOM   406  O O   . VAL A 1 56  ? 32.841 -3.505  8.406  1.00 17.19  ? 56  VAL A O   1 
ATOM   407  C CB  . VAL A 1 56  ? 31.190 -0.603  8.242  1.00 16.19  ? 56  VAL A CB  1 
ATOM   408  C CG1 . VAL A 1 56  ? 32.024 -0.591  9.513  1.00 16.85  ? 56  VAL A CG1 1 
ATOM   409  C CG2 . VAL A 1 56  ? 31.254 0.764   7.584  1.00 15.09  ? 56  VAL A CG2 1 
ATOM   410  N N   . GLY A 1 57  ? 30.586 -3.550  8.298  1.00 18.11  ? 57  GLY A N   1 
ATOM   411  C CA  . GLY A 1 57  ? 30.455 -4.787  9.010  1.00 17.88  ? 57  GLY A CA  1 
ATOM   412  C C   . GLY A 1 57  ? 31.151 -5.887  8.260  1.00 24.34  ? 57  GLY A C   1 
ATOM   413  O O   . GLY A 1 57  ? 31.880 -6.696  8.838  1.00 24.53  ? 57  GLY A O   1 
ATOM   414  N N   . ALA A 1 58  ? 30.932 -5.904  6.959  1.00 19.82  ? 58  ALA A N   1 
ATOM   415  C CA  . ALA A 1 58  ? 31.546 -6.911  6.125  1.00 19.75  ? 58  ALA A CA  1 
ATOM   416  C C   . ALA A 1 58  ? 33.064 -6.808  6.162  1.00 23.85  ? 58  ALA A C   1 
ATOM   417  O O   . ALA A 1 58  ? 33.766 -7.824  6.217  1.00 23.70  ? 58  ALA A O   1 
ATOM   418  C CB  . ALA A 1 58  ? 31.009 -6.854  4.704  1.00 20.47  ? 58  ALA A CB  1 
ATOM   419  N N   . ALA A 1 59  ? 33.568 -5.562  6.136  1.00 17.69  ? 59  ALA A N   1 
ATOM   420  C CA  . ALA A 1 59  ? 35.000 -5.287  6.186  1.00 16.20  ? 59  ALA A CA  1 
ATOM   421  C C   . ALA A 1 59  ? 35.594 -5.751  7.504  1.00 21.69  ? 59  ALA A C   1 
ATOM   422  O O   . ALA A 1 59  ? 36.655 -6.367  7.552  1.00 21.77  ? 59  ALA A O   1 
ATOM   423  C CB  . ALA A 1 59  ? 35.284 -3.803  5.958  1.00 17.44  ? 59  ALA A CB  1 
ATOM   424  N N   . ILE A 1 60  ? 34.881 -5.460  8.584  1.00 19.13  ? 60  ILE A N   1 
ATOM   425  C CA  . ILE A 1 60  ? 35.304 -5.861  9.904  1.00 19.08  ? 60  ILE A CA  1 
ATOM   426  C C   . ILE A 1 60  ? 35.447 -7.369  10.000 1.00 25.17  ? 60  ILE A C   1 
ATOM   427  O O   . ILE A 1 60  ? 36.498 -7.895  10.363 1.00 25.58  ? 60  ILE A O   1 
ATOM   428  C CB  . ILE A 1 60  ? 34.289 -5.421  10.936 1.00 21.89  ? 60  ILE A CB  1 
ATOM   429  C CG1 . ILE A 1 60  ? 34.280 -3.905  11.044 1.00 21.71  ? 60  ILE A CG1 1 
ATOM   430  C CG2 . ILE A 1 60  ? 34.611 -6.058  12.288 1.00 20.81  ? 60  ILE A CG2 1 
ATOM   431  C CD1 . ILE A 1 60  ? 33.153 -3.381  11.919 1.00 25.13  ? 60  ILE A CD1 1 
ATOM   432  N N   . ALA A 1 61  ? 34.365 -8.059  9.669  1.00 21.11  ? 61  ALA A N   1 
ATOM   433  C CA  . ALA A 1 61  ? 34.367 -9.497  9.693  1.00 21.59  ? 61  ALA A CA  1 
ATOM   434  C C   . ALA A 1 61  ? 35.485 -10.061 8.849  1.00 28.40  ? 61  ALA A C   1 
ATOM   435  O O   . ALA A 1 61  ? 36.147 -11.023 9.225  1.00 30.03  ? 61  ALA A O   1 
ATOM   436  C CB  . ALA A 1 61  ? 33.024 -10.042 9.235  1.00 22.78  ? 61  ALA A CB  1 
ATOM   437  N N   . ALA A 1 62  ? 35.693 -9.444  7.693  1.00 25.73  ? 62  ALA A N   1 
ATOM   438  C CA  . ALA A 1 62  ? 36.736 -9.876  6.793  1.00 25.32  ? 62  ALA A CA  1 
ATOM   439  C C   . ALA A 1 62  ? 38.110 -9.741  7.422  1.00 28.60  ? 62  ALA A C   1 
ATOM   440  O O   . ALA A 1 62  ? 38.975 -10.591 7.239  1.00 29.23  ? 62  ALA A O   1 
ATOM   441  C CB  . ALA A 1 62  ? 36.660 -9.157  5.459  1.00 26.48  ? 62  ALA A CB  1 
ATOM   442  N N   . SER A 1 63  ? 38.303 -8.657  8.159  1.00 24.97  ? 63  SER A N   1 
ATOM   443  C CA  . SER A 1 63  ? 39.554 -8.433  8.844  1.00 25.24  ? 63  SER A CA  1 
ATOM   444  C C   . SER A 1 63  ? 39.580 -9.442  9.952  1.00 34.95  ? 63  SER A C   1 
ATOM   445  O O   . SER A 1 63  ? 38.530 -9.775  10.490 1.00 37.76  ? 63  SER A O   1 
ATOM   446  C CB  . SER A 1 63  ? 39.578 -7.047  9.467  1.00 24.44  ? 63  SER A CB  1 
ATOM   447  O OG  . SER A 1 63  ? 38.829 -7.058  10.671 1.00 24.50  ? 63  SER A OG  1 
ATOM   448  N N   . GLY A 1 64  ? 40.714 -9.960  10.320 1.00 31.49  ? 64  GLY A N   1 
ATOM   449  C CA  . GLY A 1 64  ? 40.635 -10.927 11.394 1.00 32.89  ? 64  GLY A CA  1 
ATOM   450  C C   . GLY A 1 64  ? 40.409 -10.251 12.747 1.00 39.42  ? 64  GLY A C   1 
ATOM   451  O O   . GLY A 1 64  ? 39.981 -10.877 13.715 1.00 42.65  ? 64  GLY A O   1 
ATOM   452  N N   . ILE A 1 65  ? 40.688 -8.962  12.761 1.00 30.42  ? 65  ILE A N   1 
ATOM   453  C CA  . ILE A 1 65  ? 40.606 -8.092  13.919 1.00 24.77  ? 65  ILE A CA  1 
ATOM   454  C C   . ILE A 1 65  ? 39.631 -8.426  15.059 1.00 26.40  ? 65  ILE A C   1 
ATOM   455  O O   . ILE A 1 65  ? 38.438 -8.648  14.852 1.00 28.07  ? 65  ILE A O   1 
ATOM   456  C CB  . ILE A 1 65  ? 40.607 -6.613  13.546 1.00 25.97  ? 65  ILE A CB  1 
ATOM   457  C CG1 . ILE A 1 65  ? 41.696 -6.331  12.515 1.00 25.13  ? 65  ILE A CG1 1 
ATOM   458  C CG2 . ILE A 1 65  ? 40.847 -5.768  14.790 1.00 26.86  ? 65  ILE A CG2 1 
ATOM   459  C CD1 . ILE A 1 65  ? 41.516 -4.993  11.797 1.00 27.20  ? 65  ILE A CD1 1 
ATOM   460  N N   . ALA A 1 66  ? 40.197 -8.394  16.286 1.00 22.47  ? 66  ALA A N   1 
ATOM   461  C CA  . ALA A 1 66  ? 39.478 -8.620  17.536 1.00 22.95  ? 66  ALA A CA  1 
ATOM   462  C C   . ALA A 1 66  ? 38.534 -7.459  17.779 1.00 26.26  ? 66  ALA A C   1 
ATOM   463  O O   . ALA A 1 66  ? 38.890 -6.289  17.591 1.00 24.05  ? 66  ALA A O   1 
ATOM   464  C CB  . ALA A 1 66  ? 40.440 -8.779  18.707 1.00 23.75  ? 66  ALA A CB  1 
ATOM   465  N N   . ARG A 1 67  ? 37.323 -7.792  18.163 1.00 23.05  ? 67  ARG A N   1 
ATOM   466  C CA  . ARG A 1 67  ? 36.310 -6.790  18.368 1.00 21.54  ? 67  ARG A CA  1 
ATOM   467  C C   . ARG A 1 67  ? 36.730 -5.646  19.258 1.00 25.07  ? 67  ARG A C   1 
ATOM   468  O O   . ARG A 1 67  ? 36.479 -4.471  18.966 1.00 24.27  ? 67  ARG A O   1 
ATOM   469  C CB  . ARG A 1 67  ? 34.984 -7.386  18.798 1.00 21.01  ? 67  ARG A CB  1 
ATOM   470  C CG  . ARG A 1 67  ? 33.889 -6.333  18.973 1.00 20.74  ? 67  ARG A CG  1 
ATOM   471  C CD  . ARG A 1 67  ? 33.687 -5.413  17.760 1.00 22.54  ? 67  ARG A CD  1 
ATOM   472  N NE  . ARG A 1 67  ? 32.649 -4.399  17.986 1.00 27.24  ? 67  ARG A NE  1 
ATOM   473  C CZ  . ARG A 1 67  ? 32.887 -3.137  18.363 1.00 34.12  ? 67  ARG A CZ  1 
ATOM   474  N NH1 . ARG A 1 67  ? 34.128 -2.691  18.553 1.00 17.48  ? 67  ARG A NH1 1 
ATOM   475  N NH2 . ARG A 1 67  ? 31.856 -2.302  18.543 1.00 19.85  ? 67  ARG A NH2 1 
ATOM   476  N N   . ASP A 1 68  ? 37.370 -6.013  20.341 1.00 22.71  ? 68  ASP A N   1 
ATOM   477  C CA  . ASP A 1 68  ? 37.822 -5.077  21.329 1.00 23.80  ? 68  ASP A CA  1 
ATOM   478  C C   . ASP A 1 68  ? 38.865 -4.133  20.806 1.00 24.17  ? 68  ASP A C   1 
ATOM   479  O O   . ASP A 1 68  ? 39.117 -3.084  21.398 1.00 25.00  ? 68  ASP A O   1 
ATOM   480  C CB  . ASP A 1 68  ? 38.334 -5.791  22.594 1.00 27.26  ? 68  ASP A CB  1 
ATOM   481  C CG  . ASP A 1 68  ? 37.282 -6.581  23.329 1.00 47.80  ? 68  ASP A CG  1 
ATOM   482  O OD1 . ASP A 1 68  ? 36.103 -6.601  23.016 1.00 44.66  ? 68  ASP A OD1 1 
ATOM   483  O OD2 . ASP A 1 68  ? 37.774 -7.233  24.352 1.00 60.87  ? 68  ASP A OD2 1 
ATOM   484  N N   . ASP A 1 69  ? 39.490 -4.501  19.716 1.00 22.96  ? 69  ASP A N   1 
ATOM   485  C CA  . ASP A 1 69  ? 40.509 -3.641  19.183 1.00 24.37  ? 69  ASP A CA  1 
ATOM   486  C C   . ASP A 1 69  ? 39.955 -2.589  18.267 1.00 26.88  ? 69  ASP A C   1 
ATOM   487  O O   . ASP A 1 69  ? 40.681 -1.715  17.803 1.00 26.41  ? 69  ASP A O   1 
ATOM   488  C CB  . ASP A 1 69  ? 41.623 -4.410  18.476 1.00 28.27  ? 69  ASP A CB  1 
ATOM   489  C CG  . ASP A 1 69  ? 42.364 -5.329  19.394 1.00 38.13  ? 69  ASP A CG  1 
ATOM   490  O OD1 . ASP A 1 69  ? 42.406 -5.178  20.601 1.00 36.81  ? 69  ASP A OD1 1 
ATOM   491  O OD2 . ASP A 1 69  ? 42.938 -6.322  18.758 1.00 50.92  ? 69  ASP A OD2 1 
ATOM   492  N N   . LEU A 1 70  ? 38.670 -2.683  17.997 1.00 21.43  ? 70  LEU A N   1 
ATOM   493  C CA  . LEU A 1 70  ? 38.032 -1.748  17.111 1.00 18.98  ? 70  LEU A CA  1 
ATOM   494  C C   . LEU A 1 70  ? 37.104 -0.786  17.820 1.00 19.36  ? 70  LEU A C   1 
ATOM   495  O O   . LEU A 1 70  ? 36.507 -1.119  18.847 1.00 17.25  ? 70  LEU A O   1 
ATOM   496  C CB  . LEU A 1 70  ? 37.198 -2.521  16.075 1.00 19.11  ? 70  LEU A CB  1 
ATOM   497  C CG  . LEU A 1 70  ? 38.027 -3.411  15.169 1.00 19.68  ? 70  LEU A CG  1 
ATOM   498  C CD1 . LEU A 1 70  ? 37.101 -4.292  14.335 1.00 19.67  ? 70  LEU A CD1 1 
ATOM   499  C CD2 . LEU A 1 70  ? 38.883 -2.539  14.252 1.00 15.02  ? 70  LEU A CD2 1 
ATOM   500  N N   . PHE A 1 71  ? 36.960 0.399   17.225 1.00 16.92  ? 71  PHE A N   1 
ATOM   501  C CA  . PHE A 1 71  ? 36.049 1.431   17.705 1.00 15.58  ? 71  PHE A CA  1 
ATOM   502  C C   . PHE A 1 71  ? 35.074 1.762   16.598 1.00 17.27  ? 71  PHE A C   1 
ATOM   503  O O   . PHE A 1 71  ? 35.434 2.381   15.592 1.00 12.72  ? 71  PHE A O   1 
ATOM   504  C CB  . PHE A 1 71  ? 36.696 2.730   18.216 1.00 15.34  ? 71  PHE A CB  1 
ATOM   505  C CG  . PHE A 1 71  ? 35.781 3.559   19.128 1.00 13.42  ? 71  PHE A CG  1 
ATOM   506  C CD1 . PHE A 1 71  ? 34.735 4.357   18.654 1.00 11.16  ? 71  PHE A CD1 1 
ATOM   507  C CD2 . PHE A 1 71  ? 36.023 3.557   20.500 1.00 13.65  ? 71  PHE A CD2 1 
ATOM   508  C CE1 . PHE A 1 71  ? 33.939 5.099   19.532 1.00 10.26  ? 71  PHE A CE1 1 
ATOM   509  C CE2 . PHE A 1 71  ? 35.249 4.299   21.393 1.00 13.09  ? 71  PHE A CE2 1 
ATOM   510  C CZ  . PHE A 1 71  ? 34.195 5.070   20.905 1.00 9.53   ? 71  PHE A CZ  1 
ATOM   511  N N   . ILE A 1 72  ? 33.834 1.331   16.818 1.00 14.74  ? 72  ILE A N   1 
ATOM   512  C CA  . ILE A 1 72  ? 32.753 1.526   15.875 1.00 13.97  ? 72  ILE A CA  1 
ATOM   513  C C   . ILE A 1 72  ? 31.714 2.545   16.323 1.00 15.40  ? 72  ILE A C   1 
ATOM   514  O O   . ILE A 1 72  ? 31.118 2.440   17.402 1.00 13.45  ? 72  ILE A O   1 
ATOM   515  C CB  . ILE A 1 72  ? 32.096 0.198   15.518 1.00 16.34  ? 72  ILE A CB  1 
ATOM   516  C CG1 . ILE A 1 72  ? 33.169 -0.844  15.222 1.00 15.67  ? 72  ILE A CG1 1 
ATOM   517  C CG2 . ILE A 1 72  ? 31.183 0.379   14.314 1.00 15.06  ? 72  ILE A CG2 1 
ATOM   518  C CD1 . ILE A 1 72  ? 34.023 -0.482  14.005 1.00 21.77  ? 72  ILE A CD1 1 
ATOM   519  N N   . THR A 1 73  ? 31.506 3.531   15.455 1.00 14.75  ? 73  THR A N   1 
ATOM   520  C CA  . THR A 1 73  ? 30.533 4.579   15.676 1.00 14.30  ? 73  THR A CA  1 
ATOM   521  C C   . THR A 1 73  ? 29.470 4.634   14.592 1.00 15.78  ? 73  THR A C   1 
ATOM   522  O O   . THR A 1 73  ? 29.781 4.656   13.397 1.00 14.34  ? 73  THR A O   1 
ATOM   523  C CB  . THR A 1 73  ? 31.159 5.994   15.767 1.00 16.87  ? 73  THR A CB  1 
ATOM   524  O OG1 . THR A 1 73  ? 32.109 6.062   16.803 1.00 12.41  ? 73  THR A OG1 1 
ATOM   525  C CG2 . THR A 1 73  ? 30.052 7.031   15.983 1.00 10.34  ? 73  THR A CG2 1 
ATOM   526  N N   . THR A 1 74  ? 28.207 4.633   15.014 1.00 13.18  ? 74  THR A N   1 
ATOM   527  C CA  . THR A 1 74  ? 27.072 4.782   14.118 1.00 12.95  ? 74  THR A CA  1 
ATOM   528  C C   . THR A 1 74  ? 26.135 5.876   14.640 1.00 18.07  ? 74  THR A C   1 
ATOM   529  O O   . THR A 1 74  ? 26.293 6.311   15.779 1.00 16.73  ? 74  THR A O   1 
ATOM   530  C CB  . THR A 1 74  ? 26.437 3.565   13.428 1.00 15.81  ? 74  THR A CB  1 
ATOM   531  O OG1 . THR A 1 74  ? 25.595 4.010   12.376 1.00 13.82  ? 74  THR A OG1 1 
ATOM   532  C CG2 . THR A 1 74  ? 25.648 2.722   14.415 1.00 7.38   ? 74  THR A CG2 1 
ATOM   533  N N   . LYS A 1 75  ? 25.209 6.373   13.819 1.00 12.30  ? 75  LYS A N   1 
ATOM   534  C CA  . LYS A 1 75  ? 24.375 7.472   14.280 1.00 11.44  ? 75  LYS A CA  1 
ATOM   535  C C   . LYS A 1 75  ? 22.905 7.282   14.015 1.00 19.11  ? 75  LYS A C   1 
ATOM   536  O O   . LYS A 1 75  ? 22.514 6.621   13.046 1.00 18.19  ? 75  LYS A O   1 
ATOM   537  C CB  . LYS A 1 75  ? 24.826 8.764   13.629 1.00 10.76  ? 75  LYS A CB  1 
ATOM   538  C CG  . LYS A 1 75  ? 26.327 8.805   13.389 1.00 8.79   ? 75  LYS A CG  1 
ATOM   539  C CD  . LYS A 1 75  ? 26.833 10.209  13.084 1.00 17.88  ? 75  LYS A CD  1 
ATOM   540  C CE  . LYS A 1 75  ? 28.327 10.253  12.809 1.00 18.30  ? 75  LYS A CE  1 
ATOM   541  N NZ  . LYS A 1 75  ? 28.684 9.688   11.501 1.00 24.83  ? 75  LYS A NZ  1 
ATOM   542  N N   . LEU A 1 76  ? 22.099 7.909   14.875 1.00 16.13  ? 76  LEU A N   1 
ATOM   543  C CA  . LEU A 1 76  ? 20.640 7.856   14.791 1.00 15.12  ? 76  LEU A CA  1 
ATOM   544  C C   . LEU A 1 76  ? 20.075 8.926   13.840 1.00 17.74  ? 76  LEU A C   1 
ATOM   545  O O   . LEU A 1 76  ? 20.265 10.130  14.045 1.00 16.10  ? 76  LEU A O   1 
ATOM   546  C CB  . LEU A 1 76  ? 20.051 7.985   16.209 1.00 13.91  ? 76  LEU A CB  1 
ATOM   547  C CG  . LEU A 1 76  ? 18.544 8.160   16.254 1.00 16.25  ? 76  LEU A CG  1 
ATOM   548  C CD1 . LEU A 1 76  ? 17.845 6.844   15.897 1.00 12.66  ? 76  LEU A CD1 1 
ATOM   549  C CD2 . LEU A 1 76  ? 18.145 8.609   17.662 1.00 17.95  ? 76  LEU A CD2 1 
ATOM   550  N N   . TRP A 1 77  ? 19.382 8.465   12.792 1.00 14.71  ? 77  TRP A N   1 
ATOM   551  C CA  . TRP A 1 77  ? 18.801 9.353   11.789 1.00 15.19  ? 77  TRP A CA  1 
ATOM   552  C C   . TRP A 1 77  ? 17.637 10.218  12.285 1.00 16.05  ? 77  TRP A C   1 
ATOM   553  O O   . TRP A 1 77  ? 16.946 9.871   13.237 1.00 14.71  ? 77  TRP A O   1 
ATOM   554  C CB  . TRP A 1 77  ? 18.611 8.724   10.398 1.00 14.14  ? 77  TRP A CB  1 
ATOM   555  C CG  . TRP A 1 77  ? 18.321 9.772   9.392  1.00 14.08  ? 77  TRP A CG  1 
ATOM   556  C CD1 . TRP A 1 77  ? 17.174 9.918   8.699  1.00 16.45  ? 77  TRP A CD1 1 
ATOM   557  C CD2 . TRP A 1 77  ? 19.163 10.867  9.027  1.00 13.18  ? 77  TRP A CD2 1 
ATOM   558  N NE1 . TRP A 1 77  ? 17.247 11.022  7.895  1.00 15.35  ? 77  TRP A NE1 1 
ATOM   559  C CE2 . TRP A 1 77  ? 18.462 11.630  8.082  1.00 16.26  ? 77  TRP A CE2 1 
ATOM   560  C CE3 . TRP A 1 77  ? 20.439 11.261  9.407  1.00 12.76  ? 77  TRP A CE3 1 
ATOM   561  C CZ2 . TRP A 1 77  ? 19.022 12.772  7.505  1.00 15.95  ? 77  TRP A CZ2 1 
ATOM   562  C CZ3 . TRP A 1 77  ? 20.995 12.382  8.841  1.00 13.85  ? 77  TRP A CZ3 1 
ATOM   563  C CH2 . TRP A 1 77  ? 20.292 13.133  7.902  1.00 14.42  ? 77  TRP A CH2 1 
ATOM   564  N N   . ASN A 1 78  ? 17.470 11.378  11.637 1.00 14.69  ? 78  ASN A N   1 
ATOM   565  C CA  . ASN A 1 78  ? 16.484 12.408  11.978 1.00 14.53  ? 78  ASN A CA  1 
ATOM   566  C C   . ASN A 1 78  ? 15.035 11.980  12.120 1.00 20.55  ? 78  ASN A C   1 
ATOM   567  O O   . ASN A 1 78  ? 14.265 12.594  12.879 1.00 15.21  ? 78  ASN A O   1 
ATOM   568  C CB  . ASN A 1 78  ? 16.577 13.612  11.019 1.00 13.45  ? 78  ASN A CB  1 
ATOM   569  C CG  . ASN A 1 78  ? 17.970 14.171  10.932 1.00 18.26  ? 78  ASN A CG  1 
ATOM   570  O OD1 . ASN A 1 78  ? 18.871 13.760  11.686 1.00 18.23  ? 78  ASN A OD1 1 
ATOM   571  N ND2 . ASN A 1 78  ? 18.162 15.096  9.997  1.00 15.74  ? 78  ASN A ND2 1 
ATOM   572  N N   . ASP A 1 79  ? 14.664 10.962  11.359 1.00 20.07  ? 79  ASP A N   1 
ATOM   573  C CA  . ASP A 1 79  ? 13.306 10.440  11.339 1.00 19.87  ? 79  ASP A CA  1 
ATOM   574  C C   . ASP A 1 79  ? 13.028 9.333   12.350 1.00 19.42  ? 79  ASP A C   1 
ATOM   575  O O   . ASP A 1 79  ? 11.951 8.743   12.345 1.00 14.96  ? 79  ASP A O   1 
ATOM   576  C CB  . ASP A 1 79  ? 12.904 9.998   9.917  1.00 21.56  ? 79  ASP A CB  1 
ATOM   577  C CG  . ASP A 1 79  ? 13.712 8.845   9.379  1.00 21.39  ? 79  ASP A CG  1 
ATOM   578  O OD1 . ASP A 1 79  ? 14.659 8.346   9.964  1.00 19.85  ? 79  ASP A OD1 1 
ATOM   579  O OD2 . ASP A 1 79  ? 13.275 8.425   8.223  1.00 27.52  ? 79  ASP A OD2 1 
ATOM   580  N N   . ARG A 1 80  ? 13.996 9.046   13.213 1.00 17.26  ? 80  ARG A N   1 
ATOM   581  C CA  . ARG A 1 80  ? 13.826 8.000   14.205 1.00 17.63  ? 80  ARG A CA  1 
ATOM   582  C C   . ARG A 1 80  ? 13.941 8.528   15.620 1.00 20.70  ? 80  ARG A C   1 
ATOM   583  O O   . ARG A 1 80  ? 14.381 7.813   16.511 1.00 20.69  ? 80  ARG A O   1 
ATOM   584  C CB  . ARG A 1 80  ? 14.831 6.882   13.998 1.00 14.44  ? 80  ARG A CB  1 
ATOM   585  C CG  . ARG A 1 80  ? 15.094 6.594   12.530 1.00 16.35  ? 80  ARG A CG  1 
ATOM   586  C CD  . ARG A 1 80  ? 13.871 6.025   11.813 1.00 23.93  ? 80  ARG A CD  1 
ATOM   587  N NE  . ARG A 1 80  ? 13.428 4.764   12.383 1.00 14.01  ? 80  ARG A NE  1 
ATOM   588  C CZ  . ARG A 1 80  ? 14.039 3.596   12.209 1.00 37.34  ? 80  ARG A CZ  1 
ATOM   589  N NH1 . ARG A 1 80  ? 15.139 3.469   11.471 1.00 23.42  ? 80  ARG A NH1 1 
ATOM   590  N NH2 . ARG A 1 80  ? 13.527 2.515   12.795 1.00 40.34  ? 80  ARG A NH2 1 
ATOM   591  N N   . HIS A 1 81  ? 13.560 9.786   15.827 1.00 15.74  ? 81  HIS A N   1 
ATOM   592  C CA  . HIS A 1 81  ? 13.668 10.396  17.146 1.00 13.88  ? 81  HIS A CA  1 
ATOM   593  C C   . HIS A 1 81  ? 12.526 10.043  18.056 1.00 19.14  ? 81  HIS A C   1 
ATOM   594  O O   . HIS A 1 81  ? 12.646 10.048  19.277 1.00 19.13  ? 81  HIS A O   1 
ATOM   595  C CB  . HIS A 1 81  ? 13.710 11.945  17.055 1.00 12.86  ? 81  HIS A CB  1 
ATOM   596  C CG  . HIS A 1 81  ? 15.008 12.524  16.573 1.00 13.89  ? 81  HIS A CG  1 
ATOM   597  N ND1 . HIS A 1 81  ? 15.278 13.885  16.675 1.00 14.58  ? 81  HIS A ND1 1 
ATOM   598  C CD2 . HIS A 1 81  ? 16.085 11.925  16.000 1.00 14.26  ? 81  HIS A CD2 1 
ATOM   599  C CE1 . HIS A 1 81  ? 16.489 14.082  16.164 1.00 14.06  ? 81  HIS A CE1 1 
ATOM   600  N NE2 . HIS A 1 81  ? 17.003 12.922  15.748 1.00 14.74  ? 81  HIS A NE2 1 
ATOM   601  N N   . ASP A 1 82  ? 11.406 9.778   17.431 1.00 17.18  ? 82  ASP A N   1 
ATOM   602  C CA  . ASP A 1 82  ? 10.179 9.525   18.115 1.00 16.80  ? 82  ASP A CA  1 
ATOM   603  C C   . ASP A 1 82  ? 9.973  8.153   18.728 1.00 18.70  ? 82  ASP A C   1 
ATOM   604  O O   . ASP A 1 82  ? 10.551 7.161   18.302 1.00 19.15  ? 82  ASP A O   1 
ATOM   605  C CB  . ASP A 1 82  ? 8.986  10.030  17.295 1.00 17.34  ? 82  ASP A CB  1 
ATOM   606  C CG  . ASP A 1 82  ? 9.210  11.448  16.806 1.00 22.82  ? 82  ASP A CG  1 
ATOM   607  O OD1 . ASP A 1 82  ? 9.546  12.360  17.551 1.00 17.88  ? 82  ASP A OD1 1 
ATOM   608  O OD2 . ASP A 1 82  ? 9.042  11.585  15.504 1.00 30.41  ? 82  ASP A OD2 1 
ATOM   609  N N   . GLY A 1 83  ? 9.121  8.150   19.761 1.00 15.57  ? 83  GLY A N   1 
ATOM   610  C CA  . GLY A 1 83  ? 8.741  6.958   20.512 1.00 16.71  ? 83  GLY A CA  1 
ATOM   611  C C   . GLY A 1 83  ? 9.887  5.991   20.762 1.00 21.21  ? 83  GLY A C   1 
ATOM   612  O O   . GLY A 1 83  ? 10.908 6.346   21.339 1.00 19.21  ? 83  GLY A O   1 
ATOM   613  N N   . ASP A 1 84  ? 9.708  4.743   20.316 1.00 17.99  ? 84  ASP A N   1 
ATOM   614  C CA  . ASP A 1 84  ? 10.740 3.743   20.475 1.00 15.99  ? 84  ASP A CA  1 
ATOM   615  C C   . ASP A 1 84  ? 11.489 3.477   19.185 1.00 17.64  ? 84  ASP A C   1 
ATOM   616  O O   . ASP A 1 84  ? 12.123 2.430   19.018 1.00 15.70  ? 84  ASP A O   1 
ATOM   617  C CB  . ASP A 1 84  ? 10.302 2.450   21.190 1.00 18.01  ? 84  ASP A CB  1 
ATOM   618  C CG  . ASP A 1 84  ? 10.525 2.505   22.673 1.00 18.05  ? 84  ASP A CG  1 
ATOM   619  O OD1 . ASP A 1 84  ? 11.474 3.075   23.183 1.00 23.70  ? 84  ASP A OD1 1 
ATOM   620  O OD2 . ASP A 1 84  ? 9.559  1.932   23.356 1.00 18.68  ? 84  ASP A OD2 1 
ATOM   621  N N   . GLU A 1 85  ? 11.410 4.448   18.273 1.00 9.06   ? 85  GLU A N   1 
ATOM   622  C CA  . GLU A 1 85  ? 12.130 4.376   17.016 1.00 8.65   ? 85  GLU A CA  1 
ATOM   623  C C   . GLU A 1 85  ? 13.639 4.260   17.236 1.00 14.90  ? 85  GLU A C   1 
ATOM   624  O O   . GLU A 1 85  ? 14.331 3.562   16.503 1.00 18.44  ? 85  GLU A O   1 
ATOM   625  C CB  . GLU A 1 85  ? 11.818 5.588   16.128 1.00 8.84   ? 85  GLU A CB  1 
ATOM   626  C CG  . GLU A 1 85  ? 10.439 5.443   15.464 1.00 17.21  ? 85  GLU A CG  1 
ATOM   627  C CD  . GLU A 1 85  ? 10.300 4.134   14.732 1.00 40.96  ? 85  GLU A CD  1 
ATOM   628  O OE1 . GLU A 1 85  ? 11.128 3.722   13.942 1.00 43.83  ? 85  GLU A OE1 1 
ATOM   629  O OE2 . GLU A 1 85  ? 9.214  3.473   15.056 1.00 34.07  ? 85  GLU A OE2 1 
ATOM   630  N N   . PRO A 1 86  ? 14.170 4.946   18.260 1.00 16.40  ? 86  PRO A N   1 
ATOM   631  C CA  . PRO A 1 86  ? 15.599 4.880   18.511 1.00 15.87  ? 86  PRO A CA  1 
ATOM   632  C C   . PRO A 1 86  ? 16.115 3.457   18.702 1.00 18.79  ? 86  PRO A C   1 
ATOM   633  O O   . PRO A 1 86  ? 17.160 3.086   18.162 1.00 16.33  ? 86  PRO A O   1 
ATOM   634  C CB  . PRO A 1 86  ? 15.873 5.782   19.710 1.00 17.78  ? 86  PRO A CB  1 
ATOM   635  C CG  . PRO A 1 86  ? 14.689 6.736   19.797 1.00 20.71  ? 86  PRO A CG  1 
ATOM   636  C CD  . PRO A 1 86  ? 13.555 6.052   19.059 1.00 16.18  ? 86  PRO A CD  1 
ATOM   637  N N   . ALA A 1 87  ? 15.360 2.666   19.454 1.00 15.64  ? 87  ALA A N   1 
ATOM   638  C CA  . ALA A 1 87  ? 15.716 1.278   19.682 1.00 15.82  ? 87  ALA A CA  1 
ATOM   639  C C   . ALA A 1 87  ? 15.604 0.481   18.378 1.00 20.99  ? 87  ALA A C   1 
ATOM   640  O O   . ALA A 1 87  ? 16.447 -0.370  18.072 1.00 21.27  ? 87  ALA A O   1 
ATOM   641  C CB  . ALA A 1 87  ? 14.869 0.667   20.789 1.00 16.26  ? 87  ALA A CB  1 
ATOM   642  N N   . ALA A 1 88  ? 14.570 0.771   17.594 1.00 15.73  ? 88  ALA A N   1 
ATOM   643  C CA  . ALA A 1 88  ? 14.396 0.096   16.314 1.00 13.34  ? 88  ALA A CA  1 
ATOM   644  C C   . ALA A 1 88  ? 15.547 0.434   15.359 1.00 13.98  ? 88  ALA A C   1 
ATOM   645  O O   . ALA A 1 88  ? 16.120 -0.449  14.732 1.00 14.20  ? 88  ALA A O   1 
ATOM   646  C CB  . ALA A 1 88  ? 13.049 0.453   15.705 1.00 13.58  ? 88  ALA A CB  1 
ATOM   647  N N   . ALA A 1 89  ? 15.880 1.735   15.269 1.00 12.18  ? 89  ALA A N   1 
ATOM   648  C CA  . ALA A 1 89  ? 16.965 2.218   14.432 1.00 10.39  ? 89  ALA A CA  1 
ATOM   649  C C   . ALA A 1 89  ? 18.288 1.552   14.829 1.00 17.95  ? 89  ALA A C   1 
ATOM   650  O O   . ALA A 1 89  ? 18.965 0.953   13.995 1.00 20.37  ? 89  ALA A O   1 
ATOM   651  C CB  . ALA A 1 89  ? 17.069 3.740   14.478 1.00 9.90   ? 89  ALA A CB  1 
ATOM   652  N N   . ILE A 1 90  ? 18.654 1.625   16.119 1.00 13.70  ? 90  ILE A N   1 
ATOM   653  C CA  . ILE A 1 90  ? 19.901 0.995   16.540 1.00 12.08  ? 90  ILE A CA  1 
ATOM   654  C C   . ILE A 1 90  ? 19.980 -0.500  16.212 1.00 17.17  ? 90  ILE A C   1 
ATOM   655  O O   . ILE A 1 90  ? 21.024 -0.988  15.790 1.00 15.13  ? 90  ILE A O   1 
ATOM   656  C CB  . ILE A 1 90  ? 20.430 1.355   17.941 1.00 14.69  ? 90  ILE A CB  1 
ATOM   657  C CG1 . ILE A 1 90  ? 21.846 0.790   18.091 1.00 12.71  ? 90  ILE A CG1 1 
ATOM   658  C CG2 . ILE A 1 90  ? 19.525 0.775   19.022 1.00 11.73  ? 90  ILE A CG2 1 
ATOM   659  C CD1 . ILE A 1 90  ? 22.644 1.381   19.248 1.00 10.91  ? 90  ILE A CD1 1 
ATOM   660  N N   . ALA A 1 91  ? 18.866 -1.227  16.393 1.00 16.31  ? 91  ALA A N   1 
ATOM   661  C CA  . ALA A 1 91  ? 18.823 -2.658  16.086 1.00 14.24  ? 91  ALA A CA  1 
ATOM   662  C C   . ALA A 1 91  ? 19.089 -2.887  14.612 1.00 15.75  ? 91  ALA A C   1 
