data_1MJ4
# 
_entry.id   1MJ4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1MJ4         
RCSB  RCSB016948   
WWPDB D_1000016948 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1SOX 
_pdbx_database_related.details        'SULFITE OXIDASE FROM CHICKEN LIVER' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1MJ4 
_pdbx_database_status.recvd_initial_deposition_date   2002-08-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rudolph, M.J.'     1 
'Johnson, J.L.'     2 
'Rajagopalan, K.V.' 3 
'Kisker, C.'        4 
# 
_citation.id                        primary 
_citation.title                     'The 1.2 A structure of the human sulfite oxidase cytochrome b(5) domain.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            59 
_citation.page_first                1183 
_citation.page_last                 1191 
_citation.year                      2003 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12832761 
_citation.pdbx_database_id_DOI      10.1107/S0907444903009934 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rudolph, M.J.'     1 
primary 'Johnson, J.L.'     2 
primary 'Rajagopalan, K.V.' 3 
primary 'Kisker, C.'        4 
# 
_cell.entry_id           1MJ4 
_cell.length_a           98.899 
_cell.length_b           35.447 
_cell.length_c           26.263 
_cell.angle_alpha        90.00 
_cell.angle_beta         93.78 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1MJ4 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.cell_setting                     monoclinic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'sulfite oxidase'                 9087.128 1   1.8.3.1 ? 'cytochrome b5 domain, residues 22-103 of SWS P51687' ? 
2 non-polymer syn 'SULFATE ION'                     96.063   1   ?       ? ?                                                     ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487  1   ?       ? ?                                                     ? 
4 non-polymer syn GLYCEROL                          92.094   1   ?       ? ?                                                     ? 
5 water       nat water                             18.015   117 ?       ? ?                                                     ? 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.1.8.3.1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;QESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYKIG
EL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;QESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYKIG
EL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLN n 
1 2  GLU n 
1 3  SER n 
1 4  THR n 
1 5  HIS n 
1 6  ILE n 
1 7  TYR n 
1 8  THR n 
1 9  LYS n 
1 10 GLU n 
1 11 GLU n 
1 12 VAL n 
1 13 SER n 
1 14 SER n 
1 15 HIS n 
1 16 THR n 
1 17 SER n 
1 18 PRO n 
1 19 GLU n 
1 20 THR n 
1 21 GLY n 
1 22 ILE n 
1 23 TRP n 
1 24 VAL n 
1 25 THR n 
1 26 LEU n 
1 27 GLY n 
1 28 SER n 
1 29 GLU n 
1 30 VAL n 
1 31 PHE n 
1 32 ASP n 
1 33 VAL n 
1 34 THR n 
1 35 GLU n 
1 36 PHE n 
1 37 VAL n 
1 38 ASP n 
1 39 LEU n 
1 40 HIS n 
1 41 PRO n 
1 42 GLY n 
1 43 GLY n 
1 44 PRO n 
1 45 SER n 
1 46 LYS n 
1 47 LEU n 
1 48 MET n 
1 49 LEU n 
1 50 ALA n 
1 51 ALA n 
1 52 GLY n 
1 53 GLY n 
1 54 PRO n 
1 55 LEU n 
1 56 GLU n 
1 57 PRO n 
1 58 PHE n 
1 59 TRP n 
1 60 ALA n 
1 61 LEU n 
1 62 TYR n 
1 63 ALA n 
1 64 VAL n 
1 65 HIS n 
1 66 ASN n 
1 67 GLN n 
1 68 SER n 
1 69 HIS n 
1 70 VAL n 
1 71 ARG n 
1 72 GLU n 
1 73 LEU n 
1 74 LEU n 
1 75 ALA n 
1 76 GLN n 
1 77 TYR n 
1 78 LYS n 
1 79 ILE n 
1 80 GLY n 
1 81 GLU n 
1 82 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SUOX_HUMAN 
_struct_ref.pdbx_db_accession          P51687 
_struct_ref.pdbx_align_begin           22 
_struct_ref.pdbx_seq_one_letter_code   
;QESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYKIG
EL
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1MJ4 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 82 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P51687 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  103 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       82 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?                               'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?                               'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?                               'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?                               'C4 H7 N O4'       133.103 
GLN 'L-peptide linking' y GLUTAMINE                         ?                               'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?                               'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?                               'C2 H5 N O2'       75.067  
GOL non-polymer         . GLYCEROL                          'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'         92.094  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME                            'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?                               'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?                               'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?                               'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?                               'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?                               'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?                               'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?                               'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?                               'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?                               'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION'                     ?                               'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE                         ?                               'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?                               'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?                               'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?                               'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1MJ4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.31 
_exptl_crystal.density_Matthews      2.53 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    'ammonium sulfate and Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP at 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-05-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    platinum 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.100 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X26C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X26C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.100 
# 
_reflns.entry_id                     1MJ4 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.d_resolution_high            1.200 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   120723 
_reflns.number_obs                   120114 
_reflns.percent_possible_obs         96.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.20 
_reflns_shell.d_res_low              1.24 
_reflns_shell.percent_possible_all   88.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1MJ4 
_refine.ls_number_reflns_obs                     26118 
_refine.ls_number_reflns_all                     27496 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             49.39 
_refine.ls_d_res_high                            1.20 
_refine.ls_percent_reflns_obs                    96.77 
_refine.ls_R_factor_obs                          0.1195 
_refine.ls_R_factor_all                          0.1195 
_refine.ls_R_factor_R_work                       0.11845 
_refine.ls_R_factor_R_free                       0.13855 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1378 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.982 
_refine.correlation_coeff_Fo_to_Fc_free          0.977 
_refine.B_iso_mean                               11.983 
_refine.aniso_B[1][1]                            0.15 
_refine.aniso_B[2][2]                            -0.01 
_refine.aniso_B[3][3]                            -0.11 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.23 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        617 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         54 
_refine_hist.number_atoms_solvent             117 
_refine_hist.number_atoms_total               788 
_refine_hist.d_res_high                       1.20 
_refine_hist.d_res_low                        49.39 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.023 0.021 ? 688  'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.007 0.020 ? 578  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2.186 2.144 ? 949  'X-RAY DIFFRACTION' ? 
r_angle_other_deg        1.108 3.000 ? 1340 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.504 5.000 ? 77   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.150 0.200 ? 93   'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.018 0.020 ? 747  'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.022 0.020 ? 124  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.739 0.200 ? 242  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.278 0.200 ? 708  'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.098 0.200 ? 334  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.342 0.200 ? 79   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.257 0.200 ? 11   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.282 0.200 ? 35   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.198 0.200 ? 21   'X-RAY DIFFRACTION' ? 
r_mcbond_it              2.426 1.500 ? 393  'X-RAY DIFFRACTION' ? 
r_mcangle_it             3.552 2.000 ? 628  'X-RAY DIFFRACTION' ? 
r_scbond_it              4.069 3.000 ? 295  'X-RAY DIFFRACTION' ? 
r_scangle_it             5.647 4.500 ? 321  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       2.427 2.000 ? 688  'X-RAY DIFFRACTION' ? 
r_sphericity_free        9.026 2.000 ? 145  'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      5.493 2.000 ? 665  'X-RAY DIFFRACTION' ? 
p_bond_d                 0.023 0.021 ? 688  'X-RAY DIFFRACTION' ? 
p_angle_d                2.186 2.144 ? 949  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.202 
_refine_ls_shell.d_res_low                        1.233 
_refine_ls_shell.number_reflns_R_work             1629 
_refine_ls_shell.R_factor_R_work                  0.307 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.335 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             87 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1MJ4 
_struct.title                     'Crystal Structure Analysis of the cytochrome b5 domain of human sulfite oxidase' 
_struct.pdbx_descriptor           'sulfite oxidase (E.C.1.8.3.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MJ4 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'cytochrome b5, Heme, sulfite oxidase, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 8  ? SER A 14 ? THR A 8  SER A 14 1 ? 7  
HELX_P HELX_P2 2 PHE A 36 ? HIS A 40 ? PHE A 36 HIS A 40 5 ? 5  
HELX_P HELX_P3 3 GLY A 43 ? LEU A 49 ? GLY A 43 LEU A 49 1 ? 7  
HELX_P HELX_P4 4 LEU A 55 ? ALA A 60 ? LEU A 55 ALA A 60 1 ? 6  
HELX_P HELX_P5 5 LEU A 61 ? ASN A 66 ? LEU A 61 ASN A 66 5 ? 6  
HELX_P HELX_P6 6 GLN A 67 ? GLN A 76 ? GLN A 67 GLN A 76 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 40 NE2 ? ? ? 1_555 C HEM . FE ? ? A HIS 40 A HEM 502 1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc2 metalc ? ? A HIS 65 NE2 ? ? ? 1_555 C HEM . FE ? ? A HIS 65 A HEM 502 1_555 ? ? ? ? ? ? ? 2.006 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 16 ? SER A 17 ? THR A 16 SER A 17 
A 2 GLY A 21 ? LEU A 26 ? GLY A 21 LEU A 26 
A 3 GLU A 29 ? ASP A 32 ? GLU A 29 ASP A 32 
A 4 LYS A 78 ? GLU A 81 ? LYS A 78 GLU A 81 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 17 ? N SER A 17 O GLY A 21 ? O GLY A 21 
A 2 3 N VAL A 24 ? N VAL A 24 O PHE A 31 ? O PHE A 31 
A 3 4 N VAL A 30 ? N VAL A 30 O ILE A 79 ? O ILE A 79 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 A 83'   
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE HEM A 502'  
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 9601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  LYS A 46 ? LYS A 46   . ? 1_556 ? 
2  AC1 8  GLN A 67 ? GLN A 67   . ? 1_555 ? 
3  AC1 8  SER A 68 ? SER A 68   . ? 1_555 ? 
4  AC1 8  HOH E .  ? HOH A 510  . ? 1_555 ? 
5  AC1 8  HOH E .  ? HOH A 525  . ? 1_555 ? 
6  AC1 8  HOH E .  ? HOH A 527  . ? 4_546 ? 
7  AC1 8  HOH E .  ? HOH A 577  . ? 1_555 ? 
8  AC1 8  HOH E .  ? HOH A 596  . ? 1_555 ? 
9  AC2 14 HIS A 40 ? HIS A 40   . ? 1_555 ? 
10 AC2 14 PRO A 41 ? PRO A 41   . ? 1_555 ? 
11 AC2 14 LYS A 46 ? LYS A 46   . ? 1_555 ? 
12 AC2 14 LEU A 47 ? LEU A 47   . ? 1_555 ? 
13 AC2 14 TRP A 59 ? TRP A 59   . ? 1_555 ? 
14 AC2 14 TYR A 62 ? TYR A 62   . ? 1_555 ? 
15 AC2 14 HIS A 65 ? HIS A 65   . ? 1_555 ? 
16 AC2 14 GLN A 67 ? GLN A 67   . ? 1_555 ? 
17 AC2 14 HIS A 69 ? HIS A 69   . ? 1_555 ? 
18 AC2 14 HOH E .  ? HOH A 539  . ? 1_555 ? 
19 AC2 14 HOH E .  ? HOH A 546  . ? 1_555 ? 
20 AC2 14 HOH E .  ? HOH A 573  . ? 1_555 ? 
21 AC2 14 HOH E .  ? HOH A 584  . ? 1_555 ? 
22 AC2 14 GOL D .  ? GOL A 9601 . ? 1_555 ? 
23 AC3 8  PRO A 41 ? PRO A 41   . ? 1_555 ? 
24 AC3 8  HIS A 69 ? HIS A 69   . ? 1_555 ? 
25 AC3 8  ARG A 71 ? ARG A 71   . ? 4_556 ? 
26 AC3 8  HEM C .  ? HEM A 502  . ? 1_555 ? 
27 AC3 8  HOH E .  ? HOH A 513  . ? 4_556 ? 
28 AC3 8  HOH E .  ? HOH A 518  . ? 1_555 ? 
29 AC3 8  HOH E .  ? HOH A 530  . ? 4_556 ? 
30 AC3 8  HOH E .  ? HOH A 531  . ? 4_556 ? 
# 
_database_PDB_matrix.entry_id          1MJ4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1MJ4 
_atom_sites.fract_transf_matrix[1][1]   0.010111 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000668 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.028211 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.038159 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . SER A 1 3  ? -0.149 -1.284  20.986 1.00 33.55 ? 3    SER A N   1 
ATOM   2   C  CA  . SER A 1 3  ? -0.627 -1.490  19.597 1.00 31.35 ? 3    SER A CA  1 
ATOM   3   C  C   . SER A 1 3  ? 0.541  -1.414  18.656 1.00 29.35 ? 3    SER A C   1 
ATOM   4   O  O   . SER A 1 3  ? 1.644  -0.932  19.049 1.00 31.39 ? 3    SER A O   1 
ATOM   5   C  CB  . SER A 1 3  ? -1.585 -0.396  19.178 1.00 32.09 ? 3    SER A CB  1 
ATOM   6   O  OG  . SER A 1 3  ? -1.048 0.862   19.386 1.00 32.78 ? 3    SER A OG  1 
ATOM   7   N  N   . THR A 1 4  ? 0.337  -1.870  17.431 1.00 26.34 ? 4    THR A N   1 
ATOM   8   C  CA  . THR A 1 4  ? 1.440  -1.989  16.477 1.00 24.32 ? 4    THR A CA  1 
ATOM   9   C  C   . THR A 1 4  ? 0.902  -1.720  15.122 1.00 20.66 ? 4    THR A C   1 
ATOM   10  O  O   . THR A 1 4  ? -0.064 -2.359  14.730 1.00 21.33 ? 4    THR A O   1 
ATOM   11  C  CB  . THR A 1 4  ? 2.036  -3.403  16.531 1.00 26.25 ? 4    THR A CB  1 
ATOM   12  O  OG1 . THR A 1 4  ? 2.371  -3.746  17.876 1.00 32.65 ? 4    THR A OG1 1 
ATOM   13  C  CG2 . THR A 1 4  ? 3.418  -3.456  15.817 1.00 29.12 ? 4    THR A CG2 1 
ATOM   14  N  N   . HIS A 1 5  ? 1.563  -0.893  14.305 1.00 18.86 ? 5    HIS A N   1 
ATOM   15  C  CA  . HIS A 1 5  ? 1.276  -0.768  12.917 1.00 17.06 ? 5    HIS A CA  1 
ATOM   16  C  C   . HIS A 1 5  ? 1.951  -1.923  12.166 1.00 15.06 ? 5    HIS A C   1 
ATOM   17  O  O   . HIS A 1 5  ? 3.154  -2.042  12.205 1.00 16.01 ? 5    HIS A O   1 
ATOM   18  C  CB  . HIS A 1 5  ? 1.640  0.604   12.386 1.00 20.71 ? 5    HIS A CB  1 
ATOM   19  C  CG  . HIS A 1 5  ? 0.780  1.060   11.290 1.00 28.49 ? 5    HIS A CG  1 
ATOM   20  N  ND1 . HIS A 1 5  ? -0.348 1.853   11.494 1.00 32.51 ? 5    HIS A ND1 1 
ATOM   21  C  CD2 . HIS A 1 5  ? 0.851  0.848   9.959  1.00 36.52 ? 5    HIS A CD2 1 
ATOM   22  C  CE1 . HIS A 1 5  ? -0.900 2.123   10.318 1.00 39.34 ? 5    HIS A CE1 1 
ATOM   23  N  NE2 . HIS A 1 5  ? -0.178 1.552   9.370  1.00 40.75 ? 5    HIS A NE2 1 
ATOM   24  N  N   . ILE A 1 6  ? 1.170  -2.755  11.483 1.00 14.96 ? 6    ILE A N   1 
ATOM   25  C  CA  . ILE A 1 6  ? 1.656  -3.938  10.821 1.00 15.88 ? 6    ILE A CA  1 
ATOM   26  C  C   . ILE A 1 6  ? 1.634  -3.734  9.324  1.00 16.94 ? 6    ILE A C   1 
ATOM   27  O  O   . ILE A 1 6  ? 0.624  -3.317  8.752  1.00 20.06 ? 6    ILE A O   1 
ATOM   28  C  CB  . ILE A 1 6  ? 0.860  -5.212  11.251 1.00 16.66 ? 6    ILE A CB  1 
ATOM   29  C  CG1 . ILE A 1 6  ? 0.958  -5.530  12.730 1.00 19.17 ? 6    ILE A CG1 1 
ATOM   30  C  CG2 . ILE A 1 6  ? 1.199  -6.395  10.364 1.00 19.91 ? 6    ILE A CG2 1 
ATOM   31  C  CD1 . ILE A 1 6  ? 2.296  -5.910  13.180 1.00 22.00 ? 6    ILE A CD1 1 
ATOM   32  N  N   . TYR A 1 7  ? 2.767  -4.087  8.681  1.00 17.81 ? 7    TYR A N   1 
ATOM   33  C  CA  . TYR A 1 7  ? 2.942  -4.040  7.237  1.00 17.76 ? 7    TYR A CA  1 
ATOM   34  C  C   . TYR A 1 7  ? 3.300  -5.421  6.752  1.00 18.38 ? 7    TYR A C   1 
ATOM   35  O  O   . TYR A 1 7  ? 3.880  -6.263  7.433  1.00 22.30 ? 7    TYR A O   1 
ATOM   36  C  CB  . TYR A 1 7  ? 4.165  -3.122  6.902  1.00 16.84 ? 7    TYR A CB  1 
ATOM   37  C  CG  . TYR A 1 7  ? 4.015  -1.736  7.338  1.00 15.94 ? 7    TYR A CG  1 
ATOM   38  C  CD1 . TYR A 1 7  ? 4.467  -1.319  8.593  1.00 17.81 ? 7    TYR A CD1 1 
ATOM   39  C  CD2 . TYR A 1 7  ? 3.361  -0.768  6.542  1.00 20.42 ? 7    TYR A CD2 1 
ATOM   40  C  CE1 . TYR A 1 7  ? 4.253  -0.041  9.031  1.00 17.77 ? 7    TYR A CE1 1 
ATOM   41  C  CE2 . TYR A 1 7  ? 3.212  0.551   6.995  1.00 20.75 ? 7    TYR A CE2 1 
ATOM   42  C  CZ  . TYR A 1 7  ? 3.661  0.916   8.250  1.00 21.64 ? 7    TYR A CZ  1 
ATOM   43  O  OH  . TYR A 1 7  ? 3.522  2.254   8.709  1.00 25.27 ? 7    TYR A OH  1 
ATOM   44  N  N   . THR A 1 8  ? 2.889  -5.712  5.506  1.00 20.80 ? 8    THR A N   1 
ATOM   45  C  CA  . THR A 1 8  ? 3.347  -6.930  4.872  1.00 23.14 ? 8    THR A CA  1 
ATOM   46  C  C   . THR A 1 8  ? 4.653  -6.705  4.139  1.00 23.21 ? 8    THR A C   1 
ATOM   47  O  O   . THR A 1 8  ? 5.003  -5.556  3.794  1.00 21.10 ? 8    THR A O   1 
ATOM   48  C  CB  . THR A 1 8  ? 2.381  -7.411  3.771  1.00 24.87 ? 8    THR A CB  1 
ATOM   49  O  OG1 . THR A 1 8  ? 2.217  -6.412  2.776  1.00 27.01 ? 8    THR A OG1 1 
ATOM   50  C  CG2 . THR A 1 8  ? 0.901  -7.576  4.245  1.00 29.22 ? 8    THR A CG2 1 
ATOM   51  N  N   . LYS A 1 9  ? 5.395  -7.806  3.966  1.00 24.00 ? 9    LYS A N   1 
ATOM   52  C  CA  . LYS A 1 9  ? 6.692  -7.760  3.270  1.00 24.09 ? 9    LYS A CA  1 
ATOM   53  C  C   . LYS A 1 9  ? 6.507  -7.209  1.881  1.00 24.88 ? 9    LYS A C   1 
ATOM   54  O  O   . LYS A 1 9  ? 7.348  -6.485  1.355  1.00 22.64 ? 9    LYS A O   1 
ATOM   55  C  CB  . LYS A 1 9  ? 7.312  -9.178  3.184  1.00 26.54 ? 9    LYS A CB  1 
ATOM   56  C  CG  . LYS A 1 9  ? 8.308  -9.605  4.264  1.00 33.02 ? 9    LYS A CG  1 
ATOM   57  C  CD  . LYS A 1 9  ? 8.627  -11.097 4.243  1.00 37.67 ? 9    LYS A CD  1 
ATOM   58  C  CE  . LYS A 1 9  ? 9.134  -11.547 5.653  1.00 40.63 ? 9    LYS A CE  1 
ATOM   59  N  NZ  . LYS A 1 9  ? 10.029 -12.714 5.609  1.00 43.28 ? 9    LYS A NZ  1 
ATOM   60  N  N   . GLU A 1 10 ? 5.395  -7.520  1.252  1.00 25.71 ? 10   GLU A N   1 
ATOM   61  C  CA  . GLU A 1 10 ? 5.062  -7.043  -0.054 1.00 26.62 ? 10   GLU A CA  1 
ATOM   62  C  C   . GLU A 1 10 ? 4.880  -5.536  -0.075 1.00 26.29 ? 10   GLU A C   1 
ATOM   63  O  O   . GLU A 1 10 ? 5.348  -4.755  -0.944 1.00 26.69 ? 10   GLU A O   1 
ATOM   64  C  CB  . GLU A 1 10 ? 3.759  -7.775  -0.469 1.00 28.87 ? 10   GLU A CB  1 
ATOM   65  C  CG  . GLU A 1 10 ? 3.897  -9.270  -0.759 1.00 36.67 ? 10   GLU A CG  1 
ATOM   66  C  CD  . GLU A 1 10 ? 4.146  -10.218 0.433  1.00 42.76 ? 10   GLU A CD  1 
ATOM   67  O  OE1 . GLU A 1 10 ? 3.732  -9.944  1.629  1.00 39.25 ? 10   GLU A OE1 1 
ATOM   68  O  OE2 . GLU A 1 10 ? 4.768  -11.310 0.146  1.00 48.51 ? 10   GLU A OE2 1 
ATOM   69  N  N   . GLU A 1 11 ? 4.270  -5.071  1.018  1.00 24.42 ? 11   GLU A N   1 
ATOM   70  C  C   . GLU A 1 11 ? 5.530  -2.803  1.212  1.00 18.72 ? 11   GLU A C   1 
