data_1MJN
# 
_entry.id   1MJN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1MJN         pdb_00001mjn 10.2210/pdb1mjn/pdb 
RCSB  RCSB016962   ?            ?                   
WWPDB D_1000016962 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1MJN 
_pdbx_database_status.recvd_initial_deposition_date   2002-08-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shimaoka, M.'   1  
'Xiao, T.'       2  
'Liu, J.H.'      3  
'Yang, Y.T.'     4  
'Dong, Y.C.'     5  
'Jun, C.D.'      6  
'McCormack, A.'  7  
'Zhang, R.G.'    8  
'Wang, J.H.'     9  
'Springer, T.A.' 10 
# 
_citation.id                        primary 
_citation.title                     
'Structures of the alphaL I Domain and its Complex with ICAM-1 reveal a Shape-shifting Pathway for Integrin Regulation' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            112 
_citation.page_first                99 
_citation.page_last                 111 
_citation.year                      2003 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12526797 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(02)01257-6' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shimaoka, M.'   1  ? 
primary 'Xiao, T.'       2  ? 
primary 'Liu, J.H.'      3  ? 
primary 'Yang, Y.T.'     4  ? 
primary 'Dong, Y.C.'     5  ? 
primary 'Jun, C.D.'      6  ? 
primary 'McCormack, A.'  7  ? 
primary 'Zhang, R.G.'    8  ? 
primary 'Joachimiak, A.' 9  ? 
primary 'Takagi, J.'     10 ? 
primary 'Wang, J.H.'     11 ? 
primary 'Springer, T.A.' 12 ? 
# 
_cell.entry_id           1MJN 
_cell.length_a           40.374 
_cell.length_b           57.399 
_cell.length_c           66.909 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1MJN 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Integrin alpha-L' 20362.336 1   ? 'L161C, F299C' 'Intermediate Affinity aL I Domain' ? 
2 non-polymer syn 'MAGNESIUM ION'    24.305    1   ? ?              ?                                   ? 
3 water       nat water              18.015    322 ? ?              ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Leukocyte adhesion glycoprotein LFA-1 alpha chain, Leukocyte function associated molecule 1, alpha chain, CD11a' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKCSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTN
TFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVK
ILDTFEKLKDLCTELQKKI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKCSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTN
TFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVK
ILDTFEKLKDLCTELQKKI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   VAL n 
1 4   ASP n 
1 5   LEU n 
1 6   VAL n 
1 7   PHE n 
1 8   LEU n 
1 9   PHE n 
1 10  ASP n 
1 11  GLY n 
1 12  SER n 
1 13  MET n 
1 14  SER n 
1 15  LEU n 
1 16  GLN n 
1 17  PRO n 
1 18  ASP n 
1 19  GLU n 
1 20  PHE n 
1 21  GLN n 
1 22  LYS n 
1 23  ILE n 
1 24  LEU n 
1 25  ASP n 
1 26  PHE n 
1 27  MET n 
1 28  LYS n 
1 29  ASP n 
1 30  VAL n 
1 31  MET n 
1 32  LYS n 
1 33  LYS n 
1 34  CYS n 
1 35  SER n 
1 36  ASN n 
1 37  THR n 
1 38  SER n 
1 39  TYR n 
1 40  GLN n 
1 41  PHE n 
1 42  ALA n 
1 43  ALA n 
1 44  VAL n 
1 45  GLN n 
1 46  PHE n 
1 47  SER n 
1 48  THR n 
1 49  SER n 
1 50  TYR n 
1 51  LYS n 
1 52  THR n 
1 53  GLU n 
1 54  PHE n 
1 55  ASP n 
1 56  PHE n 
1 57  SER n 
1 58  ASP n 
1 59  TYR n 
1 60  VAL n 
1 61  LYS n 
1 62  ARG n 
1 63  LYS n 
1 64  ASP n 
1 65  PRO n 
1 66  ASP n 
1 67  ALA n 
1 68  LEU n 
1 69  LEU n 
1 70  LYS n 
1 71  HIS n 
1 72  VAL n 
1 73  LYS n 
1 74  HIS n 
1 75  MET n 
1 76  LEU n 
1 77  LEU n 
1 78  LEU n 
1 79  THR n 
1 80  ASN n 
1 81  THR n 
1 82  PHE n 
1 83  GLY n 
1 84  ALA n 
1 85  ILE n 
1 86  ASN n 
1 87  TYR n 
1 88  VAL n 
1 89  ALA n 
1 90  THR n 
1 91  GLU n 
1 92  VAL n 
1 93  PHE n 
1 94  ARG n 
1 95  GLU n 
1 96  GLU n 
1 97  LEU n 
1 98  GLY n 
1 99  ALA n 
1 100 ARG n 
1 101 PRO n 
1 102 ASP n 
1 103 ALA n 
1 104 THR n 
1 105 LYS n 
1 106 VAL n 
1 107 LEU n 
1 108 ILE n 
1 109 ILE n 
1 110 ILE n 
1 111 THR n 
1 112 ASP n 
1 113 GLY n 
1 114 GLU n 
1 115 ALA n 
1 116 THR n 
1 117 ASP n 
1 118 SER n 
1 119 GLY n 
1 120 ASN n 
1 121 ILE n 
1 122 ASP n 
1 123 ALA n 
1 124 ALA n 
1 125 LYS n 
1 126 ASP n 
1 127 ILE n 
1 128 ILE n 
1 129 ARG n 
1 130 TYR n 
1 131 ILE n 
1 132 ILE n 
1 133 GLY n 
1 134 ILE n 
1 135 GLY n 
1 136 LYS n 
1 137 HIS n 
1 138 PHE n 
1 139 GLN n 
1 140 THR n 
1 141 LYS n 
1 142 GLU n 
1 143 SER n 
1 144 GLN n 
1 145 GLU n 
1 146 THR n 
1 147 LEU n 
1 148 HIS n 
1 149 LYS n 
1 150 PHE n 
1 151 ALA n 
1 152 SER n 
1 153 LYS n 
1 154 PRO n 
1 155 ALA n 
1 156 SER n 
1 157 GLU n 
1 158 PHE n 
1 159 VAL n 
1 160 LYS n 
1 161 ILE n 
1 162 LEU n 
1 163 ASP n 
1 164 THR n 
1 165 PHE n 
1 166 GLU n 
1 167 LYS n 
1 168 LEU n 
1 169 LYS n 
1 170 ASP n 
1 171 LEU n 
1 172 CYS n 
1 173 THR n 
1 174 GLU n 
1 175 LEU n 
1 176 GLN n 
1 177 LYS n 
1 178 LYS n 
1 179 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ITAL_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTN
TFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVK
ILDTFEKLKDLFTELQKKI
;
_struct_ref.pdbx_align_begin           153 
_struct_ref.pdbx_db_accession          P20701 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1MJN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 179 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P20701 
_struct_ref_seq.db_align_beg                  153 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  331 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       128 
_struct_ref_seq.pdbx_auth_seq_align_end       306 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1MJN CYS A 34  ? UNP P20701 LEU 186 'engineered mutation' 161 1 
1 1MJN CYS A 172 ? UNP P20701 PHE 324 'engineered mutation' 299 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1MJN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   35.38 
_exptl_crystal.density_Matthews      1.90 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    'PEG 4000, MgCl2, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   SBC 
_diffrn_detector.pdbx_collection_date   2000-12-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0332 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             1.0332 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1MJN 
_reflns.observed_criterion_sigma_F   1. 
_reflns.observed_criterion_sigma_I   1. 
_reflns.d_resolution_high            1.3 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   35329 
_reflns.number_obs                   33956 
_reflns.percent_possible_obs         90.2 
_reflns.pdbx_Rmerge_I_obs            0.088 
_reflns.pdbx_Rsym_value              0.088 
_reflns.pdbx_netI_over_sigmaI        17.8 
_reflns.B_iso_Wilson_estimate        7.8 
_reflns.pdbx_redundancy              5.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.3 
_reflns_shell.d_res_low              1.35 
_reflns_shell.percent_possible_all   47 
_reflns_shell.Rmerge_I_obs           0.352 
_reflns_shell.pdbx_Rsym_value        0.352 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        2.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2897 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1MJN 
_refine.ls_d_res_high                            1.30 
_refine.ls_d_res_low                             50 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     31703 
_refine.ls_number_reflns_obs                     31703 
_refine.ls_number_reflns_R_free                  3516 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.156 
_refine.ls_R_factor_R_free                       0.202 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1LFA' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1432 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             322 
_refine_hist.number_atoms_total               1755 
_refine_hist.d_res_high                       1.30 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d              0.012  ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d             0.030  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes   0.0282 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol     0.060  ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol 0.064  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.30 
_refine_ls_shell.d_res_low                        1.38 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.227 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_obs                3195 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_pdbx_refine.entry_id                                    1MJN 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1563 
_pdbx_refine.number_reflns_obs_no_cutoff                 31703 
_pdbx_refine.free_R_factor_no_cutoff                     0.202 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            3516 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     10 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.14 
_pdbx_refine.number_reflns_obs_4sig_cutoff               24644 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.1845 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          2764 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   10 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1MJN 
_struct.title                     'Crystal Structure of the intermediate affinity aL I domain mutant' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MJN 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'Rossmann Fold, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 16  ? CYS A 34  ? GLN A 143 CYS A 161 1 ? 19 
HELX_P HELX_P2  2  ASP A 55  ? LYS A 63  ? ASP A 182 LYS A 190 1 ? 9  
HELX_P HELX_P3  3  ASP A 64  ? LYS A 70  ? ASP A 191 LYS A 197 1 ? 7  
HELX_P HELX_P4  4  ASN A 80  ? VAL A 92  ? ASN A 207 VAL A 219 1 ? 13 
HELX_P HELX_P5  5  ARG A 94  ? GLY A 98  ? ARG A 221 GLY A 225 5 ? 5  
HELX_P HELX_P6  6  ILE A 121 ? LYS A 125 ? ILE A 248 LYS A 252 5 ? 5  
HELX_P HELX_P7  7  LYS A 136 ? GLN A 139 ? LYS A 263 GLN A 266 5 ? 4  
HELX_P HELX_P8  8  THR A 140 ? THR A 146 ? THR A 267 THR A 273 1 ? 7  
HELX_P HELX_P9  9  LEU A 147 ? ALA A 151 ? LEU A 274 ALA A 278 5 ? 5  
HELX_P HELX_P10 10 PRO A 154 ? PHE A 158 ? PRO A 281 PHE A 285 1 ? 5  
HELX_P HELX_P11 11 THR A 164 ? LEU A 168 ? THR A 291 LEU A 295 5 ? 5  
HELX_P HELX_P12 12 ASP A 170 ? ILE A 179 ? ASP A 297 ILE A 306 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 34  SG  ? ? ? 1_555 A CYS 172 SG ? ? A CYS 161  A CYS 299  1_555 ? ? ? ? ? ? ? 2.081 ? ? 
metalc1 metalc ? ? A SER 12  OG  ? ? ? 1_555 B MG  .   MG ? ? A SER 139  A MG  1001 1_555 ? ? ? ? ? ? ? 2.212 ? ? 
metalc2 metalc ? ? A SER 14  OG  ? ? ? 1_555 B MG  .   MG ? ? A SER 141  A MG  1001 1_555 ? ? ? ? ? ? ? 2.072 ? ? 
metalc3 metalc ? ? A ASP 112 OD1 ? ? ? 1_555 B MG  .   MG ? ? A ASP 239  A MG  1001 1_555 ? ? ? ? ? ? ? 2.065 ? ? 
metalc4 metalc ? ? B MG  .   MG  ? ? ? 1_555 C HOH .   O  ? ? A MG  1001 A HOH 2265 1_555 ? ? ? ? ? ? ? 2.080 ? ? 
metalc5 metalc ? ? B MG  .   MG  ? ? ? 1_555 C HOH .   O  ? ? A MG  1001 A HOH 2266 1_555 ? ? ? ? ? ? ? 2.072 ? ? 
metalc6 metalc ? ? B MG  .   MG  ? ? ? 1_555 C HOH .   O  ? ? A MG  1001 A HOH 2267 1_555 ? ? ? ? ? ? ? 2.043 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           153 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            280 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    154 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     281 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.06 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 50  ? PHE A 54  ? TYR A 177 PHE A 181 
A 2 TYR A 39  ? PHE A 46  ? TYR A 166 PHE A 173 
A 3 VAL A 3   ? ASP A 10  ? VAL A 130 ASP A 137 
A 4 THR A 104 ? THR A 111 ? THR A 231 THR A 238 
A 5 ILE A 128 ? ILE A 134 ? ILE A 255 ILE A 261 
A 6 VAL A 159 ? LEU A 162 ? VAL A 286 LEU A 289 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 54  ? O PHE A 181 N ALA A 43  ? N ALA A 170 
A 2 3 O VAL A 44  ? O VAL A 171 N PHE A 7   ? N PHE A 134 
A 3 4 N LEU A 8   ? N LEU A 135 O ILE A 110 ? O ILE A 237 
A 4 5 N ILE A 109 ? N ILE A 236 O ILE A 132 ? O ILE A 259 
A 5 6 N ILE A 131 ? N ILE A 258 O LYS A 160 ? O LYS A 287 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    MG 
_struct_site.pdbx_auth_seq_id     1001 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE MG A 1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 SER A 12  ? SER A 139  . ? 1_555 ? 
2 AC1 6 SER A 14  ? SER A 141  . ? 1_555 ? 
3 AC1 6 ASP A 112 ? ASP A 239  . ? 1_555 ? 
4 AC1 6 HOH C .   ? HOH A 2265 . ? 1_555 ? 
5 AC1 6 HOH C .   ? HOH A 2266 . ? 1_555 ? 
6 AC1 6 HOH C .   ? HOH A 2267 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1MJN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1MJN 
_atom_sites.fract_transf_matrix[1][1]   0.024768 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017422 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014946 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 1   ? 36.265 58.204 13.962  1.00 53.31  ? 128  GLY A N   1 
ATOM   2    C  CA  . GLY A 1 1   ? 35.944 57.407 12.781  1.00 32.47  ? 128  GLY A CA  1 
ATOM   3    C  C   . GLY A 1 1   ? 34.472 56.988 12.705  1.00 14.81  ? 128  GLY A C   1 
ATOM   4    O  O   . GLY A 1 1   ? 34.159 56.294 11.740  1.00 18.40  ? 128  GLY A O   1 
ATOM   5    N  N   . ASN A 1 2   ? 33.683 57.401 13.681  1.00 15.23  ? 129  ASN A N   1 
ATOM   6    C  CA  . ASN A 1 2   ? 32.262 57.051 13.717  1.00 9.06   ? 129  ASN A CA  1 
ATOM   7    C  C   . ASN A 1 2   ? 31.531 57.790 12.582  1.00 10.30  ? 129  ASN A C   1 
ATOM   8    O  O   . ASN A 1 2   ? 31.785 58.953 12.343  1.00 11.45  ? 129  ASN A O   1 
ATOM   9    C  CB  . ASN A 1 2   ? 31.683 57.341 15.078  1.00 13.43  ? 129  ASN A CB  1 
ATOM   10   C  CG  . ASN A 1 2   ? 32.174 56.418 16.184  1.00 26.74  ? 129  ASN A CG  1 
ATOM   11   O  OD1 . ASN A 1 2   ? 32.737 55.366 15.894  1.00 20.47  ? 129  ASN A OD1 1 
ATOM   12   N  ND2 . ASN A 1 2   ? 31.946 56.794 17.436  1.00 31.94  ? 129  ASN A ND2 1 
ATOM   13   N  N   . VAL A 1 3   ? 30.637 57.042 11.927  1.00 8.23   ? 130  VAL A N   1 
ATOM   14   C  CA  . VAL A 1 3   ? 29.783 57.618 10.887  1.00 7.27   ? 130  VAL A CA  1 
ATOM   15   C  C   . VAL A 1 3   ? 28.345 57.224 11.207  1.00 5.56   ? 130  VAL A C   1 
ATOM   16   O  O   . VAL A 1 3   ? 28.081 56.039 11.375  1.00 7.69   ? 130  VAL A O   1 
ATOM   17   C  CB  . VAL A 1 3   ? 30.138 57.125 9.481   1.00 8.09   ? 130  VAL A CB  1 
ATOM   18   C  CG1 . VAL A 1 3   ? 29.221 57.718 8.413   1.00 11.20  ? 130  VAL A CG1 1 
ATOM   19   C  CG2 . VAL A 1 3   ? 31.583 57.431 9.145   1.00 16.71  ? 130  VAL A CG2 1 
ATOM   20   N  N   . ASP A 1 4   ? 27.484 58.210 11.252  1.00 5.32   ? 131  ASP A N   1 
ATOM   21   C  CA  . ASP A 1 4   ? 26.038 58.043 11.350  1.00 5.77   ? 131  ASP A CA  1 
ATOM   22   C  C   . ASP A 1 4   ? 25.422 58.301 9.958   1.00 5.45   ? 131  ASP A C   1 
ATOM   23   O  O   . ASP A 1 4   ? 25.489 59.414 9.427   1.00 5.04   ? 131  ASP A O   1 
ATOM   24   C  CB  . ASP A 1 4   ? 25.390 58.968 12.361  1.00 4.94   ? 131  ASP A CB  1 
ATOM   25   C  CG  . ASP A 1 4   ? 25.600 58.613 13.806  1.00 8.65   ? 131  ASP A CG  1 
ATOM   26   O  OD1 . ASP A 1 4   ? 26.099 57.486 14.196  1.00 11.32  ? 131  ASP A OD1 1 
ATOM   27   O  OD2 . ASP A 1 4   ? 25.281 59.423 14.689  1.00 9.48   ? 131  ASP A OD2 1 
ATOM   28   N  N   . LEU A 1 5   ? 24.870 57.245 9.356   1.00 4.84   ? 132  LEU A N   1 
ATOM   29   C  CA  . LEU A 1 5   ? 24.420 57.292 7.976   1.00 4.95   ? 132  LEU A CA  1 
ATOM   30   C  C   . LEU A 1 5   ? 22.902 57.070 7.951   1.00 3.72   ? 132  LEU A C   1 
ATOM   31   O  O   . LEU A 1 5   ? 22.430 56.097 8.499   1.00 5.02   ? 132  LEU A O   1 
ATOM   32   C  CB  . LEU A 1 5   ? 25.162 56.262 7.101   1.00 3.92   ? 132  LEU A CB  1 
ATOM   33   C  CG  . LEU A 1 5   ? 24.897 56.359 5.596   1.00 4.74   ? 132  LEU A CG  1 
ATOM   34   C  CD1 . LEU A 1 5   ? 26.089 55.874 4.765   1.00 7.94   ? 132  LEU A CD1 1 
ATOM   35   C  CD2 . LEU A 1 5   ? 23.649 55.612 5.121   1.00 6.59   ? 132  LEU A CD2 1 
ATOM   36   N  N   . VAL A 1 6   ? 22.229 57.988 7.248   1.00 2.88   ? 133  VAL A N   1 
ATOM   37   C  CA  . VAL A 1 6   ? 20.801 57.860 7.018   1.00 3.07   ? 133  VAL A CA  1 
ATOM   38   C  C   . VAL A 1 6   ? 20.568 57.583 5.553   1.00 3.18   ? 133  VAL A C   1 
ATOM   39   O  O   . VAL A 1 6   ? 21.029 58.311 4.669   1.00 4.26   ? 133  VAL A O   1 
ATOM   40   C  CB  . VAL A 1 6   ? 20.044 59.124 7.421   1.00 3.45   ? 133  VAL A CB  1 
ATOM   41   C  CG1 . VAL A 1 6   ? 18.554 59.085 7.094   1.00 4.61   ? 133  VAL A CG1 1 
ATOM   42   C  CG2 . VAL A 1 6   ? 20.194 59.402 8.899   1.00 5.67   ? 133  VAL A CG2 1 
ATOM   43   N  N   . PHE A 1 7   ? 19.803 56.544 5.270   1.00 2.74   ? 134  PHE A N   1 
ATOM   44   C  CA  . PHE A 1 7   ? 19.234 56.328 3.957   1.00 2.27   ? 134  PHE A CA  1 
ATOM   45   C  C   . PHE A 1 7   ? 17.880 57.035 3.880   1.00 3.25   ? 134  PHE A C   1 
ATOM   46   O  O   . PHE A 1 7   ? 17.043 56.757 4.732   1.00 4.37   ? 134  PHE A O   1 
ATOM   47   C  CB  . PHE A 1 7   ? 18.982 54.875 3.615   1.00 3.70   ? 134  PHE A CB  1 
ATOM   48   C  CG  . PHE A 1 7   ? 20.197 53.984 3.619   1.00 4.83   ? 134  PHE A CG  1 
ATOM   49   C  CD1 . PHE A 1 7   ? 21.050 53.994 2.535   1.00 5.85   ? 134  PHE A CD1 1 
ATOM   50   C  CD2 . PHE A 1 7   ? 20.413 53.167 4.702   1.00 5.45   ? 134  PHE A CD2 1 
ATOM   51   C  CE1 . PHE A 1 7   ? 22.145 53.115 2.550   1.00 7.90   ? 134  PHE A CE1 1 
ATOM   52   C  CE2 . PHE A 1 7   ? 21.494 52.305 4.738   1.00 8.34   ? 134  PHE A CE2 1 
ATOM   53   C  CZ  . PHE A 1 7   ? 22.342 52.329 3.660   1.00 6.62   ? 134  PHE A CZ  1 
ATOM   54   N  N   . LEU A 1 8   ? 17.701 57.912 2.931   1.00 3.08   ? 135  LEU A N   1 
ATOM   55   C  CA  . LEU A 1 8   ? 16.432 58.643 2.715   1.00 1.88   ? 135  LEU A CA  1 
ATOM   56   C  C   . LEU A 1 8   ? 15.919 58.178 1.365   1.00 2.40   ? 135  LEU A C   1 
ATOM   57   O  O   . LEU A 1 8   ? 16.488 58.545 0.331   1.00 3.60   ? 135  LEU A O   1 
ATOM   58   C  CB  . LEU A 1 8   ? 16.647 60.129 2.709   1.00 1.99   ? 135  LEU A CB  1 
ATOM   59   C  CG  . LEU A 1 8   ? 15.372 60.954 2.438   1.00 3.13   ? 135  LEU A CG  1 
ATOM   60   C  CD1 . LEU A 1 8   ? 14.285 60.618 3.432   1.00 3.79   ? 135  LEU A CD1 1 
ATOM   61   C  CD2 . LEU A 1 8   ? 15.713 62.440 2.478   1.00 3.69   ? 135  LEU A CD2 1 
ATOM   62   N  N   . PHE A 1 9   ? 14.928 57.290 1.355   1.00 2.53   ? 136  PHE A N   1 
ATOM   63   C  CA  . PHE A 1 9   ? 14.579 56.562 0.139   1.00 3.17   ? 136  PHE A CA  1 
ATOM   64   C  C   . PHE A 1 9   ? 13.143 56.841 -0.311  1.00 3.14   ? 136  PHE A C   1 
ATOM   65   O  O   . PHE A 1 9   ? 12.199 56.850 0.491   1.00 4.09   ? 136  PHE A O   1 
ATOM   66   C  CB  . PHE A 1 9   ? 14.835 55.044 0.259   1.00 3.61   ? 136  PHE A CB  1 
ATOM   67   C  CG  . PHE A 1 9   ? 14.008 54.276 1.259   1.00 2.83   ? 136  PHE A CG  1 
ATOM   68   C  CD1 . PHE A 1 9   ? 14.244 54.239 2.623   1.00 3.35   ? 136  PHE A CD1 1 
ATOM   69   C  CD2 . PHE A 1 9   ? 12.904 53.538 0.794   1.00 3.54   ? 136  PHE A CD2 1 
ATOM   70   C  CE1 . PHE A 1 9   ? 13.479 53.508 3.524   1.00 4.06   ? 136  PHE A CE1 1 
ATOM   71   C  CE2 . PHE A 1 9   ? 12.140 52.811 1.704   1.00 4.13   ? 136  PHE A CE2 1 
ATOM   72   C  CZ  . PHE A 1 9   ? 12.391 52.819 3.048   1.00 3.78   ? 136  PHE A CZ  1 
ATOM   73   N  N   . ASP A 1 10  ? 13.009 57.080 -1.598  1.00 4.25   ? 137  ASP A N   1 
ATOM   74   C  CA  . ASP A 1 10  ? 11.763 57.418 -2.318  1.00 4.39   ? 137  ASP A CA  1 
ATOM   75   C  C   . ASP A 1 10  ? 10.822 56.238 -2.335  1.00 4.07   ? 137  ASP A C   1 
ATOM   76   O  O   . ASP A 1 10  ? 11.177 55.118 -2.701  1.00 5.03   ? 137  ASP A O   1 
ATOM   77   C  CB  . ASP A 1 10  ? 12.204 57.874 -3.689  1.00 3.84   ? 137  ASP A CB  1 
ATOM   78   C  CG  . ASP A 1 10  ? 11.268 58.368 -4.746  1.00 6.09   ? 137  ASP A CG  1 
ATOM   79   O  OD1 . ASP A 1 10  ? 10.114 57.834 -4.766  1.00 6.90   ? 137  ASP A OD1 1 
ATOM   80   O  OD2 . ASP A 1 10  ? 11.660 59.159 -5.610  1.00 5.28   ? 137  ASP A OD2 1 
ATOM   81   N  N   . GLY A 1 11  ? 9.568  56.510 -1.959  1.00 3.89   ? 138  GLY A N   1 
ATOM   82   C  CA  . GLY A 1 11  ? 8.496  55.523 -2.071  1.00 4.11   ? 138  GLY A CA  1 
ATOM   83   C  C   . GLY A 1 11  ? 7.372  56.023 -2.932  1.00 3.44   ? 138  GLY A C   1 
ATOM   84   O  O   . GLY A 1 11  ? 6.178  55.676 -2.697  1.00 3.62   ? 138  GLY A O   1 
ATOM   85   N  N   . SER A 1 12  ? 7.676  56.822 -3.931  1.00 3.52   ? 139  SER A N   1 
ATOM   86   C  CA  . SER A 1 12  ? 6.663  57.405 -4.783  1.00 2.60   ? 139  SER A CA  1 
ATOM   87   C  C   . SER A 1 12  ? 5.925  56.391 -5.654  1.00 4.65   ? 139  SER A C   1 
ATOM   88   O  O   . SER A 1 12  ? 6.310  55.247 -5.876  1.00 3.57   ? 139  SER A O   1 
ATOM   89   C  CB  . SER A 1 12  ? 7.276  58.459 -5.681  1.00 4.37   ? 139  SER A CB  1 
ATOM   90   O  OG  . SER A 1 12  ? 8.261  57.936 -6.560  1.00 4.50   ? 139  SER A OG  1 
ATOM   91   N  N   . MET A 1 13  ? 4.815  56.917 -6.187  1.00 4.05   ? 140  MET A N   1 
ATOM   92   C  CA  . MET A 1 13  ? 3.890  56.114 -6.982  1.00 5.23   ? 140  MET A CA  1 
ATOM   93   C  C   . MET A 1 13  ? 4.482  55.633 -8.289  1.00 5.73   ? 140  MET A C   1 
ATOM   94   O  O   . MET A 1 13  ? 3.927  54.714 -8.928  1.00 6.55   ? 140  MET A O   1 
ATOM   95   C  CB  . MET A 1 13  ? 2.658  56.940 -7.231  1.00 8.13   ? 140  MET A CB  1 
ATOM   96   C  CG  . MET A 1 13  ? 2.702  58.221 -7.960  1.00 19.08  ? 140  MET A CG  1 
ATOM   97   S  SD  A MET A 1 13  ? 3.063  58.247 -9.697  0.61 32.83  ? 140  MET A SD  1 
ATOM   98   S  SD  B MET A 1 13  ? 1.228  58.778 -8.813  0.39 29.37  ? 140  MET A SD  1 
ATOM   99   C  CE  A MET A 1 13  ? 1.702  57.316 -10.395 0.61 18.83  ? 140  MET A CE  1 
ATOM   100  C  CE  B MET A 1 13  ? 0.046  57.457 -8.578  0.39 6.31   ? 140  MET A CE  1 
ATOM   101  N  N   . SER A 1 14  ? 5.608  56.165 -8.750  1.00 4.00   ? 141  SER A N   1 
ATOM   102  C  CA  . SER A 1 14  ? 6.244  55.790 -10.015 1.00 4.39   ? 141  SER A CA  1 
ATOM   103  C  C   . SER A 1 14  ? 7.029  54.495 -9.936  1.00 4.37   ? 141  SER A C   1 
ATOM   104  O  O   . SER A 1 14  ? 7.410  53.936 -10.968 1.00 6.76   ? 141  SER A O   1 
ATOM   105  C  CB  . SER A 1 14  ? 7.190  56.923 -10.451 1.00 5.68   ? 141  SER A CB  1 
ATOM   106  O  OG  . SER A 1 14  ? 8.153  57.105 -9.416  1.00 4.46   ? 141  SER A OG  1 
ATOM   107  N  N   . LEU A 1 15  ? 7.289  54.047 -8.729  1.00 4.47   ? 142  LEU A N   1 
ATOM   108  C  CA  . LEU A 1 15  ? 8.088  52.842 -8.557  1.00 3.74   ? 142  LEU A CA  1 
ATOM   109  C  C   . LEU A 1 15  ? 7.229  51.585 -8.741  1.00 5.20   ? 142  LEU A C   1 
ATOM   110  O  O   . LEU A 1 15  ? 6.300  51.403 -7.992  1.00 6.66   ? 142  LEU A O   1 
ATOM   111  C  CB  . LEU A 1 15  ? 8.751  52.834 -7.189  1.00 5.68   ? 142  LEU A CB  1 
ATOM   112  C  CG  . LEU A 1 15  ? 9.872  53.889 -6.999  1.00 4.97   ? 142  LEU A CG  1 
ATOM   113  C  CD1 . LEU A 1 15  ? 10.136 54.214 -5.550  1.00 5.30   ? 142  LEU A CD1 1 
ATOM   114  C  CD2 . LEU A 1 15  ? 11.169 53.415 -7.655  1.00 5.07   ? 142  LEU A CD2 1 
ATOM   115  N  N   . GLN A 1 16  ? 7.601  50.762 -9.697  1.00 6.71   ? 143  GLN A N   1 
ATOM   116  C  CA  . GLN A 1 16  ? 7.073  49.404 -9.812  1.00 8.85   ? 143  GLN A CA  1 
ATOM   117  C  C   . GLN A 1 16  ? 7.483  48.606 -8.593  1.00 7.46   ? 143  GLN A C   1 
ATOM   118  O  O   . GLN A 1 16  ? 8.462  48.913 -7.900  1.00 6.90   ? 143  GLN A O   1 
ATOM   119  C  CB  . GLN A 1 16  ? 7.601  48.772 -11.091 1.00 7.47   ? 143  GLN A CB  1 
ATOM   120  C  CG  . GLN A 1 16  ? 7.125  49.528 -12.311 1.00 12.83  ? 143  GLN A CG  1 
ATOM   121  C  CD  . GLN A 1 16  ? 7.527  48.945 -13.648 1.00 29.28  ? 143  GLN A CD  1 
ATOM   122  O  OE1 . GLN A 1 16  ? 7.734  47.738 -13.751 1.00 25.16  ? 143  GLN A OE1 1 
ATOM   123  N  NE2 . GLN A 1 16  ? 7.616  49.811 -14.648 1.00 27.54  ? 143  GLN A NE2 1 
ATOM   124  N  N   . PRO A 1 17  ? 6.782  47.538 -8.223  1.00 7.09   ? 144  PRO A N   1 