ATOM   663  O O   . ALA A 1 91  ? 19.830 -3.795  14.245 1.00 18.64  ? 91  ALA A O   1 
ATOM   664  C CB  . ALA A 1 91  ? 17.497 -3.280  16.497 1.00 14.64  ? 91  ALA A CB  1 
ATOM   665  N N   . GLU A 1 92  ? 18.489 -2.038  13.769 1.00 14.36  ? 92  GLU A N   1 
ATOM   666  C CA  . GLU A 1 92  ? 18.710 -2.136  12.330 1.00 15.91  ? 92  GLU A CA  1 
ATOM   667  C C   . GLU A 1 92  ? 20.193 -1.981  12.041 1.00 22.26  ? 92  GLU A C   1 
ATOM   668  O O   . GLU A 1 92  ? 20.805 -2.811  11.377 1.00 22.70  ? 92  GLU A O   1 
ATOM   669  C CB  . GLU A 1 92  ? 17.942 -1.073  11.533 1.00 17.19  ? 92  GLU A CB  1 
ATOM   670  C CG  . GLU A 1 92  ? 16.429 -1.221  11.605 1.00 27.98  ? 92  GLU A CG  1 
ATOM   671  C CD  . GLU A 1 92  ? 15.735 0.033   11.181 1.00 23.05  ? 92  GLU A CD  1 
ATOM   672  O OE1 . GLU A 1 92  ? 16.306 0.946   10.623 1.00 26.92  ? 92  GLU A OE1 1 
ATOM   673  O OE2 . GLU A 1 92  ? 14.467 0.045   11.510 1.00 22.12  ? 92  GLU A OE2 1 
ATOM   674  N N   . SER A 1 93  ? 20.764 -0.895  12.566 1.00 14.74  ? 93  SER A N   1 
ATOM   675  C CA  . SER A 1 93  ? 22.174 -0.626  12.401 1.00 12.23  ? 93  SER A CA  1 
ATOM   676  C C   . SER A 1 93  ? 23.011 -1.831  12.815 1.00 17.00  ? 93  SER A C   1 
ATOM   677  O O   . SER A 1 93  ? 23.891 -2.278  12.083 1.00 17.35  ? 93  SER A O   1 
ATOM   678  C CB  . SER A 1 93  ? 22.605 0.605   13.178 1.00 13.50  ? 93  SER A CB  1 
ATOM   679  O OG  . SER A 1 93  ? 21.961 1.763   12.678 1.00 12.67  ? 93  SER A OG  1 
ATOM   680  N N   . LEU A 1 94  ? 22.733 -2.357  14.009 1.00 14.83  ? 94  LEU A N   1 
ATOM   681  C CA  . LEU A 1 94  ? 23.465 -3.508  14.536 1.00 14.80  ? 94  LEU A CA  1 
ATOM   682  C C   . LEU A 1 94  ? 23.441 -4.695  13.581 1.00 19.57  ? 94  LEU A C   1 
ATOM   683  O O   . LEU A 1 94  ? 24.449 -5.374  13.353 1.00 18.98  ? 94  LEU A O   1 
ATOM   684  C CB  . LEU A 1 94  ? 22.963 -3.900  15.949 1.00 13.78  ? 94  LEU A CB  1 
ATOM   685  C CG  . LEU A 1 94  ? 23.411 -2.922  17.038 1.00 16.16  ? 94  LEU A CG  1 
ATOM   686  C CD1 . LEU A 1 94  ? 22.696 -3.217  18.358 1.00 16.28  ? 94  LEU A CD1 1 
ATOM   687  C CD2 . LEU A 1 94  ? 24.918 -3.012  17.234 1.00 14.27  ? 94  LEU A CD2 1 
ATOM   688  N N   . ALA A 1 95  ? 22.267 -4.932  13.022 1.00 18.92  ? 95  ALA A N   1 
ATOM   689  C CA  . ALA A 1 95  ? 22.064 -6.010  12.084 1.00 20.51  ? 95  ALA A CA  1 
ATOM   690  C C   . ALA A 1 95  ? 22.925 -5.841  10.833 1.00 24.38  ? 95  ALA A C   1 
ATOM   691  O O   . ALA A 1 95  ? 23.502 -6.807  10.323 1.00 24.83  ? 95  ALA A O   1 
ATOM   692  C CB  . ALA A 1 95  ? 20.587 -6.144  11.738 1.00 20.46  ? 95  ALA A CB  1 
ATOM   693  N N   . LYS A 1 96  ? 23.022 -4.595  10.358 1.00 17.07  ? 96  LYS A N   1 
ATOM   694  C CA  . LYS A 1 96  ? 23.813 -4.261  9.179  1.00 15.16  ? 96  LYS A CA  1 
ATOM   695  C C   . LYS A 1 96  ? 25.292 -4.484  9.396  1.00 19.16  ? 96  LYS A C   1 
ATOM   696  O O   . LYS A 1 96  ? 25.971 -5.058  8.553  1.00 18.96  ? 96  LYS A O   1 
ATOM   697  C CB  . LYS A 1 96  ? 23.547 -2.846  8.711  1.00 12.95  ? 96  LYS A CB  1 
ATOM   698  C CG  . LYS A 1 96  ? 22.200 -2.745  8.007  1.00 20.04  ? 96  LYS A CG  1 
ATOM   699  C CD  . LYS A 1 96  ? 21.718 -1.327  7.804  1.00 27.22  ? 96  LYS A CD  1 
ATOM   700  C CE  . LYS A 1 96  ? 20.206 -1.198  7.919  1.00 34.29  ? 96  LYS A CE  1 
ATOM   701  N NZ  . LYS A 1 96  ? 19.698 0.112   7.487  1.00 33.64  ? 96  LYS A NZ  1 
ATOM   702  N N   . LEU A 1 97  ? 25.772 -4.018  10.544 1.00 17.86  ? 97  LEU A N   1 
ATOM   703  C CA  . LEU A 1 97  ? 27.171 -4.120  10.954 1.00 18.17  ? 97  LEU A CA  1 
ATOM   704  C C   . LEU A 1 97  ? 27.540 -5.521  11.402 1.00 20.74  ? 97  LEU A C   1 
ATOM   705  O O   . LEU A 1 97  ? 28.721 -5.880  11.492 1.00 15.96  ? 97  LEU A O   1 
ATOM   706  C CB  . LEU A 1 97  ? 27.423 -3.196  12.163 1.00 17.49  ? 97  LEU A CB  1 
ATOM   707  C CG  . LEU A 1 97  ? 27.275 -1.717  11.854 1.00 19.82  ? 97  LEU A CG  1 
ATOM   708  C CD1 . LEU A 1 97  ? 27.137 -0.925  13.154 1.00 19.06  ? 97  LEU A CD1 1 
ATOM   709  C CD2 . LEU A 1 97  ? 28.497 -1.246  11.083 1.00 23.30  ? 97  LEU A CD2 1 
ATOM   710  N N   . ALA A 1 98  ? 26.506 -6.287  11.728 1.00 19.71  ? 98  ALA A N   1 
ATOM   711  C CA  . ALA A 1 98  ? 26.668 -7.634  12.234 1.00 20.83  ? 98  ALA A CA  1 
ATOM   712  C C   . ALA A 1 98  ? 27.500 -7.635  13.511 1.00 24.90  ? 98  ALA A C   1 
ATOM   713  O O   . ALA A 1 98  ? 28.373 -8.487  13.719 1.00 22.54  ? 98  ALA A O   1 
ATOM   714  C CB  . ALA A 1 98  ? 27.237 -8.582  11.192 1.00 21.70  ? 98  ALA A CB  1 
ATOM   715  N N   . LEU A 1 99  ? 27.223 -6.650  14.354 1.00 19.12  ? 99  LEU A N   1 
ATOM   716  C CA  . LEU A 1 99  ? 27.893 -6.486  15.621 1.00 15.50  ? 99  LEU A CA  1 
ATOM   717  C C   . LEU A 1 99  ? 26.895 -6.676  16.747 1.00 27.13  ? 99  LEU A C   1 
ATOM   718  O O   . LEU A 1 99  ? 25.687 -6.524  16.552 1.00 25.43  ? 99  LEU A O   1 
ATOM   719  C CB  . LEU A 1 99  ? 28.529 -5.092  15.717 1.00 12.84  ? 99  LEU A CB  1 
ATOM   720  C CG  . LEU A 1 99  ? 29.596 -4.866  14.666 1.00 16.76  ? 99  LEU A CG  1 
ATOM   721  C CD1 . LEU A 1 99  ? 30.153 -3.457  14.785 1.00 16.57  ? 99  LEU A CD1 1 
ATOM   722  C CD2 . LEU A 1 99  ? 30.721 -5.877  14.849 1.00 20.88  ? 99  LEU A CD2 1 
ATOM   723  N N   . ASP A 1 100 ? 27.409 -6.993  17.922 1.00 30.72  ? 100 ASP A N   1 
ATOM   724  C CA  . ASP A 1 100 ? 26.569 -7.170  19.079 1.00 32.73  ? 100 ASP A CA  1 
ATOM   725  C C   . ASP A 1 100 ? 26.174 -5.810  19.603 1.00 31.64  ? 100 ASP A C   1 
ATOM   726  O O   . ASP A 1 100 ? 25.063 -5.588  20.079 1.00 30.70  ? 100 ASP A O   1 
ATOM   727  C CB  . ASP A 1 100 ? 27.298 -7.966  20.165 1.00 36.69  ? 100 ASP A CB  1 
ATOM   728  C CG  . ASP A 1 100 ? 26.379 -8.906  20.873 1.00 65.49  ? 100 ASP A CG  1 
ATOM   729  O OD1 . ASP A 1 100 ? 25.198 -8.668  21.054 1.00 66.69  ? 100 ASP A OD1 1 
ATOM   730  O OD2 . ASP A 1 100 ? 26.970 -10.016 21.237 1.00 82.80  ? 100 ASP A OD2 1 
ATOM   731  N N   . GLN A 1 101 ? 27.121 -4.896  19.487 1.00 28.15  ? 101 GLN A N   1 
ATOM   732  C CA  . GLN A 1 101 ? 26.932 -3.534  19.913 1.00 26.16  ? 101 GLN A CA  1 
ATOM   733  C C   . GLN A 1 101 ? 27.978 -2.646  19.298 1.00 21.28  ? 101 GLN A C   1 
ATOM   734  O O   . GLN A 1 101 ? 29.006 -3.106  18.811 1.00 17.30  ? 101 GLN A O   1 
ATOM   735  C CB  . GLN A 1 101 ? 27.028 -3.421  21.429 1.00 28.38  ? 101 GLN A CB  1 
ATOM   736  C CG  . GLN A 1 101 ? 28.398 -3.888  21.890 1.00 19.68  ? 101 GLN A CG  1 
ATOM   737  C CD  . GLN A 1 101 ? 28.672 -3.652  23.352 1.00 29.93  ? 101 GLN A CD  1 
ATOM   738  O OE1 . GLN A 1 101 ? 29.811 -3.789  23.795 1.00 26.80  ? 101 GLN A OE1 1 
ATOM   739  N NE2 . GLN A 1 101 ? 27.634 -3.333  24.115 1.00 26.28  ? 101 GLN A NE2 1 
ATOM   740  N N   . VAL A 1 102 ? 27.697 -1.357  19.341 1.00 15.09  ? 102 VAL A N   1 
ATOM   741  C CA  . VAL A 1 102 ? 28.593 -0.363  18.832 1.00 13.23  ? 102 VAL A CA  1 
ATOM   742  C C   . VAL A 1 102 ? 29.329 0.290   19.986 1.00 13.88  ? 102 VAL A C   1 
ATOM   743  O O   . VAL A 1 102 ? 28.896 0.197   21.132 1.00 13.89  ? 102 VAL A O   1 
ATOM   744  C CB  . VAL A 1 102 ? 27.845 0.689   18.006 1.00 15.52  ? 102 VAL A CB  1 
ATOM   745  C CG1 . VAL A 1 102 ? 27.532 0.121   16.624 1.00 13.28  ? 102 VAL A CG1 1 
ATOM   746  C CG2 . VAL A 1 102 ? 26.550 1.103   18.710 1.00 14.26  ? 102 VAL A CG2 1 
ATOM   747  N N   . ASP A 1 103 ? 30.438 0.952   19.682 1.00 9.80   ? 103 ASP A N   1 
ATOM   748  C CA  . ASP A 1 103 ? 31.215 1.633   20.704 1.00 11.13  ? 103 ASP A CA  1 
ATOM   749  C C   . ASP A 1 103 ? 30.590 2.953   21.107 1.00 13.23  ? 103 ASP A C   1 
ATOM   750  O O   . ASP A 1 103 ? 30.571 3.336   22.274 1.00 14.78  ? 103 ASP A O   1 
ATOM   751  C CB  . ASP A 1 103 ? 32.667 1.844   20.238 1.00 12.67  ? 103 ASP A CB  1 
ATOM   752  C CG  . ASP A 1 103 ? 33.404 0.551   20.279 1.00 20.54  ? 103 ASP A CG  1 
ATOM   753  O OD1 . ASP A 1 103 ? 33.804 0.062   21.316 1.00 23.82  ? 103 ASP A OD1 1 
ATOM   754  O OD2 . ASP A 1 103 ? 33.366 -0.099  19.134 1.00 18.53  ? 103 ASP A OD2 1 
ATOM   755  N N   . LEU A 1 104 ? 30.083 3.645   20.118 1.00 9.61   ? 104 LEU A N   1 
ATOM   756  C CA  . LEU A 1 104 ? 29.481 4.935   20.329 1.00 9.47   ? 104 LEU A CA  1 
ATOM   757  C C   . LEU A 1 104 ? 28.294 5.087   19.402 1.00 13.50  ? 104 LEU A C   1 
ATOM   758  O O   . LEU A 1 104 ? 28.314 4.606   18.270 1.00 10.41  ? 104 LEU A O   1 
ATOM   759  C CB  . LEU A 1 104 ? 30.559 6.037   20.142 1.00 9.60   ? 104 LEU A CB  1 
ATOM   760  C CG  . LEU A 1 104 ? 30.089 7.500   20.154 1.00 11.88  ? 104 LEU A CG  1 
ATOM   761  C CD1 . LEU A 1 104 ? 29.600 7.903   21.539 1.00 12.27  ? 104 LEU A CD1 1 
ATOM   762  C CD2 . LEU A 1 104 ? 31.253 8.403   19.733 1.00 10.39  ? 104 LEU A CD2 1 
ATOM   763  N N   . TYR A 1 105 ? 27.246 5.725   19.908 1.00 15.22  ? 105 TYR A N   1 
ATOM   764  C CA  . TYR A 1 105 ? 26.024 5.937   19.153 1.00 14.59  ? 105 TYR A CA  1 
ATOM   765  C C   . TYR A 1 105 ? 25.633 7.391   19.242 1.00 17.15  ? 105 TYR A C   1 
ATOM   766  O O   . TYR A 1 105 ? 25.611 7.943   20.334 1.00 18.01  ? 105 TYR A O   1 
ATOM   767  C CB  . TYR A 1 105 ? 24.903 5.072   19.712 1.00 15.10  ? 105 TYR A CB  1 
ATOM   768  C CG  . TYR A 1 105 ? 23.770 4.916   18.750 1.00 13.29  ? 105 TYR A CG  1 
ATOM   769  C CD1 . TYR A 1 105 ? 24.022 4.551   17.428 1.00 14.68  ? 105 TYR A CD1 1 
ATOM   770  C CD2 . TYR A 1 105 ? 22.453 5.140   19.143 1.00 11.99  ? 105 TYR A CD2 1 
ATOM   771  C CE1 . TYR A 1 105 ? 22.993 4.413   16.498 1.00 15.93  ? 105 TYR A CE1 1 
ATOM   772  C CE2 . TYR A 1 105 ? 21.410 5.011   18.227 1.00 12.67  ? 105 TYR A CE2 1 
ATOM   773  C CZ  . TYR A 1 105 ? 21.680 4.641   16.907 1.00 19.65  ? 105 TYR A CZ  1 
ATOM   774  O OH  . TYR A 1 105 ? 20.648 4.501   16.017 1.00 14.47  ? 105 TYR A OH  1 
ATOM   775  N N   . LEU A 1 106 ? 25.335 8.015   18.101 1.00 10.58  ? 106 LEU A N   1 
ATOM   776  C CA  . LEU A 1 106 ? 25.000 9.426   18.116 1.00 9.50   ? 106 LEU A CA  1 
ATOM   777  C C   . LEU A 1 106 ? 23.655 9.812   17.526 1.00 12.94  ? 106 LEU A C   1 
ATOM   778  O O   . LEU A 1 106 ? 23.174 9.225   16.553 1.00 13.08  ? 106 LEU A O   1 
ATOM   779  C CB  . LEU A 1 106 ? 26.066 10.270  17.368 1.00 10.22  ? 106 LEU A CB  1 
ATOM   780  C CG  . LEU A 1 106 ? 27.519 9.914   17.658 1.00 15.74  ? 106 LEU A CG  1 
ATOM   781  C CD1 . LEU A 1 106 ? 28.432 10.687  16.704 1.00 15.71  ? 106 LEU A CD1 1 
ATOM   782  C CD2 . LEU A 1 106 ? 27.863 10.277  19.097 1.00 19.39  ? 106 LEU A CD2 1 
ATOM   783  N N   . VAL A 1 107 ? 23.091 10.880  18.116 1.00 12.41  ? 107 VAL A N   1 
ATOM   784  C CA  . VAL A 1 107 ? 21.879 11.486  17.621 1.00 11.61  ? 107 VAL A CA  1 
ATOM   785  C C   . VAL A 1 107 ? 22.384 12.382  16.499 1.00 13.09  ? 107 VAL A C   1 
ATOM   786  O O   . VAL A 1 107 ? 22.958 13.446  16.753 1.00 11.06  ? 107 VAL A O   1 
ATOM   787  C CB  . VAL A 1 107 ? 21.132 12.313  18.677 1.00 14.30  ? 107 VAL A CB  1 
ATOM   788  C CG1 . VAL A 1 107 ? 19.938 13.031  18.027 1.00 13.06  ? 107 VAL A CG1 1 
ATOM   789  C CG2 . VAL A 1 107 ? 20.649 11.433  19.831 1.00 13.66  ? 107 VAL A CG2 1 
ATOM   790  N N   . HIS A 1 108 ? 22.250 11.905  15.266 1.00 10.13  ? 108 HIS A N   1 
ATOM   791  C CA  . HIS A 1 108 ? 22.759 12.604  14.090 1.00 8.88   ? 108 HIS A CA  1 
ATOM   792  C C   . HIS A 1 108 ? 22.579 14.126  14.044 1.00 16.69  ? 108 HIS A C   1 
ATOM   793  O O   . HIS A 1 108 ? 23.532 14.866  13.786 1.00 15.11  ? 108 HIS A O   1 
ATOM   794  C CB  . HIS A 1 108 ? 22.332 11.943  12.769 1.00 9.08   ? 108 HIS A CB  1 
ATOM   795  C CG  . HIS A 1 108 ? 23.429 11.992  11.752 1.00 13.09  ? 108 HIS A CG  1 
ATOM   796  N ND1 . HIS A 1 108 ? 23.696 10.919  10.915 1.00 14.01  ? 108 HIS A ND1 1 
ATOM   797  C CD2 . HIS A 1 108 ? 24.321 12.979  11.473 1.00 12.81  ? 108 HIS A CD2 1 
ATOM   798  C CE1 . HIS A 1 108 ? 24.722 11.275  10.152 1.00 13.10  ? 108 HIS A CE1 1 
ATOM   799  N NE2 . HIS A 1 108 ? 25.120 12.506  10.463 1.00 12.77  ? 108 HIS A NE2 1 
ATOM   800  N N   . TRP A 1 109 ? 21.345 14.577  14.257 1.00 13.93  ? 109 TRP A N   1 
ATOM   801  C CA  . TRP A 1 109 ? 20.978 15.991  14.224 1.00 13.46  ? 109 TRP A CA  1 
ATOM   802  C C   . TRP A 1 109 ? 19.957 16.285  15.324 1.00 18.69  ? 109 TRP A C   1 
ATOM   803  O O   . TRP A 1 109 ? 19.196 15.398  15.720 1.00 15.30  ? 109 TRP A O   1 
ATOM   804  C CB  . TRP A 1 109 ? 20.355 16.350  12.846 1.00 10.96  ? 109 TRP A CB  1 
ATOM   805  C CG  . TRP A 1 109 ? 21.337 16.368  11.700 1.00 11.09  ? 109 TRP A CG  1 
ATOM   806  C CD1 . TRP A 1 109 ? 21.668 15.322  10.889 1.00 12.75  ? 109 TRP A CD1 1 
ATOM   807  C CD2 . TRP A 1 109 ? 22.100 17.497  11.229 1.00 11.04  ? 109 TRP A CD2 1 
ATOM   808  N NE1 . TRP A 1 109 ? 22.603 15.715  9.956  1.00 11.83  ? 109 TRP A NE1 1 
ATOM   809  C CE2 . TRP A 1 109 ? 22.885 17.046  10.140 1.00 13.88  ? 109 TRP A CE2 1 
ATOM   810  C CE3 . TRP A 1 109 ? 22.189 18.837  11.630 1.00 12.57  ? 109 TRP A CE3 1 
ATOM   811  C CZ2 . TRP A 1 109 ? 23.752 17.906  9.459  1.00 14.19  ? 109 TRP A CZ2 1 
ATOM   812  C CZ3 . TRP A 1 109 ? 23.054 19.685  10.959 1.00 13.53  ? 109 TRP A CZ3 1 
ATOM   813  C CH2 . TRP A 1 109 ? 23.818 19.224  9.883  1.00 14.50  ? 109 TRP A CH2 1 
ATOM   814  N N   . PRO A 1 110 ? 19.922 17.527  15.814 1.00 15.28  ? 110 PRO A N   1 
ATOM   815  C CA  . PRO A 1 110 ? 18.974 17.861  16.857 1.00 14.40  ? 110 PRO A CA  1 
ATOM   816  C C   . PRO A 1 110 ? 17.539 18.079  16.364 1.00 16.44  ? 110 PRO A C   1 
ATOM   817  O O   . PRO A 1 110 ? 16.610 17.855  17.138 1.00 15.57  ? 110 PRO A O   1 
ATOM   818  C CB  . PRO A 1 110 ? 19.477 19.141  17.534 1.00 15.86  ? 110 PRO A CB  1 
ATOM   819  C CG  . PRO A 1 110 ? 20.567 19.702  16.635 1.00 18.36  ? 110 PRO A CG  1 
ATOM   820  C CD  . PRO A 1 110 ? 20.961 18.584  15.677 1.00 14.26  ? 110 PRO A CD  1 
ATOM   821  N N   . THR A 1 111 ? 17.372 18.511  15.101 1.00 13.05  ? 111 THR A N   1 
ATOM   822  C CA  . THR A 1 111 ? 16.041 18.768  14.501 1.00 14.48  ? 111 THR A CA  1 
ATOM   823  C C   . THR A 1 111 ? 15.133 19.526  15.462 1.00 14.87  ? 111 THR A C   1 
ATOM   824  O O   . THR A 1 111 ? 14.031 19.090  15.798 1.00 13.32  ? 111 THR A O   1 
ATOM   825  C CB  . THR A 1 111 ? 15.375 17.478  13.976 1.00 20.33  ? 111 THR A CB  1 
ATOM   826  O OG1 . THR A 1 111 ? 15.047 16.629  15.057 1.00 16.86  ? 111 THR A OG1 1 
ATOM   827  C CG2 . THR A 1 111 ? 16.320 16.750  13.024 1.00 18.59  ? 111 THR A CG2 1 
ATOM   828  N N   . PRO A 1 112 ? 15.670 20.642  15.953 1.00 14.66  ? 112 PRO A N   1 
ATOM   829  C CA  . PRO A 1 112 ? 15.011 21.491  16.923 1.00 14.79  ? 112 PRO A CA  1 
ATOM   830  C C   . PRO A 1 112 ? 13.573 21.787  16.598 1.00 19.66  ? 112 PRO A C   1 
ATOM   831  O O   . PRO A 1 112 ? 12.706 21.812  17.469 1.00 20.75  ? 112 PRO A O   1 
ATOM   832  C CB  . PRO A 1 112 ? 15.818 22.790  17.002 1.00 14.53  ? 112 PRO A CB  1 
ATOM   833  C CG  . PRO A 1 112 ? 17.032 22.621  16.100 1.00 18.62  ? 112 PRO A CG  1 
ATOM   834  C CD  . PRO A 1 112 ? 16.927 21.257  15.445 1.00 12.82  ? 112 PRO A CD  1 
ATOM   835  N N   . ALA A 1 113 ? 13.315 22.062  15.347 1.00 16.52  ? 113 ALA A N   1 
ATOM   836  C CA  . ALA A 1 113 ? 11.975 22.385  14.971 1.00 17.63  ? 113 ALA A CA  1 
ATOM   837  C C   . ALA A 1 113 ? 11.001 21.263  15.289 1.00 20.71  ? 113 ALA A C   1 
ATOM   838  O O   . ALA A 1 113 ? 9.811  21.489  15.463 1.00 19.39  ? 113 ALA A O   1 
ATOM   839  C CB  . ALA A 1 113 ? 11.909 22.790  13.512 1.00 19.30  ? 113 ALA A CB  1 
ATOM   840  N N   . ALA A 1 114 ? 11.505 20.039  15.355 1.00 15.87  ? 114 ALA A N   1 
ATOM   841  C CA  . ALA A 1 114 ? 10.651 18.916  15.658 1.00 16.09  ? 114 ALA A CA  1 
ATOM   842  C C   . ALA A 1 114 ? 10.458 18.747  17.168 1.00 23.03  ? 114 ALA A C   1 
ATOM   843  O O   . ALA A 1 114 ? 9.567  18.024  17.623 1.00 22.78  ? 114 ALA A O   1 
ATOM   844  C CB  . ALA A 1 114 ? 11.183 17.640  15.009 1.00 16.49  ? 114 ALA A CB  1 
ATOM   845  N N   . ASP A 1 115 ? 11.314 19.430  17.938 1.00 22.64  ? 115 ASP A N   1 
ATOM   846  C CA  . ASP A 1 115 ? 11.284 19.399  19.400 1.00 21.91  ? 115 ASP A CA  1 
ATOM   847  C C   . ASP A 1 115 ? 11.188 17.986  19.942 1.00 18.76  ? 115 ASP A C   1 
ATOM   848  O O   . ASP A 1 115 ? 10.388 17.699  20.827 1.00 14.51  ? 115 ASP A O   1 
ATOM   849  C CB  . ASP A 1 115 ? 10.191 20.318  20.005 1.00 26.00  ? 115 ASP A CB  1 
ATOM   850  C CG  . ASP A 1 115 ? 10.311 20.561  21.493 1.00 36.78  ? 115 ASP A CG  1 
ATOM   851  O OD1 . ASP A 1 115 ? 11.284 21.066  22.015 1.00 40.04  ? 115 ASP A OD1 1 
ATOM   852  O OD2 . ASP A 1 115 ? 9.232  20.216  22.155 1.00 48.71  ? 115 ASP A OD2 1 
ATOM   853  N N   . ASN A 1 116 ? 12.019 17.106  19.390 1.00 15.93  ? 116 ASN A N   1 
ATOM   854  C CA  . ASN A 1 116 ? 12.056 15.720  19.812 1.00 14.59  ? 116 ASN A CA  1 
ATOM   855  C C   . ASN A 1 116 ? 13.472 15.264  20.162 1.00 17.62  ? 116 ASN A C   1 
ATOM   856  O O   . ASN A 1 116 ? 13.706 14.081  20.409 1.00 15.66  ? 116 ASN A O   1 
ATOM   857  C CB  . ASN A 1 116 ? 11.390 14.769  18.790 1.00 13.29  ? 116 ASN A CB  1 
ATOM   858  C CG  . ASN A 1 116 ? 11.983 14.876  17.401 1.00 27.97  ? 116 ASN A CG  1 
ATOM   859  O OD1 . ASN A 1 116 ? 13.059 15.475  17.209 1.00 18.16  ? 116 ASN A OD1 1 
ATOM   860  N ND2 . ASN A 1 116 ? 11.286 14.289  16.427 1.00 11.80  ? 116 ASN A ND2 1 
ATOM   861  N N   . TYR A 1 117 ? 14.415 16.207  20.208 1.00 11.50  ? 117 TYR A N   1 
ATOM   862  C CA  . TYR A 1 117 ? 15.783 15.856  20.535 1.00 10.44  ? 117 TYR A CA  1 
ATOM   863  C C   . TYR A 1 117 ? 16.002 15.425  21.988 1.00 15.83  ? 117 TYR A C   1 
ATOM   864  O O   . TYR A 1 117 ? 16.921 14.649  22.291 1.00 12.83  ? 117 TYR A O   1 
ATOM   865  C CB  . TYR A 1 117 ? 16.832 16.860  20.012 1.00 11.23  ? 117 TYR A CB  1 
ATOM   866  C CG  . TYR A 1 117 ? 16.769 18.242  20.621 1.00 11.98  ? 117 TYR A CG  1 
ATOM   867  C CD1 . TYR A 1 117 ? 17.441 18.518  21.811 1.00 12.30  ? 117 TYR A CD1 1 
ATOM   868  C CD2 . TYR A 1 117 ? 16.087 19.282  19.983 1.00 13.69  ? 117 TYR A CD2 1 
ATOM   869  C CE1 . TYR A 1 117 ? 17.435 19.799  22.363 1.00 8.38   ? 117 TYR A CE1 1 
ATOM   870  C CE2 . TYR A 1 117 ? 16.060 20.569  20.522 1.00 12.91  ? 117 TYR A CE2 1 
ATOM   871  C CZ  . TYR A 1 117 ? 16.742 20.820  21.713 1.00 16.93  ? 117 TYR A CZ  1 
ATOM   872  O OH  . TYR A 1 117 ? 16.721 22.072  22.255 1.00 17.03  ? 117 TYR A OH  1 
ATOM   873  N N   . VAL A 1 118 ? 15.136 15.913  22.883 1.00 14.43  ? 118 VAL A N   1 
ATOM   874  C CA  . VAL A 1 118 ? 15.210 15.548  24.297 1.00 13.52  ? 118 VAL A CA  1 
ATOM   875  C C   . VAL A 1 118 ? 14.726 14.110  24.457 1.00 17.02  ? 118 VAL A C   1 
ATOM   876  O O   . VAL A 1 118 ? 15.361 13.283  25.105 1.00 16.01  ? 118 VAL A O   1 
ATOM   877  C CB  . VAL A 1 118 ? 14.438 16.527  25.186 1.00 16.50  ? 118 VAL A CB  1 
ATOM   878  C CG1 . VAL A 1 118 ? 14.317 15.975  26.600 1.00 16.08  ? 118 VAL A CG1 1 
ATOM   879  C CG2 . VAL A 1 118 ? 15.156 17.877  25.224 1.00 15.58  ? 118 VAL A CG2 1 
ATOM   880  N N   . HIS A 1 119 ? 13.608 13.821  23.810 1.00 13.43  ? 119 HIS A N   1 
ATOM   881  C CA  . HIS A 1 119 ? 13.065 12.492  23.818 1.00 9.95   ? 119 HIS A CA  1 
ATOM   882  C C   . HIS A 1 119 ? 14.102 11.525  23.239 1.00 11.57  ? 119 HIS A C   1 
ATOM   883  O O   . HIS A 1 119 ? 14.356 10.458  23.786 1.00 14.03  ? 119 HIS A O   1 
ATOM   884  C CB  . HIS A 1 119 ? 11.701 12.431  23.100 1.00 10.10  ? 119 HIS A CB  1 
ATOM   885  C CG  . HIS A 1 119 ? 11.222 11.030  22.992 1.00 12.36  ? 119 HIS A CG  1 
ATOM   886  N ND1 . HIS A 1 119 ? 10.543 10.415  24.030 1.00 14.19  ? 119 HIS A ND1 1 
ATOM   887  C CD2 . HIS A 1 119 ? 11.387 10.129  21.990 1.00 11.94  ? 119 HIS A CD2 1 
ATOM   888  C CE1 . HIS A 1 119 ? 10.292 9.167   23.634 1.00 12.20  ? 119 HIS A CE1 1 
ATOM   889  N NE2 . HIS A 1 119 ? 10.776 8.963   22.412 1.00 12.35  ? 119 HIS A NE2 1 
ATOM   890  N N   . ALA A 1 120 ? 14.748 11.937  22.144 1.00 14.84  ? 120 ALA A N   1 
ATOM   891  C CA  . ALA A 1 120 ? 15.790 11.127  21.530 1.00 15.65  ? 120 ALA A CA  1 
ATOM   892  C C   . ALA A 1 120 ? 16.858 10.805  22.570 1.00 17.80  ? 120 ALA A C   1 
ATOM   893  O O   . ALA A 1 120 ? 17.243 9.648   22.750 1.00 18.41  ? 120 ALA A O   1 
ATOM   894  C CB  . ALA A 1 120 ? 16.399 11.868  20.340 1.00 17.31  ? 120 ALA A CB  1 
ATOM   895  N N   . TRP A 1 121 ? 17.311 11.862  23.270 1.00 11.38  ? 121 TRP A N   1 
ATOM   896  C CA  . TRP A 1 121 ? 18.326 11.738  24.305 1.00 10.31  ? 121 TRP A CA  1 
ATOM   897  C C   . TRP A 1 121 ? 17.930 10.733  25.402 1.00 13.17  ? 121 TRP A C   1 
ATOM   898  O O   . TRP A 1 121 ? 18.731 9.874   25.806 1.00 12.38  ? 121 TRP A O   1 
ATOM   899  C CB  . TRP A 1 121 ? 18.848 13.098  24.841 1.00 8.89   ? 121 TRP A CB  1 
ATOM   900  C CG  . TRP A 1 121 ? 20.058 12.928  25.708 1.00 10.51  ? 121 TRP A CG  1 
ATOM   901  C CD1 . TRP A 1 121 ? 20.128 13.205  27.035 1.00 13.31  ? 121 TRP A CD1 1 
ATOM   902  C CD2 . TRP A 1 121 ? 21.342 12.390  25.340 1.00 10.70  ? 121 TRP A CD2 1 
ATOM   903  N NE1 . TRP A 1 121 ? 21.367 12.893  27.526 1.00 13.37  ? 121 TRP A NE1 1 
ATOM   904  C CE2 . TRP A 1 121 ? 22.139 12.393  26.509 1.00 14.77  ? 121 TRP A CE2 1 
ATOM   905  C CE3 . TRP A 1 121 ? 21.894 11.911  24.144 1.00 10.75  ? 121 TRP A CE3 1 
ATOM   906  C CZ2 . TRP A 1 121 ? 23.464 11.947  26.498 1.00 12.89  ? 121 TRP A CZ2 1 
ATOM   907  C CZ3 . TRP A 1 121 ? 23.200 11.472  24.138 1.00 10.84  ? 121 TRP A CZ3 1 
ATOM   908  C CH2 . TRP A 1 121 ? 23.975 11.485  25.300 1.00 11.36  ? 121 TRP A CH2 1 
ATOM   909  N N   . GLU A 1 122 ? 16.681 10.812  25.861 1.00 9.52   ? 122 GLU A N   1 
ATOM   910  C CA  . GLU A 1 122 ? 16.160 9.904   26.871 1.00 10.54  ? 122 GLU A CA  1 
ATOM   911  C C   . GLU A 1 122 ? 16.278 8.453   26.417 1.00 15.82  ? 122 GLU A C   1 
ATOM   912  O O   . GLU A 1 122 ? 16.737 7.568   27.156 1.00 13.02  ? 122 GLU A O   1 
ATOM   913  C CB  . GLU A 1 122 ? 14.689 10.217  27.186 1.00 11.50  ? 122 GLU A CB  1 
ATOM   914  C CG  . GLU A 1 122 ? 14.513 11.451  28.072 1.00 17.99  ? 122 GLU A CG  1 
ATOM   915  C CD  . GLU A 1 122 ? 13.114 11.991  28.031 1.00 26.10  ? 122 GLU A CD  1 
ATOM   916  O OE1 . GLU A 1 122 ? 12.316 11.713  27.158 1.00 27.64  ? 122 GLU A OE1 1 
ATOM   917  O OE2 . GLU A 1 122 ? 12.852 12.781  29.041 1.00 31.60  ? 122 GLU A OE2 1 
ATOM   918  N N   . LYS A 1 123 ? 15.846 8.222   25.183 1.00 13.83  ? 123 LYS A N   1 
ATOM   919  C CA  . LYS A 1 123 ? 15.906 6.904   24.590 1.00 14.42  ? 123 LYS A CA  1 
