data_1MKP
# 
_entry.id   1MKP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1MKP         
WWPDB D_1000175037 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1MKP 
_pdbx_database_status.recvd_initial_deposition_date   1998-07-11 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Stewart, A.E.'  1 
'Dowd, S.'       2 
'Keyse, S.'      3 
'Mcdonald, N.Q.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of the MAPK phosphatase Pyst1 catalytic domain and implications for regulated activation.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            6 
_citation.page_first                174 
_citation.page_last                 181 
_citation.year                      1999 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10048930 
_citation.pdbx_database_id_DOI      10.1038/5861 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Stewart, A.E.'  1 
primary 'Dowd, S.'       2 
primary 'Keyse, S.M.'    3 
primary 'McDonald, N.Q.' 4 
# 
_cell.entry_id           1MKP 
_cell.length_a           90.000 
_cell.length_b           90.000 
_cell.length_c           68.410 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1MKP 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man PYST1                           16274.654 1  '3.1.3.48, 3.1.3.16' C293S 'CATALYTIC DOMAIN' 
'MPD AND CHLORIDE ION' 
2 non-polymer syn 'CHLORIDE ION'                  35.453    1  ?                    ?     ?                  ? 
3 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174   1  ?                    ?     ?                  ? 
4 water       nat water                           18.015    40 ?                    ?     ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DUAL SPECIFICITY PHOSPHATASE, MAP KINASE PHOSPHATASE 3, MKP-3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ASFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEAR
GKNCGVLVHSLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ASFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEAR
GKNCGVLVHSLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   SER n 
1 3   PHE n 
1 4   PRO n 
1 5   VAL n 
1 6   GLU n 
1 7   ILE n 
1 8   LEU n 
1 9   PRO n 
1 10  PHE n 
1 11  LEU n 
1 12  TYR n 
1 13  LEU n 
1 14  GLY n 
1 15  CYS n 
1 16  ALA n 
1 17  LYS n 
1 18  ASP n 
1 19  SER n 
1 20  THR n 
1 21  ASN n 
1 22  LEU n 
1 23  ASP n 
1 24  VAL n 
1 25  LEU n 
1 26  GLU n 
1 27  GLU n 
1 28  PHE n 
1 29  GLY n 
1 30  ILE n 
1 31  LYS n 
1 32  TYR n 
1 33  ILE n 
1 34  LEU n 
1 35  ASN n 
1 36  VAL n 
1 37  THR n 
1 38  PRO n 
1 39  ASN n 
1 40  LEU n 
1 41  PRO n 
1 42  ASN n 
1 43  LEU n 
1 44  PHE n 
1 45  GLU n 
1 46  ASN n 
1 47  ALA n 
1 48  GLY n 
1 49  GLU n 
1 50  PHE n 
1 51  LYS n 
1 52  TYR n 
1 53  LYS n 
1 54  GLN n 
1 55  ILE n 
1 56  PRO n 
1 57  ILE n 
1 58  SER n 
1 59  ASP n 
1 60  HIS n 
1 61  TRP n 
1 62  SER n 
1 63  GLN n 
1 64  ASN n 
1 65  LEU n 
1 66  SER n 
1 67  GLN n 
1 68  PHE n 
1 69  PHE n 
1 70  PRO n 
1 71  GLU n 
1 72  ALA n 
1 73  ILE n 
1 74  SER n 
1 75  PHE n 
1 76  ILE n 
1 77  ASP n 
1 78  GLU n 
1 79  ALA n 
1 80  ARG n 
1 81  GLY n 
1 82  LYS n 
1 83  ASN n 
1 84  CYS n 
1 85  GLY n 
1 86  VAL n 
1 87  LEU n 
1 88  VAL n 
1 89  HIS n 
1 90  SER n 
1 91  LEU n 
1 92  ALA n 
1 93  GLY n 
1 94  ILE n 
1 95  SER n 
1 96  ARG n 
1 97  SER n 
1 98  VAL n 
1 99  THR n 
1 100 VAL n 
1 101 THR n 
1 102 VAL n 
1 103 ALA n 
1 104 TYR n 
1 105 LEU n 
1 106 MET n 
1 107 GLN n 
1 108 LYS n 
1 109 LEU n 
1 110 ASN n 
1 111 LEU n 
1 112 SER n 
1 113 MET n 
1 114 ASN n 
1 115 ASP n 
1 116 ALA n 
1 117 TYR n 
1 118 ASP n 
1 119 ILE n 
1 120 VAL n 
1 121 LYS n 
1 122 MET n 
1 123 LYS n 
1 124 LYS n 
1 125 SER n 
1 126 ASN n 
1 127 ILE n 
1 128 SER n 
1 129 PRO n 
1 130 ASN n 
1 131 PHE n 
1 132 ASN n 
1 133 PHE n 
1 134 MET n 
1 135 GLY n 
1 136 GLN n 
1 137 LEU n 
1 138 LEU n 
1 139 ASP n 
1 140 PHE n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET14B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DUS6_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q16828 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPVRALFTRG
EDRDRFTRRCGTDTVVLYDESSSDWNENTGGESLLGLLLKKLKDEGCRAFYLEGGFSKFQAEFSLHCETNLDGSCSSSSP
PLPVLGLGGLRISSDSSSDIESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAY
DIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLYFTTPSNQNVYQVDSLQST
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1MKP 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 144 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q16828 
_struct_ref_seq.db_align_beg                  205 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  347 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       205 
_struct_ref_seq.pdbx_auth_seq_align_end       347 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1MKP 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      90 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q16828 
_struct_ref_seq_dif.db_mon_id                    CYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          293 
_struct_ref_seq_dif.details                      ENGINEERED 
_struct_ref_seq_dif.pdbx_auth_seq_num            293 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                 ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'                  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE                        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                 ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                      ? 'C5 H11 N O2 S'  149.211 
MPD non-polymer         . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2'      118.174 
PHE 'L-peptide linking' y PHENYLALANINE                   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1MKP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.25 
_exptl_crystal.density_percent_sol   71 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.87 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX9.6' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX9.6 
_diffrn_source.pdbx_wavelength             0.87 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1MKP 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.35 
_reflns.number_obs                   12163 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0390000 
_reflns.pdbx_netI_over_sigmaI        11.8 
_reflns.B_iso_Wilson_estimate        47 
_reflns.pdbx_redundancy              7.8 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.35 
_reflns_shell.d_res_low              2.45 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.1780000 
_reflns_shell.meanI_over_sigI_obs    4.2 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1MKP 
_refine.ls_number_reflns_obs                     12163 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.35 
_refine.ls_percent_reflns_obs                    99.8 
_refine.ls_R_factor_obs                          0.2010000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2010000 
_refine.ls_R_factor_R_free                       0.2350000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               44 
_refine.aniso_B[1][1]                            2.23 
_refine.aniso_B[2][2]                            2.26 
_refine.aniso_B[3][3]                            2.61 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1186 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             39 
_refine_hist.number_atoms_total               1234 
_refine_hist.d_res_high                       2.35 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.32  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.13  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 ?            ?            'X-RAY DIFFRACTION' 
2 ?            ?            'X-RAY DIFFRACTION' 
3 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1MKP 
_struct.title                     'CRYSTAL STRUCTURE OF PYST1 (MKP3)' 
_struct.pdbx_descriptor           PYST1 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MKP 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 22  ? GLU A 27  ? LEU A 225 GLU A 230 1 ? 6  
HELX_P HELX_P2 2 SER A 66  ? GLY A 81  ? SER A 269 GLY A 284 5 ? 16 
HELX_P HELX_P3 3 SER A 95  ? LYS A 108 ? SER A 298 LYS A 311 1 ? 14 
HELX_P HELX_P4 4 MET A 113 ? LYS A 123 ? MET A 316 LYS A 326 1 ? 11 
HELX_P HELX_P5 5 MET A 134 ? ARG A 142 ? MET A 337 ARG A 345 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 5  ? LEU A 8  ? VAL A 208 LEU A 211 
A 2 LEU A 11 ? GLY A 14 ? LEU A 214 GLY A 217 
A 3 GLY A 85 ? HIS A 89 ? GLY A 288 HIS A 292 
A 4 ILE A 30 ? ASN A 35 ? ILE A 233 ASN A 238 
A 5 PHE A 50 ? GLN A 54 ? PHE A 253 GLN A 257 
A 6 LEU A 43 ? ALA A 47 ? LEU A 246 ALA A 250 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 5  ? O VAL A 208 N LEU A 13 ? N LEU A 216 
A 2 3 O TYR A 12 ? O TYR A 215 N VAL A 86 ? N VAL A 289 
A 3 4 O GLY A 85 ? O GLY A 288 N LYS A 31 ? N LYS A 234 
A 4 5 O ILE A 33 ? O ILE A 236 N LYS A 51 ? N LYS A 254 
A 5 6 O PHE A 50 ? O PHE A 253 N ALA A 47 ? N ALA A 250 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 500'  
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MPD A 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 SER A 90  ? SER A 293 . ? 1_555 ? 
2 AC1 2 ARG A 96  ? ARG A 299 . ? 1_555 ? 
3 AC2 7 MET A 113 ? MET A 316 . ? 1_555 ? 
4 AC2 7 ASN A 114 ? ASN A 317 . ? 1_555 ? 
5 AC2 7 TYR A 117 ? TYR A 320 . ? 1_555 ? 
6 AC2 7 ASN A 130 ? ASN A 333 . ? 1_555 ? 
7 AC2 7 PHE A 133 ? PHE A 336 . ? 1_555 ? 
8 AC2 7 LEU A 137 ? LEU A 340 . ? 1_555 ? 
9 AC2 7 HOH D .   ? HOH A 404 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1MKP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1MKP 
_atom_sites.fract_transf_matrix[1][1]   0.011111 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011111 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014618 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 1   ? 6.218   54.494 35.465 1.00 64.94 ? 204 ALA A N   1 
ATOM   2    C  CA  . ALA A 1 1   ? 7.668   54.135 35.456 1.00 65.13 ? 204 ALA A CA  1 
ATOM   3    C  C   . ALA A 1 1   ? 8.458   55.047 34.512 1.00 65.41 ? 204 ALA A C   1 
ATOM   4    O  O   . ALA A 1 1   ? 9.473   55.615 34.916 1.00 66.14 ? 204 ALA A O   1 
ATOM   5    C  CB  . ALA A 1 1   ? 7.869   52.658 35.076 1.00 64.16 ? 204 ALA A CB  1 
ATOM   6    N  N   . SER A 1 2   ? 8.010   55.182 33.261 1.00 64.88 ? 205 SER A N   1 
ATOM   7    C  CA  . SER A 1 2   ? 8.700   56.047 32.294 1.00 64.01 ? 205 SER A CA  1 
ATOM   8    C  C   . SER A 1 2   ? 7.772   57.112 31.707 1.00 63.01 ? 205 SER A C   1 
ATOM   9    O  O   . SER A 1 2   ? 6.588   56.857 31.497 1.00 62.73 ? 205 SER A O   1 
ATOM   10   C  CB  . SER A 1 2   ? 9.341   55.220 31.167 1.00 64.39 ? 205 SER A CB  1 
ATOM   11   O  OG  . SER A 1 2   ? 8.372   54.515 30.414 1.00 65.15 ? 205 SER A OG  1 
ATOM   12   N  N   . PHE A 1 3   ? 8.316   58.296 31.431 1.00 62.10 ? 206 PHE A N   1 
ATOM   13   C  CA  . PHE A 1 3   ? 7.519   59.404 30.889 1.00 61.37 ? 206 PHE A CA  1 
ATOM   14   C  C   . PHE A 1 3   ? 8.029   59.912 29.538 1.00 59.54 ? 206 PHE A C   1 
ATOM   15   O  O   . PHE A 1 3   ? 9.146   59.594 29.130 1.00 59.78 ? 206 PHE A O   1 
ATOM   16   C  CB  . PHE A 1 3   ? 7.508   60.571 31.884 1.00 63.29 ? 206 PHE A CB  1 
ATOM   17   C  CG  . PHE A 1 3   ? 7.051   60.190 33.258 1.00 65.78 ? 206 PHE A CG  1 
ATOM   18   C  CD1 . PHE A 1 3   ? 5.780   59.662 33.462 1.00 66.50 ? 206 PHE A CD1 1 
ATOM   19   C  CD2 . PHE A 1 3   ? 7.901   60.340 34.352 1.00 66.78 ? 206 PHE A CD2 1 
ATOM   20   C  CE1 . PHE A 1 3   ? 5.358   59.284 34.733 1.00 67.13 ? 206 PHE A CE1 1 
ATOM   21   C  CE2 . PHE A 1 3   ? 7.492   59.967 35.629 1.00 67.54 ? 206 PHE A CE2 1 
ATOM   22   C  CZ  . PHE A 1 3   ? 6.216   59.437 35.820 1.00 67.58 ? 206 PHE A CZ  1 
ATOM   23   N  N   . PRO A 1 4   ? 7.188   60.665 28.802 1.00 57.30 ? 207 PRO A N   1 
ATOM   24   C  CA  . PRO A 1 4   ? 7.552   61.226 27.496 1.00 55.35 ? 207 PRO A CA  1 
ATOM   25   C  C   . PRO A 1 4   ? 8.771   62.129 27.619 1.00 53.38 ? 207 PRO A C   1 
ATOM   26   O  O   . PRO A 1 4   ? 8.883   62.902 28.566 1.00 53.13 ? 207 PRO A O   1 
ATOM   27   C  CB  . PRO A 1 4   ? 6.308   62.027 27.122 1.00 55.67 ? 207 PRO A CB  1 
ATOM   28   C  CG  . PRO A 1 4   ? 5.215   61.177 27.674 1.00 56.90 ? 207 PRO A CG  1 
ATOM   29   C  CD  . PRO A 1 4   ? 5.746   60.850 29.055 1.00 57.06 ? 207 PRO A CD  1 
ATOM   30   N  N   . VAL A 1 5   ? 9.690   62.005 26.671 1.00 51.28 ? 208 VAL A N   1 
ATOM   31   C  CA  . VAL A 1 5   ? 10.912  62.796 26.686 1.00 49.37 ? 208 VAL A CA  1 
ATOM   32   C  C   . VAL A 1 5   ? 10.748  64.069 25.876 1.00 48.22 ? 208 VAL A C   1 
ATOM   33   O  O   . VAL A 1 5   ? 10.125  64.052 24.818 1.00 48.19 ? 208 VAL A O   1 
ATOM   34   C  CB  . VAL A 1 5   ? 12.098  61.988 26.114 1.00 49.55 ? 208 VAL A CB  1 
ATOM   35   C  CG1 . VAL A 1 5   ? 13.401  62.774 26.245 1.00 49.48 ? 208 VAL A CG1 1 
ATOM   36   C  CG2 . VAL A 1 5   ? 12.208  60.650 26.823 1.00 49.35 ? 208 VAL A CG2 1 
ATOM   37   N  N   . GLU A 1 6   ? 11.282  65.175 26.389 1.00 47.34 ? 209 GLU A N   1 
ATOM   38   C  CA  . GLU A 1 6   ? 11.217  66.450 25.683 1.00 46.99 ? 209 GLU A CA  1 
ATOM   39   C  C   . GLU A 1 6   ? 12.416  66.495 24.739 1.00 46.12 ? 209 GLU A C   1 
ATOM   40   O  O   . GLU A 1 6   ? 13.565  66.524 25.183 1.00 46.72 ? 209 GLU A O   1 
ATOM   41   C  CB  . GLU A 1 6   ? 11.268  67.621 26.664 1.00 47.58 ? 209 GLU A CB  1 
ATOM   42   C  CG  . GLU A 1 6   ? 11.024  68.973 26.012 1.00 50.29 ? 209 GLU A CG  1 
ATOM   43   C  CD  . GLU A 1 6   ? 11.080  70.142 26.993 1.00 52.52 ? 209 GLU A CD  1 
ATOM   44   O  OE1 . GLU A 1 6   ? 12.106  70.297 27.693 1.00 53.41 ? 209 GLU A OE1 1 
ATOM   45   O  OE2 . GLU A 1 6   ? 10.102  70.925 27.044 1.00 53.17 ? 209 GLU A OE2 1 
ATOM   46   N  N   . ILE A 1 7   ? 12.144  66.426 23.440 1.00 44.86 ? 210 ILE A N   1 
ATOM   47   C  CA  . ILE A 1 7   ? 13.188  66.449 22.415 1.00 43.21 ? 210 ILE A CA  1 
ATOM   48   C  C   . ILE A 1 7   ? 13.670  67.888 22.209 1.00 43.14 ? 210 ILE A C   1 
ATOM   49   O  O   . ILE A 1 7   ? 14.873  68.160 22.155 1.00 43.10 ? 210 ILE A O   1 
ATOM   50   C  CB  . ILE A 1 7   ? 12.652  65.850 21.101 1.00 41.56 ? 210 ILE A CB  1 
ATOM   51   C  CG1 . ILE A 1 7   ? 12.080  64.460 21.377 1.00 40.16 ? 210 ILE A CG1 1 
ATOM   52   C  CG2 . ILE A 1 7   ? 13.753  65.754 20.063 1.00 41.02 ? 210 ILE A CG2 1 
ATOM   53   C  CD1 . ILE A 1 7   ? 13.068  63.501 22.026 1.00 38.94 ? 210 ILE A CD1 1 
ATOM   54   N  N   . LEU A 1 8   ? 12.707  68.793 22.084 1.00 42.40 ? 211 LEU A N   1 
ATOM   55   C  CA  . LEU A 1 8   ? 12.956  70.220 21.941 1.00 42.58 ? 211 LEU A CA  1 
ATOM   56   C  C   . LEU A 1 8   ? 11.922  70.846 22.860 1.00 43.00 ? 211 LEU A C   1 
ATOM   57   O  O   . LEU A 1 8   ? 10.951  70.189 23.234 1.00 43.39 ? 211 LEU A O   1 
ATOM   58   C  CB  . LEU A 1 8   ? 12.696  70.691 20.510 1.00 42.28 ? 211 LEU A CB  1 
ATOM   59   C  CG  . LEU A 1 8   ? 13.651  70.334 19.372 1.00 41.85 ? 211 LEU A CG  1 
ATOM   60   C  CD1 . LEU A 1 8   ? 13.174  71.037 18.110 1.00 40.74 ? 211 LEU A CD1 1 