ATOM   125  C  CA  . PRO A 1 17  ? 7.143  46.773 -7.044  1.00 7.53   ? 144  PRO A CA  1 
ATOM   126  C  C   . PRO A 1 17  ? 8.577  46.255 -7.076  1.00 6.31   ? 144  PRO A C   1 
ATOM   127  O  O   . PRO A 1 17  ? 9.238  46.366 -6.042  1.00 7.67   ? 144  PRO A O   1 
ATOM   128  C  CB  . PRO A 1 17  ? 6.154  45.610 -7.031  1.00 10.18  ? 144  PRO A CB  1 
ATOM   129  C  CG  . PRO A 1 17  ? 5.523  45.621 -8.380  1.00 29.04  ? 144  PRO A CG  1 
ATOM   130  C  CD  . PRO A 1 17  ? 5.548  47.036 -8.885  1.00 11.24  ? 144  PRO A CD  1 
ATOM   131  N  N   . ASP A 1 18  ? 9.080  45.814 -8.206  1.00 7.61   ? 145  ASP A N   1 
ATOM   132  C  CA  . ASP A 1 18  ? 10.450 45.315 -8.248  1.00 6.50   ? 145  ASP A CA  1 
ATOM   133  C  C   . ASP A 1 18  ? 11.465 46.455 -8.053  1.00 7.73   ? 145  ASP A C   1 
ATOM   134  O  O   . ASP A 1 18  ? 12.507 46.241 -7.438  1.00 8.63   ? 145  ASP A O   1 
ATOM   135  C  CB  . ASP A 1 18  ? 10.761 44.570 -9.541  1.00 9.02   ? 145  ASP A CB  1 
ATOM   136  C  CG  . ASP A 1 18  ? 10.750 45.331 -10.834 1.00 16.06  ? 145  ASP A CG  1 
ATOM   137  O  OD1 . ASP A 1 18  ? 9.903  46.200 -11.056 1.00 20.42  ? 145  ASP A OD1 1 
ATOM   138  O  OD2 . ASP A 1 18  ? 11.633 45.087 -11.698 1.00 51.14  ? 145  ASP A OD2 1 
ATOM   139  N  N   . GLU A 1 19  ? 11.108 47.635 -8.554  1.00 6.71   ? 146  GLU A N   1 
ATOM   140  C  CA  . GLU A 1 19  ? 11.968 48.806 -8.389  1.00 7.30   ? 146  GLU A CA  1 
ATOM   141  C  C   . GLU A 1 19  ? 12.031 49.227 -6.938  1.00 5.74   ? 146  GLU A C   1 
ATOM   142  O  O   . GLU A 1 19  ? 13.116 49.571 -6.420  1.00 7.01   ? 146  GLU A O   1 
ATOM   143  C  CB  . GLU A 1 19  ? 11.469 49.923 -9.297  1.00 5.90   ? 146  GLU A CB  1 
ATOM   144  C  CG  . GLU A 1 19  ? 11.605 49.583 -10.767 1.00 8.71   ? 146  GLU A CG  1 
ATOM   145  C  CD  . GLU A 1 19  ? 10.959 50.580 -11.698 1.00 11.55  ? 146  GLU A CD  1 
ATOM   146  O  OE1 . GLU A 1 19  ? 10.058 51.346 -11.279 1.00 10.78  ? 146  GLU A OE1 1 
ATOM   147  O  OE2 . GLU A 1 19  ? 11.374 50.612 -12.883 1.00 15.77  ? 146  GLU A OE2 1 
ATOM   148  N  N   . PHE A 1 20  ? 10.944 49.229 -6.215  1.00 4.81   ? 147  PHE A N   1 
ATOM   149  C  CA  . PHE A 1 20  ? 10.972 49.536 -4.794  1.00 5.33   ? 147  PHE A CA  1 
ATOM   150  C  C   . PHE A 1 20  ? 11.745 48.474 -4.030  1.00 7.63   ? 147  PHE A C   1 
ATOM   151  O  O   . PHE A 1 20  ? 12.567 48.809 -3.172  1.00 6.78   ? 147  PHE A O   1 
ATOM   152  C  CB  . PHE A 1 20  ? 9.527  49.694 -4.279  1.00 4.97   ? 147  PHE A CB  1 
ATOM   153  C  CG  . PHE A 1 20  ? 9.447  50.144 -2.841  1.00 3.53   ? 147  PHE A CG  1 
ATOM   154  C  CD1 . PHE A 1 20  ? 9.772  51.436 -2.493  1.00 5.78   ? 147  PHE A CD1 1 
ATOM   155  C  CD2 . PHE A 1 20  ? 9.047  49.299 -1.830  1.00 6.75   ? 147  PHE A CD2 1 
ATOM   156  C  CE1 . PHE A 1 20  ? 9.679  51.866 -1.194  1.00 4.88   ? 147  PHE A CE1 1 
ATOM   157  C  CE2 . PHE A 1 20  ? 8.973  49.711 -0.509  1.00 6.56   ? 147  PHE A CE2 1 
ATOM   158  C  CZ  . PHE A 1 20  ? 9.286  51.018 -0.180  1.00 5.99   ? 147  PHE A CZ  1 
ATOM   159  N  N   . GLN A 1 21  ? 11.553 47.192 -4.346  1.00 6.10   ? 148  GLN A N   1 
ATOM   160  C  CA  . GLN A 1 21  ? 12.312 46.132 -3.735  1.00 6.78   ? 148  GLN A CA  1 
ATOM   161  C  C   . GLN A 1 21  ? 13.804 46.259 -4.019  1.00 5.92   ? 148  GLN A C   1 
ATOM   162  O  O   . GLN A 1 21  ? 14.632 45.988 -3.126  1.00 8.07   ? 148  GLN A O   1 
ATOM   163  C  CB  . GLN A 1 21  ? 11.758 44.786 -4.236  1.00 9.68   ? 148  GLN A CB  1 
ATOM   164  C  CG  . GLN A 1 21  ? 12.385 43.584 -3.534  1.00 11.84  ? 148  GLN A CG  1 
ATOM   165  C  CD  . GLN A 1 21  ? 12.194 43.606 -2.041  1.00 10.84  ? 148  GLN A CD  1 
ATOM   166  O  OE1 . GLN A 1 21  ? 11.161 43.919 -1.474  1.00 13.00  ? 148  GLN A OE1 1 
ATOM   167  N  NE2 . GLN A 1 21  ? 13.284 43.282 -1.329  1.00 26.36  ? 148  GLN A NE2 1 
ATOM   168  N  N   . LYS A 1 22  ? 14.180 46.685 -5.203  1.00 5.35   ? 149  LYS A N   1 
ATOM   169  C  CA  . LYS A 1 22  ? 15.603 46.897 -5.461  1.00 6.59   ? 149  LYS A CA  1 
ATOM   170  C  C   . LYS A 1 22  ? 16.196 48.014 -4.611  1.00 5.70   ? 149  LYS A C   1 
ATOM   171  O  O   . LYS A 1 22  ? 17.361 47.917 -4.229  1.00 5.55   ? 149  LYS A O   1 
ATOM   172  C  CB  . LYS A 1 22  ? 15.789 47.158 -6.944  1.00 7.22   ? 149  LYS A CB  1 
ATOM   173  C  CG  . LYS A 1 22  ? 15.726 45.861 -7.736  1.00 11.07  ? 149  LYS A CG  1 
ATOM   174  C  CD  . LYS A 1 22  ? 15.735 46.100 -9.228  1.00 15.77  ? 149  LYS A CD  1 
ATOM   175  C  CE  . LYS A 1 22  ? 15.820 44.796 -10.018 1.00 20.48  ? 149  LYS A CE  1 
ATOM   176  N  NZ  . LYS A 1 22  ? 14.610 43.952 -9.776  1.00 39.89  ? 149  LYS A NZ  1 
ATOM   177  N  N   . ILE A 1 23  ? 15.398 49.023 -4.266  1.00 5.78   ? 150  ILE A N   1 
ATOM   178  C  CA  . ILE A 1 23  ? 15.895 50.083 -3.362  1.00 4.16   ? 150  ILE A CA  1 
ATOM   179  C  C   . ILE A 1 23  ? 16.129 49.497 -1.994  1.00 6.13   ? 150  ILE A C   1 
ATOM   180  O  O   . ILE A 1 23  ? 17.166 49.716 -1.360  1.00 6.50   ? 150  ILE A O   1 
ATOM   181  C  CB  . ILE A 1 23  ? 14.956 51.291 -3.312  1.00 5.17   ? 150  ILE A CB  1 
ATOM   182  C  CG1 . ILE A 1 23  ? 15.002 52.002 -4.664  1.00 4.39   ? 150  ILE A CG1 1 
ATOM   183  C  CG2 . ILE A 1 23  ? 15.246 52.199 -2.140  1.00 5.95   ? 150  ILE A CG2 1 
ATOM   184  C  CD1 . ILE A 1 23  ? 13.852 52.991 -4.825  1.00 11.02  ? 150  ILE A CD1 1 
ATOM   185  N  N   . LEU A 1 24  ? 15.185 48.676 -1.479  1.00 5.81   ? 151  LEU A N   1 
ATOM   186  C  CA  . LEU A 1 24  ? 15.352 47.994 -0.205  1.00 5.97   ? 151  LEU A CA  1 
ATOM   187  C  C   . LEU A 1 24  ? 16.595 47.098 -0.225  1.00 4.95   ? 151  LEU A C   1 
ATOM   188  O  O   . LEU A 1 24  ? 17.383 47.158 0.719   1.00 6.97   ? 151  LEU A O   1 
ATOM   189  C  CB  . LEU A 1 24  ? 14.120 47.179 0.156   1.00 5.05   ? 151  LEU A CB  1 
ATOM   190  C  CG  . LEU A 1 24  ? 12.816 47.974 0.333   1.00 9.41   ? 151  LEU A CG  1 
ATOM   191  C  CD1 . LEU A 1 24  ? 11.661 47.042 0.655   1.00 9.47   ? 151  LEU A CD1 1 
ATOM   192  C  CD2 . LEU A 1 24  ? 12.980 49.055 1.373   1.00 11.49  ? 151  LEU A CD2 1 
ATOM   193  N  N   . ASP A 1 25  ? 16.766 46.335 -1.278  1.00 6.15   ? 152  ASP A N   1 
ATOM   194  C  CA  . ASP A 1 25  ? 17.890 45.423 -1.378  1.00 6.58   ? 152  ASP A CA  1 
ATOM   195  C  C   . ASP A 1 25  ? 19.205 46.177 -1.420  1.00 8.32   ? 152  ASP A C   1 
ATOM   196  O  O   . ASP A 1 25  ? 20.197 45.726 -0.838  1.00 9.14   ? 152  ASP A O   1 
ATOM   197  C  CB  . ASP A 1 25  ? 17.722 44.576 -2.639  1.00 9.73   ? 152  ASP A CB  1 
ATOM   198  C  CG  . ASP A 1 25  ? 16.688 43.473 -2.451  1.00 20.61  ? 152  ASP A CG  1 
ATOM   199  O  OD1 . ASP A 1 25  ? 16.332 43.155 -1.298  1.00 21.27  ? 152  ASP A OD1 1 
ATOM   200  O  OD2 . ASP A 1 25  ? 16.227 42.933 -3.484  1.00 25.93  ? 152  ASP A OD2 1 
ATOM   201  N  N   . PHE A 1 26  ? 19.252 47.301 -2.107  1.00 5.54   ? 153  PHE A N   1 
ATOM   202  C  CA  . PHE A 1 26  ? 20.432 48.147 -2.148  1.00 6.45   ? 153  PHE A CA  1 
ATOM   203  C  C   . PHE A 1 26  ? 20.810 48.589 -0.763  1.00 6.04   ? 153  PHE A C   1 
ATOM   204  O  O   . PHE A 1 26  ? 22.013 48.529 -0.375  1.00 6.94   ? 153  PHE A O   1 
ATOM   205  C  CB  . PHE A 1 26  ? 20.154 49.334 -3.087  1.00 5.98   ? 153  PHE A CB  1 
ATOM   206  C  CG  . PHE A 1 26  ? 21.295 50.358 -3.021  1.00 6.60   ? 153  PHE A CG  1 
ATOM   207  C  CD1 . PHE A 1 26  ? 22.485 50.083 -3.682  1.00 11.72  ? 153  PHE A CD1 1 
ATOM   208  C  CD2 . PHE A 1 26  ? 21.179 51.523 -2.329  1.00 5.99   ? 153  PHE A CD2 1 
ATOM   209  C  CE1 . PHE A 1 26  ? 23.519 51.019 -3.642  1.00 11.66  ? 153  PHE A CE1 1 
ATOM   210  C  CE2 . PHE A 1 26  ? 22.195 52.474 -2.280  1.00 10.81  ? 153  PHE A CE2 1 
ATOM   211  C  CZ  . PHE A 1 26  ? 23.352 52.188 -2.962  1.00 8.95   ? 153  PHE A CZ  1 
ATOM   212  N  N   . MET A 1 27  ? 19.887 49.091 0.062   1.00 6.11   ? 154  MET A N   1 
ATOM   213  C  CA  . MET A 1 27  ? 20.199 49.552 1.385   1.00 6.68   ? 154  MET A CA  1 
ATOM   214  C  C   . MET A 1 27  ? 20.726 48.372 2.209   1.00 6.64   ? 154  MET A C   1 
ATOM   215  O  O   . MET A 1 27  ? 21.700 48.524 2.958   1.00 6.13   ? 154  MET A O   1 
ATOM   216  C  CB  . MET A 1 27  ? 18.996 50.212 2.052   1.00 6.37   ? 154  MET A CB  1 
ATOM   217  C  CG  . MET A 1 27  ? 18.554 51.492 1.346   1.00 4.65   ? 154  MET A CG  1 
ATOM   218  S  SD  . MET A 1 27  ? 17.178 52.303 2.182   1.00 8.24   ? 154  MET A SD  1 
ATOM   219  C  CE  . MET A 1 27  ? 15.823 51.206 1.879   1.00 5.67   ? 154  MET A CE  1 
ATOM   220  N  N   . LYS A 1 28  ? 20.079 47.224 2.108   1.00 6.15   ? 155  LYS A N   1 
ATOM   221  C  CA  . LYS A 1 28  ? 20.507 46.067 2.872   1.00 6.14   ? 155  LYS A CA  1 
ATOM   222  C  C   . LYS A 1 28  ? 21.935 45.676 2.479   1.00 5.69   ? 155  LYS A C   1 
ATOM   223  O  O   . LYS A 1 28  ? 22.695 45.319 3.379   1.00 7.40   ? 155  LYS A O   1 
ATOM   224  C  CB  . LYS A 1 28  ? 19.571 44.881 2.633   1.00 6.77   ? 155  LYS A CB  1 
ATOM   225  C  CG  . LYS A 1 28  ? 18.171 45.109 3.197   1.00 9.93   ? 155  LYS A CG  1 
ATOM   226  C  CD  . LYS A 1 28  ? 17.351 43.863 3.003   1.00 15.85  ? 155  LYS A CD  1 
ATOM   227  C  CE  . LYS A 1 28  ? 15.866 44.052 2.894   1.00 22.03  ? 155  LYS A CE  1 
ATOM   228  N  NZ  . LYS A 1 28  ? 15.243 42.699 3.049   1.00 25.49  ? 155  LYS A NZ  1 
ATOM   229  N  N   . ASP A 1 29  ? 22.227 45.741 1.207   1.00 5.94   ? 156  ASP A N   1 
ATOM   230  C  CA  . ASP A 1 29  ? 23.563 45.310 0.741   1.00 9.46   ? 156  ASP A CA  1 
ATOM   231  C  C   . ASP A 1 29  ? 24.618 46.255 1.282   1.00 13.11  ? 156  ASP A C   1 
ATOM   232  O  O   . ASP A 1 29  ? 25.692 45.828 1.740   1.00 11.03  ? 156  ASP A O   1 
ATOM   233  C  CB  . ASP A 1 29  ? 23.584 45.288 -0.765  1.00 10.67  ? 156  ASP A CB  1 
ATOM   234  C  CG  . ASP A 1 29  ? 24.878 44.907 -1.438  1.00 17.53  ? 156  ASP A CG  1 
ATOM   235  O  OD1 . ASP A 1 29  ? 25.141 43.682 -1.341  1.00 23.02  ? 156  ASP A OD1 1 
ATOM   236  O  OD2 . ASP A 1 29  ? 25.594 45.730 -2.054  1.00 19.28  ? 156  ASP A OD2 1 
ATOM   237  N  N   . VAL A 1 30  ? 24.386 47.558 1.254   1.00 6.60   ? 157  VAL A N   1 
ATOM   238  C  CA  . VAL A 1 30  ? 25.322 48.514 1.823   1.00 6.38   ? 157  VAL A CA  1 
ATOM   239  C  C   . VAL A 1 30  ? 25.526 48.211 3.290   1.00 8.77   ? 157  VAL A C   1 
ATOM   240  O  O   . VAL A 1 30  ? 26.685 48.175 3.789   1.00 8.56   ? 157  VAL A O   1 
ATOM   241  C  CB  . VAL A 1 30  ? 24.825 49.973 1.707   1.00 6.48   ? 157  VAL A CB  1 
ATOM   242  C  CG1 . VAL A 1 30  ? 25.740 50.953 2.426   1.00 9.47   ? 157  VAL A CG1 1 
ATOM   243  C  CG2 . VAL A 1 30  ? 24.732 50.375 0.248   1.00 8.34   ? 157  VAL A CG2 1 
ATOM   244  N  N   . MET A 1 31  ? 24.468 48.000 4.067   1.00 6.87   ? 158  MET A N   1 
ATOM   245  C  CA  . MET A 1 31  ? 24.588 47.709 5.482   1.00 6.58   ? 158  MET A CA  1 
ATOM   246  C  C   . MET A 1 31  ? 25.354 46.411 5.789   1.00 8.85   ? 158  MET A C   1 
ATOM   247  O  O   . MET A 1 31  ? 26.146 46.394 6.745   1.00 9.82   ? 158  MET A O   1 
ATOM   248  C  CB  . MET A 1 31  ? 23.194 47.623 6.132   1.00 8.19   ? 158  MET A CB  1 
ATOM   249  C  CG  . MET A 1 31  ? 22.625 49.050 6.273   1.00 7.27   ? 158  MET A CG  1 
ATOM   250  S  SD  . MET A 1 31  ? 21.039 49.032 7.122   1.00 16.16  ? 158  MET A SD  1 
ATOM   251  C  CE  . MET A 1 31  ? 19.959 48.610 5.829   1.00 16.00  ? 158  MET A CE  1 
ATOM   252  N  N   . LYS A 1 32  ? 25.087 45.364 5.026   1.00 8.31   ? 159  LYS A N   1 
ATOM   253  C  CA  . LYS A 1 32  ? 25.772 44.085 5.252   1.00 7.32   ? 159  LYS A CA  1 
ATOM   254  C  C   . LYS A 1 32  ? 27.246 44.254 4.982   1.00 11.04  ? 159  LYS A C   1 
ATOM   255  O  O   . LYS A 1 32  ? 28.076 43.736 5.746   1.00 11.57  ? 159  LYS A O   1 
ATOM   256  C  CB  . LYS A 1 32  ? 25.157 42.992 4.390   1.00 9.00   ? 159  LYS A CB  1 
ATOM   257  C  CG  . LYS A 1 32  ? 23.756 42.597 4.824   1.00 9.95   ? 159  LYS A CG  1 
ATOM   258  C  CD  . LYS A 1 32  ? 23.149 41.533 3.910   1.00 15.97  ? 159  LYS A CD  1 
ATOM   259  C  CE  . LYS A 1 32  ? 21.772 41.089 4.373   1.00 29.67  ? 159  LYS A CE  1 
ATOM   260  N  NZ  . LYS A 1 32  ? 20.998 40.249 3.416   1.00 26.51  ? 159  LYS A NZ  1 
ATOM   261  N  N   . LYS A 1 33  ? 27.597 44.955 3.924   1.00 9.04   ? 160  LYS A N   1 
ATOM   262  C  CA  . LYS A 1 33  ? 29.010 45.126 3.593   1.00 10.34  ? 160  LYS A CA  1 
ATOM   263  C  C   . LYS A 1 33  ? 29.697 45.988 4.631   1.00 12.81  ? 160  LYS A C   1 
ATOM   264  O  O   . LYS A 1 33  ? 30.893 45.808 4.907   1.00 14.04  ? 160  LYS A O   1 
ATOM   265  C  CB  . LYS A 1 33  ? 29.177 45.674 2.181   1.00 13.45  ? 160  LYS A CB  1 
ATOM   266  C  CG  . LYS A 1 33  ? 28.946 44.660 1.083   1.00 17.94  ? 160  LYS A CG  1 
ATOM   267  C  CD  . LYS A 1 33  ? 28.570 45.274 -0.242  1.00 16.92  ? 160  LYS A CD  1 
ATOM   268  C  CE  . LYS A 1 33  ? 28.628 44.300 -1.408  1.00 18.74  ? 160  LYS A CE  1 
ATOM   269  N  NZ  . LYS A 1 33  ? 28.031 44.931 -2.625  1.00 20.86  ? 160  LYS A NZ  1 
ATOM   270  N  N   . CYS A 1 34  ? 28.970 46.907 5.259   1.00 10.93  ? 161  CYS A N   1 
ATOM   271  C  CA  . CYS A 1 34  ? 29.556 47.871 6.181   1.00 12.30  ? 161  CYS A CA  1 
ATOM   272  C  C   . CYS A 1 34  ? 29.271 47.497 7.613   1.00 17.25  ? 161  CYS A C   1 
ATOM   273  O  O   . CYS A 1 34  ? 29.325 48.329 8.513   1.00 22.94  ? 161  CYS A O   1 
ATOM   274  C  CB  . CYS A 1 34  ? 29.062 49.275 5.802   1.00 14.36  ? 161  CYS A CB  1 
ATOM   275  S  SG  . CYS A 1 34  ? 30.223 50.261 4.803   1.00 19.65  ? 161  CYS A SG  1 
ATOM   276  N  N   . SER A 1 35  ? 28.938 46.207 7.816   1.00 17.40  ? 162  SER A N   1 
ATOM   277  C  CA  . SER A 1 35  ? 28.531 45.825 9.170   1.00 18.38  ? 162  SER A CA  1 
ATOM   278  C  C   . SER A 1 35  ? 29.704 45.530 10.109  1.00 20.71  ? 162  SER A C   1 
ATOM   279  O  O   . SER A 1 35  ? 30.786 45.183 9.636   1.00 17.48  ? 162  SER A O   1 
ATOM   280  C  CB  . SER A 1 35  ? 27.644 44.578 9.159   1.00 24.54  ? 162  SER A CB  1 
ATOM   281  O  OG  . SER A 1 35  ? 28.423 43.496 8.684   1.00 25.22  ? 162  SER A OG  1 
ATOM   282  N  N   . ASN A 1 36  ? 29.390 45.671 11.391  1.00 20.69  ? 163  ASN A N   1 
ATOM   283  C  CA  . ASN A 1 36  ? 30.410 45.504 12.431  1.00 31.02  ? 163  ASN A CA  1 
ATOM   284  C  C   . ASN A 1 36  ? 31.551 46.488 12.184  1.00 36.73  ? 163  ASN A C   1 
ATOM   285  O  O   . ASN A 1 36  ? 32.725 46.139 12.346  1.00 28.60  ? 163  ASN A O   1 
ATOM   286  C  CB  . ASN A 1 36  ? 30.896 44.057 12.455  1.00 24.55  ? 163  ASN A CB  1 
ATOM   287  C  CG  . ASN A 1 36  ? 31.874 43.693 13.543  1.00 39.23  ? 163  ASN A CG  1 
ATOM   288  O  OD1 . ASN A 1 36  ? 32.680 42.770 13.374  1.00 49.66  ? 163  ASN A OD1 1 
ATOM   289  N  ND2 . ASN A 1 36  ? 31.856 44.375 14.683  1.00 47.01  ? 163  ASN A ND2 1 
ATOM   290  N  N   . THR A 1 37  ? 31.194 47.711 11.783  1.00 25.40  ? 164  THR A N   1 
ATOM   291  C  CA  . THR A 1 37  ? 32.177 48.774 11.564  1.00 25.80  ? 164  THR A CA  1 
ATOM   292  C  C   . THR A 1 37  ? 31.753 49.953 12.455  1.00 16.75  ? 164  THR A C   1 
ATOM   293  O  O   . THR A 1 37  ? 30.872 49.822 13.305  1.00 24.74  ? 164  THR A O   1 
ATOM   294  C  CB  . THR A 1 37  ? 32.406 49.183 10.095  1.00 39.05  ? 164  THR A CB  1 
ATOM   295  O  OG1 . THR A 1 37  ? 31.206 49.576 9.406   1.00 36.75  ? 164  THR A OG1 1 
ATOM   296  C  CG2 . THR A 1 37  ? 32.972 48.012 9.292   1.00 45.61  ? 164  THR A CG2 1 
ATOM   297  N  N   . SER A 1 38  ? 32.369 51.113 12.311  1.00 16.53  ? 165  SER A N   1 
ATOM   298  C  CA  . SER A 1 38  ? 32.034 52.272 13.111  1.00 13.09  ? 165  SER A CA  1 
ATOM   299  C  C   . SER A 1 38  ? 30.817 52.994 12.542  1.00 9.37   ? 165  SER A C   1 
ATOM   300  O  O   . SER A 1 38  ? 30.431 54.060 12.988  1.00 12.19  ? 165  SER A O   1 
ATOM   301  C  CB  . SER A 1 38  ? 33.248 53.201 13.060  1.00 29.05  ? 165  SER A CB  1 
ATOM   302  O  OG  . SER A 1 38  ? 33.351 53.675 11.706  1.00 30.98  ? 165  SER A OG  1 
ATOM   303  N  N   . TYR A 1 39  ? 30.232 52.401 11.534  1.00 9.50   ? 166  TYR A N   1 
ATOM   304  C  CA  . TYR A 1 39  ? 29.001 52.903 10.909  1.00 7.29   ? 166  TYR A CA  1 
ATOM   305  C  C   . TYR A 1 39  ? 27.782 52.474 11.674  1.00 9.76   ? 166  TYR A C   1 
ATOM   306  O  O   . TYR A 1 39  ? 27.630 51.330 12.071  1.00 10.54  ? 166  TYR A O   1 
ATOM   307  C  CB  . TYR A 1 39  ? 28.916 52.381 9.469   1.00 8.59   ? 166  TYR A CB  1 
ATOM   308  C  CG  . TYR A 1 39  ? 29.732 53.189 8.498   1.00 9.92   ? 166  TYR A CG  1 
ATOM   309  C  CD1 . TYR A 1 39  ? 31.118 53.225 8.648   1.00 13.11  ? 166  TYR A CD1 1 
ATOM   310  C  CD2 . TYR A 1 39  ? 29.165 53.912 7.451   1.00 14.54  ? 166  TYR A CD2 1 
ATOM   311  C  CE1 . TYR A 1 39  ? 31.842 53.970 7.747   1.00 13.25  ? 166  TYR A CE1 1 
ATOM   312  C  CE2 . TYR A 1 39  ? 29.907 54.672 6.552   1.00 17.96  ? 166  TYR A CE2 1 
ATOM   313  C  CZ  . TYR A 1 39  ? 31.289 54.677 6.729   1.00 12.60  ? 166  TYR A CZ  1 
ATOM   314  O  OH  . TYR A 1 39  ? 32.054 55.421 5.870   1.00 17.76  ? 166  TYR A OH  1 
ATOM   315  N  N   . GLN A 1 40  ? 26.878 53.432 11.896  1.00 8.80   ? 167  GLN A N   1 
ATOM   316  C  CA  . GLN A 1 40  ? 25.553 53.061 12.382  1.00 6.03   ? 167  GLN A CA  1 
ATOM   317  C  C   . GLN A 1 40  ? 24.538 53.696 11.419  1.00 5.64   ? 167  GLN A C   1 
ATOM   318  O  O   . GLN A 1 40  ? 24.848 54.710 10.786  1.00 5.76   ? 167  GLN A O   1 
ATOM   319  C  CB  . GLN A 1 40  ? 25.367 53.431 13.836  1.00 11.06  ? 167  GLN A CB  1 
ATOM   320  C  CG  . GLN A 1 40  ? 26.395 52.636 14.659  1.00 17.56  ? 167  GLN A CG  1 
ATOM   321  C  CD  . GLN A 1 40  ? 26.205 52.801 16.155  1.00 27.22  ? 167  GLN A CD  1 
ATOM   322  O  OE1 . GLN A 1 40  ? 25.547 53.727 16.633  1.00 21.39  ? 167  GLN A OE1 1 
ATOM   323  N  NE2 . GLN A 1 40  ? 26.836 51.859 16.851  1.00 19.15  ? 167  GLN A NE2 1 
ATOM   324  N  N   . PHE A 1 41  ? 23.388 53.076 11.239  1.00 6.14   ? 168  PHE A N   1 
ATOM   325  C  CA  . PHE A 1 41  ? 22.438 53.393 10.207  1.00 5.42   ? 168  PHE A CA  1 
ATOM   326  C  C   . PHE A 1 41  ? 21.036 53.692 10.750  1.00 5.14   ? 168  PHE A C   1 
ATOM   327  O  O   . PHE A 1 41  ? 20.598 53.211 11.787  1.00 5.76   ? 168  PHE A O   1 
ATOM   328  C  CB  . PHE A 1 41  ? 22.300 52.206 9.236   1.00 5.83   ? 168  PHE A CB  1 
ATOM   329  C  CG  . PHE A 1 41  ? 23.581 51.873 8.538   1.00 6.87   ? 168  PHE A CG  1 
ATOM   330  C  CD1 . PHE A 1 41  ? 23.892 52.536 7.363   1.00 8.82   ? 168  PHE A CD1 1 
ATOM   331  C  CD2 . PHE A 1 41  ? 24.462 50.908 9.037   1.00 7.52   ? 168  PHE A CD2 1 
ATOM   332  C  CE1 . PHE A 1 41  ? 25.065 52.271 6.695   1.00 6.69   ? 168  PHE A CE1 1 
ATOM   333  C  CE2 . PHE A 1 41  ? 25.654 50.693 8.351   1.00 8.36   ? 168  PHE A CE2 1 
ATOM   334  C  CZ  . PHE A 1 41  ? 25.947 51.340 7.189   1.00 6.76   ? 168  PHE A CZ  1 
ATOM   335  N  N   . ALA A 1 42  ? 20.338 54.500 9.956   1.00 4.48   ? 169  ALA A N   1 
ATOM   336  C  CA  . ALA A 1 42  ? 18.900 54.723 10.071  1.00 4.91   ? 169  ALA A CA  1 
ATOM   337  C  C   . ALA A 1 42  ? 18.327 54.809 8.657   1.00 5.13   ? 169  ALA A C   1 
ATOM   338  O  O   . ALA A 1 42  ? 19.056 55.116 7.717   1.00 4.11   ? 169  ALA A O   1 
ATOM   339  C  CB  . ALA A 1 42  ? 18.546 56.005 10.779  1.00 6.31   ? 169  ALA A CB  1 
ATOM   340  N  N   . ALA A 1 43  ? 17.039 54.551 8.499   1.00 4.75   ? 170  ALA A N   1 
ATOM   341  C  CA  . ALA A 1 43  ? 16.430 54.662 7.179   1.00 4.20   ? 170  ALA A CA  1 
ATOM   342  C  C   . ALA A 1 43  ? 15.051 55.332 7.306   1.00 4.67   ? 170  ALA A C   1 
ATOM   343  O  O   . ALA A 1 43  ? 14.302 55.019 8.243   1.00 4.53   ? 170  ALA A O   1 
ATOM   344  C  CB  . ALA A 1 43  ? 16.265 53.337 6.484   1.00 5.54   ? 170  ALA A CB  1 
ATOM   345  N  N   . VAL A 1 44  ? 14.817 56.219 6.353   1.00 3.10   ? 171  VAL A N   1 
ATOM   346  C  CA  . VAL A 1 44  ? 13.598 57.000 6.291   1.00 3.80   ? 171  VAL A CA  1 
ATOM   347  C  C   . VAL A 1 44  ? 12.999 56.869 4.897   1.00 3.09   ? 171  VAL A C   1 
ATOM   348  O  O   . VAL A 1 44  ? 13.674 57.146 3.914   1.00 2.71   ? 171  VAL A O   1 
ATOM   349  C  CB  . VAL A 1 44  ? 13.901 58.485 6.553   1.00 4.72   ? 171  VAL A CB  1 
ATOM   350  C  CG1 . VAL A 1 44  ? 12.644 59.325 6.434   1.00 4.49   ? 171  VAL A CG1 1 
ATOM   351  C  CG2 . VAL A 1 44  ? 14.533 58.737 7.936   1.00 6.75   ? 171  VAL A CG2 1 
ATOM   352  N  N   . GLN A 1 45  ? 11.723 56.446 4.819   1.00 3.02   ? 172  GLN A N   1 
ATOM   353  C  CA  . GLN A 1 45  ? 11.015 56.425 3.551   1.00 2.31   ? 172  GLN A CA  1 
ATOM   354  C  C   . GLN A 1 45  ? 10.333 57.777 3.369   1.00 3.73   ? 172  GLN A C   1 
ATOM   355  O  O   . GLN A 1 45  ? 9.751  58.294 4.335   1.00 4.79   ? 172  GLN A O   1 
ATOM   356  C  CB  . GLN A 1 45  ? 9.959  55.303 3.485   1.00 1.78   ? 172  GLN A CB  1 
ATOM   357  C  CG  . GLN A 1 45  ? 9.333  55.151 2.111   1.00 3.04   ? 172  GLN A CG  1 
ATOM   358  C  CD  . GLN A 1 45  ? 8.169  54.208 1.985   1.00 3.57   ? 172  GLN A CD  1 
ATOM   359  O  OE1 . GLN A 1 45  ? 7.570  54.167 0.910   1.00 4.98   ? 172  GLN A OE1 1 
ATOM   360  N  NE2 . GLN A 1 45  ? 7.887  53.459 3.055   1.00 5.42   ? 172  GLN A NE2 1 
ATOM   361  N  N   . PHE A 1 46  ? 10.356 58.364 2.181   1.00 3.42   ? 173  PHE A N   1 
ATOM   362  C  CA  . PHE A 1 46  ? 9.592  59.571 1.921   1.00 1.77   ? 173  PHE A CA  1 
ATOM   363  C  C   . PHE A 1 46  ? 8.802  59.450 0.632   1.00 3.51   ? 173  PHE A C   1 
ATOM   364  O  O   . PHE A 1 46  ? 9.241  58.837 -0.337  1.00 4.05   ? 173  PHE A O   1 
ATOM   365  C  CB  . PHE A 1 46  ? 10.463 60.823 1.835   1.00 4.45   ? 173  PHE A CB  1 
ATOM   366  C  CG  . PHE A 1 46  ? 11.309 61.007 0.591   1.00 2.67   ? 173  PHE A CG  1 
ATOM   367  C  CD1 . PHE A 1 46  ? 12.469 60.286 0.387   1.00 2.95   ? 173  PHE A CD1 1 
ATOM   368  C  CD2 . PHE A 1 46  ? 10.936 61.889 -0.421  1.00 3.80   ? 173  PHE A CD2 1 
ATOM   369  C  CE1 . PHE A 1 46  ? 13.200 60.444 -0.767  1.00 5.07   ? 173  PHE A CE1 1 
ATOM   370  C  CE2 . PHE A 1 46  ? 11.670 62.085 -1.559  1.00 5.31   ? 173  PHE A CE2 1 
ATOM   371  C  CZ  . PHE A 1 46  ? 12.824 61.367 -1.719  1.00 5.15   ? 173  PHE A CZ  1 
ATOM   372  N  N   . SER A 1 47  ? 7.613  60.085 0.668   1.00 3.03   ? 174  SER A N   1 
ATOM   373  C  CA  . SER A 1 47  ? 6.819  60.193 -0.557  1.00 3.35   ? 174  SER A CA  1 
ATOM   374  C  C   . SER A 1 47  ? 6.029  61.480 -0.398  1.00 3.58   ? 174  SER A C   1 
ATOM   375  O  O   . SER A 1 47  ? 6.610  62.543 -0.605  1.00 3.87   ? 174  SER A O   1 
ATOM   376  C  CB  . SER A 1 47  ? 6.004  58.931 -0.769  1.00 4.80   ? 174  SER A CB  1 
ATOM   377  O  OG  . SER A 1 47  ? 5.296  58.954 -1.988  1.00 5.01   ? 174  SER A OG  1 
ATOM   378  N  N   . THR A 1 48  ? 4.783  61.411 0.032   1.00 4.06   ? 175  THR A N   1 
ATOM   379  C  CA  . THR A 1 48  ? 4.112  62.617 0.543   1.00 3.41   ? 175  THR A CA  1 
ATOM   380  C  C   . THR A 1 48  ? 4.568  62.951 1.938   1.00 4.88   ? 175  THR A C   1 
ATOM   381  O  O   . THR A 1 48  ? 4.874  64.123 2.208   1.00 6.71   ? 175  THR A O   1 
ATOM   382  C  CB  . THR A 1 48  ? 2.588  62.446 0.576   1.00 4.28   ? 175  THR A CB  1 
ATOM   383  O  OG1 . THR A 1 48  ? 2.209  62.454 -0.775  1.00 6.63   ? 175  THR A OG1 1 
ATOM   384  C  CG2 . THR A 1 48  ? 1.846  63.597 1.222   1.00 5.90   ? 175  THR A CG2 1 
ATOM   385  N  N   . SER A 1 49  ? 4.588  62.001 2.830   1.00 4.51   ? 176  SER A N   1 
ATOM   386  C  CA  . SER A 1 49  ? 4.980  62.056 4.197   1.00 6.98   ? 176  SER A CA  1 
ATOM   387  C  C   . SER A 1 49  ? 6.307  61.330 4.359   1.00 4.84   ? 176  SER A C   1 
ATOM   388  O  O   . SER A 1 49  ? 6.830  60.774 3.393   1.00 6.07   ? 176  SER A O   1 
ATOM   389  C  CB  . SER A 1 49  ? 3.919  61.363 5.088   1.00 15.08  ? 176  SER A CB  1 
ATOM   390  O  OG  . SER A 1 49  ? 2.727  62.126 4.895   1.00 31.62  ? 176  SER A OG  1 
ATOM   391  N  N   . TYR A 1 50  ? 6.844  61.403 5.544   1.00 6.95   ? 177  TYR A N   1 
ATOM   392  C  CA  . TYR A 1 50  ? 8.159  60.879 5.919   1.00 6.10   ? 177  TYR A CA  1 
ATOM   393  C  C   . TYR A 1 50  ? 8.007  59.917 7.067   1.00 10.18  ? 177  TYR A C   1 
ATOM   394  O  O   . TYR A 1 50  ? 7.273  60.246 8.019   1.00 12.63  ? 177  TYR A O   1 
