data_1ML0
# 
_entry.id   1ML0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ML0         
RCSB  RCSB016993   
WWPDB D_1000016993 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1MKF 'VIRAL CHEMOKINE BINDING PROTEIN M3 FROM MURINE GAMMAHERPESVIRUS68' unspecified 
PDB 1DOK 'MONOCYTE CHEMOATTRACTANT PROTEIN 1'                                unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ML0 
_pdbx_database_status.recvd_initial_deposition_date   2002-08-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Alexander, J.M.' 1 
'Fremont, D.H.'   2 
# 
_citation.id                        primary 
_citation.title                     'Structural Basis of Chemokine Sequestration by a Herpesvirus Decoy Receptor' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            111 
_citation.page_first                343 
_citation.page_last                 356 
_citation.year                      2002 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12419245 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(02)01007-3' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Alexander, J.M.' 1  
primary 'Nelson, C.A.'    2  
primary 'van Berkel, V.'  3  
primary 'Lau, E.K.'       4  
primary 'Studts, J.M.'    5  
primary 'Brett, T.J.'     6  
primary 'Speck, S.H.'     7  
primary 'Handel, T.M.'    8  
primary 'Virgin, H.W.'    9  
primary 'Fremont, D.H.'   10 
# 
_cell.entry_id           1ML0 
_cell.length_a           99.200 
_cell.length_b           99.200 
_cell.length_c           78.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ML0 
_symmetry.space_group_name_H-M             'P 3 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                150 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'M3 Protein'               41826.230 1  ? ?   ? ? 
2 polymer man 'Small Inducible Cytokine' 8654.971  1  ? P8A ? ? 
3 water   nat water                      18.015    43 ? ?   ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
;CCL2, Monocyte chemotactic protein 1, MCP-1, Monocyte chemotactic protein 1, MCP-1, Monocyte chemoattractant protein-1,
Monocyte chemotactic and activating factor, MCAF, Monocyte secretory protein JE, HC11
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;LTLGLAPALSTHSSGVSTQSVDLSQIKRGDEIQAHCLTPAETEVTECAGILKDVLSKNLHELQGLCNVKNKMGVPWVSVE
ELGQEIITGRLPFPSVGGTPVNDLVRVLVVAESNTPEETPEEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPK
SYVDVGMLTRATFLEQWPGAKVTVMIPYSSTFTWCGELGAISEESAPQPSLSARSPVCKNSARYSTSKFCEVDGCTAETG
MEKMSLLTPFGGPPQQAKMNTCPCYYKYSVSPLPAMDHLILADLAGLDSLTSPVYVMAAYFDSTHENPVRPSSKLYHCAL
QMTSHDGVWTSTSSEQCPIRLVEGQSQNVLQVRVAPTSMPNLVGVSLMLEGQQYRLEYFGDH
;
;LTLGLAPALSTHSSGVSTQSVDLSQIKRGDEIQAHCLTPAETEVTECAGILKDVLSKNLHELQGLCNVKNKMGVPWVSVE
ELGQEIITGRLPFPSVGGTPVNDLVRVLVVAESNTPEETPEEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPK
SYVDVGMLTRATFLEQWPGAKVTVMIPYSSTFTWCGELGAISEESAPQPSLSARSPVCKNSARYSTSKFCEVDGCTAETG
MEKMSLLTPFGGPPQQAKMNTCPCYYKYSVSPLPAMDHLILADLAGLDSLTSPVYVMAAYFDSTHENPVRPSSKLYHCAL
QMTSHDGVWTSTSSEQCPIRLVEGQSQNVLQVRVAPTSMPNLVGVSLMLEGQQYRLEYFGDH
;
A ? 
2 'polypeptide(L)' no no QPDAINAAVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSIDHLDKQTQTPKT 
QPDAINAAVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSIDHLDKQTQTPKT D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LEU n 
1 2   THR n 
1 3   LEU n 
1 4   GLY n 
1 5   LEU n 
1 6   ALA n 
1 7   PRO n 
1 8   ALA n 
1 9   LEU n 
1 10  SER n 
1 11  THR n 
1 12  HIS n 
1 13  SER n 
1 14  SER n 
1 15  GLY n 
1 16  VAL n 
1 17  SER n 
1 18  THR n 
1 19  GLN n 
1 20  SER n 
1 21  VAL n 
1 22  ASP n 
1 23  LEU n 
1 24  SER n 
1 25  GLN n 
1 26  ILE n 
1 27  LYS n 
1 28  ARG n 
1 29  GLY n 
1 30  ASP n 
1 31  GLU n 
1 32  ILE n 
1 33  GLN n 
1 34  ALA n 
1 35  HIS n 
1 36  CYS n 
1 37  LEU n 
1 38  THR n 
1 39  PRO n 
1 40  ALA n 
1 41  GLU n 
1 42  THR n 
1 43  GLU n 
1 44  VAL n 
1 45  THR n 
1 46  GLU n 
1 47  CYS n 
1 48  ALA n 
1 49  GLY n 
1 50  ILE n 
1 51  LEU n 
1 52  LYS n 
1 53  ASP n 
1 54  VAL n 
1 55  LEU n 
1 56  SER n 
1 57  LYS n 
1 58  ASN n 
1 59  LEU n 
1 60  HIS n 
1 61  GLU n 
1 62  LEU n 
1 63  GLN n 
1 64  GLY n 
1 65  LEU n 
1 66  CYS n 
1 67  ASN n 
1 68  VAL n 
1 69  LYS n 
1 70  ASN n 
1 71  LYS n 
1 72  MET n 
1 73  GLY n 
1 74  VAL n 
1 75  PRO n 
1 76  TRP n 
1 77  VAL n 
1 78  SER n 
1 79  VAL n 
1 80  GLU n 
1 81  GLU n 
1 82  LEU n 
1 83  GLY n 
1 84  GLN n 
1 85  GLU n 
1 86  ILE n 
1 87  ILE n 
1 88  THR n 
1 89  GLY n 
1 90  ARG n 
1 91  LEU n 
1 92  PRO n 
1 93  PHE n 
1 94  PRO n 
1 95  SER n 
1 96  VAL n 
1 97  GLY n 
1 98  GLY n 
1 99  THR n 
1 100 PRO n 
1 101 VAL n 
1 102 ASN n 
1 103 ASP n 
1 104 LEU n 
1 105 VAL n 
1 106 ARG n 
1 107 VAL n 
1 108 LEU n 
1 109 VAL n 
1 110 VAL n 
1 111 ALA n 
1 112 GLU n 
1 113 SER n 
1 114 ASN n 
1 115 THR n 
1 116 PRO n 
1 117 GLU n 
1 118 GLU n 
1 119 THR n 
1 120 PRO n 
1 121 GLU n 
1 122 GLU n 
1 123 GLU n 
1 124 PHE n 
1 125 TYR n 
1 126 ALA n 
1 127 TYR n 
1 128 VAL n 
1 129 GLU n 
1 130 LEU n 
1 131 GLN n 
1 132 THR n 
1 133 GLU n 
1 134 LEU n 
1 135 TYR n 
1 136 THR n 
1 137 PHE n 
1 138 GLY n 
1 139 LEU n 
1 140 SER n 
1 141 ASP n 
1 142 ASP n 
1 143 ASN n 
1 144 VAL n 
1 145 VAL n 
1 146 PHE n 
1 147 THR n 
1 148 SER n 
1 149 ASP n 
1 150 TYR n 
1 151 MET n 
1 152 THR n 
1 153 VAL n 
1 154 TRP n 
1 155 MET n 
1 156 ILE n 
1 157 ASP n 
1 158 ILE n 
1 159 PRO n 
1 160 LYS n 
1 161 SER n 
1 162 TYR n 
1 163 VAL n 
1 164 ASP n 
1 165 VAL n 
1 166 GLY n 
1 167 MET n 
1 168 LEU n 
1 169 THR n 
1 170 ARG n 
1 171 ALA n 
1 172 THR n 
1 173 PHE n 
1 174 LEU n 
1 175 GLU n 
1 176 GLN n 
1 177 TRP n 
1 178 PRO n 
1 179 GLY n 
1 180 ALA n 
1 181 LYS n 
1 182 VAL n 
1 183 THR n 
1 184 VAL n 
1 185 MET n 
1 186 ILE n 
1 187 PRO n 
1 188 TYR n 
1 189 SER n 
1 190 SER n 
1 191 THR n 
1 192 PHE n 
1 193 THR n 
1 194 TRP n 
1 195 CYS n 
1 196 GLY n 
1 197 GLU n 
1 198 LEU n 
1 199 GLY n 
1 200 ALA n 
1 201 ILE n 
1 202 SER n 
1 203 GLU n 
1 204 GLU n 
1 205 SER n 
1 206 ALA n 
1 207 PRO n 
1 208 GLN n 
1 209 PRO n 
1 210 SER n 
1 211 LEU n 
1 212 SER n 
1 213 ALA n 
1 214 ARG n 
1 215 SER n 
1 216 PRO n 
1 217 VAL n 
1 218 CYS n 
1 219 LYS n 
1 220 ASN n 
1 221 SER n 
1 222 ALA n 
1 223 ARG n 
1 224 TYR n 
1 225 SER n 
1 226 THR n 
1 227 SER n 
1 228 LYS n 
1 229 PHE n 
1 230 CYS n 
1 231 GLU n 
1 232 VAL n 
1 233 ASP n 
1 234 GLY n 
1 235 CYS n 
1 236 THR n 
1 237 ALA n 
1 238 GLU n 
1 239 THR n 
1 240 GLY n 
1 241 MET n 
1 242 GLU n 
1 243 LYS n 
1 244 MET n 
1 245 SER n 
1 246 LEU n 
1 247 LEU n 
1 248 THR n 
1 249 PRO n 
1 250 PHE n 
1 251 GLY n 
1 252 GLY n 
1 253 PRO n 
1 254 PRO n 
1 255 GLN n 
1 256 GLN n 
1 257 ALA n 
1 258 LYS n 
1 259 MET n 
1 260 ASN n 
1 261 THR n 
1 262 CYS n 
1 263 PRO n 
1 264 CYS n 
1 265 TYR n 
1 266 TYR n 
1 267 LYS n 
1 268 TYR n 
1 269 SER n 
1 270 VAL n 
1 271 SER n 
1 272 PRO n 
1 273 LEU n 
1 274 PRO n 
1 275 ALA n 
1 276 MET n 
1 277 ASP n 
1 278 HIS n 
1 279 LEU n 
1 280 ILE n 
1 281 LEU n 
1 282 ALA n 
1 283 ASP n 
1 284 LEU n 
1 285 ALA n 
1 286 GLY n 
1 287 LEU n 
1 288 ASP n 
1 289 SER n 
1 290 LEU n 
1 291 THR n 
1 292 SER n 
1 293 PRO n 
1 294 VAL n 
1 295 TYR n 
1 296 VAL n 
1 297 MET n 
1 298 ALA n 
1 299 ALA n 
1 300 TYR n 
1 301 PHE n 
1 302 ASP n 
1 303 SER n 
1 304 THR n 
1 305 HIS n 
1 306 GLU n 
1 307 ASN n 
1 308 PRO n 
1 309 VAL n 
1 310 ARG n 
1 311 PRO n 
1 312 SER n 
1 313 SER n 
1 314 LYS n 
1 315 LEU n 
1 316 TYR n 
1 317 HIS n 
1 318 CYS n 
1 319 ALA n 
1 320 LEU n 
1 321 GLN n 
1 322 MET n 
1 323 THR n 
1 324 SER n 
1 325 HIS n 
1 326 ASP n 
1 327 GLY n 
1 328 VAL n 
1 329 TRP n 
1 330 THR n 
1 331 SER n 
1 332 THR n 
1 333 SER n 
1 334 SER n 
1 335 GLU n 
1 336 GLN n 
1 337 CYS n 
1 338 PRO n 
1 339 ILE n 
1 340 ARG n 
1 341 LEU n 
1 342 VAL n 
1 343 GLU n 
1 344 GLY n 
1 345 GLN n 
1 346 SER n 
1 347 GLN n 
1 348 ASN n 
1 349 VAL n 
1 350 LEU n 
1 351 GLN n 
1 352 VAL n 
1 353 ARG n 
1 354 VAL n 
1 355 ALA n 
1 356 PRO n 
1 357 THR n 
1 358 SER n 
1 359 MET n 
1 360 PRO n 
1 361 ASN n 
1 362 LEU n 
1 363 VAL n 
1 364 GLY n 
1 365 VAL n 
1 366 SER n 
1 367 LEU n 
1 368 MET n 
1 369 LEU n 
1 370 GLU n 
1 371 GLY n 
1 372 GLN n 
1 373 GLN n 
1 374 TYR n 
1 375 ARG n 
1 376 LEU n 
1 377 GLU n 
1 378 TYR n 
1 379 PHE n 
1 380 GLY n 
1 381 ASP n 
1 382 HIS n 
2 1   GLN n 
2 2   PRO n 
2 3   ASP n 
2 4   ALA n 
2 5   ILE n 
2 6   ASN n 
2 7   ALA n 
2 8   ALA n 
2 9   VAL n 
2 10  THR n 
2 11  CYS n 
2 12  CYS n 
2 13  TYR n 
2 14  ASN n 
2 15  PHE n 
2 16  THR n 
2 17  ASN n 
2 18  ARG n 
2 19  LYS n 
2 20  ILE n 
2 21  SER n 
2 22  VAL n 
2 23  GLN n 
2 24  ARG n 
2 25  LEU n 
2 26  ALA n 
2 27  SER n 
2 28  TYR n 
2 29  ARG n 
2 30  ARG n 
2 31  ILE n 
2 32  THR n 
2 33  SER n 
2 34  SER n 
2 35  LYS n 
2 36  CYS n 
2 37  PRO n 
2 38  LYS n 
2 39  GLU n 
2 40  ALA n 
2 41  VAL n 
2 42  ILE n 
2 43  PHE n 
2 44  LYS n 
2 45  THR n 
2 46  ILE n 
2 47  VAL n 
2 48  ALA n 
2 49  LYS n 
2 50  GLU n 
2 51  ILE n 
2 52  CYS n 
2 53  ALA n 
2 54  ASP n 
2 55  PRO n 
2 56  LYS n 
2 57  GLN n 
2 58  LYS n 
2 59  TRP n 
2 60  VAL n 
2 61  GLN n 
2 62  ASP n 
2 63  SER n 
2 64  ILE n 
2 65  ASP n 
2 66  HIS n 
2 67  LEU n 
2 68  ASP n 
2 69  LYS n 
2 70  GLN n 
2 71  THR n 
2 72  GLN n 
2 73  THR n 
2 74  PRO n 
2 75  LYS n 
2 76  THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'Murine herpesvirus 68' Rhadinovirus M3                                   ? ? ? ? ? ? 'Murid herpesvirus 4' 33708 
? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 Spodoptera  ? ? ? ? ? ?             ? SF9 ? ? ? ? ? BACULOVIRUS ? ? ? ? 
? ? 
2 1 sample ? ? ? human                   Homo         'MONOCYTE CHEMOATTRACTANT PROTEIN 1' ? ? ? ? ? ? 'Homo sapiens'        9606  
? ? ? ? ? ? ? ?               'Escherichia coli'      562  Escherichia ? ? ? ? ? 'BL21 PLYS S' ? ?   ? ? ? ? ? PLASMID     ? ? ? 
PAED-4 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP O41925_MHV68 1 
;LTLGLAPALSTHSSGVSTQSVDLSQIKRGDEIQAHCLTPAETEVTECAGILKDVLSKNLHELQGLCNVKNKMGVPWVSVE
ELGQEIITGRLPFPSVGGTPVNDLVRVLVVAESNTPEETPEEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPK
SYVDVGMLTRATFLEQWPGAKVTVMIPYSSTFTWCGELGAISEESAPQPSLSARSPVCKNSARYSTSKFCEVDGCTAETG
MEKMSLLTPFGGPPQQAKMNTCPCYYKYSVSPLPAMDHLILADLAGLDSLTSPVYVMAAYFDSTHENPVRPSSKLYHCAL
QMTSHDGVWTSTSSEQCPIRLVEGQSQNVLQVRVAPTSMPNLVGVSLMLEGQQYRLEYFGDH
;
25 O41925 ? 
2 UNP CCL2_HUMAN   2 QPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT 24 P13500 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ML0 A 1 ? 382 ? O41925 25 ? 406 ? 1 382 
2 2 1ML0 D 1 ? 76  ? P13500 24 ? 99  ? 1 76  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 1ML0 ALA D 8  ? UNP P13500 PRO 31 ENGINEERED 8  1 
2 1ML0 ILE D 64 ? UNP P13500 MET 87 ENGINEERED 64 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ML0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.21 
_exptl_crystal.density_percent_sol   47 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.10 
_exptl_crystal_grow.pdbx_details    
'14% PEG4000 200MM, SODIUM ACETATE, 100MM MAGNESIUM CHLORIDE, pH 4.10, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2000-06-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.100  1.0 
2 1.000  1.0 
3 0.9796 1.0 
4 0.9789 1.0 
5 0.9599 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             1.100 
_diffrn_source.pdbx_wavelength_list        '1.000, 0.9796, 0.9789, 0.9599' 
# 
_reflns.entry_id                     1ML0 
_reflns.observed_criterion_sigma_I   -3.00 
_reflns.observed_criterion_sigma_F   0.00 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   11156 
_reflns.number_all                   11156 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.088 
_reflns.pdbx_netI_over_sigmaI        14.5 
_reflns.B_iso_Wilson_estimate        70.9 
_reflns.pdbx_redundancy              13.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.97 
_reflns_shell.percent_possible_all   97.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.422 
_reflns_shell.meanI_over_sigI_obs    4.8 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1ML0 
_refine.ls_number_reflns_obs                     10904 
_refine.ls_number_reflns_all                     10904 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               36852.37 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             19.37 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    96.0 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.201 
_refine.ls_R_factor_R_free                       0.282 
_refine.ls_R_factor_R_free_error                 0.012 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  569 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               62.8 
_refine.aniso_B[1][1]                            -14.22 
_refine.aniso_B[2][2]                            -14.22 
_refine.aniso_B[3][3]                            28.43 
_refine.aniso_B[1][2]                            5.30 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 0.316929 
_refine.solvent_model_param_bsol                 43.4831 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1MKF' 
_refine.pdbx_method_to_determine_struct          'MAD AND MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           36852.37 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1ML0 
_refine_analyze.Luzzati_coordinate_error_obs    0.33 
_refine_analyze.Luzzati_sigma_a_obs             0.46 
_refine_analyze.Luzzati_d_res_low_obs           6.00 
_refine_analyze.Luzzati_coordinate_error_free   0.48 
_refine_analyze.Luzzati_sigma_a_free            0.60 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3368 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             43 
_refine_hist.number_atoms_total               3411 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        19.37 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
o_bond_d           0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg        1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d 25.7  ?    ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d 0.87  ?    ? ? 'X-RAY DIFFRACTION' ? 
o_mcbond_it        1.36  1.50 ? ? 'X-RAY DIFFRACTION' ? 
o_mcangle_it       2.42  2.00 ? ? 'X-RAY DIFFRACTION' ? 
o_scbond_it        1.80  2.00 ? ? 'X-RAY DIFFRACTION' ? 
o_scangle_it       2.79  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.97 
_refine_ls_shell.number_reflns_R_work             1564 
_refine_ls_shell.R_factor_R_work                  0.324 
_refine_ls_shell.percent_reflns_obs               89.4 
_refine_ls_shell.R_factor_R_free                  0.371 
_refine_ls_shell.R_factor_R_free_error            0.039 
_refine_ls_shell.percent_reflns_R_free            5.5 
_refine_ls_shell.number_reflns_R_free             91 
_refine_ls_shell.number_reflns_obs                1564 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1ML0 
_struct.title                     
'VIRAL CHEMOKINE BINDING PROTEIN M3 FROM MURINE GAMMAHERPESVIRUS68 IN COMPLEX WITH THE P8A VARIANT OF CC-CHEMOKINE MCP-1' 
_struct.pdbx_descriptor           'M3 Protein/Small Inducible Cytokine' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ML0 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'HERPESVIRUS, VIRAL IMMUNE EVASION, CHEMOKINE BINDING PROTEIN, DECOY RECEPTOR, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 22  ? ILE A 26  ? ASP A 22  ILE A 26  5 ? 5  
HELX_P HELX_P2  2  ARG A 28  ? CYS A 36  ? ARG A 28  CYS A 36  1 ? 9  
HELX_P HELX_P3  3  VAL A 44  ? ASN A 58  ? VAL A 44  ASN A 58  1 ? 15 
HELX_P HELX_P4  4  HIS A 60  ? CYS A 66  ? HIS A 60  CYS A 66  5 ? 7  
HELX_P HELX_P5  5  SER A 161 ? VAL A 163 ? SER A 161 VAL A 163 5 ? 3  
HELX_P HELX_P6  6  ASN A 220 ? SER A 225 ? ASN A 220 SER A 225 5 ? 6  
HELX_P HELX_P7  7  PHE A 229 ? GLY A 234 ? PHE A 229 GLY A 234 1 ? 6  
HELX_P HELX_P8  8  CYS A 262 ? SER A 269 ? CYS A 262 SER A 269 1 ? 8  
HELX_P HELX_P9  9  SER A 358 ? PRO A 360 ? SER A 358 PRO A 360 5 ? 3  
HELX_P HELX_P10 10 SER B 21  ? GLN B 23  ? SER D 21  GLN D 23  5 ? 3  
HELX_P HELX_P11 11 GLN B 57  ? LYS B 69  ? GLN D 57  LYS D 69  1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 36  SG ? ? ? 1_555 A CYS 47  SG ? ? A CYS 36  A CYS 47  1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf2 disulf ? ? A CYS 66  SG ? ? ? 1_555 A CYS 195 SG ? ? A CYS 66  A CYS 195 1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf3 disulf ? ? A CYS 218 SG ? ? ? 1_555 A CYS 264 SG ? ? A CYS 218 A CYS 264 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf4 disulf ? ? A CYS 235 SG ? ? ? 1_555 A CYS 262 SG ? ? A CYS 235 A CYS 262 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf5 disulf ? ? A CYS 318 SG ? ? ? 1_555 A CYS 337 SG ? ? A CYS 318 A CYS 337 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf6 disulf ? ? B CYS 11  SG ? ? ? 1_555 B CYS 36  SG ? ? D CYS 11  D CYS 36  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf7 disulf ? ? B CYS 12  SG ? ? ? 1_555 B CYS 52  SG ? ? D CYS 12  D CYS 52  1_555 ? ? ? ? ? ? ? 2.029 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 5 ? 
C ? 6 ? 
D ? 5 ? 
E ? 2 ? 
F ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 15  ? THR A 18  ? GLY A 15  THR A 18  
A 2 VAL A 68  ? PRO A 75  ? VAL A 68  PRO A 75  
A 3 PHE A 192 ? ILE A 201 ? PHE A 192 ILE A 201 
A 4 LYS A 181 ? SER A 189 ? LYS A 181 SER A 189 
A 5 LEU A 104 ? GLU A 112 ? LEU A 104 GLU A 112 
A 6 MET A 151 ? PRO A 159 ? MET A 151 PRO A 159 
A 7 VAL A 144 ? SER A 148 ? VAL A 144 SER A 148 
B 1 VAL A 77  ? VAL A 79  ? VAL A 77  VAL A 79  
B 2 GLN A 84  ? GLY A 89  ? GLN A 84  GLY A 89  
B 3 LEU A 168 ? PHE A 173 ? LEU A 168 PHE A 173 
B 4 TYR A 127 ? GLN A 131 ? TYR A 127 GLN A 131 
B 5 THR A 136 ? GLY A 138 ? THR A 136 GLY A 138 
C 1 SER A 212 ? PRO A 216 ? SER A 212 PRO A 216 
C 2 GLN A 372 ? GLU A 377 ? GLN A 372 GLU A 377 
C 3 LEU A 362 ? LEU A 369 ? LEU A 362 LEU A 369 
C 4 VAL A 294 ? PHE A 301 ? VAL A 294 PHE A 301 
C 5 LEU A 315 ? HIS A 325 ? LEU A 315 HIS A 325 
C 6 VAL A 328 ? SER A 331 ? VAL A 328 SER A 331 
D 1 MET A 244 ? LEU A 246 ? MET A 244 LEU A 246 
D 2 GLN A 256 ? ASN A 260 ? GLN A 256 ASN A 260 
D 3 LEU A 279 ? ALA A 285 ? LEU A 279 ALA A 285 
D 4 VAL A 349 ? VAL A 354 ? VAL A 349 VAL A 354 
D 5 ILE A 339 ? GLU A 343 ? ILE A 339 GLU A 343 
E 1 LEU A 273 ? PRO A 274 ? LEU A 273 PRO A 274 
E 2 THR B 10  ? CYS B 11  ? THR D 10  CYS D 11  
F 1 LEU B 25  ? ARG B 30  ? LEU D 25  ARG D 30  
F 2 VAL B 41  ? THR B 45  ? VAL D 41  THR D 45  
F 3 GLU B 50  ? ALA B 53  ? GLU D 50  ALA D 53  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 15  ? N GLY A 15  O LYS A 71  ? O LYS A 71  
A 2 3 N VAL A 74  ? N VAL A 74  O GLY A 199 ? O GLY A 199 
A 3 4 O TRP A 194 ? O TRP A 194 N ILE A 186 ? N ILE A 186 
A 4 5 O MET A 185 ? O MET A 185 N LEU A 108 ? N LEU A 108 
A 5 6 N VAL A 105 ? N VAL A 105 O ILE A 158 ? O ILE A 158 
A 6 7 O VAL A 153 ? O VAL A 153 N PHE A 146 ? N PHE A 146 
B 1 2 N VAL A 77  ? N VAL A 77  O ILE A 86  ? O ILE A 86  
B 2 3 N ILE A 87  ? N ILE A 87  O ALA A 171 ? O ALA A 171 
B 3 4 O LEU A 168 ? O LEU A 168 N GLN A 131 ? N GLN A 131 
B 4 5 N LEU A 130 ? N LEU A 130 O PHE A 137 ? O PHE A 137 
C 1 2 N SER A 215 ? N SER A 215 O ARG A 375 ? O ARG A 375 
C 2 3 O GLN A 372 ? O GLN A 372 N LEU A 369 ? N LEU A 369 
C 3 4 O SER A 366 ? O SER A 366 N MET A 297 ? N MET A 297 
C 4 5 N VAL A 296 ? N VAL A 296 O LEU A 320 ? O LEU A 320 
C 5 6 N HIS A 325 ? N HIS A 325 O VAL A 328 ? O VAL A 328 
D 1 2 N SER A 245 ? N SER A 245 O MET A 259 ? O MET A 259 
D 2 3 N GLN A 256 ? N GLN A 256 O ALA A 285 ? O ALA A 285 
D 3 4 N LEU A 284 ? N LEU A 284 O LEU A 350 ? O LEU A 350 
D 4 5 O GLN A 351 ? O GLN A 351 N VAL A 342 ? N VAL A 342 
E 1 2 N LEU A 273 ? N LEU A 273 O CYS B 11  ? O CYS D 11  
F 1 2 N ARG B 29  ? N ARG D 29  O ILE B 42  ? O ILE D 42  
F 2 3 N PHE B 43  ? N PHE D 43  O ILE B 51  ? O ILE D 51  
# 
_database_PDB_matrix.entry_id          1ML0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ML0 
_atom_sites.fract_transf_matrix[1][1]   0.010081 
_atom_sites.fract_transf_matrix[1][2]   0.005820 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011640 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012674 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . HIS A 1 12  ? 38.955 9.564   8.009  1.00 90.06  ? 12  HIS A N   1 
ATOM   2    C CA  . HIS A 1 12  ? 39.949 8.811   8.827  1.00 89.74  ? 12  HIS A CA  1 
ATOM   3    C C   . HIS A 1 12  ? 39.290 7.648   9.536  1.00 88.05  ? 12  HIS A C   1 
ATOM   4    O O   . HIS A 1 12  ? 38.080 7.445   9.438  1.00 88.03  ? 12  HIS A O   1 
ATOM   5    C CB  . HIS A 1 12  ? 40.602 9.728   9.862  1.00 92.10  ? 12  HIS A CB  1 
ATOM   6    C CG  . HIS A 1 12  ? 41.328 10.885  9.255  1.00 96.13  ? 12  HIS A CG  1 
ATOM   7    N ND1 . HIS A 1 12  ? 42.421 10.724  8.430  1.00 97.98  ? 12  HIS A ND1 1 
ATOM   8    C CD2 . HIS A 1 12  ? 41.086 12.218  9.303  1.00 97.34  ? 12  HIS A CD2 1 
ATOM   9    C CE1 . HIS A 1 12  ? 42.819 11.906  7.993  1.00 98.39  ? 12  HIS A CE1 1 
ATOM   10   N NE2 . HIS A 1 12  ? 42.026 12.830  8.507  1.00 98.00  ? 12  HIS A NE2 1 
ATOM   11   N N   . SER A 1 13  ? 40.100 6.892   10.261 1.00 85.79  ? 13  SER A N   1 
ATOM   12   C CA  . SER A 1 13  ? 39.613 5.733   10.983 1.00 84.03  ? 13  SER A CA  1 
ATOM   13   C C   . SER A 1 13  ? 39.042 6.079   12.355 1.00 82.41  ? 13  SER A C   1 
ATOM   14   O O   . SER A 1 13  ? 38.699 5.179   13.123 1.00 83.53  ? 13  SER A O   1 
ATOM   15   C CB  . SER A 1 13  ? 40.748 4.724   11.142 1.00 84.54  ? 13  SER A CB  1 
ATOM   16   O OG  . SER A 1 13  ? 41.873 5.341   11.747 1.00 86.56  ? 13  SER A OG  1 
ATOM   17   N N   . SER A 1 14  ? 38.930 7.371   12.664 1.00 79.07  ? 14  SER A N   1 
ATOM   18   C CA  . SER A 1 14  ? 38.409 7.795   13.966 1.00 75.03  ? 14  SER A CA  1 
ATOM   19   C C   . SER A 1 14  ? 38.124 9.295   14.028 1.00 72.18  ? 14  SER A C   1 
ATOM   20   O O   . SER A 1 14  ? 38.671 10.066  13.238 1.00 73.20  ? 14  SER A O   1 
ATOM   21   C CB  . SER A 1 14  ? 39.414 7.445   15.061 1.00 74.88  ? 14  SER A CB  1 
ATOM   22   O OG  . SER A 1 14  ? 40.576 8.245   14.936 1.00 74.25  ? 14  SER A OG  1 
ATOM   23   N N   . GLY A 1 15  ? 37.282 9.706   14.977 1.00 67.75  ? 15  GLY A N   1 
ATOM   24   C CA  . GLY A 1 15  ? 36.956 11.118  15.114 1.00 62.74  ? 15  GLY A CA  1 
ATOM   25   C C   . GLY A 1 15  ? 35.665 11.448  15.850 1.00 59.72  ? 15  GLY A C   1 
ATOM   26   O O   . GLY A 1 15  ? 34.930 10.557  16.277 1.00 59.79  ? 15  GLY A O   1 
ATOM   27   N N   . VAL A 1 16  ? 35.393 12.744  15.991 1.00 56.53  ? 16  VAL A N   1 
ATOM   28   C CA  . VAL A 1 16  ? 34.200 13.236  16.679 1.00 52.18  ? 16  VAL A CA  1 
ATOM   29   C C   . VAL A 1 16  ? 33.466 14.233  15.777 1.00 51.36  ? 16  VAL A C   1 
ATOM   30   O O   . VAL A 1 16  ? 34.069 15.196  15.305 1.00 51.47  ? 16  VAL A O   1 
ATOM   31   C CB  . VAL A 1 16  ? 34.587 13.932  17.998 1.00 49.88  ? 16  VAL A CB  1 
ATOM   32   C CG1 . VAL A 1 16  ? 33.346 14.381  18.750 1.00 50.62  ? 16  VAL A CG1 1 
ATOM   33   C CG2 . VAL A 1 16  ? 35.405 12.992  18.841 1.00 46.94  ? 16  VAL A CG2 1 
ATOM   34   N N   . SER A 1 17  ? 32.173 13.994  15.541 1.00 49.93  ? 17  SER A N   1 
ATOM   35   C CA  . SER A 1 17  ? 31.355 14.855  14.687 1.00 48.55  ? 17  SER A CA  1 
ATOM   36   C C   . SER A 1 17  ? 30.058 15.322  15.343 1.00 49.38  ? 17  SER A C   1 
ATOM   37   O O   . SER A 1 17  ? 29.576 14.738  16.317 1.00 49.63  ? 17  SER A O   1 
ATOM   38   C CB  . SER A 1 17  ? 30.993 14.122  13.403 1.00 46.88  ? 17  SER A CB  1 
ATOM   39   O OG  . SER A 1 17  ? 32.130 13.514  12.834 1.00 50.14  ? 17  SER A OG  1 
ATOM   40   N N   . THR A 1 18  ? 29.486 16.381  14.780 1.00 49.95  ? 18  THR A N   1 
ATOM   41   C CA  . THR A 1 18  ? 28.233 16.932  15.273 1.00 49.83  ? 18  THR A CA  1 
ATOM   42   C C   . THR A 1 18  ? 27.391 17.468  14.119 1.00 49.39  ? 18  THR A C   1 
ATOM   43   O O   . THR A 1 18  ? 27.912 17.870  13.083 1.00 48.06  ? 18  THR A O   1 
ATOM   44   C CB  . THR A 1 18  ? 28.474 18.078  16.261 1.00 50.40  ? 18  THR A CB  1 
ATOM   45   O OG1 . THR A 1 18  ? 29.198 19.123  15.599 1.00 51.15  ? 18  THR A OG1 1 
ATOM   46   C CG2 . THR A 1 18  ? 29.255 17.583  17.479 1.00 48.71  ? 18  THR A CG2 1 
ATOM   47   N N   . GLN A 1 19  ? 26.082 17.475  14.316 1.00 49.77  ? 19  GLN A N   1 
ATOM   48   C CA  . GLN A 1 19  ? 25.154 17.961  13.312 1.00 50.76  ? 19  GLN A CA  1 
ATOM   49   C C   . GLN A 1 19  ? 23.837 18.230  14.031 1.00 53.46  ? 19  GLN A C   1 
ATOM   50   O O   . GLN A 1 19  ? 23.610 17.705  15.123 1.00 55.06  ? 19  GLN A O   1 
ATOM   51   C CB  . GLN A 1 19  ? 24.939 16.892  12.256 1.00 48.17  ? 19  GLN A CB  1 
ATOM   52   C CG  . GLN A 1 19  ? 24.272 15.651  12.808 1.00 47.51  ? 19  GLN A CG  1 
ATOM   53   C CD  . GLN A 1 19  ? 23.941 14.664  11.727 1.00 46.46  ? 19  GLN A CD  1 
ATOM   54   O OE1 . GLN A 1 19  ? 23.851 15.040  10.560 1.00 47.33  ? 19  GLN A OE1 1 
ATOM   55   N NE2 . GLN A 1 19  ? 23.743 13.397  12.100 1.00 42.95  ? 19  GLN A NE2 1 
ATOM   56   N N   . SER A 1 20  ? 22.969 19.039  13.434 1.00 54.45  ? 20  SER A N   1 
ATOM   57   C CA  . SER A 1 20  ? 21.675 19.320  14.052 1.00 55.28  ? 20  SER A CA  1 
ATOM   58   C C   . SER A 1 20  ? 20.763 18.161  13.701 1.00 55.12  ? 20  SER A C   1 
ATOM   59   O O   . SER A 1 20  ? 20.923 17.550  12.647 1.00 55.23  ? 20  SER A O   1 
ATOM   60   C CB  . SER A 1 20  ? 21.078 20.611  13.502 1.00 55.28  ? 20  SER A CB  1 
ATOM   61   O OG  . SER A 1 20  ? 22.020 21.661  13.577 1.00 59.05  ? 20  SER A OG  1 
ATOM   62   N N   . VAL A 1 21  ? 19.811 17.855  14.577 1.00 55.39  ? 21  VAL A N   1 
ATOM   63   C CA  . VAL A 1 21  ? 18.881 16.758  14.318 1.00 54.79  ? 21  VAL A CA  1 
ATOM   64   C C   . VAL A 1 21  ? 17.434 17.235  14.324 1.00 55.68  ? 21  VAL A C   1 
ATOM   65   O O   . VAL A 1 21  ? 16.779 17.269  15.369 1.00 54.83  ? 21  VAL A O   1 
ATOM   66   C CB  . VAL A 1 21  ? 19.048 15.609  15.356 1.00 53.60  ? 21  VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 21  ? 18.061 14.486  15.066 1.00 49.03  ? 21  VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 21  ? 20.478 15.076  15.314 1.00 52.14  ? 21  VAL A CG2 1 
ATOM   69   N N   . ASP A 1 22  ? 16.943 17.608  13.147 1.00 56.77  ? 22  ASP A N   1 
ATOM   70   C CA  . ASP A 1 22  ? 15.569 18.066  13.016 1.00 58.45  ? 22  ASP A CA  1 
ATOM   71   C C   . ASP A 1 22  ? 14.625 16.926  12.657 1.00 59.95  ? 22  ASP A C   1 
ATOM   72   O O   . ASP A 1 22  ? 14.481 16.604  11.474 1.00 60.39  ? 22  ASP A O   1 
ATOM   73   C CB  . ASP A 1 22  ? 15.473 19.115  11.935 1.00 58.24  ? 22  ASP A CB  1 
ATOM   74   C CG  . ASP A 1 22  ? 14.110 19.727  11.869 1.00 59.41  ? 22  ASP A CG  1 
ATOM   75   O OD1 . ASP A 1 22  ? 13.202 19.193  12.541 1.00 57.10  ? 22  ASP A OD1 1 
ATOM   76   O OD2 . ASP A 1 22  ? 13.950 20.740  11.151 1.00 61.43  ? 22  ASP A OD2 1 
ATOM   77   N N   . LEU A 1 23  ? 13.977 16.340  13.669 1.00 60.68  ? 23  LEU A N   1 
ATOM   78   C CA  . LEU A 1 23  ? 13.048 15.218  13.479 1.00 62.44  ? 23  LEU A CA  1 
ATOM   79   C C   . LEU A 1 23  ? 11.907 15.479  12.500 1.00 64.23  ? 23  LEU A C   1 
ATOM   80   O O   . LEU A 1 23  ? 11.334 14.553  11.913 1.00 62.65  ? 23  LEU A O   1 
ATOM   81   C CB  . LEU A 1 23  ? 12.451 14.804  14.817 1.00 60.73  ? 23  LEU A CB  1 
ATOM   82   C CG  . LEU A 1 23  ? 13.384 14.013  15.725 1.00 59.07  ? 23  LEU A CG  1 
ATOM   83   C CD1 . LEU A 1 23  ? 12.604 13.549  16.923 1.00 59.63  ? 23  LEU A CD1 1 
ATOM   84   C CD2 . LEU A 1 23  ? 13.971 12.826  14.979 1.00 58.33  ? 23  LEU A CD2 1 
ATOM   85   N N   . SER A 1 24  ? 11.582 16.755  12.350 1.00 67.31  ? 24  SER A N   1 
ATOM   86   C CA  . SER A 1 24  ? 10.525 17.202  11.459 1.00 69.03  ? 24  SER A CA  1 
ATOM   87   C C   . SER A 1 24  ? 10.849 16.807  10.029 1.00 69.15  ? 24  SER A C   1 
ATOM   88   O O   . SER A 1 24  ? 10.002 16.274  9.320  1.00 70.82  ? 24  SER A O   1 
ATOM   89   C CB  . SER A 1 24  ? 10.403 18.723  11.542 1.00 70.36  ? 24  SER A CB  1 
ATOM   90   O OG  . SER A 1 24  ? 10.642 19.176  12.871 1.00 74.16  ? 24  SER A OG  1 
ATOM   91   N N   . GLN A 1 25  ? 12.080 17.070  9.610  1.00 68.96  ? 25  GLN A N   1 
ATOM   92   C CA  . GLN A 1 25  ? 12.504 16.762  8.252  1.00 69.75  ? 25  GLN A CA  1 
ATOM   93   C C   . GLN A 1 25  ? 13.206 15.411  8.117  1.00 69.08  ? 25  GLN A C   1 
ATOM   94   O O   . GLN A 1 25  ? 14.121 15.243  7.307  1.00 68.12  ? 25  GLN A O   1 
ATOM   95   C CB  . GLN A 1 25  ? 13.396 17.893  7.743  1.00 72.05  ? 25  GLN A CB  1 
ATOM   96   C CG  . GLN A 1 25  ? 14.250 18.516  8.842  1.00 75.69  ? 25  GLN A CG  1 
ATOM   97   C CD  . GLN A 1 25  ? 14.634 19.958  8.542  1.00 78.06  ? 25  GLN A CD  1 
ATOM   98   O OE1 . GLN A 1 25  ? 13.767 20.814  8.316  1.00 78.21  ? 25  GLN A OE1 1 
ATOM   99   N NE2 . GLN A 1 25  ? 15.937 20.236  8.544  1.00 78.09  ? 25  GLN A NE2 1 
ATOM   100  N N   . ILE A 1 26  ? 12.767 14.445  8.916  1.00 68.12  ? 26  ILE A N   1 
ATOM   101  C CA  . ILE A 1 26  ? 13.331 13.107  8.866  1.00 66.62  ? 26  ILE A CA  1 
ATOM   102  C C   . ILE A 1 26  ? 12.173 12.140  8.792  1.00 66.37  ? 26  ILE A C   1 
ATOM   103  O O   . ILE A 1 26  ? 11.384 12.038  9.733  1.00 67.23  ? 26  ILE A O   1 
ATOM   104  C CB  . ILE A 1 26  ? 14.148 12.785  10.118 1.00 66.35  ? 26  ILE A CB  1 
ATOM   105  C CG1 . ILE A 1 26  ? 15.376 13.687  10.173 1.00 64.88  ? 26  ILE A CG1 1 
ATOM   106  C CG2 . ILE A 1 26  ? 14.545 11.311  10.115 1.00 64.95  ? 26  ILE A CG2 1 
ATOM   107  C CD1 . ILE A 1 26  ? 16.091 13.624  11.486 1.00 66.10  ? 26  ILE A CD1 1 
ATOM   108  N N   . LYS A 1 27  ? 12.075 11.439  7.670  1.00 65.22  ? 27  LYS A N   1 
ATOM   109  C CA  . LYS A 1 27  ? 11.012 10.472  7.447  1.00 64.14  ? 27  LYS A CA  1 
ATOM   110  C C   . LYS A 1 27  ? 10.628 9.687   8.707  1.00 63.29  ? 27  LYS A C   1 
ATOM   111  O O   . LYS A 1 27  ? 11.447 8.958   9.282  1.00 63.18  ? 27  LYS A O   1 
ATOM   112  C CB  . LYS A 1 27  ? 11.426 9.512   6.329  1.00 65.59  ? 27  LYS A CB  1 
ATOM   113  C CG  . LYS A 1 27  ? 11.808 10.220  5.022  1.00 68.17  ? 27  LYS A CG  1 
ATOM   114  C CD  . LYS A 1 27  ? 10.699 11.176  4.512  1.00 68.94  ? 27  LYS A CD  1 
ATOM   115  C CE  . LYS A 1 27  ? 9.446  10.440  3.999  1.00 68.58  ? 27  LYS A CE  1 
ATOM   116  N NZ  . LYS A 1 27  ? 8.698  9.675   5.053  1.00 66.80  ? 27  LYS A NZ  1 
ATOM   117  N N   . ARG A 1 28  ? 9.375  9.854   9.126  1.00 60.72  ? 28  ARG A N   1 
ATOM   118  C CA  . ARG A 1 28  ? 8.839  9.185   10.304 1.00 59.20  ? 28  ARG A CA  1 
ATOM   119  C C   . ARG A 1 28  ? 9.770  9.310   11.485 1.00 59.96  ? 28  ARG A C   1 
ATOM   120  O O   . ARG A 1 28  ? 9.809  8.440   12.347 1.00 58.79  ? 28  ARG A O   1 
ATOM   121  C CB  . ARG A 1 28  ? 8.566  7.709   9.997  1.00 56.88  ? 28  ARG A CB  1 
ATOM   122  C CG  . ARG A 1 28  ? 7.486  7.545   8.950  1.00 54.89  ? 28  ARG A CG  1 
ATOM   123  C CD  . ARG A 1 28  ? 7.152  6.101   8.620  1.00 54.55  ? 28  ARG A CD  1 
ATOM   124  N NE  . ARG A 1 28  ? 6.336  5.405   9.615  1.00 51.79  ? 28  ARG A NE  1 
ATOM   125  C CZ  . ARG A 1 28  ? 5.939  4.138   9.479  1.00 52.04  ? 28  ARG A CZ  1 
ATOM   126  N NH1 . ARG A 1 28  ? 6.288  3.450   8.394  1.00 51.61  ? 28  ARG A NH1 1 
ATOM   127  N NH2 . ARG A 1 28  ? 5.206  3.548   10.419 1.00 48.19  ? 28  ARG A NH2 1 
ATOM   128  N N   . GLY A 1 29  ? 10.509 10.412  11.521 1.00 62.63  ? 29  GLY A N   1 
ATOM   129  C CA  . GLY A 1 29  ? 11.448 10.645  12.602 1.00 65.47  ? 29  GLY A CA  1 
ATOM   130  C C   . GLY A 1 29  ? 10.813 10.483  13.966 1.00 67.70  ? 29  GLY A C   1 
ATOM   131  O O   . GLY A 1 29  ? 11.277 9.698   14.790 1.00 68.49  ? 29  GLY A O   1 
ATOM   132  N N   . ASP A 1 30  ? 9.742  11.226  14.202 1.00 69.97  ? 30  ASP A N   1 
ATOM   133  C CA  . ASP A 1 30  ? 9.025  11.176  15.469 1.00 72.46  ? 30  ASP A CA  1 
ATOM   134  C C   . ASP A 1 30  ? 8.712  9.735   15.870 1.00 72.80  ? 30  ASP A C   1 
ATOM   135  O O   . ASP A 1 30  ? 8.940  9.327   17.020 1.00 73.58  ? 30  ASP A O   1 
ATOM   136  C CB  . ASP A 1 30  ? 7.739  11.967  15.323 1.00 75.28  ? 30  ASP A CB  1 
ATOM   137  C CG  . ASP A 1 30  ? 7.652  12.659  13.974 1.00 80.22  ? 30  ASP A CG  1 
ATOM   138  O OD1 . ASP A 1 30  ? 7.667  11.945  12.938 1.00 79.93  ? 30  ASP A OD1 1 
ATOM   139  O OD2 . ASP A 1 30  ? 7.586  13.913  13.951 1.00 82.09  ? 30  ASP A OD2 1 
ATOM   140  N N   . GLU A 1 31  ? 8.198  8.969   14.913 1.00 70.98  ? 31  GLU A N   1 
ATOM   141  C CA  . GLU A 1 31  ? 7.848  7.577   15.152 1.00 69.85  ? 31  GLU A CA  1 
ATOM   142  C C   . GLU A 1 31  ? 9.032  6.717   15.574 1.00 69.47  ? 31  GLU A C   1 
ATOM   143  O O   . GLU A 1 31  ? 8.917  5.863   16.457 1.00 69.21  ? 31  GLU A O   1 
ATOM   144  C CB  . GLU A 1 31  ? 7.229  6.982   13.900 1.00 70.12  ? 31  GLU A CB  1 
ATOM   145  C CG  . GLU A 1 31  ? 6.040  7.746   13.378 1.00 68.40  ? 31  GLU A CG  1 
ATOM   146  C CD  . GLU A 1 31  ? 5.194  6.886   12.467 1.00 68.35  ? 31  GLU A CD  1 
ATOM   147  O OE1 . GLU A 1 31  ? 4.766  5.799   12.921 1.00 68.08  ? 31  GLU A OE1 1 
ATOM   148  O OE2 . GLU A 1 31  ? 4.959  7.292   11.310 1.00 67.97  ? 31  GLU A OE2 1 
ATOM   149  N N   . ILE A 1 32  ? 10.168 6.928   14.925 1.00 69.15  ? 32  ILE A N   1 
ATOM   150  C CA  . ILE A 1 32  ? 11.362 6.169   15.256 1.00 70.49  ? 32  ILE A CA  1 
ATOM   151  C C   . ILE A 1 32  ? 11.708 6.443   16.707 1.00 71.05  ? 32  ILE A C   1 
ATOM   152  O O   . ILE A 1 32  ? 11.679 5.548   17.554 1.00 70.93  ? 32  ILE A O   1 
ATOM   153  C CB  . ILE A 1 32  ? 12.553 6.587   14.377 1.00 70.44  ? 32  ILE A CB  1 
ATOM   154  C CG1 . ILE A 1 32  ? 12.271 6.223   12.916 1.00 70.78  ? 32  ILE A CG1 1 
ATOM   155  C CG2 . ILE A 1 32  ? 13.818 5.897   14.859 1.00 69.98  ? 32  ILE A CG2 1 
ATOM   156  C CD1 . ILE A 1 32  ? 13.135 6.969   11.920 1.00 71.14  ? 32  ILE A CD1 1 
ATOM   157  N N   . GLN A 1 33  ? 12.025 7.701   16.981 1.00 72.48  ? 33  GLN A N   1 
ATOM   158  C CA  . GLN A 1 33  ? 12.379 8.144   18.322 1.00 73.90  ? 33  GLN A CA  1 
ATOM   159  C C   . GLN A 1 33  ? 11.379 7.624   19.362 1.00 73.16  ? 33  GLN A C   1 
ATOM   160  O O   . GLN A 1 33  ? 11.737 7.369   20.509 1.00 73.84  ? 33  GLN A O   1 
ATOM   161  C CB  . GLN A 1 33  ? 12.438 9.682   18.346 1.00 74.73  ? 33  GLN A CB  1 
ATOM   162  C CG  . GLN A 1 33  ? 12.771 10.285  19.697 1.00 78.60  ? 33  GLN A CG  1 
ATOM   163  C CD  . GLN A 1 33  ? 11.545 10.443  20.580 1.00 81.73  ? 33  GLN A CD  1 
ATOM   164  O OE1 . GLN A 1 33  ? 11.636 10.362  21.809 1.00 82.53  ? 33  GLN A OE1 1 
ATOM   165  N NE2 . GLN A 1 33  ? 10.388 10.687  19.957 1.00 82.33  ? 33  GLN A NE2 1 
ATOM   166  N N   . ALA A 1 34  ? 10.131 7.447   18.943 1.00 71.60  ? 34  ALA A N   1 
ATOM   167  C CA  . ALA A 1 34  ? 9.083  6.985   19.837 1.00 70.02  ? 34  ALA A CA  1 
ATOM   168  C C   . ALA A 1 34  ? 9.120  5.489   20.152 1.00 70.05  ? 34  ALA A C   1 
ATOM   169  O O   . ALA A 1 34  ? 9.069  5.093   21.321 1.00 70.02  ? 34  ALA A O   1 
ATOM   170  C CB  . ALA A 1 34  ? 7.731  7.359   19.255 1.00 68.77  ? 34  ALA A CB  1 
ATOM   171  N N   . HIS A 1 35  ? 9.212  4.662   19.111 1.00 68.96  ? 35  HIS A N   1 
ATOM   172  C CA  . HIS A 1 35  ? 9.212  3.208   19.278 1.00 66.96  ? 35  HIS A CA  1 
ATOM   173  C C   . HIS A 1 35  ? 10.563 2.529   19.217 1.00 65.29  ? 35  HIS A C   1 
ATOM   174  O O   . HIS A 1 35  ? 10.731 1.428   19.738 1.00 65.04  ? 35  HIS A O   1 
ATOM   175  C CB  . HIS A 1 35  ? 8.313  2.581   18.224 1.00 67.63  ? 35  HIS A CB  1 
ATOM   176  C CG  . HIS A 1 35  ? 6.894  3.022   18.325 1.00 68.72  ? 35  HIS A CG  1 
ATOM   177  N ND1 . HIS A 1 35  ? 6.058  2.599   19.335 1.00 68.66  ? 35  HIS A ND1 1 
ATOM   178  C CD2 . HIS A 1 35  ? 6.176  3.889   17.576 1.00 70.03  ? 35  HIS A CD2 1 
ATOM   179  C CE1 . HIS A 1 35  ? 4.884  3.189   19.203 1.00 70.51  ? 35  HIS A CE1 1 
ATOM   180  N NE2 . HIS A 1 35  ? 4.928  3.977   18.144 1.00 70.44  ? 35  HIS A NE2 1 
ATOM   181  N N   . CYS A 1 36  ? 11.519 3.182   18.573 1.00 64.00  ? 36  CYS A N   1 
ATOM   182  C CA  . CYS A 1 36  ? 12.850 2.617   18.426 1.00 62.77  ? 36  CYS A CA  1 
ATOM   183  C C   . CYS A 1 36  ? 13.867 3.110   19.463 1.00 61.97  ? 36  CYS A C   1 
ATOM   184  O O   . CYS A 1 36  ? 14.661 2.324   19.985 1.00 61.41  ? 36  CYS A O   1 
ATOM   185  C CB  . CYS A 1 36  ? 13.379 2.906   17.021 1.00 62.65  ? 36  CYS A CB  1 
ATOM   186  S SG  . CYS A 1 36  ? 12.467 2.198   15.595 1.00 61.42  ? 36  CYS A SG  1 
ATOM   187  N N   . LEU A 1 37  ? 13.830 4.404   19.772 1.00 60.94  ? 37  LEU A N   1 
ATOM   188  C CA  . LEU A 1 37  ? 14.767 4.986   20.730 1.00 59.14  ? 37  LEU A CA  1 
ATOM   189  C C   . LEU A 1 37  ? 14.202 5.221   22.126 1.00 58.77  ? 37  LEU A C   1 
ATOM   190  O O   . LEU A 1 37  ? 14.906 5.685   23.019 1.00 59.16  ? 37  LEU A O   1 
ATOM   191  C CB  . LEU A 1 37  ? 15.322 6.282   20.155 1.00 58.39  ? 37  LEU A CB  1 
ATOM   192  C CG  . LEU A 1 37  ? 16.071 6.007   18.843 1.00 56.97  ? 37  LEU A CG  1 
ATOM   193  C CD1 . LEU A 1 37  ? 16.343 7.292   18.092 1.00 54.41  ? 37  LEU A CD1 1 
ATOM   194  C CD2 . LEU A 1 37  ? 17.346 5.270   19.149 1.00 53.84  ? 37  LEU A CD2 1 
ATOM   195  N N   . THR A 1 38  ? 12.927 4.897   22.308 1.00 58.48  ? 38  THR A N   1 
ATOM   196  C CA  . THR A 1 38  ? 12.264 5.032   23.604 1.00 57.19  ? 38  THR A CA  1 
ATOM   197  C C   . THR A 1 38  ? 11.885 3.622   24.012 1.00 56.72  ? 38  THR A C   1 
ATOM   198  O O   . THR A 1 38  ? 11.483 2.829   23.165 1.00 58.38  ? 38  THR A O   1 
ATOM   199  C CB  . THR A 1 38  ? 10.978 5.859   23.502 1.00 56.21  ? 38  THR A CB  1 
ATOM   200  O OG1 . THR A 1 38  ? 11.304 7.250   23.416 1.00 55.85  ? 38  THR A OG1 1 
ATOM   201  C CG2 . THR A 1 38  ? 10.109 5.623   24.713 1.00 57.36  ? 38  THR A CG2 1 
ATOM   202  N N   . PRO A 1 39  ? 12.020 3.275   25.302 1.00 55.49  ? 39  PRO A N   1 
ATOM   203  C CA  . PRO A 1 39  ? 11.650 1.907   25.686 1.00 55.04  ? 39  PRO A CA  1 
ATOM   204  C C   . PRO A 1 39  ? 10.130 1.683   25.745 1.00 55.13  ? 39  PRO A C   1 
ATOM   205  O O   . PRO A 1 39  ? 9.543  1.586   26.815 1.00 54.81  ? 39  PRO A O   1 
ATOM   206  C CB  . PRO A 1 39  ? 12.344 1.729   27.036 1.00 52.86  ? 39  PRO A CB  1 
ATOM   207  C CG  . PRO A 1 39  ? 12.356 3.100   27.579 1.00 54.44  ? 39  PRO A CG  1 
ATOM   208  C CD  . PRO A 1 39  ? 12.721 3.958   26.399 1.00 53.65  ? 39  PRO A CD  1 
ATOM   209  N N   . ALA A 1 40  ? 9.510  1.591   24.572 1.00 55.07  ? 40  ALA A N   1 
ATOM   210  C CA  . ALA A 1 40  ? 8.071  1.389   24.454 1.00 56.22  ? 40  ALA A CA  1 
ATOM   211  C C   . ALA A 1 40  ? 7.686  -0.086  24.498 1.00 57.73  ? 40  ALA A C   1 
