data_1MJM
# 
_entry.id   1MJM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1MJM         pdb_00001mjm 10.2210/pdb1mjm/pdb 
RCSB  PD0245       ?            ?                   
WWPDB D_1000175027 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1MJ2 . unspecified 
PDB 1MJO . unspecified 
PDB 1MJP . unspecified 
PDB 1MJQ . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1MJM 
_pdbx_database_status.recvd_initial_deposition_date   1998-01-30 
_pdbx_database_status.deposit_site                    NDB 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Garvie, C.W.'     1 
'Phillips, S.E.V.' 2 
# 
_citation.id                        primary 
_citation.title                     'Direct and indirect readout in mutant Met repressor-operator complexes.' 
_citation.journal_abbrev            'Structure Fold.Des.' 
_citation.journal_volume            8 
_citation.page_first                905 
_citation.page_last                 914 
_citation.year                      2000 
_citation.journal_id_ASTM           FODEFH 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            1263 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10986458 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(00)00182-9' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Garvie, C.W.'   1 ? 
primary 'Phillips, S.E.' 2 ? 
# 
_cell.entry_id           1MJM 
_cell.length_a           39.960 
_cell.length_b           64.000 
_cell.length_c           114.470 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1MJM 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'HALF CONSENSUS DNA OPERATOR DUPLEX' 3045.005  2   ? ?    ? ? 
2 polymer man 'METHIONINE REPRESSOR'               12028.607 2   ? Q44K ? ? 
3 water   nat water                                18.015    177 ? ?    ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DA)(DG)(DA)(DC)(DG)(DT)(DC)(DT)(DC)' GAGACGTCTC C,D ? 
2 'polypeptide(L)'        no no 
;AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRKVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKER
SDEIPEAAKEIMREMGINPETWEY
;
;AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRKVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKER
SDEIPEAAKEIMREMGINPETWEY
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DA  n 
1 3   DG  n 
1 4   DA  n 
1 5   DC  n 
1 6   DG  n 
1 7   DT  n 
1 8   DC  n 
1 9   DT  n 
1 10  DC  n 
2 1   ALA n 
2 2   GLU n 
2 3   TRP n 
2 4   SER n 
2 5   GLY n 
2 6   GLU n 
2 7   TYR n 
2 8   ILE n 
2 9   SER n 
2 10  PRO n 
2 11  TYR n 
2 12  ALA n 
2 13  GLU n 
2 14  HIS n 
2 15  GLY n 
2 16  LYS n 
2 17  LYS n 
2 18  SER n 
2 19  GLU n 
2 20  GLN n 
2 21  VAL n 
2 22  LYS n 
2 23  LYS n 
2 24  ILE n 
2 25  THR n 
2 26  VAL n 
2 27  SER n 
2 28  ILE n 
2 29  PRO n 
2 30  LEU n 
2 31  LYS n 
2 32  VAL n 
2 33  LEU n 
2 34  LYS n 
2 35  ILE n 
2 36  LEU n 
2 37  THR n 
2 38  ASP n 
2 39  GLU n 
2 40  ARG n 
2 41  THR n 
2 42  ARG n 
2 43  ARG n 
2 44  LYS n 
2 45  VAL n 
2 46  ASN n 
2 47  ASN n 
2 48  LEU n 
2 49  ARG n 
2 50  HIS n 
2 51  ALA n 
2 52  THR n 
2 53  ASN n 
2 54  SER n 
2 55  GLU n 
2 56  LEU n 
2 57  LEU n 
2 58  CYS n 
2 59  GLU n 
2 60  ALA n 
2 61  PHE n 
2 62  LEU n 
2 63  HIS n 
2 64  ALA n 
2 65  PHE n 
2 66  THR n 
2 67  GLY n 
2 68  GLN n 
2 69  PRO n 
2 70  LEU n 
2 71  PRO n 
2 72  ASP n 
2 73  ASP n 
2 74  ALA n 
2 75  ASP n 
2 76  LEU n 
2 77  ARG n 
2 78  LYS n 
2 79  GLU n 
2 80  ARG n 
2 81  SER n 
2 82  ASP n 
2 83  GLU n 
2 84  ILE n 
2 85  PRO n 
2 86  GLU n 
2 87  ALA n 
2 88  ALA n 
2 89  LYS n 
2 90  GLU n 
2 91  ILE n 
2 92  MET n 
2 93  ARG n 
2 94  GLU n 
2 95  MET n 
2 96  GLY n 
2 97  ILE n 
2 98  ASN n 
2 99  PRO n 
2 100 GLU n 
2 101 THR n 
2 102 TRP n 
2 103 GLU n 
2 104 TYR n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 METJ 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP METJ_ECOLI 2 P0A8U6 1 
;AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKER
SDEIPEAAKEIMREMGINPETWEY
;
? 
2 PDB 1MJM       1 1MJM   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1MJM A 1 ? 104 ? P0A8U6 1   ? 104 ? 1   104 
2 1 1MJM B 1 ? 104 ? P0A8U6 1   ? 104 ? 1   104 
3 2 1MJM C 1 ? 10  ? 1MJM   401 ? 410 ? 401 410 
4 2 1MJM D 1 ? 10  ? 1MJM   411 ? 420 ? 411 420 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1MJM LYS A 44 ? UNP P0A8U6 GLN 44 'engineered mutation' 44 1 
2 1MJM LYS B 44 ? UNP P0A8U6 GLN 44 'engineered mutation' 44 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1MJM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.44 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'PROTEIN (10MG/ML) + DNA (3.8MG/ML) WAS CRYSTALLISED FROM 8-14% P4000, 100MM CITRATE BUFFER, PH 5.0-6.0, 20% GLYCEROL, pH 7.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 PROTEIN          ? ? ? 
1 2 1 DNA              ? ? ? 
1 3 1 'PEG 4000'       ? ? ? 
1 4 1 'CITRATE BUFFER' ? ? ? 
1 5 1 GLYCEROL         ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   1996-08 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1MJM 
_reflns.observed_criterion_sigma_I   3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25.4 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   60504 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         89.8 
_reflns.pdbx_Rmerge_I_obs            0.0750000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.0 
_reflns.B_iso_Wilson_estimate        25.7 
_reflns.pdbx_redundancy              4.4 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.32 
_reflns_shell.percent_possible_all   56.3 
_reflns_shell.Rmerge_I_obs           0.0750000 
_reflns_shell.pdbx_Rsym_value        0.2170000 
_reflns_shell.meanI_over_sigI_obs    2.8 
_reflns_shell.pdbx_redundancy        2.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1MJM 
_refine.ls_number_reflns_obs                     13755 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               10000000.00 
_refine.pdbx_data_cutoff_low_absF                0.00100 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.40 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    88.6 
_refine.ls_R_factor_obs                          0.2270000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2270000 
_refine.ls_R_factor_R_free                       0.2820000 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.3 
_refine.ls_number_reflns_R_free                  725 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               28.0 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'PDB ENTRY 1CMA' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1MJM 
_refine_analyze.Luzzati_coordinate_error_obs    0.31 
_refine_analyze.Luzzati_sigma_a_obs             0.35 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.37 
_refine_analyze.Luzzati_sigma_a_free            0.34 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1690 
_refine_hist.pdbx_number_atoms_nucleic_acid   404 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             177 
_refine_hist.number_atoms_total               2271 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        25.40 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      22.7  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.31  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   15 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.25 
_refine_ls_shell.number_reflns_R_work             505 
_refine_ls_shell.R_factor_R_work                  0.3630000 
_refine_ls_shell.percent_reflns_obs               53.7 
_refine_ls_shell.R_factor_R_free                  0.3390000 
_refine_ls_shell.R_factor_R_free_error            0.063 
_refine_ls_shell.percent_reflns_R_free            3.20 
_refine_ls_shell.number_reflns_R_free             32 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO       TOPHCSDX.PRO      'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM  DNA-RNA.TOP       'X-RAY DIFFRACTION' 
3 PARAMETER.ELEMENTS TOPOLOGY.ELEMENTS 'X-RAY DIFFRACTION' 
4 PARAMETER.ELEMENTS TOPH19.SOL        'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1MJM 
_struct.title                     'METHIONINE APOREPRESSOR MUTANT (Q44K) COMPLEXED TO HALF OF THE CONSENSUS OPERATOR SEQUENCE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MJM 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
;TRANSCRIPTION REGULATION, METJ, METHIONINE REPRESSOR, SHEET-HELIX-HELIX, S-ADENOSYL METHIONINE, DNA, COMPLEX (TRANSCRIPTION REGULATION-DNA), TRANSCRIPTION-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA LEU C 30 ? VAL C 45 ? LEU A 30 VAL A 45 1 ? 16 
HELX_P HELX_P2 AB ASN C 53 ? THR C 66 ? ASN A 53 THR A 66 1 ? 14 
HELX_P HELX_P3 AC GLU C 86 ? GLU C 94 ? GLU A 86 GLU A 94 1 ? 9  
HELX_P HELX_P4 BA LEU D 30 ? VAL D 45 ? LEU B 30 VAL B 45 1 ? 16 
HELX_P HELX_P5 BB ASN D 53 ? THR D 66 ? ASN B 53 THR B 66 1 ? 14 
HELX_P HELX_P6 BC GLU D 86 ? MET D 95 ? GLU B 86 MET B 95 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DG 1  N1 ? ? ? 1_555 B DC 10 N3 ? ? C DG 401 D DC 420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog2  hydrog ? ? A DG 1  N2 ? ? ? 1_555 B DC 10 O2 ? ? C DG 401 D DC 420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3  hydrog ? ? A DG 1  O6 ? ? ? 1_555 B DC 10 N4 ? ? C DG 401 D DC 420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4  hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT 9  N3 ? ? C DA 402 D DT 419 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5  hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT 9  O4 ? ? C DA 402 D DT 419 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC 8  N3 ? ? C DG 403 D DC 418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC 8  O2 ? ? C DG 403 D DC 418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC 8  N4 ? ? C DG 403 D DC 418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 7  N3 ? ? C DA 404 D DT 417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10 hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 7  O4 ? ? C DA 404 D DT 417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11 hydrog ? ? A DC 5  N3 ? ? ? 1_555 B DG 6  N1 ? ? C DC 405 D DG 416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12 hydrog ? ? A DC 5  N4 ? ? ? 1_555 B DG 6  O6 ? ? C DC 405 D DG 416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13 hydrog ? ? A DC 5  O2 ? ? ? 1_555 B DG 6  N2 ? ? C DC 405 D DG 416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14 hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC 5  N3 ? ? C DG 406 D DC 415 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15 hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC 5  O2 ? ? C DG 406 D DC 415 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16 hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC 5  N4 ? ? C DG 406 D DC 415 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 4  N1 ? ? C DT 407 D DA 414 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 4  N6 ? ? C DT 407 D DA 414 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19 hydrog ? ? A DC 8  N3 ? ? ? 1_555 B DG 3  N1 ? ? C DC 408 D DG 413 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20 hydrog ? ? A DC 8  N4 ? ? ? 1_555 B DG 3  O6 ? ? C DC 408 D DG 413 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21 hydrog ? ? A DC 8  O2 ? ? ? 1_555 B DG 3  N2 ? ? C DC 408 D DG 413 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22 hydrog ? ? A DT 9  N3 ? ? ? 1_555 B DA 2  N1 ? ? C DT 409 D DA 412 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23 hydrog ? ? A DT 9  O4 ? ? ? 1_555 B DA 2  N6 ? ? C DT 409 D DA 412 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24 hydrog ? ? A DC 10 N3 ? ? ? 1_555 B DG 1  N1 ? ? C DC 410 D DG 411 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25 hydrog ? ? A DC 10 N4 ? ? ? 1_555 B DG 1  O6 ? ? C DC 410 D DG 411 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26 hydrog ? ? A DC 10 O2 ? ? ? 1_555 B DG 1  N2 ? ? C DC 410 D DG 411 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AS1 ? 1 ? 
BS2 ? 1 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AS1 1 VAL C 21 ? ILE C 28 ? VAL A 21 ILE A 28 
BS2 1 VAL D 21 ? ILE D 28 ? VAL B 21 ILE B 28 
# 
_database_PDB_matrix.entry_id          1MJM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1MJM 
_atom_sites.fract_transf_matrix[1][1]   0.025025 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015625 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008736 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DG  A 1 1   ? 14.270  -12.422 28.612 1.00 37.67 ? 401  DG  C "O5'" 1 
ATOM   2    C "C5'" . DG  A 1 1   ? 13.891  -13.190 29.765 1.00 35.77 ? 401  DG  C "C5'" 1 
ATOM   3    C "C4'" . DG  A 1 1   ? 14.730  -12.819 30.962 1.00 34.42 ? 401  DG  C "C4'" 1 
ATOM   4    O "O4'" . DG  A 1 1   ? 16.105  -13.210 30.698 1.00 33.64 ? 401  DG  C "O4'" 1 
ATOM   5    C "C3'" . DG  A 1 1   ? 14.766  -11.301 31.109 1.00 33.82 ? 401  DG  C "C3'" 1 
ATOM   6    O "O3'" . DG  A 1 1   ? 14.972  -10.870 32.446 1.00 33.11 ? 401  DG  C "O3'" 1 
ATOM   7    C "C2'" . DG  A 1 1   ? 15.953  -10.899 30.266 1.00 33.28 ? 401  DG  C "C2'" 1 
ATOM   8    C "C1'" . DG  A 1 1   ? 16.905  -12.055 30.501 1.00 31.80 ? 401  DG  C "C1'" 1 
ATOM   9    N N9    . DG  A 1 1   ? 17.775  -12.246 29.350 1.00 28.49 ? 401  DG  C N9    1 
ATOM   10   C C8    . DG  A 1 1   ? 17.403  -12.376 28.033 1.00 26.78 ? 401  DG  C C8    1 
ATOM   11   N N7    . DG  A 1 1   ? 18.422  -12.438 27.221 1.00 26.80 ? 401  DG  C N7    1 
ATOM   12   C C5    . DG  A 1 1   ? 19.529  -12.365 28.056 1.00 25.51 ? 401  DG  C C5    1 
ATOM   13   C C6    . DG  A 1 1   ? 20.906  -12.381 27.748 1.00 25.39 ? 401  DG  C C6    1 
ATOM   14   O O6    . DG  A 1 1   ? 21.444  -12.470 26.634 1.00 24.91 ? 401  DG  C O6    1 
ATOM   15   N N1    . DG  A 1 1   ? 21.687  -12.280 28.898 1.00 24.29 ? 401  DG  C N1    1 
ATOM   16   C C2    . DG  A 1 1   ? 21.197  -12.176 30.183 1.00 24.91 ? 401  DG  C C2    1 
ATOM   17   N N2    . DG  A 1 1   ? 22.105  -12.080 31.172 1.00 22.80 ? 401  DG  C N2    1 
ATOM   18   N N3    . DG  A 1 1   ? 19.910  -12.166 30.478 1.00 24.94 ? 401  DG  C N3    1 
ATOM   19   C C4    . DG  A 1 1   ? 19.141  -12.262 29.374 1.00 25.99 ? 401  DG  C C4    1 
ATOM   20   P P     . DA  A 1 2   ? 14.911  -9.298  32.771 1.00 30.82 ? 402  DA  C P     1 
ATOM   21   O OP1   . DA  A 1 2   ? 13.846  -9.087  33.790 1.00 31.45 ? 402  DA  C OP1   1 
ATOM   22   O OP2   . DA  A 1 2   ? 14.864  -8.549  31.481 1.00 27.21 ? 402  DA  C OP2   1 
ATOM   23   O "O5'" . DA  A 1 2   ? 16.315  -9.014  33.456 1.00 28.38 ? 402  DA  C "O5'" 1 
ATOM   24   C "C5'" . DA  A 1 2   ? 16.753  -9.796  34.554 1.00 24.62 ? 402  DA  C "C5'" 1 
ATOM   25   C "C4'" . DA  A 1 2   ? 18.150  -9.386  34.946 1.00 23.06 ? 402  DA  C "C4'" 1 
ATOM   26   O "O4'" . DA  A 1 2   ? 19.033  -9.634  33.819 1.00 22.43 ? 402  DA  C "O4'" 1 
ATOM   27   C "C3'" . DA  A 1 2   ? 18.244  -7.883  35.206 1.00 22.10 ? 402  DA  C "C3'" 1 
ATOM   28   O "O3'" . DA  A 1 2   ? 19.261  -7.618  36.171 1.00 22.49 ? 402  DA  C "O3'" 1 
ATOM   29   C "C2'" . DA  A 1 2   ? 18.570  -7.313  33.837 1.00 20.76 ? 402  DA  C "C2'" 1 
ATOM   30   C "C1'" . DA  A 1 2   ? 19.463  -8.397  33.251 1.00 20.06 ? 402  DA  C "C1'" 1 
ATOM   31   N N9    . DA  A 1 2   ? 19.447  -8.519  31.793 1.00 17.24 ? 402  DA  C N9    1 
ATOM   32   C C8    . DA  A 1 2   ? 18.363  -8.540  30.954 1.00 16.21 ? 402  DA  C C8    1 
ATOM   33   N N7    . DA  A 1 2   ? 18.674  -8.651  29.685 1.00 15.72 ? 402  DA  C N7    1 
ATOM   34   C C5    . DA  A 1 2   ? 20.062  -8.708  29.688 1.00 16.34 ? 402  DA  C C5    1 
ATOM   35   C C6    . DA  A 1 2   ? 21.006  -8.822  28.648 1.00 15.65 ? 402  DA  C C6    1 
ATOM   36   N N6    . DA  A 1 2   ? 20.672  -8.899  27.353 1.00 14.81 ? 402  DA  C N6    1 
ATOM   37   N N1    . DA  A 1 2   ? 22.316  -8.848  28.986 1.00 15.32 ? 402  DA  C N1    1 
ATOM   38   C C2    . DA  A 1 2   ? 22.645  -8.760  30.283 1.00 16.46 ? 402  DA  C C2    1 
ATOM   39   N N3    . DA  A 1 2   ? 21.849  -8.647  31.351 1.00 17.89 ? 402  DA  C N3    1 
ATOM   40   C C4    . DA  A 1 2   ? 20.553  -8.628  30.979 1.00 17.28 ? 402  DA  C C4    1 
ATOM   41   P P     . DG  A 1 3   ? 19.384  -6.160  36.823 1.00 22.32 ? 403  DG  C P     1 
ATOM   42   O OP1   . DG  A 1 3   ? 19.813  -6.272  38.242 1.00 22.49 ? 403  DG  C OP1   1 
ATOM   43   O OP2   . DG  A 1 3   ? 18.165  -5.394  36.471 1.00 22.51 ? 403  DG  C OP2   1 
ATOM   44   O "O5'" . DG  A 1 3   ? 20.612  -5.522  36.062 1.00 23.59 ? 403  DG  C "O5'" 1 
ATOM   45   C "C5'" . DG  A 1 3   ? 20.953  -5.974  34.781 1.00 23.60 ? 403  DG  C "C5'" 1 
ATOM   46   C "C4'" . DG  A 1 3   ? 22.190  -5.265  34.315 1.00 22.68 ? 403  DG  C "C4'" 1 
ATOM   47   O "O4'" . DG  A 1 3   ? 22.340  -5.610  32.921 1.00 22.65 ? 403  DG  C "O4'" 1 
ATOM   48   C "C3'" . DG  A 1 3   ? 21.979  -3.748  34.350 1.00 23.35 ? 403  DG  C "C3'" 1 
ATOM   49   O "O3'" . DG  A 1 3   ? 23.239  -3.080  34.484 1.00 25.52 ? 403  DG  C "O3'" 1 
ATOM   50   C "C2'" . DG  A 1 3   ? 21.355  -3.470  33.001 1.00 22.22 ? 403  DG  C "C2'" 1 
ATOM   51   C "C1'" . DG  A 1 3   ? 22.090  -4.471  32.138 1.00 22.02 ? 403  DG  C "C1'" 1 
ATOM   52   N N9    . DG  A 1 3   ? 21.427  -4.865  30.909 1.00 20.54 ? 403  DG  C N9    1 
ATOM   53   C C8    . DG  A 1 3   ? 20.082  -4.913  30.654 1.00 20.05 ? 403  DG  C C8    1 
ATOM   54   N N7    . DG  A 1 3   ? 19.813  -5.226  29.417 1.00 20.72 ? 403  DG  C N7    1 
ATOM   55   C C5    . DG  A 1 3   ? 21.058  -5.414  28.832 1.00 20.25 ? 403  DG  C C5    1 
ATOM   56   C C6    . DG  A 1 3   ? 21.411  -5.756  27.504 1.00 19.85 ? 403  DG  C C6    1 
ATOM   57   O O6    . DG  A 1 3   ? 20.671  -5.970  26.541 1.00 19.25 ? 403  DG  C O6    1 
ATOM   58   N N1    . DG  A 1 3   ? 22.789  -5.836  27.345 1.00 20.94 ? 403  DG  C N1    1 
ATOM   59   C C2    . DG  A 1 3   ? 23.711  -5.620  28.334 1.00 21.72 ? 403  DG  C C2    1 
ATOM   60   N N2    . DG  A 1 3   ? 25.002  -5.756  27.985 1.00 22.82 ? 403  DG  C N2    1 
ATOM   61   N N3    . DG  A 1 3   ? 23.394  -5.298  29.574 1.00 21.19 ? 403  DG  C N3    1 
ATOM   62   C C4    . DG  A 1 3   ? 22.059  -5.211  29.748 1.00 20.39 ? 403  DG  C C4    1 
ATOM   63   P P     . DA  A 1 4   ? 23.301  -1.488  34.752 1.00 27.96 ? 404  DA  C P     1 
ATOM   64   O OP1   . DA  A 1 4   ? 23.261  -1.274  36.216 1.00 26.35 ? 404  DA  C OP1   1 
ATOM   65   O OP2   . DA  A 1 4   ? 22.339  -0.764  33.876 1.00 26.62 ? 404  DA  C OP2   1 
ATOM   66   O "O5'" . DA  A 1 4   ? 24.760  -1.131  34.225 1.00 28.19 ? 404  DA  C "O5'" 1 
ATOM   67   C "C5'" . DA  A 1 4   ? 25.810  -2.080  34.381 1.00 25.67 ? 404  DA  C "C5'" 1 
ATOM   68   C "C4'" . DA  A 1 4   ? 26.782  -2.031  33.224 1.00 24.56 ? 404  DA  C "C4'" 1 
ATOM   69   O "O4'" . DA  A 1 4   ? 26.185  -2.566  32.010 1.00 22.60 ? 404  DA  C "O4'" 1 
ATOM   70   C "C3'" . DA  A 1 4   ? 27.196  -0.604  32.862 1.00 25.55 ? 404  DA  C "C3'" 1 
ATOM   71   O "O3'" . DA  A 1 4   ? 28.519  -0.630  32.326 1.00 29.92 ? 404  DA  C "O3'" 1 
ATOM   72   C "C2'" . DA  A 1 4   ? 26.181  -0.214  31.802 1.00 23.58 ? 404  DA  C "C2'" 1 
ATOM   73   C "C1'" . DA  A 1 4   ? 26.018  -1.527  31.047 1.00 21.57 ? 404  DA  C "C1'" 1 
ATOM   74   N N9    . DA  A 1 4   ? 24.746  -1.719  30.344 1.00 19.10 ? 404  DA  C N9    1 
ATOM   75   C C8    . DA  A 1 4   ? 23.477  -1.689  30.869 1.00 17.39 ? 404  DA  C C8    1 
ATOM   76   N N7    . DA  A 1 4   ? 22.534  -1.877  29.981 1.00 16.22 ? 404  DA  C N7    1 
ATOM   77   C C5    . DA  A 1 4   ? 23.222  -2.044  28.789 1.00 15.97 ? 404  DA  C C5    1 
ATOM   78   C C6    . DA  A 1 4   ? 22.788  -2.285  27.476 1.00 15.80 ? 404  DA  C C6    1 
ATOM   79   N N6    . DA  A 1 4   ? 21.504  -2.390  27.135 1.00 16.80 ? 404  DA  C N6    1 
ATOM   80   N N1    . DA  A 1 4   ? 23.729  -2.411  26.511 1.00 16.40 ? 404  DA  C N1    1 
ATOM   81   C C2    . DA  A 1 4   ? 25.018  -2.296  26.858 1.00 14.96 ? 404  DA  C C2    1 
ATOM   82   N N3    . DA  A 1 4   ? 25.551  -2.067  28.061 1.00 17.62 ? 404  DA  C N3    1 
ATOM   83   C C4    . DA  A 1 4   ? 24.587  -1.952  28.996 1.00 17.49 ? 404  DA  C C4    1 
ATOM   84   P P     . DC  A 1 5   ? 29.448  0.681   32.391 1.00 31.78 ? 405  DC  C P     1 
ATOM   85   O OP1   . DC  A 1 5   ? 30.820  0.165   32.625 1.00 34.16 ? 405  DC  C OP1   1 
ATOM   86   O OP2   . DC  A 1 5   ? 28.866  1.677   33.332 1.00 31.30 ? 405  DC  C OP2   1 
ATOM   87   O "O5'" . DC  A 1 5   ? 29.379  1.242   30.905 1.00 30.25 ? 405  DC  C "O5'" 1 
ATOM   88   C "C5'" . DC  A 1 5   ? 28.458  0.681   29.984 1.00 31.10 ? 405  DC  C "C5'" 1 
ATOM   89   C "C4'" . DC  A 1 5   ? 28.773  1.131   28.581 1.00 30.13 ? 405  DC  C "C4'" 1 
ATOM   90   O "O4'" . DC  A 1 5   ? 27.659  0.740   27.746 1.00 29.15 ? 405  DC  C "O4'" 1 
ATOM   91   C "C3'" . DC  A 1 5   ? 28.861  2.648   28.458 1.00 31.69 ? 405  DC  C "C3'" 1 
ATOM   92   O "O3'" . DC  A 1 5   ? 29.710  2.994   27.364 1.00 35.12 ? 405  DC  C "O3'" 1 
ATOM   93   C "C2'" . DC  A 1 5   ? 27.425  3.045   28.187 1.00 30.69 ? 405  DC  C "C2'" 1 
ATOM   94   C "C1'" . DC  A 1 5   ? 26.916  1.879   27.351 1.00 28.70 ? 405  DC  C "C1'" 1 
ATOM   95   N N1    . DC  A 1 5   ? 25.486  1.601   27.550 1.00 25.55 ? 405  DC  C N1    1 
ATOM   96   C C2    . DC  A 1 5   ? 24.712  1.236   26.450 1.00 25.81 ? 405  DC  C C2    1 
ATOM   97   O O2    . DC  A 1 5   ? 25.262  1.105   25.347 1.00 25.34 ? 405  DC  C O2    1 
ATOM   98   N N3    . DC  A 1 5   ? 23.386  1.033   26.612 1.00 26.43 ? 405  DC  C N3    1 
ATOM   99   C C4    . DC  A 1 5   ? 22.833  1.174   27.821 1.00 27.27 ? 405  DC  C C4    1 
ATOM   100  N N4    . DC  A 1 5   ? 21.515  0.974   27.934 1.00 27.81 ? 405  DC  C N4    1 
ATOM   101  C C5    . DC  A 1 5   ? 23.607  1.528   28.967 1.00 25.99 ? 405  DC  C C5    1 
ATOM   102  C C6    . DC  A 1 5   ? 24.916  1.726   28.786 1.00 25.49 ? 405  DC  C C6    1 
ATOM   103  P P     . DG  A 1 6   ? 30.261  4.499   27.210 1.00 36.42 ? 406  DG  C P     1 
ATOM   104  O OP1   . DG  A 1 6   ? 31.740  4.469   27.337 1.00 37.14 ? 406  DG  C OP1   1 
ATOM   105  O OP2   . DG  A 1 6   ? 29.469  5.417   28.075 1.00 35.89 ? 406  DG  C OP2   1 
ATOM   106  O "O5'" . DG  A 1 6   ? 29.925  4.816   25.694 1.00 33.96 ? 406  DG  C "O5'" 1 
ATOM   107  C "C5'" . DG  A 1 6   ? 30.142  3.820   24.716 1.00 33.29 ? 406  DG  C "C5'" 1 
ATOM   108  C "C4'" . DG  A 1 6   ? 29.407  4.155   23.442 1.00 33.13 ? 406  DG  C "C4'" 1 
ATOM   109  O "O4'" . DG  A 1 6   ? 27.994  3.843   23.566 1.00 31.04 ? 406  DG  C "O4'" 1 
ATOM   110  C "C3'" . DG  A 1 6   ? 29.461  5.650   23.143 1.00 33.80 ? 406  DG  C "C3'" 1 
ATOM   111  O "O3'" . DG  A 1 6   ? 29.460  5.818   21.731 1.00 36.82 ? 406  DG  C "O3'" 1 
ATOM   112  C "C2'" . DG  A 1 6   ? 28.213  6.182   23.828 1.00 31.48 ? 406  DG  C "C2'" 1 
ATOM   113  C "C1'" . DG  A 1 6   ? 27.231  5.044   23.592 1.00 28.87 ? 406  DG  C "C1'" 1 
ATOM   114  N N9    . DG  A 1 6   ? 26.159  4.890   24.571 1.00 25.39 ? 406  DG  C N9    1 
ATOM   115  C C8    . DG  A 1 6   ? 26.244  5.017   25.935 1.00 24.40 ? 406  DG  C C8    1 
ATOM   116  N N7    . DG  A 1 6   ? 25.104  4.814   26.539 1.00 22.64 ? 406  DG  C N7    1 
ATOM   117  C C5    . DG  A 1 6   ? 24.213  4.538   25.508 1.00 21.06 ? 406  DG  C C5    1 
ATOM   118  C C6    . DG  A 1 6   ? 22.827  4.238   25.544 1.00 20.95 ? 406  DG  C C6    1 
ATOM   119  O O6    . DG  A 1 6   ? 22.083  4.146   26.529 1.00 22.01 ? 406  DG  C O6    1 
ATOM   120  N N1    . DG  A 1 6   ? 22.313  4.029   24.269 1.00 19.14 ? 406  DG  C N1    1 
ATOM   121  C C2    . DG  A 1 6   ? 23.040  4.095   23.110 1.00 19.85 ? 406  DG  C C2    1 
ATOM   122  N N2    . DG  A 1 6   ? 22.369  3.853   21.975 1.00 19.67 ? 406  DG  C N2    1 
ATOM   123  N N3    . DG  A 1 6   ? 24.329  4.372   23.063 1.00 20.59 ? 406  DG  C N3    1 
ATOM   124  C C4    . DG  A 1 6   ? 24.848  4.582   24.290 1.00 22.35 ? 406  DG  C C4    1 
ATOM   125  P P     . DT  A 1 7   ? 29.410  7.285   21.091 1.00 39.15 ? 407  DT  C P     1 
ATOM   126  O OP1   . DT  A 1 7   ? 30.114  7.138   19.790 1.00 39.40 ? 407  DT  C OP1   1 
ATOM   127  O OP2   . DT  A 1 7   ? 29.894  8.285   22.088 1.00 37.46 ? 407  DT  C OP2   1 
ATOM   128  O "O5'" . DT  A 1 7   ? 27.853  7.469   20.792 1.00 37.62 ? 407  DT  C "O5'" 1 
ATOM   129  C "C5'" . DT  A 1 7   ? 27.159  6.454   20.071 1.00 34.64 ? 407  DT  C "C5'" 1 
ATOM   130  C "C4'" . DT  A 1 7   ? 25.920  6.994   19.394 1.00 32.70 ? 407  DT  C "C4'" 1 
ATOM   131  O "O4'" . DT  A 1 7   ? 24.769  6.827   20.255 1.00 31.29 ? 407  DT  C "O4'" 1 
ATOM   132  C "C3'" . DT  A 1 7   ? 25.967  8.488   19.077 1.00 32.90 ? 407  DT  C "C3'" 1 
ATOM   133  O "O3'" . DT  A 1 7   ? 25.202  8.721   17.889 1.00 36.14 ? 407  DT  C "O3'" 1 
ATOM   134  C "C2'" . DT  A 1 7   ? 25.365  9.118   20.325 1.00 29.72 ? 407  DT  C "C2'" 1 
ATOM   135  C "C1'" . DT  A 1 7   ? 24.299  8.092   20.707 1.00 28.15 ? 407  DT  C "C1'" 1 
ATOM   136  N N1    . DT  A 1 7   ? 23.891  7.968   22.137 1.00 24.41 ? 407  DT  C N1    1 
ATOM   137  C C2    . DT  A 1 7   ? 22.596  7.547   22.409 1.00 21.00 ? 407  DT  C C2    1 
ATOM   138  O O2    . DT  A 1 7   ? 21.780  7.267   21.545 1.00 20.53 ? 407  DT  C O2    1 
ATOM   139  N N3    . DT  A 1 7   ? 22.291  7.468   23.741 1.00 17.45 ? 407  DT  C N3    1 
ATOM   140  C C4    . DT  A 1 7   ? 23.114  7.754   24.808 1.00 16.52 ? 407  DT  C C4    1 
ATOM   141  O O4    . DT  A 1 7   ? 22.689  7.632   25.951 1.00 14.13 ? 407  DT  C O4    1 
ATOM   142  C C5    . DT  A 1 7   ? 24.447  8.183   24.461 1.00 17.95 ? 407  DT  C C5    1 
ATOM   143  C C7    . DT  A 1 7   ? 25.408  8.518   25.559 1.00 19.13 ? 407  DT  C C7    1 
ATOM   144  C C6    . DT  A 1 7   ? 24.768  8.266   23.161 1.00 21.08 ? 407  DT  C C6    1 
ATOM   145  P P     . DC  A 1 8   ? 25.307  10.127  17.122 1.00 38.10 ? 408  DC  C P     1 
ATOM   146  O OP1   . DC  A 1 8   ? 25.492  9.887   15.669 1.00 38.52 ? 408  DC  C OP1   1 
ATOM   147  O OP2   . DC  A 1 8   ? 26.260  10.997  17.853 1.00 38.55 ? 408  DC  C OP2   1 
ATOM   148  O "O5'" . DC  A 1 8   ? 23.851  10.726  17.315 1.00 39.94 ? 408  DC  C "O5'" 1 
ATOM   149  C "C5'" . DC  A 1 8   ? 23.016  10.181  18.324 1.00 41.29 ? 408  DC  C "C5'" 1 
ATOM   150  C "C4'" . DC  A 1 8   ? 21.564  10.414  17.998 1.00 40.73 ? 408  DC  C "C4'" 1 
ATOM   151  O "O4'" . DC  A 1 8   ? 20.835  9.929   19.146 1.00 38.94 ? 408  DC  C "O4'" 1 
ATOM   152  C "C3'" . DC  A 1 8   ? 21.226  11.897  17.881 1.00 41.67 ? 408  DC  C "C3'" 1 
ATOM   153  O "O3'" . DC  A 1 8   ? 20.132  12.171  17.004 1.00 44.39 ? 408  DC  C "O3'" 1 
ATOM   154  C "C2'" . DC  A 1 8   ? 20.919  12.284  19.307 1.00 39.71 ? 408  DC  C "C2'" 1 
ATOM   155  C "C1'" . DC  A 1 8   ? 20.334  11.014  19.904 1.00 36.95 ? 408  DC  C "C1'" 1 
ATOM   156  N N1    . DC  A 1 8   ? 20.825  10.874  21.277 1.00 33.71 ? 408  DC  C N1    1 
ATOM   157  C C2    . DC  A 1 8   ? 19.987  10.345  22.256 1.00 31.28 ? 408  DC  C C2    1 
ATOM   158  O O2    . DC  A 1 8   ? 18.860  9.943   21.930 1.00 29.94 ? 408  DC  C O2    1 
ATOM   159  N N3    . DC  A 1 8   ? 20.425  10.289  23.532 1.00 30.47 ? 408  DC  C N3    1 
ATOM   160  C C4    . DC  A 1 8   ? 21.648  10.730  23.840 1.00 29.51 ? 408  DC  C C4    1 
ATOM   161  N N4    . DC  A 1 8   ? 22.040  10.665  25.112 1.00 28.99 ? 408  DC  C N4    1 
ATOM   162  C C5    . DC  A 1 8   ? 22.526  11.257  22.855 1.00 30.64 ? 408  DC  C C5    1 
ATOM   163  C C6    . DC  A 1 8   ? 22.084  11.301  21.598 1.00 31.52 ? 408  DC  C C6    1 
ATOM   164  P P     . DT  A 1 9   ? 19.458  13.637  17.019 1.00 46.69 ? 409  DT  C P     1 
ATOM   165  O OP1   . DT  A 1 9   ? 19.048  13.940  15.620 1.00 46.59 ? 409  DT  C OP1   1 
ATOM   166  O OP2   . DT  A 1 9   ? 20.365  14.569  17.739 1.00 44.09 ? 409  DT  C OP2   1 
ATOM   167  O "O5'" . DT  A 1 9   ? 18.161  13.416  17.915 1.00 44.56 ? 409  DT  C "O5'" 1 
ATOM   168  C "C5'" . DT  A 1 9   ? 17.344  12.262  17.708 1.00 41.56 ? 409  DT  C "C5'" 1 
ATOM   169  C "C4'" . DT  A 1 9   ? 16.008  12.425  18.390 1.00 38.48 ? 409  DT  C "C4'" 1 
ATOM   170  O "O4'" . DT  A 1 9   ? 16.164  12.186  19.811 1.00 35.40 ? 409  DT  C "O4'" 1 
ATOM   171  C "C3'" . DT  A 1 9   ? 15.482  13.853  18.272 1.00 38.53 ? 409  DT  C "C3'" 1 
ATOM   172  O "O3'" . DT  A 1 9   ? 14.054  13.863  18.228 1.00 41.20 ? 409  DT  C "O3'" 1 
ATOM   173  C "C2'" . DT  A 1 9   ? 16.054  14.527  19.506 1.00 36.37 ? 409  DT  C "C2'" 1 
ATOM   174  C "C1'" . DT  A 1 9   ? 16.021  13.402  20.534 1.00 32.91 ? 409  DT  C "C1'" 1 
ATOM   175  N N1    . DT  A 1 9   ? 17.070  13.458  21.578 1.00 28.64 ? 409  DT  C N1    1 
ATOM   176  C C2    . DT  A 1 9   ? 16.703  13.181  22.877 1.00 26.28 ? 409  DT  C C2    1 
ATOM   177  O O2    . DT  A 1 9   ? 15.563  12.885  23.199 1.00 26.09 ? 409  DT  C O2    1 
ATOM   178  N N3    . DT  A 1 9   ? 17.722  13.269  23.793 1.00 23.94 ? 409  DT  C N3    1 
ATOM   179  C C4    . DT  A 1 9   ? 19.040  13.600  23.550 1.00 23.12 ? 409  DT  C C4    1 
ATOM   180  O O4    . DT  A 1 9   ? 19.839  13.642  24.481 1.00 21.92 ? 409  DT  C O4    1 
ATOM   181  C C5    . DT  A 1 9   ? 19.357  13.874  22.168 1.00 23.64 ? 409  DT  C C5    1 
ATOM   182  C C7    . DT  A 1 9   ? 20.758  14.249  21.806 1.00 22.43 ? 409  DT  C C7    1 
ATOM   183  C C6    . DT  A 1 9   ? 18.372  13.787  21.263 1.00 26.40 ? 409  DT  C C6    1 
ATOM   184  P P     . DC  A 1 10  ? 13.269  15.234  17.912 1.00 42.99 ? 410  DC  C P     1 
ATOM   185  O OP1   . DC  A 1 10  ? 12.394  14.985  16.734 1.00 41.80 ? 410  DC  C OP1   1 
ATOM   186  O OP2   . DC  A 1 10  ? 14.267  16.344  17.872 1.00 41.24 ? 410  DC  C OP2   1 
ATOM   187  O "O5'" . DC  A 1 10  ? 12.360  15.412  19.210 1.00 41.66 ? 410  DC  C "O5'" 1 
ATOM   188  C "C5'" . DC  A 1 10  ? 12.484  14.496  20.302 1.00 41.19 ? 410  DC  C "C5'" 1 
ATOM   189  C "C4'" . DC  A 1 10  ? 11.846  15.063  21.548 1.00 39.95 ? 410  DC  C "C4'" 1 
ATOM   190  O "O4'" . DC  A 1 10  ? 12.861  15.167  22.575 1.00 39.57 ? 410  DC  C "O4'" 1 
ATOM   191  C "C3'" . DC  A 1 10  ? 11.322  16.486  21.356 1.00 39.95 ? 410  DC  C "C3'" 1 