ATOM   395  C  CB  . TYR A 1 50  ? 9.122  62.023 6.371   1.00 9.78   ? 177  TYR A CB  1 
ATOM   396  C  CG  . TYR A 1 50  ? 8.730  63.352 5.786   1.00 7.09   ? 177  TYR A CG  1 
ATOM   397  C  CD1 . TYR A 1 50  ? 8.280  64.497 6.409   1.00 15.05  ? 177  TYR A CD1 1 
ATOM   398  C  CD2 . TYR A 1 50  ? 8.826  63.364 4.412   1.00 11.59  ? 177  TYR A CD2 1 
ATOM   399  C  CE1 . TYR A 1 50  ? 7.957  65.624 5.620   1.00 16.24  ? 177  TYR A CE1 1 
ATOM   400  C  CE2 . TYR A 1 50  ? 8.504  64.409 3.630   1.00 14.34  ? 177  TYR A CE2 1 
ATOM   401  C  CZ  . TYR A 1 50  ? 8.066  65.550 4.262   1.00 12.12  ? 177  TYR A CZ  1 
ATOM   402  O  OH  . TYR A 1 50  ? 7.782  66.557 3.343   1.00 18.26  ? 177  TYR A OH  1 
ATOM   403  N  N   . LYS A 1 51  ? 8.616  58.760 7.070   1.00 6.22   ? 178  LYS A N   1 
ATOM   404  C  CA  . LYS A 1 51  ? 8.529  57.789 8.127   1.00 8.54   ? 178  LYS A CA  1 
ATOM   405  C  C   . LYS A 1 51  ? 9.920  57.219 8.439   1.00 6.28   ? 178  LYS A C   1 
ATOM   406  O  O   . LYS A 1 51  ? 10.569 56.713 7.524   1.00 5.54   ? 178  LYS A O   1 
ATOM   407  C  CB  . LYS A 1 51  ? 7.597  56.641 7.736   1.00 7.62   ? 178  LYS A CB  1 
ATOM   408  C  CG  . LYS A 1 51  ? 7.434  55.609 8.848   1.00 11.45  ? 178  LYS A CG  1 
ATOM   409  C  CD  . LYS A 1 51  ? 6.441  54.544 8.437   1.00 13.76  ? 178  LYS A CD  1 
ATOM   410  C  CE  . LYS A 1 51  ? 6.142  53.672 9.648   1.00 34.33  ? 178  LYS A CE  1 
ATOM   411  N  NZ  . LYS A 1 51  ? 7.153  52.627 9.895   1.00 24.17  ? 178  LYS A NZ  1 
ATOM   412  N  N   . THR A 1 52  ? 10.355 57.328 9.666   1.00 6.47   ? 179  THR A N   1 
ATOM   413  C  CA  . THR A 1 52  ? 11.593 56.639 10.045  1.00 5.05   ? 179  THR A CA  1 
ATOM   414  C  C   . THR A 1 52  ? 11.280 55.168 10.183  1.00 5.98   ? 179  THR A C   1 
ATOM   415  O  O   . THR A 1 52  ? 10.486 54.748 11.070  1.00 8.56   ? 179  THR A O   1 
ATOM   416  C  CB  . THR A 1 52  ? 12.116 57.193 11.355  1.00 6.12   ? 179  THR A CB  1 
ATOM   417  O  OG1 . THR A 1 52  ? 12.408 58.582 11.160  1.00 9.43   ? 179  THR A OG1 1 
ATOM   418  C  CG2 . THR A 1 52  ? 13.412 56.489 11.698  1.00 9.62   ? 179  THR A CG2 1 
ATOM   419  N  N   . GLU A 1 53  ? 11.784 54.379 9.279   1.00 4.86   ? 180  GLU A N   1 
ATOM   420  C  CA  . GLU A 1 53  ? 11.508 52.932 9.234   1.00 4.17   ? 180  GLU A CA  1 
ATOM   421  C  C   . GLU A 1 53  ? 12.307 52.211 10.304  1.00 7.36   ? 180  GLU A C   1 
ATOM   422  O  O   . GLU A 1 53  ? 11.826 51.235 10.933  1.00 8.05   ? 180  GLU A O   1 
ATOM   423  C  CB  . GLU A 1 53  ? 11.756 52.402 7.840   1.00 6.66   ? 180  GLU A CB  1 
ATOM   424  C  CG  . GLU A 1 53  ? 10.890 53.019 6.742   1.00 6.63   ? 180  GLU A CG  1 
ATOM   425  C  CD  . GLU A 1 53  ? 9.417  52.659 6.737   1.00 10.24  ? 180  GLU A CD  1 
ATOM   426  O  OE1 . GLU A 1 53  ? 8.987  51.935 7.694   1.00 9.30   ? 180  GLU A OE1 1 
ATOM   427  O  OE2 . GLU A 1 53  ? 8.714  53.062 5.773   1.00 8.20   ? 180  GLU A OE2 1 
ATOM   428  N  N   . PHE A 1 54  ? 13.548 52.651 10.587  1.00 5.14   ? 181  PHE A N   1 
ATOM   429  C  CA  . PHE A 1 54  ? 14.326 52.192 11.733  1.00 6.96   ? 181  PHE A CA  1 
ATOM   430  C  C   . PHE A 1 54  ? 15.307 53.312 12.075  1.00 6.55   ? 181  PHE A C   1 
ATOM   431  O  O   . PHE A 1 54  ? 15.755 53.997 11.125  1.00 5.70   ? 181  PHE A O   1 
ATOM   432  C  CB  . PHE A 1 54  ? 15.038 50.879 11.511  1.00 5.72   ? 181  PHE A CB  1 
ATOM   433  C  CG  . PHE A 1 54  ? 16.187 50.844 10.528  1.00 4.59   ? 181  PHE A CG  1 
ATOM   434  C  CD1 . PHE A 1 54  ? 17.481 51.153 10.934  1.00 5.88   ? 181  PHE A CD1 1 
ATOM   435  C  CD2 . PHE A 1 54  ? 16.006 50.524 9.200   1.00 6.30   ? 181  PHE A CD2 1 
ATOM   436  C  CE1 . PHE A 1 54  ? 18.539 51.136 10.061  1.00 5.12   ? 181  PHE A CE1 1 
ATOM   437  C  CE2 . PHE A 1 54  ? 17.062 50.482 8.324   1.00 6.74   ? 181  PHE A CE2 1 
ATOM   438  C  CZ  . PHE A 1 54  ? 18.341 50.800 8.733   1.00 6.67   ? 181  PHE A CZ  1 
ATOM   439  N  N   . ASP A 1 55  ? 15.595 53.474 13.356  1.00 7.06   ? 182  ASP A N   1 
ATOM   440  C  CA  . ASP A 1 55  ? 16.542 54.494 13.773  1.00 7.44   ? 182  ASP A CA  1 
ATOM   441  C  C   . ASP A 1 55  ? 17.858 53.856 14.250  1.00 8.43   ? 182  ASP A C   1 
ATOM   442  O  O   . ASP A 1 55  ? 18.023 52.655 14.165  1.00 6.76   ? 182  ASP A O   1 
ATOM   443  C  CB  . ASP A 1 55  ? 15.947 55.400 14.824  1.00 8.63   ? 182  ASP A CB  1 
ATOM   444  C  CG  . ASP A 1 55  ? 15.542 54.710 16.102  1.00 14.24  ? 182  ASP A CG  1 
ATOM   445  O  OD1 . ASP A 1 55  ? 16.194 53.733 16.482  1.00 12.38  ? 182  ASP A OD1 1 
ATOM   446  O  OD2 . ASP A 1 55  ? 14.591 55.229 16.731  1.00 21.60  ? 182  ASP A OD2 1 
ATOM   447  N  N   . PHE A 1 56  ? 18.791 54.717 14.696  1.00 5.91   ? 183  PHE A N   1 
ATOM   448  C  CA  . PHE A 1 56  ? 20.120 54.247 15.050  1.00 6.53   ? 183  PHE A CA  1 
ATOM   449  C  C   . PHE A 1 56  ? 20.050 53.293 16.252  1.00 6.93   ? 183  PHE A C   1 
ATOM   450  O  O   . PHE A 1 56  ? 20.790 52.332 16.317  1.00 9.26   ? 183  PHE A O   1 
ATOM   451  C  CB  . PHE A 1 56  ? 21.055 55.419 15.329  1.00 6.62   ? 183  PHE A CB  1 
ATOM   452  C  CG  . PHE A 1 56  ? 21.216 56.406 14.191  1.00 5.11   ? 183  PHE A CG  1 
ATOM   453  C  CD1 . PHE A 1 56  ? 21.977 56.077 13.084  1.00 5.62   ? 183  PHE A CD1 1 
ATOM   454  C  CD2 . PHE A 1 56  ? 20.606 57.652 14.223  1.00 8.87   ? 183  PHE A CD2 1 
ATOM   455  C  CE1 . PHE A 1 56  ? 22.110 56.961 12.030  1.00 6.76   ? 183  PHE A CE1 1 
ATOM   456  C  CE2 . PHE A 1 56  ? 20.741 58.582 13.196  1.00 6.34   ? 183  PHE A CE2 1 
ATOM   457  C  CZ  . PHE A 1 56  ? 21.511 58.214 12.111  1.00 7.05   ? 183  PHE A CZ  1 
ATOM   458  N  N   . SER A 1 57  ? 19.122 53.625 17.164  1.00 9.27   ? 184  SER A N   1 
ATOM   459  C  CA  . SER A 1 57  ? 18.972 52.709 18.310  1.00 9.01   ? 184  SER A CA  1 
ATOM   460  C  C   . SER A 1 57  ? 18.531 51.334 17.890  1.00 9.76   ? 184  SER A C   1 
ATOM   461  O  O   . SER A 1 57  ? 18.997 50.309 18.403  1.00 12.10  ? 184  SER A O   1 
ATOM   462  C  CB  . SER A 1 57  ? 17.961 53.319 19.282  1.00 14.57  ? 184  SER A CB  1 
ATOM   463  O  OG  . SER A 1 57  ? 18.410 54.516 19.883  1.00 15.49  ? 184  SER A OG  1 
ATOM   464  N  N   . ASP A 1 58  ? 17.625 51.309 16.908  1.00 9.45   ? 185  ASP A N   1 
ATOM   465  C  CA  . ASP A 1 58  ? 17.180 50.028 16.377  1.00 7.52   ? 185  ASP A CA  1 
ATOM   466  C  C   . ASP A 1 58  ? 18.285 49.241 15.710  1.00 8.31   ? 185  ASP A C   1 
ATOM   467  O  O   . ASP A 1 58  ? 18.436 48.030 15.832  1.00 9.95   ? 185  ASP A O   1 
ATOM   468  C  CB  . ASP A 1 58  ? 16.092 50.230 15.322  1.00 9.73   ? 185  ASP A CB  1 
ATOM   469  C  CG  . ASP A 1 58  ? 14.816 50.868 15.801  1.00 11.64  ? 185  ASP A CG  1 
ATOM   470  O  OD1 . ASP A 1 58  ? 14.347 50.636 16.949  1.00 14.36  ? 185  ASP A OD1 1 
ATOM   471  O  OD2 . ASP A 1 58  ? 14.217 51.637 15.022  1.00 11.09  ? 185  ASP A OD2 1 
ATOM   472  N  N   . TYR A 1 59  ? 19.079 49.988 14.909  1.00 7.93   ? 186  TYR A N   1 
ATOM   473  C  CA  . TYR A 1 59  ? 20.240 49.393 14.270  1.00 9.84   ? 186  TYR A CA  1 
ATOM   474  C  C   . TYR A 1 59  ? 21.178 48.737 15.295  1.00 11.43  ? 186  TYR A C   1 
ATOM   475  O  O   . TYR A 1 59  ? 21.572 47.606 15.036  1.00 12.39  ? 186  TYR A O   1 
ATOM   476  C  CB  . TYR A 1 59  ? 21.065 50.435 13.452  1.00 8.25   ? 186  TYR A CB  1 
ATOM   477  C  CG  . TYR A 1 59  ? 22.263 49.777 12.835  1.00 7.50   ? 186  TYR A CG  1 
ATOM   478  C  CD1 . TYR A 1 59  ? 22.089 48.977 11.713  1.00 9.76   ? 186  TYR A CD1 1 
ATOM   479  C  CD2 . TYR A 1 59  ? 23.552 49.890 13.357  1.00 8.80   ? 186  TYR A CD2 1 
ATOM   480  C  CE1 . TYR A 1 59  ? 23.104 48.319 11.082  1.00 12.59  ? 186  TYR A CE1 1 
ATOM   481  C  CE2 . TYR A 1 59  ? 24.595 49.236 12.755  1.00 11.30  ? 186  TYR A CE2 1 
ATOM   482  C  CZ  . TYR A 1 59  ? 24.373 48.469 11.637  1.00 16.60  ? 186  TYR A CZ  1 
ATOM   483  O  OH  . TYR A 1 59  ? 25.405 47.810 11.014  1.00 14.88  ? 186  TYR A OH  1 
ATOM   484  N  N   . VAL A 1 60  ? 21.526 49.467 16.339  1.00 9.61   ? 187  VAL A N   1 
ATOM   485  C  CA  . VAL A 1 60  ? 22.488 48.905 17.321  1.00 10.91  ? 187  VAL A CA  1 
ATOM   486  C  C   . VAL A 1 60  ? 21.916 47.657 17.960  1.00 16.53  ? 187  VAL A C   1 
ATOM   487  O  O   . VAL A 1 60  ? 22.658 46.707 18.164  1.00 18.36  ? 187  VAL A O   1 
ATOM   488  C  CB  . VAL A 1 60  ? 22.805 49.966 18.381  1.00 13.61  ? 187  VAL A CB  1 
ATOM   489  C  CG1 . VAL A 1 60  ? 23.613 49.433 19.548  1.00 23.47  ? 187  VAL A CG1 1 
ATOM   490  C  CG2 . VAL A 1 60  ? 23.531 51.137 17.715  1.00 16.11  ? 187  VAL A CG2 1 
ATOM   491  N  N   . LYS A 1 61  ? 20.622 47.674 18.277  1.00 14.33  ? 188  LYS A N   1 
ATOM   492  C  CA  . LYS A 1 61  ? 19.954 46.521 18.891  1.00 15.18  ? 188  LYS A CA  1 
ATOM   493  C  C   . LYS A 1 61  ? 19.912 45.296 18.001  1.00 24.16  ? 188  LYS A C   1 
ATOM   494  O  O   . LYS A 1 61  ? 20.318 44.185 18.383  1.00 19.74  ? 188  LYS A O   1 
ATOM   495  C  CB  . LYS A 1 61  ? 18.512 46.873 19.283  1.00 18.38  ? 188  LYS A CB  1 
ATOM   496  C  CG  . LYS A 1 61  ? 17.860 45.686 20.015  1.00 21.00  ? 188  LYS A CG  1 
ATOM   497  C  CD  . LYS A 1 61  ? 16.523 46.044 20.625  1.00 28.29  ? 188  LYS A CD  1 
ATOM   498  C  CE  . LYS A 1 61  ? 15.728 44.860 21.156  1.00 26.11  ? 188  LYS A CE  1 
ATOM   499  N  NZ  . LYS A 1 61  ? 16.485 43.995 22.091  1.00 26.87  ? 188  LYS A NZ  1 
ATOM   500  N  N   . ARG A 1 62  ? 19.399 45.451 16.778  1.00 16.74  ? 189  ARG A N   1 
ATOM   501  C  CA  . ARG A 1 62  ? 19.200 44.248 15.972  1.00 16.57  ? 189  ARG A CA  1 
ATOM   502  C  C   . ARG A 1 62  ? 20.304 43.960 14.961  1.00 23.97  ? 189  ARG A C   1 
ATOM   503  O  O   . ARG A 1 62  ? 20.482 42.760 14.680  1.00 18.45  ? 189  ARG A O   1 
ATOM   504  C  CB  . ARG A 1 62  ? 17.839 44.271 15.286  1.00 26.12  ? 189  ARG A CB  1 
ATOM   505  C  CG  . ARG A 1 62  ? 16.728 45.169 15.660  1.00 27.70  ? 189  ARG A CG  1 
ATOM   506  C  CD  . ARG A 1 62  ? 15.967 45.094 16.922  1.00 35.63  ? 189  ARG A CD  1 
ATOM   507  N  NE  . ARG A 1 62  ? 14.916 44.146 17.131  1.00 52.87  ? 189  ARG A NE  1 
ATOM   508  C  CZ  . ARG A 1 62  ? 14.831 43.167 18.015  1.00 70.18  ? 189  ARG A CZ  1 
ATOM   509  N  NH1 . ARG A 1 62  ? 15.774 42.875 18.905  1.00 82.79  ? 189  ARG A NH1 1 
ATOM   510  N  NH2 . ARG A 1 62  ? 13.744 42.400 18.035  1.00 102.22 ? 189  ARG A NH2 1 
ATOM   511  N  N   . LYS A 1 63  ? 21.010 44.939 14.406  1.00 16.55  ? 190  LYS A N   1 
ATOM   512  C  CA  . LYS A 1 63  ? 22.112 44.693 13.486  1.00 23.76  ? 190  LYS A CA  1 
ATOM   513  C  C   . LYS A 1 63  ? 21.827 43.658 12.404  1.00 27.93  ? 190  LYS A C   1 
ATOM   514  O  O   . LYS A 1 63  ? 22.715 42.872 12.071  1.00 25.35  ? 190  LYS A O   1 
ATOM   515  C  CB  . LYS A 1 63  ? 23.314 44.218 14.318  1.00 33.83  ? 190  LYS A CB  1 
ATOM   516  C  CG  . LYS A 1 63  ? 23.550 45.096 15.538  1.00 39.65  ? 190  LYS A CG  1 
ATOM   517  C  CD  . LYS A 1 63  ? 25.035 45.235 15.853  1.00 50.29  ? 190  LYS A CD  1 
ATOM   518  C  CE  . LYS A 1 63  ? 25.308 46.411 16.784  1.00 45.95  ? 190  LYS A CE  1 
ATOM   519  N  NZ  . LYS A 1 63  ? 25.067 46.053 18.208  1.00 41.43  ? 190  LYS A NZ  1 
ATOM   520  N  N   . ASP A 1 64  ? 20.602 43.650 11.904  1.00 15.00  ? 191  ASP A N   1 
ATOM   521  C  CA  . ASP A 1 64  ? 20.113 42.749 10.884  1.00 11.49  ? 191  ASP A CA  1 
ATOM   522  C  C   . ASP A 1 64  ? 19.283 43.582 9.899   1.00 10.02  ? 191  ASP A C   1 
ATOM   523  O  O   . ASP A 1 64  ? 18.144 43.903 10.198  1.00 11.81  ? 191  ASP A O   1 
ATOM   524  C  CB  . ASP A 1 64  ? 19.298 41.622 11.456  1.00 19.59  ? 191  ASP A CB  1 
ATOM   525  C  CG  . ASP A 1 64  ? 18.629 40.678 10.492  1.00 12.34  ? 191  ASP A CG  1 
ATOM   526  O  OD1 . ASP A 1 64  ? 18.706 40.822 9.256   1.00 19.43  ? 191  ASP A OD1 1 
ATOM   527  O  OD2 . ASP A 1 64  ? 17.997 39.728 11.025  1.00 32.90  ? 191  ASP A OD2 1 
ATOM   528  N  N   . PRO A 1 65  ? 19.869 43.910 8.769   1.00 13.23  ? 192  PRO A N   1 
ATOM   529  C  CA  . PRO A 1 65  ? 19.140 44.785 7.827   1.00 11.07  ? 192  PRO A CA  1 
ATOM   530  C  C   . PRO A 1 65  ? 17.853 44.156 7.363   1.00 13.30  ? 192  PRO A C   1 
ATOM   531  O  O   . PRO A 1 65  ? 16.872 44.867 7.203   1.00 12.68  ? 192  PRO A O   1 
ATOM   532  C  CB  . PRO A 1 65  ? 20.147 44.957 6.695   1.00 15.17  ? 192  PRO A CB  1 
ATOM   533  C  CG  . PRO A 1 65  ? 21.471 44.760 7.371   1.00 14.47  ? 192  PRO A CG  1 
ATOM   534  C  CD  . PRO A 1 65  ? 21.217 43.593 8.275   1.00 14.32  ? 192  PRO A CD  1 
ATOM   535  N  N   . ASP A 1 66  ? 17.774 42.836 7.192   1.00 15.13  ? 193  ASP A N   1 
ATOM   536  C  CA  . ASP A 1 66  ? 16.492 42.236 6.777   1.00 12.69  ? 193  ASP A CA  1 
ATOM   537  C  C   . ASP A 1 66  ? 15.445 42.439 7.843   1.00 10.99  ? 193  ASP A C   1 
ATOM   538  O  O   . ASP A 1 66  ? 14.280 42.816 7.612   1.00 16.22  ? 193  ASP A O   1 
ATOM   539  C  CB  . ASP A 1 66  ? 16.726 40.754 6.443   1.00 13.39  ? 193  ASP A CB  1 
ATOM   540  C  CG  . ASP A 1 66  ? 17.686 40.558 5.293   1.00 25.33  ? 193  ASP A CG  1 
ATOM   541  O  OD1 . ASP A 1 66  ? 17.410 41.010 4.164   1.00 24.74  ? 193  ASP A OD1 1 
ATOM   542  O  OD2 . ASP A 1 66  ? 18.757 39.934 5.489   1.00 36.98  ? 193  ASP A OD2 1 
ATOM   543  N  N   . ALA A 1 67  ? 15.720 42.284 9.131   1.00 10.83  ? 194  ALA A N   1 
ATOM   544  C  CA  . ALA A 1 67  ? 14.730 42.518 10.157  1.00 12.43  ? 194  ALA A CA  1 
ATOM   545  C  C   . ALA A 1 67  ? 14.412 43.989 10.312  1.00 9.98   ? 194  ALA A C   1 
ATOM   546  O  O   . ALA A 1 67  ? 13.269 44.348 10.572  1.00 10.48  ? 194  ALA A O   1 
ATOM   547  C  CB  . ALA A 1 67  ? 15.203 41.924 11.482  1.00 17.74  ? 194  ALA A CB  1 
ATOM   548  N  N   . LEU A 1 68  ? 15.390 44.869 10.149  1.00 9.78   ? 195  LEU A N   1 
ATOM   549  C  CA  . LEU A 1 68  ? 15.129 46.307 10.342  1.00 10.72  ? 195  LEU A CA  1 
ATOM   550  C  C   . LEU A 1 68  ? 14.160 46.861 9.295   1.00 6.13   ? 195  LEU A C   1 
ATOM   551  O  O   . LEU A 1 68  ? 13.449 47.828 9.616   1.00 8.99   ? 195  LEU A O   1 
ATOM   552  C  CB  . LEU A 1 68  ? 16.458 47.058 10.320  1.00 9.72   ? 195  LEU A CB  1 
ATOM   553  C  CG  . LEU A 1 68  ? 17.354 46.827 11.540  1.00 9.55   ? 195  LEU A CG  1 
ATOM   554  C  CD1 . LEU A 1 68  ? 18.791 47.216 11.210  1.00 9.26   ? 195  LEU A CD1 1 
ATOM   555  C  CD2 . LEU A 1 68  ? 16.807 47.575 12.738  1.00 12.56  ? 195  LEU A CD2 1 
ATOM   556  N  N   . LEU A 1 69  ? 14.119 46.273 8.117   1.00 6.48   ? 196  LEU A N   1 
ATOM   557  C  CA  . LEU A 1 69  ? 13.303 46.781 7.019   1.00 9.10   ? 196  LEU A CA  1 
ATOM   558  C  C   . LEU A 1 69  ? 12.074 45.914 6.726   1.00 11.24  ? 196  LEU A C   1 
ATOM   559  O  O   . LEU A 1 69  ? 11.320 46.195 5.785   1.00 10.64  ? 196  LEU A O   1 
ATOM   560  C  CB  . LEU A 1 69  ? 14.174 46.922 5.770   1.00 8.55   ? 196  LEU A CB  1 
ATOM   561  C  CG  . LEU A 1 69  ? 15.160 48.073 5.824   1.00 7.33   ? 196  LEU A CG  1 
ATOM   562  C  CD1 . LEU A 1 69  ? 16.211 47.964 4.746   1.00 10.94  ? 196  LEU A CD1 1 
ATOM   563  C  CD2 . LEU A 1 69  ? 14.462 49.433 5.674   1.00 9.51   ? 196  LEU A CD2 1 
ATOM   564  N  N   . LYS A 1 70  ? 11.857 44.864 7.507   1.00 10.67  ? 197  LYS A N   1 
ATOM   565  C  CA  . LYS A 1 70  ? 10.794 43.907 7.211   1.00 12.64  ? 197  LYS A CA  1 
ATOM   566  C  C   . LYS A 1 70  ? 9.391  44.488 7.213   1.00 16.20  ? 197  LYS A C   1 
ATOM   567  O  O   . LYS A 1 70  ? 8.486  43.940 6.568   1.00 16.35  ? 197  LYS A O   1 
ATOM   568  C  CB  . LYS A 1 70  ? 10.829 42.746 8.220   1.00 13.24  ? 197  LYS A CB  1 
ATOM   569  C  CG  . LYS A 1 70  ? 10.463 43.104 9.645   1.00 22.37  ? 197  LYS A CG  1 
ATOM   570  C  CD  . LYS A 1 70  ? 10.765 41.899 10.543  1.00 39.08  ? 197  LYS A CD  1 
ATOM   571  C  CE  . LYS A 1 70  ? 11.092 42.319 11.971  1.00 45.20  ? 197  LYS A CE  1 
ATOM   572  N  NZ  . LYS A 1 70  ? 10.331 41.502 12.973  1.00 64.29  ? 197  LYS A NZ  1 
ATOM   573  N  N   . HIS A 1 71  ? 9.182  45.569 7.930   1.00 10.36  ? 198  HIS A N   1 
ATOM   574  C  CA  . HIS A 1 71  ? 7.834  46.149 8.034   1.00 11.91  ? 198  HIS A CA  1 
ATOM   575  C  C   . HIS A 1 71  ? 7.571  47.328 7.118   1.00 11.93  ? 198  HIS A C   1 
ATOM   576  O  O   . HIS A 1 71  ? 6.491  47.964 7.226   1.00 13.45  ? 198  HIS A O   1 
ATOM   577  C  CB  . HIS A 1 71  ? 7.596  46.545 9.508   1.00 25.93  ? 198  HIS A CB  1 
ATOM   578  C  CG  . HIS A 1 71  ? 7.014  45.420 10.323  1.00 38.60  ? 198  HIS A CG  1 
ATOM   579  N  ND1 . HIS A 1 71  ? 7.068  44.105 9.924   1.00 38.12  ? 198  HIS A ND1 1 
ATOM   580  C  CD2 . HIS A 1 71  ? 6.339  45.421 11.496  1.00 45.98  ? 198  HIS A CD2 1 
ATOM   581  C  CE1 . HIS A 1 71  ? 6.471  43.341 10.819  1.00 48.51  ? 198  HIS A CE1 1 
ATOM   582  N  NE2 . HIS A 1 71  ? 6.019  44.114 11.787  1.00 53.65  ? 198  HIS A NE2 1 
ATOM   583  N  N   . VAL A 1 72  ? 8.490  47.671 6.234   1.00 10.14  ? 199  VAL A N   1 
ATOM   584  C  CA  . VAL A 1 72  ? 8.308  48.803 5.328   1.00 7.23   ? 199  VAL A CA  1 
ATOM   585  C  C   . VAL A 1 72  ? 7.103  48.567 4.437   1.00 6.86   ? 199  VAL A C   1 
ATOM   586  O  O   . VAL A 1 72  ? 6.959  47.459 3.899   1.00 9.59   ? 199  VAL A O   1 
ATOM   587  C  CB  . VAL A 1 72  ? 9.542  49.040 4.458   1.00 7.44   ? 199  VAL A CB  1 
ATOM   588  C  CG1 . VAL A 1 72  ? 9.266  50.107 3.411   1.00 9.75   ? 199  VAL A CG1 1 
ATOM   589  C  CG2 . VAL A 1 72  ? 10.742 49.438 5.323   1.00 7.56   ? 199  VAL A CG2 1 
ATOM   590  N  N   . LYS A 1 73  ? 6.277  49.582 4.295   1.00 6.03   ? 200  LYS A N   1 
ATOM   591  C  CA  . LYS A 1 73  ? 5.167  49.558 3.346   1.00 5.32   ? 200  LYS A CA  1 
ATOM   592  C  C   . LYS A 1 73  ? 5.383  50.671 2.323   1.00 4.36   ? 200  LYS A C   1 
ATOM   593  O  O   . LYS A 1 73  ? 5.495  51.840 2.718   1.00 6.30   ? 200  LYS A O   1 
ATOM   594  C  CB  . LYS A 1 73  ? 3.827  49.710 4.058   1.00 10.21  ? 200  LYS A CB  1 
ATOM   595  C  CG  . LYS A 1 73  ? 2.671  49.775 3.064   1.00 23.67  ? 200  LYS A CG  1 
ATOM   596  C  CD  . LYS A 1 73  ? 2.218  48.390 2.667   1.00 49.90  ? 200  LYS A CD  1 
ATOM   597  C  CE  . LYS A 1 73  ? 0.924  48.346 1.871   1.00 47.78  ? 200  LYS A CE  1 
ATOM   598  N  NZ  . LYS A 1 73  ? 1.082  47.446 0.682   1.00 37.68  ? 200  LYS A NZ  1 
ATOM   599  N  N   . HIS A 1 74  ? 5.379  50.330 1.057   1.00 5.73   ? 201  HIS A N   1 
ATOM   600  C  CA  . HIS A 1 74  ? 5.576  51.299 -0.024  1.00 3.97   ? 201  HIS A CA  1 
ATOM   601  C  C   . HIS A 1 74  ? 4.469  52.331 0.000   1.00 6.60   ? 201  HIS A C   1 
ATOM   602  O  O   . HIS A 1 74  ? 3.275  52.001 -0.127  1.00 6.22   ? 201  HIS A O   1 
ATOM   603  C  CB  . HIS A 1 74  ? 5.649  50.525 -1.322  1.00 4.00   ? 201  HIS A CB  1 
ATOM   604  C  CG  . HIS A 1 74  ? 5.967  51.290 -2.558  1.00 3.65   ? 201  HIS A CG  1 
ATOM   605  N  ND1 . HIS A 1 74  ? 5.957  50.744 -3.824  1.00 5.97   ? 201  HIS A ND1 1 
ATOM   606  C  CD2 . HIS A 1 74  ? 6.297  52.592 -2.724  1.00 4.12   ? 201  HIS A CD2 1 
ATOM   607  C  CE1 . HIS A 1 74  ? 6.274  51.676 -4.707  1.00 5.90   ? 201  HIS A CE1 1 
ATOM   608  N  NE2 . HIS A 1 74  ? 6.475  52.810 -4.056  1.00 4.62   ? 201  HIS A NE2 1 
ATOM   609  N  N   . MET A 1 75  ? 4.817  53.585 0.173   1.00 5.78   ? 202  MET A N   1 
ATOM   610  C  CA  . MET A 1 75  ? 3.834  54.646 0.357   1.00 5.03   ? 202  MET A CA  1 
ATOM   611  C  C   . MET A 1 75  ? 3.043  54.962 -0.900  1.00 5.82   ? 202  MET A C   1 
ATOM   612  O  O   . MET A 1 75  ? 1.808  55.230 -0.811  1.00 6.36   ? 202  MET A O   1 
ATOM   613  C  CB  . MET A 1 75  ? 4.550  55.910 0.839   1.00 3.96   ? 202  MET A CB  1 
ATOM   614  C  CG  . MET A 1 75  ? 5.028  55.877 2.270   1.00 3.69   ? 202  MET A CG  1 
ATOM   615  S  SD  . MET A 1 75  ? 6.194  57.195 2.623   1.00 6.20   ? 202  MET A SD  1 
ATOM   616  C  CE  . MET A 1 75  ? 6.285  57.060 4.412   1.00 7.85   ? 202  MET A CE  1 
ATOM   617  N  N   . LEU A 1 76  ? 3.647  54.965 -2.079  1.00 2.88   ? 203  LEU A N   1 
ATOM   618  C  CA  . LEU A 1 76  ? 3.012  55.115 -3.364  1.00 4.17   ? 203  LEU A CA  1 
ATOM   619  C  C   . LEU A 1 76  ? 2.351  56.463 -3.587  1.00 5.72   ? 203  LEU A C   1 
ATOM   620  O  O   . LEU A 1 76  ? 1.276  56.592 -4.202  1.00 6.04   ? 203  LEU A O   1 
ATOM   621  C  CB  . LEU A 1 76  ? 1.958  53.992 -3.554  1.00 6.34   ? 203  LEU A CB  1 
ATOM   622  C  CG  . LEU A 1 76  ? 2.632  52.631 -3.851  1.00 7.09   ? 203  LEU A CG  1 
ATOM   623  C  CD1 . LEU A 1 76  ? 1.653  51.505 -3.521  1.00 9.92   ? 203  LEU A CD1 1 
ATOM   624  C  CD2 . LEU A 1 76  ? 3.082  52.548 -5.293  1.00 9.27   ? 203  LEU A CD2 1 
ATOM   625  N  N   . LEU A 1 77  ? 3.010  57.549 -3.174  1.00 4.42   ? 204  LEU A N   1 
ATOM   626  C  CA  . LEU A 1 77  ? 2.437  58.914 -3.338  1.00 4.34   ? 204  LEU A CA  1 
ATOM   627  C  C   . LEU A 1 77  ? 3.458  59.801 -4.041  1.00 4.23   ? 204  LEU A C   1 
ATOM   628  O  O   . LEU A 1 77  ? 3.993  59.463 -5.097  1.00 5.54   ? 204  LEU A O   1 
ATOM   629  C  CB  . LEU A 1 77  ? 1.874  59.393 -2.013  1.00 4.30   ? 204  LEU A CB  1 
ATOM   630  C  CG  . LEU A 1 77  ? 0.693  58.544 -1.444  1.00 5.21   ? 204  LEU A CG  1 
ATOM   631  C  CD1 . LEU A 1 77  ? 0.441  58.899 -0.003  1.00 6.97   ? 204  LEU A CD1 1 
ATOM   632  C  CD2 . LEU A 1 77  ? -0.547 58.738 -2.302  1.00 9.20   ? 204  LEU A CD2 1 
ATOM   633  N  N   . LEU A 1 78  ? 3.716  60.997 -3.599  1.00 7.15   ? 205  LEU A N   1 
ATOM   634  C  CA  . LEU A 1 78  ? 4.427  62.150 -4.069  1.00 4.99   ? 205  LEU A CA  1 
ATOM   635  C  C   . LEU A 1 78  ? 5.898  61.903 -3.787  1.00 4.62   ? 205  LEU A C   1 
ATOM   636  O  O   . LEU A 1 78  ? 6.389  60.879 -3.392  1.00 4.74   ? 205  LEU A O   1 
ATOM   637  C  CB  . LEU A 1 78  ? 3.935  63.461 -3.467  1.00 7.35   ? 205  LEU A CB  1 
ATOM   638  C  CG  . LEU A 1 78  ? 2.448  63.806 -3.662  1.00 12.51  ? 205  LEU A CG  1 
ATOM   639  C  CD1 . LEU A 1 78  ? 2.129  65.119 -2.929  1.00 14.61  ? 205  LEU A CD1 1 
ATOM   640  C  CD2 . LEU A 1 78  ? 2.078  63.860 -5.122  1.00 14.78  ? 205  LEU A CD2 1 
ATOM   641  N  N   . THR A 1 79  ? 6.751  62.828 -4.012  1.00 5.54   ? 206  THR A N   1 
ATOM   642  C  CA  . THR A 1 79  ? 8.184  62.967 -3.904  1.00 3.53   ? 206  THR A CA  1 
ATOM   643  C  C   . THR A 1 79  ? 8.598  64.271 -3.178  1.00 2.55   ? 206  THR A C   1 
ATOM   644  O  O   . THR A 1 79  ? 9.309  65.149 -3.760  1.00 4.85   ? 206  THR A O   1 
ATOM   645  C  CB  . THR A 1 79  ? 8.850  62.886 -5.277  1.00 5.76   ? 206  THR A CB  1 
ATOM   646  O  OG1 . THR A 1 79  ? 8.259  61.795 -6.010  1.00 6.73   ? 206  THR A OG1 1 
ATOM   647  C  CG2 . THR A 1 79  ? 10.359 62.633 -5.163  1.00 6.26   ? 206  THR A CG2 1 
ATOM   648  N  N   . ASN A 1 80  ? 8.222  64.420 -1.918  1.00 2.83   ? 207  ASN A N   1 
ATOM   649  C  CA  . ASN A 1 80  ? 8.494  65.650 -1.159  1.00 3.79   ? 207  ASN A CA  1 
ATOM   650  C  C   . ASN A 1 80  ? 9.867  65.727 -0.531  1.00 2.03   ? 207  ASN A C   1 
ATOM   651  O  O   . ASN A 1 80  ? 10.027 65.670 0.669   1.00 3.67   ? 207  ASN A O   1 
ATOM   652  C  CB  . ASN A 1 80  ? 7.328  65.849 -0.167  1.00 3.72   ? 207  ASN A CB  1 
ATOM   653  C  CG  . ASN A 1 80  ? 5.997  66.241 -0.742  1.00 4.62   ? 207  ASN A CG  1 
ATOM   654  O  OD1 . ASN A 1 80  ? 4.949  66.036 -0.040  1.00 7.39   ? 207  ASN A OD1 1 
ATOM   655  N  ND2 . ASN A 1 80  ? 5.912  66.819 -1.891  1.00 2.74   ? 207  ASN A ND2 1 
ATOM   656  N  N   . THR A 1 81  ? 10.819 65.899 -1.418  1.00 3.33   ? 208  THR A N   1 
ATOM   657  C  CA  . THR A 1 81  ? 12.245 65.795 -1.081  1.00 2.34   ? 208  THR A CA  1 
ATOM   658  C  C   . THR A 1 81  ? 12.673 66.920 -0.174  1.00 3.57   ? 208  THR A C   1 
ATOM   659  O  O   . THR A 1 81  ? 13.498 66.720 0.718   1.00 3.25   ? 208  THR A O   1 
ATOM   660  C  CB  . THR A 1 81  ? 13.077 65.790 -2.374  1.00 4.47   ? 208  THR A CB  1 
ATOM   661  O  OG1 . THR A 1 81  ? 12.515 64.875 -3.352  1.00 4.41   ? 208  THR A OG1 1 
ATOM   662  C  CG2 . THR A 1 81  ? 14.514 65.351 -2.125  1.00 5.35   ? 208  THR A CG2 1 
ATOM   663  N  N   . PHE A 1 82  ? 12.160 68.142 -0.358  1.00 3.75   ? 209  PHE A N   1 
ATOM   664  C  CA  . PHE A 1 82  ? 12.561 69.226 0.539   1.00 3.16   ? 209  PHE A CA  1 