ATOM   212  O O   . ALA A 1 40  ? 7.854  -0.743  25.528 1.00 57.63  ? 40  ALA A O   1 
ATOM   213  C CB  . ALA A 1 40  ? 7.565  2.020   23.164 1.00 55.27  ? 40  ALA A CB  1 
ATOM   214  N N   . GLU A 1 41  ? 7.168  -0.600  23.382 1.00 58.94  ? 41  GLU A N   1 
ATOM   215  C CA  . GLU A 1 41  ? 6.758  -1.997  23.303 1.00 60.70  ? 41  GLU A CA  1 
ATOM   216  C C   . GLU A 1 41  ? 7.915  -2.966  23.547 1.00 61.48  ? 41  GLU A C   1 
ATOM   217  O O   . GLU A 1 41  ? 9.054  -2.710  23.166 1.00 62.03  ? 41  GLU A O   1 
ATOM   218  C CB  . GLU A 1 41  ? 6.107  -2.288  21.950 1.00 61.80  ? 41  GLU A CB  1 
ATOM   219  C CG  . GLU A 1 41  ? 4.925  -1.383  21.629 1.00 65.24  ? 41  GLU A CG  1 
ATOM   220  C CD  . GLU A 1 41  ? 5.352  -0.077  20.974 1.00 68.84  ? 41  GLU A CD  1 
ATOM   221  O OE1 . GLU A 1 41  ? 6.561  0.247   21.036 1.00 71.30  ? 41  GLU A OE1 1 
ATOM   222  O OE2 . GLU A 1 41  ? 4.485  0.623   20.401 1.00 67.89  ? 41  GLU A OE2 1 
ATOM   223  N N   . THR A 1 42  ? 7.604  -4.083  24.190 1.00 62.44  ? 42  THR A N   1 
ATOM   224  C CA  . THR A 1 42  ? 8.592  -5.098  24.514 1.00 64.49  ? 42  THR A CA  1 
ATOM   225  C C   . THR A 1 42  ? 8.753  -6.092  23.367 1.00 66.03  ? 42  THR A C   1 
ATOM   226  O O   . THR A 1 42  ? 8.951  -7.288  23.597 1.00 66.32  ? 42  THR A O   1 
ATOM   227  C CB  . THR A 1 42  ? 8.157  -5.865  25.766 1.00 64.52  ? 42  THR A CB  1 
ATOM   228  O OG1 . THR A 1 42  ? 6.861  -6.426  25.534 1.00 65.57  ? 42  THR A OG1 1 
ATOM   229  C CG2 . THR A 1 42  ? 8.075  -4.938  26.961 1.00 62.78  ? 42  THR A CG2 1 
ATOM   230  N N   . GLU A 1 43  ? 8.672  -5.592  22.135 1.00 68.23  ? 43  GLU A N   1 
ATOM   231  C CA  . GLU A 1 43  ? 8.784  -6.429  20.937 1.00 68.62  ? 43  GLU A CA  1 
ATOM   232  C C   . GLU A 1 43  ? 9.288  -5.610  19.751 1.00 66.05  ? 43  GLU A C   1 
ATOM   233  O O   . GLU A 1 43  ? 9.010  -4.410  19.641 1.00 63.49  ? 43  GLU A O   1 
ATOM   234  C CB  . GLU A 1 43  ? 7.420  -7.007  20.587 1.00 73.14  ? 43  GLU A CB  1 
ATOM   235  C CG  . GLU A 1 43  ? 6.434  -5.939  20.142 1.00 79.08  ? 43  GLU A CG  1 
ATOM   236  C CD  . GLU A 1 43  ? 5.041  -6.489  19.918 1.00 83.59  ? 43  GLU A CD  1 
ATOM   237  O OE1 . GLU A 1 43  ? 4.411  -6.923  20.911 1.00 85.72  ? 43  GLU A OE1 1 
ATOM   238  O OE2 . GLU A 1 43  ? 4.580  -6.490  18.751 1.00 85.94  ? 43  GLU A OE2 1 
ATOM   239  N N   . VAL A 1 44  ? 9.998  -6.276  18.847 1.00 64.18  ? 44  VAL A N   1 
ATOM   240  C CA  . VAL A 1 44  ? 10.561 -5.604  17.677 1.00 63.01  ? 44  VAL A CA  1 
ATOM   241  C C   . VAL A 1 44  ? 9.547  -5.164  16.625 1.00 60.89  ? 44  VAL A C   1 
ATOM   242  O O   . VAL A 1 44  ? 9.801  -4.226  15.877 1.00 60.80  ? 44  VAL A O   1 
ATOM   243  C CB  . VAL A 1 44  ? 11.619 -6.495  16.977 1.00 63.42  ? 44  VAL A CB  1 
ATOM   244  C CG1 . VAL A 1 44  ? 12.789 -6.750  17.912 1.00 62.81  ? 44  VAL A CG1 1 
ATOM   245  C CG2 . VAL A 1 44  ? 10.994 -7.811  16.554 1.00 63.47  ? 44  VAL A CG2 1 
ATOM   246  N N   . THR A 1 45  ? 8.398  -5.830  16.584 1.00 58.96  ? 45  THR A N   1 
ATOM   247  C CA  . THR A 1 45  ? 7.354  -5.535  15.599 1.00 56.58  ? 45  THR A CA  1 
ATOM   248  C C   . THR A 1 45  ? 7.132  -4.069  15.225 1.00 55.40  ? 45  THR A C   1 
ATOM   249  O O   . THR A 1 45  ? 7.292  -3.705  14.061 1.00 55.20  ? 45  THR A O   1 
ATOM   250  C CB  . THR A 1 45  ? 5.993  -6.145  16.027 1.00 56.26  ? 45  THR A CB  1 
ATOM   251  O OG1 . THR A 1 45  ? 6.111  -7.574  16.100 1.00 55.89  ? 45  THR A OG1 1 
ATOM   252  C CG2 . THR A 1 45  ? 4.906  -5.783  15.029 1.00 53.47  ? 45  THR A CG2 1 
ATOM   253  N N   . GLU A 1 46  ? 6.767  -3.229  16.190 1.00 54.50  ? 46  GLU A N   1 
ATOM   254  C CA  . GLU A 1 46  ? 6.502  -1.823  15.890 1.00 54.05  ? 46  GLU A CA  1 
ATOM   255  C C   . GLU A 1 46  ? 7.672  -1.119  15.228 1.00 53.85  ? 46  GLU A C   1 
ATOM   256  O O   . GLU A 1 46  ? 7.538  -0.541  14.147 1.00 52.48  ? 46  GLU A O   1 
ATOM   257  C CB  . GLU A 1 46  ? 6.118  -1.054  17.154 1.00 54.71  ? 46  GLU A CB  1 
ATOM   258  C CG  . GLU A 1 46  ? 4.757  -1.387  17.714 1.00 58.25  ? 46  GLU A CG  1 
ATOM   259  C CD  . GLU A 1 46  ? 4.611  -2.854  18.067 1.00 61.78  ? 46  GLU A CD  1 
ATOM   260  O OE1 . GLU A 1 46  ? 5.538  -3.421  18.691 1.00 62.62  ? 46  GLU A OE1 1 
ATOM   261  O OE2 . GLU A 1 46  ? 3.560  -3.440  17.727 1.00 64.68  ? 46  GLU A OE2 1 
ATOM   262  N N   . CYS A 1 47  ? 8.822  -1.158  15.886 1.00 53.51  ? 47  CYS A N   1 
ATOM   263  C CA  . CYS A 1 47  ? 9.992  -0.506  15.346 1.00 54.17  ? 47  CYS A CA  1 
ATOM   264  C C   . CYS A 1 47  ? 10.435 -1.232  14.062 1.00 52.51  ? 47  CYS A C   1 
ATOM   265  O O   . CYS A 1 47  ? 10.856 -0.601  13.086 1.00 51.76  ? 47  CYS A O   1 
ATOM   266  C CB  . CYS A 1 47  ? 11.101 -0.457  16.418 1.00 56.91  ? 47  CYS A CB  1 
ATOM   267  S SG  . CYS A 1 47  ? 12.671 0.169   15.753 1.00 63.40  ? 47  CYS A SG  1 
ATOM   268  N N   . ALA A 1 48  ? 10.302 -2.555  14.058 1.00 51.40  ? 48  ALA A N   1 
ATOM   269  C CA  . ALA A 1 48  ? 10.656 -3.370  12.896 1.00 50.74  ? 48  ALA A CA  1 
ATOM   270  C C   . ALA A 1 48  ? 9.878  -2.916  11.660 1.00 50.85  ? 48  ALA A C   1 
ATOM   271  O O   . ALA A 1 48  ? 10.446 -2.796  10.573 1.00 51.45  ? 48  ALA A O   1 
ATOM   272  C CB  . ALA A 1 48  ? 10.371 -4.834  13.177 1.00 48.64  ? 48  ALA A CB  1 
ATOM   273  N N   . GLY A 1 49  ? 8.583  -2.661  11.830 1.00 51.14  ? 49  GLY A N   1 
ATOM   274  C CA  . GLY A 1 49  ? 7.757  -2.206  10.723 1.00 53.01  ? 49  GLY A CA  1 
ATOM   275  C C   . GLY A 1 49  ? 7.955  -0.751  10.293 1.00 54.84  ? 49  GLY A C   1 
ATOM   276  O O   . GLY A 1 49  ? 7.590  -0.373  9.180  1.00 55.18  ? 49  GLY A O   1 
ATOM   277  N N   . ILE A 1 50  ? 8.527  0.077   11.159 1.00 56.30  ? 50  ILE A N   1 
ATOM   278  C CA  . ILE A 1 50  ? 8.746  1.476   10.815 1.00 57.42  ? 50  ILE A CA  1 
ATOM   279  C C   . ILE A 1 50  ? 10.046 1.599   10.060 1.00 57.37  ? 50  ILE A C   1 
ATOM   280  O O   . ILE A 1 50  ? 10.186 2.435   9.165  1.00 57.90  ? 50  ILE A O   1 
ATOM   281  C CB  . ILE A 1 50  ? 8.861  2.376   12.065 1.00 59.81  ? 50  ILE A CB  1 
ATOM   282  C CG1 . ILE A 1 50  ? 7.748  2.046   13.064 1.00 60.10  ? 50  ILE A CG1 1 
ATOM   283  C CG2 . ILE A 1 50  ? 8.764  3.850   11.649 1.00 59.06  ? 50  ILE A CG2 1 
ATOM   284  C CD1 . ILE A 1 50  ? 7.944  2.702   14.417 1.00 61.02  ? 50  ILE A CD1 1 
ATOM   285  N N   . LEU A 1 51  ? 11.006 0.767   10.443 1.00 57.30  ? 51  LEU A N   1 
ATOM   286  C CA  . LEU A 1 51  ? 12.317 0.781   9.807  1.00 57.13  ? 51  LEU A CA  1 
ATOM   287  C C   . LEU A 1 51  ? 12.245 0.269   8.386  1.00 57.69  ? 51  LEU A C   1 
ATOM   288  O O   . LEU A 1 51  ? 12.911 0.790   7.502  1.00 57.98  ? 51  LEU A O   1 
ATOM   289  C CB  . LEU A 1 51  ? 13.301 -0.058  10.620 1.00 54.56  ? 51  LEU A CB  1 
ATOM   290  C CG  . LEU A 1 51  ? 13.636 0.620   11.949 1.00 53.21  ? 51  LEU A CG  1 
ATOM   291  C CD1 . LEU A 1 51  ? 14.486 -0.285  12.840 1.00 52.08  ? 51  LEU A CD1 1 
ATOM   292  C CD2 . LEU A 1 51  ? 14.345 1.922   11.643 1.00 49.55  ? 51  LEU A CD2 1 
ATOM   293  N N   . LYS A 1 52  ? 11.421 -0.748  8.167  1.00 59.73  ? 52  LYS A N   1 
ATOM   294  C CA  . LYS A 1 52  ? 11.277 -1.319  6.839  1.00 61.41  ? 52  LYS A CA  1 
ATOM   295  C C   . LYS A 1 52  ? 10.790 -0.259  5.856  1.00 62.14  ? 52  LYS A C   1 
ATOM   296  O O   . LYS A 1 52  ? 11.290 -0.139  4.735  1.00 61.78  ? 52  LYS A O   1 
ATOM   297  C CB  . LYS A 1 52  ? 10.297 -2.484  6.872  1.00 61.22  ? 52  LYS A CB  1 
ATOM   298  C CG  . LYS A 1 52  ? 10.312 -3.292  5.590  1.00 65.53  ? 52  LYS A CG  1 
ATOM   299  C CD  . LYS A 1 52  ? 11.726 -3.818  5.301  1.00 67.47  ? 52  LYS A CD  1 
ATOM   300  C CE  . LYS A 1 52  ? 11.844 -4.413  3.897  1.00 69.02  ? 52  LYS A CE  1 
ATOM   301  N NZ  . LYS A 1 52  ? 10.825 -5.465  3.625  1.00 68.26  ? 52  LYS A NZ  1 
ATOM   302  N N   . ASP A 1 53  ? 9.811  0.522   6.282  1.00 62.92  ? 53  ASP A N   1 
ATOM   303  C CA  . ASP A 1 53  ? 9.287  1.562   5.428  1.00 63.81  ? 53  ASP A CA  1 
ATOM   304  C C   . ASP A 1 53  ? 10.358 2.621   5.173  1.00 64.66  ? 53  ASP A C   1 
ATOM   305  O O   . ASP A 1 53  ? 10.671 2.938   4.027  1.00 66.38  ? 53  ASP A O   1 
ATOM   306  C CB  . ASP A 1 53  ? 8.049  2.198   6.070  1.00 64.04  ? 53  ASP A CB  1 
ATOM   307  C CG  . ASP A 1 53  ? 7.559  3.415   5.305  1.00 66.58  ? 53  ASP A CG  1 
ATOM   308  O OD1 . ASP A 1 53  ? 7.599  3.381   4.059  1.00 68.01  ? 53  ASP A OD1 1 
ATOM   309  O OD2 . ASP A 1 53  ? 7.127  4.403   5.938  1.00 66.44  ? 53  ASP A OD2 1 
ATOM   310  N N   . VAL A 1 54  ? 10.940 3.141   6.248  1.00 64.16  ? 54  VAL A N   1 
ATOM   311  C CA  . VAL A 1 54  ? 11.947 4.198   6.157  1.00 63.34  ? 54  VAL A CA  1 
ATOM   312  C C   . VAL A 1 54  ? 13.300 3.827   5.550  1.00 61.73  ? 54  VAL A C   1 
ATOM   313  O O   . VAL A 1 54  ? 13.780 4.486   4.624  1.00 59.88  ? 54  VAL A O   1 
ATOM   314  C CB  . VAL A 1 54  ? 12.212 4.804   7.557  1.00 64.26  ? 54  VAL A CB  1 
ATOM   315  C CG1 . VAL A 1 54  ? 13.106 6.020   7.441  1.00 61.98  ? 54  VAL A CG1 1 
ATOM   316  C CG2 . VAL A 1 54  ? 10.891 5.162   8.221  1.00 65.56  ? 54  VAL A CG2 1 
ATOM   317  N N   . LEU A 1 55  ? 13.910 2.781   6.097  1.00 60.91  ? 55  LEU A N   1 
ATOM   318  C CA  . LEU A 1 55  ? 15.224 2.317   5.672  1.00 59.22  ? 55  LEU A CA  1 
ATOM   319  C C   . LEU A 1 55  ? 15.273 1.727   4.290  1.00 61.10  ? 55  LEU A C   1 
ATOM   320  O O   . LEU A 1 55  ? 16.351 1.512   3.740  1.00 61.87  ? 55  LEU A O   1 
ATOM   321  C CB  . LEU A 1 55  ? 15.758 1.299   6.671  1.00 55.60  ? 55  LEU A CB  1 
ATOM   322  C CG  . LEU A 1 55  ? 16.717 1.831   7.727  1.00 50.83  ? 55  LEU A CG  1 
ATOM   323  C CD1 . LEU A 1 55  ? 16.529 3.328   7.875  1.00 50.11  ? 55  LEU A CD1 1 
ATOM   324  C CD2 . LEU A 1 55  ? 16.495 1.078   9.029  1.00 46.45  ? 55  LEU A CD2 1 
ATOM   325  N N   . SER A 1 56  ? 14.109 1.442   3.728  1.00 63.23  ? 56  SER A N   1 
ATOM   326  C CA  . SER A 1 56  ? 14.071 0.889   2.388  1.00 64.68  ? 56  SER A CA  1 
ATOM   327  C C   . SER A 1 56  ? 14.068 2.052   1.412  1.00 64.25  ? 56  SER A C   1 
ATOM   328  O O   . SER A 1 56  ? 14.609 1.959   0.316  1.00 63.50  ? 56  SER A O   1 
ATOM   329  C CB  . SER A 1 56  ? 12.832 0.005   2.214  1.00 66.14  ? 56  SER A CB  1 
ATOM   330  O OG  . SER A 1 56  ? 13.001 -1.231  2.901  1.00 66.07  ? 56  SER A OG  1 
ATOM   331  N N   . LYS A 1 57  ? 13.460 3.152   1.830  1.00 66.04  ? 57  LYS A N   1 
ATOM   332  C CA  . LYS A 1 57  ? 13.406 4.350   1.004  1.00 69.33  ? 57  LYS A CA  1 
ATOM   333  C C   . LYS A 1 57  ? 14.764 5.014   1.137  1.00 70.12  ? 57  LYS A C   1 
ATOM   334  O O   . LYS A 1 57  ? 15.235 5.674   0.217  1.00 70.65  ? 57  LYS A O   1 
ATOM   335  C CB  . LYS A 1 57  ? 12.310 5.306   1.495  1.00 70.80  ? 57  LYS A CB  1 
ATOM   336  C CG  . LYS A 1 57  ? 10.893 4.755   1.384  1.00 73.45  ? 57  LYS A CG  1 
ATOM   337  C CD  . LYS A 1 57  ? 9.875  5.679   2.063  1.00 75.62  ? 57  LYS A CD  1 
ATOM   338  C CE  . LYS A 1 57  ? 8.446  5.161   1.877  1.00 76.74  ? 57  LYS A CE  1 
ATOM   339  N NZ  . LYS A 1 57  ? 7.427  5.968   2.611  1.00 76.54  ? 57  LYS A NZ  1 
ATOM   340  N N   . ASN A 1 58  ? 15.379 4.840   2.303  1.00 71.11  ? 58  ASN A N   1 
ATOM   341  C CA  . ASN A 1 58  ? 16.700 5.392   2.572  1.00 71.61  ? 58  ASN A CA  1 
ATOM   342  C C   . ASN A 1 58  ? 17.384 4.547   3.629  1.00 70.29  ? 58  ASN A C   1 
ATOM   343  O O   . ASN A 1 58  ? 17.045 4.594   4.810  1.00 70.29  ? 58  ASN A O   1 
ATOM   344  C CB  . ASN A 1 58  ? 16.612 6.841   3.035  1.00 74.67  ? 58  ASN A CB  1 
ATOM   345  C CG  . ASN A 1 58  ? 17.962 7.390   3.460  1.00 78.76  ? 58  ASN A CG  1 
ATOM   346  O OD1 . ASN A 1 58  ? 18.995 7.084   2.850  1.00 79.72  ? 58  ASN A OD1 1 
ATOM   347  N ND2 . ASN A 1 58  ? 17.963 8.212   4.507  1.00 80.75  ? 58  ASN A ND2 1 
ATOM   348  N N   . LEU A 1 59  ? 18.359 3.775   3.174  1.00 69.69  ? 59  LEU A N   1 
ATOM   349  C CA  . LEU A 1 59  ? 19.103 2.854   4.013  1.00 68.54  ? 59  LEU A CA  1 
ATOM   350  C C   . LEU A 1 59  ? 20.062 3.508   4.987  1.00 67.62  ? 59  LEU A C   1 
ATOM   351  O O   . LEU A 1 59  ? 20.648 2.828   5.827  1.00 66.81  ? 59  LEU A O   1 
ATOM   352  C CB  . LEU A 1 59  ? 19.877 1.892   3.121  1.00 70.12  ? 59  LEU A CB  1 
ATOM   353  C CG  . LEU A 1 59  ? 20.628 0.744   3.789  1.00 71.74  ? 59  LEU A CG  1 
ATOM   354  C CD1 . LEU A 1 59  ? 19.809 -0.538  3.680  1.00 72.67  ? 59  LEU A CD1 1 
ATOM   355  C CD2 . LEU A 1 59  ? 21.977 0.566   3.104  1.00 72.54  ? 59  LEU A CD2 1 
ATOM   356  N N   . HIS A 1 60  ? 20.233 4.819   4.884  1.00 66.77  ? 60  HIS A N   1 
ATOM   357  C CA  . HIS A 1 60  ? 21.152 5.497   5.786  1.00 67.53  ? 60  HIS A CA  1 
ATOM   358  C C   . HIS A 1 60  ? 20.485 6.555   6.652  1.00 66.73  ? 60  HIS A C   1 
ATOM   359  O O   . HIS A 1 60  ? 21.158 7.314   7.346  1.00 65.86  ? 60  HIS A O   1 
ATOM   360  C CB  . HIS A 1 60  ? 22.294 6.121   4.984  1.00 69.08  ? 60  HIS A CB  1 
ATOM   361  C CG  . HIS A 1 60  ? 23.124 5.116   4.246  1.00 71.57  ? 60  HIS A CG  1 
ATOM   362  N ND1 . HIS A 1 60  ? 23.694 4.022   4.866  1.00 72.44  ? 60  HIS A ND1 1 
ATOM   363  C CD2 . HIS A 1 60  ? 23.484 5.039   2.943  1.00 71.60  ? 60  HIS A CD2 1 
ATOM   364  C CE1 . HIS A 1 60  ? 24.368 3.316   3.977  1.00 72.59  ? 60  HIS A CE1 1 
ATOM   365  N NE2 . HIS A 1 60  ? 24.259 3.911   2.802  1.00 73.10  ? 60  HIS A NE2 1 
ATOM   366  N N   . GLU A 1 61  ? 19.159 6.583   6.629  1.00 66.20  ? 61  GLU A N   1 
ATOM   367  C CA  . GLU A 1 61  ? 18.416 7.569   7.393  1.00 65.36  ? 61  GLU A CA  1 
ATOM   368  C C   . GLU A 1 61  ? 18.838 7.685   8.855  1.00 64.41  ? 61  GLU A C   1 
ATOM   369  O O   . GLU A 1 61  ? 19.043 8.797   9.346  1.00 63.55  ? 61  GLU A O   1 
ATOM   370  C CB  . GLU A 1 61  ? 16.909 7.288   7.302  1.00 66.40  ? 61  GLU A CB  1 
ATOM   371  C CG  . GLU A 1 61  ? 16.059 8.327   8.032  1.00 69.79  ? 61  GLU A CG  1 
ATOM   372  C CD  . GLU A 1 61  ? 14.731 8.615   7.341  1.00 72.27  ? 61  GLU A CD  1 
ATOM   373  O OE1 . GLU A 1 61  ? 14.741 8.887   6.118  1.00 72.85  ? 61  GLU A OE1 1 
ATOM   374  O OE2 . GLU A 1 61  ? 13.680 8.586   8.021  1.00 73.21  ? 61  GLU A OE2 1 
ATOM   375  N N   . LEU A 1 62  ? 18.991 6.552   9.540  1.00 62.53  ? 62  LEU A N   1 
ATOM   376  C CA  . LEU A 1 62  ? 19.354 6.563   10.961 1.00 61.54  ? 62  LEU A CA  1 
ATOM   377  C C   . LEU A 1 62  ? 20.566 7.410   11.355 1.00 61.54  ? 62  LEU A C   1 
ATOM   378  O O   . LEU A 1 62  ? 20.725 7.755   12.524 1.00 60.56  ? 62  LEU A O   1 
ATOM   379  C CB  . LEU A 1 62  ? 19.562 5.137   11.474 1.00 60.42  ? 62  LEU A CB  1 
ATOM   380  C CG  . LEU A 1 62  ? 18.393 4.146   11.455 1.00 59.12  ? 62  LEU A CG  1 
ATOM   381  C CD1 . LEU A 1 62  ? 18.853 2.853   12.113 1.00 56.22  ? 62  LEU A CD1 1 
ATOM   382  C CD2 . LEU A 1 62  ? 17.184 4.708   12.190 1.00 57.06  ? 62  LEU A CD2 1 
ATOM   383  N N   . GLN A 1 63  ? 21.417 7.744   10.390 1.00 62.65  ? 63  GLN A N   1 
ATOM   384  C CA  . GLN A 1 63  ? 22.597 8.561   10.670 1.00 62.33  ? 63  GLN A CA  1 
ATOM   385  C C   . GLN A 1 63  ? 22.204 9.994   10.982 1.00 60.22  ? 63  GLN A C   1 
ATOM   386  O O   . GLN A 1 63  ? 22.976 10.749  11.571 1.00 59.80  ? 63  GLN A O   1 
ATOM   387  C CB  . GLN A 1 63  ? 23.545 8.562   9.474  1.00 65.12  ? 63  GLN A CB  1 
ATOM   388  C CG  . GLN A 1 63  ? 24.021 7.187   9.078  1.00 71.58  ? 63  GLN A CG  1 
ATOM   389  C CD  . GLN A 1 63  ? 25.288 7.233   8.243  1.00 74.96  ? 63  GLN A CD  1 
ATOM   390  O OE1 . GLN A 1 63  ? 26.324 7.752   8.688  1.00 75.97  ? 63  GLN A OE1 1 
ATOM   391  N NE2 . GLN A 1 63  ? 25.219 6.685   7.027  1.00 76.21  ? 63  GLN A NE2 1 
ATOM   392  N N   . GLY A 1 64  ? 21.000 10.365  10.572 1.00 58.22  ? 64  GLY A N   1 
ATOM   393  C CA  . GLY A 1 64  ? 20.534 11.711  10.813 1.00 57.31  ? 64  GLY A CA  1 
ATOM   394  C C   . GLY A 1 64  ? 19.997 11.898  12.214 1.00 56.35  ? 64  GLY A C   1 
ATOM   395  O O   . GLY A 1 64  ? 19.670 13.012  12.607 1.00 56.44  ? 64  GLY A O   1 
ATOM   396  N N   . LEU A 1 65  ? 19.909 10.817  12.974 1.00 55.31  ? 65  LEU A N   1 
ATOM   397  C CA  . LEU A 1 65  ? 19.393 10.917  14.324 1.00 56.04  ? 65  LEU A CA  1 
ATOM   398  C C   . LEU A 1 65  ? 20.468 11.200  15.366 1.00 57.82  ? 65  LEU A C   1 
ATOM   399  O O   . LEU A 1 65  ? 20.149 11.561  16.502 1.00 58.83  ? 65  LEU A O   1 
ATOM   400  C CB  . LEU A 1 65  ? 18.644 9.643   14.698 1.00 55.63  ? 65  LEU A CB  1 
ATOM   401  C CG  . LEU A 1 65  ? 17.559 9.220   13.713 1.00 57.48  ? 65  LEU A CG  1 
ATOM   402  C CD1 . LEU A 1 65  ? 16.650 8.200   14.371 1.00 55.57  ? 65  LEU A CD1 1 
ATOM   403  C CD2 . LEU A 1 65  ? 16.744 10.434  13.277 1.00 59.05  ? 65  LEU A CD2 1 
ATOM   404  N N   . CYS A 1 66  ? 21.738 11.043  14.992 1.00 58.59  ? 66  CYS A N   1 
ATOM   405  C CA  . CYS A 1 66  ? 22.829 11.287  15.933 1.00 58.70  ? 66  CYS A CA  1 
ATOM   406  C C   . CYS A 1 66  ? 23.197 12.760  15.973 1.00 58.71  ? 66  CYS A C   1 
ATOM   407  O O   . CYS A 1 66  ? 23.490 13.360  14.934 1.00 59.71  ? 66  CYS A O   1 
ATOM   408  C CB  . CYS A 1 66  ? 24.090 10.516  15.541 1.00 59.10  ? 66  CYS A CB  1 
ATOM   409  S SG  . CYS A 1 66  ? 23.912 8.747   15.157 1.00 62.72  ? 66  CYS A SG  1 
ATOM   410  N N   . ASN A 1 67  ? 23.189 13.344  17.165 1.00 57.72  ? 67  ASN A N   1 
ATOM   411  C CA  . ASN A 1 67  ? 23.573 14.742  17.299 1.00 56.47  ? 67  ASN A CA  1 
ATOM   412  C C   . ASN A 1 67  ? 25.097 14.759  17.339 1.00 55.31  ? 67  ASN A C   1 
ATOM   413  O O   . ASN A 1 67  ? 25.748 15.718  16.932 1.00 55.35  ? 67  ASN A O   1 
ATOM   414  C CB  . ASN A 1 67  ? 23.020 15.338  18.591 1.00 56.11  ? 67  ASN A CB  1 
ATOM   415  C CG  . ASN A 1 67  ? 21.518 15.231  18.686 1.00 57.34  ? 67  ASN A CG  1 
ATOM   416  O OD1 . ASN A 1 67  ? 20.973 14.254  19.216 1.00 57.54  ? 67  ASN A OD1 1 
ATOM   417  N ND2 . ASN A 1 67  ? 20.831 16.237  18.162 1.00 57.60  ? 67  ASN A ND2 1 
ATOM   418  N N   . VAL A 1 68  ? 25.650 13.666  17.839 1.00 54.81  ? 68  VAL A N   1 
ATOM   419  C CA  . VAL A 1 68  ? 27.081 13.502  17.960 1.00 54.77  ? 68  VAL A CA  1 
ATOM   420  C C   . VAL A 1 68  ? 27.398 12.086  17.566 1.00 54.53  ? 68  VAL A C   1 
ATOM   421  O O   . VAL A 1 68  ? 26.602 11.170  17.787 1.00 52.92  ? 68  VAL A O   1 
ATOM   422  C CB  . VAL A 1 68  ? 27.570 13.693  19.418 1.00 55.19  ? 68  VAL A CB  1 
ATOM   423  C CG1 . VAL A 1 68  ? 29.031 13.301  19.532 1.00 53.17  ? 68  VAL A CG1 1 
ATOM   424  C CG2 . VAL A 1 68  ? 27.380 15.124  19.850 1.00 55.25  ? 68  VAL A CG2 1 
ATOM   425  N N   . LYS A 1 69  ? 28.576 11.918  16.985 1.00 55.34  ? 69  LYS A N   1 
ATOM   426  C CA  . LYS A 1 69  ? 29.047 10.614  16.565 1.00 56.09  ? 69  LYS A CA  1 
ATOM   427  C C   . LYS A 1 69  ? 30.498 10.560  16.994 1.00 54.99  ? 69  LYS A C   1 
ATOM   428  O O   . LYS A 1 69  ? 31.273 11.447  16.658 1.00 54.51  ? 69  LYS A O   1 
ATOM   429  C CB  . LYS A 1 69  ? 28.931 10.479  15.054 1.00 58.20  ? 69  LYS A CB  1 
ATOM   430  C CG  . LYS A 1 69  ? 29.323 9.122   14.510 1.00 62.59  ? 69  LYS A CG  1 
ATOM   431  C CD  . LYS A 1 69  ? 29.162 9.098   12.986 1.00 65.46  ? 69  LYS A CD  1 
ATOM   432  C CE  . LYS A 1 69  ? 29.796 7.866   12.346 1.00 65.81  ? 69  LYS A CE  1 
ATOM   433  N NZ  . LYS A 1 69  ? 29.796 7.966   10.850 1.00 66.28  ? 69  LYS A NZ  1 
ATOM   434  N N   . ASN A 1 70  ? 30.855 9.538   17.763 1.00 53.98  ? 70  ASN A N   1 
ATOM   435  C CA  . ASN A 1 70  ? 32.224 9.382   18.232 1.00 53.48  ? 70  ASN A CA  1 
ATOM   436  C C   . ASN A 1 70  ? 32.697 8.031   17.710 1.00 54.40  ? 70  ASN A C   1 
ATOM   437  O O   . ASN A 1 70  ? 32.163 6.995   18.112 1.00 54.83  ? 70  ASN A O   1 
ATOM   438  C CB  . ASN A 1 70  ? 32.253 9.419   19.766 1.00 52.00  ? 70  ASN A CB  1 
ATOM   439  C CG  . ASN A 1 70  ? 33.657 9.542   20.328 1.00 49.27  ? 70  ASN A CG  1 
ATOM   440  O OD1 . ASN A 1 70  ? 34.486 8.657   20.154 1.00 49.48  ? 70  ASN A OD1 1 
ATOM   441  N ND2 . ASN A 1 70  ? 33.926 10.644  21.007 1.00 47.15  ? 70  ASN A ND2 1 
ATOM   442  N N   . LYS A 1 71  ? 33.679 8.041   16.806 1.00 55.15  ? 71  LYS A N   1 
ATOM   443  C CA  . LYS A 1 71  ? 34.181 6.794   16.229 1.00 58.26  ? 71  LYS A CA  1 
ATOM   444  C C   . LYS A 1 71  ? 35.658 6.527   16.496 1.00 57.37  ? 71  LYS A C   1 
ATOM   445  O O   . LYS A 1 71  ? 36.481 7.437   16.488 1.00 55.55  ? 71  LYS A O   1 
ATOM   446  C CB  . LYS A 1 71  ? 33.965 6.765   14.715 1.00 61.01  ? 71  LYS A CB  1 
ATOM   447  C CG  . LYS A 1 71  ? 35.069 7.496   13.947 1.00 67.51  ? 71  LYS A CG  1 
ATOM   448  C CD  . LYS A 1 71  ? 35.028 7.243   12.444 1.00 70.36  ? 71  LYS A CD  1 
ATOM   449  C CE  . LYS A 1 71  ? 35.365 5.795   12.108 1.00 71.47  ? 71  LYS A CE  1 
ATOM   450  N NZ  . LYS A 1 71  ? 35.332 5.562   10.634 1.00 72.52  ? 71  LYS A NZ  1 
ATOM   451  N N   . MET A 1 72  ? 35.974 5.254   16.711 1.00 58.98  ? 72  MET A N   1 
ATOM   452  C CA  . MET A 1 72  ? 37.335 4.801   16.968 1.00 59.62  ? 72  MET A CA  1 
ATOM   453  C C   . MET A 1 72  ? 37.697 3.666   16.002 1.00 59.30  ? 72  MET A C   1 
ATOM   454  O O   . MET A 1 72  ? 36.829 2.895   15.587 1.00 57.39  ? 72  MET A O   1 
ATOM   455  C CB  . MET A 1 72  ? 37.462 4.334   18.423 1.00 61.14  ? 72  MET A CB  1 
ATOM   456  C CG  . MET A 1 72  ? 36.352 3.397   18.883 1.00 63.57  ? 72  MET A CG  1 
ATOM   457  S SD  . MET A 1 72  ? 36.633 2.748   20.553 1.00 65.26  ? 72  MET A SD  1 
ATOM   458  C CE  . MET A 1 72  ? 38.013 1.698   20.240 1.00 64.63  ? 72  MET A CE  1 
ATOM   459  N N   . GLY A 1 73  ? 38.975 3.580   15.634 1.00 59.96  ? 73  GLY A N   1 
ATOM   460  C CA  . GLY A 1 73  ? 39.423 2.539   14.718 1.00 61.31  ? 73  GLY A CA  1 
ATOM   461  C C   . GLY A 1 73  ? 39.920 1.325   15.477 1.00 61.91  ? 73  GLY A C   1 
ATOM   462  O O   . GLY A 1 73  ? 40.857 1.421   16.256 1.00 63.35  ? 73  GLY A O   1 
ATOM   463  N N   . VAL A 1 74  ? 39.292 0.176   15.269 1.00 63.37  ? 74  VAL A N   1 
ATOM   464  C CA  . VAL A 1 74  ? 39.705 -1.031  15.970 1.00 64.23  ? 74  VAL A CA  1 
ATOM   465  C C   . VAL A 1 74  ? 40.273 -2.109  15.032 1.00 64.77  ? 74  VAL A C   1 
ATOM   466  O O   . VAL A 1 74  ? 39.739 -2.382  13.944 1.00 63.48  ? 74  VAL A O   1 
ATOM   467  C CB  . VAL A 1 74  ? 38.535 -1.603  16.808 1.00 64.62  ? 74  VAL A CB  1 
ATOM   468  C CG1 . VAL A 1 74  ? 37.263 -1.597  15.979 1.00 65.32  ? 74  VAL A CG1 1 
ATOM   469  C CG2 . VAL A 1 74  ? 38.860 -3.028  17.282 1.00 65.51  ? 74  VAL A CG2 1 
ATOM   470  N N   . PRO A 1 75  ? 41.393 -2.717  15.444 1.00 65.34  ? 75  PRO A N   1 
ATOM   471  C CA  . PRO A 1 75  ? 42.071 -3.762  14.682 1.00 65.46  ? 75  PRO A CA  1 
ATOM   472  C C   . PRO A 1 75  ? 41.234 -5.020  14.539 1.00 65.54  ? 75  PRO A C   1 
ATOM   473  O O   . PRO A 1 75  ? 40.493 -5.416  15.444 1.00 65.29  ? 75  PRO A O   1 
ATOM   474  C CB  . PRO A 1 75  ? 43.337 -4.018  15.495 1.00 65.42  ? 75  PRO A CB  1 
ATOM   475  C CG  . PRO A 1 75  ? 43.591 -2.707  16.162 1.00 66.44  ? 75  PRO A CG  1 
ATOM   476  C CD  . PRO A 1 75  ? 42.208 -2.313  16.604 1.00 66.22  ? 75  PRO A CD  1 
ATOM   477  N N   . TRP A 1 76  ? 41.373 -5.640  13.378 1.00 65.63  ? 76  TRP A N   1 
ATOM   478  C CA  . TRP A 1 76  ? 40.682 -6.869  13.049 1.00 65.58  ? 76  TRP A CA  1 
ATOM   479  C C   . TRP A 1 76  ? 41.381 -8.020  13.764 1.00 66.66  ? 76  TRP A C   1 
ATOM   480  O O   . TRP A 1 76  ? 42.525 -8.340  13.434 1.00 68.07  ? 76  TRP A O   1 
ATOM   481  C CB  . TRP A 1 76  ? 40.781 -7.135  11.543 1.00 63.88  ? 76  TRP A CB  1 
ATOM   482  C CG  . TRP A 1 76  ? 39.615 -6.735  10.708 1.00 63.73  ? 76  TRP A CG  1 
ATOM   483  C CD1 . TRP A 1 76  ? 39.642 -5.982  9.561  1.00 64.08  ? 76  TRP A CD1 1 
ATOM   484  C CD2 . TRP A 1 76  ? 38.255 -7.143  10.883 1.00 64.56  ? 76  TRP A CD2 1 
ATOM   485  N NE1 . TRP A 1 76  ? 38.381 -5.903  9.008  1.00 63.32  ? 76  TRP A NE1 1 
ATOM   486  C CE2 . TRP A 1 76  ? 37.512 -6.607  9.799  1.00 64.08  ? 76  TRP A CE2 1 
ATOM   487  C CE3 . TRP A 1 76  ? 37.589 -7.912  11.844 1.00 64.59  ? 76  TRP A CE3 1 
ATOM   488  C CZ2 . TRP A 1 76  ? 36.143 -6.818  9.658  1.00 63.78  ? 76  TRP A CZ2 1 
ATOM   489  C CZ3 . TRP A 1 76  ? 36.225 -8.120  11.699 1.00 64.77  ? 76  TRP A CZ3 1 
ATOM   490  C CH2 . TRP A 1 76  ? 35.518 -7.575  10.614 1.00 64.02  ? 76  TRP A CH2 1 
ATOM   491  N N   . VAL A 1 77  ? 40.739 -8.633  14.749 1.00 66.61  ? 77  VAL A N   1 
ATOM   492  C CA  . VAL A 1 77  ? 41.369 -9.792  15.367 1.00 66.96  ? 77  VAL A CA  1 
ATOM   493  C C   . VAL A 1 77  ? 40.698 -11.019 14.738 1.00 69.35  ? 77  VAL A C   1 
ATOM   494  O O   . VAL A 1 77  ? 39.465 -11.139 14.709 1.00 68.66  ? 77  VAL A O   1 
ATOM   495  C CB  . VAL A 1 77  ? 41.215 -9.813  16.899 1.00 64.83  ? 77  VAL A CB  1 
ATOM   496  C CG1 . VAL A 1 77  ? 41.589 -11.176 17.438 1.00 60.24  ? 77  VAL A CG1 1 
ATOM   497  C CG2 . VAL A 1 77  ? 42.119 -8.768  17.513 1.00 63.01  ? 77  VAL A CG2 1 
ATOM   498  N N   . SER A 1 78  ? 41.519 -11.917 14.205 1.00 71.94  ? 78  SER A N   1 
ATOM   499  C CA  . SER A 1 78  ? 40.997 -13.108 13.553 1.00 74.23  ? 78  SER A CA  1 
ATOM   500  C C   . SER A 1 78  ? 40.974 -14.385 14.401 1.00 75.34  ? 78  SER A C   1 
ATOM   501  O O   . SER A 1 78  ? 41.748 -14.545 15.348 1.00 75.30  ? 78  SER A O   1 
ATOM   502  C CB  . SER A 1 78  ? 41.772 -13.369 12.263 1.00 73.44  ? 78  SER A CB  1 
ATOM   503  O OG  . SER A 1 78  ? 41.225 -14.487 11.587 1.00 73.27  ? 78  SER A OG  1 
ATOM   504  N N   . VAL A 1 79  ? 40.065 -15.284 14.034 1.00 76.87  ? 79  VAL A N   1 
ATOM   505  C CA  . VAL A 1 79  ? 39.892 -16.570 14.701 1.00 78.57  ? 79  VAL A CA  1 
ATOM   506  C C   . VAL A 1 79  ? 39.926 -17.652 13.621 1.00 79.64  ? 79  VAL A C   1 
ATOM   507  O O   . VAL A 1 79  ? 38.878 -18.139 13.179 1.00 79.66  ? 79  VAL A O   1 
ATOM   508  C CB  . VAL A 1 79  ? 38.538 -16.635 15.427 1.00 78.15  ? 79  VAL A CB  1 
ATOM   509  C CG1 . VAL A 1 79  ? 38.407 -17.961 16.182 1.00 78.62  ? 79  VAL A CG1 1 
ATOM   510  C CG2 . VAL A 1 79  ? 38.410 -15.461 16.365 1.00 77.97  ? 79  VAL A CG2 1 
ATOM   511  N N   . GLU A 1 80  ? 41.134 -18.021 13.201 1.00 80.46  ? 80  GLU A N   1 
ATOM   512  C CA  . GLU A 1 80  ? 41.315 -19.017 12.143 1.00 81.31  ? 80  GLU A CA  1 
ATOM   513  C C   . GLU A 1 80  ? 40.400 -20.232 12.271 1.00 80.66  ? 80  GLU A C   1 
ATOM   514  O O   . GLU A 1 80  ? 39.652 -20.563 11.349 1.00 79.53  ? 80  GLU A O   1 
ATOM   515  C CB  . GLU A 1 80  ? 42.779 -19.485 12.087 1.00 82.30  ? 80  GLU A CB  1 
ATOM   516  C CG  . GLU A 1 80  ? 43.807 -18.363 11.903 1.00 85.32  ? 80  GLU A CG  1 
ATOM   517  C CD  . GLU A 1 80  ? 43.383 -17.314 10.874 1.00 86.70  ? 80  GLU A CD  1 
ATOM   518  O OE1 . GLU A 1 80  ? 42.994 -17.691 9.744  1.00 86.87  ? 80  GLU A OE1 1 
ATOM   519  O OE2 . GLU A 1 80  ? 43.445 -16.106 11.199 1.00 86.87  ? 80  GLU A OE2 1 
ATOM   520  N N   . GLU A 1 81  ? 40.469 -20.887 13.422 1.00 80.10  ? 81  GLU A N   1 
ATOM   521  C CA  . GLU A 1 81  ? 39.678 -22.076 13.698 1.00 79.24  ? 81  GLU A CA  1 
ATOM   522  C C   . GLU A 1 81  ? 38.231 -22.001 13.215 1.00 77.57  ? 81  GLU A C   1 
ATOM   523  O O   . GLU A 1 81  ? 37.740 -22.930 12.574 1.00 77.12  ? 81  GLU A O   1 
ATOM   524  C CB  . GLU A 1 81  ? 39.707 -22.345 15.198 1.00 81.50  ? 81  GLU A CB  1 
ATOM   525  C CG  . GLU A 1 81  ? 41.105 -22.285 15.774 1.00 85.76  ? 81  GLU A CG  1 
ATOM   526  C CD  . GLU A 1 81  ? 41.112 -22.265 17.291 1.00 89.71  ? 81  GLU A CD  1 
ATOM   527  O OE1 . GLU A 1 81  ? 40.683 -23.268 17.913 1.00 90.47  ? 81  GLU A OE1 1 
ATOM   528  O OE2 . GLU A 1 81  ? 41.550 -21.238 17.861 1.00 92.02  ? 81  GLU A OE2 1 
ATOM   529  N N   . LEU A 1 82  ? 37.562 -20.889 13.512 1.00 75.58  ? 82  LEU A N   1 
ATOM   530  C CA  . LEU A 1 82  ? 36.160 -20.700 13.145 1.00 73.03  ? 82  LEU A CA  1 
ATOM   531  C C   . LEU A 1 82  ? 35.929 -19.743 11.978 1.00 72.63  ? 82  LEU A C   1 
ATOM   532  O O   . LEU A 1 82  ? 34.813 -19.639 11.456 1.00 71.59  ? 82  LEU A O   1 
ATOM   533  C CB  . LEU A 1 82  ? 35.393 -20.218 14.371 1.00 72.11  ? 82  LEU A CB  1 
ATOM   534  C CG  . LEU A 1 82  ? 35.542 -21.170 15.561 1.00 71.49  ? 82  LEU A CG  1 
ATOM   535  C CD1 . LEU A 1 82  ? 35.386 -20.420 16.870 1.00 70.59  ? 82  LEU A CD1 1 
ATOM   536  C CD2 . LEU A 1 82  ? 34.529 -22.293 15.426 1.00 70.49  ? 82  LEU A CD2 1 
ATOM   537  N N   . GLY A 1 83  ? 36.987 -19.055 11.565 1.00 72.67  ? 83  GLY A N   1 
ATOM   538  C CA  . GLY A 1 83  ? 36.870 -18.120 10.459 1.00 73.45  ? 83  GLY A CA  1 
ATOM   539  C C   . GLY A 1 83  ? 36.119 -16.886 10.906 1.00 73.27  ? 83  GLY A C   1 
ATOM   540  O O   . GLY A 1 83  ? 35.321 -16.310 10.159 1.00 71.92  ? 83  GLY A O   1 
ATOM   541  N N   . GLN A 1 84  ? 36.379 -16.491 12.148 1.00 73.41  ? 84  GLN A N   1 
ATOM   542  C CA  . GLN A 1 84  ? 35.733 -15.334 12.735 1.00 72.19  ? 84  GLN A CA  1 
ATOM   543  C C   . GLN A 1 84  ? 36.690 -14.172 12.790 1.00 71.59  ? 84  GLN A C   1 
ATOM   544  O O   . GLN A 1 84  ? 37.740 -14.242 13.429 1.00 71.83  ? 84  GLN A O   1 
ATOM   545  C CB  . GLN A 1 84  ? 35.238 -15.649 14.154 1.00 72.26  ? 84  GLN A CB  1 
ATOM   546  C CG  . GLN A 1 84  ? 34.299 -16.847 14.232 1.00 71.13  ? 84  GLN A CG  1 
ATOM   547  C CD  . GLN A 1 84  ? 33.838 -17.158 15.643 1.00 71.16  ? 84  GLN A CD  1 
ATOM   548  O OE1 . GLN A 1 84  ? 34.551 -16.905 16.628 1.00 70.03  ? 84  GLN A OE1 1 
ATOM   549  N NE2 . GLN A 1 84  ? 32.645 -17.734 15.751 1.00 71.63  ? 84  GLN A NE2 1 
ATOM   550  N N   . GLU A 1 85  ? 36.325 -13.112 12.082 1.00 70.69  ? 85  GLU A N   1 
ATOM   551  C CA  . GLU A 1 85  ? 37.093 -11.886 12.065 1.00 69.00  ? 85  GLU A CA  1 
ATOM   552  C C   . GLU A 1 85  ? 36.353 -11.049 13.091 1.00 67.60  ? 85  GLU A C   1 
ATOM   553  O O   . GLU A 1 85  ? 35.174 -10.740 12.916 1.00 65.24  ? 85  GLU A O   1 
ATOM   554  C CB  . GLU A 1 85  ? 37.019 -11.269 10.682 1.00 70.59  ? 85  GLU A CB  1 
ATOM   555  C CG  . GLU A 1 85  ? 37.506 -12.233 9.637  1.00 75.31  ? 85  GLU A CG  1 
ATOM   556  C CD  . GLU A 1 85  ? 38.836 -12.845 10.036 1.00 78.67  ? 85  GLU A CD  1 
ATOM   557  O OE1 . GLU A 1 85  ? 39.845 -12.105 10.055 1.00 80.42  ? 85  GLU A OE1 1 
ATOM   558  O OE2 . GLU A 1 85  ? 38.874 -14.057 10.354 1.00 80.63  ? 85  GLU A OE2 1 
ATOM   559  N N   . ILE A 1 86  ? 37.034 -10.694 14.173 1.00 66.55  ? 86  ILE A N   1 
ATOM   560  C CA  . ILE A 1 86  ? 36.375 -9.946  15.233 1.00 65.09  ? 86  ILE A CA  1 
ATOM   561  C C   . ILE A 1 86  ? 36.950 -8.591  15.616 1.00 63.81  ? 86  ILE A C   1 
ATOM   562  O O   . ILE A 1 86  ? 38.167 -8.424  15.742 1.00 63.80  ? 86  ILE A O   1 
ATOM   563  C CB  . ILE A 1 86  ? 36.306 -10.801 16.516 1.00 64.72  ? 86  ILE A CB  1 
ATOM   564  C CG1 . ILE A 1 86  ? 35.677 -12.154 16.190 1.00 64.18  ? 86  ILE A CG1 1 
ATOM   565  C CG2 . ILE A 1 86  ? 35.506 -10.073 17.591 1.00 63.54  ? 86  ILE A CG2 1 
ATOM   566  C CD1 . ILE A 1 86  ? 35.484 -13.036 17.395 1.00 64.33  ? 86  ILE A CD1 1 
ATOM   567  N N   . ILE A 1 87  ? 36.059 -7.620  15.799 1.00 61.99  ? 87  ILE A N   1 
ATOM   568  C CA  . ILE A 1 87  ? 36.483 -6.292  16.231 1.00 61.30  ? 87  ILE A CA  1 
ATOM   569  C C   . ILE A 1 87  ? 35.833 -6.027  17.575 1.00 60.01  ? 87  ILE A C   1 
ATOM   570  O O   . ILE A 1 87  ? 34.660 -6.334  17.790 1.00 58.28  ? 87  ILE A O   1 
ATOM   571  C CB  . ILE A 1 87  ? 36.095 -5.165  15.240 1.00 59.56  ? 87  ILE A CB  1 
ATOM   572  C CG1 . ILE A 1 87  ? 34.615 -5.245  14.888 1.00 59.66  ? 87  ILE A CG1 1 
ATOM   573  C CG2 . ILE A 1 87  ? 36.965 -5.248  14.006 1.00 58.29  ? 87  ILE A CG2 1 
ATOM   574  C CD1 . ILE A 1 87  ? 34.205 -4.253  13.822 1.00 60.43  ? 87  ILE A CD1 1 
ATOM   575  N N   . THR A 1 88  ? 36.614 -5.467  18.484 1.00 58.70  ? 88  THR A N   1 
ATOM   576  C CA  . THR A 1 88  ? 36.119 -5.195  19.811 1.00 58.11  ? 88  THR A CA  1 
ATOM   577  C C   . THR A 1 88  ? 36.635 -3.839  20.288 1.00 58.20  ? 88  THR A C   1 
ATOM   578  O O   . THR A 1 88  ? 37.692 -3.384  19.852 1.00 59.01  ? 88  THR A O   1 
ATOM   579  C CB  . THR A 1 88  ? 36.546 -6.351  20.751 1.00 57.51  ? 88  THR A CB  1 
ATOM   580  O OG1 . THR A 1 88  ? 36.152 -6.064  22.096 1.00 56.50  ? 88  THR A OG1 1 
ATOM   581  C CG2 . THR A 1 88  ? 38.040 -6.578  20.666 1.00 57.03  ? 88  THR A CG2 1 
ATOM   582  N N   . GLY A 1 89  ? 35.871 -3.179  21.155 1.00 58.19  ? 89  GLY A N   1 
ATOM   583  C CA  . GLY A 1 89  ? 36.284 -1.878  21.651 1.00 57.31  ? 89  GLY A CA  1 
ATOM   584  C C   . GLY A 1 89  ? 35.487 -1.362  22.838 1.00 57.17  ? 89  GLY A C   1 
ATOM   585  O O   . GLY A 1 89  ? 34.426 -1.897  23.179 1.00 57.04  ? 89  GLY A O   1 
ATOM   586  N N   . ARG A 1 90  ? 36.025 -0.324  23.477 1.00 56.41  ? 90  ARG A N   1 
ATOM   587  C CA  . ARG A 1 90  ? 35.394 0.321   24.625 1.00 54.91  ? 90  ARG A CA  1 
ATOM   588  C C   . ARG A 1 90  ? 35.050 1.734   24.223 1.00 53.65  ? 90  ARG A C   1 
ATOM   589  O O   . ARG A 1 90  ? 35.918 2.588   24.114 1.00 54.31  ? 90  ARG A O   1 
ATOM   590  C CB  . ARG A 1 90  ? 36.341 0.359   25.814 1.00 54.46  ? 90  ARG A CB  1 
ATOM   591  C CG  . ARG A 1 90  ? 36.423 -0.948  26.518 1.00 57.12  ? 90  ARG A CG  1 
ATOM   592  C CD  . ARG A 1 90  ? 37.458 -0.965  27.631 1.00 59.39  ? 90  ARG A CD  1 
ATOM   593  N NE  . ARG A 1 90  ? 37.219 -2.143  28.458 1.00 62.43  ? 90  ARG A NE  1 
ATOM   594  C CZ  . ARG A 1 90  ? 36.147 -2.300  29.233 1.00 63.69  ? 90  ARG A CZ  1 
ATOM   595  N NH1 . ARG A 1 90  ? 35.225 -1.340  29.299 1.00 64.02  ? 90  ARG A NH1 1 
ATOM   596  N NH2 . ARG A 1 90  ? 35.968 -3.436  29.900 1.00 63.52  ? 90  ARG A NH2 1 
ATOM   597  N N   . LEU A 1 91  ? 33.775 1.984   24.000 1.00 52.35  ? 91  LEU A N   1 
ATOM   598  C CA  . LEU A 1 91  ? 33.364 3.302   23.592 1.00 51.46  ? 91  LEU A CA  1 
ATOM   599  C C   . LEU A 1 91  ? 33.583 4.348   24.662 1.00 50.75  ? 91  LEU A C   1 
ATOM   600  O O   . LEU A 1 91  ? 33.394 4.094   25.856 1.00 50.84  ? 91  LEU A O   1 
ATOM   601  C CB  . LEU A 1 91  ? 31.894 3.287   23.201 1.00 51.52  ? 91  LEU A CB  1 
ATOM   602  C CG  . LEU A 1 91  ? 31.569 2.388   22.015 1.00 51.48  ? 91  LEU A CG  1 
ATOM   603  C CD1 . LEU A 1 91  ? 30.099 2.550   21.633 1.00 51.90  ? 91  LEU A CD1 1 
ATOM   604  C CD2 . LEU A 1 91  ? 32.470 2.768   20.853 1.00 52.22  ? 91  LEU A CD2 1 
ATOM   605  N N   . PRO A 1 92  ? 34.002 5.546   24.243 1.00 49.30  ? 92  PRO A N   1 
ATOM   606  C CA  . PRO A 1 92  ? 34.232 6.636   25.184 1.00 49.34  ? 92  PRO A CA  1 
ATOM   607  C C   . PRO A 1 92  ? 32.877 7.286   25.520 1.00 50.19  ? 92  PRO A C   1 
ATOM   608  O O   . PRO A 1 92  ? 32.574 8.381   25.033 1.00 50.06  ? 92  PRO A O   1 
ATOM   609  C CB  . PRO A 1 92  ? 35.143 7.564   24.396 1.00 46.93  ? 92  PRO A CB  1 
ATOM   610  C CG  . PRO A 1 92  ? 34.613 7.422   23.015 1.00 46.94  ? 92  PRO A CG  1 
ATOM   611  C CD  . PRO A 1 92  ? 34.450 5.922   22.891 1.00 48.18  ? 92  PRO A CD  1 
ATOM   612  N N   . PHE A 1 93  ? 32.062 6.604   26.332 1.00 50.53  ? 93  PHE A N   1 
ATOM   613  C CA  . PHE A 1 93  ? 30.742 7.126   26.718 1.00 51.49  ? 93  PHE A CA  1 
ATOM   614  C C   . PHE A 1 93  ? 30.834 8.548   27.272 1.00 51.54  ? 93  PHE A C   1 
ATOM   615  O O   . PHE A 1 93  ? 31.571 8.833   28.216 1.00 51.09  ? 93  PHE A O   1 
ATOM   616  C CB  . PHE A 1 93  ? 30.064 6.194   27.728 1.00 51.75  ? 93  PHE A CB  1 
ATOM   617  C CG  . PHE A 1 93  ? 29.737 4.836   27.164 1.00 52.34  ? 93  PHE A CG  1 
ATOM   618  C CD1 . PHE A 1 93  ? 28.798 4.697   26.143 1.00 52.14  ? 93  PHE A CD1 1 
ATOM   619  C CD2 . PHE A 1 93  ? 30.400 3.700   27.613 1.00 52.12  ? 93  PHE A CD2 1 
ATOM   620  C CE1 . PHE A 1 93  ? 28.533 3.445   25.578 1.00 49.72  ? 93  PHE A CE1 1 
ATOM   621  C CE2 . PHE A 1 93  ? 30.139 2.445   27.051 1.00 50.44  ? 93  PHE A CE2 1 
ATOM   622  C CZ  . PHE A 1 93  ? 29.208 2.324   26.037 1.00 49.16  ? 93  PHE A CZ  1 
ATOM   623  N N   . PRO A 1 94  ? 30.069 9.463   26.680 1.00 51.74  ? 94  PRO A N   1 
ATOM   624  C CA  . PRO A 1 94  ? 30.034 10.876  27.060 1.00 53.17  ? 94  PRO A CA  1 
ATOM   625  C C   . PRO A 1 94  ? 29.700 11.247  28.514 1.00 54.45  ? 94  PRO A C   1 
ATOM   626  O O   . PRO A 1 94  ? 30.296 12.173  29.056 1.00 55.66  ? 94  PRO A O   1 
ATOM   627  C CB  . PRO A 1 94  ? 29.045 11.464  26.054 1.00 52.26  ? 94  PRO A CB  1 
ATOM   628  C CG  . PRO A 1 94  ? 28.111 10.315  25.817 1.00 49.45  ? 94  PRO A CG  1 
ATOM   629  C CD  . PRO A 1 94  ? 29.044 9.163   25.668 1.00 49.44  ? 94  PRO A CD  1 
ATOM   630  N N   . SER A 1 95  ? 28.769 10.538  29.148 1.00 54.40  ? 95  SER A N   1 
ATOM   631  C CA  . SER A 1 95  ? 28.387 10.865  30.520 1.00 54.00  ? 95  SER A CA  1 
ATOM   632  C C   . SER A 1 95  ? 28.123 9.653   31.406 1.00 53.54  ? 95  SER A C   1 
ATOM   633  O O   . SER A 1 95  ? 28.284 8.513   30.980 1.00 53.44  ? 95  SER A O   1 
ATOM   634  C CB  . SER A 1 95  ? 27.144 11.752  30.501 1.00 54.02  ? 95  SER A CB  1 
ATOM   635  O OG  . SER A 1 95  ? 26.806 12.205  31.798 1.00 57.47  ? 95  SER A OG  1 
ATOM   636  N N   . VAL A 1 96  ? 27.733 9.909   32.652 1.00 53.72  ? 96  VAL A N   1 
ATOM   637  C CA  . VAL A 1 96  ? 27.429 8.830   33.578 1.00 52.97  ? 96  VAL A CA  1 
ATOM   638  C C   . VAL A 1 96  ? 26.118 8.277   33.101 1.00 54.92  ? 96  VAL A C   1 
ATOM   639  O O   . VAL A 1 96  ? 25.175 9.038   32.867 1.00 56.40  ? 96  VAL A O   1 
ATOM   640  C CB  . VAL A 1 96  ? 27.220 9.313   35.017 1.00 51.73  ? 96  VAL A CB  1 
ATOM   641  C CG1 . VAL A 1 96  ? 26.622 8.192   35.845 1.00 48.27  ? 96  VAL A CG1 1 
ATOM   642  C CG2 . VAL A 1 96  ? 28.536 9.757   35.617 1.00 51.58  ? 96  VAL A CG2 1 
ATOM   643  N N   . GLY A 1 97  ? 26.062 6.955   32.959 1.00 55.79  ? 97  GLY A N   1 
ATOM   644  C CA  . GLY A 1 97  ? 24.853 6.307   32.488 1.00 54.82  ? 97  GLY A CA  1 
ATOM   645  C C   . GLY A 1 97  ? 23.640 6.611   33.346 1.00 53.81  ? 97  GLY A C   1 
ATOM   646  O O   . GLY A 1 97  ? 22.630 7.165   32.878 1.00 51.14  ? 97  GLY A O   1 
ATOM   647  N N   . GLY A 1 98  ? 23.743 6.243   34.615 1.00 53.51  ? 98  GLY A N   1 
ATOM   648  C CA  . GLY A 1 98  ? 22.639 6.472   35.512 1.00 54.58  ? 98  GLY A CA  1 
ATOM   649  C C   . GLY A 1 98  ? 22.856 5.874   36.876 1.00 55.40  ? 98  GLY A C   1 
ATOM   650  O O   . GLY A 1 98  ? 23.971 5.665   37.327 1.00 55.54  ? 98  GLY A O   1 
ATOM   651  N N   . THR A 1 99  ? 21.747 5.591   37.528 1.00 58.04  ? 99  THR A N   1 
ATOM   652  C CA  . THR A 1 99  ? 21.743 5.045   38.869 1.00 60.73  ? 99  THR A CA  1 
ATOM   653  C C   . THR A 1 99  ? 20.784 3.866   38.885 1.00 62.66  ? 99  THR A C   1 