ATOM   192  O "O3'" . DC  A 1 10  ? 10.364  16.758  22.396 1.00 39.95 ? 410  DC  C "O3'" 1 
ATOM   193  C "C2'" . DC  A 1 10  ? 12.545  17.330  21.668 1.00 38.55 ? 410  DC  C "C2'" 1 
ATOM   194  C "C1'" . DC  A 1 10  ? 13.165  16.537  22.810 1.00 37.88 ? 410  DC  C "C1'" 1 
ATOM   195  N N1    . DC  A 1 10  ? 14.616  16.674  23.004 1.00 35.20 ? 410  DC  C N1    1 
ATOM   196  C C2    . DC  A 1 10  ? 15.133  16.534  24.301 1.00 33.35 ? 410  DC  C C2    1 
ATOM   197  O O2    . DC  A 1 10  ? 14.354  16.290  25.236 1.00 30.79 ? 410  DC  C O2    1 
ATOM   198  N N3    . DC  A 1 10  ? 16.464  16.666  24.497 1.00 32.99 ? 410  DC  C N3    1 
ATOM   199  C C4    . DC  A 1 10  ? 17.269  16.922  23.460 1.00 33.46 ? 410  DC  C C4    1 
ATOM   200  N N4    . DC  A 1 10  ? 18.576  17.039  23.696 1.00 34.20 ? 410  DC  C N4    1 
ATOM   201  C C5    . DC  A 1 10  ? 16.768  17.069  22.132 1.00 33.54 ? 410  DC  C C5    1 
ATOM   202  C C6    . DC  A 1 10  ? 15.449  16.938  21.951 1.00 34.59 ? 410  DC  C C6    1 
ATOM   203  O "O5'" . DG  B 1 1   ? 21.187  16.059  34.302 1.00 26.40 ? 411  DG  D "O5'" 1 
ATOM   204  C "C5'" . DG  B 1 1   ? 20.346  17.219  34.356 1.00 24.49 ? 411  DG  D "C5'" 1 
ATOM   205  C "C4'" . DG  B 1 1   ? 18.878  16.873  34.233 1.00 23.23 ? 411  DG  D "C4'" 1 
ATOM   206  O "O4'" . DG  B 1 1   ? 18.438  17.305  32.917 1.00 22.05 ? 411  DG  D "O4'" 1 
ATOM   207  C "C3'" . DG  B 1 1   ? 18.679  15.356  34.252 1.00 23.40 ? 411  DG  D "C3'" 1 
ATOM   208  O "O3'" . DG  B 1 1   ? 17.431  14.931  34.811 1.00 23.73 ? 411  DG  D "O3'" 1 
ATOM   209  C "C2'" . DG  B 1 1   ? 18.783  14.977  32.794 1.00 22.46 ? 411  DG  D "C2'" 1 
ATOM   210  C "C1'" . DG  B 1 1   ? 18.163  16.177  32.100 1.00 20.62 ? 411  DG  D "C1'" 1 
ATOM   211  N N9    . DG  B 1 1   ? 18.748  16.371  30.781 1.00 18.80 ? 411  DG  D N9    1 
ATOM   212  C C8    . DG  B 1 1   ? 20.087  16.444  30.464 1.00 17.60 ? 411  DG  D C8    1 
ATOM   213  N N7    . DG  B 1 1   ? 20.305  16.525  29.180 1.00 16.76 ? 411  DG  D N7    1 
ATOM   214  C C5    . DG  B 1 1   ? 19.035  16.529  28.615 1.00 16.72 ? 411  DG  D C5    1 
ATOM   215  C C6    . DG  B 1 1   ? 18.631  16.594  27.254 1.00 17.26 ? 411  DG  D C6    1 
ATOM   216  O O6    . DG  B 1 1   ? 19.335  16.671  26.239 1.00 17.57 ? 411  DG  D O6    1 
ATOM   217  N N1    . DG  B 1 1   ? 17.246  16.559  27.130 1.00 18.38 ? 411  DG  D N1    1 
ATOM   218  C C2    . DG  B 1 1   ? 16.362  16.471  28.184 1.00 18.06 ? 411  DG  D C2    1 
ATOM   219  N N2    . DG  B 1 1   ? 15.060  16.444  27.865 1.00 18.01 ? 411  DG  D N2    1 
ATOM   220  N N3    . DG  B 1 1   ? 16.726  16.412  29.452 1.00 16.94 ? 411  DG  D N3    1 
ATOM   221  C C4    . DG  B 1 1   ? 18.065  16.447  29.594 1.00 17.31 ? 411  DG  D C4    1 
ATOM   222  P P     . DA  B 1 2   ? 17.182  13.362  35.092 1.00 21.45 ? 412  DA  D P     1 
ATOM   223  O OP1   . DA  B 1 2   ? 16.702  13.212  36.489 1.00 21.17 ? 412  DA  D OP1   1 
ATOM   224  O OP2   . DA  B 1 2   ? 18.392  12.621  34.645 1.00 21.18 ? 412  DA  D OP2   1 
ATOM   225  O "O5'" . DA  B 1 2   ? 15.996  12.971  34.102 1.00 22.49 ? 412  DA  D "O5'" 1 
ATOM   226  C "C5'" . DA  B 1 2   ? 14.749  13.656  34.158 1.00 20.92 ? 412  DA  D "C5'" 1 
ATOM   227  C "C4'" . DA  B 1 2   ? 13.822  13.193  33.056 1.00 19.82 ? 412  DA  D "C4'" 1 
ATOM   228  O "O4'" . DA  B 1 2   ? 14.389  13.513  31.757 1.00 19.01 ? 412  DA  D "O4'" 1 
ATOM   229  C "C3'" . DA  B 1 2   ? 13.599  11.682  33.024 1.00 19.92 ? 412  DA  D "C3'" 1 
ATOM   230  O "O3'" . DA  B 1 2   ? 12.292  11.437  32.488 1.00 20.55 ? 412  DA  D "O3'" 1 
ATOM   231  C "C2'" . DA  B 1 2   ? 14.708  11.193  32.104 1.00 18.00 ? 412  DA  D "C2'" 1 
ATOM   232  C "C1'" . DA  B 1 2   ? 14.786  12.321  31.078 1.00 16.95 ? 412  DA  D "C1'" 1 
ATOM   233  N N9    . DA  B 1 2   ? 16.096  12.551  30.461 1.00 14.27 ? 412  DA  D N9    1 
ATOM   234  C C8    . DA  B 1 2   ? 17.325  12.608  31.080 1.00 13.86 ? 412  DA  D C8    1 
ATOM   235  N N7    . DA  B 1 2   ? 18.321  12.830  30.256 1.00 11.52 ? 412  DA  D N7    1 
ATOM   236  C C5    . DA  B 1 2   ? 17.710  12.922  29.013 1.00 10.55 ? 412  DA  D C5    1 
ATOM   237  C C6    . DA  B 1 2   ? 18.222  13.139  27.734 1.00 10.32 ? 412  DA  D C6    1 
ATOM   238  N N6    . DA  B 1 2   ? 19.519  13.316  27.479 1.00 13.58 ? 412  DA  D N6    1 
ATOM   239  N N1    . DA  B 1 2   ? 17.352  13.170  26.706 1.00 11.16 ? 412  DA  D N1    1 
ATOM   240  C C2    . DA  B 1 2   ? 16.054  12.998  26.962 1.00 10.61 ? 412  DA  D C2    1 
ATOM   241  N N3    . DA  B 1 2   ? 15.450  12.788  28.123 1.00 12.53 ? 412  DA  D N3    1 
ATOM   242  C C4    . DA  B 1 2   ? 16.343  12.757  29.124 1.00 11.54 ? 412  DA  D C4    1 
ATOM   243  P P     . DG  B 1 3   ? 11.617  9.986   32.622 1.00 20.02 ? 413  DG  D P     1 
ATOM   244  O OP1   . DG  B 1 3   ? 10.148  10.159  32.808 1.00 21.90 ? 413  DG  D OP1   1 
ATOM   245  O OP2   . DG  B 1 3   ? 12.392  9.178   33.592 1.00 18.98 ? 413  DG  D OP2   1 
ATOM   246  O "O5'" . DG  B 1 3   ? 11.808  9.385   31.174 1.00 20.07 ? 413  DG  D "O5'" 1 
ATOM   247  C "C5'" . DG  B 1 3   ? 12.723  9.981   30.292 1.00 21.45 ? 413  DG  D "C5'" 1 
ATOM   248  C "C4'" . DG  B 1 3   ? 12.641  9.312   28.951 1.00 21.54 ? 413  DG  D "C4'" 1 
ATOM   249  O "O4'" . DG  B 1 3   ? 13.820  9.713   28.217 1.00 22.58 ? 413  DG  D "O4'" 1 
ATOM   250  C "C3'" . DG  B 1 3   ? 12.760  7.797   29.112 1.00 23.54 ? 413  DG  D "C3'" 1 
ATOM   251  O "O3'" . DG  B 1 3   ? 12.164  7.172   27.979 1.00 24.54 ? 413  DG  D "O3'" 1 
ATOM   252  C "C2'" . DG  B 1 3   ? 14.257  7.575   29.105 1.00 22.65 ? 413  DG  D "C2'" 1 
ATOM   253  C "C1'" . DG  B 1 3   ? 14.685  8.604   28.090 1.00 21.74 ? 413  DG  D "C1'" 1 
ATOM   254  N N9    . DG  B 1 3   ? 16.065  9.052   28.187 1.00 19.04 ? 413  DG  D N9    1 
ATOM   255  C C8    . DG  B 1 3   ? 16.863  9.141   29.305 1.00 17.81 ? 413  DG  D C8    1 
ATOM   256  N N7    . DG  B 1 3   ? 18.083  9.507   29.025 1.00 17.00 ? 413  DG  D N7    1 
ATOM   257  C C5    . DG  B 1 3   ? 18.076  9.688   27.646 1.00 16.07 ? 413  DG  D C5    1 
ATOM   258  C C6    . DG  B 1 3   ? 19.109  10.085  26.762 1.00 15.98 ? 413  DG  D C6    1 
ATOM   259  O O6    . DG  B 1 3   ? 20.278  10.374  27.027 1.00 17.63 ? 413  DG  D O6    1 
ATOM   260  N N1    . DG  B 1 3   ? 18.664  10.136  25.442 1.00 14.43 ? 413  DG  D N1    1 
ATOM   261  C C2    . DG  B 1 3   ? 17.382  9.848   25.029 1.00 15.73 ? 413  DG  D C2    1 
ATOM   262  N N2    . DG  B 1 3   ? 17.128  9.952   23.716 1.00 15.14 ? 413  DG  D N2    1 
ATOM   263  N N3    . DG  B 1 3   ? 16.417  9.482   25.845 1.00 15.60 ? 413  DG  D N3    1 
ATOM   264  C C4    . DG  B 1 3   ? 16.833  9.423   27.126 1.00 16.72 ? 413  DG  D C4    1 
ATOM   265  P P     . DA  B 1 4   ? 12.106  5.572   27.869 1.00 25.85 ? 414  DA  D P     1 
ATOM   266  O OP1   . DA  B 1 4   ? 10.805  5.150   28.428 1.00 24.46 ? 414  DA  D OP1   1 
ATOM   267  O OP2   . DA  B 1 4   ? 13.363  4.961   28.393 1.00 23.05 ? 414  DA  D OP2   1 
ATOM   268  O "O5'" . DA  B 1 4   ? 12.075  5.374   26.286 1.00 26.03 ? 414  DA  D "O5'" 1 
ATOM   269  C "C5'" . DA  B 1 4   ? 11.433  6.344   25.465 1.00 23.85 ? 414  DA  D "C5'" 1 
ATOM   270  C "C4'" . DA  B 1 4   ? 12.062  6.414   24.090 1.00 23.44 ? 414  DA  D "C4'" 1 
ATOM   271  O "O4'" . DA  B 1 4   ? 13.400  6.977   24.166 1.00 22.63 ? 414  DA  D "O4'" 1 
ATOM   272  C "C3'" . DA  B 1 4   ? 12.248  5.045   23.441 1.00 23.94 ? 414  DA  D "C3'" 1 
ATOM   273  O "O3'" . DA  B 1 4   ? 12.137  5.164   22.021 1.00 27.27 ? 414  DA  D "O3'" 1 
ATOM   274  C "C2'" . DA  B 1 4   ? 13.642  4.643   23.885 1.00 21.93 ? 414  DA  D "C2'" 1 
ATOM   275  C "C1'" . DA  B 1 4   ? 14.370  5.980   23.863 1.00 21.13 ? 414  DA  D "C1'" 1 
ATOM   276  N N9    . DA  B 1 4   ? 15.493  6.104   24.797 1.00 18.47 ? 414  DA  D N9    1 
ATOM   277  C C8    . DA  B 1 4   ? 15.480  5.998   26.166 1.00 17.20 ? 414  DA  D C8    1 
ATOM   278  N N7    . DA  B 1 4   ? 16.665  6.130   26.719 1.00 16.79 ? 414  DA  D N7    1 
ATOM   279  C C5    . DA  B 1 4   ? 17.516  6.342   25.639 1.00 14.59 ? 414  DA  D C5    1 
ATOM   280  C C6    . DA  B 1 4   ? 18.912  6.558   25.552 1.00 12.56 ? 414  DA  D C6    1 
ATOM   281  N N6    . DA  B 1 4   ? 19.728  6.599   26.605 1.00 9.78  ? 414  DA  D N6    1 
ATOM   282  N N1    . DA  B 1 4   ? 19.444  6.738   24.324 1.00 13.17 ? 414  DA  D N1    1 
ATOM   283  C C2    . DA  B 1 4   ? 18.626  6.706   23.258 1.00 13.77 ? 414  DA  D C2    1 
ATOM   284  N N3    . DA  B 1 4   ? 17.309  6.515   23.212 1.00 16.02 ? 414  DA  D N3    1 
ATOM   285  C C4    . DA  B 1 4   ? 16.807  6.337   24.450 1.00 15.79 ? 414  DA  D C4    1 
ATOM   286  P P     . DC  B 1 5   ? 11.829  3.861   21.124 1.00 30.49 ? 415  DC  D P     1 
ATOM   287  O OP1   . DC  B 1 5   ? 11.109  4.313   19.900 1.00 29.84 ? 415  DC  D OP1   1 
ATOM   288  O OP2   . DC  B 1 5   ? 11.237  2.805   21.991 1.00 29.42 ? 415  DC  D OP2   1 
ATOM   289  O "O5'" . DC  B 1 5   ? 13.271  3.361   20.678 1.00 31.25 ? 415  DC  D "O5'" 1 
ATOM   290  C "C5'" . DC  B 1 5   ? 14.411  4.194   20.872 1.00 32.58 ? 415  DC  D "C5'" 1 
ATOM   291  C "C4'" . DC  B 1 5   ? 15.630  3.553   20.261 1.00 30.81 ? 415  DC  D "C4'" 1 
ATOM   292  O "O4'" . DC  B 1 5   ? 16.766  3.766   21.135 1.00 30.39 ? 415  DC  D "O4'" 1 
ATOM   293  C "C3'" . DC  B 1 5   ? 15.453  2.040   20.201 1.00 32.20 ? 415  DC  D "C3'" 1 
ATOM   294  O "O3'" . DC  B 1 5   ? 16.293  1.567   19.163 1.00 36.39 ? 415  DC  D "O3'" 1 
ATOM   295  C "C2'" . DC  B 1 5   ? 15.986  1.585   21.548 1.00 29.88 ? 415  DC  D "C2'" 1 
ATOM   296  C "C1'" . DC  B 1 5   ? 17.153  2.535   21.717 1.00 26.48 ? 415  DC  D "C1'" 1 
ATOM   297  N N1    . DC  B 1 5   ? 17.656  2.777   23.072 1.00 21.79 ? 415  DC  D N1    1 
ATOM   298  C C2    . DC  B 1 5   ? 18.973  3.202   23.211 1.00 20.06 ? 415  DC  D C2    1 
ATOM   299  O O2    . DC  B 1 5   ? 19.645  3.387   22.194 1.00 18.50 ? 415  DC  D O2    1 
ATOM   300  N N3    . DC  B 1 5   ? 19.483  3.403   24.444 1.00 18.48 ? 415  DC  D N3    1 
ATOM   301  C C4    . DC  B 1 5   ? 18.723  3.196   25.516 1.00 18.72 ? 415  DC  D C4    1 
ATOM   302  N N4    . DC  B 1 5   ? 19.272  3.402   26.714 1.00 18.29 ? 415  DC  D N4    1 
ATOM   303  C C5    . DC  B 1 5   ? 17.366  2.770   25.407 1.00 19.55 ? 415  DC  D C5    1 
ATOM   304  C C6    . DC  B 1 5   ? 16.876  2.578   24.172 1.00 20.28 ? 415  DC  D C6    1 
ATOM   305  P P     . DG  B 1 6   ? 15.915  0.242   18.345 1.00 39.23 ? 416  DG  D P     1 
ATOM   306  O OP1   . DG  B 1 6   ? 15.000  0.655   17.247 1.00 37.22 ? 416  DG  D OP1   1 
ATOM   307  O OP2   . DG  B 1 6   ? 15.523  -0.865  19.264 1.00 38.56 ? 416  DG  D OP2   1 
ATOM   308  O "O5'" . DG  B 1 6   ? 17.333  -0.118  17.720 1.00 39.04 ? 416  DG  D "O5'" 1 
ATOM   309  C "C5'" . DG  B 1 6   ? 18.113  0.916   17.126 1.00 37.98 ? 416  DG  D "C5'" 1 
ATOM   310  C "C4'" . DG  B 1 6   ? 19.590  0.658   17.309 1.00 37.68 ? 416  DG  D "C4'" 1 
ATOM   311  O "O4'" . DG  B 1 6   ? 19.997  0.954   18.675 1.00 35.53 ? 416  DG  D "O4'" 1 
ATOM   312  C "C3'" . DG  B 1 6   ? 19.909  -0.825  17.108 1.00 38.43 ? 416  DG  D "C3'" 1 
ATOM   313  O "O3'" . DG  B 1 6   ? 21.224  -0.966  16.554 1.00 42.44 ? 416  DG  D "O3'" 1 
ATOM   314  C "C2'" . DG  B 1 6   ? 19.792  -1.394  18.514 1.00 35.14 ? 416  DG  D "C2'" 1 
ATOM   315  C "C1'" . DG  B 1 6   ? 20.378  -0.253  19.324 1.00 33.26 ? 416  DG  D "C1'" 1 
ATOM   316  N N9    . DG  B 1 6   ? 20.057  -0.175  20.748 1.00 29.40 ? 416  DG  D N9    1 
ATOM   317  C C8    . DG  B 1 6   ? 18.837  -0.377  21.345 1.00 28.93 ? 416  DG  D C8    1 
ATOM   318  N N7    . DG  B 1 6   ? 18.879  -0.259  22.647 1.00 26.91 ? 416  DG  D N7    1 
ATOM   319  C C5    . DG  B 1 6   ? 20.205  0.041   22.926 1.00 24.11 ? 416  DG  D C5    1 
ATOM   320  C C6    . DG  B 1 6   ? 20.853  0.282   24.167 1.00 21.86 ? 416  DG  D C6    1 
ATOM   321  O O6    . DG  B 1 6   ? 20.371  0.283   25.299 1.00 19.37 ? 416  DG  D O6    1 
ATOM   322  N N1    . DG  B 1 6   ? 22.204  0.546   23.995 1.00 22.00 ? 416  DG  D N1    1 
ATOM   323  C C2    . DG  B 1 6   ? 22.852  0.580   22.786 1.00 22.44 ? 416  DG  D C2    1 
ATOM   324  N N2    . DG  B 1 6   ? 24.166  0.852   22.829 1.00 22.44 ? 416  DG  D N2    1 
ATOM   325  N N3    . DG  B 1 6   ? 22.260  0.365   21.622 1.00 23.62 ? 416  DG  D N3    1 
ATOM   326  C C4    . DG  B 1 6   ? 20.947  0.101   21.766 1.00 25.85 ? 416  DG  D C4    1 
ATOM   327  P P     . DT  B 1 7   ? 21.813  -2.429  16.229 1.00 44.93 ? 417  DT  D P     1 
ATOM   328  O OP1   . DT  B 1 7   ? 22.360  -2.376  14.843 1.00 43.43 ? 417  DT  D OP1   1 
ATOM   329  O OP2   . DT  B 1 7   ? 20.774  -3.439  16.575 1.00 44.02 ? 417  DT  D OP2   1 
ATOM   330  O "O5'" . DT  B 1 7   ? 23.016  -2.565  17.265 1.00 42.78 ? 417  DT  D "O5'" 1 
ATOM   331  C "C5'" . DT  B 1 7   ? 23.951  -1.498  17.411 1.00 41.56 ? 417  DT  D "C5'" 1 
ATOM   332  C "C4'" . DT  B 1 7   ? 25.144  -1.927  18.232 1.00 39.75 ? 417  DT  D "C4'" 1 
ATOM   333  O "O4'" . DT  B 1 7   ? 24.835  -1.806  19.645 1.00 37.89 ? 417  DT  D "O4'" 1 
ATOM   334  C "C3'" . DT  B 1 7   ? 25.492  -3.402  18.019 1.00 39.53 ? 417  DT  D "C3'" 1 
ATOM   335  O "O3'" . DT  B 1 7   ? 26.910  -3.612  18.135 1.00 40.13 ? 417  DT  D "O3'" 1 
ATOM   336  C "C2'" . DT  B 1 7   ? 24.672  -4.099  19.095 1.00 37.92 ? 417  DT  D "C2'" 1 
ATOM   337  C "C1'" . DT  B 1 7   ? 24.753  -3.093  20.235 1.00 36.66 ? 417  DT  D "C1'" 1 
ATOM   338  N N1    . DT  B 1 7   ? 23.667  -3.105  21.245 1.00 35.07 ? 417  DT  D N1    1 
ATOM   339  C C2    . DT  B 1 7   ? 24.022  -2.874  22.560 1.00 33.56 ? 417  DT  D C2    1 
ATOM   340  O O2    . DT  B 1 7   ? 25.163  -2.646  22.912 1.00 33.43 ? 417  DT  D O2    1 
ATOM   341  N N3    . DT  B 1 7   ? 22.986  -2.927  23.454 1.00 32.62 ? 417  DT  D N3    1 
ATOM   342  C C4    . DT  B 1 7   ? 21.659  -3.181  23.177 1.00 32.75 ? 417  DT  D C4    1 
ATOM   343  O O4    . DT  B 1 7   ? 20.839  -3.204  24.090 1.00 32.48 ? 417  DT  D O4    1 
ATOM   344  C C5    . DT  B 1 7   ? 21.350  -3.403  21.784 1.00 33.04 ? 417  DT  D C5    1 
ATOM   345  C C7    . DT  B 1 7   ? 19.934  -3.684  21.397 1.00 33.11 ? 417  DT  D C7    1 
ATOM   346  C C6    . DT  B 1 7   ? 22.356  -3.351  20.896 1.00 34.18 ? 417  DT  D C6    1 
ATOM   347  P P     . DC  B 1 8   ? 27.524  -5.095  17.981 1.00 40.94 ? 418  DC  D P     1 
ATOM   348  O OP1   . DC  B 1 8   ? 28.921  -4.997  17.482 1.00 41.41 ? 418  DC  D OP1   1 
ATOM   349  O OP2   . DC  B 1 8   ? 26.544  -5.941  17.246 1.00 40.13 ? 418  DC  D OP2   1 
ATOM   350  O "O5'" . DC  B 1 8   ? 27.624  -5.590  19.488 1.00 40.36 ? 418  DC  D "O5'" 1 
ATOM   351  C "C5'" . DC  B 1 8   ? 27.743  -4.637  20.537 1.00 39.50 ? 418  DC  D "C5'" 1 
ATOM   352  C "C4'" . DC  B 1 8   ? 28.530  -5.208  21.691 1.00 39.00 ? 418  DC  D "C4'" 1 
ATOM   353  O "O4'" . DC  B 1 8   ? 27.702  -5.109  22.873 1.00 38.27 ? 418  DC  D "O4'" 1 
ATOM   354  C "C3'" . DC  B 1 8   ? 28.859  -6.691  21.552 1.00 39.92 ? 418  DC  D "C3'" 1 
ATOM   355  O "O3'" . DC  B 1 8   ? 30.086  -6.994  22.230 1.00 42.35 ? 418  DC  D "O3'" 1 
ATOM   356  C "C2'" . DC  B 1 8   ? 27.647  -7.364  22.166 1.00 38.61 ? 418  DC  D "C2'" 1 
ATOM   357  C "C1'" . DC  B 1 8   ? 27.235  -6.392  23.265 1.00 37.10 ? 418  DC  D "C1'" 1 
ATOM   358  N N1    . DC  B 1 8   ? 25.776  -6.311  23.425 1.00 34.67 ? 418  DC  D N1    1 
ATOM   359  C C2    . DC  B 1 8   ? 25.235  -5.961  24.671 1.00 33.26 ? 418  DC  D C2    1 
ATOM   360  O O2    . DC  B 1 8   ? 25.999  -5.701  25.609 1.00 31.42 ? 418  DC  D O2    1 
ATOM   361  N N3    . DC  B 1 8   ? 23.892  -5.916  24.817 1.00 33.06 ? 418  DC  D N3    1 
ATOM   362  C C4    . DC  B 1 8   ? 23.099  -6.198  23.778 1.00 33.48 ? 418  DC  D C4    1 
ATOM   363  N N4    . DC  B 1 8   ? 21.778  -6.147  23.961 1.00 33.41 ? 418  DC  D N4    1 
ATOM   364  C C5    . DC  B 1 8   ? 23.624  -6.547  22.500 1.00 33.96 ? 418  DC  D C5    1 
ATOM   365  C C6    . DC  B 1 8   ? 24.954  -6.589  22.369 1.00 33.99 ? 418  DC  D C6    1 
ATOM   366  P P     . DT  B 1 9   ? 30.471  -8.523  22.560 1.00 43.05 ? 419  DT  D P     1 
ATOM   367  O OP1   . DT  B 1 9   ? 31.960  -8.605  22.520 1.00 43.62 ? 419  DT  D OP1   1 
ATOM   368  O OP2   . DT  B 1 9   ? 29.675  -9.390  21.660 1.00 43.51 ? 419  DT  D OP2   1 
ATOM   369  O "O5'" . DT  B 1 9   ? 29.997  -8.684  24.076 1.00 42.48 ? 419  DT  D "O5'" 1 
ATOM   370  C "C5'" . DT  B 1 9   ? 30.257  -7.640  25.018 1.00 39.19 ? 419  DT  D "C5'" 1 
ATOM   371  C "C4'" . DT  B 1 9   ? 30.103  -8.127  26.442 1.00 37.00 ? 419  DT  D "C4'" 1 
ATOM   372  O "O4'" . DT  B 1 9   ? 28.721  -7.993  26.868 1.00 34.96 ? 419  DT  D "O4'" 1 
ATOM   373  C "C3'" . DT  B 1 9   ? 30.433  -9.612  26.605 1.00 36.18 ? 419  DT  D "C3'" 1 
ATOM   374  O "O3'" . DT  B 1 9   ? 30.973  -9.871  27.911 1.00 37.40 ? 419  DT  D "O3'" 1 
ATOM   375  C "C2'" . DT  B 1 9   ? 29.086  -10.280 26.388 1.00 34.65 ? 419  DT  D "C2'" 1 
ATOM   376  C "C1'" . DT  B 1 9   ? 28.136  -9.278  27.033 1.00 32.65 ? 419  DT  D "C1'" 1 
ATOM   377  N N1    . DT  B 1 9   ? 26.745  -9.250  26.530 1.00 29.24 ? 419  DT  D N1    1 
ATOM   378  C C2    . DT  B 1 9   ? 25.728  -8.995  27.433 1.00 27.14 ? 419  DT  D C2    1 
ATOM   379  O O2    . DT  B 1 9   ? 25.927  -8.778  28.620 1.00 25.80 ? 419  DT  D O2    1 
ATOM   380  N N3    . DT  B 1 9   ? 24.462  -9.017  26.898 1.00 24.57 ? 419  DT  D N3    1 
ATOM   381  C C4    . DT  B 1 9   ? 24.118  -9.268  25.583 1.00 25.75 ? 419  DT  D C4    1 
ATOM   382  O O4    . DT  B 1 9   ? 22.940  -9.259  25.247 1.00 24.60 ? 419  DT  D O4    1 
ATOM   383  C C5    . DT  B 1 9   ? 25.230  -9.519  24.690 1.00 27.43 ? 419  DT  D C5    1 
ATOM   384  C C7    . DT  B 1 9   ? 24.946  -9.806  23.248 1.00 27.02 ? 419  DT  D C7    1 
ATOM   385  C C6    . DT  B 1 9   ? 26.472  -9.493  25.199 1.00 28.80 ? 419  DT  D C6    1 
ATOM   386  P P     . DC  B 1 10  ? 31.581  -11.325 28.259 1.00 38.51 ? 420  DC  D P     1 
ATOM   387  O OP1   . DC  B 1 10  ? 32.939  -11.144 28.839 1.00 38.22 ? 420  DC  D OP1   1 
ATOM   388  O OP2   . DC  B 1 10  ? 31.405  -12.205 27.069 1.00 36.84 ? 420  DC  D OP2   1 
ATOM   389  O "O5'" . DC  B 1 10  ? 30.632  -11.834 29.431 1.00 36.14 ? 420  DC  D "O5'" 1 
ATOM   390  C "C5'" . DC  B 1 10  ? 30.029  -10.896 30.316 1.00 34.02 ? 420  DC  D "C5'" 1 
ATOM   391  C "C4'" . DC  B 1 10  ? 29.252  -11.611 31.395 1.00 32.46 ? 420  DC  D "C4'" 1 
ATOM   392  O "O4'" . DC  B 1 10  ? 27.845  -11.507 31.067 1.00 31.35 ? 420  DC  D "O4'" 1 
ATOM   393  C "C3'" . DC  B 1 10  ? 29.545  -13.108 31.457 1.00 31.80 ? 420  DC  D "C3'" 1 
ATOM   394  O "O3'" . DC  B 1 10  ? 29.219  -13.678 32.717 1.00 34.43 ? 420  DC  D "O3'" 1 
ATOM   395  C "C2'" . DC  B 1 10  ? 28.549  -13.677 30.468 1.00 31.33 ? 420  DC  D "C2'" 1 
ATOM   396  C "C1'" . DC  B 1 10  ? 27.342  -12.770 30.656 1.00 29.16 ? 420  DC  D "C1'" 1 
ATOM   397  N N1    . DC  B 1 10  ? 26.523  -12.588 29.435 1.00 26.78 ? 420  DC  D N1    1 
ATOM   398  C C2    . DC  B 1 10  ? 25.146  -12.308 29.563 1.00 25.63 ? 420  DC  D C2    1 
ATOM   399  O O2    . DC  B 1 10  ? 24.653  -12.181 30.700 1.00 25.27 ? 420  DC  D O2    1 
ATOM   400  N N3    . DC  B 1 10  ? 24.393  -12.188 28.444 1.00 24.26 ? 420  DC  D N3    1 
ATOM   401  C C4    . DC  B 1 10  ? 24.957  -12.336 27.239 1.00 23.36 ? 420  DC  D C4    1 
ATOM   402  N N4    . DC  B 1 10  ? 24.179  -12.231 26.167 1.00 23.32 ? 420  DC  D N4    1 
ATOM   403  C C5    . DC  B 1 10  ? 26.346  -12.604 27.084 1.00 24.18 ? 420  DC  D C5    1 
ATOM   404  C C6    . DC  B 1 10  ? 27.086  -12.716 28.194 1.00 25.01 ? 420  DC  D C6    1 
ATOM   405  N N     . ALA C 2 1   ? 6.212   4.297   61.252 1.00 61.02 ? 1    ALA A N     1 
ATOM   406  C CA    . ALA C 2 1   ? 7.243   4.226   60.171 1.00 60.07 ? 1    ALA A CA    1 
ATOM   407  C C     . ALA C 2 1   ? 8.568   3.585   60.631 1.00 59.32 ? 1    ALA A C     1 
ATOM   408  O O     . ALA C 2 1   ? 8.946   3.649   61.815 1.00 59.65 ? 1    ALA A O     1 
ATOM   409  C CB    . ALA C 2 1   ? 7.497   5.633   59.592 1.00 59.46 ? 1    ALA A CB    1 
ATOM   410  N N     . GLU C 2 2   ? 9.237   2.913   59.690 1.00 56.83 ? 2    GLU A N     1 
ATOM   411  C CA    . GLU C 2 2   ? 10.532  2.276   59.949 1.00 52.95 ? 2    GLU A CA    1 
ATOM   412  C C     . GLU C 2 2   ? 11.610  3.276   59.524 1.00 49.51 ? 2    GLU A C     1 
ATOM   413  O O     . GLU C 2 2   ? 12.791  2.922   59.410 1.00 50.07 ? 2    GLU A O     1 
ATOM   414  C CB    . GLU C 2 2   ? 10.676  0.980   59.128 1.00 53.42 ? 2    GLU A CB    1 
ATOM   415  C CG    . GLU C 2 2   ? 10.532  1.174   57.609 1.00 54.18 ? 2    GLU A CG    1 
ATOM   416  C CD    . GLU C 2 2   ? 10.898  -0.064  56.793 1.00 54.79 ? 2    GLU A CD    1 
ATOM   417  O OE1   . GLU C 2 2   ? 11.729  -0.872  57.262 1.00 55.89 ? 2    GLU A OE1   1 
ATOM   418  O OE2   . GLU C 2 2   ? 10.366  -0.219  55.670 1.00 53.82 ? 2    GLU A OE2   1 
ATOM   419  N N     . TRP C 2 3   ? 11.193  4.528   59.311 1.00 43.84 ? 3    TRP A N     1 
ATOM   420  C CA    . TRP C 2 3   ? 12.092  5.580   58.862 1.00 38.25 ? 3    TRP A CA    1 
ATOM   421  C C     . TRP C 2 3   ? 12.958  6.194   59.940 1.00 35.17 ? 3    TRP A C     1 
ATOM   422  O O     . TRP C 2 3   ? 12.459  6.687   60.946 1.00 34.85 ? 3    TRP A O     1 
ATOM   423  C CB    . TRP C 2 3   ? 11.322  6.683   58.147 1.00 35.64 ? 3    TRP A CB    1 
ATOM   424  C CG    . TRP C 2 3   ? 12.202  7.468   57.243 1.00 32.22 ? 3    TRP A CG    1 
ATOM   425  C CD1   . TRP C 2 3   ? 13.158  6.973   56.406 1.00 31.05 ? 3    TRP A CD1   1 
ATOM   426  C CD2   . TRP C 2 3   ? 12.213  8.886   57.073 1.00 31.04 ? 3    TRP A CD2   1 
ATOM   427  N NE1   . TRP C 2 3   ? 13.764  7.996   55.723 1.00 30.70 ? 3    TRP A NE1   1 
ATOM   428  C CE2   . TRP C 2 3   ? 13.204  9.183   56.112 1.00 30.53 ? 3    TRP A CE2   1 
ATOM   429  C CE3   . TRP C 2 3   ? 11.485  9.938   57.642 1.00 30.08 ? 3    TRP A CE3   1 
ATOM   430  C CZ2   . TRP C 2 3   ? 13.484  10.492  55.703 1.00 31.03 ? 3    TRP A CZ2   1 
ATOM   431  C CZ3   . TRP C 2 3   ? 11.766  11.240  57.236 1.00 29.97 ? 3    TRP A CZ3   1 
ATOM   432  C CH2   . TRP C 2 3   ? 12.758  11.504  56.273 1.00 29.44 ? 3    TRP A CH2   1 
ATOM   433  N N     . SER C 2 4   ? 14.258  6.212   59.673 1.00 31.93 ? 4    SER A N     1 
ATOM   434  C CA    . SER C 2 4   ? 15.249  6.764   60.587 1.00 29.66 ? 4    SER A CA    1 
ATOM   435  C C     . SER C 2 4   ? 15.205  8.292   60.601 1.00 28.33 ? 4    SER A C     1 
ATOM   436  O O     . SER C 2 4   ? 15.561  8.929   61.604 1.00 28.67 ? 4    SER A O     1 
ATOM   437  C CB    . SER C 2 4   ? 16.651  6.289   60.184 1.00 27.66 ? 4    SER A CB    1 
ATOM   438  O OG    . SER C 2 4   ? 16.939  6.617   58.834 1.00 26.52 ? 4    SER A OG    1 
ATOM   439  N N     . GLY C 2 5   ? 14.741  8.860   59.490 1.00 25.82 ? 5    GLY A N     1 
ATOM   440  C CA    . GLY C 2 5   ? 14.663  10.298  59.351 1.00 24.23 ? 5    GLY A CA    1 
ATOM   441  C C     . GLY C 2 5   ? 15.817  10.820  58.515 1.00 23.90 ? 5    GLY A C     1 
ATOM   442  O O     . GLY C 2 5   ? 15.940  12.025  58.320 1.00 23.16 ? 5    GLY A O     1 
ATOM   443  N N     . GLU C 2 6   ? 16.680  9.918   58.044 1.00 23.60 ? 6    GLU A N     1 
ATOM   444  C CA    . GLU C 2 6   ? 17.831  10.301  57.227 1.00 23.06 ? 6    GLU A CA    1 
ATOM   445  C C     . GLU C 2 6   ? 17.419  10.447  55.774 1.00 21.78 ? 6    GLU A C     1 
ATOM   446  O O     . GLU C 2 6   ? 17.636  9.558   54.950 1.00 21.49 ? 6    GLU A O     1 
ATOM   447  C CB    . GLU C 2 6   ? 18.966  9.295   57.390 1.00 24.08 ? 6    GLU A CB    1 
ATOM   448  C CG    . GLU C 2 6   ? 19.511  9.256   58.804 1.00 27.73 ? 6    GLU A CG    1 
ATOM   449  C CD    . GLU C 2 6   ? 20.780  8.428   58.931 1.00 30.91 ? 6    GLU A CD    1 
ATOM   450  O OE1   . GLU C 2 6   ? 20.694  7.178   58.906 1.00 30.98 ? 6    GLU A OE1   1 
ATOM   451  O OE2   . GLU C 2 6   ? 21.864  9.038   59.073 1.00 32.35 ? 6    GLU A OE2   1 
ATOM   452  N N     . TYR C 2 7   ? 16.849  11.610  55.474 1.00 20.31 ? 7    TYR A N     1 
ATOM   453  C CA    . TYR C 2 7   ? 16.333  11.917  54.154 1.00 18.28 ? 7    TYR A CA    1 
ATOM   454  C C     . TYR C 2 7   ? 17.298  11.807  52.992 1.00 19.22 ? 7    TYR A C     1 
ATOM   455  O O     . TYR C 2 7   ? 18.369  12.421  52.993 1.00 19.12 ? 7    TYR A O     1 
ATOM   456  C CB    . TYR C 2 7   ? 15.693  13.299  54.144 1.00 16.29 ? 7    TYR A CB    1 
ATOM   457  C CG    . TYR C 2 7   ? 14.969  13.584  52.857 1.00 14.45 ? 7    TYR A CG    1 
ATOM   458  C CD1   . TYR C 2 7   ? 15.639  14.137  51.772 1.00 12.77 ? 7    TYR A CD1   1 
ATOM   459  C CD2   . TYR C 2 7   ? 13.615  13.258  52.707 1.00 14.33 ? 7    TYR A CD2   1 
ATOM   460  C CE1   . TYR C 2 7   ? 14.988  14.361  50.567 1.00 12.99 ? 7    TYR A CE1   1 
ATOM   461  C CE2   . TYR C 2 7   ? 12.951  13.480  51.500 1.00 13.01 ? 7    TYR A CE2   1 
ATOM   462  C CZ    . TYR C 2 7   ? 13.647  14.033  50.437 1.00 12.81 ? 7    TYR A CZ    1 
ATOM   463  O OH    . TYR C 2 7   ? 13.015  14.270  49.242 1.00 12.14 ? 7    TYR A OH    1 
ATOM   464  N N     . ILE C 2 8   ? 16.869  11.061  51.972 1.00 18.91 ? 8    ILE A N     1 
ATOM   465  C CA    . ILE C 2 8   ? 17.646  10.859  50.761 1.00 17.88 ? 8    ILE A CA    1 
ATOM   466  C C     . ILE C 2 8   ? 16.799  11.317  49.591 1.00 19.51 ? 8    ILE A C     1 
ATOM   467  O O     . ILE C 2 8   ? 15.670  10.852  49.400 1.00 20.49 ? 8    ILE A O     1 
ATOM   468  C CB    . ILE C 2 8   ? 18.002  9.376   50.531 1.00 17.05 ? 8    ILE A CB    1 
ATOM   469  C CG1   . ILE C 2 8   ? 18.823  8.836   51.698 1.00 16.99 ? 8    ILE A CG1   1 
ATOM   470  C CG2   . ILE C 2 8   ? 18.788  9.217   49.233 1.00 17.04 ? 8    ILE A CG2   1 
ATOM   471  C CD1   . ILE C 2 8   ? 18.966  7.329   51.695 1.00 16.28 ? 8    ILE A CD1   1 
ATOM   472  N N     . SER C 2 9   ? 17.347  12.238  48.811 1.00 18.69 ? 9    SER A N     1 
ATOM   473  C CA    . SER C 2 9   ? 16.647  12.743  47.657 1.00 17.77 ? 9    SER A CA    1 
ATOM   474  C C     . SER C 2 9   ? 16.569  11.678  46.561 1.00 18.43 ? 9    SER A C     1 
ATOM   475  O O     . SER C 2 9   ? 17.576  11.053  46.222 1.00 18.01 ? 9    SER A O     1 
ATOM   476  C CB    . SER C 2 9   ? 17.357  13.977  47.131 1.00 14.87 ? 9    SER A CB    1 
ATOM   477  O OG    . SER C 2 9   ? 16.806  14.362  45.890 1.00 15.89 ? 9    SER A OG    1 
ATOM   478  N N     . PRO C 2 10  ? 15.350  11.402  46.055 1.00 18.48 ? 10   PRO A N     1 
ATOM   479  C CA    . PRO C 2 10  ? 15.118  10.415  44.994 1.00 17.80 ? 10   PRO A CA    1 
ATOM   480  C C     . PRO C 2 10  ? 15.270  11.111  43.647 1.00 18.05 ? 10   PRO A C     1 
ATOM   481  O O     . PRO C 2 10  ? 15.075  10.499  42.593 1.00 17.68 ? 10   PRO A O     1 
ATOM   482  C CB    . PRO C 2 10  ? 13.644  10.034  45.196 1.00 17.61 ? 10   PRO A CB    1 
ATOM   483  C CG    . PRO C 2 10  ? 13.296  10.537  46.556 1.00 17.91 ? 10   PRO A CG    1 
ATOM   484  C CD    . PRO C 2 10  ? 14.069  11.806  46.650 1.00 18.20 ? 10   PRO A CD    1 
ATOM   485  N N     . TYR C 2 11  ? 15.628  12.396  43.704 1.00 18.85 ? 11   TYR A N     1 
ATOM   486  C CA    . TYR C 2 11  ? 15.744  13.244  42.527 1.00 20.09 ? 11   TYR A CA    1 
ATOM   487  C C     . TYR C 2 11  ? 17.136  13.727  42.170 1.00 20.88 ? 11   TYR A C     1 
ATOM   488  O O     . TYR C 2 11  ? 17.971  13.961  43.034 1.00 20.39 ? 11   TYR A O     1 
ATOM   489  C CB    . TYR C 2 11  ? 14.859  14.483  42.713 1.00 19.80 ? 11   TYR A CB    1 
ATOM   490  C CG    . TYR C 2 11  ? 13.541  14.219  43.400 1.00 19.23 ? 11   TYR A CG    1 
ATOM   491  C CD1   . TYR C 2 11  ? 12.661  13.246  42.914 1.00 18.67 ? 11   TYR A CD1   1 
ATOM   492  C CD2   . TYR C 2 11  ? 13.159  14.960  44.529 1.00 18.96 ? 11   TYR A CD2   1 
ATOM   493  C CE1   . TYR C 2 11  ? 11.430  13.020  43.521 1.00 18.62 ? 11   TYR A CE1   1 
ATOM   494  C CE2   . TYR C 2 11  ? 11.927  14.741  45.151 1.00 18.79 ? 11   TYR A CE2   1 
ATOM   495  C CZ    . TYR C 2 11  ? 11.067  13.770  44.634 1.00 20.13 ? 11   TYR A CZ    1 
ATOM   496  O OH    . TYR C 2 11  ? 9.833   13.576  45.203 1.00 20.21 ? 11   TYR A OH    1 
ATOM   497  N N     . ALA C 2 12  ? 17.343  13.940  40.875 1.00 23.61 ? 12   ALA A N     1 
ATOM   498  C CA    . ALA C 2 12  ? 18.610  14.449  40.357 1.00 26.33 ? 12   ALA A CA    1 
ATOM   499  C C     . ALA C 2 12  ? 18.727  15.896  40.827 1.00 28.61 ? 12   ALA A C     1 
ATOM   500  O O     . ALA C 2 12  ? 19.747  16.310  41.370 1.00 29.09 ? 12   ALA A O     1 
ATOM   501  C CB    . ALA C 2 12  ? 18.608  14.400  38.835 1.00 24.69 ? 12   ALA A CB    1 
ATOM   502  N N     . GLU C 2 13  ? 17.638  16.639  40.659 1.00 30.82 ? 13   GLU A N     1 
ATOM   503  C CA    . GLU C 2 13  ? 17.586  18.039  41.047 1.00 33.16 ? 13   GLU A CA    1 
ATOM   504  C C     . GLU C 2 13  ? 16.521  18.325  42.103 1.00 33.70 ? 13   GLU A C     1 
ATOM   505  O O     . GLU C 2 13  ? 15.349  17.981  41.929 1.00 33.87 ? 13   GLU A O     1 
ATOM   506  C CB    . GLU C 2 13  ? 17.291  18.904  39.816 1.00 34.29 ? 13   GLU A CB    1 
ATOM   507  C CG    . GLU C 2 13  ? 18.008  18.474  38.532 1.00 37.29 ? 13   GLU A CG    1 
ATOM   508  C CD    . GLU C 2 13  ? 19.515  18.713  38.562 1.00 38.95 ? 13   GLU A CD    1 
ATOM   509  O OE1   . GLU C 2 13  ? 20.034  19.195  39.588 1.00 39.60 ? 13   GLU A OE1   1 
ATOM   510  O OE2   . GLU C 2 13  ? 20.181  18.424  37.544 1.00 40.36 ? 13   GLU A OE2   1 
ATOM   511  N N     . HIS C 2 14  ? 16.942  18.911  43.217 1.00 34.82 ? 14   HIS A N     1 
ATOM   512  C CA    . HIS C 2 14  ? 16.009  19.307  44.265 1.00 36.86 ? 14   HIS A CA    1 
ATOM   513  C C     . HIS C 2 14  ? 16.325  20.769  44.591 1.00 37.93 ? 14   HIS A C     1 
ATOM   514  O O     . HIS C 2 14  ? 17.367  21.089  45.160 1.00 38.16 ? 14   HIS A O     1 
ATOM   515  C CB    . HIS C 2 14  ? 16.061  18.374  45.493 1.00 36.41 ? 14   HIS A CB    1 
ATOM   516  C CG    . HIS C 2 14  ? 17.213  18.616  46.417 1.00 36.43 ? 14   HIS A CG    1 