ATOM   920  C C   . LYS A 1 123 ? 17.360 6.412   24.456 1.00 20.21  ? 123 LYS A C   1 
ATOM   921  O O   . LYS A 1 123 ? 17.657 5.239   24.691 1.00 20.91  ? 123 LYS A O   1 
ATOM   922  C CB  . LYS A 1 123 ? 15.153 6.879   23.276 1.00 13.88  ? 123 LYS A CB  1 
ATOM   923  C CG  . LYS A 1 123 ? 13.669 7.102   23.498 1.00 14.52  ? 123 LYS A CG  1 
ATOM   924  C CD  . LYS A 1 123 ? 13.095 6.099   24.488 1.00 21.25  ? 123 LYS A CD  1 
ATOM   925  C CE  . LYS A 1 123 ? 11.588 5.925   24.376 1.00 20.60  ? 123 LYS A CE  1 
ATOM   926  N NZ  . LYS A 1 123 ? 11.083 4.870   25.264 1.00 13.68  ? 123 LYS A NZ  1 
ATOM   927  N N   . MET A 1 124 ? 18.271 7.337   24.096 1.00 14.92  ? 124 MET A N   1 
ATOM   928  C CA  . MET A 1 124 ? 19.703 7.030   23.944 1.00 14.54  ? 124 MET A CA  1 
ATOM   929  C C   . MET A 1 124 ? 20.284 6.455   25.227 1.00 16.98  ? 124 MET A C   1 
ATOM   930  O O   . MET A 1 124 ? 21.106 5.534   25.224 1.00 13.52  ? 124 MET A O   1 
ATOM   931  C CB  . MET A 1 124 ? 20.528 8.278   23.524 1.00 15.66  ? 124 MET A CB  1 
ATOM   932  C CG  . MET A 1 124 ? 20.199 8.804   22.132 1.00 15.18  ? 124 MET A CG  1 
ATOM   933  S SD  . MET A 1 124 ? 20.814 7.746   20.801 1.00 15.48  ? 124 MET A SD  1 
ATOM   934  C CE  . MET A 1 124 ? 22.581 8.140   20.846 1.00 11.46  ? 124 MET A CE  1 
ATOM   935  N N   . ILE A 1 125 ? 19.842 7.031   26.329 1.00 15.74  ? 125 ILE A N   1 
ATOM   936  C CA  . ILE A 1 125 ? 20.278 6.613   27.638 1.00 16.31  ? 125 ILE A CA  1 
ATOM   937  C C   . ILE A 1 125 ? 19.859 5.183   27.903 1.00 17.66  ? 125 ILE A C   1 
ATOM   938  O O   . ILE A 1 125 ? 20.584 4.402   28.513 1.00 17.34  ? 125 ILE A O   1 
ATOM   939  C CB  . ILE A 1 125 ? 19.724 7.542   28.703 1.00 18.38  ? 125 ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 125 ? 20.330 8.940   28.558 1.00 17.47  ? 125 ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 125 ? 20.022 6.962   30.081 1.00 19.72  ? 125 ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 125 ? 19.592 10.001  29.367 1.00 13.84  ? 125 ILE A CD1 1 
ATOM   943  N N   . GLU A 1 126 ? 18.672 4.856   27.420 1.00 15.48  ? 126 GLU A N   1 
ATOM   944  C CA  . GLU A 1 126 ? 18.136 3.534   27.575 1.00 14.21  ? 126 GLU A CA  1 
ATOM   945  C C   . GLU A 1 126 ? 18.901 2.546   26.726 1.00 16.65  ? 126 GLU A C   1 
ATOM   946  O O   . GLU A 1 126 ? 19.090 1.392   27.113 1.00 18.01  ? 126 GLU A O   1 
ATOM   947  C CB  . GLU A 1 126 ? 16.626 3.513   27.322 1.00 15.54  ? 126 GLU A CB  1 
ATOM   948  C CG  . GLU A 1 126 ? 15.894 3.960   28.593 1.00 21.76  ? 126 GLU A CG  1 
ATOM   949  C CD  . GLU A 1 126 ? 14.500 4.473   28.387 1.00 32.25  ? 126 GLU A CD  1 
ATOM   950  O OE1 . GLU A 1 126 ? 13.898 4.391   27.337 1.00 23.02  ? 126 GLU A OE1 1 
ATOM   951  O OE2 . GLU A 1 126 ? 14.000 5.005   29.472 1.00 41.25  ? 126 GLU A OE2 1 
ATOM   952  N N   . LEU A 1 127 ? 19.368 3.019   25.579 1.00 13.57  ? 127 LEU A N   1 
ATOM   953  C CA  . LEU A 1 127 ? 20.158 2.181   24.682 1.00 13.96  ? 127 LEU A CA  1 
ATOM   954  C C   . LEU A 1 127 ? 21.473 1.791   25.323 1.00 16.86  ? 127 LEU A C   1 
ATOM   955  O O   . LEU A 1 127 ? 21.910 0.649   25.239 1.00 15.64  ? 127 LEU A O   1 
ATOM   956  C CB  . LEU A 1 127 ? 20.361 2.846   23.309 1.00 12.06  ? 127 LEU A CB  1 
ATOM   957  C CG  . LEU A 1 127 ? 19.029 3.136   22.629 1.00 16.45  ? 127 LEU A CG  1 
ATOM   958  C CD1 . LEU A 1 127 ? 19.259 3.907   21.344 1.00 15.51  ? 127 LEU A CD1 1 
ATOM   959  C CD2 . LEU A 1 127 ? 18.285 1.825   22.339 1.00 14.58  ? 127 LEU A CD2 1 
ATOM   960  N N   . ARG A 1 128 ? 22.092 2.756   25.990 1.00 15.93  ? 128 ARG A N   1 
ATOM   961  C CA  . ARG A 1 128 ? 23.327 2.496   26.681 1.00 15.75  ? 128 ARG A CA  1 
ATOM   962  C C   . ARG A 1 128 ? 23.065 1.538   27.854 1.00 20.50  ? 128 ARG A C   1 
ATOM   963  O O   . ARG A 1 128 ? 23.811 0.580   28.086 1.00 19.42  ? 128 ARG A O   1 
ATOM   964  C CB  . ARG A 1 128 ? 23.961 3.798   27.168 1.00 13.96  ? 128 ARG A CB  1 
ATOM   965  C CG  . ARG A 1 128 ? 25.383 3.605   27.649 1.00 16.86  ? 128 ARG A CG  1 
ATOM   966  C CD  . ARG A 1 128 ? 25.971 4.855   28.276 1.00 11.03  ? 128 ARG A CD  1 
ATOM   967  N NE  . ARG A 1 128 ? 25.135 5.416   29.330 1.00 12.35  ? 128 ARG A NE  1 
ATOM   968  C CZ  . ARG A 1 128 ? 25.444 6.558   29.927 1.00 31.80  ? 128 ARG A CZ  1 
ATOM   969  N NH1 . ARG A 1 128 ? 26.532 7.242   29.581 1.00 16.26  ? 128 ARG A NH1 1 
ATOM   970  N NH2 . ARG A 1 128 ? 24.659 7.034   30.888 1.00 18.65  ? 128 ARG A NH2 1 
ATOM   971  N N   . ALA A 1 129 ? 21.977 1.789   28.596 1.00 15.45  ? 129 ALA A N   1 
ATOM   972  C CA  . ALA A 1 129 ? 21.640 0.927   29.719 1.00 14.74  ? 129 ALA A CA  1 
ATOM   973  C C   . ALA A 1 129 ? 21.513 -0.541  29.284 1.00 16.81  ? 129 ALA A C   1 
ATOM   974  O O   . ALA A 1 129 ? 22.012 -1.450  29.955 1.00 14.88  ? 129 ALA A O   1 
ATOM   975  C CB  . ALA A 1 129 ? 20.420 1.419   30.495 1.00 14.59  ? 129 ALA A CB  1 
ATOM   976  N N   . ALA A 1 130 ? 20.867 -0.751  28.136 1.00 14.30  ? 130 ALA A N   1 
ATOM   977  C CA  . ALA A 1 130 ? 20.648 -2.074  27.566 1.00 14.18  ? 130 ALA A CA  1 
ATOM   978  C C   . ALA A 1 130 ? 21.908 -2.719  26.979 1.00 18.39  ? 130 ALA A C   1 
ATOM   979  O O   . ALA A 1 130 ? 21.911 -3.902  26.652 1.00 17.68  ? 130 ALA A O   1 
ATOM   980  C CB  . ALA A 1 130 ? 19.543 -2.027  26.529 1.00 14.51  ? 130 ALA A CB  1 
ATOM   981  N N   . GLY A 1 131 ? 22.976 -1.932  26.838 1.00 16.05  ? 131 GLY A N   1 
ATOM   982  C CA  . GLY A 1 131 ? 24.235 -2.440  26.305 1.00 13.77  ? 131 GLY A CA  1 
ATOM   983  C C   . GLY A 1 131 ? 24.301 -2.450  24.785 1.00 16.32  ? 131 GLY A C   1 
ATOM   984  O O   . GLY A 1 131 ? 25.208 -3.035  24.195 1.00 14.64  ? 131 GLY A O   1 
ATOM   985  N N   . LEU A 1 132 ? 23.336 -1.803  24.154 1.00 13.61  ? 132 LEU A N   1 
ATOM   986  C CA  . LEU A 1 132 ? 23.292 -1.724  22.704 1.00 17.39  ? 132 LEU A CA  1 
ATOM   987  C C   . LEU A 1 132 ? 24.491 -0.925  22.173 1.00 18.91  ? 132 LEU A C   1 
ATOM   988  O O   . LEU A 1 132 ? 24.966 -1.107  21.048 1.00 15.60  ? 132 LEU A O   1 
ATOM   989  C CB  . LEU A 1 132 ? 21.965 -1.074  22.244 1.00 19.82  ? 132 LEU A CB  1 
ATOM   990  C CG  . LEU A 1 132 ? 20.749 -2.013  22.235 1.00 25.64  ? 132 LEU A CG  1 
ATOM   991  C CD1 . LEU A 1 132 ? 20.870 -2.992  21.084 1.00 28.15  ? 132 LEU A CD1 1 
ATOM   992  C CD2 . LEU A 1 132 ? 20.614 -2.763  23.563 1.00 26.61  ? 132 LEU A CD2 1 
ATOM   993  N N   . THR A 1 133 ? 24.965 -0.021  23.009 1.00 14.39  ? 133 THR A N   1 
ATOM   994  C CA  . THR A 1 133 ? 26.095 0.821   22.676 1.00 14.98  ? 133 THR A CA  1 
ATOM   995  C C   . THR A 1 133 ? 26.890 1.093   23.916 1.00 14.55  ? 133 THR A C   1 
ATOM   996  O O   . THR A 1 133 ? 26.325 1.168   24.997 1.00 11.70  ? 133 THR A O   1 
ATOM   997  C CB  . THR A 1 133 ? 25.653 2.158   22.023 1.00 18.69  ? 133 THR A CB  1 
ATOM   998  O OG1 . THR A 1 133 ? 26.779 2.953   21.713 1.00 14.11  ? 133 THR A OG1 1 
ATOM   999  C CG2 . THR A 1 133 ? 24.716 2.929   22.938 1.00 4.86   ? 133 THR A CG2 1 
ATOM   1000 N N   . ARG A 1 134 ? 28.204 1.239   23.776 1.00 14.42  ? 134 ARG A N   1 
ATOM   1001 C CA  . ARG A 1 134 ? 29.044 1.505   24.929 1.00 13.78  ? 134 ARG A CA  1 
ATOM   1002 C C   . ARG A 1 134 ? 28.897 2.928   25.483 1.00 14.31  ? 134 ARG A C   1 
ATOM   1003 O O   . ARG A 1 134 ? 28.730 3.140   26.685 1.00 13.44  ? 134 ARG A O   1 
ATOM   1004 C CB  . ARG A 1 134 ? 30.500 1.112   24.711 1.00 13.69  ? 134 ARG A CB  1 
ATOM   1005 C CG  . ARG A 1 134 ? 30.718 -0.383  24.903 1.00 26.84  ? 134 ARG A CG  1 
ATOM   1006 C CD  . ARG A 1 134 ? 32.085 -0.859  24.428 1.00 25.93  ? 134 ARG A CD  1 
ATOM   1007 N NE  . ARG A 1 134 ? 33.160 -0.555  25.373 1.00 48.39  ? 134 ARG A NE  1 
ATOM   1008 C CZ  . ARG A 1 134 ? 34.167 0.297   25.141 1.00 69.11  ? 134 ARG A CZ  1 
ATOM   1009 N NH1 . ARG A 1 134 ? 34.297 0.965   23.989 1.00 35.23  ? 134 ARG A NH1 1 
ATOM   1010 N NH2 . ARG A 1 134 ? 35.074 0.484   26.099 1.00 63.84  ? 134 ARG A NH2 1 
ATOM   1011 N N   . SER A 1 135 ? 28.960 3.899   24.592 1.00 11.27  ? 135 SER A N   1 
ATOM   1012 C CA  . SER A 1 135 ? 28.822 5.297   24.957 1.00 8.10   ? 135 SER A CA  1 
ATOM   1013 C C   . SER A 1 135 ? 27.814 5.974   24.059 1.00 14.19  ? 135 SER A C   1 
ATOM   1014 O O   . SER A 1 135 ? 27.484 5.469   22.987 1.00 15.09  ? 135 SER A O   1 
ATOM   1015 C CB  . SER A 1 135 ? 30.149 6.044   24.857 1.00 12.13  ? 135 SER A CB  1 
ATOM   1016 O OG  . SER A 1 135 ? 31.182 5.348   25.534 1.00 15.81  ? 135 SER A OG  1 
ATOM   1017 N N   . ILE A 1 136 ? 27.354 7.134   24.486 1.00 11.01  ? 136 ILE A N   1 
ATOM   1018 C CA  . ILE A 1 136 ? 26.404 7.894   23.710 1.00 11.16  ? 136 ILE A CA  1 
ATOM   1019 C C   . ILE A 1 136 ? 26.836 9.331   23.601 1.00 12.89  ? 136 ILE A C   1 
ATOM   1020 O O   . ILE A 1 136 ? 27.460 9.888   24.515 1.00 12.07  ? 136 ILE A O   1 
ATOM   1021 C CB  . ILE A 1 136 ? 25.006 7.814   24.282 1.00 14.43  ? 136 ILE A CB  1 
ATOM   1022 C CG1 . ILE A 1 136 ? 25.076 8.159   25.767 1.00 13.18  ? 136 ILE A CG1 1 
ATOM   1023 C CG2 . ILE A 1 136 ? 24.453 6.406   24.091 1.00 17.56  ? 136 ILE A CG2 1 
ATOM   1024 C CD1 . ILE A 1 136 ? 23.782 7.877   26.519 1.00 14.69  ? 136 ILE A CD1 1 
ATOM   1025 N N   . GLY A 1 137 ? 26.492 9.916   22.469 1.00 10.77  ? 137 GLY A N   1 
ATOM   1026 C CA  . GLY A 1 137 ? 26.814 11.292  22.180 1.00 10.95  ? 137 GLY A CA  1 
ATOM   1027 C C   . GLY A 1 137 ? 25.819 11.876  21.206 1.00 13.78  ? 137 GLY A C   1 
ATOM   1028 O O   . GLY A 1 137 ? 24.832 11.254  20.818 1.00 14.30  ? 137 GLY A O   1 
ATOM   1029 N N   . VAL A 1 138 ? 26.090 13.086  20.817 1.00 12.01  ? 138 VAL A N   1 
ATOM   1030 C CA  . VAL A 1 138 ? 25.225 13.745  19.895 1.00 12.20  ? 138 VAL A CA  1 
ATOM   1031 C C   . VAL A 1 138 ? 26.023 14.337  18.787 1.00 19.39  ? 138 VAL A C   1 
ATOM   1032 O O   . VAL A 1 138 ? 27.253 14.248  18.758 1.00 20.84  ? 138 VAL A O   1 
ATOM   1033 C CB  . VAL A 1 138 ? 24.429 14.829  20.577 1.00 13.13  ? 138 VAL A CB  1 
ATOM   1034 C CG1 . VAL A 1 138 ? 23.540 14.222  21.663 1.00 12.59  ? 138 VAL A CG1 1 
ATOM   1035 C CG2 . VAL A 1 138 ? 25.393 15.845  21.181 1.00 10.12  ? 138 VAL A CG2 1 
ATOM   1036 N N   . SER A 1 139 ? 25.318 14.956  17.883 1.00 15.75  ? 139 SER A N   1 
ATOM   1037 C CA  . SER A 1 139 ? 25.954 15.557  16.759 1.00 14.87  ? 139 SER A CA  1 
ATOM   1038 C C   . SER A 1 139 ? 25.220 16.785  16.321 1.00 13.73  ? 139 SER A C   1 
ATOM   1039 O O   . SER A 1 139 ? 23.995 16.804  16.271 1.00 12.42  ? 139 SER A O   1 
ATOM   1040 C CB  . SER A 1 139 ? 26.022 14.546  15.609 1.00 19.69  ? 139 SER A CB  1 
ATOM   1041 O OG  . SER A 1 139 ? 26.628 15.108  14.459 1.00 22.30  ? 139 SER A OG  1 
ATOM   1042 N N   . ASN A 1 140 ? 25.977 17.809  15.990 1.00 10.46  ? 140 ASN A N   1 
ATOM   1043 C CA  . ASN A 1 140 ? 25.370 19.015  15.516 1.00 9.83   ? 140 ASN A CA  1 
ATOM   1044 C C   . ASN A 1 140 ? 24.483 19.699  16.540 1.00 12.41  ? 140 ASN A C   1 
ATOM   1045 O O   . ASN A 1 140 ? 23.583 20.461  16.195 1.00 13.07  ? 140 ASN A O   1 
ATOM   1046 C CB  . ASN A 1 140 ? 24.628 18.733  14.204 1.00 8.53   ? 140 ASN A CB  1 
ATOM   1047 C CG  . ASN A 1 140 ? 25.584 18.250  13.125 1.00 31.52  ? 140 ASN A CG  1 
ATOM   1048 O OD1 . ASN A 1 140 ? 26.653 18.846  12.917 1.00 16.47  ? 140 ASN A OD1 1 
ATOM   1049 N ND2 . ASN A 1 140 ? 25.203 17.181  12.431 1.00 19.42  ? 140 ASN A ND2 1 
ATOM   1050 N N   . HIS A 1 141 ? 24.763 19.436  17.807 1.00 10.44  ? 141 HIS A N   1 
ATOM   1051 C CA  . HIS A 1 141 ? 24.021 20.048  18.880 1.00 8.19   ? 141 HIS A CA  1 
ATOM   1052 C C   . HIS A 1 141 ? 24.639 21.374  19.299 1.00 12.73  ? 141 HIS A C   1 
ATOM   1053 O O   . HIS A 1 141 ? 25.834 21.453  19.582 1.00 9.85   ? 141 HIS A O   1 
ATOM   1054 C CB  . HIS A 1 141 ? 23.925 19.108  20.089 1.00 7.88   ? 141 HIS A CB  1 
ATOM   1055 C CG  . HIS A 1 141 ? 22.839 18.119  19.915 1.00 11.66  ? 141 HIS A CG  1 
ATOM   1056 N ND1 . HIS A 1 141 ? 22.678 17.434  18.719 1.00 13.94  ? 141 HIS A ND1 1 
ATOM   1057 C CD2 . HIS A 1 141 ? 21.864 17.716  20.773 1.00 13.03  ? 141 HIS A CD2 1 
ATOM   1058 C CE1 . HIS A 1 141 ? 21.626 16.631  18.879 1.00 12.29  ? 141 HIS A CE1 1 
ATOM   1059 N NE2 . HIS A 1 141 ? 21.115 16.778  20.098 1.00 11.81  ? 141 HIS A NE2 1 
ATOM   1060 N N   . LEU A 1 142 ? 23.804 22.407  19.334 1.00 9.39   ? 142 LEU A N   1 
ATOM   1061 C CA  . LEU A 1 142 ? 24.205 23.735  19.735 1.00 7.14   ? 142 LEU A CA  1 
ATOM   1062 C C   . LEU A 1 142 ? 24.195 23.782  21.262 1.00 11.66  ? 142 LEU A C   1 
ATOM   1063 O O   . LEU A 1 142 ? 23.699 22.865  21.915 1.00 11.51  ? 142 LEU A O   1 
ATOM   1064 C CB  . LEU A 1 142 ? 23.269 24.801  19.123 1.00 7.12   ? 142 LEU A CB  1 
ATOM   1065 C CG  . LEU A 1 142 ? 23.207 24.727  17.595 1.00 12.02  ? 142 LEU A CG  1 
ATOM   1066 C CD1 . LEU A 1 142 ? 22.179 25.723  17.062 1.00 9.38   ? 142 LEU A CD1 1 
ATOM   1067 C CD2 . LEU A 1 142 ? 24.581 25.029  17.004 1.00 12.50  ? 142 LEU A CD2 1 
ATOM   1068 N N   . VAL A 1 143 ? 24.759 24.834  21.835 1.00 8.93   ? 143 VAL A N   1 
ATOM   1069 C CA  . VAL A 1 143 ? 24.824 24.975  23.285 1.00 9.57   ? 143 VAL A CA  1 
ATOM   1070 C C   . VAL A 1 143 ? 23.469 24.758  23.990 1.00 14.13  ? 143 VAL A C   1 
ATOM   1071 O O   . VAL A 1 143 ? 23.370 23.977  24.944 1.00 13.11  ? 143 VAL A O   1 
ATOM   1072 C CB  . VAL A 1 143 ? 25.526 26.276  23.692 1.00 12.38  ? 143 VAL A CB  1 
ATOM   1073 C CG1 . VAL A 1 143 ? 25.273 26.612  25.163 1.00 11.29  ? 143 VAL A CG1 1 
ATOM   1074 C CG2 . VAL A 1 143 ? 27.032 26.156  23.437 1.00 11.69  ? 143 VAL A CG2 1 
ATOM   1075 N N   . PRO A 1 144 ? 22.423 25.449  23.509 1.00 11.61  ? 144 PRO A N   1 
ATOM   1076 C CA  . PRO A 1 144 ? 21.108 25.306  24.085 1.00 12.77  ? 144 PRO A CA  1 
ATOM   1077 C C   . PRO A 1 144 ? 20.604 23.882  23.967 1.00 16.75  ? 144 PRO A C   1 
ATOM   1078 O O   . PRO A 1 144 ? 19.945 23.374  24.871 1.00 16.22  ? 144 PRO A O   1 
ATOM   1079 C CB  . PRO A 1 144 ? 20.186 26.302  23.371 1.00 14.79  ? 144 PRO A CB  1 
ATOM   1080 C CG  . PRO A 1 144 ? 21.089 27.223  22.563 1.00 15.68  ? 144 PRO A CG  1 
ATOM   1081 C CD  . PRO A 1 144 ? 22.472 26.595  22.565 1.00 11.06  ? 144 PRO A CD  1 
ATOM   1082 N N   . HIS A 1 145 ? 20.921 23.219  22.854 1.00 12.13  ? 145 HIS A N   1 
ATOM   1083 C CA  . HIS A 1 145 ? 20.507 21.827  22.690 1.00 11.76  ? 145 HIS A CA  1 
ATOM   1084 C C   . HIS A 1 145 ? 21.076 20.992  23.826 1.00 16.96  ? 145 HIS A C   1 
ATOM   1085 O O   . HIS A 1 145 ? 20.375 20.261  24.519 1.00 16.46  ? 145 HIS A O   1 
ATOM   1086 C CB  . HIS A 1 145 ? 20.973 21.254  21.338 1.00 10.42  ? 145 HIS A CB  1 
ATOM   1087 C CG  . HIS A 1 145 ? 20.436 22.010  20.177 1.00 12.02  ? 145 HIS A CG  1 
ATOM   1088 N ND1 . HIS A 1 145 ? 21.037 21.957  18.931 1.00 13.24  ? 145 HIS A ND1 1 
ATOM   1089 C CD2 . HIS A 1 145 ? 19.357 22.833  20.099 1.00 13.41  ? 145 HIS A CD2 1 
ATOM   1090 C CE1 . HIS A 1 145 ? 20.317 22.734  18.129 1.00 13.82  ? 145 HIS A CE1 1 
ATOM   1091 N NE2 . HIS A 1 145 ? 19.297 23.272  18.800 1.00 13.34  ? 145 HIS A NE2 1 
ATOM   1092 N N   . LEU A 1 146 ? 22.382 21.138  24.009 1.00 13.99  ? 146 LEU A N   1 
ATOM   1093 C CA  . LEU A 1 146 ? 23.129 20.434  25.027 1.00 10.69  ? 146 LEU A CA  1 
ATOM   1094 C C   . LEU A 1 146 ? 22.646 20.731  26.439 1.00 17.35  ? 146 LEU A C   1 
ATOM   1095 O O   . LEU A 1 146 ? 22.471 19.824  27.241 1.00 17.67  ? 146 LEU A O   1 
ATOM   1096 C CB  . LEU A 1 146 ? 24.617 20.750  24.892 1.00 9.64   ? 146 LEU A CB  1 
ATOM   1097 C CG  . LEU A 1 146 ? 25.143 20.480  23.489 1.00 11.40  ? 146 LEU A CG  1 
ATOM   1098 C CD1 . LEU A 1 146 ? 26.457 21.235  23.279 1.00 14.48  ? 146 LEU A CD1 1 
ATOM   1099 C CD2 . LEU A 1 146 ? 25.363 18.984  23.312 1.00 14.41  ? 146 LEU A CD2 1 
ATOM   1100 N N   . GLU A 1 147 ? 22.457 22.009  26.762 1.00 13.93  ? 147 GLU A N   1 
ATOM   1101 C CA  . GLU A 1 147 ? 21.992 22.370  28.093 1.00 12.51  ? 147 GLU A CA  1 
ATOM   1102 C C   . GLU A 1 147 ? 20.697 21.647  28.413 1.00 15.29  ? 147 GLU A C   1 
ATOM   1103 O O   . GLU A 1 147 ? 20.521 21.049  29.466 1.00 15.93  ? 147 GLU A O   1 
ATOM   1104 C CB  . GLU A 1 147 ? 21.737 23.890  28.200 1.00 13.66  ? 147 GLU A CB  1 
ATOM   1105 C CG  . GLU A 1 147 ? 23.007 24.731  28.396 1.00 8.39   ? 147 GLU A CG  1 
ATOM   1106 C CD  . GLU A 1 147 ? 23.528 24.669  29.797 1.00 18.93  ? 147 GLU A CD  1 
ATOM   1107 O OE1 . GLU A 1 147 ? 22.959 24.085  30.685 1.00 19.25  ? 147 GLU A OE1 1 
ATOM   1108 O OE2 . GLU A 1 147 ? 24.689 25.259  29.948 1.00 12.75  ? 147 GLU A OE2 1 
ATOM   1109 N N   . ARG A 1 148 ? 19.787 21.739  27.455 1.00 12.51  ? 148 ARG A N   1 
ATOM   1110 C CA  . ARG A 1 148 ? 18.462 21.159  27.554 1.00 14.74  ? 148 ARG A CA  1 
ATOM   1111 C C   . ARG A 1 148 ? 18.454 19.660  27.785 1.00 16.54  ? 148 ARG A C   1 
ATOM   1112 O O   . ARG A 1 148 ? 17.714 19.164  28.636 1.00 13.91  ? 148 ARG A O   1 
ATOM   1113 C CB  . ARG A 1 148 ? 17.578 21.537  26.365 1.00 14.59  ? 148 ARG A CB  1 
ATOM   1114 C CG  . ARG A 1 148 ? 16.088 21.268  26.586 1.00 17.89  ? 148 ARG A CG  1 
ATOM   1115 C CD  . ARG A 1 148 ? 15.266 21.236  25.286 1.00 14.09  ? 148 ARG A CD  1 
ATOM   1116 N NE  . ARG A 1 148 ? 13.821 21.469  25.472 1.00 14.53  ? 148 ARG A NE  1 
ATOM   1117 C CZ  . ARG A 1 148 ? 12.960 21.454  24.454 1.00 15.01  ? 148 ARG A CZ  1 
ATOM   1118 N NH1 . ARG A 1 148 ? 13.365 21.468  23.200 1.00 9.11   ? 148 ARG A NH1 1 
ATOM   1119 N NH2 . ARG A 1 148 ? 11.658 21.678  24.689 1.00 13.71  ? 148 ARG A NH2 1 
ATOM   1120 N N   . ILE A 1 149 ? 19.254 18.926  27.013 1.00 13.17  ? 149 ILE A N   1 
ATOM   1121 C CA  . ILE A 1 149 ? 19.274 17.478  27.183 1.00 14.06  ? 149 ILE A CA  1 
ATOM   1122 C C   . ILE A 1 149 ? 19.862 17.067  28.498 1.00 17.76  ? 149 ILE A C   1 
ATOM   1123 O O   . ILE A 1 149 ? 19.419 16.117  29.130 1.00 22.42  ? 149 ILE A O   1 
ATOM   1124 C CB  . ILE A 1 149 ? 19.898 16.680  26.039 1.00 16.09  ? 149 ILE A CB  1 
ATOM   1125 C CG1 . ILE A 1 149 ? 21.409 16.907  25.934 1.00 14.92  ? 149 ILE A CG1 1 
ATOM   1126 C CG2 . ILE A 1 149 ? 19.192 16.979  24.716 1.00 17.24  ? 149 ILE A CG2 1 
ATOM   1127 C CD1 . ILE A 1 149 ? 22.053 16.124  24.788 1.00 11.91  ? 149 ILE A CD1 1 
ATOM   1128 N N   . VAL A 1 150 ? 20.875 17.785  28.908 1.00 12.24  ? 150 VAL A N   1 
ATOM   1129 C CA  . VAL A 1 150 ? 21.498 17.463  30.151 1.00 10.70  ? 150 VAL A CA  1 
ATOM   1130 C C   . VAL A 1 150 ? 20.579 17.800  31.314 1.00 17.55  ? 150 VAL A C   1 
ATOM   1131 O O   . VAL A 1 150 ? 20.469 17.057  32.287 1.00 19.82  ? 150 VAL A O   1 
ATOM   1132 C CB  . VAL A 1 150 ? 22.858 18.123  30.268 1.00 13.28  ? 150 VAL A CB  1 
ATOM   1133 C CG1 . VAL A 1 150 ? 23.406 17.889  31.667 1.00 13.32  ? 150 VAL A CG1 1 
ATOM   1134 C CG2 . VAL A 1 150 ? 23.805 17.530  29.227 1.00 12.73  ? 150 VAL A CG2 1 
ATOM   1135 N N   . ALA A 1 151 ? 19.902 18.931  31.190 1.00 15.14  ? 151 ALA A N   1 
ATOM   1136 C CA  . ALA A 1 151 ? 18.985 19.373  32.203 1.00 14.33  ? 151 ALA A CA  1 
ATOM   1137 C C   . ALA A 1 151 ? 17.845 18.411  32.333 1.00 20.71  ? 151 ALA A C   1 
ATOM   1138 O O   . ALA A 1 151 ? 17.364 18.125  33.420 1.00 20.68  ? 151 ALA A O   1 
ATOM   1139 C CB  . ALA A 1 151 ? 18.441 20.751  31.871 1.00 14.42  ? 151 ALA A CB  1 
ATOM   1140 N N   . ALA A 1 152 ? 17.404 17.912  31.206 1.00 18.45  ? 152 ALA A N   1 
ATOM   1141 C CA  . ALA A 1 152 ? 16.300 17.003  31.229 1.00 19.21  ? 152 ALA A CA  1 
ATOM   1142 C C   . ALA A 1 152 ? 16.645 15.609  31.721 1.00 23.30  ? 152 ALA A C   1 
ATOM   1143 O O   . ALA A 1 152 ? 15.799 14.935  32.296 1.00 21.67  ? 152 ALA A O   1 
ATOM   1144 C CB  . ALA A 1 152 ? 15.627 16.943  29.873 1.00 18.89  ? 152 ALA A CB  1 
ATOM   1145 N N   . THR A 1 153 ? 17.876 15.171  31.471 1.00 20.73  ? 153 THR A N   1 
ATOM   1146 C CA  . THR A 1 153 ? 18.285 13.818  31.814 1.00 18.46  ? 153 THR A CA  1 
ATOM   1147 C C   . THR A 1 153 ? 19.318 13.671  32.895 1.00 21.87  ? 153 THR A C   1 
ATOM   1148 O O   . THR A 1 153 ? 19.379 12.635  33.547 1.00 19.24  ? 153 THR A O   1 
ATOM   1149 C CB  . THR A 1 153 ? 18.839 13.121  30.570 1.00 16.18  ? 153 THR A CB  1 
ATOM   1150 O OG1 . THR A 1 153 ? 20.070 13.730  30.206 1.00 7.82   ? 153 THR A OG1 1 
ATOM   1151 C CG2 . THR A 1 153 ? 17.835 13.206  29.438 1.00 16.01  ? 153 THR A CG2 1 
ATOM   1152 N N   . GLY A 1 154 ? 20.176 14.660  33.038 1.00 18.73  ? 154 GLY A N   1 
ATOM   1153 C CA  . GLY A 1 154 ? 21.223 14.547  34.010 1.00 18.11  ? 154 GLY A CA  1 
ATOM   1154 C C   . GLY A 1 154 ? 22.364 13.697  33.457 1.00 20.33  ? 154 GLY A C   1 
ATOM   1155 O O   . GLY A 1 154 ? 23.315 13.389  34.152 1.00 20.26  ? 154 GLY A O   1 
ATOM   1156 N N   . VAL A 1 155 ? 22.258 13.317  32.186 1.00 16.26  ? 155 VAL A N   1 
ATOM   1157 C CA  . VAL A 1 155 ? 23.300 12.531  31.548 1.00 14.14  ? 155 VAL A CA  1 
ATOM   1158 C C   . VAL A 1 155 ? 23.970 13.364  30.471 1.00 16.68  ? 155 VAL A C   1 
ATOM   1159 O O   . VAL A 1 155 ? 23.291 13.896  29.600 1.00 16.16  ? 155 VAL A O   1 
ATOM   1160 C CB  . VAL A 1 155 ? 22.746 11.247  30.939 1.00 16.64  ? 155 VAL A CB  1 
ATOM   1161 C CG1 . VAL A 1 155 ? 23.864 10.432  30.279 1.00 14.63  ? 155 VAL A CG1 1 
ATOM   1162 C CG2 . VAL A 1 155 ? 22.036 10.420  32.007 1.00 16.77  ? 155 VAL A CG2 1 
ATOM   1163 N N   . VAL A 1 156 ? 25.296 13.475  30.545 1.00 13.93  ? 156 VAL A N   1 
ATOM   1164 C CA  . VAL A 1 156 ? 26.081 14.250  29.593 1.00 13.65  ? 156 VAL A CA  1 
ATOM   1165 C C   . VAL A 1 156 ? 26.634 13.399  28.467 1.00 19.37  ? 156 VAL A C   1 
ATOM   1166 O O   . VAL A 1 156 ? 27.243 12.360  28.702 1.00 20.61  ? 156 VAL A O   1 
ATOM   1167 C CB  . VAL A 1 156 ? 27.255 14.933  30.297 1.00 15.47  ? 156 VAL A CB  1 
ATOM   1168 C CG1 . VAL A 1 156 ? 27.856 16.031  29.419 1.00 12.11  ? 156 VAL A CG1 1 
ATOM   1169 C CG2 . VAL A 1 156 ? 26.802 15.509  31.634 1.00 13.50  ? 156 VAL A CG2 1 
ATOM   1170 N N   . PRO A 1 157 ? 26.434 13.866  27.236 1.00 16.22  ? 157 PRO A N   1 
ATOM   1171 C CA  . PRO A 1 157 ? 26.942 13.175  26.082 1.00 15.01  ? 157 PRO A CA  1 
ATOM   1172 C C   . PRO A 1 157 ? 28.450 13.020  26.180 1.00 18.22  ? 157 PRO A C   1 
ATOM   1173 O O   . PRO A 1 157 ? 29.147 13.905  26.665 1.00 15.79  ? 157 PRO A O   1 
ATOM   1174 C CB  . PRO A 1 157 ? 26.626 14.060  24.865 1.00 15.49  ? 157 PRO A CB  1 
ATOM   1175 C CG  . PRO A 1 157 ? 25.935 15.315  25.384 1.00 20.12  ? 157 PRO A CG  1 