ATOM   61   C  CD2 . LEU A 1 8   ? 15.068  70.769 19.715 1.00 41.49 ? 211 LEU A CD2 1 
ATOM   62   N  N   . PRO A 1 9   ? 12.125  72.105 23.273 1.00 42.97 ? 212 PRO A N   1 
ATOM   63   C  CA  . PRO A 1 9   ? 11.138  72.730 24.156 1.00 42.35 ? 212 PRO A CA  1 
ATOM   64   C  C   . PRO A 1 9   ? 9.752   72.652 23.528 1.00 42.26 ? 212 PRO A C   1 
ATOM   65   O  O   . PRO A 1 9   ? 9.578   73.034 22.372 1.00 41.81 ? 212 PRO A O   1 
ATOM   66   C  CB  . PRO A 1 9   ? 11.638  74.169 24.239 1.00 42.64 ? 212 PRO A CB  1 
ATOM   67   C  CG  . PRO A 1 9   ? 13.122  73.988 24.197 1.00 42.51 ? 212 PRO A CG  1 
ATOM   68   C  CD  . PRO A 1 9   ? 13.281  72.995 23.067 1.00 42.53 ? 212 PRO A CD  1 
ATOM   69   N  N   . PHE A 1 10  ? 8.798   72.090 24.275 1.00 41.96 ? 213 PHE A N   1 
ATOM   70   C  CA  . PHE A 1 10  ? 7.400   71.932 23.842 1.00 41.81 ? 213 PHE A CA  1 
ATOM   71   C  C   . PHE A 1 10  ? 7.122   70.781 22.887 1.00 40.91 ? 213 PHE A C   1 
ATOM   72   O  O   . PHE A 1 10  ? 6.006   70.638 22.402 1.00 41.49 ? 213 PHE A O   1 
ATOM   73   C  CB  . PHE A 1 10  ? 6.855   73.229 23.233 1.00 43.56 ? 213 PHE A CB  1 
ATOM   74   C  CG  . PHE A 1 10  ? 7.002   74.414 24.130 1.00 45.97 ? 213 PHE A CG  1 
ATOM   75   C  CD1 . PHE A 1 10  ? 6.394   74.428 25.384 1.00 46.66 ? 213 PHE A CD1 1 
ATOM   76   C  CD2 . PHE A 1 10  ? 7.803   75.490 23.755 1.00 46.54 ? 213 PHE A CD2 1 
ATOM   77   C  CE1 . PHE A 1 10  ? 6.589   75.498 26.258 1.00 47.50 ? 213 PHE A CE1 1 
ATOM   78   C  CE2 . PHE A 1 10  ? 8.006   76.564 24.619 1.00 47.16 ? 213 PHE A CE2 1 
ATOM   79   C  CZ  . PHE A 1 10  ? 7.398   76.567 25.876 1.00 47.51 ? 213 PHE A CZ  1 
ATOM   80   N  N   . LEU A 1 11  ? 8.132   69.964 22.617 1.00 39.39 ? 214 LEU A N   1 
ATOM   81   C  CA  . LEU A 1 11  ? 7.981   68.830 21.721 1.00 37.83 ? 214 LEU A CA  1 
ATOM   82   C  C   . LEU A 1 11  ? 8.317   67.569 22.497 1.00 37.72 ? 214 LEU A C   1 
ATOM   83   O  O   . LEU A 1 11  ? 9.445   67.383 22.954 1.00 37.02 ? 214 LEU A O   1 
ATOM   84   C  CB  . LEU A 1 11  ? 8.899   68.984 20.511 1.00 37.67 ? 214 LEU A CB  1 
ATOM   85   C  CG  . LEU A 1 11  ? 8.961   67.826 19.513 1.00 38.29 ? 214 LEU A CG  1 
ATOM   86   C  CD1 . LEU A 1 11  ? 7.587   67.550 18.918 1.00 38.04 ? 214 LEU A CD1 1 
ATOM   87   C  CD2 . LEU A 1 11  ? 9.961   68.155 18.415 1.00 37.58 ? 214 LEU A CD2 1 
ATOM   88   N  N   . TYR A 1 12  ? 7.316   66.716 22.665 1.00 37.99 ? 215 TYR A N   1 
ATOM   89   C  CA  . TYR A 1 12  ? 7.479   65.479 23.406 1.00 38.73 ? 215 TYR A CA  1 
ATOM   90   C  C   . TYR A 1 12  ? 7.273   64.240 22.565 1.00 39.23 ? 215 TYR A C   1 
ATOM   91   O  O   . TYR A 1 12  ? 6.410   64.202 21.692 1.00 39.12 ? 215 TYR A O   1 
ATOM   92   C  CB  . TYR A 1 12  ? 6.506   65.442 24.585 1.00 39.46 ? 215 TYR A CB  1 
ATOM   93   C  CG  . TYR A 1 12  ? 6.870   66.384 25.702 1.00 39.44 ? 215 TYR A CG  1 
ATOM   94   C  CD1 . TYR A 1 12  ? 6.399   67.699 25.714 1.00 39.48 ? 215 TYR A CD1 1 
ATOM   95   C  CD2 . TYR A 1 12  ? 7.698   65.967 26.739 1.00 38.98 ? 215 TYR A CD2 1 
ATOM   96   C  CE1 . TYR A 1 12  ? 6.747   68.576 26.735 1.00 40.11 ? 215 TYR A CE1 1 
ATOM   97   C  CE2 . TYR A 1 12  ? 8.054   66.830 27.760 1.00 40.32 ? 215 TYR A CE2 1 
ATOM   98   C  CZ  . TYR A 1 12  ? 7.577   68.135 27.756 1.00 41.07 ? 215 TYR A CZ  1 
ATOM   99   O  OH  . TYR A 1 12  ? 7.933   68.992 28.778 1.00 43.06 ? 215 TYR A OH  1 
ATOM   100  N  N   . LEU A 1 13  ? 8.061   63.218 22.865 1.00 40.10 ? 216 LEU A N   1 
ATOM   101  C  CA  . LEU A 1 13  ? 7.983   61.948 22.173 1.00 41.73 ? 216 LEU A CA  1 
ATOM   102  C  C   . LEU A 1 13  ? 7.739   60.881 23.224 1.00 43.96 ? 216 LEU A C   1 
ATOM   103  O  O   . LEU A 1 13  ? 8.506   60.747 24.182 1.00 43.70 ? 216 LEU A O   1 
ATOM   104  C  CB  . LEU A 1 13  ? 9.292   61.655 21.443 1.00 40.75 ? 216 LEU A CB  1 
ATOM   105  C  CG  . LEU A 1 13  ? 9.443   60.260 20.831 1.00 40.18 ? 216 LEU A CG  1 
ATOM   106  C  CD1 . LEU A 1 13  ? 8.563   60.122 19.600 1.00 39.00 ? 216 LEU A CD1 1 
ATOM   107  C  CD2 . LEU A 1 13  ? 10.892  60.028 20.471 1.00 39.79 ? 216 LEU A CD2 1 
ATOM   108  N  N   . GLY A 1 14  ? 6.651   60.141 23.060 1.00 46.68 ? 217 GLY A N   1 
ATOM   109  C  CA  . GLY A 1 14  ? 6.339   59.092 24.007 1.00 49.73 ? 217 GLY A CA  1 
ATOM   110  C  C   . GLY A 1 14  ? 6.461   57.720 23.380 1.00 52.40 ? 217 GLY A C   1 
ATOM   111  O  O   . GLY A 1 14  ? 6.058   57.521 22.235 1.00 52.78 ? 217 GLY A O   1 
ATOM   112  N  N   . CYS A 1 15  ? 7.093   56.796 24.096 1.00 54.85 ? 218 CYS A N   1 
ATOM   113  C  CA  . CYS A 1 15  ? 7.234   55.423 23.622 1.00 56.83 ? 218 CYS A CA  1 
ATOM   114  C  C   . CYS A 1 15  ? 5.934   54.713 24.027 1.00 57.77 ? 218 CYS A C   1 
ATOM   115  O  O   . CYS A 1 15  ? 5.254   55.145 24.964 1.00 56.96 ? 218 CYS A O   1 
ATOM   116  C  CB  . CYS A 1 15  ? 8.453   54.752 24.276 1.00 57.02 ? 218 CYS A CB  1 
ATOM   117  S  SG  . CYS A 1 15  ? 8.779   53.069 23.697 1.00 57.86 ? 218 CYS A SG  1 
ATOM   118  N  N   . ALA A 1 16  ? 5.572   53.651 23.312 1.00 59.07 ? 219 ALA A N   1 
ATOM   119  C  CA  . ALA A 1 16  ? 4.347   52.907 23.614 1.00 59.96 ? 219 ALA A CA  1 
ATOM   120  C  C   . ALA A 1 16  ? 4.244   52.536 25.103 1.00 60.67 ? 219 ALA A C   1 
ATOM   121  O  O   . ALA A 1 16  ? 3.177   52.649 25.716 1.00 60.55 ? 219 ALA A O   1 
ATOM   122  C  CB  . ALA A 1 16  ? 4.271   51.649 22.739 1.00 60.30 ? 219 ALA A CB  1 
ATOM   123  N  N   . LYS A 1 17  ? 5.380   52.160 25.684 1.00 61.60 ? 220 LYS A N   1 
ATOM   124  C  CA  . LYS A 1 17  ? 5.457   51.767 27.086 1.00 62.62 ? 220 LYS A CA  1 
ATOM   125  C  C   . LYS A 1 17  ? 5.564   52.940 28.074 1.00 63.55 ? 220 LYS A C   1 
ATOM   126  O  O   . LYS A 1 17  ? 5.933   52.739 29.232 1.00 63.60 ? 220 LYS A O   1 
ATOM   127  C  CB  . LYS A 1 17  ? 6.624   50.802 27.282 1.00 61.47 ? 220 LYS A CB  1 
ATOM   128  N  N   . ASP A 1 18  ? 5.237   54.154 27.626 1.00 64.78 ? 221 ASP A N   1 
ATOM   129  C  CA  . ASP A 1 18  ? 5.298   55.344 28.486 1.00 65.90 ? 221 ASP A CA  1 
ATOM   130  C  C   . ASP A 1 18  ? 3.973   55.649 29.194 1.00 66.28 ? 221 ASP A C   1 
ATOM   131  O  O   . ASP A 1 18  ? 2.904   55.237 28.731 1.00 66.44 ? 221 ASP A O   1 
ATOM   132  C  CB  . ASP A 1 18  ? 5.748   56.580 27.688 1.00 66.16 ? 221 ASP A CB  1 
ATOM   133  C  CG  . ASP A 1 18  ? 7.257   56.614 27.435 1.00 66.73 ? 221 ASP A CG  1 
ATOM   134  O  OD1 . ASP A 1 18  ? 7.973   55.664 27.826 1.00 66.96 ? 221 ASP A OD1 1 
ATOM   135  O  OD2 . ASP A 1 18  ? 7.735   57.607 26.842 1.00 66.95 ? 221 ASP A OD2 1 
ATOM   136  N  N   . SER A 1 19  ? 4.059   56.372 30.313 1.00 66.50 ? 222 SER A N   1 
ATOM   137  C  CA  . SER A 1 19  ? 2.883   56.753 31.100 1.00 66.63 ? 222 SER A CA  1 
ATOM   138  C  C   . SER A 1 19  ? 2.176   57.938 30.451 1.00 65.50 ? 222 SER A C   1 
ATOM   139  O  O   . SER A 1 19  ? 2.590   59.088 30.601 1.00 65.71 ? 222 SER A O   1 
ATOM   140  C  CB  . SER A 1 19  ? 3.268   57.098 32.548 1.00 67.29 ? 222 SER A CB  1 
ATOM   141  O  OG  . SER A 1 19  ? 3.808   55.971 33.228 1.00 69.02 ? 222 SER A OG  1 
ATOM   142  N  N   . THR A 1 20  ? 1.111   57.631 29.720 1.00 63.99 ? 223 THR A N   1 
ATOM   143  C  CA  . THR A 1 20  ? 0.314   58.631 29.019 1.00 62.04 ? 223 THR A CA  1 
ATOM   144  C  C   . THR A 1 20  ? -0.828  59.181 29.889 1.00 60.05 ? 223 THR A C   1 
ATOM   145  O  O   . THR A 1 20  ? -1.872  59.597 29.384 1.00 59.67 ? 223 THR A O   1 
ATOM   146  C  CB  . THR A 1 20  ? -0.231  58.050 27.674 1.00 62.74 ? 223 THR A CB  1 
ATOM   147  O  OG1 . THR A 1 20  ? -1.015  56.869 27.911 1.00 62.59 ? 223 THR A OG1 1 
ATOM   148  C  CG2 . THR A 1 20  ? 0.926   57.692 26.755 1.00 63.12 ? 223 THR A CG2 1 
ATOM   149  N  N   . ASN A 1 21  ? -0.601  59.192 31.199 1.00 57.78 ? 224 ASN A N   1 
ATOM   150  C  CA  . ASN A 1 21  ? -1.569  59.676 32.177 1.00 55.46 ? 224 ASN A CA  1 
ATOM   151  C  C   . ASN A 1 21  ? -1.877  61.160 31.966 1.00 53.92 ? 224 ASN A C   1 
ATOM   152  O  O   . ASN A 1 21  ? -0.965  61.963 31.800 1.00 53.35 ? 224 ASN A O   1 
ATOM   153  C  CB  . ASN A 1 21  ? -1.008  59.453 33.576 1.00 55.81 ? 224 ASN A CB  1 
ATOM   154  C  CG  . ASN A 1 21  ? -1.978  59.834 34.655 1.00 56.18 ? 224 ASN A CG  1 
ATOM   155  O  OD1 . ASN A 1 21  ? -2.024  60.985 35.092 1.00 55.94 ? 224 ASN A OD1 1 
ATOM   156  N  ND2 . ASN A 1 21  ? -2.766  58.867 35.100 1.00 56.72 ? 224 ASN A ND2 1 
ATOM   157  N  N   . LEU A 1 22  ? -3.157  61.522 32.021 1.00 52.66 ? 225 LEU A N   1 
ATOM   158  C  CA  . LEU A 1 22  ? -3.581  62.908 31.808 1.00 51.52 ? 225 LEU A CA  1 
ATOM   159  C  C   . LEU A 1 22  ? -3.004  63.925 32.777 1.00 51.57 ? 225 LEU A C   1 
ATOM   160  O  O   . LEU A 1 22  ? -2.785  65.077 32.412 1.00 51.33 ? 225 LEU A O   1 
ATOM   161  C  CB  . LEU A 1 22  ? -5.102  63.030 31.806 1.00 50.07 ? 225 LEU A CB  1 
ATOM   162  C  CG  . LEU A 1 22  ? -5.876  62.354 30.675 1.00 49.57 ? 225 LEU A CG  1 
ATOM   163  C  CD1 . LEU A 1 22  ? -7.274  62.937 30.635 1.00 49.01 ? 225 LEU A CD1 1 
ATOM   164  C  CD2 . LEU A 1 22  ? -5.192  62.562 29.333 1.00 48.62 ? 225 LEU A CD2 1 
ATOM   165  N  N   . ASP A 1 23  ? -2.802  63.515 34.021 1.00 51.90 ? 226 ASP A N   1 
ATOM   166  C  CA  . ASP A 1 23  ? -2.240  64.415 35.015 1.00 52.72 ? 226 ASP A CA  1 
ATOM   167  C  C   . ASP A 1 23  ? -0.779  64.700 34.677 1.00 52.44 ? 226 ASP A C   1 
ATOM   168  O  O   . ASP A 1 23  ? -0.323  65.842 34.764 1.00 52.98 ? 226 ASP A O   1 
ATOM   169  C  CB  . ASP A 1 23  ? -2.379  63.820 36.420 1.00 54.16 ? 226 ASP A CB  1 
ATOM   170  C  CG  . ASP A 1 23  ? -3.808  63.890 36.952 1.00 56.10 ? 226 ASP A CG  1 
ATOM   171  O  OD1 . ASP A 1 23  ? -4.724  64.327 36.217 1.00 57.30 ? 226 ASP A OD1 1 
ATOM   172  O  OD2 . ASP A 1 23  ? -4.018  63.507 38.121 1.00 57.54 ? 226 ASP A OD2 1 
ATOM   173  N  N   . VAL A 1 24  ? -0.071  63.658 34.246 1.00 51.54 ? 227 VAL A N   1 
ATOM   174  C  CA  . VAL A 1 24  ? 1.332   63.762 33.859 1.00 49.93 ? 227 VAL A CA  1 
ATOM   175  C  C   . VAL A 1 24  ? 1.463   64.733 32.687 1.00 49.76 ? 227 VAL A C   1 
ATOM   176  O  O   . VAL A 1 24  ? 2.375   65.550 32.651 1.00 49.67 ? 227 VAL A O   1 
ATOM   177  C  CB  . VAL A 1 24  ? 1.890   62.386 33.433 1.00 49.53 ? 227 VAL A CB  1 
ATOM   178  C  CG1 . VAL A 1 24  ? 3.312   62.516 32.945 1.00 49.83 ? 227 VAL A CG1 1 
ATOM   179  C  CG2 . VAL A 1 24  ? 1.831   61.413 34.588 1.00 49.56 ? 227 VAL A CG2 1 
ATOM   180  N  N   . LEU A 1 25  ? 0.529   64.661 31.746 1.00 49.65 ? 228 LEU A N   1 
ATOM   181  C  CA  . LEU A 1 25  ? 0.559   65.539 30.585 1.00 49.64 ? 228 LEU A CA  1 
ATOM   182  C  C   . LEU A 1 25  ? 0.274   66.986 30.965 1.00 50.07 ? 228 LEU A C   1 
ATOM   183  O  O   . LEU A 1 25  ? 0.912   67.901 30.450 1.00 49.37 ? 228 LEU A O   1 
ATOM   184  C  CB  . LEU A 1 25  ? -0.438  65.071 29.521 1.00 49.56 ? 228 LEU A CB  1 
ATOM   185  C  CG  . LEU A 1 25  ? -0.299  63.664 28.926 1.00 49.57 ? 228 LEU A CG  1 
ATOM   186  C  CD1 . LEU A 1 25  ? -1.314  63.498 27.801 1.00 48.80 ? 228 LEU A CD1 1 
ATOM   187  C  CD2 . LEU A 1 25  ? 1.109   63.418 28.408 1.00 48.50 ? 228 LEU A CD2 1 
ATOM   188  N  N   . GLU A 1 26  ? -0.693  67.185 31.860 1.00 51.21 ? 229 GLU A N   1 
ATOM   189  C  CA  . GLU A 1 26  ? -1.058  68.524 32.319 1.00 52.18 ? 229 GLU A CA  1 
ATOM   190  C  C   . GLU A 1 26  ? 0.158   69.147 32.992 1.00 53.05 ? 229 GLU A C   1 
ATOM   191  O  O   . GLU A 1 26  ? 0.501   70.306 32.740 1.00 52.95 ? 229 GLU A O   1 
ATOM   192  C  CB  . GLU A 1 26  ? -2.223  68.450 33.307 1.00 51.70 ? 229 GLU A CB  1 
ATOM   193  N  N   . GLU A 1 27  ? 0.836   68.335 33.800 1.00 53.23 ? 230 GLU A N   1 
ATOM   194  C  CA  . GLU A 1 27  ? 2.018   68.756 34.536 1.00 53.64 ? 230 GLU A CA  1 
ATOM   195  C  C   . GLU A 1 27  ? 3.159   69.197 33.622 1.00 52.82 ? 230 GLU A C   1 
ATOM   196  O  O   . GLU A 1 27  ? 3.916   70.103 33.970 1.00 53.02 ? 230 GLU A O   1 
ATOM   197  C  CB  . GLU A 1 27  ? 2.494   67.622 35.438 1.00 56.01 ? 230 GLU A CB  1 
ATOM   198  C  CG  . GLU A 1 27  ? 3.695   67.975 36.301 1.00 59.98 ? 230 GLU A CG  1 
ATOM   199  C  CD  . GLU A 1 27  ? 4.446   66.748 36.795 1.00 62.70 ? 230 GLU A CD  1 
ATOM   200  O  OE1 . GLU A 1 27  ? 3.810   65.687 37.010 1.00 64.17 ? 230 GLU A OE1 1 
ATOM   201  O  OE2 . GLU A 1 27  ? 5.683   66.847 36.960 1.00 63.94 ? 230 GLU A OE2 1 
ATOM   202  N  N   . PHE A 1 28  ? 3.300   68.535 32.473 1.00 51.63 ? 231 PHE A N   1 
ATOM   203  C  CA  . PHE A 1 28  ? 4.354   68.870 31.512 1.00 49.44 ? 231 PHE A CA  1 
ATOM   204  C  C   . PHE A 1 28  ? 3.911   70.004 30.592 1.00 48.08 ? 231 PHE A C   1 
ATOM   205  O  O   . PHE A 1 28  ? 4.654   70.406 29.701 1.00 48.65 ? 231 PHE A O   1 
ATOM   206  C  CB  . PHE A 1 28  ? 4.724   67.663 30.639 1.00 49.37 ? 231 PHE A CB  1 
ATOM   207  C  CG  . PHE A 1 28  ? 5.421   66.545 31.371 1.00 49.98 ? 231 PHE A CG  1 
ATOM   208  C  CD1 . PHE A 1 28  ? 5.502   66.521 32.755 1.00 50.93 ? 231 PHE A CD1 1 
ATOM   209  C  CD2 . PHE A 1 28  ? 5.984   65.492 30.655 1.00 50.28 ? 231 PHE A CD2 1 
ATOM   210  C  CE1 . PHE A 1 28  ? 6.131   65.464 33.414 1.00 51.25 ? 231 PHE A CE1 1 
ATOM   211  C  CE2 . PHE A 1 28  ? 6.615   64.432 31.300 1.00 50.48 ? 231 PHE A CE2 1 
ATOM   212  C  CZ  . PHE A 1 28  ? 6.689   64.417 32.681 1.00 50.98 ? 231 PHE A CZ  1 
ATOM   213  N  N   . GLY A 1 29  ? 2.688   70.489 30.776 1.00 46.50 ? 232 GLY A N   1 
ATOM   214  C  CA  . GLY A 1 29  ? 2.197   71.568 29.937 1.00 44.98 ? 232 GLY A CA  1 
ATOM   215  C  C   . GLY A 1 29  ? 1.853   71.124 28.526 1.00 44.24 ? 232 GLY A C   1 
ATOM   216  O  O   . GLY A 1 29  ? 1.880   71.925 27.589 1.00 44.44 ? 232 GLY A O   1 
ATOM   217  N  N   . ILE A 1 30  ? 1.547   69.838 28.374 1.00 43.08 ? 233 ILE A N   1 
ATOM   218  C  CA  . ILE A 1 30  ? 1.180   69.274 27.081 1.00 41.31 ? 233 ILE A CA  1 
ATOM   219  C  C   . ILE A 1 30  ? -0.315  69.488 26.881 1.00 41.10 ? 233 ILE A C   1 
ATOM   220  O  O   . ILE A 1 30  ? -1.112  69.112 27.738 1.00 41.73 ? 233 ILE A O   1 
ATOM   221  C  CB  . ILE A 1 30  ? 1.495   67.764 27.028 1.00 39.81 ? 233 ILE A CB  1 
ATOM   222  C  CG1 . ILE A 1 30  ? 2.998   67.542 27.185 1.00 37.82 ? 233 ILE A CG1 1 
ATOM   223  C  CG2 . ILE A 1 30  ? 1.000   67.163 25.724 1.00 38.88 ? 233 ILE A CG2 1 
ATOM   224  C  CD1 . ILE A 1 30  ? 3.401   66.087 27.204 1.00 37.33 ? 233 ILE A CD1 1 
ATOM   225  N  N   . LYS A 1 31  ? -0.682  70.130 25.776 1.00 40.01 ? 234 LYS A N   1 
ATOM   226  C  CA  . LYS A 1 31  ? -2.079  70.397 25.477 1.00 39.21 ? 234 LYS A CA  1 
ATOM   227  C  C   . LYS A 1 31  ? -2.478  69.816 24.127 1.00 39.23 ? 234 LYS A C   1 
ATOM   228  O  O   . LYS A 1 31  ? -3.657  69.721 23.817 1.00 39.36 ? 234 LYS A O   1 
ATOM   229  C  CB  . LYS A 1 31  ? -2.347  71.895 25.514 1.00 38.54 ? 234 LYS A CB  1 
ATOM   230  N  N   . TYR A 1 32  ? -1.489  69.432 23.325 1.00 39.05 ? 235 TYR A N   1 
ATOM   231  C  CA  . TYR A 1 32  ? -1.741  68.854 22.007 1.00 38.62 ? 235 TYR A CA  1 
ATOM   232  C  C   . TYR A 1 32  ? -1.261  67.414 21.949 1.00 38.33 ? 235 TYR A C   1 
ATOM   233  O  O   . TYR A 1 32  ? -0.162  67.098 22.398 1.00 38.33 ? 235 TYR A O   1 
ATOM   234  C  CB  . TYR A 1 32  ? -1.014  69.646 20.924 1.00 40.40 ? 235 TYR A CB  1 