ATOM   517  N ND1   . HIS C 2 14  ? 18.414  17.952  46.300 1.00 37.33 ? 14   HIS A ND1   1 
ATOM   518  C CD2   . HIS C 2 14  ? 17.330  19.416  47.504 1.00 36.64 ? 14   HIS A CD2   1 
ATOM   519  C CE1   . HIS C 2 14  ? 19.223  18.332  47.273 1.00 36.08 ? 14   HIS A CE1   1 
ATOM   520  N NE2   . HIS C 2 14  ? 18.589  19.218  48.018 1.00 35.94 ? 14   HIS A NE2   1 
ATOM   521  N N     . GLY C 2 15  ? 15.476  21.661  44.088 1.00 39.61 ? 15   GLY A N     1 
ATOM   522  C CA    . GLY C 2 15  ? 15.674  23.082  44.298 1.00 41.24 ? 15   GLY A CA    1 
ATOM   523  C C     . GLY C 2 15  ? 16.849  23.614  43.495 1.00 42.25 ? 15   GLY A C     1 
ATOM   524  O O     . GLY C 2 15  ? 16.754  23.809  42.282 1.00 42.59 ? 15   GLY A O     1 
ATOM   525  N N     . LYS C 2 16  ? 17.969  23.823  44.177 1.00 43.07 ? 16   LYS A N     1 
ATOM   526  C CA    . LYS C 2 16  ? 19.180  24.336  43.548 1.00 43.96 ? 16   LYS A CA    1 
ATOM   527  C C     . LYS C 2 16  ? 20.274  23.278  43.462 1.00 43.69 ? 16   LYS A C     1 
ATOM   528  O O     . LYS C 2 16  ? 21.124  23.349  42.569 1.00 43.92 ? 16   LYS A O     1 
ATOM   529  C CB    . LYS C 2 16  ? 19.739  25.532  44.334 1.00 45.32 ? 16   LYS A CB    1 
ATOM   530  C CG    . LYS C 2 16  ? 18.971  26.838  44.226 1.00 46.33 ? 16   LYS A CG    1 
ATOM   531  C CD    . LYS C 2 16  ? 19.571  27.860  45.188 1.00 47.52 ? 16   LYS A CD    1 
ATOM   532  C CE    . LYS C 2 16  ? 18.877  29.213  45.098 1.00 48.80 ? 16   LYS A CE    1 
ATOM   533  N NZ    . LYS C 2 16  ? 19.306  30.149  46.185 1.00 48.70 ? 16   LYS A NZ    1 
ATOM   534  N N     . LYS C 2 17  ? 20.283  22.332  44.407 1.00 42.55 ? 17   LYS A N     1 
ATOM   535  C CA    . LYS C 2 17  ? 21.315  21.291  44.422 1.00 41.91 ? 17   LYS A CA    1 
ATOM   536  C C     . LYS C 2 17  ? 21.129  20.186  43.402 1.00 41.17 ? 17   LYS A C     1 
ATOM   537  O O     . LYS C 2 17  ? 20.009  19.879  42.988 1.00 40.85 ? 17   LYS A O     1 
ATOM   538  C CB    . LYS C 2 17  ? 21.505  20.685  45.815 1.00 41.41 ? 17   LYS A CB    1 
ATOM   539  C CG    . LYS C 2 17  ? 22.979  20.539  46.205 1.00 41.60 ? 17   LYS A CG    1 
ATOM   540  C CD    . LYS C 2 17  ? 23.606  19.182  45.863 1.00 41.56 ? 17   LYS A CD    1 
ATOM   541  C CE    . LYS C 2 17  ? 23.242  18.102  46.886 1.00 41.59 ? 17   LYS A CE    1 
ATOM   542  N NZ    . LYS C 2 17  ? 24.380  17.175  47.193 1.00 41.60 ? 17   LYS A NZ    1 
ATOM   543  N N     . SER C 2 18  ? 22.258  19.630  42.973 1.00 40.31 ? 18   SER A N     1 
ATOM   544  C CA    . SER C 2 18  ? 22.280  18.549  42.001 1.00 39.37 ? 18   SER A CA    1 
ATOM   545  C C     . SER C 2 18  ? 22.957  17.339  42.623 1.00 38.25 ? 18   SER A C     1 
ATOM   546  O O     . SER C 2 18  ? 23.965  17.465  43.322 1.00 38.08 ? 18   SER A O     1 
ATOM   547  C CB    . SER C 2 18  ? 23.051  18.962  40.749 1.00 40.33 ? 18   SER A CB    1 
ATOM   548  O OG    . SER C 2 18  ? 22.563  20.183  40.225 1.00 43.00 ? 18   SER A OG    1 
ATOM   549  N N     . GLU C 2 19  ? 22.390  16.166  42.370 1.00 36.25 ? 19   GLU A N     1 
ATOM   550  C CA    . GLU C 2 19  ? 22.939  14.929  42.889 1.00 33.92 ? 19   GLU A CA    1 
ATOM   551  C C     . GLU C 2 19  ? 23.731  14.292  41.768 1.00 34.08 ? 19   GLU A C     1 
ATOM   552  O O     . GLU C 2 19  ? 23.599  14.672  40.600 1.00 34.44 ? 19   GLU A O     1 
ATOM   553  C CB    . GLU C 2 19  ? 21.815  13.961  43.276 1.00 32.05 ? 19   GLU A CB    1 
ATOM   554  C CG    . GLU C 2 19  ? 20.735  14.535  44.165 1.00 29.12 ? 19   GLU A CG    1 
ATOM   555  C CD    . GLU C 2 19  ? 21.224  14.897  45.545 1.00 28.18 ? 19   GLU A CD    1 
ATOM   556  O OE1   . GLU C 2 19  ? 22.216  14.310  46.029 1.00 27.42 ? 19   GLU A OE1   1 
ATOM   557  O OE2   . GLU C 2 19  ? 20.591  15.773  46.160 1.00 28.45 ? 19   GLU A OE2   1 
ATOM   558  N N     . GLN C 2 20  ? 24.576  13.336  42.132 1.00 33.86 ? 20   GLN A N     1 
ATOM   559  C CA    . GLN C 2 20  ? 25.341  12.588  41.150 1.00 32.73 ? 20   GLN A CA    1 
ATOM   560  C C     . GLN C 2 20  ? 24.363  11.475  40.797 1.00 30.91 ? 20   GLN A C     1 
ATOM   561  O O     . GLN C 2 20  ? 23.830  10.816  41.690 1.00 30.51 ? 20   GLN A O     1 
ATOM   562  C CB    . GLN C 2 20  ? 26.591  11.999  41.797 1.00 34.22 ? 20   GLN A CB    1 
ATOM   563  C CG    . GLN C 2 20  ? 27.522  13.035  42.391 1.00 36.37 ? 20   GLN A CG    1 
ATOM   564  C CD    . GLN C 2 20  ? 28.734  12.414  43.049 1.00 37.87 ? 20   GLN A CD    1 
ATOM   565  O OE1   . GLN C 2 20  ? 29.107  12.799  44.151 1.00 40.58 ? 20   GLN A OE1   1 
ATOM   566  N NE2   . GLN C 2 20  ? 29.354  11.444  42.381 1.00 38.47 ? 20   GLN A NE2   1 
ATOM   567  N N     . VAL C 2 21  ? 24.057  11.319  39.515 1.00 30.18 ? 21   VAL A N     1 
ATOM   568  C CA    . VAL C 2 21  ? 23.112  10.286  39.103 1.00 29.02 ? 21   VAL A CA    1 
ATOM   569  C C     . VAL C 2 21  ? 23.688  9.343   38.069 1.00 28.34 ? 21   VAL A C     1 
ATOM   570  O O     . VAL C 2 21  ? 24.526  9.727   37.257 1.00 28.02 ? 21   VAL A O     1 
ATOM   571  C CB    . VAL C 2 21  ? 21.784  10.892  38.528 1.00 28.37 ? 21   VAL A CB    1 
ATOM   572  C CG1   . VAL C 2 21  ? 21.173  11.876  39.505 1.00 27.59 ? 21   VAL A CG1   1 
ATOM   573  C CG2   . VAL C 2 21  ? 22.027  11.570  37.193 1.00 28.95 ? 21   VAL A CG2   1 
ATOM   574  N N     . LYS C 2 22  ? 23.260  8.089   38.137 1.00 28.17 ? 22   LYS A N     1 
ATOM   575  C CA    . LYS C 2 22  ? 23.680  7.088   37.167 1.00 27.86 ? 22   LYS A CA    1 
ATOM   576  C C     . LYS C 2 22  ? 22.426  6.661   36.416 1.00 27.03 ? 22   LYS A C     1 
ATOM   577  O O     . LYS C 2 22  ? 21.341  6.637   36.987 1.00 28.18 ? 22   LYS A O     1 
ATOM   578  C CB    . LYS C 2 22  ? 24.320  5.864   37.845 1.00 27.80 ? 22   LYS A CB    1 
ATOM   579  C CG    . LYS C 2 22  ? 24.561  4.701   36.867 1.00 28.93 ? 22   LYS A CG    1 
ATOM   580  C CD    . LYS C 2 22  ? 25.501  3.631   37.409 1.00 30.21 ? 22   LYS A CD    1 
ATOM   581  C CE    . LYS C 2 22  ? 25.543  2.399   36.491 1.00 30.25 ? 22   LYS A CE    1 
ATOM   582  N NZ    . LYS C 2 22  ? 25.951  2.692   35.087 1.00 30.11 ? 22   LYS A NZ    1 
ATOM   583  N N     . LYS C 2 23  ? 22.561  6.394   35.126 1.00 25.45 ? 23   LYS A N     1 
ATOM   584  C CA    . LYS C 2 23  ? 21.429  5.937   34.348 1.00 24.95 ? 23   LYS A CA    1 
ATOM   585  C C     . LYS C 2 23  ? 21.535  4.429   34.235 1.00 24.83 ? 23   LYS A C     1 
ATOM   586  O O     . LYS C 2 23  ? 22.562  3.909   33.807 1.00 26.48 ? 23   LYS A O     1 
ATOM   587  C CB    . LYS C 2 23  ? 21.420  6.578   32.971 1.00 25.56 ? 23   LYS A CB    1 
ATOM   588  C CG    . LYS C 2 23  ? 20.960  8.015   32.985 1.00 26.00 ? 23   LYS A CG    1 
ATOM   589  C CD    . LYS C 2 23  ? 20.915  8.550   31.581 1.00 26.72 ? 23   LYS A CD    1 
ATOM   590  C CE    . LYS C 2 23  ? 20.340  9.934   31.548 1.00 26.57 ? 23   LYS A CE    1 
ATOM   591  N NZ    . LYS C 2 23  ? 20.436  10.419  30.156 1.00 29.65 ? 23   LYS A NZ    1 
ATOM   592  N N     . ILE C 2 24  ? 20.503  3.732   34.706 1.00 23.52 ? 24   ILE A N     1 
ATOM   593  C CA    . ILE C 2 24  ? 20.467  2.277   34.672 1.00 21.23 ? 24   ILE A CA    1 
ATOM   594  C C     . ILE C 2 24  ? 19.337  1.772   33.781 1.00 21.25 ? 24   ILE A C     1 
ATOM   595  O O     . ILE C 2 24  ? 18.294  2.408   33.655 1.00 21.63 ? 24   ILE A O     1 
ATOM   596  C CB    . ILE C 2 24  ? 20.308  1.677   36.097 1.00 19.44 ? 24   ILE A CB    1 
ATOM   597  C CG1   . ILE C 2 24  ? 19.029  2.198   36.760 1.00 17.89 ? 24   ILE A CG1   1 
ATOM   598  C CG2   . ILE C 2 24  ? 21.542  1.990   36.948 1.00 17.64 ? 24   ILE A CG2   1 
ATOM   599  C CD1   . ILE C 2 24  ? 18.729  1.587   38.128 1.00 16.41 ? 24   ILE A CD1   1 
ATOM   600  N N     . THR C 2 25  ? 19.575  0.646   33.123 1.00 21.42 ? 25   THR A N     1 
ATOM   601  C CA    . THR C 2 25  ? 18.570  0.040   32.265 1.00 20.90 ? 25   THR A CA    1 
ATOM   602  C C     . THR C 2 25  ? 17.723  -0.831  33.163 1.00 21.31 ? 25   THR A C     1 
ATOM   603  O O     . THR C 2 25  ? 18.232  -1.735  33.833 1.00 21.74 ? 25   THR A O     1 
ATOM   604  C CB    . THR C 2 25  ? 19.212  -0.794  31.154 1.00 20.23 ? 25   THR A CB    1 
ATOM   605  O OG1   . THR C 2 25  ? 19.825  0.095   30.218 1.00 21.33 ? 25   THR A OG1   1 
ATOM   606  C CG2   . THR C 2 25  ? 18.178  -1.649  30.432 1.00 19.96 ? 25   THR A CG2   1 
ATOM   607  N N     . VAL C 2 26  ? 16.436  -0.511  33.215 1.00 21.61 ? 26   VAL A N     1 
ATOM   608  C CA    . VAL C 2 26  ? 15.496  -1.236  34.054 1.00 21.31 ? 26   VAL A CA    1 
ATOM   609  C C     . VAL C 2 26  ? 14.440  -2.042  33.286 1.00 21.18 ? 26   VAL A C     1 
ATOM   610  O O     . VAL C 2 26  ? 13.770  -1.529  32.379 1.00 20.85 ? 26   VAL A O     1 
ATOM   611  C CB    . VAL C 2 26  ? 14.817  -0.267  35.042 1.00 21.26 ? 26   VAL A CB    1 
ATOM   612  C CG1   . VAL C 2 26  ? 13.680  -0.967  35.809 1.00 21.09 ? 26   VAL A CG1   1 
ATOM   613  C CG2   . VAL C 2 26  ? 15.865  0.287   36.009 1.00 20.15 ? 26   VAL A CG2   1 
ATOM   614  N N     . SER C 2 27  ? 14.341  -3.323  33.635 1.00 20.66 ? 27   SER A N     1 
ATOM   615  C CA    . SER C 2 27  ? 13.363  -4.225  33.032 1.00 20.33 ? 27   SER A CA    1 
ATOM   616  C C     . SER C 2 27  ? 12.057  -4.103  33.819 1.00 18.72 ? 27   SER A C     1 
ATOM   617  O O     . SER C 2 27  ? 12.006  -4.383  35.017 1.00 17.98 ? 27   SER A O     1 
ATOM   618  C CB    . SER C 2 27  ? 13.882  -5.668  33.034 1.00 19.97 ? 27   SER A CB    1 
ATOM   619  O OG    . SER C 2 27  ? 14.907  -5.842  32.066 1.00 18.86 ? 27   SER A OG    1 
ATOM   620  N N     . ILE C 2 28  ? 11.006  -3.674  33.134 1.00 18.61 ? 28   ILE A N     1 
ATOM   621  C CA    . ILE C 2 28  ? 9.706   -3.470  33.764 1.00 18.80 ? 28   ILE A CA    1 
ATOM   622  C C     . ILE C 2 28  ? 8.571   -4.127  32.972 1.00 18.77 ? 28   ILE A C     1 
ATOM   623  O O     . ILE C 2 28  ? 8.482   -3.974  31.747 1.00 19.55 ? 28   ILE A O     1 
ATOM   624  C CB    . ILE C 2 28  ? 9.455   -1.935  33.949 1.00 18.71 ? 28   ILE A CB    1 
ATOM   625  C CG1   . ILE C 2 28  ? 8.080   -1.664  34.558 1.00 17.87 ? 28   ILE A CG1   1 
ATOM   626  C CG2   . ILE C 2 28  ? 9.631   -1.208  32.625 1.00 18.82 ? 28   ILE A CG2   1 
ATOM   627  C CD1   . ILE C 2 28  ? 7.918   -0.258  35.071 1.00 16.73 ? 28   ILE A CD1   1 
ATOM   628  N N     . PRO C 2 29  ? 7.727   -4.925  33.649 1.00 18.50 ? 29   PRO A N     1 
ATOM   629  C CA    . PRO C 2 29  ? 6.607   -5.592  32.977 1.00 19.09 ? 29   PRO A CA    1 
ATOM   630  C C     . PRO C 2 29  ? 5.644   -4.539  32.436 1.00 21.04 ? 29   PRO A C     1 
ATOM   631  O O     . PRO C 2 29  ? 5.462   -3.478  33.047 1.00 20.61 ? 29   PRO A O     1 
ATOM   632  C CB    . PRO C 2 29  ? 5.962   -6.388  34.104 1.00 19.20 ? 29   PRO A CB    1 
ATOM   633  C CG    . PRO C 2 29  ? 7.088   -6.630  35.056 1.00 18.02 ? 29   PRO A CG    1 
ATOM   634  C CD    . PRO C 2 29  ? 7.784   -5.309  35.068 1.00 17.79 ? 29   PRO A CD    1 
ATOM   635  N N     . LEU C 2 30  ? 5.024   -4.841  31.299 1.00 23.05 ? 30   LEU A N     1 
ATOM   636  C CA    . LEU C 2 30  ? 4.092   -3.926  30.637 1.00 25.07 ? 30   LEU A CA    1 
ATOM   637  C C     . LEU C 2 30  ? 3.024   -3.326  31.555 1.00 24.85 ? 30   LEU A C     1 
ATOM   638  O O     . LEU C 2 30  ? 2.759   -2.128  31.508 1.00 24.52 ? 30   LEU A O     1 
ATOM   639  C CB    . LEU C 2 30  ? 3.408   -4.632  29.467 1.00 26.93 ? 30   LEU A CB    1 
ATOM   640  C CG    . LEU C 2 30  ? 2.936   -3.692  28.361 1.00 28.83 ? 30   LEU A CG    1 
ATOM   641  C CD1   . LEU C 2 30  ? 4.156   -3.196  27.604 1.00 29.91 ? 30   LEU A CD1   1 
ATOM   642  C CD2   . LEU C 2 30  ? 1.988   -4.414  27.417 1.00 29.98 ? 30   LEU A CD2   1 
ATOM   643  N N     . LYS C 2 31  ? 2.414   -4.164  32.387 1.00 25.08 ? 31   LYS A N     1 
ATOM   644  C CA    . LYS C 2 31  ? 1.376   -3.701  33.301 1.00 25.37 ? 31   LYS A CA    1 
ATOM   645  C C     . LYS C 2 31  ? 1.944   -2.759  34.358 1.00 24.63 ? 31   LYS A C     1 
ATOM   646  O O     . LYS C 2 31  ? 1.264   -1.833  34.805 1.00 24.84 ? 31   LYS A O     1 
ATOM   647  C CB    . LYS C 2 31  ? 0.660   -4.887  33.961 1.00 26.23 ? 31   LYS A CB    1 
ATOM   648  C CG    . LYS C 2 31  ? -0.129  -5.771  32.995 1.00 26.18 ? 31   LYS A CG    1 
ATOM   649  C CD    . LYS C 2 31  ? -0.906  -6.837  33.758 1.00 27.90 ? 31   LYS A CD    1 
ATOM   650  C CE    . LYS C 2 31  ? -1.755  -7.707  32.837 1.00 30.03 ? 31   LYS A CE    1 
ATOM   651  N NZ    . LYS C 2 31  ? -0.937  -8.595  31.957 1.00 32.54 ? 31   LYS A NZ    1 
ATOM   652  N N     . VAL C 2 32  ? 3.187   -2.994  34.762 1.00 23.22 ? 32   VAL A N     1 
ATOM   653  C CA    . VAL C 2 32  ? 3.809   -2.129  35.752 1.00 22.22 ? 32   VAL A CA    1 
ATOM   654  C C     . VAL C 2 32  ? 4.179   -0.800  35.079 1.00 22.04 ? 32   VAL A C     1 
ATOM   655  O O     . VAL C 2 32  ? 4.041   0.258   35.679 1.00 21.94 ? 32   VAL A O     1 
ATOM   656  C CB    . VAL C 2 32  ? 5.060   -2.787  36.398 1.00 22.60 ? 32   VAL A CB    1 
ATOM   657  C CG1   . VAL C 2 32  ? 5.566   -1.937  37.570 1.00 21.65 ? 32   VAL A CG1   1 
ATOM   658  C CG2   . VAL C 2 32  ? 4.734   -4.205  36.888 1.00 21.76 ? 32   VAL A CG2   1 
ATOM   659  N N     . LEU C 2 33  ? 4.568   -0.857  33.808 1.00 21.87 ? 33   LEU A N     1 
ATOM   660  C CA    . LEU C 2 33  ? 4.947   0.344   33.059 1.00 22.69 ? 33   LEU A CA    1 
ATOM   661  C C     . LEU C 2 33  ? 3.773   1.295   32.798 1.00 24.65 ? 33   LEU A C     1 
ATOM   662  O O     . LEU C 2 33  ? 3.930   2.508   32.884 1.00 24.85 ? 33   LEU A O     1 
ATOM   663  C CB    . LEU C 2 33  ? 5.619   -0.029  31.730 1.00 20.78 ? 33   LEU A CB    1 
ATOM   664  C CG    . LEU C 2 33  ? 6.183   1.146   30.925 1.00 19.46 ? 33   LEU A CG    1 
ATOM   665  C CD1   . LEU C 2 33  ? 7.307   1.817   31.693 1.00 18.13 ? 33   LEU A CD1   1 
ATOM   666  C CD2   . LEU C 2 33  ? 6.670   0.669   29.576 1.00 18.96 ? 33   LEU A CD2   1 
ATOM   667  N N     . LYS C 2 34  ? 2.609   0.751   32.446 1.00 26.32 ? 34   LYS A N     1 
ATOM   668  C CA    . LYS C 2 34  ? 1.426   1.578   32.193 1.00 26.77 ? 34   LYS A CA    1 
ATOM   669  C C     . LYS C 2 34  ? 0.997   2.324   33.454 1.00 25.99 ? 34   LYS A C     1 
ATOM   670  O O     . LYS C 2 34  ? 0.649   3.502   33.386 1.00 26.76 ? 34   LYS A O     1 
ATOM   671  C CB    . LYS C 2 34  ? 0.270   0.728   31.631 1.00 28.96 ? 34   LYS A CB    1 
ATOM   672  C CG    . LYS C 2 34  ? -1.137  1.271   31.900 1.00 30.52 ? 34   LYS A CG    1 
ATOM   673  C CD    . LYS C 2 34  ? -1.804  0.445   33.006 1.00 33.46 ? 34   LYS A CD    1 
ATOM   674  C CE    . LYS C 2 34  ? -3.006  1.135   33.665 1.00 34.41 ? 34   LYS A CE    1 
ATOM   675  N NZ    . LYS C 2 34  ? -2.657  2.049   34.803 1.00 33.40 ? 34   LYS A NZ    1 
ATOM   676  N N     . ILE C 2 35  ? 1.059   1.649   34.603 1.00 24.38 ? 35   ILE A N     1 
ATOM   677  C CA    . ILE C 2 35  ? 0.679   2.249   35.884 1.00 22.41 ? 35   ILE A CA    1 
ATOM   678  C C     . ILE C 2 35  ? 1.643   3.358   36.293 1.00 21.68 ? 35   ILE A C     1 
ATOM   679  O O     . ILE C 2 35  ? 1.248   4.342   36.917 1.00 21.90 ? 35   ILE A O     1 
ATOM   680  C CB    . ILE C 2 35  ? 0.644   1.191   37.007 1.00 22.59 ? 35   ILE A CB    1 
ATOM   681  C CG1   . ILE C 2 35  ? -0.346  0.081   36.648 1.00 22.76 ? 35   ILE A CG1   1 
ATOM   682  C CG2   . ILE C 2 35  ? 0.265   1.832   38.340 1.00 21.87 ? 35   ILE A CG2   1 
ATOM   683  C CD1   . ILE C 2 35  ? -0.463  -0.989  37.703 1.00 22.74 ? 35   ILE A CD1   1 
ATOM   684  N N     . LEU C 2 36  ? 2.917   3.156   35.977 1.00 20.51 ? 36   LEU A N     1 
ATOM   685  C CA    . LEU C 2 36  ? 3.971   4.114   36.286 1.00 19.39 ? 36   LEU A CA    1 
ATOM   686  C C     . LEU C 2 36  ? 3.781   5.337   35.401 1.00 18.71 ? 36   LEU A C     1 
ATOM   687  O O     . LEU C 2 36  ? 3.721   6.458   35.883 1.00 18.90 ? 36   LEU A O     1 
ATOM   688  C CB    . LEU C 2 36  ? 5.339   3.470   36.018 1.00 18.18 ? 36   LEU A CB    1 
ATOM   689  C CG    . LEU C 2 36  ? 6.618   4.283   36.202 1.00 17.52 ? 36   LEU A CG    1 
ATOM   690  C CD1   . LEU C 2 36  ? 6.825   4.664   37.678 1.00 15.56 ? 36   LEU A CD1   1 
ATOM   691  C CD2   . LEU C 2 36  ? 7.791   3.463   35.669 1.00 16.14 ? 36   LEU A CD2   1 
ATOM   692  N N     . THR C 2 37  ? 3.658   5.090   34.103 1.00 19.33 ? 37   THR A N     1 
ATOM   693  C CA    . THR C 2 37  ? 3.460   6.130   33.104 1.00 20.43 ? 37   THR A CA    1 
ATOM   694  C C     . THR C 2 37  ? 2.177   6.931   33.378 1.00 20.39 ? 37   THR A C     1 
ATOM   695  O O     . THR C 2 37  ? 2.120   8.132   33.097 1.00 20.59 ? 37   THR A O     1 
ATOM   696  C CB    . THR C 2 37  ? 3.405   5.513   31.677 1.00 20.44 ? 37   THR A CB    1 
ATOM   697  O OG1   . THR C 2 37  ? 4.639   4.835   31.399 1.00 20.04 ? 37   THR A OG1   1 
ATOM   698  C CG2   . THR C 2 37  ? 3.202   6.590   30.632 1.00 20.95 ? 37   THR A CG2   1 
ATOM   699  N N     . ASP C 2 38  ? 1.160   6.267   33.929 1.00 19.37 ? 38   ASP A N     1 
ATOM   700  C CA    . ASP C 2 38  ? -0.104  6.926   34.240 1.00 19.15 ? 38   ASP A CA    1 
ATOM   701  C C     . ASP C 2 38  ? 0.070   7.900   35.389 1.00 19.39 ? 38   ASP A C     1 
ATOM   702  O O     . ASP C 2 38  ? -0.564  8.949   35.411 1.00 20.27 ? 38   ASP A O     1 
ATOM   703  C CB    . ASP C 2 38  ? -1.182  5.913   34.617 1.00 18.80 ? 38   ASP A CB    1 
ATOM   704  C CG    . ASP C 2 38  ? -1.865  5.287   33.409 1.00 19.99 ? 38   ASP A CG    1 
ATOM   705  O OD1   . ASP C 2 38  ? -1.507  5.592   32.244 1.00 20.09 ? 38   ASP A OD1   1 
ATOM   706  O OD2   . ASP C 2 38  ? -2.779  4.469   33.640 1.00 20.63 ? 38   ASP A OD2   1 
ATOM   707  N N     . GLU C 2 39  ? 0.911   7.538   36.354 1.00 19.19 ? 39   GLU A N     1 
ATOM   708  C CA    . GLU C 2 39  ? 1.163   8.394   37.505 1.00 19.24 ? 39   GLU A CA    1 
ATOM   709  C C     . GLU C 2 39  ? 2.029   9.571   37.100 1.00 19.59 ? 39   GLU A C     1 
ATOM   710  O O     . GLU C 2 39  ? 1.914   10.652  37.662 1.00 19.54 ? 39   GLU A O     1 
ATOM   711  C CB    . GLU C 2 39  ? 1.825   7.609   38.638 1.00 19.62 ? 39   GLU A CB    1 
ATOM   712  C CG    . GLU C 2 39  ? 2.211   8.454   39.852 1.00 21.48 ? 39   GLU A CG    1 
ATOM   713  C CD    . GLU C 2 39  ? 1.027   9.140   40.533 1.00 23.79 ? 39   GLU A CD    1 
ATOM   714  O OE1   . GLU C 2 39  ? -0.127  8.976   40.077 1.00 23.20 ? 39   GLU A OE1   1 
ATOM   715  O OE2   . GLU C 2 39  ? 1.252   9.844   41.545 1.00 24.76 ? 39   GLU A OE2   1 
ATOM   716  N N     . ARG C 2 40  ? 2.884   9.346   36.105 1.00 20.43 ? 40   ARG A N     1 
ATOM   717  C CA    . ARG C 2 40  ? 3.767   10.373  35.589 1.00 19.10 ? 40   ARG A CA    1 
ATOM   718  C C     . ARG C 2 40  ? 2.935   11.396  34.839 1.00 19.49 ? 40   ARG A C     1 
ATOM   719  O O     . ARG C 2 40  ? 3.123   12.594  35.021 1.00 18.99 ? 40   ARG A O     1 
ATOM   720  C CB    . ARG C 2 40  ? 4.796   9.764   34.651 1.00 19.60 ? 40   ARG A CB    1 
ATOM   721  C CG    . ARG C 2 40  ? 5.872   10.741  34.250 1.00 21.67 ? 40   ARG A CG    1 
ATOM   722  C CD    . ARG C 2 40  ? 5.900   10.931  32.771 1.00 22.80 ? 40   ARG A CD    1 
ATOM   723  N NE    . ARG C 2 40  ? 6.850   10.048  32.114 1.00 23.14 ? 40   ARG A NE    1 
ATOM   724  C CZ    . ARG C 2 40  ? 6.592   9.352   31.011 1.00 24.19 ? 40   ARG A CZ    1 
ATOM   725  N NH1   . ARG C 2 40  ? 5.393   9.412   30.436 1.00 24.38 ? 40   ARG A NH1   1 
ATOM   726  N NH2   . ARG C 2 40  ? 7.567   8.664   30.430 1.00 23.71 ? 40   ARG A NH2   1 
ATOM   727  N N     . THR C 2 41  ? 2.000   10.924  34.013 1.00 20.05 ? 41   THR A N     1 
ATOM   728  C CA    . THR C 2 41  ? 1.140   11.833  33.258 1.00 20.68 ? 41   THR A CA    1 
ATOM   729  C C     . THR C 2 41  ? 0.129   12.515  34.171 1.00 19.75 ? 41   THR A C     1 
ATOM   730  O O     . THR C 2 41  ? -0.322  13.616  33.874 1.00 20.09 ? 41   THR A O     1 
ATOM   731  C CB    . THR C 2 41  ? 0.450   11.158  32.044 1.00 21.84 ? 41   THR A CB    1 
ATOM   732  O OG1   . THR C 2 41  ? -0.337  10.050  32.480 1.00 26.12 ? 41   THR A OG1   1 
ATOM   733  C CG2   . THR C 2 41  ? 1.490   10.668  31.048 1.00 21.90 ? 41   THR A CG2   1 
ATOM   734  N N     . ARG C 2 42  ? -0.167  11.898  35.312 1.00 19.19 ? 42   ARG A N     1 
ATOM   735  C CA    . ARG C 2 42  ? -1.089  12.491  36.272 1.00 19.46 ? 42   ARG A CA    1 
ATOM   736  C C     . ARG C 2 42  ? -0.414  13.684  36.938 1.00 20.52 ? 42   ARG A C     1 
ATOM   737  O O     . ARG C 2 42  ? -1.050  14.702  37.195 1.00 21.98 ? 42   ARG A O     1 
ATOM   738  C CB    . ARG C 2 42  ? -1.514  11.493  37.348 1.00 18.43 ? 42   ARG A CB    1 
ATOM   739  C CG    . ARG C 2 42  ? -2.697  11.995  38.159 1.00 17.90 ? 42   ARG A CG    1 
ATOM   740  C CD    . ARG C 2 42  ? -2.971  11.137  39.364 1.00 17.68 ? 42   ARG A CD    1 
ATOM   741  N NE    . ARG C 2 42  ? -1.908  11.220  40.361 1.00 18.73 ? 42   ARG A NE    1 
ATOM   742  C CZ    . ARG C 2 42  ? -1.703  12.251  41.177 1.00 18.74 ? 42   ARG A CZ    1 
ATOM   743  N NH1   . ARG C 2 42  ? -2.492  13.320  41.125 1.00 19.06 ? 42   ARG A NH1   1 
ATOM   744  N NH2   . ARG C 2 42  ? -0.712  12.210  42.064 1.00 18.36 ? 42   ARG A NH2   1 
ATOM   745  N N     . ARG C 2 43  ? 0.866   13.544  37.264 1.00 21.13 ? 43   ARG A N     1 
ATOM   746  C CA    . ARG C 2 43  ? 1.605   14.646  37.872 1.00 20.80 ? 43   ARG A CA    1 
ATOM   747  C C     . ARG C 2 43  ? 1.795   15.755  36.837 1.00 21.49 ? 43   ARG A C     1 
ATOM   748  O O     . ARG C 2 43  ? 1.706   16.929  37.156 1.00 22.26 ? 43   ARG A O     1 
ATOM   749  C CB    . ARG C 2 43  ? 2.963   14.177  38.391 1.00 19.00 ? 43   ARG A CB    1 
ATOM   750  C CG    . ARG C 2 43  ? 2.888   13.283  39.592 1.00 14.46 ? 43   ARG A CG    1 
ATOM   751  C CD    . ARG C 2 43  ? 4.278   12.966  40.070 1.00 14.98 ? 43   ARG A CD    1 
ATOM   752  N NE    . ARG C 2 43  ? 4.257   12.222  41.324 1.00 14.09 ? 43   ARG A NE    1 
ATOM   753  C CZ    . ARG C 2 43  ? 5.292   12.101  42.142 1.00 11.61 ? 43   ARG A CZ    1 
ATOM   754  N NH1   . ARG C 2 43  ? 6.449   12.673  41.853 1.00 13.16 ? 43   ARG A NH1   1 
ATOM   755  N NH2   . ARG C 2 43  ? 5.166   11.402  43.253 1.00 12.64 ? 43   ARG A NH2   1 
ATOM   756  N N     . LYS C 2 44  ? 2.043   15.368  35.591 1.00 23.35 ? 44   LYS A N     1 
ATOM   757  C CA    . LYS C 2 44  ? 2.225   16.323  34.502 1.00 25.92 ? 44   LYS A CA    1 
ATOM   758  C C     . LYS C 2 44  ? 1.003   17.214  34.317 1.00 26.52 ? 44   LYS A C     1 
ATOM   759  O O     . LYS C 2 44  ? 1.104   18.437  34.397 1.00 26.51 ? 44   LYS A O     1 
ATOM   760  C CB    . LYS C 2 44  ? 2.488   15.587  33.190 1.00 26.63 ? 44   LYS A CB    1 
ATOM   761  C CG    . LYS C 2 44  ? 3.931   15.474  32.819 1.00 28.83 ? 44   LYS A CG    1 
ATOM   762  C CD    . LYS C 2 44  ? 4.140   14.256  31.952 1.00 32.03 ? 44   LYS A CD    1 
ATOM   763  C CE    . LYS C 2 44  ? 5.280   14.465  30.996 1.00 33.64 ? 44   LYS A CE    1 
ATOM   764  N NZ    . LYS C 2 44  ? 6.406   15.192  31.646 1.00 36.86 ? 44   LYS A NZ    1 
ATOM   765  N N     . VAL C 2 45  ? -0.147  16.587  34.062 1.00 27.24 ? 45   VAL A N     1 
ATOM   766  C CA    . VAL C 2 45  ? -1.397  17.311  33.848 1.00 27.13 ? 45   VAL A CA    1 
ATOM   767  C C     . VAL C 2 45  ? -1.787  18.193  35.036 1.00 26.67 ? 45   VAL A C     1 
ATOM   768  O O     . VAL C 2 45  ? -2.439  19.219  34.854 1.00 26.65 ? 45   VAL A O     1 
ATOM   769  C CB    . VAL C 2 45  ? -2.563  16.357  33.462 1.00 27.48 ? 45   VAL A CB    1 
ATOM   770  C CG1   . VAL C 2 45  ? -2.227  15.610  32.171 1.00 27.04 ? 45   VAL A CG1   1 
ATOM   771  C CG2   . VAL C 2 45  ? -2.870  15.389  34.596 1.00 27.63 ? 45   VAL A CG2   1 
ATOM   772  N N     . ASN C 2 46  ? -1.377  17.793  36.240 1.00 26.15 ? 46   ASN A N     1 
ATOM   773  C CA    . ASN C 2 46  ? -1.648  18.567  37.452 1.00 25.31 ? 46   ASN A CA    1 
ATOM   774  C C     . ASN C 2 46  ? -0.563  19.622  37.681 1.00 24.19 ? 46   ASN A C     1 
ATOM   775  O O     . ASN C 2 46  ? -0.573  20.310  38.698 1.00 22.60 ? 46   ASN A O     1 
ATOM   776  C CB    . ASN C 2 46  ? -1.717  17.653  38.675 1.00 26.03 ? 46   ASN A CB    1 
ATOM   777  C CG    . ASN C 2 46  ? -3.074  17.015  38.850 1.00 27.57 ? 46   ASN A CG    1 
ATOM   778  O OD1   . ASN C 2 46  ? -3.892  17.486  39.640 1.00 28.05 ? 46   ASN A OD1   1 
ATOM   779  N ND2   . ASN C 2 46  ? -3.322  15.932  38.122 1.00 27.55 ? 46   ASN A ND2   1 
ATOM   780  N N     . ASN C 2 47  ? 0.392   19.691  36.753 1.00 24.33 ? 47   ASN A N     1 
ATOM   781  C CA    . ASN C 2 47  ? 1.515   20.626  36.799 1.00 24.38 ? 47   ASN A CA    1 
ATOM   782  C C     . ASN C 2 47  ? 2.352   20.500  38.075 1.00 23.92 ? 47   ASN A C     1 
ATOM   783  O O     . ASN C 2 47  ? 2.853   21.494  38.607 1.00 24.01 ? 47   ASN A O     1 
ATOM   784  C CB    . ASN C 2 47  ? 1.014   22.061  36.619 1.00 26.71 ? 47   ASN A CB    1 
ATOM   785  C CG    . ASN C 2 47  ? 2.112   23.016  36.178 1.00 28.58 ? 47   ASN A CG    1 
ATOM   786  O OD1   . ASN C 2 47  ? 2.162   24.162  36.625 1.00 28.64 ? 47   ASN A OD1   1 
ATOM   787  N ND2   . ASN C 2 47  ? 2.985   22.553  35.280 1.00 30.14 ? 47   ASN A ND2   1 
ATOM   788  N N     . LEU C 2 48  ? 2.484   19.270  38.567 1.00 23.47 ? 48   LEU A N     1 
ATOM   789  C CA    . LEU C 2 48  ? 3.258   18.973  39.773 1.00 22.96 ? 48   LEU A CA    1 
ATOM   790  C C     . LEU C 2 48  ? 4.735   18.720  39.438 1.00 22.56 ? 48   LEU A C     1 
ATOM   791  O O     . LEU C 2 48  ? 5.070   18.290  38.338 1.00 23.19 ? 48   LEU A O     1 
ATOM   792  C CB    . LEU C 2 48  ? 2.677   17.738  40.481 1.00 21.82 ? 48   LEU A CB    1 
ATOM   793  C CG    . LEU C 2 48  ? 1.196   17.786  40.879 1.00 21.95 ? 48   LEU A CG    1 
ATOM   794  C CD1   . LEU C 2 48  ? 0.749   16.448  41.428 1.00 20.21 ? 48   LEU A CD1   1 
ATOM   795  C CD2   . LEU C 2 48  ? 0.957   18.892  41.901 1.00 21.96 ? 48   LEU A CD2   1 
ATOM   796  N N     . ARG C 2 49  ? 5.617   19.006  40.389 1.00 22.38 ? 49   ARG A N     1 
ATOM   797  C CA    . ARG C 2 49  ? 7.047   18.784  40.207 1.00 20.78 ? 49   ARG A CA    1 
ATOM   798  C C     . ARG C 2 49  ? 7.331   17.277  40.195 1.00 19.70 ? 49   ARG A C     1 
ATOM   799  O O     . ARG C 2 49  ? 6.493   16.471  40.591 1.00 18.65 ? 49   ARG A O     1 
ATOM   800  C CB    . ARG C 2 49  ? 7.832   19.393  41.377 1.00 21.80 ? 49   ARG A CB    1 
ATOM   801  C CG    . ARG C 2 49  ? 7.751   20.897  41.556 1.00 22.27 ? 49   ARG A CG    1 
ATOM   802  C CD    . ARG C 2 49  ? 8.493   21.295  42.833 1.00 23.85 ? 49   ARG A CD    1 
ATOM   803  N NE    . ARG C 2 49  ? 8.414   22.725  43.135 1.00 25.20 ? 49   ARG A NE    1 
ATOM   804  C CZ    . ARG C 2 49  ? 9.227   23.647  42.619 1.00 25.78 ? 49   ARG A CZ    1 
ATOM   805  N NH1   . ARG C 2 49  ? 10.188  23.297  41.772 1.00 26.37 ? 49   ARG A NH1   1 
ATOM   806  N NH2   . ARG C 2 49  ? 9.077   24.922  42.944 1.00 24.76 ? 49   ARG A NH2   1 
ATOM   807  N N     . HIS C 2 50  ? 8.534   16.919  39.755 1.00 19.25 ? 50   HIS A N     1 
ATOM   808  C CA    . HIS C 2 50  ? 9.001   15.530  39.721 1.00 18.41 ? 50   HIS A CA    1 
ATOM   809  C C     . HIS C 2 50  ? 8.099   14.553  38.977 1.00 16.97 ? 50   HIS A C     1 
ATOM   810  O O     . HIS C 2 50  ? 7.917   13.409  39.397 1.00 16.36 ? 50   HIS A O     1 
ATOM   811  C CB    . HIS C 2 50  ? 9.269   15.047  41.155 1.00 18.05 ? 50   HIS A CB    1 
ATOM   812  C CG    . HIS C 2 50  ? 10.083  16.010  41.962 1.00 18.04 ? 50   HIS A CG    1 
ATOM   813  N ND1   . HIS C 2 50  ? 11.380  16.345  41.634 1.00 18.20 ? 50   HIS A ND1   1 
ATOM   814  C CD2   . HIS C 2 50  ? 9.772   16.743  43.055 1.00 18.65 ? 50   HIS A CD2   1 
ATOM   815  C CE1   . HIS C 2 50  ? 11.835  17.241  42.491 1.00 17.88 ? 50   HIS A CE1   1 
ATOM   816  N NE2   . HIS C 2 50  ? 10.878  17.500  43.363 1.00 19.05 ? 50   HIS A NE2   1 
ATOM   817  N N     . ALA C 2 51  ? 7.571   15.015  37.850 1.00 15.95 ? 51   ALA A N     1 
ATOM   818  C CA    . ALA C 2 51  ? 6.689   14.226  37.004 1.00 15.46 ? 51   ALA A CA    1 
ATOM   819  C C     . ALA C 2 51  ? 7.477   13.392  35.987 1.00 15.46 ? 51   ALA A C     1 
ATOM   820  O O     . ALA C 2 51  ? 7.405   13.631  34.779 1.00 15.49 ? 51   ALA A O     1 
ATOM   821  C CB    . ALA C 2 51  ? 5.714   15.153  36.284 1.00 15.47 ? 51   ALA A CB    1 
ATOM   822  N N     . THR C 2 52  ? 8.230   12.413  36.482 1.00 15.67 ? 52   THR A N     1 
ATOM   823  C CA    . THR C 2 52  ? 9.040   11.535  35.624 1.00 14.63 ? 52   THR A CA    1 
ATOM   824  C C     . THR C 2 52  ? 8.982   10.099  36.152 1.00 13.88 ? 52   THR A C     1 
ATOM   825  O O     . THR C 2 52  ? 8.758   9.887   37.347 1.00 14.08 ? 52   THR A O     1 
ATOM   826  C CB    . THR C 2 52  ? 10.533  11.975  35.604 1.00 14.43 ? 52   THR A CB    1 
ATOM   827  O OG1   . THR C 2 52  ? 11.094  11.846  36.917 1.00 15.27 ? 52   THR A OG1   1 
ATOM   828  C CG2   . THR C 2 52  ? 10.671  13.417  35.152 1.00 13.60 ? 52   THR A CG2   1 
ATOM   829  N N     . ASN C 2 53  ? 9.167   9.117   35.271 1.00 12.80 ? 53   ASN A N     1 
ATOM   830  C CA    . ASN C 2 53  ? 9.151   7.714   35.692 1.00 13.43 ? 53   ASN A CA    1 
ATOM   831  C C     . ASN C 2 53  ? 10.320  7.386   36.637 1.00 14.07 ? 53   ASN A C     1 
ATOM   832  O O     . ASN C 2 53  ? 10.181  6.571   37.561 1.00 15.57 ? 53   ASN A O     1 
ATOM   833  C CB    . ASN C 2 53  ? 9.188   6.775   34.479 1.00 13.22 ? 53   ASN A CB    1 
ATOM   834  C CG    . ASN C 2 53  ? 7.833   6.657   33.776 1.00 14.66 ? 53   ASN A CG    1 
ATOM   835  O OD1   . ASN C 2 53  ? 6.807   7.124   34.281 1.00 16.42 ? 53   ASN A OD1   1 
ATOM   836  N ND2   . ASN C 2 53  ? 7.828   6.021   32.608 1.00 12.46 ? 53   ASN A ND2   1 
ATOM   837  N N     . SER C 2 54  ? 11.455  8.053   36.430 1.00 13.26 ? 54   SER A N     1 
ATOM   838  C CA    . SER C 2 54  ? 12.642  7.831   37.248 1.00 12.37 ? 54   SER A CA    1 
ATOM   839  C C     . SER C 2 54  ? 12.410  8.215   38.692 1.00 12.92 ? 54   SER A C     1 
ATOM   840  O O     . SER C 2 54  ? 12.608  7.407   39.605 1.00 14.55 ? 54   SER A O     1 
ATOM   841  C CB    . SER C 2 54  ? 13.818  8.640   36.706 1.00 11.30 ? 54   SER A CB    1 
ATOM   842  O OG    . SER C 2 54  ? 13.988  8.404   35.323 1.00 10.42 ? 54   SER A OG    1 