ATOM   71  O  O   . GLU A 1 11 ? 5.834  -1.757  0.658  1.00 20.60 ? 11   GLU A O   1 
ATOM   72  O  OE1 A GLU A 1 11 ? 0.884  -4.124  4.253  0.50 28.85 ? 11   GLU A OE1 1 
ATOM   73  O  OE1 B GLU A 1 11 ? 1.357  -2.751  4.378  0.50 23.67 ? 11   GLU A OE1 1 
ATOM   74  O  OE2 A GLU A 1 11 ? 1.297  -1.588  3.658  0.50 30.29 ? 11   GLU A OE2 1 
ATOM   75  O  OE2 B GLU A 1 11 ? 1.896  0.252   2.939  0.50 34.00 ? 11   GLU A OE2 1 
ATOM   76  N  N   . VAL A 1 12 ? 6.313  -3.404  2.117  1.00 16.99 ? 12   VAL A N   1 
ATOM   77  C  CA  . VAL A 1 12 ? 7.641  -2.847  2.374  1.00 14.97 ? 12   VAL A CA  1 
ATOM   78  C  C   . VAL A 1 12 ? 8.406  -2.837  1.039  1.00 14.39 ? 12   VAL A C   1 
ATOM   79  O  O   . VAL A 1 12 ? 9.175  -1.880  0.767  1.00 14.00 ? 12   VAL A O   1 
ATOM   80  C  CB  . VAL A 1 12 ? 8.321  -3.677  3.412  1.00 15.12 ? 12   VAL A CB  1 
ATOM   81  C  CG1 . VAL A 1 12 ? 9.754  -3.196  3.575  1.00 15.90 ? 12   VAL A CG1 1 
ATOM   82  C  CG2 . VAL A 1 12 ? 7.587  -3.501  4.708  1.00 15.22 ? 12   VAL A CG2 1 
ATOM   83  N  N   . SER A 1 13 ? 8.305  -3.906  0.239  1.00 14.46 ? 13   SER A N   1 
ATOM   84  C  CA  . SER A 1 13 ? 9.087  -4.066  -0.965 1.00 14.78 ? 13   SER A CA  1 
ATOM   85  C  C   . SER A 1 13 ? 8.855  -2.973  -2.004 1.00 15.60 ? 13   SER A C   1 
ATOM   86  O  O   . SER A 1 13 ? 9.717  -2.732  -2.824 1.00 18.15 ? 13   SER A O   1 
ATOM   87  C  CB  . SER A 1 13 ? 8.862  -5.476  -1.567 1.00 16.75 ? 13   SER A CB  1 
ATOM   88  O  OG  . SER A 1 13 ? 7.685  -5.512  -2.284 1.00 22.50 ? 13   SER A OG  1 
ATOM   89  N  N   . SER A 1 14 ? 7.737  -2.283  -1.918 1.00 15.07 ? 14   SER A N   1 
ATOM   90  C  CA  . SER A 1 14 ? 7.396  -1.196  -2.844 1.00 17.19 ? 14   SER A CA  1 
ATOM   91  C  C   . SER A 1 14 ? 8.082  0.130   -2.463 1.00 16.70 ? 14   SER A C   1 
ATOM   92  O  O   . SER A 1 14 ? 8.118  1.054   -3.252 1.00 19.16 ? 14   SER A O   1 
ATOM   93  C  CB  . SER A 1 14 ? 5.875  -1.048  -2.944 1.00 19.77 ? 14   SER A CB  1 
ATOM   94  O  OG  . SER A 1 14 ? 5.316  -0.389  -1.887 1.00 26.01 ? 14   SER A OG  1 
ATOM   95  N  N   . HIS A 1 15 ? 8.713  0.205   -1.276 1.00 14.30 ? 15   HIS A N   1 
ATOM   96  C  CA  . HIS A 1 15 ? 9.233  1.451   -0.781 1.00 13.67 ? 15   HIS A CA  1 
ATOM   97  C  C   . HIS A 1 15 ? 10.725 1.539   -0.962 1.00 12.76 ? 15   HIS A C   1 
ATOM   98  O  O   . HIS A 1 15 ? 11.552 1.283   -0.035 1.00 12.96 ? 15   HIS A O   1 
ATOM   99  C  CB  . HIS A 1 15 ? 8.831  1.599   0.699  1.00 15.68 ? 15   HIS A CB  1 
ATOM   100 C  CG  . HIS A 1 15 ? 7.383  1.998   0.822  1.00 17.52 ? 15   HIS A CG  1 
ATOM   101 N  ND1 . HIS A 1 15 ? 6.337  1.107   0.934  1.00 22.02 ? 15   HIS A ND1 1 
ATOM   102 C  CD2 . HIS A 1 15 ? 6.828  3.222   0.800  1.00 21.50 ? 15   HIS A CD2 1 
ATOM   103 C  CE1 . HIS A 1 15 ? 5.177  1.779   0.998  1.00 20.14 ? 15   HIS A CE1 1 
ATOM   104 N  NE2 . HIS A 1 15 ? 5.466  3.064   0.930  1.00 23.93 ? 15   HIS A NE2 1 
ATOM   105 N  N   . THR A 1 16 ? 11.089 1.926   -2.184 1.00 13.77 ? 16   THR A N   1 
ATOM   106 C  CA  . THR A 1 16 ? 12.450 1.885   -2.620 1.00 14.13 ? 16   THR A CA  1 
ATOM   107 C  C   . THR A 1 16 ? 12.932 3.227   -3.151 1.00 15.08 ? 16   THR A C   1 
ATOM   108 O  O   . THR A 1 16 ? 14.063 3.295   -3.617 1.00 18.51 ? 16   THR A O   1 
ATOM   109 C  CB  . THR A 1 16 ? 12.695 0.775   -3.673 1.00 15.05 ? 16   THR A CB  1 
ATOM   110 O  OG1 . THR A 1 16 ? 11.858 1.063   -4.819 1.00 16.81 ? 16   THR A OG1 1 
ATOM   111 C  CG2 . THR A 1 16 ? 12.368 -0.586  -3.180 1.00 18.05 ? 16   THR A CG2 1 
ATOM   112 N  N   . SER A 1 17 ? 12.143 4.267   -3.043 1.00 16.35 ? 17   SER A N   1 
ATOM   113 C  CA  . SER A 1 17 ? 12.498 5.616   -3.562 1.00 17.83 ? 17   SER A CA  1 
ATOM   114 C  C   . SER A 1 17 ? 11.969 6.710   -2.614 1.00 18.13 ? 17   SER A C   1 
ATOM   115 O  O   . SER A 1 17 ? 11.021 6.509   -1.839 1.00 20.87 ? 17   SER A O   1 
ATOM   116 C  CB  . SER A 1 17 ? 11.900 5.827   -4.994 1.00 19.72 ? 17   SER A CB  1 
ATOM   117 O  OG  . SER A 1 17 ? 10.508 5.967   -4.864 1.00 23.51 ? 17   SER A OG  1 
ATOM   118 N  N   . PRO A 1 18 ? 12.473 7.910   -2.753 1.00 22.71 ? 18   PRO A N   1 
ATOM   119 C  CA  . PRO A 1 18 ? 11.890 9.105   -2.023 1.00 25.42 ? 18   PRO A CA  1 
ATOM   120 C  C   . PRO A 1 18 ? 10.422 9.387   -2.227 1.00 28.55 ? 18   PRO A C   1 
ATOM   121 O  O   . PRO A 1 18 ? 9.693  9.717   -1.236 1.00 28.65 ? 18   PRO A O   1 
ATOM   122 C  CB  . PRO A 1 18 ? 12.650 10.239  -2.564 1.00 26.85 ? 18   PRO A CB  1 
ATOM   123 C  CG  . PRO A 1 18 ? 13.963 9.623   -2.915 1.00 24.45 ? 18   PRO A CG  1 
ATOM   124 C  CD  . PRO A 1 18 ? 13.708 8.216   -3.505 1.00 23.26 ? 18   PRO A CD  1 
ATOM   125 N  N   . GLU A 1 19 ? 9.958  9.205   -3.460 1.00 30.81 ? 19   GLU A N   1 
ATOM   126 C  CA  . GLU A 1 19 ? 8.550  9.431   -3.783 1.00 33.11 ? 19   GLU A CA  1 
ATOM   127 C  C   . GLU A 1 19 ? 7.681  8.539   -2.917 1.00 31.24 ? 19   GLU A C   1 
ATOM   128 O  O   . GLU A 1 19 ? 6.693  8.981   -2.297 1.00 32.60 ? 19   GLU A O   1 
ATOM   129 C  CB  . GLU A 1 19 ? 8.293  9.214   -5.289 1.00 36.22 ? 19   GLU A CB  1 
ATOM   130 C  CG  . GLU A 1 19 ? 7.859  7.825   -5.745 1.00 43.78 ? 19   GLU A CG  1 
ATOM   131 C  CD  . GLU A 1 19 ? 7.768  7.644   -7.287 1.00 53.22 ? 19   GLU A CD  1 
ATOM   132 O  OE1 . GLU A 1 19 ? 8.211  8.551   -8.063 1.00 56.87 ? 19   GLU A OE1 1 
ATOM   133 O  OE2 . GLU A 1 19 ? 7.255  6.564   -7.731 1.00 57.71 ? 19   GLU A OE2 1 
ATOM   134 N  N   . THR A 1 20 ? 8.083  7.265   -2.806 1.00 28.23 ? 20   THR A N   1 
ATOM   135 C  CA  . THR A 1 20 ? 7.340  6.347   -2.019 1.00 26.43 ? 20   THR A CA  1 
ATOM   136 C  C   . THR A 1 20 ? 7.751  6.391   -0.556 1.00 23.03 ? 20   THR A C   1 
ATOM   137 O  O   . THR A 1 20 ? 6.946  5.978   0.303  1.00 23.92 ? 20   THR A O   1 
ATOM   138 C  CB  . THR A 1 20 ? 7.579  4.921   -2.577 1.00 26.92 ? 20   THR A CB  1 
ATOM   139 O  OG1 . THR A 1 20 ? 6.819  3.957   -1.888 1.00 36.89 ? 20   THR A OG1 1 
ATOM   140 C  CG2 . THR A 1 20 ? 8.920  4.492   -2.349 1.00 18.65 ? 20   THR A CG2 1 
ATOM   141 N  N   . GLY A 1 21 ? 8.981  6.849   -0.252 1.00 21.55 ? 21   GLY A N   1 
ATOM   142 C  CA  . GLY A 1 21 ? 9.683  6.528   1.025  1.00 17.63 ? 21   GLY A CA  1 
ATOM   143 C  C   . GLY A 1 21 ? 10.535 5.284   0.799  1.00 14.49 ? 21   GLY A C   1 
ATOM   144 O  O   . GLY A 1 21 ? 10.138 4.341   0.095  1.00 16.39 ? 21   GLY A O   1 
ATOM   145 N  N   . ILE A 1 22 ? 11.720 5.324   1.420  1.00 10.65 ? 22   ILE A N   1 
ATOM   146 C  CA  . ILE A 1 22 ? 12.697 4.255   1.386  1.00 9.45  ? 22   ILE A CA  1 
ATOM   147 C  C   . ILE A 1 22 ? 12.602 3.521   2.721  1.00 9.50  ? 22   ILE A C   1 
ATOM   148 O  O   . ILE A 1 22 ? 12.932 4.108   3.760  1.00 9.61  ? 22   ILE A O   1 
ATOM   149 C  CB  . ILE A 1 22 ? 14.123 4.834   1.189  1.00 10.93 ? 22   ILE A CB  1 
ATOM   150 C  CG1 . ILE A 1 22 ? 14.194 5.666   -0.072 1.00 12.70 ? 22   ILE A CG1 1 
ATOM   151 C  CG2 . ILE A 1 22 ? 15.152 3.708   1.226  1.00 11.11 ? 22   ILE A CG2 1 
ATOM   152 C  CD1 . ILE A 1 22 ? 15.367 6.609   -0.183 1.00 13.64 ? 22   ILE A CD1 1 
ATOM   153 N  N   . TRP A 1 23 ? 12.179 2.282   2.681  1.00 9.38  ? 23   TRP A N   1 
ATOM   154 C  CA  . TRP A 1 23 ? 11.998 1.452   3.870  1.00 9.33  ? 23   TRP A CA  1 
ATOM   155 C  C   . TRP A 1 23 ? 12.920 0.260   3.866  1.00 8.56  ? 23   TRP A C   1 
ATOM   156 O  O   . TRP A 1 23 ? 13.292 -0.248  2.829  1.00 10.47 ? 23   TRP A O   1 
ATOM   157 C  CB  . TRP A 1 23 ? 10.582 0.955   4.004  1.00 9.52  ? 23   TRP A CB  1 
ATOM   158 C  CG  . TRP A 1 23 ? 9.456  2.000   4.067  1.00 11.08 ? 23   TRP A CG  1 
ATOM   159 C  CD1 . TRP A 1 23 ? 9.534  3.370   3.979  1.00 10.37 ? 23   TRP A CD1 1 
ATOM   160 C  CD2 . TRP A 1 23 ? 8.072  1.687   4.212  1.00 12.11 ? 23   TRP A CD2 1 
ATOM   161 N  NE1 . TRP A 1 23 ? 8.259  3.900   4.045  1.00 12.52 ? 23   TRP A NE1 1 
ATOM   162 C  CE2 . TRP A 1 23 ? 7.379  2.898   4.214  1.00 12.41 ? 23   TRP A CE2 1 
ATOM   163 C  CE3 . TRP A 1 23 ? 7.373  0.517   4.417  1.00 13.09 ? 23   TRP A CE3 1 
ATOM   164 C  CZ2 . TRP A 1 23 ? 5.979  2.963   4.340  1.00 14.27 ? 23   TRP A CZ2 1 
ATOM   165 C  CZ3 . TRP A 1 23 ? 5.998  0.562   4.521  1.00 16.90 ? 23   TRP A CZ3 1 
ATOM   166 C  CH2 . TRP A 1 23 ? 5.334  1.775   4.451  1.00 16.44 ? 23   TRP A CH2 1 
ATOM   167 N  N   . VAL A 1 24 ? 13.272 -0.176  5.066  1.00 8.61  ? 24   VAL A N   1 
ATOM   168 C  CA  . VAL A 1 24 ? 14.011 -1.416  5.314  1.00 8.27  ? 24   VAL A CA  1 
ATOM   169 C  C   . VAL A 1 24 ? 13.418 -2.112  6.491  1.00 7.52  ? 24   VAL A C   1 
ATOM   170 O  O   . VAL A 1 24 ? 12.659 -1.552  7.270  1.00 8.80  ? 24   VAL A O   1 
ATOM   171 C  CB  . VAL A 1 24 ? 15.514 -1.182  5.528  1.00 8.09  ? 24   VAL A CB  1 
ATOM   172 C  CG1 . VAL A 1 24 ? 16.182 -0.558  4.296  1.00 9.51  ? 24   VAL A CG1 1 
ATOM   173 C  CG2 . VAL A 1 24 ? 15.784 -0.334  6.758  1.00 9.48  ? 24   VAL A CG2 1 
ATOM   174 N  N   . THR A 1 25 ? 13.804 -3.383  6.682  1.00 8.06  ? 25   THR A N   1 
ATOM   175 C  CA  . THR A 1 25 ? 13.479 -4.143  7.851  1.00 8.24  ? 25   THR A CA  1 
ATOM   176 C  C   . THR A 1 25 ? 14.712 -4.683  8.585  1.00 7.95  ? 25   THR A C   1 
ATOM   177 O  O   . THR A 1 25 ? 15.763 -4.876  8.000  1.00 8.14  ? 25   THR A O   1 
ATOM   178 C  CB  . THR A 1 25 ? 12.462 -5.269  7.555  1.00 9.31  ? 25   THR A CB  1 
ATOM   179 O  OG1 . THR A 1 25 ? 13.102 -6.320  6.806  1.00 9.63  ? 25   THR A OG1 1 
ATOM   180 C  CG2 . THR A 1 25 ? 11.255 -4.790  6.816  1.00 11.69 ? 25   THR A CG2 1 
ATOM   181 N  N   . LEU A 1 26 ? 14.516 -4.907  9.876  1.00 7.42  ? 26   LEU A N   1 
ATOM   182 C  CA  . LEU A 1 26 ? 15.529 -5.542  10.697 1.00 7.71  ? 26   LEU A CA  1 
ATOM   183 C  C   . LEU A 1 26 ? 14.771 -6.334  11.731 1.00 8.50  ? 26   LEU A C   1 
ATOM   184 O  O   . LEU A 1 26 ? 13.899 -5.793  12.436 1.00 8.92  ? 26   LEU A O   1 
ATOM   185 C  CB  . LEU A 1 26 ? 16.490 -4.557  11.367 1.00 8.13  ? 26   LEU A CB  1 
ATOM   186 C  CG  . LEU A 1 26 ? 17.600 -5.218  12.191 1.00 8.81  ? 26   LEU A CG  1 
ATOM   187 C  CD1 . LEU A 1 26 ? 18.619 -5.947  11.338 1.00 9.92  ? 26   LEU A CD1 1 
ATOM   188 C  CD2 . LEU A 1 26 ? 18.336 -4.216  13.015 1.00 10.81 ? 26   LEU A CD2 1 
ATOM   189 N  N   . GLY A 1 27 ? 15.003 -7.629  11.803 1.00 9.26  ? 27   GLY A N   1 
ATOM   190 C  CA  . GLY A 1 27 ? 14.086 -8.482  12.576 1.00 10.57 ? 27   GLY A CA  1 
ATOM   191 C  C   . GLY A 1 27 ? 12.715 -8.367  11.975 1.00 11.50 ? 27   GLY A C   1 
ATOM   192 O  O   . GLY A 1 27 ? 12.532 -8.343  10.769 1.00 13.27 ? 27   GLY A O   1 
ATOM   193 N  N   . SER A 1 28 ? 11.704 -8.220  12.843 1.00 12.29 ? 28   SER A N   1 
ATOM   194 C  CA  . SER A 1 28 ? 10.317 -7.963  12.401 1.00 13.38 ? 28   SER A CA  1 
ATOM   195 C  C   . SER A 1 28 ? 9.994  -6.495  12.371 1.00 12.58 ? 28   SER A C   1 
ATOM   196 O  O   . SER A 1 28 ? 8.822  -6.149  12.185 1.00 18.46 ? 28   SER A O   1 
ATOM   197 C  CB  . SER A 1 28 ? 9.313  -8.682  13.346 1.00 16.11 ? 28   SER A CB  1 
ATOM   198 O  OG  . SER A 1 28 ? 9.514  -10.040 13.097 1.00 24.74 ? 28   SER A OG  1 
ATOM   199 N  N   . GLU A 1 29 ? 10.922 -5.599  12.556 1.00 9.62  ? 29   GLU A N   1 
ATOM   200 C  CA  . GLU A 1 29 ? 10.640 -4.174  12.610 1.00 9.80  ? 29   GLU A CA  1 
ATOM   201 C  C   . GLU A 1 29 ? 10.833 -3.532  11.225 1.00 8.71  ? 29   GLU A C   1 
ATOM   202 O  O   . GLU A 1 29 ? 11.717 -3.934  10.444 1.00 9.22  ? 29   GLU A O   1 
ATOM   203 C  CB  . GLU A 1 29 ? 11.494 -3.501  13.671 1.00 9.47  ? 29   GLU A CB  1 
ATOM   204 C  CG  . GLU A 1 29 ? 11.210 -3.976  15.075 1.00 10.92 ? 29   GLU A CG  1 
ATOM   205 C  CD  . GLU A 1 29 ? 11.946 -3.233  16.141 1.00 13.02 ? 29   GLU A CD  1 
ATOM   206 O  OE1 . GLU A 1 29 ? 13.154 -3.044  16.002 1.00 14.00 ? 29   GLU A OE1 1 
ATOM   207 O  OE2 . GLU A 1 29 ? 11.309 -2.820  17.121 1.00 16.99 ? 29   GLU A OE2 1 
ATOM   208 N  N   . VAL A 1 30 ? 10.023 -2.514  10.943 1.00 8.56  ? 30   VAL A N   1 
ATOM   209 C  CA  . VAL A 1 30 ? 9.980  -1.773  9.685  1.00 8.14  ? 30   VAL A CA  1 
ATOM   210 C  C   . VAL A 1 30 ? 10.403 -0.341  9.954  1.00 7.79  ? 30   VAL A C   1 
ATOM   211 O  O   . VAL A 1 30 ? 9.887  0.273   10.915 1.00 9.07  ? 30   VAL A O   1 
ATOM   212 C  CB  . VAL A 1 30 ? 8.593  -1.829  9.050  1.00 9.10  ? 30   VAL A CB  1 
ATOM   213 C  CG1 . VAL A 1 30 ? 8.537  -1.109  7.724  1.00 10.44 ? 30   VAL A CG1 1 
ATOM   214 C  CG2 . VAL A 1 30 ? 8.142  -3.276  8.889  1.00 11.07 ? 30   VAL A CG2 1 
ATOM   215 N  N   . PHE A 1 31 ? 11.287 0.215   9.100  1.00 8.41  ? 31   PHE A N   1 
ATOM   216 C  CA  . PHE A 1 31 ? 11.863 1.531   9.305  1.00 7.65  ? 31   PHE A CA  1 
ATOM   217 C  C   . PHE A 1 31 ? 11.740 2.324   8.009  1.00 8.56  ? 31   PHE A C   1 
ATOM   218 O  O   . PHE A 1 31 ? 12.046 1.819   6.930  1.00 9.57  ? 31   PHE A O   1 
ATOM   219 C  CB  . PHE A 1 31 ? 13.358 1.402   9.663  1.00 7.32  ? 31   PHE A CB  1 
ATOM   220 C  CG  . PHE A 1 31 ? 13.600 0.534   10.837 1.00 7.09  ? 31   PHE A CG  1 
ATOM   221 C  CD1 . PHE A 1 31 ? 13.787 -0.824  10.688 1.00 8.04  ? 31   PHE A CD1 1 
ATOM   222 C  CD2 . PHE A 1 31 ? 13.636 1.033   12.112 1.00 8.01  ? 31   PHE A CD2 1 
ATOM   223 C  CE1 . PHE A 1 31 ? 13.986 -1.670  11.763 1.00 8.53  ? 31   PHE A CE1 1 
ATOM   224 C  CE2 . PHE A 1 31 ? 13.811 0.224   13.205 1.00 8.44  ? 31   PHE A CE2 1 
ATOM   225 C  CZ  . PHE A 1 31 ? 13.967 -1.151  13.019 1.00 8.65  ? 31   PHE A CZ  1 
ATOM   226 N  N   . ASP A 1 32 ? 11.298 3.571   8.124  1.00 8.33  ? 32   ASP A N   1 
ATOM   227 C  CA  . ASP A 1 32 ? 11.268 4.517   6.996  1.00 8.84  ? 32   ASP A CA  1 
ATOM   228 C  C   . ASP A 1 32 ? 12.504 5.420   7.151  1.00 7.54  ? 32   ASP A C   1 
ATOM   229 O  O   . ASP A 1 32 ? 12.510 6.337   7.961  1.00 8.46  ? 32   ASP A O   1 
ATOM   230 C  CB  . ASP A 1 32 ? 10.006 5.357   6.965  1.00 9.64  ? 32   ASP A CB  1 
ATOM   231 C  CG  . ASP A 1 32 ? 10.030 6.423   5.906  1.00 11.46 ? 32   ASP A CG  1 
ATOM   232 O  OD1 . ASP A 1 32 ? 11.015 6.552   5.208  1.00 10.49 ? 32   ASP A OD1 1 
ATOM   233 O  OD2 . ASP A 1 32 ? 9.038  7.207   5.801  1.00 18.38 ? 32   ASP A OD2 1 
ATOM   234 N  N   . VAL A 1 33 ? 13.566 5.107   6.401  1.00 7.47  ? 33   VAL A N   1 
ATOM   235 C  CA  . VAL A 1 33 ? 14.863 5.710   6.568  1.00 7.80  ? 33   VAL A CA  1 
ATOM   236 C  C   . VAL A 1 33 ? 15.127 6.794   5.505  1.00 8.55  ? 33   VAL A C   1 
ATOM   237 O  O   . VAL A 1 33 ? 16.262 7.285   5.411  1.00 9.54  ? 33   VAL A O   1 
ATOM   238 C  CB  . VAL A 1 33 ? 16.012 4.682   6.572  1.00 8.10  ? 33   VAL A CB  1 
ATOM   239 C  CG1 . VAL A 1 33 ? 15.874 3.765   7.779  1.00 8.57  ? 33   VAL A CG1 1 
ATOM   240 C  CG2 . VAL A 1 33 ? 16.082 3.895   5.292  1.00 8.06  ? 33   VAL A CG2 1 
ATOM   241 N  N   . THR A 1 34 ? 14.106 7.239   4.802  1.00 8.82  ? 34   THR A N   1 
ATOM   242 C  CA  . THR A 1 34 ? 14.225 8.246   3.751  1.00 8.75  ? 34   THR A CA  1 
ATOM   243 C  C   . THR A 1 34 ? 15.103 9.405   4.166  1.00 10.17 ? 34   THR A C   1 
ATOM   244 O  O   . THR A 1 34 ? 16.003 9.787   3.385  1.00 10.72 ? 34   THR A O   1 
ATOM   245 C  CB  . THR A 1 34 ? 12.823 8.742   3.375  1.00 10.32 ? 34   THR A CB  1 
ATOM   246 O  OG1 . THR A 1 34 ? 11.967 7.659   3.041  1.00 10.66 ? 34   THR A OG1 1 
ATOM   247 C  CG2 . THR A 1 34 ? 12.873 9.646   2.150  1.00 13.12 ? 34   THR A CG2 1 
ATOM   248 N  N   . GLU A 1 35 ? 14.844 10.010  5.304  1.00 9.76  ? 35   GLU A N   1 
ATOM   249 C  CA  . GLU A 1 35 ? 15.560 11.209  5.710  1.00 10.55 ? 35   GLU A CA  1 
ATOM   250 C  C   . GLU A 1 35 ? 16.966 10.967  6.162  1.00 10.41 ? 35   GLU A C   1 
ATOM   251 O  O   . GLU A 1 35 ? 17.747 11.929  6.233  1.00 14.84 ? 35   GLU A O   1 
ATOM   252 C  CB  . GLU A 1 35 ? 14.781 12.045  6.697  1.00 12.76 ? 35   GLU A CB  1 
ATOM   253 C  CG  . GLU A 1 35 ? 13.434 12.527  6.128  1.00 15.04 ? 35   GLU A CG  1 
ATOM   254 C  CD  . GLU A 1 35 ? 13.584 13.358  4.852  1.00 30.10 ? 35   GLU A CD  1 
ATOM   255 O  OE1 . GLU A 1 35 ? 14.578 14.142  4.720  1.00 31.70 ? 35   GLU A OE1 1 
ATOM   256 O  OE2 . GLU A 1 35 ? 12.743 13.191  3.917  1.00 39.27 ? 35   GLU A OE2 1 
ATOM   257 N  N   . PHE A 1 36 ? 17.366 9.738   6.431  1.00 8.93  ? 36   PHE A N   1 
ATOM   258 C  CA  . PHE A 1 36 ? 18.728 9.407   6.796  1.00 8.40  ? 36   PHE A CA  1 
ATOM   259 C  C   . PHE A 1 36 ? 19.620 9.146   5.604  1.00 7.60  ? 36   PHE A C   1 
ATOM   260 O  O   . PHE A 1 36 ? 20.843 9.285   5.745  1.00 8.42  ? 36   PHE A O   1 
ATOM   261 C  CB  . PHE A 1 36 ? 18.752 8.173   7.716  1.00 8.52  ? 36   PHE A CB  1 
ATOM   262 C  CG  . PHE A 1 36 ? 20.112 7.755   8.140  1.00 8.38  ? 36   PHE A CG  1 
ATOM   263 C  CD1 . PHE A 1 36 ? 20.871 8.538   9.024  1.00 9.85  ? 36   PHE A CD1 1 
ATOM   264 C  CD2 . PHE A 1 36 ? 20.683 6.608   7.619  1.00 8.92  ? 36   PHE A CD2 1 
ATOM   265 C  CE1 . PHE A 1 36 ? 22.159 8.186   9.328  1.00 10.83 ? 36   PHE A CE1 1 
ATOM   266 C  CE2 . PHE A 1 36 ? 21.989 6.281   7.949  1.00 10.20 ? 36   PHE A CE2 1 
ATOM   267 C  CZ  . PHE A 1 36 ? 22.693 7.013   8.808  1.00 10.63 ? 36   PHE A CZ  1 
ATOM   268 N  N   . VAL A 1 37 ? 19.130 8.632   4.489  1.00 8.44  ? 37   VAL A N   1 
ATOM   269 C  CA  . VAL A 1 37 ? 20.003 7.982   3.523  1.00 8.37  ? 37   VAL A CA  1 
ATOM   270 C  C   . VAL A 1 37 ? 21.165 8.810   3.053  1.00 7.25  ? 37   VAL A C   1 
ATOM   271 O  O   . VAL A 1 37 ? 22.266 8.296   2.951  1.00 7.89  ? 37   VAL A O   1 
ATOM   272 C  CB  A VAL A 1 37 ? 18.157 6.522   2.789  0.50 11.74 ? 37   VAL A CB  1 
ATOM   273 C  CB  B VAL A 1 37 ? 19.782 7.200   1.030  0.50 15.69 ? 37   VAL A CB  1 
ATOM   274 C  CG2 A VAL A 1 37 ? 18.708 8.322   1.405  0.50 12.01 ? 37   VAL A CG2 1 
ATOM   275 C  CG2 B VAL A 1 37 ? 18.082 6.400   2.790  0.50 19.98 ? 37   VAL A CG2 1 
ATOM   276 N  N   . ASP A 1 38 ? 20.967 10.104  2.782  1.00 8.08  ? 38   ASP A N   1 
ATOM   277 C  CA  . ASP A 1 38 ? 22.061 10.930  2.227  1.00 9.53  ? 38   ASP A CA  1 
ATOM   278 C  C   . ASP A 1 38 ? 23.202 11.081  3.243  1.00 8.83  ? 38   ASP A C   1 
ATOM   279 O  O   . ASP A 1 38 ? 24.329 11.419  2.869  1.00 9.87  ? 38   ASP A O   1 
ATOM   280 C  CB  . ASP A 1 38 ? 21.560 12.287  1.816  1.00 10.14 ? 38   ASP A CB  1 
ATOM   281 C  CG  . ASP A 1 38 ? 20.706 12.299  0.539  1.00 11.01 ? 38   ASP A CG  1 
ATOM   282 O  OD1 . ASP A 1 38 ? 20.605 11.265  -0.115 1.00 12.67 ? 38   ASP A OD1 1 
ATOM   283 O  OD2 . ASP A 1 38 ? 20.206 13.410  0.276  1.00 14.14 ? 38   ASP A OD2 1 
ATOM   284 N  N   . LEU A 1 39 ? 22.934 10.872  4.562  1.00 8.48  ? 39   LEU A N   1 
ATOM   285 C  CA  . LEU A 1 39 ? 23.892 10.967  5.632  1.00 8.87  ? 39   LEU A CA  1 
ATOM   286 C  C   . LEU A 1 39 ? 24.585 9.655   5.901  1.00 8.90  ? 39   LEU A C   1 
ATOM   287 O  O   . LEU A 1 39 ? 25.441 9.580   6.790  1.00 11.19 ? 39   LEU A O   1 
ATOM   288 C  CB  . LEU A 1 39 ? 23.214 11.441  6.938  1.00 9.64  ? 39   LEU A CB  1 
ATOM   289 C  CG  . LEU A 1 39 ? 22.699 12.854  6.965  1.00 13.87 ? 39   LEU A CG  1 
ATOM   290 C  CD1 . LEU A 1 39 ? 23.713 13.843  6.707  1.00 16.24 ? 39   LEU A CD1 1 
ATOM   291 C  CD2 . LEU A 1 39 ? 21.497 13.215  6.144  1.00 18.57 ? 39   LEU A CD2 1 
ATOM   292 N  N   . HIS A 1 40 ? 24.281 8.608   5.189  1.00 8.21  ? 40   HIS A N   1 
ATOM   293 C  CA  . HIS A 1 40 ? 24.912 7.330   5.440  1.00 8.59  ? 40   HIS A CA  1 
ATOM   294 C  C   . HIS A 1 40 ? 26.407 7.425   5.202  1.00 9.30  ? 40   HIS A C   1 
ATOM   295 O  O   . HIS A 1 40 ? 26.823 7.870   4.124  1.00 11.28 ? 40   HIS A O   1 
ATOM   296 C  CB  . HIS A 1 40 ? 24.340 6.249   4.526  1.00 7.71  ? 40   HIS A CB  1 
ATOM   297 C  CG  . HIS A 1 40 ? 24.895 4.890   4.786  1.00 7.37  ? 40   HIS A CG  1 
ATOM   298 N  ND1 . HIS A 1 40 ? 25.663 4.211   3.882  1.00 7.73  ? 40   HIS A ND1 1 
ATOM   299 C  CD2 . HIS A 1 40 ? 24.870 4.116   5.904  1.00 7.91  ? 40   HIS A CD2 1 
ATOM   300 C  CE1 . HIS A 1 40 ? 26.033 3.051   4.422  1.00 8.48  ? 40   HIS A CE1 1 
ATOM   301 N  NE2 . HIS A 1 40 ? 25.558 2.945   5.663  1.00 7.08  ? 40   HIS A NE2 1 
ATOM   302 N  N   . PRO A 1 41 ? 27.246 7.008   6.126  1.00 9.99  ? 41   PRO A N   1 
ATOM   303 C  CA  . PRO A 1 41 ? 28.694 7.025   5.896  1.00 12.81 ? 41   PRO A CA  1 
ATOM   304 C  C   . PRO A 1 41 ? 29.139 6.317   4.576  1.00 17.39 ? 41   PRO A C   1 