ATOM   665  C  C   . PHE A 1 82  ? 12.129 68.949 1.960   1.00 3.38   ? 209  PHE A C   1 
ATOM   666  O  O   . PHE A 1 82  ? 12.838 69.056 2.953   1.00 4.47   ? 209  PHE A O   1 
ATOM   667  C  CB  . PHE A 1 82  ? 11.999 70.572 0.102   1.00 3.81   ? 209  PHE A CB  1 
ATOM   668  C  CG  . PHE A 1 82  ? 12.738 71.194 -1.078  1.00 2.05   ? 209  PHE A CG  1 
ATOM   669  C  CD1 . PHE A 1 82  ? 12.337 70.978 -2.370  1.00 3.64   ? 209  PHE A CD1 1 
ATOM   670  C  CD2 . PHE A 1 82  ? 13.836 72.015 -0.841  1.00 5.04   ? 209  PHE A CD2 1 
ATOM   671  C  CE1 . PHE A 1 82  ? 12.991 71.539 -3.459  1.00 5.77   ? 209  PHE A CE1 1 
ATOM   672  C  CE2 . PHE A 1 82  ? 14.492 72.558 -1.934  1.00 3.77   ? 209  PHE A CE2 1 
ATOM   673  C  CZ  . PHE A 1 82  ? 14.075 72.345 -3.215  1.00 4.92   ? 209  PHE A CZ  1 
ATOM   674  N  N   . GLY A 1 83  ? 10.853 68.568 2.122   1.00 4.14   ? 210  GLY A N   1 
ATOM   675  C  CA  . GLY A 1 83  ? 10.365 68.244 3.453   1.00 3.38   ? 210  GLY A CA  1 
ATOM   676  C  C   . GLY A 1 83  ? 11.105 67.049 4.036   1.00 4.01   ? 210  GLY A C   1 
ATOM   677  O  O   . GLY A 1 83  ? 11.402 67.063 5.244   1.00 4.89   ? 210  GLY A O   1 
ATOM   678  N  N   . ALA A 1 84  ? 11.407 66.075 3.197   1.00 2.97   ? 211  ALA A N   1 
ATOM   679  C  CA  . ALA A 1 84  ? 12.079 64.871 3.698   1.00 3.23   ? 211  ALA A CA  1 
ATOM   680  C  C   . ALA A 1 84  ? 13.495 65.145 4.201   1.00 3.66   ? 211  ALA A C   1 
ATOM   681  O  O   . ALA A 1 84  ? 13.867 64.631 5.272   1.00 3.68   ? 211  ALA A O   1 
ATOM   682  C  CB  . ALA A 1 84  ? 12.090 63.812 2.623   1.00 2.99   ? 211  ALA A CB  1 
ATOM   683  N  N   . ILE A 1 85  ? 14.267 65.943 3.467   1.00 2.87   ? 212  ILE A N   1 
ATOM   684  C  CA  . ILE A 1 85  ? 15.623 66.257 3.928   1.00 2.72   ? 212  ILE A CA  1 
ATOM   685  C  C   . ILE A 1 85  ? 15.609 67.090 5.188   1.00 3.17   ? 212  ILE A C   1 
ATOM   686  O  O   . ILE A 1 85  ? 16.397 66.856 6.105   1.00 4.20   ? 212  ILE A O   1 
ATOM   687  C  CB  . ILE A 1 85  ? 16.385 66.922 2.772   1.00 2.43   ? 212  ILE A CB  1 
ATOM   688  C  CG1 . ILE A 1 85  ? 16.610 65.934 1.621   1.00 2.81   ? 212  ILE A CG1 1 
ATOM   689  C  CG2 . ILE A 1 85  ? 17.694 67.510 3.246   1.00 3.80   ? 212  ILE A CG2 1 
ATOM   690  C  CD1 . ILE A 1 85  ? 17.161 66.510 0.338   1.00 4.56   ? 212  ILE A CD1 1 
ATOM   691  N  N   . ASN A 1 86  ? 14.692 68.056 5.295   1.00 3.38   ? 213  ASN A N   1 
ATOM   692  C  CA  . ASN A 1 86  ? 14.538 68.806 6.526   1.00 2.88   ? 213  ASN A CA  1 
ATOM   693  C  C   . ASN A 1 86  ? 14.196 67.883 7.698   1.00 4.41   ? 213  ASN A C   1 
ATOM   694  O  O   . ASN A 1 86  ? 14.761 68.024 8.781   1.00 5.27   ? 213  ASN A O   1 
ATOM   695  C  CB  . ASN A 1 86  ? 13.474 69.894 6.381   1.00 3.46   ? 213  ASN A CB  1 
ATOM   696  C  CG  . ASN A 1 86  ? 13.954 71.124 5.645   1.00 4.52   ? 213  ASN A CG  1 
ATOM   697  O  OD1 . ASN A 1 86  ? 13.726 71.360 4.431   1.00 6.43   ? 213  ASN A OD1 1 
ATOM   698  N  ND2 . ASN A 1 86  ? 14.619 71.955 6.438   1.00 3.70   ? 213  ASN A ND2 1 
ATOM   699  N  N   . TYR A 1 87  ? 13.285 66.938 7.435   1.00 4.07   ? 214  TYR A N   1 
ATOM   700  C  CA  . TYR A 1 87  ? 12.925 65.961 8.480   1.00 5.30   ? 214  TYR A CA  1 
ATOM   701  C  C   . TYR A 1 87  ? 14.136 65.194 8.982   1.00 3.95   ? 214  TYR A C   1 
ATOM   702  O  O   . TYR A 1 87  ? 14.356 65.031 10.178  1.00 5.74   ? 214  TYR A O   1 
ATOM   703  C  CB  . TYR A 1 87  ? 11.833 65.030 7.969   1.00 4.57   ? 214  TYR A CB  1 
ATOM   704  C  CG  . TYR A 1 87  ? 11.435 63.915 8.885   1.00 5.73   ? 214  TYR A CG  1 
ATOM   705  C  CD1 . TYR A 1 87  ? 10.477 64.228 9.840   1.00 13.55  ? 214  TYR A CD1 1 
ATOM   706  C  CD2 . TYR A 1 87  ? 11.968 62.637 8.817   1.00 8.21   ? 214  TYR A CD2 1 
ATOM   707  C  CE1 . TYR A 1 87  ? 10.083 63.243 10.708  1.00 18.43  ? 214  TYR A CE1 1 
ATOM   708  C  CE2 . TYR A 1 87  ? 11.580 61.632 9.697   1.00 8.63   ? 214  TYR A CE2 1 
ATOM   709  C  CZ  . TYR A 1 87  ? 10.635 61.968 10.624  1.00 15.27  ? 214  TYR A CZ  1 
ATOM   710  O  OH  . TYR A 1 87  ? 10.072 61.161 11.598  1.00 38.76  ? 214  TYR A OH  1 
ATOM   711  N  N   . VAL A 1 88  ? 14.940 64.713 8.030   1.00 3.93   ? 215  VAL A N   1 
ATOM   712  C  CA  . VAL A 1 88  ? 16.127 63.974 8.480   1.00 3.95   ? 215  VAL A CA  1 
ATOM   713  C  C   . VAL A 1 88  ? 17.037 64.841 9.317   1.00 5.06   ? 215  VAL A C   1 
ATOM   714  O  O   . VAL A 1 88  ? 17.531 64.409 10.368  1.00 5.61   ? 215  VAL A O   1 
ATOM   715  C  CB  . VAL A 1 88  ? 16.867 63.415 7.252   1.00 4.58   ? 215  VAL A CB  1 
ATOM   716  C  CG1 . VAL A 1 88  ? 18.256 62.926 7.675   1.00 6.62   ? 215  VAL A CG1 1 
ATOM   717  C  CG2 . VAL A 1 88  ? 16.069 62.311 6.598   1.00 5.47   ? 215  VAL A CG2 1 
ATOM   718  N  N   . ALA A 1 89  ? 17.273 66.055 8.852   1.00 4.30   ? 216  ALA A N   1 
ATOM   719  C  CA  . ALA A 1 89  ? 18.254 66.918 9.502   1.00 5.62   ? 216  ALA A CA  1 
ATOM   720  C  C   . ALA A 1 89  ? 17.811 67.264 10.913  1.00 8.19   ? 216  ALA A C   1 
ATOM   721  O  O   . ALA A 1 89  ? 18.642 67.374 11.830  1.00 8.19   ? 216  ALA A O   1 
ATOM   722  C  CB  . ALA A 1 89  ? 18.512 68.163 8.689   1.00 7.55   ? 216  ALA A CB  1 
ATOM   723  N  N   . THR A 1 90  ? 16.524 67.501 11.120  1.00 7.25   ? 217  THR A N   1 
ATOM   724  C  CA  . THR A 1 90  ? 16.041 67.995 12.404  1.00 8.48   ? 217  THR A CA  1 
ATOM   725  C  C   . THR A 1 90  ? 15.421 66.919 13.278  1.00 8.93   ? 217  THR A C   1 
ATOM   726  O  O   . THR A 1 90  ? 15.381 67.094 14.507  1.00 12.83  ? 217  THR A O   1 
ATOM   727  C  CB  . THR A 1 90  ? 14.985 69.113 12.183  1.00 11.14  ? 217  THR A CB  1 
ATOM   728  O  OG1 . THR A 1 90  ? 13.840 68.526 11.570  1.00 20.27  ? 217  THR A OG1 1 
ATOM   729  C  CG2 . THR A 1 90  ? 15.585 70.197 11.288  1.00 10.92  ? 217  THR A CG2 1 
ATOM   730  N  N   . GLU A 1 91  ? 14.909 65.840 12.708  1.00 7.87   ? 218  GLU A N   1 
ATOM   731  C  CA  . GLU A 1 91  ? 14.202 64.832 13.481  1.00 7.68   ? 218  GLU A CA  1 
ATOM   732  C  C   . GLU A 1 91  ? 14.942 63.520 13.546  1.00 12.98  ? 218  GLU A C   1 
ATOM   733  O  O   . GLU A 1 91  ? 14.585 62.677 14.390  1.00 18.87  ? 218  GLU A O   1 
ATOM   734  C  CB  . GLU A 1 91  ? 12.797 64.542 12.923  1.00 13.30  ? 218  GLU A CB  1 
ATOM   735  C  CG  . GLU A 1 91  ? 11.837 65.704 12.960  1.00 18.70  ? 218  GLU A CG  1 
ATOM   736  C  CD  . GLU A 1 91  ? 11.448 66.159 14.345  1.00 32.36  ? 218  GLU A CD  1 
ATOM   737  O  OE1 . GLU A 1 91  ? 11.794 65.524 15.364  1.00 29.30  ? 218  GLU A OE1 1 
ATOM   738  O  OE2 . GLU A 1 91  ? 10.770 67.214 14.368  1.00 48.46  ? 218  GLU A OE2 1 
ATOM   739  N  N   . VAL A 1 92  ? 15.931 63.239 12.703  1.00 7.23   ? 219  VAL A N   1 
ATOM   740  C  CA  . VAL A 1 92  ? 16.520 61.894 12.704  1.00 7.07   ? 219  VAL A CA  1 
ATOM   741  C  C   . VAL A 1 92  ? 17.941 61.902 13.250  1.00 9.73   ? 219  VAL A C   1 
ATOM   742  O  O   . VAL A 1 92  ? 18.361 61.052 14.022  1.00 8.00   ? 219  VAL A O   1 
ATOM   743  C  CB  . VAL A 1 92  ? 16.505 61.262 11.295  1.00 7.73   ? 219  VAL A CB  1 
ATOM   744  C  CG1 . VAL A 1 92  ? 17.205 59.926 11.262  1.00 7.40   ? 219  VAL A CG1 1 
ATOM   745  C  CG2 . VAL A 1 92  ? 15.062 61.136 10.845  1.00 7.77   ? 219  VAL A CG2 1 
ATOM   746  N  N   . PHE A 1 93  ? 18.721 62.932 12.887  1.00 7.23   ? 220  PHE A N   1 
ATOM   747  C  CA  . PHE A 1 93  ? 20.070 63.111 13.445  1.00 7.07   ? 220  PHE A CA  1 
ATOM   748  C  C   . PHE A 1 93  ? 19.927 63.760 14.815  1.00 8.71   ? 220  PHE A C   1 
ATOM   749  O  O   . PHE A 1 93  ? 20.180 64.960 15.038  1.00 12.68  ? 220  PHE A O   1 
ATOM   750  C  CB  . PHE A 1 93  ? 20.924 63.965 12.517  1.00 6.84   ? 220  PHE A CB  1 
ATOM   751  C  CG  . PHE A 1 93  ? 21.515 63.216 11.332  1.00 5.50   ? 220  PHE A CG  1 
ATOM   752  C  CD1 . PHE A 1 93  ? 22.511 62.271 11.560  1.00 5.63   ? 220  PHE A CD1 1 
ATOM   753  C  CD2 . PHE A 1 93  ? 21.100 63.465 10.034  1.00 5.64   ? 220  PHE A CD2 1 
ATOM   754  C  CE1 . PHE A 1 93  ? 23.041 61.600 10.479  1.00 5.89   ? 220  PHE A CE1 1 
ATOM   755  C  CE2 . PHE A 1 93  ? 21.642 62.803 8.953   1.00 4.57   ? 220  PHE A CE2 1 
ATOM   756  C  CZ  . PHE A 1 93  ? 22.647 61.861 9.192   1.00 5.31   ? 220  PHE A CZ  1 
ATOM   757  N  N   . ARG A 1 94  ? 19.441 62.931 15.740  1.00 8.38   ? 221  ARG A N   1 
ATOM   758  C  CA  . ARG A 1 94  ? 19.201 63.391 17.108  1.00 10.77  ? 221  ARG A CA  1 
ATOM   759  C  C   . ARG A 1 94  ? 19.599 62.291 18.089  1.00 7.08   ? 221  ARG A C   1 
ATOM   760  O  O   . ARG A 1 94  ? 19.393 61.122 17.767  1.00 9.09   ? 221  ARG A O   1 
ATOM   761  C  CB  . ARG A 1 94  ? 17.722 63.674 17.383  1.00 14.85  ? 221  ARG A CB  1 
ATOM   762  C  CG  . ARG A 1 94  ? 16.970 64.381 16.293  1.00 22.48  ? 221  ARG A CG  1 
ATOM   763  C  CD  . ARG A 1 94  ? 17.245 65.868 16.361  1.00 29.47  ? 221  ARG A CD  1 
ATOM   764  N  NE  . ARG A 1 94  ? 17.287 66.327 17.742  1.00 42.68  ? 221  ARG A NE  1 
ATOM   765  C  CZ  . ARG A 1 94  ? 16.195 66.444 18.493  1.00 37.48  ? 221  ARG A CZ  1 
ATOM   766  N  NH1 . ARG A 1 94  ? 15.014 66.131 17.976  1.00 61.99  ? 221  ARG A NH1 1 
ATOM   767  N  NH2 . ARG A 1 94  ? 16.294 66.874 19.743  1.00 30.00  ? 221  ARG A NH2 1 
ATOM   768  N  N   . GLU A 1 95  ? 20.155 62.732 19.226  1.00 8.49   ? 222  GLU A N   1 
ATOM   769  C  CA  . GLU A 1 95  ? 20.540 61.778 20.236  1.00 8.24   ? 222  GLU A CA  1 
ATOM   770  C  C   . GLU A 1 95  ? 19.364 60.907 20.683  1.00 7.57   ? 222  GLU A C   1 
ATOM   771  O  O   . GLU A 1 95  ? 19.539 59.762 21.039  1.00 10.43  ? 222  GLU A O   1 
ATOM   772  C  CB  . GLU A 1 95  ? 21.113 62.448 21.481  1.00 14.52  ? 222  GLU A CB  1 
ATOM   773  C  CG  . GLU A 1 95  ? 22.568 62.852 21.330  1.00 27.97  ? 222  GLU A CG  1 
ATOM   774  C  CD  . GLU A 1 95  ? 23.061 63.370 22.683  1.00 35.07  ? 222  GLU A CD  1 
ATOM   775  O  OE1 . GLU A 1 95  ? 22.573 64.436 23.117  1.00 31.89  ? 222  GLU A OE1 1 
ATOM   776  O  OE2 . GLU A 1 95  ? 23.900 62.669 23.276  1.00 31.07  ? 222  GLU A OE2 1 
ATOM   777  N  N   . GLU A 1 96  ? 18.178 61.478 20.667  1.00 8.69   ? 223  GLU A N   1 
ATOM   778  C  CA  . GLU A 1 96  ? 17.002 60.721 21.092  1.00 10.01  ? 223  GLU A CA  1 
ATOM   779  C  C   . GLU A 1 96  ? 16.729 59.529 20.191  1.00 11.59  ? 223  GLU A C   1 
ATOM   780  O  O   . GLU A 1 96  ? 16.001 58.607 20.604  1.00 12.07  ? 223  GLU A O   1 
ATOM   781  C  CB  . GLU A 1 96  ? 15.791 61.662 21.137  1.00 10.14  ? 223  GLU A CB  1 
ATOM   782  C  CG  . GLU A 1 96  ? 15.859 62.742 22.185  1.00 11.50  ? 223  GLU A CG  1 
ATOM   783  C  CD  . GLU A 1 96  ? 16.597 64.001 21.789  1.00 12.93  ? 223  GLU A CD  1 
ATOM   784  O  OE1 . GLU A 1 96  ? 17.186 64.046 20.694  1.00 11.07  ? 223  GLU A OE1 1 
ATOM   785  O  OE2 . GLU A 1 96  ? 16.594 64.957 22.596  1.00 11.68  ? 223  GLU A OE2 1 
ATOM   786  N  N   . LEU A 1 97  ? 17.261 59.533 18.977  1.00 8.55   ? 224  LEU A N   1 
ATOM   787  C  CA  . LEU A 1 97  ? 17.073 58.428 18.032  1.00 9.26   ? 224  LEU A CA  1 
ATOM   788  C  C   . LEU A 1 97  ? 18.323 57.563 17.914  1.00 6.78   ? 224  LEU A C   1 
ATOM   789  O  O   . LEU A 1 97  ? 18.371 56.726 17.031  1.00 9.40   ? 224  LEU A O   1 
ATOM   790  C  CB  . LEU A 1 97  ? 16.684 58.926 16.636  1.00 11.14  ? 224  LEU A CB  1 
ATOM   791  C  CG  . LEU A 1 97  ? 15.165 58.901 16.400  1.00 24.23  ? 224  LEU A CG  1 
ATOM   792  C  CD1 . LEU A 1 97  ? 14.510 59.969 17.262  1.00 31.43  ? 224  LEU A CD1 1 
ATOM   793  C  CD2 . LEU A 1 97  ? 14.869 59.057 14.924  1.00 23.16  ? 224  LEU A CD2 1 
ATOM   794  N  N   . GLY A 1 98  ? 19.267 57.794 18.822  1.00 7.72   ? 225  GLY A N   1 
ATOM   795  C  CA  . GLY A 1 98  ? 20.496 57.025 18.835  1.00 6.67   ? 225  GLY A CA  1 
ATOM   796  C  C   . GLY A 1 98  ? 21.679 57.599 18.100  1.00 7.28   ? 225  GLY A C   1 
ATOM   797  O  O   . GLY A 1 98  ? 22.729 56.936 18.025  1.00 10.25  ? 225  GLY A O   1 
ATOM   798  N  N   . ALA A 1 99  ? 21.515 58.779 17.531  1.00 7.61   ? 226  ALA A N   1 
ATOM   799  C  CA  . ALA A 1 99  ? 22.652 59.388 16.845  1.00 8.32   ? 226  ALA A CA  1 
ATOM   800  C  C   . ALA A 1 99  ? 23.746 59.750 17.854  1.00 15.63  ? 226  ALA A C   1 
ATOM   801  O  O   . ALA A 1 99  ? 23.509 60.075 19.011  1.00 13.32  ? 226  ALA A O   1 
ATOM   802  C  CB  . ALA A 1 99  ? 22.244 60.608 16.039  1.00 9.93   ? 226  ALA A CB  1 
ATOM   803  N  N   . ARG A 1 100 ? 24.997 59.687 17.417  1.00 10.82  ? 227  ARG A N   1 
ATOM   804  C  CA  . ARG A 1 100 ? 26.166 59.930 18.249  1.00 10.42  ? 227  ARG A CA  1 
ATOM   805  C  C   . ARG A 1 100 ? 26.700 61.322 17.973  1.00 15.49  ? 227  ARG A C   1 
ATOM   806  O  O   . ARG A 1 100 ? 27.050 61.650 16.837  1.00 12.29  ? 227  ARG A O   1 
ATOM   807  C  CB  . ARG A 1 100 ? 27.267 58.925 17.911  1.00 12.49  ? 227  ARG A CB  1 
ATOM   808  C  CG  . ARG A 1 100 ? 26.971 57.500 18.268  1.00 10.83  ? 227  ARG A CG  1 
ATOM   809  C  CD  . ARG A 1 100 ? 27.982 56.520 17.709  1.00 13.29  ? 227  ARG A CD  1 
ATOM   810  N  NE  . ARG A 1 100 ? 27.865 56.396 16.250  1.00 11.97  ? 227  ARG A NE  1 
ATOM   811  C  CZ  . ARG A 1 100 ? 28.564 55.601 15.473  1.00 10.96  ? 227  ARG A CZ  1 
ATOM   812  N  NH1 . ARG A 1 100 ? 29.508 54.809 15.975  1.00 15.34  ? 227  ARG A NH1 1 
ATOM   813  N  NH2 . ARG A 1 100 ? 28.376 55.556 14.165  1.00 12.52  ? 227  ARG A NH2 1 
ATOM   814  N  N   . PRO A 1 101 ? 26.775 62.174 18.981  1.00 15.49  ? 228  PRO A N   1 
ATOM   815  C  CA  . PRO A 1 101 ? 27.297 63.520 18.734  1.00 20.87  ? 228  PRO A CA  1 
ATOM   816  C  C   . PRO A 1 101 ? 28.679 63.544 18.124  1.00 14.70  ? 228  PRO A C   1 
ATOM   817  O  O   . PRO A 1 101 ? 29.044 64.430 17.348  1.00 24.96  ? 228  PRO A O   1 
ATOM   818  C  CB  . PRO A 1 101 ? 27.343 64.095 20.169  1.00 27.78  ? 228  PRO A CB  1 
ATOM   819  C  CG  . PRO A 1 101 ? 26.229 63.381 20.878  1.00 28.29  ? 228  PRO A CG  1 
ATOM   820  C  CD  . PRO A 1 101 ? 26.349 61.958 20.373  1.00 19.84  ? 228  PRO A CD  1 
ATOM   821  N  N   . ASP A 1 102 ? 29.537 62.575 18.417  1.00 15.17  ? 229  ASP A N   1 
ATOM   822  C  CA  . ASP A 1 102 ? 30.870 62.638 17.805  1.00 22.39  ? 229  ASP A CA  1 
ATOM   823  C  C   . ASP A 1 102 ? 30.916 62.247 16.339  1.00 27.23  ? 229  ASP A C   1 
ATOM   824  O  O   . ASP A 1 102 ? 31.936 62.515 15.698  1.00 30.62  ? 229  ASP A O   1 
ATOM   825  C  CB  . ASP A 1 102 ? 31.781 61.706 18.619  1.00 28.45  ? 229  ASP A CB  1 
ATOM   826  C  CG  . ASP A 1 102 ? 31.177 60.306 18.681  1.00 34.64  ? 229  ASP A CG  1 
ATOM   827  O  OD1 . ASP A 1 102 ? 30.264 60.046 19.499  1.00 30.93  ? 229  ASP A OD1 1 
ATOM   828  O  OD2 . ASP A 1 102 ? 31.655 59.488 17.865  1.00 34.90  ? 229  ASP A OD2 1 
ATOM   829  N  N   . ALA A 1 103 ? 29.920 61.618 15.744  1.00 12.10  ? 230  ALA A N   1 
ATOM   830  C  CA  . ALA A 1 103 ? 29.965 61.023 14.436  1.00 10.14  ? 230  ALA A CA  1 
ATOM   831  C  C   . ALA A 1 103 ? 29.838 61.999 13.290  1.00 7.69   ? 230  ALA A C   1 
ATOM   832  O  O   . ALA A 1 103 ? 29.185 63.031 13.364  1.00 13.27  ? 230  ALA A O   1 
ATOM   833  C  CB  . ALA A 1 103 ? 28.860 59.957 14.321  1.00 9.15   ? 230  ALA A CB  1 
ATOM   834  N  N   . THR A 1 104 ? 30.465 61.613 12.195  1.00 7.21   ? 231  THR A N   1 
ATOM   835  C  CA  . THR A 1 104 ? 30.303 62.281 10.916  1.00 6.58   ? 231  THR A CA  1 
ATOM   836  C  C   . THR A 1 104 ? 28.916 61.891 10.361  1.00 7.08   ? 231  THR A C   1 
ATOM   837  O  O   . THR A 1 104 ? 28.554 60.711 10.332  1.00 8.35   ? 231  THR A O   1 
ATOM   838  C  CB  . THR A 1 104 ? 31.369 61.870 9.917   1.00 7.44   ? 231  THR A CB  1 
ATOM   839  O  OG1 . THR A 1 104 ? 32.657 62.275 10.471  1.00 10.95  ? 231  THR A OG1 1 
ATOM   840  C  CG2 . THR A 1 104 ? 31.209 62.527 8.565   1.00 8.94   ? 231  THR A CG2 1 
ATOM   841  N  N   . LYS A 1 105 ? 28.167 62.885 9.947   1.00 5.42   ? 232  LYS A N   1 
ATOM   842  C  CA  . LYS A 1 105 ? 26.802 62.683 9.443   1.00 5.17   ? 232  LYS A CA  1 
ATOM   843  C  C   . LYS A 1 105 ? 26.828 62.518 7.937   1.00 5.92   ? 232  LYS A C   1 
ATOM   844  O  O   . LYS A 1 105 ? 27.351 63.400 7.219   1.00 5.94   ? 232  LYS A O   1 
ATOM   845  C  CB  . LYS A 1 105 ? 25.926 63.864 9.834   1.00 5.98   ? 232  LYS A CB  1 
ATOM   846  C  CG  . LYS A 1 105 ? 25.686 64.095 11.309  1.00 9.51   ? 232  LYS A CG  1 
ATOM   847  C  CD  . LYS A 1 105 ? 24.656 65.233 11.488  1.00 9.91   ? 232  LYS A CD  1 
ATOM   848  C  CE  . LYS A 1 105 ? 24.675 65.795 12.888  1.00 19.46  ? 232  LYS A CE  1 
ATOM   849  N  NZ  . LYS A 1 105 ? 23.816 67.034 12.946  1.00 20.67  ? 232  LYS A NZ  1 
ATOM   850  N  N   . VAL A 1 106 ? 26.195 61.434 7.447   1.00 5.59   ? 233  VAL A N   1 
ATOM   851  C  CA  . VAL A 1 106 ? 26.089 61.157 6.037   1.00 4.26   ? 233  VAL A CA  1 
ATOM   852  C  C   . VAL A 1 106 ? 24.626 60.841 5.667   1.00 2.76   ? 233  VAL A C   1 
ATOM   853  O  O   . VAL A 1 106 ? 23.968 60.107 6.382   1.00 4.47   ? 233  VAL A O   1 
ATOM   854  C  CB  . VAL A 1 106 ? 26.967 59.977 5.600   1.00 3.56   ? 233  VAL A CB  1 
ATOM   855  C  CG1 . VAL A 1 106 ? 26.794 59.656 4.122   1.00 4.28   ? 233  VAL A CG1 1 
ATOM   856  C  CG2 . VAL A 1 106 ? 28.444 60.275 5.915   1.00 5.35   ? 233  VAL A CG2 1 
ATOM   857  N  N   . LEU A 1 107 ? 24.161 61.414 4.589   1.00 3.87   ? 234  LEU A N   1 
ATOM   858  C  CA  . LEU A 1 107 ? 22.824 61.181 4.069   1.00 3.07   ? 234  LEU A CA  1 
ATOM   859  C  C   . LEU A 1 107 ? 22.946 60.606 2.669   1.00 4.70   ? 234  LEU A C   1 
ATOM   860  O  O   . LEU A 1 107 ? 23.646 61.213 1.843   1.00 5.11   ? 234  LEU A O   1 
ATOM   861  C  CB  . LEU A 1 107 ? 22.083 62.486 4.021   1.00 4.57   ? 234  LEU A CB  1 
ATOM   862  C  CG  . LEU A 1 107 ? 20.648 62.615 3.624   1.00 9.36   ? 234  LEU A CG  1 
ATOM   863  C  CD1 . LEU A 1 107 ? 19.736 61.563 4.225   1.00 6.29   ? 234  LEU A CD1 1 
ATOM   864  C  CD2 . LEU A 1 107 ? 20.115 64.004 3.970   1.00 6.71   ? 234  LEU A CD2 1 
ATOM   865  N  N   . ILE A 1 108 ? 22.336 59.460 2.379   1.00 2.40   ? 235  ILE A N   1 
ATOM   866  C  CA  . ILE A 1 108 ? 22.268 58.855 1.091   1.00 3.70   ? 235  ILE A CA  1 
ATOM   867  C  C   . ILE A 1 108 ? 20.811 58.958 0.615   1.00 4.18   ? 235  ILE A C   1 
ATOM   868  O  O   . ILE A 1 108 ? 19.981 58.228 1.170   1.00 4.53   ? 235  ILE A O   1 
ATOM   869  C  CB  . ILE A 1 108 ? 22.742 57.388 1.087   1.00 4.55   ? 235  ILE A CB  1 
ATOM   870  C  CG1 . ILE A 1 108 ? 24.135 57.202 1.705   1.00 5.08   ? 235  ILE A CG1 1 
ATOM   871  C  CG2 . ILE A 1 108 ? 22.688 56.867 -0.320  1.00 6.50   ? 235  ILE A CG2 1 
ATOM   872  C  CD1 . ILE A 1 108 ? 25.231 57.957 1.021   1.00 8.13   ? 235  ILE A CD1 1 
ATOM   873  N  N   . ILE A 1 109 ? 20.553 59.826 -0.325  1.00 3.59   ? 236  ILE A N   1 
ATOM   874  C  CA  . ILE A 1 109 ? 19.174 60.068 -0.808  1.00 2.89   ? 236  ILE A CA  1 
ATOM   875  C  C   . ILE A 1 109 ? 19.001 59.239 -2.044  1.00 3.67   ? 236  ILE A C   1 
ATOM   876  O  O   . ILE A 1 109 ? 19.848 59.291 -2.954  1.00 4.65   ? 236  ILE A O   1 
ATOM   877  C  CB  . ILE A 1 109 ? 18.965 61.563 -1.085  1.00 4.29   ? 236  ILE A CB  1 
ATOM   878  C  CG1 . ILE A 1 109 ? 19.283 62.406 0.152   1.00 5.15   ? 236  ILE A CG1 1 
ATOM   879  C  CG2 . ILE A 1 109 ? 17.563 61.807 -1.611  1.00 4.88   ? 236  ILE A CG2 1 
ATOM   880  C  CD1 . ILE A 1 109 ? 19.693 63.838 -0.157  1.00 7.15   ? 236  ILE A CD1 1 
ATOM   881  N  N   . ILE A 1 110 ? 17.943 58.438 -2.112  1.00 3.36   ? 237  ILE A N   1 
ATOM   882  C  CA  . ILE A 1 110 ? 17.719 57.555 -3.267  1.00 3.37   ? 237  ILE A CA  1 
ATOM   883  C  C   . ILE A 1 110 ? 16.401 57.950 -3.889  1.00 3.46   ? 237  ILE A C   1 
ATOM   884  O  O   . ILE A 1 110 ? 15.380 57.874 -3.135  1.00 4.49   ? 237  ILE A O   1 
ATOM   885  C  CB  . ILE A 1 110 ? 17.715 56.082 -2.856  1.00 4.38   ? 237  ILE A CB  1 
ATOM   886  C  CG1 . ILE A 1 110 ? 18.965 55.671 -2.128  1.00 5.14   ? 237  ILE A CG1 1 
ATOM   887  C  CG2 . ILE A 1 110 ? 17.473 55.231 -4.089  1.00 7.62   ? 237  ILE A CG2 1 
ATOM   888  C  CD1 . ILE A 1 110 ? 18.945 54.385 -1.339  1.00 12.63  ? 237  ILE A CD1 1 
ATOM   889  N  N   . THR A 1 111 ? 16.352 58.351 -5.142  1.00 3.50   ? 238  THR A N   1 
ATOM   890  C  CA  . THR A 1 111 ? 15.101 58.861 -5.695  1.00 3.23   ? 238  THR A CA  1 
ATOM   891  C  C   . THR A 1 111 ? 14.949 58.487 -7.148  1.00 3.82   ? 238  THR A C   1 
ATOM   892  O  O   . THR A 1 111 ? 15.925 58.307 -7.866  1.00 4.92   ? 238  THR A O   1 
ATOM   893  C  CB  . THR A 1 111 ? 15.012 60.385 -5.483  1.00 5.53   ? 238  THR A CB  1 
ATOM   894  O  OG1 . THR A 1 111 ? 13.715 60.859 -5.887  1.00 5.14   ? 238  THR A OG1 1 
ATOM   895  C  CG2 . THR A 1 111 ? 16.042 61.161 -6.315  1.00 5.10   ? 238  THR A CG2 1 
ATOM   896  N  N   . ASP A 1 112 ? 13.698 58.328 -7.603  1.00 3.37   ? 239  ASP A N   1 
ATOM   897  C  CA  . ASP A 1 112 ? 13.452 58.041 -9.004  1.00 3.12   ? 239  ASP A CA  1 
ATOM   898  C  C   . ASP A 1 112 ? 12.726 59.181 -9.694  1.00 3.40   ? 239  ASP A C   1 
ATOM   899  O  O   . ASP A 1 112 ? 12.160 59.001 -10.795 1.00 5.67   ? 239  ASP A O   1 
ATOM   900  C  CB  . ASP A 1 112 ? 12.669 56.735 -9.185  1.00 5.07   ? 239  ASP A CB  1 
ATOM   901  C  CG  . ASP A 1 112 ? 11.162 56.864 -9.077  1.00 4.77   ? 239  ASP A CG  1 
ATOM   902  O  OD1 . ASP A 1 112 ? 10.673 57.768 -8.374  1.00 5.25   ? 239  ASP A OD1 1 
ATOM   903  O  OD2 . ASP A 1 112 ? 10.455 56.037 -9.701  1.00 5.25   ? 239  ASP A OD2 1 
ATOM   904  N  N   . GLY A 1 113 ? 12.739 60.388 -9.130  1.00 4.15   ? 240  GLY A N   1 
ATOM   905  C  CA  . GLY A 1 113 ? 12.130 61.501 -9.851  1.00 6.12   ? 240  GLY A CA  1 
ATOM   906  C  C   . GLY A 1 113 ? 12.444 62.836 -9.212  1.00 4.33   ? 240  GLY A C   1 
ATOM   907  O  O   . GLY A 1 113 ? 13.054 62.915 -8.151  1.00 5.27   ? 240  GLY A O   1 
ATOM   908  N  N   . GLU A 1 114 ? 12.014 63.870 -9.942  1.00 5.59   ? 241  GLU A N   1 
ATOM   909  C  CA  . GLU A 1 114 ? 12.229 65.223 -9.412  1.00 8.24   ? 241  GLU A CA  1 
ATOM   910  C  C   . GLU A 1 114 ? 11.355 65.480 -8.209  1.00 4.25   ? 241  GLU A C   1 
ATOM   911  O  O   . GLU A 1 114 ? 10.263 64.948 -8.040  1.00 4.87   ? 241  GLU A O   1 
ATOM   912  C  CB  . GLU A 1 114 ? 11.943 66.261 -10.513 1.00 7.42   ? 241  GLU A CB  1 
ATOM   913  C  CG  . GLU A 1 114 ? 12.944 66.179 -11.651 1.00 11.68  ? 241  GLU A CG  1 
ATOM   914  C  CD  . GLU A 1 114 ? 12.664 67.134 -12.800 1.00 18.39  ? 241  GLU A CD  1 
ATOM   915  O  OE1 . GLU A 1 114 ? 12.196 68.266 -12.530 1.00 16.16  ? 241  GLU A OE1 1 
ATOM   916  O  OE2 . GLU A 1 114 ? 12.959 66.686 -13.936 1.00 19.17  ? 241  GLU A OE2 1 
ATOM   917  N  N   . ALA A 1 115 ? 11.815 66.338 -7.329  1.00 5.20   ? 242  ALA A N   1 
ATOM   918  C  CA  . ALA A 1 115 ? 11.057 66.756 -6.163  1.00 5.03   ? 242  ALA A CA  1 
ATOM   919  C  C   . ALA A 1 115 ? 9.701  67.359 -6.538  1.00 5.00   ? 242  ALA A C   1 
ATOM   920  O  O   . ALA A 1 115 ? 9.623  68.159 -7.486  1.00 6.81   ? 242  ALA A O   1 
ATOM   921  C  CB  . ALA A 1 115 ? 11.877 67.748 -5.335  1.00 5.49   ? 242  ALA A CB  1 
ATOM   922  N  N   . THR A 1 116 ? 8.661  67.031 -5.786  1.00 4.85   ? 243  THR A N   1 
ATOM   923  C  CA  . THR A 1 116 ? 7.382  67.671 -6.071  1.00 5.28   ? 243  THR A CA  1 
ATOM   924  C  C   . THR A 1 116 ? 7.192  68.889 -5.176  1.00 4.91   ? 243  THR A C   1 
ATOM   925  O  O   . THR A 1 116 ? 6.308  69.697 -5.517  1.00 5.90   ? 243  THR A O   1 
ATOM   926  C  CB  . THR A 1 116 ? 6.190  66.738 -5.859  1.00 6.76   ? 243  THR A CB  1 
ATOM   927  O  OG1 . THR A 1 116 ? 6.499  66.176 -4.599  1.00 8.13   ? 243  THR A OG1 1 
ATOM   928  C  CG2 . THR A 1 116 ? 6.111  65.656 -6.899  1.00 6.80   ? 243  THR A CG2 1 
ATOM   929  N  N   . ASP A 1 117 ? 7.929  69.077 -4.119  1.00 3.17   ? 244  ASP A N   1 
ATOM   930  C  CA  . ASP A 1 117 ? 7.723  70.183 -3.176  1.00 5.07   ? 244  ASP A CA  1 
ATOM   931  C  C   . ASP A 1 117 ? 8.782  71.255 -3.464  1.00 3.10   ? 244  ASP A C   1 
ATOM   932  O  O   . ASP A 1 117 ? 9.378  71.290 -4.535  1.00 5.29   ? 244  ASP A O   1 
ATOM   933  C  CB  . ASP A 1 117 ? 7.595  69.710 -1.742  1.00 4.91   ? 244  ASP A CB  1 
ATOM   934  C  CG  . ASP A 1 117 ? 8.851  69.083 -1.119  1.00 4.23   ? 244  ASP A CG  1 