ATOM   843  N N     . GLU C 2 55  ? 11.996  9.460   38.890 1.00 13.17 ? 55   GLU A N     1 
ATOM   844  C CA    . GLU C 2 55  ? 11.748  9.998   40.215 1.00 13.35 ? 55   GLU A CA    1 
ATOM   845  C C     . GLU C 2 55  ? 10.677  9.219   40.940 1.00 13.69 ? 55   GLU A C     1 
ATOM   846  O O     . GLU C 2 55  ? 10.765  9.002   42.155 1.00 15.36 ? 55   GLU A O     1 
ATOM   847  C CB    . GLU C 2 55  ? 11.390  11.472  40.099 1.00 14.14 ? 55   GLU A CB    1 
ATOM   848  C CG    . GLU C 2 55  ? 12.541  12.256  39.507 1.00 15.22 ? 55   GLU A CG    1 
ATOM   849  C CD    . GLU C 2 55  ? 12.213  13.695  39.225 1.00 14.78 ? 55   GLU A CD    1 
ATOM   850  O OE1   . GLU C 2 55  ? 11.419  13.963  38.302 1.00 14.96 ? 55   GLU A OE1   1 
ATOM   851  O OE2   . GLU C 2 55  ? 12.777  14.558  39.915 1.00 14.06 ? 55   GLU A OE2   1 
ATOM   852  N N     . LEU C 2 56  ? 9.673   8.783   40.190 1.00 13.51 ? 56   LEU A N     1 
ATOM   853  C CA    . LEU C 2 56  ? 8.592   7.987   40.754 1.00 13.62 ? 56   LEU A CA    1 
ATOM   854  C C     . LEU C 2 56  ? 9.148   6.661   41.276 1.00 13.00 ? 56   LEU A C     1 
ATOM   855  O O     . LEU C 2 56  ? 8.879   6.272   42.412 1.00 13.40 ? 56   LEU A O     1 
ATOM   856  C CB    . LEU C 2 56  ? 7.502   7.755   39.698 1.00 14.32 ? 56   LEU A CB    1 
ATOM   857  C CG    . LEU C 2 56  ? 6.515   8.918   39.517 1.00 14.21 ? 56   LEU A CG    1 
ATOM   858  C CD1   . LEU C 2 56  ? 5.688   8.733   38.265 1.00 14.54 ? 56   LEU A CD1   1 
ATOM   859  C CD2   . LEU C 2 56  ? 5.609   8.991   40.734 1.00 14.27 ? 56   LEU A CD2   1 
ATOM   860  N N     . LEU C 2 57  ? 9.984   6.008   40.475 1.00 12.91 ? 57   LEU A N     1 
ATOM   861  C CA    . LEU C 2 57  ? 10.578  4.737   40.881 1.00 13.75 ? 57   LEU A CA    1 
ATOM   862  C C     . LEU C 2 57  ? 11.493  4.857   42.098 1.00 14.10 ? 57   LEU A C     1 
ATOM   863  O O     . LEU C 2 57  ? 11.460  3.999   42.979 1.00 14.79 ? 57   LEU A O     1 
ATOM   864  C CB    . LEU C 2 57  ? 11.327  4.079   39.710 1.00 15.50 ? 57   LEU A CB    1 
ATOM   865  C CG    . LEU C 2 57  ? 10.510  3.346   38.633 1.00 15.15 ? 57   LEU A CG    1 
ATOM   866  C CD1   . LEU C 2 57  ? 11.417  2.962   37.469 1.00 15.97 ? 57   LEU A CD1   1 
ATOM   867  C CD2   . LEU C 2 57  ? 9.835   2.105   39.215 1.00 14.32 ? 57   LEU A CD2   1 
ATOM   868  N N     . CYS C 2 58  ? 12.302  5.917   42.152 1.00 13.90 ? 58   CYS A N     1 
ATOM   869  C CA    . CYS C 2 58  ? 13.214  6.123   43.278 1.00 13.39 ? 58   CYS A CA    1 
ATOM   870  C C     . CYS C 2 58  ? 12.450  6.450   44.561 1.00 13.31 ? 58   CYS A C     1 
ATOM   871  O O     . CYS C 2 58  ? 12.836  6.019   45.662 1.00 11.96 ? 58   CYS A O     1 
ATOM   872  C CB    . CYS C 2 58  ? 14.238  7.214   42.947 1.00 14.32 ? 58   CYS A CB    1 
ATOM   873  S SG    . CYS C 2 58  ? 15.335  6.781   41.573 1.00 14.49 ? 58   CYS A SG    1 
ATOM   874  N N     . GLU C 2 59  ? 11.367  7.216   44.416 1.00 13.46 ? 59   GLU A N     1 
ATOM   875  C CA    . GLU C 2 59  ? 10.513  7.571   45.552 1.00 13.93 ? 59   GLU A CA    1 
ATOM   876  C C     . GLU C 2 59  ? 9.955   6.273   46.144 1.00 13.39 ? 59   GLU A C     1 
ATOM   877  O O     . GLU C 2 59  ? 9.982   6.068   47.352 1.00 13.13 ? 59   GLU A O     1 
ATOM   878  C CB    . GLU C 2 59  ? 9.312   8.402   45.093 1.00 14.67 ? 59   GLU A CB    1 
ATOM   879  C CG    . GLU C 2 59  ? 9.523   9.874   44.822 1.00 14.75 ? 59   GLU A CG    1 
ATOM   880  C CD    . GLU C 2 59  ? 8.247   10.536  44.293 1.00 15.39 ? 59   GLU A CD    1 
ATOM   881  O OE1   . GLU C 2 59  ? 7.193   9.865   44.291 1.00 13.80 ? 59   GLU A OE1   1 
ATOM   882  O OE2   . GLU C 2 59  ? 8.293   11.715  43.864 1.00 15.65 ? 59   GLU A OE2   1 
ATOM   883  N N     . ALA C 2 60  ? 9.411   5.430   45.265 1.00 13.32 ? 60   ALA A N     1 
ATOM   884  C CA    . ALA C 2 60  ? 8.817   4.145   45.642 1.00 13.34 ? 60   ALA A CA    1 
ATOM   885  C C     . ALA C 2 60  ? 9.798   3.200   46.315 1.00 13.26 ? 60   ALA A C     1 
ATOM   886  O O     . ALA C 2 60  ? 9.458   2.554   47.311 1.00 11.45 ? 60   ALA A O     1 
ATOM   887  C CB    . ALA C 2 60  ? 8.211   3.473   44.417 1.00 13.42 ? 60   ALA A CB    1 
ATOM   888  N N     . PHE C 2 61  ? 11.007  3.110   45.756 1.00 14.68 ? 61   PHE A N     1 
ATOM   889  C CA    . PHE C 2 61  ? 12.043  2.243   46.309 1.00 14.25 ? 61   PHE A CA    1 
ATOM   890  C C     . PHE C 2 61  ? 12.454  2.690   47.702 1.00 13.92 ? 61   PHE A C     1 
ATOM   891  O O     . PHE C 2 61  ? 12.549  1.881   48.610 1.00 13.74 ? 61   PHE A O     1 
ATOM   892  C CB    . PHE C 2 61  ? 13.287  2.181   45.410 1.00 15.16 ? 61   PHE A CB    1 
ATOM   893  C CG    . PHE C 2 61  ? 14.388  1.355   46.004 1.00 16.32 ? 61   PHE A CG    1 
ATOM   894  C CD1   . PHE C 2 61  ? 14.332  -0.042  45.938 1.00 15.57 ? 61   PHE A CD1   1 
ATOM   895  C CD2   . PHE C 2 61  ? 15.395  1.960   46.769 1.00 16.36 ? 61   PHE A CD2   1 
ATOM   896  C CE1   . PHE C 2 61  ? 15.249  -0.828  46.635 1.00 16.77 ? 61   PHE A CE1   1 
ATOM   897  C CE2   . PHE C 2 61  ? 16.314  1.193   47.468 1.00 16.23 ? 61   PHE A CE2   1 
ATOM   898  C CZ    . PHE C 2 61  ? 16.239  -0.214  47.405 1.00 16.69 ? 61   PHE A CZ    1 
ATOM   899  N N     . LEU C 2 62  ? 12.716  3.982   47.864 1.00 15.23 ? 62   LEU A N     1 
ATOM   900  C CA    . LEU C 2 62  ? 13.107  4.506   49.167 1.00 15.21 ? 62   LEU A CA    1 
ATOM   901  C C     . LEU C 2 62  ? 11.979  4.277   50.160 1.00 15.66 ? 62   LEU A C     1 
ATOM   902  O O     . LEU C 2 62  ? 12.207  3.825   51.284 1.00 16.41 ? 62   LEU A O     1 
ATOM   903  C CB    . LEU C 2 62  ? 13.442  6.000   49.082 1.00 13.54 ? 62   LEU A CB    1 
ATOM   904  C CG    . LEU C 2 62  ? 14.768  6.418   48.436 1.00 12.94 ? 62   LEU A CG    1 
ATOM   905  C CD1   . LEU C 2 62  ? 14.848  7.943   48.400 1.00 11.92 ? 62   LEU A CD1   1 
ATOM   906  C CD2   . LEU C 2 62  ? 15.948  5.845   49.209 1.00 9.51  ? 62   LEU A CD2   1 
ATOM   907  N N     . HIS C 2 63  ? 10.755  4.565   49.730 1.00 15.46 ? 63   HIS A N     1 
ATOM   908  C CA    . HIS C 2 63  ? 9.605   4.373   50.593 1.00 16.59 ? 63   HIS A CA    1 
ATOM   909  C C     . HIS C 2 63  ? 9.466   2.915   51.040 1.00 16.31 ? 63   HIS A C     1 
ATOM   910  O O     . HIS C 2 63  ? 9.302   2.631   52.224 1.00 16.29 ? 63   HIS A O     1 
ATOM   911  C CB    . HIS C 2 63  ? 8.314   4.843   49.903 1.00 17.51 ? 63   HIS A CB    1 
ATOM   912  C CG    . HIS C 2 63  ? 7.099   4.717   50.771 1.00 19.51 ? 63   HIS A CG    1 
ATOM   913  N ND1   . HIS C 2 63  ? 6.133   3.753   50.568 1.00 20.29 ? 63   HIS A ND1   1 
ATOM   914  C CD2   . HIS C 2 63  ? 6.755   5.356   51.916 1.00 18.37 ? 63   HIS A CD2   1 
ATOM   915  C CE1   . HIS C 2 63  ? 5.257   3.793   51.556 1.00 19.68 ? 63   HIS A CE1   1 
ATOM   916  N NE2   . HIS C 2 63  ? 5.613   4.757   52.387 1.00 19.93 ? 63   HIS A NE2   1 
ATOM   917  N N     . ALA C 2 64  ? 9.592   1.993   50.096 1.00 17.85 ? 64   ALA A N     1 
ATOM   918  C CA    . ALA C 2 64  ? 9.449   0.573   50.393 1.00 19.44 ? 64   ALA A CA    1 
ATOM   919  C C     . ALA C 2 64  ? 10.575  -0.064  51.187 1.00 20.64 ? 64   ALA A C     1 
ATOM   920  O O     . ALA C 2 64  ? 10.326  -0.957  51.991 1.00 21.67 ? 64   ALA A O     1 
ATOM   921  C CB    . ALA C 2 64  ? 9.218   -0.216  49.108 1.00 19.61 ? 64   ALA A CB    1 
ATOM   922  N N     . PHE C 2 65  ? 11.807  0.396   50.991 1.00 22.13 ? 65   PHE A N     1 
ATOM   923  C CA    . PHE C 2 65  ? 12.931  -0.210  51.692 1.00 21.67 ? 65   PHE A CA    1 
ATOM   924  C C     . PHE C 2 65  ? 13.553  0.546   52.848 1.00 22.45 ? 65   PHE A C     1 
ATOM   925  O O     . PHE C 2 65  ? 14.119  -0.074  53.750 1.00 23.85 ? 65   PHE A O     1 
ATOM   926  C CB    . PHE C 2 65  ? 13.977  -0.698  50.693 1.00 21.52 ? 65   PHE A CB    1 
ATOM   927  C CG    . PHE C 2 65  ? 13.515  -1.878  49.902 1.00 20.99 ? 65   PHE A CG    1 
ATOM   928  C CD1   . PHE C 2 65  ? 13.700  -3.168  50.390 1.00 20.93 ? 65   PHE A CD1   1 
ATOM   929  C CD2   . PHE C 2 65  ? 12.823  -1.704  48.706 1.00 21.57 ? 65   PHE A CD2   1 
ATOM   930  C CE1   . PHE C 2 65  ? 13.199  -4.273  49.703 1.00 20.50 ? 65   PHE A CE1   1 
ATOM   931  C CE2   . PHE C 2 65  ? 12.314  -2.802  48.006 1.00 21.90 ? 65   PHE A CE2   1 
ATOM   932  C CZ    . PHE C 2 65  ? 12.504  -4.093  48.509 1.00 21.21 ? 65   PHE A CZ    1 
ATOM   933  N N     . THR C 2 66  ? 13.454  1.872   52.844 1.00 22.15 ? 66   THR A N     1 
ATOM   934  C CA    . THR C 2 66  ? 13.994  2.644   53.956 1.00 20.46 ? 66   THR A CA    1 
ATOM   935  C C     . THR C 2 66  ? 12.853  3.188   54.799 1.00 20.08 ? 66   THR A C     1 
ATOM   936  O O     . THR C 2 66  ? 13.054  3.546   55.952 1.00 21.19 ? 66   THR A O     1 
ATOM   937  C CB    . THR C 2 66  ? 14.878  3.810   53.492 1.00 20.97 ? 66   THR A CB    1 
ATOM   938  O OG1   . THR C 2 66  ? 14.058  4.871   52.992 1.00 21.61 ? 66   THR A OG1   1 
ATOM   939  C CG2   . THR C 2 66  ? 15.833  3.347   52.399 1.00 20.93 ? 66   THR A CG2   1 
ATOM   940  N N     . GLY C 2 67  ? 11.661  3.262   54.208 1.00 19.06 ? 67   GLY A N     1 
ATOM   941  C CA    . GLY C 2 67  ? 10.492  3.762   54.912 1.00 17.47 ? 67   GLY A CA    1 
ATOM   942  C C     . GLY C 2 67  ? 10.234  5.254   54.758 1.00 16.73 ? 67   GLY A C     1 
ATOM   943  O O     . GLY C 2 67  ? 9.339   5.802   55.397 1.00 17.41 ? 67   GLY A O     1 
ATOM   944  N N     . GLN C 2 68  ? 10.990  5.908   53.886 1.00 16.10 ? 68   GLN A N     1 
ATOM   945  C CA    . GLN C 2 68  ? 10.856  7.346   53.656 1.00 15.51 ? 68   GLN A CA    1 
ATOM   946  C C     . GLN C 2 68  ? 9.494   7.732   53.088 1.00 16.17 ? 68   GLN A C     1 
ATOM   947  O O     . GLN C 2 68  ? 9.087   7.229   52.034 1.00 16.69 ? 68   GLN A O     1 
ATOM   948  C CB    . GLN C 2 68  ? 11.966  7.821   52.716 1.00 13.94 ? 68   GLN A CB    1 
ATOM   949  C CG    . GLN C 2 68  ? 11.976  9.311   52.433 1.00 12.06 ? 68   GLN A CG    1 
ATOM   950  C CD    . GLN C 2 68  ? 13.200  9.725   51.659 1.00 11.50 ? 68   GLN A CD    1 
ATOM   951  O OE1   . GLN C 2 68  ? 14.316  9.618   52.156 1.00 12.97 ? 68   GLN A OE1   1 
ATOM   952  N NE2   . GLN C 2 68  ? 13.007  10.169  50.429 1.00 8.97  ? 68   GLN A NE2   1 
ATOM   953  N N     . PRO C 2 69  ? 8.793   8.671   53.752 1.00 15.60 ? 69   PRO A N     1 
ATOM   954  C CA    . PRO C 2 69  ? 7.467   9.136   53.319 1.00 15.22 ? 69   PRO A CA    1 
ATOM   955  C C     . PRO C 2 69  ? 7.443   9.593   51.866 1.00 15.24 ? 69   PRO A C     1 
ATOM   956  O O     . PRO C 2 69  ? 8.393   10.207  51.383 1.00 16.22 ? 69   PRO A O     1 
ATOM   957  C CB    . PRO C 2 69  ? 7.189   10.300  54.270 1.00 14.56 ? 69   PRO A CB    1 
ATOM   958  C CG    . PRO C 2 69  ? 7.888   9.884   55.523 1.00 15.21 ? 69   PRO A CG    1 
ATOM   959  C CD    . PRO C 2 69  ? 9.201   9.344   55.001 1.00 15.57 ? 69   PRO A CD    1 
ATOM   960  N N     . LEU C 2 70  ? 6.368   9.266   51.160 1.00 14.88 ? 70   LEU A N     1 
ATOM   961  C CA    . LEU C 2 70  ? 6.234   9.670   49.762 1.00 15.46 ? 70   LEU A CA    1 
ATOM   962  C C     . LEU C 2 70  ? 5.699   11.105  49.718 1.00 15.76 ? 70   LEU A C     1 
ATOM   963  O O     . LEU C 2 70  ? 5.236   11.625  50.727 1.00 16.14 ? 70   LEU A O     1 
ATOM   964  C CB    . LEU C 2 70  ? 5.270   8.733   49.020 1.00 14.87 ? 70   LEU A CB    1 
ATOM   965  C CG    . LEU C 2 70  ? 5.646   7.288   48.675 1.00 14.43 ? 70   LEU A CG    1 
ATOM   966  C CD1   . LEU C 2 70  ? 4.390   6.545   48.254 1.00 14.91 ? 70   LEU A CD1   1 
ATOM   967  C CD2   . LEU C 2 70  ? 6.672   7.242   47.558 1.00 13.08 ? 70   LEU A CD2   1 
ATOM   968  N N     . PRO C 2 71  ? 5.862   11.801  48.580 1.00 16.55 ? 71   PRO A N     1 
ATOM   969  C CA    . PRO C 2 71  ? 5.346   13.170  48.520 1.00 17.36 ? 71   PRO A CA    1 
ATOM   970  C C     . PRO C 2 71  ? 3.843   13.272  48.209 1.00 19.11 ? 71   PRO A C     1 
ATOM   971  O O     . PRO C 2 71  ? 3.327   12.557  47.344 1.00 19.78 ? 71   PRO A O     1 
ATOM   972  C CB    . PRO C 2 71  ? 6.169   13.784  47.390 1.00 15.06 ? 71   PRO A CB    1 
ATOM   973  C CG    . PRO C 2 71  ? 6.375   12.648  46.481 1.00 13.70 ? 71   PRO A CG    1 
ATOM   974  C CD    . PRO C 2 71  ? 6.756   11.542  47.436 1.00 15.14 ? 71   PRO A CD    1 
ATOM   975  N N     . ASP C 2 72  ? 3.159   14.156  48.936 1.00 20.24 ? 72   ASP A N     1 
ATOM   976  C CA    . ASP C 2 72  ? 1.743   14.439  48.720 1.00 20.97 ? 72   ASP A CA    1 
ATOM   977  C C     . ASP C 2 72  ? 1.741   15.378  47.531 1.00 21.36 ? 72   ASP A C     1 
ATOM   978  O O     . ASP C 2 72  ? 2.761   16.006  47.232 1.00 22.47 ? 72   ASP A O     1 
ATOM   979  C CB    . ASP C 2 72  ? 1.150   15.213  49.909 1.00 21.94 ? 72   ASP A CB    1 
ATOM   980  C CG    . ASP C 2 72  ? 0.558   14.309  50.967 1.00 23.40 ? 72   ASP A CG    1 
ATOM   981  O OD1   . ASP C 2 72  ? 0.283   13.137  50.657 1.00 25.98 ? 72   ASP A OD1   1 
ATOM   982  O OD2   . ASP C 2 72  ? 0.337   14.772  52.108 1.00 23.91 ? 72   ASP A OD2   1 
ATOM   983  N N     . ASP C 2 73  ? 0.603   15.508  46.863 1.00 20.92 ? 73   ASP A N     1 
ATOM   984  C CA    . ASP C 2 73  ? 0.518   16.426  45.738 1.00 19.96 ? 73   ASP A CA    1 
ATOM   985  C C     . ASP C 2 73  ? 0.820   17.856  46.231 1.00 18.27 ? 73   ASP A C     1 
ATOM   986  O O     . ASP C 2 73  ? 1.385   18.666  45.502 1.00 16.60 ? 73   ASP A O     1 
ATOM   987  C CB    . ASP C 2 73  ? -0.870  16.341  45.095 1.00 21.57 ? 73   ASP A CB    1 
ATOM   988  C CG    . ASP C 2 73  ? -1.018  15.148  44.152 1.00 22.21 ? 73   ASP A CG    1 
ATOM   989  O OD1   . ASP C 2 73  ? -0.106  14.296  44.077 1.00 21.99 ? 73   ASP A OD1   1 
ATOM   990  O OD2   . ASP C 2 73  ? -2.056  15.079  43.459 1.00 23.40 ? 73   ASP A OD2   1 
ATOM   991  N N     . ALA C 2 74  ? 0.484   18.126  47.490 1.00 17.34 ? 74   ALA A N     1 
ATOM   992  C CA    . ALA C 2 74  ? 0.724   19.424  48.107 1.00 18.25 ? 74   ALA A CA    1 
ATOM   993  C C     . ALA C 2 74  ? 2.225   19.716  48.166 1.00 18.63 ? 74   ALA A C     1 
ATOM   994  O O     . ALA C 2 74  ? 2.663   20.842  47.925 1.00 19.56 ? 74   ALA A O     1 
ATOM   995  C CB    . ALA C 2 74  ? 0.122   19.462  49.514 1.00 16.20 ? 74   ALA A CB    1 
ATOM   996  N N     . ASP C 2 75  ? 3.015   18.683  48.445 1.00 18.77 ? 75   ASP A N     1 
ATOM   997  C CA    . ASP C 2 75  ? 4.472   18.815  48.523 1.00 18.29 ? 75   ASP A CA    1 
ATOM   998  C C     . ASP C 2 75  ? 5.118   19.098  47.169 1.00 18.08 ? 75   ASP A C     1 
ATOM   999  O O     . ASP C 2 75  ? 6.239   19.600  47.110 1.00 18.82 ? 75   ASP A O     1 
ATOM   1000 C CB    . ASP C 2 75  ? 5.089   17.527  49.079 1.00 18.15 ? 75   ASP A CB    1 
ATOM   1001 C CG    . ASP C 2 75  ? 4.664   17.238  50.499 1.00 17.08 ? 75   ASP A CG    1 
ATOM   1002 O OD1   . ASP C 2 75  ? 4.696   18.153  51.334 1.00 17.61 ? 75   ASP A OD1   1 
ATOM   1003 O OD2   . ASP C 2 75  ? 4.326   16.079  50.793 1.00 18.31 ? 75   ASP A OD2   1 
ATOM   1004 N N     . LEU C 2 76  ? 4.408   18.761  46.092 1.00 17.79 ? 76   LEU A N     1 
ATOM   1005 C CA    . LEU C 2 76  ? 4.907   18.923  44.726 1.00 17.13 ? 76   LEU A CA    1 
ATOM   1006 C C     . LEU C 2 76  ? 4.388   20.137  43.945 1.00 18.64 ? 76   LEU A C     1 
ATOM   1007 O O     . LEU C 2 76  ? 4.581   20.215  42.729 1.00 17.83 ? 76   LEU A O     1 
ATOM   1008 C CB    . LEU C 2 76  ? 4.624   17.647  43.923 1.00 15.69 ? 76   LEU A CB    1 
ATOM   1009 C CG    . LEU C 2 76  ? 5.016   16.294  44.524 1.00 13.29 ? 76   LEU A CG    1 
ATOM   1010 C CD1   . LEU C 2 76  ? 4.370   15.187  43.717 1.00 12.74 ? 76   LEU A CD1   1 
ATOM   1011 C CD2   . LEU C 2 76  ? 6.525   16.137  44.545 1.00 12.69 ? 76   LEU A CD2   1 
ATOM   1012 N N     . ARG C 2 77  ? 3.732   21.077  44.625 1.00 20.45 ? 77   ARG A N     1 
ATOM   1013 C CA    . ARG C 2 77  ? 3.226   22.274  43.949 1.00 22.32 ? 77   ARG A CA    1 
ATOM   1014 C C     . ARG C 2 77  ? 4.395   23.176  43.581 1.00 23.82 ? 77   ARG A C     1 
ATOM   1015 O O     . ARG C 2 77  ? 5.288   23.407  44.396 1.00 23.41 ? 77   ARG A O     1 
ATOM   1016 C CB    . ARG C 2 77  ? 2.302   23.075  44.860 1.00 24.22 ? 77   ARG A CB    1 
ATOM   1017 C CG    . ARG C 2 77  ? 1.169   22.318  45.468 1.00 26.27 ? 77   ARG A CG    1 
ATOM   1018 C CD    . ARG C 2 77  ? 0.120   21.911  44.457 1.00 29.54 ? 77   ARG A CD    1 
ATOM   1019 N NE    . ARG C 2 77  ? -1.002  21.342  45.193 1.00 32.08 ? 77   ARG A NE    1 
ATOM   1020 C CZ    . ARG C 2 77  ? -1.943  20.554  44.688 1.00 33.41 ? 77   ARG A CZ    1 
ATOM   1021 N NH1   . ARG C 2 77  ? -1.936  20.212  43.401 1.00 32.96 ? 77   ARG A NH1   1 
ATOM   1022 N NH2   . ARG C 2 77  ? -2.897  20.111  45.495 1.00 34.63 ? 77   ARG A NH2   1 
ATOM   1023 N N     . LYS C 2 78  ? 4.359   23.728  42.375 1.00 24.52 ? 78   LYS A N     1 
ATOM   1024 C CA    . LYS C 2 78  ? 5.418   24.613  41.923 1.00 26.74 ? 78   LYS A CA    1 
ATOM   1025 C C     . LYS C 2 78  ? 5.373   25.990  42.586 1.00 29.40 ? 78   LYS A C     1 
ATOM   1026 O O     . LYS C 2 78  ? 6.283   26.794  42.405 1.00 30.37 ? 78   LYS A O     1 
ATOM   1027 C CB    . LYS C 2 78  ? 5.399   24.726  40.397 1.00 25.13 ? 78   LYS A CB    1 
ATOM   1028 C CG    . LYS C 2 78  ? 5.719   23.404  39.715 1.00 23.20 ? 78   LYS A CG    1 
ATOM   1029 C CD    . LYS C 2 78  ? 5.598   23.473  38.217 1.00 20.48 ? 78   LYS A CD    1 
ATOM   1030 C CE    . LYS C 2 78  ? 5.977   22.144  37.618 1.00 19.92 ? 78   LYS A CE    1 
ATOM   1031 N NZ    . LYS C 2 78  ? 5.820   22.130  36.144 1.00 21.05 ? 78   LYS A NZ    1 
ATOM   1032 N N     . GLU C 2 79  ? 4.311   26.257  43.347 1.00 32.59 ? 79   GLU A N     1 
ATOM   1033 C CA    . GLU C 2 79  ? 4.155   27.525  44.073 1.00 34.54 ? 79   GLU A CA    1 
ATOM   1034 C C     . GLU C 2 79  ? 4.865   27.415  45.424 1.00 34.76 ? 79   GLU A C     1 
ATOM   1035 O O     . GLU C 2 79  ? 5.115   28.416  46.102 1.00 35.03 ? 79   GLU A O     1 
ATOM   1036 C CB    . GLU C 2 79  ? 2.678   27.856  44.299 1.00 36.23 ? 79   GLU A CB    1 
ATOM   1037 C CG    . GLU C 2 79  ? 1.908   28.204  43.041 1.00 39.34 ? 79   GLU A CG    1 
ATOM   1038 C CD    . GLU C 2 79  ? 1.712   27.008  42.130 1.00 42.61 ? 79   GLU A CD    1 
ATOM   1039 O OE1   . GLU C 2 79  ? 1.243   25.950  42.623 1.00 42.42 ? 79   GLU A OE1   1 
ATOM   1040 O OE2   . GLU C 2 79  ? 2.033   27.129  40.921 1.00 45.04 ? 79   GLU A OE2   1 
ATOM   1041 N N     . ARG C 2 80  ? 5.134   26.176  45.820 1.00 34.80 ? 80   ARG A N     1 
ATOM   1042 C CA    . ARG C 2 80  ? 5.830   25.864  47.056 1.00 34.91 ? 80   ARG A CA    1 
ATOM   1043 C C     . ARG C 2 80  ? 7.276   25.567  46.667 1.00 34.84 ? 80   ARG A C     1 
ATOM   1044 O O     . ARG C 2 80  ? 7.542   25.080  45.567 1.00 35.99 ? 80   ARG A O     1 
ATOM   1045 C CB    . ARG C 2 80  ? 5.220   24.607  47.680 1.00 36.25 ? 80   ARG A CB    1 
ATOM   1046 C CG    . ARG C 2 80  ? 5.925   24.085  48.927 1.00 38.60 ? 80   ARG A CG    1 
ATOM   1047 C CD    . ARG C 2 80  ? 5.636   22.591  49.144 1.00 40.40 ? 80   ARG A CD    1 
ATOM   1048 N NE    . ARG C 2 80  ? 6.113   22.118  50.445 1.00 41.24 ? 80   ARG A NE    1 
ATOM   1049 C CZ    . ARG C 2 80  ? 7.014   21.153  50.628 1.00 41.43 ? 80   ARG A CZ    1 
ATOM   1050 N NH1   . ARG C 2 80  ? 7.558   20.527  49.585 1.00 40.64 ? 80   ARG A NH1   1 
ATOM   1051 N NH2   . ARG C 2 80  ? 7.369   20.816  51.864 1.00 39.82 ? 80   ARG A NH2   1 
ATOM   1052 N N     . SER C 2 81  ? 8.209   25.859  47.562 1.00 33.96 ? 81   SER A N     1 
ATOM   1053 C CA    . SER C 2 81  ? 9.614   25.585  47.301 1.00 32.73 ? 81   SER A CA    1 
ATOM   1054 C C     . SER C 2 81  ? 9.791   24.068  47.270 1.00 31.29 ? 81   SER A C     1 
ATOM   1055 O O     . SER C 2 81  ? 9.080   23.339  47.964 1.00 31.03 ? 81   SER A O     1 
ATOM   1056 C CB    . SER C 2 81  ? 10.478  26.187  48.407 1.00 34.29 ? 81   SER A CB    1 
ATOM   1057 O OG    . SER C 2 81  ? 10.208  27.569  48.573 1.00 37.20 ? 81   SER A OG    1 
ATOM   1058 N N     . ASP C 2 82  ? 10.725  23.604  46.447 1.00 30.41 ? 82   ASP A N     1 
ATOM   1059 C CA    . ASP C 2 82  ? 11.011  22.178  46.291 1.00 29.38 ? 82   ASP A CA    1 
ATOM   1060 C C     . ASP C 2 82  ? 11.673  21.638  47.563 1.00 28.89 ? 82   ASP A C     1 
ATOM   1061 O O     . ASP C 2 82  ? 12.873  21.366  47.592 1.00 28.59 ? 82   ASP A O     1 
ATOM   1062 C CB    . ASP C 2 82  ? 11.928  21.976  45.076 1.00 29.10 ? 82   ASP A CB    1 
ATOM   1063 C CG    . ASP C 2 82  ? 11.827  20.583  44.484 1.00 29.30 ? 82   ASP A CG    1 
ATOM   1064 O OD1   . ASP C 2 82  ? 11.147  19.717  45.072 1.00 29.26 ? 82   ASP A OD1   1 
ATOM   1065 O OD2   . ASP C 2 82  ? 12.428  20.365  43.413 1.00 28.85 ? 82   ASP A OD2   1 
ATOM   1066 N N     . GLU C 2 83  ? 10.867  21.448  48.601 1.00 27.61 ? 83   GLU A N     1 
ATOM   1067 C CA    . GLU C 2 83  ? 11.370  20.979  49.877 1.00 26.94 ? 83   GLU A CA    1 
ATOM   1068 C C     . GLU C 2 83  ? 10.942  19.570  50.244 1.00 26.19 ? 83   GLU A C     1 
ATOM   1069 O O     . GLU C 2 83  ? 10.092  18.976  49.587 1.00 26.78 ? 83   GLU A O     1 
ATOM   1070 C CB    . GLU C 2 83  ? 10.951  21.957  50.975 1.00 27.60 ? 83   GLU A CB    1 
ATOM   1071 C CG    . GLU C 2 83  ? 11.692  23.278  50.907 1.00 30.31 ? 83   GLU A CG    1 
ATOM   1072 C CD    . GLU C 2 83  ? 11.184  24.278  51.907 1.00 32.60 ? 83   GLU A CD    1 
ATOM   1073 O OE1   . GLU C 2 83  ? 11.383  24.067  53.123 1.00 34.88 ? 83   GLU A OE1   1 
ATOM   1074 O OE2   . GLU C 2 83  ? 10.580  25.282  51.479 1.00 34.74 ? 83   GLU A OE2   1 
ATOM   1075 N N     . ILE C 2 84  ? 11.578  19.041  51.286 1.00 24.90 ? 84   ILE A N     1 
ATOM   1076 C CA    . ILE C 2 84  ? 11.299  17.711  51.827 1.00 23.74 ? 84   ILE A CA    1 
ATOM   1077 C C     . ILE C 2 84  ? 9.807   17.658  52.197 1.00 23.43 ? 84   ILE A C     1 
ATOM   1078 O O     . ILE C 2 84  ? 9.278   18.621  52.751 1.00 23.75 ? 84   ILE A O     1 
ATOM   1079 C CB    . ILE C 2 84  ? 12.162  17.481  53.127 1.00 22.48 ? 84   ILE A CB    1 
ATOM   1080 C CG1   . ILE C 2 84  ? 13.650  17.410  52.769 1.00 22.07 ? 84   ILE A CG1   1 
ATOM   1081 C CG2   . ILE C 2 84  ? 11.705  16.247  53.914 1.00 20.29 ? 84   ILE A CG2   1 
ATOM   1082 C CD1   . ILE C 2 84  ? 14.571  17.253  53.980 1.00 20.51 ? 84   ILE A CD1   1 
ATOM   1083 N N     . PRO C 2 85  ? 9.104   16.556  51.850 1.00 23.13 ? 85   PRO A N     1 
ATOM   1084 C CA    . PRO C 2 85  ? 7.678   16.408  52.167 1.00 21.24 ? 85   PRO A CA    1 
ATOM   1085 C C     . PRO C 2 85  ? 7.432   16.743  53.626 1.00 20.07 ? 85   PRO A C     1 
ATOM   1086 O O     . PRO C 2 85  ? 8.238   16.403  54.492 1.00 19.19 ? 85   PRO A O     1 
ATOM   1087 C CB    . PRO C 2 85  ? 7.434   14.933  51.892 1.00 21.84 ? 85   PRO A CB    1 
ATOM   1088 C CG    . PRO C 2 85  ? 8.297   14.699  50.699 1.00 22.85 ? 85   PRO A CG    1 
ATOM   1089 C CD    . PRO C 2 85  ? 9.584   15.394  51.076 1.00 23.39 ? 85   PRO A CD    1 
ATOM   1090 N N     . GLU C 2 86  ? 6.334   17.438  53.894 1.00 19.86 ? 86   GLU A N     1 
ATOM   1091 C CA    . GLU C 2 86  ? 6.014   17.839  55.256 1.00 20.44 ? 86   GLU A CA    1 
ATOM   1092 C C     . GLU C 2 86  ? 5.945   16.720  56.283 1.00 19.42 ? 86   GLU A C     1 
ATOM   1093 O O     . GLU C 2 86  ? 6.373   16.898  57.425 1.00 19.19 ? 86   GLU A O     1 
ATOM   1094 C CB    . GLU C 2 86  ? 4.746   18.695  55.286 1.00 23.19 ? 86   GLU A CB    1 
ATOM   1095 C CG    . GLU C 2 86  ? 4.965   20.107  54.751 1.00 26.64 ? 86   GLU A CG    1 
ATOM   1096 C CD    . GLU C 2 86  ? 6.150   20.819  55.415 1.00 28.87 ? 86   GLU A CD    1 
ATOM   1097 O OE1   . GLU C 2 86  ? 6.243   20.835  56.675 1.00 29.19 ? 86   GLU A OE1   1 
ATOM   1098 O OE2   . GLU C 2 86  ? 7.019   21.324  54.671 1.00 29.66 ? 86   GLU A OE2   1 
ATOM   1099 N N     . ALA C 2 87  ? 5.414   15.571  55.877 1.00 19.22 ? 87   ALA A N     1 
ATOM   1100 C CA    . ALA C 2 87  ? 5.307   14.408  56.762 1.00 18.42 ? 87   ALA A CA    1 
ATOM   1101 C C     . ALA C 2 87  ? 6.707   13.950  57.140 1.00 18.12 ? 87   ALA A C     1 
ATOM   1102 O O     . ALA C 2 87  ? 6.969   13.607  58.290 1.00 17.78 ? 87   ALA A O     1 
ATOM   1103 C CB    . ALA C 2 87  ? 4.559   13.276  56.062 1.00 17.62 ? 87   ALA A CB    1 
ATOM   1104 N N     . ALA C 2 88  ? 7.603   13.975  56.152 1.00 18.79 ? 88   ALA A N     1 
ATOM   1105 C CA    . ALA C 2 88  ? 8.999   13.582  56.323 1.00 17.97 ? 88   ALA A CA    1 
ATOM   1106 C C     . ALA C 2 88  ? 9.734   14.562  57.237 1.00 17.79 ? 88   ALA A C     1 
ATOM   1107 O O     . ALA C 2 88  ? 10.444  14.145  58.150 1.00 17.90 ? 88   ALA A O     1 
ATOM   1108 C CB    . ALA C 2 88  ? 9.686   13.492  54.964 1.00 17.18 ? 88   ALA A CB    1 
ATOM   1109 N N     . LYS C 2 89  ? 9.519   15.861  57.037 1.00 18.28 ? 89   LYS A N     1 
ATOM   1110 C CA    . LYS C 2 89  ? 10.178  16.863  57.876 1.00 18.51 ? 89   LYS A CA    1 
ATOM   1111 C C     . LYS C 2 89  ? 9.858   16.645  59.341 1.00 18.50 ? 89   LYS A C     1 
ATOM   1112 O O     . LYS C 2 89  ? 10.746  16.636  60.196 1.00 18.74 ? 89   LYS A O     1 
ATOM   1113 C CB    . LYS C 2 89  ? 9.752   18.281  57.500 1.00 17.77 ? 89   LYS A CB    1 
ATOM   1114 C CG    . LYS C 2 89  ? 10.282  18.796  56.184 1.00 18.20 ? 89   LYS A CG    1 
ATOM   1115 C CD    . LYS C 2 89  ? 10.006  20.282  56.100 1.00 19.33 ? 89   LYS A CD    1 
ATOM   1116 C CE    . LYS C 2 89  ? 10.380  20.855  54.753 1.00 20.38 ? 89   LYS A CE    1 
ATOM   1117 N NZ    . LYS C 2 89  ? 9.859   22.248  54.582 1.00 20.30 ? 89   LYS A NZ    1 
ATOM   1118 N N     . GLU C 2 90  ? 8.574   16.452  59.614 1.00 18.41 ? 90   GLU A N     1 
ATOM   1119 C CA    . GLU C 2 90  ? 8.086   16.252  60.966 1.00 18.01 ? 90   GLU A CA    1 
ATOM   1120 C C     . GLU C 2 90  ? 8.694   15.027  61.644 1.00 18.44 ? 90   GLU A C     1 
ATOM   1121 O O     . GLU C 2 90  ? 9.064   15.075  62.821 1.00 18.69 ? 90   GLU A O     1 
ATOM   1122 C CB    . GLU C 2 90  ? 6.564   16.165  60.924 1.00 18.58 ? 90   GLU A CB    1 
ATOM   1123 C CG    . GLU C 2 90  ? 5.900   16.065  62.270 1.00 20.21 ? 90   GLU A CG    1 
ATOM   1124 C CD    . GLU C 2 90  ? 6.237   17.209  63.195 1.00 20.40 ? 90   GLU A CD    1 
ATOM   1125 O OE1   . GLU C 2 90  ? 6.597   18.321  62.733 1.00 21.20 ? 90   GLU A OE1   1 
ATOM   1126 O OE2   . GLU C 2 90  ? 6.103   17.006  64.417 1.00 22.80 ? 90   GLU A OE2   1 
ATOM   1127 N N     . ILE C 2 91  ? 8.806   13.935  60.891 1.00 19.83 ? 91   ILE A N     1 
ATOM   1128 C CA    . ILE C 2 91  ? 9.380   12.691  61.395 1.00 19.60 ? 91   ILE A CA    1 
ATOM   1129 C C     . ILE C 2 91  ? 10.850  12.936  61.707 1.00 20.47 ? 91   ILE A C     1 
ATOM   1130 O O     . ILE C 2 91  ? 11.332  12.508  62.756 1.00 20.96 ? 91   ILE A O     1 
ATOM   1131 C CB    . ILE C 2 91  ? 9.241   11.529  60.365 1.00 20.72 ? 91   ILE A CB    1 
ATOM   1132 C CG1   . ILE C 2 91  ? 7.751   11.220  60.118 1.00 20.73 ? 91   ILE A CG1   1 
ATOM   1133 C CG2   . ILE C 2 91  ? 9.999   10.273  60.859 1.00 18.22 ? 91   ILE A CG2   1 
ATOM   1134 C CD1   . ILE C 2 91  ? 7.474   10.214  59.009 1.00 18.57 ? 91   ILE A CD1   1 
ATOM   1135 N N     . MET C 2 92  ? 11.544  13.645  60.810 1.00 20.53 ? 92   MET A N     1 
ATOM   1136 C CA    . MET C 2 92  ? 12.964  13.980  60.993 1.00 20.92 ? 92   MET A CA    1 
ATOM   1137 C C     . MET C 2 92  ? 13.154  14.703  62.322 1.00 21.69 ? 92   MET A C     1 
ATOM   1138 O O     . MET C 2 92  ? 14.029  14.349  63.110 1.00 21.41 ? 92   MET A O     1 
ATOM   1139 C CB    . MET C 2 92  ? 13.459  14.874  59.854 1.00 19.88 ? 92   MET A CB    1 
ATOM   1140 C CG    . MET C 2 92  ? 13.554  14.165  58.523 1.00 19.65 ? 92   MET A CG    1 
ATOM   1141 S SD    . MET C 2 92  ? 13.976  15.244  57.152 1.00 22.12 ? 92   MET A SD    1 
ATOM   1142 C CE    . MET C 2 92  ? 15.681  15.523  57.484 1.00 19.87 ? 92   MET A CE    1 
ATOM   1143 N N     . ARG C 2 93  ? 12.287  15.683  62.578 1.00 23.07 ? 93   ARG A N     1 
ATOM   1144 C CA    . ARG C 2 93  ? 12.317  16.460  63.813 1.00 24.09 ? 93   ARG A CA    1 
ATOM   1145 C C     . ARG C 2 93  ? 12.106  15.592  65.046 1.00 24.51 ? 93   ARG A C     1 
ATOM   1146 O O     . ARG C 2 93  ? 12.760  15.778  66.066 1.00 24.16 ? 93   ARG A O     1 
ATOM   1147 C CB    . ARG C 2 93  ? 11.269  17.582  63.772 1.00 24.40 ? 93   ARG A CB    1 
ATOM   1148 C CG    . ARG C 2 93  ? 11.713  18.804  62.983 1.00 25.70 ? 93   ARG A CG    1 
ATOM   1149 C CD    . ARG C 2 93  ? 10.697  19.945  63.041 1.00 26.94 ? 93   ARG A CD    1 
ATOM   1150 N NE    . ARG C 2 93  ? 9.549   19.689  62.175 1.00 28.41 ? 93   ARG A NE    1 
ATOM   1151 C CZ    . ARG C 2 93  ? 9.361   20.262  60.988 1.00 29.36 ? 93   ARG A CZ    1 
ATOM   1152 N NH1   . ARG C 2 93  ? 10.241  21.142  60.511 1.00 29.27 ? 93   ARG A NH1   1 
ATOM   1153 N NH2   . ARG C 2 93  ? 8.313   19.909  60.248 1.00 30.32 ? 93   ARG A NH2   1 
ATOM   1154 N N     . GLU C 2 94  ? 11.185  14.643  64.963 1.00 25.78 ? 94   GLU A N     1 
ATOM   1155 C CA    . GLU C 2 94  ? 10.940  13.762  66.095 1.00 27.73 ? 94   GLU A CA    1 
ATOM   1156 C C     . GLU C 2 94  ? 12.087  12.770  66.284 1.00 27.55 ? 94   GLU A C     1 
ATOM   1157 O O     . GLU C 2 94  ? 12.208  12.141  67.337 1.00 28.19 ? 94   GLU A O     1 
ATOM   1158 C CB    . GLU C 2 94  ? 9.601   13.053  65.925 1.00 29.95 ? 94   GLU A CB    1 
ATOM   1159 C CG    . GLU C 2 94  ? 8.435   14.026  66.009 1.00 33.92 ? 94   GLU A CG    1 
ATOM   1160 C CD    . GLU C 2 94  ? 7.103   13.422  65.614 1.00 36.58 ? 94   GLU A CD    1 
ATOM   1161 O OE1   . GLU C 2 94  ? 7.022   12.191  65.442 1.00 37.13 ? 94   GLU A OE1   1 
ATOM   1162 O OE2   . GLU C 2 94  ? 6.129   14.198  65.493 1.00 38.78 ? 94   GLU A OE2   1 
ATOM   1163 N N     . MET C 2 95  ? 12.943  12.662  65.269 1.00 27.30 ? 95   MET A N     1 
ATOM   1164 C CA    . MET C 2 95  ? 14.110  11.777  65.314 1.00 27.56 ? 95   MET A CA    1 
ATOM   1165 C C     . MET C 2 95  ? 15.388  12.532  65.735 1.00 26.92 ? 95   MET A C     1 
ATOM   1166 O O     . MET C 2 95  ? 16.468  11.948  65.799 1.00 26.99 ? 95   MET A O     1 
ATOM   1167 C CB    . MET C 2 95  ? 14.317  11.099  63.954 1.00 27.79 ? 95   MET A CB    1 
ATOM   1168 C CG    . MET C 2 95  ? 13.145  10.222  63.497 1.00 28.74 ? 95   MET A CG    1 