ATOM   305 O  O   . PRO A 1 41 ? 28.660 5.250   4.386  1.00 18.18 ? 41   PRO A O   1 
ATOM   306 C  CB  . PRO A 1 41 ? 29.307 6.433   7.183  1.00 13.21 ? 41   PRO A CB  1 
ATOM   307 C  CG  . PRO A 1 41 ? 28.341 6.882   8.202  1.00 11.01 ? 41   PRO A CG  1 
ATOM   308 C  CD  . PRO A 1 41 ? 26.953 6.661   7.526  1.00 10.49 ? 41   PRO A CD  1 
ATOM   309 N  N   . GLY A 1 42 ? 29.918 7.031   3.712  1.00 19.48 ? 42   GLY A N   1 
ATOM   310 C  CA  . GLY A 1 42 ? 30.307 6.601   2.349  1.00 19.88 ? 42   GLY A CA  1 
ATOM   311 C  C   . GLY A 1 42 ? 29.247 6.907   1.280  1.00 18.98 ? 42   GLY A C   1 
ATOM   312 O  O   . GLY A 1 42 ? 29.414 6.648   0.076  1.00 21.51 ? 42   GLY A O   1 
ATOM   313 N  N   . GLY A 1 43 ? 28.137 7.398   1.667  1.00 17.81 ? 43   GLY A N   1 
ATOM   314 C  CA  . GLY A 1 43 ? 27.148 7.710   0.778  1.00 15.92 ? 43   GLY A CA  1 
ATOM   315 C  C   . GLY A 1 43 ? 26.002 6.719   0.760  1.00 11.41 ? 43   GLY A C   1 
ATOM   316 O  O   . GLY A 1 43 ? 26.010 5.586   1.300  1.00 11.57 ? 43   GLY A O   1 
ATOM   317 N  N   . PRO A 1 44 ? 24.960 7.215   0.188  1.00 9.71  ? 44   PRO A N   1 
ATOM   318 C  CA  . PRO A 1 44 ? 23.692 6.527   0.176  1.00 8.47  ? 44   PRO A CA  1 
ATOM   319 C  C   . PRO A 1 44 ? 23.641 5.351   -0.712 1.00 7.55  ? 44   PRO A C   1 
ATOM   320 O  O   . PRO A 1 44 ? 22.790 4.495   -0.490 1.00 8.51  ? 44   PRO A O   1 
ATOM   321 C  CB  . PRO A 1 44 ? 22.711 7.615   -0.260 1.00 11.62 ? 44   PRO A CB  1 
ATOM   322 C  CG  . PRO A 1 44 ? 23.487 8.574   -0.977 1.00 13.39 ? 44   PRO A CG  1 
ATOM   323 C  CD  . PRO A 1 44 ? 24.820 8.646   -0.278 1.00 12.38 ? 44   PRO A CD  1 
ATOM   324 N  N   . SER A 1 45 ? 24.433 5.248   -1.777 1.00 7.58  ? 45   SER A N   1 
ATOM   325 C  CA  . SER A 1 45 ? 24.217 4.169   -2.737 1.00 7.51  ? 45   SER A CA  1 
ATOM   326 C  C   . SER A 1 45 ? 24.424 2.789   -2.087 1.00 7.72  ? 45   SER A C   1 
ATOM   327 O  O   . SER A 1 45 ? 23.709 1.845   -2.465 1.00 8.23  ? 45   SER A O   1 
ATOM   328 C  CB  . SER A 1 45 ? 25.052 4.344   -4.000 1.00 8.71  ? 45   SER A CB  1 
ATOM   329 N  N   . LYS A 1 46 ? 25.388 2.607   -1.185 1.00 7.68  ? 46   LYS A N   1 
ATOM   330 C  CA  . LYS A 1 46 ? 25.534 1.313   -0.536 1.00 8.85  ? 46   LYS A CA  1 
ATOM   331 C  C   . LYS A 1 46 ? 24.303 0.961   0.263  1.00 8.69  ? 46   LYS A C   1 
ATOM   332 O  O   . LYS A 1 46 ? 23.807 -0.181  0.208  1.00 9.20  ? 46   LYS A O   1 
ATOM   333 C  CB  . LYS A 1 46 ? 26.749 1.334   0.349  1.00 13.15 ? 46   LYS A CB  1 
ATOM   334 C  CG  . LYS A 1 46 ? 27.950 0.961   -0.400 1.00 18.62 ? 46   LYS A CG  1 
ATOM   335 C  CD  . LYS A 1 46 ? 28.207 -0.491  0.028  1.00 27.42 ? 46   LYS A CD  1 
ATOM   336 C  CE  . LYS A 1 46 ? 29.697 -0.710  0.087  1.00 27.70 ? 46   LYS A CE  1 
ATOM   337 N  NZ  . LYS A 1 46 ? 29.983 -1.808  -0.942 1.00 23.04 ? 46   LYS A NZ  1 
ATOM   338 N  N   . LEU A 1 47 ? 23.772 1.890   1.060  1.00 7.91  ? 47   LEU A N   1 
ATOM   339 C  CA  . LEU A 1 47 ? 22.590 1.667   1.836  1.00 7.92  ? 47   LEU A CA  1 
ATOM   340 C  C   . LEU A 1 47 ? 21.459 1.215   0.949  1.00 7.84  ? 47   LEU A C   1 
ATOM   341 O  O   . LEU A 1 47 ? 20.672 0.304   1.313  1.00 8.34  ? 47   LEU A O   1 
ATOM   342 C  CB  . LEU A 1 47 ? 22.251 2.946   2.646  1.00 8.28  ? 47   LEU A CB  1 
ATOM   343 C  CG  . LEU A 1 47 ? 21.000 2.918   3.518  1.00 8.02  ? 47   LEU A CG  1 
ATOM   344 C  CD1 . LEU A 1 47 ? 21.096 3.982   4.589  1.00 8.43  ? 47   LEU A CD1 1 
ATOM   345 C  CD2 . LEU A 1 47 ? 19.716 3.102   2.715  1.00 9.93  ? 47   LEU A CD2 1 
ATOM   346 N  N   . MET A 1 48 ? 21.325 1.838   -0.220 1.00 7.39  ? 48   MET A N   1 
ATOM   347 C  CA  . MET A 1 48 ? 20.210 1.607   -1.107 1.00 7.72  ? 48   MET A CA  1 
ATOM   348 C  C   . MET A 1 48 ? 20.180 0.193   -1.653 1.00 7.56  ? 48   MET A C   1 
ATOM   349 O  O   . MET A 1 48 ? 19.113 -0.233  -2.114 1.00 8.64  ? 48   MET A O   1 
ATOM   350 C  CB  . MET A 1 48 ? 20.189 2.600   -2.251 1.00 8.01  ? 48   MET A CB  1 
ATOM   351 C  CG  . MET A 1 48 ? 19.826 3.997   -1.806 1.00 9.01  ? 48   MET A CG  1 
ATOM   352 S  SD  . MET A 1 48 ? 18.229 4.170   -0.989 1.00 10.25 ? 48   MET A SD  1 
ATOM   353 C  CE  . MET A 1 48 ? 17.117 3.816   -2.367 1.00 10.62 ? 48   MET A CE  1 
ATOM   354 N  N   . LEU A 1 49 ? 21.279 -0.558  -1.597 1.00 7.90  ? 49   LEU A N   1 
ATOM   355 C  CA  . LEU A 1 49 ? 21.236 -1.979  -1.957 1.00 8.78  ? 49   LEU A CA  1 
ATOM   356 C  C   . LEU A 1 49 ? 20.178 -2.731  -1.186 1.00 8.92  ? 49   LEU A C   1 
ATOM   357 O  O   . LEU A 1 49 ? 19.641 -3.721  -1.701 1.00 9.66  ? 49   LEU A O   1 
ATOM   358 C  CB  . LEU A 1 49 ? 22.599 -2.586  -1.773 1.00 8.51  ? 49   LEU A CB  1 
ATOM   359 C  CG  . LEU A 1 49 ? 23.704 -2.170  -2.699 1.00 10.24 ? 49   LEU A CG  1 
ATOM   360 C  CD1 . LEU A 1 49 ? 25.050 -2.677  -2.226 1.00 10.82 ? 49   LEU A CD1 1 
ATOM   361 C  CD2 . LEU A 1 49 ? 23.390 -2.548  -4.162 1.00 11.88 ? 49   LEU A CD2 1 
ATOM   362 N  N   . ALA A 1 50 ? 19.885 -2.313  0.029  1.00 8.35  ? 50   ALA A N   1 
ATOM   363 C  CA  . ALA A 1 50 ? 18.933 -2.993  0.894  1.00 8.69  ? 50   ALA A CA  1 
ATOM   364 C  C   . ALA A 1 50 ? 17.537 -2.448  0.810  1.00 8.71  ? 50   ALA A C   1 
ATOM   365 O  O   . ALA A 1 50 ? 16.643 -2.977  1.460  1.00 9.40  ? 50   ALA A O   1 
ATOM   366 C  CB  . ALA A 1 50 ? 19.460 -2.938  2.354  1.00 9.70  ? 50   ALA A CB  1 
ATOM   367 N  N   . ALA A 1 51 ? 17.306 -1.371  0.056  1.00 8.87  ? 51   ALA A N   1 
ATOM   368 C  CA  . ALA A 1 51 ? 15.985 -0.731  0.047  1.00 9.53  ? 51   ALA A CA  1 
ATOM   369 C  C   . ALA A 1 51 ? 14.881 -1.708  -0.253 1.00 9.09  ? 51   ALA A C   1 
ATOM   370 O  O   . ALA A 1 51 ? 14.963 -2.522  -1.162 1.00 10.71 ? 51   ALA A O   1 
ATOM   371 C  CB  . ALA A 1 51 ? 15.975 0.410   -0.974 1.00 10.72 ? 51   ALA A CB  1 
ATOM   372 N  N   . GLY A 1 52 ? 13.789 -1.588  0.493  1.00 9.29  ? 52   GLY A N   1 
ATOM   373 C  CA  . GLY A 1 52 ? 12.627 -2.419  0.303  1.00 11.14 ? 52   GLY A CA  1 
ATOM   374 C  C   . GLY A 1 52 ? 12.689 -3.778  0.948  1.00 11.02 ? 52   GLY A C   1 
ATOM   375 O  O   . GLY A 1 52 ? 11.719 -4.529  0.800  1.00 15.34 ? 52   GLY A O   1 
ATOM   376 N  N   . GLY A 1 53 ? 13.712 -4.100  1.702  1.00 9.48  ? 53   GLY A N   1 
ATOM   377 C  CA  . GLY A 1 53 ? 13.904 -5.416  2.234  1.00 10.30 ? 53   GLY A CA  1 
ATOM   378 C  C   . GLY A 1 53 ? 14.708 -5.457  3.505  1.00 8.53  ? 53   GLY A C   1 
ATOM   379 O  O   . GLY A 1 53 ? 14.951 -4.416  4.143  1.00 8.54  ? 53   GLY A O   1 
ATOM   380 N  N   . PRO A 1 54 ? 15.127 -6.651  3.899  1.00 8.85  ? 54   PRO A N   1 
ATOM   381 C  CA  . PRO A 1 54 ? 15.821 -6.823  5.161  1.00 7.90  ? 54   PRO A CA  1 
ATOM   382 C  C   . PRO A 1 54 ? 17.263 -6.335  5.081  1.00 7.58  ? 54   PRO A C   1 
ATOM   383 O  O   . PRO A 1 54 ? 18.003 -6.485  4.088  1.00 8.29  ? 54   PRO A O   1 
ATOM   384 C  CB  . PRO A 1 54 ? 15.795 -8.339  5.335  1.00 9.80  ? 54   PRO A CB  1 
ATOM   385 C  CG  . PRO A 1 54 ? 15.788 -8.880  3.910  1.00 12.29 ? 54   PRO A CG  1 
ATOM   386 C  CD  . PRO A 1 54 ? 14.891 -7.944  3.180  1.00 10.01 ? 54   PRO A CD  1 
ATOM   387 N  N   . LEU A 1 55 ? 17.739 -5.799  6.193  1.00 7.07  ? 55   LEU A N   1 
ATOM   388 C  CA  . LEU A 1 55 ? 19.139 -5.417  6.355  1.00 6.41  ? 55   LEU A CA  1 
ATOM   389 C  C   . LEU A 1 55 ? 20.031 -6.615  6.605  1.00 6.87  ? 55   LEU A C   1 
ATOM   390 O  O   . LEU A 1 55 ? 21.239 -6.553  6.256  1.00 7.25  ? 55   LEU A O   1 
ATOM   391 C  CB  . LEU A 1 55 ? 19.312 -4.415  7.515  1.00 7.47  ? 55   LEU A CB  1 
ATOM   392 C  CG  . LEU A 1 55 ? 18.665 -3.046  7.262  1.00 6.66  ? 55   LEU A CG  1 
ATOM   393 C  CD1 . LEU A 1 55 ? 18.761 -2.194  8.500  1.00 7.94  ? 55   LEU A CD1 1 
ATOM   394 C  CD2 . LEU A 1 55 ? 19.363 -2.349  6.122  1.00 9.74  ? 55   LEU A CD2 1 
ATOM   395 N  N   . GLU A 1 56 ? 19.543 -7.650  7.238  1.00 7.06  ? 56   GLU A N   1 
ATOM   396 C  CA  . GLU A 1 56 ? 20.380 -8.754  7.680  1.00 7.80  ? 56   GLU A CA  1 
ATOM   397 C  C   . GLU A 1 56 ? 21.350 -9.293  6.639  1.00 7.21  ? 56   GLU A C   1 
ATOM   398 O  O   . GLU A 1 56 ? 22.526 -9.496  6.981  1.00 7.60  ? 56   GLU A O   1 
ATOM   399 C  CB  . GLU A 1 56 ? 19.579 -9.937  8.242  1.00 8.71  ? 56   GLU A CB  1 
ATOM   400 C  CG  . GLU A 1 56 ? 18.852 -9.658  9.543  1.00 9.64  ? 56   GLU A CG  1 
ATOM   401 C  CD  . GLU A 1 56 ? 17.473 -9.035  9.471  1.00 9.21  ? 56   GLU A CD  1 
ATOM   402 O  OE1 . GLU A 1 56 ? 17.125 -8.352  8.522  1.00 8.85  ? 56   GLU A OE1 1 
ATOM   403 O  OE2 . GLU A 1 56 ? 16.753 -9.250  10.508 1.00 10.08 ? 56   GLU A OE2 1 
ATOM   404 N  N   . PRO A 1 57 ? 20.960 -9.561  5.394  1.00 7.78  ? 57   PRO A N   1 
ATOM   405 C  CA  . PRO A 1 57 ? 21.899 -10.203 4.471  1.00 8.76  ? 57   PRO A CA  1 
ATOM   406 C  C   . PRO A 1 57 ? 23.068 -9.279  4.126  1.00 8.57  ? 57   PRO A C   1 
ATOM   407 O  O   . PRO A 1 57 ? 24.093 -9.785  3.639  1.00 10.87 ? 57   PRO A O   1 
ATOM   408 C  CB  . PRO A 1 57 ? 21.086 -10.413 3.225  1.00 11.27 ? 57   PRO A CB  1 
ATOM   409 C  CG  . PRO A 1 57 ? 19.617 -10.305 3.589  1.00 13.99 ? 57   PRO A CG  1 
ATOM   410 C  CD  . PRO A 1 57 ? 19.636 -9.468  4.812  1.00 8.40  ? 57   PRO A CD  1 
ATOM   411 N  N   . PHE A 1 58 ? 22.926 -7.973  4.284  1.00 7.83  ? 58   PHE A N   1 
ATOM   412 C  CA  . PHE A 1 58 ? 23.937 -6.962  3.979  1.00 8.08  ? 58   PHE A CA  1 
ATOM   413 C  C   . PHE A 1 58 ? 24.745 -6.627  5.201  1.00 7.79  ? 58   PHE A C   1 
ATOM   414 O  O   . PHE A 1 58 ? 26.017 -6.636  5.191  1.00 8.66  ? 58   PHE A O   1 
ATOM   415 C  CB  . PHE A 1 58 ? 23.297 -5.688  3.438  1.00 7.67  ? 58   PHE A CB  1 
ATOM   416 C  CG  . PHE A 1 58 ? 22.582 -5.894  2.139  1.00 8.74  ? 58   PHE A CG  1 
ATOM   417 C  CD1 . PHE A 1 58 ? 21.228 -6.200  2.084  1.00 10.16 ? 58   PHE A CD1 1 
ATOM   418 C  CD2 . PHE A 1 58 ? 23.324 -5.831  0.919  1.00 9.05  ? 58   PHE A CD2 1 
ATOM   419 C  CE1 . PHE A 1 58 ? 20.612 -6.445  0.856  1.00 12.07 ? 58   PHE A CE1 1 
ATOM   420 C  CE2 . PHE A 1 58 ? 22.659 -6.075  -0.239 1.00 11.58 ? 58   PHE A CE2 1 
ATOM   421 C  CZ  . PHE A 1 58 ? 21.324 -6.402  -0.304 1.00 11.88 ? 58   PHE A CZ  1 
ATOM   422 N  N   . TRP A 1 59 ? 24.091 -6.359  6.342  1.00 7.92  ? 59   TRP A N   1 
ATOM   423 C  CA  . TRP A 1 59 ? 24.753 -6.031  7.579  1.00 7.64  ? 59   TRP A CA  1 
ATOM   424 C  C   . TRP A 1 59 ? 25.656 -7.164  8.074  1.00 7.00  ? 59   TRP A C   1 
ATOM   425 O  O   . TRP A 1 59 ? 26.630 -6.912  8.753  1.00 8.08  ? 59   TRP A O   1 
ATOM   426 C  CB  . TRP A 1 59 ? 23.797 -5.611  8.648  1.00 7.60  ? 59   TRP A CB  1 
ATOM   427 C  CG  . TRP A 1 59 ? 23.353 -4.178  8.601  1.00 7.47  ? 59   TRP A CG  1 
ATOM   428 C  CD1 . TRP A 1 59 ? 23.508 -3.278  7.581  1.00 7.63  ? 59   TRP A CD1 1 
ATOM   429 C  CD2 . TRP A 1 59 ? 22.705 -3.455  9.645  1.00 6.55  ? 59   TRP A CD2 1 
ATOM   430 N  NE1 . TRP A 1 59 ? 23.065 -2.053  7.933  1.00 8.01  ? 59   TRP A NE1 1 
ATOM   431 C  CE2 . TRP A 1 59 ? 22.581 -2.116  9.217  1.00 7.42  ? 59   TRP A CE2 1 
ATOM   432 C  CE3 . TRP A 1 59 ? 22.245 -3.775  10.915 1.00 7.51  ? 59   TRP A CE3 1 
ATOM   433 C  CZ2 . TRP A 1 59 ? 22.033 -1.137  10.005 1.00 7.93  ? 59   TRP A CZ2 1 
ATOM   434 C  CZ3 . TRP A 1 59 ? 21.714 -2.815  11.719 1.00 8.21  ? 59   TRP A CZ3 1 
ATOM   435 C  CH2 . TRP A 1 59 ? 21.631 -1.490  11.269 1.00 8.59  ? 59   TRP A CH2 1 
ATOM   436 N  N   . ALA A 1 60 ? 25.372 -8.384  7.709  1.00 8.02  ? 60   ALA A N   1 
ATOM   437 C  CA  . ALA A 1 60 ? 26.191 -9.517  8.056  1.00 8.23  ? 60   ALA A CA  1 
ATOM   438 C  C   . ALA A 1 60 ? 27.642 -9.321  7.653  1.00 8.11  ? 60   ALA A C   1 
ATOM   439 O  O   . ALA A 1 60 ? 28.560 -9.792  8.344  1.00 9.34  ? 60   ALA A O   1 
ATOM   440 C  CB  . ALA A 1 60 ? 25.687 -10.807 7.409  1.00 8.83  ? 60   ALA A CB  1 
ATOM   441 N  N   . LEU A 1 61 ? 27.875 -8.619  6.535  1.00 6.86  ? 61   LEU A N   1 
ATOM   442 C  CA  . LEU A 1 61 ? 29.222 -8.374  6.002  1.00 7.38  ? 61   LEU A CA  1 
ATOM   443 C  C   . LEU A 1 61 ? 29.872 -7.126  6.529  1.00 7.27  ? 61   LEU A C   1 
ATOM   444 O  O   . LEU A 1 61 ? 31.016 -6.870  6.208  1.00 8.82  ? 61   LEU A O   1 
ATOM   445 C  CD1 A LEU A 1 61 ? 30.487 -10.107 3.594  0.50 12.35 ? 61   LEU A CD1 1 
ATOM   446 C  CD1 B LEU A 1 61 ? 27.604 -10.235 3.889  0.50 17.98 ? 61   LEU A CD1 1 
ATOM   447 C  CD2 A LEU A 1 61 ? 27.840 -10.296 3.876  0.50 7.74  ? 61   LEU A CD2 1 
ATOM   448 C  CD2 B LEU A 1 61 ? 29.570 -9.625  2.385  0.50 10.29 ? 61   LEU A CD2 1 
ATOM   449 N  N   . TYR A 1 62 ? 29.130 -6.351  7.331  1.00 7.12  ? 62   TYR A N   1 
ATOM   450 C  CA  . TYR A 1 62 ? 29.574 -5.043  7.811  1.00 7.23  ? 62   TYR A CA  1 
ATOM   451 C  C   . TYR A 1 62 ? 29.320 -4.906  9.293  1.00 7.34  ? 62   TYR A C   1 
ATOM   452 O  O   . TYR A 1 62 ? 28.354 -4.292  9.742  1.00 6.93  ? 62   TYR A O   1 
ATOM   453 C  CB  . TYR A 1 62 ? 28.890 -3.933  6.997  1.00 8.13  ? 62   TYR A CB  1 
ATOM   454 C  CG  . TYR A 1 62 ? 29.341 -3.902  5.574  1.00 8.25  ? 62   TYR A CG  1 
ATOM   455 C  CD1 . TYR A 1 62 ? 30.548 -3.254  5.248  1.00 11.56 ? 62   TYR A CD1 1 
ATOM   456 C  CD2 . TYR A 1 62 ? 28.660 -4.466  4.536  1.00 8.40  ? 62   TYR A CD2 1 
ATOM   457 C  CE1 . TYR A 1 62 ? 31.016 -3.251  3.955  1.00 12.44 ? 62   TYR A CE1 1 
ATOM   458 C  CE2 . TYR A 1 62 ? 29.095 -4.434  3.234  1.00 9.53  ? 62   TYR A CE2 1 
ATOM   459 C  CZ  . TYR A 1 62 ? 30.255 -3.816  2.939  1.00 11.03 ? 62   TYR A CZ  1 
ATOM   460 O  OH  . TYR A 1 62 ? 30.762 -3.710  1.641  1.00 13.53 ? 62   TYR A OH  1 
ATOM   461 N  N   . ALA A 1 63 ? 30.237 -5.498  10.080 1.00 8.33  ? 63   ALA A N   1 
ATOM   462 C  CA  . ALA A 1 63 ? 30.122 -5.496  11.517 1.00 8.60  ? 63   ALA A CA  1 
ATOM   463 C  C   . ALA A 1 63 ? 30.288 -4.132  12.152 1.00 8.03  ? 63   ALA A C   1 
ATOM   464 O  O   . ALA A 1 63 ? 29.921 -3.994  13.335 1.00 8.53  ? 63   ALA A O   1 
ATOM   465 C  CB  . ALA A 1 63 ? 31.085 -6.484  12.135 1.00 9.53  ? 63   ALA A CB  1 
ATOM   466 N  N   . VAL A 1 64 ? 30.627 -3.098  11.440 1.00 8.03  ? 64   VAL A N   1 
ATOM   467 C  CA  . VAL A 1 64 ? 30.558 -1.726  11.956 1.00 8.74  ? 64   VAL A CA  1 
ATOM   468 C  C   . VAL A 1 64 ? 29.107 -1.375  12.375 1.00 7.61  ? 64   VAL A C   1 
ATOM   469 O  O   . VAL A 1 64 ? 28.943 -0.501  13.218 1.00 8.85  ? 64   VAL A O   1 
ATOM   470 C  CB  . VAL A 1 64 ? 31.035 -0.748  10.865 1.00 11.13 ? 64   VAL A CB  1 
ATOM   471 C  CG1 . VAL A 1 64 ? 30.096 -0.605  9.688  1.00 11.52 ? 64   VAL A CG1 1 
ATOM   472 C  CG2 . VAL A 1 64 ? 31.366 0.606   11.495 1.00 13.82 ? 64   VAL A CG2 1 
ATOM   473 N  N   . HIS A 1 65 ? 28.093 -2.039  11.855 1.00 7.14  ? 65   HIS A N   1 
ATOM   474 C  CA  . HIS A 1 65 ? 26.739 -1.790  12.295 1.00 6.51  ? 65   HIS A CA  1 
ATOM   475 C  C   . HIS A 1 65 ? 26.388 -2.405  13.652 1.00 7.03  ? 65   HIS A C   1 
ATOM   476 O  O   . HIS A 1 65 ? 25.333 -2.138  14.199 1.00 7.32  ? 65   HIS A O   1 
ATOM   477 C  CB  . HIS A 1 65 ? 25.711 -2.206  11.224 1.00 6.63  ? 65   HIS A CB  1 
ATOM   478 C  CG  . HIS A 1 65 ? 25.918 -1.553  9.923  1.00 5.98  ? 65   HIS A CG  1 
ATOM   479 N  ND1 . HIS A 1 65 ? 26.682 -2.124  8.921  1.00 6.80  ? 65   HIS A ND1 1 
ATOM   480 C  CD2 . HIS A 1 65 ? 25.549 -0.332  9.441  1.00 6.73  ? 65   HIS A CD2 1 
ATOM   481 C  CE1 . HIS A 1 65 ? 26.685 -1.266  7.889  1.00 6.50  ? 65   HIS A CE1 1 
ATOM   482 N  NE2 . HIS A 1 65 ? 25.977 -0.181  8.141  1.00 6.81  ? 65   HIS A NE2 1 
ATOM   483 N  N   . ASN A 1 66 ? 27.291 -3.259  14.173 1.00 7.39  ? 66   ASN A N   1 
ATOM   484 C  CA  . ASN A 1 66 ? 27.054 -3.946  15.411 1.00 7.81  ? 66   ASN A CA  1 
ATOM   485 C  C   . ASN A 1 66 ? 27.544 -3.141  16.610 1.00 7.90  ? 66   ASN A C   1 
ATOM   486 O  O   . ASN A 1 66 ? 28.469 -3.527  17.312 1.00 9.77  ? 66   ASN A O   1 
ATOM   487 C  CB  . ASN A 1 66 ? 27.685 -5.353  15.369 1.00 8.52  ? 66   ASN A CB  1 
ATOM   488 C  CG  . ASN A 1 66 ? 27.171 -6.163  14.204 1.00 8.33  ? 66   ASN A CG  1 
ATOM   489 O  OD1 . ASN A 1 66 ? 26.073 -5.876  13.680 1.00 10.80 ? 66   ASN A OD1 1 
ATOM   490 N  ND2 . ASN A 1 66 ? 27.847 -7.217  13.832 1.00 8.80  ? 66   ASN A ND2 1 
ATOM   491 N  N   . GLN A 1 67 ? 26.933 -1.978  16.773 1.00 7.54  ? 67   GLN A N   1 
ATOM   492 C  CA  . GLN A 1 67 ? 27.229 -1.013  17.817 1.00 7.40  ? 67   GLN A CA  1 
ATOM   493 C  C   . GLN A 1 67 ? 25.915 -0.505  18.358 1.00 7.01  ? 67   GLN A C   1 
ATOM   494 O  O   . GLN A 1 67 ? 24.956 -0.309  17.601 1.00 7.34  ? 67   GLN A O   1 
ATOM   495 C  CB  . GLN A 1 67 ? 28.039 0.151   17.336 1.00 8.80  ? 67   GLN A CB  1 
ATOM   496 C  CG  . GLN A 1 67 ? 29.418 -0.186  16.787 1.00 9.56  ? 67   GLN A CG  1 
ATOM   497 C  CD  . GLN A 1 67 ? 30.118 1.028   16.328 1.00 9.08  ? 67   GLN A CD  1 
ATOM   498 O  OE1 . GLN A 1 67 ? 30.535 1.853   17.186 1.00 11.99 ? 67   GLN A OE1 1 
ATOM   499 N  NE2 . GLN A 1 67 ? 30.234 1.267   15.044 1.00 10.37 ? 67   GLN A NE2 1 
ATOM   500 N  N   . SER A 1 68 ? 25.820 -0.255  19.672 1.00 7.02  ? 68   SER A N   1 
ATOM   501 C  CA  . SER A 1 68 ? 24.569 0.220   20.243 1.00 7.20  ? 68   SER A CA  1 
ATOM   502 C  C   . SER A 1 68 ? 24.107 1.521   19.615 1.00 6.22  ? 68   SER A C   1 
ATOM   503 O  O   . SER A 1 68 ? 22.893 1.712   19.440 1.00 7.17  ? 68   SER A O   1 
ATOM   504 C  CB  . SER A 1 68 ? 24.667 0.357   21.760 1.00 8.18  ? 68   SER A CB  1 
ATOM   505 O  OG  . SER A 1 68 ? 25.517 1.380   22.170 1.00 10.44 ? 68   SER A OG  1 
ATOM   506 N  N   . HIS A 1 69 ? 25.010 2.421   19.244 1.00 6.42  ? 69   HIS A N   1 
ATOM   507 C  CA  . HIS A 1 69 ? 24.568 3.705   18.696 1.00 6.52  ? 69   HIS A CA  1 
ATOM   508 C  C   . HIS A 1 69 ? 23.906 3.509   17.352 1.00 6.56  ? 69   HIS A C   1 
ATOM   509 O  O   . HIS A 1 69 ? 22.903 4.170   17.036 1.00 6.99  ? 69   HIS A O   1 
ATOM   510 C  CB  . HIS A 1 69 ? 25.695 4.733   18.594 1.00 7.11  ? 69   HIS A CB  1 
ATOM   511 C  CG  . HIS A 1 69 ? 26.519 4.665   17.345 1.00 8.55  ? 69   HIS A CG  1 
ATOM   512 N  ND1 . HIS A 1 69 ? 26.154 5.385   16.229 1.00 8.94  ? 69   HIS A ND1 1 
ATOM   513 C  CD2 . HIS A 1 69 ? 27.694 4.090   17.045 1.00 9.42  ? 69   HIS A CD2 1 
ATOM   514 C  CE1 . HIS A 1 69 ? 27.077 5.180   15.294 1.00 9.07  ? 69   HIS A CE1 1 
ATOM   515 N  NE2 . HIS A 1 69 ? 28.031 4.409   15.787 1.00 9.87  ? 69   HIS A NE2 1 
ATOM   516 N  N   . VAL A 1 70 ? 24.381 2.560   16.534 1.00 5.86  ? 70   VAL A N   1 
ATOM   517 C  CA  . VAL A 1 70 ? 23.790 2.325   15.225 1.00 6.17  ? 70   VAL A CA  1 
ATOM   518 C  C   . VAL A 1 70 ? 22.385 1.803   15.353 1.00 6.15  ? 70   VAL A C   1 
ATOM   519 O  O   . VAL A 1 70 ? 21.458 2.178   14.653 1.00 6.87  ? 70   VAL A O   1 
ATOM   520 C  CB  . VAL A 1 70 ? 24.654 1.360   14.388 1.00 6.47  ? 70   VAL A CB  1 
ATOM   521 C  CG1 . VAL A 1 70 ? 23.984 1.020   13.080 1.00 7.28  ? 70   VAL A CG1 1 
ATOM   522 C  CG2 . VAL A 1 70 ? 26.062 1.935   14.161 1.00 7.32  ? 70   VAL A CG2 1 
ATOM   523 N  N   . ARG A 1 71 ? 22.213 0.878   16.313 1.00 6.88  ? 71   ARG A N   1 
ATOM   524 C  CA  . ARG A 1 71 ? 20.882 0.280   16.497 1.00 7.22  ? 71   ARG A CA  1 
ATOM   525 C  C   . ARG A 1 71 ? 19.845 1.279   17.000 1.00 6.90  ? 71   ARG A C   1 
ATOM   526 O  O   . ARG A 1 71 ? 18.696 1.235   16.577 1.00 7.69  ? 71   ARG A O   1 
ATOM   527 C  CB  . ARG A 1 71 ? 20.979 -0.913  17.432 1.00 8.34  ? 71   ARG A CB  1 
ATOM   528 C  CG  . ARG A 1 71 ? 21.943 -1.974  16.946 1.00 9.85  ? 71   ARG A CG  1 
ATOM   529 C  CD  . ARG A 1 71 ? 21.895 -2.287  15.438 1.00 9.86  ? 71   ARG A CD  1 
ATOM   530 N  NE  . ARG A 1 71 ? 22.817 -3.317  15.023 1.00 9.94  ? 71   ARG A NE  1 
ATOM   531 C  CZ  . ARG A 1 71 ? 22.562 -4.606  15.026 1.00 10.61 ? 71   ARG A CZ  1 
ATOM   532 N  NH1 . ARG A 1 71 ? 21.375 -5.044  15.407 1.00 11.56 ? 71   ARG A NH1 1 
ATOM   533 N  NH2 . ARG A 1 71 ? 23.478 -5.460  14.617 1.00 11.95 ? 71   ARG A NH2 1 
ATOM   534 N  N   . GLU A 1 72 ? 20.262 2.185   17.902 1.00 7.02  ? 72   GLU A N   1 
ATOM   535 C  CA  . GLU A 1 72 ? 19.329 3.172   18.396 1.00 7.25  ? 72   GLU A CA  1 
ATOM   536 C  C   . GLU A 1 72 ? 19.086 4.267   17.342 1.00 6.60  ? 72   GLU A C   1 
ATOM   537 O  O   . GLU A 1 72 ? 17.963 4.774   17.233 1.00 7.67  ? 72   GLU A O   1 
ATOM   538 C  CB  . GLU A 1 72 ? 19.750 3.737   19.729 1.00 8.42  ? 72   GLU A CB  1 
ATOM   539 C  CG  . GLU A 1 72 ? 18.668 4.639   20.418 1.00 10.41 ? 72   GLU A CG  1 