ATOM   1176 C CD  . PRO A 1 157 ? 25.681 15.096  26.863 1.00 15.60  ? 157 PRO A CD  1 
ATOM   1177 N N   . ALA A 1 158 ? 28.943 11.885  25.702 1.00 12.88  ? 158 ALA A N   1 
ATOM   1178 C CA  . ALA A 1 158 ? 30.359 11.641  25.716 1.00 11.86  ? 158 ALA A CA  1 
ATOM   1179 C C   . ALA A 1 158 ? 31.016 12.529  24.687 1.00 16.99  ? 158 ALA A C   1 
ATOM   1180 O O   . ALA A 1 158 ? 32.125 13.024  24.871 1.00 19.20  ? 158 ALA A O   1 
ATOM   1181 C CB  . ALA A 1 158 ? 30.664 10.169  25.422 1.00 11.15  ? 158 ALA A CB  1 
ATOM   1182 N N   . VAL A 1 159 ? 30.302 12.754  23.594 1.00 13.14  ? 159 VAL A N   1 
ATOM   1183 C CA  . VAL A 1 159 ? 30.835 13.593  22.553 1.00 13.49  ? 159 VAL A CA  1 
ATOM   1184 C C   . VAL A 1 159 ? 29.784 14.395  21.836 1.00 16.07  ? 159 VAL A C   1 
ATOM   1185 O O   . VAL A 1 159 ? 28.583 14.116  21.898 1.00 13.90  ? 159 VAL A O   1 
ATOM   1186 C CB  . VAL A 1 159 ? 31.604 12.802  21.485 1.00 17.50  ? 159 VAL A CB  1 
ATOM   1187 C CG1 . VAL A 1 159 ? 32.329 11.599  22.084 1.00 16.44  ? 159 VAL A CG1 1 
ATOM   1188 C CG2 . VAL A 1 159 ? 30.669 12.362  20.352 1.00 16.17  ? 159 VAL A CG2 1 
ATOM   1189 N N   . ASN A 1 160 ? 30.293 15.378  21.122 1.00 11.90  ? 160 ASN A N   1 
ATOM   1190 C CA  . ASN A 1 160 ? 29.517 16.207  20.247 1.00 11.41  ? 160 ASN A CA  1 
ATOM   1191 C C   . ASN A 1 160 ? 30.266 16.316  18.932 1.00 15.22  ? 160 ASN A C   1 
ATOM   1192 O O   . ASN A 1 160 ? 31.323 16.938  18.841 1.00 15.08  ? 160 ASN A O   1 
ATOM   1193 C CB  . ASN A 1 160 ? 29.077 17.570  20.804 1.00 6.87   ? 160 ASN A CB  1 
ATOM   1194 C CG  . ASN A 1 160 ? 27.995 18.239  19.954 1.00 12.88  ? 160 ASN A CG  1 
ATOM   1195 O OD1 . ASN A 1 160 ? 27.246 17.588  19.190 1.00 13.58  ? 160 ASN A OD1 1 
ATOM   1196 N ND2 . ASN A 1 160 ? 27.893 19.553  20.110 1.00 18.05  ? 160 ASN A ND2 1 
ATOM   1197 N N   . GLN A 1 161 ? 29.727 15.642  17.925 1.00 9.32   ? 161 GLN A N   1 
ATOM   1198 C CA  . GLN A 1 161 ? 30.315 15.642  16.608 1.00 7.20   ? 161 GLN A CA  1 
ATOM   1199 C C   . GLN A 1 161 ? 29.781 16.817  15.805 1.00 12.26  ? 161 GLN A C   1 
ATOM   1200 O O   . GLN A 1 161 ? 28.603 16.861  15.465 1.00 13.64  ? 161 GLN A O   1 
ATOM   1201 C CB  . GLN A 1 161 ? 30.074 14.301  15.890 1.00 6.77   ? 161 GLN A CB  1 
ATOM   1202 C CG  . GLN A 1 161 ? 30.849 14.244  14.561 1.00 10.63  ? 161 GLN A CG  1 
ATOM   1203 C CD  . GLN A 1 161 ? 30.733 12.923  13.848 1.00 18.76  ? 161 GLN A CD  1 
ATOM   1204 O OE1 . GLN A 1 161 ? 30.334 12.861  12.676 1.00 18.61  ? 161 GLN A OE1 1 
ATOM   1205 N NE2 . GLN A 1 161 ? 31.134 11.854  14.530 1.00 12.64  ? 161 GLN A NE2 1 
ATOM   1206 N N   . ILE A 1 162 ? 30.637 17.788  15.519 1.00 10.82  ? 162 ILE A N   1 
ATOM   1207 C CA  . ILE A 1 162 ? 30.203 18.968  14.792 1.00 10.17  ? 162 ILE A CA  1 
ATOM   1208 C C   . ILE A 1 162 ? 31.170 19.325  13.677 1.00 14.48  ? 162 ILE A C   1 
ATOM   1209 O O   . ILE A 1 162 ? 32.313 18.884  13.667 1.00 14.74  ? 162 ILE A O   1 
ATOM   1210 C CB  . ILE A 1 162 ? 30.146 20.160  15.755 1.00 13.69  ? 162 ILE A CB  1 
ATOM   1211 C CG1 . ILE A 1 162 ? 31.533 20.344  16.362 1.00 14.32  ? 162 ILE A CG1 1 
ATOM   1212 C CG2 . ILE A 1 162 ? 29.135 19.918  16.865 1.00 13.28  ? 162 ILE A CG2 1 
ATOM   1213 C CD1 . ILE A 1 162 ? 31.689 21.642  17.141 1.00 17.08  ? 162 ILE A CD1 1 
ATOM   1214 N N   . GLU A 1 163 ? 30.706 20.162  12.761 1.00 12.69  ? 163 GLU A N   1 
ATOM   1215 C CA  . GLU A 1 163 ? 31.537 20.644  11.684 1.00 12.45  ? 163 GLU A CA  1 
ATOM   1216 C C   . GLU A 1 163 ? 32.639 21.508  12.290 1.00 17.63  ? 163 GLU A C   1 
ATOM   1217 O O   . GLU A 1 163 ? 32.341 22.455  13.022 1.00 17.00  ? 163 GLU A O   1 
ATOM   1218 C CB  . GLU A 1 163 ? 30.686 21.511  10.752 1.00 13.37  ? 163 GLU A CB  1 
ATOM   1219 C CG  . GLU A 1 163 ? 31.466 22.015  9.537  1.00 9.31   ? 163 GLU A CG  1 
ATOM   1220 C CD  . GLU A 1 163 ? 30.678 22.950  8.666  1.00 22.03  ? 163 GLU A CD  1 
ATOM   1221 O OE1 . GLU A 1 163 ? 29.465 22.929  8.572  1.00 26.49  ? 163 GLU A OE1 1 
ATOM   1222 O OE2 . GLU A 1 163 ? 31.449 23.772  8.000  1.00 21.09  ? 163 GLU A OE2 1 
ATOM   1223 N N   . LEU A 1 164 ? 33.905 21.198  11.996 1.00 13.08  ? 164 LEU A N   1 
ATOM   1224 C CA  . LEU A 1 164 ? 35.003 21.975  12.572 1.00 14.06  ? 164 LEU A CA  1 
ATOM   1225 C C   . LEU A 1 164 ? 36.278 21.920  11.731 1.00 13.84  ? 164 LEU A C   1 
ATOM   1226 O O   . LEU A 1 164 ? 36.775 20.853  11.405 1.00 11.93  ? 164 LEU A O   1 
ATOM   1227 C CB  . LEU A 1 164 ? 35.298 21.486  14.016 1.00 13.27  ? 164 LEU A CB  1 
ATOM   1228 C CG  . LEU A 1 164 ? 35.805 22.547  14.997 1.00 17.10  ? 164 LEU A CG  1 
ATOM   1229 C CD1 . LEU A 1 164 ? 35.536 22.074  16.428 1.00 16.99  ? 164 LEU A CD1 1 
ATOM   1230 C CD2 . LEU A 1 164 ? 37.306 22.768  14.821 1.00 15.76  ? 164 LEU A CD2 1 
ATOM   1231 N N   . HIS A 1 165 ? 36.796 23.098  11.410 1.00 11.22  ? 165 HIS A N   1 
ATOM   1232 C CA  . HIS A 1 165 ? 38.010 23.274  10.645 1.00 11.64  ? 165 HIS A CA  1 
ATOM   1233 C C   . HIS A 1 165 ? 38.510 24.682  10.890 1.00 15.37  ? 165 HIS A C   1 
ATOM   1234 O O   . HIS A 1 165 ? 37.833 25.463  11.557 1.00 12.96  ? 165 HIS A O   1 
ATOM   1235 C CB  . HIS A 1 165 ? 37.838 22.956  9.162  1.00 11.16  ? 165 HIS A CB  1 
ATOM   1236 C CG  . HIS A 1 165 ? 36.587 23.546  8.660  1.00 13.80  ? 165 HIS A CG  1 
ATOM   1237 N ND1 . HIS A 1 165 ? 36.536 24.865  8.248  1.00 14.46  ? 165 HIS A ND1 1 
ATOM   1238 C CD2 . HIS A 1 165 ? 35.347 23.008  8.543  1.00 12.74  ? 165 HIS A CD2 1 
ATOM   1239 C CE1 . HIS A 1 165 ? 35.291 25.100  7.878  1.00 12.28  ? 165 HIS A CE1 1 
ATOM   1240 N NE2 . HIS A 1 165 ? 34.554 23.999  8.039  1.00 13.21  ? 165 HIS A NE2 1 
ATOM   1241 N N   . PRO A 1 166 ? 39.687 25.015  10.395 1.00 16.27  ? 166 PRO A N   1 
ATOM   1242 C CA  . PRO A 1 166 ? 40.226 26.324  10.675 1.00 17.51  ? 166 PRO A CA  1 
ATOM   1243 C C   . PRO A 1 166 ? 39.330 27.555  10.454 1.00 19.68  ? 166 PRO A C   1 
ATOM   1244 O O   . PRO A 1 166 ? 39.359 28.494  11.255 1.00 19.66  ? 166 PRO A O   1 
ATOM   1245 C CB  . PRO A 1 166 ? 41.618 26.399  10.047 1.00 19.24  ? 166 PRO A CB  1 
ATOM   1246 C CG  . PRO A 1 166 ? 42.008 24.957  9.737  1.00 21.63  ? 166 PRO A CG  1 
ATOM   1247 C CD  . PRO A 1 166 ? 40.705 24.160  9.713  1.00 17.01  ? 166 PRO A CD  1 
ATOM   1248 N N   . ALA A 1 167 ? 38.528 27.560  9.392  1.00 15.21  ? 167 ALA A N   1 
ATOM   1249 C CA  . ALA A 1 167 ? 37.662 28.707  9.105  1.00 15.29  ? 167 ALA A CA  1 
ATOM   1250 C C   . ALA A 1 167 ? 36.361 28.745  9.894  1.00 23.10  ? 167 ALA A C   1 
ATOM   1251 O O   . ALA A 1 167 ? 35.662 29.762  9.906  1.00 27.40  ? 167 ALA A O   1 
ATOM   1252 C CB  . ALA A 1 167 ? 37.356 28.781  7.616  1.00 15.23  ? 167 ALA A CB  1 
ATOM   1253 N N   . TYR A 1 168 ? 36.022 27.633  10.531 1.00 16.98  ? 168 TYR A N   1 
ATOM   1254 C CA  . TYR A 1 168 ? 34.780 27.537  11.272 1.00 14.63  ? 168 TYR A CA  1 
ATOM   1255 C C   . TYR A 1 168 ? 34.924 26.563  12.445 1.00 16.16  ? 168 TYR A C   1 
ATOM   1256 O O   . TYR A 1 168 ? 34.773 25.346  12.322 1.00 10.91  ? 168 TYR A O   1 
ATOM   1257 C CB  . TYR A 1 168 ? 33.669 27.184  10.268 1.00 15.92  ? 168 TYR A CB  1 
ATOM   1258 C CG  . TYR A 1 168 ? 32.283 27.117  10.826 1.00 12.73  ? 168 TYR A CG  1 
ATOM   1259 C CD1 . TYR A 1 168 ? 31.593 28.246  11.270 1.00 15.30  ? 168 TYR A CD1 1 
ATOM   1260 C CD2 . TYR A 1 168 ? 31.646 25.880  10.864 1.00 13.86  ? 168 TYR A CD2 1 
ATOM   1261 C CE1 . TYR A 1 168 ? 30.298 28.136  11.783 1.00 14.76  ? 168 TYR A CE1 1 
ATOM   1262 C CE2 . TYR A 1 168 ? 30.349 25.751  11.359 1.00 12.79  ? 168 TYR A CE2 1 
ATOM   1263 C CZ  . TYR A 1 168 ? 29.679 26.884  11.820 1.00 18.22  ? 168 TYR A CZ  1 
ATOM   1264 O OH  . TYR A 1 168 ? 28.403 26.762  12.302 1.00 13.15  ? 168 TYR A OH  1 
ATOM   1265 N N   . GLN A 1 169 ? 35.236 27.172  13.593 1.00 15.61  ? 169 GLN A N   1 
ATOM   1266 C CA  . GLN A 1 169 ? 35.554 26.514  14.851 1.00 16.15  ? 169 GLN A CA  1 
ATOM   1267 C C   . GLN A 1 169 ? 34.473 26.266  15.900 1.00 18.87  ? 169 GLN A C   1 
ATOM   1268 O O   . GLN A 1 169 ? 34.735 25.474  16.814 1.00 14.90  ? 169 GLN A O   1 
ATOM   1269 C CB  . GLN A 1 169 ? 36.781 27.189  15.487 1.00 16.43  ? 169 GLN A CB  1 
ATOM   1270 C CG  . GLN A 1 169 ? 38.016 27.099  14.563 1.00 17.65  ? 169 GLN A CG  1 
ATOM   1271 C CD  . GLN A 1 169 ? 39.075 28.136  14.882 1.00 20.79  ? 169 GLN A CD  1 
ATOM   1272 O OE1 . GLN A 1 169 ? 39.231 28.560  16.035 1.00 10.60  ? 169 GLN A OE1 1 
ATOM   1273 N NE2 . GLN A 1 169 ? 39.798 28.566  13.853 1.00 14.23  ? 169 GLN A NE2 1 
ATOM   1274 N N   . GLN A 1 170 ? 33.306 26.936  15.783 1.00 15.57  ? 170 GLN A N   1 
ATOM   1275 C CA  . GLN A 1 170 ? 32.197 26.778  16.731 1.00 13.74  ? 170 GLN A CA  1 
ATOM   1276 C C   . GLN A 1 170 ? 32.684 26.798  18.174 1.00 13.85  ? 170 GLN A C   1 
ATOM   1277 O O   . GLN A 1 170 ? 32.368 25.918  18.967 1.00 11.10  ? 170 GLN A O   1 
ATOM   1278 C CB  . GLN A 1 170 ? 31.391 25.504  16.430 1.00 13.85  ? 170 GLN A CB  1 
ATOM   1279 C CG  . GLN A 1 170 ? 31.095 25.338  14.935 1.00 10.69  ? 170 GLN A CG  1 
ATOM   1280 C CD  . GLN A 1 170 ? 29.901 24.442  14.679 1.00 18.30  ? 170 GLN A CD  1 
ATOM   1281 O OE1 . GLN A 1 170 ? 28.789 24.724  15.130 1.00 19.57  ? 170 GLN A OE1 1 
ATOM   1282 N NE2 . GLN A 1 170 ? 30.129 23.338  13.974 1.00 18.91  ? 170 GLN A NE2 1 
ATOM   1283 N N   . ARG A 1 171 ? 33.513 27.809  18.463 1.00 12.53  ? 171 ARG A N   1 
ATOM   1284 C CA  . ARG A 1 171 ? 34.161 28.010  19.762 1.00 14.08  ? 171 ARG A CA  1 
ATOM   1285 C C   . ARG A 1 171 ? 33.238 27.926  20.991 1.00 19.87  ? 171 ARG A C   1 
ATOM   1286 O O   . ARG A 1 171 ? 33.605 27.349  22.017 1.00 19.06  ? 171 ARG A O   1 
ATOM   1287 C CB  . ARG A 1 171 ? 35.082 29.246  19.778 1.00 12.39  ? 171 ARG A CB  1 
ATOM   1288 C CG  . ARG A 1 171 ? 36.175 29.237  18.686 1.00 22.18  ? 171 ARG A CG  1 
ATOM   1289 C CD  . ARG A 1 171 ? 37.049 30.508  18.660 1.00 16.10  ? 171 ARG A CD  1 
ATOM   1290 N NE  . ARG A 1 171 ? 38.105 30.477  17.637 1.00 30.87  ? 171 ARG A NE  1 
ATOM   1291 C CZ  . ARG A 1 171 ? 39.178 31.273  17.628 1.00 32.72  ? 171 ARG A CZ  1 
ATOM   1292 N NH1 . ARG A 1 171 ? 39.378 32.185  18.568 1.00 21.50  ? 171 ARG A NH1 1 
ATOM   1293 N NH2 . ARG A 1 171 ? 40.072 31.158  16.646 1.00 18.63  ? 171 ARG A NH2 1 
ATOM   1294 N N   . GLU A 1 172 ? 32.041 28.512  20.875 1.00 16.87  ? 172 GLU A N   1 
ATOM   1295 C CA  . GLU A 1 172 ? 31.058 28.495  21.943 1.00 14.28  ? 172 GLU A CA  1 
ATOM   1296 C C   . GLU A 1 172 ? 30.744 27.061  22.336 1.00 16.06  ? 172 GLU A C   1 
ATOM   1297 O O   . GLU A 1 172 ? 30.660 26.737  23.513 1.00 19.37  ? 172 GLU A O   1 
ATOM   1298 C CB  . GLU A 1 172 ? 29.759 29.264  21.564 1.00 14.48  ? 172 GLU A CB  1 
ATOM   1299 C CG  . GLU A 1 172 ? 29.998 30.793  21.445 1.00 20.65  ? 172 GLU A CG  1 
ATOM   1300 C CD  . GLU A 1 172 ? 28.805 31.589  20.971 1.00 34.15  ? 172 GLU A CD  1 
ATOM   1301 O OE1 . GLU A 1 172 ? 27.775 31.088  20.568 1.00 24.47  ? 172 GLU A OE1 1 
ATOM   1302 O OE2 . GLU A 1 172 ? 28.998 32.884  21.052 1.00 48.51  ? 172 GLU A OE2 1 
ATOM   1303 N N   . ILE A 1 173 ? 30.596 26.208  21.326 1.00 14.00  ? 173 ILE A N   1 
ATOM   1304 C CA  . ILE A 1 173 ? 30.308 24.791  21.542 1.00 12.54  ? 173 ILE A CA  1 
ATOM   1305 C C   . ILE A 1 173 ? 31.485 24.079  22.180 1.00 15.12  ? 173 ILE A C   1 
ATOM   1306 O O   . ILE A 1 173 ? 31.346 23.385  23.185 1.00 14.02  ? 173 ILE A O   1 
ATOM   1307 C CB  . ILE A 1 173 ? 29.850 24.101  20.253 1.00 14.10  ? 173 ILE A CB  1 
ATOM   1308 C CG1 . ILE A 1 173 ? 28.612 24.821  19.720 1.00 16.36  ? 173 ILE A CG1 1 
ATOM   1309 C CG2 . ILE A 1 173 ? 29.522 22.622  20.520 1.00 11.88  ? 173 ILE A CG2 1 
ATOM   1310 C CD1 . ILE A 1 173 ? 28.156 24.340  18.342 1.00 14.26  ? 173 ILE A CD1 1 
ATOM   1311 N N   . THR A 1 174 ? 32.658 24.268  21.580 1.00 13.01  ? 174 THR A N   1 
ATOM   1312 C CA  . THR A 1 174 ? 33.872 23.643  22.069 1.00 12.79  ? 174 THR A CA  1 
ATOM   1313 C C   . THR A 1 174 ? 34.210 24.097  23.478 1.00 13.37  ? 174 THR A C   1 
ATOM   1314 O O   . THR A 1 174 ? 34.771 23.337  24.276 1.00 13.39  ? 174 THR A O   1 
ATOM   1315 C CB  . THR A 1 174 ? 35.065 23.766  21.090 1.00 17.84  ? 174 THR A CB  1 
ATOM   1316 O OG1 . THR A 1 174 ? 35.481 25.117  20.960 1.00 18.27  ? 174 THR A OG1 1 
ATOM   1317 C CG2 . THR A 1 174 ? 34.686 23.197  19.724 1.00 14.64  ? 174 THR A CG2 1 
ATOM   1318 N N   . ASP A 1 175 ? 33.847 25.338  23.774 1.00 10.52  ? 175 ASP A N   1 
ATOM   1319 C CA  . ASP A 1 175 ? 34.066 25.906  25.091 1.00 9.82   ? 175 ASP A CA  1 
ATOM   1320 C C   . ASP A 1 175 ? 33.137 25.250  26.088 1.00 15.90  ? 175 ASP A C   1 
ATOM   1321 O O   . ASP A 1 175 ? 33.552 24.791  27.156 1.00 14.96  ? 175 ASP A O   1 
ATOM   1322 C CB  . ASP A 1 175 ? 33.857 27.421  25.083 1.00 11.93  ? 175 ASP A CB  1 
ATOM   1323 C CG  . ASP A 1 175 ? 35.107 28.142  24.714 1.00 22.80  ? 175 ASP A CG  1 
ATOM   1324 O OD1 . ASP A 1 175 ? 36.190 27.603  24.695 1.00 26.00  ? 175 ASP A OD1 1 
ATOM   1325 O OD2 . ASP A 1 175 ? 34.910 29.398  24.407 1.00 22.17  ? 175 ASP A OD2 1 
ATOM   1326 N N   . TRP A 1 176 ? 31.860 25.202  25.712 1.00 13.34  ? 176 TRP A N   1 
ATOM   1327 C CA  . TRP A 1 176 ? 30.842 24.587  26.538 1.00 12.21  ? 176 TRP A CA  1 
ATOM   1328 C C   . TRP A 1 176 ? 31.221 23.141  26.837 1.00 15.25  ? 176 TRP A C   1 
ATOM   1329 O O   . TRP A 1 176 ? 31.117 22.649  27.974 1.00 13.36  ? 176 TRP A O   1 
ATOM   1330 C CB  . TRP A 1 176 ? 29.458 24.655  25.844 1.00 10.71  ? 176 TRP A CB  1 
ATOM   1331 C CG  . TRP A 1 176 ? 28.351 24.215  26.750 1.00 10.20  ? 176 TRP A CG  1 
ATOM   1332 C CD1 . TRP A 1 176 ? 27.576 25.025  27.516 1.00 12.28  ? 176 TRP A CD1 1 
ATOM   1333 C CD2 . TRP A 1 176 ? 27.921 22.873  27.014 1.00 9.20   ? 176 TRP A CD2 1 
ATOM   1334 N NE1 . TRP A 1 176 ? 26.683 24.276  28.242 1.00 11.46  ? 176 TRP A NE1 1 
ATOM   1335 C CE2 . TRP A 1 176 ? 26.868 22.950  27.952 1.00 12.55  ? 176 TRP A CE2 1 
ATOM   1336 C CE3 . TRP A 1 176 ? 28.315 21.622  26.543 1.00 9.62   ? 176 TRP A CE3 1 
ATOM   1337 C CZ2 . TRP A 1 176 ? 26.216 21.805  28.417 1.00 12.40  ? 176 TRP A CZ2 1 
ATOM   1338 C CZ3 . TRP A 1 176 ? 27.677 20.497  27.005 1.00 10.20  ? 176 TRP A CZ3 1 
ATOM   1339 C CH2 . TRP A 1 176 ? 26.634 20.583  27.933 1.00 10.46  ? 176 TRP A CH2 1 
ATOM   1340 N N   . ALA A 1 177 ? 31.700 22.473  25.792 1.00 12.19  ? 177 ALA A N   1 
ATOM   1341 C CA  . ALA A 1 177 ? 32.121 21.081  25.877 1.00 14.61  ? 177 ALA A CA  1 
ATOM   1342 C C   . ALA A 1 177 ? 33.240 20.880  26.896 1.00 18.05  ? 177 ALA A C   1 
ATOM   1343 O O   . ALA A 1 177 ? 33.171 19.974  27.740 1.00 17.39  ? 177 ALA A O   1 
ATOM   1344 C CB  . ALA A 1 177 ? 32.496 20.535  24.495 1.00 14.42  ? 177 ALA A CB  1 
ATOM   1345 N N   . ALA A 1 178 ? 34.263 21.741  26.830 1.00 15.07  ? 178 ALA A N   1 
ATOM   1346 C CA  . ALA A 1 178 ? 35.383 21.653  27.763 1.00 17.95  ? 178 ALA A CA  1 
ATOM   1347 C C   . ALA A 1 178 ? 34.929 21.838  29.209 1.00 19.27  ? 178 ALA A C   1 
ATOM   1348 O O   . ALA A 1 178 ? 35.402 21.149  30.118 1.00 17.48  ? 178 ALA A O   1 
ATOM   1349 C CB  . ALA A 1 178 ? 36.525 22.598  27.386 1.00 18.04  ? 178 ALA A CB  1 
ATOM   1350 N N   . ALA A 1 179 ? 33.980 22.752  29.403 1.00 13.55  ? 179 ALA A N   1 
ATOM   1351 C CA  . ALA A 1 179 ? 33.432 23.024  30.718 1.00 11.60  ? 179 ALA A CA  1 
ATOM   1352 C C   . ALA A 1 179 ? 32.623 21.857  31.255 1.00 14.45  ? 179 ALA A C   1 
ATOM   1353 O O   . ALA A 1 179 ? 32.545 21.651  32.461 1.00 12.03  ? 179 ALA A O   1 
ATOM   1354 C CB  . ALA A 1 179 ? 32.560 24.276  30.680 1.00 12.99  ? 179 ALA A CB  1 
ATOM   1355 N N   . HIS A 1 180 ? 32.019 21.104  30.330 1.00 11.91  ? 180 HIS A N   1 
ATOM   1356 C CA  . HIS A 1 180 ? 31.177 19.956  30.644 1.00 10.82  ? 180 HIS A CA  1 
ATOM   1357 C C   . HIS A 1 180 ? 31.847 18.606  30.409 1.00 16.66  ? 180 HIS A C   1 
ATOM   1358 O O   . HIS A 1 180 ? 31.238 17.549  30.593 1.00 15.13  ? 180 HIS A O   1 
ATOM   1359 C CB  . HIS A 1 180 ? 29.835 20.078  29.919 1.00 10.08  ? 180 HIS A CB  1 
ATOM   1360 C CG  . HIS A 1 180 ? 29.154 21.319  30.378 1.00 13.25  ? 180 HIS A CG  1 
ATOM   1361 N ND1 . HIS A 1 180 ? 29.417 22.555  29.809 1.00 16.72  ? 180 HIS A ND1 1 
ATOM   1362 C CD2 . HIS A 1 180 ? 28.274 21.497  31.397 1.00 15.28  ? 180 HIS A CD2 1 
ATOM   1363 C CE1 . HIS A 1 180 ? 28.663 23.442  30.467 1.00 16.50  ? 180 HIS A CE1 1 
ATOM   1364 N NE2 . HIS A 1 180 ? 27.974 22.838  31.429 1.00 16.06  ? 180 HIS A NE2 1 
ATOM   1365 N N   . ASP A 1 181 ? 33.113 18.664  29.999 1.00 15.00  ? 181 ASP A N   1 
ATOM   1366 C CA  . ASP A 1 181 ? 33.926 17.479  29.770 1.00 15.84  ? 181 ASP A CA  1 
ATOM   1367 C C   . ASP A 1 181 ? 33.469 16.570  28.624 1.00 21.72  ? 181 ASP A C   1 
ATOM   1368 O O   . ASP A 1 181 ? 33.768 15.367  28.587 1.00 20.90  ? 181 ASP A O   1 
ATOM   1369 C CB  . ASP A 1 181 ? 34.192 16.713  31.074 1.00 15.66  ? 181 ASP A CB  1 
ATOM   1370 C CG  . ASP A 1 181 ? 34.790 17.600  32.134 1.00 23.92  ? 181 ASP A CG  1 
ATOM   1371 O OD1 . ASP A 1 181 ? 35.759 18.325  31.937 1.00 24.32  ? 181 ASP A OD1 1 
ATOM   1372 O OD2 . ASP A 1 181 ? 34.157 17.515  33.276 1.00 24.75  ? 181 ASP A OD2 1 
ATOM   1373 N N   . VAL A 1 182 ? 32.760 17.177  27.681 1.00 15.22  ? 182 VAL A N   1 
ATOM   1374 C CA  . VAL A 1 182 ? 32.279 16.501  26.494 1.00 12.98  ? 182 VAL A CA  1 
ATOM   1375 C C   . VAL A 1 182 ? 33.347 16.606  25.423 1.00 16.80  ? 182 VAL A C   1 
ATOM   1376 O O   . VAL A 1 182 ? 33.859 17.701  25.161 1.00 15.01  ? 182 VAL A O   1 
ATOM   1377 C CB  . VAL A 1 182 ? 31.001 17.163  25.981 1.00 15.35  ? 182 VAL A CB  1 
ATOM   1378 C CG1 . VAL A 1 182 ? 30.631 16.598  24.616 1.00 13.55  ? 182 VAL A CG1 1 
ATOM   1379 C CG2 . VAL A 1 182 ? 29.858 16.983  26.974 1.00 14.85  ? 182 VAL A CG2 1 
ATOM   1380 N N   . LYS A 1 183 ? 33.703 15.475  24.816 1.00 13.16  ? 183 LYS A N   1 
ATOM   1381 C CA  . LYS A 1 183 ? 34.710 15.495  23.784 1.00 11.75  ? 183 LYS A CA  1 
ATOM   1382 C C   . LYS A 1 183 ? 34.128 15.949  22.470 1.00 15.88  ? 183 LYS A C   1 
ATOM   1383 O O   . LYS A 1 183 ? 32.949 15.748  22.184 1.00 14.28  ? 183 LYS A O   1 
ATOM   1384 C CB  . LYS A 1 183 ? 35.470 14.194  23.633 1.00 11.01  ? 183 LYS A CB  1 
ATOM   1385 C CG  . LYS A 1 183 ? 36.227 13.797  24.886 1.00 17.89  ? 183 LYS A CG  1 
ATOM   1386 C CD  . LYS A 1 183 ? 37.355 14.757  25.259 1.00 17.08  ? 183 LYS A CD  1 
ATOM   1387 C CE  . LYS A 1 183 ? 38.377 14.100  26.175 1.00 17.27  ? 183 LYS A CE  1 
ATOM   1388 N NZ  . LYS A 1 183 ? 39.405 15.023  26.663 1.00 16.06  ? 183 LYS A NZ  1 
ATOM   1389 N N   . ILE A 1 184 ? 34.989 16.575  21.686 1.00 14.91  ? 184 ILE A N   1 
ATOM   1390 C CA  . ILE A 1 184 ? 34.633 17.100  20.383 1.00 14.98  ? 184 ILE A CA  1 
ATOM   1391 C C   . ILE A 1 184 ? 35.173 16.272  19.219 1.00 16.73  ? 184 ILE A C   1 
ATOM   1392 O O   . ILE A 1 184 ? 36.380 16.057  19.088 1.00 16.31  ? 184 ILE A O   1 
ATOM   1393 C CB  . ILE A 1 184 ? 35.142 18.533  20.219 1.00 17.20  ? 184 ILE A CB  1 
ATOM   1394 C CG1 . ILE A 1 184 ? 34.384 19.510  21.115 1.00 15.78  ? 184 ILE A CG1 1 
ATOM   1395 C CG2 . ILE A 1 184 ? 35.052 18.952  18.758 1.00 16.34  ? 184 ILE A CG2 1 
ATOM   1396 C CD1 . ILE A 1 184 ? 32.885 19.551  20.847 1.00 11.68  ? 184 ILE A CD1 1 
ATOM   1397 N N   . GLU A 1 185 ? 34.243 15.842  18.359 1.00 12.54  ? 185 GLU A N   1 
ATOM   1398 C CA  . GLU A 1 185 ? 34.541 15.097  17.138 1.00 12.31  ? 185 GLU A CA  1 
ATOM   1399 C C   . GLU A 1 185 ? 34.390 16.066  15.974 1.00 17.50  ? 185 GLU A C   1 
ATOM   1400 O O   . GLU A 1 185 ? 33.299 16.573  15.698 1.00 15.65  ? 185 GLU A O   1 
ATOM   1401 C CB  . GLU A 1 185 ? 33.623 13.879  16.928 1.00 11.86  ? 185 GLU A CB  1 
ATOM   1402 C CG  . GLU A 1 185 ? 33.995 12.641  17.766 1.00 10.77  ? 185 GLU A CG  1 
ATOM   1403 C CD  . GLU A 1 185 ? 33.215 11.424  17.343 1.00 29.08  ? 185 GLU A CD  1 
ATOM   1404 O OE1 . GLU A 1 185 ? 32.014 11.444  17.135 1.00 15.68  ? 185 GLU A OE1 1 
ATOM   1405 O OE2 . GLU A 1 185 ? 33.977 10.367  17.167 1.00 18.87  ? 185 GLU A OE2 1 
ATOM   1406 N N   . SER A 1 186 ? 35.502 16.353  15.327 1.00 12.33  ? 186 SER A N   1 
ATOM   1407 C CA  . SER A 1 186 ? 35.501 17.288  14.232 1.00 13.09  ? 186 SER A CA  1 
ATOM   1408 C C   . SER A 1 186 ? 35.100 16.676  12.911 1.00 16.89  ? 186 SER A C   1 
ATOM   1409 O O   . SER A 1 186 ? 35.857 15.926  12.302 1.00 18.98  ? 186 SER A O   1 
ATOM   1410 C CB  . SER A 1 186 ? 36.850 17.986  14.082 1.00 13.17  ? 186 SER A CB  1 
ATOM   1411 O OG  . SER A 1 186 ? 37.229 18.597  15.297 1.00 16.15  ? 186 SER A OG  1 
ATOM   1412 N N   . TRP A 1 187 ? 33.918 17.017  12.439 1.00 15.74  ? 187 TRP A N   1 
ATOM   1413 C CA  . TRP A 1 187 ? 33.536 16.535  11.147 1.00 18.42  ? 187 TRP A CA  1 
ATOM   1414 C C   . TRP A 1 187 ? 33.906 17.558  10.085 1.00 21.81  ? 187 TRP A C   1 
ATOM   1415 O O   . TRP A 1 187 ? 33.905 18.756  10.357 1.00 17.84  ? 187 TRP A O   1 
ATOM   1416 C CB  . TRP A 1 187 ? 32.165 15.864  11.021 1.00 19.30  ? 187 TRP A CB  1 
ATOM   1417 C CG  . TRP A 1 187 ? 30.955 16.730  11.081 1.00 21.57  ? 187 TRP A CG  1 
ATOM   1418 C CD1 . TRP A 1 187 ? 30.099 16.792  12.130 1.00 24.76  ? 187 TRP A CD1 1 
ATOM   1419 C CD2 . TRP A 1 187 ? 30.350 17.513  10.019 1.00 23.79  ? 187 TRP A CD2 1 
ATOM   1420 N NE1 . TRP A 1 187 ? 29.033 17.598  11.840 1.00 25.34  ? 187 TRP A NE1 1 
ATOM   1421 C CE2 . TRP A 1 187 ? 29.153 18.060  10.553 1.00 27.97  ? 187 TRP A CE2 1 
ATOM   1422 C CE3 . TRP A 1 187 ? 30.718 17.839  8.706  1.00 25.84  ? 187 TRP A CE3 1 
ATOM   1423 C CZ2 . TRP A 1 187 ? 28.329 18.910  9.805  1.00 27.80  ? 187 TRP A CZ2 1 
ATOM   1424 C CZ3 . TRP A 1 187 ? 29.902 18.680  7.971  1.00 29.10  ? 187 TRP A CZ3 1 
ATOM   1425 C CH2 . TRP A 1 187 ? 28.717 19.209  8.515  1.00 29.58  ? 187 TRP A CH2 1 
ATOM   1426 N N   . GLY A 1 188 ? 34.262 17.085  8.894  1.00 18.46  ? 188 GLY A N   1 
ATOM   1427 C CA  . GLY A 1 188 ? 34.732 17.971  7.850  1.00 16.43  ? 188 GLY A CA  1 
ATOM   1428 C C   . GLY A 1 188 ? 36.012 18.671  8.334  1.00 16.80  ? 188 GLY A C   1 
ATOM   1429 O O   . GLY A 1 188 ? 36.204 19.856  8.084  1.00 17.31  ? 188 GLY A O   1 
ATOM   1430 N N   . PRO A 1 189 ? 36.886 17.929  9.059  1.00 13.21  ? 189 PRO A N   1 
ATOM   1431 C CA  . PRO A 1 189 ? 38.126 18.484  9.630  1.00 13.48  ? 189 PRO A CA  1 
ATOM   1432 C C   . PRO A 1 189 ? 38.987 19.270  8.628  1.00 16.73  ? 189 PRO A C   1 