ATOM   654  O O   . THR A 1 99  ? 19.858 3.802   38.081 1.00 64.42  ? 99  THR A O   1 
ATOM   655  C CB  . THR A 1 99  ? 21.250 6.130   39.857 1.00 59.73  ? 99  THR A CB  1 
ATOM   656  O OG1 . THR A 1 99  ? 22.333 7.003   40.182 1.00 60.14  ? 99  THR A OG1 1 
ATOM   657  C CG2 . THR A 1 99  ? 20.699 5.520   41.114 1.00 61.42  ? 99  THR A CG2 1 
ATOM   658  N N   . PRO A 1 100 ? 21.002 2.901   39.782 1.00 64.08  ? 100 PRO A N   1 
ATOM   659  C CA  . PRO A 1 100 ? 20.064 1.774   39.798 1.00 64.61  ? 100 PRO A CA  1 
ATOM   660  C C   . PRO A 1 100 ? 18.611 2.276   39.848 1.00 64.97  ? 100 PRO A C   1 
ATOM   661  O O   . PRO A 1 100 ? 17.695 1.613   39.373 1.00 65.08  ? 100 PRO A O   1 
ATOM   662  C CB  . PRO A 1 100 ? 20.486 1.015   41.047 1.00 64.26  ? 100 PRO A CB  1 
ATOM   663  C CG  . PRO A 1 100 ? 22.001 1.192   41.009 1.00 65.07  ? 100 PRO A CG  1 
ATOM   664  C CD  . PRO A 1 100 ? 22.170 2.653   40.649 1.00 64.17  ? 100 PRO A CD  1 
ATOM   665  N N   . VAL A 1 101 ? 18.427 3.472   40.397 1.00 66.20  ? 101 VAL A N   1 
ATOM   666  C CA  . VAL A 1 101 ? 17.114 4.104   40.527 1.00 69.36  ? 101 VAL A CA  1 
ATOM   667  C C   . VAL A 1 101 ? 16.549 4.639   39.197 1.00 70.45  ? 101 VAL A C   1 
ATOM   668  O O   . VAL A 1 101 ? 15.373 5.005   39.120 1.00 71.38  ? 101 VAL A O   1 
ATOM   669  C CB  . VAL A 1 101 ? 17.170 5.277   41.572 1.00 71.03  ? 101 VAL A CB  1 
ATOM   670  C CG1 . VAL A 1 101 ? 15.803 5.978   41.710 1.00 70.09  ? 101 VAL A CG1 1 
ATOM   671  C CG2 . VAL A 1 101 ? 17.610 4.735   42.915 1.00 71.62  ? 101 VAL A CG2 1 
ATOM   672  N N   . ASN A 1 102 ? 17.375 4.698   38.155 1.00 71.25  ? 102 ASN A N   1 
ATOM   673  C CA  . ASN A 1 102 ? 16.909 5.180   36.848 1.00 71.24  ? 102 ASN A CA  1 
ATOM   674  C C   . ASN A 1 102 ? 16.128 4.107   36.105 1.00 71.20  ? 102 ASN A C   1 
ATOM   675  O O   . ASN A 1 102 ? 16.035 2.961   36.556 1.00 72.55  ? 102 ASN A O   1 
ATOM   676  C CB  . ASN A 1 102 ? 18.084 5.628   35.977 1.00 71.07  ? 102 ASN A CB  1 
ATOM   677  C CG  . ASN A 1 102 ? 18.540 7.032   36.298 1.00 71.76  ? 102 ASN A CG  1 
ATOM   678  O OD1 . ASN A 1 102 ? 19.097 7.299   37.377 1.00 72.68  ? 102 ASN A OD1 1 
ATOM   679  N ND2 . ASN A 1 102 ? 18.295 7.951   35.367 1.00 69.43  ? 102 ASN A ND2 1 
ATOM   680  N N   . ASP A 1 103 ? 15.568 4.473   34.959 1.00 70.28  ? 103 ASP A N   1 
ATOM   681  C CA  . ASP A 1 103 ? 14.808 3.503   34.192 1.00 69.49  ? 103 ASP A CA  1 
ATOM   682  C C   . ASP A 1 103 ? 15.654 2.852   33.112 1.00 66.43  ? 103 ASP A C   1 
ATOM   683  O O   . ASP A 1 103 ? 16.841 2.594   33.323 1.00 64.88  ? 103 ASP A O   1 
ATOM   684  C CB  . ASP A 1 103 ? 13.565 4.161   33.597 1.00 73.16  ? 103 ASP A CB  1 
ATOM   685  C CG  . ASP A 1 103 ? 12.634 4.722   34.676 1.00 76.60  ? 103 ASP A CG  1 
ATOM   686  O OD1 . ASP A 1 103 ? 12.494 4.075   35.745 1.00 76.85  ? 103 ASP A OD1 1 
ATOM   687  O OD2 . ASP A 1 103 ? 12.037 5.800   34.452 1.00 78.66  ? 103 ASP A OD2 1 
ATOM   688  N N   . LEU A 1 104 ? 15.060 2.582   31.956 1.00 62.87  ? 104 LEU A N   1 
ATOM   689  C CA  . LEU A 1 104 ? 15.813 1.930   30.898 1.00 59.86  ? 104 LEU A CA  1 
ATOM   690  C C   . LEU A 1 104 ? 16.068 2.796   29.680 1.00 58.39  ? 104 LEU A C   1 
ATOM   691  O O   . LEU A 1 104 ? 15.346 3.746   29.397 1.00 59.20  ? 104 LEU A O   1 
ATOM   692  C CB  . LEU A 1 104 ? 15.099 0.648   30.446 1.00 60.16  ? 104 LEU A CB  1 
ATOM   693  C CG  . LEU A 1 104 ? 14.693 -0.381  31.507 1.00 60.09  ? 104 LEU A CG  1 
ATOM   694  C CD1 . LEU A 1 104 ? 13.511 0.145   32.286 1.00 62.34  ? 104 LEU A CD1 1 
ATOM   695  C CD2 . LEU A 1 104 ? 14.304 -1.682  30.856 1.00 60.81  ? 104 LEU A CD2 1 
ATOM   696  N N   . VAL A 1 105 ? 17.129 2.462   28.964 1.00 55.92  ? 105 VAL A N   1 
ATOM   697  C CA  . VAL A 1 105 ? 17.455 3.151   27.738 1.00 52.27  ? 105 VAL A CA  1 
ATOM   698  C C   . VAL A 1 105 ? 17.256 2.101   26.656 1.00 51.38  ? 105 VAL A C   1 
ATOM   699  O O   . VAL A 1 105 ? 17.621 0.938   26.844 1.00 51.35  ? 105 VAL A O   1 
ATOM   700  C CB  . VAL A 1 105 ? 18.932 3.633   27.718 1.00 51.42  ? 105 VAL A CB  1 
ATOM   701  C CG1 . VAL A 1 105 ? 19.845 2.548   28.219 1.00 49.15  ? 105 VAL A CG1 1 
ATOM   702  C CG2 . VAL A 1 105 ? 19.335 4.023   26.299 1.00 50.14  ? 105 VAL A CG2 1 
ATOM   703  N N   . ARG A 1 106 ? 16.640 2.488   25.546 1.00 50.40  ? 106 ARG A N   1 
ATOM   704  C CA  . ARG A 1 106 ? 16.461 1.557   24.436 1.00 50.74  ? 106 ARG A CA  1 
ATOM   705  C C   . ARG A 1 106 ? 17.448 1.972   23.371 1.00 50.24  ? 106 ARG A C   1 
ATOM   706  O O   . ARG A 1 106 ? 17.184 2.901   22.603 1.00 49.93  ? 106 ARG A O   1 
ATOM   707  C CB  . ARG A 1 106 ? 15.038 1.612   23.867 1.00 52.75  ? 106 ARG A CB  1 
ATOM   708  C CG  . ARG A 1 106 ? 14.894 0.947   22.485 1.00 52.82  ? 106 ARG A CG  1 
ATOM   709  C CD  . ARG A 1 106 ? 13.446 0.650   22.159 1.00 52.26  ? 106 ARG A CD  1 
ATOM   710  N NE  . ARG A 1 106 ? 12.869 -0.278  23.136 1.00 52.45  ? 106 ARG A NE  1 
ATOM   711  C CZ  . ARG A 1 106 ? 11.637 -0.785  23.069 1.00 51.80  ? 106 ARG A CZ  1 
ATOM   712  N NH1 . ARG A 1 106 ? 10.823 -0.456  22.060 1.00 47.13  ? 106 ARG A NH1 1 
ATOM   713  N NH2 . ARG A 1 106 ? 11.222 -1.628  24.014 1.00 48.47  ? 106 ARG A NH2 1 
ATOM   714  N N   . VAL A 1 107 ? 18.587 1.286   23.335 1.00 50.71  ? 107 VAL A N   1 
ATOM   715  C CA  . VAL A 1 107 ? 19.643 1.598   22.370 1.00 51.24  ? 107 VAL A CA  1 
ATOM   716  C C   . VAL A 1 107 ? 19.533 0.835   21.067 1.00 49.90  ? 107 VAL A C   1 
ATOM   717  O O   . VAL A 1 107 ? 19.097 -0.313  21.042 1.00 50.52  ? 107 VAL A O   1 
ATOM   718  C CB  . VAL A 1 107 ? 21.025 1.294   22.939 1.00 51.09  ? 107 VAL A CB  1 
ATOM   719  C CG1 . VAL A 1 107 ? 21.272 2.134   24.175 1.00 52.76  ? 107 VAL A CG1 1 
ATOM   720  C CG2 . VAL A 1 107 ? 21.128 -0.186  23.249 1.00 52.28  ? 107 VAL A CG2 1 
ATOM   721  N N   . LEU A 1 108 ? 19.953 1.488   19.992 1.00 48.75  ? 108 LEU A N   1 
ATOM   722  C CA  . LEU A 1 108 ? 19.936 0.894   18.666 1.00 48.83  ? 108 LEU A CA  1 
ATOM   723  C C   . LEU A 1 108 ? 21.368 0.506   18.258 1.00 49.54  ? 108 LEU A C   1 
ATOM   724  O O   . LEU A 1 108 ? 22.326 1.268   18.484 1.00 48.64  ? 108 LEU A O   1 
ATOM   725  C CB  . LEU A 1 108 ? 19.369 1.901   17.676 1.00 48.07  ? 108 LEU A CB  1 
ATOM   726  C CG  . LEU A 1 108 ? 18.240 1.503   16.729 1.00 48.78  ? 108 LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 108 ? 17.165 0.685   17.438 1.00 48.17  ? 108 LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 108 ? 17.642 2.787   16.159 1.00 49.52  ? 108 LEU A CD2 1 
ATOM   729  N N   . VAL A 1 109 ? 21.515 -0.681  17.671 1.00 48.40  ? 109 VAL A N   1 
ATOM   730  C CA  . VAL A 1 109 ? 22.824 -1.147  17.234 1.00 47.61  ? 109 VAL A CA  1 
ATOM   731  C C   . VAL A 1 109 ? 22.811 -1.428  15.746 1.00 47.35  ? 109 VAL A C   1 
ATOM   732  O O   . VAL A 1 109 ? 21.901 -2.063  15.233 1.00 47.32  ? 109 VAL A O   1 
ATOM   733  C CB  . VAL A 1 109 ? 23.219 -2.424  17.949 1.00 47.70  ? 109 VAL A CB  1 
ATOM   734  C CG1 . VAL A 1 109 ? 24.621 -2.826  17.543 1.00 48.00  ? 109 VAL A CG1 1 
ATOM   735  C CG2 . VAL A 1 109 ? 23.121 -2.221  19.446 1.00 48.15  ? 109 VAL A CG2 1 
ATOM   736  N N   . VAL A 1 110 ? 23.833 -0.956  15.053 1.00 48.83  ? 110 VAL A N   1 
ATOM   737  C CA  . VAL A 1 110 ? 23.932 -1.156  13.611 1.00 50.22  ? 110 VAL A CA  1 
ATOM   738  C C   . VAL A 1 110 ? 25.258 -1.767  13.187 1.00 50.43  ? 110 VAL A C   1 
ATOM   739  O O   . VAL A 1 110 ? 26.321 -1.238  13.491 1.00 49.80  ? 110 VAL A O   1 
ATOM   740  C CB  . VAL A 1 110 ? 23.791 0.176   12.861 1.00 50.80  ? 110 VAL A CB  1 
ATOM   741  C CG1 . VAL A 1 110 ? 23.847 -0.049  11.360 1.00 50.37  ? 110 VAL A CG1 1 
ATOM   742  C CG2 . VAL A 1 110 ? 22.505 0.841   13.256 1.00 51.91  ? 110 VAL A CG2 1 
ATOM   743  N N   . ALA A 1 111 ? 25.187 -2.886  12.480 1.00 52.61  ? 111 ALA A N   1 
ATOM   744  C CA  . ALA A 1 111 ? 26.386 -3.546  11.969 1.00 54.26  ? 111 ALA A CA  1 
ATOM   745  C C   . ALA A 1 111 ? 26.285 -3.495  10.453 1.00 55.58  ? 111 ALA A C   1 
ATOM   746  O O   . ALA A 1 111 ? 25.259 -3.852  9.879  1.00 54.78  ? 111 ALA A O   1 
ATOM   747  C CB  . ALA A 1 111 ? 26.449 -4.976  12.433 1.00 52.34  ? 111 ALA A CB  1 
ATOM   748  N N   . GLU A 1 112 ? 27.342 -3.034  9.805  1.00 58.93  ? 112 GLU A N   1 
ATOM   749  C CA  . GLU A 1 112 ? 27.338 -2.945  8.357  1.00 63.88  ? 112 GLU A CA  1 
ATOM   750  C C   . GLU A 1 112 ? 28.754 -2.941  7.796  1.00 66.51  ? 112 GLU A C   1 
ATOM   751  O O   . GLU A 1 112 ? 29.740 -2.888  8.537  1.00 67.61  ? 112 GLU A O   1 
ATOM   752  C CB  . GLU A 1 112 ? 26.629 -1.674  7.920  1.00 64.92  ? 112 GLU A CB  1 
ATOM   753  C CG  . GLU A 1 112 ? 27.243 -0.443  8.537  1.00 67.39  ? 112 GLU A CG  1 
ATOM   754  C CD  . GLU A 1 112 ? 26.854 0.819   7.818  1.00 69.46  ? 112 GLU A CD  1 
ATOM   755  O OE1 . GLU A 1 112 ? 27.239 0.959   6.637  1.00 72.19  ? 112 GLU A OE1 1 
ATOM   756  O OE2 . GLU A 1 112 ? 26.167 1.667   8.430  1.00 70.08  ? 112 GLU A OE2 1 
ATOM   757  N N   . SER A 1 113 ? 28.843 -2.991  6.473  1.00 68.54  ? 113 SER A N   1 
ATOM   758  C CA  . SER A 1 113 ? 30.121 -2.993  5.789  1.00 69.83  ? 113 SER A CA  1 
ATOM   759  C C   . SER A 1 113 ? 29.825 -2.517  4.404  1.00 71.61  ? 113 SER A C   1 
ATOM   760  O O   . SER A 1 113 ? 28.664 -2.417  4.009  1.00 70.20  ? 113 SER A O   1 
ATOM   761  C CB  . SER A 1 113 ? 30.674 -4.400  5.663  1.00 69.93  ? 113 SER A CB  1 
ATOM   762  O OG  . SER A 1 113 ? 30.012 -5.063  4.596  1.00 70.27  ? 113 SER A OG  1 
ATOM   763  N N   . ASN A 1 114 ? 30.885 -2.247  3.659  1.00 74.47  ? 114 ASN A N   1 
ATOM   764  C CA  . ASN A 1 114 ? 30.728 -1.808  2.297  1.00 77.62  ? 114 ASN A CA  1 
ATOM   765  C C   . ASN A 1 114 ? 30.228 -2.978  1.486  1.00 79.21  ? 114 ASN A C   1 
ATOM   766  O O   . ASN A 1 114 ? 30.568 -4.131  1.757  1.00 77.65  ? 114 ASN A O   1 
ATOM   767  C CB  . ASN A 1 114 ? 32.052 -1.319  1.725  1.00 78.83  ? 114 ASN A CB  1 
ATOM   768  C CG  . ASN A 1 114 ? 32.151 0.188   1.708  1.00 80.25  ? 114 ASN A CG  1 
ATOM   769  O OD1 . ASN A 1 114 ? 31.292 0.870   1.136  1.00 79.79  ? 114 ASN A OD1 1 
ATOM   770  N ND2 . ASN A 1 114 ? 33.204 0.722   2.330  1.00 80.84  ? 114 ASN A ND2 1 
ATOM   771  N N   . THR A 1 115 ? 29.396 -2.661  0.504  1.00 82.26  ? 115 THR A N   1 
ATOM   772  C CA  . THR A 1 115 ? 28.841 -3.656  -0.387 1.00 86.07  ? 115 THR A CA  1 
ATOM   773  C C   . THR A 1 115 ? 29.981 -4.001  -1.338 1.00 88.76  ? 115 THR A C   1 
ATOM   774  O O   . THR A 1 115 ? 30.457 -3.148  -2.078 1.00 88.88  ? 115 THR A O   1 
ATOM   775  C CB  . THR A 1 115 ? 27.639 -3.062  -1.163 1.00 86.55  ? 115 THR A CB  1 
ATOM   776  O OG1 . THR A 1 115 ? 28.077 -1.958  -1.966 1.00 87.13  ? 115 THR A OG1 1 
ATOM   777  C CG2 . THR A 1 115 ? 26.582 -2.551  -0.186 1.00 86.80  ? 115 THR A CG2 1 
ATOM   778  N N   . PRO A 1 116 ? 30.476 -5.244  -1.287 1.00 91.84  ? 116 PRO A N   1 
ATOM   779  C CA  . PRO A 1 116 ? 31.570 -5.653  -2.170 1.00 94.76  ? 116 PRO A CA  1 
ATOM   780  C C   . PRO A 1 116 ? 31.063 -5.816  -3.591 1.00 98.11  ? 116 PRO A C   1 
ATOM   781  O O   . PRO A 1 116 ? 30.065 -6.507  -3.830 1.00 99.33  ? 116 PRO A O   1 
ATOM   782  C CB  . PRO A 1 116 ? 32.022 -6.980  -1.571 1.00 93.68  ? 116 PRO A CB  1 
ATOM   783  C CG  . PRO A 1 116 ? 30.715 -7.540  -1.009 1.00 92.72  ? 116 PRO A CG  1 
ATOM   784  C CD  . PRO A 1 116 ? 30.147 -6.314  -0.332 1.00 92.30  ? 116 PRO A CD  1 
ATOM   785  N N   . GLU A 1 117 ? 31.757 -5.180  -4.527 1.00 100.42 ? 117 GLU A N   1 
ATOM   786  C CA  . GLU A 1 117 ? 31.389 -5.237  -5.930 1.00 102.96 ? 117 GLU A CA  1 
ATOM   787  C C   . GLU A 1 117 ? 31.358 -6.675  -6.467 1.00 104.04 ? 117 GLU A C   1 
ATOM   788  O O   . GLU A 1 117 ? 30.674 -6.962  -7.457 1.00 104.32 ? 117 GLU A O   1 
ATOM   789  C CB  . GLU A 1 117 ? 32.372 -4.381  -6.723 1.00 104.43 ? 117 GLU A CB  1 
ATOM   790  C CG  . GLU A 1 117 ? 33.829 -4.747  -6.476 1.00 106.12 ? 117 GLU A CG  1 
ATOM   791  C CD  . GLU A 1 117 ? 34.780 -3.600  -6.775 1.00 106.61 ? 117 GLU A CD  1 
ATOM   792  O OE1 . GLU A 1 117 ? 34.730 -3.048  -7.901 1.00 105.08 ? 117 GLU A OE1 1 
ATOM   793  O OE2 . GLU A 1 117 ? 35.580 -3.256  -5.875 1.00 106.78 ? 117 GLU A OE2 1 
ATOM   794  N N   . GLU A 1 118 ? 32.090 -7.576  -5.811 1.00 104.46 ? 118 GLU A N   1 
ATOM   795  C CA  . GLU A 1 118 ? 32.136 -8.978  -6.230 1.00 104.36 ? 118 GLU A CA  1 
ATOM   796  C C   . GLU A 1 118 ? 31.348 -9.857  -5.264 1.00 103.10 ? 118 GLU A C   1 
ATOM   797  O O   . GLU A 1 118 ? 31.752 -10.035 -4.116 1.00 103.42 ? 118 GLU A O   1 
ATOM   798  C CB  . GLU A 1 118 ? 33.586 -9.470  -6.284 1.00 105.80 ? 118 GLU A CB  1 
ATOM   799  C CG  . GLU A 1 118 ? 34.549 -8.539  -7.022 1.00 109.39 ? 118 GLU A CG  1 
ATOM   800  C CD  . GLU A 1 118 ? 34.289 -8.454  -8.529 1.00 111.27 ? 118 GLU A CD  1 
ATOM   801  O OE1 . GLU A 1 118 ? 34.463 -9.478  -9.232 1.00 112.16 ? 118 GLU A OE1 1 
ATOM   802  O OE2 . GLU A 1 118 ? 33.911 -7.360  -9.011 1.00 111.17 ? 118 GLU A OE2 1 
ATOM   803  N N   . THR A 1 119 ? 30.228 -10.406 -5.727 1.00 101.39 ? 119 THR A N   1 
ATOM   804  C CA  . THR A 1 119 ? 29.410 -11.271 -4.880 1.00 99.63  ? 119 THR A CA  1 
ATOM   805  C C   . THR A 1 119 ? 30.288 -12.223 -4.075 1.00 98.76  ? 119 THR A C   1 
ATOM   806  O O   . THR A 1 119 ? 30.982 -13.072 -4.638 1.00 97.90  ? 119 THR A O   1 
ATOM   807  C CB  . THR A 1 119 ? 28.437 -12.117 -5.705 1.00 99.21  ? 119 THR A CB  1 
ATOM   808  O OG1 . THR A 1 119 ? 27.536 -11.255 -6.406 1.00 98.53  ? 119 THR A OG1 1 
ATOM   809  C CG2 . THR A 1 119 ? 27.653 -13.055 -4.796 1.00 98.36  ? 119 THR A CG2 1 
ATOM   810  N N   . PRO A 1 120 ? 30.262 -12.090 -2.738 1.00 98.23  ? 120 PRO A N   1 
ATOM   811  C CA  . PRO A 1 120 ? 31.053 -12.928 -1.831 1.00 97.13  ? 120 PRO A CA  1 
ATOM   812  C C   . PRO A 1 120 ? 30.530 -14.353 -1.698 1.00 95.63  ? 120 PRO A C   1 
ATOM   813  O O   . PRO A 1 120 ? 29.448 -14.683 -2.186 1.00 94.34  ? 120 PRO A O   1 
ATOM   814  C CB  . PRO A 1 120 ? 30.981 -12.163 -0.515 1.00 97.52  ? 120 PRO A CB  1 
ATOM   815  C CG  . PRO A 1 120 ? 29.587 -11.596 -0.559 1.00 98.02  ? 120 PRO A CG  1 
ATOM   816  C CD  . PRO A 1 120 ? 29.493 -11.081 -1.983 1.00 97.96  ? 120 PRO A CD  1 
ATOM   817  N N   . GLU A 1 121 ? 31.316 -15.192 -1.033 1.00 95.36  ? 121 GLU A N   1 
ATOM   818  C CA  . GLU A 1 121 ? 30.940 -16.581 -0.819 1.00 95.74  ? 121 GLU A CA  1 
ATOM   819  C C   . GLU A 1 121 ? 29.697 -16.693 0.058  1.00 94.40  ? 121 GLU A C   1 
ATOM   820  O O   . GLU A 1 121 ? 28.673 -17.219 -0.385 1.00 93.72  ? 121 GLU A O   1 
ATOM   821  C CB  . GLU A 1 121 ? 32.103 -17.363 -0.191 1.00 97.03  ? 121 GLU A CB  1 
ATOM   822  C CG  . GLU A 1 121 ? 33.180 -17.762 -1.202 1.00 100.13 ? 121 GLU A CG  1 
ATOM   823  C CD  . GLU A 1 121 ? 32.635 -18.652 -2.324 1.00 101.75 ? 121 GLU A CD  1 
ATOM   824  O OE1 . GLU A 1 121 ? 32.302 -19.833 -2.054 1.00 101.77 ? 121 GLU A OE1 1 
ATOM   825  O OE2 . GLU A 1 121 ? 32.533 -18.163 -3.473 1.00 101.68 ? 121 GLU A OE2 1 
ATOM   826  N N   . GLU A 1 122 ? 29.786 -16.185 1.289  1.00 93.24  ? 122 GLU A N   1 
ATOM   827  C CA  . GLU A 1 122 ? 28.665 -16.231 2.235  1.00 90.89  ? 122 GLU A CA  1 
ATOM   828  C C   . GLU A 1 122 ? 27.910 -14.907 2.365  1.00 87.74  ? 122 GLU A C   1 
ATOM   829  O O   . GLU A 1 122 ? 28.375 -13.858 1.917  1.00 85.90  ? 122 GLU A O   1 
ATOM   830  C CB  . GLU A 1 122 ? 29.146 -16.675 3.629  1.00 92.18  ? 122 GLU A CB  1 
ATOM   831  C CG  . GLU A 1 122 ? 30.045 -15.677 4.337  1.00 94.94  ? 122 GLU A CG  1 
ATOM   832  C CD  . GLU A 1 122 ? 31.257 -15.331 3.509  1.00 96.68  ? 122 GLU A CD  1 
ATOM   833  O OE1 . GLU A 1 122 ? 31.971 -16.272 3.099  1.00 98.65  ? 122 GLU A OE1 1 
ATOM   834  O OE2 . GLU A 1 122 ? 31.494 -14.127 3.262  1.00 97.30  ? 122 GLU A OE2 1 
ATOM   835  N N   . GLU A 1 123 ? 26.737 -14.979 2.986  1.00 85.46  ? 123 GLU A N   1 
ATOM   836  C CA  . GLU A 1 123 ? 25.894 -13.813 3.203  1.00 83.32  ? 123 GLU A CA  1 
ATOM   837  C C   . GLU A 1 123 ? 26.443 -12.993 4.369  1.00 81.25  ? 123 GLU A C   1 
ATOM   838  O O   . GLU A 1 123 ? 26.955 -13.554 5.347  1.00 82.05  ? 123 GLU A O   1 
ATOM   839  C CB  . GLU A 1 123 ? 24.465 -14.255 3.527  1.00 83.89  ? 123 GLU A CB  1 
ATOM   840  C CG  . GLU A 1 123 ? 23.878 -15.243 2.536  1.00 86.08  ? 123 GLU A CG  1 
ATOM   841  C CD  . GLU A 1 123 ? 22.437 -15.609 2.861  1.00 88.22  ? 123 GLU A CD  1 
ATOM   842  O OE1 . GLU A 1 123 ? 21.544 -14.750 2.678  1.00 88.20  ? 123 GLU A OE1 1 
ATOM   843  O OE2 . GLU A 1 123 ? 22.198 -16.756 3.308  1.00 88.93  ? 123 GLU A OE2 1 
ATOM   844  N N   . PHE A 1 124 ? 26.342 -11.669 4.263  1.00 77.30  ? 124 PHE A N   1 
ATOM   845  C CA  . PHE A 1 124 ? 26.812 -10.783 5.325  1.00 73.30  ? 124 PHE A CA  1 
ATOM   846  C C   . PHE A 1 124 ? 26.345 -11.332 6.669  1.00 71.08  ? 124 PHE A C   1 
ATOM   847  O O   . PHE A 1 124 ? 25.261 -11.897 6.781  1.00 70.51  ? 124 PHE A O   1 
ATOM   848  C CB  . PHE A 1 124 ? 26.259 -9.369  5.121  1.00 72.72  ? 124 PHE A CB  1 
ATOM   849  C CG  . PHE A 1 124 ? 26.585 -8.419  6.243  1.00 72.22  ? 124 PHE A CG  1 
ATOM   850  C CD1 . PHE A 1 124 ? 27.894 -7.998  6.460  1.00 70.52  ? 124 PHE A CD1 1 
ATOM   851  C CD2 . PHE A 1 124 ? 25.585 -7.965  7.103  1.00 71.88  ? 124 PHE A CD2 1 
ATOM   852  C CE1 . PHE A 1 124 ? 28.205 -7.146  7.517  1.00 68.82  ? 124 PHE A CE1 1 
ATOM   853  C CE2 . PHE A 1 124 ? 25.889 -7.115  8.161  1.00 69.55  ? 124 PHE A CE2 1 
ATOM   854  C CZ  . PHE A 1 124 ? 27.202 -6.705  8.367  1.00 69.08  ? 124 PHE A CZ  1 
ATOM   855  N N   . TYR A 1 125 ? 27.169 -11.178 7.693  1.00 69.71  ? 125 TYR A N   1 
ATOM   856  C CA  . TYR A 1 125 ? 26.810 -11.678 9.015  1.00 68.48  ? 125 TYR A CA  1 
ATOM   857  C C   . TYR A 1 125 ? 27.564 -10.938 10.104 1.00 66.85  ? 125 TYR A C   1 
ATOM   858  O O   . TYR A 1 125 ? 28.743 -10.606 9.940  1.00 67.55  ? 125 TYR A O   1 
ATOM   859  C CB  . TYR A 1 125 ? 27.136 -13.164 9.136  1.00 68.59  ? 125 TYR A CB  1 
ATOM   860  C CG  . TYR A 1 125 ? 26.979 -13.681 10.544 1.00 67.90  ? 125 TYR A CG  1 
ATOM   861  C CD1 . TYR A 1 125 ? 25.739 -14.073 11.024 1.00 67.45  ? 125 TYR A CD1 1 
ATOM   862  C CD2 . TYR A 1 125 ? 28.073 -13.768 11.400 1.00 68.19  ? 125 TYR A CD2 1 
ATOM   863  C CE1 . TYR A 1 125 ? 25.588 -14.548 12.321 1.00 68.15  ? 125 TYR A CE1 1 
ATOM   864  C CE2 . TYR A 1 125 ? 27.936 -14.238 12.702 1.00 67.93  ? 125 TYR A CE2 1 
ATOM   865  C CZ  . TYR A 1 125 ? 26.691 -14.631 13.156 1.00 68.12  ? 125 TYR A CZ  1 
ATOM   866  O OH  . TYR A 1 125 ? 26.549 -15.141 14.428 1.00 67.83  ? 125 TYR A OH  1 
ATOM   867  N N   . ALA A 1 126 ? 26.882 -10.703 11.219 1.00 63.87  ? 126 ALA A N   1 
ATOM   868  C CA  . ALA A 1 126 ? 27.481 -10.011 12.343 1.00 60.65  ? 126 ALA A CA  1 
ATOM   869  C C   . ALA A 1 126 ? 26.734 -10.335 13.621 1.00 58.89  ? 126 ALA A C   1 
ATOM   870  O O   . ALA A 1 126 ? 25.505 -10.356 13.661 1.00 57.80  ? 126 ALA A O   1 
ATOM   871  C CB  . ALA A 1 126 ? 27.481 -8.517  12.108 1.00 59.33  ? 126 ALA A CB  1 
ATOM   872  N N   . TYR A 1 127 ? 27.498 -10.613 14.666 1.00 57.46  ? 127 TYR A N   1 
ATOM   873  C CA  . TYR A 1 127 ? 26.932 -10.897 15.969 1.00 57.56  ? 127 TYR A CA  1 
ATOM   874  C C   . TYR A 1 127 ? 27.550 -9.895  16.939 1.00 58.27  ? 127 TYR A C   1 
ATOM   875  O O   . TYR A 1 127 ? 28.751 -9.958  17.256 1.00 58.82  ? 127 TYR A O   1 
ATOM   876  C CB  . TYR A 1 127 ? 27.233 -12.327 16.415 1.00 57.30  ? 127 TYR A CB  1 
ATOM   877  C CG  . TYR A 1 127 ? 26.604 -12.631 17.758 1.00 57.73  ? 127 TYR A CG  1 
ATOM   878  C CD1 . TYR A 1 127 ? 25.225 -12.741 17.891 1.00 58.90  ? 127 TYR A CD1 1 
ATOM   879  C CD2 . TYR A 1 127 ? 27.383 -12.681 18.920 1.00 58.78  ? 127 TYR A CD2 1 
ATOM   880  C CE1 . TYR A 1 127 ? 24.632 -12.879 19.149 1.00 59.92  ? 127 TYR A CE1 1 
ATOM   881  C CE2 . TYR A 1 127 ? 26.807 -12.817 20.179 1.00 58.54  ? 127 TYR A CE2 1 
ATOM   882  C CZ  . TYR A 1 127 ? 25.429 -12.907 20.288 1.00 60.54  ? 127 TYR A CZ  1 
ATOM   883  O OH  . TYR A 1 127 ? 24.841 -12.951 21.533 1.00 60.51  ? 127 TYR A OH  1 
ATOM   884  N N   . VAL A 1 128 ? 26.719 -8.959  17.390 1.00 57.51  ? 128 VAL A N   1 
ATOM   885  C CA  . VAL A 1 128 ? 27.156 -7.921  18.307 1.00 55.53  ? 128 VAL A CA  1 
ATOM   886  C C   . VAL A 1 128 ? 26.704 -8.260  19.713 1.00 54.81  ? 128 VAL A C   1 
ATOM   887  O O   . VAL A 1 128 ? 25.609 -8.778  19.917 1.00 54.03  ? 128 VAL A O   1 
ATOM   888  C CB  . VAL A 1 128 ? 26.575 -6.559  17.904 1.00 54.77  ? 128 VAL A CB  1 
ATOM   889  C CG1 . VAL A 1 128 ? 27.202 -5.452  18.742 1.00 55.90  ? 128 VAL A CG1 1 
ATOM   890  C CG2 . VAL A 1 128 ? 26.824 -6.307  16.441 1.00 53.02  ? 128 VAL A CG2 1 
ATOM   891  N N   . GLU A 1 129 ? 27.562 -7.985  20.682 1.00 55.20  ? 129 GLU A N   1 
ATOM   892  C CA  . GLU A 1 129 ? 27.226 -8.251  22.064 1.00 56.21  ? 129 GLU A CA  1 
ATOM   893  C C   . GLU A 1 129 ? 27.921 -7.198  22.896 1.00 56.48  ? 129 GLU A C   1 
ATOM   894  O O   . GLU A 1 129 ? 29.068 -6.843  22.631 1.00 55.59  ? 129 GLU A O   1 
ATOM   895  C CB  . GLU A 1 129 ? 27.658 -9.669  22.467 1.00 57.84  ? 129 GLU A CB  1 
ATOM   896  C CG  . GLU A 1 129 ? 29.166 -9.954  22.445 1.00 63.04  ? 129 GLU A CG  1 
ATOM   897  C CD  . GLU A 1 129 ? 29.534 -11.321 21.807 1.00 64.63  ? 129 GLU A CD  1 
ATOM   898  O OE1 . GLU A 1 129 ? 29.415 -11.456 20.560 1.00 64.70  ? 129 GLU A OE1 1 
ATOM   899  O OE2 . GLU A 1 129 ? 29.949 -12.249 22.548 1.00 62.01  ? 129 GLU A OE2 1 
ATOM   900  N N   . LEU A 1 130 ? 27.190 -6.667  23.872 1.00 57.42  ? 130 LEU A N   1 
ATOM   901  C CA  . LEU A 1 130 ? 27.693 -5.640  24.780 1.00 57.63  ? 130 LEU A CA  1 
ATOM   902  C C   . LEU A 1 130 ? 27.871 -6.299  26.140 1.00 58.08  ? 130 LEU A C   1 
ATOM   903  O O   . LEU A 1 130 ? 26.883 -6.677  26.774 1.00 58.62  ? 130 LEU A O   1 
ATOM   904  C CB  . LEU A 1 130 ? 26.671 -4.512  24.909 1.00 57.84  ? 130 LEU A CB  1 
ATOM   905  C CG  . LEU A 1 130 ? 26.134 -3.911  23.616 1.00 57.72  ? 130 LEU A CG  1 
ATOM   906  C CD1 . LEU A 1 130 ? 24.992 -2.969  23.914 1.00 56.68  ? 130 LEU A CD1 1 
ATOM   907  C CD2 . LEU A 1 130 ? 27.254 -3.194  22.903 1.00 58.66  ? 130 LEU A CD2 1 
ATOM   908  N N   . GLN A 1 131 ? 29.106 -6.433  26.609 1.00 57.66  ? 131 GLN A N   1 
ATOM   909  C CA  . GLN A 1 131 ? 29.294 -7.084  27.889 1.00 59.27  ? 131 GLN A CA  1 
ATOM   910  C C   . GLN A 1 131 ? 29.668 -6.155  29.010 1.00 59.70  ? 131 GLN A C   1 
ATOM   911  O O   . GLN A 1 131 ? 30.429 -5.210  28.828 1.00 59.01  ? 131 GLN A O   1 
ATOM   912  C CB  . GLN A 1 131 ? 30.342 -8.186  27.784 1.00 59.53  ? 131 GLN A CB  1 
ATOM   913  C CG  . GLN A 1 131 ? 31.764 -7.687  27.777 1.00 61.93  ? 131 GLN A CG  1 
ATOM   914  C CD  . GLN A 1 131 ? 32.777 -8.789  27.499 1.00 62.08  ? 131 GLN A CD  1 
ATOM   915  O OE1 . GLN A 1 131 ? 33.951 -8.659  27.839 1.00 62.30  ? 131 GLN A OE1 1 
ATOM   916  N NE2 . GLN A 1 131 ? 32.330 -9.868  26.865 1.00 61.34  ? 131 GLN A NE2 1 
ATOM   917  N N   . THR A 1 132 ? 29.099 -6.443  30.172 1.00 61.94  ? 132 THR A N   1 
ATOM   918  C CA  . THR A 1 132 ? 29.353 -5.696  31.392 1.00 64.22  ? 132 THR A CA  1 
ATOM   919  C C   . THR A 1 132 ? 29.844 -6.736  32.379 1.00 65.54  ? 132 THR A C   1 
ATOM   920  O O   . THR A 1 132 ? 29.595 -7.932  32.200 1.00 65.70  ? 132 THR A O   1 
ATOM   921  C CB  . THR A 1 132 ? 28.080 -5.024  31.929 1.00 63.32  ? 132 THR A CB  1 
ATOM   922  O OG1 . THR A 1 132 ? 27.005 -5.969  31.945 1.00 64.34  ? 132 THR A OG1 1 
ATOM   923  C CG2 . THR A 1 132 ? 27.700 -3.844  31.053 1.00 64.57  ? 132 THR A CG2 1 
ATOM   924  N N   . GLU A 1 133 ? 30.542 -6.284  33.412 1.00 67.38  ? 133 GLU A N   1 
ATOM   925  C CA  . GLU A 1 133 ? 31.104 -7.181  34.406 1.00 68.75  ? 133 GLU A CA  1 
ATOM   926  C C   . GLU A 1 133 ? 30.184 -8.337  34.778 1.00 68.69  ? 133 GLU A C   1 
ATOM   927  O O   . GLU A 1 133 ? 30.627 -9.479  34.920 1.00 67.76  ? 133 GLU A O   1 
ATOM   928  C CB  . GLU A 1 133 ? 31.491 -6.384  35.648 1.00 71.10  ? 133 GLU A CB  1 
ATOM   929  C CG  . GLU A 1 133 ? 32.429 -7.123  36.589 1.00 76.32  ? 133 GLU A CG  1 
ATOM   930  C CD  . GLU A 1 133 ? 33.058 -6.213  37.644 1.00 78.98  ? 133 GLU A CD  1 
ATOM   931  O OE1 . GLU A 1 133 ? 32.340 -5.337  38.192 1.00 79.12  ? 133 GLU A OE1 1 
ATOM   932  O OE2 . GLU A 1 133 ? 34.270 -6.389  37.930 1.00 79.40  ? 133 GLU A OE2 1 
ATOM   933  N N   . LEU A 1 134 ? 28.899 -8.047  34.913 1.00 69.30  ? 134 LEU A N   1 
ATOM   934  C CA  . LEU A 1 134 ? 27.942 -9.075  35.282 1.00 69.66  ? 134 LEU A CA  1 
ATOM   935  C C   . LEU A 1 134 ? 27.266 -9.774  34.132 1.00 69.60  ? 134 LEU A C   1 
ATOM   936  O O   . LEU A 1 134 ? 27.514 -10.945 33.886 1.00 70.44  ? 134 LEU A O   1 
ATOM   937  C CB  . LEU A 1 134 ? 26.869 -8.497  36.188 1.00 70.56  ? 134 LEU A CB  1 
ATOM   938  C CG  . LEU A 1 134 ? 27.259 -8.465  37.657 1.00 69.84  ? 134 LEU A CG  1 
ATOM   939  C CD1 . LEU A 1 134 ? 26.079 -7.972  38.481 1.00 71.51  ? 134 LEU A CD1 1 
ATOM   940  C CD2 . LEU A 1 134 ? 27.672 -9.856  38.095 1.00 69.02  ? 134 LEU A CD2 1 
ATOM   941  N N   . TYR A 1 135 ? 26.388 -9.062  33.441 1.00 70.76  ? 135 TYR A N   1 
ATOM   942  C CA  . TYR A 1 135 ? 25.676 -9.662  32.326 1.00 72.09  ? 135 TYR A CA  1 
ATOM   943  C C   . TYR A 1 135 ? 26.174 -9.184  30.972 1.00 70.38  ? 135 TYR A C   1 
ATOM   944  O O   . TYR A 1 135 ? 26.661 -8.061  30.829 1.00 69.97  ? 135 TYR A O   1 
ATOM   945  C CB  . TYR A 1 135 ? 24.174 -9.378  32.441 1.00 75.24  ? 135 TYR A CB  1 
ATOM   946  C CG  . TYR A 1 135 ? 23.345 -10.003 31.325 1.00 78.41  ? 135 TYR A CG  1 
ATOM   947  C CD1 . TYR A 1 135 ? 23.219 -11.395 31.209 1.00 79.40  ? 135 TYR A CD1 1 
ATOM   948  C CD2 . TYR A 1 135 ? 22.677 -9.203  30.393 1.00 78.53  ? 135 TYR A CD2 1 
ATOM   949  C CE1 . TYR A 1 135 ? 22.439 -11.972 30.189 1.00 79.65  ? 135 TYR A CE1 1 
ATOM   950  C CE2 . TYR A 1 135 ? 21.901 -9.766  29.375 1.00 79.47  ? 135 TYR A CE2 1 
ATOM   951  C CZ  . TYR A 1 135 ? 21.782 -11.150 29.277 1.00 80.06  ? 135 TYR A CZ  1 
ATOM   952  O OH  . TYR A 1 135 ? 21.000 -11.701 28.279 1.00 77.75  ? 135 TYR A OH  1 
ATOM   953  N N   . THR A 1 136 ? 26.054 -10.054 29.979 1.00 67.75  ? 136 THR A N   1 
ATOM   954  C CA  . THR A 1 136 ? 26.457 -9.708  28.631 1.00 66.21  ? 136 THR A CA  1 
ATOM   955  C C   . THR A 1 136 ? 25.198 -9.660  27.789 1.00 64.82  ? 136 THR A C   1 
ATOM   956  O O   . THR A 1 136 ? 24.530 -10.670 27.597 1.00 65.62  ? 136 THR A O   1 
ATOM   957  C CB  . THR A 1 136 ? 27.430 -10.746 28.040 1.00 66.24  ? 136 THR A CB  1 
ATOM   958  O OG1 . THR A 1 136 ? 28.653 -10.723 28.783 1.00 66.59  ? 136 THR A OG1 1 
ATOM   959  C CG2 . THR A 1 136 ? 27.724 -10.437 26.576 1.00 65.14  ? 136 THR A CG2 1 
ATOM   960  N N   . PHE A 1 137 ? 24.861 -8.473  27.308 1.00 63.45  ? 137 PHE A N   1 
ATOM   961  C CA  . PHE A 1 137 ? 23.680 -8.310  26.484 1.00 60.89  ? 137 PHE A CA  1 
ATOM   962  C C   . PHE A 1 137 ? 24.072 -8.626  25.050 1.00 60.19  ? 137 PHE A C   1 
ATOM   963  O O   . PHE A 1 137 ? 24.804 -7.871  24.418 1.00 59.37  ? 137 PHE A O   1 
ATOM   964  C CB  . PHE A 1 137 ? 23.153 -6.878  26.571 1.00 60.40  ? 137 PHE A CB  1 
ATOM   965  C CG  . PHE A 1 137 ? 22.906 -6.395  27.979 1.00 60.64  ? 137 PHE A CG  1 
ATOM   966  C CD1 . PHE A 1 137 ? 23.961 -5.935  28.773 1.00 59.95  ? 137 PHE A CD1 1 
ATOM   967  C CD2 . PHE A 1 137 ? 21.616 -6.379  28.507 1.00 60.42  ? 137 PHE A CD2 1 
ATOM   968  C CE1 . PHE A 1 137 ? 23.733 -5.464  30.077 1.00 58.51  ? 137 PHE A CE1 1 
ATOM   969  C CE2 . PHE A 1 137 ? 21.378 -5.910  29.810 1.00 60.18  ? 137 PHE A CE2 1 
ATOM   970  C CZ  . PHE A 1 137 ? 22.438 -5.451  30.593 1.00 58.44  ? 137 PHE A CZ  1 
ATOM   971  N N   . GLY A 1 138 ? 23.590 -9.753  24.543 1.00 60.06  ? 138 GLY A N   1 
ATOM   972  C CA  . GLY A 1 138 ? 23.916 -10.133 23.184 1.00 60.96  ? 138 GLY A CA  1 
ATOM   973  C C   . GLY A 1 138 ? 22.765 -9.953  22.217 1.00 61.35  ? 138 GLY A C   1 
ATOM   974  O O   . GLY A 1 138 ? 21.754 -10.645 22.326 1.00 62.15  ? 138 GLY A O   1 
ATOM   975  N N   . LEU A 1 139 ? 22.915 -9.029  21.269 1.00 61.01  ? 139 LEU A N   1 
ATOM   976  C CA  . LEU A 1 139 ? 21.877 -8.777  20.275 1.00 60.19  ? 139 LEU A CA  1 
ATOM   977  C C   . LEU A 1 139 ? 21.592 -10.046 19.480 1.00 60.05  ? 139 LEU A C   1 
ATOM   978  O O   . LEU A 1 139 ? 22.303 -10.378 18.537 1.00 57.60  ? 139 LEU A O   1 
ATOM   979  C CB  . LEU A 1 139 ? 22.300 -7.655  19.319 1.00 59.55  ? 139 LEU A CB  1 
ATOM   980  C CG  . LEU A 1 139 ? 22.357 -6.244  19.908 1.00 58.69  ? 139 LEU A CG  1 
ATOM   981  C CD1 . LEU A 1 139 ? 21.024 -5.951  20.579 1.00 58.84  ? 139 LEU A CD1 1 
ATOM   982  C CD2 . LEU A 1 139 ? 23.496 -6.121  20.911 1.00 58.39  ? 139 LEU A CD2 1 
ATOM   983  N N   . SER A 1 140 ? 20.541 -10.750 19.879 1.00 61.81  ? 140 SER A N   1 
ATOM   984  C CA  . SER A 1 140 ? 20.158 -11.988 19.224 1.00 64.87  ? 140 SER A CA  1 
ATOM   985  C C   . SER A 1 140 ? 19.339 -11.724 17.967 1.00 66.74  ? 140 SER A C   1 
ATOM   986  O O   . SER A 1 140 ? 19.322 -10.612 17.430 1.00 67.73  ? 140 SER A O   1 
ATOM   987  C CB  . SER A 1 140 ? 19.337 -12.860 20.175 1.00 63.24  ? 140 SER A CB  1 
ATOM   988  O OG  . SER A 1 140 ? 17.974 -12.492 20.120 1.00 62.66  ? 140 SER A OG  1 
ATOM   989  N N   . ASP A 1 141 ? 18.671 -12.774 17.501 1.00 68.14  ? 141 ASP A N   1 
ATOM   990  C CA  . ASP A 1 141 ? 17.828 -12.697 16.322 1.00 68.42  ? 141 ASP A CA  1 
ATOM   991  C C   . ASP A 1 141 ? 16.542 -12.013 16.741 1.00 67.20  ? 141 ASP A C   1 
ATOM   992  O O   . ASP A 1 141 ? 16.001 -11.175 16.013 1.00 67.91  ? 141 ASP A O   1 
ATOM   993  C CB  . ASP A 1 141 ? 17.522 -14.105 15.800 1.00 71.48  ? 141 ASP A CB  1 
ATOM   994  C CG  . ASP A 1 141 ? 18.433 -14.520 14.653 1.00 74.23  ? 141 ASP A CG  1 
ATOM   995  O OD1 . ASP A 1 141 ? 19.674 -14.502 14.827 1.00 75.02  ? 141 ASP A OD1 1 
ATOM   996  O OD2 . ASP A 1 141 ? 17.895 -14.868 13.575 1.00 76.53  ? 141 ASP A OD2 1 
ATOM   997  N N   . ASP A 1 142 ? 16.063 -12.377 17.929 1.00 64.21  ? 142 ASP A N   1 
ATOM   998  C CA  . ASP A 1 142 ? 14.834 -11.811 18.470 1.00 60.96  ? 142 ASP A CA  1 
ATOM   999  C C   . ASP A 1 142 ? 14.917 -10.308 18.673 1.00 57.68  ? 142 ASP A C   1 
ATOM   1000 O O   . ASP A 1 142 ? 13.913 -9.672  18.979 1.00 56.57  ? 142 ASP A O   1 
ATOM   1001 C CB  . ASP A 1 142 ? 14.485 -12.488 19.790 1.00 64.11  ? 142 ASP A CB  1 
ATOM   1002 C CG  . ASP A 1 142 ? 13.765 -13.806 19.594 1.00 67.41  ? 142 ASP A CG  1 
ATOM   1003 O OD1 . ASP A 1 142 ? 14.070 -14.510 18.602 1.00 69.70  ? 142 ASP A OD1 1 
ATOM   1004 O OD2 . ASP A 1 142 ? 12.899 -14.140 20.437 1.00 68.54  ? 142 ASP A OD2 1 
ATOM   1005 N N   . ASN A 1 143 ? 16.112 -9.747  18.501 1.00 53.51  ? 143 ASN A N   1 
ATOM   1006 C CA  . ASN A 1 143 ? 16.304 -8.316  18.655 1.00 50.10  ? 143 ASN A CA  1 
ATOM   1007 C C   . ASN A 1 143 ? 16.364 -7.601  17.331 1.00 49.15  ? 143 ASN A C   1 
ATOM   1008 O O   . ASN A 1 143 ? 16.418 -6.375  17.293 1.00 50.45  ? 143 ASN A O   1 
ATOM   1009 C CB  . ASN A 1 143 ? 17.592 -8.015  19.410 1.00 48.81  ? 143 ASN A CB  1 
ATOM   1010 C CG  . ASN A 1 143 ? 17.558 -8.522  20.822 1.00 48.00  ? 143 ASN A CG  1 
ATOM   1011 O OD1 . ASN A 1 143 ? 17.806 -9.698  21.076 1.00 46.74  ? 143 ASN A OD1 1 
ATOM   1012 N ND2 . ASN A 1 143 ? 17.224 -7.641  21.757 1.00 47.00  ? 143 ASN A ND2 1 
ATOM   1013 N N   . VAL A 1 144 ? 16.354 -8.355  16.240 1.00 48.59  ? 144 VAL A N   1 
ATOM   1014 C CA  . VAL A 1 144 ? 16.449 -7.741  14.915 1.00 47.87  ? 144 VAL A CA  1 
ATOM   1015 C C   . VAL A 1 144 ? 15.225 -6.918  14.574 1.00 48.12  ? 144 VAL A C   1 
ATOM   1016 O O   . VAL A 1 144 ? 14.096 -7.363  14.787 1.00 48.93  ? 144 VAL A O   1 
ATOM   1017 C CB  . VAL A 1 144 ? 16.658 -8.796  13.812 1.00 45.25  ? 144 VAL A CB  1 
ATOM   1018 C CG1 . VAL A 1 144 ? 16.915 -8.106  12.484 1.00 42.15  ? 144 VAL A CG1 1 
ATOM   1019 C CG2 . VAL A 1 144 ? 17.818 -9.698  14.181 1.00 44.27  ? 144 VAL A CG2 1 
ATOM   1020 N N   . VAL A 1 145 ? 15.464 -5.717  14.052 1.00 47.75  ? 145 VAL A N   1 
ATOM   1021 C CA  . VAL A 1 145 ? 14.401 -4.793  13.664 1.00 47.34  ? 145 VAL A CA  1 
ATOM   1022 C C   . VAL A 1 145 ? 14.612 -4.356  12.219 1.00 48.15  ? 145 VAL A C   1 
ATOM   1023 O O   . VAL A 1 145 ? 13.878 -3.513  11.698 1.00 47.81  ? 145 VAL A O   1 
ATOM   1024 C CB  . VAL A 1 145 ? 14.407 -3.529  14.557 1.00 47.71  ? 145 VAL A CB  1 
ATOM   1025 C CG1 . VAL A 1 145 ? 13.952 -3.872  15.967 1.00 46.90  ? 145 VAL A CG1 1 
ATOM   1026 C CG2 . VAL A 1 145 ? 15.801 -2.935  14.593 1.00 45.50  ? 145 VAL A CG2 1 
ATOM   1027 N N   . PHE A 1 146 ? 15.647 -4.907  11.588 1.00 48.46  ? 146 PHE A N   1 
ATOM   1028 C CA  . PHE A 1 146 ? 15.951 -4.601  10.199 1.00 50.11  ? 146 PHE A CA  1 
ATOM   1029 C C   . PHE A 1 146 ? 17.131 -5.399  9.700  1.00 53.06  ? 146 PHE A C   1 
ATOM   1030 O O   . PHE A 1 146 ? 18.044 -5.725  10.459 1.00 54.46  ? 146 PHE A O   1 
ATOM   1031 C CB  . PHE A 1 146 ? 16.269 -3.130  10.013 1.00 48.64  ? 146 PHE A CB  1 
ATOM   1032 C CG  . PHE A 1 146 ? 16.396 -2.721  8.573  1.00 47.72  ? 146 PHE A CG  1 
ATOM   1033 C CD1 . PHE A 1 146 ? 15.262 -2.433  7.821  1.00 46.15  ? 146 PHE A CD1 1 
ATOM   1034 C CD2 . PHE A 1 146 ? 17.649 -2.592  7.974  1.00 46.81  ? 146 PHE A CD2 1 
ATOM   1035 C CE1 . PHE A 1 146 ? 15.371 -2.017  6.501  1.00 44.81  ? 146 PHE A CE1 1 
ATOM   1036 C CE2 . PHE A 1 146 ? 17.771 -2.174  6.644  1.00 43.34  ? 146 PHE A CE2 1 
ATOM   1037 C CZ  . PHE A 1 146 ? 16.632 -1.885  5.910  1.00 43.13  ? 146 PHE A CZ  1 
ATOM   1038 N N   . THR A 1 147 ? 17.101 -5.720  8.411  1.00 55.81  ? 147 THR A N   1 
ATOM   1039 C CA  . THR A 1 147 ? 18.184 -6.470  7.777  1.00 57.39  ? 147 THR A CA  1 
ATOM   1040 C C   . THR A 1 147 ? 18.186 -6.131  6.299  1.00 57.77  ? 147 THR A C   1 
ATOM   1041 O O   . THR A 1 147 ? 17.145 -5.852  5.709  1.00 56.92  ? 147 THR A O   1 
ATOM   1042 C CB  . THR A 1 147 ? 18.008 -7.998  7.869  1.00 55.78  ? 147 THR A CB  1 
ATOM   1043 O OG1 . THR A 1 147 ? 17.005 -8.396  6.938  1.00 55.12  ? 147 THR A OG1 1 
ATOM   1044 C CG2 . THR A 1 147 ? 17.584 -8.430  9.264  1.00 56.91  ? 147 THR A CG2 1 
ATOM   1045 N N   . SER A 1 148 ? 19.372 -6.162  5.713  1.00 59.10  ? 148 SER A N   1 
ATOM   1046 C CA  . SER A 1 148 ? 19.547 -5.886  4.305  1.00 61.66  ? 148 SER A CA  1 
ATOM   1047 C C   . SER A 1 148 ? 20.772 -6.700  3.905  1.00 64.13  ? 148 SER A C   1 
ATOM   1048 O O   . SER A 1 148 ? 21.340 -7.414  4.741  1.00 64.01  ? 148 SER A O   1 
ATOM   1049 C CB  . SER A 1 148 ? 19.784 -4.385  4.071  1.00 61.45  ? 148 SER A CB  1 
ATOM   1050 O OG  . SER A 1 148 ? 21.047 -3.956  4.550  1.00 63.63  ? 148 SER A OG  1 
ATOM   1051 N N   . ASP A 1 149 ? 21.169 -6.608  2.639  1.00 66.40  ? 149 ASP A N   1 
ATOM   1052 C CA  . ASP A 1 149 ? 22.327 -7.341  2.165  1.00 67.68  ? 149 ASP A CA  1 
ATOM   1053 C C   . ASP A 1 149 ? 23.537 -7.080  3.040  1.00 68.15  ? 149 ASP A C   1 
ATOM   1054 O O   . ASP A 1 149 ? 24.198 -8.023  3.475  1.00 68.52  ? 149 ASP A O   1 
ATOM   1055 C CB  . ASP A 1 149 ? 22.669 -6.959  0.724  1.00 69.29  ? 149 ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 149 ? 21.609 -7.401  -0.264 1.00 71.48  ? 149 ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 149 ? 21.076 -8.522  -0.088 1.00 71.23  ? 149 ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 149 ? 21.317 -6.635  -1.218 1.00 73.30  ? 149 ASP A OD2 1 
ATOM   1059 N N   . TYR A 1 150 ? 23.808 -5.802  3.319  1.00 67.64  ? 150 TYR A N   1 
ATOM   1060 C CA  . TYR A 1 150 ? 24.976 -5.427  4.111  1.00 67.73  ? 150 TYR A CA  1 
ATOM   1061 C C   . TYR A 1 150 ? 24.707 -4.515  5.295  1.00 66.75  ? 150 TYR A C   1 
ATOM   1062 O O   . TYR A 1 150 ? 25.441 -3.541  5.542  1.00 66.46  ? 150 TYR A O   1 
ATOM   1063 C CB  . TYR A 1 150 ? 26.004 -4.802  3.184  1.00 69.39  ? 150 TYR A CB  1 
ATOM   1064 C CG  . TYR A 1 150 ? 26.473 -5.792  2.159  1.00 72.09  ? 150 TYR A CG  1 
ATOM   1065 C CD1 . TYR A 1 150 ? 27.359 -6.817  2.512  1.00 73.03  ? 150 TYR A CD1 1 
ATOM   1066 C CD2 . TYR A 1 150 ? 25.978 -5.754  0.847  1.00 71.87  ? 150 TYR A CD2 1 
ATOM   1067 C CE1 . TYR A 1 150 ? 27.737 -7.774  1.587  1.00 75.26  ? 150 TYR A CE1 1 
ATOM   1068 C CE2 . TYR A 1 150 ? 26.347 -6.701  -0.079 1.00 73.88  ? 150 TYR A CE2 1 
ATOM   1069 C CZ  . TYR A 1 150 ? 27.227 -7.709  0.293  1.00 76.30  ? 150 TYR A CZ  1 
ATOM   1070 O OH  . TYR A 1 150 ? 27.621 -8.650  -0.630 1.00 77.30  ? 150 TYR A OH  1 
ATOM   1071 N N   . MET A 1 151 ? 23.674 -4.849  6.059  1.00 65.01  ? 151 MET A N   1 
ATOM   1072 C CA  . MET A 1 151 ? 23.344 -4.046  7.219  1.00 62.12  ? 151 MET A CA  1 
ATOM   1073 C C   . MET A 1 151 ? 22.346 -4.758  8.119  1.00 60.63  ? 151 MET A C   1 
ATOM   1074 O O   . MET A 1 151 ? 21.464 -5.468  7.652  1.00 60.57  ? 151 MET A O   1 
ATOM   1075 C CB  . MET A 1 151 ? 22.761 -2.705  6.772  1.00 59.93  ? 151 MET A CB  1 
ATOM   1076 C CG  . MET A 1 151 ? 22.865 -1.605  7.818  1.00 57.57  ? 151 MET A CG  1 
ATOM   1077 S SD  . MET A 1 151 ? 22.007 -0.092  7.344  1.00 50.57  ? 151 MET A SD  1 
ATOM   1078 C CE  . MET A 1 151 ? 20.450 -0.415  8.102  1.00 49.36  ? 151 MET A CE  1 
ATOM   1079 N N   . THR A 1 152 ? 22.505 -4.578  9.420  1.00 59.34  ? 152 THR A N   1 
ATOM   1080 C CA  . THR A 1 152 ? 21.586 -5.175  10.376 1.00 58.74  ? 152 THR A CA  1 
ATOM   1081 C C   . THR A 1 152 ? 21.343 -4.181  11.488 1.00 56.91  ? 152 THR A C   1 
ATOM   1082 O O   . THR A 1 152 ? 22.231 -3.401  11.852 1.00 56.41  ? 152 THR A O   1 
ATOM   1083 C CB  . THR A 1 152 ? 22.130 -6.472  11.009 1.00 58.86  ? 152 THR A CB  1 
ATOM   1084 O OG1 . THR A 1 152 ? 22.287 -7.468  9.999  1.00 60.33  ? 152 THR A OG1 1 
ATOM   1085 C CG2 . THR A 1 152 ? 21.156 -7.000  12.051 1.00 58.42  ? 152 THR A CG2 1 
ATOM   1086 N N   . VAL A 1 153 ? 20.130 -4.204  12.020 1.00 54.63  ? 153 VAL A N   1 
ATOM   1087 C CA  . VAL A 1 153 ? 19.793 -3.305  13.092 1.00 53.41  ? 153 VAL A CA  1 
ATOM   1088 C C   . VAL A 1 153 ? 19.117 -4.064  14.216 1.00 53.91  ? 153 VAL A C   1 
ATOM   1089 O O   . VAL A 1 153 ? 18.186 -4.850  14.010 1.00 53.53  ? 153 VAL A O   1 
ATOM   1090 C CB  . VAL A 1 153 ? 18.869 -2.178  12.618 1.00 51.65  ? 153 VAL A CB  1 
ATOM   1091 C CG1 . VAL A 1 153 ? 18.920 -1.033  13.607 1.00 51.76  ? 153 VAL A CG1 1 
ATOM   1092 C CG2 . VAL A 1 153 ? 19.280 -1.704  11.243 1.00 50.63  ? 153 VAL A CG2 1 
ATOM   1093 N N   . TRP A 1 154 ? 19.622 -3.845  15.416 1.00 54.09  ? 154 TRP A N   1 
ATOM   1094 C CA  . TRP A 1 154 ? 19.053 -4.475  16.578 1.00 54.75  ? 154 TRP A CA  1 
ATOM   1095 C C   . TRP A 1 154 ? 18.518 -3.388  17.502 1.00 54.24  ? 154 TRP A C   1 