ATOM   540 C  CD  . GLU A 1 72 ? 17.241 4.003   20.546 1.00 11.56 ? 72   GLU A CD  1 
ATOM   541 O  OE1 . GLU A 1 72 ? 17.126 2.757   20.660 1.00 11.80 ? 72   GLU A OE1 1 
ATOM   542 O  OE2 . GLU A 1 72 ? 16.272 4.792   20.656 1.00 15.38 ? 72   GLU A OE2 1 
ATOM   543 N  N   . LEU A 1 73 ? 20.095 4.586   16.516 1.00 6.20  ? 73   LEU A N   1 
ATOM   544 C  CA  . LEU A 1 73 ? 19.888 5.493   15.415 1.00 6.81  ? 73   LEU A CA  1 
ATOM   545 C  C   . LEU A 1 73 ? 18.798 4.989   14.485 1.00 6.41  ? 73   LEU A C   1 
ATOM   546 O  O   . LEU A 1 73 ? 17.842 5.661   14.157 1.00 7.21  ? 73   LEU A O   1 
ATOM   547 C  CB  . LEU A 1 73 ? 21.205 5.735   14.668 1.00 7.81  ? 73   LEU A CB  1 
ATOM   548 C  CG  . LEU A 1 73 ? 21.135 6.645   13.439 1.00 9.27  ? 73   LEU A CG  1 
ATOM   549 C  CD1 . LEU A 1 73 ? 22.568 7.257   13.202 1.00 11.59 ? 73   LEU A CD1 1 
ATOM   550 C  CD2 . LEU A 1 73 ? 20.711 5.956   12.194 1.00 9.63  ? 73   LEU A CD2 1 
ATOM   551 N  N   . LEU A 1 74 ? 18.916 3.696   14.105 1.00 6.58  ? 74   LEU A N   1 
ATOM   552 C  CA  . LEU A 1 74 ? 17.913 3.098   13.254 1.00 6.37  ? 74   LEU A CA  1 
ATOM   553 C  C   . LEU A 1 74 ? 16.530 3.145   13.893 1.00 6.68  ? 74   LEU A C   1 
ATOM   554 O  O   . LEU A 1 74 ? 15.544 3.393   13.217 1.00 7.51  ? 74   LEU A O   1 
ATOM   555 C  CB  . LEU A 1 74 ? 18.325 1.656   12.926 1.00 7.56  ? 74   LEU A CB  1 
ATOM   556 C  CG  . LEU A 1 74 ? 17.370 0.879   12.041 1.00 7.42  ? 74   LEU A CG  1 
ATOM   557 C  CD1 . LEU A 1 74 ? 17.145 1.482   10.669 1.00 9.32  ? 74   LEU A CD1 1 
ATOM   558 C  CD2 . LEU A 1 74 ? 17.804 -0.590  11.916 1.00 9.95  ? 74   LEU A CD2 1 
ATOM   559 N  N   . ALA A 1 75 ? 16.460 2.868   15.204 1.00 6.86  ? 75   ALA A N   1 
ATOM   560 C  CA  . ALA A 1 75 ? 15.196 2.894   15.915 1.00 7.56  ? 75   ALA A CA  1 
ATOM   561 C  C   . ALA A 1 75 ? 14.464 4.196   15.801 1.00 7.18  ? 75   ALA A C   1 
ATOM   562 O  O   . ALA A 1 75 ? 13.236 4.195   15.898 1.00 8.48  ? 75   ALA A O   1 
ATOM   563 C  CB  . ALA A 1 75 ? 15.458 2.581   17.404 1.00 8.25  ? 75   ALA A CB  1 
ATOM   564 N  N   . GLN A 1 76 ? 15.127 5.330   15.547 1.00 7.39  ? 76   GLN A N   1 
ATOM   565 C  CA  . GLN A 1 76 ? 14.441 6.581   15.417 1.00 7.63  ? 76   GLN A CA  1 
ATOM   566 C  C   . GLN A 1 76 ? 13.565 6.604   14.197 1.00 7.88  ? 76   GLN A C   1 
ATOM   567 O  O   . GLN A 1 76 ? 12.653 7.452   14.118 1.00 11.04 ? 76   GLN A O   1 
ATOM   568 C  CB  . GLN A 1 76 ? 15.459 7.751   15.333 1.00 8.27  ? 76   GLN A CB  1 
ATOM   569 C  CG  . GLN A 1 76 ? 16.419 7.841   16.474 1.00 9.09  ? 76   GLN A CG  1 
ATOM   570 C  CD  . GLN A 1 76 ? 15.801 7.718   17.804 1.00 9.19  ? 76   GLN A CD  1 
ATOM   571 O  OE1 . GLN A 1 76 ? 14.983 8.587   18.182 1.00 11.73 ? 76   GLN A OE1 1 
ATOM   572 N  NE2 . GLN A 1 76 ? 16.120 6.657   18.536 1.00 9.64  ? 76   GLN A NE2 1 
ATOM   573 N  N   . TYR A 1 77 ? 13.759 5.720   13.258 1.00 7.65  ? 77   TYR A N   1 
ATOM   574 C  CA  . TYR A 1 77 ? 13.045 5.669   11.996 1.00 7.67  ? 77   TYR A CA  1 
ATOM   575 C  C   . TYR A 1 77 ? 11.988 4.583   11.956 1.00 8.29  ? 77   TYR A C   1 
ATOM   576 O  O   . TYR A 1 77 ? 11.382 4.340   10.938 1.00 8.54  ? 77   TYR A O   1 
ATOM   577 C  CB  . TYR A 1 77 ? 14.061 5.527   10.853 1.00 7.28  ? 77   TYR A CB  1 
ATOM   578 C  CG  . TYR A 1 77 ? 14.984 6.723   10.759 1.00 7.91  ? 77   TYR A CG  1 
ATOM   579 C  CD1 . TYR A 1 77 ? 14.655 7.854   10.091 1.00 9.04  ? 77   TYR A CD1 1 
ATOM   580 C  CD2 . TYR A 1 77 ? 16.224 6.692   11.382 1.00 7.92  ? 77   TYR A CD2 1 
ATOM   581 C  CE1 . TYR A 1 77 ? 15.481 8.953   10.071 1.00 9.61  ? 77   TYR A CE1 1 
ATOM   582 C  CE2 . TYR A 1 77 ? 17.073 7.775   11.362 1.00 8.88  ? 77   TYR A CE2 1 
ATOM   583 C  CZ  . TYR A 1 77 ? 16.700 8.900   10.705 1.00 7.97  ? 77   TYR A CZ  1 
ATOM   584 O  OH  . TYR A 1 77 ? 17.571 9.993   10.675 1.00 9.51  ? 77   TYR A OH  1 
ATOM   585 N  N   . LYS A 1 78 ? 11.739 3.900   13.095 1.00 8.41  ? 78   LYS A N   1 
ATOM   586 C  CA  . LYS A 1 78 ? 10.757 2.794   13.111 1.00 8.24  ? 78   LYS A CA  1 
ATOM   587 C  C   . LYS A 1 78 ? 9.379  3.324   12.815 1.00 9.66  ? 78   LYS A C   1 
ATOM   588 O  O   . LYS A 1 78 ? 8.944  4.354   13.366 1.00 10.76 ? 78   LYS A O   1 
ATOM   589 C  CB  . LYS A 1 78 ? 10.775 2.128   14.474 1.00 9.62  ? 78   LYS A CB  1 
ATOM   590 C  CG  . LYS A 1 78 ? 9.835  0.926   14.524 1.00 11.31 ? 78   LYS A CG  1 
ATOM   591 C  CD  . LYS A 1 78 ? 9.930  0.150   15.848 1.00 12.60 ? 78   LYS A CD  1 
ATOM   592 C  CE  . LYS A 1 78 ? 8.857  -0.917  15.874 1.00 15.57 ? 78   LYS A CE  1 
ATOM   593 N  NZ  . LYS A 1 78 ? 8.861  -1.661  17.210 1.00 16.15 ? 78   LYS A NZ  1 
ATOM   594 N  N   . ILE A 1 79 ? 8.648  2.625   11.962 1.00 9.08  ? 79   ILE A N   1 
ATOM   595 C  CA  . ILE A 1 79 ? 7.248  2.914   11.631 1.00 10.12 ? 79   ILE A CA  1 
ATOM   596 C  C   . ILE A 1 79 ? 6.299  1.796   11.974 1.00 10.46 ? 79   ILE A C   1 
ATOM   597 O  O   . ILE A 1 79 ? 5.084  2.012   11.997 1.00 12.94 ? 79   ILE A O   1 
ATOM   598 C  CB  . ILE A 1 79 ? 7.066  3.352   10.180 1.00 11.54 ? 79   ILE A CB  1 
ATOM   599 C  CG1 . ILE A 1 79 ? 7.517  2.308   9.184  1.00 11.67 ? 79   ILE A CG1 1 
ATOM   600 C  CG2 . ILE A 1 79 ? 7.756  4.730   9.955  1.00 12.85 ? 79   ILE A CG2 1 
ATOM   601 C  CD1 . ILE A 1 79 ? 7.088  2.647   7.755  1.00 12.21 ? 79   ILE A CD1 1 
ATOM   602 N  N   . GLY A 1 80 ? 6.775  0.586   12.258 1.00 10.35 ? 80   GLY A N   1 
ATOM   603 C  CA  . GLY A 1 80 ? 5.898  -0.518  12.567 1.00 11.52 ? 80   GLY A CA  1 
ATOM   604 C  C   . GLY A 1 80 ? 6.627  -1.829  12.495 1.00 11.03 ? 80   GLY A C   1 
ATOM   605 O  O   . GLY A 1 80 ? 7.839  -1.874  12.683 1.00 10.48 ? 80   GLY A O   1 
ATOM   606 N  N   . GLU A 1 81 ? 5.864  -2.897  12.246 1.00 12.09 ? 81   GLU A N   1 
ATOM   607 C  CA  . GLU A 1 81 ? 6.355  -4.225  12.267 1.00 12.88 ? 81   GLU A CA  1 
ATOM   608 C  C   . GLU A 1 81 ? 5.786  -5.035  11.138 1.00 12.91 ? 81   GLU A C   1 
ATOM   609 O  O   . GLU A 1 81 ? 4.730  -4.700  10.608 1.00 14.10 ? 81   GLU A O   1 
ATOM   610 C  CB  . GLU A 1 81 ? 6.104  -4.883  13.645 1.00 14.97 ? 81   GLU A CB  1 
ATOM   611 C  CG  . GLU A 1 81 ? 6.760  -4.121  14.751 1.00 16.03 ? 81   GLU A CG  1 
ATOM   612 C  CD  . GLU A 1 81 ? 6.672  -4.676  16.148 1.00 20.41 ? 81   GLU A CD  1 
ATOM   613 O  OE1 . GLU A 1 81 ? 6.080  -5.788  16.346 1.00 25.35 ? 81   GLU A OE1 1 
ATOM   614 O  OE2 . GLU A 1 81 ? 7.169  -3.982  17.089 1.00 24.09 ? 81   GLU A OE2 1 
ATOM   615 N  N   . LEU A 1 82 ? 6.410  -6.157  10.826 1.00 14.85 ? 82   LEU A N   1 
ATOM   616 C  CA  . LEU A 1 82 ? 5.894  -7.196  9.940  1.00 17.68 ? 82   LEU A CA  1 
ATOM   617 C  C   . LEU A 1 82 ? 5.044  -8.139  10.810 1.00 21.87 ? 82   LEU A C   1 
ATOM   618 O  O   . LEU A 1 82 ? 5.312  -8.365  11.987 1.00 23.22 ? 82   LEU A O   1 
ATOM   619 C  CB  . LEU A 1 82 ? 7.036  -8.033  9.393  1.00 18.42 ? 82   LEU A CB  1 
ATOM   620 C  CG  . LEU A 1 82 ? 8.014  -7.304  8.481  1.00 17.87 ? 82   LEU A CG  1 
ATOM   621 C  CD1 . LEU A 1 82 ? 9.156  -8.196  8.134  1.00 20.44 ? 82   LEU A CD1 1 
ATOM   622 C  CD2 . LEU A 1 82 ? 7.369  -6.837  7.330  1.00 21.70 ? 82   LEU A CD2 1 
ATOM   623 O  OXT . LEU A 1 82 ? 4.164  -8.746  10.255 1.00 29.03 ? 82   LEU A OXT 1 
HETATM 624 S  S   . SO4 B 2 .  ? 28.786 -0.351  22.008 1.00 15.84 ? 83   SO4 A S   1 
HETATM 625 O  O1  . SO4 B 2 .  ? 27.765 0.195   22.972 1.00 19.61 ? 83   SO4 A O1  1 
HETATM 626 O  O2  . SO4 B 2 .  ? 28.241 -0.980  20.925 1.00 20.94 ? 83   SO4 A O2  1 
HETATM 627 O  O3  . SO4 B 2 .  ? 29.358 0.954   21.570 1.00 23.44 ? 83   SO4 A O3  1 
HETATM 628 O  O4  . SO4 B 2 .  ? 29.829 -1.070  22.714 1.00 20.82 ? 83   SO4 A O4  1 
HETATM 629 C  CHA . HEM C 3 .  ? 28.639 2.652   8.135  1.00 8.49  ? 502  HEM A CHA 1 
HETATM 630 C  CHB . HEM C 3 .  ? 24.018 3.125   9.336  1.00 7.50  ? 502  HEM A CHB 1 
HETATM 631 C  CHC . HEM C 3 .  ? 22.834 0.265   5.650  1.00 6.01  ? 502  HEM A CHC 1 
HETATM 632 C  CHD . HEM C 3 .  ? 27.487 -0.343  4.586  1.00 7.63  ? 502  HEM A CHD 1 
HETATM 633 C  C1A . HEM C 3 .  ? 27.515 2.979   8.823  1.00 7.37  ? 502  HEM A C1A 1 
HETATM 634 C  C2A . HEM C 3 .  ? 27.438 3.839   10.023 1.00 7.85  ? 502  HEM A C2A 1 
HETATM 635 C  C3A . HEM C 3 .  ? 26.142 4.006   10.307 1.00 7.78  ? 502  HEM A C3A 1 
HETATM 636 C  C4A . HEM C 3 .  ? 25.388 3.211   9.334  1.00 7.25  ? 502  HEM A C4A 1 
HETATM 637 C  CMA . HEM C 3 .  ? 25.527 4.827   11.413 1.00 9.01  ? 502  HEM A CMA 1 
HETATM 638 C  CAA . HEM C 3 .  ? 28.656 4.399   10.748 1.00 9.21  ? 502  HEM A CAA 1 
HETATM 639 C  CBA . HEM C 3 .  ? 29.004 3.598   11.999 1.00 9.97  ? 502  HEM A CBA 1 
HETATM 640 C  CGA . HEM C 3 .  ? 30.187 4.057   12.762 1.00 10.71 ? 502  HEM A CGA 1 
HETATM 641 O  O1A . HEM C 3 .  ? 31.201 4.272   12.055 1.00 18.75 ? 502  HEM A O1A 1 
HETATM 642 O  O2A . HEM C 3 .  ? 30.228 4.080   13.960 1.00 10.26 ? 502  HEM A O2A 1 
HETATM 643 C  C1B . HEM C 3 .  ? 23.314 2.353   8.464  1.00 6.55  ? 502  HEM A C1B 1 
HETATM 644 C  C2B . HEM C 3 .  ? 21.868 2.325   8.384  1.00 6.66  ? 502  HEM A C2B 1 
HETATM 645 C  C3B . HEM C 3 .  ? 21.527 1.595   7.313  1.00 6.82  ? 502  HEM A C3B 1 
HETATM 646 C  C4B . HEM C 3 .  ? 22.741 1.131   6.731  1.00 6.43  ? 502  HEM A C4B 1 
HETATM 647 C  CMB . HEM C 3 .  ? 20.984 2.968   9.414  1.00 9.50  ? 502  HEM A CMB 1 
HETATM 648 C  CAB . HEM C 3 .  ? 20.198 1.261   6.784  1.00 8.37  ? 502  HEM A CAB 1 
HETATM 649 C  CBB . HEM C 3 .  ? 19.060 1.884   6.946  1.00 9.89  ? 502  HEM A CBB 1 
HETATM 650 C  C1C . HEM C 3 .  ? 23.974 -0.212  5.062  1.00 6.86  ? 502  HEM A C1C 1 
HETATM 651 C  C2C . HEM C 3 .  ? 24.063 -1.217  4.009  1.00 6.80  ? 502  HEM A C2C 1 
HETATM 652 C  C3C . HEM C 3 .  ? 25.380 -1.383  3.726  1.00 6.86  ? 502  HEM A C3C 1 
HETATM 653 C  C4C . HEM C 3 .  ? 26.119 -0.502  4.606  1.00 6.98  ? 502  HEM A C4C 1 
HETATM 654 C  CMC . HEM C 3 .  ? 22.884 -1.860  3.437  1.00 8.00  ? 502  HEM A CMC 1 
HETATM 655 C  CAC . HEM C 3 .  ? 26.015 -2.330  2.777  1.00 9.14  ? 502  HEM A CAC 1 
HETATM 656 C  CBC . HEM C 3 .  ? 25.543 -2.805  1.664  1.00 10.14 ? 502  HEM A CBC 1 
HETATM 657 C  C1D . HEM C 3 .  ? 28.201 0.525   5.365  1.00 8.23  ? 502  HEM A C1D 1 
HETATM 658 C  C2D . HEM C 3 .  ? 29.601 0.736   5.260  1.00 9.44  ? 502  HEM A C2D 1 
HETATM 659 C  C3D . HEM C 3 .  ? 29.955 1.608   6.303  1.00 9.67  ? 502  HEM A C3D 1 
HETATM 660 C  C4D . HEM C 3 .  ? 28.729 1.872   7.019  1.00 7.85  ? 502  HEM A C4D 1 
HETATM 661 C  CMD . HEM C 3 .  ? 30.508 0.186   4.169  1.00 12.54 ? 502  HEM A CMD 1 
HETATM 662 C  CAD . HEM C 3 .  ? 31.320 2.093   6.633  1.00 13.15 ? 502  HEM A CAD 1 
HETATM 663 C  CBD . HEM C 3 .  ? 31.638 3.402   5.980  1.00 18.16 ? 502  HEM A CBD 1 
HETATM 664 C  CGD . HEM C 3 .  ? 32.994 3.963   6.316  1.00 27.79 ? 502  HEM A CGD 1 
HETATM 665 O  O1D . HEM C 3 .  ? 33.415 4.080   7.505  1.00 33.51 ? 502  HEM A O1D 1 
HETATM 666 O  O2D . HEM C 3 .  ? 33.587 4.224   5.311  1.00 36.85 ? 502  HEM A O2D 1 
HETATM 667 N  NA  . HEM C 3 .  ? 26.263 2.627   8.432  1.00 7.21  ? 502  HEM A NA  1 
HETATM 668 N  NB  . HEM C 3 .  ? 23.848 1.578   7.397  1.00 6.79  ? 502  HEM A NB  1 
HETATM 669 N  NC  . HEM C 3 .  ? 25.264 0.162   5.418  1.00 6.29  ? 502  HEM A NC  1 
HETATM 670 N  ND  . HEM C 3 .  ? 27.642 1.246   6.403  1.00 7.48  ? 502  HEM A ND  1 
HETATM 671 FE FE  . HEM C 3 .  ? 25.764 1.407   6.934  1.00 6.91  ? 502  HEM A FE  1 
HETATM 672 C  C1  . GOL D 4 .  ? 26.370 8.777   10.644 1.00 12.12 ? 9601 GOL A C1  1 
HETATM 673 O  O1  . GOL D 4 .  ? 27.248 9.909   10.499 1.00 12.57 ? 9601 GOL A O1  1 
HETATM 674 C  C2  . GOL D 4 .  ? 25.935 8.654   12.082 1.00 11.27 ? 9601 GOL A C2  1 
HETATM 675 O  O2  . GOL D 4 .  ? 25.195 9.794   12.410 1.00 14.69 ? 9601 GOL A O2  1 
HETATM 676 C  C3  . GOL D 4 .  ? 27.116 8.431   13.041 1.00 11.04 ? 9601 GOL A C3  1 
HETATM 677 O  O3  . GOL D 4 .  ? 27.728 7.269   12.709 1.00 12.55 ? 9601 GOL A O3  1 
HETATM 678 O  O   . HOH E 5 .  ? 14.288 -8.145  8.488  1.00 10.35 ? 503  HOH A O   1 
HETATM 679 O  O   . HOH E 5 .  ? 22.760 0.753   -4.872 1.00 10.03 ? 504  HOH A O   1 
HETATM 680 O  O   . HOH E 5 .  ? 12.830 9.113   7.164  1.00 10.62 ? 505  HOH A O   1 
HETATM 681 O  O   . HOH E 5 .  ? 24.542 7.715   16.474 1.00 10.18 ? 506  HOH A O   1 
HETATM 682 O  O   . HOH E 5 .  ? 32.143 -3.245  8.846  1.00 13.12 ? 507  HOH A O   1 
HETATM 683 O  O   . HOH E 5 .  ? 15.061 11.091  17.118 1.00 12.12 ? 508  HOH A O   1 
HETATM 684 O  O   . HOH E 5 .  ? 17.189 -5.820  1.555  1.00 12.77 ? 509  HOH A O   1 
HETATM 685 O  O   . HOH E 5 .  ? 27.834 2.549   19.999 1.00 12.40 ? 510  HOH A O   1 
HETATM 686 O  O   . HOH E 5 .  ? 16.883 12.137  9.365  1.00 14.90 ? 511  HOH A O   1 
HETATM 687 O  O   . HOH E 5 .  ? 18.941 -3.693  16.462 1.00 15.23 ? 512  HOH A O   1 
HETATM 688 O  O   . HOH E 5 .  ? 17.420 -9.880  13.039 1.00 13.83 ? 513  HOH A O   1 
HETATM 689 O  O   . HOH E 5 .  ? 14.245 -0.594  16.730 1.00 17.31 ? 514  HOH A O   1 
HETATM 690 O  O   . HOH E 5 .  ? 27.552 4.579   -1.199 1.00 15.82 ? 515  HOH A O   1 
HETATM 691 O  O   . HOH E 5 .  ? 18.298 11.407  2.887  1.00 17.27 ? 516  HOH A O   1 
HETATM 692 O  O   . HOH E 5 .  ? 26.809 10.617  3.588  1.00 19.66 ? 517  HOH A O   1 
HETATM 693 O  O   . HOH E 5 .  ? 27.567 10.751  7.815  1.00 18.52 ? 518  HOH A O   1 
HETATM 694 O  O   . HOH E 5 .  ? 10.695 7.517   9.896  1.00 16.56 ? 519  HOH A O   1 
HETATM 695 O  O   . HOH E 5 .  ? 18.447 0.335   20.549 1.00 18.45 ? 520  HOH A O   1 
HETATM 696 O  O   . HOH E 5 .  ? 18.079 10.914  -1.271 1.00 18.47 ? 521  HOH A O   1 
HETATM 697 O  O   . HOH E 5 .  ? 28.104 -8.256  10.988 1.00 15.83 ? 523  HOH A O   1 
HETATM 698 O  O   . HOH E 5 .  ? 11.571 -7.550  4.719  1.00 20.10 ? 524  HOH A O   1 
HETATM 699 O  O   . HOH E 5 .  ? 31.345 1.087   19.696 1.00 23.01 ? 525  HOH A O   1 
HETATM 700 O  O   . HOH E 5 .  ? 14.676 -4.924  14.920 1.00 19.66 ? 526  HOH A O   1 
HETATM 701 O  O   . HOH E 5 .  ? 17.695 14.729  6.392  1.00 21.77 ? 527  HOH A O   1 
HETATM 702 O  O   . HOH E 5 .  ? 9.723  6.959   12.438 1.00 24.91 ? 528  HOH A O   1 
HETATM 703 O  O   . HOH E 5 .  ? 14.749 1.567   20.993 1.00 20.26 ? 529  HOH A O   1 
HETATM 704 O  O   . HOH E 5 .  ? 23.279 -7.782  11.253 1.00 15.38 ? 530  HOH A O   1 
HETATM 705 O  O   . HOH E 5 .  ? 17.776 -8.141  15.165 1.00 16.44 ? 531  HOH A O   1 
HETATM 706 O  O   . HOH E 5 .  ? 17.014 -5.600  16.055 1.00 16.86 ? 532  HOH A O   1 
HETATM 707 O  O   . HOH E 5 .  ? 29.281 4.998   20.022 1.00 20.11 ? 533  HOH A O   1 
HETATM 708 O  O   . HOH E 5 .  ? 13.023 0.490   18.978 1.00 18.90 ? 534  HOH A O   1 
HETATM 709 O  O   . HOH E 5 .  ? 32.473 -6.380  3.818  1.00 17.77 ? 535  HOH A O   1 
HETATM 710 O  O   . HOH E 5 .  ? 20.361 -5.553  -3.707 1.00 20.62 ? 536  HOH A O   1 
HETATM 711 O  O   . HOH E 5 .  ? 10.275 -6.507  2.232  1.00 20.76 ? 537  HOH A O   1 
HETATM 712 O  O   . HOH E 5 .  ? 32.893 -1.186  7.513  1.00 24.28 ? 538  HOH A O   1 
HETATM 713 O  O   . HOH E 5 .  ? 31.955 5.735   15.529 1.00 21.10 ? 539  HOH A O   1 
HETATM 714 O  O   . HOH E 5 .  ? 12.274 -8.040  15.573 1.00 25.90 ? 540  HOH A O   1 
HETATM 715 O  O   . HOH E 5 .  ? 19.866 -4.011  18.909 1.00 21.55 ? 541  HOH A O   1 
HETATM 716 O  O   . HOH E 5 .  ? 30.140 10.196  6.972  1.00 25.16 ? 542  HOH A O   1 
HETATM 717 O  O   . HOH E 5 .  ? 13.692 4.472   20.336 1.00 26.58 ? 543  HOH A O   1 
HETATM 718 O  O   . HOH E 5 .  ? 25.873 -7.215  11.339 1.00 24.54 ? 544  HOH A O   1 
HETATM 719 O  O   . HOH E 5 .  ? 11.864 3.148   17.989 1.00 28.39 ? 545  HOH A O   1 
HETATM 720 O  O   . HOH E 5 .  ? 32.073 3.964   9.461  1.00 26.29 ? 546  HOH A O   1 
HETATM 721 O  O   . HOH E 5 .  ? 31.188 4.575   17.741 1.00 26.15 ? 547  HOH A O   1 
HETATM 722 O  O   . HOH E 5 .  ? 28.521 3.949   -3.691 1.00 24.86 ? 548  HOH A O   1 
HETATM 723 O  O   . HOH E 5 .  ? 11.907 -4.313  -3.354 1.00 29.66 ? 549  HOH A O   1 
HETATM 724 O  O   . HOH E 5 .  ? 31.835 6.113   -0.718 1.00 35.04 ? 550  HOH A O   1 
HETATM 725 O  O   . HOH E 5 .  ? 7.662  1.104   -5.918 1.00 29.87 ? 551  HOH A O   1 
HETATM 726 O  O   . HOH E 5 .  ? 6.798  6.891   7.127  1.00 29.15 ? 552  HOH A O   1 
HETATM 727 O  O   . HOH E 5 .  ? 11.787 -10.133 5.124  1.00 31.30 ? 553  HOH A O   1 
HETATM 728 O  O   . HOH E 5 .  ? 13.171 -10.442 7.321  1.00 24.50 ? 554  HOH A O   1 
HETATM 729 O  O   . HOH E 5 .  ? 12.332 10.742  9.389  1.00 27.72 ? 555  HOH A O   1 
HETATM 730 O  O   . HOH E 5 .  ? 15.538 15.895  6.884  1.00 30.96 ? 556  HOH A O   1 
HETATM 731 O  O   . HOH E 5 .  ? 12.292 -2.101  19.566 1.00 29.37 ? 558  HOH A O   1 
HETATM 732 O  O   . HOH E 5 .  ? 16.643 -7.277  -0.497 1.00 30.69 ? 559  HOH A O   1 
HETATM 733 O  O   . HOH E 5 .  ? 10.373 9.868   6.149  1.00 24.18 ? 560  HOH A O   1 
HETATM 734 O  O   . HOH E 5 .  ? 28.579 3.504   2.185  1.00 23.81 ? 561  HOH A O   1 
HETATM 735 O  O   . HOH E 5 .  ? 34.074 -1.529  5.050  1.00 26.44 ? 562  HOH A O   1 
HETATM 736 O  O   . HOH E 5 .  ? 34.462 -4.448  4.348  1.00 26.49 ? 563  HOH A O   1 
HETATM 737 O  O   . HOH E 5 .  ? 31.023 2.645   0.980  1.00 28.71 ? 564  HOH A O   1 
HETATM 738 O  O   . HOH E 5 .  ? 31.559 8.754   9.046  1.00 26.04 ? 565  HOH A O   1 
HETATM 739 O  O   . HOH E 5 .  ? 33.262 -5.025  6.880  1.00 28.07 ? 566  HOH A O   1 
HETATM 740 O  O   . HOH E 5 .  ? 11.494 -8.400  0.781  1.00 35.42 ? 567  HOH A O   1 
HETATM 741 O  O   . HOH E 5 .  ? 15.865 10.273  0.476  1.00 29.79 ? 568  HOH A O   1 
HETATM 742 O  O   . HOH E 5 .  ? 19.701 -4.133  -5.503 1.00 41.33 ? 569  HOH A O   1 
HETATM 743 O  O   . HOH E 5 .  ? 8.500  8.452   8.536  1.00 34.36 ? 570  HOH A O   1 
HETATM 744 O  O   . HOH E 5 .  ? 13.123 -10.752 15.557 1.00 31.48 ? 571  HOH A O   1 
HETATM 745 O  O   . HOH E 5 .  ? 31.522 -2.686  15.303 1.00 34.57 ? 572  HOH A O   1 
HETATM 746 O  O   . HOH E 5 .  ? 32.657 6.367   12.339 1.00 28.50 ? 573  HOH A O   1 
HETATM 747 O  O   . HOH E 5 .  ? 4.704  -11.339 10.641 1.00 38.29 ? 574  HOH A O   1 
HETATM 748 O  O   . HOH E 5 .  ? 34.570 5.963   14.784 1.00 32.07 ? 575  HOH A O   1 
HETATM 749 O  O   . HOH E 5 .  ? 33.292 -4.484  1.343  1.00 39.75 ? 576  HOH A O   1 
HETATM 750 O  O   . HOH E 5 .  ? 30.374 -3.665  22.914 1.00 34.32 ? 577  HOH A O   1 
HETATM 751 O  O   . HOH E 5 .  ? 5.404  -8.167  14.656 1.00 33.52 ? 578  HOH A O   1 
HETATM 752 O  O   . HOH E 5 .  ? 16.089 -5.285  18.791 1.00 36.82 ? 579  HOH A O   1 
HETATM 753 O  O   . HOH E 5 .  ? 18.213 -1.420  -4.441 1.00 36.03 ? 580  HOH A O   1 
HETATM 754 O  O   . HOH E 5 .  ? 15.385 -2.458  19.226 1.00 31.60 ? 581  HOH A O   1 
HETATM 755 O  O   . HOH E 5 .  ? 9.575  -5.414  18.178 1.00 41.22 ? 582  HOH A O   1 
HETATM 756 O  O   . HOH E 5 .  ? 30.817 9.931   4.115  1.00 30.54 ? 583  HOH A O   1 
HETATM 757 O  O   . HOH E 5 .  ? 33.560 2.908   13.131 1.00 38.71 ? 584  HOH A O   1 
HETATM 758 O  O   . HOH E 5 .  ? 10.500 -0.585  -6.365 1.00 31.04 ? 585  HOH A O   1 
HETATM 759 O  O   . HOH E 5 .  ? 12.032 8.899   18.750 1.00 36.41 ? 586  HOH A O   1 
HETATM 760 O  O   . HOH E 5 .  ? 32.370 5.127   -3.777 1.00 40.55 ? 587  HOH A O   1 
HETATM 761 O  O   . HOH E 5 .  ? 4.427  -0.618  15.789 1.00 33.59 ? 588  HOH A O   1 
HETATM 762 O  O   . HOH E 5 .  ? 16.965 -3.399  -2.874 1.00 34.47 ? 589  HOH A O   1 
HETATM 763 O  O   . HOH E 5 .  ? 12.876 10.308  12.680 1.00 44.00 ? 590  HOH A O   1 
HETATM 764 O  O   . HOH E 5 .  ? 9.611  2.961   -4.715 1.00 36.47 ? 591  HOH A O   1 
HETATM 765 O  O   . HOH E 5 .  ? 4.486  -1.474  19.392 1.00 45.32 ? 592  HOH A O   1 
HETATM 766 O  O   . HOH E 5 .  ? 14.078 12.325  0.137  1.00 32.92 ? 593  HOH A O   1 
HETATM 767 O  O   . HOH E 5 .  ? 14.287 8.942   20.932 1.00 35.10 ? 594  HOH A O   1 
HETATM 768 O  O   . HOH E 5 .  ? 6.619  2.099   15.720 1.00 37.08 ? 595  HOH A O   1 
HETATM 769 O  O   . HOH E 5 .  ? 32.495 -1.276  22.977 1.00 53.36 ? 596  HOH A O   1 
HETATM 770 O  O   . HOH E 5 .  ? 13.489 13.804  -2.042 1.00 42.58 ? 597  HOH A O   1 
HETATM 771 O  O   . HOH E 5 .  ? 34.093 0.859   8.888  1.00 32.43 ? 598  HOH A O   1 
HETATM 772 O  O   . HOH E 5 .  ? 13.386 -10.234 1.107  1.00 34.38 ? 599  HOH A O   1 
HETATM 773 O  O   . HOH E 5 .  ? 33.132 2.872   2.328  1.00 46.97 ? 600  HOH A O   1 