ATOM   235  C  CG  . TYR A 1 32  ? -1.640  70.972 20.585 1.00 42.75 ? 235 TYR A CG  1 
ATOM   236  C  CD1 . TYR A 1 32  ? -1.600  72.040 21.485 1.00 43.50 ? 235 TYR A CD1 1 
ATOM   237  C  CD2 . TYR A 1 32  ? -2.281  71.161 19.362 1.00 43.24 ? 235 TYR A CD2 1 
ATOM   238  C  CE1 . TYR A 1 32  ? -2.188  73.261 21.172 1.00 44.34 ? 235 TYR A CE1 1 
ATOM   239  C  CE2 . TYR A 1 32  ? -2.870  72.372 19.039 1.00 44.12 ? 235 TYR A CE2 1 
ATOM   240  C  CZ  . TYR A 1 32  ? -2.822  73.416 19.946 1.00 44.93 ? 235 TYR A CZ  1 
ATOM   241  O  OH  . TYR A 1 32  ? -3.425  74.608 19.624 1.00 46.77 ? 235 TYR A OH  1 
ATOM   242  N  N   . ILE A 1 33  ? -2.080  66.540 21.380 1.00 37.67 ? 236 ILE A N   1 
ATOM   243  C  CA  . ILE A 1 33  ? -1.711  65.134 21.261 1.00 36.49 ? 236 ILE A CA  1 
ATOM   244  C  C   . ILE A 1 33  ? -1.850  64.688 19.816 1.00 35.92 ? 236 ILE A C   1 
ATOM   245  O  O   . ILE A 1 33  ? -2.913  64.832 19.212 1.00 35.97 ? 236 ILE A O   1 
ATOM   246  C  CB  . ILE A 1 33  ? -2.603  64.226 22.142 1.00 36.35 ? 236 ILE A CB  1 
ATOM   247  C  CG1 . ILE A 1 33  ? -2.435  64.577 23.619 1.00 34.97 ? 236 ILE A CG1 1 
ATOM   248  C  CG2 . ILE A 1 33  ? -2.256  62.756 21.920 1.00 35.96 ? 236 ILE A CG2 1 
ATOM   249  C  CD1 . ILE A 1 33  ? -3.397  63.844 24.513 1.00 33.74 ? 236 ILE A CD1 1 
ATOM   250  N  N   . LEU A 1 34  ? -0.751  64.196 19.254 1.00 35.15 ? 237 LEU A N   1 
ATOM   251  C  CA  . LEU A 1 34  ? -0.733  63.695 17.886 1.00 34.09 ? 237 LEU A CA  1 
ATOM   252  C  C   . LEU A 1 34  ? -0.582  62.188 18.027 1.00 33.49 ? 237 LEU A C   1 
ATOM   253  O  O   . LEU A 1 34  ? 0.459   61.689 18.468 1.00 32.23 ? 237 LEU A O   1 
ATOM   254  C  CB  . LEU A 1 34  ? 0.464   64.249 17.116 1.00 33.82 ? 237 LEU A CB  1 
ATOM   255  C  CG  . LEU A 1 34  ? 0.331   64.461 15.603 1.00 33.70 ? 237 LEU A CG  1 
ATOM   256  C  CD1 . LEU A 1 34  ? 1.669   64.161 14.977 1.00 32.88 ? 237 LEU A CD1 1 
ATOM   257  C  CD2 . LEU A 1 34  ? -0.747  63.593 14.975 1.00 32.98 ? 237 LEU A CD2 1 
ATOM   258  N  N   . ASN A 1 35  ? -1.645  61.471 17.697 1.00 33.17 ? 238 ASN A N   1 
ATOM   259  C  CA  . ASN A 1 35  ? -1.632  60.025 17.792 1.00 33.51 ? 238 ASN A CA  1 
ATOM   260  C  C   . ASN A 1 35  ? -1.309  59.464 16.427 1.00 33.58 ? 238 ASN A C   1 
ATOM   261  O  O   . ASN A 1 35  ? -1.979  59.780 15.443 1.00 33.47 ? 238 ASN A O   1 
ATOM   262  C  CB  . ASN A 1 35  ? -2.994  59.512 18.258 1.00 33.01 ? 238 ASN A CB  1 
ATOM   263  C  CG  . ASN A 1 35  ? -2.973  58.040 18.642 1.00 33.07 ? 238 ASN A CG  1 
ATOM   264  O  OD1 . ASN A 1 35  ? -3.980  57.508 19.104 1.00 34.27 ? 238 ASN A OD1 1 
ATOM   265  N  ND2 . ASN A 1 35  ? -1.834  57.380 18.466 1.00 32.38 ? 238 ASN A ND2 1 
ATOM   266  N  N   . VAL A 1 36  ? -0.246  58.672 16.364 1.00 34.21 ? 239 VAL A N   1 
ATOM   267  C  CA  . VAL A 1 36  ? 0.165   58.052 15.114 1.00 34.61 ? 239 VAL A CA  1 
ATOM   268  C  C   . VAL A 1 36  ? 0.028   56.523 15.158 1.00 35.12 ? 239 VAL A C   1 
ATOM   269  O  O   . VAL A 1 36  ? 0.720   55.804 14.436 1.00 35.37 ? 239 VAL A O   1 
ATOM   270  C  CB  . VAL A 1 36  ? 1.589   58.508 14.671 1.00 33.65 ? 239 VAL A CB  1 
ATOM   271  C  CG1 . VAL A 1 36  ? 1.550   59.960 14.280 1.00 33.17 ? 239 VAL A CG1 1 
ATOM   272  C  CG2 . VAL A 1 36  ? 2.605   58.308 15.782 1.00 33.58 ? 239 VAL A CG2 1 
ATOM   273  N  N   . THR A 1 37  ? -0.862  56.035 16.026 1.00 35.71 ? 240 THR A N   1 
ATOM   274  C  CA  . THR A 1 37  ? -1.132  54.602 16.123 1.00 36.18 ? 240 THR A CA  1 
ATOM   275  C  C   . THR A 1 37  ? -1.900  54.272 14.836 1.00 37.27 ? 240 THR A C   1 
ATOM   276  O  O   . THR A 1 37  ? -2.824  54.998 14.454 1.00 36.78 ? 240 THR A O   1 
ATOM   277  C  CB  . THR A 1 37  ? -2.018  54.258 17.337 1.00 35.47 ? 240 THR A CB  1 
ATOM   278  O  OG1 . THR A 1 37  ? -1.374  54.681 18.543 1.00 36.26 ? 240 THR A OG1 1 
ATOM   279  C  CG2 . THR A 1 37  ? -2.257  52.766 17.410 1.00 33.79 ? 240 THR A CG2 1 
ATOM   280  N  N   . PRO A 1 38  ? -1.516  53.187 14.140 1.00 37.85 ? 241 PRO A N   1 
ATOM   281  C  CA  . PRO A 1 38  ? -2.177  52.790 12.892 1.00 39.01 ? 241 PRO A CA  1 
ATOM   282  C  C   . PRO A 1 38  ? -3.600  52.240 12.987 1.00 40.48 ? 241 PRO A C   1 
ATOM   283  O  O   . PRO A 1 38  ? -4.067  51.851 14.057 1.00 41.38 ? 241 PRO A O   1 
ATOM   284  C  CB  . PRO A 1 38  ? -1.218  51.753 12.323 1.00 38.07 ? 241 PRO A CB  1 
ATOM   285  C  CG  . PRO A 1 38  ? -0.649  51.123 13.554 1.00 37.84 ? 241 PRO A CG  1 
ATOM   286  C  CD  . PRO A 1 38  ? -0.377  52.299 14.439 1.00 37.04 ? 241 PRO A CD  1 
ATOM   287  N  N   . ASN A 1 39  ? -4.279  52.241 11.842 1.00 41.86 ? 242 ASN A N   1 
ATOM   288  C  CA  . ASN A 1 39  ? -5.642  51.732 11.690 1.00 43.03 ? 242 ASN A CA  1 
ATOM   289  C  C   . ASN A 1 39  ? -6.713  52.442 12.493 1.00 43.45 ? 242 ASN A C   1 
ATOM   290  O  O   . ASN A 1 39  ? -7.618  51.805 13.035 1.00 44.36 ? 242 ASN A O   1 
ATOM   291  C  CB  . ASN A 1 39  ? -5.686  50.232 11.992 1.00 43.54 ? 242 ASN A CB  1 
ATOM   292  C  CG  . ASN A 1 39  ? -4.721  49.443 11.143 1.00 44.65 ? 242 ASN A CG  1 
ATOM   293  O  OD1 . ASN A 1 39  ? -4.465  49.786 9.984  1.00 46.17 ? 242 ASN A OD1 1 
ATOM   294  N  ND2 . ASN A 1 39  ? -4.155  48.392 11.722 1.00 44.46 ? 242 ASN A ND2 1 
ATOM   295  N  N   . LEU A 1 40  ? -6.622  53.761 12.566 1.00 43.81 ? 243 LEU A N   1 
ATOM   296  C  CA  . LEU A 1 40  ? -7.608  54.535 13.303 1.00 44.20 ? 243 LEU A CA  1 
ATOM   297  C  C   . LEU A 1 40  ? -8.164  55.583 12.360 1.00 44.80 ? 243 LEU A C   1 
ATOM   298  O  O   . LEU A 1 40  ? -7.478  56.013 11.430 1.00 45.26 ? 243 LEU A O   1 
ATOM   299  C  CB  . LEU A 1 40  ? -6.974  55.199 14.530 1.00 43.56 ? 243 LEU A CB  1 
ATOM   300  C  CG  . LEU A 1 40  ? -6.360  54.288 15.598 1.00 43.23 ? 243 LEU A CG  1 
ATOM   301  C  CD1 . LEU A 1 40  ? -5.718  55.143 16.669 1.00 43.68 ? 243 LEU A CD1 1 
ATOM   302  C  CD2 . LEU A 1 40  ? -7.408  53.372 16.209 1.00 42.58 ? 243 LEU A CD2 1 
ATOM   303  N  N   . PRO A 1 41  ? -9.442  55.957 12.538 1.00 45.35 ? 244 PRO A N   1 
ATOM   304  C  CA  . PRO A 1 41  ? -10.062 56.967 11.676 1.00 45.96 ? 244 PRO A CA  1 
ATOM   305  C  C   . PRO A 1 41  ? -9.472  58.350 11.916 1.00 46.28 ? 244 PRO A C   1 
ATOM   306  O  O   . PRO A 1 41  ? -8.932  58.632 12.988 1.00 46.52 ? 244 PRO A O   1 
ATOM   307  C  CB  . PRO A 1 41  ? -11.531 56.913 12.092 1.00 45.64 ? 244 PRO A CB  1 
ATOM   308  C  CG  . PRO A 1 41  ? -11.454 56.527 13.532 1.00 45.95 ? 244 PRO A CG  1 
ATOM   309  C  CD  . PRO A 1 41  ? -10.418 55.432 13.507 1.00 45.16 ? 244 PRO A CD  1 
ATOM   310  N  N   . ASN A 1 42  ? -9.559  59.201 10.905 1.00 46.58 ? 245 ASN A N   1 
ATOM   311  C  CA  . ASN A 1 42  ? -9.047  60.552 11.020 1.00 47.00 ? 245 ASN A CA  1 
ATOM   312  C  C   . ASN A 1 42  ? -9.943  61.337 11.980 1.00 47.40 ? 245 ASN A C   1 
ATOM   313  O  O   . ASN A 1 42  ? -11.166 61.313 11.856 1.00 47.66 ? 245 ASN A O   1 
ATOM   314  C  CB  . ASN A 1 42  ? -9.024  61.207 9.639  1.00 47.69 ? 245 ASN A CB  1 
ATOM   315  C  CG  . ASN A 1 42  ? -8.527  62.637 9.677  1.00 48.79 ? 245 ASN A CG  1 
ATOM   316  O  OD1 . ASN A 1 42  ? -9.271  63.569 9.374  1.00 50.28 ? 245 ASN A OD1 1 
ATOM   317  N  ND2 . ASN A 1 42  ? -7.267  62.819 10.044 1.00 48.25 ? 245 ASN A ND2 1 
ATOM   318  N  N   . LEU A 1 43  ? -9.323  61.975 12.970 1.00 47.53 ? 246 LEU A N   1 
ATOM   319  C  CA  . LEU A 1 43  ? -10.023 62.782 13.970 1.00 47.23 ? 246 LEU A CA  1 
ATOM   320  C  C   . LEU A 1 43  ? -9.172  63.976 14.373 1.00 47.78 ? 246 LEU A C   1 
ATOM   321  O  O   . LEU A 1 43  ? -7.945  63.927 14.339 1.00 47.68 ? 246 LEU A O   1 
ATOM   322  C  CB  . LEU A 1 43  ? -10.289 61.982 15.251 1.00 47.05 ? 246 LEU A CB  1 
ATOM   323  C  CG  . LEU A 1 43  ? -11.354 60.893 15.346 1.00 47.45 ? 246 LEU A CG  1 
ATOM   324  C  CD1 . LEU A 1 43  ? -11.133 60.081 16.610 1.00 47.25 ? 246 LEU A CD1 1 
ATOM   325  C  CD2 . LEU A 1 43  ? -12.733 61.507 15.348 1.00 47.12 ? 246 LEU A CD2 1 
ATOM   326  N  N   . PHE A 1 44  ? -9.846  65.042 14.775 1.00 48.50 ? 247 PHE A N   1 
ATOM   327  C  CA  . PHE A 1 44  ? -9.201  66.251 15.257 1.00 48.67 ? 247 PHE A CA  1 
ATOM   328  C  C   . PHE A 1 44  ? -10.309 66.977 15.996 1.00 47.92 ? 247 PHE A C   1 
ATOM   329  O  O   . PHE A 1 44  ? -11.123 67.674 15.399 1.00 47.16 ? 247 PHE A O   1 
ATOM   330  C  CB  . PHE A 1 44  ? -8.644  67.103 14.114 1.00 50.63 ? 247 PHE A CB  1 
ATOM   331  C  CG  . PHE A 1 44  ? -7.790  68.263 14.577 1.00 53.45 ? 247 PHE A CG  1 
ATOM   332  C  CD1 . PHE A 1 44  ? -8.022  68.883 15.807 1.00 54.84 ? 247 PHE A CD1 1 
ATOM   333  C  CD2 . PHE A 1 44  ? -6.764  68.746 13.776 1.00 54.99 ? 247 PHE A CD2 1 
ATOM   334  C  CE1 . PHE A 1 44  ? -7.252  69.962 16.231 1.00 55.32 ? 247 PHE A CE1 1 
ATOM   335  C  CE2 . PHE A 1 44  ? -5.983  69.829 14.192 1.00 55.73 ? 247 PHE A CE2 1 
ATOM   336  C  CZ  . PHE A 1 44  ? -6.232  70.437 15.425 1.00 55.40 ? 247 PHE A CZ  1 
ATOM   337  N  N   . GLU A 1 45  ? -10.370 66.744 17.298 1.00 47.51 ? 248 GLU A N   1 
ATOM   338  C  CA  . GLU A 1 45  ? -11.383 67.349 18.139 1.00 48.52 ? 248 GLU A CA  1 
ATOM   339  C  C   . GLU A 1 45  ? -10.737 67.670 19.467 1.00 49.31 ? 248 GLU A C   1 
ATOM   340  O  O   . GLU A 1 45  ? -9.590  67.287 19.711 1.00 49.34 ? 248 GLU A O   1 
ATOM   341  C  CB  . GLU A 1 45  ? -12.513 66.349 18.404 1.00 48.68 ? 248 GLU A CB  1 
ATOM   342  C  CG  . GLU A 1 45  ? -13.062 65.631 17.181 1.00 49.18 ? 248 GLU A CG  1 
ATOM   343  C  CD  . GLU A 1 45  ? -13.862 66.532 16.258 1.00 49.25 ? 248 GLU A CD  1 
ATOM   344  O  OE1 . GLU A 1 45  ? -14.246 67.649 16.675 1.00 49.31 ? 248 GLU A OE1 1 
ATOM   345  O  OE2 . GLU A 1 45  ? -14.120 66.109 15.110 1.00 49.07 ? 248 GLU A OE2 1 
ATOM   346  N  N   . ASN A 1 46  ? -11.476 68.369 20.326 1.00 50.30 ? 249 ASN A N   1 
ATOM   347  C  CA  . ASN A 1 46  ? -10.984 68.699 21.661 1.00 51.18 ? 249 ASN A CA  1 
ATOM   348  C  C   . ASN A 1 46  ? -11.419 67.579 22.594 1.00 51.43 ? 249 ASN A C   1 
ATOM   349  O  O   . ASN A 1 46  ? -12.575 67.168 22.570 1.00 51.75 ? 249 ASN A O   1 
ATOM   350  C  CB  . ASN A 1 46  ? -11.564 70.025 22.151 1.00 51.71 ? 249 ASN A CB  1 
ATOM   351  C  CG  . ASN A 1 46  ? -11.142 71.197 21.292 1.00 52.83 ? 249 ASN A CG  1 
ATOM   352  O  OD1 . ASN A 1 46  ? -9.953  71.439 21.081 1.00 53.31 ? 249 ASN A OD1 1 
ATOM   353  N  ND2 . ASN A 1 46  ? -12.118 71.934 20.788 1.00 53.67 ? 249 ASN A ND2 1 
ATOM   354  N  N   . ALA A 1 47  ? -10.477 67.046 23.364 1.00 51.80 ? 250 ALA A N   1 
ATOM   355  C  CA  . ALA A 1 47  ? -10.763 65.971 24.307 1.00 52.12 ? 250 ALA A CA  1 
ATOM   356  C  C   . ALA A 1 47  ? -10.340 66.439 25.692 1.00 52.47 ? 250 ALA A C   1 
ATOM   357  O  O   . ALA A 1 47  ? -9.161  66.379 26.048 1.00 52.53 ? 250 ALA A O   1 
ATOM   358  C  CB  . ALA A 1 47  ? -10.012 64.704 23.912 1.00 52.33 ? 250 ALA A CB  1 
ATOM   359  N  N   . GLY A 1 48  ? -11.311 66.908 26.468 1.00 52.89 ? 251 GLY A N   1 
ATOM   360  C  CA  . GLY A 1 48  ? -11.015 67.417 27.790 1.00 53.26 ? 251 GLY A CA  1 
ATOM   361  C  C   . GLY A 1 48  ? -10.174 68.665 27.605 1.00 53.95 ? 251 GLY A C   1 
ATOM   362  O  O   . GLY A 1 48  ? -10.499 69.526 26.775 1.00 54.22 ? 251 GLY A O   1 
ATOM   363  N  N   . GLU A 1 49  ? -9.052  68.721 28.317 1.00 54.14 ? 252 GLU A N   1 
ATOM   364  C  CA  . GLU A 1 49  ? -8.126  69.854 28.250 1.00 54.43 ? 252 GLU A CA  1 
ATOM   365  C  C   . GLU A 1 49  ? -7.163  69.778 27.062 1.00 52.93 ? 252 GLU A C   1 
ATOM   366  O  O   . GLU A 1 49  ? -6.267  70.613 26.941 1.00 53.18 ? 252 GLU A O   1 
ATOM   367  C  CB  . GLU A 1 49  ? -7.288  69.912 29.536 1.00 56.48 ? 252 GLU A CB  1 
ATOM   368  C  CG  . GLU A 1 49  ? -8.077  70.204 30.798 1.00 59.58 ? 252 GLU A CG  1 
ATOM   369  C  CD  . GLU A 1 49  ? -8.730  71.573 30.763 1.00 61.59 ? 252 GLU A CD  1 
ATOM   370  O  OE1 . GLU A 1 49  ? -8.018  72.580 30.989 1.00 62.69 ? 252 GLU A OE1 1 
ATOM   371  O  OE2 . GLU A 1 49  ? -9.952  71.638 30.496 1.00 61.89 ? 252 GLU A OE2 1 
ATOM   372  N  N   . PHE A 1 50  ? -7.366  68.814 26.167 1.00 50.89 ? 253 PHE A N   1 
ATOM   373  C  CA  . PHE A 1 50  ? -6.455  68.627 25.046 1.00 48.30 ? 253 PHE A CA  1 
ATOM   374  C  C   . PHE A 1 50  ? -7.052  68.763 23.670 1.00 47.36 ? 253 PHE A C   1 
ATOM   375  O  O   . PHE A 1 50  ? -8.263  68.682 23.495 1.00 46.85 ? 253 PHE A O   1 
ATOM   376  C  CB  . PHE A 1 50  ? -5.813  67.247 25.149 1.00 46.93 ? 253 PHE A CB  1 
ATOM   377  C  CG  . PHE A 1 50  ? -5.295  66.935 26.511 1.00 46.40 ? 253 PHE A CG  1 
ATOM   378  C  CD1 . PHE A 1 50  ? -6.156  66.501 27.509 1.00 46.50 ? 253 PHE A CD1 1 
ATOM   379  C  CD2 . PHE A 1 50  ? -3.957  67.124 26.816 1.00 46.57 ? 253 PHE A CD2 1 
ATOM   380  C  CE1 . PHE A 1 50  ? -5.692  66.266 28.795 1.00 47.10 ? 253 PHE A CE1 1 
ATOM   381  C  CE2 . PHE A 1 50  ? -3.481  66.892 28.098 1.00 46.68 ? 253 PHE A CE2 1 
ATOM   382  C  CZ  . PHE A 1 50  ? -4.350  66.463 29.091 1.00 47.06 ? 253 PHE A CZ  1 
ATOM   383  N  N   . LYS A 1 51  ? -6.171  69.011 22.704 1.00 46.92 ? 254 LYS A N   1 
ATOM   384  C  CA  . LYS A 1 51  ? -6.531  69.110 21.296 1.00 46.41 ? 254 LYS A CA  1 
ATOM   385  C  C   . LYS A 1 51  ? -5.951  67.828 20.734 1.00 44.48 ? 254 LYS A C   1 
ATOM   386  O  O   . LYS A 1 51  ? -4.740  67.681 20.591 1.00 44.32 ? 254 LYS A O   1 
ATOM   387  C  CB  . LYS A 1 51  ? -5.917  70.347 20.645 1.00 48.38 ? 254 LYS A CB  1 
ATOM   388  C  CG  . LYS A 1 51  ? -6.947  71.444 20.434 1.00 51.64 ? 254 LYS A CG  1 
ATOM   389  C  CD  . LYS A 1 51  ? -6.328  72.830 20.386 1.00 54.50 ? 254 LYS A CD  1 
ATOM   390  C  CE  . LYS A 1 51  ? -7.395  73.916 20.568 1.00 55.95 ? 254 LYS A CE  1 
ATOM   391  N  NZ  . LYS A 1 51  ? -8.141  73.768 21.863 1.00 56.16 ? 254 LYS A NZ  1 
ATOM   392  N  N   . TYR A 1 52  ? -6.840  66.870 20.525 1.00 42.30 ? 255 TYR A N   1 
ATOM   393  C  CA  . TYR A 1 52  ? -6.483  65.548 20.056 1.00 40.19 ? 255 TYR A CA  1 
ATOM   394  C  C   . TYR A 1 52  ? -6.536  65.370 18.547 1.00 39.01 ? 255 TYR A C   1 
ATOM   395  O  O   . TYR A 1 52  ? -7.556  65.643 17.919 1.00 39.14 ? 255 TYR A O   1 
ATOM   396  C  CB  . TYR A 1 52  ? -7.405  64.547 20.746 1.00 39.65 ? 255 TYR A CB  1 
ATOM   397  C  CG  . TYR A 1 52  ? -7.150  63.102 20.419 1.00 39.28 ? 255 TYR A CG  1 
ATOM   398  C  CD1 . TYR A 1 52  ? -6.157  62.381 21.087 1.00 38.99 ? 255 TYR A CD1 1 
ATOM   399  C  CD2 . TYR A 1 52  ? -7.931  62.438 19.471 1.00 38.43 ? 255 TYR A CD2 1 
ATOM   400  C  CE1 . TYR A 1 52  ? -5.950  61.036 20.820 1.00 38.37 ? 255 TYR A CE1 1 
ATOM   401  C  CE2 . TYR A 1 52  ? -7.733  61.096 19.198 1.00 38.63 ? 255 TYR A CE2 1 
ATOM   402  C  CZ  . TYR A 1 52  ? -6.745  60.404 19.876 1.00 38.75 ? 255 TYR A CZ  1 
ATOM   403  O  OH  . TYR A 1 52  ? -6.562  59.075 19.613 1.00 40.12 ? 255 TYR A OH  1 
ATOM   404  N  N   . LYS A 1 53  ? -5.431  64.887 17.984 1.00 37.89 ? 256 LYS A N   1 
ATOM   405  C  CA  . LYS A 1 53  ? -5.325  64.632 16.552 1.00 37.44 ? 256 LYS A CA  1 
ATOM   406  C  C   . LYS A 1 53  ? -4.939  63.167 16.332 1.00 37.26 ? 256 LYS A C   1 
ATOM   407  O  O   . LYS A 1 53  ? -4.039  62.640 16.977 1.00 37.05 ? 256 LYS A O   1 
ATOM   408  C  CB  . LYS A 1 53  ? -4.291  65.548 15.897 1.00 36.88 ? 256 LYS A CB  1 