ATOM   1096 O O   . TRP A 1 154 ? 18.885 -2.214  17.400 1.00 53.14  ? 154 TRP A O   1 
ATOM   1097 C CB  . TRP A 1 154 ? 20.110 -5.291  17.298 1.00 56.56  ? 154 TRP A CB  1 
ATOM   1098 C CG  . TRP A 1 154 ? 20.548 -6.480  16.547 1.00 59.12  ? 154 TRP A CG  1 
ATOM   1099 C CD1 . TRP A 1 154 ? 19.921 -7.694  16.485 1.00 59.48  ? 154 TRP A CD1 1 
ATOM   1100 C CD2 . TRP A 1 154 ? 21.731 -6.596  15.756 1.00 60.47  ? 154 TRP A CD2 1 
ATOM   1101 N NE1 . TRP A 1 154 ? 20.649 -8.565  15.706 1.00 59.21  ? 154 TRP A NE1 1 
ATOM   1102 C CE2 . TRP A 1 154 ? 21.767 -7.916  15.247 1.00 59.98  ? 154 TRP A CE2 1 
ATOM   1103 C CE3 . TRP A 1 154 ? 22.769 -5.713  15.424 1.00 60.23  ? 154 TRP A CE3 1 
ATOM   1104 C CZ2 . TRP A 1 154 ? 22.803 -8.376  14.428 1.00 59.22  ? 154 TRP A CZ2 1 
ATOM   1105 C CZ3 . TRP A 1 154 ? 23.798 -6.172  14.603 1.00 59.36  ? 154 TRP A CZ3 1 
ATOM   1106 C CH2 . TRP A 1 154 ? 23.806 -7.492  14.118 1.00 58.18  ? 154 TRP A CH2 1 
ATOM   1107 N N   . MET A 1 155 ? 17.639 -3.807  18.398 1.00 53.30  ? 155 MET A N   1 
ATOM   1108 C CA  . MET A 1 155 ? 17.021 -2.940  19.378 1.00 51.44  ? 155 MET A CA  1 
ATOM   1109 C C   . MET A 1 155 ? 17.094 -3.720  20.686 1.00 52.21  ? 155 MET A C   1 
ATOM   1110 O O   . MET A 1 155 ? 16.936 -4.945  20.694 1.00 51.42  ? 155 MET A O   1 
ATOM   1111 C CB  . MET A 1 155 ? 15.572 -2.701  18.981 1.00 50.03  ? 155 MET A CB  1 
ATOM   1112 C CG  . MET A 1 155 ? 14.677 -2.098  20.040 1.00 49.54  ? 155 MET A CG  1 
ATOM   1113 S SD  . MET A 1 155 ? 12.946 -2.105  19.456 1.00 50.06  ? 155 MET A SD  1 
ATOM   1114 C CE  . MET A 1 155 ? 12.225 -3.368  20.505 1.00 42.01  ? 155 MET A CE  1 
ATOM   1115 N N   . ILE A 1 156 ? 17.369 -3.023  21.786 1.00 52.55  ? 156 ILE A N   1 
ATOM   1116 C CA  . ILE A 1 156 ? 17.426 -3.680  23.089 1.00 51.77  ? 156 ILE A CA  1 
ATOM   1117 C C   . ILE A 1 156 ? 17.430 -2.704  24.277 1.00 51.99  ? 156 ILE A C   1 
ATOM   1118 O O   . ILE A 1 156 ? 18.134 -1.686  24.256 1.00 52.39  ? 156 ILE A O   1 
ATOM   1119 C CB  . ILE A 1 156 ? 18.643 -4.617  23.170 1.00 49.62  ? 156 ILE A CB  1 
ATOM   1120 C CG1 . ILE A 1 156 ? 18.556 -5.448  24.451 1.00 48.19  ? 156 ILE A CG1 1 
ATOM   1121 C CG2 . ILE A 1 156 ? 19.922 -3.812  23.081 1.00 49.92  ? 156 ILE A CG2 1 
ATOM   1122 C CD1 . ILE A 1 156 ? 19.671 -6.433  24.626 1.00 47.16  ? 156 ILE A CD1 1 
ATOM   1123 N N   . ASP A 1 157 ? 16.628 -3.016  25.300 1.00 51.93  ? 157 ASP A N   1 
ATOM   1124 C CA  . ASP A 1 157 ? 16.525 -2.179  26.498 1.00 52.90  ? 157 ASP A CA  1 
ATOM   1125 C C   . ASP A 1 157 ? 17.574 -2.562  27.526 1.00 54.60  ? 157 ASP A C   1 
ATOM   1126 O O   . ASP A 1 157 ? 17.768 -3.736  27.812 1.00 55.02  ? 157 ASP A O   1 
ATOM   1127 C CB  . ASP A 1 157 ? 15.146 -2.303  27.139 1.00 50.70  ? 157 ASP A CB  1 
ATOM   1128 C CG  . ASP A 1 157 ? 14.037 -1.859  26.217 1.00 52.48  ? 157 ASP A CG  1 
ATOM   1129 O OD1 . ASP A 1 157 ? 14.202 -0.804  25.555 1.00 53.00  ? 157 ASP A OD1 1 
ATOM   1130 O OD2 . ASP A 1 157 ? 12.995 -2.556  26.157 1.00 51.85  ? 157 ASP A OD2 1 
ATOM   1131 N N   . ILE A 1 158 ? 18.236 -1.563  28.097 1.00 56.14  ? 158 ILE A N   1 
ATOM   1132 C CA  . ILE A 1 158 ? 19.276 -1.810  29.080 1.00 56.53  ? 158 ILE A CA  1 
ATOM   1133 C C   . ILE A 1 158 ? 19.153 -0.820  30.214 1.00 55.40  ? 158 ILE A C   1 
ATOM   1134 O O   . ILE A 1 158 ? 18.864 0.345   29.993 1.00 54.24  ? 158 ILE A O   1 
ATOM   1135 C CB  . ILE A 1 158 ? 20.665 -1.613  28.453 1.00 59.35  ? 158 ILE A CB  1 
ATOM   1136 C CG1 . ILE A 1 158 ? 20.780 -2.445  27.178 1.00 62.94  ? 158 ILE A CG1 1 
ATOM   1137 C CG2 . ILE A 1 158 ? 21.753 -1.985  29.442 1.00 58.84  ? 158 ILE A CG2 1 
ATOM   1138 C CD1 . ILE A 1 158 ? 22.073 -2.205  26.411 1.00 64.91  ? 158 ILE A CD1 1 
ATOM   1139 N N   . PRO A 1 159 ? 19.355 -1.279  31.452 1.00 56.17  ? 159 PRO A N   1 
ATOM   1140 C CA  . PRO A 1 159 ? 19.274 -0.389  32.612 1.00 56.15  ? 159 PRO A CA  1 
ATOM   1141 C C   . PRO A 1 159 ? 20.363 0.655   32.409 1.00 55.02  ? 159 PRO A C   1 
ATOM   1142 O O   . PRO A 1 159 ? 21.532 0.303   32.346 1.00 55.70  ? 159 PRO A O   1 
ATOM   1143 C CB  . PRO A 1 159 ? 19.605 -1.317  33.776 1.00 55.88  ? 159 PRO A CB  1 
ATOM   1144 C CG  . PRO A 1 159 ? 19.064 -2.620  33.320 1.00 56.09  ? 159 PRO A CG  1 
ATOM   1145 C CD  . PRO A 1 159 ? 19.526 -2.676  31.880 1.00 56.56  ? 159 PRO A CD  1 
ATOM   1146 N N   . LYS A 1 160 ? 19.985 1.926   32.308 1.00 54.22  ? 160 LYS A N   1 
ATOM   1147 C CA  . LYS A 1 160 ? 20.949 3.002   32.084 1.00 51.99  ? 160 LYS A CA  1 
ATOM   1148 C C   . LYS A 1 160 ? 22.250 2.874   32.852 1.00 52.52  ? 160 LYS A C   1 
ATOM   1149 O O   . LYS A 1 160 ? 23.315 3.131   32.298 1.00 52.44  ? 160 LYS A O   1 
ATOM   1150 C CB  . LYS A 1 160 ? 20.322 4.353   32.389 1.00 48.98  ? 160 LYS A CB  1 
ATOM   1151 C CG  . LYS A 1 160 ? 19.272 4.766   31.391 1.00 45.87  ? 160 LYS A CG  1 
ATOM   1152 C CD  . LYS A 1 160 ? 18.703 6.108   31.756 1.00 43.87  ? 160 LYS A CD  1 
ATOM   1153 C CE  . LYS A 1 160 ? 18.003 6.718   30.582 1.00 43.39  ? 160 LYS A CE  1 
ATOM   1154 N NZ  . LYS A 1 160 ? 17.896 8.186   30.751 1.00 45.21  ? 160 LYS A NZ  1 
ATOM   1155 N N   . SER A 1 161 ? 22.184 2.479   34.118 1.00 52.41  ? 161 SER A N   1 
ATOM   1156 C CA  . SER A 1 161 ? 23.407 2.343   34.899 1.00 53.95  ? 161 SER A CA  1 
ATOM   1157 C C   . SER A 1 161 ? 24.476 1.483   34.216 1.00 53.67  ? 161 SER A C   1 
ATOM   1158 O O   . SER A 1 161 ? 25.667 1.681   34.449 1.00 54.18  ? 161 SER A O   1 
ATOM   1159 C CB  . SER A 1 161 ? 23.086 1.780   36.282 1.00 56.17  ? 161 SER A CB  1 
ATOM   1160 O OG  . SER A 1 161 ? 22.049 0.826   36.185 1.00 59.24  ? 161 SER A OG  1 
ATOM   1161 N N   . TYR A 1 162 ? 24.061 0.550   33.361 1.00 52.95  ? 162 TYR A N   1 
ATOM   1162 C CA  . TYR A 1 162 ? 24.998 -0.334  32.662 1.00 52.96  ? 162 TYR A CA  1 
ATOM   1163 C C   . TYR A 1 162 ? 25.745 0.315   31.514 1.00 54.04  ? 162 TYR A C   1 
ATOM   1164 O O   . TYR A 1 162 ? 26.861 -0.096  31.195 1.00 56.06  ? 162 TYR A O   1 
ATOM   1165 C CB  . TYR A 1 162 ? 24.284 -1.557  32.093 1.00 52.90  ? 162 TYR A CB  1 
ATOM   1166 C CG  . TYR A 1 162 ? 23.897 -2.610  33.102 1.00 53.54  ? 162 TYR A CG  1 
ATOM   1167 C CD1 . TYR A 1 162 ? 24.864 -3.355  33.775 1.00 51.31  ? 162 TYR A CD1 1 
ATOM   1168 C CD2 . TYR A 1 162 ? 22.553 -2.886  33.358 1.00 53.83  ? 162 TYR A CD2 1 
ATOM   1169 C CE1 . TYR A 1 162 ? 24.500 -4.350  34.673 1.00 51.33  ? 162 TYR A CE1 1 
ATOM   1170 C CE2 . TYR A 1 162 ? 22.181 -3.878  34.257 1.00 53.94  ? 162 TYR A CE2 1 
ATOM   1171 C CZ  . TYR A 1 162 ? 23.157 -4.605  34.908 1.00 52.01  ? 162 TYR A CZ  1 
ATOM   1172 O OH  . TYR A 1 162 ? 22.774 -5.586  35.787 1.00 52.17  ? 162 TYR A OH  1 
ATOM   1173 N N   . VAL A 1 163 ? 25.123 1.301   30.875 1.00 54.58  ? 163 VAL A N   1 
ATOM   1174 C CA  . VAL A 1 163 ? 25.726 1.995   29.736 1.00 55.16  ? 163 VAL A CA  1 
ATOM   1175 C C   . VAL A 1 163 ? 26.699 3.074   30.202 1.00 56.13  ? 163 VAL A C   1 
ATOM   1176 O O   . VAL A 1 163 ? 26.315 4.222   30.451 1.00 57.12  ? 163 VAL A O   1 
ATOM   1177 C CB  . VAL A 1 163 ? 24.633 2.634   28.865 1.00 56.42  ? 163 VAL A CB  1 
ATOM   1178 C CG1 . VAL A 1 163 ? 25.256 3.343   27.648 1.00 56.36  ? 163 VAL A CG1 1 
ATOM   1179 C CG2 . VAL A 1 163 ? 23.625 1.559   28.450 1.00 55.79  ? 163 VAL A CG2 1 
ATOM   1180 N N   . ASP A 1 164 ? 27.969 2.700   30.307 1.00 56.84  ? 164 ASP A N   1 
ATOM   1181 C CA  . ASP A 1 164 ? 28.995 3.616   30.780 1.00 56.58  ? 164 ASP A CA  1 
ATOM   1182 C C   . ASP A 1 164 ? 30.323 2.929   30.524 1.00 55.90  ? 164 ASP A C   1 
ATOM   1183 O O   . ASP A 1 164 ? 30.373 1.878   29.887 1.00 55.57  ? 164 ASP A O   1 
ATOM   1184 C CB  . ASP A 1 164 ? 28.804 3.838   32.284 1.00 57.30  ? 164 ASP A CB  1 
ATOM   1185 C CG  . ASP A 1 164 ? 29.383 5.150   32.771 1.00 58.35  ? 164 ASP A CG  1 
ATOM   1186 O OD1 . ASP A 1 164 ? 30.583 5.392   32.552 1.00 61.24  ? 164 ASP A OD1 1 
ATOM   1187 O OD2 . ASP A 1 164 ? 28.640 5.937   33.388 1.00 58.34  ? 164 ASP A OD2 1 
ATOM   1188 N N   . VAL A 1 165 ? 31.400 3.527   31.004 1.00 56.07  ? 165 VAL A N   1 
ATOM   1189 C CA  . VAL A 1 165 ? 32.707 2.930   30.841 1.00 57.38  ? 165 VAL A CA  1 
ATOM   1190 C C   . VAL A 1 165 ? 32.675 1.612   31.608 1.00 59.35  ? 165 VAL A C   1 
ATOM   1191 O O   . VAL A 1 165 ? 32.219 1.562   32.754 1.00 61.21  ? 165 VAL A O   1 
ATOM   1192 C CB  . VAL A 1 165 ? 33.782 3.815   31.436 1.00 57.62  ? 165 VAL A CB  1 
ATOM   1193 C CG1 . VAL A 1 165 ? 35.156 3.225   31.138 1.00 59.94  ? 165 VAL A CG1 1 
ATOM   1194 C CG2 . VAL A 1 165 ? 33.645 5.219   30.887 1.00 57.39  ? 165 VAL A CG2 1 
ATOM   1195 N N   . GLY A 1 166 ? 33.163 0.549   30.981 1.00 59.53  ? 166 GLY A N   1 
ATOM   1196 C CA  . GLY A 1 166 ? 33.150 -0.756  31.609 1.00 58.03  ? 166 GLY A CA  1 
ATOM   1197 C C   . GLY A 1 166 ? 32.473 -1.664  30.609 1.00 59.04  ? 166 GLY A C   1 
ATOM   1198 O O   . GLY A 1 166 ? 32.882 -2.815  30.400 1.00 59.57  ? 166 GLY A O   1 
ATOM   1199 N N   . MET A 1 167 ? 31.427 -1.128  29.980 1.00 58.90  ? 167 MET A N   1 
ATOM   1200 C CA  . MET A 1 167 ? 30.677 -1.852  28.962 1.00 56.83  ? 167 MET A CA  1 
ATOM   1201 C C   . MET A 1 167 ? 31.615 -2.039  27.787 1.00 55.99  ? 167 MET A C   1 
ATOM   1202 O O   . MET A 1 167 ? 32.268 -1.100  27.343 1.00 55.92  ? 167 MET A O   1 
ATOM   1203 C CB  . MET A 1 167 ? 29.443 -1.054  28.535 1.00 55.35  ? 167 MET A CB  1 
ATOM   1204 C CG  . MET A 1 167 ? 28.786 -1.567  27.262 1.00 53.97  ? 167 MET A CG  1 
ATOM   1205 S SD  . MET A 1 167 ? 27.077 -1.005  27.052 1.00 49.89  ? 167 MET A SD  1 
ATOM   1206 C CE  . MET A 1 167 ? 26.214 -2.370  27.809 1.00 52.50  ? 167 MET A CE  1 
ATOM   1207 N N   . LEU A 1 168 ? 31.693 -3.267  27.300 1.00 56.55  ? 168 LEU A N   1 
ATOM   1208 C CA  . LEU A 1 168 ? 32.562 -3.591  26.184 1.00 56.26  ? 168 LEU A CA  1 
ATOM   1209 C C   . LEU A 1 168 ? 31.750 -3.978  24.940 1.00 55.91  ? 168 LEU A C   1 
ATOM   1210 O O   . LEU A 1 168 ? 30.754 -4.690  25.035 1.00 57.20  ? 168 LEU A O   1 
ATOM   1211 C CB  . LEU A 1 168 ? 33.483 -4.735  26.600 1.00 55.81  ? 168 LEU A CB  1 
ATOM   1212 C CG  . LEU A 1 168 ? 34.576 -5.084  25.595 1.00 56.37  ? 168 LEU A CG  1 
ATOM   1213 C CD1 . LEU A 1 168 ? 35.932 -4.895  26.258 1.00 53.30  ? 168 LEU A CD1 1 
ATOM   1214 C CD2 . LEU A 1 168 ? 34.375 -6.511  25.082 1.00 54.03  ? 168 LEU A CD2 1 
ATOM   1215 N N   . THR A 1 169 ? 32.174 -3.511  23.774 1.00 55.47  ? 169 THR A N   1 
ATOM   1216 C CA  . THR A 1 169 ? 31.459 -3.819  22.540 1.00 54.85  ? 169 THR A CA  1 
ATOM   1217 C C   . THR A 1 169 ? 32.248 -4.784  21.677 1.00 56.45  ? 169 THR A C   1 
ATOM   1218 O O   . THR A 1 169 ? 33.426 -4.555  21.416 1.00 56.78  ? 169 THR A O   1 
ATOM   1219 C CB  . THR A 1 169 ? 31.204 -2.555  21.722 1.00 53.36  ? 169 THR A CB  1 
ATOM   1220 O OG1 . THR A 1 169 ? 30.424 -1.637  22.496 1.00 53.04  ? 169 THR A OG1 1 
ATOM   1221 C CG2 . THR A 1 169 ? 30.462 -2.895  20.455 1.00 51.13  ? 169 THR A CG2 1 
ATOM   1222 N N   . ARG A 1 170 ? 31.589 -5.848  21.219 1.00 58.13  ? 170 ARG A N   1 
ATOM   1223 C CA  . ARG A 1 170 ? 32.232 -6.872  20.391 1.00 58.50  ? 170 ARG A CA  1 
ATOM   1224 C C   . ARG A 1 170 ? 31.392 -7.292  19.190 1.00 58.65  ? 170 ARG A C   1 
ATOM   1225 O O   . ARG A 1 170 ? 30.249 -7.724  19.334 1.00 59.14  ? 170 ARG A O   1 
ATOM   1226 C CB  . ARG A 1 170 ? 32.537 -8.107  21.240 1.00 58.74  ? 170 ARG A CB  1 
ATOM   1227 C CG  . ARG A 1 170 ? 33.207 -9.250  20.491 1.00 60.94  ? 170 ARG A CG  1 
ATOM   1228 C CD  . ARG A 1 170 ? 33.451 -10.473 21.401 1.00 62.68  ? 170 ARG A CD  1 
ATOM   1229 N NE  . ARG A 1 170 ? 34.185 -10.130 22.623 1.00 63.04  ? 170 ARG A NE  1 
ATOM   1230 C CZ  . ARG A 1 170 ? 33.623 -9.921  23.816 1.00 63.23  ? 170 ARG A CZ  1 
ATOM   1231 N NH1 . ARG A 1 170 ? 32.308 -10.022 23.980 1.00 62.68  ? 170 ARG A NH1 1 
ATOM   1232 N NH2 . ARG A 1 170 ? 34.381 -9.591  24.850 1.00 62.89  ? 170 ARG A NH2 1 
ATOM   1233 N N   . ALA A 1 171 ? 31.977 -7.175  18.004 1.00 58.76  ? 171 ALA A N   1 
ATOM   1234 C CA  . ALA A 1 171 ? 31.302 -7.545  16.768 1.00 59.21  ? 171 ALA A CA  1 
ATOM   1235 C C   . ALA A 1 171 ? 32.080 -8.640  16.060 1.00 60.46  ? 171 ALA A C   1 
ATOM   1236 O O   . ALA A 1 171 ? 33.251 -8.469  15.719 1.00 60.87  ? 171 ALA A O   1 
ATOM   1237 C CB  . ALA A 1 171 ? 31.178 -6.340  15.861 1.00 58.66  ? 171 ALA A CB  1 
ATOM   1238 N N   . THR A 1 172 ? 31.413 -9.761  15.830 1.00 62.51  ? 172 THR A N   1 
ATOM   1239 C CA  . THR A 1 172 ? 32.028 -10.903 15.172 1.00 64.01  ? 172 THR A CA  1 
ATOM   1240 C C   . THR A 1 172 ? 31.473 -11.119 13.771 1.00 65.13  ? 172 THR A C   1 
ATOM   1241 O O   . THR A 1 172 ? 30.268 -11.270 13.594 1.00 66.23  ? 172 THR A O   1 
ATOM   1242 C CB  . THR A 1 172 ? 31.787 -12.172 15.986 1.00 64.30  ? 172 THR A CB  1 
ATOM   1243 O OG1 . THR A 1 172 ? 32.373 -12.018 17.286 1.00 66.62  ? 172 THR A OG1 1 
ATOM   1244 C CG2 . THR A 1 172 ? 32.390 -13.369 15.294 1.00 64.21  ? 172 THR A CG2 1 
ATOM   1245 N N   . PHE A 1 173 ? 32.357 -11.128 12.778 1.00 66.25  ? 173 PHE A N   1 
ATOM   1246 C CA  . PHE A 1 173 ? 31.956 -11.350 11.390 1.00 66.61  ? 173 PHE A CA  1 
ATOM   1247 C C   . PHE A 1 173 ? 32.605 -12.647 10.922 1.00 67.66  ? 173 PHE A C   1 
ATOM   1248 O O   . PHE A 1 173 ? 33.365 -13.269 11.663 1.00 68.84  ? 173 PHE A O   1 
ATOM   1249 C CB  . PHE A 1 173 ? 32.425 -10.198 10.492 1.00 64.76  ? 173 PHE A CB  1 
ATOM   1250 C CG  . PHE A 1 173 ? 31.908 -8.852  10.907 1.00 63.74  ? 173 PHE A CG  1 
ATOM   1251 C CD1 . PHE A 1 173 ? 32.469 -8.178  11.989 1.00 63.78  ? 173 PHE A CD1 1 
ATOM   1252 C CD2 . PHE A 1 173 ? 30.873 -8.243  10.204 1.00 63.02  ? 173 PHE A CD2 1 
ATOM   1253 C CE1 . PHE A 1 173 ? 32.011 -6.914  12.362 1.00 62.80  ? 173 PHE A CE1 1 
ATOM   1254 C CE2 . PHE A 1 173 ? 30.406 -6.978  10.569 1.00 62.11  ? 173 PHE A CE2 1 
ATOM   1255 C CZ  . PHE A 1 173 ? 30.978 -6.314  11.649 1.00 62.75  ? 173 PHE A CZ  1 
ATOM   1256 N N   . LEU A 1 174 ? 32.310 -13.064 9.698  1.00 69.05  ? 174 LEU A N   1 
ATOM   1257 C CA  . LEU A 1 174 ? 32.913 -14.288 9.174  1.00 70.02  ? 174 LEU A CA  1 
ATOM   1258 C C   . LEU A 1 174 ? 34.022 -13.941 8.184  1.00 70.01  ? 174 LEU A C   1 
ATOM   1259 O O   . LEU A 1 174 ? 34.760 -14.810 7.729  1.00 71.14  ? 174 LEU A O   1 
ATOM   1260 C CB  . LEU A 1 174 ? 31.852 -15.149 8.487  1.00 69.58  ? 174 LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 174 ? 30.653 -15.528 9.358  1.00 68.68  ? 174 LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 174 ? 29.650 -16.290 8.505  1.00 69.77  ? 174 LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 174 ? 31.099 -16.359 10.548 1.00 65.71  ? 174 LEU A CD2 1 
ATOM   1264 N N   . GLU A 1 175 ? 34.133 -12.659 7.863  1.00 70.56  ? 175 GLU A N   1 
ATOM   1265 C CA  . GLU A 1 175 ? 35.136 -12.172 6.925  1.00 71.70  ? 175 GLU A CA  1 
ATOM   1266 C C   . GLU A 1 175 ? 35.555 -10.792 7.401  1.00 70.25  ? 175 GLU A C   1 
ATOM   1267 O O   . GLU A 1 175 ? 34.911 -10.218 8.278  1.00 70.49  ? 175 GLU A O   1 
ATOM   1268 C CB  . GLU A 1 175 ? 34.534 -12.027 5.523  1.00 74.78  ? 175 GLU A CB  1 
ATOM   1269 C CG  . GLU A 1 175 ? 33.439 -13.024 5.188  1.00 79.07  ? 175 GLU A CG  1 
ATOM   1270 C CD  . GLU A 1 175 ? 33.977 -14.402 4.890  1.00 82.48  ? 175 GLU A CD  1 
ATOM   1271 O OE1 . GLU A 1 175 ? 34.756 -14.526 3.915  1.00 83.16  ? 175 GLU A OE1 1 
ATOM   1272 O OE2 . GLU A 1 175 ? 33.617 -15.354 5.625  1.00 84.00  ? 175 GLU A OE2 1 
ATOM   1273 N N   . GLN A 1 176 ? 36.623 -10.255 6.821  1.00 69.22  ? 176 GLN A N   1 
ATOM   1274 C CA  . GLN A 1 176 ? 37.078 -8.917  7.183  1.00 69.01  ? 176 GLN A CA  1 
ATOM   1275 C C   . GLN A 1 176 ? 36.478 -7.936  6.186  1.00 70.30  ? 176 GLN A C   1 
ATOM   1276 O O   . GLN A 1 176 ? 37.191 -7.245  5.454  1.00 70.92  ? 176 GLN A O   1 
ATOM   1277 C CB  . GLN A 1 176 ? 38.607 -8.845  7.181  1.00 64.88  ? 176 GLN A CB  1 
ATOM   1278 C CG  . GLN A 1 176 ? 39.226 -9.554  8.379  1.00 61.67  ? 176 GLN A CG  1 
ATOM   1279 C CD  . GLN A 1 176 ? 40.733 -9.408  8.452  1.00 60.89  ? 176 GLN A CD  1 
ATOM   1280 O OE1 . GLN A 1 176 ? 41.318 -8.561  7.785  1.00 61.63  ? 176 GLN A OE1 1 
ATOM   1281 N NE2 . GLN A 1 176 ? 41.369 -10.226 9.281  1.00 60.18  ? 176 GLN A NE2 1 
ATOM   1282 N N   . TRP A 1 177 ? 35.146 -7.893  6.177  1.00 71.59  ? 177 TRP A N   1 
ATOM   1283 C CA  . TRP A 1 177 ? 34.386 -7.042  5.268  1.00 73.51  ? 177 TRP A CA  1 
ATOM   1284 C C   . TRP A 1 177 ? 34.953 -5.642  5.139  1.00 74.28  ? 177 TRP A C   1 
ATOM   1285 O O   . TRP A 1 177 ? 35.478 -5.074  6.098  1.00 75.24  ? 177 TRP A O   1 
ATOM   1286 C CB  . TRP A 1 177 ? 32.915 -6.954  5.702  1.00 73.95  ? 177 TRP A CB  1 
ATOM   1287 C CG  . TRP A 1 177 ? 32.255 -8.293  5.924  1.00 75.19  ? 177 TRP A CG  1 
ATOM   1288 C CD1 . TRP A 1 177 ? 32.241 -9.021  7.082  1.00 76.16  ? 177 TRP A CD1 1 
ATOM   1289 C CD2 . TRP A 1 177 ? 31.541 -9.070  4.957  1.00 75.76  ? 177 TRP A CD2 1 
ATOM   1290 N NE1 . TRP A 1 177 ? 31.562 -10.203 6.896  1.00 76.47  ? 177 TRP A NE1 1 
ATOM   1291 C CE2 . TRP A 1 177 ? 31.123 -10.259 5.601  1.00 76.49  ? 177 TRP A CE2 1 
ATOM   1292 C CE3 . TRP A 1 177 ? 31.212 -8.880  3.609  1.00 76.80  ? 177 TRP A CE3 1 
ATOM   1293 C CZ2 . TRP A 1 177 ? 30.395 -11.253 4.939  1.00 77.35  ? 177 TRP A CZ2 1 
ATOM   1294 C CZ3 . TRP A 1 177 ? 30.486 -9.871  2.951  1.00 77.14  ? 177 TRP A CZ3 1 
ATOM   1295 C CH2 . TRP A 1 177 ? 30.087 -11.041 3.618  1.00 76.72  ? 177 TRP A CH2 1 
ATOM   1296 N N   . PRO A 1 178 ? 34.872 -5.071  3.933  1.00 74.84  ? 178 PRO A N   1 
ATOM   1297 C CA  . PRO A 1 178 ? 35.388 -3.720  3.707  1.00 74.55  ? 178 PRO A CA  1 
ATOM   1298 C C   . PRO A 1 178 ? 34.414 -2.686  4.266  1.00 73.28  ? 178 PRO A C   1 
ATOM   1299 O O   . PRO A 1 178 ? 33.190 -2.833  4.137  1.00 73.08  ? 178 PRO A O   1 
ATOM   1300 C CB  . PRO A 1 178 ? 35.500 -3.642  2.181  1.00 75.16  ? 178 PRO A CB  1 
ATOM   1301 C CG  . PRO A 1 178 ? 35.648 -5.079  1.769  1.00 74.89  ? 178 PRO A CG  1 
ATOM   1302 C CD  . PRO A 1 178 ? 34.628 -5.747  2.651  1.00 74.81  ? 178 PRO A CD  1 
ATOM   1303 N N   . GLY A 1 179 ? 34.963 -1.652  4.892  1.00 71.36  ? 179 GLY A N   1 
ATOM   1304 C CA  . GLY A 1 179 ? 34.134 -0.605  5.457  1.00 69.89  ? 179 GLY A CA  1 
ATOM   1305 C C   . GLY A 1 179 ? 33.250 -1.116  6.573  1.00 68.43  ? 179 GLY A C   1 
ATOM   1306 O O   . GLY A 1 179 ? 32.268 -0.473  6.952  1.00 68.88  ? 179 GLY A O   1 
ATOM   1307 N N   . ALA A 1 180 ? 33.606 -2.277  7.109  1.00 66.69  ? 180 ALA A N   1 
ATOM   1308 C CA  . ALA A 1 180 ? 32.830 -2.878  8.177  1.00 64.70  ? 180 ALA A CA  1 
ATOM   1309 C C   . ALA A 1 180 ? 32.871 -2.003  9.420  1.00 64.14  ? 180 ALA A C   1 
ATOM   1310 O O   . ALA A 1 180 ? 33.930 -1.484  9.793  1.00 64.51  ? 180 ALA A O   1 
ATOM   1311 C CB  . ALA A 1 180 ? 33.370 -4.266  8.498  1.00 62.59  ? 180 ALA A CB  1 
ATOM   1312 N N   . LYS A 1 181 ? 31.714 -1.827  10.049 1.00 62.15  ? 181 LYS A N   1 
ATOM   1313 C CA  . LYS A 1 181 ? 31.637 -1.043  11.271 1.00 59.90  ? 181 LYS A CA  1 
ATOM   1314 C C   . LYS A 1 181 ? 30.371 -1.340  12.061 1.00 58.04  ? 181 LYS A C   1 
ATOM   1315 O O   . LYS A 1 181 ? 29.366 -1.796  11.507 1.00 56.99  ? 181 LYS A O   1 
ATOM   1316 C CB  . LYS A 1 181 ? 31.716 0.448   10.962 1.00 59.98  ? 181 LYS A CB  1 
ATOM   1317 C CG  . LYS A 1 181 ? 30.601 0.968   10.111 1.00 61.18  ? 181 LYS A CG  1 
ATOM   1318 C CD  . LYS A 1 181 ? 30.868 2.417   9.780  1.00 64.35  ? 181 LYS A CD  1 
ATOM   1319 C CE  . LYS A 1 181 ? 30.070 2.868   8.574  1.00 67.86  ? 181 LYS A CE  1 
ATOM   1320 N NZ  . LYS A 1 181 ? 28.609 2.970   8.865  1.00 69.58  ? 181 LYS A NZ  1 
ATOM   1321 N N   . VAL A 1 182 ? 30.451 -1.111  13.370 1.00 55.36  ? 182 VAL A N   1 
ATOM   1322 C CA  . VAL A 1 182 ? 29.325 -1.310  14.274 1.00 52.99  ? 182 VAL A CA  1 
ATOM   1323 C C   . VAL A 1 182 ? 29.031 0.036   14.901 1.00 51.54  ? 182 VAL A C   1 
ATOM   1324 O O   . VAL A 1 182 ? 29.944 0.800   15.198 1.00 51.72  ? 182 VAL A O   1 
ATOM   1325 C CB  . VAL A 1 182 ? 29.645 -2.287  15.425 1.00 51.63  ? 182 VAL A CB  1 
ATOM   1326 C CG1 . VAL A 1 182 ? 28.517 -2.285  16.428 1.00 50.58  ? 182 VAL A CG1 1 
ATOM   1327 C CG2 . VAL A 1 182 ? 29.832 -3.676  14.892 1.00 52.44  ? 182 VAL A CG2 1 
ATOM   1328 N N   . THR A 1 183 ? 27.758 0.333   15.102 1.00 50.25  ? 183 THR A N   1 
ATOM   1329 C CA  . THR A 1 183 ? 27.395 1.590   15.720 1.00 48.89  ? 183 THR A CA  1 
ATOM   1330 C C   . THR A 1 183 ? 26.437 1.354   16.858 1.00 48.16  ? 183 THR A C   1 
ATOM   1331 O O   . THR A 1 183 ? 25.596 0.450   16.806 1.00 48.21  ? 183 THR A O   1 
ATOM   1332 C CB  . THR A 1 183 ? 26.755 2.539   14.720 1.00 48.72  ? 183 THR A CB  1 
ATOM   1333 O OG1 . THR A 1 183 ? 27.681 2.778   13.655 1.00 50.33  ? 183 THR A OG1 1 
ATOM   1334 C CG2 . THR A 1 183 ? 26.409 3.859   15.385 1.00 47.94  ? 183 THR A CG2 1 
ATOM   1335 N N   . VAL A 1 184 ? 26.598 2.144   17.911 1.00 47.18  ? 184 VAL A N   1 
ATOM   1336 C CA  . VAL A 1 184 ? 25.717 2.037   19.056 1.00 45.89  ? 184 VAL A CA  1 
ATOM   1337 C C   . VAL A 1 184 ? 25.070 3.377   19.294 1.00 46.58  ? 184 VAL A C   1 
ATOM   1338 O O   . VAL A 1 184 ? 25.705 4.341   19.724 1.00 46.34  ? 184 VAL A O   1 
ATOM   1339 C CB  . VAL A 1 184 ? 26.448 1.603   20.310 1.00 43.81  ? 184 VAL A CB  1 
ATOM   1340 C CG1 . VAL A 1 184 ? 25.501 1.678   21.473 1.00 43.92  ? 184 VAL A CG1 1 
ATOM   1341 C CG2 . VAL A 1 184 ? 26.956 0.183   20.148 1.00 40.38  ? 184 VAL A CG2 1 
ATOM   1342 N N   . MET A 1 185 ? 23.790 3.435   18.972 1.00 49.02  ? 185 MET A N   1 
ATOM   1343 C CA  . MET A 1 185 ? 23.031 4.660   19.137 1.00 49.94  ? 185 MET A CA  1 
ATOM   1344 C C   . MET A 1 185 ? 22.509 4.712   20.572 1.00 49.84  ? 185 MET A C   1 
ATOM   1345 O O   . MET A 1 185 ? 21.785 3.824   21.039 1.00 48.84  ? 185 MET A O   1 
ATOM   1346 C CB  . MET A 1 185 ? 21.894 4.702   18.113 1.00 47.72  ? 185 MET A CB  1 
ATOM   1347 C CG  . MET A 1 185 ? 22.408 4.739   16.680 1.00 47.52  ? 185 MET A CG  1 
ATOM   1348 S SD  . MET A 1 185 ? 21.111 4.731   15.420 1.00 48.73  ? 185 MET A SD  1 
ATOM   1349 C CE  . MET A 1 185 ? 20.391 6.406   15.621 1.00 42.91  ? 185 MET A CE  1 
ATOM   1350 N N   . ILE A 1 186 ? 22.917 5.751   21.284 1.00 49.37  ? 186 ILE A N   1 
ATOM   1351 C CA  . ILE A 1 186 ? 22.495 5.896   22.653 1.00 49.01  ? 186 ILE A CA  1 
ATOM   1352 C C   . ILE A 1 186 ? 21.795 7.217   22.864 1.00 49.19  ? 186 ILE A C   1 
ATOM   1353 O O   . ILE A 1 186 ? 22.401 8.283   22.722 1.00 49.02  ? 186 ILE A O   1 
ATOM   1354 C CB  . ILE A 1 186 ? 23.687 5.800   23.605 1.00 48.28  ? 186 ILE A CB  1 
ATOM   1355 C CG1 . ILE A 1 186 ? 24.464 4.517   23.287 1.00 47.25  ? 186 ILE A CG1 1 
ATOM   1356 C CG2 . ILE A 1 186 ? 23.194 5.832   25.068 1.00 43.11  ? 186 ILE A CG2 1 
ATOM   1357 C CD1 . ILE A 1 186 ? 25.830 4.462   23.897 1.00 47.31  ? 186 ILE A CD1 1 
ATOM   1358 N N   . PRO A 1 187 ? 20.485 7.166   23.163 1.00 49.23  ? 187 PRO A N   1 
ATOM   1359 C CA  . PRO A 1 187 ? 19.716 8.393   23.400 1.00 48.93  ? 187 PRO A CA  1 
ATOM   1360 C C   . PRO A 1 187 ? 19.807 8.732   24.893 1.00 48.18  ? 187 PRO A C   1 
ATOM   1361 O O   . PRO A 1 187 ? 19.356 7.958   25.744 1.00 49.74  ? 187 PRO A O   1 
ATOM   1362 C CB  . PRO A 1 187 ? 18.312 7.998   22.963 1.00 48.48  ? 187 PRO A CB  1 
ATOM   1363 C CG  . PRO A 1 187 ? 18.226 6.594   23.436 1.00 48.66  ? 187 PRO A CG  1 
ATOM   1364 C CD  . PRO A 1 187 ? 19.584 6.001   23.036 1.00 48.56  ? 187 PRO A CD  1 
ATOM   1365 N N   . TYR A 1 188 ? 20.389 9.883   25.209 1.00 47.60  ? 188 TYR A N   1 
ATOM   1366 C CA  . TYR A 1 188 ? 20.571 10.296  26.600 1.00 47.40  ? 188 TYR A CA  1 
ATOM   1367 C C   . TYR A 1 188 ? 19.347 11.072  27.112 1.00 48.13  ? 188 TYR A C   1 
ATOM   1368 O O   . TYR A 1 188 ? 18.950 10.934  28.275 1.00 46.74  ? 188 TYR A O   1 
ATOM   1369 C CB  . TYR A 1 188 ? 21.827 11.160  26.703 1.00 45.26  ? 188 TYR A CB  1 
ATOM   1370 C CG  . TYR A 1 188 ? 23.077 10.319  26.838 1.00 44.55  ? 188 TYR A CG  1 
ATOM   1371 C CD1 . TYR A 1 188 ? 23.549 9.951   28.099 1.00 44.79  ? 188 TYR A CD1 1 
ATOM   1372 C CD2 . TYR A 1 188 ? 23.739 9.807   25.718 1.00 44.17  ? 188 TYR A CD2 1 
ATOM   1373 C CE1 . TYR A 1 188 ? 24.627 9.099   28.252 1.00 42.93  ? 188 TYR A CE1 1 
ATOM   1374 C CE2 . TYR A 1 188 ? 24.833 8.940   25.873 1.00 43.61  ? 188 TYR A CE2 1 
ATOM   1375 C CZ  . TYR A 1 188 ? 25.253 8.592   27.151 1.00 42.69  ? 188 TYR A CZ  1 
ATOM   1376 O OH  . TYR A 1 188 ? 26.236 7.655   27.344 1.00 46.09  ? 188 TYR A OH  1 
ATOM   1377 N N   . SER A 1 189 ? 18.771 11.863  26.205 1.00 49.39  ? 189 SER A N   1 
ATOM   1378 C CA  . SER A 1 189 ? 17.597 12.654  26.481 1.00 49.47  ? 189 SER A CA  1 
ATOM   1379 C C   . SER A 1 189 ? 16.673 12.550  25.246 1.00 49.11  ? 189 SER A C   1 
ATOM   1380 O O   . SER A 1 189 ? 17.151 12.292  24.135 1.00 48.65  ? 189 SER A O   1 
ATOM   1381 C CB  . SER A 1 189 ? 17.956 14.125  26.742 1.00 48.13  ? 189 SER A CB  1 
ATOM   1382 O OG  . SER A 1 189 ? 17.596 14.922  25.625 1.00 47.14  ? 189 SER A OG  1 
ATOM   1383 N N   . SER A 1 190 ? 15.360 12.688  25.439 1.00 50.90  ? 190 SER A N   1 
ATOM   1384 C CA  . SER A 1 190 ? 14.395 12.599  24.326 1.00 53.44  ? 190 SER A CA  1 
ATOM   1385 C C   . SER A 1 190 ? 14.854 13.380  23.091 1.00 53.24  ? 190 SER A C   1 
ATOM   1386 O O   . SER A 1 190 ? 14.425 13.106  21.971 1.00 53.27  ? 190 SER A O   1 
ATOM   1387 C CB  . SER A 1 190 ? 13.017 13.142  24.760 1.00 55.46  ? 190 SER A CB  1 
ATOM   1388 O OG  . SER A 1 190 ? 12.993 14.570  24.802 1.00 58.26  ? 190 SER A OG  1 
ATOM   1389 N N   . THR A 1 191 ? 15.719 14.365  23.287 1.00 53.91  ? 191 THR A N   1 
ATOM   1390 C CA  . THR A 1 191 ? 16.158 15.168  22.156 1.00 54.21  ? 191 THR A CA  1 
ATOM   1391 C C   . THR A 1 191 ? 17.661 15.093  21.867 1.00 52.09  ? 191 THR A C   1 
ATOM   1392 O O   . THR A 1 191 ? 18.198 15.850  21.045 1.00 51.21  ? 191 THR A O   1 
ATOM   1393 C CB  . THR A 1 191 ? 15.724 16.645  22.360 1.00 55.79  ? 191 THR A CB  1 
ATOM   1394 O OG1 . THR A 1 191 ? 16.533 17.261  23.375 1.00 57.79  ? 191 THR A OG1 1 
ATOM   1395 C CG2 . THR A 1 191 ? 14.256 16.693  22.806 1.00 55.71  ? 191 THR A CG2 1 
ATOM   1396 N N   . PHE A 1 192 ? 18.344 14.172  22.531 1.00 50.45  ? 192 PHE A N   1 
ATOM   1397 C CA  . PHE A 1 192 ? 19.772 14.022  22.297 1.00 49.94  ? 192 PHE A CA  1 
ATOM   1398 C C   . PHE A 1 192 ? 20.147 12.566  22.137 1.00 49.18  ? 192 PHE A C   1 
ATOM   1399 O O   . PHE A 1 192 ? 19.779 11.732  22.967 1.00 47.90  ? 192 PHE A O   1 
ATOM   1400 C CB  . PHE A 1 192 ? 20.596 14.617  23.445 1.00 49.40  ? 192 PHE A CB  1 
ATOM   1401 C CG  . PHE A 1 192 ? 22.071 14.573  23.199 1.00 48.22  ? 192 PHE A CG  1 
ATOM   1402 C CD1 . PHE A 1 192 ? 22.671 15.465  22.314 1.00 48.93  ? 192 PHE A CD1 1 
ATOM   1403 C CD2 . PHE A 1 192 ? 22.856 13.598  23.800 1.00 50.49  ? 192 PHE A CD2 1 
ATOM   1404 C CE1 . PHE A 1 192 ? 24.034 15.389  22.024 1.00 47.88  ? 192 PHE A CE1 1 
ATOM   1405 C CE2 . PHE A 1 192 ? 24.222 13.506  23.522 1.00 50.25  ? 192 PHE A CE2 1 
ATOM   1406 C CZ  . PHE A 1 192 ? 24.810 14.408  22.627 1.00 50.43  ? 192 PHE A CZ  1 
ATOM   1407 N N   . THR A 1 193 ? 20.880 12.276  21.063 1.00 49.10  ? 193 THR A N   1 
ATOM   1408 C CA  . THR A 1 193 ? 21.346 10.923  20.772 1.00 49.18  ? 193 THR A CA  1 
ATOM   1409 C C   . THR A 1 193 ? 22.842 10.922  20.449 1.00 49.56  ? 193 THR A C   1 
ATOM   1410 O O   . THR A 1 193 ? 23.310 11.696  19.609 1.00 48.17  ? 193 THR A O   1 
ATOM   1411 C CB  . THR A 1 193 ? 20.598 10.316  19.583 1.00 49.05  ? 193 THR A CB  1 
ATOM   1412 O OG1 . THR A 1 193 ? 19.200 10.218  19.892 1.00 46.27  ? 193 THR A OG1 1 
ATOM   1413 C CG2 . THR A 1 193 ? 21.160 8.934   19.273 1.00 48.12  ? 193 THR A CG2 1 
ATOM   1414 N N   . TRP A 1 194 ? 23.581 10.050  21.125 1.00 50.02  ? 194 TRP A N   1 
ATOM   1415 C CA  . TRP A 1 194 ? 25.025 9.945   20.937 1.00 52.87  ? 194 TRP A CA  1 
ATOM   1416 C C   . TRP A 1 194 ? 25.346 8.615   20.284 1.00 54.42  ? 194 TRP A C   1 
ATOM   1417 O O   . TRP A 1 194 ? 24.912 7.559   20.763 1.00 55.44  ? 194 TRP A O   1 
ATOM   1418 C CB  . TRP A 1 194 ? 25.749 10.026  22.291 1.00 53.67  ? 194 TRP A CB  1 
ATOM   1419 C CG  . TRP A 1 194 ? 27.244 9.953   22.191 1.00 53.16  ? 194 TRP A CG  1 
ATOM   1420 C CD1 . TRP A 1 194 ? 28.095 10.973  21.872 1.00 54.48  ? 194 TRP A CD1 1 
ATOM   1421 C CD2 . TRP A 1 194 ? 28.064 8.788   22.363 1.00 54.55  ? 194 TRP A CD2 1 
ATOM   1422 N NE1 . TRP A 1 194 ? 29.394 10.521  21.832 1.00 54.18  ? 194 TRP A NE1 1 
ATOM   1423 C CE2 . TRP A 1 194 ? 29.404 9.182   22.130 1.00 56.18  ? 194 TRP A CE2 1 
ATOM   1424 C CE3 . TRP A 1 194 ? 27.799 7.449   22.690 1.00 54.37  ? 194 TRP A CE3 1 
ATOM   1425 C CZ2 . TRP A 1 194 ? 30.479 8.279   22.213 1.00 56.46  ? 194 TRP A CZ2 1 
ATOM   1426 C CZ3 . TRP A 1 194 ? 28.870 6.550   22.772 1.00 53.23  ? 194 TRP A CZ3 1 
ATOM   1427 C CH2 . TRP A 1 194 ? 30.190 6.973   22.534 1.00 55.97  ? 194 TRP A CH2 1 
ATOM   1428 N N   . CYS A 1 195 ? 26.124 8.651   19.206 1.00 55.86  ? 195 CYS A N   1 
ATOM   1429 C CA  . CYS A 1 195 ? 26.456 7.411   18.522 1.00 57.40  ? 195 CYS A CA  1 
ATOM   1430 C C   . CYS A 1 195 ? 27.895 6.953   18.679 1.00 56.45  ? 195 CYS A C   1 
ATOM   1431 O O   . CYS A 1 195 ? 28.831 7.634   18.264 1.00 56.96  ? 195 CYS A O   1 
ATOM   1432 C CB  . CYS A 1 195 ? 26.062 7.515   17.042 1.00 57.75  ? 195 CYS A CB  1 
ATOM   1433 S SG  . CYS A 1 195 ? 24.258 7.755   16.907 1.00 62.80  ? 195 CYS A SG  1 
ATOM   1434 N N   . GLY A 1 196 ? 28.052 5.798   19.316 1.00 55.50  ? 196 GLY A N   1 
ATOM   1435 C CA  . GLY A 1 196 ? 29.370 5.224   19.513 1.00 57.36  ? 196 GLY A CA  1 
ATOM   1436 C C   . GLY A 1 196 ? 29.675 4.252   18.384 1.00 57.64  ? 196 GLY A C   1 
ATOM   1437 O O   . GLY A 1 196 ? 29.009 3.223   18.236 1.00 56.25  ? 196 GLY A O   1 
ATOM   1438 N N   . GLU A 1 197 ? 30.686 4.566   17.586 1.00 58.60  ? 197 GLU A N   1 
ATOM   1439 C CA  . GLU A 1 197 ? 31.021 3.710   16.463 1.00 60.13  ? 197 GLU A CA  1 
ATOM   1440 C C   . GLU A 1 197 ? 32.400 3.051   16.490 1.00 59.23  ? 197 GLU A C   1 
ATOM   1441 O O   . GLU A 1 197 ? 33.384 3.638   16.941 1.00 56.76  ? 197 GLU A O   1 
ATOM   1442 C CB  . GLU A 1 197 ? 30.878 4.491   15.161 1.00 62.70  ? 197 GLU A CB  1 
ATOM   1443 C CG  . GLU A 1 197 ? 31.060 3.608   13.952 1.00 68.90  ? 197 GLU A CG  1 
ATOM   1444 C CD  . GLU A 1 197 ? 31.271 4.382   12.669 1.00 72.54  ? 197 GLU A CD  1 
ATOM   1445 O OE1 . GLU A 1 197 ? 30.406 5.219   12.321 1.00 74.66  ? 197 GLU A OE1 1 
ATOM   1446 O OE2 . GLU A 1 197 ? 32.305 4.141   12.006 1.00 74.90  ? 197 GLU A OE2 1 
ATOM   1447 N N   . LEU A 1 198 ? 32.443 1.819   15.989 1.00 59.61  ? 198 LEU A N   1 
ATOM   1448 C CA  . LEU A 1 198 ? 33.668 1.026   15.890 1.00 60.99  ? 198 LEU A CA  1 
ATOM   1449 C C   . LEU A 1 198 ? 33.960 0.694   14.428 1.00 61.34  ? 198 LEU A C   1 
ATOM   1450 O O   . LEU A 1 198 ? 33.194 -0.027  13.791 1.00 63.17  ? 198 LEU A O   1 
ATOM   1451 C CB  . LEU A 1 198 ? 33.531 -0.287  16.658 1.00 59.90  ? 198 LEU A CB  1 
ATOM   1452 C CG  . LEU A 1 198 ? 33.560 -0.177  18.175 1.00 60.62  ? 198 LEU A CG  1 
ATOM   1453 C CD1 . LEU A 1 198 ? 33.328 -1.547  18.791 1.00 60.22  ? 198 LEU A CD1 1 
ATOM   1454 C CD2 . LEU A 1 198 ? 34.907 0.380   18.608 1.00 61.77  ? 198 LEU A CD2 1 
ATOM   1455 N N   . GLY A 1 199 ? 35.063 1.217   13.903 1.00 61.15  ? 199 GLY A N   1 
ATOM   1456 C CA  . GLY A 1 199 ? 35.436 0.943   12.524 1.00 60.19  ? 199 GLY A CA  1 
ATOM   1457 C C   . GLY A 1 199 ? 36.575 -0.057  12.460 1.00 59.46  ? 199 GLY A C   1 
ATOM   1458 O O   . GLY A 1 199 ? 37.582 0.082   13.149 1.00 59.57  ? 199 GLY A O   1 
ATOM   1459 N N   . ALA A 1 200 ? 36.422 -1.076  11.628 1.00 60.27  ? 200 ALA A N   1 
ATOM   1460 C CA  . ALA A 1 200 ? 37.449 -2.101  11.505 1.00 58.84  ? 200 ALA A CA  1 
ATOM   1461 C C   . ALA A 1 200 ? 38.628 -1.626  10.676 1.00 58.85  ? 200 ALA A C   1 
ATOM   1462 O O   . ALA A 1 200 ? 38.456 -1.011  9.622  1.00 57.16  ? 200 ALA A O   1 
ATOM   1463 C CB  . ALA A 1 200 ? 36.859 -3.350  10.884 1.00 57.11  ? 200 ALA A CB  1 
ATOM   1464 N N   . ILE A 1 201 ? 39.828 -1.894  11.178 1.00 60.02  ? 201 ILE A N   1 
ATOM   1465 C CA  . ILE A 1 201 ? 41.053 -1.552  10.468 1.00 60.19  ? 201 ILE A CA  1 
ATOM   1466 C C   . ILE A 1 201 ? 41.877 -2.836  10.386 1.00 63.00  ? 201 ILE A C   1 
ATOM   1467 O O   . ILE A 1 201 ? 41.498 -3.863  10.950 1.00 63.04  ? 201 ILE A O   1 
ATOM   1468 C CB  . ILE A 1 201 ? 41.859 -0.453  11.185 1.00 56.38  ? 201 ILE A CB  1 
ATOM   1469 C CG1 . ILE A 1 201 ? 42.116 -0.852  12.635 1.00 55.08  ? 201 ILE A CG1 1 
ATOM   1470 C CG2 . ILE A 1 201 ? 41.118 0.862   11.104 1.00 54.70  ? 201 ILE A CG2 1 
ATOM   1471 C CD1 . ILE A 1 201 ? 42.908 0.175   13.415 1.00 53.30  ? 201 ILE A CD1 1 
ATOM   1472 N N   . SER A 1 202 ? 43.000 -2.780  9.685  1.00 66.53  ? 202 SER A N   1 
ATOM   1473 C CA  . SER A 1 202 ? 43.865 -3.944  9.506  1.00 69.90  ? 202 SER A CA  1 
ATOM   1474 C C   . SER A 1 202 ? 44.353 -4.627  10.788 1.00 71.73  ? 202 SER A C   1 
ATOM   1475 O O   . SER A 1 202 ? 44.633 -3.971  11.798 1.00 71.84  ? 202 SER A O   1 
ATOM   1476 C CB  . SER A 1 202 ? 45.062 -3.525  8.668  1.00 70.88  ? 202 SER A CB  1 
ATOM   1477 O OG  . SER A 1 202 ? 44.653 -2.565  7.708  1.00 74.72  ? 202 SER A OG  1 
ATOM   1478 N N   . GLU A 1 203 ? 44.461 -5.954  10.726 1.00 73.66  ? 203 GLU A N   1 
ATOM   1479 C CA  . GLU A 1 203 ? 44.926 -6.766  11.855 1.00 76.53  ? 203 GLU A CA  1 
ATOM   1480 C C   . GLU A 1 203 ? 46.121 -6.113  12.558 1.00 77.80  ? 203 GLU A C   1 
ATOM   1481 O O   . GLU A 1 203 ? 46.104 -5.894  13.768 1.00 78.43  ? 203 GLU A O   1 
ATOM   1482 C CB  . GLU A 1 203 ? 45.334 -8.168  11.370 1.00 77.45  ? 203 GLU A CB  1 
ATOM   1483 C CG  . GLU A 1 203 ? 44.192 -9.067  10.892 1.00 78.41  ? 203 GLU A CG  1 
ATOM   1484 C CD  . GLU A 1 203 ? 44.640 -10.511 10.684 1.00 79.35  ? 203 GLU A CD  1 
ATOM   1485 O OE1 . GLU A 1 203 ? 45.422 -11.009 11.520 1.00 79.30  ? 203 GLU A OE1 1 
ATOM   1486 O OE2 . GLU A 1 203 ? 44.208 -11.155 9.700  1.00 80.28  ? 203 GLU A OE2 1 
ATOM   1487 N N   . GLU A 1 204 ? 47.153 -5.808  11.780 1.00 78.70  ? 204 GLU A N   1 
ATOM   1488 C CA  . GLU A 1 204 ? 48.368 -5.180  12.286 1.00 80.50  ? 204 GLU A CA  1 
ATOM   1489 C C   . GLU A 1 204 ? 48.117 -3.855  13.016 1.00 79.51  ? 204 GLU A C   1 
ATOM   1490 O O   . GLU A 1 204 ? 48.470 -3.707  14.183 1.00 78.58  ? 204 GLU A O   1 
ATOM   1491 C CB  . GLU A 1 204 ? 49.335 -4.950  11.118 1.00 83.54  ? 204 GLU A CB  1 
ATOM   1492 C CG  . GLU A 1 204 ? 48.722 -4.152  9.972  1.00 87.36  ? 204 GLU A CG  1 
ATOM   1493 C CD  . GLU A 1 204 ? 49.210 -4.604  8.611  1.00 89.74  ? 204 GLU A CD  1 
ATOM   1494 O OE1 . GLU A 1 204 ? 50.393 -4.349  8.283  1.00 91.33  ? 204 GLU A OE1 1 
ATOM   1495 O OE2 . GLU A 1 204 ? 48.403 -5.223  7.873  1.00 90.09  ? 204 GLU A OE2 1 
ATOM   1496 N N   . SER A 1 205 ? 47.507 -2.905  12.312 1.00 79.20  ? 205 SER A N   1 
ATOM   1497 C CA  . SER A 1 205 ? 47.208 -1.576  12.844 1.00 78.21  ? 205 SER A CA  1 
ATOM   1498 C C   . SER A 1 205 ? 46.952 -1.581  14.351 1.00 77.56  ? 205 SER A C   1 
ATOM   1499 O O   . SER A 1 205 ? 46.420 -2.551  14.903 1.00 77.67  ? 205 SER A O   1 
ATOM   1500 C CB  . SER A 1 205 ? 45.981 -0.989  12.133 1.00 77.95  ? 205 SER A CB  1 
ATOM   1501 O OG  . SER A 1 205 ? 45.926 -1.380  10.770 1.00 77.33  ? 205 SER A OG  1 
ATOM   1502 N N   . ALA A 1 206 ? 47.345 -0.497  15.015 1.00 75.49  ? 206 ALA A N   1 
ATOM   1503 C CA  . ALA A 1 206 ? 47.129 -0.373  16.447 1.00 72.46  ? 206 ALA A CA  1 
ATOM   1504 C C   . ALA A 1 206 ? 45.838 0.415   16.605 1.00 71.63  ? 206 ALA A C   1 
ATOM   1505 O O   . ALA A 1 206 ? 45.474 1.202   15.728 1.00 70.82  ? 206 ALA A O   1 
ATOM   1506 C CB  . ALA A 1 206 ? 48.283 0.365   17.094 1.00 70.58  ? 206 ALA A CB  1 
ATOM   1507 N N   . PRO A 1 207 ? 45.118 0.204   17.717 1.00 70.68  ? 207 PRO A N   1 
ATOM   1508 C CA  . PRO A 1 207 ? 43.863 0.920   17.950 1.00 68.58  ? 207 PRO A CA  1 
ATOM   1509 C C   . PRO A 1 207 ? 44.030 2.431   17.781 1.00 67.29  ? 207 PRO A C   1 
ATOM   1510 O O   . PRO A 1 207 ? 44.944 3.029   18.353 1.00 67.36  ? 207 PRO A O   1 
ATOM   1511 C CB  . PRO A 1 207 ? 43.516 0.534   19.383 1.00 69.15  ? 207 PRO A CB  1 
ATOM   1512 C CG  . PRO A 1 207 ? 44.079 -0.855  19.500 1.00 69.65  ? 207 PRO A CG  1 
ATOM   1513 C CD  . PRO A 1 207 ? 45.422 -0.704  18.840 1.00 70.46  ? 207 PRO A CD  1 
ATOM   1514 N N   . GLN A 1 208 ? 43.150 3.030   16.983 1.00 64.82  ? 208 GLN A N   1 
ATOM   1515 C CA  . GLN A 1 208 ? 43.152 4.464   16.730 1.00 62.92  ? 208 GLN A CA  1 
ATOM   1516 C C   . GLN A 1 208 ? 41.870 5.080   17.277 1.00 62.02  ? 208 GLN A C   1 
ATOM   1517 O O   . GLN A 1 208 ? 40.867 5.200   16.567 1.00 61.71  ? 208 GLN A O   1 
ATOM   1518 C CB  . GLN A 1 208 ? 43.260 4.733   15.235 1.00 63.67  ? 208 GLN A CB  1 
ATOM   1519 C CG  . GLN A 1 208 ? 44.663 4.537   14.705 1.00 68.30  ? 208 GLN A CG  1 
ATOM   1520 C CD  . GLN A 1 208 ? 44.695 3.814   13.373 1.00 70.14  ? 208 GLN A CD  1 
ATOM   1521 O OE1 . GLN A 1 208 ? 44.276 4.349   12.339 1.00 69.79  ? 208 GLN A OE1 1 
ATOM   1522 N NE2 . GLN A 1 208 ? 45.189 2.579   13.392 1.00 72.11  ? 208 GLN A NE2 1 
ATOM   1523 N N   . PRO A 1 209 ? 41.887 5.479   18.558 1.00 60.69  ? 209 PRO A N   1 
ATOM   1524 C CA  . PRO A 1 209 ? 40.743 6.088   19.248 1.00 59.62  ? 209 PRO A CA  1 
ATOM   1525 C C   . PRO A 1 209 ? 40.418 7.492   18.738 1.00 58.84  ? 209 PRO A C   1 
ATOM   1526 O O   . PRO A 1 209 ? 40.960 7.946   17.727 1.00 59.34  ? 209 PRO A O   1 
ATOM   1527 C CB  . PRO A 1 209 ? 41.212 6.121   20.695 1.00 59.85  ? 209 PRO A CB  1 
ATOM   1528 C CG  . PRO A 1 209 ? 42.676 6.429   20.535 1.00 58.53  ? 209 PRO A CG  1 
ATOM   1529 C CD  . PRO A 1 209 ? 43.072 5.463   19.437 1.00 59.35  ? 209 PRO A CD  1 
ATOM   1530 N N   . SER A 1 210 ? 39.527 8.178   19.443 1.00 56.48  ? 210 SER A N   1 
ATOM   1531 C CA  . SER A 1 210 ? 39.180 9.545   19.082 1.00 54.29  ? 210 SER A CA  1 
ATOM   1532 C C   . SER A 1 210 ? 39.690 10.452  20.214 1.00 53.14  ? 210 SER A C   1 
ATOM   1533 O O   . SER A 1 210 ? 40.057 9.967   21.290 1.00 51.59  ? 210 SER A O   1 
ATOM   1534 C CB  . SER A 1 210 ? 37.666 9.693   18.918 1.00 52.30  ? 210 SER A CB  1 
ATOM   1535 O OG  . SER A 1 210 ? 36.992 9.477   20.141 1.00 51.33  ? 210 SER A OG  1 
ATOM   1536 N N   . LEU A 1 211 ? 39.736 11.757  19.968 1.00 51.16  ? 211 LEU A N   1 
ATOM   1537 C CA  . LEU A 1 211 ? 40.192 12.684  20.990 1.00 50.92  ? 211 LEU A CA  1 