ATOM   935  O  OD1 . ASP A 1 117 ? 9.773  68.868 -1.941  1.00 5.01   ? 244  ASP A OD1 1 
ATOM   936  O  OD2 . ASP A 1 117 ? 8.818  68.885 0.123   1.00 5.10   ? 244  ASP A OD2 1 
ATOM   937  N  N   . SER A 1 118 ? 8.957  72.166 -2.521  1.00 3.49   ? 245  SER A N   1 
ATOM   938  C  CA  . SER A 1 118 ? 9.706  73.380 -2.714  1.00 3.27   ? 245  SER A CA  1 
ATOM   939  C  C   . SER A 1 118 ? 10.140 73.880 -1.351  1.00 2.94   ? 245  SER A C   1 
ATOM   940  O  O   . SER A 1 118 ? 9.599  73.544 -0.309  1.00 4.52   ? 245  SER A O   1 
ATOM   941  C  CB  . SER A 1 118 ? 8.884  74.441 -3.432  1.00 4.04   ? 245  SER A CB  1 
ATOM   942  O  OG  . SER A 1 118 ? 7.718  74.753 -2.667  1.00 4.43   ? 245  SER A OG  1 
ATOM   943  N  N   . GLY A 1 119 ? 11.160 74.756 -1.393  1.00 3.80   ? 246  GLY A N   1 
ATOM   944  C  CA  . GLY A 1 119 ? 11.670 75.378 -0.182  1.00 4.79   ? 246  GLY A CA  1 
ATOM   945  C  C   . GLY A 1 119 ? 13.192 75.474 -0.166  1.00 4.80   ? 246  GLY A C   1 
ATOM   946  O  O   . GLY A 1 119 ? 13.790 75.865 -1.177  1.00 6.41   ? 246  GLY A O   1 
ATOM   947  N  N   . ASN A 1 120 ? 13.749 75.099 0.959   1.00 3.18   ? 247  ASN A N   1 
ATOM   948  C  CA  . ASN A 1 120 ? 15.213 75.029 1.031   1.00 3.25   ? 247  ASN A CA  1 
ATOM   949  C  C   . ASN A 1 120 ? 15.598 73.873 1.946   1.00 3.58   ? 247  ASN A C   1 
ATOM   950  O  O   . ASN A 1 120 ? 14.794 73.340 2.714   1.00 3.49   ? 247  ASN A O   1 
ATOM   951  C  CB  . ASN A 1 120 ? 15.795 76.368 1.468   1.00 4.02   ? 247  ASN A CB  1 
ATOM   952  C  CG  . ASN A 1 120 ? 15.641 76.625 2.940   1.00 4.87   ? 247  ASN A CG  1 
ATOM   953  O  OD1 . ASN A 1 120 ? 16.008 75.880 3.827   1.00 5.76   ? 247  ASN A OD1 1 
ATOM   954  N  ND2 . ASN A 1 120 ? 15.046 77.784 3.293   1.00 7.83   ? 247  ASN A ND2 1 
ATOM   955  N  N   . ILE A 1 121 ? 16.881 73.499 1.876   1.00 3.14   ? 248  ILE A N   1 
ATOM   956  C  CA  . ILE A 1 121 ? 17.442 72.491 2.763   1.00 3.34   ? 248  ILE A CA  1 
ATOM   957  C  C   . ILE A 1 121 ? 18.595 73.057 3.583   1.00 4.93   ? 248  ILE A C   1 
ATOM   958  O  O   . ILE A 1 121 ? 19.502 72.297 3.950   1.00 4.41   ? 248  ILE A O   1 
ATOM   959  C  CB  . ILE A 1 121 ? 17.883 71.228 1.999   1.00 4.35   ? 248  ILE A CB  1 
ATOM   960  C  CG1 . ILE A 1 121 ? 19.008 71.498 0.982   1.00 3.89   ? 248  ILE A CG1 1 
ATOM   961  C  CG2 . ILE A 1 121 ? 16.696 70.512 1.349   1.00 3.78   ? 248  ILE A CG2 1 
ATOM   962  C  CD1 . ILE A 1 121 ? 19.901 70.298 0.797   1.00 7.51   ? 248  ILE A CD1 1 
ATOM   963  N  N   . ASP A 1 122 ? 18.511 74.336 3.930   1.00 5.17   ? 249  ASP A N   1 
ATOM   964  C  CA  . ASP A 1 122 ? 19.540 74.972 4.795   1.00 4.39   ? 249  ASP A CA  1 
ATOM   965  C  C   . ASP A 1 122 ? 19.890 74.146 6.000   1.00 6.18   ? 249  ASP A C   1 
ATOM   966  O  O   . ASP A 1 122 ? 21.082 73.978 6.358   1.00 6.59   ? 249  ASP A O   1 
ATOM   967  C  CB  . ASP A 1 122 ? 19.050 76.319 5.365   1.00 9.44   ? 249  ASP A CB  1 
ATOM   968  C  CG  . ASP A 1 122 ? 18.815 77.394 4.332   1.00 8.03   ? 249  ASP A CG  1 
ATOM   969  O  OD1 . ASP A 1 122 ? 18.932 77.184 3.125   1.00 8.09   ? 249  ASP A OD1 1 
ATOM   970  O  OD2 . ASP A 1 122 ? 18.499 78.552 4.796   1.00 12.93  ? 249  ASP A OD2 1 
ATOM   971  N  N   . ALA A 1 123 ? 18.929 73.584 6.691   1.00 4.93   ? 250  ALA A N   1 
ATOM   972  C  CA  . ALA A 1 123 ? 19.160 72.882 7.918   1.00 5.57   ? 250  ALA A CA  1 
ATOM   973  C  C   . ALA A 1 123 ? 20.012 71.610 7.746   1.00 4.87   ? 250  ALA A C   1 
ATOM   974  O  O   . ALA A 1 123 ? 20.555 71.118 8.748   1.00 8.09   ? 250  ALA A O   1 
ATOM   975  C  CB  . ALA A 1 123 ? 17.819 72.475 8.548   1.00 9.16   ? 250  ALA A CB  1 
ATOM   976  N  N   . ALA A 1 124 ? 20.105 71.101 6.535   1.00 4.64   ? 251  ALA A N   1 
ATOM   977  C  CA  . ALA A 1 124 ? 20.855 69.883 6.240   1.00 3.11   ? 251  ALA A CA  1 
ATOM   978  C  C   . ALA A 1 124 ? 22.182 70.136 5.532   1.00 3.12   ? 251  ALA A C   1 
ATOM   979  O  O   . ALA A 1 124 ? 22.880 69.152 5.230   1.00 4.45   ? 251  ALA A O   1 
ATOM   980  C  CB  . ALA A 1 124 ? 20.016 68.974 5.358   1.00 6.06   ? 251  ALA A CB  1 
ATOM   981  N  N   . LYS A 1 125 ? 22.561 71.378 5.248   1.00 3.67   ? 252  LYS A N   1 
ATOM   982  C  CA  . LYS A 1 125 ? 23.700 71.628 4.367   1.00 2.91   ? 252  LYS A CA  1 
ATOM   983  C  C   . LYS A 1 125 ? 25.013 71.120 4.934   1.00 3.33   ? 252  LYS A C   1 
ATOM   984  O  O   . LYS A 1 125 ? 25.916 70.794 4.149   1.00 4.30   ? 252  LYS A O   1 
ATOM   985  C  CB  . LYS A 1 125 ? 23.754 73.115 4.055   1.00 6.30   ? 252  LYS A CB  1 
ATOM   986  C  CG  . LYS A 1 125 ? 22.648 73.639 3.167   1.00 7.79   ? 252  LYS A CG  1 
ATOM   987  C  CD  . LYS A 1 125 ? 22.779 73.226 1.722   1.00 8.51   ? 252  LYS A CD  1 
ATOM   988  C  CE  . LYS A 1 125 ? 24.119 73.719 1.129   1.00 6.66   ? 252  LYS A CE  1 
ATOM   989  N  NZ  . LYS A 1 125 ? 23.975 73.880 -0.344  1.00 8.47   ? 252  LYS A NZ  1 
ATOM   990  N  N   . ASP A 1 126 ? 25.188 71.035 6.229   1.00 3.66   ? 253  ASP A N   1 
ATOM   991  C  CA  . ASP A 1 126 ? 26.481 70.586 6.741   1.00 4.26   ? 253  ASP A CA  1 
ATOM   992  C  C   . ASP A 1 126 ? 26.577 69.064 6.736   1.00 5.84   ? 253  ASP A C   1 
ATOM   993  O  O   . ASP A 1 126 ? 27.637 68.519 7.041   1.00 7.25   ? 253  ASP A O   1 
ATOM   994  C  CB  . ASP A 1 126 ? 26.758 71.153 8.124   1.00 7.25   ? 253  ASP A CB  1 
ATOM   995  C  CG  . ASP A 1 126 ? 25.782 70.774 9.213   1.00 17.00  ? 253  ASP A CG  1 
ATOM   996  O  OD1 . ASP A 1 126 ? 24.831 70.003 8.980   1.00 16.65  ? 253  ASP A OD1 1 
ATOM   997  O  OD2 . ASP A 1 126 ? 25.975 71.221 10.376  1.00 20.55  ? 253  ASP A OD2 1 
ATOM   998  N  N   . ILE A 1 127 ? 25.539 68.328 6.447   1.00 5.12   ? 254  ILE A N   1 
ATOM   999  C  CA  . ILE A 1 127 ? 25.597 66.879 6.330   1.00 3.02   ? 254  ILE A CA  1 
ATOM   1000 C  C   . ILE A 1 127 ? 26.257 66.560 5.010   1.00 2.54   ? 254  ILE A C   1 
ATOM   1001 O  O   . ILE A 1 127 ? 26.029 67.241 4.037   1.00 3.97   ? 254  ILE A O   1 
ATOM   1002 C  CB  . ILE A 1 127 ? 24.162 66.301 6.407   1.00 4.13   ? 254  ILE A CB  1 
ATOM   1003 C  CG1 . ILE A 1 127 ? 23.453 66.658 7.717   1.00 6.21   ? 254  ILE A CG1 1 
ATOM   1004 C  CG2 . ILE A 1 127 ? 24.187 64.808 6.163   1.00 6.37   ? 254  ILE A CG2 1 
ATOM   1005 C  CD1 . ILE A 1 127 ? 21.947 66.396 7.667   1.00 7.13   ? 254  ILE A CD1 1 
ATOM   1006 N  N   . ILE A 1 128 ? 27.065 65.509 4.918   1.00 4.18   ? 255  ILE A N   1 
ATOM   1007 C  CA  . ILE A 1 128 ? 27.597 65.013 3.672   1.00 3.13   ? 255  ILE A CA  1 
ATOM   1008 C  C   . ILE A 1 128 ? 26.466 64.297 2.942   1.00 3.28   ? 255  ILE A C   1 
ATOM   1009 O  O   . ILE A 1 128 ? 25.935 63.320 3.516   1.00 3.60   ? 255  ILE A O   1 
ATOM   1010 C  CB  . ILE A 1 128 ? 28.791 64.072 3.906   1.00 4.55   ? 255  ILE A CB  1 
ATOM   1011 C  CG1 . ILE A 1 128 ? 29.951 64.794 4.578   1.00 6.63   ? 255  ILE A CG1 1 
ATOM   1012 C  CG2 . ILE A 1 128 ? 29.253 63.398 2.616   1.00 6.94   ? 255  ILE A CG2 1 
ATOM   1013 C  CD1 . ILE A 1 128 ? 31.051 63.875 5.072   1.00 9.77   ? 255  ILE A CD1 1 
ATOM   1014 N  N   . ARG A 1 129 ? 26.103 64.772 1.767   1.00 2.89   ? 256  ARG A N   1 
ATOM   1015 C  CA  . ARG A 1 129 ? 24.915 64.325 1.087   1.00 2.15   ? 256  ARG A CA  1 
ATOM   1016 C  C   . ARG A 1 129 ? 25.228 63.774 -0.288  1.00 3.83   ? 256  ARG A C   1 
ATOM   1017 O  O   . ARG A 1 129 ? 25.695 64.534 -1.141  1.00 4.40   ? 256  ARG A O   1 
ATOM   1018 C  CB  . ARG A 1 129 ? 23.947 65.521 0.963   1.00 3.00   ? 256  ARG A CB  1 
ATOM   1019 C  CG  . ARG A 1 129 ? 23.302 65.893 2.275   1.00 3.64   ? 256  ARG A CG  1 
ATOM   1020 C  CD  . ARG A 1 129 ? 22.810 67.285 2.424   1.00 4.28   ? 256  ARG A CD  1 
ATOM   1021 N  NE  . ARG A 1 129 ? 23.884 68.291 2.369   1.00 5.11   ? 256  ARG A NE  1 
ATOM   1022 C  CZ  . ARG A 1 129 ? 24.134 69.090 1.355   1.00 4.74   ? 256  ARG A CZ  1 
ATOM   1023 N  NH1 . ARG A 1 129 ? 23.454 69.092 0.189   1.00 3.92   ? 256  ARG A NH1 1 
ATOM   1024 N  NH2 . ARG A 1 129 ? 25.127 69.977 1.458   1.00 4.98   ? 256  ARG A NH2 1 
ATOM   1025 N  N   . TYR A 1 130 ? 24.982 62.491 -0.527  1.00 2.92   ? 257  TYR A N   1 
ATOM   1026 C  CA  . TYR A 1 130 ? 24.967 61.859 -1.814  1.00 2.66   ? 257  TYR A CA  1 
ATOM   1027 C  C   . TYR A 1 130 ? 23.530 61.730 -2.283  1.00 3.26   ? 257  TYR A C   1 
ATOM   1028 O  O   . TYR A 1 130 ? 22.648 61.443 -1.430  1.00 4.29   ? 257  TYR A O   1 
ATOM   1029 C  CB  . TYR A 1 130 ? 25.588 60.451 -1.741  1.00 4.59   ? 257  TYR A CB  1 
ATOM   1030 C  CG  . TYR A 1 130 ? 27.092 60.463 -1.565  1.00 4.65   ? 257  TYR A CG  1 
ATOM   1031 C  CD1 . TYR A 1 130 ? 27.690 60.507 -0.306  1.00 6.62   ? 257  TYR A CD1 1 
ATOM   1032 C  CD2 . TYR A 1 130 ? 27.836 60.423 -2.727  1.00 4.37   ? 257  TYR A CD2 1 
ATOM   1033 C  CE1 . TYR A 1 130 ? 29.082 60.515 -0.233  1.00 6.34   ? 257  TYR A CE1 1 
ATOM   1034 C  CE2 . TYR A 1 130 ? 29.227 60.438 -2.659  1.00 8.20   ? 257  TYR A CE2 1 
ATOM   1035 C  CZ  . TYR A 1 130 ? 29.792 60.477 -1.416  1.00 5.91   ? 257  TYR A CZ  1 
ATOM   1036 O  OH  . TYR A 1 130 ? 31.211 60.497 -1.376  1.00 10.65  ? 257  TYR A OH  1 
ATOM   1037 N  N   . ILE A 1 131 ? 23.296 61.898 -3.547  1.00 3.55   ? 258  ILE A N   1 
ATOM   1038 C  CA  . ILE A 1 131 ? 21.952 61.627 -4.086  1.00 4.02   ? 258  ILE A CA  1 
ATOM   1039 C  C   . ILE A 1 131 ? 22.170 60.690 -5.259  1.00 4.02   ? 258  ILE A C   1 
ATOM   1040 O  O   . ILE A 1 131 ? 23.022 60.896 -6.128  1.00 4.95   ? 258  ILE A O   1 
ATOM   1041 C  CB  . ILE A 1 131 ? 21.172 62.894 -4.399  1.00 3.77   ? 258  ILE A CB  1 
ATOM   1042 C  CG1 . ILE A 1 131 ? 19.698 62.577 -4.742  1.00 3.31   ? 258  ILE A CG1 1 
ATOM   1043 C  CG2 . ILE A 1 131 ? 21.792 63.744 -5.483  1.00 6.70   ? 258  ILE A CG2 1 
ATOM   1044 C  CD1 . ILE A 1 131 ? 18.784 63.764 -4.634  1.00 4.78   ? 258  ILE A CD1 1 
ATOM   1045 N  N   . ILE A 1 132 ? 21.362 59.636 -5.285  1.00 4.13   ? 259  ILE A N   1 
ATOM   1046 C  CA  . ILE A 1 132 ? 21.286 58.678 -6.346  1.00 3.63   ? 259  ILE A CA  1 
ATOM   1047 C  C   . ILE A 1 132 ? 19.959 58.835 -7.079  1.00 4.43   ? 259  ILE A C   1 
ATOM   1048 O  O   . ILE A 1 132 ? 18.886 58.644 -6.463  1.00 5.66   ? 259  ILE A O   1 
ATOM   1049 C  CB  . ILE A 1 132 ? 21.410 57.254 -5.791  1.00 6.25   ? 259  ILE A CB  1 
ATOM   1050 C  CG1 . ILE A 1 132 ? 22.725 56.999 -5.087  1.00 7.39   ? 259  ILE A CG1 1 
ATOM   1051 C  CG2 . ILE A 1 132 ? 21.196 56.237 -6.903  1.00 10.08  ? 259  ILE A CG2 1 
ATOM   1052 C  CD1 . ILE A 1 132 ? 22.803 55.802 -4.182  1.00 7.04   ? 259  ILE A CD1 1 
ATOM   1053 N  N   . GLY A 1 133 ? 20.033 59.194 -8.336  1.00 4.49   ? 260  GLY A N   1 
ATOM   1054 C  CA  . GLY A 1 133 ? 18.876 59.345 -9.192  1.00 4.57   ? 260  GLY A CA  1 
ATOM   1055 C  C   . GLY A 1 133 ? 18.798 58.108 -10.065 1.00 11.24  ? 260  GLY A C   1 
ATOM   1056 O  O   . GLY A 1 133 ? 19.665 57.915 -10.906 1.00 8.44   ? 260  GLY A O   1 
ATOM   1057 N  N   . ILE A 1 134 ? 17.800 57.274 -9.850  1.00 8.22   ? 261  ILE A N   1 
ATOM   1058 C  CA  . ILE A 1 134 ? 17.669 55.993 -10.542 1.00 9.00   ? 261  ILE A CA  1 
ATOM   1059 C  C   . ILE A 1 134 ? 16.540 56.035 -11.547 1.00 13.82  ? 261  ILE A C   1 
ATOM   1060 O  O   . ILE A 1 134 ? 15.436 56.595 -11.385 1.00 10.43  ? 261  ILE A O   1 
ATOM   1061 C  CB  . ILE A 1 134 ? 17.520 54.871 -9.522  1.00 12.22  ? 261  ILE A CB  1 
ATOM   1062 C  CG1 . ILE A 1 134 ? 17.482 53.478 -10.193 1.00 17.44  ? 261  ILE A CG1 1 
ATOM   1063 C  CG2 . ILE A 1 134 ? 16.314 54.984 -8.577  1.00 16.51  ? 261  ILE A CG2 1 
ATOM   1064 C  CD1 . ILE A 1 134 ? 18.800 52.749 -10.049 1.00 18.53  ? 261  ILE A CD1 1 
ATOM   1065 N  N   . GLY A 1 135 ? 16.820 55.459 -12.722 1.00 16.75  ? 262  GLY A N   1 
ATOM   1066 C  CA  . GLY A 1 135 ? 15.795 55.250 -13.730 1.00 11.50  ? 262  GLY A CA  1 
ATOM   1067 C  C   . GLY A 1 135 ? 15.585 56.302 -14.768 1.00 12.89  ? 262  GLY A C   1 
ATOM   1068 O  O   . GLY A 1 135 ? 16.303 57.297 -14.883 1.00 15.40  ? 262  GLY A O   1 
ATOM   1069 N  N   . LYS A 1 136 ? 14.531 56.103 -15.565 1.00 14.86  ? 263  LYS A N   1 
ATOM   1070 C  CA  . LYS A 1 136 ? 14.138 56.843 -16.750 1.00 17.65  ? 263  LYS A CA  1 
ATOM   1071 C  C   . LYS A 1 136 ? 13.811 58.300 -16.605 1.00 15.78  ? 263  LYS A C   1 
ATOM   1072 O  O   . LYS A 1 136 ? 13.863 59.107 -17.544 1.00 17.74  ? 263  LYS A O   1 
ATOM   1073 C  CB  . LYS A 1 136 ? 12.875 56.187 -17.373 1.00 28.06  ? 263  LYS A CB  1 
ATOM   1074 C  CG  . LYS A 1 136 ? 11.666 55.964 -16.485 1.00 52.49  ? 263  LYS A CG  1 
ATOM   1075 C  CD  . LYS A 1 136 ? 10.661 57.083 -16.405 1.00 62.36  ? 263  LYS A CD  1 
ATOM   1076 C  CE  . LYS A 1 136 ? 9.982  57.278 -17.759 1.00 67.58  ? 263  LYS A CE  1 
ATOM   1077 N  NZ  . LYS A 1 136 ? 10.328 58.618 -18.323 1.00 61.02  ? 263  LYS A NZ  1 
ATOM   1078 N  N   . HIS A 1 137 ? 13.424 58.730 -15.397 1.00 9.73   ? 264  HIS A N   1 
ATOM   1079 C  CA  . HIS A 1 137 ? 13.097 60.135 -15.243 1.00 12.32  ? 264  HIS A CA  1 
ATOM   1080 C  C   . HIS A 1 137 ? 14.335 60.994 -15.252 1.00 12.05  ? 264  HIS A C   1 
ATOM   1081 O  O   . HIS A 1 137 ? 14.227 62.210 -15.320 1.00 18.76  ? 264  HIS A O   1 
ATOM   1082 C  CB  . HIS A 1 137 ? 12.322 60.396 -13.943 1.00 13.61  ? 264  HIS A CB  1 
ATOM   1083 C  CG  . HIS A 1 137 ? 10.914 59.916 -14.009 1.00 14.82  ? 264  HIS A CG  1 
ATOM   1084 N  ND1 . HIS A 1 137 ? 9.896  60.657 -14.572 1.00 30.71  ? 264  HIS A ND1 1 
ATOM   1085 C  CD2 . HIS A 1 137 ? 10.378 58.751 -13.574 1.00 18.27  ? 264  HIS A CD2 1 
ATOM   1086 C  CE1 . HIS A 1 137 ? 8.777  59.963 -14.473 1.00 30.30  ? 264  HIS A CE1 1 
ATOM   1087 N  NE2 . HIS A 1 137 ? 9.030  58.809 -13.880 1.00 26.54  ? 264  HIS A NE2 1 
ATOM   1088 N  N   . PHE A 1 138 ? 15.513 60.368 -15.207 1.00 10.45  ? 265  PHE A N   1 
ATOM   1089 C  CA  . PHE A 1 138 ? 16.713 61.205 -15.247 1.00 9.21   ? 265  PHE A CA  1 
ATOM   1090 C  C   . PHE A 1 138 ? 17.465 61.016 -16.551 1.00 13.73  ? 265  PHE A C   1 
ATOM   1091 O  O   . PHE A 1 138 ? 18.685 61.011 -16.574 1.00 17.83  ? 265  PHE A O   1 
ATOM   1092 C  CB  . PHE A 1 138 ? 17.605 60.888 -14.042 1.00 10.88  ? 265  PHE A CB  1 
ATOM   1093 C  CG  . PHE A 1 138 ? 16.887 61.244 -12.736 1.00 8.76   ? 265  PHE A CG  1 
ATOM   1094 C  CD1 . PHE A 1 138 ? 16.640 62.562 -12.435 1.00 8.45   ? 265  PHE A CD1 1 
ATOM   1095 C  CD2 . PHE A 1 138 ? 16.468 60.280 -11.837 1.00 9.75   ? 265  PHE A CD2 1 
ATOM   1096 C  CE1 . PHE A 1 138 ? 15.974 62.947 -11.286 1.00 9.75   ? 265  PHE A CE1 1 
ATOM   1097 C  CE2 . PHE A 1 138 ? 15.791 60.664 -10.683 1.00 7.33   ? 265  PHE A CE2 1 
ATOM   1098 C  CZ  . PHE A 1 138 ? 15.548 61.983 -10.396 1.00 7.01   ? 265  PHE A CZ  1 
ATOM   1099 N  N   . GLN A 1 139 ? 16.740 60.812 -17.645 1.00 17.50  ? 266  GLN A N   1 
ATOM   1100 C  CA  . GLN A 1 139 ? 17.452 60.528 -18.891 1.00 24.09  ? 266  GLN A CA  1 
ATOM   1101 C  C   . GLN A 1 139 ? 18.017 61.797 -19.505 1.00 16.92  ? 266  GLN A C   1 
ATOM   1102 O  O   . GLN A 1 139 ? 19.050 61.778 -20.169 1.00 32.20  ? 266  GLN A O   1 
ATOM   1103 C  CB  . GLN A 1 139 ? 16.554 59.859 -19.922 1.00 31.21  ? 266  GLN A CB  1 
ATOM   1104 C  CG  . GLN A 1 139 ? 15.797 58.612 -19.508 1.00 52.84  ? 266  GLN A CG  1 
ATOM   1105 C  CD  . GLN A 1 139 ? 14.850 58.205 -20.636 1.00 61.81  ? 266  GLN A CD  1 
ATOM   1106 O  OE1 . GLN A 1 139 ? 13.735 58.732 -20.710 1.00 24.18  ? 266  GLN A OE1 1 
ATOM   1107 N  NE2 . GLN A 1 139 ? 15.326 57.299 -21.485 1.00 74.34  ? 266  GLN A NE2 1 
ATOM   1108 N  N   . THR A 1 140 ? 17.380 62.949 -19.304 1.00 18.55  ? 267  THR A N   1 
ATOM   1109 C  CA  . THR A 1 140 ? 18.084 64.137 -19.797 1.00 22.05  ? 267  THR A CA  1 
ATOM   1110 C  C   . THR A 1 140 ? 18.968 64.831 -18.776 1.00 27.06  ? 267  THR A C   1 
ATOM   1111 O  O   . THR A 1 140 ? 18.774 64.741 -17.556 1.00 20.11  ? 267  THR A O   1 
ATOM   1112 C  CB  . THR A 1 140 ? 17.025 65.167 -20.231 1.00 27.75  ? 267  THR A CB  1 
ATOM   1113 O  OG1 . THR A 1 140 ? 16.137 65.306 -19.135 1.00 25.51  ? 267  THR A OG1 1 
ATOM   1114 C  CG2 . THR A 1 140 ? 16.227 64.620 -21.399 1.00 66.64  ? 267  THR A CG2 1 
ATOM   1115 N  N   . LYS A 1 141 ? 19.944 65.570 -19.281 1.00 21.14  ? 268  LYS A N   1 
ATOM   1116 C  CA  . LYS A 1 141 ? 20.881 66.307 -18.439 1.00 18.74  ? 268  LYS A CA  1 
ATOM   1117 C  C   . LYS A 1 141 ? 20.178 67.270 -17.519 1.00 13.76  ? 268  LYS A C   1 
ATOM   1118 O  O   . LYS A 1 141 ? 20.534 67.426 -16.351 1.00 16.21  ? 268  LYS A O   1 
ATOM   1119 C  CB  . LYS A 1 141 ? 21.855 67.046 -19.368 1.00 30.81  ? 268  LYS A CB  1 
ATOM   1120 C  CG  . LYS A 1 141 ? 22.632 68.191 -18.750 1.00 44.98  ? 268  LYS A CG  1 
ATOM   1121 C  CD  . LYS A 1 141 ? 23.525 68.883 -19.785 1.00 55.10  ? 268  LYS A CD  1 
ATOM   1122 C  CE  . LYS A 1 141 ? 24.975 69.015 -19.354 1.00 58.14  ? 268  LYS A CE  1 
ATOM   1123 N  NZ  . LYS A 1 141 ? 25.467 70.416 -19.340 1.00 54.43  ? 268  LYS A NZ  1 
ATOM   1124 N  N   . GLU A 1 142 ? 19.151 67.975 -17.999 1.00 18.85  ? 269  GLU A N   1 
ATOM   1125 C  CA  . GLU A 1 142 ? 18.358 68.962 -17.270 1.00 17.09  ? 269  GLU A CA  1 
ATOM   1126 C  C   . GLU A 1 142 ? 17.752 68.377 -16.006 1.00 11.01  ? 269  GLU A C   1 
ATOM   1127 O  O   . GLU A 1 142 ? 17.790 68.920 -14.899 1.00 12.94  ? 269  GLU A O   1 
ATOM   1128 C  CB  . GLU A 1 142 ? 17.226 69.496 -18.161 1.00 28.73  ? 269  GLU A CB  1 
ATOM   1129 C  CG  . GLU A 1 142 ? 17.607 70.488 -19.235 1.00 44.22  ? 269  GLU A CG  1 
ATOM   1130 C  CD  . GLU A 1 142 ? 18.317 69.969 -20.459 1.00 46.62  ? 269  GLU A CD  1 
ATOM   1131 O  OE1 . GLU A 1 142 ? 18.142 68.788 -20.828 1.00 40.77  ? 269  GLU A OE1 1 
ATOM   1132 O  OE2 . GLU A 1 142 ? 19.078 70.747 -21.087 1.00 63.24  ? 269  GLU A OE2 1 
ATOM   1133 N  N   . SER A 1 143 ? 17.158 67.191 -16.168 1.00 12.35  ? 270  SER A N   1 
ATOM   1134 C  CA  . SER A 1 143 ? 16.532 66.476 -15.052 1.00 13.43  ? 270  SER A CA  1 
ATOM   1135 C  C   . SER A 1 143 ? 17.567 66.102 -14.009 1.00 6.66   ? 270  SER A C   1 
ATOM   1136 O  O   . SER A 1 143 ? 17.341 66.205 -12.809 1.00 9.62   ? 270  SER A O   1 
ATOM   1137 C  CB  . SER A 1 143 ? 15.809 65.227 -15.540 1.00 13.39  ? 270  SER A CB  1 
ATOM   1138 O  OG  . SER A 1 143 ? 16.618 64.219 -16.131 1.00 19.57  ? 270  SER A OG  1 
ATOM   1139 N  N   . GLN A 1 144 ? 18.713 65.661 -14.492 1.00 12.02  ? 271  GLN A N   1 
ATOM   1140 C  CA  . GLN A 1 144 ? 19.803 65.241 -13.597 1.00 8.30   ? 271  GLN A CA  1 
ATOM   1141 C  C   . GLN A 1 144 ? 20.249 66.406 -12.742 1.00 10.96  ? 271  GLN A C   1 
ATOM   1142 O  O   . GLN A 1 144 ? 20.522 66.347 -11.543 1.00 9.16   ? 271  GLN A O   1 
ATOM   1143 C  CB  . GLN A 1 144 ? 20.946 64.674 -14.431 1.00 9.13   ? 271  GLN A CB  1 
ATOM   1144 C  CG  . GLN A 1 144 ? 20.653 63.384 -15.159 1.00 10.35  ? 271  GLN A CG  1 
ATOM   1145 C  CD  . GLN A 1 144 ? 21.639 63.053 -16.256 1.00 12.62  ? 271  GLN A CD  1 
ATOM   1146 O  OE1 . GLN A 1 144 ? 22.766 63.528 -16.250 1.00 15.10  ? 271  GLN A OE1 1 
ATOM   1147 N  NE2 . GLN A 1 144 ? 21.287 62.223 -17.223 1.00 19.69  ? 271  GLN A NE2 1 
ATOM   1148 N  N   . GLU A 1 145 ? 20.337 67.557 -13.428 1.00 8.62   ? 272  GLU A N   1 
ATOM   1149 C  CA  . GLU A 1 145 ? 20.866 68.733 -12.782 1.00 7.39   ? 272  GLU A CA  1 
ATOM   1150 C  C   . GLU A 1 145 ? 19.948 69.236 -11.671 1.00 7.41   ? 272  GLU A C   1 
ATOM   1151 O  O   . GLU A 1 145 ? 20.398 69.931 -10.775 1.00 7.70   ? 272  GLU A O   1 
ATOM   1152 C  CB  . GLU A 1 145 ? 21.197 69.825 -13.808 1.00 13.80  ? 272  GLU A CB  1 
ATOM   1153 C  CG  . GLU A 1 145 ? 22.499 69.501 -14.538 1.00 16.90  ? 272  GLU A CG  1 
ATOM   1154 C  CD  . GLU A 1 145 ? 22.791 70.444 -15.692 1.00 34.30  ? 272  GLU A CD  1 
ATOM   1155 O  OE1 . GLU A 1 145 ? 22.009 71.384 -15.908 1.00 31.32  ? 272  GLU A OE1 1 
ATOM   1156 O  OE2 . GLU A 1 145 ? 23.806 70.248 -16.388 1.00 43.00  ? 272  GLU A OE2 1 
ATOM   1157 N  N   . THR A 1 146 ? 18.667 68.849 -11.711 1.00 8.29   ? 273  THR A N   1 
ATOM   1158 C  CA  . THR A 1 146 ? 17.736 69.278 -10.671 1.00 8.75   ? 273  THR A CA  1 
ATOM   1159 C  C   . THR A 1 146 ? 18.063 68.616 -9.340  1.00 5.62   ? 273  THR A C   1 
ATOM   1160 O  O   . THR A 1 146 ? 17.641 69.015 -8.267  1.00 9.00   ? 273  THR A O   1 
ATOM   1161 C  CB  . THR A 1 146 ? 16.253 68.971 -10.903 1.00 7.83   ? 273  THR A CB  1 
ATOM   1162 O  OG1 . THR A 1 146 ? 16.044 67.554 -10.806 1.00 9.51   ? 273  THR A OG1 1 
ATOM   1163 C  CG2 . THR A 1 146 ? 15.837 69.466 -12.274 1.00 12.89  ? 273  THR A CG2 1 
ATOM   1164 N  N   . LEU A 1 147 ? 18.914 67.577 -9.385  1.00 4.77   ? 274  LEU A N   1 
ATOM   1165 C  CA  . LEU A 1 147 ? 19.255 66.935 -8.127  1.00 5.90   ? 274  LEU A CA  1 
ATOM   1166 C  C   . LEU A 1 147 ? 20.460 67.559 -7.417  1.00 6.67   ? 274  LEU A C   1 
ATOM   1167 O  O   . LEU A 1 147 ? 20.695 67.294 -6.234  1.00 5.05   ? 274  LEU A O   1 
ATOM   1168 C  CB  . LEU A 1 147 ? 19.593 65.466 -8.388  1.00 5.40   ? 274  LEU A CB  1 
ATOM   1169 C  CG  . LEU A 1 147 ? 18.495 64.603 -8.964  1.00 6.15   ? 274  LEU A CG  1 
ATOM   1170 C  CD1 . LEU A 1 147 ? 18.950 63.139 -9.052  1.00 6.92   ? 274  LEU A CD1 1 
ATOM   1171 C  CD2 . LEU A 1 147 ? 17.227 64.762 -8.115  1.00 9.70   ? 274  LEU A CD2 1 
ATOM   1172 N  N   . HIS A 1 148 ? 21.219 68.388 -8.143  1.00 5.81   ? 275  HIS A N   1 
ATOM   1173 C  CA  . HIS A 1 148 ? 22.465 68.907 -7.586  1.00 4.86   ? 275  HIS A CA  1 
ATOM   1174 C  C   . HIS A 1 148 ? 22.218 69.701 -6.319  1.00 4.65   ? 275  HIS A C   1 
ATOM   1175 O  O   . HIS A 1 148 ? 23.048 69.673 -5.383  1.00 6.29   ? 275  HIS A O   1 
ATOM   1176 C  CB  . HIS A 1 148 ? 23.183 69.808 -8.612  1.00 7.71   ? 275  HIS A CB  1 
ATOM   1177 C  CG  . HIS A 1 148 ? 23.690 69.023 -9.781  1.00 6.72   ? 275  HIS A CG  1 
ATOM   1178 N  ND1 . HIS A 1 148 ? 24.588 69.564 -10.688 1.00 11.89  ? 275  HIS A ND1 1 
ATOM   1179 C  CD2 . HIS A 1 148 ? 23.426 67.777 -10.192 1.00 7.90   ? 275  HIS A CD2 1 
ATOM   1180 C  CE1 . HIS A 1 148 ? 24.850 68.642 -11.598 1.00 9.12   ? 275  HIS A CE1 1 
ATOM   1181 N  NE2 . HIS A 1 148 ? 24.171 67.540 -11.343 1.00 8.70   ? 275  HIS A NE2 1 
ATOM   1182 N  N   . LYS A 1 149 ? 21.107 70.446 -6.212  1.00 4.93   ? 276  LYS A N   1 
ATOM   1183 C  CA  . LYS A 1 149 ? 20.806 71.274 -5.040  1.00 5.45   ? 276  LYS A CA  1 
ATOM   1184 C  C   . LYS A 1 149 ? 20.652 70.487 -3.740  1.00 4.69   ? 276  LYS A C   1 
ATOM   1185 O  O   . LYS A 1 149 ? 20.700 71.069 -2.665  1.00 7.05   ? 276  LYS A O   1 
ATOM   1186 C  CB  . LYS A 1 149 ? 19.527 72.092 -5.288  1.00 5.80   ? 276  LYS A CB  1 
ATOM   1187 C  CG  . LYS A 1 149 ? 18.241 71.295 -5.428  1.00 7.56   ? 276  LYS A CG  1 
ATOM   1188 C  CD  . LYS A 1 149 ? 17.048 72.196 -5.675  1.00 11.13  ? 276  LYS A CD  1 
ATOM   1189 C  CE  . LYS A 1 149 ? 16.110 71.692 -6.726  1.00 26.95  ? 276  LYS A CE  1 
ATOM   1190 N  NZ  . LYS A 1 149 ? 16.736 71.895 -8.046  1.00 20.87  ? 276  LYS A NZ  1 
ATOM   1191 N  N   . PHE A 1 150 ? 20.475 69.165 -3.859  1.00 2.96   ? 277  PHE A N   1 
ATOM   1192 C  CA  . PHE A 1 150 ? 20.270 68.380 -2.677  1.00 4.19   ? 277  PHE A CA  1 
ATOM   1193 C  C   . PHE A 1 150 ? 21.558 67.729 -2.141  1.00 3.58   ? 277  PHE A C   1 
ATOM   1194 O  O   . PHE A 1 150 ? 21.576 67.142 -1.065  1.00 4.00   ? 277  PHE A O   1 
ATOM   1195 C  CB  . PHE A 1 150 ? 19.261 67.250 -2.991  1.00 4.06   ? 277  PHE A CB  1 
ATOM   1196 C  CG  . PHE A 1 150 ? 17.883 67.784 -3.363  1.00 3.28   ? 277  PHE A CG  1 
ATOM   1197 C  CD1 . PHE A 1 150 ? 17.172 68.612 -2.513  1.00 3.11   ? 277  PHE A CD1 1 
ATOM   1198 C  CD2 . PHE A 1 150 ? 17.345 67.412 -4.566  1.00 5.61   ? 277  PHE A CD2 1 
ATOM   1199 C  CE1 . PHE A 1 150 ? 15.903 69.066 -2.872  1.00 5.03   ? 277  PHE A CE1 1 
ATOM   1200 C  CE2 . PHE A 1 150 ? 16.096 67.876 -4.970  1.00 4.64   ? 277  PHE A CE2 1 
ATOM   1201 C  CZ  . PHE A 1 150 ? 15.408 68.683 -4.100  1.00 6.08   ? 277  PHE A CZ  1 
ATOM   1202 N  N   . ALA A 1 151 ? 22.634 67.840 -2.942  1.00 3.62   ? 278  ALA A N   1 
ATOM   1203 C  CA  . ALA A 1 151 ? 23.881 67.107 -2.692  1.00 4.68   ? 278  ALA A CA  1 
ATOM   1204 C  C   . ALA A 1 151 ? 25.048 68.029 -2.316  1.00 3.52   ? 278  ALA A C   1 