ATOM   1169 S SD    . MET C 2 95  ? 13.106  8.544   64.173 1.00 30.49 ? 95   MET A SD    1 
ATOM   1170 C CE    . MET C 2 95  ? 12.350  8.804   65.774 1.00 30.05 ? 95   MET A CE    1 
ATOM   1171 N N     . GLY C 2 96  ? 15.248  13.818  66.056 1.00 26.47 ? 96   GLY A N     1 
ATOM   1172 C CA    . GLY C 2 96  ? 16.382  14.630  66.468 1.00 25.51 ? 96   GLY A CA    1 
ATOM   1173 C C     . GLY C 2 96  ? 17.235  15.052  65.286 1.00 25.65 ? 96   GLY A C     1 
ATOM   1174 O O     . GLY C 2 96  ? 18.462  15.079  65.376 1.00 25.98 ? 96   GLY A O     1 
ATOM   1175 N N     . ILE C 2 97  ? 16.579  15.303  64.158 1.00 24.55 ? 97   ILE A N     1 
ATOM   1176 C CA    . ILE C 2 97  ? 17.256  15.707  62.938 1.00 23.83 ? 97   ILE A CA    1 
ATOM   1177 C C     . ILE C 2 97  ? 16.617  17.001  62.439 1.00 24.15 ? 97   ILE A C     1 
ATOM   1178 O O     . ILE C 2 97  ? 15.415  17.045  62.148 1.00 23.76 ? 97   ILE A O     1 
ATOM   1179 C CB    . ILE C 2 97  ? 17.126  14.622  61.843 1.00 23.96 ? 97   ILE A CB    1 
ATOM   1180 C CG1   . ILE C 2 97  ? 17.821  13.336  62.287 1.00 24.64 ? 97   ILE A CG1   1 
ATOM   1181 C CG2   . ILE C 2 97  ? 17.711  15.112  60.525 1.00 23.68 ? 97   ILE A CG2   1 
ATOM   1182 C CD1   . ILE C 2 97  ? 17.679  12.209  61.298 1.00 24.68 ? 97   ILE A CD1   1 
ATOM   1183 N N     . ASN C 2 98  ? 17.435  18.037  62.297 1.00 23.48 ? 98   ASN A N     1 
ATOM   1184 C CA    . ASN C 2 98  ? 16.971  19.333  61.840 1.00 22.47 ? 98   ASN A CA    1 
ATOM   1185 C C     . ASN C 2 98  ? 16.763  19.304  60.330 1.00 22.07 ? 98   ASN A C     1 
ATOM   1186 O O     . ASN C 2 98  ? 17.724  19.332  59.561 1.00 21.87 ? 98   ASN A O     1 
ATOM   1187 C CB    . ASN C 2 98  ? 18.005  20.395  62.216 1.00 23.84 ? 98   ASN A CB    1 
ATOM   1188 C CG    . ASN C 2 98  ? 17.456  21.810  62.159 1.00 24.35 ? 98   ASN A CG    1 
ATOM   1189 O OD1   . ASN C 2 98  ? 17.681  22.596  63.070 1.00 25.06 ? 98   ASN A OD1   1 
ATOM   1190 N ND2   . ASN C 2 98  ? 16.778  22.157  61.069 1.00 23.64 ? 98   ASN A ND2   1 
ATOM   1191 N N     . PRO C 2 99  ? 15.494  19.284  59.880 1.00 21.05 ? 99   PRO A N     1 
ATOM   1192 C CA    . PRO C 2 99  ? 15.198  19.256  58.449 1.00 20.74 ? 99   PRO A CA    1 
ATOM   1193 C C     . PRO C 2 99  ? 15.637  20.524  57.710 1.00 21.73 ? 99   PRO A C     1 
ATOM   1194 O O     . PRO C 2 99  ? 15.822  20.506  56.490 1.00 19.96 ? 99   PRO A O     1 
ATOM   1195 C CB    . PRO C 2 99  ? 13.679  19.071  58.427 1.00 20.45 ? 99   PRO A CB    1 
ATOM   1196 C CG    . PRO C 2 99  ? 13.243  19.729  59.665 1.00 19.40 ? 99   PRO A CG    1 
ATOM   1197 C CD    . PRO C 2 99  ? 14.248  19.240  60.661 1.00 19.90 ? 99   PRO A CD    1 
ATOM   1198 N N     . GLU C 2 100 ? 15.791  21.621  58.450 1.00 22.87 ? 100  GLU A N     1 
ATOM   1199 C CA    . GLU C 2 100 ? 16.213  22.883  57.856 1.00 24.95 ? 100  GLU A CA    1 
ATOM   1200 C C     . GLU C 2 100 ? 17.720  22.868  57.566 1.00 25.13 ? 100  GLU A C     1 
ATOM   1201 O O     . GLU C 2 100 ? 18.167  23.448  56.575 1.00 25.61 ? 100  GLU A O     1 
ATOM   1202 C CB    . GLU C 2 100 ? 15.861  24.073  58.762 1.00 26.48 ? 100  GLU A CB    1 
ATOM   1203 C CG    . GLU C 2 100 ? 14.488  24.008  59.465 1.00 30.62 ? 100  GLU A CG    1 
ATOM   1204 C CD    . GLU C 2 100 ? 13.306  23.789  58.524 1.00 33.33 ? 100  GLU A CD    1 
ATOM   1205 O OE1   . GLU C 2 100 ? 13.308  24.339  57.397 1.00 35.30 ? 100  GLU A OE1   1 
ATOM   1206 O OE2   . GLU C 2 100 ? 12.364  23.062  58.923 1.00 35.16 ? 100  GLU A OE2   1 
ATOM   1207 N N     . THR C 2 101 ? 18.499  22.197  58.415 1.00 24.80 ? 101  THR A N     1 
ATOM   1208 C CA    . THR C 2 101 ? 19.948  22.122  58.207 1.00 25.18 ? 101  THR A CA    1 
ATOM   1209 C C     . THR C 2 101 ? 20.452  20.830  57.551 1.00 25.66 ? 101  THR A C     1 
ATOM   1210 O O     . THR C 2 101 ? 21.580  20.797  57.047 1.00 26.79 ? 101  THR A O     1 
ATOM   1211 C CB    . THR C 2 101 ? 20.732  22.325  59.505 1.00 24.33 ? 101  THR A CB    1 
ATOM   1212 O OG1   . THR C 2 101 ? 20.386  21.295  60.433 1.00 24.93 ? 101  THR A OG1   1 
ATOM   1213 C CG2   . THR C 2 101 ? 20.434  23.679  60.099 1.00 23.56 ? 101  THR A CG2   1 
ATOM   1214 N N     . TRP C 2 102 ? 19.623  19.782  57.541 1.00 24.75 ? 102  TRP A N     1 
ATOM   1215 C CA    . TRP C 2 102 ? 19.991  18.493  56.940 1.00 22.54 ? 102  TRP A CA    1 
ATOM   1216 C C     . TRP C 2 102 ? 20.539  18.709  55.536 1.00 22.62 ? 102  TRP A C     1 
ATOM   1217 O O     . TRP C 2 102 ? 19.919  19.403  54.733 1.00 22.69 ? 102  TRP A O     1 
ATOM   1218 C CB    . TRP C 2 102 ? 18.772  17.565  56.876 1.00 20.34 ? 102  TRP A CB    1 
ATOM   1219 C CG    . TRP C 2 102 ? 19.071  16.181  56.378 1.00 17.33 ? 102  TRP A CG    1 
ATOM   1220 C CD1   . TRP C 2 102 ? 18.736  15.658  55.164 1.00 16.96 ? 102  TRP A CD1   1 
ATOM   1221 C CD2   . TRP C 2 102 ? 19.751  15.135  57.095 1.00 17.24 ? 102  TRP A CD2   1 
ATOM   1222 N NE1   . TRP C 2 102 ? 19.162  14.349  55.076 1.00 16.94 ? 102  TRP A NE1   1 
ATOM   1223 C CE2   . TRP C 2 102 ? 19.786  14.003  56.247 1.00 16.77 ? 102  TRP A CE2   1 
ATOM   1224 C CE3   . TRP C 2 102 ? 20.333  15.046  58.371 1.00 15.83 ? 102  TRP A CE3   1 
ATOM   1225 C CZ2   . TRP C 2 102 ? 20.380  12.796  56.633 1.00 15.61 ? 102  TRP A CZ2   1 
ATOM   1226 C CZ3   . TRP C 2 102 ? 20.923  13.840  58.756 1.00 15.92 ? 102  TRP A CZ3   1 
ATOM   1227 C CH2   . TRP C 2 102 ? 20.941  12.734  57.891 1.00 15.74 ? 102  TRP A CH2   1 
ATOM   1228 N N     . GLU C 2 103 ? 21.714  18.150  55.259 1.00 22.48 ? 103  GLU A N     1 
ATOM   1229 C CA    . GLU C 2 103 ? 22.346  18.295  53.951 1.00 22.07 ? 103  GLU A CA    1 
ATOM   1230 C C     . GLU C 2 103 ? 22.021  17.035  53.152 1.00 20.97 ? 103  GLU A C     1 
ATOM   1231 O O     . GLU C 2 103 ? 22.087  15.930  53.677 1.00 20.36 ? 103  GLU A O     1 
ATOM   1232 C CB    . GLU C 2 103 ? 23.856  18.485  54.121 1.00 24.49 ? 103  GLU A CB    1 
ATOM   1233 C CG    . GLU C 2 103 ? 24.479  19.506  53.174 1.00 27.70 ? 103  GLU A CG    1 
ATOM   1234 C CD    . GLU C 2 103 ? 24.035  20.950  53.443 1.00 29.86 ? 103  GLU A CD    1 
ATOM   1235 O OE1   . GLU C 2 103 ? 23.984  21.383  54.623 1.00 30.98 ? 103  GLU A OE1   1 
ATOM   1236 O OE2   . GLU C 2 103 ? 23.759  21.668  52.460 1.00 30.81 ? 103  GLU A OE2   1 
ATOM   1237 N N     . TYR C 2 104 ? 21.623  17.204  51.894 1.00 20.24 ? 104  TYR A N     1 
ATOM   1238 C CA    . TYR C 2 104 ? 21.234  16.056  51.081 1.00 20.94 ? 104  TYR A CA    1 
ATOM   1239 C C     . TYR C 2 104 ? 21.164  16.364  49.600 1.00 21.22 ? 104  TYR A C     1 
ATOM   1240 O O     . TYR C 2 104 ? 20.901  15.422  48.822 1.00 21.71 ? 104  TYR A O     1 
ATOM   1241 C CB    . TYR C 2 104 ? 19.857  15.540  51.534 1.00 21.73 ? 104  TYR A CB    1 
ATOM   1242 C CG    . TYR C 2 104 ? 18.712  16.496  51.252 1.00 21.28 ? 104  TYR A CG    1 
ATOM   1243 C CD1   . TYR C 2 104 ? 18.445  17.568  52.105 1.00 21.35 ? 104  TYR A CD1   1 
ATOM   1244 C CD2   . TYR C 2 104 ? 17.915  16.341  50.120 1.00 20.73 ? 104  TYR A CD2   1 
ATOM   1245 C CE1   . TYR C 2 104 ? 17.417  18.470  51.833 1.00 22.25 ? 104  TYR A CE1   1 
ATOM   1246 C CE2   . TYR C 2 104 ? 16.885  17.233  49.839 1.00 22.28 ? 104  TYR A CE2   1 
ATOM   1247 C CZ    . TYR C 2 104 ? 16.640  18.298  50.698 1.00 22.77 ? 104  TYR A CZ    1 
ATOM   1248 O OH    . TYR C 2 104 ? 15.633  19.199  50.411 1.00 24.13 ? 104  TYR A OH    1 
ATOM   1249 O OXT   . TYR C 2 104 ? 21.283  17.552  49.246 1.00 22.81 ? 104  TYR A OXT   1 
ATOM   1250 N N     . ALA D 2 1   ? -8.337  -3.986  52.273 1.00 50.56 ? 1    ALA B N     1 
ATOM   1251 C CA    . ALA D 2 1   ? -8.089  -2.851  53.216 1.00 50.11 ? 1    ALA B CA    1 
ATOM   1252 C C     . ALA D 2 1   ? -7.647  -1.578  52.472 1.00 49.58 ? 1    ALA B C     1 
ATOM   1253 O O     . ALA D 2 1   ? -7.735  -0.468  53.009 1.00 50.22 ? 1    ALA B O     1 
ATOM   1254 C CB    . ALA D 2 1   ? -7.050  -3.255  54.263 1.00 50.15 ? 1    ALA B CB    1 
ATOM   1255 N N     . GLU D 2 2   ? -7.175  -1.762  51.238 1.00 47.86 ? 2    GLU B N     1 
ATOM   1256 C CA    . GLU D 2 2   ? -6.725  -0.684  50.344 1.00 45.46 ? 2    GLU B CA    1 
ATOM   1257 C C     . GLU D 2 2   ? -6.280  -1.296  49.018 1.00 42.73 ? 2    GLU B C     1 
ATOM   1258 O O     . GLU D 2 2   ? -6.756  -0.903  47.944 1.00 42.75 ? 2    GLU B O     1 
ATOM   1259 C CB    . GLU D 2 2   ? -5.597  0.167   50.949 1.00 46.78 ? 2    GLU B CB    1 
ATOM   1260 C CG    . GLU D 2 2   ? -6.066  1.535   51.468 1.00 49.19 ? 2    GLU B CG    1 
ATOM   1261 C CD    . GLU D 2 2   ? -7.119  2.189   50.566 1.00 50.95 ? 2    GLU B CD    1 
ATOM   1262 O OE1   . GLU D 2 2   ? -6.795  2.513   49.399 1.00 50.89 ? 2    GLU B OE1   1 
ATOM   1263 O OE2   . GLU D 2 2   ? -8.278  2.360   51.023 1.00 51.07 ? 2    GLU B OE2   1 
ATOM   1264 N N     . TRP D 2 3   ? -5.358  -2.255  49.098 1.00 38.82 ? 3    TRP B N     1 
ATOM   1265 C CA    . TRP D 2 3   ? -4.891  -2.954  47.905 1.00 33.78 ? 3    TRP B CA    1 
ATOM   1266 C C     . TRP D 2 3   ? -6.081  -3.808  47.455 1.00 32.00 ? 3    TRP B C     1 
ATOM   1267 O O     . TRP D 2 3   ? -6.628  -4.585  48.245 1.00 32.52 ? 3    TRP B O     1 
ATOM   1268 C CB    . TRP D 2 3   ? -3.688  -3.858  48.230 1.00 29.56 ? 3    TRP B CB    1 
ATOM   1269 C CG    . TRP D 2 3   ? -3.205  -4.647  47.043 1.00 24.08 ? 3    TRP B CG    1 
ATOM   1270 C CD1   . TRP D 2 3   ? -2.957  -4.166  45.793 1.00 23.57 ? 3    TRP B CD1   1 
ATOM   1271 C CD2   . TRP D 2 3   ? -2.948  -6.056  46.988 1.00 22.08 ? 3    TRP B CD2   1 
ATOM   1272 N NE1   . TRP D 2 3   ? -2.565  -5.185  44.959 1.00 22.75 ? 3    TRP B NE1   1 
ATOM   1273 C CE2   . TRP D 2 3   ? -2.550  -6.357  45.667 1.00 21.60 ? 3    TRP B CE2   1 
ATOM   1274 C CE3   . TRP D 2 3   ? -3.021  -7.095  47.922 1.00 21.47 ? 3    TRP B CE3   1 
ATOM   1275 C CZ2   . TRP D 2 3   ? -2.222  -7.655  45.257 1.00 20.12 ? 3    TRP B CZ2   1 
ATOM   1276 C CZ3   . TRP D 2 3   ? -2.696  -8.386  47.512 1.00 19.87 ? 3    TRP B CZ3   1 
ATOM   1277 C CH2   . TRP D 2 3   ? -2.302  -8.652  46.191 1.00 19.60 ? 3    TRP B CH2   1 
ATOM   1278 N N     . SER D 2 4   ? -6.492  -3.636  46.202 1.00 29.54 ? 4    SER B N     1 
ATOM   1279 C CA    . SER D 2 4   ? -7.620  -4.374  45.644 1.00 27.55 ? 4    SER B CA    1 
ATOM   1280 C C     . SER D 2 4   ? -7.471  -5.891  45.754 1.00 27.13 ? 4    SER B C     1 
ATOM   1281 O O     . SER D 2 4   ? -8.419  -6.585  46.106 1.00 27.12 ? 4    SER B O     1 
ATOM   1282 C CB    . SER D 2 4   ? -7.817  -3.993  44.178 1.00 26.78 ? 4    SER B CB    1 
ATOM   1283 O OG    . SER D 2 4   ? -6.695  -4.361  43.392 1.00 27.42 ? 4    SER B OG    1 
ATOM   1284 N N     . GLY D 2 5   ? -6.259  -6.382  45.513 1.00 26.40 ? 5    GLY B N     1 
ATOM   1285 C CA    . GLY D 2 5   ? -5.996  -7.808  45.534 1.00 23.97 ? 5    GLY B CA    1 
ATOM   1286 C C     . GLY D 2 5   ? -5.703  -8.249  44.106 1.00 23.64 ? 5    GLY B C     1 
ATOM   1287 O O     . GLY D 2 5   ? -5.454  -9.421  43.833 1.00 23.12 ? 5    GLY B O     1 
ATOM   1288 N N     . GLU D 2 6   ? -5.752  -7.297  43.180 1.00 24.34 ? 6    GLU B N     1 
ATOM   1289 C CA    . GLU D 2 6   ? -5.481  -7.579  41.779 1.00 25.54 ? 6    GLU B CA    1 
ATOM   1290 C C     . GLU D 2 6   ? -3.965  -7.610  41.587 1.00 25.80 ? 6    GLU B C     1 
ATOM   1291 O O     . GLU D 2 6   ? -3.332  -6.595  41.272 1.00 26.34 ? 6    GLU B O     1 
ATOM   1292 C CB    . GLU D 2 6   ? -6.129  -6.520  40.888 1.00 27.16 ? 6    GLU B CB    1 
ATOM   1293 C CG    . GLU D 2 6   ? -7.641  -6.380  41.099 1.00 30.28 ? 6    GLU B CG    1 
ATOM   1294 C CD    . GLU D 2 6   ? -8.341  -5.712  39.926 1.00 30.65 ? 6    GLU B CD    1 
ATOM   1295 O OE1   . GLU D 2 6   ? -8.344  -6.293  38.817 1.00 31.71 ? 6    GLU B OE1   1 
ATOM   1296 O OE2   . GLU D 2 6   ? -8.887  -4.609  40.114 1.00 32.02 ? 6    GLU B OE2   1 
ATOM   1297 N N     . TYR D 2 7   ? -3.393  -8.788  41.810 1.00 24.77 ? 7    TYR B N     1 
ATOM   1298 C CA    . TYR D 2 7   ? -1.960  -8.989  41.711 1.00 22.89 ? 7    TYR B CA    1 
ATOM   1299 C C     . TYR D 2 7   ? -1.366  -8.746  40.329 1.00 22.32 ? 7    TYR B C     1 
ATOM   1300 O O     . TYR D 2 7   ? -1.890  -9.216  39.316 1.00 22.58 ? 7    TYR B O     1 
ATOM   1301 C CB    . TYR D 2 7   ? -1.605  -10.394 42.191 1.00 22.35 ? 7    TYR B CB    1 
ATOM   1302 C CG    . TYR D 2 7   ? -0.123  -10.666 42.217 1.00 22.54 ? 7    TYR B CG    1 
ATOM   1303 C CD1   . TYR D 2 7   ? 0.649   -10.300 43.313 1.00 21.03 ? 7    TYR B CD1   1 
ATOM   1304 C CD2   . TYR D 2 7   ? 0.511   -11.293 41.137 1.00 22.75 ? 7    TYR B CD2   1 
ATOM   1305 C CE1   . TYR D 2 7   ? 2.016   -10.548 43.340 1.00 22.53 ? 7    TYR B CE1   1 
ATOM   1306 C CE2   . TYR D 2 7   ? 1.885   -11.547 41.154 1.00 22.31 ? 7    TYR B CE2   1 
ATOM   1307 C CZ    . TYR D 2 7   ? 2.628   -11.169 42.260 1.00 22.40 ? 7    TYR B CZ    1 
ATOM   1308 O OH    . TYR D 2 7   ? 3.983   -11.398 42.288 1.00 22.36 ? 7    TYR B OH    1 
ATOM   1309 N N     . ILE D 2 8   ? -0.273  -7.990  40.306 1.00 20.66 ? 8    ILE B N     1 
ATOM   1310 C CA    . ILE D 2 8   ? 0.447   -7.689  39.075 1.00 19.68 ? 8    ILE B CA    1 
ATOM   1311 C C     . ILE D 2 8   ? 1.873   -8.184  39.297 1.00 19.99 ? 8    ILE B C     1 
ATOM   1312 O O     . ILE D 2 8   ? 2.465   -7.956  40.354 1.00 19.22 ? 8    ILE B O     1 
ATOM   1313 C CB    . ILE D 2 8   ? 0.434   -6.173  38.749 1.00 18.36 ? 8    ILE B CB    1 
ATOM   1314 C CG1   . ILE D 2 8   ? -1.004  -5.715  38.498 1.00 18.53 ? 8    ILE B CG1   1 
ATOM   1315 C CG2   . ILE D 2 8   ? 1.262   -5.883  37.513 1.00 17.53 ? 8    ILE B CG2   1 
ATOM   1316 C CD1   . ILE D 2 8   ? -1.154  -4.252  38.239 1.00 16.49 ? 8    ILE B CD1   1 
ATOM   1317 N N     . SER D 2 9   ? 2.389   -8.938  38.338 1.00 20.72 ? 9    SER B N     1 
ATOM   1318 C CA    . SER D 2 9   ? 3.735   -9.471  38.462 1.00 22.33 ? 9    SER B CA    1 
ATOM   1319 C C     . SER D 2 9   ? 4.796   -8.419  38.218 1.00 22.30 ? 9    SER B C     1 
ATOM   1320 O O     . SER D 2 9   ? 4.803   -7.767  37.173 1.00 23.09 ? 9    SER B O     1 
ATOM   1321 C CB    . SER D 2 9   ? 3.963   -10.623 37.489 1.00 22.51 ? 9    SER B CB    1 
ATOM   1322 O OG    . SER D 2 9   ? 5.282   -11.132 37.640 1.00 24.64 ? 9    SER B OG    1 
ATOM   1323 N N     . PRO D 2 10  ? 5.688   -8.215  39.198 1.00 22.33 ? 10   PRO B N     1 
ATOM   1324 C CA    . PRO D 2 10  ? 6.751   -7.221  39.026 1.00 23.06 ? 10   PRO B CA    1 
ATOM   1325 C C     . PRO D 2 10  ? 7.954   -7.854  38.321 1.00 24.02 ? 10   PRO B C     1 
ATOM   1326 O O     . PRO D 2 10  ? 8.995   -7.218  38.157 1.00 24.56 ? 10   PRO B O     1 
ATOM   1327 C CB    . PRO D 2 10  ? 7.060   -6.808  40.459 1.00 22.69 ? 10   PRO B CB    1 
ATOM   1328 C CG    . PRO D 2 10  ? 6.818   -8.057  41.227 1.00 22.49 ? 10   PRO B CG    1 
ATOM   1329 C CD    . PRO D 2 10  ? 5.597   -8.671  40.596 1.00 20.92 ? 10   PRO B CD    1 
ATOM   1330 N N     . TYR D 2 11  ? 7.762   -9.086  37.840 1.00 24.99 ? 11   TYR B N     1 
ATOM   1331 C CA    . TYR D 2 11  ? 8.798   -9.849  37.154 1.00 25.51 ? 11   TYR B CA    1 
ATOM   1332 C C     . TYR D 2 11  ? 8.400   -10.219 35.721 1.00 29.13 ? 11   TYR B C     1 
ATOM   1333 O O     . TYR D 2 11  ? 7.236   -10.147 35.353 1.00 29.25 ? 11   TYR B O     1 
ATOM   1334 C CB    . TYR D 2 11  ? 9.102   -11.124 37.940 1.00 21.54 ? 11   TYR B CB    1 
ATOM   1335 C CG    . TYR D 2 11  ? 9.068   -10.972 39.449 1.00 18.50 ? 11   TYR B CG    1 
ATOM   1336 C CD1   . TYR D 2 11  ? 9.828   -9.998  40.101 1.00 17.54 ? 11   TYR B CD1   1 
ATOM   1337 C CD2   . TYR D 2 11  ? 8.273   -11.810 40.225 1.00 18.20 ? 11   TYR B CD2   1 
ATOM   1338 C CE1   . TYR D 2 11  ? 9.792   -9.867  41.494 1.00 16.91 ? 11   TYR B CE1   1 
ATOM   1339 C CE2   . TYR D 2 11  ? 8.229   -11.689 41.610 1.00 16.99 ? 11   TYR B CE2   1 
ATOM   1340 C CZ    . TYR D 2 11  ? 8.987   -10.721 42.239 1.00 16.94 ? 11   TYR B CZ    1 
ATOM   1341 O OH    . TYR D 2 11  ? 8.924   -10.616 43.610 1.00 15.95 ? 11   TYR B OH    1 
ATOM   1342 N N     . ALA D 2 12  ? 9.379   -10.652 34.933 1.00 34.49 ? 12   ALA B N     1 
ATOM   1343 C CA    . ALA D 2 12  ? 9.167   -11.042 33.542 1.00 40.52 ? 12   ALA B CA    1 
ATOM   1344 C C     . ALA D 2 12  ? 8.709   -12.487 33.376 1.00 45.82 ? 12   ALA B C     1 
ATOM   1345 O O     . ALA D 2 12  ? 8.362   -12.892 32.263 1.00 46.13 ? 12   ALA B O     1 
ATOM   1346 C CB    . ALA D 2 12  ? 10.440  -10.831 32.756 1.00 40.61 ? 12   ALA B CB    1 
ATOM   1347 N N     . GLU D 2 13  ? 8.718   -13.239 34.483 1.00 52.21 ? 13   GLU B N     1 
ATOM   1348 C CA    . GLU D 2 13  ? 8.339   -14.667 34.557 1.00 58.57 ? 13   GLU B CA    1 
ATOM   1349 C C     . GLU D 2 13  ? 7.222   -15.153 33.620 1.00 61.97 ? 13   GLU B C     1 
ATOM   1350 O O     . GLU D 2 13  ? 6.097   -15.421 34.054 1.00 61.97 ? 13   GLU B O     1 
ATOM   1351 C CB    . GLU D 2 13  ? 7.977   -15.051 36.002 1.00 60.08 ? 13   GLU B CB    1 
ATOM   1352 C CG    . GLU D 2 13  ? 8.916   -14.517 37.093 1.00 63.81 ? 13   GLU B CG    1 
ATOM   1353 C CD    . GLU D 2 13  ? 10.389  -14.862 36.865 1.00 66.01 ? 13   GLU B CD    1 
ATOM   1354 O OE1   . GLU D 2 13  ? 10.740  -16.064 36.899 1.00 67.93 ? 13   GLU B OE1   1 
ATOM   1355 O OE2   . GLU D 2 13  ? 11.200  -13.927 36.669 1.00 66.36 ? 13   GLU B OE2   1 
ATOM   1356 N N     . HIS D 2 14  ? 7.578   -15.349 32.354 1.00 66.28 ? 14   HIS B N     1 
ATOM   1357 C CA    . HIS D 2 14  ? 6.646   -15.797 31.321 1.00 71.00 ? 14   HIS B CA    1 
ATOM   1358 C C     . HIS D 2 14  ? 7.468   -16.404 30.185 1.00 73.66 ? 14   HIS B C     1 
ATOM   1359 O O     . HIS D 2 14  ? 7.127   -17.475 29.666 1.00 73.94 ? 14   HIS B O     1 
ATOM   1360 C CB    . HIS D 2 14  ? 5.800   -14.601 30.831 1.00 72.18 ? 14   HIS B CB    1 
ATOM   1361 C CG    . HIS D 2 14  ? 5.332   -14.703 29.406 1.00 74.28 ? 14   HIS B CG    1 
ATOM   1362 N ND1   . HIS D 2 14  ? 5.639   -13.752 28.454 1.00 75.05 ? 14   HIS B ND1   1 
ATOM   1363 C CD2   . HIS D 2 14  ? 4.576   -15.634 28.774 1.00 75.02 ? 14   HIS B CD2   1 
ATOM   1364 C CE1   . HIS D 2 14  ? 5.095   -14.094 27.298 1.00 75.40 ? 14   HIS B CE1   1 
ATOM   1365 N NE2   . HIS D 2 14  ? 4.445   -15.232 27.466 1.00 75.09 ? 14   HIS B NE2   1 
ATOM   1366 N N     . GLY D 2 15  ? 8.578   -15.730 29.868 1.00 76.19 ? 15   GLY B N     1 
ATOM   1367 C CA    . GLY D 2 15  ? 9.493   -16.132 28.806 1.00 79.06 ? 15   GLY B CA    1 
ATOM   1368 C C     . GLY D 2 15  ? 9.555   -17.593 28.395 1.00 80.93 ? 15   GLY B C     1 
ATOM   1369 O O     . GLY D 2 15  ? 10.348  -18.382 28.924 1.00 80.98 ? 15   GLY B O     1 
ATOM   1370 N N     . LYS D 2 16  ? 8.713   -17.941 27.428 1.00 82.37 ? 16   LYS B N     1 
ATOM   1371 C CA    . LYS D 2 16  ? 8.642   -19.295 26.893 1.00 83.77 ? 16   LYS B CA    1 
ATOM   1372 C C     . LYS D 2 16  ? 8.494   -19.227 25.377 1.00 84.60 ? 16   LYS B C     1 
ATOM   1373 O O     . LYS D 2 16  ? 8.634   -20.244 24.687 1.00 84.80 ? 16   LYS B O     1 
ATOM   1374 C CB    . LYS D 2 16  ? 7.472   -20.065 27.523 1.00 84.05 ? 16   LYS B CB    1 
ATOM   1375 C CG    . LYS D 2 16  ? 7.751   -20.545 28.945 1.00 84.12 ? 16   LYS B CG    1 
ATOM   1376 C CD    . LYS D 2 16  ? 6.539   -21.181 29.598 1.00 83.79 ? 16   LYS B CD    1 
ATOM   1377 C CE    . LYS D 2 16  ? 6.954   -21.969 30.834 1.00 84.15 ? 16   LYS B CE    1 
ATOM   1378 N NZ    . LYS D 2 16  ? 7.826   -23.135 30.479 1.00 83.97 ? 16   LYS B NZ    1 
ATOM   1379 N N     . LYS D 2 17  ? 8.263   -18.011 24.868 1.00 85.34 ? 17   LYS B N     1 
ATOM   1380 C CA    . LYS D 2 17  ? 8.101   -17.779 23.432 1.00 85.51 ? 17   LYS B CA    1 
ATOM   1381 C C     . LYS D 2 17  ? 8.041   -16.290 23.024 1.00 85.13 ? 17   LYS B C     1 
ATOM   1382 O O     . LYS D 2 17  ? 8.306   -15.959 21.860 1.00 85.18 ? 17   LYS B O     1 
ATOM   1383 C CB    . LYS D 2 17  ? 6.849   -18.503 22.928 1.00 86.05 ? 17   LYS B CB    1 
ATOM   1384 C CG    . LYS D 2 17  ? 6.919   -18.929 21.483 1.00 86.55 ? 17   LYS B CG    1 
ATOM   1385 C CD    . LYS D 2 17  ? 7.788   -20.161 21.279 1.00 87.10 ? 17   LYS B CD    1 
ATOM   1386 C CE    . LYS D 2 17  ? 7.766   -20.576 19.814 1.00 87.34 ? 17   LYS B CE    1 
ATOM   1387 N NZ    . LYS D 2 17  ? 6.366   -20.708 19.303 1.00 87.58 ? 17   LYS B NZ    1 
ATOM   1388 N N     . SER D 2 18  ? 7.716   -15.396 23.967 1.00 84.31 ? 18   SER B N     1 
ATOM   1389 C CA    . SER D 2 18  ? 7.613   -13.955 23.661 1.00 83.08 ? 18   SER B CA    1 
ATOM   1390 C C     . SER D 2 18  ? 8.043   -12.975 24.759 1.00 81.76 ? 18   SER B C     1 
ATOM   1391 O O     . SER D 2 18  ? 8.619   -13.382 25.782 1.00 82.07 ? 18   SER B O     1 
ATOM   1392 C CB    . SER D 2 18  ? 6.193   -13.613 23.204 1.00 83.35 ? 18   SER B CB    1 
ATOM   1393 O OG    . SER D 2 18  ? 6.175   -13.219 21.839 1.00 83.00 ? 18   SER B OG    1 
ATOM   1394 N N     . GLU D 2 19  ? 7.771   -11.683 24.517 1.00 79.39 ? 19   GLU B N     1 
ATOM   1395 C CA    . GLU D 2 19  ? 8.135   -10.582 25.425 1.00 76.38 ? 19   GLU B CA    1 
ATOM   1396 C C     . GLU D 2 19  ? 6.950   -9.958  26.178 1.00 72.77 ? 19   GLU B C     1 
ATOM   1397 O O     . GLU D 2 19  ? 5.892   -9.669  25.601 1.00 72.97 ? 19   GLU B O     1 
ATOM   1398 C CB    . GLU D 2 19  ? 8.868   -9.471  24.649 1.00 78.14 ? 19   GLU B CB    1 
ATOM   1399 C CG    . GLU D 2 19  ? 9.925   -9.950  23.650 1.00 80.22 ? 19   GLU B CG    1 
ATOM   1400 C CD    . GLU D 2 19  ? 9.623   -9.538  22.197 1.00 81.60 ? 19   GLU B CD    1 
ATOM   1401 O OE1   . GLU D 2 19  ? 8.461   -9.684  21.739 1.00 82.15 ? 19   GLU B OE1   1 
ATOM   1402 O OE2   . GLU D 2 19  ? 10.563  -9.083  21.503 1.00 82.03 ? 19   GLU B OE2   1 
ATOM   1403 N N     . GLN D 2 20  ? 7.173   -9.699  27.463 1.00 67.49 ? 20   GLN B N     1 
ATOM   1404 C CA    . GLN D 2 20  ? 6.174   -9.101  28.352 1.00 60.85 ? 20   GLN B CA    1 
ATOM   1405 C C     . GLN D 2 20  ? 6.793   -7.839  28.955 1.00 56.89 ? 20   GLN B C     1 
ATOM   1406 O O     . GLN D 2 20  ? 6.089   -6.992  29.510 1.00 56.26 ? 20   GLN B O     1 
ATOM   1407 C CB    . GLN D 2 20  ? 5.846   -10.109 29.463 1.00 60.27 ? 20   GLN B CB    1 
ATOM   1408 C CG    . GLN D 2 20  ? 5.281   -9.545  30.778 1.00 59.70 ? 20   GLN B CG    1 
ATOM   1409 C CD    . GLN D 2 20  ? 5.321   -10.567 31.937 1.00 60.42 ? 20   GLN B CD    1 
ATOM   1410 O OE1   . GLN D 2 20  ? 4.868   -10.285 33.048 1.00 59.45 ? 20   GLN B OE1   1 
ATOM   1411 N NE2   . GLN D 2 20  ? 5.874   -11.747 31.672 1.00 60.65 ? 20   GLN B NE2   1 
ATOM   1412 N N     . VAL D 2 21  ? 8.112   -7.717  28.803 1.00 52.04 ? 21   VAL B N     1 
ATOM   1413 C CA    . VAL D 2 21  ? 8.886   -6.615  29.373 1.00 47.00 ? 21   VAL B CA    1 
ATOM   1414 C C     . VAL D 2 21  ? 9.442   -5.580  28.394 1.00 43.68 ? 21   VAL B C     1 
ATOM   1415 O O     . VAL D 2 21  ? 9.675   -5.856  27.215 1.00 42.82 ? 21   VAL B O     1 
ATOM   1416 C CB    . VAL D 2 21  ? 10.056  -7.203  30.207 1.00 46.90 ? 21   VAL B CB    1 
ATOM   1417 C CG1   . VAL D 2 21  ? 10.989  -6.119  30.726 1.00 46.21 ? 21   VAL B CG1   1 
ATOM   1418 C CG2   . VAL D 2 21  ? 9.505   -8.009  31.370 1.00 46.04 ? 21   VAL B CG2   1 
ATOM   1419 N N     . LYS D 2 22  ? 9.606   -4.365  28.909 1.00 40.19 ? 22   LYS B N     1 
ATOM   1420 C CA    . LYS D 2 22  ? 10.166  -3.234  28.172 1.00 36.45 ? 22   LYS B CA    1 
ATOM   1421 C C     . LYS D 2 22  ? 11.349  -2.753  29.013 1.00 33.02 ? 22   LYS B C     1 
ATOM   1422 O O     . LYS D 2 22  ? 11.331  -2.857  30.237 1.00 31.48 ? 22   LYS B O     1 
ATOM   1423 C CB    . LYS D 2 22  ? 9.142   -2.100  28.056 1.00 37.69 ? 22   LYS B CB    1 
ATOM   1424 C CG    . LYS D 2 22  ? 7.865   -2.454  27.294 1.00 39.30 ? 22   LYS B CG    1 
ATOM   1425 C CD    . LYS D 2 22  ? 8.132   -2.615  25.807 1.00 40.52 ? 22   LYS B CD    1 
ATOM   1426 C CE    . LYS D 2 22  ? 6.839   -2.786  25.021 1.00 41.77 ? 22   LYS B CE    1 
ATOM   1427 N NZ    . LYS D 2 22  ? 7.055   -2.658  23.544 1.00 42.12 ? 22   LYS B NZ    1 
ATOM   1428 N N     . LYS D 2 23  ? 12.400  -2.285  28.357 1.00 30.48 ? 23   LYS B N     1 
ATOM   1429 C CA    . LYS D 2 23  ? 13.570  -1.786  29.071 1.00 27.62 ? 23   LYS B CA    1 
ATOM   1430 C C     . LYS D 2 23  ? 13.568  -0.272  28.993 1.00 25.63 ? 23   LYS B C     1 
ATOM   1431 O O     . LYS D 2 23  ? 13.519  0.296   27.900 1.00 26.03 ? 23   LYS B O     1 
ATOM   1432 C CB    . LYS D 2 23  ? 14.848  -2.334  28.451 1.00 27.62 ? 23   LYS B CB    1 
ATOM   1433 C CG    . LYS D 2 23  ? 15.163  -3.756  28.851 1.00 26.05 ? 23   LYS B CG    1 
ATOM   1434 C CD    . LYS D 2 23  ? 16.136  -4.342  27.863 1.00 26.42 ? 23   LYS B CD    1 
ATOM   1435 C CE    . LYS D 2 23  ? 16.954  -5.453  28.463 1.00 25.92 ? 23   LYS B CE    1 
ATOM   1436 N NZ    . LYS D 2 23  ? 17.946  -5.896  27.452 1.00 26.00 ? 23   LYS B NZ    1 
ATOM   1437 N N     . ILE D 2 24  ? 13.615  0.377   30.151 1.00 22.43 ? 24   ILE B N     1 
ATOM   1438 C CA    . ILE D 2 24  ? 13.594  1.833   30.198 1.00 19.24 ? 24   ILE B CA    1 
ATOM   1439 C C     . ILE D 2 24  ? 14.835  2.393   30.881 1.00 17.51 ? 24   ILE B C     1 
ATOM   1440 O O     . ILE D 2 24  ? 15.403  1.762   31.763 1.00 16.69 ? 24   ILE B O     1 
ATOM   1441 C CB    . ILE D 2 24  ? 12.302  2.354   30.919 1.00 17.32 ? 24   ILE B CB    1 
ATOM   1442 C CG1   . ILE D 2 24  ? 12.224  1.813   32.343 1.00 15.80 ? 24   ILE B CG1   1 
ATOM   1443 C CG2   . ILE D 2 24  ? 11.058  1.939   30.150 1.00 16.16 ? 24   ILE B CG2   1 
ATOM   1444 C CD1   . ILE D 2 24  ? 11.050  2.310   33.129 1.00 16.22 ? 24   ILE B CD1   1 
ATOM   1445 N N     . THR D 2 25  ? 15.276  3.566   30.443 1.00 17.90 ? 25   THR B N     1 
ATOM   1446 C CA    . THR D 2 25  ? 16.444  4.198   31.050 1.00 17.71 ? 25   THR B CA    1 
ATOM   1447 C C     . THR D 2 25  ? 15.984  4.967   32.278 1.00 17.83 ? 25   THR B C     1 
ATOM   1448 O O     . THR D 2 25  ? 15.179  5.895   32.174 1.00 19.34 ? 25   THR B O     1 
ATOM   1449 C CB    . THR D 2 25  ? 17.142  5.163   30.086 1.00 17.58 ? 25   THR B CB    1 
ATOM   1450 O OG1   . THR D 2 25  ? 17.389  4.495   28.845 1.00 17.41 ? 25   THR B OG1   1 
ATOM   1451 C CG2   . THR D 2 25  ? 18.471  5.627   30.683 1.00 15.40 ? 25   THR B CG2   1 
ATOM   1452 N N     . VAL D 2 26  ? 16.517  4.596   33.437 1.00 17.40 ? 26   VAL B N     1 
ATOM   1453 C CA    . VAL D 2 26  ? 16.134  5.220   34.700 1.00 16.05 ? 26   VAL B CA    1 
ATOM   1454 C C     . VAL D 2 26  ? 17.283  5.966   35.384 1.00 16.89 ? 26   VAL B C     1 
ATOM   1455 O O     . VAL D 2 26  ? 18.314  5.381   35.705 1.00 17.42 ? 26   VAL B O     1 
ATOM   1456 C CB    . VAL D 2 26  ? 15.550  4.143   35.686 1.00 14.74 ? 26   VAL B CB    1 
ATOM   1457 C CG1   . VAL D 2 26  ? 15.250  4.744   37.060 1.00 12.88 ? 26   VAL B CG1   1 
ATOM   1458 C CG2   . VAL D 2 26  ? 14.290  3.524   35.106 1.00 13.22 ? 26   VAL B CG2   1 
ATOM   1459 N N     . SER D 2 27  ? 17.083  7.263   35.608 1.00 17.28 ? 27   SER B N     1 
ATOM   1460 C CA    . SER D 2 27  ? 18.060  8.105   36.291 1.00 16.10 ? 27   SER B CA    1 
ATOM   1461 C C     . SER D 2 27  ? 17.862  7.876   37.780 1.00 16.87 ? 27   SER B C     1 
ATOM   1462 O O     . SER D 2 27  ? 16.768  8.069   38.311 1.00 17.06 ? 27   SER B O     1 
ATOM   1463 C CB    . SER D 2 27  ? 17.822  9.575   35.961 1.00 14.34 ? 27   SER B CB    1 
ATOM   1464 O OG    . SER D 2 27  ? 17.850  9.786   34.564 1.00 13.58 ? 27   SER B OG    1 
ATOM   1465 N N     . ILE D 2 28  ? 18.926  7.451   38.449 1.00 18.00 ? 28   ILE B N     1 
ATOM   1466 C CA    . ILE D 2 28  ? 18.870  7.169   39.876 1.00 17.76 ? 28   ILE B CA    1 
ATOM   1467 C C     . ILE D 2 28  ? 20.045  7.816   40.616 1.00 17.73 ? 28   ILE B C     1 
ATOM   1468 O O     . ILE D 2 28  ? 21.198  7.686   40.203 1.00 18.67 ? 28   ILE B O     1 
ATOM   1469 C CB    . ILE D 2 28  ? 18.858  5.633   40.114 1.00 17.26 ? 28   ILE B CB    1 
ATOM   1470 C CG1   . ILE D 2 28  ? 18.795  5.314   41.606 1.00 17.98 ? 28   ILE B CG1   1 
ATOM   1471 C CG2   . ILE D 2 28  ? 20.082  4.984   39.474 1.00 18.27 ? 28   ILE B CG2   1 
ATOM   1472 C CD1   . ILE D 2 28  ? 18.668  3.825   41.907 1.00 18.12 ? 28   ILE B CD1   1 
ATOM   1473 N N     . PRO D 2 29  ? 19.757  8.595   41.669 1.00 16.95 ? 29   PRO B N     1 
ATOM   1474 C CA    . PRO D 2 29  ? 20.844  9.231   42.416 1.00 17.19 ? 29   PRO B CA    1 
ATOM   1475 C C     . PRO D 2 29  ? 21.723  8.154   43.059 1.00 17.52 ? 29   PRO B C     1 
ATOM   1476 O O     . PRO D 2 29  ? 21.223  7.120   43.496 1.00 17.77 ? 29   PRO B O     1 
ATOM   1477 C CB    . PRO D 2 29  ? 20.086  10.062  43.457 1.00 16.47 ? 29   PRO B CB    1 
ATOM   1478 C CG    . PRO D 2 29  ? 18.833  10.420  42.736 1.00 14.68 ? 29   PRO B CG    1 
ATOM   1479 C CD    . PRO D 2 29  ? 18.452  9.103   42.124 1.00 15.32 ? 29   PRO B CD    1 
ATOM   1480 N N     . LEU D 2 30  ? 23.026  8.405   43.129 1.00 17.67 ? 30   LEU B N     1 
ATOM   1481 C CA    . LEU D 2 30  ? 23.959  7.431   43.693 1.00 18.43 ? 30   LEU B CA    1 
ATOM   1482 C C     . LEU D 2 30  ? 23.617  6.950   45.101 1.00 18.68 ? 30   LEU B C     1 
ATOM   1483 O O     . LEU D 2 30  ? 23.818  5.779   45.433 1.00 18.18 ? 30   LEU B O     1 
ATOM   1484 C CB    . LEU D 2 30  ? 25.399  7.957   43.638 1.00 17.67 ? 30   LEU B CB    1 
ATOM   1485 C CG    . LEU D 2 30  ? 26.013  8.218   42.257 1.00 18.16 ? 30   LEU B CG    1 
ATOM   1486 C CD1   . LEU D 2 30  ? 27.508  8.464   42.421 1.00 18.05 ? 30   LEU B CD1   1 
ATOM   1487 C CD2   . LEU D 2 30  ? 25.773  7.040   41.306 1.00 17.12 ? 30   LEU B CD2   1 
ATOM   1488 N N     . LYS D 2 31  ? 23.102  7.852   45.928 1.00 19.51 ? 31   LYS B N     1 
ATOM   1489 C CA    . LYS D 2 31  ? 22.726  7.500   47.293 1.00 19.59 ? 31   LYS B CA    1 
ATOM   1490 C C     . LYS D 2 31  ? 21.537  6.535   47.302 1.00 19.63 ? 31   LYS B C     1 
ATOM   1491 O O     . LYS D 2 31  ? 21.386  5.748   48.230 1.00 20.81 ? 31   LYS B O     1 
ATOM   1492 C CB    . LYS D 2 31  ? 22.417  8.760   48.102 1.00 20.28 ? 31   LYS B CB    1 
ATOM   1493 C CG    . LYS D 2 31  ? 23.613  9.691   48.264 1.00 21.94 ? 31   LYS B CG    1 