ATOM   1538 C C   . LEU A 1 211 ? 39.064 12.891  22.004 1.00 51.63  ? 211 LEU A C   1 
ATOM   1539 O O   . LEU A 1 211 ? 38.402 13.936  22.045 1.00 50.31  ? 211 LEU A O   1 
ATOM   1540 C CB  . LEU A 1 211 ? 40.622 14.012  20.352 1.00 49.08  ? 211 LEU A CB  1 
ATOM   1541 C CG  . LEU A 1 211 ? 41.121 15.113  21.295 1.00 48.90  ? 211 LEU A CG  1 
ATOM   1542 C CD1 . LEU A 1 211 ? 41.844 14.521  22.494 1.00 46.79  ? 211 LEU A CD1 1 
ATOM   1543 C CD2 . LEU A 1 211 ? 42.011 16.054  20.518 1.00 47.98  ? 211 LEU A CD2 1 
ATOM   1544 N N   . SER A 1 212 ? 38.852 11.849  22.802 1.00 52.13  ? 212 SER A N   1 
ATOM   1545 C CA  . SER A 1 212 ? 37.836 11.825  23.837 1.00 52.73  ? 212 SER A CA  1 
ATOM   1546 C C   . SER A 1 212 ? 38.533 11.622  25.161 1.00 53.53  ? 212 SER A C   1 
ATOM   1547 O O   . SER A 1 212 ? 39.240 10.644  25.354 1.00 53.60  ? 212 SER A O   1 
ATOM   1548 C CB  . SER A 1 212 ? 36.854 10.669  23.613 1.00 51.90  ? 212 SER A CB  1 
ATOM   1549 O OG  . SER A 1 212 ? 36.151 10.812  22.392 1.00 50.74  ? 212 SER A OG  1 
ATOM   1550 N N   . ALA A 1 213 ? 38.347 12.559  26.074 1.00 56.30  ? 213 ALA A N   1 
ATOM   1551 C CA  . ALA A 1 213 ? 38.956 12.436  27.382 1.00 56.29  ? 213 ALA A CA  1 
ATOM   1552 C C   . ALA A 1 213 ? 37.883 12.494  28.450 1.00 56.39  ? 213 ALA A C   1 
ATOM   1553 O O   . ALA A 1 213 ? 36.764 12.973  28.234 1.00 54.73  ? 213 ALA A O   1 
ATOM   1554 C CB  . ALA A 1 213 ? 39.977 13.533  27.597 1.00 56.35  ? 213 ALA A CB  1 
ATOM   1555 N N   . ARG A 1 214 ? 38.252 11.978  29.605 1.00 58.01  ? 214 ARG A N   1 
ATOM   1556 C CA  . ARG A 1 214 ? 37.383 11.934  30.755 1.00 59.76  ? 214 ARG A CA  1 
ATOM   1557 C C   . ARG A 1 214 ? 38.234 12.533  31.860 1.00 60.45  ? 214 ARG A C   1 
ATOM   1558 O O   . ARG A 1 214 ? 39.351 12.078  32.117 1.00 60.38  ? 214 ARG A O   1 
ATOM   1559 C CB  . ARG A 1 214 ? 37.033 10.484  31.056 1.00 60.21  ? 214 ARG A CB  1 
ATOM   1560 C CG  . ARG A 1 214 ? 36.303 10.254  32.340 1.00 61.21  ? 214 ARG A CG  1 
ATOM   1561 C CD  . ARG A 1 214 ? 36.271 8.776   32.581 1.00 64.53  ? 214 ARG A CD  1 
ATOM   1562 N NE  . ARG A 1 214 ? 35.525 8.414   33.774 1.00 69.21  ? 214 ARG A NE  1 
ATOM   1563 C CZ  . ARG A 1 214 ? 35.315 7.159   34.149 1.00 71.24  ? 214 ARG A CZ  1 
ATOM   1564 N NH1 . ARG A 1 214 ? 35.806 6.165   33.414 1.00 72.21  ? 214 ARG A NH1 1 
ATOM   1565 N NH2 . ARG A 1 214 ? 34.611 6.895   35.246 1.00 71.79  ? 214 ARG A NH2 1 
ATOM   1566 N N   . SER A 1 215 ? 37.711 13.567  32.500 1.00 60.84  ? 215 SER A N   1 
ATOM   1567 C CA  . SER A 1 215 ? 38.451 14.231  33.546 1.00 61.28  ? 215 SER A CA  1 
ATOM   1568 C C   . SER A 1 215 ? 37.719 14.433  34.865 1.00 60.97  ? 215 SER A C   1 
ATOM   1569 O O   . SER A 1 215 ? 36.686 15.100  34.923 1.00 61.90  ? 215 SER A O   1 
ATOM   1570 C CB  . SER A 1 215 ? 38.927 15.586  33.041 1.00 62.14  ? 215 SER A CB  1 
ATOM   1571 O OG  . SER A 1 215 ? 39.319 16.395  34.135 1.00 66.19  ? 215 SER A OG  1 
ATOM   1572 N N   . PRO A 1 216 ? 38.237 13.834  35.944 1.00 60.48  ? 216 PRO A N   1 
ATOM   1573 C CA  . PRO A 1 216 ? 37.599 14.001  37.255 1.00 58.85  ? 216 PRO A CA  1 
ATOM   1574 C C   . PRO A 1 216 ? 38.080 15.353  37.792 1.00 57.50  ? 216 PRO A C   1 
ATOM   1575 O O   . PRO A 1 216 ? 39.227 15.492  38.236 1.00 56.40  ? 216 PRO A O   1 
ATOM   1576 C CB  . PRO A 1 216 ? 38.144 12.822  38.061 1.00 59.59  ? 216 PRO A CB  1 
ATOM   1577 C CG  . PRO A 1 216 ? 39.522 12.632  37.482 1.00 59.99  ? 216 PRO A CG  1 
ATOM   1578 C CD  . PRO A 1 216 ? 39.297 12.808  35.987 1.00 59.74  ? 216 PRO A CD  1 
ATOM   1579 N N   . VAL A 1 217 ? 37.204 16.349  37.731 1.00 55.67  ? 217 VAL A N   1 
ATOM   1580 C CA  . VAL A 1 217 ? 37.534 17.694  38.182 1.00 53.24  ? 217 VAL A CA  1 
ATOM   1581 C C   . VAL A 1 217 ? 37.807 17.847  39.683 1.00 54.43  ? 217 VAL A C   1 
ATOM   1582 O O   . VAL A 1 217 ? 38.643 18.654  40.086 1.00 54.07  ? 217 VAL A O   1 
ATOM   1583 C CB  . VAL A 1 217 ? 36.426 18.668  37.783 1.00 49.52  ? 217 VAL A CB  1 
ATOM   1584 C CG1 . VAL A 1 217 ? 36.957 20.090  37.784 1.00 48.46  ? 217 VAL A CG1 1 
ATOM   1585 C CG2 . VAL A 1 217 ? 35.894 18.290  36.427 1.00 48.13  ? 217 VAL A CG2 1 
ATOM   1586 N N   . CYS A 1 218 ? 37.123 17.077  40.517 1.00 56.17  ? 218 CYS A N   1 
ATOM   1587 C CA  . CYS A 1 218 ? 37.330 17.212  41.949 1.00 59.19  ? 218 CYS A CA  1 
ATOM   1588 C C   . CYS A 1 218 ? 37.969 15.989  42.616 1.00 61.52  ? 218 CYS A C   1 
ATOM   1589 O O   . CYS A 1 218 ? 37.353 15.325  43.467 1.00 61.20  ? 218 CYS A O   1 
ATOM   1590 C CB  . CYS A 1 218 ? 36.001 17.539  42.631 1.00 60.20  ? 218 CYS A CB  1 
ATOM   1591 S SG  . CYS A 1 218 ? 34.957 18.751  41.746 1.00 63.15  ? 218 CYS A SG  1 
ATOM   1592 N N   . LYS A 1 219 ? 39.204 15.685  42.224 1.00 62.41  ? 219 LYS A N   1 
ATOM   1593 C CA  . LYS A 1 219 ? 39.915 14.566  42.817 1.00 62.80  ? 219 LYS A CA  1 
ATOM   1594 C C   . LYS A 1 219 ? 40.035 14.907  44.288 1.00 63.72  ? 219 LYS A C   1 
ATOM   1595 O O   . LYS A 1 219 ? 40.321 16.053  44.652 1.00 62.83  ? 219 LYS A O   1 
ATOM   1596 C CB  . LYS A 1 219 ? 41.313 14.422  42.230 1.00 64.05  ? 219 LYS A CB  1 
ATOM   1597 C CG  . LYS A 1 219 ? 41.351 14.120  40.746 1.00 68.08  ? 219 LYS A CG  1 
ATOM   1598 C CD  . LYS A 1 219 ? 42.777 13.804  40.284 1.00 69.27  ? 219 LYS A CD  1 
ATOM   1599 C CE  . LYS A 1 219 ? 43.305 12.522  40.934 1.00 69.56  ? 219 LYS A CE  1 
ATOM   1600 N NZ  . LYS A 1 219 ? 44.708 12.221  40.519 1.00 70.09  ? 219 LYS A NZ  1 
ATOM   1601 N N   . ASN A 1 220 ? 39.820 13.907  45.131 1.00 64.65  ? 220 ASN A N   1 
ATOM   1602 C CA  . ASN A 1 220 ? 39.885 14.104  46.562 1.00 64.99  ? 220 ASN A CA  1 
ATOM   1603 C C   . ASN A 1 220 ? 38.922 15.230  46.916 1.00 63.78  ? 220 ASN A C   1 
ATOM   1604 O O   . ASN A 1 220 ? 39.330 16.344  47.240 1.00 63.82  ? 220 ASN A O   1 
ATOM   1605 C CB  . ASN A 1 220 ? 41.296 14.489  46.984 1.00 67.59  ? 220 ASN A CB  1 
ATOM   1606 C CG  . ASN A 1 220 ? 41.522 14.302  48.472 1.00 71.44  ? 220 ASN A CG  1 
ATOM   1607 O OD1 . ASN A 1 220 ? 40.561 14.228  49.255 1.00 72.68  ? 220 ASN A OD1 1 
ATOM   1608 N ND2 . ASN A 1 220 ? 42.792 14.231  48.877 1.00 71.22  ? 220 ASN A ND2 1 
ATOM   1609 N N   . SER A 1 221 ? 37.635 14.938  46.843 1.00 61.65  ? 221 SER A N   1 
ATOM   1610 C CA  . SER A 1 221 ? 36.643 15.942  47.147 1.00 59.76  ? 221 SER A CA  1 
ATOM   1611 C C   . SER A 1 221 ? 36.798 16.441  48.574 1.00 58.25  ? 221 SER A C   1 
ATOM   1612 O O   . SER A 1 221 ? 36.231 17.464  48.944 1.00 59.11  ? 221 SER A O   1 
ATOM   1613 C CB  . SER A 1 221 ? 35.249 15.364  46.940 1.00 59.03  ? 221 SER A CB  1 
ATOM   1614 O OG  . SER A 1 221 ? 35.114 14.156  47.653 1.00 59.67  ? 221 SER A OG  1 
ATOM   1615 N N   . ALA A 1 222 ? 37.570 15.727  49.379 1.00 56.16  ? 222 ALA A N   1 
ATOM   1616 C CA  . ALA A 1 222 ? 37.746 16.142  50.759 1.00 54.89  ? 222 ALA A CA  1 
ATOM   1617 C C   . ALA A 1 222 ? 38.430 17.500  50.766 1.00 54.99  ? 222 ALA A C   1 
ATOM   1618 O O   . ALA A 1 222 ? 38.119 18.363  51.593 1.00 54.27  ? 222 ALA A O   1 
ATOM   1619 C CB  . ALA A 1 222 ? 38.574 15.120  51.509 1.00 53.61  ? 222 ALA A CB  1 
ATOM   1620 N N   . ARG A 1 223 ? 39.351 17.680  49.821 1.00 54.13  ? 223 ARG A N   1 
ATOM   1621 C CA  . ARG A 1 223 ? 40.110 18.920  49.665 1.00 54.24  ? 223 ARG A CA  1 
ATOM   1622 C C   . ARG A 1 223 ? 39.218 20.154  49.557 1.00 54.17  ? 223 ARG A C   1 
ATOM   1623 O O   . ARG A 1 223 ? 39.631 21.272  49.870 1.00 56.26  ? 223 ARG A O   1 
ATOM   1624 C CB  . ARG A 1 223 ? 40.975 18.839  48.403 1.00 54.99  ? 223 ARG A CB  1 
ATOM   1625 C CG  . ARG A 1 223 ? 41.664 20.147  48.049 1.00 58.75  ? 223 ARG A CG  1 
ATOM   1626 C CD  . ARG A 1 223 ? 42.266 20.138  46.636 1.00 61.12  ? 223 ARG A CD  1 
ATOM   1627 N NE  . ARG A 1 223 ? 43.028 21.358  46.350 1.00 59.68  ? 223 ARG A NE  1 
ATOM   1628 C CZ  . ARG A 1 223 ? 44.121 21.719  47.014 1.00 59.27  ? 223 ARG A CZ  1 
ATOM   1629 N NH1 . ARG A 1 223 ? 44.579 20.959  47.998 1.00 59.46  ? 223 ARG A NH1 1 
ATOM   1630 N NH2 . ARG A 1 223 ? 44.764 22.833  46.696 1.00 61.19  ? 223 ARG A NH2 1 
ATOM   1631 N N   . TYR A 1 224 ? 37.989 19.946  49.115 1.00 52.80  ? 224 TYR A N   1 
ATOM   1632 C CA  . TYR A 1 224 ? 37.062 21.038  48.920 1.00 50.85  ? 224 TYR A CA  1 
ATOM   1633 C C   . TYR A 1 224 ? 35.999 21.111  50.010 1.00 50.80  ? 224 TYR A C   1 
ATOM   1634 O O   . TYR A 1 224 ? 35.044 21.874  49.903 1.00 50.05  ? 224 TYR A O   1 
ATOM   1635 C CB  . TYR A 1 224 ? 36.418 20.866  47.552 1.00 50.05  ? 224 TYR A CB  1 
ATOM   1636 C CG  . TYR A 1 224 ? 37.429 20.717  46.429 1.00 51.21  ? 224 TYR A CG  1 
ATOM   1637 C CD1 . TYR A 1 224 ? 38.042 21.833  45.878 1.00 52.19  ? 224 TYR A CD1 1 
ATOM   1638 C CD2 . TYR A 1 224 ? 37.764 19.455  45.908 1.00 51.43  ? 224 TYR A CD2 1 
ATOM   1639 C CE1 . TYR A 1 224 ? 38.961 21.710  44.830 1.00 53.62  ? 224 TYR A CE1 1 
ATOM   1640 C CE2 . TYR A 1 224 ? 38.682 19.318  44.862 1.00 51.20  ? 224 TYR A CE2 1 
ATOM   1641 C CZ  . TYR A 1 224 ? 39.278 20.459  44.324 1.00 53.09  ? 224 TYR A CZ  1 
ATOM   1642 O OH  . TYR A 1 224 ? 40.178 20.384  43.274 1.00 52.69  ? 224 TYR A OH  1 
ATOM   1643 N N   . SER A 1 225 ? 36.169 20.328  51.067 1.00 50.66  ? 225 SER A N   1 
ATOM   1644 C CA  . SER A 1 225 ? 35.191 20.333  52.144 1.00 51.60  ? 225 SER A CA  1 
ATOM   1645 C C   . SER A 1 225 ? 35.101 21.702  52.832 1.00 52.15  ? 225 SER A C   1 
ATOM   1646 O O   . SER A 1 225 ? 34.068 22.034  53.418 1.00 50.69  ? 225 SER A O   1 
ATOM   1647 C CB  . SER A 1 225 ? 35.516 19.236  53.166 1.00 50.61  ? 225 SER A CB  1 
ATOM   1648 O OG  . SER A 1 225 ? 36.611 19.594  53.978 1.00 51.49  ? 225 SER A OG  1 
ATOM   1649 N N   . THR A 1 226 ? 36.180 22.486  52.748 1.00 53.10  ? 226 THR A N   1 
ATOM   1650 C CA  . THR A 1 226 ? 36.239 23.831  53.340 1.00 53.82  ? 226 THR A CA  1 
ATOM   1651 C C   . THR A 1 226 ? 37.019 24.789  52.448 1.00 54.39  ? 226 THR A C   1 
ATOM   1652 O O   . THR A 1 226 ? 37.580 24.374  51.428 1.00 55.19  ? 226 THR A O   1 
ATOM   1653 C CB  . THR A 1 226 ? 36.908 23.836  54.731 1.00 52.77  ? 226 THR A CB  1 
ATOM   1654 O OG1 . THR A 1 226 ? 38.139 23.110  54.678 1.00 54.29  ? 226 THR A OG1 1 
ATOM   1655 C CG2 . THR A 1 226 ? 36.002 23.208  55.752 1.00 52.20  ? 226 THR A CG2 1 
ATOM   1656 N N   . SER A 1 227 ? 37.065 26.063  52.845 1.00 54.54  ? 227 SER A N   1 
ATOM   1657 C CA  . SER A 1 227 ? 37.771 27.094  52.075 1.00 54.51  ? 227 SER A CA  1 
ATOM   1658 C C   . SER A 1 227 ? 39.282 27.187  52.346 1.00 54.88  ? 227 SER A C   1 
ATOM   1659 O O   . SER A 1 227 ? 39.964 28.081  51.838 1.00 54.12  ? 227 SER A O   1 
ATOM   1660 C CB  . SER A 1 227 ? 37.111 28.460  52.306 1.00 53.32  ? 227 SER A CB  1 
ATOM   1661 O OG  . SER A 1 227 ? 36.931 28.719  53.684 1.00 54.14  ? 227 SER A OG  1 
ATOM   1662 N N   . LYS A 1 228 ? 39.803 26.243  53.123 1.00 56.38  ? 228 LYS A N   1 
ATOM   1663 C CA  . LYS A 1 228 ? 41.222 26.216  53.458 1.00 56.79  ? 228 LYS A CA  1 
ATOM   1664 C C   . LYS A 1 228 ? 42.186 26.375  52.285 1.00 56.47  ? 228 LYS A C   1 
ATOM   1665 O O   . LYS A 1 228 ? 43.103 27.187  52.352 1.00 58.06  ? 228 LYS A O   1 
ATOM   1666 C CB  . LYS A 1 228 ? 41.562 24.923  54.198 1.00 57.84  ? 228 LYS A CB  1 
ATOM   1667 C CG  . LYS A 1 228 ? 43.040 24.763  54.528 1.00 58.82  ? 228 LYS A CG  1 
ATOM   1668 C CD  . LYS A 1 228 ? 43.289 23.437  55.216 1.00 61.87  ? 228 LYS A CD  1 
ATOM   1669 C CE  . LYS A 1 228 ? 44.774 23.187  55.444 1.00 63.34  ? 228 LYS A CE  1 
ATOM   1670 N NZ  . LYS A 1 228 ? 45.027 21.850  56.083 1.00 63.75  ? 228 LYS A NZ  1 
ATOM   1671 N N   . PHE A 1 229 ? 41.996 25.604  51.218 1.00 54.98  ? 229 PHE A N   1 
ATOM   1672 C CA  . PHE A 1 229 ? 42.900 25.684  50.082 1.00 53.84  ? 229 PHE A CA  1 
ATOM   1673 C C   . PHE A 1 229 ? 42.493 26.659  49.010 1.00 54.54  ? 229 PHE A C   1 
ATOM   1674 O O   . PHE A 1 229 ? 43.138 26.743  47.962 1.00 54.26  ? 229 PHE A O   1 
ATOM   1675 C CB  . PHE A 1 229 ? 43.093 24.306  49.461 1.00 52.97  ? 229 PHE A CB  1 
ATOM   1676 C CG  . PHE A 1 229 ? 43.955 23.397  50.281 1.00 54.20  ? 229 PHE A CG  1 
ATOM   1677 C CD1 . PHE A 1 229 ? 45.252 23.772  50.618 1.00 53.50  ? 229 PHE A CD1 1 
ATOM   1678 C CD2 . PHE A 1 229 ? 43.467 22.183  50.753 1.00 54.59  ? 229 PHE A CD2 1 
ATOM   1679 C CE1 . PHE A 1 229 ? 46.047 22.959  51.410 1.00 51.25  ? 229 PHE A CE1 1 
ATOM   1680 C CE2 . PHE A 1 229 ? 44.259 21.363  51.544 1.00 53.35  ? 229 PHE A CE2 1 
ATOM   1681 C CZ  . PHE A 1 229 ? 45.552 21.757  51.873 1.00 51.89  ? 229 PHE A CZ  1 
ATOM   1682 N N   . CYS A 1 230 ? 41.434 27.409  49.272 1.00 56.15  ? 230 CYS A N   1 
ATOM   1683 C CA  . CYS A 1 230 ? 40.949 28.372  48.293 1.00 59.26  ? 230 CYS A CA  1 
ATOM   1684 C C   . CYS A 1 230 ? 42.062 29.268  47.774 1.00 60.59  ? 230 CYS A C   1 
ATOM   1685 O O   . CYS A 1 230 ? 42.303 29.343  46.565 1.00 60.53  ? 230 CYS A O   1 
ATOM   1686 C CB  . CYS A 1 230 ? 39.836 29.225  48.896 1.00 59.66  ? 230 CYS A CB  1 
ATOM   1687 S SG  . CYS A 1 230 ? 38.280 28.332  49.089 1.00 61.69  ? 230 CYS A SG  1 
ATOM   1688 N N   . GLU A 1 231 ? 42.742 29.934  48.699 1.00 61.69  ? 231 GLU A N   1 
ATOM   1689 C CA  . GLU A 1 231 ? 43.834 30.833  48.363 1.00 62.19  ? 231 GLU A CA  1 
ATOM   1690 C C   . GLU A 1 231 ? 44.915 30.156  47.498 1.00 62.02  ? 231 GLU A C   1 
ATOM   1691 O O   . GLU A 1 231 ? 45.362 30.704  46.485 1.00 61.26  ? 231 GLU A O   1 
ATOM   1692 C CB  . GLU A 1 231 ? 44.443 31.373  49.654 1.00 62.16  ? 231 GLU A CB  1 
ATOM   1693 C CG  . GLU A 1 231 ? 44.775 32.839  49.583 1.00 65.24  ? 231 GLU A CG  1 
ATOM   1694 C CD  . GLU A 1 231 ? 43.544 33.730  49.422 1.00 65.92  ? 231 GLU A CD  1 
ATOM   1695 O OE1 . GLU A 1 231 ? 42.611 33.624  50.251 1.00 66.94  ? 231 GLU A OE1 1 
ATOM   1696 O OE2 . GLU A 1 231 ? 43.517 34.544  48.475 1.00 64.01  ? 231 GLU A OE2 1 
ATOM   1697 N N   . VAL A 1 232 ? 45.328 28.961  47.903 1.00 62.63  ? 232 VAL A N   1 
ATOM   1698 C CA  . VAL A 1 232 ? 46.340 28.207  47.168 1.00 63.48  ? 232 VAL A CA  1 
ATOM   1699 C C   . VAL A 1 232 ? 45.842 27.824  45.775 1.00 63.89  ? 232 VAL A C   1 
ATOM   1700 O O   . VAL A 1 232 ? 46.584 27.915  44.797 1.00 62.89  ? 232 VAL A O   1 
ATOM   1701 C CB  . VAL A 1 232 ? 46.710 26.904  47.908 1.00 62.81  ? 232 VAL A CB  1 
ATOM   1702 C CG1 . VAL A 1 232 ? 47.786 26.164  47.146 1.00 62.68  ? 232 VAL A CG1 1 
ATOM   1703 C CG2 . VAL A 1 232 ? 47.172 27.221  49.308 1.00 62.34  ? 232 VAL A CG2 1 
ATOM   1704 N N   . ASP A 1 233 ? 44.588 27.380  45.700 1.00 64.04  ? 233 ASP A N   1 
ATOM   1705 C CA  . ASP A 1 233 ? 44.001 26.969  44.433 1.00 63.95  ? 233 ASP A CA  1 
ATOM   1706 C C   . ASP A 1 233 ? 43.756 28.128  43.485 1.00 63.63  ? 233 ASP A C   1 
ATOM   1707 O O   . ASP A 1 233 ? 43.611 27.931  42.278 1.00 63.06  ? 233 ASP A O   1 
ATOM   1708 C CB  . ASP A 1 233 ? 42.676 26.236  44.662 1.00 64.69  ? 233 ASP A CB  1 
ATOM   1709 C CG  . ASP A 1 233 ? 42.871 24.819  45.156 1.00 66.12  ? 233 ASP A CG  1 
ATOM   1710 O OD1 . ASP A 1 233 ? 43.838 24.164  44.702 1.00 65.44  ? 233 ASP A OD1 1 
ATOM   1711 O OD2 . ASP A 1 233 ? 42.050 24.354  45.981 1.00 65.91  ? 233 ASP A OD2 1 
ATOM   1712 N N   . GLY A 1 234 ? 43.701 29.337  44.029 1.00 63.21  ? 234 GLY A N   1 
ATOM   1713 C CA  . GLY A 1 234 ? 43.446 30.488  43.192 1.00 62.40  ? 234 GLY A CA  1 
ATOM   1714 C C   . GLY A 1 234 ? 41.960 30.628  42.920 1.00 62.40  ? 234 GLY A C   1 
ATOM   1715 O O   . GLY A 1 234 ? 41.546 30.995  41.819 1.00 62.25  ? 234 GLY A O   1 
ATOM   1716 N N   . CYS A 1 235 ? 41.152 30.315  43.928 1.00 62.28  ? 235 CYS A N   1 
ATOM   1717 C CA  . CYS A 1 235 ? 39.706 30.430  43.813 1.00 62.32  ? 235 CYS A CA  1 
ATOM   1718 C C   . CYS A 1 235 ? 39.204 31.438  44.823 1.00 63.07  ? 235 CYS A C   1 
ATOM   1719 O O   . CYS A 1 235 ? 38.831 31.074  45.945 1.00 62.62  ? 235 CYS A O   1 
ATOM   1720 C CB  . CYS A 1 235 ? 39.038 29.090  44.068 1.00 61.96  ? 235 CYS A CB  1 
ATOM   1721 S SG  . CYS A 1 235 ? 39.448 27.865  42.802 1.00 62.89  ? 235 CYS A SG  1 
ATOM   1722 N N   . THR A 1 236 ? 39.201 32.706  44.415 1.00 63.71  ? 236 THR A N   1 
ATOM   1723 C CA  . THR A 1 236 ? 38.756 33.793  45.277 1.00 63.73  ? 236 THR A CA  1 
ATOM   1724 C C   . THR A 1 236 ? 37.874 34.790  44.543 1.00 64.02  ? 236 THR A C   1 
ATOM   1725 O O   . THR A 1 236 ? 37.901 34.881  43.316 1.00 62.69  ? 236 THR A O   1 
ATOM   1726 C CB  . THR A 1 236 ? 39.951 34.564  45.870 1.00 63.18  ? 236 THR A CB  1 
ATOM   1727 O OG1 . THR A 1 236 ? 40.696 35.183  44.813 1.00 63.09  ? 236 THR A OG1 1 
ATOM   1728 C CG2 . THR A 1 236 ? 40.858 33.619  46.642 1.00 62.84  ? 236 THR A CG2 1 
ATOM   1729 N N   . ALA A 1 237 ? 37.099 35.542  45.317 1.00 65.75  ? 237 ALA A N   1 
ATOM   1730 C CA  . ALA A 1 237 ? 36.200 36.546  44.769 1.00 67.06  ? 237 ALA A CA  1 
ATOM   1731 C C   . ALA A 1 237 ? 36.981 37.450  43.826 1.00 68.42  ? 237 ALA A C   1 
ATOM   1732 O O   . ALA A 1 237 ? 36.409 38.055  42.915 1.00 69.15  ? 237 ALA A O   1 
ATOM   1733 C CB  . ALA A 1 237 ? 35.582 37.362  45.896 1.00 65.06  ? 237 ALA A CB  1 
ATOM   1734 N N   . GLU A 1 238 ? 38.292 37.524  44.048 1.00 69.60  ? 238 GLU A N   1 
ATOM   1735 C CA  . GLU A 1 238 ? 39.171 38.350  43.227 1.00 70.46  ? 238 GLU A CA  1 
ATOM   1736 C C   . GLU A 1 238 ? 39.159 37.815  41.791 1.00 70.33  ? 238 GLU A C   1 
ATOM   1737 O O   . GLU A 1 238 ? 38.540 38.408  40.905 1.00 70.56  ? 238 GLU A O   1 
ATOM   1738 C CB  . GLU A 1 238 ? 40.604 38.332  43.785 1.00 71.73  ? 238 GLU A CB  1 
ATOM   1739 C CG  . GLU A 1 238 ? 40.733 38.166  45.315 1.00 73.48  ? 238 GLU A CG  1 
ATOM   1740 C CD  . GLU A 1 238 ? 39.881 39.141  46.119 1.00 74.99  ? 238 GLU A CD  1 
ATOM   1741 O OE1 . GLU A 1 238 ? 39.814 40.333  45.744 1.00 75.02  ? 238 GLU A OE1 1 
ATOM   1742 O OE2 . GLU A 1 238 ? 39.288 38.713  47.140 1.00 75.71  ? 238 GLU A OE2 1 
ATOM   1743 N N   . THR A 1 239 ? 39.837 36.695  41.564 1.00 69.61  ? 239 THR A N   1 
ATOM   1744 C CA  . THR A 1 239 ? 39.885 36.083  40.237 1.00 68.92  ? 239 THR A CA  1 
ATOM   1745 C C   . THR A 1 239 ? 38.486 35.683  39.767 1.00 67.15  ? 239 THR A C   1 
ATOM   1746 O O   . THR A 1 239 ? 38.324 35.165  38.659 1.00 66.55  ? 239 THR A O   1 
ATOM   1747 C CB  . THR A 1 239 ? 40.764 34.814  40.242 1.00 70.87  ? 239 THR A CB  1 
ATOM   1748 O OG1 . THR A 1 239 ? 40.116 33.769  40.992 1.00 71.04  ? 239 THR A OG1 1 
ATOM   1749 C CG2 . THR A 1 239 ? 42.119 35.125  40.875 1.00 72.04  ? 239 THR A CG2 1 
ATOM   1750 N N   . GLY A 1 240 ? 37.487 35.917  40.617 1.00 65.24  ? 240 GLY A N   1 
ATOM   1751 C CA  . GLY A 1 240 ? 36.119 35.565  40.279 1.00 63.82  ? 240 GLY A CA  1 
ATOM   1752 C C   . GLY A 1 240 ? 35.912 34.059  40.295 1.00 63.36  ? 240 GLY A C   1 
ATOM   1753 O O   . GLY A 1 240 ? 35.180 33.509  39.471 1.00 62.54  ? 240 GLY A O   1 
ATOM   1754 N N   . MET A 1 241 ? 36.567 33.386  41.236 1.00 62.19  ? 241 MET A N   1 
ATOM   1755 C CA  . MET A 1 241 ? 36.459 31.942  41.353 1.00 60.38  ? 241 MET A CA  1 
ATOM   1756 C C   . MET A 1 241 ? 36.705 31.265  40.004 1.00 60.57  ? 241 MET A C   1 
ATOM   1757 O O   . MET A 1 241 ? 35.840 30.556  39.489 1.00 60.07  ? 241 MET A O   1 
ATOM   1758 C CB  . MET A 1 241 ? 35.078 31.575  41.886 1.00 59.15  ? 241 MET A CB  1 
ATOM   1759 C CG  . MET A 1 241 ? 34.746 32.232  43.210 1.00 56.58  ? 241 MET A CG  1 
ATOM   1760 S SD  . MET A 1 241 ? 35.937 31.816  44.471 1.00 52.63  ? 241 MET A SD  1 
ATOM   1761 C CE  . MET A 1 241 ? 35.639 30.069  44.664 1.00 52.99  ? 241 MET A CE  1 
ATOM   1762 N N   . GLU A 1 242 ? 37.894 31.495  39.446 1.00 60.67  ? 242 GLU A N   1 
ATOM   1763 C CA  . GLU A 1 242 ? 38.298 30.927  38.163 1.00 60.72  ? 242 GLU A CA  1 
ATOM   1764 C C   . GLU A 1 242 ? 39.707 30.361  38.190 1.00 60.39  ? 242 GLU A C   1 
ATOM   1765 O O   . GLU A 1 242 ? 40.669 31.089  38.361 1.00 61.66  ? 242 GLU A O   1 
ATOM   1766 C CB  . GLU A 1 242 ? 38.213 31.988  37.066 1.00 61.50  ? 242 GLU A CB  1 
ATOM   1767 C CG  . GLU A 1 242 ? 36.880 31.999  36.342 1.00 65.22  ? 242 GLU A CG  1 
ATOM   1768 C CD  . GLU A 1 242 ? 36.639 33.258  35.515 1.00 66.33  ? 242 GLU A CD  1 
ATOM   1769 O OE1 . GLU A 1 242 ? 37.372 33.495  34.523 1.00 66.15  ? 242 GLU A OE1 1 
ATOM   1770 O OE2 . GLU A 1 242 ? 35.700 34.010  35.862 1.00 66.63  ? 242 GLU A OE2 1 
ATOM   1771 N N   . LYS A 1 243 ? 39.818 29.054  38.017 1.00 60.95  ? 243 LYS A N   1 
ATOM   1772 C CA  . LYS A 1 243 ? 41.105 28.367  37.990 1.00 60.95  ? 243 LYS A CA  1 
ATOM   1773 C C   . LYS A 1 243 ? 41.057 27.425  36.772 1.00 60.52  ? 243 LYS A C   1 
ATOM   1774 O O   . LYS A 1 243 ? 40.818 26.210  36.891 1.00 59.33  ? 243 LYS A O   1 
ATOM   1775 C CB  . LYS A 1 243 ? 41.307 27.587  39.301 1.00 63.22  ? 243 LYS A CB  1 
ATOM   1776 C CG  . LYS A 1 243 ? 42.535 26.684  39.325 1.00 64.60  ? 243 LYS A CG  1 
ATOM   1777 C CD  . LYS A 1 243 ? 43.824 27.463  39.059 1.00 66.68  ? 243 LYS A CD  1 
ATOM   1778 C CE  . LYS A 1 243 ? 45.014 26.526  38.913 1.00 65.93  ? 243 LYS A CE  1 
ATOM   1779 N NZ  . LYS A 1 243 ? 45.085 25.561  40.052 1.00 65.69  ? 243 LYS A NZ  1 
ATOM   1780 N N   . MET A 1 244 ? 41.275 28.015  35.598 1.00 59.89  ? 244 MET A N   1 
ATOM   1781 C CA  . MET A 1 244 ? 41.229 27.298  34.321 1.00 58.58  ? 244 MET A CA  1 
ATOM   1782 C C   . MET A 1 244 ? 42.440 26.434  33.969 1.00 57.56  ? 244 MET A C   1 
ATOM   1783 O O   . MET A 1 244 ? 43.592 26.819  34.160 1.00 56.64  ? 244 MET A O   1 
ATOM   1784 C CB  . MET A 1 244 ? 40.989 28.287  33.172 1.00 56.64  ? 244 MET A CB  1 
ATOM   1785 C CG  . MET A 1 244 ? 39.907 29.336  33.436 1.00 54.97  ? 244 MET A CG  1 
ATOM   1786 S SD  . MET A 1 244 ? 38.302 28.681  33.889 1.00 50.88  ? 244 MET A SD  1 
ATOM   1787 C CE  . MET A 1 244 ? 37.707 28.064  32.319 1.00 47.97  ? 244 MET A CE  1 
ATOM   1788 N N   . SER A 1 245 ? 42.149 25.252  33.445 1.00 57.69  ? 245 SER A N   1 
ATOM   1789 C CA  . SER A 1 245 ? 43.170 24.316  33.016 1.00 57.02  ? 245 SER A CA  1 
ATOM   1790 C C   . SER A 1 245 ? 42.796 23.957  31.580 1.00 57.25  ? 245 SER A C   1 
ATOM   1791 O O   . SER A 1 245 ? 41.615 23.939  31.224 1.00 56.82  ? 245 SER A O   1 
ATOM   1792 C CB  . SER A 1 245 ? 43.150 23.073  33.900 1.00 55.25  ? 245 SER A CB  1 
ATOM   1793 O OG  . SER A 1 245 ? 42.150 23.198  34.898 1.00 57.82  ? 245 SER A OG  1 
ATOM   1794 N N   . LEU A 1 246 ? 43.803 23.688  30.758 1.00 56.89  ? 246 LEU A N   1 
ATOM   1795 C CA  . LEU A 1 246 ? 43.586 23.343  29.363 1.00 55.81  ? 246 LEU A CA  1 
ATOM   1796 C C   . LEU A 1 246 ? 43.132 21.899  29.230 1.00 55.08  ? 246 LEU A C   1 
ATOM   1797 O O   . LEU A 1 246 ? 43.605 21.038  29.960 1.00 54.62  ? 246 LEU A O   1 
ATOM   1798 C CB  . LEU A 1 246 ? 44.883 23.540  28.588 1.00 56.86  ? 246 LEU A CB  1 
ATOM   1799 C CG  . LEU A 1 246 ? 44.766 23.672  27.074 1.00 58.81  ? 246 LEU A CG  1 
ATOM   1800 C CD1 . LEU A 1 246 ? 44.098 25.004  26.714 1.00 57.61  ? 246 LEU A CD1 1 
ATOM   1801 C CD2 . LEU A 1 246 ? 46.147 23.599  26.469 1.00 59.68  ? 246 LEU A CD2 1 
ATOM   1802 N N   . LEU A 1 247 ? 42.216 21.643  28.297 1.00 56.01  ? 247 LEU A N   1 
ATOM   1803 C CA  . LEU A 1 247 ? 41.697 20.292  28.039 1.00 56.79  ? 247 LEU A CA  1 
ATOM   1804 C C   . LEU A 1 247 ? 42.193 19.817  26.686 1.00 57.65  ? 247 LEU A C   1 
ATOM   1805 O O   . LEU A 1 247 ? 42.446 18.633  26.479 1.00 58.47  ? 247 LEU A O   1 
ATOM   1806 C CB  . LEU A 1 247 ? 40.170 20.286  28.011 1.00 55.18  ? 247 LEU A CB  1 
ATOM   1807 C CG  . LEU A 1 247 ? 39.492 20.593  29.334 1.00 56.23  ? 247 LEU A CG  1 
ATOM   1808 C CD1 . LEU A 1 247 ? 38.058 20.976  29.077 1.00 56.92  ? 247 LEU A CD1 1 
ATOM   1809 C CD2 . LEU A 1 247 ? 39.593 19.390  30.248 1.00 56.80  ? 247 LEU A CD2 1 
ATOM   1810 N N   . THR A 1 248 ? 42.320 20.756  25.761 1.00 59.06  ? 248 THR A N   1 
ATOM   1811 C CA  . THR A 1 248 ? 42.770 20.438  24.422 1.00 61.03  ? 248 THR A CA  1 
ATOM   1812 C C   . THR A 1 248 ? 44.288 20.296  24.378 1.00 63.04  ? 248 THR A C   1 
ATOM   1813 O O   . THR A 1 248 ? 45.013 21.215  24.760 1.00 63.30  ? 248 THR A O   1 
ATOM   1814 C CB  . THR A 1 248 ? 42.368 21.539  23.442 1.00 61.62  ? 248 THR A CB  1 
ATOM   1815 O OG1 . THR A 1 248 ? 41.015 21.949  23.692 1.00 58.44  ? 248 THR A OG1 1 
ATOM   1816 C CG2 . THR A 1 248 ? 42.496 21.027  22.012 1.00 62.72  ? 248 THR A CG2 1 
ATOM   1817 N N   . PRO A 1 249 ? 44.786 19.137  23.915 1.00 64.80  ? 249 PRO A N   1 
ATOM   1818 C CA  . PRO A 1 249 ? 46.225 18.872  23.818 1.00 65.65  ? 249 PRO A CA  1 
ATOM   1819 C C   . PRO A 1 249 ? 46.933 19.779  22.802 1.00 67.38  ? 249 PRO A C   1 
ATOM   1820 O O   . PRO A 1 249 ? 46.282 20.542  22.083 1.00 67.74  ? 249 PRO A O   1 
ATOM   1821 C CB  . PRO A 1 249 ? 46.273 17.392  23.441 1.00 65.40  ? 249 PRO A CB  1 
ATOM   1822 C CG  . PRO A 1 249 ? 44.991 17.183  22.682 1.00 64.81  ? 249 PRO A CG  1 
ATOM   1823 C CD  . PRO A 1 249 ? 44.009 17.944  23.531 1.00 66.11  ? 249 PRO A CD  1 
ATOM   1824 N N   . PHE A 1 250 ? 48.262 19.687  22.743 1.00 69.48  ? 250 PHE A N   1 
ATOM   1825 C CA  . PHE A 1 250 ? 49.062 20.519  21.845 1.00 70.41  ? 250 PHE A CA  1 
ATOM   1826 C C   . PHE A 1 250 ? 48.792 20.334  20.351 1.00 71.66  ? 250 PHE A C   1 
ATOM   1827 O O   . PHE A 1 250 ? 48.875 21.300  19.576 1.00 72.37  ? 250 PHE A O   1 
ATOM   1828 C CB  . PHE A 1 250 ? 50.549 20.303  22.111 1.00 69.99  ? 250 PHE A CB  1 
ATOM   1829 C CG  . PHE A 1 250 ? 51.429 21.313  21.432 1.00 70.59  ? 250 PHE A CG  1 
ATOM   1830 C CD1 . PHE A 1 250 ? 51.349 22.661  21.772 1.00 69.73  ? 250 PHE A CD1 1 
ATOM   1831 C CD2 . PHE A 1 250 ? 52.330 20.924  20.441 1.00 70.45  ? 250 PHE A CD2 1 
ATOM   1832 C CE1 . PHE A 1 250 ? 52.152 23.609  21.133 1.00 69.47  ? 250 PHE A CE1 1 
ATOM   1833 C CE2 . PHE A 1 250 ? 53.136 21.863  19.796 1.00 69.36  ? 250 PHE A CE2 1 
ATOM   1834 C CZ  . PHE A 1 250 ? 53.047 23.207  20.144 1.00 69.36  ? 250 PHE A CZ  1 
ATOM   1835 N N   . GLY A 1 251 ? 48.485 19.105  19.941 1.00 70.93  ? 251 GLY A N   1 
ATOM   1836 C CA  . GLY A 1 251 ? 48.201 18.858  18.537 1.00 71.63  ? 251 GLY A CA  1 
ATOM   1837 C C   . GLY A 1 251 ? 46.738 19.068  18.167 1.00 71.49  ? 251 GLY A C   1 
ATOM   1838 O O   . GLY A 1 251 ? 46.406 19.292  16.993 1.00 70.29  ? 251 GLY A O   1 
ATOM   1839 N N   . GLY A 1 252 ? 45.874 18.998  19.180 1.00 71.40  ? 252 GLY A N   1 
ATOM   1840 C CA  . GLY A 1 252 ? 44.440 19.164  18.996 1.00 72.06  ? 252 GLY A CA  1 
ATOM   1841 C C   . GLY A 1 252 ? 43.979 20.208  17.990 1.00 72.61  ? 252 GLY A C   1 
ATOM   1842 O O   . GLY A 1 252 ? 44.748 21.092  17.595 1.00 72.75  ? 252 GLY A O   1 
ATOM   1843 N N   . PRO A 1 253 ? 42.705 20.130  17.561 1.00 72.46  ? 253 PRO A N   1 
ATOM   1844 C CA  . PRO A 1 253 ? 42.097 21.048  16.592 1.00 71.97  ? 253 PRO A CA  1 
ATOM   1845 C C   . PRO A 1 253 ? 42.358 22.520  16.875 1.00 70.98  ? 253 PRO A C   1 
ATOM   1846 O O   . PRO A 1 253 ? 42.932 22.874  17.904 1.00 70.74  ? 253 PRO A O   1 
ATOM   1847 C CB  . PRO A 1 253 ? 40.611 20.695  16.673 1.00 71.87  ? 253 PRO A CB  1 
ATOM   1848 C CG  . PRO A 1 253 ? 40.653 19.234  16.892 1.00 72.69  ? 253 PRO A CG  1 
ATOM   1849 C CD  . PRO A 1 253 ? 41.728 19.107  17.974 1.00 72.62  ? 253 PRO A CD  1 
ATOM   1850 N N   . PRO A 1 254 ? 41.934 23.396  15.952 1.00 70.16  ? 254 PRO A N   1 
ATOM   1851 C CA  . PRO A 1 254 ? 42.093 24.848  16.052 1.00 69.32  ? 254 PRO A CA  1 
ATOM   1852 C C   . PRO A 1 254 ? 41.235 25.483  17.150 1.00 68.41  ? 254 PRO A C   1 
ATOM   1853 O O   . PRO A 1 254 ? 41.303 26.696  17.381 1.00 69.17  ? 254 PRO A O   1 
ATOM   1854 C CB  . PRO A 1 254 ? 41.704 25.325  14.658 1.00 70.05  ? 254 PRO A CB  1 
ATOM   1855 C CG  . PRO A 1 254 ? 40.664 24.320  14.254 1.00 70.28  ? 254 PRO A CG  1 
ATOM   1856 C CD  . PRO A 1 254 ? 41.326 23.033  14.662 1.00 70.06  ? 254 PRO A CD  1 
ATOM   1857 N N   . GLN A 1 255 ? 40.412 24.674  17.810 1.00 66.14  ? 255 GLN A N   1 
ATOM   1858 C CA  . GLN A 1 255 ? 39.593 25.188  18.900 1.00 64.18  ? 255 GLN A CA  1 
ATOM   1859 C C   . GLN A 1 255 ? 40.307 24.819  20.190 1.00 62.34  ? 255 GLN A C   1 
ATOM   1860 O O   . GLN A 1 255 ? 41.043 23.835  20.244 1.00 60.72  ? 255 GLN A O   1 
ATOM   1861 C CB  . GLN A 1 255 ? 38.180 24.595  18.873 1.00 64.04  ? 255 GLN A CB  1 
ATOM   1862 C CG  . GLN A 1 255 ? 37.279 25.160  17.779 1.00 61.80  ? 255 GLN A CG  1 
ATOM   1863 C CD  . GLN A 1 255 ? 37.796 24.856  16.386 1.00 62.72  ? 255 GLN A CD  1 
ATOM   1864 O OE1 . GLN A 1 255 ? 38.263 23.748  16.115 1.00 63.72  ? 255 GLN A OE1 1 
ATOM   1865 N NE2 . GLN A 1 255 ? 37.705 25.831  15.492 1.00 61.87  ? 255 GLN A NE2 1 
ATOM   1866 N N   . GLN A 1 256 ? 40.095 25.616  21.224 1.00 61.19  ? 256 GLN A N   1 
ATOM   1867 C CA  . GLN A 1 256 ? 40.760 25.381  22.491 1.00 61.29  ? 256 GLN A CA  1 
ATOM   1868 C C   . GLN A 1 256 ? 39.761 25.372  23.626 1.00 60.15  ? 256 GLN A C   1 
ATOM   1869 O O   . GLN A 1 256 ? 39.088 26.371  23.879 1.00 60.72  ? 256 GLN A O   1 
ATOM   1870 C CB  . GLN A 1 256 ? 41.804 26.475  22.733 1.00 63.01  ? 256 GLN A CB  1 
ATOM   1871 C CG  . GLN A 1 256 ? 42.719 26.234  23.925 1.00 66.10  ? 256 GLN A CG  1 
ATOM   1872 C CD  . GLN A 1 256 ? 43.520 27.477  24.332 1.00 68.15  ? 256 GLN A CD  1 
ATOM   1873 O OE1 . GLN A 1 256 ? 42.955 28.483  24.790 1.00 68.20  ? 256 GLN A OE1 1 
ATOM   1874 N NE2 . GLN A 1 256 ? 44.843 27.408  24.170 1.00 67.33  ? 256 GLN A NE2 1 
ATOM   1875 N N   . ALA A 1 257 ? 39.675 24.243  24.319 1.00 58.98  ? 257 ALA A N   1 
ATOM   1876 C CA  . ALA A 1 257 ? 38.751 24.109  25.437 1.00 57.53  ? 257 ALA A CA  1 
ATOM   1877 C C   . ALA A 1 257 ? 39.496 24.089  26.763 1.00 56.63  ? 257 ALA A C   1 
ATOM   1878 O O   . ALA A 1 257 ? 40.637 23.642  26.834 1.00 55.79  ? 257 ALA A O   1 
ATOM   1879 C CB  . ALA A 1 257 ? 37.931 22.837  25.283 1.00 57.72  ? 257 ALA A CB  1 
ATOM   1880 N N   . LYS A 1 258 ? 38.847 24.582  27.810 1.00 56.84  ? 258 LYS A N   1 
ATOM   1881 C CA  . LYS A 1 258 ? 39.452 24.609  29.132 1.00 57.69  ? 258 LYS A CA  1 
ATOM   1882 C C   . LYS A 1 258 ? 38.392 24.373  30.206 1.00 56.81  ? 258 LYS A C   1 
ATOM   1883 O O   . LYS A 1 258 ? 37.208 24.582  29.979 1.00 57.30  ? 258 LYS A O   1 
ATOM   1884 C CB  . LYS A 1 258 ? 40.172 25.947  29.362 1.00 58.34  ? 258 LYS A CB  1 
ATOM   1885 C CG  . LYS A 1 258 ? 41.390 26.165  28.444 1.00 60.86  ? 258 LYS A CG  1 
ATOM   1886 C CD  . LYS A 1 258 ? 42.205 27.426  28.801 1.00 62.83  ? 258 LYS A CD  1 
ATOM   1887 C CE  . LYS A 1 258 ? 41.446 28.719  28.493 1.00 65.09  ? 258 LYS A CE  1 
ATOM   1888 N NZ  . LYS A 1 258 ? 42.074 29.925  29.113 1.00 63.88  ? 258 LYS A NZ  1 
ATOM   1889 N N   . MET A 1 259 ? 38.830 23.911  31.368 1.00 56.49  ? 259 MET A N   1 
ATOM   1890 C CA  . MET A 1 259 ? 37.932 23.636  32.478 1.00 54.82  ? 259 MET A CA  1 
ATOM   1891 C C   . MET A 1 259 ? 38.352 24.453  33.683 1.00 53.33  ? 259 MET A C   1 
ATOM   1892 O O   . MET A 1 259 ? 39.500 24.869  33.790 1.00 52.43  ? 259 MET A O   1 
ATOM   1893 C CB  . MET A 1 259 ? 37.959 22.145  32.843 1.00 55.50  ? 259 MET A CB  1 
ATOM   1894 C CG  . MET A 1 259 ? 39.351 21.580  33.103 1.00 55.18  ? 259 MET A CG  1 
ATOM   1895 S SD  . MET A 1 259 ? 39.316 19.983  33.935 1.00 53.11  ? 259 MET A SD  1 
ATOM   1896 C CE  . MET A 1 259 ? 39.527 20.518  35.621 1.00 53.06  ? 259 MET A CE  1 
ATOM   1897 N N   . ASN A 1 260 ? 37.404 24.671  34.583 1.00 52.07  ? 260 ASN A N   1 
ATOM   1898 C CA  . ASN A 1 260 ? 37.624 25.435  35.797 1.00 52.06  ? 260 ASN A CA  1 
ATOM   1899 C C   . ASN A 1 260 ? 37.331 24.478  36.942 1.00 52.72  ? 260 ASN A C   1 
ATOM   1900 O O   . ASN A 1 260 ? 36.332 23.752  36.901 1.00 53.71  ? 260 ASN A O   1 
ATOM   1901 C CB  . ASN A 1 260 ? 36.666 26.622  35.824 1.00 51.37  ? 260 ASN A CB  1 
ATOM   1902 C CG  . ASN A 1 260 ? 36.735 27.402  37.112 1.00 51.96  ? 260 ASN A CG  1 
ATOM   1903 O OD1 . ASN A 1 260 ? 37.659 27.241  37.909 1.00 50.84  ? 260 ASN A OD1 1 
ATOM   1904 N ND2 . ASN A 1 260 ? 35.757 28.268  37.318 1.00 52.15  ? 260 ASN A ND2 1 
ATOM   1905 N N   . THR A 1 261 ? 38.184 24.467  37.963 1.00 51.83  ? 261 THR A N   1 
ATOM   1906 C CA  . THR A 1 261 ? 37.970 23.541  39.062 1.00 52.46  ? 261 THR A CA  1 
ATOM   1907 C C   . THR A 1 261 ? 37.393 24.194  40.308 1.00 52.91  ? 261 THR A C   1 
ATOM   1908 O O   . THR A 1 261 ? 36.992 23.496  41.240 1.00 52.84  ? 261 THR A O   1 
ATOM   1909 C CB  . THR A 1 261 ? 39.279 22.800  39.448 1.00 53.66  ? 261 THR A CB  1 
ATOM   1910 O OG1 . THR A 1 261 ? 39.915 23.494  40.529 1.00 54.30  ? 261 THR A OG1 1 
ATOM   1911 C CG2 . THR A 1 261 ? 40.248 22.728  38.246 1.00 52.22  ? 261 THR A CG2 1 
ATOM   1912 N N   . CYS A 1 262 ? 37.336 25.525  40.325 1.00 53.62  ? 262 CYS A N   1 
ATOM   1913 C CA  . CYS A 1 262 ? 36.791 26.250  41.480 1.00 54.19  ? 262 CYS A CA  1 
ATOM   1914 C C   . CYS A 1 262 ? 35.357 25.827  41.880 1.00 52.26  ? 262 CYS A C   1 
ATOM   1915 O O   . CYS A 1 262 ? 34.973 25.939  43.045 1.00 51.45  ? 262 CYS A O   1 
ATOM   1916 C CB  . CYS A 1 262 ? 36.833 27.771  41.236 1.00 57.05  ? 262 CYS A CB  1 
ATOM   1917 S SG  . CYS A 1 262 ? 38.494 28.541  41.142 1.00 62.84  ? 262 CYS A SG  1 
ATOM   1918 N N   . PRO A 1 263 ? 34.538 25.365  40.915 1.00 50.86  ? 263 PRO A N   1 
ATOM   1919 C CA  . PRO A 1 263 ? 33.178 24.951  41.281 1.00 50.01  ? 263 PRO A CA  1 
ATOM   1920 C C   . PRO A 1 263 ? 33.141 23.852  42.350 1.00 50.54  ? 263 PRO A C   1 
ATOM   1921 O O   . PRO A 1 263 ? 32.192 23.762  43.137 1.00 50.16  ? 263 PRO A O   1 
ATOM   1922 C CB  . PRO A 1 263 ? 32.603 24.491  39.956 1.00 48.41  ? 263 PRO A CB  1 
ATOM   1923 C CG  . PRO A 1 263 ? 33.207 25.476  39.007 1.00 49.19  ? 263 PRO A CG  1 
ATOM   1924 C CD  . PRO A 1 263 ? 34.648 25.536  39.452 1.00 49.45  ? 263 PRO A CD  1 
ATOM   1925 N N   . CYS A 1 264 ? 34.174 23.018  42.370 1.00 50.35  ? 264 CYS A N   1 
ATOM   1926 C CA  . CYS A 1 264 ? 34.261 21.941  43.346 1.00 51.48  ? 264 CYS A CA  1 
ATOM   1927 C C   . CYS A 1 264 ? 34.020 22.474  44.760 1.00 50.29  ? 264 CYS A C   1 
ATOM   1928 O O   . CYS A 1 264 ? 33.419 21.810  45.611 1.00 49.91  ? 264 CYS A O   1 
ATOM   1929 C CB  . CYS A 1 264 ? 35.640 21.285  43.278 1.00 54.72  ? 264 CYS A CB  1 
ATOM   1930 S SG  . CYS A 1 264 ? 36.050 20.470  41.699 1.00 60.81  ? 264 CYS A SG  1 
ATOM   1931 N N   . TYR A 1 265 ? 34.504 23.677  45.017 1.00 48.46  ? 265 TYR A N   1 
ATOM   1932 C CA  . TYR A 1 265 ? 34.311 24.266  46.321 1.00 48.62  ? 265 TYR A CA  1 
ATOM   1933 C C   . TYR A 1 265 ? 32.823 24.465  46.554 1.00 48.44  ? 265 TYR A C   1 
ATOM   1934 O O   . TYR A 1 265 ? 32.297 24.110  47.615 1.00 47.64  ? 265 TYR A O   1 
ATOM   1935 C CB  . TYR A 1 265 ? 35.055 25.601  46.403 1.00 49.75  ? 265 TYR A CB  1 
ATOM   1936 C CG  . TYR A 1 265 ? 36.502 25.445  46.791 1.00 50.90  ? 265 TYR A CG  1 
ATOM   1937 C CD1 . TYR A 1 265 ? 36.857 25.142  48.108 1.00 51.88  ? 265 TYR A CD1 1 
ATOM   1938 C CD2 . TYR A 1 265 ? 37.516 25.550  45.843 1.00 53.10  ? 265 TYR A CD2 1 
ATOM   1939 C CE1 . TYR A 1 265 ? 38.177 24.946  48.474 1.00 52.92  ? 265 TYR A CE1 1 
ATOM   1940 C CE2 . TYR A 1 265 ? 38.851 25.351  46.197 1.00 55.59  ? 265 TYR A CE2 1 
ATOM   1941 C CZ  . TYR A 1 265 ? 39.168 25.047  47.515 1.00 55.51  ? 265 TYR A CZ  1 
ATOM   1942 O OH  . TYR A 1 265 ? 40.475 24.819  47.867 1.00 59.56  ? 265 TYR A OH  1 
ATOM   1943 N N   . TYR A 1 266 ? 32.149 25.017  45.545 1.00 47.64  ? 266 TYR A N   1 
ATOM   1944 C CA  . TYR A 1 266 ? 30.721 25.283  45.628 1.00 47.09  ? 266 TYR A CA  1 
ATOM   1945 C C   . TYR A 1 266 ? 29.882 24.016  45.675 1.00 45.61  ? 266 TYR A C   1 
ATOM   1946 O O   . TYR A 1 266 ? 28.700 24.040  45.980 1.00 45.28  ? 266 TYR A O   1 
ATOM   1947 C CB  . TYR A 1 266 ? 30.300 26.173  44.459 1.00 48.95  ? 266 TYR A CB  1 
ATOM   1948 C CG  . TYR A 1 266 ? 30.702 27.618  44.647 1.00 51.26  ? 266 TYR A CG  1 
ATOM   1949 C CD1 . TYR A 1 266 ? 30.036 28.442  45.563 1.00 51.82  ? 266 TYR A CD1 1 
ATOM   1950 C CD2 . TYR A 1 266 ? 31.780 28.153  43.947 1.00 53.81  ? 266 TYR A CD2 1 
ATOM   1951 C CE1 . TYR A 1 266 ? 30.449 29.775  45.776 1.00 52.23  ? 266 TYR A CE1 1 
ATOM   1952 C CE2 . TYR A 1 266 ? 32.198 29.483  44.150 1.00 54.14  ? 266 TYR A CE2 1 
ATOM   1953 C CZ  . TYR A 1 266 ? 31.531 30.284  45.065 1.00 51.87  ? 266 TYR A CZ  1 
ATOM   1954 O OH  . TYR A 1 266 ? 31.968 31.576  45.255 1.00 49.56  ? 266 TYR A OH  1 
ATOM   1955 N N   . LYS A 1 267 ? 30.506 22.894  45.383 1.00 46.25  ? 267 LYS A N   1 
ATOM   1956 C CA  . LYS A 1 267 ? 29.797 21.636  45.419 1.00 46.18  ? 267 LYS A CA  1 
ATOM   1957 C C   . LYS A 1 267 ? 30.030 20.969  46.767 1.00 46.83  ? 267 LYS A C   1 
ATOM   1958 O O   . LYS A 1 267 ? 29.130 20.334  47.309 1.00 46.71  ? 267 LYS A O   1 
ATOM   1959 C CB  . LYS A 1 267 ? 30.301 20.726  44.289 1.00 45.92  ? 267 LYS A CB  1 
ATOM   1960 C CG  . LYS A 1 267 ? 29.717 19.327  44.309 1.00 44.85  ? 267 LYS A CG  1 
ATOM   1961 C CD  . LYS A 1 267 ? 30.210 18.483  43.150 1.00 44.21  ? 267 LYS A CD  1 
ATOM   1962 C CE  . LYS A 1 267 ? 29.625 17.082  43.219 1.00 44.72  ? 267 LYS A CE  1 
ATOM   1963 N NZ  . LYS A 1 267 ? 28.141 17.060  43.060 1.00 45.25  ? 267 LYS A NZ  1 
ATOM   1964 N N   . TYR A 1 268 ? 31.229 21.158  47.320 1.00 47.69  ? 268 TYR A N   1 
ATOM   1965 C CA  . TYR A 1 268 ? 31.626 20.513  48.570 1.00 48.55  ? 268 TYR A CA  1 
ATOM   1966 C C   . TYR A 1 268 ? 31.822 21.338  49.827 1.00 49.93  ? 268 TYR A C   1 
ATOM   1967 O O   . TYR A 1 268 ? 31.750 20.789  50.932 1.00 49.52  ? 268 TYR A O   1 
ATOM   1968 C CB  . TYR A 1 268 ? 32.926 19.750  48.340 1.00 47.98  ? 268 TYR A CB  1 
ATOM   1969 C CG  . TYR A 1 268 ? 32.797 18.624  47.368 1.00 47.91  ? 268 TYR A CG  1 
ATOM   1970 C CD1 . TYR A 1 268 ? 32.139 17.459  47.734 1.00 48.73  ? 268 TYR A CD1 1 
ATOM   1971 C CD2 . TYR A 1 268 ? 33.315 18.725  46.074 1.00 46.77  ? 268 TYR A CD2 1 
ATOM   1972 C CE1 . TYR A 1 268 ? 31.992 16.406  46.842 1.00 51.43  ? 268 TYR A CE1 1 
ATOM   1973 C CE2 . TYR A 1 268 ? 33.179 17.689  45.171 1.00 49.38  ? 268 TYR A CE2 1 
ATOM   1974 C CZ  . TYR A 1 268 ? 32.513 16.520  45.563 1.00 52.36  ? 268 TYR A CZ  1 
ATOM   1975 O OH  . TYR A 1 268 ? 32.377 15.444  44.711 1.00 53.91  ? 268 TYR A OH  1 
ATOM   1976 N N   . SER A 1 269 ? 32.083 22.634  49.672 1.00 50.96  ? 269 SER A N   1 
ATOM   1977 C CA  . SER A 1 269 ? 32.364 23.494  50.819 1.00 51.14  ? 269 SER A CA  1 
ATOM   1978 C C   . SER A 1 269 ? 31.290 23.707  51.870 1.00 51.74  ? 269 SER A C   1 
ATOM   1979 O O   . SER A 1 269 ? 30.122 23.885  51.567 1.00 52.11  ? 269 SER A O   1 
ATOM   1980 C CB  . SER A 1 269 ? 32.843 24.858  50.342 1.00 51.57  ? 269 SER A CB  1 