ATOM   409  C  CG  . LYS A 1 53  ? -4.470  65.679 14.386 1.00 36.63 ? 256 LYS A CG  1 
ATOM   410  C  CD  . LYS A 1 53  ? -3.230  66.240 13.713 1.00 36.58 ? 256 LYS A CD  1 
ATOM   411  C  CE  . LYS A 1 53  ? -3.561  66.951 12.405 1.00 36.44 ? 256 LYS A CE  1 
ATOM   412  N  NZ  . LYS A 1 53  ? -4.298  66.105 11.445 1.00 35.34 ? 256 LYS A NZ  1 
ATOM   413  N  N   . GLN A 1 54  ? -5.588  62.542 15.366 1.00 37.37 ? 257 GLN A N   1 
ATOM   414  C  CA  . GLN A 1 54  ? -5.371  61.141 15.059 1.00 38.20 ? 257 GLN A CA  1 
ATOM   415  C  C   . GLN A 1 54  ? -5.324  61.029 13.533 1.00 38.68 ? 257 GLN A C   1 
ATOM   416  O  O   . GLN A 1 54  ? -6.299  61.341 12.860 1.00 39.22 ? 257 GLN A O   1 
ATOM   417  C  CB  . GLN A 1 54  ? -6.576  60.383 15.615 1.00 39.06 ? 257 GLN A CB  1 
ATOM   418  C  CG  . GLN A 1 54  ? -6.478  58.892 15.758 1.00 39.67 ? 257 GLN A CG  1 
ATOM   419  C  CD  . GLN A 1 54  ? -7.746  58.317 16.378 1.00 40.21 ? 257 GLN A CD  1 
ATOM   420  O  OE1 . GLN A 1 54  ? -8.793  58.253 15.734 1.00 40.65 ? 257 GLN A OE1 1 
ATOM   421  N  NE2 . GLN A 1 54  ? -7.659  57.908 17.634 1.00 39.29 ? 257 GLN A NE2 1 
ATOM   422  N  N   . ILE A 1 55  ? -4.181  60.647 12.973 1.00 39.44 ? 258 ILE A N   1 
ATOM   423  C  CA  . ILE A 1 55  ? -4.083  60.516 11.519 1.00 39.80 ? 258 ILE A CA  1 
ATOM   424  C  C   . ILE A 1 55  ? -4.379  59.089 11.064 1.00 40.00 ? 258 ILE A C   1 
ATOM   425  O  O   . ILE A 1 55  ? -4.049  58.127 11.755 1.00 40.05 ? 258 ILE A O   1 
ATOM   426  C  CB  . ILE A 1 55  ? -2.713  60.981 10.976 1.00 39.38 ? 258 ILE A CB  1 
ATOM   427  C  CG1 . ILE A 1 55  ? -1.579  60.227 11.659 1.00 39.12 ? 258 ILE A CG1 1 
ATOM   428  C  CG2 . ILE A 1 55  ? -2.555  62.483 11.171 1.00 39.17 ? 258 ILE A CG2 1 
ATOM   429  C  CD1 . ILE A 1 55  ? -0.216  60.605 11.145 1.00 40.04 ? 258 ILE A CD1 1 
ATOM   430  N  N   . PRO A 1 56  ? -5.040  58.940 9.906  1.00 40.76 ? 259 PRO A N   1 
ATOM   431  C  CA  . PRO A 1 56  ? -5.416  57.653 9.317  1.00 41.49 ? 259 PRO A CA  1 
ATOM   432  C  C   . PRO A 1 56  ? -4.278  56.891 8.626  1.00 42.73 ? 259 PRO A C   1 
ATOM   433  O  O   . PRO A 1 56  ? -4.180  56.863 7.398  1.00 43.19 ? 259 PRO A O   1 
ATOM   434  C  CB  . PRO A 1 56  ? -6.511  58.052 8.337  1.00 41.07 ? 259 PRO A CB  1 
ATOM   435  C  CG  . PRO A 1 56  ? -6.022  59.366 7.837  1.00 40.20 ? 259 PRO A CG  1 
ATOM   436  C  CD  . PRO A 1 56  ? -5.576  60.055 9.102  1.00 40.63 ? 259 PRO A CD  1 
ATOM   437  N  N   . ILE A 1 57  ? -3.419  56.280 9.429  1.00 43.66 ? 260 ILE A N   1 
ATOM   438  C  CA  . ILE A 1 57  ? -2.301  55.505 8.918  1.00 44.66 ? 260 ILE A CA  1 
ATOM   439  C  C   . ILE A 1 57  ? -2.790  54.070 8.822  1.00 45.98 ? 260 ILE A C   1 
ATOM   440  O  O   . ILE A 1 57  ? -3.715  53.677 9.524  1.00 47.10 ? 260 ILE A O   1 
ATOM   441  C  CB  . ILE A 1 57  ? -1.127  55.534 9.904  1.00 44.44 ? 260 ILE A CB  1 
ATOM   442  C  CG1 . ILE A 1 57  ? -0.794  56.970 10.260 1.00 45.03 ? 260 ILE A CG1 1 
ATOM   443  C  CG2 . ILE A 1 57  ? 0.103   54.877 9.310  1.00 44.85 ? 260 ILE A CG2 1 
ATOM   444  C  CD1 . ILE A 1 57  ? 0.128   57.073 11.429 1.00 46.72 ? 260 ILE A CD1 1 
ATOM   445  N  N   . SER A 1 58  ? -2.195  53.299 7.926  1.00 46.93 ? 261 SER A N   1 
ATOM   446  C  CA  . SER A 1 58  ? -2.548  51.899 7.772  1.00 47.67 ? 261 SER A CA  1 
ATOM   447  C  C   . SER A 1 58  ? -1.267  51.138 8.063  1.00 47.78 ? 261 SER A C   1 
ATOM   448  O  O   . SER A 1 58  ? -0.179  51.597 7.709  1.00 47.78 ? 261 SER A O   1 
ATOM   449  C  CB  . SER A 1 58  ? -3.005  51.617 6.344  1.00 48.30 ? 261 SER A CB  1 
ATOM   450  O  OG  . SER A 1 58  ? -3.405  50.266 6.203  1.00 50.32 ? 261 SER A OG  1 
ATOM   451  N  N   . ASP A 1 59  ? -1.366  50.007 8.749  1.00 48.09 ? 262 ASP A N   1 
ATOM   452  C  CA  . ASP A 1 59  ? -0.152  49.251 9.029  1.00 49.08 ? 262 ASP A CA  1 
ATOM   453  C  C   . ASP A 1 59  ? 0.235   48.342 7.869  1.00 48.52 ? 262 ASP A C   1 
ATOM   454  O  O   . ASP A 1 59  ? 1.128   47.506 7.993  1.00 49.23 ? 262 ASP A O   1 
ATOM   455  C  CB  . ASP A 1 59  ? -0.240  48.478 10.356 1.00 50.94 ? 262 ASP A CB  1 
ATOM   456  C  CG  . ASP A 1 59  ? -1.319  47.411 10.363 1.00 53.14 ? 262 ASP A CG  1 
ATOM   457  O  OD1 . ASP A 1 59  ? -2.064  47.256 9.364  1.00 54.42 ? 262 ASP A OD1 1 
ATOM   458  O  OD2 . ASP A 1 59  ? -1.416  46.717 11.400 1.00 54.22 ? 262 ASP A OD2 1 
ATOM   459  N  N   . HIS A 1 60  ? -0.454  48.511 6.743  1.00 48.05 ? 263 HIS A N   1 
ATOM   460  C  CA  . HIS A 1 60  ? -0.183  47.735 5.539  1.00 47.53 ? 263 HIS A CA  1 
ATOM   461  C  C   . HIS A 1 60  ? 1.133   48.240 4.955  1.00 46.91 ? 263 HIS A C   1 
ATOM   462  O  O   . HIS A 1 60  ? 1.419   49.434 4.998  1.00 47.30 ? 263 HIS A O   1 
ATOM   463  C  CB  . HIS A 1 60  ? -1.320  47.921 4.532  1.00 47.13 ? 263 HIS A CB  1 
ATOM   464  C  CG  . HIS A 1 60  ? -1.286  46.952 3.391  1.00 46.82 ? 263 HIS A CG  1 
ATOM   465  N  ND1 . HIS A 1 60  ? -0.665  47.230 2.194  1.00 46.95 ? 263 HIS A ND1 1 
ATOM   466  C  CD2 . HIS A 1 60  ? -1.832  45.720 3.251  1.00 46.45 ? 263 HIS A CD2 1 
ATOM   467  C  CE1 . HIS A 1 60  ? -0.834  46.220 1.361  1.00 46.27 ? 263 HIS A CE1 1 
ATOM   468  N  NE2 . HIS A 1 60  ? -1.538  45.290 1.979  1.00 46.04 ? 263 HIS A NE2 1 
ATOM   469  N  N   . TRP A 1 61  ? 1.921   47.327 4.400  1.00 46.70 ? 264 TRP A N   1 
ATOM   470  C  CA  . TRP A 1 61  ? 3.225   47.662 3.832  1.00 46.67 ? 264 TRP A CA  1 
ATOM   471  C  C   . TRP A 1 61  ? 3.242   48.766 2.779  1.00 47.35 ? 264 TRP A C   1 
ATOM   472  O  O   . TRP A 1 61  ? 4.265   49.418 2.575  1.00 48.53 ? 264 TRP A O   1 
ATOM   473  C  CB  . TRP A 1 61  ? 3.906   46.400 3.280  1.00 45.35 ? 264 TRP A CB  1 
ATOM   474  C  CG  . TRP A 1 61  ? 3.217   45.761 2.103  1.00 43.28 ? 264 TRP A CG  1 
ATOM   475  C  CD1 . TRP A 1 61  ? 2.366   44.694 2.131  1.00 42.38 ? 264 TRP A CD1 1 
ATOM   476  C  CD2 . TRP A 1 61  ? 3.325   46.155 0.726  1.00 42.47 ? 264 TRP A CD2 1 
ATOM   477  N  NE1 . TRP A 1 61  ? 1.933   44.402 0.858  1.00 42.31 ? 264 TRP A NE1 1 
ATOM   478  C  CE2 . TRP A 1 61  ? 2.505   45.282 -0.022 1.00 42.41 ? 264 TRP A CE2 1 
ATOM   479  C  CE3 . TRP A 1 61  ? 4.032   47.159 0.052  1.00 41.75 ? 264 TRP A CE3 1 
ATOM   480  C  CZ2 . TRP A 1 61  ? 2.372   45.387 -1.407 1.00 42.18 ? 264 TRP A CZ2 1 
ATOM   481  C  CZ3 . TRP A 1 61  ? 3.900   47.265 -1.320 1.00 41.51 ? 264 TRP A CZ3 1 
ATOM   482  C  CH2 . TRP A 1 61  ? 3.075   46.381 -2.038 1.00 42.03 ? 264 TRP A CH2 1 
ATOM   483  N  N   . SER A 1 62  ? 2.121   48.965 2.097  1.00 48.02 ? 265 SER A N   1 
ATOM   484  C  CA  . SER A 1 62  ? 2.043   49.980 1.058  1.00 49.00 ? 265 SER A CA  1 
ATOM   485  C  C   . SER A 1 62  ? 1.777   51.372 1.598  1.00 50.11 ? 265 SER A C   1 
ATOM   486  O  O   . SER A 1 62  ? 1.890   52.355 0.863  1.00 50.55 ? 265 SER A O   1 
ATOM   487  C  CB  . SER A 1 62  ? 0.961   49.614 0.050  1.00 48.78 ? 265 SER A CB  1 
ATOM   488  O  OG  . SER A 1 62  ? -0.306  49.567 0.678  1.00 47.56 ? 265 SER A OG  1 
ATOM   489  N  N   . GLN A 1 63  ? 1.428   51.457 2.878  1.00 51.50 ? 266 GLN A N   1 
ATOM   490  C  CA  . GLN A 1 63  ? 1.137   52.743 3.502  1.00 52.62 ? 266 GLN A CA  1 
ATOM   491  C  C   . GLN A 1 63  ? 2.322   53.688 3.514  1.00 51.17 ? 266 GLN A C   1 
ATOM   492  O  O   . GLN A 1 63  ? 3.436   53.320 3.885  1.00 51.25 ? 266 GLN A O   1 
ATOM   493  C  CB  . GLN A 1 63  ? 0.634   52.563 4.936  1.00 55.77 ? 266 GLN A CB  1 
ATOM   494  C  CG  . GLN A 1 63  ? 0.310   53.887 5.663  1.00 59.57 ? 266 GLN A CG  1 
ATOM   495  C  CD  . GLN A 1 63  ? -0.889  54.615 5.069  1.00 61.42 ? 266 GLN A CD  1 
ATOM   496  O  OE1 . GLN A 1 63  ? -2.036  54.216 5.279  1.00 63.37 ? 266 GLN A OE1 1 
ATOM   497  N  NE2 . GLN A 1 63  ? -0.627  55.680 4.316  1.00 62.55 ? 266 GLN A NE2 1 
ATOM   498  N  N   . ASN A 1 64  ? 2.046   54.919 3.109  1.00 49.90 ? 267 ASN A N   1 
ATOM   499  C  CA  . ASN A 1 64  ? 3.031   55.979 3.072  1.00 49.15 ? 267 ASN A CA  1 
ATOM   500  C  C   . ASN A 1 64  ? 2.747   56.926 4.243  1.00 47.53 ? 267 ASN A C   1 
ATOM   501  O  O   . ASN A 1 64  ? 1.696   57.563 4.290  1.00 47.47 ? 267 ASN A O   1 
ATOM   502  C  CB  . ASN A 1 64  ? 2.908   56.718 1.737  1.00 51.06 ? 267 ASN A CB  1 
ATOM   503  C  CG  . ASN A 1 64  ? 3.715   57.991 1.695  1.00 52.78 ? 267 ASN A CG  1 
ATOM   504  O  OD1 . ASN A 1 64  ? 3.255   59.039 2.145  1.00 53.99 ? 267 ASN A OD1 1 
ATOM   505  N  ND2 . ASN A 1 64  ? 4.920   57.916 1.142  1.00 53.78 ? 267 ASN A ND2 1 
ATOM   506  N  N   . LEU A 1 65  ? 3.650   56.965 5.217  1.00 45.30 ? 268 LEU A N   1 
ATOM   507  C  CA  . LEU A 1 65  ? 3.489   57.848 6.367  1.00 43.08 ? 268 LEU A CA  1 
ATOM   508  C  C   . LEU A 1 65  ? 3.919   59.268 6.020  1.00 42.57 ? 268 LEU A C   1 
ATOM   509  O  O   . LEU A 1 65  ? 3.332   60.234 6.494  1.00 41.95 ? 268 LEU A O   1 
ATOM   510  C  CB  . LEU A 1 65  ? 4.317   57.342 7.547  1.00 41.26 ? 268 LEU A CB  1 
ATOM   511  C  CG  . LEU A 1 65  ? 4.336   58.209 8.809  1.00 39.68 ? 268 LEU A CG  1 
ATOM   512  C  CD1 . LEU A 1 65  ? 2.979   58.210 9.482  1.00 38.43 ? 268 LEU A CD1 1 
ATOM   513  C  CD2 . LEU A 1 65  ? 5.382   57.694 9.760  1.00 38.33 ? 268 LEU A CD2 1 
ATOM   514  N  N   . SER A 1 66  ? 4.916   59.379 5.150  1.00 42.70 ? 269 SER A N   1 
ATOM   515  C  CA  . SER A 1 66  ? 5.458   60.671 4.742  1.00 43.42 ? 269 SER A CA  1 
ATOM   516  C  C   . SER A 1 66  ? 4.458   61.698 4.226  1.00 43.43 ? 269 SER A C   1 
ATOM   517  O  O   . SER A 1 66  ? 4.705   62.898 4.313  1.00 44.37 ? 269 SER A O   1 
ATOM   518  C  CB  . SER A 1 66  ? 6.581   60.483 3.713  1.00 43.88 ? 269 SER A CB  1 
ATOM   519  O  OG  . SER A 1 66  ? 6.094   59.934 2.500  1.00 44.85 ? 269 SER A OG  1 
ATOM   520  N  N   . GLN A 1 67  ? 3.334   61.240 3.693  1.00 43.17 ? 270 GLN A N   1 
ATOM   521  C  CA  . GLN A 1 67  ? 2.328   62.156 3.165  1.00 43.07 ? 270 GLN A CA  1 
ATOM   522  C  C   . GLN A 1 67  ? 1.684   62.945 4.291  1.00 42.56 ? 270 GLN A C   1 
ATOM   523  O  O   . GLN A 1 67  ? 1.118   64.011 4.057  1.00 43.31 ? 270 GLN A O   1 
ATOM   524  C  CB  . GLN A 1 67  ? 1.247   61.390 2.405  1.00 44.02 ? 270 GLN A CB  1 
ATOM   525  C  CG  . GLN A 1 67  ? 0.481   60.424 3.286  1.00 46.05 ? 270 GLN A CG  1 
ATOM   526  C  CD  . GLN A 1 67  ? -0.637  59.715 2.564  1.00 46.82 ? 270 GLN A CD  1 
ATOM   527  O  OE1 . GLN A 1 67  ? -0.709  58.487 2.580  1.00 46.95 ? 270 GLN A OE1 1 
ATOM   528  N  NE2 . GLN A 1 67  ? -1.538  60.483 1.949  1.00 46.45 ? 270 GLN A NE2 1 
ATOM   529  N  N   . PHE A 1 68  ? 1.754   62.401 5.504  1.00 41.37 ? 271 PHE A N   1 
ATOM   530  C  CA  . PHE A 1 68  ? 1.177   63.042 6.683  1.00 39.94 ? 271 PHE A CA  1 
ATOM   531  C  C   . PHE A 1 68  ? 2.150   63.992 7.358  1.00 38.70 ? 271 PHE A C   1 
ATOM   532  O  O   . PHE A 1 68  ? 1.796   64.676 8.316  1.00 38.52 ? 271 PHE A O   1 
ATOM   533  C  CB  . PHE A 1 68  ? 0.704   61.989 7.681  1.00 40.80 ? 271 PHE A CB  1 
ATOM   534  C  CG  . PHE A 1 68  ? -0.375  61.101 7.147  1.00 42.37 ? 271 PHE A CG  1 
ATOM   535  C  CD1 . PHE A 1 68  ? -1.566  61.647 6.662  1.00 42.93 ? 271 PHE A CD1 1 
ATOM   536  C  CD2 . PHE A 1 68  ? -0.197  59.723 7.097  1.00 43.14 ? 271 PHE A CD2 1 
ATOM   537  C  CE1 . PHE A 1 68  ? -2.565  60.835 6.133  1.00 42.94 ? 271 PHE A CE1 1 
ATOM   538  C  CE2 . PHE A 1 68  ? -1.191  58.897 6.570  1.00 43.99 ? 271 PHE A CE2 1 
ATOM   539  C  CZ  . PHE A 1 68  ? -2.378  59.458 6.085  1.00 43.63 ? 271 PHE A CZ  1 
ATOM   540  N  N   . PHE A 1 69  ? 3.376   64.035 6.852  1.00 37.58 ? 272 PHE A N   1 
ATOM   541  C  CA  . PHE A 1 69  ? 4.394   64.913 7.401  1.00 37.15 ? 272 PHE A CA  1 
ATOM   542  C  C   . PHE A 1 69  ? 3.945   66.373 7.408  1.00 38.71 ? 272 PHE A C   1 
ATOM   543  O  O   . PHE A 1 69  ? 4.021   67.033 8.443  1.00 39.53 ? 272 PHE A O   1 
ATOM   544  C  CB  . PHE A 1 69  ? 5.719   64.761 6.642  1.00 34.90 ? 272 PHE A CB  1 
ATOM   545  C  CG  . PHE A 1 69  ? 6.471   63.493 6.966  1.00 32.69 ? 272 PHE A CG  1 
ATOM   546  C  CD1 . PHE A 1 69  ? 6.053   62.657 7.991  1.00 31.73 ? 272 PHE A CD1 1 
ATOM   547  C  CD2 . PHE A 1 69  ? 7.608   63.147 6.249  1.00 31.74 ? 272 PHE A CD2 1 
ATOM   548  C  CE1 . PHE A 1 69  ? 6.755   61.502 8.294  1.00 31.67 ? 272 PHE A CE1 1 
ATOM   549  C  CE2 . PHE A 1 69  ? 8.318   61.992 6.546  1.00 31.39 ? 272 PHE A CE2 1 
ATOM   550  C  CZ  . PHE A 1 69  ? 7.891   61.168 7.571  1.00 32.06 ? 272 PHE A CZ  1 
ATOM   551  N  N   . PRO A 1 70  ? 3.452   66.899 6.266  1.00 39.73 ? 273 PRO A N   1 
ATOM   552  C  CA  . PRO A 1 70  ? 3.027   68.300 6.299  1.00 39.82 ? 273 PRO A CA  1 
ATOM   553  C  C   . PRO A 1 70  ? 2.006   68.647 7.375  1.00 40.36 ? 273 PRO A C   1 
ATOM   554  O  O   . PRO A 1 70  ? 2.218   69.593 8.137  1.00 41.32 ? 273 PRO A O   1 
ATOM   555  C  CB  . PRO A 1 70  ? 2.500   68.547 4.879  1.00 39.07 ? 273 PRO A CB  1 
ATOM   556  C  CG  . PRO A 1 70  ? 2.251   67.187 4.328  1.00 39.82 ? 273 PRO A CG  1 
ATOM   557  C  CD  . PRO A 1 70  ? 3.369   66.370 4.895  1.00 39.75 ? 273 PRO A CD  1 
ATOM   558  N  N   . GLU A 1 71  ? 0.942   67.862 7.499  1.00 40.64 ? 274 GLU A N   1 
ATOM   559  C  CA  . GLU A 1 71  ? -0.067  68.174 8.510  1.00 41.58 ? 274 GLU A CA  1 
ATOM   560  C  C   . GLU A 1 71  ? 0.388   67.888 9.934  1.00 41.25 ? 274 GLU A C   1 
ATOM   561  O  O   . GLU A 1 71  ? -0.119  68.488 10.884 1.00 41.67 ? 274 GLU A O   1 
ATOM   562  C  CB  . GLU A 1 71  ? -1.390  67.465 8.223  1.00 42.79 ? 274 GLU A CB  1 
ATOM   563  C  CG  . GLU A 1 71  ? -1.367  65.970 8.424  1.00 44.69 ? 274 GLU A CG  1 
ATOM   564  C  CD  . GLU A 1 71  ? -2.700  65.341 8.101  1.00 45.67 ? 274 GLU A CD  1 
ATOM   565  O  OE1 . GLU A 1 71  ? -2.919  64.973 6.926  1.00 45.95 ? 274 GLU A OE1 1 
ATOM   566  O  OE2 . GLU A 1 71  ? -3.533  65.223 9.021  1.00 46.84 ? 274 GLU A OE2 1 
ATOM   567  N  N   . ALA A 1 72  ? 1.338   66.970 10.081 1.00 40.37 ? 275 ALA A N   1 
ATOM   568  C  CA  . ALA A 1 72  ? 1.860   66.624 11.394 1.00 39.58 ? 275 ALA A CA  1 
ATOM   569  C  C   . ALA A 1 72  ? 2.767   67.748 11.868 1.00 39.49 ? 275 ALA A C   1 
ATOM   570  O  O   . ALA A 1 72  ? 2.711   68.162 13.023 1.00 39.58 ? 275 ALA A O   1 
ATOM   571  C  CB  . ALA A 1 72  ? 2.630   65.325 11.326 1.00 39.02 ? 275 ALA A CB  1 
ATOM   572  N  N   . ILE A 1 73  ? 3.579   68.257 10.950 1.00 39.81 ? 276 ILE A N   1 
ATOM   573  C  CA  . ILE A 1 73  ? 4.515   69.337 11.237 1.00 40.68 ? 276 ILE A CA  1 
ATOM   574  C  C   . ILE A 1 73  ? 3.771   70.627 11.567 1.00 41.49 ? 276 ILE A C   1 
ATOM   575  O  O   . ILE A 1 73  ? 4.141   71.344 12.497 1.00 41.12 ? 276 ILE A O   1 
ATOM   576  C  CB  . ILE A 1 73  ? 5.485   69.551 10.049 1.00 40.22 ? 276 ILE A CB  1 
ATOM   577  C  CG1 . ILE A 1 73  ? 6.415   68.340 9.933  1.00 39.85 ? 276 ILE A CG1 1 
ATOM   578  C  CG2 . ILE A 1 73  ? 6.292   70.827 10.233 1.00 41.18 ? 276 ILE A CG2 1 
ATOM   579  C  CD1 . ILE A 1 73  ? 7.429   68.424 8.822  1.00 39.75 ? 276 ILE A CD1 1 
ATOM   580  N  N   . SER A 1 74  ? 2.706   70.893 10.815 1.00 42.46 ? 277 SER A N   1 
ATOM   581  C  CA  . SER A 1 74  ? 1.870   72.075 11.011 1.00 43.38 ? 277 SER A CA  1 