ATOM   1494 C CD    . LYS D 2 31  ? 23.179  11.031  48.836 1.00 24.35 ? 31   LYS B CD    1 
ATOM   1495 C CE    . LYS D 2 31  ? 24.304  12.058  48.801 1.00 24.76 ? 31   LYS B CE    1 
ATOM   1496 N NZ    . LYS D 2 31  ? 24.950  12.246  50.129 1.00 25.87 ? 31   LYS B NZ    1 
ATOM   1497 N N     . VAL D 2 32  ? 20.699  6.595   46.266 1.00 19.20 ? 32   VAL B N     1 
ATOM   1498 C CA    . VAL D 2 32  ? 19.539  5.702   46.148 1.00 18.14 ? 32   VAL B CA    1 
ATOM   1499 C C     . VAL D 2 32  ? 20.034  4.341   45.615 1.00 17.89 ? 32   VAL B C     1 
ATOM   1500 O O     . VAL D 2 32  ? 19.721  3.288   46.170 1.00 17.06 ? 32   VAL B O     1 
ATOM   1501 C CB    . VAL D 2 32  ? 18.452  6.304   45.187 1.00 16.94 ? 32   VAL B CB    1 
ATOM   1502 C CG1   . VAL D 2 32  ? 17.272  5.368   45.050 1.00 15.80 ? 32   VAL B CG1   1 
ATOM   1503 C CG2   . VAL D 2 32  ? 17.970  7.642   45.705 1.00 16.28 ? 32   VAL B CG2   1 
ATOM   1504 N N     . LEU D 2 33  ? 20.823  4.392   44.543 1.00 18.08 ? 33   LEU B N     1 
ATOM   1505 C CA    . LEU D 2 33  ? 21.404  3.213   43.904 1.00 18.52 ? 33   LEU B CA    1 
ATOM   1506 C C     . LEU D 2 33  ? 22.186  2.358   44.897 1.00 19.35 ? 33   LEU B C     1 
ATOM   1507 O O     . LEU D 2 33  ? 22.296  1.147   44.732 1.00 21.99 ? 33   LEU B O     1 
ATOM   1508 C CB    . LEU D 2 33  ? 22.335  3.650   42.769 1.00 17.14 ? 33   LEU B CB    1 
ATOM   1509 C CG    . LEU D 2 33  ? 23.033  2.554   41.967 1.00 16.46 ? 33   LEU B CG    1 
ATOM   1510 C CD1   . LEU D 2 33  ? 22.005  1.703   41.230 1.00 15.13 ? 33   LEU B CD1   1 
ATOM   1511 C CD2   . LEU D 2 33  ? 23.996  3.184   40.984 1.00 15.90 ? 33   LEU B CD2   1 
ATOM   1512 N N     . LYS D 2 34  ? 22.736  3.002   45.919 1.00 20.07 ? 34   LYS B N     1 
ATOM   1513 C CA    . LYS D 2 34  ? 23.504  2.330   46.957 1.00 20.07 ? 34   LYS B CA    1 
ATOM   1514 C C     . LYS D 2 34  ? 22.603  1.427   47.784 1.00 20.23 ? 34   LYS B C     1 
ATOM   1515 O O     . LYS D 2 34  ? 22.946  0.272   48.048 1.00 21.21 ? 34   LYS B O     1 
ATOM   1516 C CB    . LYS D 2 34  ? 24.173  3.375   47.846 1.00 20.94 ? 34   LYS B CB    1 
ATOM   1517 C CG    . LYS D 2 34  ? 24.642  2.869   49.185 1.00 23.21 ? 34   LYS B CG    1 
ATOM   1518 C CD    . LYS D 2 34  ? 25.757  1.855   49.060 1.00 25.27 ? 34   LYS B CD    1 
ATOM   1519 C CE    . LYS D 2 34  ? 26.227  1.442   50.454 1.00 26.97 ? 34   LYS B CE    1 
ATOM   1520 N NZ    . LYS D 2 34  ? 27.253  0.372   50.395 1.00 27.96 ? 34   LYS B NZ    1 
ATOM   1521 N N     . ILE D 2 35  ? 21.450  1.954   48.183 1.00 18.86 ? 35   ILE B N     1 
ATOM   1522 C CA    . ILE D 2 35  ? 20.487  1.195   48.974 1.00 18.68 ? 35   ILE B CA    1 
ATOM   1523 C C     . ILE D 2 35  ? 19.842  0.057   48.165 1.00 18.57 ? 35   ILE B C     1 
ATOM   1524 O O     . ILE D 2 35  ? 19.571  -1.023  48.696 1.00 17.38 ? 35   ILE B O     1 
ATOM   1525 C CB    . ILE D 2 35  ? 19.424  2.133   49.569 1.00 18.67 ? 35   ILE B CB    1 
ATOM   1526 C CG1   . ILE D 2 35  ? 20.109  3.104   50.519 1.00 17.71 ? 35   ILE B CG1   1 
ATOM   1527 C CG2   . ILE D 2 35  ? 18.365  1.355   50.344 1.00 17.84 ? 35   ILE B CG2   1 
ATOM   1528 C CD1   . ILE D 2 35  ? 19.172  4.023   51.180 1.00 19.50 ? 35   ILE B CD1   1 
ATOM   1529 N N     . LEU D 2 36  ? 19.638  0.303   46.872 1.00 18.31 ? 36   LEU B N     1 
ATOM   1530 C CA    . LEU D 2 36  ? 19.060  -0.682  45.965 1.00 17.91 ? 36   LEU B CA    1 
ATOM   1531 C C     . LEU D 2 36  ? 20.056  -1.829  45.834 1.00 18.88 ? 36   LEU B C     1 
ATOM   1532 O O     . LEU D 2 36  ? 19.716  -2.999  46.029 1.00 18.61 ? 36   LEU B O     1 
ATOM   1533 C CB    . LEU D 2 36  ? 18.795  -0.036  44.596 1.00 16.01 ? 36   LEU B CB    1 
ATOM   1534 C CG    . LEU D 2 36  ? 18.268  -0.859  43.418 1.00 15.25 ? 36   LEU B CG    1 
ATOM   1535 C CD1   . LEU D 2 36  ? 16.948  -1.524  43.747 1.00 14.78 ? 36   LEU B CD1   1 
ATOM   1536 C CD2   . LEU D 2 36  ? 18.115  0.043   42.224 1.00 14.53 ? 36   LEU B CD2   1 
ATOM   1537 N N     . THR D 2 37  ? 21.306  -1.467  45.568 1.00 19.63 ? 37   THR B N     1 
ATOM   1538 C CA    . THR D 2 37  ? 22.389  -2.429  45.412 1.00 20.22 ? 37   THR B CA    1 
ATOM   1539 C C     . THR D 2 37  ? 22.614  -3.303  46.656 1.00 20.54 ? 37   THR B C     1 
ATOM   1540 O O     . THR D 2 37  ? 22.802  -4.513  46.547 1.00 20.07 ? 37   THR B O     1 
ATOM   1541 C CB    . THR D 2 37  ? 23.664  -1.694  44.972 1.00 20.16 ? 37   THR B CB    1 
ATOM   1542 O OG1   . THR D 2 37  ? 23.649  -1.561  43.545 1.00 18.40 ? 37   THR B OG1   1 
ATOM   1543 C CG2   . THR D 2 37  ? 24.924  -2.403  45.440 1.00 21.46 ? 37   THR B CG2   1 
ATOM   1544 N N     . ASP D 2 38  ? 22.539  -2.706  47.839 1.00 21.56 ? 38   ASP B N     1 
ATOM   1545 C CA    . ASP D 2 38  ? 22.722  -3.473  49.069 1.00 23.27 ? 38   ASP B CA    1 
ATOM   1546 C C     . ASP D 2 38  ? 21.631  -4.532  49.236 1.00 23.69 ? 38   ASP B C     1 
ATOM   1547 O O     . ASP D 2 38  ? 21.897  -5.635  49.709 1.00 24.03 ? 38   ASP B O     1 
ATOM   1548 C CB    . ASP D 2 38  ? 22.718  -2.553  50.296 1.00 24.91 ? 38   ASP B CB    1 
ATOM   1549 C CG    . ASP D 2 38  ? 23.796  -1.483  50.242 1.00 25.93 ? 38   ASP B CG    1 
ATOM   1550 O OD1   . ASP D 2 38  ? 24.737  -1.584  49.415 1.00 26.99 ? 38   ASP B OD1   1 
ATOM   1551 O OD2   . ASP D 2 38  ? 23.682  -0.521  51.028 1.00 27.58 ? 38   ASP B OD2   1 
ATOM   1552 N N     . GLU D 2 39  ? 20.398  -4.176  48.881 1.00 23.75 ? 39   GLU B N     1 
ATOM   1553 C CA    . GLU D 2 39  ? 19.275  -5.100  48.997 1.00 23.52 ? 39   GLU B CA    1 
ATOM   1554 C C     . GLU D 2 39  ? 19.393  -6.192  47.954 1.00 22.56 ? 39   GLU B C     1 
ATOM   1555 O O     . GLU D 2 39  ? 18.980  -7.323  48.197 1.00 22.94 ? 39   GLU B O     1 
ATOM   1556 C CB    . GLU D 2 39  ? 17.929  -4.367  48.859 1.00 24.09 ? 39   GLU B CB    1 
ATOM   1557 C CG    . GLU D 2 39  ? 16.705  -5.280  48.719 1.00 23.08 ? 39   GLU B CG    1 
ATOM   1558 C CD    . GLU D 2 39  ? 16.429  -6.146  49.942 1.00 23.05 ? 39   GLU B CD    1 
ATOM   1559 O OE1   . GLU D 2 39  ? 16.705  -5.710  51.079 1.00 24.10 ? 39   GLU B OE1   1 
ATOM   1560 O OE2   . GLU D 2 39  ? 15.907  -7.264  49.762 1.00 22.82 ? 39   GLU B OE2   1 
ATOM   1561 N N     . ARG D 2 40  ? 19.955  -5.855  46.797 1.00 21.77 ? 40   ARG B N     1 
ATOM   1562 C CA    . ARG D 2 40  ? 20.136  -6.844  45.741 1.00 23.02 ? 40   ARG B CA    1 
ATOM   1563 C C     . ARG D 2 40  ? 21.171  -7.850  46.228 1.00 23.88 ? 40   ARG B C     1 
ATOM   1564 O O     . ARG D 2 40  ? 21.005  -9.067  46.083 1.00 24.30 ? 40   ARG B O     1 
ATOM   1565 C CB    . ARG D 2 40  ? 20.630  -6.189  44.453 1.00 22.28 ? 40   ARG B CB    1 
ATOM   1566 C CG    . ARG D 2 40  ? 20.789  -7.166  43.309 1.00 23.31 ? 40   ARG B CG    1 
ATOM   1567 C CD    . ARG D 2 40  ? 21.316  -6.488  42.072 1.00 24.10 ? 40   ARG B CD    1 
ATOM   1568 N NE    . ARG D 2 40  ? 22.556  -5.795  42.371 1.00 26.64 ? 40   ARG B NE    1 
ATOM   1569 C CZ    . ARG D 2 40  ? 23.268  -5.108  41.486 1.00 29.03 ? 40   ARG B CZ    1 
ATOM   1570 N NH1   . ARG D 2 40  ? 22.860  -5.014  40.221 1.00 28.61 ? 40   ARG B NH1   1 
ATOM   1571 N NH2   . ARG D 2 40  ? 24.413  -4.545  41.866 1.00 29.84 ? 40   ARG B NH2   1 
ATOM   1572 N N     . THR D 2 41  ? 22.221  -7.320  46.847 1.00 24.32 ? 41   THR B N     1 
ATOM   1573 C CA    . THR D 2 41  ? 23.304  -8.130  47.383 1.00 23.84 ? 41   THR B CA    1 
ATOM   1574 C C     . THR D 2 41  ? 22.788  -9.013  48.522 1.00 23.23 ? 41   THR B C     1 
ATOM   1575 O O     . THR D 2 41  ? 23.082  -10.201 48.554 1.00 24.00 ? 41   THR B O     1 
ATOM   1576 C CB    . THR D 2 41  ? 24.470  -7.229  47.847 1.00 22.64 ? 41   THR B CB    1 
ATOM   1577 O OG1   . THR D 2 41  ? 25.046  -6.594  46.706 1.00 22.00 ? 41   THR B OG1   1 
ATOM   1578 C CG2   . THR D 2 41  ? 25.526  -8.022  48.528 1.00 23.85 ? 41   THR B CG2   1 
ATOM   1579 N N     . ARG D 2 42  ? 21.958  -8.449  49.404 1.00 23.36 ? 42   ARG B N     1 
ATOM   1580 C CA    . ARG D 2 42  ? 21.391  -9.198  50.530 1.00 21.54 ? 42   ARG B CA    1 
ATOM   1581 C C     . ARG D 2 42  ? 20.615  -10.403 50.023 1.00 22.03 ? 42   ARG B C     1 
ATOM   1582 O O     . ARG D 2 42  ? 20.699  -11.477 50.600 1.00 23.36 ? 42   ARG B O     1 
ATOM   1583 C CB    . ARG D 2 42  ? 20.471  -8.321  51.382 1.00 20.76 ? 42   ARG B CB    1 
ATOM   1584 C CG    . ARG D 2 42  ? 20.080  -8.965  52.714 1.00 19.52 ? 42   ARG B CG    1 
ATOM   1585 C CD    . ARG D 2 42  ? 18.926  -8.236  53.418 1.00 19.30 ? 42   ARG B CD    1 
ATOM   1586 N NE    . ARG D 2 42  ? 17.657  -8.350  52.692 1.00 19.71 ? 42   ARG B NE    1 
ATOM   1587 C CZ    . ARG D 2 42  ? 16.883  -9.437  52.675 1.00 17.85 ? 42   ARG B CZ    1 
ATOM   1588 N NH1   . ARG D 2 42  ? 17.229  -10.520 53.352 1.00 17.86 ? 42   ARG B NH1   1 
ATOM   1589 N NH2   . ARG D 2 42  ? 15.793  -9.463  51.922 1.00 15.63 ? 42   ARG B NH2   1 
ATOM   1590 N N     . ARG D 2 43  ? 19.869  -10.232 48.935 1.00 22.16 ? 43   ARG B N     1 
ATOM   1591 C CA    . ARG D 2 43  ? 19.121  -11.343 48.366 1.00 22.76 ? 43   ARG B CA    1 
ATOM   1592 C C     . ARG D 2 43  ? 20.076  -12.397 47.786 1.00 24.45 ? 43   ARG B C     1 
ATOM   1593 O O     . ARG D 2 43  ? 19.851  -13.599 47.949 1.00 23.68 ? 43   ARG B O     1 
ATOM   1594 C CB    . ARG D 2 43  ? 18.134  -10.850 47.304 1.00 21.28 ? 43   ARG B CB    1 
ATOM   1595 C CG    . ARG D 2 43  ? 16.902  -10.194 47.898 1.00 19.53 ? 43   ARG B CG    1 
ATOM   1596 C CD    . ARG D 2 43  ? 15.917  -9.742  46.839 1.00 18.21 ? 43   ARG B CD    1 
ATOM   1597 N NE    . ARG D 2 43  ? 14.763  -9.088  47.456 1.00 18.71 ? 43   ARG B NE    1 
ATOM   1598 C CZ    . ARG D 2 43  ? 13.584  -8.902  46.864 1.00 16.44 ? 43   ARG B CZ    1 
ATOM   1599 N NH1   . ARG D 2 43  ? 13.375  -9.312  45.622 1.00 15.20 ? 43   ARG B NH1   1 
ATOM   1600 N NH2   . ARG D 2 43  ? 12.607  -8.306  47.529 1.00 17.15 ? 43   ARG B NH2   1 
ATOM   1601 N N     . LYS D 2 44  ? 21.154  -11.943 47.138 1.00 25.70 ? 44   LYS B N     1 
ATOM   1602 C CA    . LYS D 2 44  ? 22.148  -12.854 46.562 1.00 25.89 ? 44   LYS B CA    1 
ATOM   1603 C C     . LYS D 2 44  ? 22.849  -13.674 47.633 1.00 25.56 ? 44   LYS B C     1 
ATOM   1604 O O     . LYS D 2 44  ? 22.976  -14.882 47.492 1.00 25.55 ? 44   LYS B O     1 
ATOM   1605 C CB    . LYS D 2 44  ? 23.200  -12.092 45.756 1.00 27.16 ? 44   LYS B CB    1 
ATOM   1606 C CG    . LYS D 2 44  ? 22.705  -11.519 44.442 1.00 28.24 ? 44   LYS B CG    1 
ATOM   1607 C CD    . LYS D 2 44  ? 23.794  -10.701 43.775 1.00 29.57 ? 44   LYS B CD    1 
ATOM   1608 C CE    . LYS D 2 44  ? 23.285  -10.010 42.525 1.00 31.16 ? 44   LYS B CE    1 
ATOM   1609 N NZ    . LYS D 2 44  ? 22.810  -10.986 41.507 1.00 32.54 ? 44   LYS B NZ    1 
ATOM   1610 N N     . VAL D 2 45  ? 23.287  -13.026 48.709 1.00 26.15 ? 45   VAL B N     1 
ATOM   1611 C CA    . VAL D 2 45  ? 23.980  -13.741 49.775 1.00 27.76 ? 45   VAL B CA    1 
ATOM   1612 C C     . VAL D 2 45  ? 23.056  -14.706 50.500 1.00 28.13 ? 45   VAL B C     1 
ATOM   1613 O O     . VAL D 2 45  ? 23.517  -15.691 51.070 1.00 29.30 ? 45   VAL B O     1 
ATOM   1614 C CB    . VAL D 2 45  ? 24.664  -12.801 50.798 1.00 28.05 ? 45   VAL B CB    1 
ATOM   1615 C CG1   . VAL D 2 45  ? 25.388  -11.680 50.087 1.00 29.98 ? 45   VAL B CG1   1 
ATOM   1616 C CG2   . VAL D 2 45  ? 23.675  -12.250 51.786 1.00 29.81 ? 45   VAL B CG2   1 
ATOM   1617 N N     . ASN D 2 46  ? 21.756  -14.423 50.498 1.00 27.73 ? 46   ASN B N     1 
ATOM   1618 C CA    . ASN D 2 46  ? 20.802  -15.315 51.145 1.00 27.03 ? 46   ASN B CA    1 
ATOM   1619 C C     . ASN D 2 46  ? 20.192  -16.299 50.145 1.00 27.53 ? 46   ASN B C     1 
ATOM   1620 O O     . ASN D 2 46  ? 19.258  -17.030 50.468 1.00 28.80 ? 46   ASN B O     1 
ATOM   1621 C CB    . ASN D 2 46  ? 19.726  -14.527 51.881 1.00 25.45 ? 46   ASN B CB    1 
ATOM   1622 C CG    . ASN D 2 46  ? 20.233  -13.933 53.173 1.00 25.25 ? 46   ASN B CG    1 
ATOM   1623 O OD1   . ASN D 2 46  ? 20.237  -14.589 54.216 1.00 25.28 ? 46   ASN B OD1   1 
ATOM   1624 N ND2   . ASN D 2 46  ? 20.664  -12.683 53.118 1.00 26.23 ? 46   ASN B ND2   1 
ATOM   1625 N N     . ASN D 2 47  ? 20.748  -16.319 48.935 1.00 27.36 ? 47   ASN B N     1 
ATOM   1626 C CA    . ASN D 2 47  ? 20.311  -17.213 47.869 1.00 28.17 ? 47   ASN B CA    1 
ATOM   1627 C C     . ASN D 2 47  ? 18.798  -17.144 47.593 1.00 28.07 ? 47   ASN B C     1 
ATOM   1628 O O     . ASN D 2 47  ? 18.119  -18.167 47.454 1.00 28.56 ? 47   ASN B O     1 
ATOM   1629 C CB    . ASN D 2 47  ? 20.753  -18.646 48.183 1.00 28.71 ? 47   ASN B CB    1 
ATOM   1630 C CG    . ASN D 2 47  ? 20.713  -19.543 46.968 1.00 30.37 ? 47   ASN B CG    1 
ATOM   1631 O OD1   . ASN D 2 47  ? 21.101  -19.132 45.869 1.00 30.81 ? 47   ASN B OD1   1 
ATOM   1632 N ND2   . ASN D 2 47  ? 20.223  -20.767 47.147 1.00 28.91 ? 47   ASN B ND2   1 
ATOM   1633 N N     . LEU D 2 48  ? 18.293  -15.918 47.480 1.00 27.10 ? 48   LEU B N     1 
ATOM   1634 C CA    . LEU D 2 48  ? 16.879  -15.662 47.231 1.00 24.56 ? 48   LEU B CA    1 
ATOM   1635 C C     . LEU D 2 48  ? 16.659  -15.259 45.777 1.00 24.06 ? 48   LEU B C     1 
ATOM   1636 O O     . LEU D 2 48  ? 17.546  -14.672 45.151 1.00 23.64 ? 48   LEU B O     1 
ATOM   1637 C CB    . LEU D 2 48  ? 16.398  -14.533 48.144 1.00 23.67 ? 48   LEU B CB    1 
ATOM   1638 C CG    . LEU D 2 48  ? 16.584  -14.706 49.653 1.00 23.98 ? 48   LEU B CG    1 
ATOM   1639 C CD1   . LEU D 2 48  ? 16.292  -13.400 50.379 1.00 22.71 ? 48   LEU B CD1   1 
ATOM   1640 C CD2   . LEU D 2 48  ? 15.694  -15.826 50.162 1.00 22.83 ? 48   LEU B CD2   1 
ATOM   1641 N N     . ARG D 2 49  ? 15.479  -15.572 45.239 1.00 22.53 ? 49   ARG B N     1 
ATOM   1642 C CA    . ARG D 2 49  ? 15.153  -15.203 43.859 1.00 21.46 ? 49   ARG B CA    1 
ATOM   1643 C C     . ARG D 2 49  ? 14.894  -13.705 43.782 1.00 19.73 ? 49   ARG B C     1 
ATOM   1644 O O     . ARG D 2 49  ? 14.798  -13.014 44.800 1.00 17.61 ? 49   ARG B O     1 
ATOM   1645 C CB    . ARG D 2 49  ? 13.864  -15.862 43.390 1.00 22.42 ? 49   ARG B CB    1 
ATOM   1646 C CG    . ARG D 2 49  ? 13.737  -17.320 43.606 1.00 24.37 ? 49   ARG B CG    1 
ATOM   1647 C CD    . ARG D 2 49  ? 12.276  -17.672 43.444 1.00 25.76 ? 49   ARG B CD    1 
ATOM   1648 N NE    . ARG D 2 49  ? 12.042  -19.081 43.704 1.00 26.09 ? 49   ARG B NE    1 
ATOM   1649 C CZ    . ARG D 2 49  ? 12.344  -20.033 42.839 1.00 26.26 ? 49   ARG B CZ    1 
ATOM   1650 N NH1   . ARG D 2 49  ? 12.873  -19.704 41.666 1.00 26.03 ? 49   ARG B NH1   1 
ATOM   1651 N NH2   . ARG D 2 49  ? 12.185  -21.307 43.171 1.00 27.50 ? 49   ARG B NH2   1 
ATOM   1652 N N     . HIS D 2 50  ? 14.707  -13.234 42.556 1.00 18.85 ? 50   HIS B N     1 
ATOM   1653 C CA    . HIS D 2 50  ? 14.407  -11.835 42.292 1.00 19.45 ? 50   HIS B CA    1 
ATOM   1654 C C     . HIS D 2 50  ? 15.440  -10.865 42.866 1.00 19.63 ? 50   HIS B C     1 
ATOM   1655 O O     . HIS D 2 50  ? 15.109  -9.786  43.365 1.00 20.26 ? 50   HIS B O     1 
ATOM   1656 C CB    . HIS D 2 50  ? 12.985  -11.545 42.774 1.00 17.44 ? 50   HIS B CB    1 
ATOM   1657 C CG    . HIS D 2 50  ? 11.986  -12.538 42.261 1.00 16.77 ? 50   HIS B CG    1 
ATOM   1658 N ND1   . HIS D 2 50  ? 11.827  -12.798 40.916 1.00 15.53 ? 50   HIS B ND1   1 
ATOM   1659 C CD2   . HIS D 2 50  ? 11.149  -13.383 42.910 1.00 15.21 ? 50   HIS B CD2   1 
ATOM   1660 C CE1   . HIS D 2 50  ? 10.939  -13.765 40.757 1.00 15.19 ? 50   HIS B CE1   1 
ATOM   1661 N NE2   . HIS D 2 50  ? 10.512  -14.135 41.951 1.00 15.15 ? 50   HIS B NE2   1 
ATOM   1662 N N     . ALA D 2 51  ? 16.705  -11.259 42.735 1.00 19.56 ? 51   ALA B N     1 
ATOM   1663 C CA    . ALA D 2 51  ? 17.828  -10.474 43.219 1.00 19.40 ? 51   ALA B CA    1 
ATOM   1664 C C     . ALA D 2 51  ? 18.447  -9.649  42.099 1.00 19.59 ? 51   ALA B C     1 
ATOM   1665 O O     . ALA D 2 51  ? 19.601  -9.853  41.718 1.00 20.87 ? 51   ALA B O     1 
ATOM   1666 C CB    . ALA D 2 51  ? 18.868  -11.390 43.849 1.00 18.82 ? 51   ALA B CB    1 
ATOM   1667 N N     . THR D 2 52  ? 17.646  -8.760  41.528 1.00 19.81 ? 52   THR B N     1 
ATOM   1668 C CA    . THR D 2 52  ? 18.097  -7.870  40.465 1.00 18.75 ? 52   THR B CA    1 
ATOM   1669 C C     . THR D 2 52  ? 17.587  -6.468  40.806 1.00 19.67 ? 52   THR B C     1 
ATOM   1670 O O     . THR D 2 52  ? 16.705  -6.304  41.656 1.00 20.34 ? 52   THR B O     1 
ATOM   1671 C CB    . THR D 2 52  ? 17.556  -8.285  39.060 1.00 18.16 ? 52   THR B CB    1 
ATOM   1672 O OG1   . THR D 2 52  ? 16.132  -8.135  39.007 1.00 18.28 ? 52   THR B OG1   1 
ATOM   1673 C CG2   . THR D 2 52  ? 17.925  -9.707  38.737 1.00 17.45 ? 52   THR B CG2   1 
ATOM   1674 N N     . ASN D 2 53  ? 18.183  -5.454  40.197 1.00 19.67 ? 53   ASN B N     1 
ATOM   1675 C CA    . ASN D 2 53  ? 17.759  -4.090  40.441 1.00 20.03 ? 53   ASN B CA    1 
ATOM   1676 C C     . ASN D 2 53  ? 16.391  -3.801  39.816 1.00 20.13 ? 53   ASN B C     1 
ATOM   1677 O O     . ASN D 2 53  ? 15.556  -3.141  40.434 1.00 19.87 ? 53   ASN B O     1 
ATOM   1678 C CB    . ASN D 2 53  ? 18.826  -3.105  39.953 1.00 19.75 ? 53   ASN B CB    1 
ATOM   1679 C CG    . ASN D 2 53  ? 19.966  -2.944  40.959 1.00 20.68 ? 53   ASN B CG    1 
ATOM   1680 O OD1   . ASN D 2 53  ? 19.996  -3.617  41.991 1.00 21.56 ? 53   ASN B OD1   1 
ATOM   1681 N ND2   . ASN D 2 53  ? 20.873  -2.012  40.689 1.00 20.34 ? 53   ASN B ND2   1 
ATOM   1682 N N     . SER D 2 54  ? 16.153  -4.339  38.621 1.00 19.65 ? 54   SER B N     1 
ATOM   1683 C CA    . SER D 2 54  ? 14.885  -4.150  37.919 1.00 18.71 ? 54   SER B CA    1 
ATOM   1684 C C     . SER D 2 54  ? 13.687  -4.606  38.756 1.00 19.55 ? 54   SER B C     1 
ATOM   1685 O O     . SER D 2 54  ? 12.735  -3.847  38.969 1.00 19.46 ? 54   SER B O     1 
ATOM   1686 C CB    . SER D 2 54  ? 14.894  -4.935  36.611 1.00 18.51 ? 54   SER B CB    1 
ATOM   1687 O OG    . SER D 2 54  ? 15.868  -4.439  35.715 1.00 20.06 ? 54   SER B OG    1 
ATOM   1688 N N     . GLU D 2 55  ? 13.756  -5.848  39.235 1.00 19.65 ? 55   GLU B N     1 
ATOM   1689 C CA    . GLU D 2 55  ? 12.690  -6.450  40.027 1.00 20.24 ? 55   GLU B CA    1 
ATOM   1690 C C     . GLU D 2 55  ? 12.431  -5.743  41.346 1.00 19.30 ? 55   GLU B C     1 
ATOM   1691 O O     . GLU D 2 55  ? 11.285  -5.597  41.759 1.00 20.35 ? 55   GLU B O     1 
ATOM   1692 C CB    . GLU D 2 55  ? 12.975  -7.936  40.256 1.00 21.65 ? 55   GLU B CB    1 
ATOM   1693 C CG    . GLU D 2 55  ? 12.892  -8.768  38.978 1.00 24.04 ? 55   GLU B CG    1 
ATOM   1694 C CD    . GLU D 2 55  ? 13.465  -10.171 39.141 1.00 26.78 ? 55   GLU B CD    1 
ATOM   1695 O OE1   . GLU D 2 55  ? 14.609  -10.288 39.642 1.00 26.85 ? 55   GLU B OE1   1 
ATOM   1696 O OE2   . GLU D 2 55  ? 12.781  -11.153 38.759 1.00 26.22 ? 55   GLU B OE2   1 
ATOM   1697 N N     . LEU D 2 56  ? 13.494  -5.326  42.016 1.00 17.68 ? 56   LEU B N     1 
ATOM   1698 C CA    . LEU D 2 56  ? 13.364  -4.610  43.274 1.00 16.38 ? 56   LEU B CA    1 
ATOM   1699 C C     . LEU D 2 56  ? 12.685  -3.253  43.043 1.00 16.02 ? 56   LEU B C     1 
ATOM   1700 O O     . LEU D 2 56  ? 11.917  -2.786  43.874 1.00 16.69 ? 56   LEU B O     1 
ATOM   1701 C CB    . LEU D 2 56  ? 14.740  -4.410  43.906 1.00 16.10 ? 56   LEU B CB    1 
ATOM   1702 C CG    . LEU D 2 56  ? 15.289  -5.593  44.698 1.00 14.70 ? 56   LEU B CG    1 
ATOM   1703 C CD1   . LEU D 2 56  ? 16.800  -5.465  44.862 1.00 14.93 ? 56   LEU B CD1   1 
ATOM   1704 C CD2   . LEU D 2 56  ? 14.585  -5.660  46.040 1.00 12.25 ? 56   LEU B CD2   1 
ATOM   1705 N N     . LEU D 2 57  ? 12.982  -2.617  41.919 1.00 15.37 ? 57   LEU B N     1 
ATOM   1706 C CA    . LEU D 2 57  ? 12.360  -1.343  41.608 1.00 15.12 ? 57   LEU B CA    1 
ATOM   1707 C C     . LEU D 2 57  ? 10.879  -1.565  41.330 1.00 14.80 ? 57   LEU B C     1 
ATOM   1708 O O     . LEU D 2 57  ? 10.047  -0.834  41.833 1.00 15.52 ? 57   LEU B O     1 
ATOM   1709 C CB    . LEU D 2 57  ? 13.034  -0.663  40.404 1.00 14.45 ? 57   LEU B CB    1 
ATOM   1710 C CG    . LEU D 2 57  ? 14.388  0.024   40.648 1.00 13.85 ? 57   LEU B CG    1 
ATOM   1711 C CD1   . LEU D 2 57  ? 14.850  0.707   39.376 1.00 12.10 ? 57   LEU B CD1   1 
ATOM   1712 C CD2   . LEU D 2 57  ? 14.285  1.042   41.788 1.00 12.22 ? 57   LEU B CD2   1 
ATOM   1713 N N     . CYS D 2 58  ? 10.554  -2.602  40.567 1.00 15.49 ? 58   CYS B N     1 
ATOM   1714 C CA    . CYS D 2 58  ? 9.161   -2.905  40.239 1.00 16.54 ? 58   CYS B CA    1 
ATOM   1715 C C     . CYS D 2 58  ? 8.312   -3.297  41.438 1.00 16.62 ? 58   CYS B C     1 
ATOM   1716 O O     . CYS D 2 58  ? 7.171   -2.856  41.559 1.00 17.10 ? 58   CYS B O     1 
ATOM   1717 C CB    . CYS D 2 58  ? 9.089   -3.987  39.179 1.00 15.12 ? 58   CYS B CB    1 
ATOM   1718 S SG    . CYS D 2 58  ? 9.657   -3.385  37.633 1.00 18.08 ? 58   CYS B SG    1 
ATOM   1719 N N     . GLU D 2 59  ? 8.863   -4.136  42.311 1.00 17.45 ? 59   GLU B N     1 
ATOM   1720 C CA    . GLU D 2 59  ? 8.156   -4.557  43.510 1.00 17.50 ? 59   GLU B CA    1 
ATOM   1721 C C     . GLU D 2 59  ? 7.833   -3.315  44.323 1.00 18.53 ? 59   GLU B C     1 
ATOM   1722 O O     . GLU D 2 59  ? 6.695   -3.124  44.775 1.00 20.33 ? 59   GLU B O     1 
ATOM   1723 C CB    . GLU D 2 59  ? 9.034   -5.453  44.368 1.00 18.24 ? 59   GLU B CB    1 
ATOM   1724 C CG    . GLU D 2 59  ? 9.342   -6.821  43.796 1.00 19.76 ? 59   GLU B CG    1 
ATOM   1725 C CD    . GLU D 2 59  ? 10.220  -7.641  44.730 1.00 20.67 ? 59   GLU B CD    1 
ATOM   1726 O OE1   . GLU D 2 59  ? 10.601  -7.125  45.809 1.00 20.40 ? 59   GLU B OE1   1 
ATOM   1727 O OE2   . GLU D 2 59  ? 10.533  -8.800  44.385 1.00 21.33 ? 59   GLU B OE2   1 
ATOM   1728 N N     . ALA D 2 60  ? 8.844   -2.465  44.487 1.00 17.17 ? 60   ALA B N     1 
ATOM   1729 C CA    . ALA D 2 60  ? 8.710   -1.242  45.255 1.00 16.46 ? 60   ALA B CA    1 
ATOM   1730 C C     . ALA D 2 60  ? 7.680   -0.276  44.680 1.00 16.24 ? 60   ALA B C     1 
ATOM   1731 O O     . ALA D 2 60  ? 6.926   0.330   45.431 1.00 16.90 ? 60   ALA B O     1 
ATOM   1732 C CB    . ALA D 2 60  ? 10.057  -0.570  45.402 1.00 16.96 ? 60   ALA B CB    1 
ATOM   1733 N N     . PHE D 2 61  ? 7.636   -0.130  43.360 1.00 16.51 ? 61   PHE B N     1 
ATOM   1734 C CA    . PHE D 2 61  ? 6.665   0.777   42.751 1.00 17.48 ? 61   PHE B CA    1 
ATOM   1735 C C     . PHE D 2 61  ? 5.238   0.282   42.957 1.00 17.43 ? 61   PHE B C     1 
ATOM   1736 O O     . PHE D 2 61  ? 4.361   1.061   43.319 1.00 18.31 ? 61   PHE B O     1 
ATOM   1737 C CB    . PHE D 2 61  ? 6.917   0.992   41.254 1.00 17.30 ? 61   PHE B CB    1 
ATOM   1738 C CG    . PHE D 2 61  ? 5.849   1.808   40.590 1.00 17.49 ? 61   PHE B CG    1 
ATOM   1739 C CD1   . PHE D 2 61  ? 5.734   3.168   40.856 1.00 17.85 ? 61   PHE B CD1   1 
ATOM   1740 C CD2   . PHE D 2 61  ? 4.888   1.198   39.784 1.00 18.11 ? 61   PHE B CD2   1 
ATOM   1741 C CE1   . PHE D 2 61  ? 4.671   3.909   40.340 1.00 18.88 ? 61   PHE B CE1   1 
ATOM   1742 C CE2   . PHE D 2 61  ? 3.823   1.924   39.265 1.00 17.62 ? 61   PHE B CE2   1 
ATOM   1743 C CZ    . PHE D 2 61  ? 3.709   3.283   39.544 1.00 17.95 ? 61   PHE B CZ    1 
ATOM   1744 N N     . LEU D 2 62  ? 5.000   -0.998  42.682 1.00 16.69 ? 62   LEU B N     1 
ATOM   1745 C CA    . LEU D 2 62  ? 3.677   -1.559  42.876 1.00 16.27 ? 62   LEU B CA    1 
ATOM   1746 C C     . LEU D 2 62  ? 3.300   -1.455  44.344 1.00 16.49 ? 62   LEU B C     1 
ATOM   1747 O O     . LEU D 2 62  ? 2.152   -1.190  44.671 1.00 17.46 ? 62   LEU B O     1 
ATOM   1748 C CB    . LEU D 2 62  ? 3.622   -3.025  42.441 1.00 15.47 ? 62   LEU B CB    1 
ATOM   1749 C CG    . LEU D 2 62  ? 3.645   -3.367  40.951 1.00 14.63 ? 62   LEU B CG    1 
ATOM   1750 C CD1   . LEU D 2 62  ? 3.626   -4.878  40.795 1.00 13.33 ? 62   LEU B CD1   1 
ATOM   1751 C CD2   . LEU D 2 62  ? 2.465   -2.735  40.221 1.00 14.12 ? 62   LEU B CD2   1 
ATOM   1752 N N     . HIS D 2 63  ? 4.272   -1.615  45.234 1.00 17.19 ? 63   HIS B N     1 
ATOM   1753 C CA    . HIS D 2 63  ? 3.984   -1.544  46.662 1.00 18.05 ? 63   HIS B CA    1 
ATOM   1754 C C     . HIS D 2 63  ? 3.546   -0.159  47.101 1.00 19.99 ? 63   HIS B C     1 
ATOM   1755 O O     . HIS D 2 63  ? 2.554   0.000   47.819 1.00 20.72 ? 63   HIS B O     1 
ATOM   1756 C CB    . HIS D 2 63  ? 5.193   -1.960  47.479 1.00 16.96 ? 63   HIS B CB    1 
ATOM   1757 C CG    . HIS D 2 63  ? 4.978   -1.839  48.952 1.00 18.38 ? 63   HIS B CG    1 
ATOM   1758 N ND1   . HIS D 2 63  ? 4.076   -2.623  49.637 1.00 19.97 ? 63   HIS B ND1   1 
ATOM   1759 C CD2   . HIS D 2 63  ? 5.523   -1.005  49.869 1.00 19.48 ? 63   HIS B CD2   1 
ATOM   1760 C CE1   . HIS D 2 63  ? 4.075   -2.281  50.914 1.00 18.74 ? 63   HIS B CE1   1 
ATOM   1761 N NE2   . HIS D 2 63  ? 4.945   -1.300  51.080 1.00 19.45 ? 63   HIS B NE2   1 
ATOM   1762 N N     . ALA D 2 64  ? 4.303   0.844   46.671 1.00 21.45 ? 64   ALA B N     1 
ATOM   1763 C CA    . ALA D 2 64  ? 4.027   2.227   47.023 1.00 21.73 ? 64   ALA B CA    1 
ATOM   1764 C C     . ALA D 2 64  ? 2.798   2.821   46.336 1.00 22.07 ? 64   ALA B C     1 
ATOM   1765 O O     . ALA D 2 64  ? 2.095   3.643   46.920 1.00 22.57 ? 64   ALA B O     1 
ATOM   1766 C CB    . ALA D 2 64  ? 5.241   3.073   46.727 1.00 21.09 ? 64   ALA B CB    1 
ATOM   1767 N N     . PHE D 2 65  ? 2.523   2.394   45.110 1.00 22.80 ? 65   PHE B N     1 
ATOM   1768 C CA    . PHE D 2 65  ? 1.394   2.944   44.374 1.00 23.93 ? 65   PHE B CA    1 
ATOM   1769 C C     . PHE D 2 65  ? 0.136   2.087   44.244 1.00 23.73 ? 65   PHE B C     1 
ATOM   1770 O O     . PHE D 2 65  ? -0.908  2.586   43.815 1.00 23.96 ? 65   PHE B O     1 
ATOM   1771 C CB    . PHE D 2 65  ? 1.866   3.491   43.018 1.00 25.72 ? 65   PHE B CB    1 
ATOM   1772 C CG    . PHE D 2 65  ? 2.739   4.725   43.141 1.00 29.03 ? 65   PHE B CG    1 
ATOM   1773 C CD1   . PHE D 2 65  ? 4.093   4.615   43.472 1.00 30.42 ? 65   PHE B CD1   1 
ATOM   1774 C CD2   . PHE D 2 65  ? 2.194   6.001   42.993 1.00 29.66 ? 65   PHE B CD2   1 
ATOM   1775 C CE1   . PHE D 2 65  ? 4.891   5.761   43.660 1.00 30.32 ? 65   PHE B CE1   1 
ATOM   1776 C CE2   . PHE D 2 65  ? 2.979   7.146   43.179 1.00 30.39 ? 65   PHE B CE2   1 
ATOM   1777 C CZ    . PHE D 2 65  ? 4.328   7.023   43.514 1.00 30.70 ? 65   PHE B CZ    1 
ATOM   1778 N N     . THR D 2 66  ? 0.221   0.807   44.601 1.00 22.81 ? 66   THR B N     1 
ATOM   1779 C CA    . THR D 2 66  ? -0.958  -0.065  44.541 1.00 22.06 ? 66   THR B CA    1 
ATOM   1780 C C     . THR D 2 66  ? -1.194  -0.719  45.897 1.00 20.72 ? 66   THR B C     1 
ATOM   1781 O O     . THR D 2 66  ? -2.286  -1.199  46.176 1.00 21.07 ? 66   THR B O     1 
ATOM   1782 C CB    . THR D 2 66  ? -0.872  -1.169  43.444 1.00 21.76 ? 66   THR B CB    1 
ATOM   1783 O OG1   . THR D 2 66  ? -0.089  -2.265  43.916 1.00 24.10 ? 66   THR B OG1   1 
ATOM   1784 C CG2   . THR D 2 66  ? -0.249  -0.637  42.180 1.00 21.37 ? 66   THR B CG2   1 
ATOM   1785 N N     . GLY D 2 67  ? -0.173  -0.690  46.749 1.00 19.68 ? 67   GLY B N     1 
ATOM   1786 C CA    . GLY D 2 67  ? -0.278  -1.285  48.069 1.00 17.81 ? 67   GLY B CA    1 
ATOM   1787 C C     . GLY D 2 67  ? 0.002   -2.775  48.079 1.00 17.97 ? 67   GLY B C     1 
ATOM   1788 O O     . GLY D 2 67  ? -0.083  -3.415  49.126 1.00 18.17 ? 67   GLY B O     1 
ATOM   1789 N N     . GLN D 2 68  ? 0.337   -3.329  46.917 1.00 18.17 ? 68   GLN B N     1 
ATOM   1790 C CA    . GLN D 2 68  ? 0.631   -4.756  46.783 1.00 19.07 ? 68   GLN B CA    1 
ATOM   1791 C C     . GLN D 2 68  ? 1.792   -5.135  47.693 1.00 19.58 ? 68   GLN B C     1 
ATOM   1792 O O     . GLN D 2 68  ? 2.903   -4.640  47.515 1.00 19.61 ? 68   GLN B O     1 
ATOM   1793 C CB    . GLN D 2 68  ? 0.974   -5.067  45.327 1.00 18.36 ? 68   GLN B CB    1 
ATOM   1794 C CG    . GLN D 2 68  ? 1.372   -6.502  45.061 1.00 17.32 ? 68   GLN B CG    1 
ATOM   1795 C CD    . GLN D 2 68  ? 1.435   -6.796  43.590 1.00 16.83 ? 68   GLN B CD    1 
ATOM   1796 O OE1   . GLN D 2 68  ? 0.433   -6.699  42.890 1.00 18.32 ? 68   GLN B OE1   1 
ATOM   1797 N NE2   . GLN D 2 68  ? 2.612   -7.153  43.105 1.00 17.59 ? 68   GLN B NE2   1 
ATOM   1798 N N     . PRO D 2 69  ? 1.547   -6.026  48.674 1.00 20.43 ? 69   PRO B N     1 
ATOM   1799 C CA    . PRO D 2 69  ? 2.569   -6.471  49.625 1.00 21.43 ? 69   PRO B CA    1 
ATOM   1800 C C     . PRO D 2 69  ? 3.887   -6.904  48.979 1.00 22.67 ? 69   PRO B C     1 
ATOM   1801 O O     . PRO D 2 69  ? 3.918   -7.422  47.859 1.00 23.03 ? 69   PRO B O     1 
ATOM   1802 C CB    . PRO D 2 69  ? 1.881   -7.636  50.341 1.00 20.79 ? 69   PRO B CB    1 
ATOM   1803 C CG    . PRO D 2 69  ? 0.454   -7.237  50.327 1.00 19.28 ? 69   PRO B CG    1 
ATOM   1804 C CD    . PRO D 2 69  ? 0.289   -6.757  48.907 1.00 20.12 ? 69   PRO B CD    1 
ATOM   1805 N N     . LEU D 2 70  ? 4.981   -6.619  49.675 1.00 22.95 ? 70   LEU B N     1 
ATOM   1806 C CA    . LEU D 2 70  ? 6.309   -6.979  49.207 1.00 22.45 ? 70   LEU B CA    1 
ATOM   1807 C C     . LEU D 2 70  ? 6.570   -8.422  49.606 1.00 22.74 ? 70   LEU B C     1 
ATOM   1808 O O     . LEU D 2 70  ? 5.977   -8.928  50.570 1.00 22.90 ? 70   LEU B O     1 
ATOM   1809 C CB    . LEU D 2 70  ? 7.362   -6.083  49.865 1.00 21.29 ? 70   LEU B CB    1 
ATOM   1810 C CG    . LEU D 2 70  ? 7.405   -4.608  49.475 1.00 20.73 ? 70   LEU B CG    1 
ATOM   1811 C CD1   . LEU D 2 70  ? 8.236   -3.840  50.492 1.00 21.25 ? 70   LEU B CD1   1 
ATOM   1812 C CD2   . LEU D 2 70  ? 7.963   -4.456  48.070 1.00 19.62 ? 70   LEU B CD2   1 
ATOM   1813 N N     . PRO D 2 71  ? 7.423   -9.123  48.840 1.00 22.40 ? 71   PRO B N     1 
ATOM   1814 C CA    . PRO D 2 71  ? 7.705   -10.506 49.203 1.00 22.30 ? 71   PRO B CA    1 
ATOM   1815 C C     . PRO D 2 71  ? 8.542   -10.592 50.474 1.00 23.22 ? 71   PRO B C     1 
ATOM   1816 O O     . PRO D 2 71  ? 9.293   -9.678  50.824 1.00 22.84 ? 71   PRO B O     1 
ATOM   1817 C CB    . PRO D 2 71  ? 8.460   -11.035 47.986 1.00 21.54 ? 71   PRO B CB    1 
ATOM   1818 C CG    . PRO D 2 71  ? 9.121   -9.815  47.430 1.00 21.74 ? 71   PRO B CG    1 
ATOM   1819 C CD    . PRO D 2 71  ? 8.034   -8.785  47.542 1.00 21.68 ? 71   PRO B CD    1 