ATOM   1981 O OG  . SER A 1 269 ? 33.335 25.603  51.442 1.00 53.26  ? 269 SER A OG  1 
ATOM   1982 N N   . VAL A 1 270 ? 31.712 23.678  53.124 1.00 53.21  ? 270 VAL A N   1 
ATOM   1983 C CA  . VAL A 1 270 ? 30.817 23.917  54.246 1.00 54.28  ? 270 VAL A CA  1 
ATOM   1984 C C   . VAL A 1 270 ? 31.374 25.170  54.923 1.00 55.57  ? 270 VAL A C   1 
ATOM   1985 O O   . VAL A 1 270 ? 31.098 25.454  56.090 1.00 57.32  ? 270 VAL A O   1 
ATOM   1986 C CB  . VAL A 1 270 ? 30.814 22.746  55.258 1.00 54.30  ? 270 VAL A CB  1 
ATOM   1987 C CG1 . VAL A 1 270 ? 30.431 21.461  54.561 1.00 52.41  ? 270 VAL A CG1 1 
ATOM   1988 C CG2 . VAL A 1 270 ? 32.173 22.627  55.928 1.00 53.72  ? 270 VAL A CG2 1 
ATOM   1989 N N   . SER A 1 271 ? 32.187 25.898  54.169 1.00 55.23  ? 271 SER A N   1 
ATOM   1990 C CA  . SER A 1 271 ? 32.785 27.135  54.638 1.00 56.25  ? 271 SER A CA  1 
ATOM   1991 C C   . SER A 1 271 ? 32.151 28.227  53.784 1.00 55.85  ? 271 SER A C   1 
ATOM   1992 O O   . SER A 1 271 ? 31.905 28.029  52.593 1.00 55.66  ? 271 SER A O   1 
ATOM   1993 C CB  . SER A 1 271 ? 34.305 27.128  54.415 1.00 58.13  ? 271 SER A CB  1 
ATOM   1994 O OG  . SER A 1 271 ? 34.953 26.096  55.149 1.00 60.37  ? 271 SER A OG  1 
ATOM   1995 N N   . PRO A 1 272 ? 31.859 29.390  54.382 1.00 55.14  ? 272 PRO A N   1 
ATOM   1996 C CA  . PRO A 1 272 ? 31.249 30.463  53.596 1.00 53.15  ? 272 PRO A CA  1 
ATOM   1997 C C   . PRO A 1 272 ? 32.075 30.747  52.355 1.00 52.02  ? 272 PRO A C   1 
ATOM   1998 O O   . PRO A 1 272 ? 33.292 30.853  52.433 1.00 53.38  ? 272 PRO A O   1 
ATOM   1999 C CB  . PRO A 1 272 ? 31.240 31.626  54.573 1.00 52.55  ? 272 PRO A CB  1 
ATOM   2000 C CG  . PRO A 1 272 ? 31.006 30.936  55.895 1.00 52.31  ? 272 PRO A CG  1 
ATOM   2001 C CD  . PRO A 1 272 ? 31.957 29.769  55.805 1.00 54.69  ? 272 PRO A CD  1 
ATOM   2002 N N   . LEU A 1 273 ? 31.419 30.844  51.207 1.00 51.06  ? 273 LEU A N   1 
ATOM   2003 C CA  . LEU A 1 273 ? 32.122 31.128  49.965 1.00 49.97  ? 273 LEU A CA  1 
ATOM   2004 C C   . LEU A 1 273 ? 31.619 32.425  49.366 1.00 48.76  ? 273 LEU A C   1 
ATOM   2005 O O   . LEU A 1 273 ? 30.547 32.904  49.718 1.00 47.62  ? 273 LEU A O   1 
ATOM   2006 C CB  . LEU A 1 273 ? 31.920 29.999  48.958 1.00 50.78  ? 273 LEU A CB  1 
ATOM   2007 C CG  . LEU A 1 273 ? 32.502 28.620  49.279 1.00 51.52  ? 273 LEU A CG  1 
ATOM   2008 C CD1 . LEU A 1 273 ? 32.289 27.723  48.068 1.00 48.65  ? 273 LEU A CD1 1 
ATOM   2009 C CD2 . LEU A 1 273 ? 33.997 28.727  49.628 1.00 49.49  ? 273 LEU A CD2 1 
ATOM   2010 N N   . PRO A 1 274 ? 32.392 33.011  48.444 1.00 48.74  ? 274 PRO A N   1 
ATOM   2011 C CA  . PRO A 1 274 ? 32.029 34.265  47.786 1.00 49.23  ? 274 PRO A CA  1 
ATOM   2012 C C   . PRO A 1 274 ? 30.729 34.140  47.034 1.00 50.38  ? 274 PRO A C   1 
ATOM   2013 O O   . PRO A 1 274 ? 30.540 33.211  46.253 1.00 50.58  ? 274 PRO A O   1 
ATOM   2014 C CB  . PRO A 1 274 ? 33.196 34.513  46.835 1.00 47.29  ? 274 PRO A CB  1 
ATOM   2015 C CG  . PRO A 1 274 ? 34.338 33.886  47.537 1.00 48.76  ? 274 PRO A CG  1 
ATOM   2016 C CD  . PRO A 1 274 ? 33.724 32.575  48.003 1.00 49.66  ? 274 PRO A CD  1 
ATOM   2017 N N   . ALA A 1 275 ? 29.823 35.076  47.274 1.00 52.51  ? 275 ALA A N   1 
ATOM   2018 C CA  . ALA A 1 275 ? 28.547 35.066  46.571 1.00 54.12  ? 275 ALA A CA  1 
ATOM   2019 C C   . ALA A 1 275 ? 28.839 35.318  45.086 1.00 55.46  ? 275 ALA A C   1 
ATOM   2020 O O   . ALA A 1 275 ? 29.553 36.263  44.735 1.00 57.95  ? 275 ALA A O   1 
ATOM   2021 C CB  . ALA A 1 275 ? 27.640 36.149  47.125 1.00 50.86  ? 275 ALA A CB  1 
ATOM   2022 N N   . MET A 1 276 ? 28.312 34.469  44.214 1.00 55.28  ? 276 MET A N   1 
ATOM   2023 C CA  . MET A 1 276 ? 28.545 34.643  42.789 1.00 56.95  ? 276 MET A CA  1 
ATOM   2024 C C   . MET A 1 276 ? 27.234 34.513  42.024 1.00 58.03  ? 276 MET A C   1 
ATOM   2025 O O   . MET A 1 276 ? 26.407 33.648  42.331 1.00 57.98  ? 276 MET A O   1 
ATOM   2026 C CB  . MET A 1 276 ? 29.546 33.594  42.281 1.00 57.34  ? 276 MET A CB  1 
ATOM   2027 C CG  . MET A 1 276 ? 30.933 33.635  42.929 1.00 56.80  ? 276 MET A CG  1 
ATOM   2028 S SD  . MET A 1 276 ? 31.953 35.068  42.476 1.00 56.93  ? 276 MET A SD  1 
ATOM   2029 C CE  . MET A 1 276 ? 32.481 34.593  40.850 1.00 55.04  ? 276 MET A CE  1 
ATOM   2030 N N   . ASP A 1 277 ? 27.035 35.374  41.034 1.00 58.93  ? 277 ASP A N   1 
ATOM   2031 C CA  . ASP A 1 277 ? 25.821 35.314  40.244 1.00 59.49  ? 277 ASP A CA  1 
ATOM   2032 C C   . ASP A 1 277 ? 25.792 33.967  39.534 1.00 59.83  ? 277 ASP A C   1 
ATOM   2033 O O   . ASP A 1 277 ? 24.764 33.289  39.495 1.00 60.02  ? 277 ASP A O   1 
ATOM   2034 C CB  . ASP A 1 277 ? 25.806 36.440  39.222 1.00 63.01  ? 277 ASP A CB  1 
ATOM   2035 C CG  . ASP A 1 277 ? 24.616 36.352  38.277 1.00 68.34  ? 277 ASP A CG  1 
ATOM   2036 O OD1 . ASP A 1 277 ? 23.463 36.290  38.780 1.00 68.58  ? 277 ASP A OD1 1 
ATOM   2037 O OD2 . ASP A 1 277 ? 24.833 36.345  37.035 1.00 69.97  ? 277 ASP A OD2 1 
ATOM   2038 N N   . HIS A 1 278 ? 26.938 33.589  38.976 1.00 59.56  ? 278 HIS A N   1 
ATOM   2039 C CA  . HIS A 1 278 ? 27.088 32.325  38.269 1.00 59.04  ? 278 HIS A CA  1 
ATOM   2040 C C   . HIS A 1 278 ? 28.501 31.776  38.440 1.00 58.74  ? 278 HIS A C   1 
ATOM   2041 O O   . HIS A 1 278 ? 29.309 32.327  39.177 1.00 60.17  ? 278 HIS A O   1 
ATOM   2042 C CB  . HIS A 1 278 ? 26.811 32.513  36.779 1.00 58.54  ? 278 HIS A CB  1 
ATOM   2043 C CG  . HIS A 1 278 ? 27.687 33.533  36.125 1.00 58.78  ? 278 HIS A CG  1 
ATOM   2044 N ND1 . HIS A 1 278 ? 27.407 34.882  36.155 1.00 59.21  ? 278 HIS A ND1 1 
ATOM   2045 C CD2 . HIS A 1 278 ? 28.843 33.404  35.432 1.00 58.74  ? 278 HIS A CD2 1 
ATOM   2046 C CE1 . HIS A 1 278 ? 28.352 35.539  35.505 1.00 58.83  ? 278 HIS A CE1 1 
ATOM   2047 N NE2 . HIS A 1 278 ? 29.235 34.666  35.056 1.00 58.36  ? 278 HIS A NE2 1 
ATOM   2048 N N   . LEU A 1 279 ? 28.784 30.679  37.754 1.00 58.18  ? 279 LEU A N   1 
ATOM   2049 C CA  . LEU A 1 279 ? 30.100 30.052  37.790 1.00 57.40  ? 279 LEU A CA  1 
ATOM   2050 C C   . LEU A 1 279 ? 30.348 29.468  36.405 1.00 55.92  ? 279 LEU A C   1 
ATOM   2051 O O   . LEU A 1 279 ? 29.468 28.834  35.824 1.00 55.65  ? 279 LEU A O   1 
ATOM   2052 C CB  . LEU A 1 279 ? 30.154 28.923  38.831 1.00 59.35  ? 279 LEU A CB  1 
ATOM   2053 C CG  . LEU A 1 279 ? 29.899 29.203  40.322 1.00 61.35  ? 279 LEU A CG  1 
ATOM   2054 C CD1 . LEU A 1 279 ? 30.020 27.896  41.107 1.00 60.60  ? 279 LEU A CD1 1 
ATOM   2055 C CD2 . LEU A 1 279 ? 30.889 30.234  40.853 1.00 62.24  ? 279 LEU A CD2 1 
ATOM   2056 N N   . ILE A 1 280 ? 31.534 29.706  35.866 1.00 54.20  ? 280 ILE A N   1 
ATOM   2057 C CA  . ILE A 1 280 ? 31.880 29.179  34.559 1.00 52.68  ? 280 ILE A CA  1 
ATOM   2058 C C   . ILE A 1 280 ? 32.512 27.817  34.758 1.00 51.66  ? 280 ILE A C   1 
ATOM   2059 O O   . ILE A 1 280 ? 33.532 27.689  35.436 1.00 52.48  ? 280 ILE A O   1 
ATOM   2060 C CB  . ILE A 1 280 ? 32.877 30.084  33.844 1.00 52.38  ? 280 ILE A CB  1 
ATOM   2061 C CG1 . ILE A 1 280 ? 32.218 31.433  33.549 1.00 53.09  ? 280 ILE A CG1 1 
ATOM   2062 C CG2 . ILE A 1 280 ? 33.368 29.408  32.569 1.00 50.96  ? 280 ILE A CG2 1 
ATOM   2063 C CD1 . ILE A 1 280 ? 33.198 32.506  33.094 1.00 55.60  ? 280 ILE A CD1 1 
ATOM   2064 N N   . LEU A 1 281 ? 31.910 26.796  34.170 1.00 49.73  ? 281 LEU A N   1 
ATOM   2065 C CA  . LEU A 1 281 ? 32.445 25.456  34.321 1.00 49.67  ? 281 LEU A CA  1 
ATOM   2066 C C   . LEU A 1 281 ? 33.513 25.164  33.287 1.00 49.26  ? 281 LEU A C   1 
ATOM   2067 O O   . LEU A 1 281 ? 34.464 24.424  33.553 1.00 48.90  ? 281 LEU A O   1 
ATOM   2068 C CB  . LEU A 1 281 ? 31.330 24.423  34.204 1.00 48.88  ? 281 LEU A CB  1 
ATOM   2069 C CG  . LEU A 1 281 ? 30.281 24.489  35.310 1.00 49.69  ? 281 LEU A CG  1 
ATOM   2070 C CD1 . LEU A 1 281 ? 29.168 23.512  34.984 1.00 49.70  ? 281 LEU A CD1 1 
ATOM   2071 C CD2 . LEU A 1 281 ? 30.913 24.171  36.667 1.00 47.91  ? 281 LEU A CD2 1 
ATOM   2072 N N   . ALA A 1 282 ? 33.353 25.755  32.110 1.00 48.94  ? 282 ALA A N   1 
ATOM   2073 C CA  . ALA A 1 282 ? 34.299 25.537  31.027 1.00 49.70  ? 282 ALA A CA  1 
ATOM   2074 C C   . ALA A 1 282 ? 34.095 26.570  29.934 1.00 50.26  ? 282 ALA A C   1 
ATOM   2075 O O   . ALA A 1 282 ? 33.065 27.242  29.886 1.00 51.85  ? 282 ALA A O   1 
ATOM   2076 C CB  . ALA A 1 282 ? 34.123 24.142  30.465 1.00 47.09  ? 282 ALA A CB  1 
ATOM   2077 N N   . ASP A 1 283 ? 35.087 26.712  29.070 1.00 50.96  ? 283 ASP A N   1 
ATOM   2078 C CA  . ASP A 1 283 ? 34.985 27.666  27.983 1.00 55.81  ? 283 ASP A CA  1 
ATOM   2079 C C   . ASP A 1 283 ? 35.636 27.068  26.750 1.00 56.02  ? 283 ASP A C   1 
ATOM   2080 O O   . ASP A 1 283 ? 36.502 26.189  26.853 1.00 55.27  ? 283 ASP A O   1 
ATOM   2081 C CB  . ASP A 1 283 ? 35.659 29.003  28.339 1.00 60.37  ? 283 ASP A CB  1 
ATOM   2082 C CG  . ASP A 1 283 ? 37.194 28.914  28.381 1.00 65.88  ? 283 ASP A CG  1 
ATOM   2083 O OD1 . ASP A 1 283 ? 37.823 28.544  27.357 1.00 68.10  ? 283 ASP A OD1 1 
ATOM   2084 O OD2 . ASP A 1 283 ? 37.778 29.227  29.446 1.00 70.00  ? 283 ASP A OD2 1 
ATOM   2085 N N   . LEU A 1 284 ? 35.212 27.551  25.589 1.00 54.92  ? 284 LEU A N   1 
ATOM   2086 C CA  . LEU A 1 284 ? 35.727 27.065  24.331 1.00 54.46  ? 284 LEU A CA  1 
ATOM   2087 C C   . LEU A 1 284 ? 36.069 28.228  23.429 1.00 55.20  ? 284 LEU A C   1 
ATOM   2088 O O   . LEU A 1 284 ? 35.250 29.125  23.206 1.00 55.11  ? 284 LEU A O   1 
ATOM   2089 C CB  . LEU A 1 284 ? 34.686 26.170  23.657 1.00 54.03  ? 284 LEU A CB  1 
ATOM   2090 C CG  . LEU A 1 284 ? 34.924 25.868  22.173 1.00 52.32  ? 284 LEU A CG  1 
ATOM   2091 C CD1 . LEU A 1 284 ? 36.239 25.133  21.988 1.00 54.06  ? 284 LEU A CD1 1 
ATOM   2092 C CD2 . LEU A 1 284 ? 33.786 25.052  21.641 1.00 51.41  ? 284 LEU A CD2 1 
ATOM   2093 N N   . ALA A 1 285 ? 37.286 28.210  22.905 1.00 55.64  ? 285 ALA A N   1 
ATOM   2094 C CA  . ALA A 1 285 ? 37.729 29.274  22.019 1.00 57.95  ? 285 ALA A CA  1 
ATOM   2095 C C   . ALA A 1 285 ? 37.972 28.748  20.607 1.00 58.66  ? 285 ALA A C   1 
ATOM   2096 O O   . ALA A 1 285 ? 38.438 27.613  20.418 1.00 58.57  ? 285 ALA A O   1 
ATOM   2097 C CB  . ALA A 1 285 ? 38.996 29.923  22.573 1.00 56.36  ? 285 ALA A CB  1 
ATOM   2098 N N   . GLY A 1 286 ? 37.637 29.576  19.621 1.00 58.39  ? 286 GLY A N   1 
ATOM   2099 C CA  . GLY A 1 286 ? 37.832 29.191  18.242 1.00 59.33  ? 286 GLY A CA  1 
ATOM   2100 C C   . GLY A 1 286 ? 36.533 28.901  17.526 1.00 61.03  ? 286 GLY A C   1 
ATOM   2101 O O   . GLY A 1 286 ? 36.499 28.060  16.633 1.00 61.02  ? 286 GLY A O   1 
ATOM   2102 N N   . LEU A 1 287 ? 35.464 29.591  17.912 1.00 62.42  ? 287 LEU A N   1 
ATOM   2103 C CA  . LEU A 1 287 ? 34.160 29.399  17.276 1.00 64.57  ? 287 LEU A CA  1 
ATOM   2104 C C   . LEU A 1 287 ? 34.112 30.054  15.905 1.00 66.52  ? 287 LEU A C   1 
ATOM   2105 O O   . LEU A 1 287 ? 33.348 29.636  15.026 1.00 66.10  ? 287 LEU A O   1 
ATOM   2106 C CB  . LEU A 1 287 ? 33.052 30.009  18.127 1.00 64.09  ? 287 LEU A CB  1 
ATOM   2107 C CG  . LEU A 1 287 ? 32.753 29.361  19.467 1.00 63.21  ? 287 LEU A CG  1 
ATOM   2108 C CD1 . LEU A 1 287 ? 31.564 30.045  20.076 1.00 62.91  ? 287 LEU A CD1 1 
ATOM   2109 C CD2 . LEU A 1 287 ? 32.465 27.895  19.274 1.00 64.03  ? 287 LEU A CD2 1 
ATOM   2110 N N   . ASP A 1 288 ? 34.921 31.096  15.741 1.00 68.19  ? 288 ASP A N   1 
ATOM   2111 C CA  . ASP A 1 288 ? 34.970 31.831  14.492 1.00 69.62  ? 288 ASP A CA  1 
ATOM   2112 C C   . ASP A 1 288 ? 35.405 30.962  13.332 1.00 69.72  ? 288 ASP A C   1 
ATOM   2113 O O   . ASP A 1 288 ? 35.244 31.348  12.173 1.00 71.31  ? 288 ASP A O   1 
ATOM   2114 C CB  . ASP A 1 288 ? 35.908 33.031  14.614 1.00 70.83  ? 288 ASP A CB  1 
ATOM   2115 C CG  . ASP A 1 288 ? 35.374 34.092  15.559 1.00 73.88  ? 288 ASP A CG  1 
ATOM   2116 O OD1 . ASP A 1 288 ? 34.184 33.992  15.959 1.00 74.89  ? 288 ASP A OD1 1 
ATOM   2117 O OD2 . ASP A 1 288 ? 36.140 35.030  15.892 1.00 73.94  ? 288 ASP A OD2 1 
ATOM   2118 N N   . SER A 1 289 ? 35.950 29.788  13.626 1.00 67.89  ? 289 SER A N   1 
ATOM   2119 C CA  . SER A 1 289 ? 36.382 28.920  12.548 1.00 67.30  ? 289 SER A CA  1 
ATOM   2120 C C   . SER A 1 289 ? 35.676 27.575  12.552 1.00 67.20  ? 289 SER A C   1 
ATOM   2121 O O   . SER A 1 289 ? 35.819 26.806  11.607 1.00 67.52  ? 289 SER A O   1 
ATOM   2122 C CB  . SER A 1 289 ? 37.891 28.707  12.613 1.00 67.33  ? 289 SER A CB  1 
ATOM   2123 O OG  . SER A 1 289 ? 38.256 27.947  13.746 1.00 68.40  ? 289 SER A OG  1 
ATOM   2124 N N   . LEU A 1 290 ? 34.907 27.296  13.605 1.00 66.90  ? 290 LEU A N   1 
ATOM   2125 C CA  . LEU A 1 290 ? 34.189 26.021  13.724 1.00 66.13  ? 290 LEU A CA  1 
ATOM   2126 C C   . LEU A 1 290 ? 32.917 26.040  12.889 1.00 66.09  ? 290 LEU A C   1 
ATOM   2127 O O   . LEU A 1 290 ? 32.171 27.019  12.913 1.00 66.27  ? 290 LEU A O   1 
ATOM   2128 C CB  . LEU A 1 290 ? 33.847 25.740  15.185 1.00 65.51  ? 290 LEU A CB  1 
ATOM   2129 C CG  . LEU A 1 290 ? 33.582 24.277  15.525 1.00 66.35  ? 290 LEU A CG  1 
ATOM   2130 C CD1 . LEU A 1 290 ? 34.762 23.415  15.089 1.00 67.24  ? 290 LEU A CD1 1 
ATOM   2131 C CD2 . LEU A 1 290 ? 33.363 24.145  17.020 1.00 67.20  ? 290 LEU A CD2 1 
ATOM   2132 N N   . THR A 1 291 ? 32.660 24.947  12.171 1.00 65.79  ? 291 THR A N   1 
ATOM   2133 C CA  . THR A 1 291 ? 31.497 24.872  11.283 1.00 64.84  ? 291 THR A CA  1 
ATOM   2134 C C   . THR A 1 291 ? 30.393 23.872  11.621 1.00 64.25  ? 291 THR A C   1 
ATOM   2135 O O   . THR A 1 291 ? 29.474 23.676  10.834 1.00 63.06  ? 291 THR A O   1 
ATOM   2136 C CB  . THR A 1 291 ? 31.950 24.593  9.842  1.00 64.78  ? 291 THR A CB  1 
ATOM   2137 O OG1 . THR A 1 291 ? 32.464 23.257  9.757  1.00 63.07  ? 291 THR A OG1 1 
ATOM   2138 C CG2 . THR A 1 291 ? 33.034 25.590  9.426  1.00 62.01  ? 291 THR A CG2 1 
ATOM   2139 N N   . SER A 1 292 ? 30.488 23.232  12.778 1.00 65.01  ? 292 SER A N   1 
ATOM   2140 C CA  . SER A 1 292 ? 29.469 22.274  13.209 1.00 64.71  ? 292 SER A CA  1 
ATOM   2141 C C   . SER A 1 292 ? 28.963 22.752  14.565 1.00 64.16  ? 292 SER A C   1 
ATOM   2142 O O   . SER A 1 292 ? 29.650 23.506  15.269 1.00 65.51  ? 292 SER A O   1 
ATOM   2143 C CB  . SER A 1 292 ? 30.070 20.876  13.351 1.00 66.81  ? 292 SER A CB  1 
ATOM   2144 O OG  . SER A 1 292 ? 31.169 20.878  14.257 1.00 69.69  ? 292 SER A OG  1 
ATOM   2145 N N   . PRO A 1 293 ? 27.763 22.326  14.962 1.00 61.66  ? 293 PRO A N   1 
ATOM   2146 C CA  . PRO A 1 293 ? 27.297 22.797  16.266 1.00 60.34  ? 293 PRO A CA  1 
ATOM   2147 C C   . PRO A 1 293 ? 28.177 22.311  17.424 1.00 58.56  ? 293 PRO A C   1 
ATOM   2148 O O   . PRO A 1 293 ? 29.118 21.533  17.239 1.00 58.03  ? 293 PRO A O   1 
ATOM   2149 C CB  . PRO A 1 293 ? 25.876 22.256  16.331 1.00 59.56  ? 293 PRO A CB  1 
ATOM   2150 C CG  . PRO A 1 293 ? 25.974 20.982  15.547 1.00 60.56  ? 293 PRO A CG  1 
ATOM   2151 C CD  . PRO A 1 293 ? 26.800 21.396  14.358 1.00 61.38  ? 293 PRO A CD  1 
ATOM   2152 N N   . VAL A 1 294 ? 27.878 22.805  18.615 1.00 56.70  ? 294 VAL A N   1 
ATOM   2153 C CA  . VAL A 1 294 ? 28.601 22.418  19.811 1.00 55.42  ? 294 VAL A CA  1 
ATOM   2154 C C   . VAL A 1 294 ? 27.558 21.955  20.809 1.00 55.53  ? 294 VAL A C   1 
ATOM   2155 O O   . VAL A 1 294 ? 26.594 22.678  21.077 1.00 57.11  ? 294 VAL A O   1 
ATOM   2156 C CB  . VAL A 1 294 ? 29.357 23.603  20.440 1.00 53.96  ? 294 VAL A CB  1 
ATOM   2157 C CG1 . VAL A 1 294 ? 30.072 23.151  21.693 1.00 54.20  ? 294 VAL A CG1 1 
ATOM   2158 C CG2 . VAL A 1 294 ? 30.353 24.150  19.471 1.00 54.32  ? 294 VAL A CG2 1 
ATOM   2159 N N   . TYR A 1 295 ? 27.724 20.754  21.347 1.00 53.37  ? 295 TYR A N   1 
ATOM   2160 C CA  . TYR A 1 295 ? 26.770 20.284  22.325 1.00 52.42  ? 295 TYR A CA  1 
ATOM   2161 C C   . TYR A 1 295 ? 27.431 20.190  23.679 1.00 52.56  ? 295 TYR A C   1 
ATOM   2162 O O   . TYR A 1 295 ? 28.646 19.996  23.795 1.00 51.39  ? 295 TYR A O   1 
ATOM   2163 C CB  . TYR A 1 295 ? 26.207 18.917  21.958 1.00 55.43  ? 295 TYR A CB  1 
ATOM   2164 C CG  . TYR A 1 295 ? 25.337 18.879  20.722 1.00 56.62  ? 295 TYR A CG  1 
ATOM   2165 C CD1 . TYR A 1 295 ? 25.904 18.927  19.447 1.00 56.83  ? 295 TYR A CD1 1 
ATOM   2166 C CD2 . TYR A 1 295 ? 23.945 18.748  20.827 1.00 55.85  ? 295 TYR A CD2 1 
ATOM   2167 C CE1 . TYR A 1 295 ? 25.106 18.839  18.299 1.00 56.97  ? 295 TYR A CE1 1 
ATOM   2168 C CE2 . TYR A 1 295 ? 23.143 18.659  19.695 1.00 55.54  ? 295 TYR A CE2 1 
ATOM   2169 C CZ  . TYR A 1 295 ? 23.728 18.704  18.431 1.00 56.53  ? 295 TYR A CZ  1 
ATOM   2170 O OH  . TYR A 1 295 ? 22.942 18.612  17.303 1.00 54.64  ? 295 TYR A OH  1 
ATOM   2171 N N   . VAL A 1 296 ? 26.610 20.321  24.709 1.00 51.67  ? 296 VAL A N   1 
ATOM   2172 C CA  . VAL A 1 296 ? 27.080 20.268  26.074 1.00 49.99  ? 296 VAL A CA  1 
ATOM   2173 C C   . VAL A 1 296 ? 26.001 19.605  26.903 1.00 50.55  ? 296 VAL A C   1 
ATOM   2174 O O   . VAL A 1 296 ? 24.948 20.192  27.151 1.00 50.52  ? 296 VAL A O   1 
ATOM   2175 C CB  . VAL A 1 296 ? 27.325 21.672  26.611 1.00 48.68  ? 296 VAL A CB  1 
ATOM   2176 C CG1 . VAL A 1 296 ? 27.813 21.602  28.047 1.00 48.30  ? 296 VAL A CG1 1 
ATOM   2177 C CG2 . VAL A 1 296 ? 28.317 22.383  25.724 1.00 46.05  ? 296 VAL A CG2 1 
ATOM   2178 N N   . MET A 1 297 ? 26.269 18.374  27.321 1.00 50.14  ? 297 MET A N   1 
ATOM   2179 C CA  . MET A 1 297 ? 25.327 17.618  28.116 1.00 48.92  ? 297 MET A CA  1 
ATOM   2180 C C   . MET A 1 297 ? 25.697 17.711  29.592 1.00 49.57  ? 297 MET A C   1 
ATOM   2181 O O   . MET A 1 297 ? 26.878 17.746  29.956 1.00 48.21  ? 297 MET A O   1 
ATOM   2182 C CB  . MET A 1 297 ? 25.333 16.175  27.644 1.00 48.76  ? 297 MET A CB  1 
ATOM   2183 C CG  . MET A 1 297 ? 24.365 15.264  28.349 1.00 51.41  ? 297 MET A CG  1 
ATOM   2184 S SD  . MET A 1 297 ? 24.232 13.718  27.423 1.00 53.12  ? 297 MET A SD  1 
ATOM   2185 C CE  . MET A 1 297 ? 25.588 12.809  28.080 1.00 49.70  ? 297 MET A CE  1 
ATOM   2186 N N   . ALA A 1 298 ? 24.669 17.781  30.432 1.00 50.21  ? 298 ALA A N   1 
ATOM   2187 C CA  . ALA A 1 298 ? 24.836 17.875  31.878 1.00 50.28  ? 298 ALA A CA  1 
ATOM   2188 C C   . ALA A 1 298 ? 24.153 16.701  32.564 1.00 50.99  ? 298 ALA A C   1 
ATOM   2189 O O   . ALA A 1 298 ? 23.068 16.278  32.161 1.00 52.35  ? 298 ALA A O   1 
ATOM   2190 C CB  . ALA A 1 298 ? 24.240 19.170  32.376 1.00 49.73  ? 298 ALA A CB  1 
ATOM   2191 N N   . ALA A 1 299 ? 24.797 16.161  33.587 1.00 52.12  ? 299 ALA A N   1 
ATOM   2192 C CA  . ALA A 1 299 ? 24.226 15.046  34.340 1.00 54.57  ? 299 ALA A CA  1 
ATOM   2193 C C   . ALA A 1 299 ? 24.028 15.539  35.780 1.00 55.29  ? 299 ALA A C   1 
ATOM   2194 O O   . ALA A 1 299 ? 24.989 15.906  36.463 1.00 54.50  ? 299 ALA A O   1 
ATOM   2195 C CB  . ALA A 1 299 ? 25.165 13.835  34.302 1.00 54.35  ? 299 ALA A CB  1 
ATOM   2196 N N   . TYR A 1 300 ? 22.784 15.550  36.242 1.00 55.54  ? 300 TYR A N   1 
ATOM   2197 C CA  . TYR A 1 300 ? 22.502 16.048  37.582 1.00 57.59  ? 300 TYR A CA  1 
ATOM   2198 C C   . TYR A 1 300 ? 21.367 15.316  38.294 1.00 58.59  ? 300 TYR A C   1 
ATOM   2199 O O   . TYR A 1 300 ? 20.642 14.524  37.695 1.00 58.51  ? 300 TYR A O   1 
ATOM   2200 C CB  . TYR A 1 300 ? 22.143 17.528  37.494 1.00 56.74  ? 300 TYR A CB  1 
ATOM   2201 C CG  . TYR A 1 300 ? 20.979 17.772  36.560 1.00 57.89  ? 300 TYR A CG  1 
ATOM   2202 C CD1 . TYR A 1 300 ? 21.120 17.597  35.180 1.00 58.78  ? 300 TYR A CD1 1 
ATOM   2203 C CD2 . TYR A 1 300 ? 19.719 18.113  37.057 1.00 58.30  ? 300 TYR A CD2 1 
ATOM   2204 C CE1 . TYR A 1 300 ? 20.039 17.749  34.317 1.00 59.76  ? 300 TYR A CE1 1 
ATOM   2205 C CE2 . TYR A 1 300 ? 18.630 18.269  36.206 1.00 59.62  ? 300 TYR A CE2 1 
ATOM   2206 C CZ  . TYR A 1 300 ? 18.796 18.083  34.839 1.00 61.12  ? 300 TYR A CZ  1 
ATOM   2207 O OH  . TYR A 1 300 ? 17.720 18.223  33.996 1.00 62.65  ? 300 TYR A OH  1 
ATOM   2208 N N   . PHE A 1 301 ? 21.223 15.600  39.584 1.00 60.10  ? 301 PHE A N   1 
ATOM   2209 C CA  . PHE A 1 301 ? 20.162 15.015  40.385 1.00 61.91  ? 301 PHE A CA  1 
ATOM   2210 C C   . PHE A 1 301 ? 19.098 16.063  40.559 1.00 63.95  ? 301 PHE A C   1 
ATOM   2211 O O   . PHE A 1 301 ? 19.395 17.247  40.656 1.00 62.56  ? 301 PHE A O   1 
ATOM   2212 C CB  . PHE A 1 301 ? 20.665 14.610  41.756 1.00 60.30  ? 301 PHE A CB  1 
ATOM   2213 C CG  . PHE A 1 301 ? 21.474 13.369  41.750 1.00 59.15  ? 301 PHE A CG  1 
ATOM   2214 C CD1 . PHE A 1 301 ? 20.879 12.141  41.496 1.00 59.89  ? 301 PHE A CD1 1 
ATOM   2215 C CD2 . PHE A 1 301 ? 22.835 13.422  41.993 1.00 58.12  ? 301 PHE A CD2 1 
ATOM   2216 C CE1 . PHE A 1 301 ? 21.634 10.973  41.487 1.00 60.70  ? 301 PHE A CE1 1 
ATOM   2217 C CE2 . PHE A 1 301 ? 23.600 12.270  41.987 1.00 59.74  ? 301 PHE A CE2 1 
ATOM   2218 C CZ  . PHE A 1 301 ? 23.001 11.037  41.733 1.00 60.95  ? 301 PHE A CZ  1 
ATOM   2219 N N   . ASP A 1 302 ? 17.855 15.613  40.601 1.00 68.55  ? 302 ASP A N   1 
ATOM   2220 C CA  . ASP A 1 302 ? 16.728 16.507  40.764 1.00 72.88  ? 302 ASP A CA  1 
ATOM   2221 C C   . ASP A 1 302 ? 16.823 17.251  42.096 1.00 74.78  ? 302 ASP A C   1 
ATOM   2222 O O   . ASP A 1 302 ? 17.179 16.674  43.127 1.00 74.27  ? 302 ASP A O   1 
ATOM   2223 C CB  . ASP A 1 302 ? 15.433 15.707  40.682 1.00 74.64  ? 302 ASP A CB  1 
ATOM   2224 C CG  . ASP A 1 302 ? 14.217 16.587  40.651 1.00 77.77  ? 302 ASP A CG  1 
ATOM   2225 O OD1 . ASP A 1 302 ? 14.245 17.615  39.931 1.00 78.52  ? 302 ASP A OD1 1 
ATOM   2226 O OD2 . ASP A 1 302 ? 13.232 16.243  41.339 1.00 80.67  ? 302 ASP A OD2 1 
ATOM   2227 N N   . SER A 1 303 ? 16.504 18.539  42.062 1.00 76.87  ? 303 SER A N   1 
ATOM   2228 C CA  . SER A 1 303 ? 16.568 19.374  43.251 1.00 79.58  ? 303 SER A CA  1 
ATOM   2229 C C   . SER A 1 303 ? 15.573 19.008  44.358 1.00 80.85  ? 303 SER A C   1 
ATOM   2230 O O   . SER A 1 303 ? 15.953 18.972  45.533 1.00 81.55  ? 303 SER A O   1 
ATOM   2231 C CB  . SER A 1 303 ? 16.404 20.842  42.847 1.00 79.55  ? 303 SER A CB  1 
ATOM   2232 O OG  . SER A 1 303 ? 15.476 20.963  41.784 1.00 80.98  ? 303 SER A OG  1 
ATOM   2233 N N   . THR A 1 304 ? 14.316 18.730  44.001 1.00 81.25  ? 304 THR A N   1 
ATOM   2234 C CA  . THR A 1 304 ? 13.311 18.382  45.012 1.00 81.48  ? 304 THR A CA  1 
ATOM   2235 C C   . THR A 1 304 ? 13.929 17.384  45.973 1.00 81.51  ? 304 THR A C   1 
ATOM   2236 O O   . THR A 1 304 ? 14.606 16.446  45.549 1.00 81.65  ? 304 THR A O   1 
ATOM   2237 C CB  . THR A 1 304 ? 12.048 17.724  44.409 1.00 81.98  ? 304 THR A CB  1 
ATOM   2238 O OG1 . THR A 1 304 ? 12.203 16.298  44.404 1.00 81.60  ? 304 THR A OG1 1 
ATOM   2239 C CG2 . THR A 1 304 ? 11.812 18.216  42.982 1.00 82.90  ? 304 THR A CG2 1 
ATOM   2240 N N   . HIS A 1 305 ? 13.706 17.592  47.267 1.00 81.82  ? 305 HIS A N   1 
ATOM   2241 C CA  . HIS A 1 305 ? 14.261 16.698  48.277 1.00 80.81  ? 305 HIS A CA  1 
ATOM   2242 C C   . HIS A 1 305 ? 13.381 15.453  48.412 1.00 78.33  ? 305 HIS A C   1 
ATOM   2243 O O   . HIS A 1 305 ? 12.202 15.459  48.013 1.00 77.37  ? 305 HIS A O   1 
ATOM   2244 C CB  . HIS A 1 305 ? 14.394 17.427  49.631 1.00 83.46  ? 305 HIS A CB  1 
ATOM   2245 C CG  . HIS A 1 305 ? 13.148 17.412  50.464 1.00 86.27  ? 305 HIS A CG  1 
ATOM   2246 N ND1 . HIS A 1 305 ? 12.600 16.250  50.966 1.00 87.99  ? 305 HIS A ND1 1 
ATOM   2247 C CD2 . HIS A 1 305 ? 12.351 18.419  50.900 1.00 87.27  ? 305 HIS A CD2 1 
ATOM   2248 C CE1 . HIS A 1 305 ? 11.522 16.538  51.675 1.00 87.23  ? 305 HIS A CE1 1 
ATOM   2249 N NE2 . HIS A 1 305 ? 11.350 17.848  51.649 1.00 88.38  ? 305 HIS A NE2 1 
ATOM   2250 N N   . GLU A 1 306 ? 13.965 14.383  48.952 1.00 74.51  ? 306 GLU A N   1 
ATOM   2251 C CA  . GLU A 1 306 ? 13.231 13.136  49.137 1.00 71.36  ? 306 GLU A CA  1 
ATOM   2252 C C   . GLU A 1 306 ? 13.260 12.671  50.564 1.00 67.66  ? 306 GLU A C   1 
ATOM   2253 O O   . GLU A 1 306 ? 13.934 13.250  51.404 1.00 65.38  ? 306 GLU A O   1 
ATOM   2254 C CB  . GLU A 1 306 ? 13.771 12.007  48.239 1.00 72.05  ? 306 GLU A CB  1 
ATOM   2255 C CG  . GLU A 1 306 ? 15.274 11.985  48.083 1.00 71.38  ? 306 GLU A CG  1 
ATOM   2256 C CD  . GLU A 1 306 ? 15.763 13.129  47.225 1.00 70.23  ? 306 GLU A CD  1 
ATOM   2257 O OE1 . GLU A 1 306 ? 15.399 13.169  46.027 1.00 69.38  ? 306 GLU A OE1 1 
ATOM   2258 O OE2 . GLU A 1 306 ? 16.497 13.988  47.755 1.00 70.00  ? 306 GLU A OE2 1 
ATOM   2259 N N   . ASN A 1 307 ? 12.510 11.608  50.817 1.00 65.76  ? 307 ASN A N   1 
ATOM   2260 C CA  . ASN A 1 307 ? 12.410 11.028  52.136 1.00 64.24  ? 307 ASN A CA  1 
ATOM   2261 C C   . ASN A 1 307 ? 13.795 10.605  52.603 1.00 63.46  ? 307 ASN A C   1 
ATOM   2262 O O   . ASN A 1 307 ? 14.433 9.754   51.986 1.00 64.52  ? 307 ASN A O   1 
ATOM   2263 C CB  . ASN A 1 307 ? 11.490 9.822   52.085 1.00 64.34  ? 307 ASN A CB  1 
ATOM   2264 C CG  . ASN A 1 307 ? 11.098 9.348   53.451 1.00 67.08  ? 307 ASN A CG  1 
ATOM   2265 O OD1 . ASN A 1 307 ? 11.885 9.440   54.398 1.00 68.80  ? 307 ASN A OD1 1 
ATOM   2266 N ND2 . ASN A 1 307 ? 9.878  8.828   53.573 1.00 67.98  ? 307 ASN A ND2 1 
ATOM   2267 N N   . PRO A 1 308 ? 14.286 11.199  53.702 1.00 62.17  ? 308 PRO A N   1 
ATOM   2268 C CA  . PRO A 1 308 ? 15.619 10.832  54.201 1.00 60.96  ? 308 PRO A CA  1 
ATOM   2269 C C   . PRO A 1 308 ? 15.719 9.313   54.438 1.00 59.95  ? 308 PRO A C   1 
ATOM   2270 O O   . PRO A 1 308 ? 16.810 8.743   54.491 1.00 59.31  ? 308 PRO A O   1 
ATOM   2271 C CB  . PRO A 1 308 ? 15.733 11.637  55.504 1.00 58.82  ? 308 PRO A CB  1 
ATOM   2272 C CG  . PRO A 1 308 ? 14.848 12.817  55.261 1.00 58.19  ? 308 PRO A CG  1 
ATOM   2273 C CD  . PRO A 1 308 ? 13.652 12.196  54.582 1.00 59.91  ? 308 PRO A CD  1 
ATOM   2274 N N   . VAL A 1 309 ? 14.562 8.675   54.589 1.00 58.87  ? 309 VAL A N   1 
ATOM   2275 C CA  . VAL A 1 309 ? 14.492 7.242   54.827 1.00 58.27  ? 309 VAL A CA  1 
ATOM   2276 C C   . VAL A 1 309 ? 14.639 6.482   53.518 1.00 58.30  ? 309 VAL A C   1 
ATOM   2277 O O   . VAL A 1 309 ? 14.848 5.268   53.522 1.00 58.82  ? 309 VAL A O   1 
ATOM   2278 C CB  . VAL A 1 309 ? 13.138 6.834   55.455 1.00 57.75  ? 309 VAL A CB  1 
ATOM   2279 C CG1 . VAL A 1 309 ? 13.142 5.354   55.772 1.00 58.42  ? 309 VAL A CG1 1 
ATOM   2280 C CG2 . VAL A 1 309 ? 12.865 7.646   56.696 1.00 56.23  ? 309 VAL A CG2 1 
ATOM   2281 N N   . ARG A 1 310 ? 14.538 7.197   52.401 1.00 56.98  ? 310 ARG A N   1 
ATOM   2282 C CA  . ARG A 1 310 ? 14.637 6.562   51.097 1.00 55.11  ? 310 ARG A CA  1 
ATOM   2283 C C   . ARG A 1 310 ? 14.986 7.574   50.004 1.00 54.09  ? 310 ARG A C   1 
ATOM   2284 O O   . ARG A 1 310 ? 14.156 7.902   49.167 1.00 53.64  ? 310 ARG A O   1 
ATOM   2285 C CB  . ARG A 1 310 ? 13.301 5.876   50.792 1.00 54.47  ? 310 ARG A CB  1 
ATOM   2286 C CG  . ARG A 1 310 ? 13.330 4.959   49.610 1.00 55.40  ? 310 ARG A CG  1 
ATOM   2287 C CD  . ARG A 1 310 ? 12.026 4.234   49.438 1.00 55.77  ? 310 ARG A CD  1 
ATOM   2288 N NE  . ARG A 1 310 ? 11.780 3.287   50.513 1.00 58.99  ? 310 ARG A NE  1 
ATOM   2289 C CZ  . ARG A 1 310 ? 10.736 2.465   50.544 1.00 60.83  ? 310 ARG A CZ  1 
ATOM   2290 N NH1 . ARG A 1 310 ? 9.855  2.486   49.554 1.00 61.70  ? 310 ARG A NH1 1 
ATOM   2291 N NH2 . ARG A 1 310 ? 10.568 1.622   51.556 1.00 61.86  ? 310 ARG A NH2 1 
ATOM   2292 N N   . PRO A 1 311 ? 16.227 8.080   50.001 1.00 55.14  ? 311 PRO A N   1 
ATOM   2293 C CA  . PRO A 1 311 ? 16.737 9.064   49.031 1.00 58.00  ? 311 PRO A CA  1 
ATOM   2294 C C   . PRO A 1 311 ? 16.733 8.641   47.552 1.00 60.68  ? 311 PRO A C   1 
ATOM   2295 O O   . PRO A 1 311 ? 17.645 7.943   47.089 1.00 61.01  ? 311 PRO A O   1 
ATOM   2296 C CB  . PRO A 1 311 ? 18.152 9.332   49.524 1.00 57.26  ? 311 PRO A CB  1 
ATOM   2297 C CG  . PRO A 1 311 ? 18.047 9.087   51.004 1.00 56.82  ? 311 PRO A CG  1 
ATOM   2298 C CD  . PRO A 1 311 ? 17.223 7.829   51.053 1.00 55.80  ? 311 PRO A CD  1 
ATOM   2299 N N   . SER A 1 312 ? 15.713 9.083   46.814 1.00 61.50  ? 312 SER A N   1 
ATOM   2300 C CA  . SER A 1 312 ? 15.582 8.762   45.396 1.00 61.23  ? 312 SER A CA  1 
ATOM   2301 C C   . SER A 1 312 ? 16.701 9.389   44.563 1.00 61.44  ? 312 SER A C   1 
ATOM   2302 O O   . SER A 1 312 ? 16.696 10.589  44.248 1.00 59.30  ? 312 SER A O   1 
ATOM   2303 C CB  . SER A 1 312 ? 14.216 9.224   44.873 1.00 62.63  ? 312 SER A CB  1 
ATOM   2304 O OG  . SER A 1 312 ? 14.093 8.986   43.476 1.00 64.20  ? 312 SER A OG  1 
ATOM   2305 N N   . SER A 1 313 ? 17.659 8.547   44.201 1.00 62.14  ? 313 SER A N   1 
ATOM   2306 C CA  . SER A 1 313 ? 18.803 8.974   43.410 1.00 62.25  ? 313 SER A CA  1 
ATOM   2307 C C   . SER A 1 313 ? 18.555 8.817   41.913 1.00 61.00  ? 313 SER A C   1 
ATOM   2308 O O   . SER A 1 313 ? 19.226 8.017   41.254 1.00 63.30  ? 313 SER A O   1 
ATOM   2309 C CB  . SER A 1 313 ? 20.047 8.161   43.820 1.00 62.93  ? 313 SER A CB  1 
ATOM   2310 O OG  . SER A 1 313 ? 19.739 6.776   43.979 1.00 62.18  ? 313 SER A OG  1 
ATOM   2311 N N   . LYS A 1 314 ? 17.601 9.555   41.361 1.00 57.55  ? 314 LYS A N   1 
ATOM   2312 C CA  . LYS A 1 314 ? 17.370 9.419   39.931 1.00 56.20  ? 314 LYS A CA  1 
ATOM   2313 C C   . LYS A 1 314 ? 18.172 10.473  39.175 1.00 53.78  ? 314 LYS A C   1 
ATOM   2314 O O   . LYS A 1 314 ? 17.966 11.673  39.356 1.00 53.04  ? 314 LYS A O   1 
ATOM   2315 C CB  . LYS A 1 314 ? 15.883 9.534   39.604 1.00 59.76  ? 314 LYS A CB  1 
ATOM   2316 C CG  . LYS A 1 314 ? 15.553 9.284   38.135 1.00 61.89  ? 314 LYS A CG  1 
ATOM   2317 C CD  . LYS A 1 314 ? 14.048 9.218   37.927 1.00 67.23  ? 314 LYS A CD  1 
ATOM   2318 C CE  . LYS A 1 314 ? 13.646 9.422   36.461 1.00 69.91  ? 314 LYS A CE  1 
ATOM   2319 N NZ  . LYS A 1 314 ? 12.154 9.515   36.273 1.00 70.38  ? 314 LYS A NZ  1 
ATOM   2320 N N   . LEU A 1 315 ? 19.089 10.007  38.329 1.00 50.46  ? 315 LEU A N   1 
ATOM   2321 C CA  . LEU A 1 315 ? 19.956 10.889  37.563 1.00 47.98  ? 315 LEU A CA  1 
ATOM   2322 C C   . LEU A 1 315 ? 19.276 11.455  36.323 1.00 47.36  ? 315 LEU A C   1 
ATOM   2323 O O   . LEU A 1 315 ? 18.413 10.821  35.742 1.00 47.61  ? 315 LEU A O   1 
ATOM   2324 C CB  . LEU A 1 315 ? 21.220 10.137  37.164 1.00 47.26  ? 315 LEU A CB  1 
ATOM   2325 C CG  . LEU A 1 315 ? 22.372 10.968  36.603 1.00 47.82  ? 315 LEU A CG  1 
ATOM   2326 C CD1 . LEU A 1 315 ? 22.717 12.107  37.566 1.00 47.81  ? 315 LEU A CD1 1 
ATOM   2327 C CD2 . LEU A 1 315 ? 23.564 10.072  36.388 1.00 46.23  ? 315 LEU A CD2 1 
ATOM   2328 N N   . TYR A 1 316 ? 19.678 12.653  35.919 1.00 47.21  ? 316 TYR A N   1 
ATOM   2329 C CA  . TYR A 1 316 ? 19.095 13.293  34.759 1.00 48.00  ? 316 TYR A CA  1 
ATOM   2330 C C   . TYR A 1 316 ? 20.132 13.781  33.781 1.00 49.00  ? 316 TYR A C   1 
ATOM   2331 O O   . TYR A 1 316 ? 21.310 13.893  34.111 1.00 48.00  ? 316 TYR A O   1 
ATOM   2332 C CB  . TYR A 1 316 ? 18.228 14.474  35.186 1.00 50.29  ? 316 TYR A CB  1 
ATOM   2333 C CG  . TYR A 1 316 ? 17.010 14.062  35.976 1.00 52.90  ? 316 TYR A CG  1 
ATOM   2334 C CD1 . TYR A 1 316 ? 17.098 13.772  37.335 1.00 52.73  ? 316 TYR A CD1 1 
ATOM   2335 C CD2 . TYR A 1 316 ? 15.779 13.892  35.342 1.00 54.02  ? 316 TYR A CD2 1 
ATOM   2336 C CE1 . TYR A 1 316 ? 15.994 13.318  38.037 1.00 56.07  ? 316 TYR A CE1 1 
ATOM   2337 C CE2 . TYR A 1 316 ? 14.670 13.439  36.029 1.00 55.83  ? 316 TYR A CE2 1 
ATOM   2338 C CZ  . TYR A 1 316 ? 14.777 13.151  37.374 1.00 57.55  ? 316 TYR A CZ  1 
ATOM   2339 O OH  . TYR A 1 316 ? 13.662 12.687  38.039 1.00 59.10  ? 316 TYR A OH  1 
ATOM   2340 N N   . HIS A 1 317 ? 19.664 14.080  32.572 1.00 50.56  ? 317 HIS A N   1 
ATOM   2341 C CA  . HIS A 1 317 ? 20.507 14.583  31.488 1.00 52.47  ? 317 HIS A CA  1 
ATOM   2342 C C   . HIS A 1 317 ? 19.758 15.586  30.610 1.00 54.79  ? 317 HIS A C   1 
ATOM   2343 O O   . HIS A 1 317 ? 18.629 15.325  30.184 1.00 55.60  ? 317 HIS A O   1 
ATOM   2344 C CB  . HIS A 1 317 ? 20.961 13.455  30.544 1.00 50.38  ? 317 HIS A CB  1 
ATOM   2345 C CG  . HIS A 1 317 ? 21.929 12.483  31.140 1.00 46.82  ? 317 HIS A CG  1 
ATOM   2346 N ND1 . HIS A 1 317 ? 21.534 11.422  31.924 1.00 46.67  ? 317 HIS A ND1 1 
ATOM   2347 C CD2 . HIS A 1 317 ? 23.271 12.376  31.011 1.00 45.02  ? 317 HIS A CD2 1 
ATOM   2348 C CE1 . HIS A 1 317 ? 22.591 10.699  32.249 1.00 46.50  ? 317 HIS A CE1 1 
ATOM   2349 N NE2 . HIS A 1 317 ? 23.657 11.258  31.707 1.00 46.74  ? 317 HIS A NE2 1 
ATOM   2350 N N   . CYS A 1 318 ? 20.381 16.730  30.345 1.00 56.48  ? 318 CYS A N   1 
ATOM   2351 C CA  . CYS A 1 318 ? 19.810 17.723  29.437 1.00 58.40  ? 318 CYS A CA  1 
ATOM   2352 C C   . CYS A 1 318 ? 21.003 18.145  28.610 1.00 56.97  ? 318 CYS A C   1 
ATOM   2353 O O   . CYS A 1 318 ? 22.089 18.339  29.156 1.00 58.40  ? 318 CYS A O   1 
ATOM   2354 C CB  . CYS A 1 318 ? 19.214 18.939  30.165 1.00 61.51  ? 318 CYS A CB  1 
ATOM   2355 S SG  . CYS A 1 318 ? 20.272 19.731  31.427 1.00 74.67  ? 318 CYS A SG  1 
ATOM   2356 N N   . ALA A 1 319 ? 20.815 18.250  27.298 1.00 54.02  ? 319 ALA A N   1 
ATOM   2357 C CA  . ALA A 1 319 ? 21.884 18.652  26.400 1.00 50.95  ? 319 ALA A CA  1 
ATOM   2358 C C   . ALA A 1 319 ? 21.568 19.987  25.726 1.00 50.09  ? 319 ALA A C   1 
ATOM   2359 O O   . ALA A 1 319 ? 20.498 20.149  25.155 1.00 52.03  ? 319 ALA A O   1 
ATOM   2360 C CB  . ALA A 1 319 ? 22.084 17.581  25.357 1.00 51.35  ? 319 ALA A CB  1 
ATOM   2361 N N   . LEU A 1 320 ? 22.488 20.944  25.793 1.00 48.90  ? 320 LEU A N   1 
ATOM   2362 C CA  . LEU A 1 320 ? 22.273 22.236  25.153 1.00 47.97  ? 320 LEU A CA  1 
ATOM   2363 C C   . LEU A 1 320 ? 23.090 22.289  23.875 1.00 48.55  ? 320 LEU A C   1 
ATOM   2364 O O   . LEU A 1 320 ? 24.022 21.513  23.694 1.00 50.20  ? 320 LEU A O   1 
ATOM   2365 C CB  . LEU A 1 320 ? 22.672 23.369  26.092 1.00 49.14  ? 320 LEU A CB  1 
ATOM   2366 C CG  . LEU A 1 320 ? 21.846 23.421  27.385 1.00 50.59  ? 320 LEU A CG  1 
ATOM   2367 C CD1 . LEU A 1 320 ? 22.292 24.617  28.216 1.00 50.29  ? 320 LEU A CD1 1 
ATOM   2368 C CD2 . LEU A 1 320 ? 20.346 23.518  27.055 1.00 48.09  ? 320 LEU A CD2 1 
ATOM   2369 N N   . GLN A 1 321 ? 22.762 23.206  22.982 1.00 49.58  ? 321 GLN A N   1 
ATOM   2370 C CA  . GLN A 1 321 ? 23.472 23.268  21.716 1.00 51.93  ? 321 GLN A CA  1 
ATOM   2371 C C   . GLN A 1 321 ? 23.704 24.685  21.231 1.00 54.40  ? 321 GLN A C   1 
ATOM   2372 O O   . GLN A 1 321 ? 22.758 25.465  21.067 1.00 55.41  ? 321 GLN A O   1 
ATOM   2373 C CB  . GLN A 1 321 ? 22.673 22.494  20.677 1.00 52.95  ? 321 GLN A CB  1 
ATOM   2374 C CG  . GLN A 1 321 ? 23.162 22.582  19.257 1.00 53.62  ? 321 GLN A CG  1 
ATOM   2375 C CD  . GLN A 1 321 ? 22.203 21.889  18.289 1.00 54.24  ? 321 GLN A CD  1 
ATOM   2376 O OE1 . GLN A 1 321 ? 21.330 21.122  18.706 1.00 51.14  ? 321 GLN A OE1 1 
ATOM   2377 N NE2 . GLN A 1 321 ? 22.370 22.147  16.992 1.00 54.67  ? 321 GLN A NE2 1 
ATOM   2378 N N   . MET A 1 322 ? 24.973 25.012  21.009 1.00 55.49  ? 322 MET A N   1 
ATOM   2379 C CA  . MET A 1 322 ? 25.350 26.332  20.519 1.00 56.74  ? 322 MET A CA  1 
ATOM   2380 C C   . MET A 1 322 ? 25.541 26.146  19.015 1.00 56.63  ? 322 MET A C   1 
ATOM   2381 O O   . MET A 1 322 ? 26.392 25.370  18.573 1.00 56.77  ? 322 MET A O   1 
ATOM   2382 C CB  . MET A 1 322 ? 26.661 26.803  21.169 1.00 56.64  ? 322 MET A CB  1 
ATOM   2383 C CG  . MET A 1 322 ? 26.986 28.291  20.981 1.00 56.56  ? 322 MET A CG  1 
ATOM   2384 S SD  . MET A 1 322 ? 26.357 29.306  22.352 1.00 61.11  ? 322 MET A SD  1 
ATOM   2385 C CE  . MET A 1 322 ? 25.953 30.849  21.556 1.00 57.83  ? 322 MET A CE  1 
ATOM   2386 N N   . THR A 1 323 ? 24.738 26.849  18.229 1.00 56.10  ? 323 THR A N   1 
ATOM   2387 C CA  . THR A 1 323 ? 24.831 26.735  16.786 1.00 56.91  ? 323 THR A CA  1 
ATOM   2388 C C   . THR A 1 323 ? 25.066 28.098  16.148 1.00 59.48  ? 323 THR A C   1 
ATOM   2389 O O   . THR A 1 323 ? 24.870 29.137  16.784 1.00 59.62  ? 323 THR A O   1 
ATOM   2390 C CB  . THR A 1 323 ? 23.541 26.139  16.215 1.00 55.28  ? 323 THR A CB  1 
ATOM   2391 O OG1 . THR A 1 323 ? 23.248 24.912  16.897 1.00 53.52  ? 323 THR A OG1 1 
ATOM   2392 C CG2 . THR A 1 323 ? 23.672 25.895  14.716 1.00 52.29  ? 323 THR A CG2 1 
ATOM   2393 N N   . SER A 1 324 ? 25.491 28.084  14.888 1.00 61.88  ? 324 SER A N   1 
ATOM   2394 C CA  . SER A 1 324 ? 25.738 29.310  14.145 1.00 63.22  ? 324 SER A CA  1 
ATOM   2395 C C   . SER A 1 324 ? 24.638 29.528  13.110 1.00 64.81  ? 324 SER A C   1 
ATOM   2396 O O   . SER A 1 324 ? 24.312 28.635  12.329 1.00 66.09  ? 324 SER A O   1 
ATOM   2397 C CB  . SER A 1 324 ? 27.090 29.240  13.444 1.00 62.54  ? 324 SER A CB  1 
ATOM   2398 O OG  . SER A 1 324 ? 27.343 30.437  12.734 1.00 62.94  ? 324 SER A OG  1 
ATOM   2399 N N   . HIS A 1 325 ? 24.053 30.716  13.126 1.00 65.87  ? 325 HIS A N   1 
ATOM   2400 C CA  . HIS A 1 325 ? 23.005 31.064  12.187 1.00 67.10  ? 325 HIS A CA  1 
ATOM   2401 C C   . HIS A 1 325 ? 23.503 32.335  11.533 1.00 68.88  ? 325 HIS A C   1 
ATOM   2402 O O   . HIS A 1 325 ? 23.643 33.361  12.192 1.00 68.83  ? 325 HIS A O   1 
ATOM   2403 C CB  . HIS A 1 325 ? 21.701 31.334  12.932 1.00 68.09  ? 325 HIS A CB  1 
ATOM   2404 C CG  . HIS A 1 325 ? 21.199 30.161  13.712 1.00 68.94  ? 325 HIS A CG  1 
ATOM   2405 N ND1 . HIS A 1 325 ? 20.678 29.036  13.112 1.00 69.60  ? 325 HIS A ND1 1 
ATOM   2406 C CD2 . HIS A 1 325 ? 21.172 29.920  15.046 1.00 69.77  ? 325 HIS A CD2 1 
ATOM   2407 C CE1 . HIS A 1 325 ? 20.354 28.151  14.040 1.00 69.21  ? 325 HIS A CE1 1 
ATOM   2408 N NE2 . HIS A 1 325 ? 20.644 28.664  15.222 1.00 69.04  ? 325 HIS A NE2 1 
ATOM   2409 N N   . ASP A 1 326 ? 23.788 32.265  10.240 1.00 71.16  ? 326 ASP A N   1 
ATOM   2410 C CA  . ASP A 1 326 ? 24.292 33.428  9.518  1.00 72.86  ? 326 ASP A CA  1 
ATOM   2411 C C   . ASP A 1 326 ? 25.557 33.995  10.160 1.00 73.16  ? 326 ASP A C   1 
ATOM   2412 O O   . ASP A 1 326 ? 25.813 35.197  10.072 1.00 74.08  ? 326 ASP A O   1 
ATOM   2413 C CB  . ASP A 1 326 ? 23.237 34.540  9.454  1.00 74.15  ? 326 ASP A CB  1 
ATOM   2414 C CG  . ASP A 1 326 ? 22.069 34.197  8.544  1.00 75.03  ? 326 ASP A CG  1 
ATOM   2415 O OD1 . ASP A 1 326 ? 22.283 33.468  7.548  1.00 76.35  ? 326 ASP A OD1 1 
ATOM   2416 O OD2 . ASP A 1 326 ? 20.944 34.678  8.817  1.00 73.33  ? 326 ASP A OD2 1 
ATOM   2417 N N   . GLY A 1 327 ? 26.343 33.139  10.808 1.00 72.19  ? 327 GLY A N   1 
ATOM   2418 C CA  . GLY A 1 327 ? 27.575 33.602  11.429 1.00 70.50  ? 327 GLY A CA  1 
ATOM   2419 C C   . GLY A 1 327 ? 27.476 33.883  12.919 1.00 68.75  ? 327 GLY A C   1 
ATOM   2420 O O   . GLY A 1 327 ? 28.490 33.969  13.625 1.00 67.99  ? 327 GLY A O   1 
ATOM   2421 N N   . VAL A 1 328 ? 26.249 34.034  13.401 1.00 66.50  ? 328 VAL A N   1 
ATOM   2422 C CA  . VAL A 1 328 ? 26.022 34.299  14.812 1.00 64.99  ? 328 VAL A CA  1 
ATOM   2423 C C   . VAL A 1 328 ? 25.765 32.987  15.542 1.00 63.83  ? 328 VAL A C   1 