ATOM   582  C  C   . SER A 1 74  ? 1.214   72.047 12.405 1.00 43.54 ? 277 SER A C   1 
ATOM   583  O  O   . SER A 1 74  ? 1.108   73.072 13.077 1.00 44.27 ? 277 SER A O   1 
ATOM   584  C  CB  . SER A 1 74  ? 0.801   72.124 9.914  1.00 43.98 ? 277 SER A CB  1 
ATOM   585  O  OG  . SER A 1 74  ? 0.035   73.314 9.978  1.00 46.94 ? 277 SER A OG  1 
ATOM   586  N  N   . PHE A 1 75  ? 0.795   70.860 12.830 1.00 43.27 ? 278 PHE A N   1 
ATOM   587  C  CA  . PHE A 1 75  ? 0.164   70.656 14.129 1.00 42.50 ? 278 PHE A CA  1 
ATOM   588  C  C   . PHE A 1 75  ? 1.189   70.842 15.255 1.00 42.86 ? 278 PHE A C   1 
ATOM   589  O  O   . PHE A 1 75  ? 0.939   71.565 16.220 1.00 43.02 ? 278 PHE A O   1 
ATOM   590  C  CB  . PHE A 1 75  ? -0.436  69.244 14.164 1.00 41.73 ? 278 PHE A CB  1 
ATOM   591  C  CG  . PHE A 1 75  ? -1.154  68.898 15.442 1.00 40.40 ? 278 PHE A CG  1 
ATOM   592  C  CD1 . PHE A 1 75  ? -2.460  69.316 15.659 1.00 40.42 ? 278 PHE A CD1 1 
ATOM   593  C  CD2 . PHE A 1 75  ? -0.542  68.095 16.402 1.00 39.89 ? 278 PHE A CD2 1 
ATOM   594  C  CE1 . PHE A 1 75  ? -3.147  68.930 16.813 1.00 40.51 ? 278 PHE A CE1 1 
ATOM   595  C  CE2 . PHE A 1 75  ? -1.219  67.705 17.557 1.00 39.26 ? 278 PHE A CE2 1 
ATOM   596  C  CZ  . PHE A 1 75  ? -2.519  68.121 17.762 1.00 39.69 ? 278 PHE A CZ  1 
ATOM   597  N  N   . ILE A 1 76  ? 2.342   70.190 15.123 1.00 43.36 ? 279 ILE A N   1 
ATOM   598  C  CA  . ILE A 1 76  ? 3.402   70.281 16.125 1.00 43.73 ? 279 ILE A CA  1 
ATOM   599  C  C   . ILE A 1 76  ? 3.853   71.724 16.267 1.00 45.23 ? 279 ILE A C   1 
ATOM   600  O  O   . ILE A 1 76  ? 4.037   72.221 17.375 1.00 45.33 ? 279 ILE A O   1 
ATOM   601  C  CB  . ILE A 1 76  ? 4.649   69.455 15.721 1.00 42.71 ? 279 ILE A CB  1 
ATOM   602  C  CG1 . ILE A 1 76  ? 4.346   67.961 15.749 1.00 41.59 ? 279 ILE A CG1 1 
ATOM   603  C  CG2 . ILE A 1 76  ? 5.812   69.753 16.655 1.00 42.81 ? 279 ILE A CG2 1 
ATOM   604  C  CD1 . ILE A 1 76  ? 5.555   67.107 15.461 1.00 39.57 ? 279 ILE A CD1 1 
ATOM   605  N  N   . ASP A 1 77  ? 4.026   72.385 15.126 1.00 47.04 ? 280 ASP A N   1 
ATOM   606  C  CA  . ASP A 1 77  ? 4.478   73.766 15.079 1.00 48.69 ? 280 ASP A CA  1 
ATOM   607  C  C   . ASP A 1 77  ? 3.482   74.736 15.692 1.00 50.02 ? 280 ASP A C   1 
ATOM   608  O  O   . ASP A 1 77  ? 3.867   75.650 16.419 1.00 50.33 ? 280 ASP A O   1 
ATOM   609  C  CB  . ASP A 1 77  ? 4.767   74.164 13.636 1.00 49.44 ? 280 ASP A CB  1 
ATOM   610  C  CG  . ASP A 1 77  ? 6.048   74.945 13.497 1.00 50.46 ? 280 ASP A CG  1 
ATOM   611  O  OD1 . ASP A 1 77  ? 6.977   74.730 14.305 1.00 50.54 ? 280 ASP A OD1 1 
ATOM   612  O  OD2 . ASP A 1 77  ? 6.129   75.776 12.573 1.00 51.99 ? 280 ASP A OD2 1 
ATOM   613  N  N   . GLU A 1 78  ? 2.199   74.530 15.410 1.00 51.35 ? 281 GLU A N   1 
ATOM   614  C  CA  . GLU A 1 78  ? 1.159   75.399 15.944 1.00 52.21 ? 281 GLU A CA  1 
ATOM   615  C  C   . GLU A 1 78  ? 1.142   75.321 17.469 1.00 51.40 ? 281 GLU A C   1 
ATOM   616  O  O   . GLU A 1 78  ? 0.876   76.314 18.148 1.00 51.93 ? 281 GLU A O   1 
ATOM   617  C  CB  . GLU A 1 78  ? -0.206  75.004 15.386 1.00 54.69 ? 281 GLU A CB  1 
ATOM   618  C  CG  . GLU A 1 78  ? -1.285  76.055 15.607 1.00 58.61 ? 281 GLU A CG  1 
ATOM   619  C  CD  . GLU A 1 78  ? -2.623  75.444 15.972 1.00 61.07 ? 281 GLU A CD  1 
ATOM   620  O  OE1 . GLU A 1 78  ? -3.150  74.620 15.188 1.00 62.61 ? 281 GLU A OE1 1 
ATOM   621  O  OE2 . GLU A 1 78  ? -3.140  75.778 17.057 1.00 62.55 ? 281 GLU A OE2 1 
ATOM   622  N  N   . ALA A 1 79  ? 1.448   74.140 17.996 1.00 49.98 ? 282 ALA A N   1 
ATOM   623  C  CA  . ALA A 1 79  ? 1.482   73.920 19.435 1.00 49.02 ? 282 ALA A CA  1 
ATOM   624  C  C   . ALA A 1 79  ? 2.683   74.629 20.049 1.00 48.54 ? 282 ALA A C   1 
ATOM   625  O  O   . ALA A 1 79  ? 2.550   75.366 21.024 1.00 47.99 ? 282 ALA A O   1 
ATOM   626  C  CB  . ALA A 1 79  ? 1.551   72.430 19.734 1.00 48.70 ? 282 ALA A CB  1 
ATOM   627  N  N   . ARG A 1 80  ? 3.853   74.408 19.457 1.00 48.02 ? 283 ARG A N   1 
ATOM   628  C  CA  . ARG A 1 80  ? 5.096   75.000 19.935 1.00 47.86 ? 283 ARG A CA  1 
ATOM   629  C  C   . ARG A 1 80  ? 5.099   76.515 19.804 1.00 48.70 ? 283 ARG A C   1 
ATOM   630  O  O   . ARG A 1 80  ? 5.708   77.209 20.621 1.00 48.17 ? 283 ARG A O   1 
ATOM   631  C  CB  . ARG A 1 80  ? 6.284   74.409 19.181 1.00 46.81 ? 283 ARG A CB  1 
ATOM   632  C  CG  . ARG A 1 80  ? 6.366   72.901 19.259 1.00 45.62 ? 283 ARG A CG  1 
ATOM   633  C  CD  . ARG A 1 80  ? 7.660   72.397 18.681 1.00 44.85 ? 283 ARG A CD  1 
ATOM   634  N  NE  . ARG A 1 80  ? 8.797   72.701 19.544 1.00 44.83 ? 283 ARG A NE  1 
ATOM   635  C  CZ  . ARG A 1 80  ? 9.869   73.392 19.165 1.00 44.46 ? 283 ARG A CZ  1 
ATOM   636  N  NH1 . ARG A 1 80  ? 9.961   73.870 17.931 1.00 43.56 ? 283 ARG A NH1 1 
ATOM   637  N  NH2 . ARG A 1 80  ? 10.869  73.579 20.016 1.00 44.40 ? 283 ARG A NH2 1 
ATOM   638  N  N   . GLY A 1 81  ? 4.414   77.012 18.774 1.00 49.81 ? 284 GLY A N   1 
ATOM   639  C  CA  . GLY A 1 81  ? 4.320   78.441 18.543 1.00 50.77 ? 284 GLY A CA  1 
ATOM   640  C  C   . GLY A 1 81  ? 3.586   79.107 19.690 1.00 52.13 ? 284 GLY A C   1 
ATOM   641  O  O   . GLY A 1 81  ? 3.995   80.163 20.162 1.00 53.34 ? 284 GLY A O   1 
ATOM   642  N  N   . LYS A 1 82  ? 2.526   78.464 20.168 1.00 52.67 ? 285 LYS A N   1 
ATOM   643  C  CA  . LYS A 1 82  ? 1.726   78.980 21.276 1.00 52.94 ? 285 LYS A CA  1 
ATOM   644  C  C   . LYS A 1 82  ? 2.327   78.606 22.630 1.00 52.57 ? 285 LYS A C   1 
ATOM   645  O  O   . LYS A 1 82  ? 1.678   78.754 23.661 1.00 52.93 ? 285 LYS A O   1 
ATOM   646  C  CB  . LYS A 1 82  ? 0.301   78.428 21.191 1.00 53.94 ? 285 LYS A CB  1 
ATOM   647  C  CG  . LYS A 1 82  ? -0.449  78.828 19.931 1.00 56.78 ? 285 LYS A CG  1 
ATOM   648  C  CD  . LYS A 1 82  ? -1.807  78.120 19.852 1.00 57.36 ? 285 LYS A CD  1 
ATOM   649  C  CE  . LYS A 1 82  ? -2.839  78.958 19.021 1.00 59.61 ? 285 LYS A CE  1 
ATOM   650  N  NZ  . LYS A 1 82  ? -3.125  78.459 17.608 1.00 58.74 ? 285 LYS A NZ  1 
ATOM   651  N  N   . ASN A 1 83  ? 3.567   78.124 22.623 1.00 52.39 ? 286 ASN A N   1 
ATOM   652  C  CA  . ASN A 1 83  ? 4.252   77.707 23.845 1.00 52.19 ? 286 ASN A CA  1 
ATOM   653  C  C   . ASN A 1 83  ? 3.502   76.618 24.607 1.00 52.01 ? 286 ASN A C   1 
ATOM   654  O  O   . ASN A 1 83  ? 3.479   76.603 25.841 1.00 51.16 ? 286 ASN A O   1 
ATOM   655  C  CB  . ASN A 1 83  ? 4.535   78.905 24.747 1.00 53.22 ? 286 ASN A CB  1 
ATOM   656  C  CG  . ASN A 1 83  ? 5.790   79.653 24.340 1.00 54.90 ? 286 ASN A CG  1 
ATOM   657  O  OD1 . ASN A 1 83  ? 6.623   79.979 25.182 1.00 56.11 ? 286 ASN A OD1 1 
ATOM   658  N  ND2 . ASN A 1 83  ? 5.943   79.912 23.044 1.00 54.82 ? 286 ASN A ND2 1 
ATOM   659  N  N   . CYS A 1 84  ? 2.907   75.701 23.845 1.00 51.65 ? 287 CYS A N   1 
ATOM   660  C  CA  . CYS A 1 84  ? 2.150   74.576 24.382 1.00 50.78 ? 287 CYS A CA  1 
ATOM   661  C  C   . CYS A 1 84  ? 2.815   73.271 24.000 1.00 48.86 ? 287 CYS A C   1 
ATOM   662  O  O   . CYS A 1 84  ? 3.182   73.067 22.843 1.00 47.97 ? 287 CYS A O   1 
ATOM   663  C  CB  . CYS A 1 84  ? 0.731   74.565 23.823 1.00 52.09 ? 287 CYS A CB  1 
ATOM   664  S  SG  . CYS A 1 84  ? -0.332  75.826 24.502 1.00 57.50 ? 287 CYS A SG  1 
ATOM   665  N  N   . GLY A 1 85  ? 2.944   72.379 24.973 1.00 47.36 ? 288 GLY A N   1 
ATOM   666  C  CA  . GLY A 1 85  ? 3.547   71.088 24.710 1.00 45.40 ? 288 GLY A CA  1 
ATOM   667  C  C   . GLY A 1 85  ? 2.702   70.242 23.775 1.00 43.79 ? 288 GLY A C   1 
ATOM   668  O  O   . GLY A 1 85  ? 1.467   70.248 23.848 1.00 43.41 ? 288 GLY A O   1 
ATOM   669  N  N   . VAL A 1 86  ? 3.370   69.567 22.847 1.00 42.33 ? 289 VAL A N   1 
ATOM   670  C  CA  . VAL A 1 86  ? 2.699   68.686 21.898 1.00 40.73 ? 289 VAL A CA  1 
ATOM   671  C  C   . VAL A 1 86  ? 3.337   67.314 22.069 1.00 40.03 ? 289 VAL A C   1 
ATOM   672  O  O   . VAL A 1 86  ? 4.548   67.214 22.273 1.00 39.75 ? 289 VAL A O   1 
ATOM   673  C  CB  . VAL A 1 86  ? 2.838   69.179 20.432 1.00 40.23 ? 289 VAL A CB  1 
ATOM   674  C  CG1 . VAL A 1 86  ? 4.292   69.262 20.026 1.00 39.25 ? 289 VAL A CG1 1 
ATOM   675  C  CG2 . VAL A 1 86  ? 2.072   68.260 19.492 1.00 39.40 ? 289 VAL A CG2 1 
ATOM   676  N  N   . LEU A 1 87  ? 2.513   66.269 22.063 1.00 39.04 ? 290 LEU A N   1 
ATOM   677  C  CA  . LEU A 1 87  ? 3.003   64.904 22.230 1.00 37.56 ? 290 LEU A CA  1 
ATOM   678  C  C   . LEU A 1 87  ? 2.784   64.067 20.987 1.00 37.79 ? 290 LEU A C   1 
ATOM   679  O  O   . LEU A 1 87  ? 1.683   64.024 20.447 1.00 38.01 ? 290 LEU A O   1 
ATOM   680  C  CB  . LEU A 1 87  ? 2.312   64.219 23.417 1.00 35.48 ? 290 LEU A CB  1 
ATOM   681  C  CG  . LEU A 1 87  ? 2.600   62.729 23.646 1.00 33.66 ? 290 LEU A CG  1 
ATOM   682  C  CD1 . LEU A 1 87  ? 4.061   62.510 24.002 1.00 32.19 ? 290 LEU A CD1 1 
ATOM   683  C  CD2 . LEU A 1 87  ? 1.709   62.188 24.745 1.00 32.44 ? 290 LEU A CD2 1 
ATOM   684  N  N   . VAL A 1 88  ? 3.850   63.433 20.514 1.00 37.78 ? 291 VAL A N   1 
ATOM   685  C  CA  . VAL A 1 88  ? 3.760   62.549 19.361 1.00 37.16 ? 291 VAL A CA  1 
ATOM   686  C  C   . VAL A 1 88  ? 3.817   61.165 20.000 1.00 37.54 ? 291 VAL A C   1 
ATOM   687  O  O   . VAL A 1 88  ? 4.793   60.824 20.675 1.00 37.42 ? 291 VAL A O   1 
ATOM   688  C  CB  . VAL A 1 88  ? 4.929   62.753 18.383 1.00 35.94 ? 291 VAL A CB  1 
ATOM   689  C  CG1 . VAL A 1 88  ? 4.748   61.858 17.179 1.00 34.41 ? 291 VAL A CG1 1 
ATOM   690  C  CG2 . VAL A 1 88  ? 4.995   64.213 17.952 1.00 34.17 ? 291 VAL A CG2 1 
ATOM   691  N  N   . HIS A 1 89  ? 2.757   60.387 19.824 1.00 37.44 ? 292 HIS A N   1 
ATOM   692  C  CA  . HIS A 1 89  ? 2.700   59.079 20.450 1.00 38.52 ? 292 HIS A CA  1 
ATOM   693  C  C   . HIS A 1 89  ? 2.052   58.025 19.563 1.00 37.96 ? 292 HIS A C   1 
ATOM   694  O  O   . HIS A 1 89  ? 1.229   58.340 18.705 1.00 37.14 ? 292 HIS A O   1 
ATOM   695  C  CB  . HIS A 1 89  ? 1.910   59.206 21.765 1.00 41.28 ? 292 HIS A CB  1 
ATOM   696  C  CG  . HIS A 1 89  ? 2.035   58.024 22.681 1.00 44.32 ? 292 HIS A CG  1 
ATOM   697  N  ND1 . HIS A 1 89  ? 1.197   56.932 22.608 1.00 45.57 ? 292 HIS A ND1 1 
ATOM   698  C  CD2 . HIS A 1 89  ? 2.886   57.777 23.706 1.00 44.96 ? 292 HIS A CD2 1 
ATOM   699  C  CE1 . HIS A 1 89  ? 1.524   56.062 23.548 1.00 45.69 ? 292 HIS A CE1 1 
ATOM   700  N  NE2 . HIS A 1 89  ? 2.546   56.550 24.228 1.00 45.96 ? 292 HIS A NE2 1 
ATOM   701  N  N   . SER A 1 90  ? 2.458   56.775 19.780 1.00 37.89 ? 293 SER A N   1 
ATOM   702  C  CA  . SER A 1 90  ? 1.926   55.618 19.075 1.00 37.22 ? 293 SER A CA  1 
ATOM   703  C  C   . SER A 1 90  ? 1.902   54.478 20.075 1.00 37.49 ? 293 SER A C   1 
ATOM   704  O  O   . SER A 1 90  ? 2.857   54.281 20.827 1.00 37.09 ? 293 SER A O   1 
ATOM   705  C  CB  . SER A 1 90  ? 2.802   55.230 17.885 1.00 37.14 ? 293 SER A CB  1 
ATOM   706  O  OG  . SER A 1 90  ? 2.407   53.969 17.361 1.00 35.84 ? 293 SER A OG  1 
ATOM   707  N  N   . LEU A 1 91  ? 0.785   53.767 20.120 1.00 38.19 ? 294 LEU A N   1 
ATOM   708  C  CA  . LEU A 1 91  ? 0.631   52.628 21.017 1.00 39.05 ? 294 LEU A CA  1 
ATOM   709  C  C   . LEU A 1 91  ? 1.341   51.401 20.454 1.00 39.22 ? 294 LEU A C   1 
ATOM   710  O  O   . LEU A 1 91  ? 1.619   50.453 21.186 1.00 39.41 ? 294 LEU A O   1 
ATOM   711  C  CB  . LEU A 1 91  ? -0.848  52.296 21.185 1.00 39.69 ? 294 LEU A CB  1 
ATOM   712  C  CG  . LEU A 1 91  ? -1.663  53.051 22.222 1.00 40.86 ? 294 LEU A CG  1 
ATOM   713  C  CD1 . LEU A 1 91  ? -3.135  52.823 21.960 1.00 42.46 ? 294 LEU A CD1 1 
ATOM   714  C  CD2 . LEU A 1 91  ? -1.287  52.564 23.605 1.00 41.02 ? 294 LEU A CD2 1 
ATOM   715  N  N   . ALA A 1 92  ? 1.638   51.437 19.155 1.00 39.06 ? 295 ALA A N   1 
ATOM   716  C  CA  . ALA A 1 92  ? 2.274   50.326 18.455 1.00 39.17 ? 295 ALA A CA  1 
ATOM   717  C  C   . ALA A 1 92  ? 3.791   50.208 18.564 1.00 39.48 ? 295 ALA A C   1 
ATOM   718  O  O   . ALA A 1 92  ? 4.365   49.196 18.180 1.00 40.57 ? 295 ALA A O   1 
ATOM   719  C  CB  . ALA A 1 92  ? 1.864   50.346 16.991 1.00 38.93 ? 295 ALA A CB  1 
ATOM   720  N  N   . GLY A 1 93  ? 4.448   51.241 19.062 1.00 39.96 ? 296 GLY A N   1 
ATOM   721  C  CA  . GLY A 1 93  ? 5.891   51.187 19.166 1.00 39.81 ? 296 GLY A CA  1 
ATOM   722  C  C   . GLY A 1 93  ? 6.447   52.587 19.112 1.00 39.43 ? 296 GLY A C   1 
ATOM   723  O  O   . GLY A 1 93  ? 5.706   53.553 19.294 1.00 40.82 ? 296 GLY A O   1 
ATOM   724  N  N   . ILE A 1 94  ? 7.736   52.711 18.825 1.00 38.39 ? 297 ILE A N   1 
ATOM   725  C  CA  . ILE A 1 94  ? 8.363   54.023 18.776 1.00 37.11 ? 297 ILE A CA  1 
ATOM   726  C  C   . ILE A 1 94  ? 8.653   54.495 17.357 1.00 37.02 ? 297 ILE A C   1 
ATOM   727  O  O   . ILE A 1 94  ? 8.835   55.682 17.123 1.00 37.73 ? 297 ILE A O   1 
ATOM   728  C  CB  . ILE A 1 94  ? 9.684   54.027 19.585 1.00 36.27 ? 297 ILE A CB  1 
ATOM   729  C  CG1 . ILE A 1 94  ? 10.119  55.459 19.899 1.00 35.37 ? 297 ILE A CG1 1 
ATOM   730  C  CG2 . ILE A 1 94  ? 10.778  53.312 18.808 1.00 34.85 ? 297 ILE A CG2 1 
ATOM   731  C  CD1 . ILE A 1 94  ? 9.115   56.250 20.714 1.00 34.89 ? 297 ILE A CD1 1 
ATOM   732  N  N   . SER A 1 95  ? 8.630   53.573 16.406 1.00 36.01 ? 298 SER A N   1 
ATOM   733  C  CA  . SER A 1 95  ? 8.948   53.893 15.024 1.00 35.06 ? 298 SER A CA  1 
ATOM   734  C  C   . SER A 1 95  ? 8.193   55.027 14.323 1.00 35.44 ? 298 SER A C   1 
ATOM   735  O  O   . SER A 1 95  ? 8.817   55.943 13.790 1.00 35.65 ? 298 SER A O   1 
ATOM   736  C  CB  . SER A 1 95  ? 8.915   52.622 14.188 1.00 34.40 ? 298 SER A CB  1 
ATOM   737  O  OG  . SER A 1 95  ? 9.875   51.707 14.677 1.00 33.16 ? 298 SER A OG  1 
ATOM   738  N  N   . ARG A 1 96  ? 6.866   54.973 14.297 1.00 34.95 ? 299 ARG A N   1 
ATOM   739  C  CA  . ARG A 1 96  ? 6.106   56.021 13.626 1.00 33.76 ? 299 ARG A CA  1 
ATOM   740  C  C   . ARG A 1 96  ? 6.196   57.365 14.327 1.00 33.53 ? 299 ARG A C   1 
ATOM   741  O  O   . ARG A 1 96  ? 6.220   58.407 13.678 1.00 33.54 ? 299 ARG A O   1 
ATOM   742  C  CB  . ARG A 1 96  ? 4.650   55.616 13.467 1.00 34.01 ? 299 ARG A CB  1 
ATOM   743  C  CG  . ARG A 1 96  ? 4.452   54.477 12.508 1.00 34.37 ? 299 ARG A CG  1 
ATOM   744  C  CD  . ARG A 1 96  ? 2.984   54.188 12.311 1.00 35.23 ? 299 ARG A CD  1 
ATOM   745  N  NE  . ARG A 1 96  ? 2.785   53.144 11.313 1.00 36.79 ? 299 ARG A NE  1 
ATOM   746  C  CZ  . ARG A 1 96  ? 2.802   51.842 11.578 1.00 37.24 ? 299 ARG A CZ  1 
ATOM   747  N  NH1 . ARG A 1 96  ? 3.004   51.413 12.823 1.00 36.23 ? 299 ARG A NH1 1 
ATOM   748  N  NH2 . ARG A 1 96  ? 2.639   50.970 10.589 1.00 37.15 ? 299 ARG A NH2 1 
ATOM   749  N  N   . SER A 1 97  ? 6.223   57.347 15.652 1.00 32.90 ? 300 SER A N   1 
ATOM   750  C  CA  . SER A 1 97  ? 6.316   58.587 16.398 1.00 31.98 ? 300 SER A CA  1 
ATOM   751  C  C   . SER A 1 97  ? 7.693   59.239 16.214 1.00 31.35 ? 300 SER A C   1 
ATOM   752  O  O   . SER A 1 97  ? 7.775   60.413 15.858 1.00 31.34 ? 300 SER A O   1 
ATOM   753  C  CB  . SER A 1 97  ? 5.959   58.362 17.869 1.00 31.36 ? 300 SER A CB  1 
ATOM   754  O  OG  . SER A 1 97  ? 6.546   57.173 18.363 1.00 34.15 ? 300 SER A OG  1 
ATOM   755  N  N   . VAL A 1 98  ? 8.771   58.478 16.384 1.00 30.40 ? 301 VAL A N   1 