ATOM   1433 O O   . PRO A 1 189 ? 39.727 20.185  8.988  1.00 14.35  ? 189 PRO A O   1 
ATOM   1434 C CB  . PRO A 1 189 ? 38.942 17.273  10.102 1.00 14.53  ? 189 PRO A CB  1 
ATOM   1435 C CG  . PRO A 1 189 ? 38.373 16.060  9.393  1.00 16.52  ? 189 PRO A CG  1 
ATOM   1436 C CD  . PRO A 1 189 ? 36.978 16.439  8.949  1.00 11.46  ? 189 PRO A CD  1 
ATOM   1437 N N   . LEU A 1 190 ? 38.895 18.868  7.365  1.00 14.57  ? 190 LEU A N   1 
ATOM   1438 C CA  . LEU A 1 190 ? 39.646 19.465  6.278  1.00 14.47  ? 190 LEU A CA  1 
ATOM   1439 C C   . LEU A 1 190 ? 38.803 20.352  5.352  1.00 22.18  ? 190 LEU A C   1 
ATOM   1440 O O   . LEU A 1 190 ? 39.196 20.604  4.209  1.00 22.48  ? 190 LEU A O   1 
ATOM   1441 C CB  . LEU A 1 190 ? 40.324 18.364  5.425  1.00 14.18  ? 190 LEU A CB  1 
ATOM   1442 C CG  . LEU A 1 190 ? 41.304 17.467  6.178  1.00 21.96  ? 190 LEU A CG  1 
ATOM   1443 C CD1 . LEU A 1 190 ? 41.627 16.232  5.333  1.00 23.36  ? 190 LEU A CD1 1 
ATOM   1444 C CD2 . LEU A 1 190 ? 42.594 18.231  6.494  1.00 21.29  ? 190 LEU A CD2 1 
ATOM   1445 N N   . GLY A 1 191 ? 37.637 20.806  5.806  1.00 17.52  ? 191 GLY A N   1 
ATOM   1446 C CA  . GLY A 1 191 ? 36.787 21.659  4.964  1.00 17.83  ? 191 GLY A CA  1 
ATOM   1447 C C   . GLY A 1 191 ? 36.050 20.940  3.802  1.00 22.69  ? 191 GLY A C   1 
ATOM   1448 O O   . GLY A 1 191 ? 35.356 21.595  3.015  1.00 21.15  ? 191 GLY A O   1 
ATOM   1449 N N   . GLN A 1 192 ? 36.185 19.611  3.683  1.00 16.86  ? 192 GLN A N   1 
ATOM   1450 C CA  . GLN A 1 192 ? 35.491 18.891  2.617  1.00 16.82  ? 192 GLN A CA  1 
ATOM   1451 C C   . GLN A 1 192 ? 35.848 19.400  1.238  1.00 24.98  ? 192 GLN A C   1 
ATOM   1452 O O   . GLN A 1 192 ? 35.091 19.224  0.280  1.00 27.89  ? 192 GLN A O   1 
ATOM   1453 C CB  . GLN A 1 192 ? 33.979 19.017  2.785  1.00 16.09  ? 192 GLN A CB  1 
ATOM   1454 C CG  . GLN A 1 192 ? 33.472 18.332  4.050  1.00 37.22  ? 192 GLN A CG  1 
ATOM   1455 C CD  . GLN A 1 192 ? 32.090 18.806  4.426  1.00 80.79  ? 192 GLN A CD  1 
ATOM   1456 O OE1 . GLN A 1 192 ? 31.750 19.984  4.247  1.00 77.88  ? 192 GLN A OE1 1 
ATOM   1457 N NE2 . GLN A 1 192 ? 31.280 17.884  4.937  1.00 84.39  ? 192 GLN A NE2 1 
ATOM   1458 N N   . GLY A 1 193 ? 36.994 20.054  1.158  1.00 22.67  ? 193 GLY A N   1 
ATOM   1459 C CA  . GLY A 1 193 ? 37.488 20.613  -0.082 1.00 23.94  ? 193 GLY A CA  1 
ATOM   1460 C C   . GLY A 1 193 ? 36.680 21.821  -0.534 1.00 29.12  ? 193 GLY A C   1 
ATOM   1461 O O   . GLY A 1 193 ? 36.836 22.319  -1.647 1.00 30.05  ? 193 GLY A O   1 
ATOM   1462 N N   . LYS A 1 194 ? 35.817 22.295  0.333  1.00 19.79  ? 194 LYS A N   1 
ATOM   1463 C CA  . LYS A 1 194 ? 34.995 23.410  -0.026 1.00 17.75  ? 194 LYS A CA  1 
ATOM   1464 C C   . LYS A 1 194 ? 35.693 24.747  -0.113 1.00 22.61  ? 194 LYS A C   1 
ATOM   1465 O O   . LYS A 1 194 ? 35.148 25.708  -0.652 1.00 26.10  ? 194 LYS A O   1 
ATOM   1466 C CB  . LYS A 1 194 ? 33.689 23.405  0.705  1.00 16.13  ? 194 LYS A CB  1 
ATOM   1467 C CG  . LYS A 1 194 ? 33.069 22.025  0.621  1.00 18.67  ? 194 LYS A CG  1 
ATOM   1468 C CD  . LYS A 1 194 ? 31.593 22.065  0.914  1.00 23.92  ? 194 LYS A CD  1 
ATOM   1469 C CE  . LYS A 1 194 ? 30.866 20.785  0.557  1.00 30.84  ? 194 LYS A CE  1 
ATOM   1470 N NZ  . LYS A 1 194 ? 29.751 20.510  1.478  1.00 47.88  ? 194 LYS A NZ  1 
ATOM   1471 N N   . TYR A 1 195 ? 36.913 24.808  0.374  1.00 18.01  ? 195 TYR A N   1 
ATOM   1472 C CA  . TYR A 1 195 ? 37.667 26.037  0.280  1.00 16.45  ? 195 TYR A CA  1 
ATOM   1473 C C   . TYR A 1 195 ? 39.152 25.778  0.296  1.00 25.55  ? 195 TYR A C   1 
ATOM   1474 O O   . TYR A 1 195 ? 39.594 24.668  0.588  1.00 22.97  ? 195 TYR A O   1 
ATOM   1475 C CB  . TYR A 1 195 ? 37.262 27.098  1.299  1.00 16.84  ? 195 TYR A CB  1 
ATOM   1476 C CG  . TYR A 1 195 ? 37.635 26.698  2.690  1.00 19.49  ? 195 TYR A CG  1 
ATOM   1477 C CD1 . TYR A 1 195 ? 36.821 25.830  3.414  1.00 22.23  ? 195 TYR A CD1 1 
ATOM   1478 C CD2 . TYR A 1 195 ? 38.807 27.166  3.283  1.00 21.82  ? 195 TYR A CD2 1 
ATOM   1479 C CE1 . TYR A 1 195 ? 37.149 25.458  4.718  1.00 20.73  ? 195 TYR A CE1 1 
ATOM   1480 C CE2 . TYR A 1 195 ? 39.151 26.807  4.586  1.00 22.67  ? 195 TYR A CE2 1 
ATOM   1481 C CZ  . TYR A 1 195 ? 38.318 25.947  5.303  1.00 29.67  ? 195 TYR A CZ  1 
ATOM   1482 O OH  . TYR A 1 195 ? 38.644 25.588  6.589  1.00 23.33  ? 195 TYR A OH  1 
ATOM   1483 N N   . ASP A 1 196 ? 39.915 26.812  -0.042 1.00 26.77  ? 196 ASP A N   1 
ATOM   1484 C CA  . ASP A 1 196 ? 41.350 26.691  -0.082 1.00 29.77  ? 196 ASP A CA  1 
ATOM   1485 C C   . ASP A 1 196 ? 41.944 26.719  1.296  1.00 29.80  ? 196 ASP A C   1 
ATOM   1486 O O   . ASP A 1 196 ? 42.465 27.739  1.746  1.00 31.78  ? 196 ASP A O   1 
ATOM   1487 C CB  . ASP A 1 196 ? 42.014 27.746  -0.985 1.00 32.97  ? 196 ASP A CB  1 
ATOM   1488 C CG  . ASP A 1 196 ? 43.477 27.464  -1.182 1.00 45.73  ? 196 ASP A CG  1 
ATOM   1489 O OD1 . ASP A 1 196 ? 43.923 26.345  -1.388 1.00 44.41  ? 196 ASP A OD1 1 
ATOM   1490 O OD2 . ASP A 1 196 ? 44.218 28.535  -1.055 1.00 53.08  ? 196 ASP A OD2 1 
ATOM   1491 N N   . LEU A 1 197 ? 41.849 25.593  1.961  1.00 20.16  ? 197 LEU A N   1 
ATOM   1492 C CA  . LEU A 1 197 ? 42.376 25.473  3.288  1.00 18.62  ? 197 LEU A CA  1 
ATOM   1493 C C   . LEU A 1 197 ? 43.875 25.186  3.234  1.00 18.92  ? 197 LEU A C   1 
ATOM   1494 O O   . LEU A 1 197 ? 44.670 25.775  3.966  1.00 15.86  ? 197 LEU A O   1 
ATOM   1495 C CB  . LEU A 1 197 ? 41.583 24.402  4.089  1.00 18.87  ? 197 LEU A CB  1 
ATOM   1496 C CG  . LEU A 1 197 ? 42.215 24.008  5.424  1.00 19.38  ? 197 LEU A CG  1 
ATOM   1497 C CD1 . LEU A 1 197 ? 42.288 25.220  6.349  1.00 17.69  ? 197 LEU A CD1 1 
ATOM   1498 C CD2 . LEU A 1 197 ? 41.403 22.890  6.078  1.00 18.37  ? 197 LEU A CD2 1 
ATOM   1499 N N   . PHE A 1 198 ? 44.247 24.282  2.330  1.00 15.67  ? 198 PHE A N   1 
ATOM   1500 C CA  . PHE A 1 198 ? 45.627 23.877  2.148  1.00 14.33  ? 198 PHE A CA  1 
ATOM   1501 C C   . PHE A 1 198 ? 46.524 24.999  1.654  1.00 22.25  ? 198 PHE A C   1 
ATOM   1502 O O   . PHE A 1 198 ? 47.753 24.892  1.670  1.00 18.86  ? 198 PHE A O   1 
ATOM   1503 C CB  . PHE A 1 198 ? 45.742 22.638  1.239  1.00 15.61  ? 198 PHE A CB  1 
ATOM   1504 C CG  . PHE A 1 198 ? 45.026 21.440  1.809  1.00 17.06  ? 198 PHE A CG  1 
ATOM   1505 C CD1 . PHE A 1 198 ? 44.810 21.342  3.184  1.00 19.43  ? 198 PHE A CD1 1 
ATOM   1506 C CD2 . PHE A 1 198 ? 44.561 20.416  0.981  1.00 21.17  ? 198 PHE A CD2 1 
ATOM   1507 C CE1 . PHE A 1 198 ? 44.150 20.238  3.726  1.00 22.05  ? 198 PHE A CE1 1 
ATOM   1508 C CE2 . PHE A 1 198 ? 43.905 19.301  1.502  1.00 24.22  ? 198 PHE A CE2 1 
ATOM   1509 C CZ  . PHE A 1 198 ? 43.697 19.222  2.880  1.00 22.42  ? 198 PHE A CZ  1 
ATOM   1510 N N   . GLY A 1 199 ? 45.893 26.072  1.197  1.00 24.56  ? 199 GLY A N   1 
ATOM   1511 C CA  . GLY A 1 199 ? 46.602 27.227  0.682  1.00 23.71  ? 199 GLY A CA  1 
ATOM   1512 C C   . GLY A 1 199 ? 46.827 28.264  1.757  1.00 26.23  ? 199 GLY A C   1 
ATOM   1513 O O   . GLY A 1 199 ? 47.616 29.191  1.584  1.00 27.23  ? 199 GLY A O   1 
ATOM   1514 N N   . ALA A 1 200 ? 46.111 28.090  2.868  1.00 21.85  ? 200 ALA A N   1 
ATOM   1515 C CA  . ALA A 1 200 ? 46.226 28.984  4.001  1.00 23.09  ? 200 ALA A CA  1 
ATOM   1516 C C   . ALA A 1 200 ? 47.682 29.041  4.413  1.00 23.93  ? 200 ALA A C   1 
ATOM   1517 O O   . ALA A 1 200 ? 48.351 28.013  4.501  1.00 21.74  ? 200 ALA A O   1 
ATOM   1518 C CB  . ALA A 1 200 ? 45.331 28.528  5.145  1.00 24.19  ? 200 ALA A CB  1 
ATOM   1519 N N   . GLU A 1 201 ? 48.176 30.245  4.639  1.00 18.45  ? 201 GLU A N   1 
ATOM   1520 C CA  . GLU A 1 201 ? 49.563 30.430  5.010  1.00 18.91  ? 201 GLU A CA  1 
ATOM   1521 C C   . GLU A 1 201 ? 49.965 29.850  6.351  1.00 22.99  ? 201 GLU A C   1 
ATOM   1522 O O   . GLU A 1 201 ? 51.063 29.335  6.517  1.00 20.87  ? 201 GLU A O   1 
ATOM   1523 C CB  . GLU A 1 201 ? 50.032 31.885  4.837  1.00 20.76  ? 201 GLU A CB  1 
ATOM   1524 C CG  . GLU A 1 201 ? 51.561 32.031  4.902  1.00 29.97  ? 201 GLU A CG  1 
ATOM   1525 C CD  . GLU A 1 201 ? 52.069 32.149  6.306  1.00 53.92  ? 201 GLU A CD  1 
ATOM   1526 O OE1 . GLU A 1 201 ? 51.382 32.538  7.234  1.00 44.20  ? 201 GLU A OE1 1 
ATOM   1527 O OE2 . GLU A 1 201 ? 53.328 31.800  6.415  1.00 57.04  ? 201 GLU A OE2 1 
ATOM   1528 N N   . PRO A 1 202 ? 49.071 29.940  7.319  1.00 21.19  ? 202 PRO A N   1 
ATOM   1529 C CA  . PRO A 1 202 ? 49.358 29.400  8.623  1.00 19.63  ? 202 PRO A CA  1 
ATOM   1530 C C   . PRO A 1 202 ? 49.527 27.908  8.515  1.00 19.82  ? 202 PRO A C   1 
ATOM   1531 O O   . PRO A 1 202 ? 50.307 27.278  9.229  1.00 18.90  ? 202 PRO A O   1 
ATOM   1532 C CB  . PRO A 1 202 ? 48.156 29.756  9.486  1.00 20.60  ? 202 PRO A CB  1 
ATOM   1533 C CG  . PRO A 1 202 ? 47.463 30.918  8.791  1.00 25.33  ? 202 PRO A CG  1 
ATOM   1534 C CD  . PRO A 1 202 ? 47.950 30.913  7.364  1.00 20.41  ? 202 PRO A CD  1 
ATOM   1535 N N   . VAL A 1 203 ? 48.781 27.362  7.583  1.00 15.62  ? 203 VAL A N   1 
ATOM   1536 C CA  . VAL A 1 203 ? 48.806 25.954  7.312  1.00 13.83  ? 203 VAL A CA  1 
ATOM   1537 C C   . VAL A 1 203 ? 50.108 25.537  6.635  1.00 19.72  ? 203 VAL A C   1 
ATOM   1538 O O   . VAL A 1 203 ? 50.759 24.576  7.040  1.00 20.96  ? 203 VAL A O   1 
ATOM   1539 C CB  . VAL A 1 203 ? 47.609 25.573  6.454  1.00 16.35  ? 203 VAL A CB  1 
ATOM   1540 C CG1 . VAL A 1 203 ? 47.551 24.067  6.251  1.00 14.68  ? 203 VAL A CG1 1 
ATOM   1541 C CG2 . VAL A 1 203 ? 46.318 26.062  7.103  1.00 15.59  ? 203 VAL A CG2 1 
ATOM   1542 N N   . THR A 1 204 ? 50.483 26.257  5.587  1.00 18.06  ? 204 THR A N   1 
ATOM   1543 C CA  . THR A 1 204 ? 51.702 25.931  4.866  1.00 18.90  ? 204 THR A CA  1 
ATOM   1544 C C   . THR A 1 204 ? 52.939 26.120  5.721  1.00 24.19  ? 204 THR A C   1 
ATOM   1545 O O   . THR A 1 204 ? 53.892 25.346  5.655  1.00 24.44  ? 204 THR A O   1 
ATOM   1546 C CB  . THR A 1 204 ? 51.804 26.734  3.564  1.00 24.08  ? 204 THR A CB  1 
ATOM   1547 O OG1 . THR A 1 204 ? 51.605 28.108  3.834  1.00 20.97  ? 204 THR A OG1 1 
ATOM   1548 C CG2 . THR A 1 204 ? 50.753 26.231  2.575  1.00 17.08  ? 204 THR A CG2 1 
ATOM   1549 N N   . ALA A 1 205 ? 52.912 27.169  6.535  1.00 23.40  ? 205 ALA A N   1 
ATOM   1550 C CA  . ALA A 1 205 ? 54.028 27.474  7.411  1.00 22.70  ? 205 ALA A CA  1 
ATOM   1551 C C   . ALA A 1 205 ? 54.290 26.369  8.433  1.00 24.58  ? 205 ALA A C   1 
ATOM   1552 O O   . ALA A 1 205 ? 55.436 25.999  8.696  1.00 24.17  ? 205 ALA A O   1 
ATOM   1553 C CB  . ALA A 1 205 ? 53.868 28.841  8.054  1.00 22.88  ? 205 ALA A CB  1 
ATOM   1554 N N   . ALA A 1 206 ? 53.216 25.827  8.994  1.00 20.62  ? 206 ALA A N   1 
ATOM   1555 C CA  . ALA A 1 206 ? 53.322 24.756  9.974  1.00 21.16  ? 206 ALA A CA  1 
ATOM   1556 C C   . ALA A 1 206 ? 53.769 23.431  9.354  1.00 23.11  ? 206 ALA A C   1 
ATOM   1557 O O   . ALA A 1 206 ? 54.588 22.701  9.924  1.00 24.24  ? 206 ALA A O   1 
ATOM   1558 C CB  . ALA A 1 206 ? 52.006 24.582  10.720 1.00 22.01  ? 206 ALA A CB  1 
ATOM   1559 N N   . ALA A 1 207 ? 53.207 23.119  8.184  1.00 17.50  ? 207 ALA A N   1 
ATOM   1560 C CA  . ALA A 1 207 ? 53.526 21.886  7.467  1.00 16.88  ? 207 ALA A CA  1 
ATOM   1561 C C   . ALA A 1 207 ? 54.975 21.862  7.035  1.00 17.63  ? 207 ALA A C   1 
ATOM   1562 O O   . ALA A 1 207 ? 55.699 20.891  7.258  1.00 18.18  ? 207 ALA A O   1 
ATOM   1563 C CB  . ALA A 1 207 ? 52.599 21.700  6.278  1.00 17.04  ? 207 ALA A CB  1 
ATOM   1564 N N   . ALA A 1 208 ? 55.383 22.962  6.426  1.00 15.23  ? 208 ALA A N   1 
ATOM   1565 C CA  . ALA A 1 208 ? 56.742 23.116  5.963  1.00 16.55  ? 208 ALA A CA  1 
ATOM   1566 C C   . ALA A 1 208 ? 57.683 23.075  7.145  1.00 24.66  ? 208 ALA A C   1 
ATOM   1567 O O   . ALA A 1 208 ? 58.760 22.494  7.085  1.00 26.03  ? 208 ALA A O   1 
ATOM   1568 C CB  . ALA A 1 208 ? 56.903 24.428  5.219  1.00 16.17  ? 208 ALA A CB  1 
ATOM   1569 N N   . ALA A 1 209 ? 57.249 23.703  8.233  1.00 20.64  ? 209 ALA A N   1 
ATOM   1570 C CA  . ALA A 1 209 ? 58.029 23.766  9.442  1.00 19.90  ? 209 ALA A CA  1 
ATOM   1571 C C   . ALA A 1 209 ? 58.269 22.404  10.059 1.00 26.29  ? 209 ALA A C   1 
ATOM   1572 O O   . ALA A 1 209 ? 59.075 22.272  10.983 1.00 29.39  ? 209 ALA A O   1 
ATOM   1573 C CB  . ALA A 1 209 ? 57.382 24.693  10.459 1.00 20.69  ? 209 ALA A CB  1 
ATOM   1574 N N   . HIS A 1 210 ? 57.566 21.390  9.560  1.00 19.46  ? 210 HIS A N   1 
ATOM   1575 C CA  . HIS A 1 210 ? 57.704 20.061  10.115 1.00 16.68  ? 210 HIS A CA  1 
ATOM   1576 C C   . HIS A 1 210 ? 57.951 18.977  9.086  1.00 21.69  ? 210 HIS A C   1 
ATOM   1577 O O   . HIS A 1 210 ? 58.072 17.806  9.426  1.00 23.24  ? 210 HIS A O   1 
ATOM   1578 C CB  . HIS A 1 210 ? 56.489 19.724  11.004 1.00 17.45  ? 210 HIS A CB  1 
ATOM   1579 C CG  . HIS A 1 210 ? 56.505 20.508  12.283 1.00 18.98  ? 210 HIS A CG  1 
ATOM   1580 N ND1 . HIS A 1 210 ? 55.913 21.762  12.391 1.00 20.98  ? 210 HIS A ND1 1 
ATOM   1581 C CD2 . HIS A 1 210 ? 57.073 20.206  13.479 1.00 19.34  ? 210 HIS A CD2 1 
ATOM   1582 C CE1 . HIS A 1 210 ? 56.124 22.186  13.637 1.00 18.84  ? 210 HIS A CE1 1 
ATOM   1583 N NE2 . HIS A 1 210 ? 56.819 21.270  14.313 1.00 19.80  ? 210 HIS A NE2 1 
ATOM   1584 N N   . GLY A 1 211 ? 58.032 19.362  7.820  1.00 19.01  ? 211 GLY A N   1 
ATOM   1585 C CA  . GLY A 1 211 ? 58.253 18.385  6.778  1.00 17.15  ? 211 GLY A CA  1 
ATOM   1586 C C   . GLY A 1 211 ? 57.008 17.526  6.605  1.00 18.45  ? 211 GLY A C   1 
ATOM   1587 O O   . GLY A 1 211 ? 57.080 16.315  6.376  1.00 16.26  ? 211 GLY A O   1 
ATOM   1588 N N   . LYS A 1 212 ? 55.860 18.181  6.720  1.00 13.21  ? 212 LYS A N   1 
ATOM   1589 C CA  . LYS A 1 212 ? 54.586 17.520  6.595  1.00 12.92  ? 212 LYS A CA  1 
ATOM   1590 C C   . LYS A 1 212 ? 53.722 18.217  5.570  1.00 19.25  ? 212 LYS A C   1 
ATOM   1591 O O   . LYS A 1 212 ? 54.044 19.302  5.113  1.00 20.22  ? 212 LYS A O   1 
ATOM   1592 C CB  . LYS A 1 212 ? 53.862 17.482  7.943  1.00 13.07  ? 212 LYS A CB  1 
ATOM   1593 C CG  . LYS A 1 212 ? 54.622 16.731  9.037  1.00 16.34  ? 212 LYS A CG  1 
ATOM   1594 C CD  . LYS A 1 212 ? 54.457 15.213  8.954  1.00 15.39  ? 212 LYS A CD  1 
ATOM   1595 C CE  . LYS A 1 212 ? 54.965 14.469  10.184 1.00 31.20  ? 212 LYS A CE  1 
ATOM   1596 N NZ  . LYS A 1 212 ? 54.502 13.065  10.255 1.00 34.71  ? 212 LYS A NZ  1 
ATOM   1597 N N   . THR A 1 213 ? 52.609 17.588  5.213  1.00 20.54  ? 213 THR A N   1 
ATOM   1598 C CA  . THR A 1 213 ? 51.694 18.190  4.278  1.00 18.60  ? 213 THR A CA  1 
ATOM   1599 C C   . THR A 1 213 ? 50.748 19.079  5.029  1.00 18.96  ? 213 THR A C   1 
ATOM   1600 O O   . THR A 1 213 ? 50.619 18.990  6.252  1.00 16.68  ? 213 THR A O   1 
ATOM   1601 C CB  . THR A 1 213 ? 50.877 17.153  3.489  1.00 22.15  ? 213 THR A CB  1 
ATOM   1602 O OG1 . THR A 1 213 ? 50.006 16.467  4.362  1.00 19.24  ? 213 THR A OG1 1 
ATOM   1603 C CG2 . THR A 1 213 ? 51.809 16.165  2.804  1.00 15.03  ? 213 THR A CG2 1 
ATOM   1604 N N   . PRO A 1 214 ? 50.068 19.923  4.286  1.00 17.31  ? 214 PRO A N   1 
ATOM   1605 C CA  . PRO A 1 214 ? 49.102 20.810  4.867  1.00 16.62  ? 214 PRO A CA  1 
ATOM   1606 C C   . PRO A 1 214 ? 48.008 20.022  5.563  1.00 19.57  ? 214 PRO A C   1 
ATOM   1607 O O   . PRO A 1 214 ? 47.683 20.316  6.708  1.00 18.58  ? 214 PRO A O   1 
ATOM   1608 C CB  . PRO A 1 214 ? 48.561 21.672  3.732  1.00 18.32  ? 214 PRO A CB  1 
ATOM   1609 C CG  . PRO A 1 214 ? 49.559 21.532  2.590  1.00 22.69  ? 214 PRO A CG  1 
ATOM   1610 C CD  . PRO A 1 214 ? 50.432 20.328  2.910  1.00 17.89  ? 214 PRO A CD  1 
ATOM   1611 N N   . ALA A 1 215 ? 47.485 18.992  4.872  1.00 17.20  ? 215 ALA A N   1 
ATOM   1612 C CA  . ALA A 1 215 ? 46.456 18.126  5.433  1.00 18.27  ? 215 ALA A CA  1 
ATOM   1613 C C   . ALA A 1 215 ? 46.890 17.630  6.801  1.00 22.51  ? 215 ALA A C   1 
ATOM   1614 O O   . ALA A 1 215 ? 46.153 17.699  7.788  1.00 20.39  ? 215 ALA A O   1 
ATOM   1615 C CB  . ALA A 1 215 ? 46.200 16.937  4.518  1.00 17.96  ? 215 ALA A CB  1 
ATOM   1616 N N   . GLN A 1 216 ? 48.127 17.151  6.842  1.00 18.41  ? 216 GLN A N   1 
ATOM   1617 C CA  . GLN A 1 216 ? 48.713 16.649  8.062  1.00 16.43  ? 216 GLN A CA  1 
ATOM   1618 C C   . GLN A 1 216 ? 48.786 17.700  9.161  1.00 20.68  ? 216 GLN A C   1 
ATOM   1619 O O   . GLN A 1 216 ? 48.479 17.411  10.323 1.00 17.54  ? 216 GLN A O   1 
ATOM   1620 C CB  . GLN A 1 216 ? 50.078 16.000  7.818  1.00 15.71  ? 216 GLN A CB  1 
ATOM   1621 C CG  . GLN A 1 216 ? 49.955 14.634  7.132  1.00 18.11  ? 216 GLN A CG  1 
ATOM   1622 C CD  . GLN A 1 216 ? 51.300 14.048  6.775  1.00 28.13  ? 216 GLN A CD  1 
ATOM   1623 O OE1 . GLN A 1 216 ? 52.251 14.784  6.494  1.00 21.20  ? 216 GLN A OE1 1 
ATOM   1624 N NE2 . GLN A 1 216 ? 51.396 12.717  6.803  1.00 17.15  ? 216 GLN A NE2 1 
ATOM   1625 N N   . ALA A 1 217 ? 49.201 18.914  8.785  1.00 16.92  ? 217 ALA A N   1 
ATOM   1626 C CA  . ALA A 1 217 ? 49.313 20.012  9.731  1.00 17.64  ? 217 ALA A CA  1 
ATOM   1627 C C   . ALA A 1 217 ? 47.952 20.370  10.291 1.00 17.83  ? 217 ALA A C   1 
ATOM   1628 O O   . ALA A 1 217 ? 47.811 20.665  11.477 1.00 15.90  ? 217 ALA A O   1 
ATOM   1629 C CB  . ALA A 1 217 ? 49.991 21.220  9.097  1.00 18.85  ? 217 ALA A CB  1 
ATOM   1630 N N   . VAL A 1 218 ? 46.944 20.342  9.420  1.00 14.91  ? 218 VAL A N   1 
ATOM   1631 C CA  . VAL A 1 218 ? 45.577 20.654  9.822  1.00 16.41  ? 218 VAL A CA  1 
ATOM   1632 C C   . VAL A 1 218 ? 45.064 19.599  10.790 1.00 18.78  ? 218 VAL A C   1 
ATOM   1633 O O   . VAL A 1 218 ? 44.469 19.901  11.827 1.00 15.00  ? 218 VAL A O   1 
ATOM   1634 C CB  . VAL A 1 218 ? 44.644 20.787  8.617  1.00 19.38  ? 218 VAL A CB  1 
ATOM   1635 C CG1 . VAL A 1 218 ? 43.186 20.822  9.068  1.00 17.70  ? 218 VAL A CG1 1 
ATOM   1636 C CG2 . VAL A 1 218 ? 44.974 22.051  7.835  1.00 18.98  ? 218 VAL A CG2 1 
ATOM   1637 N N   . LEU A 1 219 ? 45.326 18.353  10.440 1.00 14.30  ? 219 LEU A N   1 
ATOM   1638 C CA  . LEU A 1 219 ? 44.939 17.253  11.279 1.00 12.26  ? 219 LEU A CA  1 
ATOM   1639 C C   . LEU A 1 219 ? 45.568 17.382  12.664 1.00 17.07  ? 219 LEU A C   1 
ATOM   1640 O O   . LEU A 1 219 ? 44.904 17.191  13.683 1.00 15.03  ? 219 LEU A O   1 
ATOM   1641 C CB  . LEU A 1 219 ? 45.293 15.892  10.638 1.00 11.82  ? 219 LEU A CB  1 
ATOM   1642 C CG  . LEU A 1 219 ? 44.349 15.459  9.519  1.00 16.31  ? 219 LEU A CG  1 
ATOM   1643 C CD1 . LEU A 1 219 ? 44.709 14.056  9.050  1.00 17.27  ? 219 LEU A CD1 1 
ATOM   1644 C CD2 . LEU A 1 219 ? 42.895 15.477  10.003 1.00 16.85  ? 219 LEU A CD2 1 
ATOM   1645 N N   . ARG A 1 220 ? 46.866 17.717  12.686 1.00 14.91  ? 220 ARG A N   1 
ATOM   1646 C CA  . ARG A 1 220 ? 47.626 17.881  13.927 1.00 12.24  ? 220 ARG A CA  1 
ATOM   1647 C C   . ARG A 1 220 ? 47.021 18.942  14.845 1.00 14.38  ? 220 ARG A C   1 
ATOM   1648 O O   . ARG A 1 220 ? 46.988 18.804  16.070 1.00 11.24  ? 220 ARG A O   1 
ATOM   1649 C CB  . ARG A 1 220 ? 49.100 18.157  13.625 1.00 13.50  ? 220 ARG A CB  1 
ATOM   1650 C CG  . ARG A 1 220 ? 50.004 18.110  14.840 1.00 19.03  ? 220 ARG A CG  1 
ATOM   1651 C CD  . ARG A 1 220 ? 50.120 16.719  15.443 1.00 12.01  ? 220 ARG A CD  1 
ATOM   1652 N NE  . ARG A 1 220 ? 50.370 16.798  16.866 1.00 15.17  ? 220 ARG A NE  1 
ATOM   1653 C CZ  . ARG A 1 220 ? 50.285 15.767  17.678 1.00 20.09  ? 220 ARG A CZ  1 
ATOM   1654 N NH1 . ARG A 1 220 ? 49.968 14.557  17.237 1.00 9.98   ? 220 ARG A NH1 1 
ATOM   1655 N NH2 . ARG A 1 220 ? 50.527 15.947  18.970 1.00 13.48  ? 220 ARG A NH2 1 
ATOM   1656 N N   . TRP A 1 221 ? 46.528 20.007  14.225 1.00 13.41  ? 221 TRP A N   1 
ATOM   1657 C CA  . TRP A 1 221 ? 45.903 21.115  14.929 1.00 12.81  ? 221 TRP A CA  1 
ATOM   1658 C C   . TRP A 1 221 ? 44.652 20.658  15.682 1.00 13.56  ? 221 TRP A C   1 
ATOM   1659 O O   . TRP A 1 221 ? 44.481 20.963  16.860 1.00 14.27  ? 221 TRP A O   1 
ATOM   1660 C CB  . TRP A 1 221 ? 45.719 22.308  13.961 1.00 10.96  ? 221 TRP A CB  1 
ATOM   1661 C CG  . TRP A 1 221 ? 44.837 23.443  14.370 1.00 11.83  ? 221 TRP A CG  1 
ATOM   1662 C CD1 . TRP A 1 221 ? 45.215 24.604  14.967 1.00 14.42  ? 221 TRP A CD1 1 
ATOM   1663 C CD2 . TRP A 1 221 ? 43.444 23.569  14.074 1.00 12.12  ? 221 TRP A CD2 1 
ATOM   1664 N NE1 . TRP A 1 221 ? 44.129 25.437  15.113 1.00 14.52  ? 221 TRP A NE1 1 
ATOM   1665 C CE2 . TRP A 1 221 ? 43.021 24.826  14.567 1.00 16.10  ? 221 TRP A CE2 1 
ATOM   1666 C CE3 . TRP A 1 221 ? 42.517 22.718  13.463 1.00 13.06  ? 221 TRP A CE3 1 
ATOM   1667 C CZ2 . TRP A 1 221 ? 41.678 25.237  14.467 1.00 14.79  ? 221 TRP A CZ2 1 
ATOM   1668 C CZ3 . TRP A 1 221 ? 41.199 23.121  13.361 1.00 14.12  ? 221 TRP A CZ3 1 
ATOM   1669 C CH2 . TRP A 1 221 ? 40.789 24.366  13.853 1.00 15.66  ? 221 TRP A CH2 1 
ATOM   1670 N N   . HIS A 1 222 ? 43.809 19.870  15.011 1.00 10.28  ? 222 HIS A N   1 
ATOM   1671 C CA  . HIS A 1 222 ? 42.620 19.329  15.648 1.00 10.04  ? 222 HIS A CA  1 
ATOM   1672 C C   . HIS A 1 222 ? 43.051 18.502  16.839 1.00 12.80  ? 222 HIS A C   1 
ATOM   1673 O O   . HIS A 1 222 ? 42.560 18.631  17.960 1.00 10.68  ? 222 HIS A O   1 
ATOM   1674 C CB  . HIS A 1 222 ? 41.843 18.402  14.689 1.00 11.35  ? 222 HIS A CB  1 
ATOM   1675 C CG  . HIS A 1 222 ? 40.946 19.109  13.708 1.00 16.25  ? 222 HIS A CG  1 
ATOM   1676 N ND1 . HIS A 1 222 ? 41.393 19.437  12.441 1.00 18.51  ? 222 HIS A ND1 1 
ATOM   1677 C CD2 . HIS A 1 222 ? 39.648 19.507  13.811 1.00 15.63  ? 222 HIS A CD2 1 
ATOM   1678 C CE1 . HIS A 1 222 ? 40.386 20.023  11.810 1.00 15.90  ? 222 HIS A CE1 1 
ATOM   1679 N NE2 . HIS A 1 222 ? 39.324 20.079  12.601 1.00 16.47  ? 222 HIS A NE2 1 
ATOM   1680 N N   . LEU A 1 223 ? 44.002 17.633  16.567 1.00 12.82  ? 223 LEU A N   1 
ATOM   1681 C CA  . LEU A 1 223 ? 44.517 16.757  17.576 1.00 13.56  ? 223 LEU A CA  1 
ATOM   1682 C C   . LEU A 1 223 ? 45.036 17.495  18.787 1.00 17.28  ? 223 LEU A C   1 
ATOM   1683 O O   . LEU A 1 223 ? 44.653 17.204  19.928 1.00 16.49  ? 223 LEU A O   1 
ATOM   1684 C CB  . LEU A 1 223 ? 45.553 15.817  16.980 1.00 13.76  ? 223 LEU A CB  1 
ATOM   1685 C CG  . LEU A 1 223 ? 44.944 14.992  15.866 1.00 18.07  ? 223 LEU A CG  1 
ATOM   1686 C CD1 . LEU A 1 223 ? 46.033 14.568  14.891 1.00 19.37  ? 223 LEU A CD1 1 
ATOM   1687 C CD2 . LEU A 1 223 ? 44.261 13.756  16.456 1.00 19.83  ? 223 LEU A CD2 1 
ATOM   1688 N N   . GLN A 1 224 ? 45.906 18.459  18.535 1.00 14.85  ? 224 GLN A N   1 
ATOM   1689 C CA  . GLN A 1 224 ? 46.489 19.248  19.602 1.00 13.92  ? 224 GLN A CA  1 