HETATM 774 O  O   . HOH E 5 .  ? 12.437 6.808   18.949 1.00 44.53 ? 601  HOH A O   1 
HETATM 775 O  O   . HOH E 5 .  ? 11.375 8.820   16.251 1.00 32.78 ? 602  HOH A O   1 
HETATM 776 O  O   . HOH E 5 .  ? 4.054  -10.311 4.668  1.00 44.40 ? 603  HOH A O   1 
HETATM 777 O  O   . HOH E 5 .  ? 7.788  1.065   18.280 1.00 40.35 ? 604  HOH A O   1 
HETATM 778 O  O   . HOH E 5 .  ? 2.794  -10.486 10.521 1.00 44.30 ? 605  HOH A O   1 
HETATM 779 O  O   . HOH E 5 .  ? 2.378  1.770   17.362 1.00 41.40 ? 606  HOH A O   1 
HETATM 780 O  O   . HOH E 5 .  ? 12.965 -11.383 3.052  1.00 48.23 ? 607  HOH A O   1 
HETATM 781 O  O   . HOH E 5 .  ? 32.879 -1.454  -0.451 1.00 48.81 ? 608  HOH A O   1 
HETATM 782 O  O   . HOH E 5 .  ? 32.898 -5.023  -1.056 1.00 63.69 ? 609  HOH A O   1 
HETATM 783 O  O   . HOH E 5 .  ? 6.855  6.316   3.458  1.00 34.08 ? 610  HOH A O   1 
HETATM 784 O  O   . HOH E 5 .  ? 7.013  -11.617 7.978  1.00 53.25 ? 611  HOH A O   1 
HETATM 785 O  O   . HOH E 5 .  ? 15.804 -5.744  -3.744 1.00 49.63 ? 612  HOH A O   1 
HETATM 786 O  O   . HOH E 5 .  ? 9.192  3.457   18.141 1.00 39.20 ? 613  HOH A O   1 
HETATM 787 O  O   . HOH E 5 .  ? 13.996 -3.766  -4.825 1.00 40.22 ? 614  HOH A O   1 
HETATM 788 O  O   . HOH E 5 .  ? 13.904 -5.044  -1.894 1.00 38.96 ? 615  HOH A O   1 
HETATM 789 O  O   . HOH E 5 .  ? 5.448  -10.420 6.331  1.00 40.87 ? 616  HOH A O   1 
HETATM 790 O  O   . HOH E 5 .  ? 0.108  3.138   13.637 1.00 54.57 ? 618  HOH A O   1 
HETATM 791 O  O   . HOH E 5 .  ? 17.755 -1.211  15.759 1.00 18.13 ? 619  HOH A O   1 
HETATM 792 O  O   . HOH E 5 .  ? 16.004 -1.160  17.152 1.00 37.47 ? 620  HOH A O   1 
HETATM 793 O  O   . HOH E 5 .  ? 17.046 -3.035  16.491 1.00 37.43 ? 621  HOH A O   1 
HETATM 794 O  O   . HOH E 5 .  ? 16.473 -1.082  15.741 1.00 28.62 ? 622  HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N  N   . SER A 3  ? 0.4090 0.4634 0.4021 -0.0118 0.0112  -0.0129 3    SER A N   
2   C  CA  . SER A 3  ? 0.3636 0.4358 0.3914 -0.0070 0.0164  -0.0136 3    SER A CA  
3   C  C   . SER A 3  ? 0.3204 0.4252 0.3693 -0.0099 0.0157  -0.0275 3    SER A C   
4   O  O   . SER A 3  ? 0.3314 0.4716 0.3895 -0.0200 0.0229  -0.0491 3    SER A O   
5   C  CB  . SER A 3  ? 0.3622 0.4425 0.4143 0.0073  0.0168  -0.0128 3    SER A CB  
6   O  OG  . SER A 3  ? 0.3426 0.4430 0.4599 -0.0036 0.0248  -0.0244 3    SER A OG  
7   N  N   . THR A 4  ? 0.2605 0.3925 0.3478 -0.0054 0.0274  -0.0245 4    THR A N   
8   C  CA  . THR A 4  ? 0.2460 0.3500 0.3278 -0.0022 0.0257  -0.0144 4    THR A CA  
9   C  C   . THR A 4  ? 0.1926 0.2898 0.3024 0.0021  0.0258  -0.0189 4    THR A C   
10  O  O   . THR A 4  ? 0.1322 0.3234 0.3548 -0.0190 0.0108  -0.0123 4    THR A O   
11  C  CB  . THR A 4  ? 0.2923 0.3703 0.3346 0.0058  0.0032  -0.0079 4    THR A CB  
12  O  OG1 . THR A 4  ? 0.3967 0.4659 0.3777 -0.0001 0.0039  0.0085  4    THR A OG1 
13  C  CG2 . THR A 4  ? 0.3339 0.4077 0.3646 0.0188  0.0237  -0.0119 4    THR A CG2 
14  N  N   . HIS A 5  ? 0.1357 0.2589 0.3218 -0.0282 0.0168  -0.0329 5    HIS A N   
15  C  CA  . HIS A 5  ? 0.1116 0.2237 0.3128 -0.0100 0.0354  0.0015  5    HIS A CA  
16  C  C   . HIS A 5  ? 0.1215 0.2007 0.2498 -0.0173 0.0315  -0.0079 5    HIS A C   
17  O  O   . HIS A 5  ? 0.0806 0.2247 0.3027 -0.0043 0.0102  -0.0319 5    HIS A O   
18  C  CB  . HIS A 5  ? 0.1850 0.2450 0.3566 -0.0327 0.0398  -0.0028 5    HIS A CB  
19  C  CG  . HIS A 5  ? 0.3147 0.3666 0.4010 0.0047  0.0180  0.0263  5    HIS A CG  
20  N  ND1 . HIS A 5  ? 0.2902 0.4606 0.4843 -0.0154 0.0345  0.0295  5    HIS A ND1 
21  C  CD2 . HIS A 5  ? 0.4286 0.5037 0.4551 0.0080  0.0200  -0.0068 5    HIS A CD2 
22  C  CE1 . HIS A 5  ? 0.4874 0.5148 0.4924 0.0147  -0.0043 0.0164  5    HIS A CE1 
23  N  NE2 . HIS A 5  ? 0.4878 0.5377 0.5229 0.0299  -0.0048 0.0123  5    HIS A NE2 
24  N  N   . ILE A 6  ? 0.0828 0.2267 0.2586 -0.0015 0.0136  -0.0062 6    ILE A N   
25  C  CA  . ILE A 6  ? 0.1078 0.2428 0.2527 -0.0137 -0.0063 -0.0096 6    ILE A CA  
26  C  C   . ILE A 6  ? 0.1214 0.2687 0.2534 -0.0038 0.0157  -0.0074 6    ILE A C   
27  O  O   . ILE A 6  ? 0.1451 0.3321 0.2849 -0.0033 0.0180  -0.0088 6    ILE A O   
28  C  CB  . ILE A 6  ? 0.1450 0.2155 0.2723 -0.0015 0.0221  -0.0097 6    ILE A CB  
29  C  CG1 . ILE A 6  ? 0.1642 0.2726 0.2914 0.0040  0.0172  -0.0137 6    ILE A CG1 
30  C  CG2 . ILE A 6  ? 0.1903 0.2628 0.3031 -0.0139 0.0342  -0.0092 6    ILE A CG2 
31  C  CD1 . ILE A 6  ? 0.2106 0.3130 0.3122 -0.0195 0.0113  0.0076  6    ILE A CD1 
32  N  N   . TYR A 7  ? 0.1182 0.2951 0.2634 -0.0398 0.0259  -0.0178 7    TYR A N   
33  C  CA  . TYR A 7  ? 0.1257 0.2943 0.2547 -0.0365 0.0063  -0.0194 7    TYR A CA  
34  C  C   . TYR A 7  ? 0.1500 0.2993 0.2487 -0.0512 -0.0052 -0.0244 7    TYR A C   
35  O  O   . TYR A 7  ? 0.2339 0.3027 0.3104 -0.0445 0.0069  -0.0484 7    TYR A O   
36  C  CB  . TYR A 7  ? 0.1043 0.3041 0.2313 -0.0345 0.0163  -0.0171 7    TYR A CB  
37  C  CG  . TYR A 7  ? 0.0932 0.2954 0.2168 -0.0244 0.0353  0.0093  7    TYR A CG  
38  C  CD1 . TYR A 7  ? 0.1612 0.2685 0.2470 -0.0310 -0.0106 -0.0184 7    TYR A CD1 
39  C  CD2 . TYR A 7  ? 0.2318 0.3099 0.2339 -0.0071 0.0271  0.0071  7    TYR A CD2 
40  C  CE1 . TYR A 7  ? 0.1326 0.2980 0.2444 -0.0456 -0.0109 -0.0244 7    TYR A CE1 
41  C  CE2 . TYR A 7  ? 0.1854 0.3075 0.2954 -0.0032 0.0236  0.0213  7    TYR A CE2 
42  C  CZ  . TYR A 7  ? 0.1825 0.3112 0.3284 -0.0131 0.0540  0.0014  7    TYR A CZ  
43  O  OH  . TYR A 7  ? 0.1961 0.3453 0.4187 -0.0117 0.0587  -0.0178 7    TYR A OH  
44  N  N   . THR A 8  ? 0.1733 0.3382 0.2786 -0.0535 0.0008  -0.0287 8    THR A N   
45  C  CA  . THR A 8  ? 0.2515 0.3268 0.3007 -0.0477 0.0063  -0.0260 8    THR A CA  
46  C  C   . THR A 8  ? 0.2769 0.3168 0.2881 -0.0293 0.0338  -0.0169 8    THR A C   
47  O  O   . THR A 8  ? 0.2652 0.3158 0.2204 -0.0693 0.0066  -0.0511 8    THR A O   
48  C  CB  . THR A 8  ? 0.2558 0.3493 0.3397 -0.0564 -0.0142 -0.0369 8    THR A CB  
49  O  OG1 . THR A 8  ? 0.2603 0.4025 0.3633 -0.0918 -0.0337 -0.0399 8    THR A OG1 
50  C  CG2 . THR A 8  ? 0.2950 0.4213 0.3936 -0.0365 0.0165  -0.0133 8    THR A CG2 
51  N  N   . LYS A 9  ? 0.3004 0.2888 0.3224 -0.0519 0.0371  -0.0146 9    LYS A N   
52  C  CA  . LYS A 9  ? 0.3059 0.2966 0.3128 -0.0354 0.0289  -0.0223 9    LYS A CA  
53  C  C   . LYS A 9  ? 0.3072 0.3151 0.3229 -0.0346 0.0131  -0.0267 9    LYS A C   
54  O  O   . LYS A 9  ? 0.3163 0.2794 0.2642 -0.0740 0.0722  -0.0350 9    LYS A O   
55  C  CB  . LYS A 9  ? 0.3307 0.3257 0.3520 -0.0128 0.0165  0.0025  9    LYS A CB  
56  C  CG  . LYS A 9  ? 0.4213 0.4122 0.4209 -0.0143 -0.0016 -0.0030 9    LYS A CG  
57  C  CD  . LYS A 9  ? 0.4779 0.4611 0.4921 0.0174  0.0037  0.0020  9    LYS A CD  
58  C  CE  . LYS A 9  ? 0.5097 0.5151 0.5187 0.0015  -0.0086 0.0005  9    LYS A CE  
59  N  NZ  . LYS A 9  ? 0.5428 0.5407 0.5609 0.0177  -0.0081 0.0104  9    LYS A NZ  
60  N  N   . GLU A 10 ? 0.3016 0.3483 0.3270 -0.0584 0.0090  -0.0155 10   GLU A N   
61  C  CA  . GLU A 10 ? 0.3034 0.3706 0.3372 -0.0294 -0.0081 -0.0083 10   GLU A CA  
62  C  C   . GLU A 10 ? 0.2853 0.3873 0.3263 -0.0307 -0.0139 -0.0290 10   GLU A C   
63  O  O   . GLU A 10 ? 0.3033 0.4235 0.2873 -0.0547 -0.0444 -0.0451 10   GLU A O   
64  C  CB  . GLU A 10 ? 0.3425 0.3919 0.3626 -0.0346 -0.0083 -0.0241 10   GLU A CB  
65  C  CG  . GLU A 10 ? 0.4684 0.4478 0.4769 -0.0092 0.0035  -0.0055 10   GLU A CG  
66  C  CD  . GLU A 10 ? 0.5587 0.5454 0.5204 -0.0043 0.0017  0.0117  10   GLU A CD  
67  O  OE1 . GLU A 10 ? 0.5009 0.4575 0.5330 -0.0674 0.0201  -0.0526 10   GLU A OE1 
68  O  OE2 . GLU A 10 ? 0.6391 0.5819 0.6221 0.0072  0.0182  -0.0245 10   GLU A OE2 
69  N  N   . GLU A 11 ? 0.2061 0.4184 0.3031 -0.0277 -0.0245 -0.0160 11   GLU A N   
70  C  C   . GLU A 11 ? 0.2032 0.2778 0.2300 0.0174  -0.0164 0.0011  11   GLU A C   
71  O  O   . GLU A 11 ? 0.2108 0.3287 0.2432 0.0329  -0.0408 0.0220  11   GLU A O   
72  O  OE1 A GLU A 11 ? 0.3323 0.3829 0.3808 0.0123  0.0351  0.0019  11   GLU A OE1 
73  O  OE1 B GLU A 11 ? 0.2176 0.3785 0.3032 -0.0057 -0.0172 -0.0052 11   GLU A OE1 
74  O  OE2 A GLU A 11 ? 0.3434 0.4091 0.3984 0.0082  0.0174  -0.0179 11   GLU A OE2 
75  O  OE2 B GLU A 11 ? 0.3719 0.4844 0.4354 -0.0073 -0.0252 0.0063  11   GLU A OE2 
76  N  N   . VAL A 12 ? 0.1906 0.2555 0.1992 -0.0016 -0.0325 -0.0171 12   VAL A N   
77  C  CA  . VAL A 12 ? 0.1783 0.2143 0.1759 -0.0090 -0.0278 -0.0058 12   VAL A CA  
78  C  C   . VAL A 12 ? 0.1609 0.2152 0.1707 -0.0115 -0.0356 -0.0203 12   VAL A C   
79  O  O   . VAL A 12 ? 0.1826 0.1929 0.1561 -0.0053 -0.0540 0.0068  12   VAL A O   
80  C  CB  . VAL A 12 ? 0.1798 0.2088 0.1857 -0.0229 -0.0320 0.0027  12   VAL A CB  
81  C  CG1 . VAL A 12 ? 0.1776 0.2421 0.1844 -0.0263 -0.0595 0.0191  12   VAL A CG1 
82  C  CG2 . VAL A 12 ? 0.1916 0.1985 0.1880 -0.0546 -0.0164 -0.0022 12   VAL A CG2 
83  N  N   . SER A 13 ? 0.1464 0.2193 0.1834 -0.0047 -0.0428 -0.0113 13   SER A N   
84  C  CA  . SER A 13 ? 0.1442 0.2207 0.1967 -0.0109 -0.0200 -0.0151 13   SER A CA  
85  C  C   . SER A 13 ? 0.1782 0.2094 0.2051 -0.0386 -0.0216 -0.0242 13   SER A C   
86  O  O   . SER A 13 ? 0.2043 0.2870 0.1983 -0.0336 -0.0118 -0.0330 13   SER A O   
87  C  CB  . SER A 13 ? 0.1865 0.2393 0.2105 -0.0179 -0.0016 -0.0247 13   SER A CB  
88  O  OG  . SER A 13 ? 0.2475 0.3295 0.2778 -0.0437 -0.0417 -0.0292 13   SER A OG  
89  N  N   . SER A 14 ? 0.1676 0.2169 0.1879 -0.0306 -0.0427 -0.0020 14   SER A N   
90  C  CA  . SER A 14 ? 0.1972 0.2429 0.2129 0.0038  -0.0382 0.0020  14   SER A CA  
91  C  C   . SER A 14 ? 0.2311 0.2192 0.1842 0.0012  -0.0395 0.0096  14   SER A C   
92  O  O   . SER A 14 ? 0.2951 0.2597 0.1730 -0.0281 -0.0653 0.0040  14   SER A O   
93  C  CB  . SER A 14 ? 0.2199 0.2875 0.2437 0.0085  -0.0640 0.0023  14   SER A CB  
94  O  OG  . SER A 14 ? 0.2531 0.4230 0.3119 0.0160  -0.0700 -0.0021 14   SER A OG  
95  N  N   . HIS A 15 ? 0.1669 0.2171 0.1590 0.0119  -0.0357 -0.0026 15   HIS A N   
96  C  CA  . HIS A 15 ? 0.1845 0.1838 0.1510 0.0221  -0.0178 -0.0025 15   HIS A CA  
97  C  C   . HIS A 15 ? 0.1670 0.1774 0.1403 0.0050  -0.0329 -0.0216 15   HIS A C   
98  O  O   . HIS A 15 ? 0.1824 0.1771 0.1326 0.0156  -0.0554 -0.0179 15   HIS A O   
99  C  CB  . HIS A 15 ? 0.2116 0.2446 0.1393 0.0098  -0.0279 -0.0104 15   HIS A CB  
100 C  CG  . HIS A 15 ? 0.2492 0.2776 0.1386 0.0268  -0.0428 -0.0149 15   HIS A CG  
101 N  ND1 . HIS A 15 ? 0.2221 0.3443 0.2703 0.0448  -0.0119 -0.0008 15   HIS A ND1 
102 C  CD2 . HIS A 15 ? 0.3100 0.2871 0.2197 0.0235  -0.0203 -0.0186 15   HIS A CD2 
103 C  CE1 . HIS A 15 ? 0.1891 0.3255 0.2503 0.0325  -0.0189 -0.0144 15   HIS A CE1 
104 N  NE2 . HIS A 15 ? 0.3011 0.3753 0.2328 0.0339  -0.0079 -0.0135 15   HIS A NE2 
105 N  N   . THR A 16 ? 0.1758 0.1983 0.1489 0.0014  -0.0226 0.0176  16   THR A N   
106 C  CA  . THR A 16 ? 0.1828 0.2143 0.1398 -0.0115 -0.0308 0.0240  16   THR A CA  
107 C  C   . THR A 16 ? 0.1883 0.2168 0.1678 -0.0110 -0.0399 0.0094  16   THR A C   
108 O  O   . THR A 16 ? 0.1949 0.2715 0.2367 -0.0320 -0.0308 0.0265  16   THR A O   
109 C  CB  . THR A 16 ? 0.1682 0.2124 0.1911 -0.0060 -0.0193 0.0311  16   THR A CB  
110 O  OG1 . THR A 16 ? 0.2065 0.2575 0.1747 0.0121  -0.0128 0.0063  16   THR A OG1 
111 C  CG2 . THR A 16 ? 0.2224 0.2309 0.2323 -0.0043 -0.0172 0.0404  16   THR A CG2 
112 N  N   . SER A 17 ? 0.2278 0.2031 0.1904 -0.0234 -0.0287 0.0129  17   SER A N   
113 C  CA  . SER A 17 ? 0.2544 0.2259 0.1969 -0.0158 -0.0185 0.0347  17   SER A CA  
114 C  C   . SER A 17 ? 0.2563 0.2201 0.2124 -0.0110 -0.0216 0.0330  17   SER A C   
115 O  O   . SER A 17 ? 0.3132 0.2450 0.2346 -0.0092 -0.0347 0.0161  17   SER A O   
116 C  CB  . SER A 17 ? 0.2721 0.2594 0.2176 -0.0304 -0.0268 0.0253  17   SER A CB  
117 O  OG  . SER A 17 ? 0.3463 0.2999 0.2469 0.0071  -0.0399 0.0224  17   SER A OG  
118 N  N   . PRO A 18 ? 0.2940 0.2878 0.2811 -0.0055 -0.0146 0.0047  18   PRO A N   
119 C  CA  . PRO A 18 ? 0.3309 0.3065 0.3285 -0.0009 -0.0017 -0.0051 18   PRO A CA  
120 C  C   . PRO A 18 ? 0.3779 0.3310 0.3755 0.0196  0.0028  0.0030  18   PRO A C   
121 O  O   . PRO A 18 ? 0.4074 0.3180 0.3631 0.0286  0.0141  0.0043  18   PRO A O   
122 C  CB  . PRO A 18 ? 0.3409 0.3280 0.3513 -0.0014 -0.0092 0.0068  18   PRO A CB  
123 C  CG  . PRO A 18 ? 0.3183 0.2814 0.3293 0.0032  -0.0025 -0.0175 18   PRO A CG  
124 C  CD  . PRO A 18 ? 0.3072 0.2898 0.2866 -0.0281 -0.0202 0.0217  18   PRO A CD  
125 N  N   . GLU A 19 ? 0.4104 0.3745 0.3858 0.0189  -0.0105 0.0017  19   GLU A N   
126 C  CA  . GLU A 19 ? 0.4203 0.4096 0.4281 0.0129  -0.0038 0.0045  19   GLU A CA  
127 C  C   . GLU A 19 ? 0.3962 0.3841 0.4065 0.0220  -0.0134 0.0022  19   GLU A C   
128 O  O   . GLU A 19 ? 0.4291 0.3811 0.4282 0.0266  -0.0156 0.0105  19   GLU A O   
129 C  CB  . GLU A 19 ? 0.4613 0.4641 0.4506 0.0165  -0.0115 0.0047  19   GLU A CB  
130 C  CG  . GLU A 19 ? 0.5582 0.5344 0.5706 -0.0047 -0.0043 -0.0029 19   GLU A CG  
131 C  CD  . GLU A 19 ? 0.6916 0.6938 0.6367 -0.0001 -0.0014 -0.0052 19   GLU A CD  
132 O  OE1 . GLU A 19 ? 0.7431 0.7078 0.7097 -0.0021 0.0104  0.0220  19   GLU A OE1 
133 O  OE2 . GLU A 19 ? 0.7487 0.7121 0.7318 -0.0122 -0.0083 -0.0158 19   GLU A OE2 
134 N  N   . THR A 20 ? 0.3697 0.3486 0.3543 0.0148  -0.0311 0.0125  20   THR A N   
135 C  CA  . THR A 20 ? 0.3267 0.3471 0.3304 0.0144  -0.0287 -0.0035 20   THR A CA  
136 C  C   . THR A 20 ? 0.2675 0.3149 0.2926 0.0166  -0.0367 0.0032  20   THR A C   
137 O  O   . THR A 20 ? 0.2192 0.3525 0.3372 0.0491  -0.0642 -0.0020 20   THR A O   
138 C  CB  . THR A 20 ? 0.3250 0.3490 0.3486 0.0138  -0.0135 -0.0052 20   THR A CB  
139 O  OG1 . THR A 20 ? 0.4584 0.4725 0.4707 -0.0079 0.0073  0.0118  20   THR A OG1 
140 C  CG2 . THR A 20 ? 0.2465 0.2323 0.2296 -0.0282 -0.0396 -0.0229 20   THR A CG2 
141 N  N   . GLY A 21 ? 0.2671 0.2721 0.2794 0.0331  -0.0616 -0.0081 21   GLY A N   
142 C  CA  . GLY A 21 ? 0.2138 0.2295 0.2265 0.0370  -0.0580 -0.0024 21   GLY A CA  
143 C  C   . GLY A 21 ? 0.1819 0.1875 0.1810 0.0152  -0.0466 -0.0341 21   GLY A C   
144 O  O   . GLY A 21 ? 0.2064 0.2074 0.2088 0.0303  -0.0829 -0.0225 21   GLY A O   
145 N  N   . ILE A 22 ? 0.1381 0.1341 0.1321 0.0093  -0.0411 -0.0127 22   ILE A N   
146 C  CA  . ILE A 22 ? 0.1140 0.1291 0.1159 0.0047  -0.0095 0.0102  22   ILE A CA  
147 C  C   . ILE A 22 ? 0.1141 0.1263 0.1204 0.0113  -0.0105 0.0146  22   ILE A C   
148 O  O   . ILE A 22 ? 0.1258 0.1313 0.1078 0.0138  -0.0160 0.0085  22   ILE A O   
149 C  CB  . ILE A 22 ? 0.1480 0.1597 0.1074 0.0100  -0.0091 0.0054  22   ILE A CB  
150 C  CG1 . ILE A 22 ? 0.1817 0.1696 0.1313 0.0053  0.0090  0.0164  22   ILE A CG1 
151 C  CG2 . ILE A 22 ? 0.1285 0.1681 0.1254 0.0014  0.0126  0.0008  22   ILE A CG2 
152 C  CD1 . ILE A 22 ? 0.1885 0.1696 0.1599 0.0261  0.0025  0.0214  22   ILE A CD1 
153 N  N   . TRP A 23 ? 0.1183 0.1325 0.1056 0.0078  -0.0173 0.0153  23   TRP A N   
154 C  CA  . TRP A 23 ? 0.1123 0.1252 0.1167 0.0075  0.0015  0.0110  23   TRP A CA  
155 C  C   . TRP A 23 ? 0.1111 0.1173 0.0965 0.0172  -0.0107 0.0156  23   TRP A C   
156 O  O   . TRP A 23 ? 0.1427 0.1493 0.1057 0.0282  -0.0079 0.0030  23   TRP A O   
157 C  CB  . TRP A 23 ? 0.1185 0.1432 0.1000 -0.0015 -0.0022 0.0071  23   TRP A CB  
158 C  CG  . TRP A 23 ? 0.1311 0.1725 0.1174 0.0072  -0.0102 -0.0033 23   TRP A CG  
159 C  CD1 . TRP A 23 ? 0.1047 0.1697 0.1194 0.0210  -0.0164 0.0024  23   TRP A CD1 
160 C  CD2 . TRP A 23 ? 0.1460 0.1845 0.1292 0.0010  -0.0223 -0.0032 23   TRP A CD2 
161 N  NE1 . TRP A 23 ? 0.1382 0.1664 0.1710 0.0391  -0.0122 0.0065  23   TRP A NE1 
162 C  CE2 . TRP A 23 ? 0.1294 0.1972 0.1449 0.0225  -0.0233 0.0063  23   TRP A CE2 
163 C  CE3 . TRP A 23 ? 0.1409 0.1866 0.1698 -0.0015 -0.0138 0.0146  23   TRP A CE3 
164 C  CZ2 . TRP A 23 ? 0.1144 0.2572 0.1704 0.0207  -0.0166 -0.0007 23   TRP A CZ2 
165 C  CZ3 . TRP A 23 ? 0.1696 0.2273 0.2453 -0.0142 0.0006  0.0216  23   TRP A CZ3 
166 C  CH2 . TRP A 23 ? 0.1563 0.2587 0.2095 0.0065  -0.0038 -0.0147 23   TRP A CH2 
167 N  N   . VAL A 24 ? 0.1086 0.1130 0.1053 0.0152  -0.0020 -0.0002 24   VAL A N   
168 C  CA  . VAL A 24 ? 0.1137 0.1044 0.0960 0.0016  -0.0070 -0.0025 24   VAL A CA  
169 C  C   . VAL A 24 ? 0.0936 0.0956 0.0964 0.0070  -0.0066 -0.0001 24   VAL A C   
170 O  O   . VAL A 24 ? 0.1070 0.1206 0.1065 0.0105  0.0061  -0.0022 24   VAL A O   
171 C  CB  . VAL A 24 ? 0.0918 0.1115 0.1039 0.0073  0.0000  0.0094  24   VAL A CB  
172 C  CG1 . VAL A 24 ? 0.1141 0.1195 0.1276 0.0056  -0.0104 0.0029  24   VAL A CG1 
173 C  CG2 . VAL A 24 ? 0.0973 0.1267 0.1362 0.0001  -0.0049 0.0129  24   VAL A CG2 
174 N  N   . THR A 25 ? 0.1038 0.0986 0.1037 0.0014  0.0190  0.0098  25   THR A N   
175 C  CA  . THR A 25 ? 0.1070 0.0983 0.1078 -0.0085 0.0087  0.0023  25   THR A CA  
176 C  C   . THR A 25 ? 0.0854 0.1057 0.1107 0.0036  0.0013  0.0087  25   THR A C   
177 O  O   . THR A 25 ? 0.0810 0.1148 0.1134 -0.0018 0.0168  0.0030  25   THR A O   
178 C  CB  . THR A 25 ? 0.0979 0.1264 0.1293 -0.0032 0.0008  0.0032  25   THR A CB  
179 O  OG1 . THR A 25 ? 0.1085 0.1147 0.1425 -0.0170 0.0142  -0.0155 25   THR A OG1 
180 C  CG2 . THR A 25 ? 0.1246 0.1476 0.1717 0.0027  -0.0010 -0.0104 25   THR A CG2 
181 N  N   . LEU A 26 ? 0.0703 0.1127 0.0988 0.0091  -0.0005 0.0042  26   LEU A N   
182 C  CA  . LEU A 26 ? 0.0932 0.1079 0.0917 -0.0017 0.0041  0.0041  26   LEU A CA  
183 C  C   . LEU A 26 ? 0.1089 0.1046 0.1093 0.0116  0.0187  0.0091  26   LEU A C   
184 O  O   . LEU A 26 ? 0.1021 0.1115 0.1252 0.0041  0.0222  0.0147  26   LEU A O   
185 C  CB  . LEU A 26 ? 0.0782 0.1216 0.1087 0.0022  0.0024  -0.0044 26   LEU A CB  
186 C  CG  . LEU A 26 ? 0.0909 0.1199 0.1240 -0.0201 0.0024  0.0094  26   LEU A CG  
187 C  CD1 . LEU A 26 ? 0.1161 0.1108 0.1497 -0.0025 -0.0177 0.0103  26   LEU A CD1 
188 C  CD2 . LEU A 26 ? 0.1101 0.1586 0.1418 -0.0084 0.0049  0.0144  26   LEU A CD2 
189 N  N   . GLY A 27 ? 0.1110 0.1066 0.1340 0.0011  0.0187  0.0212  27   GLY A N   
190 C  CA  . GLY A 27 ? 0.1351 0.1160 0.1504 0.0045  0.0357  0.0142  27   GLY A CA  
191 C  C   . GLY A 27 ? 0.1381 0.1187 0.1801 0.0033  0.0396  0.0206  27   GLY A C   
192 O  O   . GLY A 27 ? 0.1088 0.1897 0.2054 -0.0311 0.0128  -0.0007 27   GLY A O   
193 N  N   . SER A 28 ? 0.1406 0.1254 0.2010 -0.0216 0.0449  0.0181  28   SER A N   
194 C  CA  . SER A 28 ? 0.1189 0.1456 0.2439 -0.0232 0.0308  -0.0080 28   SER A CA  
195 C  C   . SER A 28 ? 0.1078 0.1460 0.2240 -0.0047 0.0094  -0.0020 28   SER A C   
196 O  O   . SER A 28 ? 0.1235 0.1734 0.4042 -0.0108 -0.0004 -0.0328 28   SER A O   
197 C  CB  . SER A 28 ? 0.1228 0.1793 0.3101 -0.0361 0.0297  0.0198  28   SER A CB  
198 O  OG  . SER A 28 ? 0.2678 0.2393 0.4327 -0.0531 0.0688  0.0184  28   SER A OG  
199 N  N   . GLU A 29 ? 0.1046 0.1179 0.1428 -0.0159 0.0245  -0.0024 29   GLU A N   
200 C  CA  . GLU A 29 ? 0.0910 0.1343 0.1469 -0.0068 0.0198  0.0031  29   GLU A CA  
201 C  C   . GLU A 29 ? 0.0783 0.1178 0.1348 -0.0127 0.0154  -0.0027 29   GLU A C   
202 O  O   . GLU A 29 ? 0.0821 0.1433 0.1246 -0.0007 0.0128  -0.0011 29   GLU A O   
203 C  CB  . GLU A 29 ? 0.0997 0.1251 0.1348 -0.0108 0.0212  -0.0013 29   GLU A CB  
204 C  CG  . GLU A 29 ? 0.1102 0.1665 0.1381 -0.0199 0.0135  0.0129  29   GLU A CG  
205 C  CD  . GLU A 29 ? 0.1742 0.1901 0.1302 -0.0048 0.0189  0.0028  29   GLU A CD  
206 O  OE1 . GLU A 29 ? 0.1550 0.2174 0.1593 -0.0183 0.0083  0.0029  29   GLU A OE1 
207 O  OE2 . GLU A 29 ? 0.1732 0.3199 0.1523 0.0264  0.0024  -0.0213 29   GLU A OE2 
208 N  N   . VAL A 30 ? 0.0838 0.1175 0.1236 0.0047  0.0147  -0.0006 30   VAL A N   
209 C  CA  . VAL A 30 ? 0.0708 0.1042 0.1339 -0.0053 0.0059  -0.0061 30   VAL A CA  
210 C  C   . VAL A 30 ? 0.0752 0.1193 0.1014 0.0060  -0.0209 -0.0048 30   VAL A C   
211 O  O   . VAL A 30 ? 0.0918 0.1276 0.1253 -0.0074 0.0080  -0.0080 30   VAL A O   
212 C  CB  . VAL A 30 ? 0.0704 0.1309 0.1443 -0.0004 0.0102  -0.0013 30   VAL A CB  
213 C  CG1 . VAL A 30 ? 0.0946 0.1494 0.1524 -0.0139 -0.0168 -0.0018 30   VAL A CG1 
214 C  CG2 . VAL A 30 ? 0.0868 0.1531 0.1805 -0.0240 -0.0075 -0.0110 30   VAL A CG2 
215 N  N   . PHE A 31 ? 0.0952 0.1082 0.1158 0.0008  0.0050  0.0008  31   PHE A N   