ATOM   756  C  CA  . VAL A 1 98  ? 10.104  59.045 16.201 1.00 30.15 ? 301 VAL A CA  1 
ATOM   757  C  C   . VAL A 1 98  ? 10.320  59.474 14.751 1.00 29.66 ? 301 VAL A C   1 
ATOM   758  O  O   . VAL A 1 98  ? 11.076  60.398 14.486 1.00 31.21 ? 301 VAL A O   1 
ATOM   759  C  CB  . VAL A 1 98  ? 11.246  58.081 16.657 1.00 30.61 ? 301 VAL A CB  1 
ATOM   760  C  CG1 . VAL A 1 98  ? 11.338  56.861 15.749 1.00 32.30 ? 301 VAL A CG1 1 
ATOM   761  C  CG2 . VAL A 1 98  ? 12.581  58.816 16.671 1.00 30.47 ? 301 VAL A CG2 1 
ATOM   762  N  N   . THR A 1 99  ? 9.638   58.825 13.815 1.00 28.74 ? 302 THR A N   1 
ATOM   763  C  CA  . THR A 1 99  ? 9.768   59.179 12.409 1.00 27.52 ? 302 THR A CA  1 
ATOM   764  C  C   . THR A 1 99  ? 9.121   60.537 12.169 1.00 27.87 ? 302 THR A C   1 
ATOM   765  O  O   . THR A 1 99  ? 9.666   61.371 11.454 1.00 29.10 ? 302 THR A O   1 
ATOM   766  C  CB  . THR A 1 99  ? 9.119   58.118 11.504 1.00 27.18 ? 302 THR A CB  1 
ATOM   767  O  OG1 . THR A 1 99  ? 9.888   56.914 11.570 1.00 28.04 ? 302 THR A OG1 1 
ATOM   768  C  CG2 . THR A 1 99  ? 9.052   58.585 10.057 1.00 25.57 ? 302 THR A CG2 1 
ATOM   769  N  N   . VAL A 1 100 ? 7.964   60.769 12.777 1.00 27.57 ? 303 VAL A N   1 
ATOM   770  C  CA  . VAL A 1 100 ? 7.284   62.045 12.619 1.00 27.23 ? 303 VAL A CA  1 
ATOM   771  C  C   . VAL A 1 100 ? 8.089   63.131 13.315 1.00 27.81 ? 303 VAL A C   1 
ATOM   772  O  O   . VAL A 1 100 ? 8.180   64.257 12.834 1.00 28.20 ? 303 VAL A O   1 
ATOM   773  C  CB  . VAL A 1 100 ? 5.866   61.987 13.189 1.00 26.79 ? 303 VAL A CB  1 
ATOM   774  C  CG1 . VAL A 1 100 ? 5.257   63.373 13.234 1.00 26.43 ? 303 VAL A CG1 1 
ATOM   775  C  CG2 . VAL A 1 100 ? 5.017   61.083 12.319 1.00 26.22 ? 303 VAL A CG2 1 
ATOM   776  N  N   . THR A 1 101 ? 8.706   62.770 14.434 1.00 28.35 ? 304 THR A N   1 
ATOM   777  C  CA  . THR A 1 101 ? 9.526   63.698 15.205 1.00 28.71 ? 304 THR A CA  1 
ATOM   778  C  C   . THR A 1 101 ? 10.766  64.098 14.399 1.00 29.38 ? 304 THR A C   1 
ATOM   779  O  O   . THR A 1 101 ? 11.069  65.284 14.268 1.00 30.06 ? 304 THR A O   1 
ATOM   780  C  CB  . THR A 1 101 ? 9.933   63.064 16.547 1.00 28.29 ? 304 THR A CB  1 
ATOM   781  O  OG1 . THR A 1 101 ? 8.753   62.757 17.295 1.00 28.30 ? 304 THR A OG1 1 
ATOM   782  C  CG2 . THR A 1 101 ? 10.795  64.003 17.363 1.00 27.90 ? 304 THR A CG2 1 
ATOM   783  N  N   . VAL A 1 102 ? 11.455  63.109 13.831 1.00 29.98 ? 305 VAL A N   1 
ATOM   784  C  CA  . VAL A 1 102 ? 12.643  63.361 13.017 1.00 30.33 ? 305 VAL A CA  1 
ATOM   785  C  C   . VAL A 1 102 ? 12.281  64.238 11.809 1.00 31.51 ? 305 VAL A C   1 
ATOM   786  O  O   . VAL A 1 102 ? 12.999  65.190 11.485 1.00 32.54 ? 305 VAL A O   1 
ATOM   787  C  CB  . VAL A 1 102 ? 13.297  62.034 12.537 1.00 28.90 ? 305 VAL A CB  1 
ATOM   788  C  CG1 . VAL A 1 102 ? 14.356  62.307 11.475 1.00 27.02 ? 305 VAL A CG1 1 
ATOM   789  C  CG2 . VAL A 1 102 ? 13.935  61.317 13.710 1.00 27.99 ? 305 VAL A CG2 1 
ATOM   790  N  N   . ALA A 1 103 ? 11.149  63.947 11.172 1.00 31.59 ? 306 ALA A N   1 
ATOM   791  C  CA  . ALA A 1 103 ? 10.714  64.725 10.019 1.00 31.88 ? 306 ALA A CA  1 
ATOM   792  C  C   . ALA A 1 103 ? 10.552  66.185 10.431 1.00 32.97 ? 306 ALA A C   1 
ATOM   793  O  O   . ALA A 1 103 ? 11.005  67.097 9.733  1.00 33.83 ? 306 ALA A O   1 
ATOM   794  C  CB  . ALA A 1 103 ? 9.410   64.178 9.473  1.00 30.21 ? 306 ALA A CB  1 
ATOM   795  N  N   . TYR A 1 104 ? 9.945   66.400 11.594 1.00 33.59 ? 307 TYR A N   1 
ATOM   796  C  CA  . TYR A 1 104 ? 9.740   67.750 12.095 1.00 33.37 ? 307 TYR A CA  1 
ATOM   797  C  C   . TYR A 1 104 ? 11.075  68.457 12.303 1.00 33.62 ? 307 TYR A C   1 
ATOM   798  O  O   . TYR A 1 104 ? 11.238  69.598 11.891 1.00 33.99 ? 307 TYR A O   1 
ATOM   799  C  CB  . TYR A 1 104 ? 8.940   67.736 13.396 1.00 32.35 ? 307 TYR A CB  1 
ATOM   800  C  CG  . TYR A 1 104 ? 8.791   69.112 13.997 1.00 32.04 ? 307 TYR A CG  1 
ATOM   801  C  CD1 . TYR A 1 104 ? 7.818   69.996 13.537 1.00 31.80 ? 307 TYR A CD1 1 
ATOM   802  C  CD2 . TYR A 1 104 ? 9.664   69.551 14.991 1.00 31.49 ? 307 TYR A CD2 1 
ATOM   803  C  CE1 . TYR A 1 104 ? 7.726   71.287 14.052 1.00 32.94 ? 307 TYR A CE1 1 
ATOM   804  C  CE2 . TYR A 1 104 ? 9.583   70.831 15.507 1.00 31.63 ? 307 TYR A CE2 1 
ATOM   805  C  CZ  . TYR A 1 104 ? 8.618   71.694 15.036 1.00 32.80 ? 307 TYR A CZ  1 
ATOM   806  O  OH  . TYR A 1 104 ? 8.568   72.971 15.539 1.00 35.40 ? 307 TYR A OH  1 
ATOM   807  N  N   . LEU A 1 105 ? 12.027  67.773 12.934 1.00 34.08 ? 308 LEU A N   1 
ATOM   808  C  CA  . LEU A 1 105 ? 13.345  68.349 13.177 1.00 34.71 ? 308 LEU A CA  1 
ATOM   809  C  C   . LEU A 1 105 ? 14.055  68.664 11.864 1.00 35.53 ? 308 LEU A C   1 
ATOM   810  O  O   . LEU A 1 105 ? 14.721  69.687 11.737 1.00 35.80 ? 308 LEU A O   1 
ATOM   811  C  CB  . LEU A 1 105 ? 14.213  67.394 13.994 1.00 34.39 ? 308 LEU A CB  1 
ATOM   812  C  CG  . LEU A 1 105 ? 13.776  67.035 15.413 1.00 35.33 ? 308 LEU A CG  1 
ATOM   813  C  CD1 . LEU A 1 105 ? 14.862  66.212 16.074 1.00 35.69 ? 308 LEU A CD1 1 
ATOM   814  C  CD2 . LEU A 1 105 ? 13.537  68.280 16.213 1.00 35.07 ? 308 LEU A CD2 1 
ATOM   815  N  N   . MET A 1 106 ? 13.904  67.781 10.886 1.00 35.77 ? 309 MET A N   1 
ATOM   816  C  CA  . MET A 1 106 ? 14.537  67.971 9.596  1.00 35.43 ? 309 MET A CA  1 
ATOM   817  C  C   . MET A 1 106 ? 14.078  69.257 8.957  1.00 36.06 ? 309 MET A C   1 
ATOM   818  O  O   . MET A 1 106 ? 14.894  70.065 8.534  1.00 36.62 ? 309 MET A O   1 
ATOM   819  C  CB  . MET A 1 106 ? 14.213  66.808 8.673  1.00 34.55 ? 309 MET A CB  1 
ATOM   820  C  CG  . MET A 1 106 ? 14.916  65.533 9.035  1.00 33.74 ? 309 MET A CG  1 
ATOM   821  S  SD  . MET A 1 106 ? 14.273  64.195 8.063  1.00 34.24 ? 309 MET A SD  1 
ATOM   822  C  CE  . MET A 1 106 ? 14.831  64.624 6.479  1.00 33.16 ? 309 MET A CE  1 
ATOM   823  N  N   . GLN A 1 107 ? 12.770  69.466 8.919  1.00 36.88 ? 310 GLN A N   1 
ATOM   824  C  CA  . GLN A 1 107 ? 12.229  70.665 8.300  1.00 38.35 ? 310 GLN A CA  1 
ATOM   825  C  C   . GLN A 1 107 ? 12.436  71.942 9.104  1.00 39.49 ? 310 GLN A C   1 
ATOM   826  O  O   . GLN A 1 107 ? 12.921  72.942 8.578  1.00 40.07 ? 310 GLN A O   1 
ATOM   827  C  CB  . GLN A 1 107 ? 10.751  70.475 8.013  1.00 38.74 ? 310 GLN A CB  1 
ATOM   828  C  CG  . GLN A 1 107 ? 10.135  71.619 7.259  1.00 39.13 ? 310 GLN A CG  1 
ATOM   829  C  CD  . GLN A 1 107 ? 8.862   71.206 6.574  1.00 41.06 ? 310 GLN A CD  1 
ATOM   830  O  OE1 . GLN A 1 107 ? 7.797   71.764 6.835  1.00 42.19 ? 310 GLN A OE1 1 
ATOM   831  N  NE2 . GLN A 1 107 ? 8.957   70.208 5.693  1.00 41.24 ? 310 GLN A NE2 1 
ATOM   832  N  N   . LYS A 1 108 ? 12.060  71.900 10.377 1.00 40.27 ? 311 LYS A N   1 
ATOM   833  C  CA  . LYS A 1 108 ? 12.181  73.044 11.271 1.00 40.43 ? 311 LYS A CA  1 
ATOM   834  C  C   . LYS A 1 108 ? 13.617  73.524 11.468 1.00 40.01 ? 311 LYS A C   1 
ATOM   835  O  O   . LYS A 1 108 ? 13.886  74.721 11.399 1.00 40.19 ? 311 LYS A O   1 
ATOM   836  C  CB  . LYS A 1 108 ? 11.565  72.708 12.628 1.00 41.13 ? 311 LYS A CB  1 
ATOM   837  C  CG  . LYS A 1 108 ? 11.579  73.850 13.624 1.00 43.01 ? 311 LYS A CG  1 
ATOM   838  C  CD  . LYS A 1 108 ? 10.647  74.972 13.195 1.00 44.19 ? 311 LYS A CD  1 
ATOM   839  C  CE  . LYS A 1 108 ? 10.586  76.069 14.248 1.00 44.57 ? 311 LYS A CE  1 
ATOM   840  N  NZ  . LYS A 1 108 ? 9.602   77.111 13.862 1.00 45.75 ? 311 LYS A NZ  1 
ATOM   841  N  N   . LEU A 1 109 ? 14.529  72.596 11.736 1.00 39.53 ? 312 LEU A N   1 
ATOM   842  C  CA  . LEU A 1 109 ? 15.932  72.943 11.958 1.00 39.57 ? 312 LEU A CA  1 
ATOM   843  C  C   . LEU A 1 109 ? 16.800  72.871 10.700 1.00 40.03 ? 312 LEU A C   1 
ATOM   844  O  O   . LEU A 1 109 ? 18.003  73.148 10.745 1.00 39.86 ? 312 LEU A O   1 
ATOM   845  C  CB  . LEU A 1 109 ? 16.533  72.063 13.059 1.00 38.30 ? 312 LEU A CB  1 
ATOM   846  C  CG  . LEU A 1 109 ? 15.832  72.100 14.417 1.00 36.92 ? 312 LEU A CG  1 
ATOM   847  C  CD1 . LEU A 1 109 ? 16.553  71.186 15.375 1.00 35.99 ? 312 LEU A CD1 1 
ATOM   848  C  CD2 . LEU A 1 109 ? 15.795  73.513 14.957 1.00 36.11 ? 312 LEU A CD2 1 
ATOM   849  N  N   . ASN A 1 110 ? 16.183  72.519 9.577  1.00 40.93 ? 313 ASN A N   1 
ATOM   850  C  CA  . ASN A 1 110 ? 16.898  72.415 8.315  1.00 41.63 ? 313 ASN A CA  1 
ATOM   851  C  C   . ASN A 1 110 ? 18.033  71.414 8.428  1.00 41.31 ? 313 ASN A C   1 
ATOM   852  O  O   . ASN A 1 110 ? 19.184  71.724 8.118  1.00 41.84 ? 313 ASN A O   1 
ATOM   853  C  CB  . ASN A 1 110 ? 17.448  73.777 7.915  1.00 44.20 ? 313 ASN A CB  1 
ATOM   854  C  CG  . ASN A 1 110 ? 16.986  74.191 6.555  1.00 46.96 ? 313 ASN A CG  1 
ATOM   855  O  OD1 . ASN A 1 110 ? 17.305  73.536 5.565  1.00 47.69 ? 313 ASN A OD1 1 
ATOM   856  N  ND2 . ASN A 1 110 ? 16.186  75.257 6.492  1.00 48.72 ? 313 ASN A ND2 1 
ATOM   857  N  N   . LEU A 1 111 ? 17.697  70.209 8.875  1.00 40.49 ? 314 LEU A N   1 
ATOM   858  C  CA  . LEU A 1 111 ? 18.679  69.154 9.061  1.00 39.96 ? 314 LEU A CA  1 
ATOM   859  C  C   . LEU A 1 111 ? 18.425  67.959 8.181  1.00 39.87 ? 314 LEU A C   1 
ATOM   860  O  O   . LEU A 1 111 ? 17.310  67.732 7.721  1.00 40.46 ? 314 LEU A O   1 
ATOM   861  C  CB  . LEU A 1 111 ? 18.639  68.658 10.498 1.00 40.36 ? 314 LEU A CB  1 
ATOM   862  C  CG  . LEU A 1 111 ? 19.026  69.628 11.596 1.00 41.06 ? 314 LEU A CG  1 
ATOM   863  C  CD1 . LEU A 1 111 ? 18.670  69.002 12.916 1.00 41.30 ? 314 LEU A CD1 1 
ATOM   864  C  CD2 . LEU A 1 111 ? 20.514  69.937 11.516 1.00 41.61 ? 314 LEU A CD2 1 
ATOM   865  N  N   . SER A 1 112 ? 19.469  67.168 7.990  1.00 39.34 ? 315 SER A N   1 
ATOM   866  C  CA  . SER A 1 112 ? 19.360  65.953 7.215  1.00 39.26 ? 315 SER A CA  1 
ATOM   867  C  C   . SER A 1 112 ? 18.731  64.936 8.165  1.00 40.08 ? 315 SER A C   1 
ATOM   868  O  O   . SER A 1 112 ? 18.698  65.150 9.382  1.00 41.59 ? 315 SER A O   1 
ATOM   869  C  CB  . SER A 1 112 ? 20.751  65.467 6.807  1.00 38.83 ? 315 SER A CB  1 
ATOM   870  O  OG  . SER A 1 112 ? 21.512  65.070 7.939  1.00 37.80 ? 315 SER A OG  1 
ATOM   871  N  N   . MET A 1 113 ? 18.240  63.832 7.616  1.00 39.46 ? 316 MET A N   1 
ATOM   872  C  CA  . MET A 1 113 ? 17.641  62.783 8.420  1.00 39.01 ? 316 MET A CA  1 
ATOM   873  C  C   . MET A 1 113 ? 18.607  62.312 9.501  1.00 38.83 ? 316 MET A C   1 
ATOM   874  O  O   . MET A 1 113 ? 18.222  62.164 10.658 1.00 38.54 ? 316 MET A O   1 
ATOM   875  C  CB  . MET A 1 113 ? 17.262  61.592 7.545  1.00 39.77 ? 316 MET A CB  1 
ATOM   876  C  CG  . MET A 1 113 ? 16.829  60.384 8.347  1.00 39.95 ? 316 MET A CG  1 
ATOM   877  S  SD  . MET A 1 113 ? 16.775  58.882 7.396  1.00 41.45 ? 316 MET A SD  1 
ATOM   878  C  CE  . MET A 1 113 ? 18.505  58.705 6.938  1.00 39.46 ? 316 MET A CE  1 
ATOM   879  N  N   . ASN A 1 114 ? 19.859  62.078 9.121  1.00 38.48 ? 317 ASN A N   1 
ATOM   880  C  CA  . ASN A 1 114 ? 20.860  61.613 10.073 1.00 39.10 ? 317 ASN A CA  1 
ATOM   881  C  C   . ASN A 1 114 ? 21.152  62.599 11.189 1.00 38.83 ? 317 ASN A C   1 
ATOM   882  O  O   . ASN A 1 114 ? 21.295  62.204 12.345 1.00 39.22 ? 317 ASN A O   1 
ATOM   883  C  CB  . ASN A 1 114 ? 22.145  61.229 9.357  1.00 40.29 ? 317 ASN A CB  1 
ATOM   884  C  CG  . ASN A 1 114 ? 22.025  59.908 8.635  1.00 41.52 ? 317 ASN A CG  1 
ATOM   885  O  OD1 . ASN A 1 114 ? 21.292  59.019 9.068  1.00 42.56 ? 317 ASN A OD1 1 
ATOM   886  N  ND2 . ASN A 1 114 ? 22.745  59.769 7.530  1.00 42.07 ? 317 ASN A ND2 1 
ATOM   887  N  N   . ASP A 1 115 ? 21.238  63.878 10.847 1.00 38.31 ? 318 ASP A N   1 
ATOM   888  C  CA  . ASP A 1 115 ? 21.493  64.903 11.848 1.00 37.99 ? 318 ASP A CA  1 
ATOM   889  C  C   . ASP A 1 115 ? 20.304  65.036 12.794 1.00 37.11 ? 318 ASP A C   1 
ATOM   890  O  O   . ASP A 1 115 ? 20.475  65.066 14.012 1.00 36.75 ? 318 ASP A O   1 
ATOM   891  C  CB  . ASP A 1 115 ? 21.805  66.241 11.174 1.00 38.75 ? 318 ASP A CB  1 
ATOM   892  C  CG  . ASP A 1 115 ? 23.209  66.283 10.589 1.00 39.71 ? 318 ASP A CG  1 
ATOM   893  O  OD1 . ASP A 1 115 ? 24.066  65.471 11.021 1.00 39.41 ? 318 ASP A OD1 1 
ATOM   894  O  OD2 . ASP A 1 115 ? 23.459  67.128 9.705  1.00 39.53 ? 318 ASP A OD2 1 
ATOM   895  N  N   . ALA A 1 116 ? 19.101  65.063 12.227 1.00 36.34 ? 319 ALA A N   1 
ATOM   896  C  CA  . ALA A 1 116 ? 17.877  65.176 13.014 1.00 35.64 ? 319 ALA A CA  1 
ATOM   897  C  C   . ALA A 1 116 ? 17.739  63.982 13.962 1.00 35.72 ? 319 ALA A C   1 
ATOM   898  O  O   . ALA A 1 116 ? 17.391  64.139 15.134 1.00 36.24 ? 319 ALA A O   1 
ATOM   899  C  CB  . ALA A 1 116 ? 16.677  65.265 12.094 1.00 34.85 ? 319 ALA A CB  1 
ATOM   900  N  N   . TYR A 1 117 ? 18.052  62.793 13.462 1.00 35.23 ? 320 TYR A N   1 
ATOM   901  C  CA  . TYR A 1 117 ? 17.967  61.588 14.269 1.00 34.94 ? 320 TYR A CA  1 
ATOM   902  C  C   . TYR A 1 117 ? 19.004  61.622 15.400 1.00 35.07 ? 320 TYR A C   1 
ATOM   903  O  O   . TYR A 1 117 ? 18.731  61.162 16.508 1.00 34.82 ? 320 TYR A O   1 
ATOM   904  C  CB  . TYR A 1 117 ? 18.141  60.342 13.392 1.00 34.90 ? 320 TYR A CB  1 
ATOM   905  C  CG  . TYR A 1 117 ? 17.922  59.045 14.137 1.00 35.40 ? 320 TYR A CG  1 
ATOM   906  C  CD1 . TYR A 1 117 ? 16.744  58.822 14.865 1.00 35.41 ? 320 TYR A CD1 1 
ATOM   907  C  CD2 . TYR A 1 117 ? 18.906  58.060 14.158 1.00 35.05 ? 320 TYR A CD2 1 
ATOM   908  C  CE1 . TYR A 1 117 ? 16.561  57.650 15.600 1.00 35.50 ? 320 TYR A CE1 1 
ATOM   909  C  CE2 . TYR A 1 117 ? 18.733  56.884 14.889 1.00 35.70 ? 320 TYR A CE2 1 
ATOM   910  C  CZ  . TYR A 1 117 ? 17.563  56.687 15.609 1.00 35.90 ? 320 TYR A CZ  1 
ATOM   911  O  OH  . TYR A 1 117 ? 17.415  55.535 16.353 1.00 37.03 ? 320 TYR A OH  1 
ATOM   912  N  N   . ASP A 1 118 ? 20.190  62.165 15.123 1.00 35.32 ? 321 ASP A N   1 
ATOM   913  C  CA  . ASP A 1 118 ? 21.228  62.275 16.146 1.00 35.24 ? 321 ASP A CA  1 
ATOM   914  C  C   . ASP A 1 118 ? 20.737  63.176 17.260 1.00 34.73 ? 321 ASP A C   1 
ATOM   915  O  O   . ASP A 1 118 ? 21.056  62.952 18.421 1.00 34.79 ? 321 ASP A O   1 
ATOM   916  C  CB  . ASP A 1 118 ? 22.524  62.854 15.576 1.00 36.26 ? 321 ASP A CB  1 
ATOM   917  C  CG  . ASP A 1 118 ? 23.381  61.812 14.892 1.00 37.79 ? 321 ASP A CG  1 
ATOM   918  O  OD1 . ASP A 1 118 ? 23.129  60.600 15.085 1.00 39.02 ? 321 ASP A OD1 1 
ATOM   919  O  OD2 . ASP A 1 118 ? 24.317  62.209 14.165 1.00 37.99 ? 321 ASP A OD2 1 
ATOM   920  N  N   . ILE A 1 119 ? 19.965  64.201 16.905 1.00 34.23 ? 322 ILE A N   1 
ATOM   921  C  CA  . ILE A 1 119 ? 19.428  65.113 17.906 1.00 34.31 ? 322 ILE A CA  1 
ATOM   922  C  C   . ILE A 1 119 ? 18.463  64.362 18.812 1.00 35.67 ? 322 ILE A C   1 
ATOM   923  O  O   . ILE A 1 119 ? 18.470  64.552 20.029 1.00 36.92 ? 322 ILE A O   1 
ATOM   924  C  CB  . ILE A 1 119 ? 18.734  66.331 17.267 1.00 32.69 ? 322 ILE A CB  1 
ATOM   925  C  CG1 . ILE A 1 119 ? 19.789  67.247 16.649 1.00 31.23 ? 322 ILE A CG1 1 
ATOM   926  C  CG2 . ILE A 1 119 ? 17.924  67.100 18.308 1.00 31.33 ? 322 ILE A CG2 1 
ATOM   927  C  CD1 . ILE A 1 119 ? 19.234  68.549 16.154 1.00 30.21 ? 322 ILE A CD1 1 
ATOM   928  N  N   . VAL A 1 120 ? 17.656  63.484 18.223 1.00 36.43 ? 323 VAL A N   1 
ATOM   929  C  CA  . VAL A 1 120 ? 16.716  62.696 19.006 1.00 37.33 ? 323 VAL A CA  1 