ATOM   1205 O  O   . ALA A 1 151 ? 25.045 69.217 -2.637  1.00 4.48   ? 278  ALA A O   1 
ATOM   1206 C  CB  . ALA A 1 151 ? 24.222 66.267 -3.913  1.00 5.76   ? 278  ALA A CB  1 
ATOM   1207 N  N   . SER A 1 152 ? 26.027 67.404 -1.670  1.00 3.35   ? 279  SER A N   1 
ATOM   1208 C  CA  . SER A 1 152 ? 27.293 68.066 -1.400  1.00 3.61   ? 279  SER A CA  1 
ATOM   1209 C  C   . SER A 1 152 ? 27.980 68.425 -2.712  1.00 3.18   ? 279  SER A C   1 
ATOM   1210 O  O   . SER A 1 152 ? 27.588 68.028 -3.806  1.00 3.40   ? 279  SER A O   1 
ATOM   1211 C  CB  . SER A 1 152 ? 28.152 67.114 -0.565  1.00 3.61   ? 279  SER A CB  1 
ATOM   1212 O  OG  . SER A 1 152 ? 27.615 66.964 0.736   1.00 3.79   ? 279  SER A OG  1 
ATOM   1213 N  N   . LYS A 1 153 ? 29.036 69.243 -2.564  1.00 3.73   ? 280  LYS A N   1 
ATOM   1214 C  CA  . LYS A 1 153 ? 29.760 69.753 -3.741  1.00 4.51   ? 280  LYS A CA  1 
ATOM   1215 C  C   . LYS A 1 153 ? 31.134 69.099 -3.849  1.00 3.58   ? 280  LYS A C   1 
ATOM   1216 O  O   . LYS A 1 153 ? 31.799 68.936 -2.816  1.00 5.02   ? 280  LYS A O   1 
ATOM   1217 C  CB  . LYS A 1 153 ? 29.946 71.275 -3.695  1.00 5.62   ? 280  LYS A CB  1 
ATOM   1218 C  CG  . LYS A 1 153 ? 28.751 72.096 -3.327  1.00 8.81   ? 280  LYS A CG  1 
ATOM   1219 C  CD  . LYS A 1 153 ? 27.568 71.809 -4.182  1.00 16.29  ? 280  LYS A CD  1 
ATOM   1220 C  CE  . LYS A 1 153 ? 27.675 72.197 -5.625  1.00 18.90  ? 280  LYS A CE  1 
ATOM   1221 N  NZ  . LYS A 1 153 ? 26.353 71.893 -6.297  1.00 19.94  ? 280  LYS A NZ  1 
ATOM   1222 N  N   . PRO A 1 154 ? 31.566 68.768 -5.071  1.00 3.54   ? 281  PRO A N   1 
ATOM   1223 C  CA  . PRO A 1 154 ? 30.903 68.942 -6.347  1.00 4.02   ? 281  PRO A CA  1 
ATOM   1224 C  C   . PRO A 1 154 ? 29.928 67.821 -6.714  1.00 3.36   ? 281  PRO A C   1 
ATOM   1225 O  O   . PRO A 1 154 ? 30.082 66.676 -6.301  1.00 4.68   ? 281  PRO A O   1 
ATOM   1226 C  CB  . PRO A 1 154 ? 32.103 68.926 -7.315  1.00 5.84   ? 281  PRO A CB  1 
ATOM   1227 C  CG  . PRO A 1 154 ? 33.061 67.971 -6.719  1.00 6.27   ? 281  PRO A CG  1 
ATOM   1228 C  CD  . PRO A 1 154 ? 32.922 68.148 -5.212  1.00 5.71   ? 281  PRO A CD  1 
ATOM   1229 N  N   . ALA A 1 155 ? 28.947 68.186 -7.536  1.00 5.54   ? 282  ALA A N   1 
ATOM   1230 C  CA  . ALA A 1 155 ? 27.982 67.185 -7.993  1.00 3.07   ? 282  ALA A CA  1 
ATOM   1231 C  C   . ALA A 1 155 ? 28.659 66.033 -8.707  1.00 5.81   ? 282  ALA A C   1 
ATOM   1232 O  O   . ALA A 1 155 ? 28.202 64.897 -8.692  1.00 7.72   ? 282  ALA A O   1 
ATOM   1233 C  CB  . ALA A 1 155 ? 26.965 67.845 -8.900  1.00 7.46   ? 282  ALA A CB  1 
ATOM   1234 N  N   . SER A 1 156 ? 29.793 66.247 -9.381  1.00 7.71   ? 283  SER A N   1 
ATOM   1235 C  CA  . SER A 1 156 ? 30.491 65.179 -10.041 1.00 7.69   ? 283  SER A CA  1 
ATOM   1236 C  C   . SER A 1 156 ? 30.862 64.058 -9.100  1.00 8.52   ? 283  SER A C   1 
ATOM   1237 O  O   . SER A 1 156 ? 30.989 62.919 -9.554  1.00 10.22  ? 283  SER A O   1 
ATOM   1238 C  CB  . SER A 1 156 ? 31.796 65.709 -10.722 1.00 12.56  ? 283  SER A CB  1 
ATOM   1239 O  OG  . SER A 1 156 ? 32.655 66.315 -9.783  1.00 10.80  ? 283  SER A OG  1 
ATOM   1240 N  N   . GLU A 1 157 ? 31.054 64.330 -7.820  1.00 6.09   ? 284  GLU A N   1 
ATOM   1241 C  CA  . GLU A 1 157 ? 31.299 63.330 -6.795  1.00 6.71   ? 284  GLU A CA  1 
ATOM   1242 C  C   . GLU A 1 157 ? 30.004 62.870 -6.124  1.00 7.51   ? 284  GLU A C   1 
ATOM   1243 O  O   . GLU A 1 157 ? 29.829 61.665 -5.871  1.00 8.82   ? 284  GLU A O   1 
ATOM   1244 C  CB  . GLU A 1 157 ? 32.248 63.838 -5.702  1.00 5.87   ? 284  GLU A CB  1 
ATOM   1245 C  CG  . GLU A 1 157 ? 32.366 62.963 -4.477  1.00 9.95   ? 284  GLU A CG  1 
ATOM   1246 C  CD  . GLU A 1 157 ? 32.872 61.553 -4.674  1.00 16.06  ? 284  GLU A CD  1 
ATOM   1247 O  OE1 . GLU A 1 157 ? 33.508 61.298 -5.707  1.00 16.50  ? 284  GLU A OE1 1 
ATOM   1248 O  OE2 . GLU A 1 157 ? 32.549 60.711 -3.792  1.00 14.64  ? 284  GLU A OE2 1 
ATOM   1249 N  N   . PHE A 1 158 ? 29.100 63.798 -5.795  1.00 4.96   ? 285  PHE A N   1 
ATOM   1250 C  CA  . PHE A 1 158 ? 27.985 63.485 -4.894  1.00 4.79   ? 285  PHE A CA  1 
ATOM   1251 C  C   . PHE A 1 158 ? 26.654 63.179 -5.550  1.00 4.23   ? 285  PHE A C   1 
ATOM   1252 O  O   . PHE A 1 158 ? 25.757 62.721 -4.835  1.00 5.42   ? 285  PHE A O   1 
ATOM   1253 C  CB  . PHE A 1 158 ? 27.844 64.611 -3.853  1.00 4.54   ? 285  PHE A CB  1 
ATOM   1254 C  CG  . PHE A 1 158 ? 29.069 64.649 -2.939  1.00 2.97   ? 285  PHE A CG  1 
ATOM   1255 C  CD1 . PHE A 1 158 ? 29.186 63.760 -1.894  1.00 3.71   ? 285  PHE A CD1 1 
ATOM   1256 C  CD2 . PHE A 1 158 ? 30.095 65.560 -3.156  1.00 3.56   ? 285  PHE A CD2 1 
ATOM   1257 C  CE1 . PHE A 1 158 ? 30.293 63.794 -1.087  1.00 3.84   ? 285  PHE A CE1 1 
ATOM   1258 C  CE2 . PHE A 1 158 ? 31.200 65.608 -2.339  1.00 5.35   ? 285  PHE A CE2 1 
ATOM   1259 C  CZ  . PHE A 1 158 ? 31.310 64.693 -1.307  1.00 3.76   ? 285  PHE A CZ  1 
ATOM   1260 N  N   . VAL A 1 159 ? 26.556 63.386 -6.855  1.00 4.49   ? 286  VAL A N   1 
ATOM   1261 C  CA  . VAL A 1 159 ? 25.331 63.040 -7.572  1.00 3.88   ? 286  VAL A CA  1 
ATOM   1262 C  C   . VAL A 1 159 ? 25.617 61.819 -8.434  1.00 5.15   ? 286  VAL A C   1 
ATOM   1263 O  O   . VAL A 1 159 ? 26.501 61.858 -9.276  1.00 7.93   ? 286  VAL A O   1 
ATOM   1264 C  CB  . VAL A 1 159 ? 24.818 64.206 -8.430  1.00 5.15   ? 286  VAL A CB  1 
ATOM   1265 C  CG1 . VAL A 1 159 ? 23.605 63.778 -9.251  1.00 4.74   ? 286  VAL A CG1 1 
ATOM   1266 C  CG2 . VAL A 1 159 ? 24.485 65.395 -7.541  1.00 5.07   ? 286  VAL A CG2 1 
ATOM   1267 N  N   . LYS A 1 160 ? 24.877 60.732 -8.236  1.00 5.98   ? 287  LYS A N   1 
ATOM   1268 C  CA  . LYS A 1 160 ? 25.028 59.515 -8.976  1.00 5.51   ? 287  LYS A CA  1 
ATOM   1269 C  C   . LYS A 1 160 ? 23.802 59.288 -9.836  1.00 5.45   ? 287  LYS A C   1 
ATOM   1270 O  O   . LYS A 1 160 ? 22.695 59.177 -9.269  1.00 10.14  ? 287  LYS A O   1 
ATOM   1271 C  CB  . LYS A 1 160 ? 25.258 58.303 -8.063  1.00 7.87   ? 287  LYS A CB  1 
ATOM   1272 C  CG  . LYS A 1 160 ? 26.279 58.505 -6.963  1.00 10.22  ? 287  LYS A CG  1 
ATOM   1273 C  CD  . LYS A 1 160 ? 27.658 58.656 -7.530  1.00 15.41  ? 287  LYS A CD  1 
ATOM   1274 C  CE  . LYS A 1 160 ? 28.644 58.483 -6.360  1.00 15.98  ? 287  LYS A CE  1 
ATOM   1275 N  NZ  . LYS A 1 160 ? 29.942 59.017 -6.861  1.00 14.92  ? 287  LYS A NZ  1 
ATOM   1276 N  N   . ILE A 1 161 ? 23.892 59.211 -11.131 1.00 6.05   ? 288  ILE A N   1 
ATOM   1277 C  CA  . ILE A 1 161 ? 22.765 58.994 -12.017 1.00 5.28   ? 288  ILE A CA  1 
ATOM   1278 C  C   . ILE A 1 161 ? 22.878 57.570 -12.553 1.00 8.88   ? 288  ILE A C   1 
ATOM   1279 O  O   . ILE A 1 161 ? 23.836 57.287 -13.262 1.00 9.82   ? 288  ILE A O   1 
ATOM   1280 C  CB  . ILE A 1 161 ? 22.705 60.040 -13.120 1.00 8.34   ? 288  ILE A CB  1 
ATOM   1281 C  CG1 . ILE A 1 161 ? 22.670 61.498 -12.619 1.00 9.18   ? 288  ILE A CG1 1 
ATOM   1282 C  CG2 . ILE A 1 161 ? 21.529 59.814 -14.073 1.00 11.65  ? 288  ILE A CG2 1 
ATOM   1283 C  CD1 . ILE A 1 161 ? 21.441 61.832 -11.804 1.00 9.06   ? 288  ILE A CD1 1 
ATOM   1284 N  N   . LEU A 1 162 ? 21.955 56.697 -12.215 1.00 6.86   ? 289  LEU A N   1 
ATOM   1285 C  CA  . LEU A 1 162 ? 22.052 55.273 -12.485 1.00 8.56   ? 289  LEU A CA  1 
ATOM   1286 C  C   . LEU A 1 162 ? 20.900 54.718 -13.307 1.00 12.22  ? 289  LEU A C   1 
ATOM   1287 O  O   . LEU A 1 162 ? 19.749 55.033 -13.057 1.00 11.60  ? 289  LEU A O   1 
ATOM   1288 C  CB  . LEU A 1 162 ? 22.067 54.445 -11.198 1.00 10.84  ? 289  LEU A CB  1 
ATOM   1289 C  CG  . LEU A 1 162 ? 23.086 54.780 -10.125 1.00 11.60  ? 289  LEU A CG  1 
ATOM   1290 C  CD1 . LEU A 1 162 ? 22.874 53.908 -8.897  1.00 16.17  ? 289  LEU A CD1 1 
ATOM   1291 C  CD2 . LEU A 1 162 ? 24.496 54.544 -10.652 1.00 17.07  ? 289  LEU A CD2 1 
ATOM   1292 N  N   . ASP A 1 163 ? 21.233 53.848 -14.246 1.00 14.92  ? 290  ASP A N   1 
ATOM   1293 C  CA  . ASP A 1 163 ? 20.260 52.990 -14.901 1.00 19.39  ? 290  ASP A CA  1 
ATOM   1294 C  C   . ASP A 1 163 ? 19.752 51.913 -13.942 1.00 14.86  ? 290  ASP A C   1 
ATOM   1295 O  O   . ASP A 1 163 ? 18.560 51.607 -13.894 1.00 22.88  ? 290  ASP A O   1 
ATOM   1296 C  CB  . ASP A 1 163 ? 20.902 52.314 -16.117 1.00 33.01  ? 290  ASP A CB  1 
ATOM   1297 C  CG  . ASP A 1 163 ? 21.197 53.233 -17.282 1.00 46.05  ? 290  ASP A CG  1 
ATOM   1298 O  OD1 . ASP A 1 163 ? 20.274 53.938 -17.747 1.00 58.45  ? 290  ASP A OD1 1 
ATOM   1299 O  OD2 . ASP A 1 163 ? 22.362 53.252 -17.755 1.00 77.64  ? 290  ASP A OD2 1 
ATOM   1300 N  N   . THR A 1 164 ? 20.641 51.339 -13.155 1.00 13.10  ? 291  THR A N   1 
ATOM   1301 C  CA  . THR A 1 164 ? 20.465 50.305 -12.192 1.00 14.17  ? 291  THR A CA  1 
ATOM   1302 C  C   . THR A 1 164 ? 21.513 50.434 -11.093 1.00 12.84  ? 291  THR A C   1 
ATOM   1303 O  O   . THR A 1 164 ? 22.567 51.017 -11.279 1.00 11.76  ? 291  THR A O   1 
ATOM   1304 C  CB  . THR A 1 164 ? 20.699 48.865 -12.718 1.00 26.95  ? 291  THR A CB  1 
ATOM   1305 O  OG1 . THR A 1 164 ? 22.105 48.764 -12.987 1.00 27.41  ? 291  THR A OG1 1 
ATOM   1306 C  CG2 . THR A 1 164 ? 19.937 48.618 -14.002 1.00 31.78  ? 291  THR A CG2 1 
ATOM   1307 N  N   . PHE A 1 165 ? 21.171 49.785 -9.991  1.00 12.64  ? 292  PHE A N   1 
ATOM   1308 C  CA  . PHE A 1 165 ? 22.060 49.844 -8.839  1.00 11.21  ? 292  PHE A CA  1 
ATOM   1309 C  C   . PHE A 1 165 ? 23.364 49.099 -9.075  1.00 18.97  ? 292  PHE A C   1 
ATOM   1310 O  O   . PHE A 1 165 ? 24.374 49.463 -8.459  1.00 21.05  ? 292  PHE A O   1 
ATOM   1311 C  CB  . PHE A 1 165 ? 21.292 49.306 -7.623  1.00 15.22  ? 292  PHE A CB  1 
ATOM   1312 C  CG  . PHE A 1 165 ? 20.295 50.279 -7.019  1.00 14.70  ? 292  PHE A CG  1 
ATOM   1313 C  CD1 . PHE A 1 165 ? 18.930 49.986 -7.005  1.00 13.48  ? 292  PHE A CD1 1 
ATOM   1314 C  CD2 . PHE A 1 165 ? 20.721 51.464 -6.475  1.00 12.92  ? 292  PHE A CD2 1 
ATOM   1315 C  CE1 . PHE A 1 165 ? 18.039 50.860 -6.440  1.00 13.60  ? 292  PHE A CE1 1 
ATOM   1316 C  CE2 . PHE A 1 165 ? 19.826 52.343 -5.908  1.00 17.26  ? 292  PHE A CE2 1 
ATOM   1317 C  CZ  . PHE A 1 165 ? 18.468 52.057 -5.903  1.00 18.49  ? 292  PHE A CZ  1 
ATOM   1318 N  N   . GLU A 1 166 ? 23.334 48.092 -9.945  1.00 22.34  ? 293  GLU A N   1 
ATOM   1319 C  CA  . GLU A 1 166 ? 24.534 47.252 -10.129 1.00 28.79  ? 293  GLU A CA  1 
ATOM   1320 C  C   . GLU A 1 166 ? 25.661 48.041 -10.762 1.00 23.43  ? 293  GLU A C   1 
ATOM   1321 O  O   . GLU A 1 166 ? 26.844 47.685 -10.729 1.00 29.94  ? 293  GLU A O   1 
ATOM   1322 C  CB  . GLU A 1 166 ? 24.211 46.032 -10.990 1.00 35.24  ? 293  GLU A CB  1 
ATOM   1323 C  CG  . GLU A 1 166 ? 23.440 44.927 -10.291 1.00 44.23  ? 293  GLU A CG  1 
ATOM   1324 C  CD  . GLU A 1 166 ? 21.991 45.295 -10.026 1.00 45.57  ? 293  GLU A CD  1 
ATOM   1325 O  OE1 . GLU A 1 166 ? 21.444 46.122 -10.789 1.00 40.33  ? 293  GLU A OE1 1 
ATOM   1326 O  OE2 . GLU A 1 166 ? 21.397 44.759 -9.067  1.00 71.61  ? 293  GLU A OE2 1 
ATOM   1327 N  N   . LYS A 1 167 ? 25.294 49.168 -11.374 1.00 14.23  ? 294  LYS A N   1 
ATOM   1328 C  CA  . LYS A 1 167 ? 26.294 49.999 -12.036 1.00 17.74  ? 294  LYS A CA  1 
ATOM   1329 C  C   . LYS A 1 167 ? 26.939 50.969 -11.079 1.00 22.43  ? 294  LYS A C   1 
ATOM   1330 O  O   . LYS A 1 167 ? 27.852 51.715 -11.454 1.00 26.90  ? 294  LYS A O   1 
ATOM   1331 C  CB  . LYS A 1 167 ? 25.606 50.733 -13.200 1.00 27.98  ? 294  LYS A CB  1 
ATOM   1332 C  CG  . LYS A 1 167 ? 25.287 49.755 -14.331 1.00 38.61  ? 294  LYS A CG  1 
ATOM   1333 C  CD  . LYS A 1 167 ? 24.602 50.482 -15.477 1.00 49.22  ? 294  LYS A CD  1 
ATOM   1334 C  CE  . LYS A 1 167 ? 23.763 49.516 -16.302 1.00 57.21  ? 294  LYS A CE  1 
ATOM   1335 N  NZ  . LYS A 1 167 ? 23.248 50.167 -17.542 1.00 67.05  ? 294  LYS A NZ  1 
ATOM   1336 N  N   . LEU A 1 168 ? 26.477 51.013 -9.836  1.00 19.31  ? 295  LEU A N   1 
ATOM   1337 C  CA  . LEU A 1 168 ? 27.114 52.001 -8.955  1.00 16.39  ? 295  LEU A CA  1 
ATOM   1338 C  C   . LEU A 1 168 ? 28.431 51.463 -8.441  1.00 17.39  ? 295  LEU A C   1 
ATOM   1339 O  O   . LEU A 1 168 ? 28.426 50.302 -8.019  1.00 18.07  ? 295  LEU A O   1 
ATOM   1340 C  CB  . LEU A 1 168 ? 26.194 52.318 -7.774  1.00 14.24  ? 295  LEU A CB  1 
ATOM   1341 C  CG  . LEU A 1 168 ? 26.695 53.335 -6.768  1.00 10.69  ? 295  LEU A CG  1 
ATOM   1342 C  CD1 . LEU A 1 168 ? 26.778 54.721 -7.393  1.00 21.32  ? 295  LEU A CD1 1 
ATOM   1343 C  CD2 . LEU A 1 168 ? 25.783 53.421 -5.545  1.00 14.55  ? 295  LEU A CD2 1 
ATOM   1344 N  N   . LYS A 1 169 ? 29.516 52.242 -8.441  1.00 16.67  ? 296  LYS A N   1 
ATOM   1345 C  CA  . LYS A 1 169 ? 30.740 51.754 -7.790  1.00 19.34  ? 296  LYS A CA  1 
ATOM   1346 C  C   . LYS A 1 169 ? 30.433 51.527 -6.318  1.00 19.57  ? 296  LYS A C   1 
ATOM   1347 O  O   . LYS A 1 169 ? 29.778 52.392 -5.706  1.00 25.31  ? 296  LYS A O   1 
ATOM   1348 C  CB  . LYS A 1 169 ? 31.828 52.784 -8.057  1.00 34.26  ? 296  LYS A CB  1 
ATOM   1349 C  CG  . LYS A 1 169 ? 33.116 52.553 -7.296  1.00 45.93  ? 296  LYS A CG  1 
ATOM   1350 C  CD  . LYS A 1 169 ? 34.333 52.859 -8.160  1.00 47.40  ? 296  LYS A CD  1 
ATOM   1351 C  CE  . LYS A 1 169 ? 35.605 52.532 -7.386  1.00 42.84  ? 296  LYS A CE  1 
ATOM   1352 N  NZ  . LYS A 1 169 ? 36.230 51.258 -7.809  1.00 33.82  ? 296  LYS A NZ  1 
ATOM   1353 N  N   . ASP A 1 170 ? 30.832 50.407 -5.734  1.00 16.25  ? 297  ASP A N   1 
ATOM   1354 C  CA  . ASP A 1 170 ? 30.276 49.901 -4.487  1.00 16.16  ? 297  ASP A CA  1 
ATOM   1355 C  C   . ASP A 1 170 ? 30.274 50.945 -3.383  1.00 13.70  ? 297  ASP A C   1 
ATOM   1356 O  O   . ASP A 1 170 ? 31.296 51.485 -2.992  1.00 14.23  ? 297  ASP A O   1 
ATOM   1357 C  CB  . ASP A 1 170 ? 31.034 48.671 -3.977  1.00 12.56  ? 297  ASP A CB  1 
ATOM   1358 C  CG  . ASP A 1 170 ? 30.426 48.150 -2.685  1.00 18.06  ? 297  ASP A CG  1 
ATOM   1359 O  OD1 . ASP A 1 170 ? 31.006 48.138 -1.570  1.00 18.75  ? 297  ASP A OD1 1 
ATOM   1360 O  OD2 . ASP A 1 170 ? 29.261 47.691 -2.819  1.00 18.92  ? 297  ASP A OD2 1 
ATOM   1361 N  N   . LEU A 1 171 ? 29.069 51.234 -2.865  1.00 12.49  ? 298  LEU A N   1 
ATOM   1362 C  CA  . LEU A 1 171 ? 28.950 52.397 -1.990  1.00 10.09  ? 298  LEU A CA  1 
ATOM   1363 C  C   . LEU A 1 171 ? 29.619 52.191 -0.657  1.00 11.53  ? 298  LEU A C   1 
ATOM   1364 O  O   . LEU A 1 171 ? 30.280 53.113 -0.149  1.00 10.68  ? 298  LEU A O   1 
ATOM   1365 C  CB  . LEU A 1 171 ? 27.469 52.777 -1.844  1.00 8.86   ? 298  LEU A CB  1 
ATOM   1366 C  CG  . LEU A 1 171 ? 27.175 54.031 -1.031  1.00 10.45  ? 298  LEU A CG  1 
ATOM   1367 C  CD1 . LEU A 1 171 ? 27.830 55.240 -1.665  1.00 13.24  ? 298  LEU A CD1 1 
ATOM   1368 C  CD2 . LEU A 1 171 ? 25.682 54.269 -0.892  1.00 10.06  ? 298  LEU A CD2 1 
ATOM   1369 N  N   . CYS A 1 172 ? 29.482 51.024 -0.028  1.00 10.52  ? 299  CYS A N   1 
ATOM   1370 C  CA  . CYS A 1 172 ? 30.163 50.835 1.260   1.00 10.03  ? 299  CYS A CA  1 
ATOM   1371 C  C   . CYS A 1 172 ? 31.676 51.036 1.113   1.00 10.73  ? 299  CYS A C   1 
ATOM   1372 O  O   . CYS A 1 172 ? 32.275 51.758 1.903   1.00 11.02  ? 299  CYS A O   1 
ATOM   1373 C  CB  . CYS A 1 172 ? 29.818 49.471 1.841   1.00 14.31  ? 299  CYS A CB  1 
ATOM   1374 S  SG  . CYS A 1 172 ? 30.806 48.993 3.259   1.00 16.24  ? 299  CYS A SG  1 
ATOM   1375 N  N   . THR A 1 173 ? 32.291 50.425 0.117   1.00 11.96  ? 300  THR A N   1 
ATOM   1376 C  CA  . THR A 1 173 ? 33.724 50.610 -0.152  1.00 10.97  ? 300  THR A CA  1 
ATOM   1377 C  C   . THR A 1 173 ? 34.053 52.079 -0.351  1.00 11.51  ? 300  THR A C   1 
ATOM   1378 O  O   . THR A 1 173 ? 35.010 52.595 0.249   1.00 10.89  ? 300  THR A O   1 
ATOM   1379 C  CB  . THR A 1 173 ? 34.149 49.773 -1.375  1.00 15.56  ? 300  THR A CB  1 
ATOM   1380 O  OG1 . THR A 1 173 ? 33.849 48.374 -1.098  1.00 21.91  ? 300  THR A OG1 1 
ATOM   1381 C  CG2 . THR A 1 173 ? 35.640 49.860 -1.612  1.00 15.00  ? 300  THR A CG2 1 
ATOM   1382 N  N   . GLU A 1 174 ? 33.270 52.802 -1.150  1.00 9.96   ? 301  GLU A N   1 
ATOM   1383 C  CA  . GLU A 1 174 ? 33.583 54.204 -1.416  1.00 10.11  ? 301  GLU A CA  1 
ATOM   1384 C  C   . GLU A 1 174 ? 33.439 55.046 -0.175  1.00 11.66  ? 301  GLU A C   1 
ATOM   1385 O  O   . GLU A 1 174 ? 34.238 55.935 0.121   1.00 11.43  ? 301  GLU A O   1 
ATOM   1386 C  CB  . GLU A 1 174 ? 32.689 54.747 -2.550  1.00 12.29  ? 301  GLU A CB  1 
ATOM   1387 C  CG  . GLU A 1 174 ? 33.156 54.115 -3.876  1.00 31.69  ? 301  GLU A CG  1 
ATOM   1388 C  CD  . GLU A 1 174 ? 34.666 54.135 -4.031  1.00 47.02  ? 301  GLU A CD  1 
ATOM   1389 O  OE1 . GLU A 1 174 ? 35.364 53.091 -3.948  1.00 27.80  ? 301  GLU A OE1 1 
ATOM   1390 O  OE2 . GLU A 1 174 ? 35.237 55.239 -4.244  1.00 25.29  ? 301  GLU A OE2 1 
ATOM   1391 N  N   . LEU A 1 175 ? 32.404 54.777 0.619   1.00 9.71   ? 302  LEU A N   1 
ATOM   1392 C  CA  . LEU A 1 175 ? 32.282 55.531 1.844   1.00 12.55  ? 302  LEU A CA  1 
ATOM   1393 C  C   . LEU A 1 175 ? 33.451 55.273 2.799   1.00 10.05  ? 302  LEU A C   1 
ATOM   1394 O  O   . LEU A 1 175 ? 33.953 56.207 3.410   1.00 11.13  ? 302  LEU A O   1 
ATOM   1395 C  CB  . LEU A 1 175 ? 30.937 55.220 2.548   1.00 12.04  ? 302  LEU A CB  1 
ATOM   1396 C  CG  . LEU A 1 175 ? 29.694 55.694 1.772   1.00 16.12  ? 302  LEU A CG  1 
ATOM   1397 C  CD1 . LEU A 1 175 ? 28.407 55.166 2.439   1.00 17.03  ? 302  LEU A CD1 1 
ATOM   1398 C  CD2 . LEU A 1 175 ? 29.646 57.208 1.644   1.00 27.92  ? 302  LEU A CD2 1 
ATOM   1399 N  N   . GLN A 1 176 ? 33.848 54.027 2.951   1.00 10.36  ? 303  GLN A N   1 
ATOM   1400 C  CA  . GLN A 1 176 ? 34.943 53.722 3.883   1.00 12.49  ? 303  GLN A CA  1 
ATOM   1401 C  C   . GLN A 1 176 ? 36.255 54.312 3.394   1.00 13.57  ? 303  GLN A C   1 
ATOM   1402 O  O   . GLN A 1 176 ? 37.109 54.681 4.192   1.00 15.41  ? 303  GLN A O   1 
ATOM   1403 C  CB  . GLN A 1 176 ? 35.040 52.211 4.073   1.00 16.96  ? 303  GLN A CB  1 
ATOM   1404 C  CG  . GLN A 1 176 ? 33.884 51.697 4.929   1.00 15.58  ? 303  GLN A CG  1 
ATOM   1405 C  CD  . GLN A 1 176 ? 34.196 50.280 5.395   1.00 34.90  ? 303  GLN A CD  1 
ATOM   1406 O  OE1 . GLN A 1 176 ? 34.903 50.085 6.383   1.00 52.08  ? 303  GLN A OE1 1 
ATOM   1407 N  NE2 . GLN A 1 176 ? 33.677 49.326 4.638   1.00 35.49  ? 303  GLN A NE2 1 
ATOM   1408 N  N   . LYS A 1 177 ? 36.391 54.407 2.091   1.00 11.01  ? 304  LYS A N   1 
ATOM   1409 C  CA  . LYS A 1 177 ? 37.589 54.990 1.480   1.00 12.11  ? 304  LYS A CA  1 
ATOM   1410 C  C   . LYS A 1 177 ? 37.636 56.497 1.710   1.00 16.25  ? 304  LYS A C   1 
ATOM   1411 O  O   . LYS A 1 177 ? 38.675 57.060 2.043   1.00 17.34  ? 304  LYS A O   1 
ATOM   1412 C  CB  . LYS A 1 177 ? 37.561 54.683 -0.010  1.00 13.47  ? 304  LYS A CB  1 
ATOM   1413 C  CG  . LYS A 1 177 ? 38.727 55.304 -0.705  1.00 16.30  ? 304  LYS A CG  1 
ATOM   1414 C  CD  . LYS A 1 177 ? 38.890 55.094 -2.170  1.00 21.73  ? 304  LYS A CD  1 
ATOM   1415 C  CE  . LYS A 1 177 ? 37.738 54.700 -3.013  1.00 33.59  ? 304  LYS A CE  1 
ATOM   1416 N  NZ  . LYS A 1 177 ? 38.107 53.577 -3.951  1.00 28.67  ? 304  LYS A NZ  1 
ATOM   1417 N  N   . LYS A 1 178 ? 36.493 57.181 1.590   1.00 16.25  ? 305  LYS A N   1 
ATOM   1418 C  CA  . LYS A 1 178 ? 36.461 58.635 1.572   1.00 14.37  ? 305  LYS A CA  1 
ATOM   1419 C  C   . LYS A 1 178 ? 35.976 59.393 2.786   1.00 21.44  ? 305  LYS A C   1 
ATOM   1420 O  O   . LYS A 1 178 ? 36.440 60.542 2.931   1.00 23.55  ? 305  LYS A O   1 
ATOM   1421 C  CB  . LYS A 1 178 ? 35.546 59.073 0.412   1.00 14.71  ? 305  LYS A CB  1 
ATOM   1422 C  CG  . LYS A 1 178 ? 36.075 58.589 -0.934  1.00 15.79  ? 305  LYS A CG  1 
ATOM   1423 C  CD  . LYS A 1 178 ? 35.198 59.045 -2.087  1.00 28.18  ? 305  LYS A CD  1 
ATOM   1424 C  CE  . LYS A 1 178 ? 35.841 58.776 -3.437  1.00 29.21  ? 305  LYS A CE  1 
ATOM   1425 N  NZ  . LYS A 1 178 ? 35.125 59.501 -4.521  1.00 32.29  ? 305  LYS A NZ  1 
ATOM   1426 N  N   . ILE A 1 179 ? 35.094 58.843 3.587   1.00 14.30  ? 306  ILE A N   1 
ATOM   1427 C  CA  . ILE A 1 179 ? 34.521 59.584 4.718   1.00 19.42  ? 306  ILE A CA  1 
ATOM   1428 C  C   . ILE A 1 179 ? 35.444 59.465 5.928   1.00 41.20  ? 306  ILE A C   1 
ATOM   1429 O  O   . ILE A 1 179 ? 35.737 60.530 6.531   1.00 60.53  ? 306  ILE A O   1 
ATOM   1430 C  CB  . ILE A 1 179 ? 33.072 59.132 5.027   1.00 13.01  ? 306  ILE A CB  1 
ATOM   1431 C  CG1 . ILE A 1 179 ? 32.115 59.185 3.848   1.00 22.14  ? 306  ILE A CG1 1 
ATOM   1432 C  CG2 . ILE A 1 179 ? 32.519 59.888 6.234   1.00 16.91  ? 306  ILE A CG2 1 
ATOM   1433 C  CD1 . ILE A 1 179 ? 31.778 60.544 3.277   1.00 26.11  ? 306  ILE A CD1 1 
ATOM   1434 O  OXT . ILE A 1 179 ? 35.915 58.362 6.297   1.00 29.79  ? 306  ILE A OXT 1 
HETATM 1435 MG MG  . MG  B 2 .   ? 8.892  58.806 -8.493  1.00 4.63   ? 1001 MG  A MG  1 
HETATM 1436 O  O   . HOH C 3 .   ? 18.221 74.665 -0.634  1.00 4.84   ? 2001 HOH A O   1 
HETATM 1437 O  O   . HOH C 3 .   ? 16.072 74.199 6.058   1.00 5.75   ? 2002 HOH A O   1 
HETATM 1438 O  O   . HOH C 3 .   ? 14.387 67.722 -8.260  1.00 11.02  ? 2003 HOH A O   1 
HETATM 1439 O  O   . HOH C 3 .   ? 13.750 63.738 -5.493  1.00 6.63   ? 2004 HOH A O   1 
HETATM 1440 O  O   . HOH C 3 .   ? 25.843 69.057 -5.748  1.00 7.48   ? 2005 HOH A O   1 
HETATM 1441 O  O   . HOH C 3 .   ? 3.875  59.331 1.976   1.00 7.13   ? 2006 HOH A O   1 
HETATM 1442 O  O   . HOH C 3 .   ? 23.266 71.309 -1.719  1.00 9.00   ? 2007 HOH A O   1 
HETATM 1443 O  O   . HOH C 3 .   ? 19.717 71.523 -8.606  1.00 10.55  ? 2008 HOH A O   1 
HETATM 1444 O  O   . HOH C 3 .   ? 6.492  69.396 1.368   1.00 7.96   ? 2009 HOH A O   1 
HETATM 1445 O  O   . HOH C 3 .   ? 26.188 71.360 -0.858  1.00 8.84   ? 2010 HOH A O   1 
HETATM 1446 O  O   . HOH C 3 .   ? 9.782  68.461 6.961   1.00 10.41  ? 2011 HOH A O   1 
HETATM 1447 O  O   . HOH C 3 .   ? 12.023 75.452 -4.242  1.00 9.98   ? 2012 HOH A O   1 
HETATM 1448 O  O   . HOH C 3 .   ? 4.751  69.090 -7.688  1.00 9.29   ? 2013 HOH A O   1 
HETATM 1449 O  O   . HOH C 3 .   ? 11.225 53.934 -11.190 1.00 11.10  ? 2014 HOH A O   1 
HETATM 1450 O  O   . HOH C 3 .   ? -0.394 62.411 -1.435  1.00 11.10  ? 2015 HOH A O   1 
HETATM 1451 O  O   . HOH C 3 .   ? 10.571 63.499 -12.474 1.00 11.56  ? 2016 HOH A O   1 
HETATM 1452 O  O   . HOH C 3 .   ? 22.421 69.539 9.938   1.00 14.66  ? 2017 HOH A O   1 
HETATM 1453 O  O   . HOH C 3 .   ? 22.368 76.323 -0.129  1.00 10.41  ? 2018 HOH A O   1 
HETATM 1454 O  O   . HOH C 3 .   ? 13.346 57.347 -12.756 1.00 10.66  ? 2019 HOH A O   1 
HETATM 1455 O  O   . HOH C 3 .   ? 6.302  51.938 5.983   1.00 11.30  ? 2020 HOH A O   1 
HETATM 1456 O  O   . HOH C 3 .   ? 24.475 55.944 15.978  1.00 12.29  ? 2021 HOH A O   1 
HETATM 1457 O  O   . HOH C 3 .   ? 21.520 67.267 11.269  1.00 11.07  ? 2022 HOH A O   1 
HETATM 1458 O  O   . HOH C 3 .   ? 41.155 55.857 1.774   1.00 11.76  ? 2023 HOH A O   1 
HETATM 1459 O  O   . HOH C 3 .   ? 16.379 64.447 25.224  1.00 11.94  ? 2024 HOH A O   1 
HETATM 1460 O  O   . HOH C 3 .   ? 30.422 68.949 -10.513 1.00 12.92  ? 2025 HOH A O   1 
HETATM 1461 O  O   . HOH C 3 .   ? 7.607  46.223 -3.735  1.00 12.88  ? 2026 HOH A O   1 
HETATM 1462 O  O   . HOH C 3 .   ? 14.867 80.023 1.502   1.00 13.66  ? 2027 HOH A O   1 
HETATM 1463 O  O   . HOH C 3 .   ? 27.892 48.804 -0.794  1.00 15.65  ? 2028 HOH A O   1 
HETATM 1464 O  O   . HOH C 3 .   ? 5.095  47.480 0.383   1.00 16.58  ? 2029 HOH A O   1 
HETATM 1465 O  O   . HOH C 3 .   ? 11.777 56.785 -21.701 1.00 14.01  ? 2030 HOH A O   1 
HETATM 1466 O  O   . HOH C 3 .   ? 23.301 72.458 8.199   1.00 25.25  ? 2031 HOH A O   1 
HETATM 1467 O  O   . HOH C 3 .   ? 24.948 62.098 14.144  1.00 12.93  ? 2032 HOH A O   1 
HETATM 1468 O  O   . HOH C 3 .   ? 20.500 73.687 -1.911  1.00 11.41  ? 2033 HOH A O   1 
HETATM 1469 O  O   . HOH C 3 .   ? 22.994 76.030 6.586   1.00 11.72  ? 2034 HOH A O   1 
HETATM 1470 O  O   . HOH C 3 .   ? 8.587  61.881 -11.396 1.00 11.59  ? 2035 HOH A O   1 
HETATM 1471 O  O   . HOH C 3 .   ? 15.743 78.718 6.054   1.00 16.27  ? 2036 HOH A O   1 
HETATM 1472 O  O   . HOH C 3 .   ? 20.372 65.458 19.643  1.00 20.46  ? 2037 HOH A O   1 
HETATM 1473 O  O   . HOH C 3 .   ? 12.819 77.722 -2.828  1.00 20.87  ? 2038 HOH A O   1 
HETATM 1474 O  O   . HOH C 3 .   ? 8.257  63.787 -9.393  1.00 13.13  ? 2039 HOH A O   1 