216 C  CA  . PHE A 31 ? 0.0869 0.0984 0.1054 -0.0010 -0.0024 -0.0020 31   PHE A CA  
217 C  C   . PHE A 31 ? 0.1129 0.1025 0.1098 0.0098  -0.0032 -0.0039 31   PHE A C   
218 O  O   . PHE A 31 ? 0.1309 0.1224 0.1100 0.0135  0.0009  0.0013  31   PHE A O   
219 C  CB  . PHE A 31 ? 0.0780 0.0947 0.1052 -0.0085 0.0065  0.0003  31   PHE A CB  
220 C  CG  . PHE A 31 ? 0.0696 0.0922 0.1074 -0.0064 0.0154  0.0109  31   PHE A CG  
221 C  CD1 . PHE A 31 ? 0.0910 0.1090 0.1052 -0.0048 0.0104  0.0010  31   PHE A CD1 
222 C  CD2 . PHE A 31 ? 0.0737 0.1141 0.1164 -0.0098 0.0004  -0.0013 31   PHE A CD2 
223 C  CE1 . PHE A 31 ? 0.0980 0.0989 0.1272 0.0102  0.0085  0.0015  31   PHE A CE1 
224 C  CE2 . PHE A 31 ? 0.0968 0.1186 0.1050 -0.0076 -0.0062 -0.0108 31   PHE A CE2 
225 C  CZ  . PHE A 31 ? 0.0816 0.1256 0.1213 -0.0192 -0.0087 0.0098  31   PHE A CZ  
226 N  N   . ASP A 32 ? 0.0989 0.1097 0.1076 0.0080  0.0065  0.0142  32   ASP A N   
227 C  CA  . ASP A 32 ? 0.1069 0.1267 0.1022 -0.0004 -0.0066 -0.0006 32   ASP A CA  
228 C  C   . ASP A 32 ? 0.0766 0.1173 0.0923 0.0039  -0.0214 -0.0020 32   ASP A C   
229 O  O   . ASP A 32 ? 0.1041 0.1156 0.1016 0.0059  -0.0045 -0.0010 32   ASP A O   
230 C  CB  . ASP A 32 ? 0.0856 0.1482 0.1324 0.0026  -0.0128 0.0142  32   ASP A CB  
231 C  CG  . ASP A 32 ? 0.0988 0.1682 0.1684 0.0124  -0.0107 0.0222  32   ASP A CG  
232 O  OD1 . ASP A 32 ? 0.1240 0.1297 0.1447 0.0128  -0.0152 0.0175  32   ASP A OD1 
233 O  OD2 . ASP A 32 ? 0.1234 0.2574 0.3174 0.0673  -0.0102 0.1092  32   ASP A OD2 
234 N  N   . VAL A 33 ? 0.0928 0.0988 0.0920 -0.0031 -0.0034 -0.0137 33   VAL A N   
235 C  CA  . VAL A 33 ? 0.0806 0.1084 0.1072 -0.0042 0.0034  0.0087  33   VAL A CA  
236 C  C   . VAL A 33 ? 0.0982 0.1066 0.1201 0.0083  -0.0027 0.0058  33   VAL A C   
237 O  O   . VAL A 33 ? 0.0995 0.0985 0.1642 -0.0023 0.0050  0.0118  33   VAL A O   
238 C  CB  . VAL A 33 ? 0.1035 0.0973 0.1067 -0.0054 0.0104  0.0068  33   VAL A CB  
239 C  CG1 . VAL A 33 ? 0.0857 0.1257 0.1142 0.0209  -0.0241 0.0080  33   VAL A CG1 
240 C  CG2 . VAL A 33 ? 0.0987 0.1039 0.1034 0.0191  0.0015  0.0206  33   VAL A CG2 
241 N  N   . THR A 34 ? 0.0944 0.1075 0.1331 0.0157  0.0015  0.0151  34   THR A N   
242 C  CA  . THR A 34 ? 0.1244 0.1012 0.1068 0.0031  -0.0009 0.0150  34   THR A CA  
243 C  C   . THR A 34 ? 0.1331 0.1218 0.1316 0.0077  0.0055  0.0269  34   THR A C   
244 O  O   . THR A 34 ? 0.1415 0.1196 0.1462 0.0038  0.0143  0.0146  34   THR A O   
245 C  CB  . THR A 34 ? 0.1481 0.1139 0.1299 0.0241  -0.0240 0.0200  34   THR A CB  
246 O  OG1 . THR A 34 ? 0.1320 0.1341 0.1387 0.0129  -0.0248 0.0124  34   THR A OG1 
247 C  CG2 . THR A 34 ? 0.1584 0.1623 0.1777 -0.0081 -0.0142 0.0482  34   THR A CG2 
248 N  N   . GLU A 35 ? 0.1413 0.0899 0.1396 0.0105  -0.0008 -0.0061 35   GLU A N   
249 C  CA  . GLU A 35 ? 0.1545 0.1056 0.1407 0.0217  -0.0067 -0.0034 35   GLU A CA  
250 C  C   . GLU A 35 ? 0.1523 0.1058 0.1373 -0.0136 -0.0183 -0.0067 35   GLU A C   
251 O  O   . GLU A 35 ? 0.1978 0.1180 0.2479 0.0010  -0.0600 0.0137  35   GLU A O   
252 C  CB  . GLU A 35 ? 0.1776 0.1329 0.1741 0.0070  -0.0196 -0.0251 35   GLU A CB  
253 C  CG  . GLU A 35 ? 0.1681 0.1901 0.2131 0.0290  -0.0244 -0.0179 35   GLU A CG  
254 C  CD  . GLU A 35 ? 0.3985 0.3535 0.3914 0.0037  -0.0041 0.0343  35   GLU A CD  
255 O  OE1 . GLU A 35 ? 0.3979 0.3250 0.4815 0.0107  -0.0322 0.0408  35   GLU A OE1 
256 O  OE2 . GLU A 35 ? 0.4546 0.5071 0.5303 0.0081  -0.0436 0.0102  35   GLU A OE2 
257 N  N   . PHE A 36 ? 0.1245 0.1054 0.1092 0.0118  0.0096  0.0123  36   PHE A N   
258 C  CA  . PHE A 36 ? 0.1200 0.1064 0.0924 0.0115  0.0116  0.0053  36   PHE A CA  
259 C  C   . PHE A 36 ? 0.0921 0.1140 0.0827 0.0046  0.0144  0.0128  36   PHE A C   
260 O  O   . PHE A 36 ? 0.1067 0.1298 0.0833 -0.0110 0.0025  0.0165  36   PHE A O   
261 C  CB  . PHE A 36 ? 0.1347 0.1090 0.0799 0.0000  0.0170  -0.0048 36   PHE A CB  
262 C  CG  . PHE A 36 ? 0.1335 0.0945 0.0902 0.0057  0.0229  0.0121  36   PHE A CG  
263 C  CD1 . PHE A 36 ? 0.1512 0.1216 0.1011 0.0073  0.0011  0.0186  36   PHE A CD1 
264 C  CD2 . PHE A 36 ? 0.1239 0.1160 0.0990 0.0071  -0.0038 0.0197  36   PHE A CD2 
265 C  CE1 . PHE A 36 ? 0.1711 0.1581 0.0822 -0.0074 -0.0039 0.0405  36   PHE A CE1 
266 C  CE2 . PHE A 36 ? 0.1449 0.1178 0.1249 0.0260  0.0233  0.0321  36   PHE A CE2 
267 C  CZ  . PHE A 36 ? 0.0906 0.1911 0.1221 -0.0001 -0.0078 0.0584  36   PHE A CZ  
268 N  N   . VAL A 37 ? 0.1150 0.1174 0.0880 0.0128  -0.0034 0.0099  37   VAL A N   
269 C  CA  . VAL A 37 ? 0.1157 0.1113 0.0908 0.0046  0.0023  0.0023  37   VAL A CA  
270 C  C   . VAL A 37 ? 0.1267 0.0721 0.0764 0.0087  0.0139  0.0070  37   VAL A C   
271 O  O   . VAL A 37 ? 0.1049 0.1006 0.0943 0.0069  0.0080  -0.0057 37   VAL A O   
272 C  CB  A VAL A 37 ? 0.1653 0.1560 0.1245 -0.0380 0.0172  -0.0295 37   VAL A CB  
273 C  CB  B VAL A 37 ? 0.2251 0.1676 0.2032 -0.0365 0.0533  -0.0189 37   VAL A CB  
274 C  CG2 A VAL A 37 ? 0.1112 0.1614 0.1837 -0.0027 0.0027  0.0075  37   VAL A CG2 
275 C  CG2 B VAL A 37 ? 0.2586 0.2734 0.2270 0.0186  -0.0022 -0.0136 37   VAL A CG2 
276 N  N   . ASP A 38 ? 0.1170 0.0932 0.0965 0.0087  0.0065  0.0061  38   ASP A N   
277 C  CA  . ASP A 38 ? 0.1441 0.0910 0.1269 -0.0122 0.0044  0.0157  38   ASP A CA  
278 C  C   . ASP A 38 ? 0.1395 0.0785 0.1172 -0.0127 0.0043  0.0138  38   ASP A C   
279 O  O   . ASP A 38 ? 0.1393 0.1202 0.1154 -0.0149 0.0061  0.0170  38   ASP A O   
280 C  CB  . ASP A 38 ? 0.1605 0.1062 0.1186 -0.0097 -0.0056 0.0227  38   ASP A CB  
281 C  CG  . ASP A 38 ? 0.1560 0.1376 0.1248 0.0081  0.0094  0.0247  38   ASP A CG  
282 O  OD1 . ASP A 38 ? 0.1956 0.1606 0.1249 0.0119  -0.0042 0.0125  38   ASP A OD1 
283 O  OD2 . ASP A 38 ? 0.2237 0.1508 0.1624 0.0259  -0.0001 0.0228  38   ASP A OD2 
284 N  N   . LEU A 39 ? 0.1367 0.0740 0.1115 0.0022  -0.0037 -0.0013 39   LEU A N   
285 C  CA  . LEU A 39 ? 0.1488 0.0796 0.1084 -0.0142 -0.0183 0.0116  39   LEU A CA  
286 C  C   . LEU A 39 ? 0.1495 0.0996 0.0890 -0.0129 -0.0054 0.0034  39   LEU A C   
287 O  O   . LEU A 39 ? 0.1722 0.1136 0.1393 -0.0185 -0.0374 -0.0056 39   LEU A O   
288 C  CB  . LEU A 39 ? 0.1718 0.0811 0.1133 -0.0104 -0.0096 0.0040  39   LEU A CB  
289 C  CG  . LEU A 39 ? 0.2389 0.1027 0.1853 -0.0119 -0.0348 0.0186  39   LEU A CG  
290 C  CD1 . LEU A 39 ? 0.2133 0.1242 0.2792 0.0003  0.0111  0.0003  39   LEU A CD1 
291 C  CD2 . LEU A 39 ? 0.2939 0.1726 0.2388 0.0504  -0.0364 -0.0323 39   LEU A CD2 
292 N  N   . HIS A 40 ? 0.1426 0.0793 0.0900 -0.0157 -0.0055 0.0077  40   HIS A N   
293 C  CA  . HIS A 40 ? 0.1320 0.0884 0.1059 -0.0146 0.0103  0.0031  40   HIS A CA  
294 C  C   . HIS A 40 ? 0.1393 0.1168 0.0969 -0.0240 -0.0160 -0.0068 40   HIS A C   
295 O  O   . HIS A 40 ? 0.1470 0.1769 0.1045 -0.0357 0.0179  -0.0026 40   HIS A O   
296 C  CB  . HIS A 40 ? 0.1180 0.0749 0.1000 -0.0182 0.0124  0.0112  40   HIS A CB  
297 C  CG  . HIS A 40 ? 0.1026 0.0687 0.1087 0.0005  -0.0088 0.0056  40   HIS A CG  
298 N  ND1 . HIS A 40 ? 0.0946 0.1031 0.0958 0.0015  -0.0063 0.0005  40   HIS A ND1 
299 C  CD2 . HIS A 40 ? 0.1255 0.0755 0.0995 0.0013  0.0027  0.0021  40   HIS A CD2 
300 C  CE1 . HIS A 40 ? 0.1180 0.0949 0.1093 0.0116  0.0084  0.0114  40   HIS A CE1 
301 N  NE2 . HIS A 40 ? 0.0924 0.0779 0.0986 -0.0044 -0.0086 0.0001  40   HIS A NE2 
302 N  N   . PRO A 41 ? 0.1242 0.1136 0.1415 -0.0059 0.0048  0.0105  41   PRO A N   
303 C  CA  . PRO A 41 ? 0.1376 0.1961 0.1530 -0.0049 -0.0216 -0.0288 41   PRO A CA  
304 C  C   . PRO A 41 ? 0.2092 0.2533 0.1979 -0.0300 -0.0091 -0.0297 41   PRO A C   
305 O  O   . PRO A 41 ? 0.1656 0.2472 0.2778 0.0200  -0.0098 -0.0987 41   PRO A O   
306 C  CB  . PRO A 41 ? 0.1473 0.1687 0.1856 0.0065  -0.0269 -0.0250 41   PRO A CB  
307 C  CG  . PRO A 41 ? 0.1373 0.1254 0.1554 -0.0200 -0.0263 0.0120  41   PRO A CG  
308 C  CD  . PRO A 41 ? 0.1508 0.1043 0.1433 -0.0146 -0.0355 0.0230  41   PRO A CD  
309 N  N   . GLY A 42 ? 0.2066 0.3098 0.2236 -0.0323 0.0177  -0.0533 42   GLY A N   
310 C  CA  . GLY A 42 ? 0.2286 0.3216 0.2048 -0.0041 0.0107  -0.0353 42   GLY A CA  
311 C  C   . GLY A 42 ? 0.2024 0.3265 0.1921 0.0009  0.0173  -0.0289 42   GLY A C   
312 O  O   . GLY A 42 ? 0.2454 0.3959 0.1757 0.0002  0.0342  -0.0454 42   GLY A O   
313 N  N   . GLY A 43 ? 0.1789 0.3090 0.1888 -0.0087 0.0301  -0.0280 43   GLY A N   
314 C  CA  . GLY A 43 ? 0.2004 0.2654 0.1389 -0.0342 0.0178  -0.0033 43   GLY A CA  
315 C  C   . GLY A 43 ? 0.1582 0.1581 0.1172 -0.0220 0.0297  -0.0241 43   GLY A C   
316 O  O   . GLY A 43 ? 0.1531 0.1984 0.0878 0.0233  -0.0224 -0.0059 43   GLY A O   
317 N  N   . PRO A 44 ? 0.1770 0.1103 0.0815 -0.0291 0.0142  -0.0004 44   PRO A N   
318 C  CA  . PRO A 44 ? 0.1367 0.0945 0.0903 -0.0064 0.0131  -0.0057 44   PRO A CA  
319 C  C   . PRO A 44 ? 0.1187 0.0827 0.0853 0.0042  0.0144  0.0077  44   PRO A C   
320 O  O   . PRO A 44 ? 0.1285 0.1066 0.0882 -0.0081 0.0129  0.0040  44   PRO A O   
321 C  CB  . PRO A 44 ? 0.1962 0.1315 0.1137 0.0109  0.0182  -0.0197 44   PRO A CB  
322 C  CG  . PRO A 44 ? 0.2477 0.1291 0.1318 0.0035  0.0409  -0.0149 44   PRO A CG  
323 C  CD  . PRO A 44 ? 0.2537 0.1126 0.1039 -0.0568 0.0179  -0.0095 44   PRO A CD  
324 N  N   . SER A 45 ? 0.1211 0.0817 0.0850 -0.0066 0.0215  -0.0041 45   SER A N   
325 C  CA  . SER A 45 ? 0.1062 0.0899 0.0891 -0.0103 0.0258  -0.0056 45   SER A CA  
326 C  C   . SER A 45 ? 0.1088 0.0972 0.0872 -0.0025 0.0092  -0.0036 45   SER A C   
327 O  O   . SER A 45 ? 0.1293 0.0967 0.0865 -0.0157 0.0042  -0.0094 45   SER A O   
328 C  CB  . SER A 45 ? 0.1409 0.0752 0.1146 -0.0018 0.0305  -0.0162 45   SER A CB  
329 N  N   . LYS A 46 ? 0.0973 0.0959 0.0985 0.0003  0.0030  0.0010  46   LYS A N   
330 C  CA  . LYS A 46 ? 0.1325 0.1111 0.0925 0.0139  -0.0163 -0.0007 46   LYS A CA  
331 C  C   . LYS A 46 ? 0.1250 0.1061 0.0988 0.0103  -0.0174 0.0105  46   LYS A C   
332 O  O   . LYS A 46 ? 0.1483 0.0971 0.1039 0.0097  -0.0019 0.0041  46   LYS A O   
333 C  CB  . LYS A 46 ? 0.1556 0.2073 0.1367 0.0236  -0.0015 0.0000  46   LYS A CB  
334 C  CG  . LYS A 46 ? 0.1960 0.3075 0.2040 0.0019  -0.0008 0.0399  46   LYS A CG  
335 C  CD  . LYS A 46 ? 0.3454 0.3447 0.3517 0.0159  0.0150  0.0204  46   LYS A CD  
336 C  CE  . LYS A 46 ? 0.3559 0.3461 0.3504 0.0385  -0.0246 -0.0154 46   LYS A CE  
337 N  NZ  . LYS A 46 ? 0.3199 0.3186 0.2368 0.0030  0.0338  0.0213  46   LYS A NZ  
338 N  N   . LEU A 47 ? 0.1214 0.1006 0.0783 -0.0149 0.0026  0.0037  47   LEU A N   
339 C  CA  . LEU A 47 ? 0.1303 0.0838 0.0867 -0.0026 -0.0037 0.0121  47   LEU A CA  
340 C  C   . LEU A 47 ? 0.1215 0.1010 0.0753 -0.0092 0.0122  0.0073  47   LEU A C   
341 O  O   . LEU A 47 ? 0.1349 0.0960 0.0859 -0.0137 0.0074  0.0112  47   LEU A O   
342 C  CB  . LEU A 47 ? 0.1363 0.0785 0.0998 0.0005  -0.0037 0.0102  47   LEU A CB  
343 C  CG  . LEU A 47 ? 0.1208 0.0922 0.0918 -0.0228 0.0054  -0.0039 47   LEU A CG  
344 C  CD1 . LEU A 47 ? 0.1184 0.1036 0.0979 -0.0066 0.0067  0.0137  47   LEU A CD1 
345 C  CD2 . LEU A 47 ? 0.1452 0.1110 0.1208 -0.0215 0.0040  -0.0193 47   LEU A CD2 
346 N  N   . MET A 48 ? 0.1102 0.0904 0.0800 -0.0067 0.0033  0.0120  48   MET A N   
347 C  CA  . MET A 48 ? 0.1128 0.0892 0.0914 0.0078  0.0004  0.0147  48   MET A CA  
348 C  C   . MET A 48 ? 0.1157 0.0978 0.0737 0.0008  0.0012  0.0121  48   MET A C   
349 O  O   . MET A 48 ? 0.1348 0.0968 0.0965 -0.0055 -0.0216 0.0055  48   MET A O   
350 C  CB  . MET A 48 ? 0.1061 0.1052 0.0929 -0.0006 -0.0138 0.0194  48   MET A CB  
351 C  CG  . MET A 48 ? 0.1399 0.0934 0.1090 0.0023  -0.0099 0.0139  48   MET A CG  
352 S  SD  . MET A 48 ? 0.1432 0.1271 0.1189 0.0202  0.0100  -0.0052 48   MET A SD  
353 C  CE  . MET A 48 ? 0.1215 0.1574 0.1244 0.0180  0.0120  0.0214  48   MET A CE  
354 N  N   . LEU A 49 ? 0.1210 0.0873 0.0917 -0.0131 0.0006  -0.0073 49   LEU A N   
355 C  CA  . LEU A 49 ? 0.1285 0.0871 0.1181 -0.0119 -0.0121 -0.0095 49   LEU A CA  
356 C  C   . LEU A 49 ? 0.1211 0.1004 0.1172 -0.0127 0.0005  -0.0066 49   LEU A C   
357 O  O   . LEU A 49 ? 0.1449 0.1045 0.1174 -0.0091 -0.0102 -0.0148 49   LEU A O   
358 C  CB  . LEU A 49 ? 0.1415 0.0719 0.1098 -0.0021 0.0132  0.0004  49   LEU A CB  
359 C  CG  . LEU A 49 ? 0.1743 0.0959 0.1186 -0.0029 0.0236  -0.0144 49   LEU A CG  
360 C  CD1 . LEU A 49 ? 0.1539 0.1108 0.1463 -0.0024 0.0275  -0.0090 49   LEU A CD1 
361 C  CD2 . LEU A 49 ? 0.1876 0.1171 0.1465 -0.0091 0.0405  -0.0077 49   LEU A CD2 
362 N  N   . ALA A 50 ? 0.1286 0.0874 0.1011 -0.0086 -0.0057 -0.0002 50   ALA A N   
363 C  CA  . ALA A 50 ? 0.1188 0.0978 0.1134 0.0032  -0.0090 0.0117  50   ALA A CA  
364 C  C   . ALA A 50 ? 0.1231 0.1045 0.1032 -0.0161 -0.0088 -0.0045 50   ALA A C   
365 O  O   . ALA A 50 ? 0.1146 0.1202 0.1224 -0.0114 -0.0186 0.0179  50   ALA A O   
366 C  CB  . ALA A 50 ? 0.1190 0.1177 0.1315 -0.0013 -0.0098 0.0158  50   ALA A CB  
367 N  N   . ALA A 51 ? 0.1122 0.1067 0.1179 -0.0112 -0.0053 0.0121  51   ALA A N   
368 C  CA  . ALA A 51 ? 0.1148 0.1227 0.1244 -0.0023 -0.0151 -0.0016 51   ALA A CA  
369 C  C   . ALA A 51 ? 0.1270 0.1137 0.1045 -0.0023 -0.0136 0.0030  51   ALA A C   
370 O  O   . ALA A 51 ? 0.1523 0.1390 0.1156 -0.0082 -0.0203 -0.0056 51   ALA A O   
371 C  CB  . ALA A 51 ? 0.1268 0.1319 0.1485 0.0159  -0.0059 0.0137  51   ALA A CB  
372 N  N   . GLY A 52 ? 0.1044 0.1428 0.1057 -0.0014 -0.0134 -0.0006 52   GLY A N   
373 C  CA  . GLY A 52 ? 0.1239 0.1632 0.1362 -0.0019 -0.0101 0.0123  52   GLY A CA  
374 C  C   . GLY A 52 ? 0.1200 0.1415 0.1570 -0.0164 -0.0374 0.0164  52   GLY A C   
375 O  O   . GLY A 52 ? 0.1508 0.1762 0.2556 -0.0346 -0.0667 0.0256  52   GLY A O   
376 N  N   . GLY A 53 ? 0.1025 0.1279 0.1296 -0.0098 -0.0291 0.0082  53   GLY A N   
377 C  CA  . GLY A 53 ? 0.1303 0.1218 0.1389 -0.0187 -0.0153 -0.0052 53   GLY A CA  
378 C  C   . GLY A 53 ? 0.0910 0.1200 0.1129 -0.0068 0.0027  -0.0038 53   GLY A C   
379 O  O   . GLY A 53 ? 0.0963 0.1218 0.1064 -0.0083 -0.0050 -0.0069 53   GLY A O   
380 N  N   . PRO A 54 ? 0.1013 0.1127 0.1220 -0.0071 -0.0005 -0.0069 54   PRO A N   
381 C  CA  . PRO A 54 ? 0.1001 0.1081 0.0917 -0.0128 0.0005  -0.0126 54   PRO A CA  
382 C  C   . PRO A 54 ? 0.0989 0.0815 0.1076 0.0092  0.0036  0.0034  54   PRO A C   
383 O  O   . PRO A 54 ? 0.1041 0.1011 0.1095 -0.0026 -0.0081 -0.0070 54   PRO A O   
384 C  CB  . PRO A 54 ? 0.1096 0.1200 0.1426 -0.0253 -0.0050 -0.0030 54   PRO A CB  
385 C  CG  . PRO A 54 ? 0.1523 0.1421 0.1725 -0.0047 -0.0083 -0.0111 54   PRO A CG  
386 C  CD  . PRO A 54 ? 0.1487 0.1042 0.1273 -0.0208 -0.0166 -0.0088 54   PRO A CD  
387 N  N   . LEU A 55 ? 0.0904 0.0921 0.0862 -0.0091 0.0088  0.0000  55   LEU A N   
388 C  CA  . LEU A 55 ? 0.0907 0.0761 0.0767 -0.0074 0.0069  -0.0043 55   LEU A CA  
389 C  C   . LEU A 55 ? 0.0855 0.0877 0.0875 0.0051  0.0081  0.0127  55   LEU A C   
390 O  O   . LEU A 55 ? 0.0953 0.0691 0.1110 -0.0051 0.0192  0.0032  55   LEU A O   
391 C  CB  . LEU A 55 ? 0.1056 0.0852 0.0929 0.0032  -0.0073 0.0083  55   LEU A CB  
392 C  CG  . LEU A 55 ? 0.0908 0.0684 0.0937 -0.0013 -0.0007 0.0089  55   LEU A CG  
393 C  CD1 . LEU A 55 ? 0.0915 0.0946 0.1156 -0.0006 0.0060  -0.0051 55   LEU A CD1 
394 C  CD2 . LEU A 55 ? 0.1764 0.0911 0.1025 -0.0139 0.0132  -0.0003 55   LEU A CD2 
395 N  N   . GLU A 56 ? 0.0869 0.0873 0.0938 0.0085  0.0125  0.0131  56   GLU A N   
396 C  CA  . GLU A 56 ? 0.1041 0.0934 0.0986 0.0081  0.0076  0.0031  56   GLU A CA  
397 C  C   . GLU A 56 ? 0.0928 0.0634 0.1175 -0.0137 0.0040  0.0046  56   GLU A C   
398 O  O   . GLU A 56 ? 0.0847 0.0931 0.1107 0.0046  0.0029  0.0191  56   GLU A O   
399 C  CB  . GLU A 56 ? 0.1154 0.0958 0.1195 0.0154  0.0294  0.0221  56   GLU A CB  
400 C  CG  . GLU A 56 ? 0.1136 0.1147 0.1377 0.0052  0.0096  0.0340  56   GLU A CG  
401 C  CD  . GLU A 56 ? 0.1090 0.1025 0.1383 0.0011  0.0382  0.0331  56   GLU A CD  
402 O  OE1 . GLU A 56 ? 0.1019 0.1189 0.1152 0.0023  0.0071  0.0166  56   GLU A OE1 
403 O  OE2 . GLU A 56 ? 0.1312 0.1196 0.1321 0.0153  0.0300  0.0220  56   GLU A OE2 
404 N  N   . PRO A 57 ? 0.0935 0.0869 0.1153 -0.0023 0.0192  0.0022  57   PRO A N   
405 C  CA  . PRO A 57 ? 0.1262 0.0992 0.1072 0.0082  0.0170  0.0036  57   PRO A CA  
406 C  C   . PRO A 57 ? 0.0923 0.1046 0.1287 0.0087  0.0269  0.0123  57   PRO A C   
407 O  O   . PRO A 57 ? 0.1274 0.0957 0.1899 0.0165  0.0441  0.0251  57   PRO A O   
408 C  CB  . PRO A 57 ? 0.1483 0.1645 0.1151 -0.0150 0.0153  -0.0091 57   PRO A CB  
409 C  CG  . PRO A 57 ? 0.1593 0.2094 0.1628 0.0172  0.0034  -0.0469 57   PRO A CG  
410 C  CD  . PRO A 57 ? 0.1099 0.1009 0.1082 0.0031  0.0058  -0.0076 57   PRO A CD  
411 N  N   . PHE A 58 ? 0.0936 0.0895 0.1143 0.0081  0.0136  0.0100  58   PHE A N   
412 C  CA  . PHE A 58 ? 0.0959 0.1001 0.1109 0.0116  0.0183  0.0112  58   PHE A CA  
413 C  C   . PHE A 58 ? 0.0972 0.0802 0.1183 -0.0083 0.0167  0.0270  58   PHE A C   
414 O  O   . PHE A 58 ? 0.0946 0.1047 0.1295 -0.0045 0.0193  0.0272  58   PHE A O   
415 C  CB  . PHE A 58 ? 0.1017 0.0856 0.1040 0.0122  0.0181  0.0171  58   PHE A CB  
416 C  CG  . PHE A 58 ? 0.1184 0.0911 0.1223 0.0106  0.0017  0.0234  58   PHE A CG  
417 C  CD1 . PHE A 58 ? 0.1196 0.1202 0.1459 0.0288  0.0042  0.0115  58   PHE A CD1 
418 C  CD2 . PHE A 58 ? 0.1453 0.0788 0.1197 0.0089  0.0129  0.0075  58   PHE A CD2 
419 C  CE1 . PHE A 58 ? 0.1661 0.1252 0.1670 0.0158  -0.0049 -0.0010 58   PHE A CE1 
420 C  CE2 . PHE A 58 ? 0.1756 0.1222 0.1420 0.0410  -0.0013 0.0064  58   PHE A CE2 
421 C  CZ  . PHE A 58 ? 0.1881 0.1338 0.1293 0.0434  -0.0391 -0.0084 58   PHE A CZ  
422 N  N   . TRP A 59 ? 0.0970 0.0964 0.1075 -0.0027 0.0066  0.0162  59   TRP A N   
423 C  CA  . TRP A 59 ? 0.0860 0.0825 0.1216 0.0111  0.0173  0.0067  59   TRP A CA  
424 C  C   . TRP A 59 ? 0.0824 0.0810 0.1022 -0.0016 0.0110  0.0043  59   TRP A C   
425 O  O   . TRP A 59 ? 0.0907 0.1030 0.1131 0.0063  -0.0062 -0.0040 59   TRP A O   
426 C  CB  . TRP A 59 ? 0.0973 0.0844 0.1071 -0.0072 0.0015  0.0149  59   TRP A CB  
427 C  CG  . TRP A 59 ? 0.0967 0.0840 0.1029 -0.0193 0.0095  0.0046  59   TRP A CG  
428 C  CD1 . TRP A 59 ? 0.1022 0.1027 0.0848 -0.0041 0.0107  -0.0122 59   TRP A CD1 
429 C  CD2 . TRP A 59 ? 0.0752 0.0791 0.0945 -0.0064 -0.0018 0.0107  59   TRP A CD2 
430 N  NE1 . TRP A 59 ? 0.1057 0.0805 0.1181 0.0053  0.0067  0.0079  59   TRP A NE1 
431 C  CE2 . TRP A 59 ? 0.0807 0.0840 0.1169 -0.0074 0.0002  -0.0100 59   TRP A CE2 
432 C  CE3 . TRP A 59 ? 0.0819 0.1011 0.1021 -0.0073 -0.0002 0.0036  59   TRP A CE3 
433 C  CZ2 . TRP A 59 ? 0.0832 0.0872 0.1306 -0.0149 0.0008  -0.0163 59   TRP A CZ2 
434 C  CZ3 . TRP A 59 ? 0.0806 0.1314 0.0998 0.0017  -0.0077 -0.0168 59   TRP A CZ3 
435 C  CH2 . TRP A 59 ? 0.0730 0.1260 0.1274 0.0072  0.0018  -0.0234 59   TRP A CH2 
436 N  N   . ALA A 60 ? 0.0976 0.0845 0.1225 0.0088  0.0015  0.0051  60   ALA A N   
437 C  CA  . ALA A 60 ? 0.1083 0.0828 0.1217 0.0057  0.0052  0.0179  60   ALA A CA  
438 C  C   . ALA A 60 ? 0.0944 0.0987 0.1147 -0.0018 -0.0099 0.0081  60   ALA A C   
439 O  O   . ALA A 60 ? 0.0923 0.1413 0.1211 0.0001  -0.0142 0.0357  60   ALA A O   
440 C  CB  . ALA A 60 ? 0.1161 0.0902 0.1290 0.0054  0.0024  0.0167  60   ALA A CB  
441 N  N   . LEU A 61 ? 0.0852 0.0790 0.0964 0.0048  -0.0117 0.0018  61   LEU A N   
442 C  CA  . LEU A 61 ? 0.1056 0.0784 0.0962 0.0065  -0.0022 -0.0018 61   LEU A CA  
443 C  C   . LEU A 61 ? 0.0848 0.0839 0.1072 0.0049  0.0192  -0.0040 61   LEU A C   
444 O  O   . LEU A 61 ? 0.0909 0.1287 0.1152 0.0068  0.0120  -0.0252 61   LEU A O   
445 C  CD1 A LEU A 61 ? 0.1050 0.1199 0.2442 0.0464  0.0478  -0.0066 61   LEU A CD1 
446 C  CD1 B LEU A 61 ? 0.2257 0.2313 0.2259 -0.0294 -0.0005 -0.0150 61   LEU A CD1 
447 C  CD2 A LEU A 61 ? 0.0886 0.1082 0.0973 -0.0370 -0.0119 0.0034  61   LEU A CD2 
448 C  CD2 B LEU A 61 ? 0.2018 0.1445 0.0445 0.0051  0.0531  -0.0168 61   LEU A CD2 
449 N  N   . TYR A 62 ? 0.0870 0.0862 0.0971 0.0066  0.0064  -0.0092 62   TYR A N   
450 C  CA  . TYR A 62 ? 0.0979 0.0737 0.1030 -0.0023 0.0097  0.0016  62   TYR A CA  
451 C  C   . TYR A 62 ? 0.0887 0.0771 0.1128 0.0069  0.0130  -0.0169 62   TYR A C   
452 O  O   . TYR A 62 ? 0.0836 0.0820 0.0975 0.0140  0.0028  -0.0051 62   TYR A O   
453 C  CB  . TYR A 62 ? 0.1256 0.0741 0.1091 -0.0047 0.0075  0.0036  62   TYR A CB  