ATOM   1690 C C   . GLN A 1 224 ? 45.482 20.023  20.421 1.00 13.32  ? 224 GLN A C   1 
ATOM   1691 O O   . GLN A 1 224 ? 45.677 20.247  21.603 1.00 14.87  ? 224 GLN A O   1 
ATOM   1692 C CB  . GLN A 1 224 ? 47.663 20.097  19.138 1.00 16.83  ? 224 GLN A CB  1 
ATOM   1693 C CG  . GLN A 1 224 ? 48.949 19.269  19.201 1.00 21.34  ? 224 GLN A CG  1 
ATOM   1694 C CD  . GLN A 1 224 ? 50.156 19.985  18.681 1.00 18.50  ? 224 GLN A CD  1 
ATOM   1695 O OE1 . GLN A 1 224 ? 50.831 19.491  17.771 1.00 18.58  ? 224 GLN A OE1 1 
ATOM   1696 N NE2 . GLN A 1 224 ? 50.465 21.130  19.296 1.00 18.52  ? 224 GLN A NE2 1 
ATOM   1697 N N   . LYS A 1 225 ? 44.392 20.411  19.769 1.00 12.68  ? 225 LYS A N   1 
ATOM   1698 C CA  . LYS A 1 225 ? 43.310 21.126  20.406 1.00 11.33  ? 225 LYS A CA  1 
ATOM   1699 C C   . LYS A 1 225 ? 42.469 20.147  21.204 1.00 16.68  ? 225 LYS A C   1 
ATOM   1700 O O   . LYS A 1 225 ? 41.559 20.522  21.948 1.00 12.65  ? 225 LYS A O   1 
ATOM   1701 C CB  . LYS A 1 225 ? 42.468 21.863  19.392 1.00 14.07  ? 225 LYS A CB  1 
ATOM   1702 C CG  . LYS A 1 225 ? 43.230 22.994  18.736 1.00 22.57  ? 225 LYS A CG  1 
ATOM   1703 C CD  . LYS A 1 225 ? 42.557 23.484  17.472 1.00 20.28  ? 225 LYS A CD  1 
ATOM   1704 C CE  . LYS A 1 225 ? 41.202 24.113  17.746 1.00 19.82  ? 225 LYS A CE  1 
ATOM   1705 N NZ  . LYS A 1 225 ? 41.306 25.418  18.418 1.00 22.06  ? 225 LYS A NZ  1 
ATOM   1706 N N   . GLY A 1 226 ? 42.799 18.864  21.024 1.00 15.87  ? 226 GLY A N   1 
ATOM   1707 C CA  . GLY A 1 226 ? 42.154 17.772  21.741 1.00 17.97  ? 226 GLY A CA  1 
ATOM   1708 C C   . GLY A 1 226 ? 40.918 17.174  21.091 1.00 18.92  ? 226 GLY A C   1 
ATOM   1709 O O   . GLY A 1 226 ? 40.193 16.410  21.725 1.00 18.34  ? 226 GLY A O   1 
ATOM   1710 N N   . PHE A 1 227 ? 40.676 17.503  19.841 1.00 12.60  ? 227 PHE A N   1 
ATOM   1711 C CA  . PHE A 1 227 ? 39.505 16.959  19.177 1.00 12.12  ? 227 PHE A CA  1 
ATOM   1712 C C   . PHE A 1 227 ? 39.763 15.600  18.539 1.00 18.77  ? 227 PHE A C   1 
ATOM   1713 O O   . PHE A 1 227 ? 40.912 15.221  18.286 1.00 18.71  ? 227 PHE A O   1 
ATOM   1714 C CB  . PHE A 1 227 ? 38.961 17.908  18.126 1.00 11.70  ? 227 PHE A CB  1 
ATOM   1715 C CG  . PHE A 1 227 ? 38.913 19.364  18.524 1.00 11.89  ? 227 PHE A CG  1 
ATOM   1716 C CD1 . PHE A 1 227 ? 38.548 19.785  19.808 1.00 13.08  ? 227 PHE A CD1 1 
ATOM   1717 C CD2 . PHE A 1 227 ? 39.089 20.322  17.504 1.00 15.71  ? 227 PHE A CD2 1 
ATOM   1718 C CE1 . PHE A 1 227 ? 38.501 21.143  20.122 1.00 15.90  ? 227 PHE A CE1 1 
ATOM   1719 C CE2 . PHE A 1 227 ? 39.068 21.683  17.802 1.00 18.94  ? 227 PHE A CE2 1 
ATOM   1720 C CZ  . PHE A 1 227 ? 38.824 22.085  19.130 1.00 18.00  ? 227 PHE A CZ  1 
ATOM   1721 N N   . VAL A 1 228 ? 38.666 14.885  18.244 1.00 15.49  ? 228 VAL A N   1 
ATOM   1722 C CA  . VAL A 1 228 ? 38.713 13.581  17.572 1.00 12.77  ? 228 VAL A CA  1 
ATOM   1723 C C   . VAL A 1 228 ? 38.480 13.782  16.067 1.00 16.08  ? 228 VAL A C   1 
ATOM   1724 O O   . VAL A 1 228 ? 37.569 14.510  15.670 1.00 13.36  ? 228 VAL A O   1 
ATOM   1725 C CB  . VAL A 1 228 ? 37.702 12.588  18.181 1.00 16.49  ? 228 VAL A CB  1 
ATOM   1726 C CG1 . VAL A 1 228 ? 37.703 11.263  17.412 1.00 14.54  ? 228 VAL A CG1 1 
ATOM   1727 C CG2 . VAL A 1 228 ? 38.045 12.338  19.646 1.00 16.36  ? 228 VAL A CG2 1 
ATOM   1728 N N   . VAL A 1 229 ? 39.336 13.177  15.223 1.00 13.52  ? 229 VAL A N   1 
ATOM   1729 C CA  . VAL A 1 229 ? 39.209 13.316  13.758 1.00 13.10  ? 229 VAL A CA  1 
ATOM   1730 C C   . VAL A 1 229 ? 39.104 11.975  13.046 1.00 16.71  ? 229 VAL A C   1 
ATOM   1731 O O   . VAL A 1 229 ? 39.683 10.986  13.471 1.00 18.87  ? 229 VAL A O   1 
ATOM   1732 C CB  . VAL A 1 229 ? 40.281 14.205  13.087 1.00 14.77  ? 229 VAL A CB  1 
ATOM   1733 C CG1 . VAL A 1 229 ? 40.189 15.661  13.530 1.00 14.63  ? 229 VAL A CG1 1 
ATOM   1734 C CG2 . VAL A 1 229 ? 41.688 13.660  13.313 1.00 14.02  ? 229 VAL A CG2 1 
ATOM   1735 N N   . PHE A 1 230 ? 38.351 11.972  11.946 1.00 17.49  ? 230 PHE A N   1 
ATOM   1736 C CA  . PHE A 1 230 ? 38.117 10.791  11.110 1.00 20.33  ? 230 PHE A CA  1 
ATOM   1737 C C   . PHE A 1 230 ? 37.897 11.225  9.660  1.00 25.92  ? 230 PHE A C   1 
ATOM   1738 O O   . PHE A 1 230 ? 36.833 10.961  9.090  1.00 25.91  ? 230 PHE A O   1 
ATOM   1739 C CB  . PHE A 1 230 ? 36.871 9.990   11.606 1.00 22.01  ? 230 PHE A CB  1 
ATOM   1740 C CG  . PHE A 1 230 ? 35.928 10.870  12.395 1.00 23.92  ? 230 PHE A CG  1 
ATOM   1741 C CD1 . PHE A 1 230 ? 36.186 11.095  13.745 1.00 28.00  ? 230 PHE A CD1 1 
ATOM   1742 C CD2 . PHE A 1 230 ? 34.832 11.513  11.811 1.00 28.89  ? 230 PHE A CD2 1 
ATOM   1743 C CE1 . PHE A 1 230 ? 35.381 11.932  14.515 1.00 30.65  ? 230 PHE A CE1 1 
ATOM   1744 C CE2 . PHE A 1 230 ? 34.013 12.359  12.562 1.00 32.83  ? 230 PHE A CE2 1 
ATOM   1745 C CZ  . PHE A 1 230 ? 34.294 12.566  13.914 1.00 31.44  ? 230 PHE A CZ  1 
ATOM   1746 N N   . PRO A 1 231 ? 38.901 11.914  9.074  1.00 20.03  ? 231 PRO A N   1 
ATOM   1747 C CA  . PRO A 1 231 ? 38.805 12.414  7.713  1.00 19.39  ? 231 PRO A CA  1 
ATOM   1748 C C   . PRO A 1 231 ? 38.487 11.328  6.719  1.00 26.97  ? 231 PRO A C   1 
ATOM   1749 O O   . PRO A 1 231 ? 38.895 10.172  6.871  1.00 24.70  ? 231 PRO A O   1 
ATOM   1750 C CB  . PRO A 1 231 ? 40.168 12.997  7.363  1.00 19.31  ? 231 PRO A CB  1 
ATOM   1751 C CG  . PRO A 1 231 ? 41.146 12.458  8.382  1.00 20.87  ? 231 PRO A CG  1 
ATOM   1752 C CD  . PRO A 1 231 ? 40.323 11.840  9.501  1.00 15.70  ? 231 PRO A CD  1 
ATOM   1753 N N   . GLY A 1 232 ? 37.750 11.733  5.695  1.00 27.32  ? 232 GLY A N   1 
ATOM   1754 C CA  . GLY A 1 232 ? 37.357 10.850  4.636  1.00 29.40  ? 232 GLY A CA  1 
ATOM   1755 C C   . GLY A 1 232 ? 38.376 10.866  3.514  1.00 39.04  ? 232 GLY A C   1 
ATOM   1756 O O   . GLY A 1 232 ? 39.014 11.885  3.238  1.00 36.98  ? 232 GLY A O   1 
ATOM   1757 N N   . SER A 1 233 ? 38.513 9.714   2.871  1.00 38.34  ? 233 SER A N   1 
ATOM   1758 C CA  . SER A 1 233 ? 39.439 9.543   1.773  1.00 38.82  ? 233 SER A CA  1 
ATOM   1759 C C   . SER A 1 233 ? 39.424 8.124   1.242  1.00 43.95  ? 233 SER A C   1 
ATOM   1760 O O   . SER A 1 233 ? 39.289 7.160   1.994  1.00 44.05  ? 233 SER A O   1 
ATOM   1761 C CB  . SER A 1 233 ? 40.852 9.900   2.186  1.00 40.55  ? 233 SER A CB  1 
ATOM   1762 O OG  . SER A 1 233 ? 41.317 8.948   3.118  1.00 48.75  ? 233 SER A OG  1 
ATOM   1763 N N   . VAL A 1 234 ? 39.571 8.007   -0.072 1.00 42.22  ? 234 VAL A N   1 
ATOM   1764 C CA  . VAL A 1 234 ? 39.608 6.710   -0.710 1.00 40.86  ? 234 VAL A CA  1 
ATOM   1765 C C   . VAL A 1 234 ? 41.004 6.381   -1.250 1.00 46.65  ? 234 VAL A C   1 
ATOM   1766 O O   . VAL A 1 234 ? 41.334 5.223   -1.510 1.00 50.09  ? 234 VAL A O   1 
ATOM   1767 C CB  . VAL A 1 234 ? 38.458 6.454   -1.695 1.00 41.03  ? 234 VAL A CB  1 
ATOM   1768 C CG1 . VAL A 1 234 ? 37.121 6.448   -0.949 1.00 39.03  ? 234 VAL A CG1 1 
ATOM   1769 C CG2 . VAL A 1 234 ? 38.443 7.511   -2.795 1.00 40.02  ? 234 VAL A CG2 1 
ATOM   1770 N N   . ARG A 1 235 ? 41.835 7.415   -1.381 1.00 37.39  ? 235 ARG A N   1 
ATOM   1771 C CA  . ARG A 1 235 ? 43.200 7.240   -1.847 1.00 36.60  ? 235 ARG A CA  1 
ATOM   1772 C C   . ARG A 1 235 ? 44.089 6.743   -0.711 1.00 38.27  ? 235 ARG A C   1 
ATOM   1773 O O   . ARG A 1 235 ? 44.150 7.358   0.358  1.00 37.46  ? 235 ARG A O   1 
ATOM   1774 C CB  . ARG A 1 235 ? 43.750 8.522   -2.479 1.00 37.02  ? 235 ARG A CB  1 
ATOM   1775 C CG  . ARG A 1 235 ? 45.235 8.470   -2.842 1.00 58.39  ? 235 ARG A CG  1 
ATOM   1776 C CD  . ARG A 1 235 ? 45.745 9.792   -3.416 1.00 86.49  ? 235 ARG A CD  1 
ATOM   1777 N NE  . ARG A 1 235 ? 44.991 10.231  -4.589 1.00 128.25 ? 235 ARG A NE  1 
ATOM   1778 C CZ  . ARG A 1 235 ? 45.203 11.375  -5.239 1.00 166.37 ? 235 ARG A CZ  1 
ATOM   1779 N NH1 . ARG A 1 235 ? 46.146 12.236  -4.867 1.00 162.38 ? 235 ARG A NH1 1 
ATOM   1780 N NH2 . ARG A 1 235 ? 44.449 11.663  -6.298 1.00 165.44 ? 235 ARG A NH2 1 
ATOM   1781 N N   . ARG A 1 236 ? 44.752 5.606   -0.960 1.00 30.63  ? 236 ARG A N   1 
ATOM   1782 C CA  . ARG A 1 236 ? 45.650 4.985   -0.005 1.00 28.58  ? 236 ARG A CA  1 
ATOM   1783 C C   . ARG A 1 236 ? 46.747 5.957   0.375  1.00 25.60  ? 236 ARG A C   1 
ATOM   1784 O O   . ARG A 1 236 ? 47.246 5.952   1.490  1.00 23.57  ? 236 ARG A O   1 
ATOM   1785 C CB  . ARG A 1 236 ? 46.230 3.690   -0.566 1.00 31.99  ? 236 ARG A CB  1 
ATOM   1786 C CG  . ARG A 1 236 ? 47.183 2.980   0.381  1.00 50.78  ? 236 ARG A CG  1 
ATOM   1787 C CD  . ARG A 1 236 ? 47.794 1.734   -0.244 1.00 80.78  ? 236 ARG A CD  1 
ATOM   1788 N NE  . ARG A 1 236 ? 48.642 0.988   0.680  1.00 117.12 ? 236 ARG A NE  1 
ATOM   1789 C CZ  . ARG A 1 236 ? 48.188 0.123   1.581  1.00 143.37 ? 236 ARG A CZ  1 
ATOM   1790 N NH1 . ARG A 1 236 ? 46.892 -0.147  1.714  1.00 135.68 ? 236 ARG A NH1 1 
ATOM   1791 N NH2 . ARG A 1 236 ? 49.060 -0.498  2.371  1.00 138.27 ? 236 ARG A NH2 1 
ATOM   1792 N N   . GLU A 1 237 ? 47.096 6.821   -0.570 1.00 21.77  ? 237 GLU A N   1 
ATOM   1793 C CA  . GLU A 1 237 ? 48.123 7.817   -0.328 1.00 23.10  ? 237 GLU A CA  1 
ATOM   1794 C C   . GLU A 1 237 ? 47.741 8.758   0.805  1.00 28.61  ? 237 GLU A C   1 
ATOM   1795 O O   . GLU A 1 237 ? 48.567 9.132   1.636  1.00 26.67  ? 237 GLU A O   1 
ATOM   1796 C CB  . GLU A 1 237 ? 48.481 8.607   -1.597 1.00 24.98  ? 237 GLU A CB  1 
ATOM   1797 C CG  . GLU A 1 237 ? 49.333 9.852   -1.291 1.00 44.54  ? 237 GLU A CG  1 
ATOM   1798 C CD  . GLU A 1 237 ? 50.118 10.328  -2.476 1.00 97.43  ? 237 GLU A CD  1 
ATOM   1799 O OE1 . GLU A 1 237 ? 50.828 9.597   -3.147 1.00 114.89 ? 237 GLU A OE1 1 
ATOM   1800 O OE2 . GLU A 1 237 ? 49.953 11.609  -2.709 1.00 96.10  ? 237 GLU A OE2 1 
ATOM   1801 N N   . HIS A 1 238 ? 46.473 9.136   0.824  1.00 23.90  ? 238 HIS A N   1 
ATOM   1802 C CA  . HIS A 1 238 ? 45.970 10.014  1.847  1.00 23.39  ? 238 HIS A CA  1 
ATOM   1803 C C   . HIS A 1 238 ? 45.696 9.260   3.140  1.00 23.82  ? 238 HIS A C   1 
ATOM   1804 O O   . HIS A 1 238 ? 45.820 9.799   4.233  1.00 25.97  ? 238 HIS A O   1 
ATOM   1805 C CB  . HIS A 1 238 ? 44.734 10.764  1.357  1.00 23.95  ? 238 HIS A CB  1 
ATOM   1806 C CG  . HIS A 1 238 ? 45.075 11.723  0.277  1.00 27.65  ? 238 HIS A CG  1 
ATOM   1807 N ND1 . HIS A 1 238 ? 44.101 12.228  -0.564 1.00 29.78  ? 238 HIS A ND1 1 
ATOM   1808 C CD2 . HIS A 1 238 ? 46.273 12.261  -0.079 1.00 28.73  ? 238 HIS A CD2 1 
ATOM   1809 C CE1 . HIS A 1 238 ? 44.714 13.052  -1.402 1.00 28.48  ? 238 HIS A CE1 1 
ATOM   1810 N NE2 . HIS A 1 238 ? 46.019 13.093  -1.139 1.00 28.30  ? 238 HIS A NE2 1 
ATOM   1811 N N   . LEU A 1 239 ? 45.335 8.000   3.006  1.00 21.45  ? 239 LEU A N   1 
ATOM   1812 C CA  . LEU A 1 239 ? 45.068 7.165   4.163  1.00 21.77  ? 239 LEU A CA  1 
ATOM   1813 C C   . LEU A 1 239 ? 46.300 7.041   5.032  1.00 22.63  ? 239 LEU A C   1 
ATOM   1814 O O   . LEU A 1 239 ? 46.275 7.283   6.236  1.00 22.38  ? 239 LEU A O   1 
ATOM   1815 C CB  . LEU A 1 239 ? 44.639 5.756   3.730  1.00 23.41  ? 239 LEU A CB  1 
ATOM   1816 C CG  . LEU A 1 239 ? 43.135 5.571   3.656  1.00 31.52  ? 239 LEU A CG  1 
ATOM   1817 C CD1 . LEU A 1 239 ? 42.776 4.152   4.066  1.00 33.90  ? 239 LEU A CD1 1 
ATOM   1818 C CD2 . LEU A 1 239 ? 42.437 6.572   4.570  1.00 38.24  ? 239 LEU A CD2 1 
ATOM   1819 N N   . GLU A 1 240 ? 47.383 6.630   4.396  1.00 22.74  ? 240 GLU A N   1 
ATOM   1820 C CA  . GLU A 1 240 ? 48.652 6.455   5.059  1.00 23.47  ? 240 GLU A CA  1 
ATOM   1821 C C   . GLU A 1 240 ? 49.131 7.785   5.612  1.00 24.04  ? 240 GLU A C   1 
ATOM   1822 O O   . GLU A 1 240 ? 49.589 7.909   6.746  1.00 24.81  ? 240 GLU A O   1 
ATOM   1823 C CB  . GLU A 1 240 ? 49.692 5.878   4.068  1.00 25.68  ? 240 GLU A CB  1 
ATOM   1824 C CG  . GLU A 1 240 ? 49.120 4.746   3.183  1.00 40.62  ? 240 GLU A CG  1 
ATOM   1825 C CD  . GLU A 1 240 ? 50.140 4.080   2.293  1.00 80.25  ? 240 GLU A CD  1 
ATOM   1826 O OE1 . GLU A 1 240 ? 50.780 4.673   1.443  1.00 84.25  ? 240 GLU A OE1 1 
ATOM   1827 O OE2 . GLU A 1 240 ? 50.245 2.793   2.517  1.00 81.82  ? 240 GLU A OE2 1 
ATOM   1828 N N   . GLU A 1 241 ? 49.007 8.782   4.773  1.00 21.30  ? 241 GLU A N   1 
ATOM   1829 C CA  . GLU A 1 241 ? 49.414 10.118  5.095  1.00 22.84  ? 241 GLU A CA  1 
ATOM   1830 C C   . GLU A 1 241 ? 48.708 10.658  6.325  1.00 24.29  ? 241 GLU A C   1 
ATOM   1831 O O   . GLU A 1 241 ? 49.338 11.195  7.232  1.00 24.50  ? 241 GLU A O   1 
ATOM   1832 C CB  . GLU A 1 241 ? 49.167 11.010  3.877  1.00 25.86  ? 241 GLU A CB  1 
ATOM   1833 C CG  . GLU A 1 241 ? 49.405 12.503  4.109  1.00 42.27  ? 241 GLU A CG  1 
ATOM   1834 C CD  . GLU A 1 241 ? 49.390 13.232  2.802  1.00 53.84  ? 241 GLU A CD  1 
ATOM   1835 O OE1 . GLU A 1 241 ? 49.837 12.748  1.777  1.00 36.36  ? 241 GLU A OE1 1 
ATOM   1836 O OE2 . GLU A 1 241 ? 48.784 14.395  2.867  1.00 30.00  ? 241 GLU A OE2 1 
ATOM   1837 N N   . ASN A 1 242 ? 47.389 10.518  6.341  1.00 20.67  ? 242 ASN A N   1 
ATOM   1838 C CA  . ASN A 1 242 ? 46.577 11.001  7.447  1.00 20.23  ? 242 ASN A CA  1 
ATOM   1839 C C   . ASN A 1 242 ? 46.861 10.262  8.750  1.00 21.13  ? 242 ASN A C   1 
ATOM   1840 O O   . ASN A 1 242 ? 46.578 10.745  9.842  1.00 18.02  ? 242 ASN A O   1 
ATOM   1841 C CB  . ASN A 1 242 ? 45.075 10.971  7.110  1.00 20.57  ? 242 ASN A CB  1 
ATOM   1842 C CG  . ASN A 1 242 ? 44.676 11.910  5.987  1.00 31.29  ? 242 ASN A CG  1 
ATOM   1843 O OD1 . ASN A 1 242 ? 45.292 12.976  5.787  1.00 24.07  ? 242 ASN A OD1 1 
ATOM   1844 N ND2 . ASN A 1 242 ? 43.613 11.535  5.277  1.00 21.33  ? 242 ASN A ND2 1 
ATOM   1845 N N   . LEU A 1 243 ? 47.421 9.082   8.616  1.00 18.34  ? 243 LEU A N   1 
ATOM   1846 C CA  . LEU A 1 243 ? 47.762 8.283   9.755  1.00 19.05  ? 243 LEU A CA  1 
ATOM   1847 C C   . LEU A 1 243 ? 49.103 8.724   10.326 1.00 23.37  ? 243 LEU A C   1 
ATOM   1848 O O   . LEU A 1 243 ? 49.381 8.550   11.508 1.00 24.28  ? 243 LEU A O   1 
ATOM   1849 C CB  . LEU A 1 243 ? 47.815 6.800   9.339  1.00 19.35  ? 243 LEU A CB  1 
ATOM   1850 C CG  . LEU A 1 243 ? 47.345 5.828   10.407 1.00 26.75  ? 243 LEU A CG  1 
ATOM   1851 C CD1 . LEU A 1 243 ? 45.904 6.144   10.804 1.00 27.60  ? 243 LEU A CD1 1 
ATOM   1852 C CD2 . LEU A 1 243 ? 47.432 4.410   9.858  1.00 32.67  ? 243 LEU A CD2 1 
ATOM   1853 N N   . ASP A 1 244 ? 49.939 9.301   9.465  1.00 18.60  ? 244 ASP A N   1 
ATOM   1854 C CA  . ASP A 1 244 ? 51.265 9.741   9.868  1.00 18.16  ? 244 ASP A CA  1 
ATOM   1855 C C   . ASP A 1 244 ? 51.310 11.111  10.539 1.00 15.45  ? 244 ASP A C   1 
ATOM   1856 O O   . ASP A 1 244 ? 52.017 11.997  10.075 1.00 14.64  ? 244 ASP A O   1 
ATOM   1857 C CB  . ASP A 1 244 ? 52.255 9.660   8.695  1.00 20.59  ? 244 ASP A CB  1 
ATOM   1858 C CG  . ASP A 1 244 ? 53.683 9.719   9.140  1.00 35.59  ? 244 ASP A CG  1 
ATOM   1859 O OD1 . ASP A 1 244 ? 54.036 9.459   10.277 1.00 40.85  ? 244 ASP A OD1 1 
ATOM   1860 O OD2 . ASP A 1 244 ? 54.496 10.097  8.182  1.00 35.97  ? 244 ASP A OD2 1 
ATOM   1861 N N   . VAL A 1 245 ? 50.574 11.276  11.657 1.00 13.98  ? 245 VAL A N   1 
ATOM   1862 C CA  . VAL A 1 245 ? 50.528 12.571  12.359 1.00 13.48  ? 245 VAL A CA  1 
ATOM   1863 C C   . VAL A 1 245 ? 50.805 12.563  13.872 1.00 17.56  ? 245 VAL A C   1 
ATOM   1864 O O   . VAL A 1 245 ? 50.537 13.557  14.538 1.00 17.84  ? 245 VAL A O   1 
ATOM   1865 C CB  . VAL A 1 245 ? 49.200 13.287  12.115 1.00 15.41  ? 245 VAL A CB  1 
ATOM   1866 C CG1 . VAL A 1 245 ? 49.044 13.688  10.648 1.00 12.57  ? 245 VAL A CG1 1 
ATOM   1867 C CG2 . VAL A 1 245 ? 48.039 12.385  12.546 1.00 15.19  ? 245 VAL A CG2 1 
ATOM   1868 N N   . PHE A 1 246 ? 51.319 11.465  14.431 1.00 14.83  ? 246 PHE A N   1 
ATOM   1869 C CA  . PHE A 1 246 ? 51.593 11.417  15.870 1.00 15.19  ? 246 PHE A CA  1 
ATOM   1870 C C   . PHE A 1 246 ? 53.060 11.533  16.154 1.00 21.76  ? 246 PHE A C   1 
ATOM   1871 O O   . PHE A 1 246 ? 53.499 11.520  17.292 1.00 21.59  ? 246 PHE A O   1 
ATOM   1872 C CB  . PHE A 1 246 ? 51.032 10.157  16.514 1.00 16.18  ? 246 PHE A CB  1 
ATOM   1873 C CG  . PHE A 1 246 ? 49.591 10.100  16.187 1.00 17.55  ? 246 PHE A CG  1 
ATOM   1874 C CD1 . PHE A 1 246 ? 48.660 10.812  16.944 1.00 20.73  ? 246 PHE A CD1 1 
ATOM   1875 C CD2 . PHE A 1 246 ? 49.164 9.424   15.048 1.00 15.51  ? 246 PHE A CD2 1 
ATOM   1876 C CE1 . PHE A 1 246 ? 47.307 10.809  16.612 1.00 21.17  ? 246 PHE A CE1 1 
ATOM   1877 C CE2 . PHE A 1 246 ? 47.816 9.408   14.702 1.00 17.96  ? 246 PHE A CE2 1 
ATOM   1878 C CZ  . PHE A 1 246 ? 46.888 10.099  15.486 1.00 17.65  ? 246 PHE A CZ  1 
ATOM   1879 N N   . ASP A 1 247 ? 53.769 11.632  15.048 1.00 21.44  ? 247 ASP A N   1 
ATOM   1880 C CA  . ASP A 1 247 ? 55.206 11.739  14.889 1.00 22.27  ? 247 ASP A CA  1 
ATOM   1881 C C   . ASP A 1 247 ? 55.745 13.112  15.251 1.00 18.13  ? 247 ASP A C   1 
ATOM   1882 O O   . ASP A 1 247 ? 56.915 13.283  15.579 1.00 12.57  ? 247 ASP A O   1 
ATOM   1883 C CB  . ASP A 1 247 ? 55.414 11.565  13.361 1.00 25.63  ? 247 ASP A CB  1 
ATOM   1884 C CG  . ASP A 1 247 ? 56.757 11.087  12.948 1.00 53.07  ? 247 ASP A CG  1 
ATOM   1885 O OD1 . ASP A 1 247 ? 57.542 10.575  13.715 1.00 64.72  ? 247 ASP A OD1 1 
ATOM   1886 O OD2 . ASP A 1 247 ? 56.984 11.265  11.664 1.00 63.17  ? 247 ASP A OD2 1 
ATOM   1887 N N   . PHE A 1 248 ? 54.878 14.097  15.122 1.00 16.34  ? 248 PHE A N   1 
ATOM   1888 C CA  . PHE A 1 248 ? 55.241 15.474  15.356 1.00 16.12  ? 248 PHE A CA  1 
ATOM   1889 C C   . PHE A 1 248 ? 54.201 16.208  16.171 1.00 17.23  ? 248 PHE A C   1 
ATOM   1890 O O   . PHE A 1 248 ? 53.169 15.654  16.567 1.00 16.64  ? 248 PHE A O   1 
ATOM   1891 C CB  . PHE A 1 248 ? 55.448 16.239  14.010 1.00 17.91  ? 248 PHE A CB  1 
ATOM   1892 C CG  . PHE A 1 248 ? 54.151 16.458  13.231 1.00 17.95  ? 248 PHE A CG  1 
ATOM   1893 C CD1 . PHE A 1 248 ? 53.350 15.364  12.899 1.00 19.03  ? 248 PHE A CD1 1 
ATOM   1894 C CD2 . PHE A 1 248 ? 53.728 17.723  12.801 1.00 19.78  ? 248 PHE A CD2 1 
ATOM   1895 C CE1 . PHE A 1 248 ? 52.158 15.500  12.197 1.00 21.80  ? 248 PHE A CE1 1 
ATOM   1896 C CE2 . PHE A 1 248 ? 52.541 17.887  12.078 1.00 20.88  ? 248 PHE A CE2 1 
ATOM   1897 C CZ  . PHE A 1 248 ? 51.758 16.770  11.764 1.00 19.04  ? 248 PHE A CZ  1 
ATOM   1898 N N   . ASP A 1 249 ? 54.499 17.481  16.382 1.00 11.04  ? 249 ASP A N   1 
ATOM   1899 C CA  . ASP A 1 249 ? 53.646 18.406  17.098 1.00 11.47  ? 249 ASP A CA  1 
ATOM   1900 C C   . ASP A 1 249 ? 53.938 19.836  16.672 1.00 14.50  ? 249 ASP A C   1 
ATOM   1901 O O   . ASP A 1 249 ? 55.061 20.177  16.318 1.00 16.26  ? 249 ASP A O   1 
ATOM   1902 C CB  . ASP A 1 249 ? 53.679 18.230  18.639 1.00 12.24  ? 249 ASP A CB  1 
ATOM   1903 C CG  . ASP A 1 249 ? 55.068 18.105  19.197 1.00 22.04  ? 249 ASP A CG  1 
ATOM   1904 O OD1 . ASP A 1 249 ? 56.010 18.786  18.802 1.00 21.19  ? 249 ASP A OD1 1 
ATOM   1905 O OD2 . ASP A 1 249 ? 55.163 17.161  20.120 1.00 15.36  ? 249 ASP A OD2 1 
ATOM   1906 N N   . LEU A 1 250 ? 52.904 20.650  16.694 1.00 13.13  ? 250 LEU A N   1 
ATOM   1907 C CA  . LEU A 1 250 ? 52.987 22.049  16.319 1.00 15.49  ? 250 LEU A CA  1 
ATOM   1908 C C   . LEU A 1 250 ? 53.324 22.903  17.524 1.00 17.27  ? 250 LEU A C   1 
ATOM   1909 O O   . LEU A 1 250 ? 53.004 22.534  18.651 1.00 16.37  ? 250 LEU A O   1 
ATOM   1910 C CB  . LEU A 1 250 ? 51.601 22.520  15.835 1.00 17.79  ? 250 LEU A CB  1 
ATOM   1911 C CG  . LEU A 1 250 ? 51.350 22.339  14.350 1.00 26.03  ? 250 LEU A CG  1 
ATOM   1912 C CD1 . LEU A 1 250 ? 52.245 21.246  13.797 1.00 27.44  ? 250 LEU A CD1 1 
ATOM   1913 C CD2 . LEU A 1 250 ? 49.887 21.977  14.129 1.00 29.36  ? 250 LEU A CD2 1 
ATOM   1914 N N   . THR A 1 251 ? 53.923 24.077  17.291 1.00 13.30  ? 251 THR A N   1 
ATOM   1915 C CA  . THR A 1 251 ? 54.205 24.985  18.388 1.00 12.94  ? 251 THR A CA  1 
ATOM   1916 C C   . THR A 1 251 ? 52.943 25.756  18.668 1.00 19.73  ? 251 THR A C   1 
ATOM   1917 O O   . THR A 1 251 ? 52.038 25.801  17.842 1.00 19.82  ? 251 THR A O   1 
ATOM   1918 C CB  . THR A 1 251 ? 55.288 26.025  18.086 1.00 16.13  ? 251 THR A CB  1 
ATOM   1919 O OG1 . THR A 1 251 ? 54.846 26.848  17.027 1.00 18.84  ? 251 THR A OG1 1 
ATOM   1920 C CG2 . THR A 1 251 ? 56.606 25.355  17.740 1.00 14.69  ? 251 THR A CG2 1 
ATOM   1921 N N   . ASP A 1 252 ? 52.895 26.373  19.826 1.00 16.49  ? 252 ASP A N   1 
ATOM   1922 C CA  . ASP A 1 252 ? 51.746 27.145  20.200 1.00 16.98  ? 252 ASP A CA  1 
ATOM   1923 C C   . ASP A 1 252 ? 51.489 28.266  19.227 1.00 21.95  ? 252 ASP A C   1 
ATOM   1924 O O   . ASP A 1 252 ? 50.350 28.591  18.875 1.00 22.70  ? 252 ASP A O   1 
ATOM   1925 C CB  . ASP A 1 252 ? 51.899 27.625  21.631 1.00 17.09  ? 252 ASP A CB  1 
ATOM   1926 C CG  . ASP A 1 252 ? 51.707 26.455  22.530 1.00 28.01  ? 252 ASP A CG  1 
ATOM   1927 O OD1 . ASP A 1 252 ? 51.256 25.389  22.131 1.00 26.22  ? 252 ASP A OD1 1 
ATOM   1928 O OD2 . ASP A 1 252 ? 52.017 26.708  23.780 1.00 33.33  ? 252 ASP A OD2 1 
ATOM   1929 N N   . THR A 1 253 ? 52.580 28.833  18.777 1.00 17.07  ? 253 THR A N   1 
ATOM   1930 C CA  . THR A 1 253 ? 52.541 29.893  17.811 1.00 17.01  ? 253 THR A CA  1 
ATOM   1931 C C   . THR A 1 253 ? 51.895 29.403  16.541 1.00 19.50  ? 253 THR A C   1 
ATOM   1932 O O   . THR A 1 253 ? 51.095 30.097  15.914 1.00 18.75  ? 253 THR A O   1 
ATOM   1933 C CB  . THR A 1 253 ? 53.955 30.364  17.489 1.00 22.94  ? 253 THR A CB  1 
ATOM   1934 O OG1 . THR A 1 253 ? 54.409 31.236  18.497 1.00 29.26  ? 253 THR A OG1 1 
ATOM   1935 C CG2 . THR A 1 253 ? 53.956 31.064  16.144 1.00 29.48  ? 253 THR A CG2 1 
ATOM   1936 N N   . GLU A 1 254 ? 52.270 28.197  16.153 1.00 18.25  ? 254 GLU A N   1 
ATOM   1937 C CA  . GLU A 1 254 ? 51.723 27.594  14.960 1.00 19.05  ? 254 GLU A CA  1 
ATOM   1938 C C   . GLU A 1 254 ? 50.226 27.373  15.119 1.00 21.67  ? 254 GLU A C   1 
ATOM   1939 O O   . GLU A 1 254 ? 49.418 27.683  14.239 1.00 20.00  ? 254 GLU A O   1 
ATOM   1940 C CB  . GLU A 1 254 ? 52.451 26.276  14.608 1.00 20.45  ? 254 GLU A CB  1 
ATOM   1941 C CG  . GLU A 1 254 ? 53.814 26.507  13.915 1.00 18.49  ? 254 GLU A CG  1 
ATOM   1942 C CD  . GLU A 1 254 ? 54.713 25.298  13.923 1.00 21.79  ? 254 GLU A CD  1 
ATOM   1943 O OE1 . GLU A 1 254 ? 54.510 24.308  14.595 1.00 16.12  ? 254 GLU A OE1 1 
ATOM   1944 O OE2 . GLU A 1 254 ? 55.752 25.437  13.150 1.00 11.88  ? 254 GLU A OE2 1 
ATOM   1945 N N   . ILE A 1 255 ? 49.854 26.842  16.262 1.00 16.36  ? 255 ILE A N   1 
ATOM   1946 C CA  . ILE A 1 255 ? 48.462 26.600  16.500 1.00 12.94  ? 255 ILE A CA  1 