HETATM 1475 O  O   . HOH C 3 .   ? 37.345 51.184 1.419   1.00 19.02  ? 2040 HOH A O   1 
HETATM 1476 O  O   . HOH C 3 .   ? 6.462  62.337 -7.899  1.00 12.85  ? 2041 HOH A O   1 
HETATM 1477 O  O   . HOH C 3 .   ? 19.145 46.319 -5.680  1.00 13.70  ? 2042 HOH A O   1 
HETATM 1478 O  O   . HOH C 3 .   ? 30.386 68.526 6.669   1.00 16.17  ? 2043 HOH A O   1 
HETATM 1479 O  O   . HOH C 3 .   ? 14.850 50.991 -8.488  1.00 12.92  ? 2044 HOH A O   1 
HETATM 1480 O  O   . HOH C 3 .   ? 20.287 75.571 1.418   1.00 12.94  ? 2045 HOH A O   1 
HETATM 1481 O  O   . HOH C 3 .   ? 18.617 48.414 -10.133 1.00 16.55  ? 2046 HOH A O   1 
HETATM 1482 O  O   . HOH C 3 .   ? 28.762 70.816 -8.562  1.00 14.48  ? 2047 HOH A O   1 
HETATM 1483 O  O   . HOH C 3 .   ? 26.696 63.404 -11.558 1.00 20.38  ? 2048 HOH A O   1 
HETATM 1484 O  O   . HOH C 3 .   ? 14.361 72.136 9.048   1.00 18.60  ? 2049 HOH A O   1 
HETATM 1485 O  O   . HOH C 3 .   ? 10.481 71.157 7.468   1.00 9.67   ? 2050 HOH A O   1 
HETATM 1486 O  O   . HOH C 3 .   ? 13.820 52.692 -10.228 1.00 13.91  ? 2051 HOH A O   1 
HETATM 1487 O  O   . HOH C 3 .   ? 16.404 75.985 8.086   1.00 13.40  ? 2052 HOH A O   1 
HETATM 1488 O  O   . HOH C 3 .   ? 16.069 49.534 -10.351 1.00 19.73  ? 2053 HOH A O   1 
HETATM 1489 O  O   . HOH C 3 .   ? 1.882  57.962 3.380   1.00 16.06  ? 2054 HOH A O   1 
HETATM 1490 O  O   . HOH C 3 .   ? 10.574 44.533 3.412   1.00 18.75  ? 2055 HOH A O   1 
HETATM 1491 O  O   . HOH C 3 .   ? 5.357  48.011 -4.089  1.00 12.86  ? 2056 HOH A O   1 
HETATM 1492 O  O   . HOH C 3 .   ? 2.358  65.451 -8.246  1.00 16.75  ? 2057 HOH A O   1 
HETATM 1493 O  O   . HOH C 3 .   ? 5.905  68.279 3.856   1.00 17.87  ? 2058 HOH A O   1 
HETATM 1494 O  O   . HOH C 3 .   ? 26.966 63.718 14.743  1.00 17.02  ? 2059 HOH A O   1 
HETATM 1495 O  O   . HOH C 3 .   ? 29.211 65.515 10.475  1.00 21.10  ? 2060 HOH A O   1 
HETATM 1496 O  O   . HOH C 3 .   ? 18.776 81.071 3.925   1.00 14.87  ? 2061 HOH A O   1 
HETATM 1497 O  O   . HOH C 3 .   ? 33.141 61.944 0.051   1.00 20.71  ? 2062 HOH A O   1 
HETATM 1498 O  O   . HOH C 3 .   ? 5.434  63.123 7.481   1.00 18.93  ? 2063 HOH A O   1 
HETATM 1499 O  O   . HOH C 3 .   ? 31.499 66.480 7.969   1.00 21.80  ? 2064 HOH A O   1 
HETATM 1500 O  O   . HOH C 3 .   ? 16.206 55.986 20.981  1.00 19.55  ? 2065 HOH A O   1 
HETATM 1501 O  O   . HOH C 3 .   ? 19.383 46.247 -8.183  1.00 22.78  ? 2066 HOH A O   1 
HETATM 1502 O  O   . HOH C 3 .   ? 4.052  62.962 -8.224  1.00 19.49  ? 2067 HOH A O   1 
HETATM 1503 O  O   . HOH C 3 .   ? 10.718 72.324 -6.602  1.00 18.38  ? 2068 HOH A O   1 
HETATM 1504 O  O   . HOH C 3 .   ? 5.322  60.163 -10.682 1.00 20.39  ? 2069 HOH A O   1 
HETATM 1505 O  O   . HOH C 3 .   ? 12.597 69.991 -10.451 1.00 14.80  ? 2070 HOH A O   1 
HETATM 1506 O  O   . HOH C 3 .   ? 17.937 71.448 -14.396 1.00 17.54  ? 2071 HOH A O   1 
HETATM 1507 O  O   . HOH C 3 .   ? 23.462 73.471 -6.124  1.00 18.58  ? 2072 HOH A O   1 
HETATM 1508 O  O   . HOH C 3 .   ? 25.166 48.253 -2.432  1.00 26.32  ? 2073 HOH A O   1 
HETATM 1509 O  O   . HOH C 3 .   ? 14.878 62.790 -18.205 1.00 26.56  ? 2074 HOH A O   1 
HETATM 1510 O  O   . HOH C 3 .   ? 26.715 50.021 -3.883  1.00 15.66  ? 2075 HOH A O   1 
HETATM 1511 O  O   . HOH C 3 .   ? 13.269 43.057 4.985   1.00 19.39  ? 2076 HOH A O   1 
HETATM 1512 O  O   . HOH C 3 .   ? 16.362 76.244 -1.990  1.00 20.58  ? 2077 HOH A O   1 
HETATM 1513 O  O   . HOH C 3 .   ? 24.526 64.947 -12.667 1.00 19.79  ? 2078 HOH A O   1 
HETATM 1514 O  O   . HOH C 3 .   ? 26.856 49.058 -6.749  1.00 21.13  ? 2079 HOH A O   1 
HETATM 1515 O  O   . HOH C 3 .   ? 18.572 78.648 0.935   1.00 20.67  ? 2080 HOH A O   1 
HETATM 1516 O  O   . HOH C 3 .   ? 19.824 49.936 20.915  1.00 23.91  ? 2081 HOH A O   1 
HETATM 1517 O  O   . HOH C 3 .   ? 19.601 78.983 7.538   1.00 19.72  ? 2082 HOH A O   1 
HETATM 1518 O  O   . HOH C 3 .   ? 2.118  49.448 -0.401  1.00 20.64  ? 2083 HOH A O   1 
HETATM 1519 O  O   . HOH C 3 .   ? 8.700  65.786 -12.966 1.00 23.10  ? 2084 HOH A O   1 
HETATM 1520 O  O   . HOH C 3 .   ? 29.199 60.846 -9.412  1.00 18.93  ? 2085 HOH A O   1 
HETATM 1521 O  O   . HOH C 3 .   ? 26.283 60.465 -12.391 1.00 23.03  ? 2086 HOH A O   1 
HETATM 1522 O  O   . HOH C 3 .   ? 11.982 71.022 9.671   1.00 21.19  ? 2087 HOH A O   1 
HETATM 1523 O  O   . HOH C 3 .   ? 14.451 75.143 -5.657  1.00 21.83  ? 2088 HOH A O   1 
HETATM 1524 O  O   . HOH C 3 .   ? -0.749 55.713 -5.769  1.00 19.72  ? 2089 HOH A O   1 
HETATM 1525 O  O   . HOH C 3 .   ? 28.749 65.572 7.910   1.00 21.27  ? 2090 HOH A O   1 
HETATM 1526 O  O   . HOH C 3 .   ? 14.079 52.814 18.259  1.00 24.23  ? 2091 HOH A O   1 
HETATM 1527 O  O   . HOH C 3 .   ? 7.473  44.816 -10.507 1.00 25.76  ? 2092 HOH A O   1 
HETATM 1528 O  O   . HOH C 3 .   ? 13.295 43.257 -7.193  1.00 22.60  ? 2093 HOH A O   1 
HETATM 1529 O  O   . HOH C 3 .   ? 25.059 45.931 9.186   1.00 42.14  ? 2094 HOH A O   1 
HETATM 1530 O  O   . HOH C 3 .   ? 6.227  62.078 -12.566 1.00 18.62  ? 2095 HOH A O   1 
HETATM 1531 O  O   . HOH C 3 .   ? 11.658 55.326 -13.565 1.00 17.46  ? 2096 HOH A O   1 
HETATM 1532 O  O   . HOH C 3 .   ? 24.156 71.703 -3.803  1.00 28.68  ? 2097 HOH A O   1 
HETATM 1533 O  O   . HOH C 3 .   ? 23.559 63.835 15.613  1.00 24.26  ? 2098 HOH A O   1 
HETATM 1534 O  O   . HOH C 3 .   ? 31.806 58.097 -4.782  1.00 21.35  ? 2099 HOH A O   1 
HETATM 1535 O  O   . HOH C 3 .   ? 10.266 70.270 -8.781  1.00 17.32  ? 2100 HOH A O   1 
HETATM 1536 O  O   . HOH C 3 .   ? 36.223 62.113 -3.768  1.00 22.28  ? 2101 HOH A O   1 
HETATM 1537 O  O   . HOH C 3 .   ? 9.251  45.163 -1.716  1.00 28.75  ? 2102 HOH A O   1 
HETATM 1538 O  O   . HOH C 3 .   ? 25.504 53.882 19.670  1.00 23.94  ? 2103 HOH A O   1 
HETATM 1539 O  O   . HOH C 3 .   ? 3.325  48.242 -6.058  1.00 27.34  ? 2104 HOH A O   1 
HETATM 1540 O  O   . HOH C 3 .   ? 0.037  60.706 -5.301  1.00 25.18  ? 2105 HOH A O   1 
HETATM 1541 O  O   . HOH C 3 .   ? 24.533 65.387 -15.097 1.00 21.75  ? 2106 HOH A O   1 
HETATM 1542 O  O   . HOH C 3 .   ? 4.362  65.434 6.721   1.00 25.03  ? 2107 HOH A O   1 
HETATM 1543 O  O   . HOH C 3 .   ? 6.176  68.436 -9.870  1.00 22.55  ? 2108 HOH A O   1 
HETATM 1544 O  O   . HOH C 3 .   ? 4.046  53.505 4.890   1.00 29.48  ? 2109 HOH A O   1 
HETATM 1545 O  O   . HOH C 3 .   ? 14.326 51.653 -12.613 1.00 31.91  ? 2110 HOH A O   1 
HETATM 1546 O  O   . HOH C 3 .   ? 28.238 46.958 -4.855  1.00 31.20  ? 2111 HOH A O   1 
HETATM 1547 O  O   . HOH C 3 .   ? 13.226 53.395 -15.011 1.00 23.03  ? 2112 HOH A O   1 
HETATM 1548 O  O   . HOH C 3 .   ? 12.154 64.082 -14.711 1.00 17.85  ? 2113 HOH A O   1 
HETATM 1549 O  O   . HOH C 3 .   ? 29.704 55.179 -5.533  1.00 27.19  ? 2114 HOH A O   1 
HETATM 1550 O  O   . HOH C 3 .   ? 13.200 72.861 -6.957  1.00 25.39  ? 2115 HOH A O   1 
HETATM 1551 O  O   . HOH C 3 .   ? 1.641  53.367 -8.900  1.00 16.66  ? 2116 HOH A O   1 
HETATM 1552 O  O   . HOH C 3 .   ? -0.734 54.838 -7.988  1.00 29.15  ? 2117 HOH A O   1 
HETATM 1553 O  O   . HOH C 3 .   ? 14.261 56.180 19.395  1.00 34.68  ? 2118 HOH A O   1 
HETATM 1554 O  O   . HOH C 3 .   ? 12.115 48.777 12.499  1.00 21.71  ? 2119 HOH A O   1 
HETATM 1555 O  O   . HOH C 3 .   ? 41.040 53.687 3.219   1.00 33.79  ? 2120 HOH A O   1 
HETATM 1556 O  O   . HOH C 3 .   ? 38.874 51.120 -1.010  1.00 30.08  ? 2121 HOH A O   1 
HETATM 1557 O  O   . HOH C 3 .   ? 12.224 43.220 1.515   1.00 28.80  ? 2122 HOH A O   1 
HETATM 1558 O  O   . HOH C 3 .   ? 12.661 63.061 16.084  1.00 27.11  ? 2123 HOH A O   1 
HETATM 1559 O  O   . HOH C 3 .   ? 28.055 48.656 11.719  1.00 21.60  ? 2124 HOH A O   1 
HETATM 1560 O  O   . HOH C 3 .   ? 15.288 48.641 18.949  1.00 29.84  ? 2125 HOH A O   1 
HETATM 1561 O  O   . HOH C 3 .   ? 11.710 52.109 15.087  1.00 32.71  ? 2126 HOH A O   1 
HETATM 1562 O  O   . HOH C 3 .   ? 20.449 42.968 -0.584  1.00 31.99  ? 2127 HOH A O   1 
HETATM 1563 O  O   . HOH C 3 .   ? 28.222 72.726 10.941  1.00 29.97  ? 2128 HOH A O   1 
HETATM 1564 O  O   . HOH C 3 .   ? 3.944  65.795 4.005   1.00 20.14  ? 2129 HOH A O   1 
HETATM 1565 O  O   . HOH C 3 .   ? 20.130 71.604 11.826  1.00 35.74  ? 2130 HOH A O   1 
HETATM 1566 O  O   . HOH C 3 .   ? 32.658 59.891 -8.295  1.00 30.56  ? 2131 HOH A O   1 
HETATM 1567 O  O   . HOH C 3 .   ? 12.744 48.741 -13.986 1.00 24.58  ? 2132 HOH A O   1 
HETATM 1568 O  O   . HOH C 3 .   ? 13.973 70.295 -7.852  1.00 28.84  ? 2133 HOH A O   1 
HETATM 1569 O  O   . HOH C 3 .   ? 38.185 61.421 0.422   1.00 22.52  ? 2134 HOH A O   1 
HETATM 1570 O  O   . HOH C 3 .   ? 30.055 57.493 20.564  1.00 40.33  ? 2135 HOH A O   1 
HETATM 1571 O  O   . HOH C 3 .   ? 13.680 47.402 -11.790 1.00 42.36  ? 2136 HOH A O   1 
HETATM 1572 O  O   . HOH C 3 .   ? 18.388 72.447 -12.258 1.00 30.17  ? 2137 HOH A O   1 
HETATM 1573 O  O   . HOH C 3 .   ? 28.692 58.989 -11.119 1.00 21.81  ? 2138 HOH A O   1 
HETATM 1574 O  O   . HOH C 3 .   ? 24.159 53.766 -14.982 1.00 43.94  ? 2139 HOH A O   1 
HETATM 1575 O  O   . HOH C 3 .   ? 6.900  65.794 -10.894 1.00 24.94  ? 2140 HOH A O   1 
HETATM 1576 O  O   . HOH C 3 .   ? 19.670 57.642 -16.421 1.00 29.98  ? 2141 HOH A O   1 
HETATM 1577 O  O   . HOH C 3 .   ? 20.623 73.976 -8.683  1.00 41.85  ? 2142 HOH A O   1 
HETATM 1578 O  O   . HOH C 3 .   ? 16.472 79.418 -0.096  1.00 26.19  ? 2143 HOH A O   1 
HETATM 1579 O  O   . HOH C 3 .   ? 23.022 58.799 21.256  1.00 50.12  ? 2144 HOH A O   1 
HETATM 1580 O  O   . HOH C 3 .   ? 24.826 43.167 9.818   1.00 33.78  ? 2145 HOH A O   1 
HETATM 1581 O  O   . HOH C 3 .   ? 7.928  46.240 0.562   1.00 28.61  ? 2146 HOH A O   1 
HETATM 1582 O  O   . HOH C 3 .   ? 12.461 60.436 -21.583 1.00 38.19  ? 2147 HOH A O   1 
HETATM 1583 O  O   . HOH C 3 .   ? 25.562 68.065 -15.624 1.00 37.82  ? 2148 HOH A O   1 
HETATM 1584 O  O   . HOH C 3 .   ? 27.550 67.458 9.828   1.00 22.04  ? 2149 HOH A O   1 
HETATM 1585 O  O   . HOH C 3 .   ? 18.414 43.637 -5.633  1.00 26.06  ? 2150 HOH A O   1 
HETATM 1586 O  O   . HOH C 3 .   ? 33.920 51.056 -4.345  1.00 26.32  ? 2151 HOH A O   1 
HETATM 1587 O  O   . HOH C 3 .   ? 21.636 45.770 -4.402  1.00 28.86  ? 2152 HOH A O   1 
HETATM 1588 O  O   . HOH C 3 .   ? 5.577  50.029 8.564   1.00 39.61  ? 2153 HOH A O   1 
HETATM 1589 O  O   . HOH C 3 .   ? 9.663  68.052 -12.844 1.00 30.23  ? 2154 HOH A O   1 
HETATM 1590 O  O   . HOH C 3 .   ? 15.428 74.189 10.619  1.00 27.86  ? 2155 HOH A O   1 
HETATM 1591 O  O   . HOH C 3 .   ? 19.231 67.845 14.407  1.00 30.52  ? 2156 HOH A O   1 
HETATM 1592 O  O   . HOH C 3 .   ? 27.657 56.556 -10.517 1.00 22.28  ? 2157 HOH A O   1 
HETATM 1593 O  O   . HOH C 3 .   ? 28.898 68.027 -12.839 1.00 31.89  ? 2158 HOH A O   1 
HETATM 1594 O  O   . HOH C 3 .   ? 27.222 50.611 19.420  1.00 24.59  ? 2159 HOH A O   1 
HETATM 1595 O  O   . HOH C 3 .   ? 34.407 64.848 -9.025  1.00 26.06  ? 2160 HOH A O   1 
HETATM 1596 O  O   . HOH C 3 .   ? 20.411 41.574 1.379   1.00 46.66  ? 2161 HOH A O   1 
HETATM 1597 O  O   . HOH C 3 .   ? 8.288  45.520 2.984   1.00 23.81  ? 2162 HOH A O   1 
HETATM 1598 O  O   . HOH C 3 .   ? 30.571 56.385 -7.734  1.00 18.29  ? 2163 HOH A O   1 
HETATM 1599 O  O   . HOH C 3 .   ? 25.638 51.582 21.166  1.00 32.99  ? 2164 HOH A O   1 
HETATM 1600 O  O   . HOH C 3 .   ? 25.854 68.845 11.809  1.00 27.18  ? 2165 HOH A O   1 
HETATM 1601 O  O   . HOH C 3 .   ? 22.524 54.207 18.550  1.00 26.33  ? 2166 HOH A O   1 
HETATM 1602 O  O   . HOH C 3 .   ? 22.796 45.411 21.377  1.00 38.20  ? 2167 HOH A O   1 
HETATM 1603 O  O   . HOH C 3 .   ? 31.715 44.328 7.191   1.00 28.93  ? 2168 HOH A O   1 
HETATM 1604 O  O   . HOH C 3 .   ? 29.280 43.411 -4.673  1.00 38.23  ? 2169 HOH A O   1 
HETATM 1605 O  O   . HOH C 3 .   ? 29.925 56.831 -3.370  1.00 28.66  ? 2170 HOH A O   1 
HETATM 1606 O  O   . HOH C 3 .   ? 33.633 63.275 2.448   1.00 41.46  ? 2171 HOH A O   1 
HETATM 1607 O  O   . HOH C 3 .   ? 10.303 47.390 -13.438 1.00 34.33  ? 2172 HOH A O   1 
HETATM 1608 O  O   . HOH C 3 .   ? 23.508 63.196 18.260  1.00 36.55  ? 2173 HOH A O   1 
HETATM 1609 O  O   . HOH C 3 .   ? 13.812 72.178 -11.427 1.00 28.11  ? 2174 HOH A O   1 
HETATM 1610 O  O   . HOH C 3 .   ? 33.946 60.574 12.622  1.00 26.17  ? 2175 HOH A O   1 
HETATM 1611 O  O   . HOH C 3 .   ? 8.125  53.242 -13.037 1.00 34.46  ? 2176 HOH A O   1 
HETATM 1612 O  O   . HOH C 3 .   ? 39.051 61.239 2.544   1.00 26.51  ? 2177 HOH A O   1 
HETATM 1613 O  O   . HOH C 3 .   ? 26.903 45.305 12.191  1.00 38.61  ? 2178 HOH A O   1 
HETATM 1614 O  O   . HOH C 3 .   ? 28.244 65.455 -13.000 1.00 34.19  ? 2179 HOH A O   1 
HETATM 1615 O  O   . HOH C 3 .   ? 16.354 38.143 9.516   1.00 27.27  ? 2180 HOH A O   1 
HETATM 1616 O  O   . HOH C 3 .   ? 33.425 46.389 3.800   1.00 31.33  ? 2181 HOH A O   1 
HETATM 1617 O  O   . HOH C 3 .   ? 29.795 51.639 15.784  1.00 36.89  ? 2182 HOH A O   1 
HETATM 1618 O  O   . HOH C 3 .   ? 13.326 47.536 14.513  1.00 40.95  ? 2183 HOH A O   1 
HETATM 1619 O  O   . HOH C 3 .   ? 15.501 41.572 0.177   1.00 31.81  ? 2184 HOH A O   1 
HETATM 1620 O  O   . HOH C 3 .   ? 21.073 37.803 4.956   1.00 33.91  ? 2185 HOH A O   1 
HETATM 1621 O  O   . HOH C 3 .   ? 16.382 73.142 -10.354 1.00 27.14  ? 2186 HOH A O   1 
HETATM 1622 O  O   . HOH C 3 .   ? 22.959 74.634 -3.380  1.00 27.39  ? 2187 HOH A O   1 
HETATM 1623 O  O   . HOH C 3 .   ? 7.368  50.252 11.028  1.00 26.96  ? 2188 HOH A O   1 
HETATM 1624 O  O   . HOH C 3 .   ? 12.448 55.874 15.410  1.00 21.22  ? 2189 HOH A O   1 
HETATM 1625 O  O   . HOH C 3 .   ? 2.973  47.870 -2.415  1.00 39.10  ? 2190 HOH A O   1 
HETATM 1626 O  O   . HOH C 3 .   ? 30.114 69.450 10.611  1.00 32.46  ? 2191 HOH A O   1 
HETATM 1627 O  O   . HOH C 3 .   ? 18.709 76.511 8.654   1.00 29.62  ? 2192 HOH A O   1 
HETATM 1628 O  O   . HOH C 3 .   ? 31.933 45.084 -4.284  1.00 43.10  ? 2193 HOH A O   1 
HETATM 1629 O  O   . HOH C 3 .   ? 1.619  46.260 -7.860  1.00 33.10  ? 2194 HOH A O   1 
HETATM 1630 O  O   . HOH C 3 .   ? 10.374 67.817 9.708   1.00 27.84  ? 2195 HOH A O   1 
HETATM 1631 O  O   . HOH C 3 .   ? 3.207  60.936 -7.550  1.00 46.01  ? 2196 HOH A O   1 
HETATM 1632 O  O   . HOH C 3 .   ? 26.698 71.689 -9.065  1.00 35.32  ? 2197 HOH A O   1 
HETATM 1633 O  O   . HOH C 3 .   ? 22.163 56.276 22.114  1.00 27.79  ? 2198 HOH A O   1 
HETATM 1634 O  O   . HOH C 3 .   ? 34.189 60.461 15.549  1.00 39.84  ? 2199 HOH A O   1 
HETATM 1635 O  O   . HOH C 3 .   ? 1.010  50.827 -7.995  1.00 41.03  ? 2200 HOH A O   1 
HETATM 1636 O  O   . HOH C 3 .   ? 30.768 54.380 18.731  1.00 47.53  ? 2201 HOH A O   1 
HETATM 1637 O  O   . HOH C 3 .   ? 27.071 47.905 19.463  1.00 23.98  ? 2202 HOH A O   1 
HETATM 1638 O  O   . HOH C 3 .   ? 20.408 51.753 -19.806 1.00 48.07  ? 2203 HOH A O   1 
HETATM 1639 O  O   . HOH C 3 .   ? 29.835 54.813 -9.596  1.00 27.92  ? 2204 HOH A O   1 
HETATM 1640 O  O   . HOH C 3 .   ? 26.105 42.618 -3.351  1.00 33.56  ? 2205 HOH A O   1 
HETATM 1641 O  O   . HOH C 3 .   ? 35.406 51.964 8.232   1.00 29.66  ? 2206 HOH A O   1 
HETATM 1642 O  O   . HOH C 3 .   ? 24.325 50.530 22.706  1.00 43.49  ? 2207 HOH A O   1 
HETATM 1643 O  O   . HOH C 3 .   ? 18.569 45.735 -11.702 1.00 45.01  ? 2208 HOH A O   1 
HETATM 1644 O  O   . HOH C 3 .   ? 16.472 50.504 -12.433 1.00 28.11  ? 2209 HOH A O   1 
HETATM 1645 O  O   . HOH C 3 .   ? 30.840 66.130 12.188  1.00 39.06  ? 2210 HOH A O   1 
HETATM 1646 O  O   . HOH C 3 .   ? 6.622  63.665 9.544   1.00 30.73  ? 2211 HOH A O   1 
HETATM 1647 O  O   . HOH C 3 .   ? 27.632 67.926 13.391  1.00 33.88  ? 2212 HOH A O   1 
HETATM 1648 O  O   . HOH C 3 .   ? 30.343 65.578 19.300  1.00 42.94  ? 2213 HOH A O   1 
HETATM 1649 O  O   . HOH C 3 .   ? 28.518 48.182 14.377  1.00 34.55  ? 2214 HOH A O   1 
HETATM 1650 O  O   . HOH C 3 .   ? 7.457  60.316 10.902  1.00 33.39  ? 2215 HOH A O   1 
HETATM 1651 O  O   . HOH C 3 .   ? 25.438 40.850 0.912   1.00 42.71  ? 2216 HOH A O   1 
HETATM 1652 O  O   . HOH C 3 .   ? 3.909  61.627 8.875   1.00 36.82  ? 2217 HOH A O   1 
HETATM 1653 O  O   . HOH C 3 .   ? 0.541  52.504 0.369   1.00 37.66  ? 2218 HOH A O   1 
HETATM 1654 O  O   . HOH C 3 .   ? 30.459 50.813 -12.520 1.00 39.93  ? 2219 HOH A O   1 
HETATM 1655 O  O   . HOH C 3 .   ? 7.784  65.668 10.171  1.00 35.53  ? 2220 HOH A O   1 
HETATM 1656 O  O   . HOH C 3 .   ? 7.204  56.256 -14.017 1.00 30.01  ? 2221 HOH A O   1 
HETATM 1657 O  O   . HOH C 3 .   ? 11.612 49.663 16.559  1.00 35.19  ? 2222 HOH A O   1 
HETATM 1658 O  O   . HOH C 3 .   ? 37.696 48.588 -7.243  1.00 48.36  ? 2223 HOH A O   1 
HETATM 1659 O  O   . HOH C 3 .   ? 9.999  65.815 17.355  1.00 33.29  ? 2224 HOH A O   1 
HETATM 1660 O  O   . HOH C 3 .   ? 11.861 60.249 13.576  1.00 28.03  ? 2225 HOH A O   1 
HETATM 1661 O  O   . HOH C 3 .   ? 20.406 73.778 -11.842 1.00 38.50  ? 2226 HOH A O   1 
HETATM 1662 O  O   . HOH C 3 .   ? 34.945 48.507 -5.216  1.00 33.65  ? 2227 HOH A O   1 
HETATM 1663 O  O   . HOH C 3 .   ? 25.367 58.848 -15.081 1.00 48.69  ? 2228 HOH A O   1 
HETATM 1664 O  O   . HOH C 3 .   ? 18.894 57.515 -13.867 1.00 32.65  ? 2229 HOH A O   1 
HETATM 1665 O  O   . HOH C 3 .   ? 1.023  60.250 3.320   1.00 32.90  ? 2230 HOH A O   1 
HETATM 1666 O  O   . HOH C 3 .   ? 10.851 51.539 -14.921 1.00 41.72  ? 2231 HOH A O   1 
HETATM 1667 O  O   . HOH C 3 .   ? 32.209 48.441 -7.704  1.00 36.38  ? 2232 HOH A O   1 
HETATM 1668 O  O   . HOH C 3 .   ? 33.980 65.373 6.901   1.00 44.66  ? 2233 HOH A O   1 
HETATM 1669 O  O   . HOH C 3 .   ? 13.329 39.413 6.517   1.00 33.48  ? 2234 HOH A O   1 
HETATM 1670 O  O   . HOH C 3 .   ? 15.049 69.361 21.298  1.00 44.05  ? 2235 HOH A O   1 
HETATM 1671 O  O   . HOH C 3 .   ? 4.406  58.862 7.242   1.00 34.25  ? 2236 HOH A O   1 
HETATM 1672 O  O   . HOH C 3 .   ? 13.942 39.041 8.982   1.00 37.25  ? 2237 HOH A O   1 
HETATM 1673 O  O   . HOH C 3 .   ? 19.287 66.416 22.153  1.00 37.34  ? 2238 HOH A O   1 
HETATM 1674 O  O   . HOH C 3 .   ? 31.923 49.503 -10.317 1.00 30.30  ? 2239 HOH A O   1 
HETATM 1675 O  O   . HOH C 3 .   ? 9.604  50.086 9.549   1.00 13.27  ? 2240 HOH A O   1 
HETATM 1676 O  O   . HOH C 3 .   ? 10.749 47.772 9.043   1.00 16.41  ? 2241 HOH A O   1 
HETATM 1677 O  O   . HOH C 3 .   ? 38.902 51.647 3.036   1.00 29.54  ? 2242 HOH A O   1 
HETATM 1678 O  O   . HOH C 3 .   ? 20.465 72.859 -15.051 1.00 75.49  ? 2243 HOH A O   1 
HETATM 1679 O  O   . HOH C 3 .   ? 20.316 65.352 23.910  1.00 33.63  ? 2244 HOH A O   1 
HETATM 1680 O  O   . HOH C 3 .   ? 28.933 48.604 -10.490 1.00 35.95  ? 2245 HOH A O   1 
HETATM 1681 O  O   . HOH C 3 .   ? 36.656 56.904 -5.328  1.00 43.25  ? 2246 HOH A O   1 
HETATM 1682 O  O   . HOH C 3 .   ? 33.218 68.205 -11.709 1.00 41.57  ? 2247 HOH A O   1 
HETATM 1683 O  O   . HOH C 3 .   ? 34.305 56.006 6.814   1.00 18.82  ? 2248 HOH A O   1 
HETATM 1684 O  O   . HOH C 3 .   ? 16.480 75.533 -4.628  1.00 40.56  ? 2249 HOH A O   1 
HETATM 1685 O  O   . HOH C 3 .   ? 34.868 63.471 4.441   1.00 42.78  ? 2250 HOH A O   1 
HETATM 1686 O  O   . HOH C 3 .   ? 23.556 40.048 -1.659  1.00 37.21  ? 2251 HOH A O   1 
HETATM 1687 O  O   . HOH C 3 .   ? 38.898 49.637 -3.680  1.00 42.23  ? 2252 HOH A O   1 
HETATM 1688 O  O   . HOH C 3 .   ? 12.573 39.445 11.936  1.00 37.66  ? 2253 HOH A O   1 
HETATM 1689 O  O   . HOH C 3 .   ? 20.385 54.348 21.936  1.00 34.73  ? 2254 HOH A O   1 
HETATM 1690 O  O   . HOH C 3 .   ? 14.110 66.518 -18.222 1.00 47.18  ? 2255 HOH A O   1 
HETATM 1691 O  O   . HOH C 3 .   ? 15.783 43.013 -5.732  1.00 31.23  ? 2256 HOH A O   1 
HETATM 1692 O  O   . HOH C 3 .   ? 16.398 52.324 -16.090 1.00 52.03  ? 2257 HOH A O   1 
HETATM 1693 O  O   . HOH C 3 .   ? 13.373 46.146 18.448  1.00 40.93  ? 2258 HOH A O   1 
HETATM 1694 O  O   . HOH C 3 .   ? 27.429 74.661 -6.985  1.00 41.29  ? 2259 HOH A O   1 
HETATM 1695 O  O   . HOH C 3 .   ? 22.205 71.160 -18.838 1.00 36.48  ? 2260 HOH A O   1 
HETATM 1696 O  O   . HOH C 3 .   ? -1.283 64.290 3.862   1.00 46.60  ? 2261 HOH A O   1 
HETATM 1697 O  O   . HOH C 3 .   ? 15.234 50.322 21.250  1.00 31.54  ? 2262 HOH A O   1 
HETATM 1698 O  O   . HOH C 3 .   ? 1.279  65.029 4.816   1.00 47.41  ? 2263 HOH A O   1 
HETATM 1699 O  O   . HOH C 3 .   ? 29.384 47.539 -8.503  1.00 40.78  ? 2264 HOH A O   1 
HETATM 1700 O  O   . HOH C 3 .   ? 9.395  59.499 -10.389 1.00 5.61   ? 2265 HOH A O   1 
HETATM 1701 O  O   . HOH C 3 .   ? 7.074  59.785 -8.667  1.00 5.90   ? 2266 HOH A O   1 
HETATM 1702 O  O   . HOH C 3 .   ? 9.890  60.226 -7.415  1.00 4.85   ? 2267 HOH A O   1 
HETATM 1703 O  O   . HOH C 3 .   ? 19.992 65.599 -22.258 1.00 40.38  ? 2268 HOH A O   1 
HETATM 1704 O  O   . HOH C 3 .   ? 19.423 75.694 -4.754  1.00 49.15  ? 2269 HOH A O   1 
HETATM 1705 O  O   . HOH C 3 .   ? 28.897 60.262 21.332  1.00 44.80  ? 2270 HOH A O   1 
HETATM 1706 O  O   . HOH C 3 .   ? 21.132 51.526 22.152  1.00 43.05  ? 2271 HOH A O   1 
HETATM 1707 O  O   . HOH C 3 .   ? 23.098 42.532 -0.696  1.00 43.51  ? 2272 HOH A O   1 
HETATM 1708 O  O   . HOH C 3 .   ? 21.785 70.644 -21.959 1.00 41.02  ? 2273 HOH A O   1 
HETATM 1709 O  O   . HOH C 3 .   ? 2.437  66.368 -10.607 1.00 32.71  ? 2274 HOH A O   1 
HETATM 1710 O  O   . HOH C 3 .   ? 32.810 61.406 -10.597 1.00 37.89  ? 2275 HOH A O   1 
HETATM 1711 O  O   . HOH C 3 .   ? 17.957 77.554 -0.986  1.00 35.47  ? 2276 HOH A O   1 
HETATM 1712 O  O   . HOH C 3 .   ? 18.181 39.587 2.215   1.00 46.38  ? 2277 HOH A O   1 
HETATM 1713 O  O   . HOH C 3 .   ? 5.432  60.635 13.073  1.00 45.46  ? 2278 HOH A O   1 
HETATM 1714 O  O   . HOH C 3 .   ? 20.469 40.054 -7.978  1.00 55.34  ? 2280 HOH A O   1 
HETATM 1715 O  O   . HOH C 3 .   ? 23.506 66.548 -22.951 1.00 42.89  ? 2281 HOH A O   1 
HETATM 1716 O  O   . HOH C 3 .   ? 24.040 71.881 -11.037 1.00 73.84  ? 2282 HOH A O   1 
HETATM 1717 O  O   . HOH C 3 .   ? 34.979 59.948 10.237  1.00 52.09  ? 2283 HOH A O   1 
HETATM 1718 O  O   . HOH C 3 .   ? 38.619 57.425 6.000   1.00 49.06  ? 2284 HOH A O   1 
HETATM 1719 O  O   . HOH C 3 .   ? 22.681 65.529 19.036  1.00 47.56  ? 2285 HOH A O   1 
HETATM 1720 O  O   . HOH C 3 .   ? 19.288 39.609 16.350  1.00 58.50  ? 2286 HOH A O   1 
HETATM 1721 O  O   . HOH C 3 .   ? 17.471 42.132 20.756  1.00 52.79  ? 2287 HOH A O   1 
HETATM 1722 O  O   . HOH C 3 .   ? 26.261 58.785 21.924  1.00 66.43  ? 2288 HOH A O   1 
HETATM 1723 O  O   . HOH C 3 .   ? 17.594 71.594 14.977  1.00 51.79  ? 2289 HOH A O   1 
HETATM 1724 O  O   . HOH C 3 .   ? 9.334  46.295 -15.201 1.00 63.95  ? 2290 HOH A O   1 
HETATM 1725 O  O   . HOH C 3 .   ? 38.935 58.263 -6.362  1.00 70.87  ? 2291 HOH A O   1 
HETATM 1726 O  O   . HOH C 3 .   ? 15.662 75.564 -9.147  1.00 66.34  ? 2292 HOH A O   1 
HETATM 1727 O  O   . HOH C 3 .   ? 20.330 70.488 14.031  1.00 89.68  ? 2293 HOH A O   1 
HETATM 1728 O  O   . HOH C 3 .   ? 11.844 46.046 -14.490 1.00 56.77  ? 2294 HOH A O   1 
HETATM 1729 O  O   . HOH C 3 .   ? 9.687  50.860 16.198  1.00 52.14  ? 2295 HOH A O   1 
HETATM 1730 O  O   . HOH C 3 .   ? 33.099 62.766 13.763  1.00 70.85  ? 2296 HOH A O   1 
HETATM 1731 O  O   . HOH C 3 .   ? 2.873  45.321 -10.290 1.00 50.00  ? 2297 HOH A O   1 
HETATM 1732 O  O   . HOH C 3 .   ? 1.263  66.480 2.814   1.00 50.00  ? 2298 HOH A O   1 
HETATM 1733 O  O   . HOH C 3 .   ? 26.472 49.376 16.450  1.00 50.00  ? 2299 HOH A O   1 
HETATM 1734 O  O   . HOH C 3 .   ? 7.653  40.651 12.696  1.00 50.00  ? 2300 HOH A O   1 
HETATM 1735 O  O   . HOH C 3 .   ? 26.705 56.618 -13.151 1.00 50.00  ? 2301 HOH A O   1 
HETATM 1736 O  O   . HOH C 3 .   ? 21.135 42.431 -3.270  1.00 50.00  ? 2302 HOH A O   1 
HETATM 1737 O  O   . HOH C 3 .   ? 17.172 40.218 13.819  1.00 50.00  ? 2303 HOH A O   1 
HETATM 1738 O  O   . HOH C 3 .   ? 33.187 56.813 -6.846  1.00 50.00  ? 2304 HOH A O   1 
HETATM 1739 O  O   . HOH C 3 .   ? 3.104  57.085 6.185   1.00 50.00  ? 2305 HOH A O   1 
HETATM 1740 O  O   . HOH C 3 .   ? 23.425 66.451 15.809  1.00 50.00  ? 2306 HOH A O   1 
HETATM 1741 O  O   . HOH C 3 .   ? 23.161 60.094 -18.882 1.00 50.00  ? 2307 HOH A O   1 
HETATM 1742 O  O   . HOH C 3 .   ? 1.201  68.372 -9.900  1.00 50.00  ? 2308 HOH A O   1 
HETATM 1743 O  O   . HOH C 3 .   ? 18.484 42.908 -8.298  1.00 50.00  ? 2309 HOH A O   1 
HETATM 1744 O  O   . HOH C 3 .   ? 18.866 63.520 -23.102 1.00 50.00  ? 2310 HOH A O   1 