454 C  CG  . TYR A 62 ? 0.1156 0.1016 0.0963 -0.0040 0.0057  -0.0007 62   TYR A CG  
455 C  CD1 . TYR A 62 ? 0.1546 0.1677 0.1167 -0.0308 0.0055  -0.0068 62   TYR A CD1 
456 C  CD2 . TYR A 62 ? 0.1164 0.0980 0.1045 0.0028  -0.0040 -0.0013 62   TYR A CD2 
457 C  CE1 . TYR A 62 ? 0.1318 0.2065 0.1343 -0.0590 0.0156  -0.0093 62   TYR A CE1 
458 C  CE2 . TYR A 62 ? 0.1209 0.1200 0.1209 -0.0084 0.0080  -0.0031 62   TYR A CE2 
459 C  CZ  . TYR A 62 ? 0.1158 0.1827 0.1203 -0.0189 0.0075  -0.0247 62   TYR A CZ  
460 O  OH  . TYR A 62 ? 0.1708 0.2308 0.1122 -0.0272 0.0328  -0.0082 62   TYR A OH  
461 N  N   . ALA A 63 ? 0.1237 0.0965 0.0962 0.0291  0.0100  -0.0066 63   ALA A N   
462 C  CA  . ALA A 63 ? 0.1168 0.1080 0.1020 0.0137  -0.0065 -0.0082 63   ALA A CA  
463 C  C   . ALA A 63 ? 0.0898 0.1156 0.0996 0.0207  0.0004  -0.0144 63   ALA A C   
464 O  O   . ALA A 63 ? 0.1089 0.1150 0.1001 0.0250  -0.0155 -0.0097 63   ALA A O   
465 C  CB  . ALA A 63 ? 0.1363 0.1246 0.1010 0.0213  -0.0249 -0.0026 63   ALA A CB  
466 N  N   . VAL A 64 ? 0.0922 0.0942 0.1184 0.0026  -0.0060 -0.0216 64   VAL A N   
467 C  CA  . VAL A 64 ? 0.1046 0.1095 0.1179 -0.0004 -0.0169 -0.0181 64   VAL A CA  
468 C  C   . VAL A 64 ? 0.0987 0.0965 0.0938 0.0197  -0.0117 -0.0170 64   VAL A C   
469 O  O   . VAL A 64 ? 0.1182 0.1034 0.1147 0.0076  -0.0084 -0.0351 64   VAL A O   
470 C  CB  . VAL A 64 ? 0.1165 0.1231 0.1831 -0.0071 0.0184  -0.0286 64   VAL A CB  
471 C  CG1 . VAL A 64 ? 0.1308 0.1379 0.1690 0.0043  0.0289  0.0181  64   VAL A CG1 
472 C  CG2 . VAL A 64 ? 0.1621 0.1560 0.2069 -0.0177 0.0311  -0.0274 64   VAL A CG2 
473 N  N   . HIS A 65 ? 0.1003 0.0859 0.0850 -0.0051 0.0006  -0.0179 65   HIS A N   
474 C  CA  . HIS A 65 ? 0.0809 0.0783 0.0879 0.0167  -0.0074 -0.0094 65   HIS A CA  
475 C  C   . HIS A 65 ? 0.0993 0.0828 0.0849 0.0207  -0.0177 -0.0212 65   HIS A C   
476 O  O   . HIS A 65 ? 0.0964 0.0918 0.0900 0.0186  0.0022  0.0001  65   HIS A O   
477 C  CB  . HIS A 65 ? 0.0684 0.0875 0.0960 0.0088  -0.0056 -0.0027 65   HIS A CB  
478 C  CG  . HIS A 65 ? 0.0757 0.0844 0.0669 -0.0114 -0.0158 0.0002  65   HIS A CG  
479 N  ND1 . HIS A 65 ? 0.0873 0.1049 0.0660 -0.0064 -0.0037 -0.0022 65   HIS A ND1 
480 C  CD2 . HIS A 65 ? 0.0805 0.0850 0.0902 0.0011  0.0017  -0.0228 65   HIS A CD2 
481 C  CE1 . HIS A 65 ? 0.0904 0.0784 0.0782 -0.0049 0.0057  -0.0087 65   HIS A CE1 
482 N  NE2 . HIS A 65 ? 0.0919 0.0805 0.0861 0.0126  0.0112  -0.0065 65   HIS A NE2 
483 N  N   . ASN A 66 ? 0.1094 0.0898 0.0813 0.0244  0.0031  0.0022  66   ASN A N   
484 C  CA  . ASN A 66 ? 0.1127 0.0771 0.1066 0.0211  -0.0035 -0.0013 66   ASN A CA  
485 C  C   . ASN A 66 ? 0.1257 0.0868 0.0877 0.0213  -0.0115 -0.0036 66   ASN A C   
486 O  O   . ASN A 66 ? 0.1545 0.1116 0.1051 0.0439  -0.0197 -0.0158 66   ASN A O   
487 C  CB  . ASN A 66 ? 0.1295 0.1016 0.0924 0.0362  0.0012  0.0067  66   ASN A CB  
488 C  CG  . ASN A 66 ? 0.1250 0.1005 0.0909 0.0240  0.0063  -0.0220 66   ASN A CG  
489 O  OD1 . ASN A 66 ? 0.1326 0.1201 0.1575 0.0204  -0.0182 -0.0366 66   ASN A OD1 
490 N  ND2 . ASN A 66 ? 0.1414 0.0855 0.1073 0.0145  0.0137  -0.0159 66   ASN A ND2 
491 N  N   . GLN A 67 ? 0.1100 0.0803 0.0962 0.0250  -0.0168 0.0039  67   GLN A N   
492 C  CA  . GLN A 67 ? 0.1231 0.0757 0.0822 0.0126  -0.0138 -0.0059 67   GLN A CA  
493 C  C   . GLN A 67 ? 0.1137 0.0674 0.0853 0.0079  -0.0126 -0.0036 67   GLN A C   
494 O  O   . GLN A 67 ? 0.1061 0.0861 0.0864 0.0085  -0.0151 -0.0099 67   GLN A O   
495 C  CB  . GLN A 67 ? 0.1362 0.1007 0.0974 -0.0002 -0.0103 -0.0082 67   GLN A CB  
496 C  CG  . GLN A 67 ? 0.1147 0.1282 0.1200 0.0104  -0.0027 -0.0112 67   GLN A CG  
497 C  CD  . GLN A 67 ? 0.0923 0.1208 0.1318 -0.0179 -0.0169 -0.0291 67   GLN A CD  
498 O  OE1 . GLN A 67 ? 0.1523 0.1674 0.1358 -0.0284 -0.0158 -0.0292 67   GLN A OE1 
499 N  NE2 . GLN A 67 ? 0.1592 0.1257 0.1091 -0.0178 0.0112  -0.0155 67   GLN A NE2 
500 N  N   . SER A 68 ? 0.1148 0.0803 0.0713 0.0041  -0.0105 -0.0141 68   SER A N   
501 C  CA  . SER A 68 ? 0.1069 0.0804 0.0862 0.0022  0.0008  0.0086  68   SER A CA  
502 C  C   . SER A 68 ? 0.0968 0.0735 0.0659 0.0005  -0.0043 -0.0066 68   SER A C   
503 O  O   . SER A 68 ? 0.1002 0.0943 0.0778 -0.0020 0.0043  -0.0013 68   SER A O   
504 C  CB  . SER A 68 ? 0.1213 0.0946 0.0948 0.0056  0.0013  0.0102  68   SER A CB  
505 O  OG  . SER A 68 ? 0.1897 0.1102 0.0967 -0.0133 -0.0201 -0.0117 68   SER A OG  
506 N  N   . HIS A 69 ? 0.0896 0.0753 0.0787 0.0104  -0.0099 -0.0037 69   HIS A N   
507 C  CA  . HIS A 69 ? 0.0896 0.0735 0.0846 0.0001  0.0030  0.0025  69   HIS A CA  
508 C  C   . HIS A 69 ? 0.0898 0.0793 0.0800 0.0028  -0.0193 -0.0039 69   HIS A C   
509 O  O   . HIS A 69 ? 0.1002 0.0878 0.0774 0.0089  -0.0100 -0.0130 69   HIS A O   
510 C  CB  . HIS A 69 ? 0.0985 0.0758 0.0956 0.0008  -0.0046 -0.0050 69   HIS A CB  
511 C  CG  . HIS A 69 ? 0.1151 0.0667 0.1431 -0.0005 -0.0006 -0.0023 69   HIS A CG  
512 N  ND1 . HIS A 69 ? 0.1290 0.0905 0.1201 -0.0105 -0.0025 -0.0097 69   HIS A ND1 
513 C  CD2 . HIS A 69 ? 0.1511 0.1141 0.0926 -0.0084 -0.0150 0.0047  69   HIS A CD2 
514 C  CE1 . HIS A 69 ? 0.1391 0.1017 0.1035 -0.0209 0.0227  -0.0177 69   HIS A CE1 
515 N  NE2 . HIS A 69 ? 0.1141 0.0974 0.1633 -0.0100 -0.0099 -0.0187 69   HIS A NE2 
516 N  N   . VAL A 70 ? 0.0877 0.0604 0.0746 0.0112  -0.0044 0.0028  70   VAL A N   
517 C  CA  . VAL A 70 ? 0.0953 0.0760 0.0632 0.0099  -0.0256 -0.0007 70   VAL A CA  
518 C  C   . VAL A 70 ? 0.0840 0.0810 0.0686 0.0112  -0.0006 0.0004  70   VAL A C   
519 O  O   . VAL A 70 ? 0.0922 0.0835 0.0851 0.0098  -0.0028 0.0014  70   VAL A O   
520 C  CB  . VAL A 70 ? 0.0927 0.0871 0.0657 0.0047  0.0026  -0.0083 70   VAL A CB  
521 C  CG1 . VAL A 70 ? 0.0876 0.0929 0.0959 0.0121  0.0017  -0.0166 70   VAL A CG1 
522 C  CG2 . VAL A 70 ? 0.0978 0.0987 0.0815 0.0139  0.0104  -0.0111 70   VAL A CG2 
523 N  N   . ARG A 71 ? 0.0886 0.0833 0.0894 0.0042  -0.0152 -0.0122 71   ARG A N   
524 C  CA  . ARG A 71 ? 0.1075 0.0815 0.0852 -0.0004 0.0001  0.0005  71   ARG A CA  
525 C  C   . ARG A 71 ? 0.0941 0.0846 0.0831 -0.0092 -0.0078 0.0095  71   ARG A C   
526 O  O   . ARG A 71 ? 0.1007 0.0993 0.0922 -0.0004 0.0011  -0.0041 71   ARG A O   
527 C  CB  . ARG A 71 ? 0.1122 0.0965 0.1079 -0.0116 0.0130  -0.0065 71   ARG A CB  
528 C  CG  . ARG A 71 ? 0.1425 0.1294 0.1023 0.0082  -0.0068 -0.0026 71   ARG A CG  
529 C  CD  . ARG A 71 ? 0.1271 0.1129 0.1346 0.0004  0.0042  -0.0165 71   ARG A CD  
530 N  NE  . ARG A 71 ? 0.1394 0.1086 0.1296 -0.0073 0.0108  -0.0127 71   ARG A NE  
531 C  CZ  . ARG A 71 ? 0.1449 0.1033 0.1547 -0.0034 0.0011  -0.0242 71   ARG A CZ  
532 N  NH1 . ARG A 71 ? 0.1380 0.0960 0.2053 -0.0039 0.0273  -0.0045 71   ARG A NH1 
533 N  NH2 . ARG A 71 ? 0.1357 0.1279 0.1902 0.0150  0.0155  -0.0346 71   ARG A NH2 
534 N  N   . GLU A 72 ? 0.0955 0.0963 0.0748 0.0007  -0.0051 -0.0036 72   GLU A N   
535 C  CA  . GLU A 72 ? 0.1066 0.1050 0.0638 -0.0069 0.0149  -0.0014 72   GLU A CA  
536 C  C   . GLU A 72 ? 0.0868 0.0926 0.0714 0.0067  -0.0163 -0.0095 72   GLU A C   
537 O  O   . GLU A 72 ? 0.0943 0.1014 0.0957 0.0047  0.0072  0.0065  72   GLU A O   
538 C  CB  . GLU A 72 ? 0.1342 0.1022 0.0834 0.0244  -0.0146 0.0054  72   GLU A CB  
539 C  CG  . GLU A 72 ? 0.1529 0.1355 0.1071 0.0121  -0.0128 -0.0307 72   GLU A CG  
540 C  CD  . GLU A 72 ? 0.1395 0.1773 0.1221 0.0179  0.0177  -0.0016 72   GLU A CD  
541 O  OE1 . GLU A 72 ? 0.1517 0.1839 0.1126 -0.0033 0.0057  0.0116  72   GLU A OE1 
542 O  OE2 . GLU A 72 ? 0.2094 0.2104 0.1644 0.0395  0.0461  0.0106  72   GLU A OE2 
543 N  N   . LEU A 73 ? 0.0802 0.0820 0.0734 0.0021  -0.0032 0.0104  73   LEU A N   
544 C  CA  . LEU A 73 ? 0.0978 0.0759 0.0850 -0.0030 0.0049  -0.0092 73   LEU A CA  
545 C  C   . LEU A 73 ? 0.0908 0.0878 0.0649 0.0060  0.0059  0.0009  73   LEU A C   
546 O  O   . LEU A 73 ? 0.0881 0.0967 0.0891 0.0124  -0.0103 0.0026  73   LEU A O   
547 C  CB  . LEU A 73 ? 0.1032 0.1140 0.0795 -0.0058 -0.0030 -0.0064 73   LEU A CB  
548 C  CG  . LEU A 73 ? 0.1187 0.1337 0.0999 -0.0081 0.0095  0.0065  73   LEU A CG  
549 C  CD1 . LEU A 73 ? 0.1606 0.1706 0.1090 -0.0477 0.0076  0.0133  73   LEU A CD1 
550 C  CD2 . LEU A 73 ? 0.1013 0.1595 0.1050 -0.0113 0.0063  0.0130  73   LEU A CD2 
551 N  N   . LEU A 74 ? 0.0903 0.0815 0.0781 0.0075  -0.0044 0.0055  74   LEU A N   
552 C  CA  . LEU A 74 ? 0.0835 0.0888 0.0696 -0.0043 -0.0081 0.0012  74   LEU A CA  
553 C  C   . LEU A 74 ? 0.0826 0.0887 0.0824 0.0091  -0.0058 -0.0031 74   LEU A C   
554 O  O   . LEU A 74 ? 0.1016 0.0991 0.0845 0.0123  -0.0045 -0.0044 74   LEU A O   
555 C  CB  . LEU A 74 ? 0.1016 0.1130 0.0723 -0.0080 -0.0049 0.0079  74   LEU A CB  
556 C  CG  . LEU A 74 ? 0.0983 0.0990 0.0844 0.0025  0.0044  -0.0064 74   LEU A CG  
557 C  CD1 . LEU A 74 ? 0.0963 0.1679 0.0898 -0.0146 -0.0017 0.0009  74   LEU A CD1 
558 C  CD2 . LEU A 74 ? 0.1257 0.1384 0.1139 -0.0019 0.0049  -0.0234 74   LEU A CD2 
559 N  N   . ALA A 75 ? 0.0912 0.0919 0.0773 -0.0036 0.0043  0.0051  75   ALA A N   
560 C  CA  . ALA A 75 ? 0.0924 0.1058 0.0887 -0.0121 0.0055  0.0071  75   ALA A CA  
561 C  C   . ALA A 75 ? 0.0799 0.1063 0.0865 -0.0129 -0.0026 -0.0169 75   ALA A C   
562 O  O   . ALA A 75 ? 0.0846 0.1252 0.1123 -0.0086 0.0134  0.0083  75   ALA A O   
563 C  CB  . ALA A 75 ? 0.1012 0.1142 0.0980 0.0031  0.0094  0.0060  75   ALA A CB  
564 N  N   . GLN A 76 ? 0.0948 0.0912 0.0947 -0.0165 0.0131  -0.0008 76   GLN A N   
565 C  CA  . GLN A 76 ? 0.0995 0.1027 0.0875 0.0040  0.0063  -0.0049 76   GLN A CA  
566 C  C   . GLN A 76 ? 0.0905 0.0949 0.1141 0.0148  -0.0055 -0.0068 76   GLN A C   
567 O  O   . GLN A 76 ? 0.1351 0.1479 0.1362 0.0364  -0.0162 -0.0255 76   GLN A O   
568 C  CB  . GLN A 76 ? 0.1061 0.1060 0.1018 0.0120  0.0072  -0.0019 76   GLN A CB  
569 C  CG  . GLN A 76 ? 0.1078 0.1012 0.1363 0.0031  0.0031  0.0001  76   GLN A CG  
570 C  CD  . GLN A 76 ? 0.1057 0.1112 0.1322 -0.0059 0.0138  -0.0126 76   GLN A CD  
571 O  OE1 . GLN A 76 ? 0.1605 0.1416 0.1432 0.0090  0.0226  -0.0200 76   GLN A OE1 
572 N  NE2 . GLN A 76 ? 0.1019 0.1380 0.1262 -0.0041 -0.0021 0.0041  76   GLN A NE2 
573 N  N   . TYR A 77 ? 0.1035 0.0969 0.0902 -0.0015 0.0016  -0.0071 77   TYR A N   
574 C  CA  . TYR A 77 ? 0.0897 0.1051 0.0963 -0.0040 -0.0044 -0.0078 77   TYR A CA  
575 C  C   . TYR A 77 ? 0.1042 0.1172 0.0934 -0.0008 -0.0021 0.0103  77   TYR A C   
576 O  O   . TYR A 77 ? 0.0829 0.1281 0.1135 -0.0081 -0.0069 -0.0119 77   TYR A O   
577 C  CB  . TYR A 77 ? 0.0910 0.1061 0.0795 0.0032  -0.0127 0.0060  77   TYR A CB  
578 C  CG  . TYR A 77 ? 0.1106 0.1077 0.0821 0.0010  0.0140  0.0085  77   TYR A CG  
579 C  CD1 . TYR A 77 ? 0.1327 0.0958 0.1149 -0.0048 -0.0256 0.0063  77   TYR A CD1 
580 C  CD2 . TYR A 77 ? 0.1156 0.0790 0.1061 -0.0029 -0.0062 0.0201  77   TYR A CD2 
581 C  CE1 . TYR A 77 ? 0.1459 0.1003 0.1190 -0.0017 -0.0143 0.0189  77   TYR A CE1 
582 C  CE2 . TYR A 77 ? 0.1148 0.1144 0.1080 0.0012  -0.0040 0.0145  77   TYR A CE2 
583 C  CZ  . TYR A 77 ? 0.1206 0.1075 0.0746 -0.0135 0.0147  0.0009  77   TYR A CZ  
584 O  OH  . TYR A 77 ? 0.1433 0.1246 0.0934 -0.0442 0.0039  -0.0096 77   TYR A OH  
585 N  N   . LYS A 78 ? 0.1075 0.1154 0.0967 -0.0054 -0.0049 -0.0056 78   LYS A N   
586 C  CA  . LYS A 78 ? 0.0932 0.0958 0.1241 -0.0065 -0.0029 0.0101  78   LYS A CA  
587 C  C   . LYS A 78 ? 0.1076 0.1361 0.1232 0.0027  0.0161  0.0002  78   LYS A C   
588 O  O   . LYS A 78 ? 0.0998 0.1504 0.1584 -0.0030 0.0174  -0.0251 78   LYS A O   
589 C  CB  . LYS A 78 ? 0.1108 0.1289 0.1256 -0.0159 0.0062  -0.0005 78   LYS A CB  
590 C  CG  . LYS A 78 ? 0.1185 0.1596 0.1516 -0.0150 0.0047  0.0121  78   LYS A CG  
591 C  CD  . LYS A 78 ? 0.1656 0.1664 0.1465 -0.0416 0.0190  0.0163  78   LYS A CD  
592 C  CE  . LYS A 78 ? 0.1889 0.1993 0.2033 -0.0346 0.0256  0.0420  78   LYS A CE  
593 N  NZ  . LYS A 78 ? 0.1862 0.2177 0.2097 -0.0213 0.0329  0.0446  78   LYS A NZ  
594 N  N   . ILE A 79 ? 0.0775 0.1275 0.1400 -0.0002 0.0170  -0.0183 79   ILE A N   
595 C  CA  . ILE A 79 ? 0.0984 0.1416 0.1446 0.0062  0.0085  -0.0183 79   ILE A CA  
596 C  C   . ILE A 79 ? 0.0872 0.1536 0.1563 -0.0076 0.0103  -0.0132 79   ILE A C   
597 O  O   . ILE A 79 ? 0.0798 0.2026 0.2091 0.0069  0.0085  -0.0001 79   ILE A O   
598 C  CB  . ILE A 79 ? 0.1006 0.1690 0.1686 0.0114  0.0022  0.0016  79   ILE A CB  
599 C  CG1 . ILE A 79 ? 0.1017 0.1872 0.1541 0.0061  -0.0135 0.0014  79   ILE A CG1 
600 C  CG2 . ILE A 79 ? 0.1391 0.1746 0.1745 0.0072  0.0063  0.0145  79   ILE A CG2 
601 C  CD1 . ILE A 79 ? 0.0975 0.1934 0.1730 0.0189  -0.0166 0.0080  79   ILE A CD1 
602 N  N   . GLY A 80 ? 0.0890 0.1472 0.1571 -0.0150 0.0170  0.0011  80   GLY A N   
603 C  CA  . GLY A 80 ? 0.0966 0.1601 0.1809 -0.0050 0.0260  -0.0046 80   GLY A CA  
604 C  C   . GLY A 80 ? 0.1049 0.1592 0.1547 -0.0061 0.0266  0.0000  80   GLY A C   
605 O  O   . GLY A 80 ? 0.0812 0.1638 0.1530 -0.0046 0.0224  -0.0031 80   GLY A O   
606 N  N   . GLU A 81 ? 0.0916 0.1514 0.2161 -0.0159 0.0264  -0.0195 81   GLU A N   
607 C  CA  . GLU A 81 ? 0.1008 0.1667 0.2215 -0.0149 0.0239  -0.0105 81   GLU A CA  
608 C  C   . GLU A 81 ? 0.1046 0.1638 0.2220 -0.0273 0.0266  -0.0057 81   GLU A C   
609 O  O   . GLU A 81 ? 0.1085 0.1975 0.2294 -0.0178 0.0030  -0.0335 81   GLU A O   
610 C  CB  . GLU A 81 ? 0.1662 0.1722 0.2303 -0.0006 0.0102  0.0021  81   GLU A CB  
611 C  CG  . GLU A 81 ? 0.1253 0.2358 0.2478 -0.0148 -0.0026 0.0209  81   GLU A CG  
612 C  CD  . GLU A 81 ? 0.2348 0.2391 0.3015 0.0000  -0.0085 0.0394  81   GLU A CD  
613 O  OE1 . GLU A 81 ? 0.3064 0.2824 0.3742 -0.0363 0.0156  0.0852  81   GLU A OE1 
614 O  OE2 . GLU A 81 ? 0.3198 0.3104 0.2852 -0.0496 0.0319  0.0400  81   GLU A OE2 
615 N  N   . LEU A 82 ? 0.1277 0.1729 0.2635 -0.0209 0.0216  -0.0247 82   LEU A N   
616 C  CA  . LEU A 82 ? 0.1702 0.2193 0.2820 -0.0062 0.0174  -0.0266 82   LEU A CA  
617 C  C   . LEU A 82 ? 0.2675 0.2421 0.3213 -0.0201 0.0117  -0.0190 82   LEU A C   
618 O  O   . LEU A 82 ? 0.3041 0.2422 0.3358 -0.0370 0.0611  0.0252  82   LEU A O   
619 C  CB  . LEU A 82 ? 0.1995 0.2063 0.2942 -0.0361 0.0270  -0.0226 82   LEU A CB  
620 C  CG  . LEU A 82 ? 0.1933 0.2022 0.2832 -0.0313 0.0305  -0.0303 82   LEU A CG  
621 C  CD1 . LEU A 82 ? 0.2487 0.2365 0.2912 -0.0008 0.0452  -0.0021 82   LEU A CD1 
622 C  CD2 . LEU A 82 ? 0.2581 0.2484 0.3179 -0.0339 0.0165  -0.0008 82   LEU A CD2 
623 O  OXT . LEU A 82 ? 0.2954 0.3809 0.4263 -0.0145 0.0221  -0.0440 82   LEU A OXT 
624 S  S   . SO4 B .  ? 0.2245 0.1925 0.1848 0.0351  -0.0192 0.0012  83   SO4 A S   
625 O  O1  . SO4 B .  ? 0.1734 0.3951 0.1766 0.0755  0.0141  -0.0857 83   SO4 A O1  
626 O  O2  . SO4 B .  ? 0.2456 0.2808 0.2691 0.0897  -0.0664 -0.0190 83   SO4 A O2  
627 O  O3  . SO4 B .  ? 0.3310 0.2489 0.3104 -0.0014 0.0378  0.0053  83   SO4 A O3  
628 O  O4  . SO4 B .  ? 0.2440 0.3057 0.2411 0.0456  -0.0461 0.0144  83   SO4 A O4  
629 C  CHA . HEM C .  ? 0.0886 0.1241 0.1096 -0.0021 -0.0166 -0.0041 502  HEM A CHA 
630 C  CHB . HEM C .  ? 0.1139 0.0730 0.0981 0.0096  -0.0004 0.0020  502  HEM A CHB 
631 C  CHC . HEM C .  ? 0.0596 0.0790 0.0895 -0.0063 -0.0149 0.0060  502  HEM A CHC 
632 C  CHD . HEM C .  ? 0.1023 0.0958 0.0916 0.0087  0.0068  -0.0076 502  HEM A CHD 
633 C  C1A . HEM C .  ? 0.0868 0.0988 0.0942 -0.0066 -0.0134 0.0033  502  HEM A C1A 
634 C  C2A . HEM C .  ? 0.0987 0.1074 0.0921 -0.0118 -0.0201 0.0020  502  HEM A C2A 
635 C  C3A . HEM C .  ? 0.1112 0.0855 0.0986 0.0015  -0.0012 0.0052  502  HEM A C3A 
636 C  C4A . HEM C .  ? 0.1192 0.0758 0.0802 0.0083  0.0032  0.0150  502  HEM A C4A 
637 C  CMA . HEM C .  ? 0.1228 0.1116 0.1077 0.0184  -0.0138 0.0000  502  HEM A CMA 
638 C  CAA . HEM C .  ? 0.1258 0.1373 0.0865 -0.0125 -0.0050 0.0178  502  HEM A CAA 
639 C  CBA . HEM C .  ? 0.1225 0.1563 0.1000 -0.0155 -0.0027 0.0056  502  HEM A CBA 
640 C  CGA . HEM C .  ? 0.1060 0.1800 0.1209 -0.0354 -0.0077 0.0206  502  HEM A CGA 
641 O  O1A . HEM C .  ? 0.1625 0.3959 0.1540 -0.0777 -0.0293 0.0290  502  HEM A O1A 
642 O  O2A . HEM C .  ? 0.1348 0.1382 0.1167 -0.0194 -0.0020 -0.0104 502  HEM A O2A 
643 C  C1B . HEM C .  ? 0.0708 0.0849 0.0928 -0.0055 0.0072  -0.0024 502  HEM A C1B 
644 C  C2B . HEM C .  ? 0.0870 0.0758 0.0901 0.0072  0.0096  0.0014  502  HEM A C2B 
645 C  C3B . HEM C .  ? 0.0741 0.0775 0.1075 -0.0088 0.0059  0.0105  502  HEM A C3B 
646 C  C4B . HEM C .  ? 0.0719 0.0801 0.0919 0.0034  -0.0003 0.0033  502  HEM A C4B 
647 C  CMB . HEM C .  ? 0.1051 0.1098 0.1461 0.0114  0.0115  0.0003  502  HEM A CMB 
648 C  CAB . HEM C .  ? 0.1093 0.0752 0.1335 -0.0031 0.0102  0.0082  502  HEM A CAB 
649 C  CBB . HEM C .  ? 0.1101 0.1418 0.1240 -0.0068 -0.0196 -0.0124 502  HEM A CBB 
650 C  C1C . HEM C .  ? 0.0897 0.0732 0.0975 -0.0039 -0.0054 0.0100  502  HEM A C1C 
651 C  C2C . HEM C .  ? 0.1019 0.0636 0.0926 0.0033  -0.0022 0.0164  502  HEM A C2C 
652 C  C3C . HEM C .  ? 0.1098 0.0742 0.0766 0.0057  -0.0036 -0.0073 502  HEM A C3C 
653 C  C4C . HEM C .  ? 0.1030 0.0932 0.0688 0.0057  0.0128  0.0189  502  HEM A C4C 
654 C  CMC . HEM C .  ? 0.1416 0.0631 0.0990 0.0014  0.0013  -0.0030 502  HEM A CMC 
655 C  CAC . HEM C .  ? 0.1130 0.1217 0.1125 0.0154  -0.0103 0.0054  502  HEM A CAC 
656 C  CBC . HEM C .  ? 0.1510 0.1122 0.1220 0.0296  -0.0050 -0.0223 502  HEM A CBC 
657 C  C1D . HEM C .  ? 0.0882 0.1145 0.1098 0.0173  0.0249  0.0156  502  HEM A C1D 
658 C  C2D . HEM C .  ? 0.0991 0.1509 0.1085 0.0055  0.0216  0.0000  502  HEM A C2D 
659 C  C3D . HEM C .  ? 0.0820 0.1442 0.1410 -0.0104 -0.0086 -0.0061 502  HEM A C3D 
660 C  C4D . HEM C .  ? 0.0969 0.1093 0.0920 0.0120  -0.0007 0.0073  502  HEM A C4D 
661 C  CMD . HEM C .  ? 0.1175 0.1744 0.1843 0.0204  0.0294  -0.0007 502  HEM A CMD 
662 C  CAD . HEM C .  ? 0.1136 0.1955 0.1905 0.0052  -0.0199 -0.0344 502  HEM A CAD 
663 C  CBD . HEM C .  ? 0.1693 0.2319 0.2888 -0.0215 0.0181  0.0028  502  HEM A CBD 
664 C  CGD . HEM C .  ? 0.2774 0.4049 0.3735 -0.0521 -0.0252 0.0138  502  HEM A CGD 
665 O  O1D . HEM C .  ? 0.3399 0.4780 0.4553 -0.0901 -0.0112 -0.0198 502  HEM A O1D 
666 O  O2D . HEM C .  ? 0.3826 0.5291 0.4882 -0.0806 0.0277  0.0091  502  HEM A O2D 
667 N  NA  . HEM C .  ? 0.0915 0.0891 0.0933 0.0015  -0.0153 0.0150  502  HEM A NA  
668 N  NB  . HEM C .  ? 0.1091 0.0676 0.0811 -0.0008 -0.0174 0.0064  502  HEM A NB  
669 N  NC  . HEM C .  ? 0.0847 0.0693 0.0848 0.0065  0.0037  0.0023  502  HEM A NC  
670 N  ND  . HEM C .  ? 0.0998 0.0917 0.0926 0.0006  -0.0250 0.0006  502  HEM A ND  
671 FE FE  . HEM C .  ? 0.0895 0.0850 0.0878 0.0000  0.0011  0.0004  502  HEM A FE  
672 C  C1  . GOL D .  ? 0.1738 0.1348 0.1517 -0.0160 -0.0102 0.0039  9601 GOL A C1  
673 O  O1  . GOL D .  ? 0.1882 0.1458 0.1435 -0.0098 0.0043  0.0002  9601 GOL A O1  
674 C  C2  . GOL D .  ? 0.1698 0.1050 0.1534 0.0090  0.0124  -0.0106 9601 GOL A C2  
675 O  O2  . GOL D .  ? 0.2360 0.1299 0.1922 0.0337  0.0430  0.0177  9601 GOL A O2  
676 C  C3  . GOL D .  ? 0.1397 0.1390 0.1407 0.0058  -0.0352 -0.0093 9601 GOL A C3  
677 O  O3  . GOL D .  ? 0.2005 0.1210 0.1553 -0.0032 -0.0061 -0.0059 9601 GOL A O3  
678 O  O   . HOH E .  ? 0.1126 0.1349 0.1454 -0.0034 -0.0165 0.0041  503  HOH A O   
679 O  O   . HOH E .  ? 0.1378 0.1280 0.1154 -0.0062 0.0051  0.0037  504  HOH A O   
680 O  O   . HOH E .  ? 0.1420 0.1227 0.1387 0.0110  0.0011  0.0045  505  HOH A O   
681 O  O   . HOH E .  ? 0.1314 0.1358 0.1193 0.0124  0.0026  -0.0029 506  HOH A O   
682 O  O   . HOH E .  ? 0.1436 0.1949 0.1601 -0.0252 0.0118  -0.0502 507  HOH A O   
683 O  O   . HOH E .  ? 0.1294 0.1810 0.1500 -0.0211 0.0230  0.0131  508  HOH A O   
684 O  O   . HOH E .  ? 0.1699 0.1742 0.1408 -0.0212 -0.0078 0.0188  509  HOH A O   
685 O  O   . HOH E .  ? 0.1350 0.1758 0.1602 0.0062  -0.0307 0.0130  510  HOH A O   
686 O  O   . HOH E .  ? 0.2194 0.1625 0.1842 -0.0338 -0.0376 0.0245  511  HOH A O   
687 O  O   . HOH E .  ? 0.1648 0.1750 0.2387 -0.0285 0.0117  -0.0249 512  HOH A O   
688 O  O   . HOH E .  ? 0.1798 0.1921 0.1537 -0.0023 0.0033  0.0292  513  HOH A O   
689 O  O   . HOH E .  ? 0.2074 0.2275 0.2225 -0.0376 0.0053  -0.0048 514  HOH A O   
690 O  O   . HOH E .  ? 0.1979 0.1797 0.2234 -0.0483 0.0190  -0.0401 515  HOH A O   