ATOM   1820 N N     . ASP D 2 72  ? 8.295   -11.670 51.199 1.00 24.99 ? 72   ASP B N     1 
ATOM   1821 C CA    . ASP D 2 72  ? 8.965   -12.022 52.436 1.00 26.46 ? 72   ASP B CA    1 
ATOM   1822 C C     . ASP D 2 72  ? 10.173  -12.813 51.952 1.00 25.99 ? 72   ASP B C     1 
ATOM   1823 O O     . ASP D 2 72  ? 10.176  -13.292 50.817 1.00 26.56 ? 72   ASP B O     1 
ATOM   1824 C CB    . ASP D 2 72  ? 8.051   -12.987 53.188 1.00 30.19 ? 72   ASP B CB    1 
ATOM   1825 C CG    . ASP D 2 72  ? 7.994   -12.719 54.654 1.00 33.79 ? 72   ASP B CG    1 
ATOM   1826 O OD1   . ASP D 2 72  ? 7.206   -11.842 55.069 1.00 36.43 ? 72   ASP B OD1   1 
ATOM   1827 O OD2   . ASP D 2 72  ? 8.717   -13.407 55.400 1.00 36.97 ? 72   ASP B OD2   1 
ATOM   1828 N N     . ASP D 2 73  ? 11.194  -12.964 52.786 1.00 25.30 ? 73   ASP B N     1 
ATOM   1829 C CA    . ASP D 2 73  ? 12.350  -13.763 52.378 1.00 24.25 ? 73   ASP B CA    1 
ATOM   1830 C C     . ASP D 2 73  ? 11.868  -15.191 52.118 1.00 23.81 ? 73   ASP B C     1 
ATOM   1831 O O     . ASP D 2 73  ? 12.320  -15.850 51.178 1.00 23.71 ? 73   ASP B O     1 
ATOM   1832 C CB    . ASP D 2 73  ? 13.421  -13.781 53.473 1.00 23.47 ? 73   ASP B CB    1 
ATOM   1833 C CG    . ASP D 2 73  ? 14.290  -12.548 53.459 1.00 21.50 ? 73   ASP B CG    1 
ATOM   1834 O OD1   . ASP D 2 73  ? 14.120  -11.697 52.574 1.00 22.16 ? 73   ASP B OD1   1 
ATOM   1835 O OD2   . ASP D 2 73  ? 15.160  -12.431 54.333 1.00 21.40 ? 73   ASP B OD2   1 
ATOM   1836 N N     . ALA D 2 74  ? 10.911  -15.632 52.935 1.00 23.66 ? 74   ALA B N     1 
ATOM   1837 C CA    . ALA D 2 74  ? 10.319  -16.967 52.835 1.00 23.60 ? 74   ALA B CA    1 
ATOM   1838 C C     . ALA D 2 74  ? 9.668   -17.146 51.466 1.00 23.67 ? 74   ALA B C     1 
ATOM   1839 O O     . ALA D 2 74  ? 9.669   -18.250 50.909 1.00 22.71 ? 74   ALA B O     1 
ATOM   1840 C CB    . ALA D 2 74  ? 9.286   -17.168 53.944 1.00 23.40 ? 74   ALA B CB    1 
ATOM   1841 N N     . ASP D 2 75  ? 9.148   -16.042 50.924 1.00 23.70 ? 75   ASP B N     1 
ATOM   1842 C CA    . ASP D 2 75  ? 8.505   -16.035 49.610 1.00 25.05 ? 75   ASP B CA    1 
ATOM   1843 C C     . ASP D 2 75  ? 9.510   -16.118 48.468 1.00 26.16 ? 75   ASP B C     1 
ATOM   1844 O O     . ASP D 2 75  ? 9.162   -16.527 47.360 1.00 26.46 ? 75   ASP B O     1 
ATOM   1845 C CB    . ASP D 2 75  ? 7.670   -14.762 49.417 1.00 25.15 ? 75   ASP B CB    1 
ATOM   1846 C CG    . ASP D 2 75  ? 6.463   -14.706 50.323 1.00 25.62 ? 75   ASP B CG    1 
ATOM   1847 O OD1   . ASP D 2 75  ? 5.664   -15.670 50.332 1.00 26.07 ? 75   ASP B OD1   1 
ATOM   1848 O OD2   . ASP D 2 75  ? 6.296   -13.686 51.009 1.00 23.72 ? 75   ASP B OD2   1 
ATOM   1849 N N     . LEU D 2 76  ? 10.746  -15.702 48.732 1.00 27.45 ? 76   LEU B N     1 
ATOM   1850 C CA    . LEU D 2 76  ? 11.799  -15.699 47.717 1.00 28.30 ? 76   LEU B CA    1 
ATOM   1851 C C     . LEU D 2 76  ? 12.691  -16.937 47.727 1.00 29.99 ? 76   LEU B C     1 
ATOM   1852 O O     . LEU D 2 76  ? 13.446  -17.155 46.778 1.00 29.66 ? 76   LEU B O     1 
ATOM   1853 C CB    . LEU D 2 76  ? 12.668  -14.451 47.882 1.00 26.58 ? 76   LEU B CB    1 
ATOM   1854 C CG    . LEU D 2 76  ? 11.959  -13.103 47.817 1.00 24.89 ? 76   LEU B CG    1 
ATOM   1855 C CD1   . LEU D 2 76  ? 12.823  -12.033 48.444 1.00 23.50 ? 76   LEU B CD1   1 
ATOM   1856 C CD2   . LEU D 2 76  ? 11.632  -12.774 46.382 1.00 23.49 ? 76   LEU B CD2   1 
ATOM   1857 N N     . ARG D 2 77  ? 12.598  -17.743 48.787 1.00 32.36 ? 77   ARG B N     1 
ATOM   1858 C CA    . ARG D 2 77  ? 13.421  -18.946 48.917 1.00 34.84 ? 77   ARG B CA    1 
ATOM   1859 C C     . ARG D 2 77  ? 13.270  -19.945 47.770 1.00 36.63 ? 77   ARG B C     1 
ATOM   1860 O O     . ARG D 2 77  ? 12.159  -20.356 47.426 1.00 35.84 ? 77   ARG B O     1 
ATOM   1861 C CB    . ARG D 2 77  ? 13.214  -19.611 50.284 1.00 35.35 ? 77   ARG B CB    1 
ATOM   1862 C CG    . ARG D 2 77  ? 14.323  -19.269 51.302 1.00 36.97 ? 77   ARG B CG    1 
ATOM   1863 C CD    . ARG D 2 77  ? 13.800  -18.471 52.497 1.00 39.28 ? 77   ARG B CD    1 
ATOM   1864 N NE    . ARG D 2 77  ? 14.870  -17.871 53.303 1.00 40.39 ? 77   ARG B NE    1 
ATOM   1865 C CZ    . ARG D 2 77  ? 14.726  -17.465 54.568 1.00 40.78 ? 77   ARG B CZ    1 
ATOM   1866 N NH1   . ARG D 2 77  ? 13.558  -17.592 55.193 1.00 39.75 ? 77   ARG B NH1   1 
ATOM   1867 N NH2   . ARG D 2 77  ? 15.750  -16.913 55.212 1.00 40.10 ? 77   ARG B NH2   1 
ATOM   1868 N N     . LYS D 2 78  ? 14.414  -20.304 47.179 1.00 39.40 ? 78   LYS B N     1 
ATOM   1869 C CA    . LYS D 2 78  ? 14.493  -21.220 46.034 1.00 42.05 ? 78   LYS B CA    1 
ATOM   1870 C C     . LYS D 2 78  ? 13.963  -22.641 46.241 1.00 44.13 ? 78   LYS B C     1 
ATOM   1871 O O     . LYS D 2 78  ? 13.556  -23.301 45.280 1.00 44.14 ? 78   LYS B O     1 
ATOM   1872 C CB    . LYS D 2 78  ? 15.927  -21.281 45.491 1.00 42.28 ? 78   LYS B CB    1 
ATOM   1873 C CG    . LYS D 2 78  ? 16.466  -19.960 44.927 1.00 42.13 ? 78   LYS B CG    1 
ATOM   1874 C CD    . LYS D 2 78  ? 17.201  -20.182 43.607 1.00 41.02 ? 78   LYS B CD    1 
ATOM   1875 C CE    . LYS D 2 78  ? 17.852  -18.909 43.104 1.00 40.78 ? 78   LYS B CE    1 
ATOM   1876 N NZ    . LYS D 2 78  ? 19.080  -18.579 43.875 1.00 41.29 ? 78   LYS B NZ    1 
ATOM   1877 N N     . GLU D 2 79  ? 13.978  -23.114 47.484 1.00 46.16 ? 79   GLU B N     1 
ATOM   1878 C CA    . GLU D 2 79  ? 13.479  -24.450 47.801 1.00 47.87 ? 79   GLU B CA    1 
ATOM   1879 C C     . GLU D 2 79  ? 11.968  -24.501 47.505 1.00 48.60 ? 79   GLU B C     1 
ATOM   1880 O O     . GLU D 2 79  ? 11.421  -25.549 47.152 1.00 48.22 ? 79   GLU B O     1 
ATOM   1881 C CB    . GLU D 2 79  ? 13.745  -24.782 49.279 1.00 49.10 ? 79   GLU B CB    1 
ATOM   1882 C CG    . GLU D 2 79  ? 15.161  -24.434 49.787 1.00 51.16 ? 79   GLU B CG    1 
ATOM   1883 C CD    . GLU D 2 79  ? 15.267  -23.034 50.409 1.00 52.47 ? 79   GLU B CD    1 
ATOM   1884 O OE1   . GLU D 2 79  ? 14.251  -22.544 50.951 1.00 53.48 ? 79   GLU B OE1   1 
ATOM   1885 O OE2   . GLU D 2 79  ? 16.367  -22.429 50.373 1.00 52.57 ? 79   GLU B OE2   1 
ATOM   1886 N N     . ARG D 2 80  ? 11.311  -23.348 47.644 1.00 49.62 ? 80   ARG B N     1 
ATOM   1887 C CA    . ARG D 2 80  ? 9.877   -23.206 47.390 1.00 49.71 ? 80   ARG B CA    1 
ATOM   1888 C C     . ARG D 2 80  ? 9.606   -22.691 45.980 1.00 48.26 ? 80   ARG B C     1 
ATOM   1889 O O     . ARG D 2 80  ? 10.421  -21.972 45.401 1.00 48.17 ? 80   ARG B O     1 
ATOM   1890 C CB    . ARG D 2 80  ? 9.235   -22.240 48.403 1.00 52.43 ? 80   ARG B CB    1 
ATOM   1891 C CG    . ARG D 2 80  ? 9.033   -22.795 49.821 1.00 55.19 ? 80   ARG B CG    1 
ATOM   1892 C CD    . ARG D 2 80  ? 8.335   -24.167 49.817 1.00 57.78 ? 80   ARG B CD    1 
ATOM   1893 N NE    . ARG D 2 80  ? 7.315   -24.292 48.771 1.00 60.05 ? 80   ARG B NE    1 
ATOM   1894 C CZ    . ARG D 2 80  ? 6.000   -24.335 48.986 1.00 61.01 ? 80   ARG B CZ    1 
ATOM   1895 N NH1   . ARG D 2 80  ? 5.516   -24.265 50.224 1.00 60.28 ? 80   ARG B NH1   1 
ATOM   1896 N NH2   . ARG D 2 80  ? 5.167   -24.445 47.950 1.00 60.64 ? 80   ARG B NH2   1 
ATOM   1897 N N     . SER D 2 81  ? 8.437   -23.039 45.452 1.00 46.55 ? 81   SER B N     1 
ATOM   1898 C CA    . SER D 2 81  ? 8.015   -22.618 44.118 1.00 44.67 ? 81   SER B CA    1 
ATOM   1899 C C     . SER D 2 81  ? 7.853   -21.093 44.054 1.00 42.54 ? 81   SER B C     1 
ATOM   1900 O O     . SER D 2 81  ? 7.599   -20.450 45.074 1.00 42.27 ? 81   SER B O     1 
ATOM   1901 C CB    . SER D 2 81  ? 6.690   -23.300 43.767 1.00 45.15 ? 81   SER B CB    1 
ATOM   1902 O OG    . SER D 2 81  ? 6.329   -23.056 42.422 1.00 47.36 ? 81   SER B OG    1 
ATOM   1903 N N     . ASP D 2 82  ? 7.986   -20.523 42.859 1.00 40.05 ? 82   ASP B N     1 
ATOM   1904 C CA    . ASP D 2 82  ? 7.860   -19.072 42.681 1.00 38.68 ? 82   ASP B CA    1 
ATOM   1905 C C     . ASP D 2 82  ? 6.395   -18.620 42.577 1.00 37.94 ? 82   ASP B C     1 
ATOM   1906 O O     . ASP D 2 82  ? 5.776   -18.724 41.517 1.00 38.50 ? 82   ASP B O     1 
ATOM   1907 C CB    . ASP D 2 82  ? 8.652   -18.626 41.442 1.00 36.89 ? 82   ASP B CB    1 
ATOM   1908 C CG    . ASP D 2 82  ? 8.838   -17.121 41.370 1.00 35.22 ? 82   ASP B CG    1 
ATOM   1909 O OD1   . ASP D 2 82  ? 8.888   -16.473 42.437 1.00 32.61 ? 82   ASP B OD1   1 
ATOM   1910 O OD2   . ASP D 2 82  ? 8.943   -16.591 40.242 1.00 35.00 ? 82   ASP B OD2   1 
ATOM   1911 N N     . GLU D 2 83  ? 5.847   -18.092 43.668 1.00 36.56 ? 83   GLU B N     1 
ATOM   1912 C CA    . GLU D 2 83  ? 4.454   -17.663 43.661 1.00 35.64 ? 83   GLU B CA    1 
ATOM   1913 C C     . GLU D 2 83  ? 4.186   -16.307 44.307 1.00 34.12 ? 83   GLU B C     1 
ATOM   1914 O O     . GLU D 2 83  ? 5.104   -15.623 44.763 1.00 34.30 ? 83   GLU B O     1 
ATOM   1915 C CB    . GLU D 2 83  ? 3.588   -18.718 44.345 1.00 36.68 ? 83   GLU B CB    1 
ATOM   1916 C CG    . GLU D 2 83  ? 3.562   -20.056 43.639 1.00 39.22 ? 83   GLU B CG    1 
ATOM   1917 C CD    . GLU D 2 83  ? 2.671   -21.061 44.339 1.00 41.40 ? 83   GLU B CD    1 
ATOM   1918 O OE1   . GLU D 2 83  ? 2.622   -21.049 45.593 1.00 41.46 ? 83   GLU B OE1   1 
ATOM   1919 O OE2   . GLU D 2 83  ? 2.018   -21.864 43.632 1.00 42.65 ? 83   GLU B OE2   1 
ATOM   1920 N N     . ILE D 2 84  ? 2.911   -15.925 44.316 1.00 31.25 ? 84   ILE B N     1 
ATOM   1921 C CA    . ILE D 2 84  ? 2.455   -14.675 44.912 1.00 28.47 ? 84   ILE B CA    1 
ATOM   1922 C C     . ILE D 2 84  ? 2.809   -14.729 46.397 1.00 27.23 ? 84   ILE B C     1 
ATOM   1923 O O     . ILE D 2 84  ? 2.739   -15.793 47.008 1.00 27.37 ? 84   ILE B O     1 
ATOM   1924 C CB    . ILE D 2 84  ? 0.911   -14.532 44.744 1.00 27.77 ? 84   ILE B CB    1 
ATOM   1925 C CG1   . ILE D 2 84  ? 0.558   -14.420 43.258 1.00 27.08 ? 84   ILE B CG1   1 
ATOM   1926 C CG2   . ILE D 2 84  ? 0.378   -13.351 45.541 1.00 26.93 ? 84   ILE B CG2   1 
ATOM   1927 C CD1   . ILE D 2 84  ? -0.918  -14.372 42.958 1.00 26.79 ? 84   ILE B CD1   1 
ATOM   1928 N N     . PRO D 2 85  ? 3.280   -13.608 46.973 1.00 25.91 ? 85   PRO B N     1 
ATOM   1929 C CA    . PRO D 2 85  ? 3.632   -13.593 48.395 1.00 25.95 ? 85   PRO B CA    1 
ATOM   1930 C C     . PRO D 2 85  ? 2.442   -14.039 49.240 1.00 26.28 ? 85   PRO B C     1 
ATOM   1931 O O     . PRO D 2 85  ? 1.295   -13.822 48.852 1.00 26.45 ? 85   PRO B O     1 
ATOM   1932 C CB    . PRO D 2 85  ? 3.989   -12.130 48.635 1.00 25.83 ? 85   PRO B CB    1 
ATOM   1933 C CG    . PRO D 2 85  ? 4.594   -11.732 47.339 1.00 24.93 ? 85   PRO B CG    1 
ATOM   1934 C CD    . PRO D 2 85  ? 3.642   -12.333 46.335 1.00 24.90 ? 85   PRO B CD    1 
ATOM   1935 N N     . GLU D 2 86  ? 2.711   -14.680 50.374 1.00 26.65 ? 86   GLU B N     1 
ATOM   1936 C CA    . GLU D 2 86  ? 1.638   -15.173 51.234 1.00 27.23 ? 86   GLU B CA    1 
ATOM   1937 C C     . GLU D 2 86  ? 0.733   -14.079 51.755 1.00 27.15 ? 86   GLU B C     1 
ATOM   1938 O O     . GLU D 2 86  ? -0.486  -14.254 51.796 1.00 27.71 ? 86   GLU B O     1 
ATOM   1939 C CB    . GLU D 2 86  ? 2.182   -16.022 52.391 1.00 28.16 ? 86   GLU B CB    1 
ATOM   1940 C CG    . GLU D 2 86  ? 2.732   -17.403 51.963 1.00 29.08 ? 86   GLU B CG    1 
ATOM   1941 C CD    . GLU D 2 86  ? 1.728   -18.245 51.167 1.00 29.20 ? 86   GLU B CD    1 
ATOM   1942 O OE1   . GLU D 2 86  ? 0.648   -18.559 51.708 1.00 28.43 ? 86   GLU B OE1   1 
ATOM   1943 O OE2   . GLU D 2 86  ? 2.025   -18.598 50.000 1.00 30.28 ? 86   GLU B OE2   1 
ATOM   1944 N N     . ALA D 2 87  ? 1.325   -12.944 52.121 1.00 26.67 ? 87   ALA B N     1 
ATOM   1945 C CA    . ALA D 2 87  ? 0.562   -11.807 52.623 1.00 26.10 ? 87   ALA B CA    1 
ATOM   1946 C C     . ALA D 2 87  ? -0.342  -11.289 51.517 1.00 26.24 ? 87   ALA B C     1 
ATOM   1947 O O     . ALA D 2 87  ? -1.479  -10.910 51.766 1.00 26.70 ? 87   ALA B O     1 
ATOM   1948 C CB    . ALA D 2 87  ? 1.495   -10.701 53.110 1.00 24.88 ? 87   ALA B CB    1 
ATOM   1949 N N     . ALA D 2 88  ? 0.165   -11.285 50.291 1.00 26.95 ? 88   ALA B N     1 
ATOM   1950 C CA    . ALA D 2 88  ? -0.620  -10.825 49.154 1.00 28.65 ? 88   ALA B CA    1 
ATOM   1951 C C     . ALA D 2 88  ? -1.773  -11.800 48.880 1.00 30.09 ? 88   ALA B C     1 
ATOM   1952 O O     . ALA D 2 88  ? -2.896  -11.384 48.583 1.00 31.08 ? 88   ALA B O     1 
ATOM   1953 C CB    . ALA D 2 88  ? 0.268   -10.680 47.925 1.00 26.92 ? 88   ALA B CB    1 
ATOM   1954 N N     . LYS D 2 89  ? -1.491  -13.094 49.013 1.00 30.70 ? 89   LYS B N     1 
ATOM   1955 C CA    . LYS D 2 89  ? -2.483  -14.134 48.794 1.00 31.26 ? 89   LYS B CA    1 
ATOM   1956 C C     . LYS D 2 89  ? -3.661  -13.995 49.739 1.00 32.12 ? 89   LYS B C     1 
ATOM   1957 O O     . LYS D 2 89  ? -4.810  -14.089 49.324 1.00 32.28 ? 89   LYS B O     1 
ATOM   1958 C CB    . LYS D 2 89  ? -1.864  -15.516 48.990 1.00 30.59 ? 89   LYS B CB    1 
ATOM   1959 C CG    . LYS D 2 89  ? -1.103  -16.046 47.795 1.00 30.39 ? 89   LYS B CG    1 
ATOM   1960 C CD    . LYS D 2 89  ? -0.846  -17.530 47.967 1.00 30.21 ? 89   LYS B CD    1 
ATOM   1961 C CE    . LYS D 2 89  ? -0.230  -18.141 46.734 1.00 30.29 ? 89   LYS B CE    1 
ATOM   1962 N NZ    . LYS D 2 89  ? -0.154  -19.621 46.877 1.00 31.61 ? 89   LYS B NZ    1 
ATOM   1963 N N     . GLU D 2 90  ? -3.376  -13.785 51.017 1.00 33.58 ? 90   GLU B N     1 
ATOM   1964 C CA    . GLU D 2 90  ? -4.445  -13.657 51.990 1.00 35.78 ? 90   GLU B CA    1 
ATOM   1965 C C     . GLU D 2 90  ? -5.379  -12.500 51.706 1.00 34.87 ? 90   GLU B C     1 
ATOM   1966 O O     . GLU D 2 90  ? -6.591  -12.656 51.798 1.00 35.52 ? 90   GLU B O     1 
ATOM   1967 C CB    . GLU D 2 90  ? -3.909  -13.544 53.414 1.00 39.31 ? 90   GLU B CB    1 
ATOM   1968 C CG    . GLU D 2 90  ? -5.045  -13.407 54.412 1.00 45.42 ? 90   GLU B CG    1 
ATOM   1969 C CD    . GLU D 2 90  ? -4.625  -13.663 55.837 1.00 49.64 ? 90   GLU B CD    1 
ATOM   1970 O OE1   . GLU D 2 90  ? -3.996  -12.764 56.447 1.00 50.74 ? 90   GLU B OE1   1 
ATOM   1971 O OE2   . GLU D 2 90  ? -4.954  -14.758 56.360 1.00 51.87 ? 90   GLU B OE2   1 
ATOM   1972 N N     . ILE D 2 91  ? -4.818  -11.337 51.389 1.00 34.19 ? 91   ILE B N     1 
ATOM   1973 C CA    . ILE D 2 91  ? -5.628  -10.162 51.089 1.00 33.04 ? 91   ILE B CA    1 
ATOM   1974 C C     . ILE D 2 91  ? -6.459  -10.449 49.852 1.00 32.90 ? 91   ILE B C     1 
ATOM   1975 O O     . ILE D 2 91  ? -7.598  -10.008 49.760 1.00 32.95 ? 91   ILE B O     1 
ATOM   1976 C CB    . ILE D 2 91  ? -4.766  -8.908  50.865 1.00 32.50 ? 91   ILE B CB    1 
ATOM   1977 C CG1   . ILE D 2 91  ? -3.912  -8.653  52.104 1.00 32.85 ? 91   ILE B CG1   1 
ATOM   1978 C CG2   . ILE D 2 91  ? -5.653  -7.685  50.606 1.00 31.13 ? 91   ILE B CG2   1 
ATOM   1979 C CD1   . ILE D 2 91  ? -2.879  -7.569  51.917 1.00 35.01 ? 91   ILE B CD1   1 
ATOM   1980 N N     . MET D 2 92  ? -5.898  -11.212 48.915 1.00 32.56 ? 92   MET B N     1 
ATOM   1981 C CA    . MET D 2 92  ? -6.630  -11.575 47.706 1.00 32.78 ? 92   MET B CA    1 
ATOM   1982 C C     . MET D 2 92  ? -7.869  -12.371 48.103 1.00 33.53 ? 92   MET B C     1 
ATOM   1983 O O     . MET D 2 92  ? -8.940  -12.169 47.542 1.00 33.80 ? 92   MET B O     1 
ATOM   1984 C CB    . MET D 2 92  ? -5.756  -12.390 46.757 1.00 31.54 ? 92   MET B CB    1 
ATOM   1985 C CG    . MET D 2 92  ? -4.653  -11.574 46.110 1.00 31.15 ? 92   MET B CG    1 
ATOM   1986 S SD    . MET D 2 92  ? -3.637  -12.533 44.984 1.00 30.64 ? 92   MET B SD    1 
ATOM   1987 C CE    . MET D 2 92  ? -4.622  -12.483 43.509 1.00 29.27 ? 92   MET B CE    1 
ATOM   1988 N N     . ARG D 2 93  ? -7.730  -13.235 49.106 1.00 34.04 ? 93   ARG B N     1 
ATOM   1989 C CA    . ARG D 2 93  ? -8.848  -14.037 49.596 1.00 35.20 ? 93   ARG B CA    1 
ATOM   1990 C C     . ARG D 2 93  ? -9.881  -13.164 50.309 1.00 36.07 ? 93   ARG B C     1 
ATOM   1991 O O     . ARG D 2 93  ? -11.085 -13.317 50.099 1.00 36.72 ? 93   ARG B O     1 
ATOM   1992 C CB    . ARG D 2 93  ? -8.353  -15.129 50.537 1.00 35.23 ? 93   ARG B CB    1 
ATOM   1993 C CG    . ARG D 2 93  ? -7.428  -16.128 49.873 1.00 36.05 ? 93   ARG B CG    1 
ATOM   1994 C CD    . ARG D 2 93  ? -6.980  -17.201 50.851 1.00 36.88 ? 93   ARG B CD    1 
ATOM   1995 N NE    . ARG D 2 93  ? -5.899  -18.016 50.303 1.00 36.67 ? 93   ARG B NE    1 
ATOM   1996 C CZ    . ARG D 2 93  ? -4.696  -18.121 50.855 1.00 35.32 ? 93   ARG B CZ    1 
ATOM   1997 N NH1   . ARG D 2 93  ? -4.424  -17.467 51.977 1.00 34.03 ? 93   ARG B NH1   1 
ATOM   1998 N NH2   . ARG D 2 93  ? -3.757  -18.852 50.268 1.00 35.41 ? 93   ARG B NH2   1 
ATOM   1999 N N     . GLU D 2 94  ? -9.404  -12.229 51.126 1.00 36.53 ? 94   GLU B N     1 
ATOM   2000 C CA    . GLU D 2 94  ? -10.276 -11.311 51.858 1.00 36.62 ? 94   GLU B CA    1 
ATOM   2001 C C     . GLU D 2 94  ? -10.969 -10.344 50.906 1.00 36.63 ? 94   GLU B C     1 
ATOM   2002 O O     . GLU D 2 94  ? -11.947 -9.694  51.274 1.00 37.02 ? 94   GLU B O     1 
ATOM   2003 C CB    . GLU D 2 94  ? -9.466  -10.534 52.890 1.00 37.21 ? 94   GLU B CB    1 
ATOM   2004 C CG    . GLU D 2 94  ? -8.862  -11.429 53.961 1.00 39.65 ? 94   GLU B CG    1 
ATOM   2005 C CD    . GLU D 2 94  ? -7.781  -10.753 54.798 1.00 41.92 ? 94   GLU B CD    1 
ATOM   2006 O OE1   . GLU D 2 94  ? -7.443  -9.569  54.550 1.00 41.97 ? 94   GLU B OE1   1 
ATOM   2007 O OE2   . GLU D 2 94  ? -7.257  -11.430 55.711 1.00 43.31 ? 94   GLU B OE2   1 
ATOM   2008 N N     . MET D 2 95  ? -10.456 -10.269 49.680 1.00 36.48 ? 95   MET B N     1 
ATOM   2009 C CA    . MET D 2 95  ? -11.003 -9.399  48.645 1.00 36.98 ? 95   MET B CA    1 
ATOM   2010 C C     . MET D 2 95  ? -11.867 -10.172 47.640 1.00 36.96 ? 95   MET B C     1 
ATOM   2011 O O     . MET D 2 95  ? -12.201 -9.665  46.567 1.00 36.57 ? 95   MET B O     1 
ATOM   2012 C CB    . MET D 2 95  ? -9.869  -8.659  47.922 1.00 36.79 ? 95   MET B CB    1 
ATOM   2013 C CG    . MET D 2 95  ? -9.141  -7.616  48.775 1.00 36.65 ? 95   MET B CG    1 
ATOM   2014 S SD    . MET D 2 95  ? -10.026 -6.061  48.971 1.00 37.08 ? 95   MET B SD    1 
ATOM   2015 C CE    . MET D 2 95  ? -10.736 -6.265  50.599 1.00 36.27 ? 95   MET B CE    1 
ATOM   2016 N N     . GLY D 2 96  ? -12.246 -11.392 48.012 1.00 37.56 ? 96   GLY B N     1 
ATOM   2017 C CA    . GLY D 2 96  ? -13.072 -12.213 47.146 1.00 37.60 ? 96   GLY B CA    1 
ATOM   2018 C C     . GLY D 2 96  ? -12.354 -12.628 45.883 1.00 37.89 ? 96   GLY B C     1 
ATOM   2019 O O     . GLY D 2 96  ? -12.997 -12.907 44.869 1.00 38.57 ? 96   GLY B O     1 
ATOM   2020 N N     . ILE D 2 97  ? -11.021 -12.628 45.937 1.00 37.20 ? 97   ILE B N     1 
ATOM   2021 C CA    . ILE D 2 97  ? -10.184 -13.018 44.800 1.00 36.42 ? 97   ILE B CA    1 
ATOM   2022 C C     . ILE D 2 97  ? -9.421  -14.307 45.133 1.00 36.43 ? 97   ILE B C     1 
ATOM   2023 O O     . ILE D 2 97  ? -8.830  -14.439 46.210 1.00 35.71 ? 97   ILE B O     1 
ATOM   2024 C CB    . ILE D 2 97  ? -9.189  -11.887 44.384 1.00 35.46 ? 97   ILE B CB    1 
ATOM   2025 C CG1   . ILE D 2 97  ? -9.957  -10.667 43.862 1.00 34.65 ? 97   ILE B CG1   1 
ATOM   2026 C CG2   . ILE D 2 97  ? -8.231  -12.386 43.309 1.00 34.55 ? 97   ILE B CG2   1 
ATOM   2027 C CD1   . ILE D 2 97  ? -9.079  -9.589  43.287 1.00 33.23 ? 97   ILE B CD1   1 
ATOM   2028 N N     . ASN D 2 98  ? -9.459  -15.262 44.207 1.00 36.92 ? 98   ASN B N     1 
ATOM   2029 C CA    . ASN D 2 98  ? -8.800  -16.546 44.403 1.00 37.27 ? 98   ASN B CA    1 
ATOM   2030 C C     . ASN D 2 98  ? -7.378  -16.561 43.865 1.00 37.14 ? 98   ASN B C     1 
ATOM   2031 O O     . ASN D 2 98  ? -7.162  -16.510 42.651 1.00 36.34 ? 98   ASN B O     1 
ATOM   2032 C CB    . ASN D 2 98  ? -9.612  -17.676 43.767 1.00 37.46 ? 98   ASN B CB    1 
ATOM   2033 C CG    . ASN D 2 98  ? -9.118  -19.046 44.187 1.00 38.43 ? 98   ASN B CG    1 
ATOM   2034 O OD1   . ASN D 2 98  ? -8.929  -19.933 43.358 1.00 38.83 ? 98   ASN B OD1   1 
ATOM   2035 N ND2   . ASN D 2 98  ? -8.892  -19.220 45.485 1.00 38.54 ? 98   ASN B ND2   1 
ATOM   2036 N N     . PRO D 2 99  ? -6.390  -16.655 44.775 1.00 37.10 ? 99   PRO B N     1 
ATOM   2037 C CA    . PRO D 2 99  ? -4.957  -16.685 44.482 1.00 36.99 ? 99   PRO B CA    1 
ATOM   2038 C C     . PRO D 2 99  ? -4.619  -17.817 43.529 1.00 37.85 ? 99   PRO B C     1 
ATOM   2039 O O     . PRO D 2 99  ? -3.849  -17.637 42.587 1.00 37.72 ? 99   PRO B O     1 
ATOM   2040 C CB    . PRO D 2 99  ? -4.344  -16.949 45.855 1.00 36.72 ? 99   PRO B CB    1 
ATOM   2041 C CG    . PRO D 2 99  ? -5.311  -16.320 46.788 1.00 36.48 ? 99   PRO B CG    1 
ATOM   2042 C CD    . PRO D 2 99  ? -6.618  -16.782 46.226 1.00 36.70 ? 99   PRO B CD    1 
ATOM   2043 N N     . GLU D 2 100 ? -5.232  -18.972 43.775 1.00 39.07 ? 100  GLU B N     1 
ATOM   2044 C CA    . GLU D 2 100 ? -5.017  -20.175 42.979 1.00 40.41 ? 100  GLU B CA    1 
ATOM   2045 C C     . GLU D 2 100 ? -5.434  -20.102 41.515 1.00 40.61 ? 100  GLU B C     1 
ATOM   2046 O O     . GLU D 2 100 ? -4.889  -20.834 40.692 1.00 41.51 ? 100  GLU B O     1 
ATOM   2047 C CB    . GLU D 2 100 ? -5.679  -21.380 43.654 1.00 41.73 ? 100  GLU B CB    1 
ATOM   2048 C CG    . GLU D 2 100 ? -4.844  -22.028 44.750 1.00 44.43 ? 100  GLU B CG    1 
ATOM   2049 C CD    . GLU D 2 100 ? -4.350  -21.040 45.802 1.00 46.58 ? 100  GLU B CD    1 
ATOM   2050 O OE1   . GLU D 2 100 ? -5.079  -20.785 46.790 1.00 46.89 ? 100  GLU B OE1   1 
ATOM   2051 O OE2   . GLU D 2 100 ? -3.221  -20.522 45.644 1.00 48.64 ? 100  GLU B OE2   1 
ATOM   2052 N N     . THR D 2 101 ? -6.386  -19.234 41.178 1.00 41.16 ? 101  THR B N     1 
ATOM   2053 C CA    . THR D 2 101 ? -6.833  -19.108 39.784 1.00 41.67 ? 101  THR B CA    1 
ATOM   2054 C C     . THR D 2 101 ? -6.594  -17.739 39.133 1.00 41.74 ? 101  THR B C     1 
ATOM   2055 O O     . THR D 2 101 ? -6.855  -17.570 37.940 1.00 42.07 ? 101  THR B O     1 
ATOM   2056 C CB    . THR D 2 101 ? -8.330  -19.486 39.605 1.00 42.10 ? 101  THR B CB    1 
ATOM   2057 O OG1   . THR D 2 101 ? -9.153  -18.646 40.428 1.00 42.86 ? 101  THR B OG1   1 
ATOM   2058 C CG2   . THR D 2 101 ? -8.559  -20.946 39.960 1.00 42.14 ? 101  THR B CG2   1 
ATOM   2059 N N     . TRP D 2 102 ? -6.093  -16.773 39.902 1.00 41.81 ? 102  TRP B N     1 
ATOM   2060 C CA    . TRP D 2 102 ? -5.828  -15.440 39.369 1.00 41.62 ? 102  TRP B CA    1 
ATOM   2061 C C     . TRP D 2 102 ? -4.772  -15.505 38.269 1.00 41.72 ? 102  TRP B C     1 
ATOM   2062 O O     . TRP D 2 102 ? -3.739  -16.159 38.420 1.00 41.60 ? 102  TRP B O     1 
ATOM   2063 C CB    . TRP D 2 102 ? -5.380  -14.482 40.485 1.00 42.24 ? 102  TRP B CB    1 
ATOM   2064 C CG    . TRP D 2 102 ? -5.056  -13.089 39.991 1.00 43.18 ? 102  TRP B CG    1 
ATOM   2065 C CD1   . TRP D 2 102 ? -3.814  -12.586 39.708 1.00 43.63 ? 102  TRP B CD1   1 
ATOM   2066 C CD2   . TRP D 2 102 ? -5.989  -12.044 39.682 1.00 43.66 ? 102  TRP B CD2   1 
ATOM   2067 N NE1   . TRP D 2 102 ? -3.918  -11.300 39.235 1.00 43.52 ? 102  TRP B NE1   1 
ATOM   2068 C CE2   . TRP D 2 102 ? -5.240  -10.940 39.209 1.00 44.05 ? 102  TRP B CE2   1 
ATOM   2069 C CE3   . TRP D 2 102 ? -7.386  -11.930 39.758 1.00 43.46 ? 102  TRP B CE3   1 
ATOM   2070 C CZ2   . TRP D 2 102 ? -5.844  -9.737  38.813 1.00 44.16 ? 102  TRP B CZ2   1 
ATOM   2071 C CZ3   . TRP D 2 102 ? -7.985  -10.732 39.366 1.00 43.60 ? 102  TRP B CZ3   1 
ATOM   2072 C CH2   . TRP D 2 102 ? -7.212  -9.653  38.899 1.00 43.61 ? 102  TRP B CH2   1 
ATOM   2073 N N     . GLU D 2 103 ? -5.059  -14.849 37.150 1.00 42.20 ? 103  GLU B N     1 
ATOM   2074 C CA    . GLU D 2 103 ? -4.147  -14.817 36.013 1.00 42.85 ? 103  GLU B CA    1 
ATOM   2075 C C     . GLU D 2 103 ? -3.261  -13.569 36.000 1.00 41.81 ? 103  GLU B C     1 
ATOM   2076 O O     . GLU D 2 103 ? -3.753  -12.439 35.967 1.00 42.35 ? 103  GLU B O     1 
ATOM   2077 C CB    . GLU D 2 103 ? -4.939  -14.912 34.714 1.00 44.50 ? 103  GLU B CB    1 
ATOM   2078 C CG    . GLU D 2 103 ? -5.661  -16.229 34.540 1.00 47.86 ? 103  GLU B CG    1 
ATOM   2079 C CD    . GLU D 2 103 ? -5.248  -16.951 33.269 1.00 49.91 ? 103  GLU B CD    1 
ATOM   2080 O OE1   . GLU D 2 103 ? -5.257  -16.312 32.190 1.00 50.45 ? 103  GLU B OE1   1 
ATOM   2081 O OE2   . GLU D 2 103 ? -4.912  -18.156 33.354 1.00 51.13 ? 103  GLU B OE2   1 
ATOM   2082 N N     . TYR D 2 104 ? -1.950  -13.787 36.005 1.00 40.49 ? 104  TYR B N     1 
ATOM   2083 C CA    . TYR D 2 104 ? -0.978  -12.698 36.005 1.00 39.44 ? 104  TYR B CA    1 
ATOM   2084 C C     . TYR D 2 104 ? 0.237   -13.029 35.130 1.00 39.94 ? 104  TYR B C     1 
ATOM   2085 O O     . TYR D 2 104 ? 1.142   -12.171 35.001 1.00 39.99 ? 104  TYR B O     1 
ATOM   2086 C CB    . TYR D 2 104 ? -0.536  -12.389 37.443 1.00 36.83 ? 104  TYR B CB    1 
ATOM   2087 C CG    . TYR D 2 104 ? 0.134   -13.543 38.160 1.00 34.53 ? 104  TYR B CG    1 
ATOM   2088 C CD1   . TYR D 2 104 ? 1.508   -13.761 38.039 1.00 32.89 ? 104  TYR B CD1   1 
ATOM   2089 C CD2   . TYR D 2 104 ? -0.603  -14.416 38.964 1.00 32.93 ? 104  TYR B CD2   1 
ATOM   2090 C CE1   . TYR D 2 104 ? 2.135   -14.816 38.697 1.00 30.91 ? 104  TYR B CE1   1 
ATOM   2091 C CE2   . TYR D 2 104 ? 0.018   -15.476 39.628 1.00 32.51 ? 104  TYR B CE2   1 
ATOM   2092 C CZ    . TYR D 2 104 ? 1.389   -15.668 39.487 1.00 30.91 ? 104  TYR B CZ    1 
ATOM   2093 O OH    . TYR D 2 104 ? 2.013   -16.707 40.133 1.00 28.70 ? 104  TYR B OH    1 
ATOM   2094 O OXT   . TYR D 2 104 ? 0.265   -14.152 34.581 1.00 40.40 ? 104  TYR B OXT   1 
HETATM 2095 O O     . HOH E 3 .   ? 24.825  0.190   38.417 1.00 33.56 ? 270  HOH C O     1 
HETATM 2096 O O     . HOH E 3 .   ? 21.833  5.062   29.207 1.00 24.73 ? 500  HOH C O     1 
HETATM 2097 O O     . HOH E 3 .   ? 13.011  12.453  23.348 1.00 31.90 ? 501  HOH C O     1 
HETATM 2098 O O     . HOH E 3 .   ? 21.430  -8.968  38.512 1.00 27.37 ? 502  HOH C O     1 
HETATM 2099 O O     . HOH E 3 .   ? 12.274  -10.244 35.965 1.00 36.78 ? 503  HOH C O     1 
HETATM 2100 O O     . HOH E 3 .   ? 24.855  5.051   29.513 1.00 42.60 ? 504  HOH C O     1 
HETATM 2101 O O     . HOH E 3 .   ? 29.497  6.280   30.501 1.00 49.03 ? 505  HOH C O     1 
HETATM 2102 O O     . HOH E 3 .   ? 26.266  3.025   21.188 1.00 61.15 ? 506  HOH C O     1 
HETATM 2103 O O     . HOH E 3 .   ? 15.399  -12.928 35.214 1.00 42.79 ? 507  HOH C O     1 
HETATM 2104 O O     . HOH E 3 .   ? 19.478  -13.947 35.430 1.00 33.64 ? 508  HOH C O     1 
HETATM 2105 O O     . HOH E 3 .   ? 28.085  9.889   23.094 1.00 50.95 ? 509  HOH C O     1 
HETATM 2106 O O     . HOH E 3 .   ? 25.475  -5.808  31.127 1.00 32.53 ? 510  HOH C O     1 
HETATM 2107 O O     . HOH E 3 .   ? 14.567  -8.444  28.763 1.00 40.27 ? 511  HOH C O     1 
HETATM 2108 O O     . HOH E 3 .   ? 16.383  -16.922 35.348 1.00 48.38 ? 1245 HOH C O     1 
HETATM 2109 O O     . HOH F 3 .   ? 9.417   12.334  31.488 1.00 15.02 ? 1500 HOH D O     1 
HETATM 2110 O O     . HOH F 3 .   ? 13.696  10.336  25.494 1.00 21.57 ? 1501 HOH D O     1 
HETATM 2111 O O     . HOH F 3 .   ? 10.494  5.396   31.163 1.00 24.00 ? 1502 HOH D O     1 
HETATM 2112 O O     . HOH F 3 .   ? 15.668  12.795  38.781 1.00 13.41 ? 1503 HOH D O     1 
HETATM 2113 O O     . HOH F 3 .   ? 12.844  12.750  27.638 1.00 22.91 ? 1504 HOH D O     1 
HETATM 2114 O O     . HOH F 3 .   ? 18.004  -0.827  26.689 1.00 34.63 ? 1505 HOH D O     1 
HETATM 2115 O O     . HOH F 3 .   ? 27.171  -8.306  30.995 1.00 27.08 ? 1506 HOH D O     1 
HETATM 2116 O O     . HOH F 3 .   ? 14.526  16.253  30.671 1.00 22.82 ? 1507 HOH D O     1 
HETATM 2117 O O     . HOH F 3 .   ? 18.450  -4.207  25.098 1.00 30.01 ? 1508 HOH D O     1 
HETATM 2118 O O     . HOH F 3 .   ? 16.472  -0.695  24.277 1.00 35.13 ? 1509 HOH D O     1 
HETATM 2119 O O     . HOH F 3 .   ? 22.454  15.571  27.058 1.00 35.22 ? 1510 HOH D O     1 
HETATM 2120 O O     . HOH F 3 .   ? 14.462  9.582   22.423 1.00 39.95 ? 1512 HOH D O     1 
HETATM 2121 O O     . HOH F 3 .   ? 26.468  0.279   20.791 1.00 56.91 ? 1513 HOH D O     1 
HETATM 2122 O O     . HOH F 3 .   ? 27.654  -1.727  23.316 1.00 38.02 ? 1514 HOH D O     1 
HETATM 2123 O O     . HOH F 3 .   ? 33.266  -15.287 27.448 1.00 33.47 ? 1515 HOH D O     1 
HETATM 2124 O O     . HOH F 3 .   ? 15.431  16.079  36.625 1.00 32.57 ? 1517 HOH D O     1 
HETATM 2125 O O     . HOH F 3 .   ? 21.027  12.713  34.022 1.00 32.12 ? 1518 HOH D O     1 
HETATM 2126 O O     . HOH G 3 .   ? 20.168  11.409  46.494 1.00 11.23 ? 200  HOH A O     1 
HETATM 2127 O O     . HOH G 3 .   ? 17.451  -4.399  32.414 1.00 12.87 ? 201  HOH A O     1 
HETATM 2128 O O     . HOH G 3 .   ? 18.723  -2.369  36.255 1.00 6.48  ? 202  HOH A O     1 
HETATM 2129 O O     . HOH G 3 .   ? 2.962   -7.116  32.077 1.00 26.29 ? 203  HOH A O     1 
HETATM 2130 O O     . HOH G 3 .   ? 20.239  12.698  49.014 1.00 11.18 ? 204  HOH A O     1 
HETATM 2131 O O     . HOH G 3 .   ? 10.598  13.094  49.092 1.00 26.09 ? 205  HOH A O     1 
HETATM 2132 O O     . HOH G 3 .   ? 3.558   15.116  53.651 1.00 23.25 ? 206  HOH A O     1 
HETATM 2133 O O     . HOH G 3 .   ? 2.123   10.670  43.915 1.00 22.74 ? 207  HOH A O     1 
HETATM 2134 O O     . HOH G 3 .   ? 21.255  10.567  61.275 1.00 40.12 ? 208  HOH A O     1 
HETATM 2135 O O     . HOH G 3 .   ? 20.629  11.921  51.541 1.00 19.27 ? 209  HOH A O     1 
HETATM 2136 O O     . HOH G 3 .   ? 15.346  10.115  39.783 1.00 15.84 ? 210  HOH A O     1 
HETATM 2137 O O     . HOH G 3 .   ? 15.239  15.578  39.138 1.00 27.37 ? 211  HOH A O     1 
HETATM 2138 O O     . HOH G 3 .   ? 1.672   17.113  52.764 1.00 40.87 ? 212  HOH A O     1 
HETATM 2139 O O     . HOH G 3 .   ? 8.467   19.429  45.272 1.00 26.67 ? 213  HOH A O     1 
HETATM 2140 O O     . HOH G 3 .   ? 10.317  10.464  49.348 1.00 11.72 ? 214  HOH A O     1 
HETATM 2141 O O     . HOH G 3 .   ? 18.830  21.593  40.576 1.00 25.26 ? 215  HOH A O     1 
HETATM 2142 O O     . HOH G 3 .   ? 15.419  22.171  47.228 1.00 37.64 ? 216  HOH A O     1 
HETATM 2143 O O     . HOH G 3 .   ? 12.560  25.033  44.910 1.00 25.23 ? 217  HOH A O     1 
HETATM 2144 O O     . HOH G 3 .   ? 21.031  2.792   30.602 1.00 19.83 ? 218  HOH A O     1 
HETATM 2145 O O     . HOH G 3 .   ? 2.054   22.873  40.630 1.00 22.33 ? 219  HOH A O     1 