ATOM   1947 C C   . ILE A 1 255 ? 47.669 27.891  16.503 1.00 18.38  ? 255 ILE A C   1 
ATOM   1948 O O   . ILE A 1 255 ? 46.614 28.000  15.885 1.00 17.55  ? 255 ILE A O   1 
ATOM   1949 C CB  . ILE A 1 255 ? 48.266 25.812  17.768 1.00 15.94  ? 255 ILE A CB  1 
ATOM   1950 C CG1 . ILE A 1 255 ? 48.624 24.351  17.501 1.00 13.93  ? 255 ILE A CG1 1 
ATOM   1951 C CG2 . ILE A 1 255 ? 46.815 25.923  18.224 1.00 16.79  ? 255 ILE A CG2 1 
ATOM   1952 C CD1 . ILE A 1 255 ? 49.040 23.609  18.762 1.00 27.05  ? 255 ILE A CD1 1 
ATOM   1953 N N   . ALA A 1 256 ? 48.205 28.874  17.217 1.00 16.55  ? 256 ALA A N   1 
ATOM   1954 C CA  . ALA A 1 256 ? 47.590 30.177  17.331 1.00 15.68  ? 256 ALA A CA  1 
ATOM   1955 C C   . ALA A 1 256 ? 47.329 30.805  15.969 1.00 23.11  ? 256 ALA A C   1 
ATOM   1956 O O   . ALA A 1 256 ? 46.301 31.443  15.761 1.00 22.77  ? 256 ALA A O   1 
ATOM   1957 C CB  . ALA A 1 256 ? 48.452 31.078  18.174 1.00 17.05  ? 256 ALA A CB  1 
ATOM   1958 N N   . ALA A 1 257 ? 48.273 30.620  15.041 1.00 23.02  ? 257 ALA A N   1 
ATOM   1959 C CA  . ALA A 1 257 ? 48.153 31.161  13.692 1.00 23.48  ? 257 ALA A CA  1 
ATOM   1960 C C   . ALA A 1 257 ? 47.020 30.500  12.923 1.00 22.43  ? 257 ALA A C   1 
ATOM   1961 O O   . ALA A 1 257 ? 46.299 31.135  12.142 1.00 20.14  ? 257 ALA A O   1 
ATOM   1962 C CB  . ALA A 1 257 ? 49.470 31.022  12.933 1.00 24.19  ? 257 ALA A CB  1 
ATOM   1963 N N   . ILE A 1 258 ? 46.869 29.214  13.153 1.00 14.14  ? 258 ILE A N   1 
ATOM   1964 C CA  . ILE A 1 258 ? 45.814 28.500  12.501 1.00 11.47  ? 258 ILE A CA  1 
ATOM   1965 C C   . ILE A 1 258 ? 44.477 28.871  13.109 1.00 16.28  ? 258 ILE A C   1 
ATOM   1966 O O   . ILE A 1 258 ? 43.467 28.952  12.414 1.00 16.28  ? 258 ILE A O   1 
ATOM   1967 C CB  . ILE A 1 258 ? 46.028 27.001  12.484 1.00 12.69  ? 258 ILE A CB  1 
ATOM   1968 C CG1 . ILE A 1 258 ? 47.121 26.650  11.478 1.00 13.64  ? 258 ILE A CG1 1 
ATOM   1969 C CG2 . ILE A 1 258 ? 44.733 26.315  12.076 1.00 13.53  ? 258 ILE A CG2 1 
ATOM   1970 C CD1 . ILE A 1 258 ? 47.758 25.287  11.743 1.00 15.78  ? 258 ILE A CD1 1 
ATOM   1971 N N   . ASP A 1 259 ? 44.476 29.115  14.405 1.00 12.36  ? 259 ASP A N   1 
ATOM   1972 C CA  . ASP A 1 259 ? 43.253 29.487  15.072 1.00 13.90  ? 259 ASP A CA  1 
ATOM   1973 C C   . ASP A 1 259 ? 42.707 30.821  14.563 1.00 18.00  ? 259 ASP A C   1 
ATOM   1974 O O   . ASP A 1 259 ? 41.502 31.026  14.561 1.00 17.26  ? 259 ASP A O   1 
ATOM   1975 C CB  . ASP A 1 259 ? 43.443 29.574  16.592 1.00 15.87  ? 259 ASP A CB  1 
ATOM   1976 C CG  . ASP A 1 259 ? 43.366 28.260  17.310 1.00 17.53  ? 259 ASP A CG  1 
ATOM   1977 O OD1 . ASP A 1 259 ? 43.040 27.210  16.783 1.00 16.54  ? 259 ASP A OD1 1 
ATOM   1978 O OD2 . ASP A 1 259 ? 43.690 28.383  18.571 1.00 22.68  ? 259 ASP A OD2 1 
ATOM   1979 N N   . ALA A 1 260 ? 43.608 31.732  14.152 1.00 14.75  ? 260 ALA A N   1 
ATOM   1980 C CA  . ALA A 1 260 ? 43.210 33.059  13.666 1.00 15.98  ? 260 ALA A CA  1 
ATOM   1981 C C   . ALA A 1 260 ? 42.431 33.024  12.352 1.00 22.54  ? 260 ALA A C   1 
ATOM   1982 O O   . ALA A 1 260 ? 41.777 33.986  11.974 1.00 25.40  ? 260 ALA A O   1 
ATOM   1983 C CB  . ALA A 1 260 ? 44.409 33.990  13.576 1.00 15.65  ? 260 ALA A CB  1 
ATOM   1984 N N   . MET A 1 261 ? 42.497 31.891  11.658 1.00 14.84  ? 261 MET A N   1 
ATOM   1985 C CA  . MET A 1 261 ? 41.803 31.721  10.395 1.00 10.96  ? 261 MET A CA  1 
ATOM   1986 C C   . MET A 1 261 ? 40.283 31.818  10.489 1.00 17.07  ? 261 MET A C   1 
ATOM   1987 O O   . MET A 1 261 ? 39.593 31.963  9.481  1.00 18.13  ? 261 MET A O   1 
ATOM   1988 C CB  . MET A 1 261 ? 42.201 30.404  9.731  1.00 11.77  ? 261 MET A CB  1 
ATOM   1989 C CG  . MET A 1 261 ? 43.607 30.460  9.182  1.00 15.05  ? 261 MET A CG  1 
ATOM   1990 S SD  . MET A 1 261 ? 44.154 28.849  8.601  1.00 21.13  ? 261 MET A SD  1 
ATOM   1991 C CE  . MET A 1 261 ? 42.967 28.563  7.266  1.00 16.24  ? 261 MET A CE  1 
ATOM   1992 N N   . ASP A 1 262 ? 39.754 31.709  11.697 1.00 16.77  ? 262 ASP A N   1 
ATOM   1993 C CA  . ASP A 1 262 ? 38.317 31.790  11.878 1.00 17.53  ? 262 ASP A CA  1 
ATOM   1994 C C   . ASP A 1 262 ? 37.842 33.251  11.857 1.00 28.87  ? 262 ASP A C   1 
ATOM   1995 O O   . ASP A 1 262 ? 38.251 34.057  12.688 1.00 30.62  ? 262 ASP A O   1 
ATOM   1996 C CB  . ASP A 1 262 ? 37.856 31.047  13.142 1.00 17.66  ? 262 ASP A CB  1 
ATOM   1997 C CG  . ASP A 1 262 ? 36.365 30.977  13.267 1.00 28.99  ? 262 ASP A CG  1 
ATOM   1998 O OD1 . ASP A 1 262 ? 35.613 31.715  12.655 1.00 31.45  ? 262 ASP A OD1 1 
ATOM   1999 O OD2 . ASP A 1 262 ? 35.965 30.046  14.106 1.00 30.47  ? 262 ASP A OD2 1 
ATOM   2000 N N   . PRO A 1 263 ? 36.988 33.597  10.883 1.00 23.22  ? 263 PRO A N   1 
ATOM   2001 C CA  . PRO A 1 263 ? 36.491 34.960  10.747 1.00 22.68  ? 263 PRO A CA  1 
ATOM   2002 C C   . PRO A 1 263 ? 35.728 35.447  11.969 1.00 26.93  ? 263 PRO A C   1 
ATOM   2003 O O   . PRO A 1 263 ? 35.554 36.643  12.176 1.00 28.27  ? 263 PRO A O   1 
ATOM   2004 C CB  . PRO A 1 263 ? 35.534 34.954  9.549  1.00 23.68  ? 263 PRO A CB  1 
ATOM   2005 C CG  . PRO A 1 263 ? 35.301 33.498  9.160  1.00 27.13  ? 263 PRO A CG  1 
ATOM   2006 C CD  . PRO A 1 263 ? 36.297 32.660  9.950  1.00 21.21  ? 263 PRO A CD  1 
ATOM   2007 N N   . GLY A 1 264 ? 35.245 34.510  12.757 1.00 22.23  ? 264 GLY A N   1 
ATOM   2008 C CA  . GLY A 1 264 ? 34.493 34.859  13.927 1.00 22.02  ? 264 GLY A CA  1 
ATOM   2009 C C   . GLY A 1 264 ? 33.062 35.270  13.597 1.00 28.36  ? 264 GLY A C   1 
ATOM   2010 O O   . GLY A 1 264 ? 32.323 35.685  14.482 1.00 30.06  ? 264 GLY A O   1 
ATOM   2011 N N   . ASP A 1 265 ? 32.641 35.164  12.346 1.00 22.92  ? 265 ASP A N   1 
ATOM   2012 C CA  . ASP A 1 265 ? 31.274 35.559  12.059 1.00 22.19  ? 265 ASP A CA  1 
ATOM   2013 C C   . ASP A 1 265 ? 30.416 34.433  11.517 1.00 21.72  ? 265 ASP A C   1 
ATOM   2014 O O   . ASP A 1 265 ? 29.267 34.630  11.126 1.00 17.32  ? 265 ASP A O   1 
ATOM   2015 C CB  . ASP A 1 265 ? 31.188 36.809  11.181 1.00 25.08  ? 265 ASP A CB  1 
ATOM   2016 C CG  . ASP A 1 265 ? 31.857 36.576  9.872  1.00 23.70  ? 265 ASP A CG  1 
ATOM   2017 O OD1 . ASP A 1 265 ? 32.493 35.566  9.641  1.00 17.59  ? 265 ASP A OD1 1 
ATOM   2018 O OD2 . ASP A 1 265 ? 31.690 37.565  9.030  1.00 29.64  ? 265 ASP A OD2 1 
ATOM   2019 N N   . GLY A 1 266 ? 30.982 33.243  11.492 1.00 18.20  ? 266 GLY A N   1 
ATOM   2020 C CA  . GLY A 1 266 ? 30.266 32.088  11.012 1.00 18.31  ? 266 GLY A CA  1 
ATOM   2021 C C   . GLY A 1 266 ? 30.297 31.966  9.501  1.00 21.88  ? 266 GLY A C   1 
ATOM   2022 O O   . GLY A 1 266 ? 29.781 31.003  8.924  1.00 21.39  ? 266 GLY A O   1 
ATOM   2023 N N   . SER A 1 267 ? 30.912 32.943  8.858  1.00 17.53  ? 267 SER A N   1 
ATOM   2024 C CA  . SER A 1 267 ? 30.993 32.930  7.411  1.00 17.81  ? 267 SER A CA  1 
ATOM   2025 C C   . SER A 1 267 ? 31.849 31.798  6.859  1.00 20.56  ? 267 SER A C   1 
ATOM   2026 O O   . SER A 1 267 ? 31.775 31.492  5.673  1.00 20.63  ? 267 SER A O   1 
ATOM   2027 C CB  . SER A 1 267 ? 31.443 34.269  6.848  1.00 24.36  ? 267 SER A CB  1 
ATOM   2028 O OG  . SER A 1 267 ? 32.615 34.714  7.502  1.00 34.16  ? 267 SER A OG  1 
ATOM   2029 N N   . GLY A 1 268 ? 32.673 31.187  7.711  1.00 17.59  ? 268 GLY A N   1 
ATOM   2030 C CA  . GLY A 1 268 ? 33.559 30.115  7.270  1.00 17.09  ? 268 GLY A CA  1 
ATOM   2031 C C   . GLY A 1 268 ? 32.891 28.750  7.160  1.00 21.88  ? 268 GLY A C   1 
ATOM   2032 O O   . GLY A 1 268 ? 33.523 27.766  6.769  1.00 19.79  ? 268 GLY A O   1 
ATOM   2033 N N   . ARG A 1 269 ? 31.608 28.696  7.509  1.00 17.59  ? 269 ARG A N   1 
ATOM   2034 C CA  . ARG A 1 269 ? 30.846 27.459  7.459  1.00 14.94  ? 269 ARG A CA  1 
ATOM   2035 C C   . ARG A 1 269 ? 30.793 26.876  6.058  1.00 18.63  ? 269 ARG A C   1 
ATOM   2036 O O   . ARG A 1 269 ? 30.668 27.605  5.073  1.00 18.16  ? 269 ARG A O   1 
ATOM   2037 C CB  . ARG A 1 269 ? 29.455 27.679  8.021  1.00 13.18  ? 269 ARG A CB  1 
ATOM   2038 C CG  . ARG A 1 269 ? 28.635 26.412  8.171  1.00 16.29  ? 269 ARG A CG  1 
ATOM   2039 C CD  . ARG A 1 269 ? 27.245 26.739  8.699  1.00 17.63  ? 269 ARG A CD  1 
ATOM   2040 N NE  . ARG A 1 269 ? 26.233 26.221  7.813  1.00 41.66  ? 269 ARG A NE  1 
ATOM   2041 C CZ  . ARG A 1 269 ? 25.378 26.976  7.159  1.00 37.44  ? 269 ARG A CZ  1 
ATOM   2042 N NH1 . ARG A 1 269 ? 25.367 28.299  7.283  1.00 18.67  ? 269 ARG A NH1 1 
ATOM   2043 N NH2 . ARG A 1 269 ? 24.498 26.387  6.353  1.00 31.94  ? 269 ARG A NH2 1 
ATOM   2044 N N   . VAL A 1 270 ? 30.899 25.544  5.972  1.00 16.11  ? 270 VAL A N   1 
ATOM   2045 C CA  . VAL A 1 270 ? 30.854 24.860  4.670  1.00 17.84  ? 270 VAL A CA  1 
ATOM   2046 C C   . VAL A 1 270 ? 29.695 23.891  4.513  1.00 24.62  ? 270 VAL A C   1 
ATOM   2047 O O   . VAL A 1 270 ? 29.420 23.435  3.408  1.00 26.83  ? 270 VAL A O   1 
ATOM   2048 C CB  . VAL A 1 270 ? 32.162 24.169  4.247  1.00 18.91  ? 270 VAL A CB  1 
ATOM   2049 C CG1 . VAL A 1 270 ? 33.387 24.971  4.682  1.00 19.30  ? 270 VAL A CG1 1 
ATOM   2050 C CG2 . VAL A 1 270 ? 32.227 22.740  4.795  1.00 17.46  ? 270 VAL A CG2 1 
ATOM   2051 N N   . SER A 1 271 ? 29.029 23.557  5.612  1.00 17.40  ? 271 SER A N   1 
ATOM   2052 C CA  . SER A 1 271 ? 27.953 22.604  5.545  1.00 16.54  ? 271 SER A CA  1 
ATOM   2053 C C   . SER A 1 271 ? 26.655 23.091  6.139  1.00 18.33  ? 271 SER A C   1 
ATOM   2054 O O   . SER A 1 271 ? 26.481 24.274  6.392  1.00 19.44  ? 271 SER A O   1 
ATOM   2055 C CB  . SER A 1 271 ? 28.368 21.309  6.192  1.00 23.33  ? 271 SER A CB  1 
ATOM   2056 O OG  . SER A 1 271 ? 27.768 20.234  5.511  1.00 32.57  ? 271 SER A OG  1 
ATOM   2057 N N   . GLY A 1 272 ? 25.743 22.145  6.365  1.00 15.27  ? 272 GLY A N   1 
ATOM   2058 C CA  . GLY A 1 272 ? 24.426 22.442  6.902  1.00 13.43  ? 272 GLY A CA  1 
ATOM   2059 C C   . GLY A 1 272 ? 24.393 22.830  8.372  1.00 17.36  ? 272 GLY A C   1 
ATOM   2060 O O   . GLY A 1 272 ? 25.102 22.261  9.207  1.00 16.82  ? 272 GLY A O   1 
ATOM   2061 N N   . HIS A 1 273 ? 23.534 23.811  8.671  1.00 16.79  ? 273 HIS A N   1 
ATOM   2062 C CA  . HIS A 1 273 ? 23.321 24.301  10.028 1.00 16.35  ? 273 HIS A CA  1 
ATOM   2063 C C   . HIS A 1 273 ? 22.191 23.527  10.701 1.00 20.27  ? 273 HIS A C   1 
ATOM   2064 O O   . HIS A 1 273 ? 21.155 23.244  10.093 1.00 17.86  ? 273 HIS A O   1 
ATOM   2065 C CB  . HIS A 1 273 ? 23.005 25.812  10.071 1.00 16.02  ? 273 HIS A CB  1 
ATOM   2066 C CG  . HIS A 1 273 ? 23.066 26.358  11.467 1.00 18.63  ? 273 HIS A CG  1 
ATOM   2067 N ND1 . HIS A 1 273 ? 22.011 26.220  12.362 1.00 18.79  ? 273 HIS A ND1 1 
ATOM   2068 C CD2 . HIS A 1 273 ? 24.071 27.031  12.100 1.00 17.98  ? 273 HIS A CD2 1 
ATOM   2069 C CE1 . HIS A 1 273 ? 22.391 26.807  13.497 1.00 17.34  ? 273 HIS A CE1 1 
ATOM   2070 N NE2 . HIS A 1 273 ? 23.621 27.307  13.372 1.00 16.86  ? 273 HIS A NE2 1 
ATOM   2071 N N   . PRO A 1 274 ? 22.392 23.185  11.969 1.00 18.29  ? 274 PRO A N   1 
ATOM   2072 C CA  . PRO A 1 274 ? 21.414 22.433  12.742 1.00 16.89  ? 274 PRO A CA  1 
ATOM   2073 C C   . PRO A 1 274 ? 20.022 23.033  12.724 1.00 22.45  ? 274 PRO A C   1 
ATOM   2074 O O   . PRO A 1 274 ? 19.035 22.310  12.812 1.00 19.92  ? 274 PRO A O   1 
ATOM   2075 C CB  . PRO A 1 274 ? 21.931 22.370  14.176 1.00 18.12  ? 274 PRO A CB  1 
ATOM   2076 C CG  . PRO A 1 274 ? 23.265 23.103  14.204 1.00 22.65  ? 274 PRO A CG  1 
ATOM   2077 C CD  . PRO A 1 274 ? 23.594 23.512  12.775 1.00 19.54  ? 274 PRO A CD  1 
ATOM   2078 N N   . ASP A 1 275 ? 19.934 24.355  12.624 1.00 19.46  ? 275 ASP A N   1 
ATOM   2079 C CA  . ASP A 1 275 ? 18.631 24.991  12.587 1.00 19.97  ? 275 ASP A CA  1 
ATOM   2080 C C   . ASP A 1 275 ? 17.949 24.791  11.252 1.00 24.09  ? 275 ASP A C   1 
ATOM   2081 O O   . ASP A 1 275 ? 16.759 25.043  11.097 1.00 26.96  ? 275 ASP A O   1 
ATOM   2082 C CB  . ASP A 1 275 ? 18.672 26.477  12.967 1.00 21.54  ? 275 ASP A CB  1 
ATOM   2083 C CG  . ASP A 1 275 ? 18.814 26.677  14.444 1.00 22.15  ? 275 ASP A CG  1 
ATOM   2084 O OD1 . ASP A 1 275 ? 18.228 26.007  15.269 1.00 21.72  ? 275 ASP A OD1 1 
ATOM   2085 O OD2 . ASP A 1 275 ? 19.667 27.615  14.747 1.00 25.65  ? 275 ASP A OD2 1 
ATOM   2086 N N   . GLU A 1 276 ? 18.704 24.321  10.282 1.00 18.94  ? 276 GLU A N   1 
ATOM   2087 C CA  . GLU A 1 276 ? 18.126 24.108  8.987  1.00 18.48  ? 276 GLU A CA  1 
ATOM   2088 C C   . GLU A 1 276 ? 17.863 22.636  8.644  1.00 25.81  ? 276 GLU A C   1 
ATOM   2089 O O   . GLU A 1 276 ? 16.961 22.341  7.868  1.00 27.88  ? 276 GLU A O   1 
ATOM   2090 C CB  . GLU A 1 276 ? 18.896 24.847  7.882  1.00 20.44  ? 276 GLU A CB  1 
ATOM   2091 C CG  . GLU A 1 276 ? 18.710 26.377  7.959  1.00 42.07  ? 276 GLU A CG  1 
ATOM   2092 C CD  . GLU A 1 276 ? 17.283 26.789  8.213  1.00 84.89  ? 276 GLU A CD  1 
ATOM   2093 O OE1 . GLU A 1 276 ? 16.386 26.644  7.402  1.00 89.88  ? 276 GLU A OE1 1 
ATOM   2094 O OE2 . GLU A 1 276 ? 17.109 27.308  9.405  1.00 83.49  ? 276 GLU A OE2 1 
ATOM   2095 N N   . VAL A 1 277 ? 18.633 21.695  9.218  1.00 22.34  ? 277 VAL A N   1 
ATOM   2096 C CA  . VAL A 1 277 ? 18.430 20.264  8.911  1.00 21.98  ? 277 VAL A CA  1 
ATOM   2097 C C   . VAL A 1 277 ? 17.268 19.584  9.659  1.00 29.09  ? 277 VAL A C   1 
ATOM   2098 O O   . VAL A 1 277 ? 17.255 19.528  10.892 1.00 29.34  ? 277 VAL A O   1 
ATOM   2099 C CB  . VAL A 1 277 ? 19.719 19.442  8.988  1.00 21.88  ? 277 VAL A CB  1 
ATOM   2100 C CG1 . VAL A 1 277 ? 19.526 18.050  8.365  1.00 19.86  ? 277 VAL A CG1 1 
ATOM   2101 C CG2 . VAL A 1 277 ? 20.851 20.190  8.285  1.00 21.21  ? 277 VAL A CG2 1 
ATOM   2102 N N   . ASP A 1 278 ? 16.307 19.053  8.866  1.00 27.17  ? 278 ASP A N   1 
ATOM   2103 C CA  . ASP A 1 278 ? 15.099 18.336  9.318  1.00 26.86  ? 278 ASP A CA  1 
ATOM   2104 C C   . ASP A 1 278 ? 14.468 18.867  10.600 1.00 84.95  ? 278 ASP A C   1 
ATOM   2105 O O   . ASP A 1 278 ? 13.527 18.206  11.115 1.00 91.80  ? 278 ASP A O   1 
ATOM   2106 C CB  . ASP A 1 278 ? 15.293 16.799  9.361  1.00 27.76  ? 278 ASP A CB  1 
HETATM 2107 S S   . SO4 B 2 .   ? 50.538 12.661  20.306 1.00 19.57  ? 301 SO4 A S   1 
HETATM 2108 O O1  . SO4 B 2 .   ? 49.840 12.176  21.527 1.00 22.20  ? 301 SO4 A O1  1 
HETATM 2109 O O2  . SO4 B 2 .   ? 51.517 11.669  19.865 1.00 17.82  ? 301 SO4 A O2  1 
HETATM 2110 O O3  . SO4 B 2 .   ? 51.237 13.952  20.624 1.00 14.69  ? 301 SO4 A O3  1 
HETATM 2111 O O4  . SO4 B 2 .   ? 49.550 12.913  19.230 1.00 20.26  ? 301 SO4 A O4  1 
HETATM 2112 P PA  . NAD C 3 .   ? 36.830 16.321  5.079  1.00 30.06  ? 300 NAD A PA  1 
HETATM 2113 O O1A . NAD C 3 .   ? 37.148 17.607  5.734  1.00 17.09  ? 300 NAD A O1A 1 
HETATM 2114 O O2A . NAD C 3 .   ? 37.447 15.095  5.671  1.00 53.49  ? 300 NAD A O2A 1 
HETATM 2115 O O5B . NAD C 3 .   ? 37.226 16.414  3.639  1.00 53.19  ? 300 NAD A O5B 1 
HETATM 2116 C C5B . NAD C 3 .   ? 37.132 15.243  2.849  1.00 66.82  ? 300 NAD A C5B 1 
HETATM 2117 C C4B . NAD C 3 .   ? 37.920 15.368  1.564  1.00 75.97  ? 300 NAD A C4B 1 
HETATM 2118 O O4B . NAD C 3 .   ? 39.303 15.642  1.880  1.00 53.72  ? 300 NAD A O4B 1 
HETATM 2119 C C3B . NAD C 3 .   ? 37.882 14.114  0.694  1.00 96.77  ? 300 NAD A C3B 1 
HETATM 2120 O O3B . NAD C 3 .   ? 37.316 14.410  -0.580 1.00 117.09 ? 300 NAD A O3B 1 
HETATM 2121 C C2B . NAD C 3 .   ? 39.330 13.649  0.579  1.00 66.65  ? 300 NAD A C2B 1 
HETATM 2122 O O2B . NAD C 3 .   ? 39.718 13.361  -0.748 1.00 63.29  ? 300 NAD A O2B 1 
HETATM 2123 C C1B . NAD C 3 .   ? 40.154 14.804  1.130  1.00 48.31  ? 300 NAD A C1B 1 
HETATM 2124 N N9A . NAD C 3 .   ? 41.186 14.299  2.007  1.00 34.84  ? 300 NAD A N9A 1 
HETATM 2125 C C8A . NAD C 3 .   ? 41.404 13.446  3.047  1.00 25.41  ? 300 NAD A C8A 1 
HETATM 2126 N N7A . NAD C 3 .   ? 42.663 13.334  3.374  1.00 22.49  ? 300 NAD A N7A 1 
HETATM 2127 C C5A . NAD C 3 .   ? 43.310 14.158  2.472  1.00 20.67  ? 300 NAD A C5A 1 
HETATM 2128 C C6A . NAD C 3 .   ? 44.661 14.471  2.286  1.00 31.82  ? 300 NAD A C6A 1 
HETATM 2129 N N6A . NAD C 3 .   ? 45.641 13.966  3.051  1.00 23.68  ? 300 NAD A N6A 1 
HETATM 2130 N N1A . NAD C 3 .   ? 44.971 15.326  1.289  1.00 42.79  ? 300 NAD A N1A 1 
HETATM 2131 C C2A . NAD C 3 .   ? 43.983 15.818  0.526  1.00 34.34  ? 300 NAD A C2A 1 
HETATM 2132 N N3A . NAD C 3 .   ? 42.676 15.589  0.603  1.00 25.73  ? 300 NAD A N3A 1 
HETATM 2133 C C4A . NAD C 3 .   ? 42.409 14.743  1.606  1.00 20.08  ? 300 NAD A C4A 1 
HETATM 2134 O O3  . NAD C 3 .   ? 35.323 16.152  4.996  1.00 64.56  ? 300 NAD A O3  1 
HETATM 2135 P PN  . NAD C 3 .   ? 34.341 14.877  5.443  1.00 65.04  ? 300 NAD A PN  1 
HETATM 2136 O O1N . NAD C 3 .   ? 32.930 15.299  5.217  1.00 63.94  ? 300 NAD A O1N 1 
HETATM 2137 O O2N . NAD C 3 .   ? 34.766 13.624  4.746  1.00 47.22  ? 300 NAD A O2N 1 
HETATM 2138 O O5D . NAD C 3 .   ? 34.532 14.724  6.946  1.00 64.18  ? 300 NAD A O5D 1 
HETATM 2139 C C5D . NAD C 3 .   ? 35.177 13.558  7.593  1.00 71.60  ? 300 NAD A C5D 1 
HETATM 2140 C C4D . NAD C 3 .   ? 34.210 12.526  8.238  1.00 83.36  ? 300 NAD A C4D 1 
HETATM 2141 O O4D . NAD C 3 .   ? 33.312 13.141  9.205  1.00 92.76  ? 300 NAD A O4D 1 
HETATM 2142 C C3D . NAD C 3 .   ? 33.299 11.744  7.294  1.00 77.99  ? 300 NAD A C3D 1 
HETATM 2143 O O3D . NAD C 3 .   ? 33.987 10.630  6.732  1.00 66.31  ? 300 NAD A O3D 1 
HETATM 2144 C C2D . NAD C 3 .   ? 32.136 11.304  8.206  1.00 70.45  ? 300 NAD A C2D 1 
HETATM 2145 O O2D . NAD C 3 .   ? 32.314 10.004  8.790  1.00 27.64  ? 300 NAD A O2D 1 
HETATM 2146 C C1D . NAD C 3 .   ? 32.075 12.419  9.269  1.00 77.91  ? 300 NAD A C1D 1 
HETATM 2147 N N1N . NAD C 3 .   ? 30.938 13.369  9.109  1.00 54.39  ? 300 NAD A N1N 1 
HETATM 2148 C C2N . NAD C 3 .   ? 29.924 13.637  10.010 1.00 50.88  ? 300 NAD A C2N 1 
HETATM 2149 C C3N . NAD C 3 .   ? 28.924 14.590  9.752  1.00 52.93  ? 300 NAD A C3N 1 
HETATM 2150 C C7N . NAD C 3 .   ? 27.794 14.909  10.742 1.00 34.12  ? 300 NAD A C7N 1 
HETATM 2151 O O7N . NAD C 3 .   ? 26.778 15.452  10.317 1.00 21.93  ? 300 NAD A O7N 1 
HETATM 2152 N N7N . NAD C 3 .   ? 28.002 14.611  12.040 1.00 23.23  ? 300 NAD A N7N 1 
HETATM 2153 C C4N . NAD C 3 .   ? 28.944 15.309  8.546  1.00 46.02  ? 300 NAD A C4N 1 
HETATM 2154 C C5N . NAD C 3 .   ? 29.974 15.046  7.622  1.00 43.26  ? 300 NAD A C5N 1 
HETATM 2155 C C6N . NAD C 3 .   ? 30.938 14.074  7.950  1.00 50.77  ? 300 NAD A C6N 1 
HETATM 2156 O O   . HOH D 4 .   ? 37.408 25.641  22.588 1.00 16.63  ? 302 HOH A O   1 
HETATM 2157 O O   . HOH D 4 .   ? 39.179 13.981  29.330 1.00 7.55   ? 303 HOH A O   1 
HETATM 2158 O O   . HOH D 4 .   ? 21.062 3.848   13.589 1.00 12.56  ? 304 HOH A O   1 
HETATM 2159 O O   . HOH D 4 .   ? 13.558 18.421  22.424 1.00 16.60  ? 305 HOH A O   1 
HETATM 2160 O O   . HOH D 4 .   ? 40.789 3.232   22.060 1.00 27.49  ? 306 HOH A O   1 
HETATM 2161 O O   . HOH D 4 .   ? 13.834 3.582   21.599 1.00 12.30  ? 307 HOH A O   1 
HETATM 2162 O O   . HOH D 4 .   ? 33.740 13.023  27.187 1.00 12.30  ? 308 HOH A O   1 
HETATM 2163 O O   . HOH D 4 .   ? 39.017 26.961  18.386 1.00 14.41  ? 309 HOH A O   1 
HETATM 2164 O O   . HOH D 4 .   ? 36.476 7.730   3.120  1.00 23.42  ? 310 HOH A O   1 
HETATM 2165 O O   . HOH D 4 .   ? 19.990 28.994  16.819 1.00 11.25  ? 311 HOH A O   1 
HETATM 2166 O O   . HOH D 4 .   ? 37.574 17.364  22.514 1.00 12.59  ? 312 HOH A O   1 
HETATM 2167 O O   . HOH D 4 .   ? 35.639 -1.895  21.203 1.00 18.67  ? 313 HOH A O   1 
HETATM 2168 O O   . HOH D 4 .   ? 36.423 13.697  10.969 1.00 20.44  ? 314 HOH A O   1 
HETATM 2169 O O   . HOH D 4 .   ? 28.380 7.598   27.402 1.00 10.51  ? 315 HOH A O   1 
HETATM 2170 O O   . HOH D 4 .   ? 19.256 12.476  14.119 1.00 13.65  ? 316 HOH A O   1 
HETATM 2171 O O   . HOH D 4 .   ? 42.021 4.669   14.348 1.00 18.39  ? 317 HOH A O   1 
HETATM 2172 O O   . HOH D 4 .   ? 22.170 21.617  31.422 1.00 17.04  ? 318 HOH A O   1 
HETATM 2173 O O   . HOH D 4 .   ? 24.484 -0.932  4.963  1.00 22.31  ? 319 HOH A O   1 
HETATM 2174 O O   . HOH D 4 .   ? 17.124 -0.050  28.813 1.00 14.66  ? 320 HOH A O   1 
HETATM 2175 O O   . HOH D 4 .   ? 18.963 19.659  12.856 1.00 16.06  ? 321 HOH A O   1 
HETATM 2176 O O   . HOH D 4 .   ? 38.778 22.392  1.996  1.00 20.85  ? 322 HOH A O   1 
HETATM 2177 O O   . HOH D 4 .   ? 27.361 6.582   1.413  1.00 20.34  ? 323 HOH A O   1 
HETATM 2178 O O   . HOH D 4 .   ? 46.927 9.956   23.992 0.50 9.86   ? 324 HOH A O   1 
HETATM 2179 O O   . HOH D 4 .   ? 49.783 14.552  23.132 1.00 8.44   ? 325 HOH A O   1 
HETATM 2180 O O   . HOH D 4 .   ? 33.226 31.045  10.436 1.00 14.92  ? 326 HOH A O   1 
HETATM 2181 O O   . HOH D 4 .   ? 51.281 17.904  21.553 1.00 13.58  ? 327 HOH A O   1 
HETATM 2182 O O   . HOH D 4 .   ? 26.076 29.197  21.907 1.00 16.59  ? 328 HOH A O   1 
HETATM 2183 O O   . HOH D 4 .   ? 7.149  0.896   22.470 1.00 12.25  ? 329 HOH A O   1 
HETATM 2184 O O   . HOH D 4 .   ? 15.732 3.267   23.992 1.00 10.67  ? 330 HOH A O   1 
HETATM 2185 O O   . HOH D 4 .   ? 13.262 14.799  13.853 1.00 16.40  ? 331 HOH A O   1 
HETATM 2186 O O   . HOH D 4 .   ? 45.297 17.009  22.533 1.00 15.20  ? 332 HOH A O   1 
HETATM 2187 O O   . HOH D 4 .   ? 57.925 24.667  14.217 1.00 14.30  ? 333 HOH A O   1 
HETATM 2188 O O   . HOH D 4 .   ? 32.264 29.292  14.147 1.00 22.25  ? 334 HOH A O   1 
HETATM 2189 O O   . HOH D 4 .   ? 19.002 31.761  16.904 1.00 22.69  ? 335 HOH A O   1 
HETATM 2190 O O   . HOH D 4 .   ? 47.806 18.449  2.296  1.00 21.28  ? 336 HOH A O   1 
HETATM 2191 O O   . HOH D 4 .   ? 47.268 11.955  22.081 1.00 15.05  ? 337 HOH A O   1 
HETATM 2192 O O   . HOH D 4 .   ? 47.335 14.472  20.225 1.00 15.61  ? 338 HOH A O   1 
HETATM 2193 O O   . HOH D 4 .   ? 37.708 1.554   26.740 1.00 18.62  ? 339 HOH A O   1 
HETATM 2194 O O   . HOH D 4 .   ? 23.573 1.983   6.495  1.00 33.47  ? 340 HOH A O   1 
HETATM 2195 O O   . HOH D 4 .   ? 11.316 -0.079  19.293 1.00 16.23  ? 341 HOH A O   1 
HETATM 2196 O O   . HOH D 4 .   ? 27.660 8.988   3.118  1.00 22.03  ? 342 HOH A O   1 
HETATM 2197 O O   . HOH D 4 .   ? 25.375 27.365  20.474 1.00 16.90  ? 343 HOH A O   1 
HETATM 2198 O O   . HOH D 4 .   ? 14.335 0.727   28.310 1.00 18.55  ? 344 HOH A O   1 
HETATM 2199 O O   . HOH D 4 .   ? 32.902 31.764  12.641 1.00 25.08  ? 345 HOH A O   1 
HETATM 2200 O O   . HOH D 4 .   ? 36.423 14.994  29.083 1.00 16.36  ? 346 HOH A O   1 
HETATM 2201 O O   . HOH D 4 .   ? 48.349 16.552  21.815 1.00 17.49  ? 347 HOH A O   1 
HETATM 2202 O O   . HOH D 4 .   ? 56.723 28.367  15.955 1.00 14.98  ? 348 HOH A O   1 
HETATM 2203 O O   . HOH D 4 .   ? 33.321 8.484   15.758 1.00 12.39  ? 349 HOH A O   1 