691 O  O   . HOH E .  ? 0.1906 0.1952 0.2701 0.0343  0.0385  0.0611  516  HOH A O   
692 O  O   . HOH E .  ? 0.1832 0.3094 0.2543 -0.0242 -0.0193 0.1293  517  HOH A O   
693 O  O   . HOH E .  ? 0.2137 0.2277 0.2623 -0.0338 -0.0372 -0.0101 518  HOH A O   
694 O  O   . HOH E .  ? 0.1916 0.2217 0.2158 0.0265  0.0102  -0.0089 519  HOH A O   
695 O  O   . HOH E .  ? 0.1809 0.2543 0.2658 -0.0072 0.0166  -0.0069 520  HOH A O   
696 O  O   . HOH E .  ? 0.2077 0.2339 0.2599 0.0062  0.0009  0.0157  521  HOH A O   
697 O  O   . HOH E .  ? 0.2385 0.2050 0.1579 -0.0103 0.0053  -0.0279 523  HOH A O   
698 O  O   . HOH E .  ? 0.2395 0.2526 0.2713 -0.0534 -0.0389 -0.0731 524  HOH A O   
699 O  O   . HOH E .  ? 0.2727 0.3972 0.2044 -0.0201 -0.0311 0.0200  525  HOH A O   
700 O  O   . HOH E .  ? 0.1945 0.3629 0.1892 0.0662  -0.0249 -0.0698 526  HOH A O   
701 O  O   . HOH E .  ? 0.3448 0.1770 0.3052 -0.0823 -0.0156 0.0358  527  HOH A O   
702 O  O   . HOH E .  ? 0.3349 0.2727 0.3388 -0.0217 0.0637  -0.0192 528  HOH A O   
703 O  O   . HOH E .  ? 0.2103 0.3330 0.2262 -0.0342 -0.0480 -0.0093 529  HOH A O   
704 O  O   . HOH E .  ? 0.2754 0.1674 0.1414 0.0078  0.0066  0.0135  530  HOH A O   
705 O  O   . HOH E .  ? 0.2309 0.2021 0.1915 0.0116  -0.0289 -0.0007 531  HOH A O   
706 O  O   . HOH E .  ? 0.1863 0.1853 0.2687 -0.0236 0.0152  0.0085  532  HOH A O   
707 O  O   . HOH E .  ? 0.2954 0.1706 0.2979 0.0065  -0.0312 -0.0077 533  HOH A O   
708 O  O   . HOH E .  ? 0.2291 0.2629 0.2259 -0.0415 -0.0067 0.0160  534  HOH A O   
709 O  O   . HOH E .  ? 0.2212 0.2608 0.1931 -0.0229 0.0428  -0.0134 535  HOH A O   
710 O  O   . HOH E .  ? 0.2485 0.2601 0.2747 0.0163  -0.0419 -0.1011 536  HOH A O   
711 O  O   . HOH E .  ? 0.2501 0.2243 0.3141 -0.0454 0.0095  -0.0049 537  HOH A O   
712 O  O   . HOH E .  ? 0.3270 0.2982 0.2971 -0.0057 0.0746  0.0350  538  HOH A O   
713 O  O   . HOH E .  ? 0.3248 0.2090 0.2676 -0.0121 0.0134  -0.0536 539  HOH A O   
714 O  O   . HOH E .  ? 0.3681 0.3985 0.2174 0.0804  0.0703  0.0485  540  HOH A O   
715 O  O   . HOH E .  ? 0.2321 0.3148 0.2718 -0.0313 -0.0350 0.0382  541  HOH A O   
716 O  O   . HOH E .  ? 0.3340 0.2762 0.3456 -0.0359 0.0470  -0.0067 542  HOH A O   
717 O  O   . HOH E .  ? 0.2770 0.4548 0.2782 0.0157  0.0598  -0.0048 543  HOH A O   
718 O  O   . HOH E .  ? 0.3546 0.3791 0.1987 -0.0475 0.0043  -0.0361 544  HOH A O   
719 O  O   . HOH E .  ? 0.3192 0.5139 0.2456 -0.0507 0.0757  0.0786  545  HOH A O   
720 O  O   . HOH E .  ? 0.2517 0.4574 0.2896 -0.0851 0.0107  -0.0548 546  HOH A O   
721 O  O   . HOH E .  ? 0.3725 0.3164 0.3044 -0.0273 -0.0070 -0.0359 547  HOH A O   
722 O  O   . HOH E .  ? 0.3741 0.2751 0.2951 0.0143  0.0290  -0.0468 548  HOH A O   
723 O  O   . HOH E .  ? 0.3911 0.3410 0.3949 -0.0103 0.0353  0.0089  549  HOH A O   
724 O  O   . HOH E .  ? 0.4037 0.5130 0.4145 0.0145  0.0231  -0.0123 550  HOH A O   
725 O  O   . HOH E .  ? 0.4401 0.4830 0.2116 0.0259  -0.0655 0.0246  551  HOH A O   
726 O  O   . HOH E .  ? 0.2555 0.4452 0.4068 0.0579  0.0497  0.0573  552  HOH A O   
727 O  O   . HOH E .  ? 0.5159 0.2485 0.4246 -0.0575 -0.0517 0.0035  553  HOH A O   
728 O  O   . HOH E .  ? 0.3780 0.2640 0.2887 -0.0932 -0.0486 0.0124  554  HOH A O   
729 O  O   . HOH E .  ? 0.3696 0.3532 0.3301 0.0705  -0.0017 -0.0338 555  HOH A O   
730 O  O   . HOH E .  ? 0.3575 0.3685 0.4502 -0.0142 -0.0057 0.0026  556  HOH A O   
731 O  O   . HOH E .  ? 0.4318 0.3920 0.2919 -0.0472 -0.0207 -0.0138 558  HOH A O   
732 O  O   . HOH E .  ? 0.4642 0.4136 0.2883 -0.0228 -0.0366 -0.0627 559  HOH A O   
733 O  O   . HOH E .  ? 0.2564 0.3043 0.3580 0.0776  -0.0195 0.0380  560  HOH A O   
734 O  O   . HOH E .  ? 0.2996 0.2876 0.3175 -0.0355 0.0375  -0.0710 561  HOH A O   
735 O  O   . HOH E .  ? 0.2737 0.3651 0.3656 -0.0021 0.0251  -0.0310 562  HOH A O   
736 O  O   . HOH E .  ? 0.2543 0.3603 0.3918 -0.0283 0.0019  0.0007  563  HOH A O   
737 O  O   . HOH E .  ? 0.2712 0.4345 0.3848 0.0194  0.0466  -0.0011 564  HOH A O   
738 O  O   . HOH E .  ? 0.2815 0.4123 0.2953 -0.0048 0.0325  -0.0469 565  HOH A O   
739 O  O   . HOH E .  ? 0.3275 0.3323 0.4068 -0.0234 0.0351  0.0056  566  HOH A O   
740 O  O   . HOH E .  ? 0.4625 0.4662 0.4170 -0.0027 -0.0065 -0.0861 567  HOH A O   
741 O  O   . HOH E .  ? 0.3736 0.4499 0.3082 0.0081  0.0456  0.0042  568  HOH A O   
742 O  O   . HOH E .  ? 0.5576 0.4795 0.5332 -0.0128 -0.0107 -0.0052 569  HOH A O   
743 O  O   . HOH E .  ? 0.4253 0.4487 0.4315 0.0765  -0.0025 -0.0134 570  HOH A O   
744 O  O   . HOH E .  ? 0.4080 0.3888 0.3992 0.0460  -0.0357 0.0449  571  HOH A O   
745 O  O   . HOH E .  ? 0.4931 0.4262 0.3941 0.0347  -0.0369 -0.0627 572  HOH A O   
746 O  O   . HOH E .  ? 0.3911 0.3087 0.3828 -0.0620 0.0678  -0.0798 573  HOH A O   
747 O  O   . HOH E .  ? 0.5004 0.3902 0.5643 -0.0264 0.0139  -0.0083 574  HOH A O   
748 O  O   . HOH E .  ? 0.3587 0.3233 0.5364 0.0044  -0.0460 0.0130  575  HOH A O   
749 O  O   . HOH E .  ? 0.4505 0.5243 0.5353 -0.0199 0.0247  0.0040  576  HOH A O   
750 O  O   . HOH E .  ? 0.4850 0.2763 0.5424 -0.0063 -0.0424 0.0128  577  HOH A O   
751 O  O   . HOH E .  ? 0.3798 0.4067 0.4871 -0.0174 0.0049  0.0649  578  HOH A O   
752 O  O   . HOH E .  ? 0.4831 0.5089 0.4066 -0.0083 -0.0283 0.0099  579  HOH A O   
753 O  O   . HOH E .  ? 0.5115 0.4431 0.4140 -0.0908 -0.0878 -0.0468 580  HOH A O   
754 O  O   . HOH E .  ? 0.3595 0.4788 0.3624 -0.0064 0.0050  0.0039  581  HOH A O   
755 O  O   . HOH E .  ? 0.5068 0.5681 0.4910 0.0023  0.0119  -0.0016 582  HOH A O   
756 O  O   . HOH E .  ? 0.2943 0.3680 0.4980 -0.0217 -0.0230 -0.0333 583  HOH A O   
757 O  O   . HOH E .  ? 0.5096 0.4228 0.5384 0.0204  -0.0313 -0.0432 584  HOH A O   
758 O  O   . HOH E .  ? 0.3993 0.4452 0.3348 -0.0702 0.0071  -0.0679 585  HOH A O   
759 O  O   . HOH E .  ? 0.3842 0.5388 0.4600 -0.0163 0.0255  0.0186  586  HOH A O   
760 O  O   . HOH E .  ? 0.5246 0.4880 0.5280 -0.0212 -0.0418 0.0291  587  HOH A O   
761 O  O   . HOH E .  ? 0.3921 0.5420 0.3421 0.0205  0.0454  0.0168  588  HOH A O   
762 O  O   . HOH E .  ? 0.4519 0.4882 0.3696 0.0211  0.0280  -0.0563 589  HOH A O   
763 O  O   . HOH E .  ? 0.5603 0.5543 0.5571 0.0329  0.0116  -0.0123 590  HOH A O   
764 O  O   . HOH E .  ? 0.3975 0.4871 0.5010 -0.0124 -0.0546 0.0097  591  HOH A O   
765 O  O   . HOH E .  ? 0.5370 0.5958 0.5890 -0.0162 -0.0053 0.0056  592  HOH A O   
766 O  O   . HOH E .  ? 0.4550 0.4261 0.3695 -0.0168 0.0092  0.0751  593  HOH A O   
767 O  O   . HOH E .  ? 0.4316 0.4431 0.4588 0.0037  0.0490  -0.0065 594  HOH A O   
768 O  O   . HOH E .  ? 0.4484 0.5354 0.4252 0.0792  0.0486  -0.0299 595  HOH A O   
769 O  O   . HOH E .  ? 0.6544 0.7105 0.6624 -0.0038 -0.0069 0.0055  596  HOH A O   
770 O  O   . HOH E .  ? 0.5328 0.5476 0.5375 0.0124  0.0206  0.0336  597  HOH A O   
771 O  O   . HOH E .  ? 0.2989 0.5131 0.4200 -0.0196 0.0138  -0.0312 598  HOH A O   
772 O  O   . HOH E .  ? 0.4646 0.4202 0.4214 -0.0258 -0.0139 -0.0866 599  HOH A O   
773 O  O   . HOH E .  ? 0.5643 0.6166 0.6035 -0.0069 -0.0027 0.0010  600  HOH A O   
774 O  O   . HOH E .  ? 0.5281 0.6099 0.5539 -0.0056 0.0082  -0.0220 601  HOH A O   
775 O  O   . HOH E .  ? 0.3495 0.4839 0.4121 0.0781  0.0254  -0.0475 602  HOH A O   
776 O  O   . HOH E .  ? 0.5651 0.5568 0.5651 -0.0225 0.0304  0.0040  603  HOH A O   
777 O  O   . HOH E .  ? 0.4917 0.5421 0.4994 0.0096  0.0130  -0.0235 604  HOH A O   
778 O  O   . HOH E .  ? 0.5602 0.5419 0.5809 -0.0109 -0.0057 -0.0299 605  HOH A O   
779 O  O   . HOH E .  ? 0.5102 0.5232 0.5395 0.0197  -0.0405 -0.0091 606  HOH A O   
780 O  O   . HOH E .  ? 0.6258 0.5872 0.6193 -0.0134 -0.0198 -0.0123 607  HOH A O   
781 O  O   . HOH E .  ? 0.6087 0.5964 0.6492 0.0017  -0.0212 -0.0121 608  HOH A O   
782 O  O   . HOH E .  ? 0.8091 0.8099 0.8009 -0.0050 0.0012  -0.0098 609  HOH A O   
783 O  O   . HOH E .  ? 0.4678 0.3812 0.4458 0.1098  0.0402  0.0259  610  HOH A O   
784 O  O   . HOH E .  ? 0.6745 0.6463 0.7024 -0.0077 -0.0072 -0.0048 611  HOH A O   
785 O  O   . HOH E .  ? 0.6264 0.6277 0.6316 0.0038  0.0204  -0.0278 612  HOH A O   
786 O  O   . HOH E .  ? 0.4907 0.4941 0.5044 0.0204  0.0143  -0.0304 613  HOH A O   
787 O  O   . HOH E .  ? 0.4997 0.5223 0.5062 0.0260  0.0039  -0.0055 614  HOH A O   
788 O  O   . HOH E .  ? 0.4900 0.4673 0.5227 -0.0295 0.0147  -0.0453 615  HOH A O   
789 O  O   . HOH E .  ? 0.5163 0.4785 0.5579 -0.0156 0.0177  -0.0049 616  HOH A O   
790 O  O   . HOH E .  ? 0.7152 0.6630 0.6950 -0.0151 -0.0058 0.0083  618  HOH A O   
791 O  O   . HOH E .  ? 0.2487 0.1689 0.2712 -0.0034 -0.0740 -0.0002 619  HOH A O   
792 O  O   . HOH E .  ? 0.5398 0.4183 0.4653 0.0401  -0.0183 -0.0130 620  HOH A O   
793 O  O   . HOH E .  ? 0.5392 0.4870 0.3957 0.0119  0.0179  -0.0038 621  HOH A O   
794 O  O   . HOH E .  ? 0.2859 0.4056 0.3958 0.0078  0.0726  -0.0118 622  HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLN 1  1  ?  ?   ?   A . n 
A 1 2  GLU 2  2  ?  ?   ?   A . n 
A 1 3  SER 3  3  3  SER SER A . n 
A 1 4  THR 4  4  4  THR THR A . n 
A 1 5  HIS 5  5  5  HIS HIS A . n 
A 1 6  ILE 6  6  6  ILE ILE A . n 
A 1 7  TYR 7  7  7  TYR TYR A . n 
A 1 8  THR 8  8  8  THR THR A . n 
A 1 9  LYS 9  9  9  LYS LYS A . n 
A 1 10 GLU 10 10 10 GLU GLU A . n 
A 1 11 GLU 11 11 11 GLU GLU A . n 
A 1 12 VAL 12 12 12 VAL VAL A . n 
A 1 13 SER 13 13 13 SER SER A . n 
A 1 14 SER 14 14 14 SER SER A . n 
A 1 15 HIS 15 15 15 HIS HIS A . n 
A 1 16 THR 16 16 16 THR THR A . n 
A 1 17 SER 17 17 17 SER SER A . n 
A 1 18 PRO 18 18 18 PRO PRO A . n 
A 1 19 GLU 19 19 19 GLU GLU A . n 
A 1 20 THR 20 20 20 THR THR A . n 
A 1 21 GLY 21 21 21 GLY GLY A . n 
A 1 22 ILE 22 22 22 ILE ILE A . n 
A 1 23 TRP 23 23 23 TRP TRP A . n 
A 1 24 VAL 24 24 24 VAL VAL A . n 
A 1 25 THR 25 25 25 THR THR A . n 
A 1 26 LEU 26 26 26 LEU LEU A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 SER 28 28 28 SER SER A . n 
A 1 29 GLU 29 29 29 GLU GLU A . n 
A 1 30 VAL 30 30 30 VAL VAL A . n 
A 1 31 PHE 31 31 31 PHE PHE A . n 
A 1 32 ASP 32 32 32 ASP ASP A . n 
A 1 33 VAL 33 33 33 VAL VAL A . n 
A 1 34 THR 34 34 34 THR THR A . n 
A 1 35 GLU 35 35 35 GLU GLU A . n 
A 1 36 PHE 36 36 36 PHE PHE A . n 
A 1 37 VAL 37 37 37 VAL VAL A . n 
A 1 38 ASP 38 38 38 ASP ASP A . n 
A 1 39 LEU 39 39 39 LEU LEU A . n 
A 1 40 HIS 40 40 40 HIS HIS A . n 
A 1 41 PRO 41 41 41 PRO PRO A . n 
A 1 42 GLY 42 42 42 GLY GLY A . n 
A 1 43 GLY 43 43 43 GLY GLY A . n 
A 1 44 PRO 44 44 44 PRO PRO A . n 
A 1 45 SER 45 45 45 SER SER A . n 
A 1 46 LYS 46 46 46 LYS LYS A . n 
A 1 47 LEU 47 47 47 LEU LEU A . n 
A 1 48 MET 48 48 48 MET MET A . n 
A 1 49 LEU 49 49 49 LEU LEU A . n 
A 1 50 ALA 50 50 50 ALA ALA A . n 
A 1 51 ALA 51 51 51 ALA ALA A . n 
A 1 52 GLY 52 52 52 GLY GLY A . n 
A 1 53 GLY 53 53 53 GLY GLY A . n 
A 1 54 PRO 54 54 54 PRO PRO A . n 
A 1 55 LEU 55 55 55 LEU LEU A . n 
A 1 56 GLU 56 56 56 GLU GLU A . n 
A 1 57 PRO 57 57 57 PRO PRO A . n 
A 1 58 PHE 58 58 58 PHE PHE A . n 
A 1 59 TRP 59 59 59 TRP TRP A . n 
A 1 60 ALA 60 60 60 ALA ALA A . n 
A 1 61 LEU 61 61 61 LEU LEU A . n 
A 1 62 TYR 62 62 62 TYR TYR A . n 
A 1 63 ALA 63 63 63 ALA ALA A . n 
A 1 64 VAL 64 64 64 VAL VAL A . n 
A 1 65 HIS 65 65 65 HIS HIS A . n 
A 1 66 ASN 66 66 66 ASN ASN A . n 
A 1 67 GLN 67 67 67 GLN GLN A . n 
A 1 68 SER 68 68 68 SER SER A . n 
A 1 69 HIS 69 69 69 HIS HIS A . n 
A 1 70 VAL 70 70 70 VAL VAL A . n 
A 1 71 ARG 71 71 71 ARG ARG A . n 
A 1 72 GLU 72 72 72 GLU GLU A . n 
A 1 73 LEU 73 73 73 LEU LEU A . n 
A 1 74 LEU 74 74 74 LEU LEU A . n 
A 1 75 ALA 75 75 75 ALA ALA A . n 
A 1 76 GLN 76 76 76 GLN GLN A . n 
A 1 77 TYR 77 77 77 TYR TYR A . n 
A 1 78 LYS 78 78 78 LYS LYS A . n 
A 1 79 ILE 79 79 79 ILE ILE A . n 
A 1 80 GLY 80 80 80 GLY GLY A . n 
A 1 81 GLU 81 81 81 GLU GLU A . n 
A 1 82 LEU 82 82 82 LEU LEU A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 40 ? A HIS 40  ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 NA  ? C HEM .  ? A HEM 502 ? 1_555 91.9  ? 
2  NE2 ? A HIS 40 ? A HIS 40  ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 NB  ? C HEM .  ? A HEM 502 ? 1_555 89.0  ? 
3  NA  ? C HEM .  ? A HEM 502 ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 NB  ? C HEM .  ? A HEM 502 ? 1_555 90.8  ? 
4  NE2 ? A HIS 40 ? A HIS 40  ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 NC  ? C HEM .  ? A HEM 502 ? 1_555 88.4  ? 
5  NA  ? C HEM .  ? A HEM 502 ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 NC  ? C HEM .  ? A HEM 502 ? 1_555 179.7 ? 
6  NB  ? C HEM .  ? A HEM 502 ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 NC  ? C HEM .  ? A HEM 502 ? 1_555 89.4  ? 
7  NE2 ? A HIS 40 ? A HIS 40  ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 ND  ? C HEM .  ? A HEM 502 ? 1_555 89.4  ? 
8  NA  ? C HEM .  ? A HEM 502 ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 ND  ? C HEM .  ? A HEM 502 ? 1_555 90.8  ? 
9  NB  ? C HEM .  ? A HEM 502 ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 ND  ? C HEM .  ? A HEM 502 ? 1_555 177.8 ? 
10 NC  ? C HEM .  ? A HEM 502 ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 ND  ? C HEM .  ? A HEM 502 ? 1_555 89.0  ? 
11 NE2 ? A HIS 40 ? A HIS 40  ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 NE2 ? A HIS 65 ? A HIS 65  ? 1_555 177.7 ? 
12 NA  ? C HEM .  ? A HEM 502 ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 NE2 ? A HIS 65 ? A HIS 65  ? 1_555 90.3  ? 
13 NB  ? C HEM .  ? A HEM 502 ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 NE2 ? A HIS 65 ? A HIS 65  ? 1_555 91.7  ? 
14 NC  ? C HEM .  ? A HEM 502 ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 NE2 ? A HIS 65 ? A HIS 65  ? 1_555 89.4  ? 
15 ND  ? C HEM .  ? A HEM 502 ? 1_555 FE ? C HEM . ? A HEM 502 ? 1_555 NE2 ? A HIS 65 ? A HIS 65  ? 1_555 89.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-09-12 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .      ? 1 
SCALEPACK 'data scaling'   .      ? 2 
AMoRE     phasing          .      ? 3 
REFMAC    refinement       5.1.24 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 619 ? ? O A HOH 622 ? ? 1.29 
2 1 O A HOH 620 ? ? O A HOH 622 ? ? 1.49 
3 1 O A HOH 514 ? ? O A HOH 620 ? ? 1.90 
4 1 O A HOH 512 ? ? O A HOH 621 ? ? 2.01 
5 1 O A HOH 619 ? ? O A HOH 621 ? ? 2.09 
6 1 O A HOH 574 ? ? O A HOH 605 ? ? 2.10 
7 1 O A HOH 586 ? ? O A HOH 601 ? ? 2.14 
8 1 O A HOH 621 ? ? O A HOH 622 ? ? 2.17 
9 1 O A HOH 603 ? ? O A HOH 616 ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CA A VAL 37 ? ? CB  A VAL 37 ? A 2.465 1.543 0.922  0.021 N 
2 1 CA A VAL 37 ? ? CB  A VAL 37 ? B 2.622 1.543 1.079  0.021 N 
3 1 CB A VAL 37 ? A CG2 A VAL 37 ? A 2.336 1.524 0.812  0.021 N 
4 1 CB A VAL 37 ? B CG2 A VAL 37 ? B 2.574 1.524 1.050  0.021 N 
5 1 N  A GLY 43 ? ? CA  A GLY 43 ? ? 1.366 1.456 -0.090 0.015 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A VAL 37 ? A CA A VAL 37 ? ? C   A VAL 37 ? ? 144.34 111.40 32.94  1.90 N 
2 1 CB A VAL 37 ? B CA A VAL 37 ? ? C   A VAL 37 ? ? 86.11  111.40 -25.29 1.90 N 
3 1 N  A VAL 37 ? ? CA A VAL 37 ? ? CB  A VAL 37 ? A 90.74  111.50 -20.76 2.20 N 
4 1 N  A VAL 37 ? ? CA A VAL 37 ? ? CB  A VAL 37 ? B 135.54 111.50 24.04  2.20 N 
5 1 CA A VAL 37 ? ? CB A VAL 37 ? A CG2 A VAL 37 ? A 62.84  110.90 -48.06 1.50 N 
6 1 CA A VAL 37 ? ? CB A VAL 37 ? B CG2 A VAL 37 ? B 59.89  110.90 -51.01 1.50 N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLU 11 ? CA  ? A GLU 11 CA  
2 1 Y 1 A GLU 11 ? CB  ? A GLU 11 CB  
3 1 Y 1 A GLU 11 ? CG  ? A GLU 11 CG  
4 1 Y 1 A GLU 11 ? CD  ? A GLU 11 CD  
5 1 Y 1 A VAL 37 ? CG1 ? A VAL 37 CG1 
6 1 Y 1 A SER 45 ? OG  ? A SER 45 OG  
7 1 Y 1 A LEU 61 ? CB  ? A LEU 61 CB  
8 1 Y 1 A LEU 61 ? CG  ? A LEU 61 CG  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLN 1 ? A GLN 1 
2 1 Y 1 A GLU 2 ? A GLU 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'                     SO4 
3 'PROTOPORPHYRIN IX CONTAINING FE' HEM 
4 GLYCEROL                          GOL 
5 water                             HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   83   1    SO4 SUL A . 
C 3 HEM 1   502  502  HEM HEM A . 
D 4 GOL 1   9601 9601 GOL GOL A . 
E 5 HOH 1   503  503  HOH HOH A . 
E 5 HOH 2   504  504  HOH HOH A . 
E 5 HOH 3   505  505  HOH HOH A . 
E 5 HOH 4   506  506  HOH HOH A . 
E 5 HOH 5   507  507  HOH HOH A . 
E 5 HOH 6   508  508  HOH HOH A . 
E 5 HOH 7   509  509  HOH HOH A . 
E 5 HOH 8   510  510  HOH HOH A . 
E 5 HOH 9   511  511  HOH HOH A . 
E 5 HOH 10  512  512  HOH HOH A . 
E 5 HOH 11  513  513  HOH HOH A . 
E 5 HOH 12  514  514  HOH HOH A . 
E 5 HOH 13  515  515  HOH HOH A . 
E 5 HOH 14  516  516  HOH HOH A . 
E 5 HOH 15  517  517  HOH HOH A . 
E 5 HOH 16  518  518  HOH HOH A . 
E 5 HOH 17  519  519  HOH HOH A . 
E 5 HOH 18  520  520  HOH HOH A . 
E 5 HOH 19  521  521  HOH HOH A . 
E 5 HOH 20  523  523  HOH HOH A . 
E 5 HOH 21  524  524  HOH HOH A . 
E 5 HOH 22  525  525  HOH HOH A . 
E 5 HOH 23  526  526  HOH HOH A . 
E 5 HOH 24  527  527  HOH HOH A . 
E 5 HOH 25  528  528  HOH HOH A . 
E 5 HOH 26  529  529  HOH HOH A . 
E 5 HOH 27  530  530  HOH HOH A . 
E 5 HOH 28  531  531  HOH HOH A . 
E 5 HOH 29  532  532  HOH HOH A . 
E 5 HOH 30  533  533  HOH HOH A . 
E 5 HOH 31  534  534  HOH HOH A . 
E 5 HOH 32  535  535  HOH HOH A . 
E 5 HOH 33  536  536  HOH HOH A . 
E 5 HOH 34  537  537  HOH HOH A . 
E 5 HOH 35  538  538  HOH HOH A . 
E 5 HOH 36  539  539  HOH HOH A . 
E 5 HOH 37  540  540  HOH HOH A . 
E 5 HOH 38  541  541  HOH HOH A . 
E 5 HOH 39  542  542  HOH HOH A . 
E 5 HOH 40  543  543  HOH HOH A . 
E 5 HOH 41  544  544  HOH HOH A . 
E 5 HOH 42  545  545  HOH HOH A . 
E 5 HOH 43  546  546  HOH HOH A . 
E 5 HOH 44  547  547  HOH HOH A . 
E 5 HOH 45  548  548  HOH HOH A . 
E 5 HOH 46  549  549  HOH HOH A . 
E 5 HOH 47  550  550  HOH HOH A . 
E 5 HOH 48  551  551  HOH HOH A . 
E 5 HOH 49  552  552  HOH HOH A . 
E 5 HOH 50  553  553  HOH HOH A . 
E 5 HOH 51  554  554  HOH HOH A . 
E 5 HOH 52  555  555  HOH HOH A . 
E 5 HOH 53  556  556  HOH HOH A . 
E 5 HOH 54  558  558  HOH HOH A . 
E 5 HOH 55  559  559  HOH HOH A . 
E 5 HOH 56  560  560  HOH HOH A . 
E 5 HOH 57  561  561  HOH HOH A . 
E 5 HOH 58  562  562  HOH HOH A . 
E 5 HOH 59  563  563  HOH HOH A . 
E 5 HOH 60  564  564  HOH HOH A . 
E 5 HOH 61  565  565  HOH HOH A . 
E 5 HOH 62  566  566  HOH HOH A . 
E 5 HOH 63  567  567  HOH HOH A . 
E 5 HOH 64  568  568  HOH HOH A . 
E 5 HOH 65  569  569  HOH HOH A . 
E 5 HOH 66  570  570  HOH HOH A . 
E 5 HOH 67  571  571  HOH HOH A . 
E 5 HOH 68  572  572  HOH HOH A . 
E 5 HOH 69  573  573  HOH HOH A . 
E 5 HOH 70  574  574  HOH HOH A . 
E 5 HOH 71  575  575  HOH HOH A . 
E 5 HOH 72  576  576  HOH HOH A . 
E 5 HOH 73  577  577  HOH HOH A . 
E 5 HOH 74  578  578  HOH HOH A . 
E 5 HOH 75  579  579  HOH HOH A . 
E 5 HOH 76  580  580  HOH HOH A . 
E 5 HOH 77  581  581  HOH HOH A . 
E 5 HOH 78  582  582  HOH HOH A . 
E 5 HOH 79  583  583  HOH HOH A . 
E 5 HOH 80  584  584  HOH HOH A . 
E 5 HOH 81  585  585  HOH HOH A . 
E 5 HOH 82  586  586  HOH HOH A . 
E 5 HOH 83  587  587  HOH HOH A . 
E 5 HOH 84  588  588  HOH HOH A . 
E 5 HOH 85  589  589  HOH HOH A . 
E 5 HOH 86  590  590  HOH HOH A . 
E 5 HOH 87  591  591  HOH HOH A . 
E 5 HOH 88  592  592  HOH HOH A . 
E 5 HOH 89  593  593  HOH HOH A . 
E 5 HOH 90  594  594  HOH HOH A . 
E 5 HOH 91  595  595  HOH HOH A . 
E 5 HOH 92  596  596  HOH HOH A . 
E 5 HOH 93  597  597  HOH HOH A . 
E 5 HOH 94  598  598  HOH HOH A . 
E 5 HOH 95  599  599  HOH HOH A . 
E 5 HOH 96  600  600  HOH HOH A . 
E 5 HOH 97  601  601  HOH HOH A . 
E 5 HOH 98  602  602  HOH HOH A . 
E 5 HOH 99  603  603  HOH HOH A . 
E 5 HOH 100 604  604  HOH HOH A . 
E 5 HOH 101 605  605  HOH HOH A . 
E 5 HOH 102 606  606  HOH HOH A . 
E 5 HOH 103 607  607  HOH HOH A . 
E 5 HOH 104 608  608  HOH HOH A . 
E 5 HOH 105 609  609  HOH HOH A . 
E 5 HOH 106 610  610  HOH HOH A . 
E 5 HOH 107 611  611  HOH HOH A . 
E 5 HOH 108 612  612  HOH HOH A . 
E 5 HOH 109 613  613  HOH HOH A . 
E 5 HOH 110 614  614  HOH HOH A . 
E 5 HOH 111 615  615  HOH HOH A . 
E 5 HOH 112 616  616  HOH HOH A . 
E 5 HOH 113 618  618  HOH HOH A . 
E 5 HOH 114 619  619  HOH HOH A . 
E 5 HOH 115 620  620  HOH HOH A . 
E 5 HOH 116 621  621  HOH HOH A . 
E 5 HOH 117 622  622  HOH HOH A . 
#