HETATM 2146 O O     . HOH G 3 .   ? 3.298   16.663  58.272 1.00 23.04 ? 220  HOH A O     1 
HETATM 2147 O O     . HOH G 3 .   ? 5.496   19.117  35.807 1.00 18.27 ? 221  HOH A O     1 
HETATM 2148 O O     . HOH G 3 .   ? 10.259  7.757   49.260 1.00 18.13 ? 222  HOH A O     1 
HETATM 2149 O O     . HOH G 3 .   ? 15.517  7.351   53.074 1.00 21.64 ? 223  HOH A O     1 
HETATM 2150 O O     . HOH G 3 .   ? 17.573  20.920  54.355 1.00 26.46 ? 224  HOH A O     1 
HETATM 2151 O O     . HOH G 3 .   ? 8.768   28.269  44.181 1.00 36.29 ? 225  HOH A O     1 
HETATM 2152 O O     . HOH G 3 .   ? 0.617   21.932  33.241 1.00 45.43 ? 226  HOH A O     1 
HETATM 2153 O O     . HOH G 3 .   ? 23.955  22.499  57.373 1.00 34.08 ? 227  HOH A O     1 
HETATM 2154 O O     . HOH G 3 .   ? 9.180   14.742  47.628 1.00 23.73 ? 228  HOH A O     1 
HETATM 2155 O O     . HOH G 3 .   ? 14.005  20.755  52.196 1.00 23.71 ? 229  HOH A O     1 
HETATM 2156 O O     . HOH G 3 .   ? 10.446  1.598   43.088 1.00 21.97 ? 231  HOH A O     1 
HETATM 2157 O O     . HOH G 3 .   ? 0.401   25.149  39.038 1.00 36.64 ? 232  HOH A O     1 
HETATM 2158 O O     . HOH G 3 .   ? 6.846   1.787   53.843 1.00 26.92 ? 233  HOH A O     1 
HETATM 2159 O O     . HOH G 3 .   ? 21.542  20.130  51.187 1.00 21.66 ? 234  HOH A O     1 
HETATM 2160 O O     . HOH G 3 .   ? -2.062  13.716  47.764 1.00 18.12 ? 235  HOH A O     1 
HETATM 2161 O O     . HOH G 3 .   ? 19.046  9.265   62.604 1.00 46.97 ? 236  HOH A O     1 
HETATM 2162 O O     . HOH G 3 .   ? -3.048  9.435   34.474 1.00 24.76 ? 237  HOH A O     1 
HETATM 2163 O O     . HOH G 3 .   ? -5.377  13.217  40.918 1.00 29.09 ? 238  HOH A O     1 
HETATM 2164 O O     . HOH G 3 .   ? 17.250  6.522   55.371 1.00 42.37 ? 239  HOH A O     1 
HETATM 2165 O O     . HOH G 3 .   ? 10.570  18.876  38.876 1.00 26.53 ? 240  HOH A O     1 
HETATM 2166 O O     . HOH G 3 .   ? 6.743   5.751   56.308 1.00 36.80 ? 241  HOH A O     1 
HETATM 2167 O O     . HOH G 3 .   ? -1.552  -2.467  34.405 1.00 33.46 ? 242  HOH A O     1 
HETATM 2168 O O     . HOH G 3 .   ? 13.371  21.107  41.084 1.00 32.35 ? 243  HOH A O     1 
HETATM 2169 O O     . HOH G 3 .   ? 14.933  4.108   57.880 1.00 44.02 ? 244  HOH A O     1 
HETATM 2170 O O     . HOH G 3 .   ? -0.056  8.135   30.552 1.00 36.96 ? 245  HOH A O     1 
HETATM 2171 O O     . HOH G 3 .   ? 11.646  16.285  37.283 1.00 34.00 ? 246  HOH A O     1 
HETATM 2172 O O     . HOH G 3 .   ? 7.986   16.823  34.018 1.00 58.78 ? 247  HOH A O     1 
HETATM 2173 O O     . HOH G 3 .   ? -2.292  8.008   38.512 1.00 29.10 ? 248  HOH A O     1 
HETATM 2174 O O     . HOH G 3 .   ? 21.590  21.515  63.153 1.00 29.90 ? 249  HOH A O     1 
HETATM 2175 O O     . HOH G 3 .   ? 17.689  9.940   67.187 1.00 37.14 ? 250  HOH A O     1 
HETATM 2176 O O     . HOH G 3 .   ? 4.198   7.547   52.251 1.00 40.33 ? 251  HOH A O     1 
HETATM 2177 O O     . HOH G 3 .   ? -1.153  5.067   38.186 1.00 25.06 ? 252  HOH A O     1 
HETATM 2178 O O     . HOH G 3 .   ? -5.559  13.787  38.093 1.00 52.47 ? 253  HOH A O     1 
HETATM 2179 O O     . HOH G 3 .   ? 24.880  7.207   33.621 1.00 39.20 ? 254  HOH A O     1 
HETATM 2180 O O     . HOH G 3 .   ? 13.474  18.497  47.505 1.00 49.33 ? 255  HOH A O     1 
HETATM 2181 O O     . HOH G 3 .   ? 20.550  23.973  54.669 1.00 55.92 ? 256  HOH A O     1 
HETATM 2182 O O     . HOH G 3 .   ? -4.681  13.505  48.568 1.00 30.34 ? 257  HOH A O     1 
HETATM 2183 O O     . HOH G 3 .   ? -4.059  12.043  34.904 1.00 40.43 ? 258  HOH A O     1 
HETATM 2184 O O     . HOH G 3 .   ? 26.056  3.638   31.884 1.00 35.01 ? 259  HOH A O     1 
HETATM 2185 O O     . HOH G 3 .   ? -4.543  9.102   36.830 1.00 44.36 ? 260  HOH A O     1 
HETATM 2186 O O     . HOH G 3 .   ? 12.589  20.813  34.725 1.00 39.58 ? 261  HOH A O     1 
HETATM 2187 O O     . HOH G 3 .   ? 24.230  9.435   62.130 1.00 40.55 ? 262  HOH A O     1 
HETATM 2188 O O     . HOH G 3 .   ? 26.202  24.592  52.208 1.00 51.09 ? 263  HOH A O     1 
HETATM 2189 O O     . HOH G 3 .   ? 11.807  16.304  33.965 1.00 30.91 ? 264  HOH A O     1 
HETATM 2190 O O     . HOH G 3 .   ? 8.574   17.398  36.491 1.00 33.22 ? 265  HOH A O     1 
HETATM 2191 O O     . HOH G 3 .   ? 7.880   26.271  51.342 1.00 52.94 ? 266  HOH A O     1 
HETATM 2192 O O     . HOH G 3 .   ? 1.827   23.437  48.295 1.00 54.34 ? 267  HOH A O     1 
HETATM 2193 O O     . HOH G 3 .   ? 1.389   5.908   51.570 1.00 28.41 ? 268  HOH A O     1 
HETATM 2194 O O     . HOH G 3 .   ? 24.433  7.094   60.117 1.00 39.83 ? 269  HOH A O     1 
HETATM 2195 O O     . HOH G 3 .   ? 14.808  15.853  47.363 1.00 35.63 ? 271  HOH A O     1 
HETATM 2196 O O     . HOH G 3 .   ? -3.293  17.840  42.783 1.00 39.54 ? 272  HOH A O     1 
HETATM 2197 O O     . HOH G 3 .   ? 0.925   28.803  38.787 1.00 48.60 ? 273  HOH A O     1 
HETATM 2198 O O     . HOH G 3 .   ? 3.984   18.880  62.123 1.00 62.40 ? 274  HOH A O     1 
HETATM 2199 O O     . HOH G 3 .   ? 3.365   19.684  34.217 1.00 38.75 ? 275  HOH A O     1 
HETATM 2200 O O     . HOH G 3 .   ? 7.925   18.580  65.304 1.00 38.14 ? 276  HOH A O     1 
HETATM 2201 O O     . HOH G 3 .   ? 2.861   2.509   29.280 1.00 30.22 ? 277  HOH A O     1 
HETATM 2202 O O     . HOH G 3 .   ? 21.519  12.764  31.156 1.00 42.65 ? 278  HOH A O     1 
HETATM 2203 O O     . HOH G 3 .   ? 18.216  6.478   67.433 1.00 42.27 ? 279  HOH A O     1 
HETATM 2204 O O     . HOH G 3 .   ? 3.785   -0.493  26.270 1.00 37.24 ? 280  HOH A O     1 
HETATM 2205 O O     . HOH G 3 .   ? 13.458  21.155  54.837 1.00 49.08 ? 282  HOH A O     1 
HETATM 2206 O O     . HOH G 3 .   ? 14.548  19.921  37.437 1.00 55.72 ? 283  HOH A O     1 
HETATM 2207 O O     . HOH G 3 .   ? 19.521  21.547  49.270 1.00 37.84 ? 284  HOH A O     1 
HETATM 2208 O O     . HOH G 3 .   ? 23.067  20.219  48.946 1.00 45.32 ? 285  HOH A O     1 
HETATM 2209 O O     . HOH G 3 .   ? 2.904   -0.679  29.414 1.00 46.66 ? 286  HOH A O     1 
HETATM 2210 O O     . HOH G 3 .   ? 24.678  12.475  44.920 1.00 54.99 ? 287  HOH A O     1 
HETATM 2211 O O     . HOH G 3 .   ? -5.637  5.614   35.768 1.00 48.40 ? 288  HOH A O     1 
HETATM 2212 O O     . HOH G 3 .   ? 13.958  -2.665  54.706 1.00 41.12 ? 289  HOH A O     1 
HETATM 2213 O O     . HOH G 3 .   ? -0.647  5.311   41.140 1.00 25.48 ? 1219 HOH A O     1 
HETATM 2214 O O     . HOH G 3 .   ? 14.882  18.549  33.369 1.00 37.38 ? 1511 HOH A O     1 
HETATM 2215 O O     . HOH G 3 .   ? 12.097  19.095  32.471 1.00 57.16 ? 1516 HOH A O     1 
HETATM 2216 O O     . HOH H 3 .   ? 12.419  -7.152  50.582 1.00 31.69 ? 230  HOH B O     1 
HETATM 2217 O O     . HOH H 3 .   ? 27.889  2.987   40.332 1.00 60.80 ? 281  HOH B O     1 
HETATM 2218 O O     . HOH H 3 .   ? 12.484  6.222   32.924 1.00 3.64  ? 1200 HOH B O     1 
HETATM 2219 O O     . HOH H 3 .   ? 5.388   -10.190 44.243 1.00 16.42 ? 1201 HOH B O     1 
HETATM 2220 O O     . HOH H 3 .   ? 11.159  -6.416  36.680 1.00 18.24 ? 1202 HOH B O     1 
HETATM 2221 O O     . HOH H 3 .   ? 12.029  -9.849  51.609 1.00 17.40 ? 1203 HOH B O     1 
HETATM 2222 O O     . HOH H 3 .   ? 4.342   -12.634 52.401 1.00 25.90 ? 1204 HOH B O     1 
HETATM 2223 O O     . HOH H 3 .   ? 16.568  8.731   32.309 1.00 15.64 ? 1205 HOH B O     1 
HETATM 2224 O O     . HOH H 3 .   ? 17.515  1.913   28.460 1.00 24.46 ? 1206 HOH B O     1 
HETATM 2225 O O     . HOH H 3 .   ? 4.936   -7.926  45.331 1.00 20.83 ? 1207 HOH B O     1 
HETATM 2226 O O     . HOH H 3 .   ? 0.975   -9.469  35.962 1.00 15.26 ? 1208 HOH B O     1 
HETATM 2227 O O     . HOH H 3 .   ? 5.024   -5.127  45.476 1.00 16.61 ? 1209 HOH B O     1 
HETATM 2228 O O     . HOH H 3 .   ? 3.174   -7.609  35.058 1.00 23.83 ? 1210 HOH B O     1 
HETATM 2229 O O     . HOH H 3 .   ? -10.589 -5.429  44.599 1.00 44.87 ? 1211 HOH B O     1 
HETATM 2230 O O     . HOH H 3 .   ? 18.961  -10.251 55.798 1.00 27.36 ? 1212 HOH B O     1 
HETATM 2231 O O     . HOH H 3 .   ? 4.359   -5.327  52.090 1.00 23.81 ? 1213 HOH B O     1 
HETATM 2232 O O     . HOH H 3 .   ? 23.750  -5.854  51.501 1.00 32.58 ? 1214 HOH B O     1 
HETATM 2233 O O     . HOH H 3 .   ? 22.686  10.705  45.580 1.00 28.53 ? 1215 HOH B O     1 
HETATM 2234 O O     . HOH H 3 .   ? 0.857   -17.841 42.770 1.00 22.78 ? 1216 HOH B O     1 
HETATM 2235 O O     . HOH H 3 .   ? 21.021  -1.897  38.051 1.00 21.46 ? 1217 HOH B O     1 
HETATM 2236 O O     . HOH H 3 .   ? 16.922  -14.270 55.109 1.00 42.26 ? 1218 HOH B O     1 
HETATM 2237 O O     . HOH H 3 .   ? -1.677  -10.026 54.432 1.00 33.78 ? 1220 HOH B O     1 
HETATM 2238 O O     . HOH H 3 .   ? -1.860  -9.054  36.214 1.00 52.78 ? 1221 HOH B O     1 
HETATM 2239 O O     . HOH H 3 .   ? 26.382  -4.152  47.683 1.00 33.83 ? 1222 HOH B O     1 
HETATM 2240 O O     . HOH H 3 .   ? -7.752  -13.648 36.761 1.00 33.89 ? 1223 HOH B O     1 
HETATM 2241 O O     . HOH H 3 .   ? 25.970  4.285   44.556 1.00 27.37 ? 1224 HOH B O     1 
HETATM 2242 O O     . HOH H 3 .   ? 20.356  -15.707 44.582 1.00 22.97 ? 1225 HOH B O     1 
HETATM 2243 O O     . HOH H 3 .   ? 16.793  -8.660  26.788 1.00 26.73 ? 1226 HOH B O     1 
HETATM 2244 O O     . HOH H 3 .   ? -8.758  -7.036  53.545 1.00 51.56 ? 1227 HOH B O     1 
HETATM 2245 O O     . HOH H 3 .   ? 15.625  -12.732 38.458 1.00 17.95 ? 1228 HOH B O     1 
HETATM 2246 O O     . HOH H 3 .   ? 25.416  1.201   44.600 1.00 29.34 ? 1229 HOH B O     1 
HETATM 2247 O O     . HOH H 3 .   ? 12.730  -2.365  25.264 1.00 23.51 ? 1230 HOH B O     1 
HETATM 2248 O O     . HOH H 3 .   ? 1.154   6.859   46.123 1.00 42.50 ? 1231 HOH B O     1 
HETATM 2249 O O     . HOH H 3 .   ? 17.806  -13.546 40.995 1.00 42.58 ? 1232 HOH B O     1 
HETATM 2250 O O     . HOH H 3 .   ? 7.271   -1.383  53.690 1.00 62.80 ? 1233 HOH B O     1 
HETATM 2251 O O     . HOH H 3 .   ? -4.520  -9.938  55.441 1.00 43.63 ? 1234 HOH B O     1 
HETATM 2252 O O     . HOH H 3 .   ? 22.944  6.002   50.190 1.00 22.43 ? 1235 HOH B O     1 
HETATM 2253 O O     . HOH H 3 .   ? 27.401  -8.570  41.417 1.00 48.21 ? 1236 HOH B O     1 
HETATM 2254 O O     . HOH H 3 .   ? -0.947  -4.656  42.530 1.00 20.92 ? 1237 HOH B O     1 
HETATM 2255 O O     . HOH H 3 .   ? 24.575  -6.890  44.136 1.00 27.22 ? 1238 HOH B O     1 
HETATM 2256 O O     . HOH H 3 .   ? 27.167  0.918   42.462 1.00 53.00 ? 1239 HOH B O     1 
HETATM 2257 O O     . HOH H 3 .   ? 8.376   -15.509 56.909 1.00 50.30 ? 1240 HOH B O     1 
HETATM 2258 O O     . HOH H 3 .   ? 10.833  -14.928 55.467 1.00 31.68 ? 1241 HOH B O     1 
HETATM 2259 O O     . HOH H 3 .   ? 23.611  -18.024 45.433 1.00 44.92 ? 1242 HOH B O     1 
HETATM 2260 O O     . HOH H 3 .   ? 25.100  -17.239 47.786 1.00 50.69 ? 1243 HOH B O     1 
HETATM 2261 O O     . HOH H 3 .   ? 26.594  -11.717 41.097 1.00 39.27 ? 1244 HOH B O     1 
HETATM 2262 O O     . HOH H 3 .   ? 9.905   -17.119 44.986 1.00 40.08 ? 1246 HOH B O     1 
HETATM 2263 O O     . HOH H 3 .   ? 8.925   -21.507 40.257 1.00 32.78 ? 1247 HOH B O     1 
HETATM 2264 O O     . HOH H 3 .   ? 7.033   -14.513 43.295 1.00 36.85 ? 1248 HOH B O     1 
HETATM 2265 O O     . HOH H 3 .   ? 7.511   -12.233 45.317 1.00 38.71 ? 1249 HOH B O     1 
HETATM 2266 O O     . HOH H 3 .   ? 4.454   -17.694 48.110 1.00 34.12 ? 1250 HOH B O     1 
HETATM 2267 O O     . HOH H 3 .   ? 4.427   -20.956 40.363 1.00 43.81 ? 1251 HOH B O     1 
HETATM 2268 O O     . HOH H 3 .   ? 5.073   -13.258 39.905 1.00 39.18 ? 1252 HOH B O     1 
HETATM 2269 O O     . HOH H 3 .   ? -7.456  -11.148 34.036 1.00 47.69 ? 1253 HOH B O     1 
HETATM 2270 O O     . HOH H 3 .   ? -1.245  -16.763 52.366 1.00 45.29 ? 1254 HOH B O     1 
HETATM 2271 O O     . HOH H 3 .   ? 21.242  -0.069  52.526 1.00 51.39 ? 1255 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   401 401 DG  G   C . n 
A 1 2   DA  2   402 402 DA  A   C . n 
A 1 3   DG  3   403 403 DG  G   C . n 
A 1 4   DA  4   404 404 DA  A   C . n 
A 1 5   DC  5   405 405 DC  C   C . n 
A 1 6   DG  6   406 406 DG  G   C . n 
A 1 7   DT  7   407 407 DT  T   C . n 
A 1 8   DC  8   408 408 DC  C   C . n 
A 1 9   DT  9   409 409 DT  T   C . n 
A 1 10  DC  10  410 410 DC  C   C . n 
B 1 1   DG  1   411 411 DG  G   D . n 
B 1 2   DA  2   412 412 DA  A   D . n 
B 1 3   DG  3   413 413 DG  G   D . n 
B 1 4   DA  4   414 414 DA  A   D . n 
B 1 5   DC  5   415 415 DC  C   D . n 
B 1 6   DG  6   416 416 DG  G   D . n 
B 1 7   DT  7   417 417 DT  T   D . n 
B 1 8   DC  8   418 418 DC  C   D . n 
B 1 9   DT  9   419 419 DT  T   D . n 
B 1 10  DC  10  420 420 DC  C   D . n 
C 2 1   ALA 1   1   1   ALA ALA A . n 
C 2 2   GLU 2   2   2   GLU GLU A . n 
C 2 3   TRP 3   3   3   TRP TRP A . n 
C 2 4   SER 4   4   4   SER SER A . n 
C 2 5   GLY 5   5   5   GLY GLY A . n 
C 2 6   GLU 6   6   6   GLU GLU A . n 
C 2 7   TYR 7   7   7   TYR TYR A . n 
C 2 8   ILE 8   8   8   ILE ILE A . n 
C 2 9   SER 9   9   9   SER SER A . n 
C 2 10  PRO 10  10  10  PRO PRO A . n 
C 2 11  TYR 11  11  11  TYR TYR A . n 
C 2 12  ALA 12  12  12  ALA ALA A . n 
C 2 13  GLU 13  13  13  GLU GLU A . n 
C 2 14  HIS 14  14  14  HIS HIS A . n 
C 2 15  GLY 15  15  15  GLY GLY A . n 
C 2 16  LYS 16  16  16  LYS LYS A . n 
C 2 17  LYS 17  17  17  LYS LYS A . n 
C 2 18  SER 18  18  18  SER SER A . n 
C 2 19  GLU 19  19  19  GLU GLU A . n 
C 2 20  GLN 20  20  20  GLN GLN A . n 
C 2 21  VAL 21  21  21  VAL VAL A . n 
C 2 22  LYS 22  22  22  LYS LYS A . n 
C 2 23  LYS 23  23  23  LYS LYS A . n 
C 2 24  ILE 24  24  24  ILE ILE A . n 
C 2 25  THR 25  25  25  THR THR A . n 
C 2 26  VAL 26  26  26  VAL VAL A . n 
C 2 27  SER 27  27  27  SER SER A . n 
C 2 28  ILE 28  28  28  ILE ILE A . n 
C 2 29  PRO 29  29  29  PRO PRO A . n 
C 2 30  LEU 30  30  30  LEU LEU A . n 
C 2 31  LYS 31  31  31  LYS LYS A . n 
C 2 32  VAL 32  32  32  VAL VAL A . n 
C 2 33  LEU 33  33  33  LEU LEU A . n 
C 2 34  LYS 34  34  34  LYS LYS A . n 
C 2 35  ILE 35  35  35  ILE ILE A . n 
C 2 36  LEU 36  36  36  LEU LEU A . n 
C 2 37  THR 37  37  37  THR THR A . n 
C 2 38  ASP 38  38  38  ASP ASP A . n 
C 2 39  GLU 39  39  39  GLU GLU A . n 
C 2 40  ARG 40  40  40  ARG ARG A . n 
C 2 41  THR 41  41  41  THR THR A . n 
C 2 42  ARG 42  42  42  ARG ARG A . n 
C 2 43  ARG 43  43  43  ARG ARG A . n 
C 2 44  LYS 44  44  44  LYS LYS A . n 
C 2 45  VAL 45  45  45  VAL VAL A . n 
C 2 46  ASN 46  46  46  ASN ASN A . n 
C 2 47  ASN 47  47  47  ASN ASN A . n 
C 2 48  LEU 48  48  48  LEU LEU A . n 
C 2 49  ARG 49  49  49  ARG ARG A . n 
C 2 50  HIS 50  50  50  HIS HIS A . n 
C 2 51  ALA 51  51  51  ALA ALA A . n 
C 2 52  THR 52  52  52  THR THR A . n 
C 2 53  ASN 53  53  53  ASN ASN A . n 
C 2 54  SER 54  54  54  SER SER A . n 
C 2 55  GLU 55  55  55  GLU GLU A . n 
C 2 56  LEU 56  56  56  LEU LEU A . n 
C 2 57  LEU 57  57  57  LEU LEU A . n 
C 2 58  CYS 58  58  58  CYS CYS A . n 
C 2 59  GLU 59  59  59  GLU GLU A . n 
C 2 60  ALA 60  60  60  ALA ALA A . n 
C 2 61  PHE 61  61  61  PHE PHE A . n 
C 2 62  LEU 62  62  62  LEU LEU A . n 
C 2 63  HIS 63  63  63  HIS HIS A . n 
C 2 64  ALA 64  64  64  ALA ALA A . n 
C 2 65  PHE 65  65  65  PHE PHE A . n 
C 2 66  THR 66  66  66  THR THR A . n 
C 2 67  GLY 67  67  67  GLY GLY A . n 
C 2 68  GLN 68  68  68  GLN GLN A . n 
C 2 69  PRO 69  69  69  PRO PRO A . n 
C 2 70  LEU 70  70  70  LEU LEU A . n 
C 2 71  PRO 71  71  71  PRO PRO A . n 
C 2 72  ASP 72  72  72  ASP ASP A . n 
C 2 73  ASP 73  73  73  ASP ASP A . n 
C 2 74  ALA 74  74  74  ALA ALA A . n 
C 2 75  ASP 75  75  75  ASP ASP A . n 
C 2 76  LEU 76  76  76  LEU LEU A . n 
C 2 77  ARG 77  77  77  ARG ARG A . n 
C 2 78  LYS 78  78  78  LYS LYS A . n 
C 2 79  GLU 79  79  79  GLU GLU A . n 
C 2 80  ARG 80  80  80  ARG ARG A . n 
C 2 81  SER 81  81  81  SER SER A . n 
C 2 82  ASP 82  82  82  ASP ASP A . n 
C 2 83  GLU 83  83  83  GLU GLU A . n 
C 2 84  ILE 84  84  84  ILE ILE A . n 
C 2 85  PRO 85  85  85  PRO PRO A . n 
C 2 86  GLU 86  86  86  GLU GLU A . n 
C 2 87  ALA 87  87  87  ALA ALA A . n 
C 2 88  ALA 88  88  88  ALA ALA A . n 
C 2 89  LYS 89  89  89  LYS LYS A . n 
C 2 90  GLU 90  90  90  GLU GLU A . n 
C 2 91  ILE 91  91  91  ILE ILE A . n 
C 2 92  MET 92  92  92  MET MET A . n 
C 2 93  ARG 93  93  93  ARG ARG A . n 
C 2 94  GLU 94  94  94  GLU GLU A . n 
C 2 95  MET 95  95  95  MET MET A . n 
C 2 96  GLY 96  96  96  GLY GLY A . n 
C 2 97  ILE 97  97  97  ILE ILE A . n 
C 2 98  ASN 98  98  98  ASN ASN A . n 
C 2 99  PRO 99  99  99  PRO PRO A . n 
C 2 100 GLU 100 100 100 GLU GLU A . n 
C 2 101 THR 101 101 101 THR THR A . n 
C 2 102 TRP 102 102 102 TRP TRP A . n 
C 2 103 GLU 103 103 103 GLU GLU A . n 
C 2 104 TYR 104 104 104 TYR TYR A . n 
D 2 1   ALA 1   1   1   ALA ALA B . n 
D 2 2   GLU 2   2   2   GLU GLU B . n 
D 2 3   TRP 3   3   3   TRP TRP B . n 
D 2 4   SER 4   4   4   SER SER B . n 
D 2 5   GLY 5   5   5   GLY GLY B . n 
D 2 6   GLU 6   6   6   GLU GLU B . n 
D 2 7   TYR 7   7   7   TYR TYR B . n 
D 2 8   ILE 8   8   8   ILE ILE B . n 
D 2 9   SER 9   9   9   SER SER B . n 
D 2 10  PRO 10  10  10  PRO PRO B . n 
D 2 11  TYR 11  11  11  TYR TYR B . n 
D 2 12  ALA 12  12  12  ALA ALA B . n 
D 2 13  GLU 13  13  13  GLU GLU B . n 
D 2 14  HIS 14  14  14  HIS HIS B . n 
D 2 15  GLY 15  15  15  GLY GLY B . n 
D 2 16  LYS 16  16  16  LYS LYS B . n 
D 2 17  LYS 17  17  17  LYS LYS B . n 
D 2 18  SER 18  18  18  SER SER B . n 
D 2 19  GLU 19  19  19  GLU GLU B . n 
D 2 20  GLN 20  20  20  GLN GLN B . n 
D 2 21  VAL 21  21  21  VAL VAL B . n 
D 2 22  LYS 22  22  22  LYS LYS B . n 
D 2 23  LYS 23  23  23  LYS LYS B . n 
D 2 24  ILE 24  24  24  ILE ILE B . n 
D 2 25  THR 25  25  25  THR THR B . n 
D 2 26  VAL 26  26  26  VAL VAL B . n 
D 2 27  SER 27  27  27  SER SER B . n 
D 2 28  ILE 28  28  28  ILE ILE B . n 
D 2 29  PRO 29  29  29  PRO PRO B . n 
D 2 30  LEU 30  30  30  LEU LEU B . n 
D 2 31  LYS 31  31  31  LYS LYS B . n 
D 2 32  VAL 32  32  32  VAL VAL B . n 
D 2 33  LEU 33  33  33  LEU LEU B . n 
D 2 34  LYS 34  34  34  LYS LYS B . n 
D 2 35  ILE 35  35  35  ILE ILE B . n 
D 2 36  LEU 36  36  36  LEU LEU B . n 
D 2 37  THR 37  37  37  THR THR B . n 
D 2 38  ASP 38  38  38  ASP ASP B . n 
D 2 39  GLU 39  39  39  GLU GLU B . n 
D 2 40  ARG 40  40  40  ARG ARG B . n 
D 2 41  THR 41  41  41  THR THR B . n 
D 2 42  ARG 42  42  42  ARG ARG B . n 
D 2 43  ARG 43  43  43  ARG ARG B . n 
D 2 44  LYS 44  44  44  LYS LYS B . n 
D 2 45  VAL 45  45  45  VAL VAL B . n 
D 2 46  ASN 46  46  46  ASN ASN B . n 
D 2 47  ASN 47  47  47  ASN ASN B . n 
D 2 48  LEU 48  48  48  LEU LEU B . n 
D 2 49  ARG 49  49  49  ARG ARG B . n 
D 2 50  HIS 50  50  50  HIS HIS B . n 
D 2 51  ALA 51  51  51  ALA ALA B . n 
D 2 52  THR 52  52  52  THR THR B . n 
D 2 53  ASN 53  53  53  ASN ASN B . n 
D 2 54  SER 54  54  54  SER SER B . n 
D 2 55  GLU 55  55  55  GLU GLU B . n 
D 2 56  LEU 56  56  56  LEU LEU B . n 
D 2 57  LEU 57  57  57  LEU LEU B . n 
D 2 58  CYS 58  58  58  CYS CYS B . n 
D 2 59  GLU 59  59  59  GLU GLU B . n 
D 2 60  ALA 60  60  60  ALA ALA B . n 
D 2 61  PHE 61  61  61  PHE PHE B . n 
D 2 62  LEU 62  62  62  LEU LEU B . n 
D 2 63  HIS 63  63  63  HIS HIS B . n 
D 2 64  ALA 64  64  64  ALA ALA B . n 
D 2 65  PHE 65  65  65  PHE PHE B . n 
D 2 66  THR 66  66  66  THR THR B . n 
D 2 67  GLY 67  67  67  GLY GLY B . n 
D 2 68  GLN 68  68  68  GLN GLN B . n 
D 2 69  PRO 69  69  69  PRO PRO B . n 
D 2 70  LEU 70  70  70  LEU LEU B . n 
D 2 71  PRO 71  71  71  PRO PRO B . n 
D 2 72  ASP 72  72  72  ASP ASP B . n 
D 2 73  ASP 73  73  73  ASP ASP B . n 
D 2 74  ALA 74  74  74  ALA ALA B . n 
D 2 75  ASP 75  75  75  ASP ASP B . n 
D 2 76  LEU 76  76  76  LEU LEU B . n 
D 2 77  ARG 77  77  77  ARG ARG B . n 
D 2 78  LYS 78  78  78  LYS LYS B . n 
D 2 79  GLU 79  79  79  GLU GLU B . n 
D 2 80  ARG 80  80  80  ARG ARG B . n 
D 2 81  SER 81  81  81  SER SER B . n 
D 2 82  ASP 82  82  82  ASP ASP B . n 
D 2 83  GLU 83  83  83  GLU GLU B . n 
D 2 84  ILE 84  84  84  ILE ILE B . n 
D 2 85  PRO 85  85  85  PRO PRO B . n 
D 2 86  GLU 86  86  86  GLU GLU B . n 
D 2 87  ALA 87  87  87  ALA ALA B . n 
D 2 88  ALA 88  88  88  ALA ALA B . n 
D 2 89  LYS 89  89  89  LYS LYS B . n 
D 2 90  GLU 90  90  90  GLU GLU B . n 
D 2 91  ILE 91  91  91  ILE ILE B . n 
D 2 92  MET 92  92  92  MET MET B . n 
D 2 93  ARG 93  93  93  ARG ARG B . n 
D 2 94  GLU 94  94  94  GLU GLU B . n 
D 2 95  MET 95  95  95  MET MET B . n 
D 2 96  GLY 96  96  96  GLY GLY B . n 
D 2 97  ILE 97  97  97  ILE ILE B . n 
D 2 98  ASN 98  98  98  ASN ASN B . n 
D 2 99  PRO 99  99  99  PRO PRO B . n 
D 2 100 GLU 100 100 100 GLU GLU B . n 
D 2 101 THR 101 101 101 THR THR B . n 
D 2 102 TRP 102 102 102 TRP TRP B . n 
D 2 103 GLU 103 103 103 GLU GLU B . n 
D 2 104 TYR 104 104 104 TYR TYR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  270  270 HOH HOH C . 
E 3 HOH 2  500  500 HOH HOH C . 
E 3 HOH 3  501  501 HOH HOH C . 
E 3 HOH 4  502  502 HOH HOH C . 
E 3 HOH 5  503  503 HOH HOH C . 
E 3 HOH 6  504  504 HOH HOH C . 
E 3 HOH 7  505  505 HOH HOH C . 
E 3 HOH 8  506  506 HOH HOH C . 
E 3 HOH 9  507  507 HOH HOH C . 
E 3 HOH 10 508  508 HOH HOH C . 
E 3 HOH 11 509  509 HOH HOH C . 
E 3 HOH 12 510  510 HOH HOH C . 
E 3 HOH 13 511  511 HOH HOH C . 
E 3 HOH 14 1245 245 HOH HOH C . 
F 3 HOH 1  1500 500 HOH HOH D . 
F 3 HOH 2  1501 501 HOH HOH D . 
F 3 HOH 3  1502 502 HOH HOH D . 
F 3 HOH 4  1503 503 HOH HOH D . 
F 3 HOH 5  1504 504 HOH HOH D . 
F 3 HOH 6  1505 505 HOH HOH D . 
F 3 HOH 7  1506 506 HOH HOH D . 
F 3 HOH 8  1507 507 HOH HOH D . 
F 3 HOH 9  1508 508 HOH HOH D . 
F 3 HOH 10 1509 509 HOH HOH D . 
F 3 HOH 11 1510 510 HOH HOH D . 
F 3 HOH 12 1512 512 HOH HOH D . 
F 3 HOH 13 1513 513 HOH HOH D . 
F 3 HOH 14 1514 514 HOH HOH D . 
F 3 HOH 15 1515 515 HOH HOH D . 
F 3 HOH 16 1517 517 HOH HOH D . 
F 3 HOH 17 1518 518 HOH HOH D . 
G 3 HOH 1  200  200 HOH HOH A . 
G 3 HOH 2  201  201 HOH HOH A . 
G 3 HOH 3  202  202 HOH HOH A . 
G 3 HOH 4  203  203 HOH HOH A . 
G 3 HOH 5  204  204 HOH HOH A . 
G 3 HOH 6  205  205 HOH HOH A . 
G 3 HOH 7  206  206 HOH HOH A . 
G 3 HOH 8  207  207 HOH HOH A . 
G 3 HOH 9  208  208 HOH HOH A . 
G 3 HOH 10 209  209 HOH HOH A . 
G 3 HOH 11 210  210 HOH HOH A . 
G 3 HOH 12 211  211 HOH HOH A . 
G 3 HOH 13 212  212 HOH HOH A . 
G 3 HOH 14 213  213 HOH HOH A . 
G 3 HOH 15 214  214 HOH HOH A . 
G 3 HOH 16 215  215 HOH HOH A . 
G 3 HOH 17 216  216 HOH HOH A . 
G 3 HOH 18 217  217 HOH HOH A . 
G 3 HOH 19 218  218 HOH HOH A . 
G 3 HOH 20 219  219 HOH HOH A . 
G 3 HOH 21 220  220 HOH HOH A . 
G 3 HOH 22 221  221 HOH HOH A . 
G 3 HOH 23 222  222 HOH HOH A . 
G 3 HOH 24 223  223 HOH HOH A . 
G 3 HOH 25 224  224 HOH HOH A . 
G 3 HOH 26 225  225 HOH HOH A . 
G 3 HOH 27 226  226 HOH HOH A . 
G 3 HOH 28 227  227 HOH HOH A . 
G 3 HOH 29 228  228 HOH HOH A . 
G 3 HOH 30 229  229 HOH HOH A . 
G 3 HOH 31 231  231 HOH HOH A . 
G 3 HOH 32 232  232 HOH HOH A . 
G 3 HOH 33 233  233 HOH HOH A . 
G 3 HOH 34 234  234 HOH HOH A . 
G 3 HOH 35 235  235 HOH HOH A . 
G 3 HOH 36 236  236 HOH HOH A . 
G 3 HOH 37 237  237 HOH HOH A . 
G 3 HOH 38 238  238 HOH HOH A . 
G 3 HOH 39 239  239 HOH HOH A . 
G 3 HOH 40 240  240 HOH HOH A . 
G 3 HOH 41 241  241 HOH HOH A . 
G 3 HOH 42 242  242 HOH HOH A . 
G 3 HOH 43 243  243 HOH HOH A . 
G 3 HOH 44 244  244 HOH HOH A . 
G 3 HOH 45 245  245 HOH HOH A . 
G 3 HOH 46 246  246 HOH HOH A . 
G 3 HOH 47 247  247 HOH HOH A . 
G 3 HOH 48 248  248 HOH HOH A . 
G 3 HOH 49 249  249 HOH HOH A . 
G 3 HOH 50 250  250 HOH HOH A . 
G 3 HOH 51 251  251 HOH HOH A . 
G 3 HOH 52 252  252 HOH HOH A . 
G 3 HOH 53 253  253 HOH HOH A . 
G 3 HOH 54 254  254 HOH HOH A . 
G 3 HOH 55 255  255 HOH HOH A . 
G 3 HOH 56 256  256 HOH HOH A . 
G 3 HOH 57 257  257 HOH HOH A . 
G 3 HOH 58 258  258 HOH HOH A . 
G 3 HOH 59 259  259 HOH HOH A . 
G 3 HOH 60 260  260 HOH HOH A . 
G 3 HOH 61 261  261 HOH HOH A . 
G 3 HOH 62 262  262 HOH HOH A . 
G 3 HOH 63 263  263 HOH HOH A . 
G 3 HOH 64 264  264 HOH HOH A . 
G 3 HOH 65 265  265 HOH HOH A . 
G 3 HOH 66 266  266 HOH HOH A . 
G 3 HOH 67 267  267 HOH HOH A . 
G 3 HOH 68 268  268 HOH HOH A . 
G 3 HOH 69 269  269 HOH HOH A . 
G 3 HOH 70 271  271 HOH HOH A . 
G 3 HOH 71 272  272 HOH HOH A . 
G 3 HOH 72 273  273 HOH HOH A . 
G 3 HOH 73 274  274 HOH HOH A . 
G 3 HOH 74 275  275 HOH HOH A . 
G 3 HOH 75 276  276 HOH HOH A . 
G 3 HOH 76 277  277 HOH HOH A . 
G 3 HOH 77 278  278 HOH HOH A . 
G 3 HOH 78 279  279 HOH HOH A . 
G 3 HOH 79 280  280 HOH HOH A . 
G 3 HOH 80 282  282 HOH HOH A . 
G 3 HOH 81 283  283 HOH HOH A . 
G 3 HOH 82 284  284 HOH HOH A . 
G 3 HOH 83 285  285 HOH HOH A . 
G 3 HOH 84 286  286 HOH HOH A . 
G 3 HOH 85 287  287 HOH HOH A . 
G 3 HOH 86 288  288 HOH HOH A . 
G 3 HOH 87 289  289 HOH HOH A . 
G 3 HOH 88 1219 219 HOH HOH A . 
G 3 HOH 89 1511 511 HOH HOH A . 
G 3 HOH 90 1516 516 HOH HOH A . 
H 3 HOH 1  230  230 HOH HOH B . 
H 3 HOH 2  281  281 HOH HOH B . 
H 3 HOH 3  1200 200 HOH HOH B . 
H 3 HOH 4  1201 201 HOH HOH B . 
H 3 HOH 5  1202 202 HOH HOH B . 
H 3 HOH 6  1203 203 HOH HOH B . 
H 3 HOH 7  1204 204 HOH HOH B . 
H 3 HOH 8  1205 205 HOH HOH B . 
H 3 HOH 9  1206 206 HOH HOH B . 
H 3 HOH 10 1207 207 HOH HOH B . 
H 3 HOH 11 1208 208 HOH HOH B . 
H 3 HOH 12 1209 209 HOH HOH B . 
H 3 HOH 13 1210 210 HOH HOH B . 
H 3 HOH 14 1211 211 HOH HOH B . 
H 3 HOH 15 1212 212 HOH HOH B . 
H 3 HOH 16 1213 213 HOH HOH B . 
H 3 HOH 17 1214 214 HOH HOH B . 
H 3 HOH 18 1215 215 HOH HOH B . 
H 3 HOH 19 1216 216 HOH HOH B . 
H 3 HOH 20 1217 217 HOH HOH B . 
H 3 HOH 21 1218 218 HOH HOH B . 
H 3 HOH 22 1220 220 HOH HOH B . 
H 3 HOH 23 1221 221 HOH HOH B . 
H 3 HOH 24 1222 222 HOH HOH B . 
H 3 HOH 25 1223 223 HOH HOH B . 
H 3 HOH 26 1224 224 HOH HOH B . 
H 3 HOH 27 1225 225 HOH HOH B . 
H 3 HOH 28 1226 226 HOH HOH B . 
H 3 HOH 29 1227 227 HOH HOH B . 
H 3 HOH 30 1228 228 HOH HOH B . 
H 3 HOH 31 1229 229 HOH HOH B . 
H 3 HOH 32 1230 230 HOH HOH B . 
H 3 HOH 33 1231 231 HOH HOH B . 
H 3 HOH 34 1232 232 HOH HOH B . 
H 3 HOH 35 1233 233 HOH HOH B . 
H 3 HOH 36 1234 234 HOH HOH B . 
H 3 HOH 37 1235 235 HOH HOH B . 
H 3 HOH 38 1236 236 HOH HOH B . 
H 3 HOH 39 1237 237 HOH HOH B . 
H 3 HOH 40 1238 238 HOH HOH B . 
H 3 HOH 41 1239 239 HOH HOH B . 
H 3 HOH 42 1240 240 HOH HOH B . 
H 3 HOH 43 1241 241 HOH HOH B . 
H 3 HOH 44 1242 242 HOH HOH B . 
H 3 HOH 45 1243 243 HOH HOH B . 
H 3 HOH 46 1244 244 HOH HOH B . 
H 3 HOH 47 1246 246 HOH HOH B . 
H 3 HOH 48 1247 247 HOH HOH B . 
H 3 HOH 49 1248 248 HOH HOH B . 
H 3 HOH 50 1249 249 HOH HOH B . 
H 3 HOH 51 1250 250 HOH HOH B . 
H 3 HOH 52 1251 251 HOH HOH B . 
H 3 HOH 53 1252 252 HOH HOH B . 
H 3 HOH 54 1253 253 HOH HOH B . 
H 3 HOH 55 1254 254 HOH HOH B . 
H 3 HOH 56 1255 255 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-08-02 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE  phasing          .     ? 1 
X-PLOR refinement       3.860 ? 2 
MOSFLM 'data reduction' .     ? 3 
CCP4   'data scaling'   .     ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 82 ? ? -69.83  75.56  
2 1 GLU B 2  ? ? -179.07 -54.52 
3 1 GLU B 13 ? ? -33.77  77.49  
4 1 HIS B 14 ? ? -158.94 -41.66 
5 1 LYS B 17 ? ? -171.78 -20.69 
# 
_ndb_struct_conf_na.entry_id   1MJM 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC 10 1_555 -0.232 -0.308 -0.566 -11.323 2.932  -0.063 1  C_DG401:DC420_D C 401 ? D 420 ? 19 1 
1 A DA 2  1_555 B DT 9  1_555 -0.110 0.035  -0.273 -5.269  -4.893 0.716  2  C_DA402:DT419_D C 402 ? D 419 ? 20 1 
1 A DG 3  1_555 B DC 8  1_555 0.020  -0.290 -0.582 -0.047  -1.633 1.710  3  C_DG403:DC418_D C 403 ? D 418 ? 19 1 
1 A DA 4  1_555 B DT 7  1_555 0.029  0.216  0.073  1.512   -6.834 -1.983 4  C_DA404:DT417_D C 404 ? D 417 ? 20 1 
1 A DC 5  1_555 B DG 6  1_555 0.621  -0.207 -0.100 3.319   -5.388 1.140  5  C_DC405:DG416_D C 405 ? D 416 ? 19 1 
1 A DG 6  1_555 B DC 5  1_555 -0.531 -0.198 -0.142 -4.390  -3.630 0.667  6  C_DG406:DC415_D C 406 ? D 415 ? 19 1 
1 A DT 7  1_555 B DA 4  1_555 -0.015 0.083  -0.016 7.537   -8.029 3.102  7  C_DT407:DA414_D C 407 ? D 414 ? 20 1 
1 A DC 8  1_555 B DG 3  1_555 -0.001 -0.486 -0.741 5.713   -3.861 1.113  8  C_DC408:DG413_D C 408 ? D 413 ? 19 1 
1 A DT 9  1_555 B DA 2  1_555 -0.501 -0.029 -0.343 2.064   -5.849 0.611  9  C_DT409:DA412_D C 409 ? D 412 ? 20 1 
1 A DC 10 1_555 B DG 1  1_555 0.306  -0.326 -0.088 2.006   -7.149 -1.819 10 C_DC410:DG411_D C 410 ? D 411 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1 1_555 B DC 10 1_555 A DA 2  1_555 B DT 9 1_555 -0.244 0.206  3.249 -0.937 5.306 37.127 -0.372 0.258  3.251 8.280  1.463   
37.502 1 CC_DG401DA402:DT419DC420_DD C 401 ? D 420 ? C 402 ? D 419 ? 
1 A DA 2 1_555 B DT 9  1_555 A DG 3  1_555 B DC 8 1_555 0.639  -0.657 3.288 3.823  6.098 24.729 -3.181 -0.365 3.102 13.867 -8.695  
25.739 2 CC_DA402DG403:DC418DT419_DD C 402 ? D 419 ? C 403 ? D 418 ? 
1 A DG 3 1_555 B DC 8  1_555 A DA 4  1_555 B DT 7 1_555 -0.732 -0.053 3.198 -7.668 5.341 36.146 -0.790 0.129  3.241 8.436  12.110  
37.295 3 CC_DG403DA404:DT417DC418_DD C 403 ? D 418 ? C 404 ? D 417 ? 
1 A DA 4 1_555 B DT 7  1_555 A DC 5  1_555 B DG 6 1_555 0.469  -0.689 3.320 1.668  4.897 35.274 -1.840 -0.523 3.217 8.027  -2.735  
35.640 4 CC_DA404DC405:DG416DT417_DD C 404 ? D 417 ? C 405 ? D 416 ? 
1 A DC 5 1_555 B DG 6  1_555 A DG 6  1_555 B DC 5 1_555 0.037  0.602  3.430 1.057  5.915 32.901 0.005  0.122  3.482 10.335 -1.847  
33.430 5 CC_DC405DG406:DC415DG416_DD C 405 ? D 416 ? C 406 ? D 415 ? 
1 A DG 6 1_555 B DC 5  1_555 A DT 7  1_555 B DA 4 1_555 -0.273 -0.655 3.065 -1.404 5.085 30.033 -2.180 0.261  2.926 9.719  2.684   
30.483 6 CC_DG406DT407:DA414DC415_DD C 406 ? D 415 ? C 407 ? D 414 ? 
1 A DT 7 1_555 B DA 4  1_555 A DC 8  1_555 B DG 3 1_555 0.483  0.015  3.271 8.042  2.375 36.947 -0.287 0.305  3.295 3.689  -12.493 
37.854 7 CC_DT407DC408:DG413DA414_DD C 407 ? D 414 ? C 408 ? D 413 ? 
1 A DC 8 1_555 B DG 3  1_555 A DT 9  1_555 B DA 2 1_555 -0.709 -0.594 3.511 -4.273 8.009 24.987 -3.540 0.344  3.243 17.778 9.486   
26.560 8 CC_DC408DT409:DA412DG413_DD C 408 ? D 413 ? C 409 ? D 412 ? 
1 A DT 9 1_555 B DA 2  1_555 A DC 10 1_555 B DG 1 1_555 0.333  0.329  3.458 -0.745 5.300 39.417 -0.171 -0.581 3.466 7.814  1.099   
39.765 9 CC_DT409DC410:DG411DA412_DD C 409 ? D 412 ? C 410 ? D 411 ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#