ATOM   2424 O O   . VAL A 1 328 ? 25.089 32.101  15.017 1.00 62.73  ? 328 VAL A O   1 
ATOM   2425 C CB  . VAL A 1 328 ? 24.802 35.211  15.017 1.00 64.73  ? 328 VAL A CB  1 
ATOM   2426 C CG1 . VAL A 1 328 ? 24.755 35.688  16.448 1.00 65.53  ? 328 VAL A CG1 1 
ATOM   2427 C CG2 . VAL A 1 328 ? 24.861 36.385  14.067 1.00 65.29  ? 328 VAL A CG2 1 
ATOM   2428 N N   . TRP A 1 329 ? 26.305 32.868  16.752 1.00 63.60  ? 329 TRP A N   1 
ATOM   2429 C CA  . TRP A 1 329 ? 26.122 31.662  17.552 1.00 63.81  ? 329 TRP A CA  1 
ATOM   2430 C C   . TRP A 1 329 ? 25.092 31.881  18.653 1.00 63.57  ? 329 TRP A C   1 
ATOM   2431 O O   . TRP A 1 329 ? 25.143 32.881  19.362 1.00 63.97  ? 329 TRP A O   1 
ATOM   2432 C CB  . TRP A 1 329 ? 27.444 31.222  18.196 1.00 64.23  ? 329 TRP A CB  1 
ATOM   2433 C CG  . TRP A 1 329 ? 28.516 30.769  17.235 1.00 63.54  ? 329 TRP A CG  1 
ATOM   2434 C CD1 . TRP A 1 329 ? 29.377 31.558  16.538 1.00 63.27  ? 329 TRP A CD1 1 
ATOM   2435 C CD2 . TRP A 1 329 ? 28.846 29.420  16.894 1.00 63.86  ? 329 TRP A CD2 1 
ATOM   2436 N NE1 . TRP A 1 329 ? 30.229 30.788  15.785 1.00 63.45  ? 329 TRP A NE1 1 
ATOM   2437 C CE2 . TRP A 1 329 ? 29.923 29.469  15.984 1.00 64.01  ? 329 TRP A CE2 1 
ATOM   2438 C CE3 . TRP A 1 329 ? 28.334 28.170  17.270 1.00 63.87  ? 329 TRP A CE3 1 
ATOM   2439 C CZ2 . TRP A 1 329 ? 30.503 28.321  15.442 1.00 65.20  ? 329 TRP A CZ2 1 
ATOM   2440 C CZ3 . TRP A 1 329 ? 28.906 27.027  16.735 1.00 63.89  ? 329 TRP A CZ3 1 
ATOM   2441 C CH2 . TRP A 1 329 ? 29.981 27.110  15.829 1.00 65.57  ? 329 TRP A CH2 1 
ATOM   2442 N N   . THR A 1 330 ? 24.159 30.942  18.787 1.00 63.95  ? 330 THR A N   1 
ATOM   2443 C CA  . THR A 1 330 ? 23.124 31.015  19.816 1.00 64.55  ? 330 THR A CA  1 
ATOM   2444 C C   . THR A 1 330 ? 22.946 29.678  20.522 1.00 63.77  ? 330 THR A C   1 
ATOM   2445 O O   . THR A 1 330 ? 23.307 28.626  20.000 1.00 63.28  ? 330 THR A O   1 
ATOM   2446 C CB  . THR A 1 330 ? 21.765 31.444  19.239 1.00 65.51  ? 330 THR A CB  1 
ATOM   2447 O OG1 . THR A 1 330 ? 21.535 30.769  17.993 1.00 68.30  ? 330 THR A OG1 1 
ATOM   2448 C CG2 . THR A 1 330 ? 21.730 32.946  19.034 1.00 66.47  ? 330 THR A CG2 1 
ATOM   2449 N N   . SER A 1 331 ? 22.370 29.731  21.716 1.00 63.94  ? 331 SER A N   1 
ATOM   2450 C CA  . SER A 1 331 ? 22.165 28.534  22.518 1.00 62.49  ? 331 SER A CA  1 
ATOM   2451 C C   . SER A 1 331 ? 20.714 28.146  22.748 1.00 61.47  ? 331 SER A C   1 
ATOM   2452 O O   . SER A 1 331 ? 19.838 28.994  22.896 1.00 60.19  ? 331 SER A O   1 
ATOM   2453 C CB  . SER A 1 331 ? 22.836 28.713  23.877 1.00 61.11  ? 331 SER A CB  1 
ATOM   2454 O OG  . SER A 1 331 ? 22.494 27.644  24.734 1.00 60.56  ? 331 SER A OG  1 
ATOM   2455 N N   . THR A 1 332 ? 20.463 26.846  22.776 1.00 61.55  ? 332 THR A N   1 
ATOM   2456 C CA  . THR A 1 332 ? 19.121 26.373  23.042 1.00 62.12  ? 332 THR A CA  1 
ATOM   2457 C C   . THR A 1 332 ? 19.024 26.569  24.556 1.00 63.58  ? 332 THR A C   1 
ATOM   2458 O O   . THR A 1 332 ? 19.984 27.021  25.174 1.00 63.75  ? 332 THR A O   1 
ATOM   2459 C CB  . THR A 1 332 ? 18.971 24.889  22.668 1.00 61.19  ? 332 THR A CB  1 
ATOM   2460 O OG1 . THR A 1 332 ? 19.732 24.082  23.574 1.00 62.73  ? 332 THR A OG1 1 
ATOM   2461 C CG2 . THR A 1 332 ? 19.479 24.652  21.257 1.00 59.89  ? 332 THR A CG2 1 
ATOM   2462 N N   . SER A 1 333 ? 17.893 26.244  25.167 1.00 65.03  ? 333 SER A N   1 
ATOM   2463 C CA  . SER A 1 333 ? 17.768 26.443  26.606 1.00 65.37  ? 333 SER A CA  1 
ATOM   2464 C C   . SER A 1 333 ? 16.721 25.534  27.218 1.00 66.19  ? 333 SER A C   1 
ATOM   2465 O O   . SER A 1 333 ? 15.832 25.046  26.523 1.00 67.38  ? 333 SER A O   1 
ATOM   2466 C CB  . SER A 1 333 ? 17.426 27.903  26.883 1.00 65.51  ? 333 SER A CB  1 
ATOM   2467 O OG  . SER A 1 333 ? 16.544 28.400  25.887 1.00 64.72  ? 333 SER A OG  1 
ATOM   2468 N N   . SER A 1 334 ? 16.829 25.300  28.520 1.00 66.86  ? 334 SER A N   1 
ATOM   2469 C CA  . SER A 1 334 ? 15.881 24.432  29.205 1.00 68.83  ? 334 SER A CA  1 
ATOM   2470 C C   . SER A 1 334 ? 15.506 25.008  30.561 1.00 70.67  ? 334 SER A C   1 
ATOM   2471 O O   . SER A 1 334 ? 16.381 25.373  31.344 1.00 69.64  ? 334 SER A O   1 
ATOM   2472 C CB  . SER A 1 334 ? 16.477 23.035  29.380 1.00 67.79  ? 334 SER A CB  1 
ATOM   2473 O OG  . SER A 1 334 ? 15.668 22.238  30.219 1.00 66.49  ? 334 SER A OG  1 
ATOM   2474 N N   . GLU A 1 335 ? 14.205 25.093  30.833 1.00 73.18  ? 335 GLU A N   1 
ATOM   2475 C CA  . GLU A 1 335 ? 13.743 25.642  32.103 1.00 76.32  ? 335 GLU A CA  1 
ATOM   2476 C C   . GLU A 1 335 ? 14.089 24.690  33.248 1.00 76.43  ? 335 GLU A C   1 
ATOM   2477 O O   . GLU A 1 335 ? 13.785 24.969  34.413 1.00 76.61  ? 335 GLU A O   1 
ATOM   2478 C CB  . GLU A 1 335 ? 12.224 25.916  32.067 1.00 79.15  ? 335 GLU A CB  1 
ATOM   2479 C CG  . GLU A 1 335 ? 11.308 24.699  32.316 1.00 84.03  ? 335 GLU A CG  1 
ATOM   2480 C CD  . GLU A 1 335 ? 11.332 23.662  31.192 1.00 86.11  ? 335 GLU A CD  1 
ATOM   2481 O OE1 . GLU A 1 335 ? 10.941 24.006  30.049 1.00 87.26  ? 335 GLU A OE1 1 
ATOM   2482 O OE2 . GLU A 1 335 ? 11.734 22.503  31.458 1.00 85.34  ? 335 GLU A OE2 1 
ATOM   2483 N N   . GLN A 1 336 ? 14.719 23.563  32.910 1.00 75.80  ? 336 GLN A N   1 
ATOM   2484 C CA  . GLN A 1 336 ? 15.125 22.578  33.912 1.00 74.62  ? 336 GLN A CA  1 
ATOM   2485 C C   . GLN A 1 336 ? 16.645 22.517  34.030 1.00 72.39  ? 336 GLN A C   1 
ATOM   2486 O O   . GLN A 1 336 ? 17.187 22.574  35.133 1.00 72.91  ? 336 GLN A O   1 
ATOM   2487 C CB  . GLN A 1 336 ? 14.576 21.195  33.559 1.00 76.51  ? 336 GLN A CB  1 
ATOM   2488 C CG  . GLN A 1 336 ? 13.059 21.135  33.558 1.00 81.44  ? 336 GLN A CG  1 
ATOM   2489 C CD  . GLN A 1 336 ? 12.461 21.516  34.905 1.00 83.76  ? 336 GLN A CD  1 
ATOM   2490 O OE1 . GLN A 1 336 ? 12.428 20.707  35.842 1.00 85.08  ? 336 GLN A OE1 1 
ATOM   2491 N NE2 . GLN A 1 336 ? 11.998 22.761  35.013 1.00 84.19  ? 336 GLN A NE2 1 
ATOM   2492 N N   . CYS A 1 337 ? 17.318 22.417  32.888 1.00 68.94  ? 337 CYS A N   1 
ATOM   2493 C CA  . CYS A 1 337 ? 18.776 22.349  32.828 1.00 67.01  ? 337 CYS A CA  1 
ATOM   2494 C C   . CYS A 1 337 ? 19.459 23.340  33.783 1.00 65.19  ? 337 CYS A C   1 
ATOM   2495 O O   . CYS A 1 337 ? 19.195 24.546  33.729 1.00 63.95  ? 337 CYS A O   1 
ATOM   2496 C CB  . CYS A 1 337 ? 19.221 22.624  31.395 1.00 68.39  ? 337 CYS A CB  1 
ATOM   2497 S SG  . CYS A 1 337 ? 20.631 21.642  30.784 1.00 72.37  ? 337 CYS A SG  1 
ATOM   2498 N N   . PRO A 1 338 ? 20.354 22.839  34.667 1.00 63.67  ? 338 PRO A N   1 
ATOM   2499 C CA  . PRO A 1 338 ? 21.090 23.648  35.645 1.00 61.46  ? 338 PRO A CA  1 
ATOM   2500 C C   . PRO A 1 338 ? 22.175 24.503  35.008 1.00 59.61  ? 338 PRO A C   1 
ATOM   2501 O O   . PRO A 1 338 ? 22.625 25.488  35.601 1.00 59.49  ? 338 PRO A O   1 
ATOM   2502 C CB  . PRO A 1 338 ? 21.666 22.602  36.586 1.00 61.28  ? 338 PRO A CB  1 
ATOM   2503 C CG  . PRO A 1 338 ? 21.991 21.505  35.669 1.00 62.25  ? 338 PRO A CG  1 
ATOM   2504 C CD  . PRO A 1 338 ? 20.733 21.421  34.805 1.00 63.93  ? 338 PRO A CD  1 
ATOM   2505 N N   . ILE A 1 339 ? 22.587 24.129  33.802 1.00 57.79  ? 339 ILE A N   1 
ATOM   2506 C CA  . ILE A 1 339 ? 23.609 24.874  33.083 1.00 58.00  ? 339 ILE A CA  1 
ATOM   2507 C C   . ILE A 1 339 ? 23.024 25.611  31.883 1.00 57.07  ? 339 ILE A C   1 
ATOM   2508 O O   . ILE A 1 339 ? 21.887 25.377  31.495 1.00 57.79  ? 339 ILE A O   1 
ATOM   2509 C CB  . ILE A 1 339 ? 24.701 23.945  32.524 1.00 59.96  ? 339 ILE A CB  1 
ATOM   2510 C CG1 . ILE A 1 339 ? 24.092 23.003  31.486 1.00 60.50  ? 339 ILE A CG1 1 
ATOM   2511 C CG2 . ILE A 1 339 ? 25.337 23.144  33.628 1.00 60.45  ? 339 ILE A CG2 1 
ATOM   2512 C CD1 . ILE A 1 339 ? 25.116 22.360  30.597 1.00 61.84  ? 339 ILE A CD1 1 
ATOM   2513 N N   . ARG A 1 340 ? 23.824 26.492  31.292 1.00 56.76  ? 340 ARG A N   1 
ATOM   2514 C CA  . ARG A 1 340 ? 23.428 27.232  30.104 1.00 57.34  ? 340 ARG A CA  1 
ATOM   2515 C C   . ARG A 1 340 ? 24.673 27.678  29.341 1.00 56.95  ? 340 ARG A C   1 
ATOM   2516 O O   . ARG A 1 340 ? 25.751 27.791  29.917 1.00 55.97  ? 340 ARG A O   1 
ATOM   2517 C CB  . ARG A 1 340 ? 22.543 28.428  30.474 1.00 58.64  ? 340 ARG A CB  1 
ATOM   2518 C CG  . ARG A 1 340 ? 23.081 29.339  31.555 1.00 59.05  ? 340 ARG A CG  1 
ATOM   2519 C CD  . ARG A 1 340 ? 21.937 30.142  32.204 1.00 61.29  ? 340 ARG A CD  1 
ATOM   2520 N NE  . ARG A 1 340 ? 21.460 31.269  31.395 1.00 62.32  ? 340 ARG A NE  1 
ATOM   2521 C CZ  . ARG A 1 340 ? 22.111 32.427  31.249 1.00 64.18  ? 340 ARG A CZ  1 
ATOM   2522 N NH1 . ARG A 1 340 ? 23.279 32.624  31.861 1.00 67.16  ? 340 ARG A NH1 1 
ATOM   2523 N NH2 . ARG A 1 340 ? 21.606 33.392  30.485 1.00 62.01  ? 340 ARG A NH2 1 
ATOM   2524 N N   . LEU A 1 341 ? 24.524 27.891  28.037 1.00 57.03  ? 341 LEU A N   1 
ATOM   2525 C CA  . LEU A 1 341 ? 25.636 28.309  27.196 1.00 57.77  ? 341 LEU A CA  1 
ATOM   2526 C C   . LEU A 1 341 ? 25.491 29.751  26.814 1.00 60.15  ? 341 LEU A C   1 
ATOM   2527 O O   . LEU A 1 341 ? 24.464 30.160  26.276 1.00 60.93  ? 341 LEU A O   1 
ATOM   2528 C CB  . LEU A 1 341 ? 25.690 27.497  25.916 1.00 57.07  ? 341 LEU A CB  1 
ATOM   2529 C CG  . LEU A 1 341 ? 25.868 25.997  26.046 1.00 57.49  ? 341 LEU A CG  1 
ATOM   2530 C CD1 . LEU A 1 341 ? 25.995 25.389  24.668 1.00 56.74  ? 341 LEU A CD1 1 
ATOM   2531 C CD2 . LEU A 1 341 ? 27.106 25.717  26.872 1.00 59.59  ? 341 LEU A CD2 1 
ATOM   2532 N N   . VAL A 1 342 ? 26.533 30.523  27.070 1.00 62.25  ? 342 VAL A N   1 
ATOM   2533 C CA  . VAL A 1 342 ? 26.497 31.935  26.751 1.00 64.64  ? 342 VAL A CA  1 
ATOM   2534 C C   . VAL A 1 342 ? 27.735 32.288  25.956 1.00 66.61  ? 342 VAL A C   1 
ATOM   2535 O O   . VAL A 1 342 ? 28.758 31.625  26.079 1.00 66.44  ? 342 VAL A O   1 
ATOM   2536 C CB  . VAL A 1 342 ? 26.462 32.789  28.043 1.00 64.49  ? 342 VAL A CB  1 
ATOM   2537 C CG1 . VAL A 1 342 ? 25.326 32.314  28.961 1.00 61.25  ? 342 VAL A CG1 1 
ATOM   2538 C CG2 . VAL A 1 342 ? 27.799 32.711  28.752 1.00 64.10  ? 342 VAL A CG2 1 
ATOM   2539 N N   . GLU A 1 343 ? 27.641 33.317  25.123 1.00 70.61  ? 343 GLU A N   1 
ATOM   2540 C CA  . GLU A 1 343 ? 28.797 33.739  24.344 1.00 74.79  ? 343 GLU A CA  1 
ATOM   2541 C C   . GLU A 1 343 ? 29.769 34.393  25.325 1.00 76.72  ? 343 GLU A C   1 
ATOM   2542 O O   . GLU A 1 343 ? 29.365 35.174  26.187 1.00 77.15  ? 343 GLU A O   1 
ATOM   2543 C CB  . GLU A 1 343 ? 28.385 34.746  23.269 1.00 76.45  ? 343 GLU A CB  1 
ATOM   2544 C CG  . GLU A 1 343 ? 27.872 36.067  23.825 1.00 80.17  ? 343 GLU A CG  1 
ATOM   2545 C CD  . GLU A 1 343 ? 27.586 37.093  22.745 1.00 81.57  ? 343 GLU A CD  1 
ATOM   2546 O OE1 . GLU A 1 343 ? 28.504 37.378  21.943 1.00 83.12  ? 343 GLU A OE1 1 
ATOM   2547 O OE2 . GLU A 1 343 ? 26.449 37.618  22.704 1.00 82.05  ? 343 GLU A OE2 1 
ATOM   2548 N N   . GLY A 1 344 ? 31.047 34.056  25.211 1.00 79.45  ? 344 GLY A N   1 
ATOM   2549 C CA  . GLY A 1 344 ? 32.034 34.631  26.105 1.00 82.18  ? 344 GLY A CA  1 
ATOM   2550 C C   . GLY A 1 344 ? 32.365 36.046  25.682 1.00 84.91  ? 344 GLY A C   1 
ATOM   2551 O O   . GLY A 1 344 ? 31.482 36.789  25.242 1.00 86.08  ? 344 GLY A O   1 
ATOM   2552 N N   . GLN A 1 345 ? 33.634 36.424  25.804 1.00 86.40  ? 345 GLN A N   1 
ATOM   2553 C CA  . GLN A 1 345 ? 34.055 37.764  25.417 1.00 86.58  ? 345 GLN A CA  1 
ATOM   2554 C C   . GLN A 1 345 ? 33.441 38.142  24.080 1.00 85.77  ? 345 GLN A C   1 
ATOM   2555 O O   . GLN A 1 345 ? 32.626 39.061  24.008 1.00 86.48  ? 345 GLN A O   1 
ATOM   2556 C CB  . GLN A 1 345 ? 35.579 37.840  25.327 1.00 87.61  ? 345 GLN A CB  1 
ATOM   2557 C CG  . GLN A 1 345 ? 36.286 37.628  26.656 1.00 90.04  ? 345 GLN A CG  1 
ATOM   2558 C CD  . GLN A 1 345 ? 35.857 38.625  27.731 1.00 91.07  ? 345 GLN A CD  1 
ATOM   2559 O OE1 . GLN A 1 345 ? 36.439 38.660  28.815 1.00 91.85  ? 345 GLN A OE1 1 
ATOM   2560 N NE2 . GLN A 1 345 ? 34.840 39.437  27.436 1.00 91.34  ? 345 GLN A NE2 1 
ATOM   2561 N N   . SER A 1 346 ? 33.815 37.416  23.029 1.00 83.66  ? 346 SER A N   1 
ATOM   2562 C CA  . SER A 1 346 ? 33.296 37.695  21.696 1.00 81.69  ? 346 SER A CA  1 
ATOM   2563 C C   . SER A 1 346 ? 32.422 36.568  21.171 1.00 81.04  ? 346 SER A C   1 
ATOM   2564 O O   . SER A 1 346 ? 31.744 35.884  21.937 1.00 80.90  ? 346 SER A O   1 
ATOM   2565 C CB  . SER A 1 346 ? 34.457 37.948  20.727 1.00 80.34  ? 346 SER A CB  1 
ATOM   2566 O OG  . SER A 1 346 ? 35.396 36.892  20.763 1.00 77.66  ? 346 SER A OG  1 
ATOM   2567 N N   . GLN A 1 347 ? 32.426 36.405  19.852 1.00 80.08  ? 347 GLN A N   1 
ATOM   2568 C CA  . GLN A 1 347 ? 31.668 35.352  19.186 1.00 78.53  ? 347 GLN A CA  1 
ATOM   2569 C C   . GLN A 1 347 ? 32.641 34.243  18.802 1.00 76.10  ? 347 GLN A C   1 
ATOM   2570 O O   . GLN A 1 347 ? 32.357 33.399  17.951 1.00 75.44  ? 347 GLN A O   1 
ATOM   2571 C CB  . GLN A 1 347 ? 30.978 35.904  17.936 1.00 80.38  ? 347 GLN A CB  1 
ATOM   2572 C CG  . GLN A 1 347 ? 29.639 36.546  18.229 1.00 81.07  ? 347 GLN A CG  1 
ATOM   2573 C CD  . GLN A 1 347 ? 28.624 35.533  18.718 1.00 82.34  ? 347 GLN A CD  1 
ATOM   2574 O OE1 . GLN A 1 347 ? 27.900 34.927  17.925 1.00 82.84  ? 347 GLN A OE1 1 
ATOM   2575 N NE2 . GLN A 1 347 ? 28.582 35.326  20.029 1.00 83.20  ? 347 GLN A NE2 1 
ATOM   2576 N N   . ASN A 1 348 ? 33.807 34.274  19.436 1.00 73.22  ? 348 ASN A N   1 
ATOM   2577 C CA  . ASN A 1 348 ? 34.839 33.282  19.199 1.00 70.47  ? 348 ASN A CA  1 
ATOM   2578 C C   . ASN A 1 348 ? 34.974 32.461  20.471 1.00 69.28  ? 348 ASN A C   1 
ATOM   2579 O O   . ASN A 1 348 ? 35.658 31.433  20.507 1.00 68.82  ? 348 ASN A O   1 
ATOM   2580 C CB  . ASN A 1 348 ? 36.161 33.968  18.873 1.00 69.18  ? 348 ASN A CB  1 
ATOM   2581 C CG  . ASN A 1 348 ? 37.238 32.985  18.481 1.00 69.38  ? 348 ASN A CG  1 
ATOM   2582 O OD1 . ASN A 1 348 ? 36.994 32.076  17.685 1.00 69.43  ? 348 ASN A OD1 1 
ATOM   2583 N ND2 . ASN A 1 348 ? 38.443 33.164  19.027 1.00 67.97  ? 348 ASN A ND2 1 
ATOM   2584 N N   . VAL A 1 349 ? 34.296 32.920  21.515 1.00 67.35  ? 349 VAL A N   1 
ATOM   2585 C CA  . VAL A 1 349 ? 34.335 32.236  22.794 1.00 65.71  ? 349 VAL A CA  1 
ATOM   2586 C C   . VAL A 1 349 ? 32.951 31.820  23.274 1.00 64.22  ? 349 VAL A C   1 
ATOM   2587 O O   . VAL A 1 349 ? 31.983 32.570  23.161 1.00 64.28  ? 349 VAL A O   1 
ATOM   2588 C CB  . VAL A 1 349 ? 35.003 33.114  23.865 1.00 64.80  ? 349 VAL A CB  1 
ATOM   2589 C CG1 . VAL A 1 349 ? 35.026 32.387  25.188 1.00 63.91  ? 349 VAL A CG1 1 
ATOM   2590 C CG2 . VAL A 1 349 ? 36.420 33.448  23.435 1.00 64.87  ? 349 VAL A CG2 1 
ATOM   2591 N N   . LEU A 1 350 ? 32.876 30.606  23.805 1.00 62.06  ? 350 LEU A N   1 
ATOM   2592 C CA  . LEU A 1 350 ? 31.635 30.051  24.318 1.00 59.23  ? 350 LEU A CA  1 
ATOM   2593 C C   . LEU A 1 350 ? 31.827 29.688  25.785 1.00 58.28  ? 350 LEU A C   1 
ATOM   2594 O O   . LEU A 1 350 ? 32.891 29.216  26.183 1.00 58.42  ? 350 LEU A O   1 
ATOM   2595 C CB  . LEU A 1 350 ? 31.270 28.812  23.511 1.00 59.27  ? 350 LEU A CB  1 
ATOM   2596 C CG  . LEU A 1 350 ? 30.406 27.763  24.191 1.00 58.81  ? 350 LEU A CG  1 
ATOM   2597 C CD1 . LEU A 1 350 ? 29.040 28.320  24.485 1.00 60.03  ? 350 LEU A CD1 1 
ATOM   2598 C CD2 . LEU A 1 350 ? 30.310 26.560  23.290 1.00 59.00  ? 350 LEU A CD2 1 
ATOM   2599 N N   . GLN A 1 351 ? 30.804 29.917  26.594 1.00 57.11  ? 351 GLN A N   1 
ATOM   2600 C CA  . GLN A 1 351 ? 30.899 29.602  28.014 1.00 55.58  ? 351 GLN A CA  1 
ATOM   2601 C C   . GLN A 1 351 ? 29.789 28.692  28.499 1.00 53.68  ? 351 GLN A C   1 
ATOM   2602 O O   . GLN A 1 351 ? 28.654 28.747  28.021 1.00 53.40  ? 351 GLN A O   1 
ATOM   2603 C CB  . GLN A 1 351 ? 30.856 30.867  28.870 1.00 55.55  ? 351 GLN A CB  1 
ATOM   2604 C CG  . GLN A 1 351 ? 31.916 31.894  28.575 1.00 55.85  ? 351 GLN A CG  1 
ATOM   2605 C CD  . GLN A 1 351 ? 32.035 32.912  29.695 1.00 56.45  ? 351 GLN A CD  1 
ATOM   2606 O OE1 . GLN A 1 351 ? 31.042 33.520  30.121 1.00 54.86  ? 351 GLN A OE1 1 
ATOM   2607 N NE2 . GLN A 1 351 ? 33.254 33.101  30.184 1.00 56.23  ? 351 GLN A NE2 1 
ATOM   2608 N N   . VAL A 1 352 ? 30.140 27.866  29.473 1.00 51.56  ? 352 VAL A N   1 
ATOM   2609 C CA  . VAL A 1 352 ? 29.207 26.954  30.094 1.00 50.05  ? 352 VAL A CA  1 
ATOM   2610 C C   . VAL A 1 352 ? 29.076 27.482  31.508 1.00 50.42  ? 352 VAL A C   1 
ATOM   2611 O O   . VAL A 1 352 ? 30.057 27.496  32.258 1.00 51.05  ? 352 VAL A O   1 
ATOM   2612 C CB  . VAL A 1 352 ? 29.776 25.544  30.147 1.00 49.21  ? 352 VAL A CB  1 
ATOM   2613 C CG1 . VAL A 1 352 ? 28.772 24.618  30.821 1.00 49.07  ? 352 VAL A CG1 1 
ATOM   2614 C CG2 . VAL A 1 352 ? 30.125 25.074  28.739 1.00 46.84  ? 352 VAL A CG2 1 
ATOM   2615 N N   . ARG A 1 353 ? 27.877 27.924  31.872 1.00 49.82  ? 353 ARG A N   1 
ATOM   2616 C CA  . ARG A 1 353 ? 27.654 28.479  33.198 1.00 49.65  ? 353 ARG A CA  1 
ATOM   2617 C C   . ARG A 1 353 ? 26.685 27.681  34.035 1.00 48.67  ? 353 ARG A C   1 
ATOM   2618 O O   . ARG A 1 353 ? 26.079 26.734  33.558 1.00 50.28  ? 353 ARG A O   1 
ATOM   2619 C CB  . ARG A 1 353 ? 27.140 29.894  33.080 1.00 51.35  ? 353 ARG A CB  1 
ATOM   2620 C CG  . ARG A 1 353 ? 28.072 30.836  32.372 1.00 54.35  ? 353 ARG A CG  1 
ATOM   2621 C CD  . ARG A 1 353 ? 27.422 32.205  32.386 1.00 59.20  ? 353 ARG A CD  1 
ATOM   2622 N NE  . ARG A 1 353 ? 28.259 33.254  31.816 1.00 61.31  ? 353 ARG A NE  1 
ATOM   2623 C CZ  . ARG A 1 353 ? 27.944 34.540  31.871 1.00 61.33  ? 353 ARG A CZ  1 
ATOM   2624 N NH1 . ARG A 1 353 ? 26.818 34.910  32.469 1.00 60.17  ? 353 ARG A NH1 1 
ATOM   2625 N NH2 . ARG A 1 353 ? 28.750 35.448  31.338 1.00 62.77  ? 353 ARG A NH2 1 
ATOM   2626 N N   . VAL A 1 354 ? 26.531 28.079  35.289 1.00 47.64  ? 354 VAL A N   1 
ATOM   2627 C CA  . VAL A 1 354 ? 25.633 27.383  36.198 1.00 48.20  ? 354 VAL A CA  1 
ATOM   2628 C C   . VAL A 1 354 ? 25.514 28.204  37.468 1.00 48.51  ? 354 VAL A C   1 
ATOM   2629 O O   . VAL A 1 354 ? 26.414 28.965  37.797 1.00 49.39  ? 354 VAL A O   1 
ATOM   2630 C CB  . VAL A 1 354 ? 26.191 25.976  36.553 1.00 47.27  ? 354 VAL A CB  1 
ATOM   2631 C CG1 . VAL A 1 354 ? 27.486 26.115  37.336 1.00 48.51  ? 354 VAL A CG1 1 
ATOM   2632 C CG2 . VAL A 1 354 ? 25.182 25.185  37.353 1.00 46.78  ? 354 VAL A CG2 1 
ATOM   2633 N N   . ALA A 1 355 ? 24.405 28.066  38.179 1.00 49.39  ? 355 ALA A N   1 
ATOM   2634 C CA  . ALA A 1 355 ? 24.238 28.808  39.420 1.00 50.37  ? 355 ALA A CA  1 
ATOM   2635 C C   . ALA A 1 355 ? 24.919 28.014  40.517 1.00 52.45  ? 355 ALA A C   1 
ATOM   2636 O O   . ALA A 1 355 ? 24.704 26.813  40.650 1.00 53.93  ? 355 ALA A O   1 
ATOM   2637 C CB  . ALA A 1 355 ? 22.789 28.980  39.746 1.00 49.12  ? 355 ALA A CB  1 
ATOM   2638 N N   . PRO A 1 356 ? 25.756 28.682  41.316 1.00 53.12  ? 356 PRO A N   1 
ATOM   2639 C CA  . PRO A 1 356 ? 26.501 28.080  42.422 1.00 52.38  ? 356 PRO A CA  1 
ATOM   2640 C C   . PRO A 1 356 ? 25.635 27.141  43.257 1.00 53.32  ? 356 PRO A C   1 
ATOM   2641 O O   . PRO A 1 356 ? 26.108 26.147  43.815 1.00 53.17  ? 356 PRO A O   1 
ATOM   2642 C CB  . PRO A 1 356 ? 26.953 29.294  43.219 1.00 53.52  ? 356 PRO A CB  1 
ATOM   2643 C CG  . PRO A 1 356 ? 27.123 30.339  42.154 1.00 55.49  ? 356 PRO A CG  1 
ATOM   2644 C CD  . PRO A 1 356 ? 25.901 30.148  41.315 1.00 53.52  ? 356 PRO A CD  1 
ATOM   2645 N N   . THR A 1 357 ? 24.353 27.456  43.348 1.00 53.06  ? 357 THR A N   1 
ATOM   2646 C CA  . THR A 1 357 ? 23.479 26.622  44.139 1.00 53.04  ? 357 THR A CA  1 
ATOM   2647 C C   . THR A 1 357 ? 23.161 25.297  43.442 1.00 50.30  ? 357 THR A C   1 
ATOM   2648 O O   . THR A 1 357 ? 22.645 24.373  44.059 1.00 48.45  ? 357 THR A O   1 
ATOM   2649 C CB  . THR A 1 357 ? 22.188 27.381  44.509 1.00 54.84  ? 357 THR A CB  1 
ATOM   2650 O OG1 . THR A 1 357 ? 21.321 26.492  45.221 1.00 59.32  ? 357 THR A OG1 1 
ATOM   2651 C CG2 . THR A 1 357 ? 21.483 27.913  43.267 1.00 56.06  ? 357 THR A CG2 1 
ATOM   2652 N N   . SER A 1 358 ? 23.500 25.205  42.160 1.00 50.15  ? 358 SER A N   1 
ATOM   2653 C CA  . SER A 1 358 ? 23.274 23.988  41.365 1.00 49.68  ? 358 SER A CA  1 
ATOM   2654 C C   . SER A 1 358 ? 24.389 22.949  41.561 1.00 48.79  ? 358 SER A C   1 
ATOM   2655 O O   . SER A 1 358 ? 24.171 21.738  41.493 1.00 47.06  ? 358 SER A O   1 
ATOM   2656 C CB  . SER A 1 358 ? 23.182 24.346  39.882 1.00 48.00  ? 358 SER A CB  1 
ATOM   2657 O OG  . SER A 1 358 ? 22.122 25.258  39.656 1.00 50.55  ? 358 SER A OG  1 
ATOM   2658 N N   . MET A 1 359 ? 25.587 23.446  41.820 1.00 49.31  ? 359 MET A N   1 
ATOM   2659 C CA  . MET A 1 359 ? 26.753 22.610  42.020 1.00 49.32  ? 359 MET A CA  1 
ATOM   2660 C C   . MET A 1 359 ? 26.583 21.382  42.918 1.00 50.81  ? 359 MET A C   1 
ATOM   2661 O O   . MET A 1 359 ? 26.910 20.264  42.509 1.00 52.97  ? 359 MET A O   1 
ATOM   2662 C CB  . MET A 1 359 ? 27.900 23.476  42.527 1.00 44.82  ? 359 MET A CB  1 
ATOM   2663 C CG  . MET A 1 359 ? 29.117 23.403  41.632 1.00 40.66  ? 359 MET A CG  1 
ATOM   2664 S SD  . MET A 1 359 ? 28.706 23.537  39.898 1.00 31.42  ? 359 MET A SD  1 
ATOM   2665 C CE  . MET A 1 359 ? 29.724 22.346  39.279 1.00 37.87  ? 359 MET A CE  1 
ATOM   2666 N N   . PRO A 1 360 ? 26.068 21.558  44.141 1.00 51.01  ? 360 PRO A N   1 
ATOM   2667 C CA  . PRO A 1 360 ? 25.905 20.396  45.019 1.00 52.11  ? 360 PRO A CA  1 
ATOM   2668 C C   . PRO A 1 360 ? 25.269 19.174  44.341 1.00 53.31  ? 360 PRO A C   1 
ATOM   2669 O O   . PRO A 1 360 ? 25.607 18.029  44.684 1.00 53.52  ? 360 PRO A O   1 
ATOM   2670 C CB  . PRO A 1 360 ? 25.056 20.949  46.161 1.00 50.79  ? 360 PRO A CB  1 
ATOM   2671 C CG  . PRO A 1 360 ? 25.493 22.359  46.235 1.00 51.55  ? 360 PRO A CG  1 
ATOM   2672 C CD  . PRO A 1 360 ? 25.512 22.761  44.775 1.00 51.93  ? 360 PRO A CD  1 
ATOM   2673 N N   . ASN A 1 361 ? 24.365 19.418  43.384 1.00 52.96  ? 361 ASN A N   1 
ATOM   2674 C CA  . ASN A 1 361 ? 23.690 18.332  42.665 1.00 52.65  ? 361 ASN A CA  1 
ATOM   2675 C C   . ASN A 1 361 ? 24.230 18.051  41.269 1.00 51.89  ? 361 ASN A C   1 
ATOM   2676 O O   . ASN A 1 361 ? 23.644 17.257  40.537 1.00 53.14  ? 361 ASN A O   1 
ATOM   2677 C CB  . ASN A 1 361 ? 22.183 18.596  42.529 1.00 52.24  ? 361 ASN A CB  1 
ATOM   2678 C CG  . ASN A 1 361 ? 21.401 18.168  43.746 1.00 53.45  ? 361 ASN A CG  1 
ATOM   2679 O OD1 . ASN A 1 361 ? 21.808 17.263  44.478 1.00 55.82  ? 361 ASN A OD1 1 
ATOM   2680 N ND2 . ASN A 1 361 ? 20.256 18.801  43.960 1.00 54.47  ? 361 ASN A ND2 1 
ATOM   2681 N N   . LEU A 1 362 ? 25.331 18.687  40.886 1.00 50.28  ? 362 LEU A N   1 
ATOM   2682 C CA  . LEU A 1 362 ? 25.877 18.460  39.553 1.00 49.27  ? 362 LEU A CA  1 
ATOM   2683 C C   . LEU A 1 362 ? 26.881 17.313  39.585 1.00 49.47  ? 362 LEU A C   1 
ATOM   2684 O O   . LEU A 1 362 ? 27.829 17.326  40.376 1.00 49.81  ? 362 LEU A O   1 
ATOM   2685 C CB  . LEU A 1 362 ? 26.548 19.731  39.029 1.00 48.17  ? 362 LEU A CB  1 
ATOM   2686 C CG  . LEU A 1 362 ? 26.838 19.718  37.529 1.00 47.66  ? 362 LEU A CG  1 
ATOM   2687 C CD1 . LEU A 1 362 ? 25.554 19.886  36.763 1.00 47.04  ? 362 LEU A CD1 1 
ATOM   2688 C CD2 . LEU A 1 362 ? 27.780 20.831  37.172 1.00 49.14  ? 362 LEU A CD2 1 
ATOM   2689 N N   . VAL A 1 363 ? 26.657 16.316  38.730 1.00 49.20  ? 363 VAL A N   1 
ATOM   2690 C CA  . VAL A 1 363 ? 27.532 15.143  38.648 1.00 48.58  ? 363 VAL A CA  1 
ATOM   2691 C C   . VAL A 1 363 ? 28.585 15.288  37.523 1.00 47.46  ? 363 VAL A C   1 
ATOM   2692 O O   . VAL A 1 363 ? 29.759 14.972  37.713 1.00 45.60  ? 363 VAL A O   1 
ATOM   2693 C CB  . VAL A 1 363 ? 26.692 13.843  38.442 1.00 48.50  ? 363 VAL A CB  1 
ATOM   2694 C CG1 . VAL A 1 363 ? 27.582 12.623  38.538 1.00 47.94  ? 363 VAL A CG1 1 
ATOM   2695 C CG2 . VAL A 1 363 ? 25.579 13.765  39.487 1.00 45.83  ? 363 VAL A CG2 1 
ATOM   2696 N N   . GLY A 1 364 ? 28.173 15.770  36.356 1.00 46.64  ? 364 GLY A N   1 
ATOM   2697 C CA  . GLY A 1 364 ? 29.135 15.958  35.286 1.00 46.83  ? 364 GLY A CA  1 
ATOM   2698 C C   . GLY A 1 364 ? 28.628 16.809  34.135 1.00 46.78  ? 364 GLY A C   1 
ATOM   2699 O O   . GLY A 1 364 ? 27.490 17.270  34.137 1.00 46.56  ? 364 GLY A O   1 
ATOM   2700 N N   . VAL A 1 365 ? 29.491 17.034  33.154 1.00 46.81  ? 365 VAL A N   1 
ATOM   2701 C CA  . VAL A 1 365 ? 29.131 17.792  31.965 1.00 48.16  ? 365 VAL A CA  1 
ATOM   2702 C C   . VAL A 1 365 ? 30.071 17.330  30.873 1.00 46.73  ? 365 VAL A C   1 
ATOM   2703 O O   . VAL A 1 365 ? 31.228 17.014  31.137 1.00 45.84  ? 365 VAL A O   1 
ATOM   2704 C CB  . VAL A 1 365 ? 29.289 19.310  32.152 1.00 50.25  ? 365 VAL A CB  1 
ATOM   2705 C CG1 . VAL A 1 365 ? 28.463 19.773  33.337 1.00 51.61  ? 365 VAL A CG1 1 
ATOM   2706 C CG2 . VAL A 1 365 ? 30.747 19.664  32.332 1.00 50.77  ? 365 VAL A CG2 1 
ATOM   2707 N N   . SER A 1 366 ? 29.570 17.282  29.650 1.00 44.83  ? 366 SER A N   1 
ATOM   2708 C CA  . SER A 1 366 ? 30.385 16.820  28.560 1.00 45.77  ? 366 SER A CA  1 
ATOM   2709 C C   . SER A 1 366 ? 30.325 17.780  27.411 1.00 47.06  ? 366 SER A C   1 
ATOM   2710 O O   . SER A 1 366 ? 29.250 18.166  26.959 1.00 50.37  ? 366 SER A O   1 
ATOM   2711 C CB  . SER A 1 366 ? 29.917 15.446  28.116 1.00 47.71  ? 366 SER A CB  1 
ATOM   2712 O OG  . SER A 1 366 ? 29.850 14.574  29.229 1.00 50.16  ? 366 SER A OG  1 
ATOM   2713 N N   . LEU A 1 367 ? 31.502 18.151  26.933 1.00 46.51  ? 367 LEU A N   1 
ATOM   2714 C CA  . LEU A 1 367 ? 31.652 19.096  25.842 1.00 45.40  ? 367 LEU A CA  1 
ATOM   2715 C C   . LEU A 1 367 ? 32.048 18.357  24.547 1.00 44.49  ? 367 LEU A C   1 
ATOM   2716 O O   . LEU A 1 367 ? 33.130 17.777  24.444 1.00 44.10  ? 367 LEU A O   1 
ATOM   2717 C CB  . LEU A 1 367 ? 32.696 20.125  26.267 1.00 43.69  ? 367 LEU A CB  1 
ATOM   2718 C CG  . LEU A 1 367 ? 33.235 21.177  25.310 1.00 46.40  ? 367 LEU A CG  1 
ATOM   2719 C CD1 . LEU A 1 367 ? 32.117 22.088  24.794 1.00 45.87  ? 367 LEU A CD1 1 
ATOM   2720 C CD2 . LEU A 1 367 ? 34.296 21.971  26.061 1.00 46.01  ? 367 LEU A CD2 1 
ATOM   2721 N N   . MET A 1 368 ? 31.151 18.387  23.565 1.00 43.49  ? 368 MET A N   1 
ATOM   2722 C CA  . MET A 1 368 ? 31.354 17.698  22.299 1.00 42.85  ? 368 MET A CA  1 
ATOM   2723 C C   . MET A 1 368 ? 31.330 18.639  21.070 1.00 45.38  ? 368 MET A C   1 
ATOM   2724 O O   . MET A 1 368 ? 30.333 19.321  20.800 1.00 46.54  ? 368 MET A O   1 
ATOM   2725 C CB  . MET A 1 368 ? 30.273 16.607  22.169 1.00 38.94  ? 368 MET A CB  1 
ATOM   2726 C CG  . MET A 1 368 ? 30.305 15.566  23.311 1.00 40.28  ? 368 MET A CG  1 
ATOM   2727 S SD  . MET A 1 368 ? 28.754 14.627  23.668 1.00 36.24  ? 368 MET A SD  1 
ATOM   2728 C CE  . MET A 1 368 ? 27.869 15.782  24.624 1.00 37.98  ? 368 MET A CE  1 
ATOM   2729 N N   . LEU A 1 369 ? 32.436 18.677  20.332 1.00 46.08  ? 369 LEU A N   1 
ATOM   2730 C CA  . LEU A 1 369 ? 32.534 19.503  19.129 1.00 47.52  ? 369 LEU A CA  1 
ATOM   2731 C C   . LEU A 1 369 ? 33.466 18.819  18.131 1.00 49.94  ? 369 LEU A C   1 
ATOM   2732 O O   . LEU A 1 369 ? 34.251 17.958  18.510 1.00 51.67  ? 369 LEU A O   1 
ATOM   2733 C CB  . LEU A 1 369 ? 33.076 20.885  19.465 1.00 45.45  ? 369 LEU A CB  1 
ATOM   2734 C CG  . LEU A 1 369 ? 34.435 20.942  20.166 1.00 45.54  ? 369 LEU A CG  1 
ATOM   2735 C CD1 . LEU A 1 369 ? 35.027 22.319  19.954 1.00 44.63  ? 369 LEU A CD1 1 
ATOM   2736 C CD2 . LEU A 1 369 ? 34.294 20.631  21.660 1.00 41.80  ? 369 LEU A CD2 1 
ATOM   2737 N N   . GLU A 1 370 ? 33.379 19.197  16.861 1.00 51.77  ? 370 GLU A N   1 
ATOM   2738 C CA  . GLU A 1 370 ? 34.212 18.598  15.826 1.00 53.02  ? 370 GLU A CA  1 
ATOM   2739 C C   . GLU A 1 370 ? 35.612 18.241  16.304 1.00 52.92  ? 370 GLU A C   1 
ATOM   2740 O O   . GLU A 1 370 ? 36.414 19.113  16.631 1.00 54.22  ? 370 GLU A O   1 
ATOM   2741 C CB  . GLU A 1 370 ? 34.310 19.537  14.624 1.00 56.94  ? 370 GLU A CB  1 
ATOM   2742 C CG  . GLU A 1 370 ? 35.444 19.215  13.631 1.00 64.97  ? 370 GLU A CG  1 
ATOM   2743 C CD  . GLU A 1 370 ? 35.345 17.820  12.984 1.00 69.53  ? 370 GLU A CD  1 
ATOM   2744 O OE1 . GLU A 1 370 ? 34.311 17.501  12.342 1.00 71.80  ? 370 GLU A OE1 1 
ATOM   2745 O OE2 . GLU A 1 370 ? 36.316 17.037  13.112 1.00 71.49  ? 370 GLU A OE2 1 
ATOM   2746 N N   . GLY A 1 371 ? 35.891 16.946  16.359 1.00 52.03  ? 371 GLY A N   1 
ATOM   2747 C CA  . GLY A 1 371 ? 37.204 16.487  16.767 1.00 51.31  ? 371 GLY A CA  1 
ATOM   2748 C C   . GLY A 1 371 ? 37.568 16.487  18.241 1.00 50.71  ? 371 GLY A C   1 
ATOM   2749 O O   . GLY A 1 371 ? 38.713 16.196  18.565 1.00 52.14  ? 371 GLY A O   1 
ATOM   2750 N N   . GLN A 1 372 ? 36.633 16.780  19.138 1.00 49.43  ? 372 GLN A N   1 
ATOM   2751 C CA  . GLN A 1 372 ? 36.970 16.811  20.554 1.00 48.86  ? 372 GLN A CA  1 
ATOM   2752 C C   . GLN A 1 372 ? 35.806 16.515  21.480 1.00 49.14  ? 372 GLN A C   1 
ATOM   2753 O O   . GLN A 1 372 ? 34.705 17.047  21.303 1.00 49.27  ? 372 GLN A O   1 
ATOM   2754 C CB  . GLN A 1 372 ? 37.538 18.178  20.935 1.00 48.67  ? 372 GLN A CB  1 
ATOM   2755 C CG  . GLN A 1 372 ? 38.793 18.586  20.201 1.00 49.98  ? 372 GLN A CG  1 
ATOM   2756 C CD  . GLN A 1 372 ? 39.306 19.927  20.676 1.00 51.90  ? 372 GLN A CD  1 
ATOM   2757 O OE1 . GLN A 1 372 ? 39.775 20.050  21.807 1.00 50.82  ? 372 GLN A OE1 1 
ATOM   2758 N NE2 . GLN A 1 372 ? 39.201 20.951  19.821 1.00 51.79  ? 372 GLN A NE2 1 
ATOM   2759 N N   . GLN A 1 373 ? 36.062 15.683  22.484 1.00 48.34  ? 373 GLN A N   1 
ATOM   2760 C CA  . GLN A 1 373 ? 35.046 15.337  23.459 1.00 47.28  ? 373 GLN A CA  1 
ATOM   2761 C C   . GLN A 1 373 ? 35.656 15.258  24.854 1.00 48.20  ? 373 GLN A C   1 
ATOM   2762 O O   . GLN A 1 373 ? 36.684 14.613  25.059 1.00 48.17  ? 373 GLN A O   1 
ATOM   2763 C CB  . GLN A 1 373 ? 34.386 14.005  23.105 1.00 45.29  ? 373 GLN A CB  1 
ATOM   2764 C CG  . GLN A 1 373 ? 33.456 13.518  24.202 1.00 45.82  ? 373 GLN A CG  1 
ATOM   2765 C CD  . GLN A 1 373 ? 32.732 12.243  23.849 1.00 45.77  ? 373 GLN A CD  1 
ATOM   2766 O OE1 . GLN A 1 373 ? 31.907 12.217  22.927 1.00 47.73  ? 373 GLN A OE1 1 
ATOM   2767 N NE2 . GLN A 1 373 ? 33.030 11.172  24.578 1.00 42.25  ? 373 GLN A NE2 1 
ATOM   2768 N N   . TYR A 1 374 ? 35.015 15.915  25.816 1.00 48.97  ? 374 TYR A N   1 
ATOM   2769 C CA  . TYR A 1 374 ? 35.522 15.923  27.178 1.00 49.34  ? 374 TYR A CA  1 
ATOM   2770 C C   . TYR A 1 374 ? 34.446 15.618  28.196 1.00 49.39  ? 374 TYR A C   1 
ATOM   2771 O O   . TYR A 1 374 ? 33.386 16.236  28.207 1.00 50.80  ? 374 TYR A O   1 
ATOM   2772 C CB  . TYR A 1 374 ? 36.173 17.276  27.473 1.00 49.35  ? 374 TYR A CB  1 
ATOM   2773 C CG  . TYR A 1 374 ? 37.361 17.519  26.579 1.00 54.05  ? 374 TYR A CG  1 
ATOM   2774 C CD1 . TYR A 1 374 ? 38.528 16.752  26.722 1.00 54.87  ? 374 TYR A CD1 1 
ATOM   2775 C CD2 . TYR A 1 374 ? 37.276 18.409  25.491 1.00 54.84  ? 374 TYR A CD2 1 
ATOM   2776 C CE1 . TYR A 1 374 ? 39.569 16.851  25.798 1.00 56.77  ? 374 TYR A CE1 1 
ATOM   2777 C CE2 . TYR A 1 374 ? 38.308 18.517  24.562 1.00 55.55  ? 374 TYR A CE2 1 
ATOM   2778 C CZ  . TYR A 1 374 ? 39.444 17.732  24.720 1.00 56.89  ? 374 TYR A CZ  1 
ATOM   2779 O OH  . TYR A 1 374 ? 40.437 17.792  23.780 1.00 57.84  ? 374 TYR A OH  1 
ATOM   2780 N N   . ARG A 1 375 ? 34.724 14.646  29.051 1.00 47.98  ? 375 ARG A N   1 
ATOM   2781 C CA  . ARG A 1 375 ? 33.779 14.266  30.079 1.00 46.47  ? 375 ARG A CA  1 
ATOM   2782 C C   . ARG A 1 375 ? 34.256 14.755  31.447 1.00 47.55  ? 375 ARG A C   1 
ATOM   2783 O O   . ARG A 1 375 ? 35.147 14.171  32.060 1.00 46.13  ? 375 ARG A O   1 
ATOM   2784 C CB  . ARG A 1 375 ? 33.605 12.748  30.074 1.00 45.70  ? 375 ARG A CB  1 
ATOM   2785 C CG  . ARG A 1 375 ? 32.711 12.195  31.153 1.00 44.82  ? 375 ARG A CG  1 
ATOM   2786 C CD  . ARG A 1 375 ? 32.662 10.677  31.058 1.00 48.78  ? 375 ARG A CD  1 
ATOM   2787 N NE  . ARG A 1 375 ? 31.926 10.066  32.163 1.00 52.80  ? 375 ARG A NE  1 
ATOM   2788 C CZ  . ARG A 1 375 ? 31.371 8.858   32.123 1.00 53.57  ? 375 ARG A CZ  1 
ATOM   2789 N NH1 . ARG A 1 375 ? 31.466 8.114   31.025 1.00 52.78  ? 375 ARG A NH1 1 
ATOM   2790 N NH2 . ARG A 1 375 ? 30.703 8.401   33.180 1.00 54.25  ? 375 ARG A NH2 1 
ATOM   2791 N N   . LEU A 1 376 ? 33.659 15.845  31.918 1.00 48.18  ? 376 LEU A N   1 
ATOM   2792 C CA  . LEU A 1 376 ? 34.006 16.397  33.217 1.00 48.78  ? 376 LEU A CA  1 
ATOM   2793 C C   . LEU A 1 376 ? 33.202 15.756  34.327 1.00 49.58  ? 376 LEU A C   1 
ATOM   2794 O O   . LEU A 1 376 ? 31.978 15.809  34.323 1.00 50.06  ? 376 LEU A O   1 
ATOM   2795 C CB  . LEU A 1 376 ? 33.758 17.900  33.229 1.00 48.46  ? 376 LEU A CB  1 
ATOM   2796 C CG  . LEU A 1 376 ? 34.901 18.700  32.614 1.00 51.25  ? 376 LEU A CG  1 
ATOM   2797 C CD1 . LEU A 1 376 ? 35.407 18.029  31.324 1.00 50.61  ? 376 LEU A CD1 1 
ATOM   2798 C CD2 . LEU A 1 376 ? 34.420 20.111  32.358 1.00 49.82  ? 376 LEU A CD2 1 
ATOM   2799 N N   . GLU A 1 377 ? 33.897 15.150  35.280 1.00 51.70  ? 377 GLU A N   1 
ATOM   2800 C CA  . GLU A 1 377 ? 33.235 14.514  36.405 1.00 54.57  ? 377 GLU A CA  1 
ATOM   2801 C C   . GLU A 1 377 ? 33.481 15.316  37.685 1.00 54.64  ? 377 GLU A C   1 
ATOM   2802 O O   . GLU A 1 377 ? 34.602 15.725  37.979 1.00 53.75  ? 377 GLU A O   1 
ATOM   2803 C CB  . GLU A 1 377 ? 33.741 13.083  36.579 1.00 58.28  ? 377 GLU A CB  1 
ATOM   2804 C CG  . GLU A 1 377 ? 33.947 12.340  35.268 1.00 63.10  ? 377 GLU A CG  1 
ATOM   2805 C CD  . GLU A 1 377 ? 33.099 11.076  35.155 1.00 67.34  ? 377 GLU A CD  1 
ATOM   2806 O OE1 . GLU A 1 377 ? 31.860 11.172  35.319 1.00 69.08  ? 377 GLU A OE1 1 
ATOM   2807 O OE2 . GLU A 1 377 ? 33.665 9.987   34.891 1.00 68.09  ? 377 GLU A OE2 1 
ATOM   2808 N N   . TYR A 1 378 ? 32.409 15.535  38.436 1.00 56.16  ? 378 TYR A N   1 
ATOM   2809 C CA  . TYR A 1 378 ? 32.465 16.287  39.677 1.00 56.94  ? 378 TYR A CA  1 
ATOM   2810 C C   . TYR A 1 378 ? 32.391 15.392  40.884 1.00 60.52  ? 378 TYR A C   1 
ATOM   2811 O O   . TYR A 1 378 ? 32.001 15.820  41.959 1.00 59.71  ? 378 TYR A O   1 
ATOM   2812 C CB  . TYR A 1 378 ? 31.340 17.296  39.709 1.00 52.54  ? 378 TYR A CB  1 
ATOM   2813 C CG  . TYR A 1 378 ? 31.518 18.293  38.625 1.00 50.47  ? 378 TYR A CG  1 
ATOM   2814 C CD1 . TYR A 1 378 ? 32.431 19.331  38.758 1.00 49.02  ? 378 TYR A CD1 1 
ATOM   2815 C CD2 . TYR A 1 378 ? 30.847 18.148  37.423 1.00 51.00  ? 378 TYR A CD2 1 
ATOM   2816 C CE1 . TYR A 1 378 ? 32.675 20.194  37.716 1.00 50.16  ? 378 TYR A CE1 1 
ATOM   2817 C CE2 . TYR A 1 378 ? 31.080 19.000  36.369 1.00 51.67  ? 378 TYR A CE2 1 
ATOM   2818 C CZ  . TYR A 1 378 ? 31.995 20.020  36.517 1.00 51.58  ? 378 TYR A CZ  1 
ATOM   2819 O OH  . TYR A 1 378 ? 32.233 20.856  35.455 1.00 53.23  ? 378 TYR A OH  1 
ATOM   2820 N N   . PHE A 1 379 ? 32.790 14.144  40.686 1.00 66.25  ? 379 PHE A N   1 
ATOM   2821 C CA  . PHE A 1 379 ? 32.793 13.147  41.743 1.00 71.85  ? 379 PHE A CA  1 
ATOM   2822 C C   . PHE A 1 379 ? 33.894 12.135  41.428 1.00 74.84  ? 379 PHE A C   1 
ATOM   2823 O O   . PHE A 1 379 ? 34.483 12.152  40.345 1.00 75.52  ? 379 PHE A O   1 
ATOM   2824 C CB  . PHE A 1 379 ? 31.467 12.409  41.762 1.00 73.59  ? 379 PHE A CB  1 
ATOM   2825 C CG  . PHE A 1 379 ? 31.349 11.400  40.669 1.00 75.65  ? 379 PHE A CG  1 
ATOM   2826 C CD1 . PHE A 1 379 ? 31.377 11.799  39.339 1.00 76.79  ? 379 PHE A CD1 1 
ATOM   2827 C CD2 . PHE A 1 379 ? 31.301 10.044  40.963 1.00 76.17  ? 379 PHE A CD2 1 
ATOM   2828 C CE1 . PHE A 1 379 ? 31.368 10.858  38.311 1.00 78.52  ? 379 PHE A CE1 1 
ATOM   2829 C CE2 . PHE A 1 379 ? 31.292 9.091   39.943 1.00 77.13  ? 379 PHE A CE2 1 
ATOM   2830 C CZ  . PHE A 1 379 ? 31.328 9.496   38.615 1.00 77.83  ? 379 PHE A CZ  1 
ATOM   2831 N N   . GLY A 1 380 ? 34.155 11.239  42.369 1.00 78.02  ? 380 GLY A N   1 
ATOM   2832 C CA  . GLY A 1 380 ? 35.175 10.234  42.145 1.00 82.58  ? 380 GLY A CA  1 
ATOM   2833 C C   . GLY A 1 380 ? 36.559 10.821  41.969 1.00 85.94  ? 380 GLY A C   1 
ATOM   2834 O O   . GLY A 1 380 ? 36.731 12.041  41.976 1.00 86.31  ? 380 GLY A O   1 
ATOM   2835 N N   . ASP A 1 381 ? 37.549 9.948   41.803 1.00 89.77  ? 381 ASP A N   1 
ATOM   2836 C CA  . ASP A 1 381 ? 38.934 10.377  41.641 1.00 93.49  ? 381 ASP A CA  1 
ATOM   2837 C C   . ASP A 1 381 ? 39.578 9.804   40.377 1.00 96.08  ? 381 ASP A C   1 
ATOM   2838 O O   . ASP A 1 381 ? 40.792 9.924   40.180 1.00 96.28  ? 381 ASP A O   1 
ATOM   2839 C CB  . ASP A 1 381 ? 39.743 9.964   42.871 1.00 93.55  ? 381 ASP A CB  1 
ATOM   2840 C CG  . ASP A 1 381 ? 39.083 10.392  44.164 1.00 93.73  ? 381 ASP A CG  1 
ATOM   2841 O OD1 . ASP A 1 381 ? 38.991 11.612  44.409 1.00 93.82  ? 381 ASP A OD1 1 
ATOM   2842 O OD2 . ASP A 1 381 ? 38.642 9.509   44.929 1.00 94.63  ? 381 ASP A OD2 1 
ATOM   2843 N N   . HIS A 1 382 ? 38.761 9.178   39.531 1.00 99.35  ? 382 HIS A N   1 
ATOM   2844 C CA  . HIS A 1 382 ? 39.230 8.597   38.269 1.00 102.17 ? 382 HIS A CA  1 
ATOM   2845 C C   . HIS A 1 382 ? 38.154 8.733   37.177 1.00 102.27 ? 382 HIS A C   1 
ATOM   2846 O O   . HIS A 1 382 ? 38.180 7.931   36.215 1.00 101.71 ? 382 HIS A O   1 
ATOM   2847 C CB  . HIS A 1 382 ? 39.579 7.110   38.452 1.00 105.05 ? 382 HIS A CB  1 
ATOM   2848 C CG  . HIS A 1 382 ? 40.628 6.848   39.492 1.00 108.38 ? 382 HIS A CG  1 
ATOM   2849 N ND1 . HIS A 1 382 ? 41.919 7.324   39.390 1.00 109.52 ? 382 HIS A ND1 1 
ATOM   2850 C CD2 . HIS A 1 382 ? 40.580 6.139   40.645 1.00 109.34 ? 382 HIS A CD2 1 
ATOM   2851 C CE1 . HIS A 1 382 ? 42.620 6.918   40.435 1.00 110.09 ? 382 HIS A CE1 1 
ATOM   2852 N NE2 . HIS A 1 382 ? 41.831 6.197   41.212 1.00 110.15 ? 382 HIS A NE2 1 
ATOM   2853 O OXT . HIS A 1 382 ? 37.309 9.652   37.283 1.00 101.99 ? 382 HIS A OXT 1 
ATOM   2854 N N   . ALA B 2 8   ? 32.695 40.831  48.967 1.00 70.05  ? 8   ALA D N   1 
ATOM   2855 C CA  . ALA B 2 8   ? 32.510 41.196  50.405 1.00 70.25  ? 8   ALA D CA  1 
ATOM   2856 C C   . ALA B 2 8   ? 31.511 40.256  51.095 1.00 69.83  ? 8   ALA D C   1 
ATOM   2857 O O   . ALA B 2 8   ? 31.686 39.885  52.264 1.00 69.56  ? 8   ALA D O   1 
ATOM   2858 C CB  . ALA B 2 8   ? 32.032 42.659  50.516 1.00 68.80  ? 8   ALA D CB  1 
ATOM   2859 N N   . VAL B 2 9   ? 30.470 39.864  50.363 1.00 68.58  ? 9   VAL D N   1 
ATOM   2860 C CA  . VAL B 2 9   ? 29.442 38.984  50.908 1.00 66.00  ? 9   VAL D CA  1 
ATOM   2861 C C   . VAL B 2 9   ? 29.753 37.518  50.642 1.00 63.68  ? 9   VAL D C   1 
ATOM   2862 O O   . VAL B 2 9   ? 30.059 37.128  49.517 1.00 63.40  ? 9   VAL D O   1 
ATOM   2863 C CB  . VAL B 2 9   ? 28.071 39.292  50.293 1.00 66.05  ? 9   VAL D CB  1 
ATOM   2864 C CG1 . VAL B 2 9   ? 26.973 38.647  51.120 1.00 65.66  ? 9   VAL D CG1 1 
ATOM   2865 C CG2 . VAL B 2 9   ? 27.880 40.790  50.198 1.00 67.39  ? 9   VAL D CG2 1 