HETATM 2204 O O   . HOH D 4 .   ? 30.583 -4.374  -3.054 1.00 22.25  ? 350 HOH A O   1 
HETATM 2205 O O   . HOH D 4 .   ? 28.737 10.304  28.609 1.00 19.81  ? 351 HOH A O   1 
HETATM 2206 O O   . HOH D 4 .   ? 30.688 -2.477  0.111  1.00 17.61  ? 352 HOH A O   1 
HETATM 2207 O O   . HOH D 4 .   ? 45.631 14.264  22.862 1.00 12.60  ? 353 HOH A O   1 
HETATM 2208 O O   . HOH D 4 .   ? 27.913 9.835   31.017 1.00 17.91  ? 354 HOH A O   1 
HETATM 2209 O O   . HOH D 4 .   ? 19.626 14.543  21.554 1.00 18.41  ? 355 HOH A O   1 
HETATM 2210 O O   . HOH D 4 .   ? 52.912 9.274   13.105 1.00 20.60  ? 356 HOH A O   1 
HETATM 2211 O O   . HOH D 4 .   ? 18.985 5.772   12.442 1.00 18.53  ? 357 HOH A O   1 
HETATM 2212 O O   . HOH D 4 .   ? 27.460 22.775  10.308 1.00 14.36  ? 358 HOH A O   1 
HETATM 2213 O O   . HOH D 4 .   ? 26.551 0.073   27.385 1.00 29.34  ? 359 HOH A O   1 
HETATM 2214 O O   . HOH D 4 .   ? 29.872 25.572  1.475  1.00 14.80  ? 360 HOH A O   1 
HETATM 2215 O O   . HOH D 4 .   ? 29.416 24.178  -1.186 1.00 15.36  ? 361 HOH A O   1 
HETATM 2216 O O   . HOH D 4 .   ? 24.526 14.132  7.038  1.00 21.21  ? 362 HOH A O   1 
HETATM 2217 O O   . HOH D 4 .   ? 11.373 15.788  23.130 1.00 16.31  ? 363 HOH A O   1 
HETATM 2218 O O   . HOH D 4 .   ? 41.841 34.356  17.334 1.00 20.54  ? 364 HOH A O   1 
HETATM 2219 O O   . HOH D 4 .   ? 40.874 15.868  24.381 1.00 17.64  ? 365 HOH A O   1 
HETATM 2220 O O   . HOH D 4 .   ? 32.516 26.753  1.406  1.00 28.29  ? 366 HOH A O   1 
HETATM 2221 O O   . HOH D 4 .   ? 50.970 27.734  11.764 1.00 16.69  ? 367 HOH A O   1 
HETATM 2222 O O   . HOH D 4 .   ? 22.308 8.422   10.398 1.00 11.81  ? 368 HOH A O   1 
HETATM 2223 O O   . HOH D 4 .   ? 26.906 1.789   -3.803 1.00 19.05  ? 369 HOH A O   1 
HETATM 2224 O O   . HOH D 4 .   ? 25.761 24.782  32.083 1.00 24.75  ? 370 HOH A O   1 
HETATM 2225 O O   . HOH D 4 .   ? 9.287  12.500  20.260 1.00 19.88  ? 371 HOH A O   1 
HETATM 2226 O O   . HOH D 4 .   ? 18.273 25.701  17.811 1.00 14.71  ? 372 HOH A O   1 
HETATM 2227 O O   . HOH D 4 .   ? 29.159 4.513   29.551 1.00 17.26  ? 373 HOH A O   1 
HETATM 2228 O O   . HOH D 4 .   ? 17.214 5.068   10.212 1.00 31.32  ? 374 HOH A O   1 
HETATM 2229 O O   . HOH D 4 .   ? 37.994 25.625  26.084 1.00 18.90  ? 375 HOH A O   1 
HETATM 2230 O O   . HOH D 4 .   ? 15.771 7.785   29.800 1.00 19.07  ? 376 HOH A O   1 
HETATM 2231 O O   . HOH D 4 .   ? 37.645 28.555  27.548 1.00 19.48  ? 377 HOH A O   1 
HETATM 2232 O O   . HOH D 4 .   ? 30.869 1.192   28.616 1.00 31.39  ? 378 HOH A O   1 
HETATM 2233 O O   . HOH D 4 .   ? 10.901 8.550   14.598 1.00 22.73  ? 379 HOH A O   1 
HETATM 2234 O O   . HOH D 4 .   ? 7.352  10.516  21.480 1.00 23.78  ? 380 HOH A O   1 
HETATM 2235 O O   . HOH D 4 .   ? 18.611 2.359   11.293 1.00 18.64  ? 381 HOH A O   1 
HETATM 2236 O O   . HOH D 4 .   ? 27.034 13.364  7.906  1.00 23.02  ? 382 HOH A O   1 
HETATM 2237 O O   . HOH D 4 .   ? 57.614 27.258  7.000  1.00 22.91  ? 383 HOH A O   1 
HETATM 2238 O O   . HOH D 4 .   ? 27.931 27.359  15.969 1.00 17.81  ? 384 HOH A O   1 
HETATM 2239 O O   . HOH D 4 .   ? 36.927 -9.420  12.393 1.00 53.31  ? 385 HOH A O   1 
HETATM 2240 O O   . HOH D 4 .   ? 36.810 -11.130 18.780 1.00 30.54  ? 386 HOH A O   1 
HETATM 2241 O O   . HOH D 4 .   ? 52.665 22.942  21.332 1.00 17.62  ? 387 HOH A O   1 
HETATM 2242 O O   . HOH D 4 .   ? 36.266 18.739  25.596 1.00 23.41  ? 388 HOH A O   1 
HETATM 2243 O O   . HOH D 4 .   ? 35.220 28.038  4.760  1.00 19.88  ? 389 HOH A O   1 
HETATM 2244 O O   . HOH D 4 .   ? 25.265 28.499  15.220 1.00 20.99  ? 390 HOH A O   1 
HETATM 2245 O O   . HOH D 4 .   ? 22.190 25.233  6.329  1.00 31.12  ? 391 HOH A O   1 
HETATM 2246 O O   . HOH D 4 .   ? 27.488 -0.927  2.489  1.00 17.94  ? 392 HOH A O   1 
HETATM 2247 O O   . HOH D 4 .   ? 41.746 -5.199  6.292  1.00 22.08  ? 393 HOH A O   1 
HETATM 2248 O O   . HOH D 4 .   ? 30.865 -7.136  11.260 1.00 22.10  ? 394 HOH A O   1 
HETATM 2249 O O   . HOH D 4 .   ? 45.135 33.003  17.396 1.00 25.32  ? 395 HOH A O   1 
HETATM 2250 O O   . HOH D 4 .   ? 34.502 16.140  35.999 1.00 29.68  ? 396 HOH A O   1 
HETATM 2251 O O   . HOH D 4 .   ? 11.447 8.828   27.046 1.00 26.64  ? 397 HOH A O   1 
HETATM 2252 O O   . HOH D 4 .   ? 36.559 21.459  23.729 1.00 24.43  ? 398 HOH A O   1 
HETATM 2253 O O   . HOH D 4 .   ? 12.000 11.432  14.384 1.00 21.62  ? 399 HOH A O   1 
HETATM 2254 O O   . HOH D 4 .   ? 15.546 26.031  14.902 1.00 21.36  ? 400 HOH A O   1 
HETATM 2255 O O   . HOH D 4 .   ? 26.381 23.362  14.351 1.00 19.31  ? 401 HOH A O   1 
HETATM 2256 O O   . HOH D 4 .   ? 30.675 15.365  31.896 1.00 22.56  ? 402 HOH A O   1 
HETATM 2257 O O   . HOH D 4 .   ? 31.250 -4.479  26.037 1.00 29.84  ? 403 HOH A O   1 
HETATM 2258 O O   . HOH D 4 .   ? 6.021  3.307   22.568 1.00 26.39  ? 404 HOH A O   1 
HETATM 2259 O O   . HOH D 4 .   ? 38.713 29.410  -1.297 1.00 29.10  ? 405 HOH A O   1 
HETATM 2260 O O   . HOH D 4 .   ? 55.693 29.727  13.506 1.00 29.63  ? 406 HOH A O   1 
HETATM 2261 O O   . HOH D 4 .   ? 36.942 25.379  18.428 1.00 18.00  ? 407 HOH A O   1 
HETATM 2262 O O   . HOH D 4 .   ? 22.413 1.037   1.359  1.00 28.85  ? 408 HOH A O   1 
HETATM 2263 O O   . HOH D 4 .   ? 21.974 24.822  33.532 1.00 34.04  ? 409 HOH A O   1 
HETATM 2264 O O   . HOH D 4 .   ? 26.951 28.113  18.618 1.00 31.80  ? 410 HOH A O   1 
HETATM 2265 O O   . HOH D 4 .   ? 16.526 10.238  31.100 1.00 23.43  ? 411 HOH A O   1 
HETATM 2266 O O   . HOH D 4 .   ? 16.294 5.831   31.715 1.00 22.54  ? 412 HOH A O   1 
HETATM 2267 O O   . HOH D 4 .   ? 55.893 27.724  11.738 1.00 22.33  ? 413 HOH A O   1 
HETATM 2268 O O   . HOH D 4 .   ? 41.389 23.302  23.083 1.00 27.12  ? 414 HOH A O   1 
HETATM 2269 O O   . HOH D 4 .   ? 26.965 24.723  11.900 1.00 19.46  ? 415 HOH A O   1 
HETATM 2270 O O   . HOH D 4 .   ? 6.649  0.094   19.943 1.00 19.44  ? 416 HOH A O   1 
HETATM 2271 O O   . HOH D 4 .   ? 38.250 23.625  24.099 1.00 31.44  ? 417 HOH A O   1 
HETATM 2272 O O   . HOH D 4 .   ? 32.898 27.555  29.055 1.00 25.75  ? 418 HOH A O   1 
HETATM 2273 O O   . HOH D 4 .   ? 27.795 21.145  12.774 1.00 19.31  ? 419 HOH A O   1 
HETATM 2274 O O   . HOH D 4 .   ? 29.208 13.224  33.206 1.00 25.34  ? 420 HOH A O   1 
HETATM 2275 O O   . HOH D 4 .   ? 9.398  14.643  21.769 1.00 23.57  ? 421 HOH A O   1 
HETATM 2276 O O   . HOH D 4 .   ? 26.614 -12.552 22.352 1.00 22.87  ? 422 HOH A O   1 
HETATM 2277 O O   . HOH D 4 .   ? 11.357 18.171  23.552 1.00 18.99  ? 423 HOH A O   1 
HETATM 2278 O O   . HOH D 4 .   ? 14.259 25.082  12.846 1.00 33.41  ? 424 HOH A O   1 
HETATM 2279 O O   . HOH D 4 .   ? 27.160 29.645  12.360 1.00 25.48  ? 425 HOH A O   1 
HETATM 2280 O O   . HOH D 4 .   ? 33.586 -2.572  -1.217 1.00 30.04  ? 426 HOH A O   1 
HETATM 2281 O O   . HOH D 4 .   ? 25.293 10.887  34.379 1.00 32.30  ? 427 HOH A O   1 
HETATM 2282 O O   . HOH D 4 .   ? 20.645 1.242   9.614  1.00 16.50  ? 428 HOH A O   1 
HETATM 2283 O O   . HOH D 4 .   ? 13.511 2.320   25.039 1.00 21.14  ? 429 HOH A O   1 
HETATM 2284 O O   . HOH D 4 .   ? 48.013 18.892  23.530 1.00 26.71  ? 430 HOH A O   1 
HETATM 2285 O O   . HOH D 4 .   ? 26.785 12.103  32.397 1.00 26.43  ? 431 HOH A O   1 
HETATM 2286 O O   . HOH D 4 .   ? 46.649 33.436  11.326 1.00 27.78  ? 432 HOH A O   1 
HETATM 2287 O O   . HOH D 4 .   ? 22.360 4.581   30.642 1.00 26.67  ? 433 HOH A O   1 
HETATM 2288 O O   . HOH D 4 .   ? 29.649 29.017  15.963 1.00 33.49  ? 434 HOH A O   1 
HETATM 2289 O O   . HOH D 4 .   ? 27.947 -6.641  7.535  1.00 25.40  ? 435 HOH A O   1 
HETATM 2290 O O   . HOH D 4 .   ? 29.966 -6.447  18.940 1.00 30.66  ? 436 HOH A O   1 
HETATM 2291 O O   . HOH D 4 .   ? 37.134 1.948   23.503 1.00 28.30  ? 437 HOH A O   1 
HETATM 2292 O O   . HOH D 4 .   ? 48.516 28.292  20.917 1.00 30.84  ? 438 HOH A O   1 
HETATM 2293 O O   . HOH D 4 .   ? 38.919 4.871   32.168 1.00 29.51  ? 439 HOH A O   1 
HETATM 2294 O O   . HOH D 4 .   ? 50.407 29.509  2.073  1.00 25.21  ? 440 HOH A O   1 
HETATM 2295 O O   . HOH D 4 .   ? 8.562  7.412   14.835 1.00 39.74  ? 441 HOH A O   1 
HETATM 2296 O O   . HOH D 4 .   ? 15.907 21.751  11.867 1.00 33.52  ? 442 HOH A O   1 
HETATM 2297 O O   . HOH D 4 .   ? 38.084 -8.824  21.094 1.00 32.62  ? 443 HOH A O   1 
HETATM 2298 O O   . HOH D 4 .   ? 44.010 4.183   20.015 1.00 32.51  ? 444 HOH A O   1 
HETATM 2299 O O   . HOH D 4 .   ? 53.545 23.466  2.955  1.00 26.74  ? 445 HOH A O   1 
HETATM 2300 O O   . HOH D 4 .   ? 37.032 30.163  4.254  1.00 24.63  ? 446 HOH A O   1 
HETATM 2301 O O   . HOH D 4 .   ? 31.536 30.844  17.840 1.00 24.06  ? 447 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   2   THR THR A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  PRO 15  15  15  PRO PRO A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  TYR 22  22  22  TYR TYR A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  PRO 26  26  26  PRO PRO A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  ASP 28  28  28  ASP ASP A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  ARG 42  42  42  ARG ARG A . n 
A 1 43  HIS 43  43  43  HIS HIS A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  TYR 50  50  50  TYR TYR A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TRP 77  77  77  TRP TRP A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  HIS 81  81  81  HIS HIS A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 HIS 108 108 108 HIS HIS A . n 
A 1 109 TRP 109 109 109 TRP TRP A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 PRO 112 112 112 PRO PRO A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 ASP 115 115 115 ASP ASP A . n 
A 1 116 ASN 116 116 116 ASN ASN A . n 
A 1 117 TYR 117 117 117 TYR TYR A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 HIS 119 119 119 HIS HIS A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 TRP 121 121 121 TRP TRP A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 MET 124 124 124 MET MET A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 THR 133 133 133 THR THR A . n 
A 1 134 ARG 134 134 134 ARG ARG A . n 
A 1 135 SER 135 135 135 SER SER A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 ASN 140 140 140 ASN ASN A . n 
A 1 141 HIS 141 141 141 HIS HIS A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 HIS 145 145 145 HIS HIS A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ILE 149 149 149 ILE ILE A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 ASN 160 160 160 ASN ASN A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 HIS 165 165 165 HIS HIS A . n 
A 1 166 PRO 166 166 166 PRO PRO A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 TYR 168 168 168 TYR TYR A . n 
A 1 169 GLN 169 169 169 GLN GLN A . n 
A 1 170 GLN 170 170 170 GLN GLN A . n 
A 1 171 ARG 171 171 171 ARG ARG A . n 
A 1 172 GLU 172 172 172 GLU GLU A . n 
A 1 173 ILE 173 173 173 ILE ILE A . n 
A 1 174 THR 174 174 174 THR THR A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 TRP 176 176 176 TRP TRP A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 HIS 180 180 180 HIS HIS A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 TRP 187 187 187 TRP TRP A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 PRO 189 189 189 PRO PRO A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLN 192 192 192 GLN GLN A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 LYS 194 194 194 LYS LYS A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 ASP 196 196 196 ASP ASP A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 PHE 198 198 198 PHE PHE A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 ALA 200 200 200 ALA ALA A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 PRO 202 202 202 PRO PRO A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 THR 204 204 204 THR THR A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 ALA 209 209 209 ALA ALA A . n 
A 1 210 HIS 210 210 210 HIS HIS A . n 
A 1 211 GLY 211 211 211 GLY GLY A . n 
A 1 212 LYS 212 212 212 LYS LYS A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 PRO 214 214 214 PRO PRO A . n 
A 1 215 ALA 215 215 215 ALA ALA A . n 
A 1 216 GLN 216 216 216 GLN GLN A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 TRP 221 221 221 TRP TRP A . n 
A 1 222 HIS 222 222 222 HIS HIS A . n 
A 1 223 LEU 223 223 223 LEU LEU A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 VAL 228 228 228 VAL VAL A . n 
A 1 229 VAL 229 229 229 VAL VAL A . n 
A 1 230 PHE 230 230 230 PHE PHE A . n 
A 1 231 PRO 231 231 231 PRO PRO A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 SER 233 233 233 SER SER A . n 
A 1 234 VAL 234 234 234 VAL VAL A . n 
A 1 235 ARG 235 235 235 ARG ARG A . n 
A 1 236 ARG 236 236 236 ARG ARG A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 HIS 238 238 238 HIS HIS A . n 
A 1 239 LEU 239 239 239 LEU LEU A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLU 241 241 241 GLU GLU A . n 
A 1 242 ASN 242 242 242 ASN ASN A . n 
A 1 243 LEU 243 243 243 LEU LEU A . n 
A 1 244 ASP 244 244 244 ASP ASP A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 PHE 246 246 246 PHE PHE A . n 
A 1 247 ASP 247 247 247 ASP ASP A . n 
A 1 248 PHE 248 248 248 PHE PHE A . n 
A 1 249 ASP 249 249 249 ASP ASP A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 THR 251 251 251 THR THR A . n 
A 1 252 ASP 252 252 252 ASP ASP A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 ILE 255 255 255 ILE ILE A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 ALA 257 257 257 ALA ALA A . n 
A 1 258 ILE 258 258 258 ILE ILE A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 ALA 260 260 260 ALA ALA A . n 
A 1 261 MET 261 261 261 MET MET A . n 
A 1 262 ASP 262 262 262 ASP ASP A . n 
A 1 263 PRO 263 263 263 PRO PRO A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 ASP 265 265 265 ASP ASP A . n 
A 1 266 GLY 266 266 266 GLY GLY A . n 
A 1 267 SER 267 267 267 SER SER A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 ARG 269 269 269 ARG ARG A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 SER 271 271 271 SER SER A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 HIS 273 273 273 HIS HIS A . n 
A 1 274 PRO 274 274 274 PRO PRO A . n 
A 1 275 ASP 275 275 275 ASP ASP A . n 
A 1 276 GLU 276 276 276 GLU GLU A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 ASP 278 278 278 ASP ASP A . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  monomeric 1 
2 software_defined_assembly            PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D 
2 1,2 A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 4360  ? 
2 MORE         -53   ? 
2 'SSA (A^2)'  19890 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 92.9266885482 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 47.9007851857 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-08-12 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
TNT       refinement       . ? 3 
TNT       phasing          . ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A ASP 28  ? ? CG A ASP 28  ? ? OD1 A ASP 28  ? ? 123.77 118.30 5.47  0.90 N 
2  1 CB A ASP 28  ? ? CG A ASP 28  ? ? OD2 A ASP 28  ? ? 112.02 118.30 -6.28 0.90 N 
3  1 CB A ASP 68  ? ? CG A ASP 68  ? ? OD1 A ASP 68  ? ? 123.92 118.30 5.62  0.90 N 
4  1 CB A ASP 68  ? ? CG A ASP 68  ? ? OD2 A ASP 68  ? ? 112.33 118.30 -5.97 0.90 N 
5  1 CB A ASP 69  ? ? CG A ASP 69  ? ? OD2 A ASP 69  ? ? 112.61 118.30 -5.69 0.90 N 
6  1 CB A ASP 79  ? ? CG A ASP 79  ? ? OD1 A ASP 79  ? ? 123.91 118.30 5.61  0.90 N 
7  1 CB A ASP 79  ? ? CG A ASP 79  ? ? OD2 A ASP 79  ? ? 112.51 118.30 -5.79 0.90 N 
8  1 CB A ASP 84  ? ? CG A ASP 84  ? ? OD2 A ASP 84  ? ? 112.85 118.30 -5.45 0.90 N 
9  1 CB A ASP 100 ? ? CG A ASP 100 ? ? OD2 A ASP 100 ? ? 112.82 118.30 -5.48 0.90 N 
10 1 CB A ASP 115 ? ? CG A ASP 115 ? ? OD2 A ASP 115 ? ? 112.89 118.30 -5.41 0.90 N 
11 1 CB A ASP 181 ? ? CG A ASP 181 ? ? OD2 A ASP 181 ? ? 112.58 118.30 -5.72 0.90 N 
12 1 CB A ASP 196 ? ? CG A ASP 196 ? ? OD2 A ASP 196 ? ? 112.64 118.30 -5.66 0.90 N 
13 1 CB A ASP 244 ? ? CG A ASP 244 ? ? OD2 A ASP 244 ? ? 112.67 118.30 -5.63 0.90 N 
14 1 CB A ASP 247 ? ? CG A ASP 247 ? ? OD2 A ASP 247 ? ? 112.58 118.30 -5.72 0.90 N 
15 1 CB A ASP 249 ? ? CG A ASP 249 ? ? OD2 A ASP 249 ? ? 112.63 118.30 -5.67 0.90 N 
16 1 CB A ASP 259 ? ? CG A ASP 259 ? ? OD1 A ASP 259 ? ? 124.16 118.30 5.86  0.90 N 
17 1 CB A ASP 259 ? ? CG A ASP 259 ? ? OD2 A ASP 259 ? ? 111.51 118.30 -6.79 0.90 N 
18 1 CB A ASP 262 ? ? CG A ASP 262 ? ? OD2 A ASP 262 ? ? 112.89 118.30 -5.41 0.90 N 
19 1 CB A ASP 275 ? ? CG A ASP 275 ? ? OD2 A ASP 275 ? ? 112.80 118.30 -5.50 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 23  ? ? 78.99   -13.65  
2 1 THR A 46  ? ? -126.28 -169.78 
3 1 ILE A 65  ? ? -26.90  130.42  
4 1 PHE A 230 ? ? -149.98 59.09   
5 1 SER A 233 ? ? 178.49  143.43  
6 1 SER A 271 ? ? -126.58 -165.47 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ARG 31  ? CG  ? A ARG 31  CG  
2 1 Y 1 A ARG 31  ? CD  ? A ARG 31  CD  
3 1 Y 1 A ARG 31  ? NE  ? A ARG 31  NE  
4 1 Y 1 A ARG 31  ? CZ  ? A ARG 31  CZ  
5 1 Y 1 A ARG 31  ? NH1 ? A ARG 31  NH1 
6 1 Y 1 A ARG 31  ? NH2 ? A ARG 31  NH2 
7 1 Y 1 A ASP 278 ? CG  ? A ASP 278 CG  
8 1 Y 1 A ASP 278 ? OD1 ? A ASP 278 OD1 
9 1 Y 1 A ASP 278 ? OD2 ? A ASP 278 OD2 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     MET 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      1 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    MET 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'                     SO4 
3 NICOTINAMIDE-ADENINE-DINUCLEOTIDE NAD 
4 water                             HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   301 301 SO4 SO4 A . 
C 3 NAD 1   300 300 NAD NAD A . 
D 4 HOH 1   302 302 HOH HOH A . 
D 4 HOH 2   303 303 HOH HOH A . 
D 4 HOH 3   304 304 HOH HOH A . 
D 4 HOH 4   305 305 HOH HOH A . 
D 4 HOH 5   306 306 HOH HOH A . 
D 4 HOH 6   307 307 HOH HOH A . 
D 4 HOH 7   308 308 HOH HOH A . 
D 4 HOH 8   309 309 HOH HOH A . 
D 4 HOH 9   310 310 HOH HOH A . 
D 4 HOH 10  311 311 HOH HOH A . 
D 4 HOH 11  312 312 HOH HOH A . 
D 4 HOH 12  313 313 HOH HOH A . 
D 4 HOH 13  314 314 HOH HOH A . 
D 4 HOH 14  315 315 HOH HOH A . 
D 4 HOH 15  316 316 HOH HOH A . 
D 4 HOH 16  317 317 HOH HOH A . 
D 4 HOH 17  318 318 HOH HOH A . 
D 4 HOH 18  319 319 HOH HOH A . 
D 4 HOH 19  320 320 HOH HOH A . 
D 4 HOH 20  321 321 HOH HOH A . 
D 4 HOH 21  322 322 HOH HOH A . 
D 4 HOH 22  323 323 HOH HOH A . 
D 4 HOH 23  324 324 HOH HOH A . 
D 4 HOH 24  325 325 HOH HOH A . 
D 4 HOH 25  326 326 HOH HOH A . 
D 4 HOH 26  327 327 HOH HOH A . 
D 4 HOH 27  328 328 HOH HOH A . 
D 4 HOH 28  329 329 HOH HOH A . 
D 4 HOH 29  330 330 HOH HOH A . 
D 4 HOH 30  331 331 HOH HOH A . 
D 4 HOH 31  332 332 HOH HOH A . 
D 4 HOH 32  333 333 HOH HOH A . 
D 4 HOH 33  334 334 HOH HOH A . 
D 4 HOH 34  335 335 HOH HOH A . 
D 4 HOH 35  336 336 HOH HOH A . 
D 4 HOH 36  337 337 HOH HOH A . 
D 4 HOH 37  338 338 HOH HOH A . 
D 4 HOH 38  339 339 HOH HOH A . 
D 4 HOH 39  340 340 HOH HOH A . 
D 4 HOH 40  341 341 HOH HOH A . 
D 4 HOH 41  342 342 HOH HOH A . 
D 4 HOH 42  343 343 HOH HOH A . 
D 4 HOH 43  344 344 HOH HOH A . 
D 4 HOH 44  345 345 HOH HOH A . 
D 4 HOH 45  346 346 HOH HOH A . 
D 4 HOH 46  347 347 HOH HOH A . 
D 4 HOH 47  348 348 HOH HOH A . 
D 4 HOH 48  349 349 HOH HOH A . 
D 4 HOH 49  350 350 HOH HOH A . 
D 4 HOH 50  351 351 HOH HOH A . 
D 4 HOH 51  352 352 HOH HOH A . 
D 4 HOH 52  353 353 HOH HOH A . 
D 4 HOH 53  354 354 HOH HOH A . 
D 4 HOH 54  355 355 HOH HOH A . 
D 4 HOH 55  356 356 HOH HOH A . 
D 4 HOH 56  357 357 HOH HOH A . 
D 4 HOH 57  358 358 HOH HOH A . 
D 4 HOH 58  359 359 HOH HOH A . 
D 4 HOH 59  360 360 HOH HOH A . 
D 4 HOH 60  361 361 HOH HOH A . 
D 4 HOH 61  362 362 HOH HOH A . 
D 4 HOH 62  363 363 HOH HOH A . 
D 4 HOH 63  364 364 HOH HOH A . 
D 4 HOH 64  365 365 HOH HOH A . 
D 4 HOH 65  366 366 HOH HOH A . 
D 4 HOH 66  367 367 HOH HOH A . 
D 4 HOH 67  368 368 HOH HOH A . 
D 4 HOH 68  369 369 HOH HOH A . 
D 4 HOH 69  370 370 HOH HOH A . 
D 4 HOH 70  371 371 HOH HOH A . 
D 4 HOH 71  372 372 HOH HOH A . 
D 4 HOH 72  373 373 HOH HOH A . 
D 4 HOH 73  374 374 HOH HOH A . 
D 4 HOH 74  375 375 HOH HOH A . 
D 4 HOH 75  376 376 HOH HOH A . 
D 4 HOH 76  377 377 HOH HOH A . 
D 4 HOH 77  378 378 HOH HOH A . 
D 4 HOH 78  379 379 HOH HOH A . 
D 4 HOH 79  380 380 HOH HOH A . 
D 4 HOH 80  381 381 HOH HOH A . 
D 4 HOH 81  382 382 HOH HOH A . 
D 4 HOH 82  383 383 HOH HOH A . 
D 4 HOH 83  384 384 HOH HOH A . 
D 4 HOH 84  385 385 HOH HOH A . 
D 4 HOH 85  386 386 HOH HOH A . 
D 4 HOH 86  387 387 HOH HOH A . 
D 4 HOH 87  388 388 HOH HOH A . 
D 4 HOH 88  389 389 HOH HOH A . 
D 4 HOH 89  390 390 HOH HOH A . 
D 4 HOH 90  391 391 HOH HOH A . 
D 4 HOH 91  392 392 HOH HOH A . 
D 4 HOH 92  393 393 HOH HOH A . 
D 4 HOH 93  394 394 HOH HOH A . 
D 4 HOH 94  395 395 HOH HOH A . 
D 4 HOH 95  396 396 HOH HOH A . 
D 4 HOH 96  397 397 HOH HOH A . 
D 4 HOH 97  398 398 HOH HOH A . 
D 4 HOH 98  399 399 HOH HOH A . 
D 4 HOH 99  400 400 HOH HOH A . 
D 4 HOH 100 401 401 HOH HOH A . 
D 4 HOH 101 402 402 HOH HOH A . 
D 4 HOH 102 403 403 HOH HOH A . 
D 4 HOH 103 404 404 HOH HOH A . 
D 4 HOH 104 405 405 HOH HOH A . 
D 4 HOH 105 406 406 HOH HOH A . 
D 4 HOH 106 407 407 HOH HOH A . 
D 4 HOH 107 408 408 HOH HOH A . 
D 4 HOH 108 409 409 HOH HOH A . 
D 4 HOH 109 410 410 HOH HOH A . 
D 4 HOH 110 411 411 HOH HOH A . 
D 4 HOH 111 412 412 HOH HOH A . 
D 4 HOH 112 413 413 HOH HOH A . 
D 4 HOH 113 414 414 HOH HOH A . 
D 4 HOH 114 415 415 HOH HOH A . 
D 4 HOH 115 416 416 HOH HOH A . 
D 4 HOH 116 417 417 HOH HOH A . 
D 4 HOH 117 418 418 HOH HOH A . 
D 4 HOH 118 419 419 HOH HOH A . 
D 4 HOH 119 420 420 HOH HOH A . 
D 4 HOH 120 421 421 HOH HOH A . 
D 4 HOH 121 422 422 HOH HOH A . 
D 4 HOH 122 423 423 HOH HOH A . 
D 4 HOH 123 424 424 HOH HOH A . 
D 4 HOH 124 425 425 HOH HOH A . 
D 4 HOH 125 426 426 HOH HOH A . 
D 4 HOH 126 427 427 HOH HOH A . 
D 4 HOH 127 428 428 HOH HOH A . 
D 4 HOH 128 429 429 HOH HOH A . 
D 4 HOH 129 430 430 HOH HOH A . 
D 4 HOH 130 431 431 HOH HOH A . 
D 4 HOH 131 432 432 HOH HOH A . 
D 4 HOH 132 433 433 HOH HOH A . 
D 4 HOH 133 434 434 HOH HOH A . 
D 4 HOH 134 435 435 HOH HOH A . 
D 4 HOH 135 436 436 HOH HOH A . 
D 4 HOH 136 437 437 HOH HOH A . 
D 4 HOH 137 438 438 HOH HOH A . 
D 4 HOH 138 439 439 HOH HOH A . 
D 4 HOH 139 440 440 HOH HOH A . 
D 4 HOH 140 441 441 HOH HOH A . 
D 4 HOH 141 442 442 HOH HOH A . 
D 4 HOH 142 443 443 HOH HOH A . 
D 4 HOH 143 444 444 HOH HOH A . 
D 4 HOH 144 445 445 HOH HOH A . 
D 4 HOH 145 446 446 HOH HOH A . 
D 4 HOH 146 447 447 HOH HOH A . 
#