ATOM   930  C  C   . VAL A 1 120 ? 17.484  61.779 19.964 1.00 39.01 ? 323 VAL A C   1 
ATOM   931  O  O   . VAL A 1 120 ? 17.129  61.664 21.137 1.00 39.47 ? 323 VAL A O   1 
ATOM   932  C  CB  . VAL A 1 120 ? 15.775  61.874 18.101 1.00 36.22 ? 323 VAL A CB  1 
ATOM   933  C  CG1 . VAL A 1 120 ? 14.947  60.905 18.932 1.00 35.40 ? 323 VAL A CG1 1 
ATOM   934  C  CG2 . VAL A 1 120 ? 14.858  62.810 17.314 1.00 34.94 ? 323 VAL A CG2 1 
ATOM   935  N  N   . LYS A 1 121 ? 18.574  61.184 19.487 1.00 40.58 ? 324 LYS A N   1 
ATOM   936  C  CA  . LYS A 1 121 ? 19.374  60.300 20.326 1.00 42.63 ? 324 LYS A CA  1 
ATOM   937  C  C   . LYS A 1 121 ? 20.112  61.017 21.463 1.00 43.11 ? 324 LYS A C   1 
ATOM   938  O  O   . LYS A 1 121 ? 20.631  60.377 22.380 1.00 43.51 ? 324 LYS A O   1 
ATOM   939  C  CB  . LYS A 1 121 ? 20.360  59.494 19.483 1.00 44.24 ? 324 LYS A CB  1 
ATOM   940  C  CG  . LYS A 1 121 ? 19.714  58.442 18.601 1.00 46.85 ? 324 LYS A CG  1 
ATOM   941  C  CD  . LYS A 1 121 ? 20.512  57.128 18.619 1.00 49.98 ? 324 LYS A CD  1 
ATOM   942  C  CE  . LYS A 1 121 ? 22.008  57.325 18.300 1.00 51.72 ? 324 LYS A CE  1 
ATOM   943  N  NZ  . LYS A 1 121 ? 22.289  57.998 16.985 1.00 52.37 ? 324 LYS A NZ  1 
ATOM   944  N  N   . MET A 1 122 ? 20.183  62.340 21.396 1.00 43.51 ? 325 MET A N   1 
ATOM   945  C  CA  . MET A 1 122 ? 20.841  63.109 22.447 1.00 44.37 ? 325 MET A CA  1 
ATOM   946  C  C   . MET A 1 122 ? 19.928  63.124 23.661 1.00 45.24 ? 325 MET A C   1 
ATOM   947  O  O   . MET A 1 122 ? 20.382  62.983 24.795 1.00 44.37 ? 325 MET A O   1 
ATOM   948  C  CB  . MET A 1 122 ? 21.084  64.552 21.995 1.00 43.76 ? 325 MET A CB  1 
ATOM   949  C  CG  . MET A 1 122 ? 22.160  64.725 20.940 1.00 42.79 ? 325 MET A CG  1 
ATOM   950  S  SD  . MET A 1 122 ? 22.203  66.425 20.367 1.00 42.07 ? 325 MET A SD  1 
ATOM   951  C  CE  . MET A 1 122 ? 23.302  66.280 18.999 1.00 42.14 ? 325 MET A CE  1 
ATOM   952  N  N   . LYS A 1 123 ? 18.632  63.268 23.395 1.00 46.65 ? 326 LYS A N   1 
ATOM   953  C  CA  . LYS A 1 123 ? 17.617  63.331 24.437 1.00 48.81 ? 326 LYS A CA  1 
ATOM   954  C  C   . LYS A 1 123 ? 17.052  61.972 24.863 1.00 50.28 ? 326 LYS A C   1 
ATOM   955  O  O   . LYS A 1 123 ? 16.588  61.822 25.992 1.00 50.55 ? 326 LYS A O   1 
ATOM   956  C  CB  . LYS A 1 123 ? 16.487  64.270 24.002 1.00 48.55 ? 326 LYS A CB  1 
ATOM   957  C  CG  . LYS A 1 123 ? 16.972  65.605 23.422 1.00 49.58 ? 326 LYS A CG  1 
ATOM   958  C  CD  . LYS A 1 123 ? 17.936  66.357 24.364 1.00 50.96 ? 326 LYS A CD  1 
ATOM   959  C  CE  . LYS A 1 123 ? 17.225  67.281 25.362 1.00 51.70 ? 326 LYS A CE  1 
ATOM   960  N  NZ  . LYS A 1 123 ? 16.522  68.437 24.701 1.00 51.97 ? 326 LYS A NZ  1 
ATOM   961  N  N   . LYS A 1 124 ? 17.100  60.981 23.975 1.00 52.01 ? 327 LYS A N   1 
ATOM   962  C  CA  . LYS A 1 124 ? 16.584  59.646 24.285 1.00 53.62 ? 327 LYS A CA  1 
ATOM   963  C  C   . LYS A 1 124 ? 17.518  58.621 23.640 1.00 55.04 ? 327 LYS A C   1 
ATOM   964  O  O   . LYS A 1 124 ? 17.184  58.010 22.629 1.00 55.24 ? 327 LYS A O   1 
ATOM   965  C  CB  . LYS A 1 124 ? 15.148  59.500 23.755 1.00 53.52 ? 327 LYS A CB  1 
ATOM   966  C  CG  . LYS A 1 124 ? 14.370  58.327 24.328 1.00 54.43 ? 327 LYS A CG  1 
ATOM   967  C  CD  . LYS A 1 124 ? 12.879  58.453 24.056 1.00 55.22 ? 327 LYS A CD  1 
ATOM   968  C  CE  . LYS A 1 124 ? 12.074  57.393 24.822 1.00 56.17 ? 327 LYS A CE  1 
ATOM   969  N  NZ  . LYS A 1 124 ? 10.612  57.744 24.898 1.00 56.42 ? 327 LYS A NZ  1 
ATOM   970  N  N   . SER A 1 125 ? 18.687  58.436 24.250 1.00 57.12 ? 328 SER A N   1 
ATOM   971  C  CA  . SER A 1 125 ? 19.725  57.522 23.754 1.00 59.00 ? 328 SER A CA  1 
ATOM   972  C  C   . SER A 1 125 ? 19.362  56.039 23.738 1.00 60.07 ? 328 SER A C   1 
ATOM   973  O  O   . SER A 1 125 ? 20.065  55.230 23.125 1.00 60.40 ? 328 SER A O   1 
ATOM   974  C  CB  . SER A 1 125 ? 21.002  57.707 24.575 1.00 59.18 ? 328 SER A CB  1 
ATOM   975  O  OG  . SER A 1 125 ? 20.733  57.522 25.956 1.00 59.39 ? 328 SER A OG  1 
ATOM   976  N  N   . ASN A 1 126 ? 18.282  55.692 24.429 1.00 60.60 ? 329 ASN A N   1 
ATOM   977  C  CA  . ASN A 1 126 ? 17.813  54.314 24.518 1.00 60.87 ? 329 ASN A CA  1 
ATOM   978  C  C   . ASN A 1 126 ? 17.001  53.858 23.303 1.00 60.03 ? 329 ASN A C   1 
ATOM   979  O  O   . ASN A 1 126 ? 16.958  52.669 22.980 1.00 60.35 ? 329 ASN A O   1 
ATOM   980  C  CB  . ASN A 1 126 ? 16.941  54.169 25.762 1.00 62.45 ? 329 ASN A CB  1 
ATOM   981  C  CG  . ASN A 1 126 ? 15.703  55.050 25.703 1.00 64.16 ? 329 ASN A CG  1 
ATOM   982  O  OD1 . ASN A 1 126 ? 14.667  54.656 25.150 1.00 64.65 ? 329 ASN A OD1 1 
ATOM   983  N  ND2 . ASN A 1 126 ? 15.811  56.257 26.247 1.00 64.66 ? 329 ASN A ND2 1 
ATOM   984  N  N   . ILE A 1 127 ? 16.335  54.818 22.669 1.00 58.70 ? 330 ILE A N   1 
ATOM   985  C  CA  . ILE A 1 127 ? 15.473  54.599 21.510 1.00 57.15 ? 330 ILE A CA  1 
ATOM   986  C  C   . ILE A 1 127 ? 15.975  53.561 20.509 1.00 56.48 ? 330 ILE A C   1 
ATOM   987  O  O   . ILE A 1 127 ? 17.128  53.599 20.080 1.00 56.71 ? 330 ILE A O   1 
ATOM   988  C  CB  . ILE A 1 127 ? 15.199  55.946 20.791 1.00 56.84 ? 330 ILE A CB  1 
ATOM   989  C  CG1 . ILE A 1 127 ? 13.981  55.833 19.887 1.00 56.52 ? 330 ILE A CG1 1 
ATOM   990  C  CG2 . ILE A 1 127 ? 16.430  56.409 20.005 1.00 56.32 ? 330 ILE A CG2 1 
ATOM   991  C  CD1 . ILE A 1 127 ? 13.473  57.169 19.453 1.00 56.71 ? 330 ILE A CD1 1 
ATOM   992  N  N   . SER A 1 128 ? 15.107  52.618 20.160 1.00 55.38 ? 331 SER A N   1 
ATOM   993  C  CA  . SER A 1 128 ? 15.461  51.572 19.203 1.00 54.35 ? 331 SER A CA  1 
ATOM   994  C  C   . SER A 1 128 ? 14.304  51.302 18.248 1.00 52.40 ? 331 SER A C   1 
ATOM   995  O  O   . SER A 1 128 ? 13.432  50.468 18.510 1.00 52.07 ? 331 SER A O   1 
ATOM   996  C  CB  . SER A 1 128 ? 15.879  50.287 19.928 1.00 55.16 ? 331 SER A CB  1 
ATOM   997  O  OG  . SER A 1 128 ? 14.891  49.873 20.858 1.00 56.54 ? 331 SER A OG  1 
ATOM   998  N  N   . PRO A 1 129 ? 14.260  52.042 17.133 1.00 50.45 ? 332 PRO A N   1 
ATOM   999  C  CA  . PRO A 1 129 ? 13.206  51.884 16.131 1.00 49.48 ? 332 PRO A CA  1 
ATOM   1000 C  C   . PRO A 1 129 ? 13.572  50.824 15.089 1.00 48.17 ? 332 PRO A C   1 
ATOM   1001 O  O   . PRO A 1 129 ? 14.683  50.297 15.100 1.00 48.43 ? 332 PRO A O   1 
ATOM   1002 C  CB  . PRO A 1 129 ? 13.171  53.263 15.493 1.00 49.31 ? 332 PRO A CB  1 
ATOM   1003 C  CG  . PRO A 1 129 ? 14.626  53.608 15.442 1.00 48.72 ? 332 PRO A CG  1 
ATOM   1004 C  CD  . PRO A 1 129 ? 15.129  53.190 16.807 1.00 49.07 ? 332 PRO A CD  1 
ATOM   1005 N  N   . ASN A 1 130 ? 12.619  50.468 14.237 1.00 46.38 ? 333 ASN A N   1 
ATOM   1006 C  CA  . ASN A 1 130 ? 12.906  49.513 13.173 1.00 45.45 ? 333 ASN A CA  1 
ATOM   1007 C  C   . ASN A 1 130 ? 13.338  50.378 11.988 1.00 44.74 ? 333 ASN A C   1 
ATOM   1008 O  O   . ASN A 1 130 ? 13.409  51.602 12.125 1.00 45.38 ? 333 ASN A O   1 
ATOM   1009 C  CB  . ASN A 1 130 ? 11.689  48.626 12.845 1.00 45.02 ? 333 ASN A CB  1 
ATOM   1010 C  CG  . ASN A 1 130 ? 10.454  49.419 12.464 1.00 44.28 ? 333 ASN A CG  1 
ATOM   1011 O  OD1 . ASN A 1 130 ? 10.489  50.276 11.579 1.00 43.81 ? 333 ASN A OD1 1 
ATOM   1012 N  ND2 . ASN A 1 130 ? 9.341   49.116 13.122 1.00 43.70 ? 333 ASN A ND2 1 
ATOM   1013 N  N   . PHE A 1 131 ? 13.644  49.780 10.841 1.00 43.38 ? 334 PHE A N   1 
ATOM   1014 C  CA  . PHE A 1 131 ? 14.081  50.588 9.708  1.00 41.92 ? 334 PHE A CA  1 
ATOM   1015 C  C   . PHE A 1 131 ? 13.012  50.841 8.652  1.00 40.32 ? 334 PHE A C   1 
ATOM   1016 O  O   . PHE A 1 131 ? 13.323  51.370 7.590  1.00 40.23 ? 334 PHE A O   1 
ATOM   1017 C  CB  . PHE A 1 131 ? 15.314  49.961 9.054  1.00 43.83 ? 334 PHE A CB  1 
ATOM   1018 C  CG  . PHE A 1 131 ? 15.034  48.671 8.344  1.00 46.16 ? 334 PHE A CG  1 
ATOM   1019 C  CD1 . PHE A 1 131 ? 14.510  48.668 7.049  1.00 47.89 ? 334 PHE A CD1 1 
ATOM   1020 C  CD2 . PHE A 1 131 ? 15.274  47.458 8.969  1.00 46.98 ? 334 PHE A CD2 1 
ATOM   1021 C  CE1 . PHE A 1 131 ? 14.226  47.476 6.392  1.00 48.78 ? 334 PHE A CE1 1 
ATOM   1022 C  CE2 . PHE A 1 131 ? 14.997  46.259 8.324  1.00 48.04 ? 334 PHE A CE2 1 
ATOM   1023 C  CZ  . PHE A 1 131 ? 14.469  46.266 7.033  1.00 49.36 ? 334 PHE A CZ  1 
ATOM   1024 N  N   . ASN A 1 132 ? 11.757  50.521 8.958  1.00 38.82 ? 335 ASN A N   1 
ATOM   1025 C  CA  . ASN A 1 132 ? 10.657  50.684 8.001  1.00 38.04 ? 335 ASN A CA  1 
ATOM   1026 C  C   . ASN A 1 132 ? 10.463  52.074 7.420  1.00 37.19 ? 335 ASN A C   1 
ATOM   1027 O  O   . ASN A 1 132 ? 9.835   52.219 6.372  1.00 36.86 ? 335 ASN A O   1 
ATOM   1028 C  CB  . ASN A 1 132 ? 9.332   50.227 8.611  1.00 38.73 ? 335 ASN A CB  1 
ATOM   1029 C  CG  . ASN A 1 132 ? 9.339   48.763 9.002  1.00 40.13 ? 335 ASN A CG  1 
ATOM   1030 O  OD1 . ASN A 1 132 ? 10.291  48.031 8.720  1.00 41.63 ? 335 ASN A OD1 1 
ATOM   1031 N  ND2 . ASN A 1 132 ? 8.273   48.327 9.666  1.00 40.05 ? 335 ASN A ND2 1 
ATOM   1032 N  N   . PHE A 1 133 ? 11.016  53.090 8.073  1.00 36.45 ? 336 PHE A N   1 
ATOM   1033 C  CA  . PHE A 1 133 ? 10.843  54.457 7.601  1.00 35.95 ? 336 PHE A CA  1 
ATOM   1034 C  C   . PHE A 1 133 ? 12.085  55.175 7.092  1.00 36.20 ? 336 PHE A C   1 
ATOM   1035 O  O   . PHE A 1 133 ? 12.022  56.358 6.760  1.00 36.27 ? 336 PHE A O   1 
ATOM   1036 C  CB  . PHE A 1 133 ? 10.119  55.279 8.663  1.00 35.61 ? 336 PHE A CB  1 
ATOM   1037 C  CG  . PHE A 1 133 ? 8.847   54.642 9.133  1.00 35.80 ? 336 PHE A CG  1 
ATOM   1038 C  CD1 . PHE A 1 133 ? 7.649   54.869 8.460  1.00 36.05 ? 336 PHE A CD1 1 
ATOM   1039 C  CD2 . PHE A 1 133 ? 8.857   53.749 10.205 1.00 36.02 ? 336 PHE A CD2 1 
ATOM   1040 C  CE1 . PHE A 1 133 ? 6.473   54.209 8.842  1.00 36.76 ? 336 PHE A CE1 1 
ATOM   1041 C  CE2 . PHE A 1 133 ? 7.692   53.082 10.598 1.00 36.77 ? 336 PHE A CE2 1 
ATOM   1042 C  CZ  . PHE A 1 133 ? 6.496   53.311 9.914  1.00 37.32 ? 336 PHE A CZ  1 
ATOM   1043 N  N   . MET A 1 134 ? 13.202  54.459 6.983  1.00 36.74 ? 337 MET A N   1 
ATOM   1044 C  CA  . MET A 1 134 ? 14.430  55.060 6.461  1.00 36.78 ? 337 MET A CA  1 
ATOM   1045 C  C   . MET A 1 134 ? 14.193  55.612 5.055  1.00 36.37 ? 337 MET A C   1 
ATOM   1046 O  O   . MET A 1 134 ? 14.537  56.751 4.769  1.00 37.64 ? 337 MET A O   1 
ATOM   1047 C  CB  . MET A 1 134 ? 15.562  54.037 6.387  1.00 37.24 ? 337 MET A CB  1 
ATOM   1048 C  CG  . MET A 1 134 ? 16.081  53.550 7.708  1.00 37.89 ? 337 MET A CG  1 
ATOM   1049 S  SD  . MET A 1 134 ? 17.484  52.454 7.428  1.00 40.04 ? 337 MET A SD  1 
ATOM   1050 C  CE  . MET A 1 134 ? 18.209  52.404 9.089  1.00 39.57 ? 337 MET A CE  1 
ATOM   1051 N  N   . GLY A 1 135 ? 13.588  54.807 4.188  1.00 35.26 ? 338 GLY A N   1 
ATOM   1052 C  CA  . GLY A 1 135 ? 13.334  55.241 2.829  1.00 34.76 ? 338 GLY A CA  1 
ATOM   1053 C  C   . GLY A 1 135 ? 12.464  56.477 2.710  1.00 34.88 ? 338 GLY A C   1 
ATOM   1054 O  O   . GLY A 1 135 ? 12.708  57.337 1.859  1.00 35.27 ? 338 GLY A O   1 
ATOM   1055 N  N   . GLN A 1 136 ? 11.453  56.581 3.565  1.00 35.12 ? 339 GLN A N   1 
ATOM   1056 C  CA  . GLN A 1 136 ? 10.553  57.729 3.522  1.00 35.31 ? 339 GLN A CA  1 
ATOM   1057 C  C   . GLN A 1 136 ? 11.196  58.986 4.062  1.00 34.46 ? 339 GLN A C   1 
ATOM   1058 O  O   . GLN A 1 136 ? 10.924  60.080 3.574  1.00 34.36 ? 339 GLN A O   1 
ATOM   1059 C  CB  . GLN A 1 136 ? 9.256   57.425 4.259  1.00 36.36 ? 339 GLN A CB  1 
ATOM   1060 C  CG  . GLN A 1 136 ? 8.507   56.279 3.628  1.00 39.42 ? 339 GLN A CG  1 
ATOM   1061 C  CD  . GLN A 1 136 ? 7.165   56.051 4.251  1.00 41.33 ? 339 GLN A CD  1 
ATOM   1062 O  OE1 . GLN A 1 136 ? 6.942   55.043 4.916  1.00 42.20 ? 339 GLN A OE1 1 
ATOM   1063 N  NE2 . GLN A 1 136 ? 6.249   56.985 4.032  1.00 42.71 ? 339 GLN A NE2 1 
ATOM   1064 N  N   . LEU A 1 137 ? 12.058  58.828 5.061  1.00 33.62 ? 340 LEU A N   1 
ATOM   1065 C  CA  . LEU A 1 137 ? 12.751  59.971 5.638  1.00 33.32 ? 340 LEU A CA  1 
ATOM   1066 C  C   . LEU A 1 137 ? 13.839  60.458 4.696  1.00 34.21 ? 340 LEU A C   1 
ATOM   1067 O  O   . LEU A 1 137 ? 14.028  61.660 4.537  1.00 34.74 ? 340 LEU A O   1 
ATOM   1068 C  CB  . LEU A 1 137 ? 13.328  59.630 7.009  1.00 31.04 ? 340 LEU A CB  1 
ATOM   1069 C  CG  . LEU A 1 137 ? 12.296  59.655 8.140  1.00 28.55 ? 340 LEU A CG  1 
ATOM   1070 C  CD1 . LEU A 1 137 ? 12.923  59.157 9.401  1.00 27.30 ? 340 LEU A CD1 1 
ATOM   1071 C  CD2 . LEU A 1 137 ? 11.768  61.059 8.342  1.00 27.09 ? 340 LEU A CD2 1 
ATOM   1072 N  N   . LEU A 1 138 ? 14.523  59.521 4.042  1.00 35.01 ? 341 LEU A N   1 
ATOM   1073 C  CA  . LEU A 1 138 ? 15.578  59.854 3.088  1.00 36.12 ? 341 LEU A CA  1 
ATOM   1074 C  C   . LEU A 1 138 ? 14.967  60.572 1.898  1.00 37.39 ? 341 LEU A C   1 
ATOM   1075 O  O   . LEU A 1 138 ? 15.523  61.545 1.387  1.00 37.43 ? 341 LEU A O   1 
ATOM   1076 C  CB  . LEU A 1 138 ? 16.292  58.587 2.624  1.00 35.73 ? 341 LEU A CB  1 
ATOM   1077 C  CG  . LEU A 1 138 ? 17.387  58.095 3.572  1.00 36.86 ? 341 LEU A CG  1 
ATOM   1078 C  CD1 . LEU A 1 138 ? 17.736  56.637 3.317  1.00 36.95 ? 341 LEU A CD1 1 
ATOM   1079 C  CD2 . LEU A 1 138 ? 18.612  58.988 3.422  1.00 37.86 ? 341 LEU A CD2 1 
ATOM   1080 N  N   . ASP A 1 139 ? 13.798  60.098 1.487  1.00 39.01 ? 342 ASP A N   1 
ATOM   1081 C  CA  . ASP A 1 139 ? 13.080  60.680 0.370  1.00 41.06 ? 342 ASP A CA  1 
ATOM   1082 C  C   . ASP A 1 139 ? 12.577  62.078 0.736  1.00 41.77 ? 342 ASP A C   1 
ATOM   1083 O  O   . ASP A 1 139 ? 12.625  63.000 -0.082 1.00 42.22 ? 342 ASP A O   1 
ATOM   1084 C  CB  . ASP A 1 139 ? 11.917  59.771 -0.013 1.00 43.58 ? 342 ASP A CB  1 
ATOM   1085 C  CG  . ASP A 1 139 ? 11.314  60.134 -1.350 1.00 45.72 ? 342 ASP A CG  1 
ATOM   1086 O  OD1 . ASP A 1 139 ? 12.085  60.315 -2.319 1.00 47.22 ? 342 ASP A OD1 1 
ATOM   1087 O  OD2 . ASP A 1 139 ? 10.071  60.237 -1.431 1.00 47.46 ? 342 ASP A OD2 1 
ATOM   1088 N  N   . PHE A 1 140 ? 12.105  62.229 1.972  1.00 42.54 ? 343 PHE A N   1 
ATOM   1089 C  CA  . PHE A 1 140 ? 11.611  63.513 2.478  1.00 42.67 ? 343 PHE A CA  1 
ATOM   1090 C  C   . PHE A 1 140 ? 12.765  64.516 2.523  1.00 43.51 ? 343 PHE A C   1 
ATOM   1091 O  O   . PHE A 1 140 ? 12.562  65.717 2.364  1.00 42.95 ? 343 PHE A O   1 
ATOM   1092 C  CB  . PHE A 1 140 ? 11.033  63.327 3.884  1.00 41.56 ? 343 PHE A CB  1 
ATOM   1093 C  CG  . PHE A 1 140 ? 10.566  64.603 4.535  1.00 40.42 ? 343 PHE A CG  1 
ATOM   1094 C  CD1 . PHE A 1 140 ? 9.617   65.412 3.918  1.00 40.02 ? 343 PHE A CD1 1 
ATOM   1095 C  CD2 . PHE A 1 140 ? 11.065  64.985 5.779  1.00 39.92 ? 343 PHE A CD2 1 
ATOM   1096 C  CE1 . PHE A 1 140 ? 9.169   66.586 4.532  1.00 39.75 ? 343 PHE A CE1 1 
ATOM   1097 C  CE2 . PHE A 1 140 ? 10.627  66.153 6.403  1.00 39.29 ? 343 PHE A CE2 1 
ATOM   1098 C  CZ  . PHE A 1 140 ? 9.677   66.956 5.779  1.00 39.82 ? 343 PHE A CZ  1 
ATOM   1099 N  N   . GLU A 1 141 ? 13.975  64.004 2.728  1.00 45.10 ? 344 GLU A N   1 
ATOM   1100 C  CA  . GLU A 1 141 ? 15.173  64.830 2.790  1.00 47.40 ? 344 GLU A CA  1 
ATOM   1101 C  C   . GLU A 1 141 ? 15.392  65.561 1.473  1.00 49.84 ? 344 GLU A C   1 
ATOM   1102 O  O   . GLU A 1 141 ? 15.797  66.725 1.462  1.00 49.73 ? 344 GLU A O   1 