HETATM 1745 O  O   . HOH C 3 .   ? 34.658 49.437 14.109  1.00 50.00  ? 2311 HOH A O   1 
HETATM 1746 O  O   . HOH C 3 .   ? 35.097 57.011 9.079   1.00 50.00  ? 2312 HOH A O   1 
HETATM 1747 O  O   . HOH C 3 .   ? 14.967 39.462 2.906   1.00 50.00  ? 2313 HOH A O   1 
HETATM 1748 O  O   . HOH C 3 .   ? 9.458  39.073 12.255  1.00 50.00  ? 2314 HOH A O   1 
HETATM 1749 O  O   . HOH C 3 .   ? 17.511 68.966 15.826  1.00 50.00  ? 2315 HOH A O   1 
HETATM 1750 O  O   . HOH C 3 .   ? 26.975 44.264 -5.035  1.00 50.00  ? 2316 HOH A O   1 
HETATM 1751 O  O   . HOH C 3 .   ? 16.501 37.900 12.189  1.00 50.00  ? 2317 HOH A O   1 
HETATM 1752 O  O   . HOH C 3 .   ? 7.909  51.717 13.054  1.00 50.00  ? 2318 HOH A O   1 
HETATM 1753 O  O   . HOH C 3 .   ? 18.309 76.117 -12.245 1.00 50.00  ? 2319 HOH A O   1 
HETATM 1754 O  O   . HOH C 3 .   ? 5.733  44.131 14.522  1.00 50.00  ? 2320 HOH A O   1 
HETATM 1755 O  O   . HOH C 3 .   ? 32.354 52.955 17.808  1.00 50.00  ? 2321 HOH A O   1 
HETATM 1756 O  O   . HOH C 3 .   ? 12.002 40.848 1.877   1.00 50.00  ? 2322 HOH A O   1 
HETATM 1757 O  O   . HOH C 3 .   ? 25.817 76.013 -8.042  1.00 50.00  ? 2323 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
97   S SD A MET A 13  ? 0.2104 0.3096 0.7275 -0.0037 -0.0830 0.1464  140 MET A SD 
98   S SD B MET A 13  ? 0.2513 0.4971 0.3676 0.2671  -0.1011 0.0370  140 MET A SD 
218  S SD . MET A 27  ? 0.0590 0.0566 0.1975 0.0112  -0.0007 -0.0151 154 MET A SD 
250  S SD . MET A 31  ? 0.1637 0.1454 0.3051 0.0656  0.0848  0.0345  158 MET A SD 
275  S SG . CYS A 34  ? 0.2034 0.1764 0.3667 0.0241  -0.0046 0.0152  161 CYS A SG 
615  S SD . MET A 75  ? 0.0634 0.0583 0.1138 -0.0150 0.0028  0.0008  202 MET A SD 
1374 S SG . CYS A 172 ? 0.1378 0.1776 0.3018 0.0107  -0.0009 0.0518  299 CYS A SG 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   128 128 GLY GLY A . n 
A 1 2   ASN 2   129 129 ASN ASN A . n 
A 1 3   VAL 3   130 130 VAL VAL A . n 
A 1 4   ASP 4   131 131 ASP ASP A . n 
A 1 5   LEU 5   132 132 LEU LEU A . n 
A 1 6   VAL 6   133 133 VAL VAL A . n 
A 1 7   PHE 7   134 134 PHE PHE A . n 
A 1 8   LEU 8   135 135 LEU LEU A . n 
A 1 9   PHE 9   136 136 PHE PHE A . n 
A 1 10  ASP 10  137 137 ASP ASP A . n 
A 1 11  GLY 11  138 138 GLY GLY A . n 
A 1 12  SER 12  139 139 SER SER A . n 
A 1 13  MET 13  140 140 MET MET A . n 
A 1 14  SER 14  141 141 SER SER A . n 
A 1 15  LEU 15  142 142 LEU LEU A . n 
A 1 16  GLN 16  143 143 GLN GLN A . n 
A 1 17  PRO 17  144 144 PRO PRO A . n 
A 1 18  ASP 18  145 145 ASP ASP A . n 
A 1 19  GLU 19  146 146 GLU GLU A . n 
A 1 20  PHE 20  147 147 PHE PHE A . n 
A 1 21  GLN 21  148 148 GLN GLN A . n 
A 1 22  LYS 22  149 149 LYS LYS A . n 
A 1 23  ILE 23  150 150 ILE ILE A . n 
A 1 24  LEU 24  151 151 LEU LEU A . n 
A 1 25  ASP 25  152 152 ASP ASP A . n 
A 1 26  PHE 26  153 153 PHE PHE A . n 
A 1 27  MET 27  154 154 MET MET A . n 
A 1 28  LYS 28  155 155 LYS LYS A . n 
A 1 29  ASP 29  156 156 ASP ASP A . n 
A 1 30  VAL 30  157 157 VAL VAL A . n 
A 1 31  MET 31  158 158 MET MET A . n 
A 1 32  LYS 32  159 159 LYS LYS A . n 
A 1 33  LYS 33  160 160 LYS LYS A . n 
A 1 34  CYS 34  161 161 CYS CYS A . n 
A 1 35  SER 35  162 162 SER SER A . n 
A 1 36  ASN 36  163 163 ASN ASN A . n 
A 1 37  THR 37  164 164 THR THR A . n 
A 1 38  SER 38  165 165 SER SER A . n 
A 1 39  TYR 39  166 166 TYR TYR A . n 
A 1 40  GLN 40  167 167 GLN GLN A . n 
A 1 41  PHE 41  168 168 PHE PHE A . n 
A 1 42  ALA 42  169 169 ALA ALA A . n 
A 1 43  ALA 43  170 170 ALA ALA A . n 
A 1 44  VAL 44  171 171 VAL VAL A . n 
A 1 45  GLN 45  172 172 GLN GLN A . n 
A 1 46  PHE 46  173 173 PHE PHE A . n 
A 1 47  SER 47  174 174 SER SER A . n 
A 1 48  THR 48  175 175 THR THR A . n 
A 1 49  SER 49  176 176 SER SER A . n 
A 1 50  TYR 50  177 177 TYR TYR A . n 
A 1 51  LYS 51  178 178 LYS LYS A . n 
A 1 52  THR 52  179 179 THR THR A . n 
A 1 53  GLU 53  180 180 GLU GLU A . n 
A 1 54  PHE 54  181 181 PHE PHE A . n 
A 1 55  ASP 55  182 182 ASP ASP A . n 
A 1 56  PHE 56  183 183 PHE PHE A . n 
A 1 57  SER 57  184 184 SER SER A . n 
A 1 58  ASP 58  185 185 ASP ASP A . n 
A 1 59  TYR 59  186 186 TYR TYR A . n 
A 1 60  VAL 60  187 187 VAL VAL A . n 
A 1 61  LYS 61  188 188 LYS LYS A . n 
A 1 62  ARG 62  189 189 ARG ARG A . n 
A 1 63  LYS 63  190 190 LYS LYS A . n 
A 1 64  ASP 64  191 191 ASP ASP A . n 
A 1 65  PRO 65  192 192 PRO PRO A . n 
A 1 66  ASP 66  193 193 ASP ASP A . n 
A 1 67  ALA 67  194 194 ALA ALA A . n 
A 1 68  LEU 68  195 195 LEU LEU A . n 
A 1 69  LEU 69  196 196 LEU LEU A . n 
A 1 70  LYS 70  197 197 LYS LYS A . n 
A 1 71  HIS 71  198 198 HIS HIS A . n 
A 1 72  VAL 72  199 199 VAL VAL A . n 
A 1 73  LYS 73  200 200 LYS LYS A . n 
A 1 74  HIS 74  201 201 HIS HIS A . n 
A 1 75  MET 75  202 202 MET MET A . n 
A 1 76  LEU 76  203 203 LEU LEU A . n 
A 1 77  LEU 77  204 204 LEU LEU A . n 
A 1 78  LEU 78  205 205 LEU LEU A . n 
A 1 79  THR 79  206 206 THR THR A . n 
A 1 80  ASN 80  207 207 ASN ASN A . n 
A 1 81  THR 81  208 208 THR THR A . n 
A 1 82  PHE 82  209 209 PHE PHE A . n 
A 1 83  GLY 83  210 210 GLY GLY A . n 
A 1 84  ALA 84  211 211 ALA ALA A . n 
A 1 85  ILE 85  212 212 ILE ILE A . n 
A 1 86  ASN 86  213 213 ASN ASN A . n 
A 1 87  TYR 87  214 214 TYR TYR A . n 
A 1 88  VAL 88  215 215 VAL VAL A . n 
A 1 89  ALA 89  216 216 ALA ALA A . n 
A 1 90  THR 90  217 217 THR THR A . n 
A 1 91  GLU 91  218 218 GLU GLU A . n 
A 1 92  VAL 92  219 219 VAL VAL A . n 
A 1 93  PHE 93  220 220 PHE PHE A . n 
A 1 94  ARG 94  221 221 ARG ARG A . n 
A 1 95  GLU 95  222 222 GLU GLU A . n 
A 1 96  GLU 96  223 223 GLU GLU A . n 
A 1 97  LEU 97  224 224 LEU LEU A . n 
A 1 98  GLY 98  225 225 GLY GLY A . n 
A 1 99  ALA 99  226 226 ALA ALA A . n 
A 1 100 ARG 100 227 227 ARG ARG A . n 
A 1 101 PRO 101 228 228 PRO PRO A . n 
A 1 102 ASP 102 229 229 ASP ASP A . n 
A 1 103 ALA 103 230 230 ALA ALA A . n 
A 1 104 THR 104 231 231 THR THR A . n 
A 1 105 LYS 105 232 232 LYS LYS A . n 
A 1 106 VAL 106 233 233 VAL VAL A . n 
A 1 107 LEU 107 234 234 LEU LEU A . n 
A 1 108 ILE 108 235 235 ILE ILE A . n 
A 1 109 ILE 109 236 236 ILE ILE A . n 
A 1 110 ILE 110 237 237 ILE ILE A . n 
A 1 111 THR 111 238 238 THR THR A . n 
A 1 112 ASP 112 239 239 ASP ASP A . n 
A 1 113 GLY 113 240 240 GLY GLY A . n 
A 1 114 GLU 114 241 241 GLU GLU A . n 
A 1 115 ALA 115 242 242 ALA ALA A . n 
A 1 116 THR 116 243 243 THR THR A . n 
A 1 117 ASP 117 244 244 ASP ASP A . n 
A 1 118 SER 118 245 245 SER SER A . n 
A 1 119 GLY 119 246 246 GLY GLY A . n 
A 1 120 ASN 120 247 247 ASN ASN A . n 
A 1 121 ILE 121 248 248 ILE ILE A . n 
A 1 122 ASP 122 249 249 ASP ASP A . n 
A 1 123 ALA 123 250 250 ALA ALA A . n 
A 1 124 ALA 124 251 251 ALA ALA A . n 
A 1 125 LYS 125 252 252 LYS LYS A . n 
A 1 126 ASP 126 253 253 ASP ASP A . n 
A 1 127 ILE 127 254 254 ILE ILE A . n 
A 1 128 ILE 128 255 255 ILE ILE A . n 
A 1 129 ARG 129 256 256 ARG ARG A . n 
A 1 130 TYR 130 257 257 TYR TYR A . n 
A 1 131 ILE 131 258 258 ILE ILE A . n 
A 1 132 ILE 132 259 259 ILE ILE A . n 
A 1 133 GLY 133 260 260 GLY GLY A . n 
A 1 134 ILE 134 261 261 ILE ILE A . n 
A 1 135 GLY 135 262 262 GLY GLY A . n 
A 1 136 LYS 136 263 263 LYS LYS A . n 
A 1 137 HIS 137 264 264 HIS HIS A . n 
A 1 138 PHE 138 265 265 PHE PHE A . n 
A 1 139 GLN 139 266 266 GLN GLN A . n 
A 1 140 THR 140 267 267 THR THR A . n 
A 1 141 LYS 141 268 268 LYS LYS A . n 
A 1 142 GLU 142 269 269 GLU GLU A . n 
A 1 143 SER 143 270 270 SER SER A . n 
A 1 144 GLN 144 271 271 GLN GLN A . n 
A 1 145 GLU 145 272 272 GLU GLU A . n 
A 1 146 THR 146 273 273 THR THR A . n 
A 1 147 LEU 147 274 274 LEU LEU A . n 
A 1 148 HIS 148 275 275 HIS HIS A . n 
A 1 149 LYS 149 276 276 LYS LYS A . n 
A 1 150 PHE 150 277 277 PHE PHE A . n 
A 1 151 ALA 151 278 278 ALA ALA A . n 
A 1 152 SER 152 279 279 SER SER A . n 
A 1 153 LYS 153 280 280 LYS LYS A . n 
A 1 154 PRO 154 281 281 PRO PRO A . n 
A 1 155 ALA 155 282 282 ALA ALA A . n 
A 1 156 SER 156 283 283 SER SER A . n 
A 1 157 GLU 157 284 284 GLU GLU A . n 
A 1 158 PHE 158 285 285 PHE PHE A . n 
A 1 159 VAL 159 286 286 VAL VAL A . n 
A 1 160 LYS 160 287 287 LYS LYS A . n 
A 1 161 ILE 161 288 288 ILE ILE A . n 
A 1 162 LEU 162 289 289 LEU LEU A . n 
A 1 163 ASP 163 290 290 ASP ASP A . n 
A 1 164 THR 164 291 291 THR THR A . n 
A 1 165 PHE 165 292 292 PHE PHE A . n 
A 1 166 GLU 166 293 293 GLU GLU A . n 
A 1 167 LYS 167 294 294 LYS LYS A . n 
A 1 168 LEU 168 295 295 LEU LEU A . n 
A 1 169 LYS 169 296 296 LYS LYS A . n 
A 1 170 ASP 170 297 297 ASP ASP A . n 
A 1 171 LEU 171 298 298 LEU LEU A . n 
A 1 172 CYS 172 299 299 CYS CYS A . n 
A 1 173 THR 173 300 300 THR THR A . n 
A 1 174 GLU 174 301 301 GLU GLU A . n 
A 1 175 LEU 175 302 302 LEU LEU A . n 
A 1 176 GLN 176 303 303 GLN GLN A . n 
A 1 177 LYS 177 304 304 LYS LYS A . n 
A 1 178 LYS 178 305 305 LYS LYS A . n 
A 1 179 ILE 179 306 306 ILE ILE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   1001 1001 MG  IUM A . 
C 3 HOH 1   2001 2001 HOH HOH A . 
C 3 HOH 2   2002 2002 HOH HOH A . 
C 3 HOH 3   2003 2003 HOH HOH A . 
C 3 HOH 4   2004 2004 HOH HOH A . 
C 3 HOH 5   2005 2005 HOH HOH A . 
C 3 HOH 6   2006 2006 HOH HOH A . 
C 3 HOH 7   2007 2007 HOH HOH A . 
C 3 HOH 8   2008 2008 HOH HOH A . 
C 3 HOH 9   2009 2009 HOH HOH A . 
C 3 HOH 10  2010 2010 HOH HOH A . 
C 3 HOH 11  2011 2011 HOH HOH A . 
C 3 HOH 12  2012 2012 HOH HOH A . 
C 3 HOH 13  2013 2013 HOH HOH A . 
C 3 HOH 14  2014 2014 HOH HOH A . 
C 3 HOH 15  2015 2015 HOH HOH A . 
C 3 HOH 16  2016 2016 HOH HOH A . 
C 3 HOH 17  2017 2017 HOH HOH A . 
C 3 HOH 18  2018 2018 HOH HOH A . 
C 3 HOH 19  2019 2019 HOH HOH A . 
C 3 HOH 20  2020 2020 HOH HOH A . 
C 3 HOH 21  2021 2021 HOH HOH A . 
C 3 HOH 22  2022 2022 HOH HOH A . 
C 3 HOH 23  2023 2023 HOH HOH A . 
C 3 HOH 24  2024 2024 HOH HOH A . 
C 3 HOH 25  2025 2025 HOH HOH A . 
C 3 HOH 26  2026 2026 HOH HOH A . 
C 3 HOH 27  2027 2027 HOH HOH A . 
C 3 HOH 28  2028 2028 HOH HOH A . 
C 3 HOH 29  2029 2029 HOH HOH A . 
C 3 HOH 30  2030 2030 HOH HOH A . 
C 3 HOH 31  2031 2031 HOH HOH A . 
C 3 HOH 32  2032 2032 HOH HOH A . 
C 3 HOH 33  2033 2033 HOH HOH A . 
C 3 HOH 34  2034 2034 HOH HOH A . 
C 3 HOH 35  2035 2035 HOH HOH A . 
C 3 HOH 36  2036 2036 HOH HOH A . 
C 3 HOH 37  2037 2037 HOH HOH A . 
C 3 HOH 38  2038 2038 HOH HOH A . 
C 3 HOH 39  2039 2039 HOH HOH A . 
C 3 HOH 40  2040 2040 HOH HOH A . 
C 3 HOH 41  2041 2041 HOH HOH A . 
C 3 HOH 42  2042 2042 HOH HOH A . 
C 3 HOH 43  2043 2043 HOH HOH A . 
C 3 HOH 44  2044 2044 HOH HOH A . 
C 3 HOH 45  2045 2045 HOH HOH A . 
C 3 HOH 46  2046 2046 HOH HOH A . 
C 3 HOH 47  2047 2047 HOH HOH A . 
C 3 HOH 48  2048 2048 HOH HOH A . 
C 3 HOH 49  2049 2049 HOH HOH A . 
C 3 HOH 50  2050 2050 HOH HOH A . 
C 3 HOH 51  2051 2051 HOH HOH A . 
C 3 HOH 52  2052 2052 HOH HOH A . 
C 3 HOH 53  2053 2053 HOH HOH A . 
C 3 HOH 54  2054 2054 HOH HOH A . 
C 3 HOH 55  2055 2055 HOH HOH A . 
C 3 HOH 56  2056 2056 HOH HOH A . 
C 3 HOH 57  2057 2057 HOH HOH A . 
C 3 HOH 58  2058 2058 HOH HOH A . 
C 3 HOH 59  2059 2059 HOH HOH A . 
C 3 HOH 60  2060 2060 HOH HOH A . 
C 3 HOH 61  2061 2061 HOH HOH A . 
C 3 HOH 62  2062 2062 HOH HOH A . 
C 3 HOH 63  2063 2063 HOH HOH A . 
C 3 HOH 64  2064 2064 HOH HOH A . 
C 3 HOH 65  2065 2065 HOH HOH A . 
C 3 HOH 66  2066 2066 HOH HOH A . 
C 3 HOH 67  2067 2067 HOH HOH A . 
C 3 HOH 68  2068 2068 HOH HOH A . 
C 3 HOH 69  2069 2069 HOH HOH A . 
C 3 HOH 70  2070 2070 HOH HOH A . 
C 3 HOH 71  2071 2071 HOH HOH A . 
C 3 HOH 72  2072 2072 HOH HOH A . 
C 3 HOH 73  2073 2073 HOH HOH A . 
C 3 HOH 74  2074 2074 HOH HOH A . 
C 3 HOH 75  2075 2075 HOH HOH A . 
C 3 HOH 76  2076 2076 HOH HOH A . 
C 3 HOH 77  2077 2077 HOH HOH A . 
C 3 HOH 78  2078 2078 HOH HOH A . 
C 3 HOH 79  2079 2079 HOH HOH A . 
C 3 HOH 80  2080 2080 HOH HOH A . 
C 3 HOH 81  2081 2081 HOH HOH A . 
C 3 HOH 82  2082 2082 HOH HOH A . 
C 3 HOH 83  2083 2083 HOH HOH A . 
C 3 HOH 84  2084 2084 HOH HOH A . 
C 3 HOH 85  2085 2085 HOH HOH A . 
C 3 HOH 86  2086 2086 HOH HOH A . 
C 3 HOH 87  2087 2087 HOH HOH A . 
C 3 HOH 88  2088 2088 HOH HOH A . 
C 3 HOH 89  2089 2089 HOH HOH A . 
C 3 HOH 90  2090 2090 HOH HOH A . 
C 3 HOH 91  2091 2091 HOH HOH A . 
C 3 HOH 92  2092 2092 HOH HOH A . 
C 3 HOH 93  2093 2093 HOH HOH A . 
C 3 HOH 94  2094 2094 HOH HOH A . 
C 3 HOH 95  2095 2095 HOH HOH A . 
C 3 HOH 96  2096 2096 HOH HOH A . 
C 3 HOH 97  2097 2097 HOH HOH A . 
C 3 HOH 98  2098 2098 HOH HOH A . 
C 3 HOH 99  2099 2099 HOH HOH A . 
C 3 HOH 100 2100 2100 HOH HOH A . 
C 3 HOH 101 2101 2101 HOH HOH A . 
C 3 HOH 102 2102 2102 HOH HOH A . 
C 3 HOH 103 2103 2103 HOH HOH A . 
C 3 HOH 104 2104 2104 HOH HOH A . 
C 3 HOH 105 2105 2105 HOH HOH A . 
C 3 HOH 106 2106 2106 HOH HOH A . 
C 3 HOH 107 2107 2107 HOH HOH A . 
C 3 HOH 108 2108 2108 HOH HOH A . 
C 3 HOH 109 2109 2109 HOH HOH A . 
C 3 HOH 110 2110 2110 HOH HOH A . 
C 3 HOH 111 2111 2111 HOH HOH A . 
C 3 HOH 112 2112 2112 HOH HOH A . 
C 3 HOH 113 2113 2113 HOH HOH A . 
C 3 HOH 114 2114 2114 HOH HOH A . 
C 3 HOH 115 2115 2115 HOH HOH A . 
C 3 HOH 116 2116 2116 HOH HOH A . 
C 3 HOH 117 2117 2117 HOH HOH A . 
C 3 HOH 118 2118 2118 HOH HOH A . 
C 3 HOH 119 2119 2119 HOH HOH A . 
C 3 HOH 120 2120 2120 HOH HOH A . 
C 3 HOH 121 2121 2121 HOH HOH A . 
C 3 HOH 122 2122 2122 HOH HOH A . 
C 3 HOH 123 2123 2123 HOH HOH A . 
C 3 HOH 124 2124 2124 HOH HOH A . 
C 3 HOH 125 2125 2125 HOH HOH A . 
C 3 HOH 126 2126 2126 HOH HOH A . 
C 3 HOH 127 2127 2127 HOH HOH A . 
C 3 HOH 128 2128 2128 HOH HOH A . 
C 3 HOH 129 2129 2129 HOH HOH A . 
C 3 HOH 130 2130 2130 HOH HOH A . 
C 3 HOH 131 2131 2131 HOH HOH A . 
C 3 HOH 132 2132 2132 HOH HOH A . 
C 3 HOH 133 2133 2133 HOH HOH A . 
C 3 HOH 134 2134 2134 HOH HOH A . 
C 3 HOH 135 2135 2135 HOH HOH A . 
C 3 HOH 136 2136 2136 HOH HOH A . 
C 3 HOH 137 2137 2137 HOH HOH A . 
C 3 HOH 138 2138 2138 HOH HOH A . 
C 3 HOH 139 2139 2139 HOH HOH A . 
C 3 HOH 140 2140 2140 HOH HOH A . 
C 3 HOH 141 2141 2141 HOH HOH A . 
C 3 HOH 142 2142 2142 HOH HOH A . 
C 3 HOH 143 2143 2143 HOH HOH A . 
C 3 HOH 144 2144 2144 HOH HOH A . 
C 3 HOH 145 2145 2145 HOH HOH A . 
C 3 HOH 146 2146 2146 HOH HOH A . 
C 3 HOH 147 2147 2147 HOH HOH A . 
C 3 HOH 148 2148 2148 HOH HOH A . 
C 3 HOH 149 2149 2149 HOH HOH A . 
C 3 HOH 150 2150 2150 HOH HOH A . 
C 3 HOH 151 2151 2151 HOH HOH A . 
C 3 HOH 152 2152 2152 HOH HOH A . 
C 3 HOH 153 2153 2153 HOH HOH A . 
C 3 HOH 154 2154 2154 HOH HOH A . 
C 3 HOH 155 2155 2155 HOH HOH A . 
C 3 HOH 156 2156 2156 HOH HOH A . 
C 3 HOH 157 2157 2157 HOH HOH A . 
C 3 HOH 158 2158 2158 HOH HOH A . 
C 3 HOH 159 2159 2159 HOH HOH A . 
C 3 HOH 160 2160 2160 HOH HOH A . 
C 3 HOH 161 2161 2161 HOH HOH A . 
C 3 HOH 162 2162 2162 HOH HOH A . 
C 3 HOH 163 2163 2163 HOH HOH A . 
C 3 HOH 164 2164 2164 HOH HOH A . 
C 3 HOH 165 2165 2165 HOH HOH A . 
C 3 HOH 166 2166 2166 HOH HOH A . 
C 3 HOH 167 2167 2167 HOH HOH A . 
C 3 HOH 168 2168 2168 HOH HOH A . 
C 3 HOH 169 2169 2169 HOH HOH A . 
C 3 HOH 170 2170 2170 HOH HOH A . 
C 3 HOH 171 2171 2171 HOH HOH A . 
C 3 HOH 172 2172 2172 HOH HOH A . 
C 3 HOH 173 2173 2173 HOH HOH A . 
C 3 HOH 174 2174 2174 HOH HOH A . 
C 3 HOH 175 2175 2175 HOH HOH A . 
C 3 HOH 176 2176 2176 HOH HOH A . 
C 3 HOH 177 2177 2177 HOH HOH A . 
C 3 HOH 178 2178 2178 HOH HOH A . 
C 3 HOH 179 2179 2179 HOH HOH A . 
C 3 HOH 180 2180 2180 HOH HOH A . 
C 3 HOH 181 2181 2181 HOH HOH A . 
C 3 HOH 182 2182 2182 HOH HOH A . 
C 3 HOH 183 2183 2183 HOH HOH A . 
C 3 HOH 184 2184 2184 HOH HOH A . 
C 3 HOH 185 2185 2185 HOH HOH A . 
C 3 HOH 186 2186 2186 HOH HOH A . 
C 3 HOH 187 2187 2187 HOH HOH A . 
C 3 HOH 188 2188 2188 HOH HOH A . 
C 3 HOH 189 2189 2189 HOH HOH A . 
C 3 HOH 190 2190 2190 HOH HOH A . 
C 3 HOH 191 2191 2191 HOH HOH A . 
C 3 HOH 192 2192 2192 HOH HOH A . 
C 3 HOH 193 2193 2193 HOH HOH A . 
C 3 HOH 194 2194 2194 HOH HOH A . 
C 3 HOH 195 2195 2195 HOH HOH A . 
C 3 HOH 196 2196 2196 HOH HOH A . 
C 3 HOH 197 2197 2197 HOH HOH A . 
C 3 HOH 198 2198 2198 HOH HOH A . 
C 3 HOH 199 2199 2199 HOH HOH A . 
C 3 HOH 200 2200 2200 HOH HOH A . 
C 3 HOH 201 2201 2201 HOH HOH A . 
C 3 HOH 202 2202 2202 HOH HOH A . 
C 3 HOH 203 2203 2203 HOH HOH A . 
C 3 HOH 204 2204 2204 HOH HOH A . 
C 3 HOH 205 2205 2205 HOH HOH A . 
C 3 HOH 206 2206 2206 HOH HOH A . 
C 3 HOH 207 2207 2207 HOH HOH A . 
C 3 HOH 208 2208 2208 HOH HOH A . 
C 3 HOH 209 2209 2209 HOH HOH A . 
C 3 HOH 210 2210 2210 HOH HOH A . 
C 3 HOH 211 2211 2211 HOH HOH A . 
C 3 HOH 212 2212 2212 HOH HOH A . 
C 3 HOH 213 2213 2213 HOH HOH A . 
C 3 HOH 214 2214 2214 HOH HOH A . 
C 3 HOH 215 2215 2215 HOH HOH A . 
C 3 HOH 216 2216 2216 HOH HOH A . 
C 3 HOH 217 2217 2217 HOH HOH A . 
C 3 HOH 218 2218 2218 HOH HOH A . 
C 3 HOH 219 2219 2219 HOH HOH A . 
C 3 HOH 220 2220 2220 HOH HOH A . 
C 3 HOH 221 2221 2221 HOH HOH A . 
C 3 HOH 222 2222 2222 HOH HOH A . 
C 3 HOH 223 2223 2223 HOH HOH A . 
C 3 HOH 224 2224 2224 HOH HOH A . 
C 3 HOH 225 2225 2225 HOH HOH A . 
C 3 HOH 226 2226 2226 HOH HOH A . 
C 3 HOH 227 2227 2227 HOH HOH A . 
C 3 HOH 228 2228 2228 HOH HOH A . 
C 3 HOH 229 2229 2229 HOH HOH A . 
C 3 HOH 230 2230 2230 HOH HOH A . 
C 3 HOH 231 2231 2231 HOH HOH A . 
C 3 HOH 232 2232 2232 HOH HOH A . 
C 3 HOH 233 2233 2233 HOH HOH A . 
C 3 HOH 234 2234 2234 HOH HOH A . 
C 3 HOH 235 2235 2235 HOH HOH A . 
C 3 HOH 236 2236 2236 HOH HOH A . 
C 3 HOH 237 2237 2237 HOH HOH A . 
C 3 HOH 238 2238 2238 HOH HOH A . 
C 3 HOH 239 2239 2239 HOH HOH A . 
C 3 HOH 240 2240 2240 HOH HOH A . 
C 3 HOH 241 2241 2241 HOH HOH A . 
C 3 HOH 242 2242 2242 HOH HOH A . 
C 3 HOH 243 2243 2243 HOH HOH A . 
C 3 HOH 244 2244 2244 HOH HOH A . 
C 3 HOH 245 2245 2245 HOH HOH A . 
C 3 HOH 246 2246 2246 HOH HOH A . 
C 3 HOH 247 2247 2247 HOH HOH A . 
C 3 HOH 248 2248 2248 HOH HOH A . 
C 3 HOH 249 2249 2249 HOH HOH A . 
C 3 HOH 250 2250 2250 HOH HOH A . 
C 3 HOH 251 2251 2251 HOH HOH A . 
C 3 HOH 252 2252 2252 HOH HOH A . 
C 3 HOH 253 2253 2253 HOH HOH A . 
C 3 HOH 254 2254 2254 HOH HOH A . 
C 3 HOH 255 2255 2255 HOH HOH A . 
C 3 HOH 256 2256 2256 HOH HOH A . 
C 3 HOH 257 2257 2257 HOH HOH A . 
C 3 HOH 258 2258 2258 HOH HOH A . 
C 3 HOH 259 2259 2259 HOH HOH A . 
C 3 HOH 260 2260 2260 HOH HOH A . 
C 3 HOH 261 2261 2261 HOH HOH A . 
C 3 HOH 262 2262 2262 HOH HOH A . 
C 3 HOH 263 2263 2263 HOH HOH A . 
C 3 HOH 264 2264 2264 HOH HOH A . 
C 3 HOH 265 2265 2265 HOH HOH A . 
C 3 HOH 266 2266 2266 HOH HOH A . 
C 3 HOH 267 2267 2267 HOH HOH A . 
C 3 HOH 268 2268 2268 HOH HOH A . 
C 3 HOH 269 2269 2269 HOH HOH A . 
C 3 HOH 270 2270 2270 HOH HOH A . 
C 3 HOH 271 2271 2271 HOH HOH A . 
C 3 HOH 272 2272 2272 HOH HOH A . 
C 3 HOH 273 2273 2273 HOH HOH A . 
C 3 HOH 274 2274 2274 HOH HOH A . 
C 3 HOH 275 2275 2275 HOH HOH A . 
C 3 HOH 276 2276 2276 HOH HOH A . 
C 3 HOH 277 2277 2277 HOH HOH A . 
C 3 HOH 278 2278 2278 HOH HOH A . 
C 3 HOH 279 2280 2280 HOH HOH A . 
C 3 HOH 280 2281 2281 HOH HOH A . 
C 3 HOH 281 2282 2282 HOH HOH A . 
C 3 HOH 282 2283 2283 HOH HOH A . 
C 3 HOH 283 2284 2284 HOH HOH A . 
C 3 HOH 284 2285 2285 HOH HOH A . 
C 3 HOH 285 2286 2286 HOH HOH A . 
C 3 HOH 286 2287 2287 HOH HOH A . 
C 3 HOH 287 2288 2288 HOH HOH A . 
C 3 HOH 288 2289 2289 HOH HOH A . 
C 3 HOH 289 2290 2290 HOH HOH A . 
C 3 HOH 290 2291 2291 HOH HOH A . 
C 3 HOH 291 2292 2292 HOH HOH A . 
C 3 HOH 292 2293 2293 HOH HOH A . 
C 3 HOH 293 2294 2294 HOH HOH A . 
C 3 HOH 294 2295 2295 HOH HOH A . 
C 3 HOH 295 2296 2296 HOH HOH A . 
C 3 HOH 296 2297 2297 HOH HOH A . 
C 3 HOH 297 2298 2298 HOH HOH A . 
C 3 HOH 298 2299 2299 HOH HOH A . 
C 3 HOH 299 2300 2300 HOH HOH A . 
C 3 HOH 300 2301 2301 HOH HOH A . 
C 3 HOH 301 2302 2302 HOH HOH A . 
C 3 HOH 302 2303 2303 HOH HOH A . 
C 3 HOH 303 2304 2304 HOH HOH A . 
C 3 HOH 304 2305 2305 HOH HOH A . 
C 3 HOH 305 2306 2306 HOH HOH A . 
C 3 HOH 306 2307 2307 HOH HOH A . 
C 3 HOH 307 2308 2308 HOH HOH A . 
C 3 HOH 308 2309 2309 HOH HOH A . 
C 3 HOH 309 2310 2310 HOH HOH A . 
C 3 HOH 310 2311 2311 HOH HOH A . 
C 3 HOH 311 2312 2312 HOH HOH A . 
C 3 HOH 312 2313 2313 HOH HOH A . 
C 3 HOH 313 2314 2314 HOH HOH A . 
C 3 HOH 314 2315 2315 HOH HOH A . 
C 3 HOH 315 2316 2316 HOH HOH A . 
C 3 HOH 316 2317 2317 HOH HOH A . 
C 3 HOH 317 2318 2318 HOH HOH A . 
C 3 HOH 318 2319 2319 HOH HOH A . 
C 3 HOH 319 2320 2320 HOH HOH A . 
C 3 HOH 320 2321 2321 HOH HOH A . 
C 3 HOH 321 2322 2322 HOH HOH A . 
C 3 HOH 322 2323 2323 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OG  ? A SER 12  ? A SER 139  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 OG  ? A SER 14  ? A SER 141  ? 1_555 88.0  ? 
2  OG  ? A SER 12  ? A SER 139  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 OD1 ? A ASP 112 ? A ASP 239  ? 1_555 89.9  ? 
3  OG  ? A SER 14  ? A SER 141  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 OD1 ? A ASP 112 ? A ASP 239  ? 1_555 85.4  ? 
4  OG  ? A SER 12  ? A SER 139  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? C HOH .   ? A HOH 2265 ? 1_555 175.2 ? 
5  OG  ? A SER 14  ? A SER 141  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? C HOH .   ? A HOH 2265 ? 1_555 87.3  ? 
6  OD1 ? A ASP 112 ? A ASP 239  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? C HOH .   ? A HOH 2265 ? 1_555 90.7  ? 
7  OG  ? A SER 12  ? A SER 139  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? C HOH .   ? A HOH 2266 ? 1_555 90.5  ? 
8  OG  ? A SER 14  ? A SER 141  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? C HOH .   ? A HOH 2266 ? 1_555 92.2  ? 
9  OD1 ? A ASP 112 ? A ASP 239  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? C HOH .   ? A HOH 2266 ? 1_555 177.6 ? 
10 O   ? C HOH .   ? A HOH 2265 ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? C HOH .   ? A HOH 2266 ? 1_555 88.8  ? 
11 OG  ? A SER 12  ? A SER 139  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? C HOH .   ? A HOH 2267 ? 1_555 87.2  ? 
12 OG  ? A SER 14  ? A SER 141  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? C HOH .   ? A HOH 2267 ? 1_555 168.5 ? 
13 OD1 ? A ASP 112 ? A ASP 239  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? C HOH .   ? A HOH 2267 ? 1_555 84.1  ? 
14 O   ? C HOH .   ? A HOH 2265 ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? C HOH .   ? A HOH 2267 ? 1_555 97.5  ? 
15 O   ? C HOH .   ? A HOH 2266 ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? C HOH .   ? A HOH 2267 ? 1_555 98.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-01-28 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2             
2 4 'Structure model' pdbx_struct_conn_angle 
3 4 'Structure model' struct_conn            
4 4 'Structure model' struct_ref_seq_dif     
5 4 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                        
2  4 'Structure model' '_database_2.pdbx_database_accession'         
3  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
4  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
15 4 'Structure model' '_pdbx_struct_conn_angle.value'               
16 4 'Structure model' '_struct_conn.pdbx_dist_value'                
17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
29 4 'Structure model' '_struct_ref_seq_dif.details'                 
30 4 'Structure model' '_struct_site.pdbx_auth_asym_id'              
31 4 'Structure model' '_struct_site.pdbx_auth_comp_id'              
32 4 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
AMoRE     phasing           . ? 3 
SHELXL-97 refinement        . ? 4 
HKL-2000  'data reduction'  . ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A TYR 177 ? ? CG A TYR 177 ? ? CD2 A TYR 177 ? ? 112.18 121.00 -8.82 0.60 N 
2 1 CB A TYR 177 ? ? CG A TYR 177 ? ? CD1 A TYR 177 ? ? 130.02 121.00 9.02  0.60 N 
3 1 NE A ARG 189 ? ? CZ A ARG 189 ? ? NH1 A ARG 189 ? ? 124.40 120.30 4.10  0.50 N 
4 1 CB A TYR 214 ? ? CG A TYR 214 ? ? CD1 A TYR 214 ? ? 115.88 121.00 -5.12 0.60 N 
5 1 NE A ARG 256 ? ? CZ A ARG 256 ? ? NH1 A ARG 256 ? ? 124.84 120.30 4.54  0.50 N 
6 1 CB A TYR 257 ? ? CG A TYR 257 ? ? CD2 A TYR 257 ? ? 115.93 121.00 -5.07 0.60 N 
7 1 CB A ASP 297 ? ? CG A ASP 297 ? ? OD1 A ASP 297 ? ? 124.94 118.30 6.64  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 174 ? ? -150.73 -97.59  
2 1 LEU A 204 ? ? -127.48 -133.77 
3 1 ASP A 244 ? ? -102.29 -164.28 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION' MG  
3 water           HOH 
#