ATOM   1103 C  CB  . GLU A 1 141 ? 16.382  63.965 3.119  1.00 46.21 ? 344 GLU A CB  1 
ATOM   1104 C  CG  . GLU A 1 141 ? 17.652  64.742 3.353  1.00 46.59 ? 344 GLU A CG  1 
ATOM   1105 C  CD  . GLU A 1 141 ? 18.796  63.854 3.800  1.00 47.37 ? 344 GLU A CD  1 
ATOM   1106 O  OE1 . GLU A 1 141 ? 18.656  63.190 4.844  1.00 46.93 ? 344 GLU A OE1 1 
ATOM   1107 O  OE2 . GLU A 1 141 ? 19.836  63.814 3.112  1.00 48.23 ? 344 GLU A OE2 1 
ATOM   1108 N  N   . ARG A 1 142 ? 15.108  64.877 0.367  1.00 52.91 ? 345 ARG A N   1 
ATOM   1109 C  CA  . ARG A 1 142 ? 15.251  65.456 -0.965 1.00 56.44 ? 345 ARG A CA  1 
ATOM   1110 C  C   . ARG A 1 142 ? 14.314  66.657 -1.136 1.00 57.62 ? 345 ARG A C   1 
ATOM   1111 O  O   . ARG A 1 142 ? 14.670  67.652 -1.777 1.00 57.90 ? 345 ARG A O   1 
ATOM   1112 C  CB  . ARG A 1 142 ? 14.936  64.407 -2.027 1.00 58.55 ? 345 ARG A CB  1 
ATOM   1113 C  CG  . ARG A 1 142 ? 15.846  63.199 -1.984 1.00 62.97 ? 345 ARG A CG  1 
ATOM   1114 C  CD  . ARG A 1 142 ? 15.346  62.104 -2.917 1.00 67.18 ? 345 ARG A CD  1 
ATOM   1115 N  NE  . ARG A 1 142 ? 16.272  60.974 -2.967 1.00 71.56 ? 345 ARG A NE  1 
ATOM   1116 C  CZ  . ARG A 1 142 ? 17.187  60.796 -3.919 1.00 73.94 ? 345 ARG A CZ  1 
ATOM   1117 N  NH1 . ARG A 1 142 ? 17.301  61.669 -4.915 1.00 74.71 ? 345 ARG A NH1 1 
ATOM   1118 N  NH2 . ARG A 1 142 ? 18.019  59.762 -3.859 1.00 75.23 ? 345 ARG A NH2 1 
ATOM   1119 N  N   . THR A 1 143 ? 13.132  66.556 -0.531 1.00 58.76 ? 346 THR A N   1 
ATOM   1120 C  CA  . THR A 1 143 ? 12.102  67.597 -0.574 1.00 59.33 ? 346 THR A CA  1 
ATOM   1121 C  C   . THR A 1 143 ? 12.574  68.931 -0.002 1.00 59.58 ? 346 THR A C   1 
ATOM   1122 O  O   . THR A 1 143 ? 12.014  69.980 -0.311 1.00 60.63 ? 346 THR A O   1 
ATOM   1123 C  CB  . THR A 1 143 ? 10.849  67.146 0.221  1.00 59.70 ? 346 THR A CB  1 
ATOM   1124 O  OG1 . THR A 1 143 ? 10.335  65.938 -0.352 1.00 60.31 ? 346 THR A OG1 1 
ATOM   1125 C  CG2 . THR A 1 143 ? 9.756   68.215 0.211  1.00 60.12 ? 346 THR A CG2 1 
ATOM   1126 N  N   . LEU A 1 144 ? 13.610  68.899 0.820  1.00 59.57 ? 347 LEU A N   1 
ATOM   1127 C  CA  . LEU A 1 144 ? 14.106  70.121 1.428  1.00 60.06 ? 347 LEU A CA  1 
ATOM   1128 C  C   . LEU A 1 144 ? 15.340  70.685 0.722  1.00 60.51 ? 347 LEU A C   1 
ATOM   1129 O  O   . LEU A 1 144 ? 15.883  70.006 -0.180 1.00 60.61 ? 347 LEU A O   1 
ATOM   1130 C  CB  . LEU A 1 144 ? 14.389  69.867 2.912  1.00 60.67 ? 347 LEU A CB  1 
ATOM   1131 C  CG  . LEU A 1 144 ? 13.322  69.063 3.679  1.00 60.73 ? 347 LEU A CG  1 
ATOM   1132 C  CD1 . LEU A 1 144 ? 13.803  68.797 5.094  1.00 60.38 ? 347 LEU A CD1 1 
ATOM   1133 C  CD2 . LEU A 1 144 ? 11.972  69.780 3.687  1.00 60.23 ? 347 LEU A CD2 1 
ATOM   1134 O  OXT . LEU A 1 144 ? 15.746  71.814 1.074  1.00 60.36 ? 347 LEU A OXT 1 
HETATM 1135 CL CL  . CL  B 2 .   ? 4.659   52.828 15.667 1.00 41.93 ? 500 CL  A CL  1 
HETATM 1136 C  C1  . MPD C 3 .   ? 14.721  57.205 12.381 1.00 59.23 ? 501 MPD A C1  1 
HETATM 1137 C  C2  . MPD C 3 .   ? 14.636  56.376 11.113 1.00 59.36 ? 501 MPD A C2  1 
HETATM 1138 O  O2  . MPD C 3 .   ? 14.805  54.999 11.688 1.00 59.50 ? 501 MPD A O2  1 
HETATM 1139 C  CM  . MPD C 3 .   ? 13.384  56.124 10.318 1.00 59.36 ? 501 MPD A CM  1 
HETATM 1140 C  C3  . MPD C 3 .   ? 15.827  56.726 10.154 1.00 59.05 ? 501 MPD A C3  1 
HETATM 1141 C  C4  . MPD C 3 .   ? 17.089  56.965 10.834 1.00 58.72 ? 501 MPD A C4  1 
HETATM 1142 O  O4  . MPD C 3 .   ? 17.331  55.711 11.468 1.00 59.24 ? 501 MPD A O4  1 
HETATM 1143 C  C5  . MPD C 3 .   ? 18.209  57.322 9.835  1.00 58.32 ? 501 MPD A C5  1 
HETATM 1144 O  O   . HOH D 4 .   ? -0.376  66.340 5.419  1.00 49.49 ? 400 HOH A O   1 
HETATM 1145 O  O   . HOH D 4 .   ? -8.845  66.571 30.712 1.00 36.11 ? 401 HOH A O   1 
HETATM 1146 O  O   . HOH D 4 .   ? 21.923  59.615 12.671 1.00 53.54 ? 402 HOH A O   1 
HETATM 1147 O  O   . HOH D 4 .   ? -2.761  72.036 13.044 1.00 47.15 ? 403 HOH A O   1 
HETATM 1148 O  O   . HOH D 4 .   ? 12.779  53.310 10.234 1.00 32.51 ? 404 HOH A O   1 
HETATM 1149 O  O   . HOH D 4 .   ? 19.238  59.901 26.990 1.00 49.17 ? 405 HOH A O   1 
HETATM 1150 O  O   . HOH D 4 .   ? 5.301   55.944 20.511 1.00 38.51 ? 406 HOH A O   1 
HETATM 1151 O  O   . HOH D 4 .   ? 2.875   53.550 8.310  1.00 34.17 ? 407 HOH A O   1 
HETATM 1152 O  O   . HOH D 4 .   ? -14.879 66.845 21.388 1.00 44.03 ? 408 HOH A O   1 
HETATM 1153 O  O   . HOH D 4 .   ? -12.437 65.000 13.271 1.00 49.52 ? 409 HOH A O   1 
HETATM 1154 O  O   . HOH D 4 .   ? -6.999  57.660 22.183 1.00 55.02 ? 410 HOH A O   1 
HETATM 1155 O  O   . HOH D 4 .   ? -6.160  63.964 12.065 1.00 48.79 ? 411 HOH A O   1 
HETATM 1156 O  O   . HOH D 4 .   ? -5.477  63.064 8.214  1.00 38.03 ? 412 HOH A O   1 
HETATM 1157 O  O   . HOH D 4 .   ? -4.283  55.452 12.322 1.00 39.61 ? 413 HOH A O   1 
HETATM 1158 O  O   . HOH D 4 .   ? -3.669  57.517 14.790 1.00 49.74 ? 414 HOH A O   1 
HETATM 1159 O  O   . HOH D 4 .   ? -1.327  56.497 21.830 1.00 52.22 ? 415 HOH A O   1 
HETATM 1160 O  O   . HOH D 4 .   ? 2.511   48.440 13.252 1.00 50.83 ? 416 HOH A O   1 
HETATM 1161 O  O   . HOH D 4 .   ? 3.775   47.754 15.658 1.00 48.24 ? 417 HOH A O   1 
HETATM 1162 O  O   . HOH D 4 .   ? 4.710   53.931 6.103  1.00 42.83 ? 418 HOH A O   1 
HETATM 1163 O  O   . HOH D 4 .   ? 6.755   50.280 12.188 1.00 40.59 ? 419 HOH A O   1 
HETATM 1164 O  O   . HOH D 4 .   ? 7.926   76.995 17.290 1.00 49.45 ? 420 HOH A O   1 
HETATM 1165 O  O   . HOH D 4 .   ? 8.575   50.496 16.819 1.00 36.29 ? 421 HOH A O   1 
HETATM 1166 O  O   . HOH D 4 .   ? 10.561  53.832 3.914  1.00 50.19 ? 422 HOH A O   1 
HETATM 1167 O  O   . HOH D 4 .   ? 12.823  75.437 18.098 1.00 30.82 ? 423 HOH A O   1 
HETATM 1168 O  O   . HOH D 4 .   ? 20.489  61.845 6.225  1.00 42.72 ? 424 HOH A O   1 
HETATM 1169 O  O   . HOH D 4 .   ? 22.049  68.792 8.366  1.00 47.77 ? 425 HOH A O   1 
HETATM 1170 O  O   . HOH D 4 .   ? 3.647   48.011 9.815  1.00 53.55 ? 426 HOH A O   1 
HETATM 1171 O  O   . HOH D 4 .   ? -6.243  52.985 20.127 1.00 39.16 ? 427 HOH A O   1 
HETATM 1172 O  O   . HOH D 4 .   ? 1.402   44.664 5.461  1.00 43.43 ? 428 HOH A O   1 
HETATM 1173 O  O   . HOH D 4 .   ? 5.765   55.109 0.775  1.00 49.60 ? 429 HOH A O   1 
HETATM 1174 O  O   . HOH D 4 .   ? 5.509   50.087 -0.732 1.00 43.14 ? 430 HOH A O   1 
HETATM 1175 O  O   . HOH D 4 .   ? 2.528   50.432 -2.708 1.00 48.85 ? 431 HOH A O   1 
HETATM 1176 O  O   . HOH D 4 .   ? 5.987   69.394 5.232  1.00 43.30 ? 432 HOH A O   1 
HETATM 1177 O  O   . HOH D 4 .   ? 3.319   74.582 28.073 1.00 57.90 ? 433 HOH A O   1 
HETATM 1178 O  O   . HOH D 4 .   ? 9.885   74.270 27.508 1.00 66.27 ? 434 HOH A O   1 
HETATM 1179 O  O   . HOH D 4 .   ? 23.119  61.462 18.852 1.00 44.76 ? 435 HOH A O   1 
HETATM 1180 O  O   . HOH D 4 .   ? 26.240  64.731 15.775 1.00 47.35 ? 436 HOH A O   1 
HETATM 1181 O  O   . HOH D 4 .   ? 18.836  69.450 4.177  1.00 62.69 ? 437 HOH A O   1 
HETATM 1182 O  O   . HOH D 4 .   ? 10.718  57.624 28.069 1.00 64.09 ? 438 HOH A O   1 
HETATM 1183 O  O   . HOH D 4 .   ? 5.262   51.028 6.789  1.00 53.48 ? 439 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   204 204 ALA ALA A . n 
A 1 2   SER 2   205 205 SER SER A . n 
A 1 3   PHE 3   206 206 PHE PHE A . n 
A 1 4   PRO 4   207 207 PRO PRO A . n 
A 1 5   VAL 5   208 208 VAL VAL A . n 
A 1 6   GLU 6   209 209 GLU GLU A . n 
A 1 7   ILE 7   210 210 ILE ILE A . n 
A 1 8   LEU 8   211 211 LEU LEU A . n 
A 1 9   PRO 9   212 212 PRO PRO A . n 
A 1 10  PHE 10  213 213 PHE PHE A . n 
A 1 11  LEU 11  214 214 LEU LEU A . n 
A 1 12  TYR 12  215 215 TYR TYR A . n 
A 1 13  LEU 13  216 216 LEU LEU A . n 
A 1 14  GLY 14  217 217 GLY GLY A . n 
A 1 15  CYS 15  218 218 CYS CYS A . n 
A 1 16  ALA 16  219 219 ALA ALA A . n 
A 1 17  LYS 17  220 220 LYS LYS A . n 
A 1 18  ASP 18  221 221 ASP ASP A . n 
A 1 19  SER 19  222 222 SER SER A . n 
A 1 20  THR 20  223 223 THR THR A . n 
A 1 21  ASN 21  224 224 ASN ASN A . n 
A 1 22  LEU 22  225 225 LEU LEU A . n 
A 1 23  ASP 23  226 226 ASP ASP A . n 
A 1 24  VAL 24  227 227 VAL VAL A . n 
A 1 25  LEU 25  228 228 LEU LEU A . n 
A 1 26  GLU 26  229 229 GLU GLU A . n 
A 1 27  GLU 27  230 230 GLU GLU A . n 
A 1 28  PHE 28  231 231 PHE PHE A . n 
A 1 29  GLY 29  232 232 GLY GLY A . n 
A 1 30  ILE 30  233 233 ILE ILE A . n 
A 1 31  LYS 31  234 234 LYS LYS A . n 
A 1 32  TYR 32  235 235 TYR TYR A . n 
A 1 33  ILE 33  236 236 ILE ILE A . n 
A 1 34  LEU 34  237 237 LEU LEU A . n 
A 1 35  ASN 35  238 238 ASN ASN A . n 
A 1 36  VAL 36  239 239 VAL VAL A . n 
A 1 37  THR 37  240 240 THR THR A . n 
A 1 38  PRO 38  241 241 PRO PRO A . n 
A 1 39  ASN 39  242 242 ASN ASN A . n 
A 1 40  LEU 40  243 243 LEU LEU A . n 
A 1 41  PRO 41  244 244 PRO PRO A . n 
A 1 42  ASN 42  245 245 ASN ASN A . n 
A 1 43  LEU 43  246 246 LEU LEU A . n 
A 1 44  PHE 44  247 247 PHE PHE A . n 
A 1 45  GLU 45  248 248 GLU GLU A . n 
A 1 46  ASN 46  249 249 ASN ASN A . n 
A 1 47  ALA 47  250 250 ALA ALA A . n 
A 1 48  GLY 48  251 251 GLY GLY A . n 
A 1 49  GLU 49  252 252 GLU GLU A . n 
A 1 50  PHE 50  253 253 PHE PHE A . n 
A 1 51  LYS 51  254 254 LYS LYS A . n 
A 1 52  TYR 52  255 255 TYR TYR A . n 
A 1 53  LYS 53  256 256 LYS LYS A . n 
A 1 54  GLN 54  257 257 GLN GLN A . n 
A 1 55  ILE 55  258 258 ILE ILE A . n 
A 1 56  PRO 56  259 259 PRO PRO A . n 
A 1 57  ILE 57  260 260 ILE ILE A . n 
A 1 58  SER 58  261 261 SER SER A . n 
A 1 59  ASP 59  262 262 ASP ASP A . n 
A 1 60  HIS 60  263 263 HIS HIS A . n 
A 1 61  TRP 61  264 264 TRP TRP A . n 
A 1 62  SER 62  265 265 SER SER A . n 
A 1 63  GLN 63  266 266 GLN GLN A . n 
A 1 64  ASN 64  267 267 ASN ASN A . n 
A 1 65  LEU 65  268 268 LEU LEU A . n 
A 1 66  SER 66  269 269 SER SER A . n 
A 1 67  GLN 67  270 270 GLN GLN A . n 
A 1 68  PHE 68  271 271 PHE PHE A . n 
A 1 69  PHE 69  272 272 PHE PHE A . n 
A 1 70  PRO 70  273 273 PRO PRO A . n 
A 1 71  GLU 71  274 274 GLU GLU A . n 
A 1 72  ALA 72  275 275 ALA ALA A . n 
A 1 73  ILE 73  276 276 ILE ILE A . n 
A 1 74  SER 74  277 277 SER SER A . n 
A 1 75  PHE 75  278 278 PHE PHE A . n 
A 1 76  ILE 76  279 279 ILE ILE A . n 
A 1 77  ASP 77  280 280 ASP ASP A . n 
A 1 78  GLU 78  281 281 GLU GLU A . n 
A 1 79  ALA 79  282 282 ALA ALA A . n 
A 1 80  ARG 80  283 283 ARG ARG A . n 
A 1 81  GLY 81  284 284 GLY GLY A . n 
A 1 82  LYS 82  285 285 LYS LYS A . n 
A 1 83  ASN 83  286 286 ASN ASN A . n 
A 1 84  CYS 84  287 287 CYS CYS A . n 
A 1 85  GLY 85  288 288 GLY GLY A . n 
A 1 86  VAL 86  289 289 VAL VAL A . n 
A 1 87  LEU 87  290 290 LEU LEU A . n 
A 1 88  VAL 88  291 291 VAL VAL A . n 
A 1 89  HIS 89  292 292 HIS HIS A . n 
A 1 90  SER 90  293 293 SER SER A . n 
A 1 91  LEU 91  294 294 LEU LEU A . n 
A 1 92  ALA 92  295 295 ALA ALA A . n 
A 1 93  GLY 93  296 296 GLY GLY A . n 
A 1 94  ILE 94  297 297 ILE ILE A . n 
A 1 95  SER 95  298 298 SER SER A . n 
A 1 96  ARG 96  299 299 ARG ARG A . n 
A 1 97  SER 97  300 300 SER SER A . n 
A 1 98  VAL 98  301 301 VAL VAL A . n 
A 1 99  THR 99  302 302 THR THR A . n 
A 1 100 VAL 100 303 303 VAL VAL A . n 
A 1 101 THR 101 304 304 THR THR A . n 
A 1 102 VAL 102 305 305 VAL VAL A . n 
A 1 103 ALA 103 306 306 ALA ALA A . n 
A 1 104 TYR 104 307 307 TYR TYR A . n 
A 1 105 LEU 105 308 308 LEU LEU A . n 
A 1 106 MET 106 309 309 MET MET A . n 
A 1 107 GLN 107 310 310 GLN GLN A . n 
A 1 108 LYS 108 311 311 LYS LYS A . n 
A 1 109 LEU 109 312 312 LEU LEU A . n 
A 1 110 ASN 110 313 313 ASN ASN A . n 
A 1 111 LEU 111 314 314 LEU LEU A . n 
A 1 112 SER 112 315 315 SER SER A . n 
A 1 113 MET 113 316 316 MET MET A . n 
A 1 114 ASN 114 317 317 ASN ASN A . n 
A 1 115 ASP 115 318 318 ASP ASP A . n 
A 1 116 ALA 116 319 319 ALA ALA A . n 
A 1 117 TYR 117 320 320 TYR TYR A . n 
A 1 118 ASP 118 321 321 ASP ASP A . n 
A 1 119 ILE 119 322 322 ILE ILE A . n 
A 1 120 VAL 120 323 323 VAL VAL A . n 
A 1 121 LYS 121 324 324 LYS LYS A . n 
A 1 122 MET 122 325 325 MET MET A . n 
A 1 123 LYS 123 326 326 LYS LYS A . n 
A 1 124 LYS 124 327 327 LYS LYS A . n 
A 1 125 SER 125 328 328 SER SER A . n 
A 1 126 ASN 126 329 329 ASN ASN A . n 
A 1 127 ILE 127 330 330 ILE ILE A . n 
A 1 128 SER 128 331 331 SER SER A . n 
A 1 129 PRO 129 332 332 PRO PRO A . n 
A 1 130 ASN 130 333 333 ASN ASN A . n 
A 1 131 PHE 131 334 334 PHE PHE A . n 
A 1 132 ASN 132 335 335 ASN ASN A . n 
A 1 133 PHE 133 336 336 PHE PHE A . n 
A 1 134 MET 134 337 337 MET MET A . n 
A 1 135 GLY 135 338 338 GLY GLY A . n 
A 1 136 GLN 136 339 339 GLN GLN A . n 
A 1 137 LEU 137 340 340 LEU LEU A . n 
A 1 138 LEU 138 341 341 LEU LEU A . n 
A 1 139 ASP 139 342 342 ASP ASP A . n 
A 1 140 PHE 140 343 343 PHE PHE A . n 
A 1 141 GLU 141 344 344 GLU GLU A . n 
A 1 142 ARG 142 345 345 ARG ARG A . n 
A 1 143 THR 143 346 346 THR THR A . n 
A 1 144 LEU 144 347 347 LEU LEU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1  500 500 CL  CL  A . 
C 3 MPD 1  501 501 MPD MPD A . 
D 4 HOH 1  400 400 HOH HOH A . 
D 4 HOH 2  401 401 HOH HOH A . 
D 4 HOH 3  402 402 HOH HOH A . 
D 4 HOH 4  403 403 HOH HOH A . 
D 4 HOH 5  404 404 HOH HOH A . 
D 4 HOH 6  405 405 HOH HOH A . 
D 4 HOH 7  406 406 HOH HOH A . 
D 4 HOH 8  407 407 HOH HOH A . 
D 4 HOH 9  408 408 HOH HOH A . 
D 4 HOH 10 409 409 HOH HOH A . 
D 4 HOH 11 410 410 HOH HOH A . 
D 4 HOH 12 411 411 HOH HOH A . 
D 4 HOH 13 412 412 HOH HOH A . 
D 4 HOH 14 413 413 HOH HOH A . 
D 4 HOH 15 414 414 HOH HOH A . 
D 4 HOH 16 415 415 HOH HOH A . 
D 4 HOH 17 416 416 HOH HOH A . 
D 4 HOH 18 417 417 HOH HOH A . 
D 4 HOH 19 418 418 HOH HOH A . 
D 4 HOH 20 419 419 HOH HOH A . 
D 4 HOH 21 420 420 HOH HOH A . 
D 4 HOH 22 421 421 HOH HOH A . 
D 4 HOH 23 422 422 HOH HOH A . 
D 4 HOH 24 423 423 HOH HOH A . 
D 4 HOH 25 424 424 HOH HOH A . 
D 4 HOH 26 425 425 HOH HOH A . 
D 4 HOH 27 426 426 HOH HOH A . 
D 4 HOH 28 427 427 HOH HOH A . 
D 4 HOH 29 428 428 HOH HOH A . 
D 4 HOH 30 429 429 HOH HOH A . 
D 4 HOH 31 430 430 HOH HOH A . 
D 4 HOH 32 431 431 HOH HOH A . 
D 4 HOH 33 432 432 HOH HOH A . 
D 4 HOH 34 433 433 HOH HOH A . 
D 4 HOH 35 434 434 HOH HOH A . 
D 4 HOH 36 435 435 HOH HOH A . 
D 4 HOH 37 436 436 HOH HOH A . 
D 4 HOH 38 437 437 HOH HOH A . 
D 4 HOH 39 438 438 HOH HOH A . 
D 4 HOH 40 439 439 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-07-22 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' 3.8 ? 1 
X-PLOR    refinement       3.8 ? 2 
HKL       'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
X-PLOR    phasing          3.8 ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 247 ? ? -162.44 93.81  
2 1 ILE A 330 ? ? -38.27  129.12 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 220 ? CG  ? A LYS 17 CG  
2  1 Y 1 A LYS 220 ? CD  ? A LYS 17 CD  
3  1 Y 1 A LYS 220 ? CE  ? A LYS 17 CE  
4  1 Y 1 A LYS 220 ? NZ  ? A LYS 17 NZ  
5  1 Y 1 A GLU 229 ? CG  ? A GLU 26 CG  
6  1 Y 1 A GLU 229 ? CD  ? A GLU 26 CD  
7  1 Y 1 A GLU 229 ? OE1 ? A GLU 26 OE1 
8  1 Y 1 A GLU 229 ? OE2 ? A GLU 26 OE2 
9  1 Y 1 A LYS 234 ? CG  ? A LYS 31 CG  
10 1 Y 1 A LYS 234 ? CD  ? A LYS 31 CD  
11 1 Y 1 A LYS 234 ? CE  ? A LYS 31 CE  
12 1 Y 1 A LYS 234 ? NZ  ? A LYS 31 NZ  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION'                  CL  
3 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 
4 water                           HOH 
#