ATOM   2866 N N   . THR B 2 10  ? 29.678 36.708  51.686 1.00 60.29  ? 10  THR D N   1 
ATOM   2867 C CA  . THR B 2 10  ? 29.930 35.294  51.542 1.00 58.76  ? 10  THR D CA  1 
ATOM   2868 C C   . THR B 2 10  ? 28.686 34.574  52.020 1.00 59.20  ? 10  THR D C   1 
ATOM   2869 O O   . THR B 2 10  ? 27.999 35.051  52.922 1.00 58.39  ? 10  THR D O   1 
ATOM   2870 C CB  . THR B 2 10  ? 31.167 34.858  52.348 1.00 57.74  ? 10  THR D CB  1 
ATOM   2871 O OG1 . THR B 2 10  ? 31.039 35.282  53.711 1.00 54.13  ? 10  THR D OG1 1 
ATOM   2872 C CG2 . THR B 2 10  ? 32.423 35.461  51.732 1.00 56.74  ? 10  THR D CG2 1 
ATOM   2873 N N   . CYS B 2 11  ? 28.387 33.436  51.401 1.00 60.39  ? 11  CYS D N   1 
ATOM   2874 C CA  . CYS B 2 11  ? 27.194 32.673  51.754 1.00 62.72  ? 11  CYS D CA  1 
ATOM   2875 C C   . CYS B 2 11  ? 27.482 31.211  52.012 1.00 62.73  ? 11  CYS D C   1 
ATOM   2876 O O   . CYS B 2 11  ? 28.590 30.734  51.786 1.00 64.03  ? 11  CYS D O   1 
ATOM   2877 C CB  . CYS B 2 11  ? 26.157 32.762  50.635 1.00 63.37  ? 11  CYS D CB  1 
ATOM   2878 S SG  . CYS B 2 11  ? 25.731 34.451  50.114 1.00 69.16  ? 11  CYS D SG  1 
ATOM   2879 N N   . CYS B 2 12  ? 26.460 30.504  52.470 1.00 61.92  ? 12  CYS D N   1 
ATOM   2880 C CA  . CYS B 2 12  ? 26.577 29.091  52.746 1.00 61.86  ? 12  CYS D CA  1 
ATOM   2881 C C   . CYS B 2 12  ? 25.847 28.320  51.662 1.00 61.79  ? 12  CYS D C   1 
ATOM   2882 O O   . CYS B 2 12  ? 24.691 28.616  51.365 1.00 63.02  ? 12  CYS D O   1 
ATOM   2883 C CB  . CYS B 2 12  ? 25.963 28.780  54.101 1.00 63.82  ? 12  CYS D CB  1 
ATOM   2884 S SG  . CYS B 2 12  ? 27.026 29.213  55.511 1.00 67.80  ? 12  CYS D SG  1 
ATOM   2885 N N   . TYR B 2 13  ? 26.520 27.332  51.072 1.00 60.70  ? 13  TYR D N   1 
ATOM   2886 C CA  . TYR B 2 13  ? 25.932 26.515  50.007 1.00 57.97  ? 13  TYR D CA  1 
ATOM   2887 C C   . TYR B 2 13  ? 25.820 25.056  50.437 1.00 56.90  ? 13  TYR D C   1 
ATOM   2888 O O   . TYR B 2 13  ? 25.195 24.244  49.753 1.00 57.57  ? 13  TYR D O   1 
ATOM   2889 C CB  . TYR B 2 13  ? 26.772 26.632  48.732 1.00 56.92  ? 13  TYR D CB  1 
ATOM   2890 C CG  . TYR B 2 13  ? 26.948 28.068  48.274 1.00 56.66  ? 13  TYR D CG  1 
ATOM   2891 C CD1 . TYR B 2 13  ? 27.563 29.006  49.098 1.00 55.11  ? 13  TYR D CD1 1 
ATOM   2892 C CD2 . TYR B 2 13  ? 26.481 28.494  47.026 1.00 56.66  ? 13  TYR D CD2 1 
ATOM   2893 C CE1 . TYR B 2 13  ? 27.709 30.319  48.702 1.00 54.54  ? 13  TYR D CE1 1 
ATOM   2894 C CE2 . TYR B 2 13  ? 26.622 29.817  46.620 1.00 54.27  ? 13  TYR D CE2 1 
ATOM   2895 C CZ  . TYR B 2 13  ? 27.239 30.720  47.469 1.00 54.58  ? 13  TYR D CZ  1 
ATOM   2896 O OH  . TYR B 2 13  ? 27.396 32.032  47.106 1.00 55.40  ? 13  TYR D OH  1 
ATOM   2897 N N   . ASN B 2 14  ? 26.424 24.739  51.580 1.00 54.31  ? 14  ASN D N   1 
ATOM   2898 C CA  . ASN B 2 14  ? 26.393 23.398  52.140 1.00 52.84  ? 14  ASN D CA  1 
ATOM   2899 C C   . ASN B 2 14  ? 26.484 23.520  53.642 1.00 53.20  ? 14  ASN D C   1 
ATOM   2900 O O   . ASN B 2 14  ? 27.208 24.369  54.146 1.00 55.59  ? 14  ASN D O   1 
ATOM   2901 C CB  . ASN B 2 14  ? 27.572 22.579  51.638 1.00 50.84  ? 14  ASN D CB  1 
ATOM   2902 C CG  . ASN B 2 14  ? 27.520 22.353  50.157 1.00 52.50  ? 14  ASN D CG  1 
ATOM   2903 O OD1 . ASN B 2 14  ? 26.679 21.593  49.662 1.00 53.50  ? 14  ASN D OD1 1 
ATOM   2904 N ND2 . ASN B 2 14  ? 28.408 23.022  49.423 1.00 52.17  ? 14  ASN D ND2 1 
ATOM   2905 N N   . PHE B 2 15  ? 25.745 22.688  54.359 1.00 53.39  ? 15  PHE D N   1 
ATOM   2906 C CA  . PHE B 2 15  ? 25.789 22.713  55.809 1.00 54.38  ? 15  PHE D CA  1 
ATOM   2907 C C   . PHE B 2 15  ? 26.555 21.512  56.279 1.00 55.39  ? 15  PHE D C   1 
ATOM   2908 O O   . PHE B 2 15  ? 26.511 20.456  55.661 1.00 55.95  ? 15  PHE D O   1 
ATOM   2909 C CB  . PHE B 2 15  ? 24.405 22.596  56.429 1.00 56.25  ? 15  PHE D CB  1 
ATOM   2910 C CG  . PHE B 2 15  ? 23.452 23.634  55.983 1.00 57.54  ? 15  PHE D CG  1 
ATOM   2911 C CD1 . PHE B 2 15  ? 23.775 24.980  56.092 1.00 56.59  ? 15  PHE D CD1 1 
ATOM   2912 C CD2 . PHE B 2 15  ? 22.216 23.264  55.466 1.00 57.21  ? 15  PHE D CD2 1 
ATOM   2913 C CE1 . PHE B 2 15  ? 22.883 25.946  55.686 1.00 58.55  ? 15  PHE D CE1 1 
ATOM   2914 C CE2 . PHE B 2 15  ? 21.313 24.222  55.055 1.00 58.43  ? 15  PHE D CE2 1 
ATOM   2915 C CZ  . PHE B 2 15  ? 21.642 25.571  55.166 1.00 59.37  ? 15  PHE D CZ  1 
ATOM   2916 N N   . THR B 2 16  ? 27.244 21.666  57.395 1.00 56.93  ? 16  THR D N   1 
ATOM   2917 C CA  . THR B 2 16  ? 27.972 20.552  57.966 1.00 57.81  ? 16  THR D CA  1 
ATOM   2918 C C   . THR B 2 16  ? 26.920 19.684  58.650 1.00 57.53  ? 16  THR D C   1 
ATOM   2919 O O   . THR B 2 16  ? 26.044 20.190  59.343 1.00 58.59  ? 16  THR D O   1 
ATOM   2920 C CB  . THR B 2 16  ? 28.983 21.023  59.016 1.00 57.56  ? 16  THR D CB  1 
ATOM   2921 O OG1 . THR B 2 16  ? 29.599 19.881  59.612 1.00 59.14  ? 16  THR D OG1 1 
ATOM   2922 C CG2 . THR B 2 16  ? 28.293 21.845  60.105 1.00 56.20  ? 16  THR D CG2 1 
ATOM   2923 N N   . ASN B 2 17  ? 26.985 18.381  58.443 1.00 57.81  ? 17  ASN D N   1 
ATOM   2924 C CA  . ASN B 2 17  ? 26.018 17.496  59.066 1.00 58.42  ? 17  ASN D CA  1 
ATOM   2925 C C   . ASN B 2 17  ? 26.645 16.998  60.330 1.00 58.93  ? 17  ASN D C   1 
ATOM   2926 O O   . ASN B 2 17  ? 26.057 16.203  61.055 1.00 59.34  ? 17  ASN D O   1 
ATOM   2927 C CB  . ASN B 2 17  ? 25.698 16.318  58.149 1.00 58.94  ? 17  ASN D CB  1 
ATOM   2928 C CG  . ASN B 2 17  ? 25.070 16.761  56.853 1.00 58.05  ? 17  ASN D CG  1 
ATOM   2929 O OD1 . ASN B 2 17  ? 24.057 17.453  56.862 1.00 58.96  ? 17  ASN D OD1 1 
ATOM   2930 N ND2 . ASN B 2 17  ? 25.670 16.375  55.729 1.00 56.83  ? 17  ASN D ND2 1 
ATOM   2931 N N   . ARG B 2 18  ? 27.852 17.486  60.587 1.00 60.82  ? 18  ARG D N   1 
ATOM   2932 C CA  . ARG B 2 18  ? 28.618 17.098  61.766 1.00 62.92  ? 18  ARG D CA  1 
ATOM   2933 C C   . ARG B 2 18  ? 28.579 18.155  62.845 1.00 63.01  ? 18  ARG D C   1 
ATOM   2934 O O   . ARG B 2 18  ? 28.888 19.318  62.595 1.00 63.22  ? 18  ARG D O   1 
ATOM   2935 C CB  . ARG B 2 18  ? 30.066 16.814  61.369 1.00 64.22  ? 18  ARG D CB  1 
ATOM   2936 C CG  . ARG B 2 18  ? 30.167 15.673  60.379 1.00 66.89  ? 18  ARG D CG  1 
ATOM   2937 C CD  . ARG B 2 18  ? 31.534 15.562  59.768 1.00 70.95  ? 18  ARG D CD  1 
ATOM   2938 N NE  . ARG B 2 18  ? 31.477 14.746  58.561 1.00 74.84  ? 18  ARG D NE  1 
ATOM   2939 C CZ  . ARG B 2 18  ? 32.490 14.586  57.717 1.00 75.83  ? 18  ARG D CZ  1 
ATOM   2940 N NH1 . ARG B 2 18  ? 33.649 15.190  57.952 1.00 74.85  ? 18  ARG D NH1 1 
ATOM   2941 N NH2 . ARG B 2 18  ? 32.335 13.831  56.637 1.00 76.50  ? 18  ARG D NH2 1 
ATOM   2942 N N   . LYS B 2 19  ? 28.193 17.736  64.046 1.00 63.43  ? 19  LYS D N   1 
ATOM   2943 C CA  . LYS B 2 19  ? 28.105 18.639  65.182 1.00 64.09  ? 19  LYS D CA  1 
ATOM   2944 C C   . LYS B 2 19  ? 29.494 19.116  65.602 1.00 64.56  ? 19  LYS D C   1 
ATOM   2945 O O   . LYS B 2 19  ? 30.507 18.474  65.329 1.00 63.39  ? 19  LYS D O   1 
ATOM   2946 C CB  . LYS B 2 19  ? 27.407 17.940  66.352 1.00 64.24  ? 19  LYS D CB  1 
ATOM   2947 C CG  . LYS B 2 19  ? 27.135 18.815  67.577 1.00 65.70  ? 19  LYS D CG  1 
ATOM   2948 C CD  . LYS B 2 19  ? 26.572 17.963  68.717 1.00 66.96  ? 19  LYS D CD  1 
ATOM   2949 C CE  . LYS B 2 19  ? 26.170 18.787  69.936 1.00 67.09  ? 19  LYS D CE  1 
ATOM   2950 N NZ  . LYS B 2 19  ? 25.458 17.936  70.946 1.00 67.35  ? 19  LYS D NZ  1 
ATOM   2951 N N   . ILE B 2 20  ? 29.525 20.270  66.251 1.00 66.01  ? 20  ILE D N   1 
ATOM   2952 C CA  . ILE B 2 20  ? 30.761 20.852  66.720 1.00 67.51  ? 20  ILE D CA  1 
ATOM   2953 C C   . ILE B 2 20  ? 30.676 20.967  68.229 1.00 70.13  ? 20  ILE D C   1 
ATOM   2954 O O   . ILE B 2 20  ? 29.620 21.314  68.789 1.00 69.51  ? 20  ILE D O   1 
ATOM   2955 C CB  . ILE B 2 20  ? 30.970 22.256  66.151 1.00 66.99  ? 20  ILE D CB  1 
ATOM   2956 C CG1 . ILE B 2 20  ? 30.816 22.224  64.634 1.00 66.49  ? 20  ILE D CG1 1 
ATOM   2957 C CG2 . ILE B 2 20  ? 32.348 22.769  66.534 1.00 67.40  ? 20  ILE D CG2 1 
ATOM   2958 C CD1 . ILE B 2 20  ? 31.064 23.554  63.966 1.00 65.45  ? 20  ILE D CD1 1 
ATOM   2959 N N   . SER B 2 21  ? 31.794 20.667  68.882 1.00 72.63  ? 21  SER D N   1 
ATOM   2960 C CA  . SER B 2 21  ? 31.876 20.736  70.330 1.00 74.03  ? 21  SER D CA  1 
ATOM   2961 C C   . SER B 2 21  ? 31.640 22.173  70.751 1.00 74.10  ? 21  SER D C   1 
ATOM   2962 O O   . SER B 2 21  ? 32.354 23.080  70.326 1.00 73.51  ? 21  SER D O   1 
ATOM   2963 C CB  . SER B 2 21  ? 33.257 20.280  70.796 1.00 75.81  ? 21  SER D CB  1 
ATOM   2964 O OG  . SER B 2 21  ? 33.354 20.317  72.209 1.00 78.43  ? 21  SER D OG  1 
ATOM   2965 N N   . VAL B 2 22  ? 30.627 22.379  71.582 1.00 75.19  ? 22  VAL D N   1 
ATOM   2966 C CA  . VAL B 2 22  ? 30.311 23.716  72.057 1.00 77.19  ? 22  VAL D CA  1 
ATOM   2967 C C   . VAL B 2 22  ? 31.545 24.331  72.708 1.00 78.45  ? 22  VAL D C   1 
ATOM   2968 O O   . VAL B 2 22  ? 31.585 25.528  72.969 1.00 78.49  ? 22  VAL D O   1 
ATOM   2969 C CB  . VAL B 2 22  ? 29.166 23.682  73.080 1.00 77.46  ? 22  VAL D CB  1 
ATOM   2970 C CG1 . VAL B 2 22  ? 27.890 23.174  72.418 1.00 78.33  ? 22  VAL D CG1 1 
ATOM   2971 C CG2 . VAL B 2 22  ? 29.549 22.782  74.242 1.00 78.21  ? 22  VAL D CG2 1 
ATOM   2972 N N   . GLN B 2 23  ? 32.555 23.502  72.957 1.00 80.34  ? 23  GLN D N   1 
ATOM   2973 C CA  . GLN B 2 23  ? 33.794 23.961  73.578 1.00 81.46  ? 23  GLN D CA  1 
ATOM   2974 C C   . GLN B 2 23  ? 34.733 24.598  72.565 1.00 80.65  ? 23  GLN D C   1 
ATOM   2975 O O   . GLN B 2 23  ? 35.805 25.079  72.929 1.00 81.61  ? 23  GLN D O   1 
ATOM   2976 C CB  . GLN B 2 23  ? 34.530 22.800  74.276 1.00 83.36  ? 23  GLN D CB  1 
ATOM   2977 C CG  . GLN B 2 23  ? 33.712 22.071  75.338 1.00 86.45  ? 23  GLN D CG  1 
ATOM   2978 C CD  . GLN B 2 23  ? 32.993 23.025  76.286 1.00 88.83  ? 23  GLN D CD  1 
ATOM   2979 O OE1 . GLN B 2 23  ? 33.622 23.803  77.015 1.00 89.67  ? 23  GLN D OE1 1 
ATOM   2980 N NE2 . GLN B 2 23  ? 31.665 22.973  76.273 1.00 89.66  ? 23  GLN D NE2 1 
ATOM   2981 N N   . ARG B 2 24  ? 34.348 24.598  71.294 1.00 78.95  ? 24  ARG D N   1 
ATOM   2982 C CA  . ARG B 2 24  ? 35.207 25.193  70.277 1.00 77.82  ? 24  ARG D CA  1 
ATOM   2983 C C   . ARG B 2 24  ? 34.485 26.215  69.436 1.00 76.02  ? 24  ARG D C   1 
ATOM   2984 O O   . ARG B 2 24  ? 35.012 26.690  68.434 1.00 74.54  ? 24  ARG D O   1 
ATOM   2985 C CB  . ARG B 2 24  ? 35.812 24.108  69.383 1.00 78.36  ? 24  ARG D CB  1 
ATOM   2986 C CG  . ARG B 2 24  ? 36.916 23.351  70.090 1.00 79.71  ? 24  ARG D CG  1 
ATOM   2987 C CD  . ARG B 2 24  ? 37.554 22.294  69.228 1.00 80.86  ? 24  ARG D CD  1 
ATOM   2988 N NE  . ARG B 2 24  ? 38.506 21.491  69.994 1.00 84.26  ? 24  ARG D NE  1 
ATOM   2989 C CZ  . ARG B 2 24  ? 38.205 20.805  71.098 1.00 87.06  ? 24  ARG D CZ  1 
ATOM   2990 N NH1 . ARG B 2 24  ? 36.970 20.817  71.589 1.00 89.65  ? 24  ARG D NH1 1 
ATOM   2991 N NH2 . ARG B 2 24  ? 39.139 20.088  71.712 1.00 87.96  ? 24  ARG D NH2 1 
ATOM   2992 N N   . LEU B 2 25  ? 33.278 26.561  69.863 1.00 75.09  ? 25  LEU D N   1 
ATOM   2993 C CA  . LEU B 2 25  ? 32.473 27.531  69.140 1.00 75.35  ? 25  LEU D CA  1 
ATOM   2994 C C   . LEU B 2 25  ? 32.484 28.888  69.825 1.00 74.69  ? 25  LEU D C   1 
ATOM   2995 O O   . LEU B 2 25  ? 31.850 29.065  70.866 1.00 74.55  ? 25  LEU D O   1 
ATOM   2996 C CB  . LEU B 2 25  ? 31.032 27.018  69.013 1.00 75.94  ? 25  LEU D CB  1 
ATOM   2997 C CG  . LEU B 2 25  ? 30.845 25.838  68.052 1.00 75.36  ? 25  LEU D CG  1 
ATOM   2998 C CD1 . LEU B 2 25  ? 29.448 25.236  68.195 1.00 74.58  ? 25  LEU D CD1 1 
ATOM   2999 C CD2 . LEU B 2 25  ? 31.099 26.327  66.629 1.00 72.32  ? 25  LEU D CD2 1 
ATOM   3000 N N   . ALA B 2 26  ? 33.210 29.839  69.241 1.00 73.86  ? 26  ALA D N   1 
ATOM   3001 C CA  . ALA B 2 26  ? 33.295 31.190  69.792 1.00 72.70  ? 26  ALA D CA  1 
ATOM   3002 C C   . ALA B 2 26  ? 31.936 31.877  69.667 1.00 73.38  ? 26  ALA D C   1 
ATOM   3003 O O   . ALA B 2 26  ? 31.138 31.884  70.609 1.00 73.26  ? 26  ALA D O   1 
ATOM   3004 C CB  . ALA B 2 26  ? 34.361 31.995  69.053 1.00 70.82  ? 26  ALA D CB  1 
ATOM   3005 N N   . SER B 2 27  ? 31.669 32.442  68.492 1.00 74.02  ? 27  SER D N   1 
ATOM   3006 C CA  . SER B 2 27  ? 30.406 33.133  68.237 1.00 72.64  ? 27  SER D CA  1 
ATOM   3007 C C   . SER B 2 27  ? 29.561 32.415  67.184 1.00 72.01  ? 27  SER D C   1 
ATOM   3008 O O   . SER B 2 27  ? 29.841 31.280  66.798 1.00 71.50  ? 27  SER D O   1 
ATOM   3009 C CB  . SER B 2 27  ? 30.688 34.558  67.764 1.00 71.94  ? 27  SER D CB  1 
ATOM   3010 O OG  . SER B 2 27  ? 31.359 34.549  66.515 1.00 70.70  ? 27  SER D OG  1 
ATOM   3011 N N   . TYR B 2 28  ? 28.521 33.097  66.726 1.00 71.33  ? 28  TYR D N   1 
ATOM   3012 C CA  . TYR B 2 28  ? 27.640 32.561  65.707 1.00 70.27  ? 28  TYR D CA  1 
ATOM   3013 C C   . TYR B 2 28  ? 26.691 33.662  65.270 1.00 69.10  ? 28  TYR D C   1 
ATOM   3014 O O   . TYR B 2 28  ? 26.163 34.413  66.094 1.00 68.32  ? 28  TYR D O   1 
ATOM   3015 C CB  . TYR B 2 28  ? 26.831 31.384  66.252 1.00 71.61  ? 28  TYR D CB  1 
ATOM   3016 C CG  . TYR B 2 28  ? 25.541 31.799  66.926 1.00 73.86  ? 28  TYR D CG  1 
ATOM   3017 C CD1 . TYR B 2 28  ? 24.354 31.933  66.195 1.00 74.50  ? 28  TYR D CD1 1 
ATOM   3018 C CD2 . TYR B 2 28  ? 25.511 32.102  68.286 1.00 74.77  ? 28  TYR D CD2 1 
ATOM   3019 C CE1 . TYR B 2 28  ? 23.172 32.363  66.807 1.00 74.90  ? 28  TYR D CE1 1 
ATOM   3020 C CE2 . TYR B 2 28  ? 24.334 32.529  68.907 1.00 75.79  ? 28  TYR D CE2 1 
ATOM   3021 C CZ  . TYR B 2 28  ? 23.173 32.660  68.164 1.00 75.30  ? 28  TYR D CZ  1 
ATOM   3022 O OH  . TYR B 2 28  ? 22.028 33.106  68.779 1.00 74.08  ? 28  TYR D OH  1 
ATOM   3023 N N   . ARG B 2 29  ? 26.480 33.753  63.966 1.00 68.03  ? 29  ARG D N   1 
ATOM   3024 C CA  . ARG B 2 29  ? 25.572 34.738  63.406 1.00 67.03  ? 29  ARG D CA  1 
ATOM   3025 C C   . ARG B 2 29  ? 24.659 34.016  62.412 1.00 68.06  ? 29  ARG D C   1 
ATOM   3026 O O   . ARG B 2 29  ? 24.909 32.861  62.040 1.00 68.34  ? 29  ARG D O   1 
ATOM   3027 C CB  . ARG B 2 29  ? 26.358 35.840  62.695 1.00 62.89  ? 29  ARG D CB  1 
ATOM   3028 C CG  . ARG B 2 29  ? 26.941 35.415  61.385 1.00 60.55  ? 29  ARG D CG  1 
ATOM   3029 C CD  . ARG B 2 29  ? 28.275 36.092  61.155 1.00 61.80  ? 29  ARG D CD  1 
ATOM   3030 N NE  . ARG B 2 29  ? 28.779 35.834  59.811 1.00 62.13  ? 29  ARG D NE  1 
ATOM   3031 C CZ  . ARG B 2 29  ? 28.142 36.204  58.705 1.00 62.18  ? 29  ARG D CZ  1 
ATOM   3032 N NH1 . ARG B 2 29  ? 26.985 36.851  58.799 1.00 63.26  ? 29  ARG D NH1 1 
ATOM   3033 N NH2 . ARG B 2 29  ? 28.647 35.918  57.512 1.00 61.94  ? 29  ARG D NH2 1 
ATOM   3034 N N   . ARG B 2 30  ? 23.594 34.694  61.998 1.00 68.37  ? 30  ARG D N   1 
ATOM   3035 C CA  . ARG B 2 30  ? 22.649 34.136  61.031 1.00 67.12  ? 30  ARG D CA  1 
ATOM   3036 C C   . ARG B 2 30  ? 22.867 34.817  59.677 1.00 66.14  ? 30  ARG D C   1 
ATOM   3037 O O   . ARG B 2 30  ? 23.283 35.978  59.627 1.00 66.66  ? 30  ARG D O   1 
ATOM   3038 C CB  . ARG B 2 30  ? 21.201 34.358  61.505 1.00 64.80  ? 30  ARG D CB  1 
ATOM   3039 C CG  . ARG B 2 30  ? 20.775 33.476  62.682 1.00 62.15  ? 30  ARG D CG  1 
ATOM   3040 C CD  . ARG B 2 30  ? 19.430 33.914  63.231 1.00 61.63  ? 30  ARG D CD  1 
ATOM   3041 N NE  . ARG B 2 30  ? 18.971 33.148  64.393 1.00 61.64  ? 30  ARG D NE  1 
ATOM   3042 C CZ  . ARG B 2 30  ? 18.537 31.887  64.355 1.00 60.46  ? 30  ARG D CZ  1 
ATOM   3043 N NH1 . ARG B 2 30  ? 18.510 31.224  63.205 1.00 59.60  ? 30  ARG D NH1 1 
ATOM   3044 N NH2 . ARG B 2 30  ? 18.083 31.304  65.462 1.00 58.07  ? 30  ARG D NH2 1 
ATOM   3045 N N   . ILE B 2 31  ? 22.632 34.084  58.590 1.00 64.43  ? 31  ILE D N   1 
ATOM   3046 C CA  . ILE B 2 31  ? 22.766 34.658  57.253 1.00 63.30  ? 31  ILE D CA  1 
ATOM   3047 C C   . ILE B 2 31  ? 21.561 35.579  57.148 1.00 62.58  ? 31  ILE D C   1 
ATOM   3048 O O   . ILE B 2 31  ? 20.461 35.182  57.540 1.00 62.29  ? 31  ILE D O   1 
ATOM   3049 C CB  . ILE B 2 31  ? 22.652 33.578  56.149 1.00 62.57  ? 31  ILE D CB  1 
ATOM   3050 C CG1 . ILE B 2 31  ? 23.992 32.875  55.948 1.00 61.56  ? 31  ILE D CG1 1 
ATOM   3051 C CG2 . ILE B 2 31  ? 22.169 34.212  54.852 1.00 63.51  ? 31  ILE D CG2 1 
ATOM   3052 C CD1 . ILE B 2 31  ? 25.066 33.780  55.376 1.00 60.49  ? 31  ILE D CD1 1 
ATOM   3053 N N   . THR B 2 32  ? 21.753 36.796  56.645 1.00 61.44  ? 32  THR D N   1 
ATOM   3054 C CA  . THR B 2 32  ? 20.631 37.730  56.523 1.00 61.57  ? 32  THR D CA  1 
ATOM   3055 C C   . THR B 2 32  ? 20.605 38.411  55.165 1.00 60.42  ? 32  THR D C   1 
ATOM   3056 O O   . THR B 2 32  ? 19.571 38.916  54.729 1.00 59.95  ? 32  THR D O   1 
ATOM   3057 C CB  . THR B 2 32  ? 20.656 38.839  57.639 1.00 61.94  ? 32  THR D CB  1 
ATOM   3058 O OG1 . THR B 2 32  ? 21.940 39.476  57.669 1.00 61.85  ? 32  THR D OG1 1 
ATOM   3059 C CG2 . THR B 2 32  ? 20.366 38.243  59.009 1.00 61.93  ? 32  THR D CG2 1 
ATOM   3060 N N   . SER B 2 33  ? 21.752 38.419  54.499 1.00 60.37  ? 33  SER D N   1 
ATOM   3061 C CA  . SER B 2 33  ? 21.860 39.049  53.196 1.00 60.87  ? 33  SER D CA  1 
ATOM   3062 C C   . SER B 2 33  ? 20.902 38.444  52.179 1.00 62.34  ? 33  SER D C   1 
ATOM   3063 O O   . SER B 2 33  ? 20.622 37.236  52.199 1.00 63.70  ? 33  SER D O   1 
ATOM   3064 C CB  . SER B 2 33  ? 23.283 38.936  52.668 1.00 59.04  ? 33  SER D CB  1 
ATOM   3065 O OG  . SER B 2 33  ? 23.339 39.373  51.328 1.00 57.37  ? 33  SER D OG  1 
ATOM   3066 N N   . SER B 2 34  ? 20.404 39.298  51.290 1.00 61.57  ? 34  SER D N   1 
ATOM   3067 C CA  . SER B 2 34  ? 19.479 38.882  50.252 1.00 60.27  ? 34  SER D CA  1 
ATOM   3068 C C   . SER B 2 34  ? 20.237 38.268  49.079 1.00 60.63  ? 34  SER D C   1 
ATOM   3069 O O   . SER B 2 34  ? 19.656 37.569  48.256 1.00 59.71  ? 34  SER D O   1 
ATOM   3070 C CB  . SER B 2 34  ? 18.666 40.084  49.776 1.00 59.74  ? 34  SER D CB  1 
ATOM   3071 O OG  . SER B 2 34  ? 19.499 41.070  49.194 1.00 57.05  ? 34  SER D OG  1 
ATOM   3072 N N   . LYS B 2 35  ? 21.537 38.536  49.014 1.00 61.84  ? 35  LYS D N   1 
ATOM   3073 C CA  . LYS B 2 35  ? 22.392 38.010  47.950 1.00 63.50  ? 35  LYS D CA  1 
ATOM   3074 C C   . LYS B 2 35  ? 22.716 36.542  48.204 1.00 64.63  ? 35  LYS D C   1 
ATOM   3075 O O   . LYS B 2 35  ? 23.347 35.875  47.374 1.00 65.33  ? 35  LYS D O   1 
ATOM   3076 C CB  . LYS B 2 35  ? 23.699 38.813  47.860 1.00 64.60  ? 35  LYS D CB  1 
ATOM   3077 C CG  . LYS B 2 35  ? 23.592 40.090  47.027 1.00 67.94  ? 35  LYS D CG  1 
ATOM   3078 C CD  . LYS B 2 35  ? 24.929 40.824  46.903 1.00 69.69  ? 35  LYS D CD  1 
ATOM   3079 C CE  . LYS B 2 35  ? 24.796 42.038  45.981 1.00 71.97  ? 35  LYS D CE  1 
ATOM   3080 N NZ  . LYS B 2 35  ? 25.980 42.964  46.025 1.00 72.99  ? 35  LYS D NZ  1 
ATOM   3081 N N   . CYS B 2 36  ? 22.286 36.046  49.360 1.00 64.08  ? 36  CYS D N   1 
ATOM   3082 C CA  . CYS B 2 36  ? 22.526 34.666  49.724 1.00 63.48  ? 36  CYS D CA  1 
ATOM   3083 C C   . CYS B 2 36  ? 21.315 33.812  49.422 1.00 63.99  ? 36  CYS D C   1 
ATOM   3084 O O   . CYS B 2 36  ? 20.180 34.239  49.616 1.00 65.11  ? 36  CYS D O   1 
ATOM   3085 C CB  . CYS B 2 36  ? 22.877 34.561  51.205 1.00 64.52  ? 36  CYS D CB  1 
ATOM   3086 S SG  . CYS B 2 36  ? 24.551 35.155  51.627 1.00 67.48  ? 36  CYS D SG  1 
ATOM   3087 N N   . PRO B 2 37  ? 21.544 32.584  48.945 1.00 64.54  ? 37  PRO D N   1 
ATOM   3088 C CA  . PRO B 2 37  ? 20.485 31.634  48.600 1.00 64.15  ? 37  PRO D CA  1 
ATOM   3089 C C   . PRO B 2 37  ? 19.960 30.703  49.705 1.00 63.86  ? 37  PRO D C   1 
ATOM   3090 O O   . PRO B 2 37  ? 18.828 30.244  49.628 1.00 64.50  ? 37  PRO D O   1 
ATOM   3091 C CB  . PRO B 2 37  ? 21.115 30.851  47.463 1.00 64.46  ? 37  PRO D CB  1 
ATOM   3092 C CG  . PRO B 2 37  ? 22.533 30.722  47.945 1.00 64.27  ? 37  PRO D CG  1 
ATOM   3093 C CD  . PRO B 2 37  ? 22.841 32.131  48.405 1.00 64.56  ? 37  PRO D CD  1 
ATOM   3094 N N   . LYS B 2 38  ? 20.759 30.402  50.719 1.00 64.04  ? 38  LYS D N   1 
ATOM   3095 C CA  . LYS B 2 38  ? 20.284 29.491  51.760 1.00 65.48  ? 38  LYS D CA  1 
ATOM   3096 C C   . LYS B 2 38  ? 20.234 30.107  53.148 1.00 67.05  ? 38  LYS D C   1 
ATOM   3097 O O   . LYS B 2 38  ? 21.093 30.908  53.521 1.00 68.46  ? 38  LYS D O   1 
ATOM   3098 C CB  . LYS B 2 38  ? 21.162 28.231  51.823 1.00 65.58  ? 38  LYS D CB  1 
ATOM   3099 C CG  . LYS B 2 38  ? 21.064 27.290  50.623 1.00 65.59  ? 38  LYS D CG  1 
ATOM   3100 C CD  . LYS B 2 38  ? 21.989 26.083  50.788 1.00 65.03  ? 38  LYS D CD  1 
ATOM   3101 C CE  . LYS B 2 38  ? 21.828 25.051  49.656 1.00 66.98  ? 38  LYS D CE  1 
ATOM   3102 N NZ  . LYS B 2 38  ? 22.416 25.422  48.320 1.00 65.87  ? 38  LYS D NZ  1 
ATOM   3103 N N   . GLU B 2 39  ? 19.216 29.732  53.911 1.00 67.86  ? 39  GLU D N   1 
ATOM   3104 C CA  . GLU B 2 39  ? 19.081 30.219  55.273 1.00 69.15  ? 39  GLU D CA  1 
ATOM   3105 C C   . GLU B 2 39  ? 20.118 29.419  56.048 1.00 68.62  ? 39  GLU D C   1 
ATOM   3106 O O   . GLU B 2 39  ? 20.074 28.189  56.054 1.00 67.61  ? 39  GLU D O   1 
ATOM   3107 C CB  . GLU B 2 39  ? 17.679 29.924  55.823 1.00 70.83  ? 39  GLU D CB  1 
ATOM   3108 C CG  . GLU B 2 39  ? 17.581 30.137  57.330 1.00 72.41  ? 39  GLU D CG  1 
ATOM   3109 C CD  . GLU B 2 39  ? 16.363 29.486  57.953 1.00 73.56  ? 39  GLU D CD  1 
ATOM   3110 O OE1 . GLU B 2 39  ? 16.054 28.320  57.603 1.00 73.19  ? 39  GLU D OE1 1 
ATOM   3111 O OE2 . GLU B 2 39  ? 15.727 30.142  58.809 1.00 74.51  ? 39  GLU D OE2 1 
ATOM   3112 N N   . ALA B 2 40  ? 21.048 30.104  56.702 1.00 68.55  ? 40  ALA D N   1 
ATOM   3113 C CA  . ALA B 2 40  ? 22.090 29.392  57.429 1.00 68.15  ? 40  ALA D CA  1 
ATOM   3114 C C   . ALA B 2 40  ? 22.609 30.086  58.671 1.00 66.95  ? 40  ALA D C   1 
ATOM   3115 O O   . ALA B 2 40  ? 22.611 31.318  58.766 1.00 67.22  ? 40  ALA D O   1 
ATOM   3116 C CB  . ALA B 2 40  ? 23.267 29.104  56.487 1.00 69.34  ? 40  ALA D CB  1 
ATOM   3117 N N   . VAL B 2 41  ? 23.071 29.267  59.611 1.00 64.33  ? 41  VAL D N   1 
ATOM   3118 C CA  . VAL B 2 41  ? 23.648 29.746  60.860 1.00 61.68  ? 41  VAL D CA  1 
ATOM   3119 C C   . VAL B 2 41  ? 25.147 29.577  60.701 1.00 60.02  ? 41  VAL D C   1 
ATOM   3120 O O   . VAL B 2 41  ? 25.608 28.471  60.444 1.00 59.46  ? 41  VAL D O   1 
ATOM   3121 C CB  . VAL B 2 41  ? 23.197 28.880  62.037 1.00 61.52  ? 41  VAL D CB  1 
ATOM   3122 C CG1 . VAL B 2 41  ? 23.962 29.250  63.274 1.00 61.55  ? 41  VAL D CG1 1 
ATOM   3123 C CG2 . VAL B 2 41  ? 21.715 29.040  62.256 1.00 62.34  ? 41  VAL D CG2 1 
ATOM   3124 N N   . ILE B 2 42  ? 25.912 30.657  60.827 1.00 59.06  ? 42  ILE D N   1 
ATOM   3125 C CA  . ILE B 2 42  ? 27.358 30.537  60.691 1.00 58.41  ? 42  ILE D CA  1 
ATOM   3126 C C   . ILE B 2 42  ? 28.055 30.570  62.032 1.00 58.65  ? 42  ILE D C   1 
ATOM   3127 O O   . ILE B 2 42  ? 28.027 31.586  62.722 1.00 60.47  ? 42  ILE D O   1 
ATOM   3128 C CB  . ILE B 2 42  ? 27.962 31.645  59.846 1.00 58.51  ? 42  ILE D CB  1 
ATOM   3129 C CG1 . ILE B 2 42  ? 27.365 31.614  58.439 1.00 58.62  ? 42  ILE D CG1 1 
ATOM   3130 C CG2 . ILE B 2 42  ? 29.485 31.469  59.807 1.00 57.92  ? 42  ILE D CG2 1 
ATOM   3131 C CD1 . ILE B 2 42  ? 27.972 32.641  57.499 1.00 59.58  ? 42  ILE D CD1 1 
ATOM   3132 N N   . PHE B 2 43  ? 28.681 29.451  62.388 1.00 57.97  ? 43  PHE D N   1 
ATOM   3133 C CA  . PHE B 2 43  ? 29.400 29.313  63.646 1.00 56.76  ? 43  PHE D CA  1 
ATOM   3134 C C   . PHE B 2 43  ? 30.845 29.730  63.480 1.00 58.02  ? 43  PHE D C   1 
ATOM   3135 O O   . PHE B 2 43  ? 31.512 29.361  62.517 1.00 58.74  ? 43  PHE D O   1 
ATOM   3136 C CB  . PHE B 2 43  ? 29.374 27.866  64.121 1.00 56.38  ? 43  PHE D CB  1 
ATOM   3137 C CG  . PHE B 2 43  ? 28.076 27.444  64.740 1.00 55.33  ? 43  PHE D CG  1 
ATOM   3138 C CD1 . PHE B 2 43  ? 27.732 27.870  66.015 1.00 55.12  ? 43  PHE D CD1 1 
ATOM   3139 C CD2 . PHE B 2 43  ? 27.210 26.595  64.060 1.00 54.55  ? 43  PHE D CD2 1 
ATOM   3140 C CE1 . PHE B 2 43  ? 26.542 27.453  66.617 1.00 55.61  ? 43  PHE D CE1 1 
ATOM   3141 C CE2 . PHE B 2 43  ? 26.021 26.172  64.645 1.00 55.62  ? 43  PHE D CE2 1 
ATOM   3142 C CZ  . PHE B 2 43  ? 25.683 26.601  65.932 1.00 55.57  ? 43  PHE D CZ  1 
ATOM   3143 N N   . LYS B 2 44  ? 31.326 30.507  64.433 1.00 59.46  ? 44  LYS D N   1 
ATOM   3144 C CA  . LYS B 2 44  ? 32.696 30.961  64.417 1.00 61.78  ? 44  LYS D CA  1 
ATOM   3145 C C   . LYS B 2 44  ? 33.367 30.179  65.533 1.00 63.33  ? 44  LYS D C   1 
ATOM   3146 O O   . LYS B 2 44  ? 32.868 30.172  66.658 1.00 63.63  ? 44  LYS D O   1 
ATOM   3147 C CB  . LYS B 2 44  ? 32.719 32.453  64.706 1.00 63.17  ? 44  LYS D CB  1 
ATOM   3148 C CG  . LYS B 2 44  ? 34.073 33.012  65.056 1.00 66.45  ? 44  LYS D CG  1 
ATOM   3149 C CD  . LYS B 2 44  ? 33.988 34.524  65.255 1.00 67.10  ? 44  LYS D CD  1 
ATOM   3150 C CE  . LYS B 2 44  ? 33.761 35.210  63.927 1.00 65.64  ? 44  LYS D CE  1 
ATOM   3151 N NZ  . LYS B 2 44  ? 34.834 34.797  62.971 1.00 66.31  ? 44  LYS D NZ  1 
ATOM   3152 N N   . THR B 2 45  ? 34.470 29.496  65.234 1.00 65.31  ? 45  THR D N   1 
ATOM   3153 C CA  . THR B 2 45  ? 35.166 28.717  66.267 1.00 67.55  ? 45  THR D CA  1 
ATOM   3154 C C   . THR B 2 45  ? 36.093 29.589  67.100 1.00 69.39  ? 45  THR D C   1 
ATOM   3155 O O   . THR B 2 45  ? 36.199 30.801  66.876 1.00 71.13  ? 45  THR D O   1 
ATOM   3156 C CB  . THR B 2 45  ? 36.045 27.582  65.686 1.00 66.79  ? 45  THR D CB  1 
ATOM   3157 O OG1 . THR B 2 45  ? 37.077 28.147  64.872 1.00 68.07  ? 45  THR D OG1 1 
ATOM   3158 C CG2 . THR B 2 45  ? 35.224 26.626  64.863 1.00 66.47  ? 45  THR D CG2 1 
ATOM   3159 N N   . ILE B 2 46  ? 36.768 28.948  68.053 1.00 70.28  ? 46  ILE D N   1 
ATOM   3160 C CA  . ILE B 2 46  ? 37.713 29.612  68.948 1.00 68.71  ? 46  ILE D CA  1 
ATOM   3161 C C   . ILE B 2 46  ? 39.013 29.861  68.190 1.00 68.94  ? 46  ILE D C   1 
ATOM   3162 O O   . ILE B 2 46  ? 39.890 30.576  68.663 1.00 68.78  ? 46  ILE D O   1 
ATOM   3163 C CB  . ILE B 2 46  ? 38.004 28.733  70.172 1.00 67.48  ? 46  ILE D CB  1 
ATOM   3164 C CG1 . ILE B 2 46  ? 38.595 27.397  69.708 1.00 67.71  ? 46  ILE D CG1 1 
ATOM   3165 C CG2 . ILE B 2 46  ? 36.719 28.500  70.963 1.00 66.19  ? 46  ILE D CG2 1 
ATOM   3166 C CD1 . ILE B 2 46  ? 38.739 26.360  70.809 1.00 67.36  ? 46  ILE D CD1 1 
ATOM   3167 N N   . VAL B 2 47  ? 39.118 29.264  67.006 1.00 69.33  ? 47  VAL D N   1 
ATOM   3168 C CA  . VAL B 2 47  ? 40.293 29.418  66.160 1.00 69.34  ? 47  VAL D CA  1 
ATOM   3169 C C   . VAL B 2 47  ? 39.951 30.369  65.019 1.00 69.89  ? 47  VAL D C   1 
ATOM   3170 O O   . VAL B 2 47  ? 40.612 30.365  63.973 1.00 69.36  ? 47  VAL D O   1 
ATOM   3171 C CB  . VAL B 2 47  ? 40.737 28.075  65.555 1.00 69.77  ? 47  VAL D CB  1 
ATOM   3172 C CG1 . VAL B 2 47  ? 42.111 28.227  64.927 1.00 70.13  ? 47  VAL D CG1 1 
ATOM   3173 C CG2 . VAL B 2 47  ? 40.742 26.992  66.627 1.00 69.91  ? 47  VAL D CG2 1 
ATOM   3174 N N   . ALA B 2 48  ? 38.901 31.165  65.227 1.00 69.81  ? 48  ALA D N   1 
ATOM   3175 C CA  . ALA B 2 48  ? 38.445 32.155  64.249 1.00 70.81  ? 48  ALA D CA  1 
ATOM   3176 C C   . ALA B 2 48  ? 37.993 31.575  62.894 1.00 71.25  ? 48  ALA D C   1 
ATOM   3177 O O   . ALA B 2 48  ? 38.079 32.244  61.853 1.00 70.40  ? 48  ALA D O   1 
ATOM   3178 C CB  . ALA B 2 48  ? 39.545 33.201  64.028 1.00 68.63  ? 48  ALA D CB  1 
ATOM   3179 N N   . LYS B 2 49  ? 37.508 30.338  62.902 1.00 71.21  ? 49  LYS D N   1 
ATOM   3180 C CA  . LYS B 2 49  ? 37.049 29.720  61.663 1.00 71.08  ? 49  LYS D CA  1 
ATOM   3181 C C   . LYS B 2 49  ? 35.536 29.567  61.644 1.00 70.41  ? 49  LYS D C   1 
ATOM   3182 O O   . LYS B 2 49  ? 34.923 29.177  62.645 1.00 69.67  ? 49  LYS D O   1 
ATOM   3183 C CB  . LYS B 2 49  ? 37.731 28.366  61.459 1.00 71.22  ? 49  LYS D CB  1 
ATOM   3184 C CG  . LYS B 2 49  ? 39.223 28.503  61.232 1.00 72.15  ? 49  LYS D CG  1 
ATOM   3185 C CD  . LYS B 2 49  ? 39.868 27.187  60.859 1.00 73.14  ? 49  LYS D CD  1 
ATOM   3186 C CE  . LYS B 2 49  ? 41.358 27.366  60.599 1.00 73.12  ? 49  LYS D CE  1 
ATOM   3187 N NZ  . LYS B 2 49  ? 42.067 27.874  61.809 1.00 73.73  ? 49  LYS D NZ  1 
ATOM   3188 N N   . GLU B 2 50  ? 34.945 29.897  60.497 1.00 69.69  ? 50  GLU D N   1 
ATOM   3189 C CA  . GLU B 2 50  ? 33.499 29.829  60.309 1.00 68.81  ? 50  GLU D CA  1 
ATOM   3190 C C   . GLU B 2 50  ? 33.050 28.546  59.621 1.00 66.82  ? 50  GLU D C   1 
ATOM   3191 O O   . GLU B 2 50  ? 33.744 28.002  58.758 1.00 63.79  ? 50  GLU D O   1 
ATOM   3192 C CB  . GLU B 2 50  ? 33.018 31.015  59.470 1.00 70.86  ? 50  GLU D CB  1 
ATOM   3193 C CG  . GLU B 2 50  ? 33.149 32.389  60.108 1.00 73.80  ? 50  GLU D CG  1 
ATOM   3194 C CD  . GLU B 2 50  ? 32.833 33.516  59.115 1.00 75.58  ? 50  GLU D CD  1 
ATOM   3195 O OE1 . GLU B 2 50  ? 33.601 33.666  58.133 1.00 75.43  ? 50  GLU D OE1 1 
ATOM   3196 O OE2 . GLU B 2 50  ? 31.820 34.242  59.311 1.00 75.11  ? 50  GLU D OE2 1 
ATOM   3197 N N   . ILE B 2 51  ? 31.869 28.080  60.004 1.00 66.36  ? 51  ILE D N   1 
ATOM   3198 C CA  . ILE B 2 51  ? 31.293 26.881  59.417 1.00 66.78  ? 51  ILE D CA  1 
ATOM   3199 C C   . ILE B 2 51  ? 29.796 27.033  59.248 1.00 65.78  ? 51  ILE D C   1 
ATOM   3200 O O   . ILE B 2 51  ? 29.111 27.564  60.119 1.00 65.60  ? 51  ILE D O   1 
ATOM   3201 C CB  . ILE B 2 51  ? 31.543 25.636  60.280 1.00 68.10  ? 51  ILE D CB  1 
ATOM   3202 C CG1 . ILE B 2 51  ? 33.039 25.345  60.344 1.00 68.20  ? 51  ILE D CG1 1 
ATOM   3203 C CG2 . ILE B 2 51  ? 30.794 24.443  59.707 1.00 66.74  ? 51  ILE D CG2 1 
ATOM   3204 C CD1 . ILE B 2 51  ? 33.616 25.552  61.726 1.00 70.04  ? 51  ILE D CD1 1 
ATOM   3205 N N   . CYS B 2 52  ? 29.301 26.541  58.121 1.00 65.13  ? 52  CYS D N   1 
ATOM   3206 C CA  . CYS B 2 52  ? 27.889 26.599  57.787 1.00 63.75  ? 52  CYS D CA  1 
ATOM   3207 C C   . CYS B 2 52  ? 27.089 25.514  58.494 1.00 63.77  ? 52  CYS D C   1 
ATOM   3208 O O   . CYS B 2 52  ? 27.477 24.343  58.480 1.00 64.12  ? 52  CYS D O   1 
ATOM   3209 C CB  . CYS B 2 52  ? 27.751 26.443  56.291 1.00 63.13  ? 52  CYS D CB  1 
ATOM   3210 S SG  . CYS B 2 52  ? 28.500 27.824  55.388 1.00 64.35  ? 52  CYS D SG  1 
ATOM   3211 N N   . ALA B 2 53  ? 25.973 25.902  59.110 1.00 63.35  ? 53  ALA D N   1 
ATOM   3212 C CA  . ALA B 2 53  ? 25.117 24.949  59.818 1.00 63.03  ? 53  ALA D CA  1 
ATOM   3213 C C   . ALA B 2 53  ? 23.638 25.114  59.467 1.00 63.33  ? 53  ALA D C   1 
ATOM   3214 O O   . ALA B 2 53  ? 23.228 26.113  58.871 1.00 62.16  ? 53  ALA D O   1 
ATOM   3215 C CB  . ALA B 2 53  ? 25.317 25.077  61.316 1.00 63.14  ? 53  ALA D CB  1 
ATOM   3216 N N   . ASP B 2 54  ? 22.841 24.122  59.849 1.00 64.20  ? 54  ASP D N   1 
ATOM   3217 C CA  . ASP B 2 54  ? 21.419 24.129  59.552 1.00 65.59  ? 54  ASP D CA  1 
ATOM   3218 C C   . ASP B 2 54  ? 20.550 24.386  60.774 1.00 65.90  ? 54  ASP D C   1 
ATOM   3219 O O   . ASP B 2 54  ? 20.541 23.603  61.733 1.00 64.15  ? 54  ASP D O   1 
ATOM   3220 C CB  . ASP B 2 54  ? 21.011 22.793  58.933 1.00 68.07  ? 54  ASP D CB  1 
ATOM   3221 C CG  . ASP B 2 54  ? 19.668 22.863  58.227 1.00 69.70  ? 54  ASP D CG  1 
ATOM   3222 O OD1 . ASP B 2 54  ? 18.756 23.571  58.721 1.00 68.95  ? 54  ASP D OD1 1 
ATOM   3223 O OD2 . ASP B 2 54  ? 19.530 22.196  57.177 1.00 70.62  ? 54  ASP D OD2 1 
ATOM   3224 N N   . PRO B 2 55  ? 19.778 25.485  60.737 1.00 66.90  ? 55  PRO D N   1 
ATOM   3225 C CA  . PRO B 2 55  ? 18.878 25.883  61.826 1.00 66.94  ? 55  PRO D CA  1 
ATOM   3226 C C   . PRO B 2 55  ? 17.898 24.772  62.203 1.00 67.73  ? 55  PRO D C   1 
ATOM   3227 O O   . PRO B 2 55  ? 17.656 24.538  63.380 1.00 68.25  ? 55  PRO D O   1 
ATOM   3228 C CB  . PRO B 2 55  ? 18.176 27.114  61.262 1.00 65.43  ? 55  PRO D CB  1 
ATOM   3229 C CG  . PRO B 2 55  ? 19.210 27.699  60.358 1.00 65.68  ? 55  PRO D CG  1 
ATOM   3230 C CD  . PRO B 2 55  ? 19.762 26.482  59.652 1.00 65.91  ? 55  PRO D CD  1 
ATOM   3231 N N   . LYS B 2 56  ? 17.341 24.083  61.211 1.00 68.44  ? 56  LYS D N   1 
ATOM   3232 C CA  . LYS B 2 56  ? 16.402 23.000  61.497 1.00 70.63  ? 56  LYS D CA  1 
ATOM   3233 C C   . LYS B 2 56  ? 16.974 21.974  62.479 1.00 70.92  ? 56  LYS D C   1 
ATOM   3234 O O   . LYS B 2 56  ? 16.251 21.445  63.319 1.00 70.77  ? 56  LYS D O   1 
ATOM   3235 C CB  . LYS B 2 56  ? 16.011 22.252  60.218 1.00 72.25  ? 56  LYS D CB  1 
ATOM   3236 C CG  . LYS B 2 56  ? 15.305 23.064  59.156 1.00 75.13  ? 56  LYS D CG  1 
ATOM   3237 C CD  . LYS B 2 56  ? 14.926 22.163  57.975 1.00 76.01  ? 56  LYS D CD  1 
ATOM   3238 C CE  . LYS B 2 56  ? 14.393 22.976  56.807 1.00 77.37  ? 56  LYS D CE  1 
ATOM   3239 N NZ  . LYS B 2 56  ? 15.398 23.987  56.347 1.00 77.49  ? 56  LYS D NZ  1 
ATOM   3240 N N   . GLN B 2 57  ? 18.267 21.684  62.356 1.00 71.58  ? 57  GLN D N   1 
ATOM   3241 C CA  . GLN B 2 57  ? 18.923 20.695  63.213 1.00 72.22  ? 57  GLN D CA  1 
ATOM   3242 C C   . GLN B 2 57  ? 18.969 21.090  64.689 1.00 72.04  ? 57  GLN D C   1 
ATOM   3243 O O   . GLN B 2 57  ? 19.326 22.226  65.021 1.00 73.03  ? 57  GLN D O   1 
ATOM   3244 C CB  . GLN B 2 57  ? 20.348 20.422  62.699 1.00 72.16  ? 57  GLN D CB  1 
ATOM   3245 C CG  . GLN B 2 57  ? 20.418 19.470  61.505 1.00 71.82  ? 57  GLN D CG  1 
ATOM   3246 C CD  . GLN B 2 57  ? 21.827 19.332  60.937 1.00 74.20  ? 57  GLN D CD  1 
ATOM   3247 O OE1 . GLN B 2 57  ? 22.816 19.316  61.682 1.00 74.71  ? 57  GLN D OE1 1 
ATOM   3248 N NE2 . GLN B 2 57  ? 21.924 19.221  59.610 1.00 73.16  ? 57  GLN D NE2 1 
ATOM   3249 N N   . LYS B 2 58  ? 18.621 20.146  65.566 1.00 70.84  ? 58  LYS D N   1 
ATOM   3250 C CA  . LYS B 2 58  ? 18.613 20.382  67.014 1.00 71.65  ? 58  LYS D CA  1 
ATOM   3251 C C   . LYS B 2 58  ? 19.954 20.757  67.646 1.00 71.51  ? 58  LYS D C   1 
ATOM   3252 O O   . LYS B 2 58  ? 19.994 21.628  68.518 1.00 71.72  ? 58  LYS D O   1 
ATOM   3253 C CB  . LYS B 2 58  ? 18.064 19.166  67.771 1.00 71.92  ? 58  LYS D CB  1 
ATOM   3254 C CG  . LYS B 2 58  ? 18.154 19.307  69.290 1.00 72.13  ? 58  LYS D CG  1 
ATOM   3255 C CD  . LYS B 2 58  ? 17.636 18.069  70.025 1.00 75.18  ? 58  LYS D CD  1 
ATOM   3256 C CE  . LYS B 2 58  ? 17.683 18.230  71.558 1.00 75.29  ? 58  LYS D CE  1 
ATOM   3257 N NZ  . LYS B 2 58  ? 19.070 18.209  72.123 1.00 74.38  ? 58  LYS D NZ  1 
ATOM   3258 N N   . TRP B 2 59  ? 21.042 20.108  67.232 1.00 70.38  ? 59  TRP D N   1 
ATOM   3259 C CA  . TRP B 2 59  ? 22.345 20.415  67.820 1.00 69.18  ? 59  TRP D CA  1 
ATOM   3260 C C   . TRP B 2 59  ? 22.755 21.848  67.503 1.00 68.87  ? 59  TRP D C   1 
ATOM   3261 O O   . TRP B 2 59  ? 23.459 22.492  68.282 1.00 68.96  ? 59  TRP D O   1 
ATOM   3262 C CB  . TRP B 2 59  ? 23.428 19.432  67.341 1.00 67.77  ? 59  TRP D CB  1 
ATOM   3263 C CG  . TRP B 2 59  ? 23.941 19.677  65.960 1.00 65.84  ? 59  TRP D CG  1 
ATOM   3264 C CD1 . TRP B 2 59  ? 23.582 19.022  64.817 1.00 65.63  ? 59  TRP D CD1 1 
ATOM   3265 C CD2 . TRP B 2 59  ? 24.920 20.648  65.576 1.00 65.45  ? 59  TRP D CD2 1 
ATOM   3266 N NE1 . TRP B 2 59  ? 24.282 19.523  63.742 1.00 65.13  ? 59  TRP D NE1 1 
ATOM   3267 C CE2 . TRP B 2 59  ? 25.110 20.523  64.182 1.00 65.30  ? 59  TRP D CE2 1 
ATOM   3268 C CE3 . TRP B 2 59  ? 25.658 21.615  66.276 1.00 63.53  ? 59  TRP D CE3 1 
ATOM   3269 C CZ2 . TRP B 2 59  ? 26.006 21.327  63.476 1.00 64.36  ? 59  TRP D CZ2 1 
ATOM   3270 C CZ3 . TRP B 2 59  ? 26.545 22.411  65.578 1.00 60.95  ? 59  TRP D CZ3 1 
ATOM   3271 C CH2 . TRP B 2 59  ? 26.713 22.263  64.192 1.00 62.71  ? 59  TRP D CH2 1 
ATOM   3272 N N   . VAL B 2 60  ? 22.309 22.348  66.358 1.00 68.40  ? 60  VAL D N   1 
ATOM   3273 C CA  . VAL B 2 60  ? 22.628 23.712  65.962 1.00 68.36  ? 60  VAL D CA  1 
ATOM   3274 C C   . VAL B 2 60  ? 21.858 24.647  66.885 1.00 68.48  ? 60  VAL D C   1 
ATOM   3275 O O   . VAL B 2 60  ? 22.418 25.582  67.458 1.00 67.73  ? 60  VAL D O   1 
ATOM   3276 C CB  . VAL B 2 60  ? 22.220 23.972  64.489 1.00 67.57  ? 60  VAL D CB  1 
ATOM   3277 C CG1 . VAL B 2 60  ? 22.716 25.333  64.026 1.00 65.41  ? 60  VAL D CG1 1 
ATOM   3278 C CG2 . VAL B 2 60  ? 22.785 22.882  63.606 1.00 68.02  ? 60  VAL D CG2 1 
ATOM   3279 N N   . GLN B 2 61  ? 20.569 24.371  67.036 1.00 69.44  ? 61  GLN D N   1 
ATOM   3280 C CA  . GLN B 2 61  ? 19.704 25.176  67.889 1.00 71.25  ? 61  GLN D CA  1 
ATOM   3281 C C   . GLN B 2 61  ? 20.208 25.185  69.331 1.00 72.37  ? 61  GLN D C   1 
ATOM   3282 O O   . GLN B 2 61  ? 20.421 26.250  69.911 1.00 71.23  ? 61  GLN D O   1 
ATOM   3283 C CB  . GLN B 2 61  ? 18.280 24.622  67.852 1.00 71.22  ? 61  GLN D CB  1 
ATOM   3284 C CG  . GLN B 2 61  ? 17.869 24.105  66.490 1.00 71.34  ? 61  GLN D CG  1 
ATOM   3285 C CD  . GLN B 2 61  ? 16.685 24.846  65.900 1.00 72.19  ? 61  GLN D CD  1 
ATOM   3286 O OE1 . GLN B 2 61  ? 16.654 26.085  65.883 1.00 73.29  ? 61  GLN D OE1 1 
ATOM   3287 N NE2 . GLN B 2 61  ? 15.708 24.093  65.390 1.00 69.58  ? 61  GLN D NE2 1 
ATOM   3288 N N   . ASP B 2 62  ? 20.390 23.994  69.903 1.00 73.74  ? 62  ASP D N   1 
ATOM   3289 C CA  . ASP B 2 62  ? 20.866 23.872  71.279 1.00 75.50  ? 62  ASP D CA  1 
ATOM   3290 C C   . ASP B 2 62  ? 22.202 24.581  71.455 1.00 75.78  ? 62  ASP D C   1 
ATOM   3291 O O   . ASP B 2 62  ? 22.430 25.244  72.464 1.00 74.85  ? 62  ASP D O   1 
ATOM   3292 C CB  . ASP B 2 62  ? 21.027 22.399  71.688 1.00 77.68  ? 62  ASP D CB  1 
ATOM   3293 C CG  . ASP B 2 62  ? 19.688 21.669  71.860 1.00 79.30  ? 62  ASP D CG  1 
ATOM   3294 O OD1 . ASP B 2 62  ? 18.740 22.250  72.439 1.00 77.84  ? 62  ASP D OD1 1 
ATOM   3295 O OD2 . ASP B 2 62  ? 19.601 20.496  71.428 1.00 79.03  ? 62  ASP D OD2 1 
ATOM   3296 N N   . SER B 2 63  ? 23.084 24.432  70.472 1.00 76.87  ? 63  SER D N   1 
ATOM   3297 C CA  . SER B 2 63  ? 24.392 25.072  70.525 1.00 78.50  ? 63  SER D CA  1 
ATOM   3298 C C   . SER B 2 63  ? 24.234 26.587  70.553 1.00 79.74  ? 63  SER D C   1 
ATOM   3299 O O   . SER B 2 63  ? 25.166 27.319  70.880 1.00 79.13  ? 63  SER D O   1 
ATOM   3300 C CB  . SER B 2 63  ? 25.246 24.660  69.318 1.00 78.55  ? 63  SER D CB  1 
ATOM   3301 O OG  . SER B 2 63  ? 25.875 23.403  69.526 1.00 77.81  ? 63  SER D OG  1 
ATOM   3302 N N   . ILE B 2 64  ? 23.036 27.008  70.167 1.00 71.69  ? 64  ILE D N   1 
ATOM   3303 C CA  . ILE B 2 64  ? 22.629 28.398  70.076 1.00 72.73  ? 64  ILE D CA  1 
ATOM   3304 C C   . ILE B 2 64  ? 22.061 28.903  71.416 1.00 74.56  ? 64  ILE D C   1 
ATOM   3305 O O   . ILE B 2 64  ? 22.135 30.092  71.731 1.00 75.61  ? 64  ILE D O   1 
ATOM   3306 C CB  . ILE B 2 64  ? 21.575 28.534  68.924 1.00 71.94  ? 64  ILE D CB  1 
ATOM   3307 C CG1 . ILE B 2 64  ? 22.242 28.276  67.561 1.00 69.12  ? 64  ILE D CG1 1 
ATOM   3308 C CG2 . ILE B 2 64  ? 20.943 29.889  68.933 1.00 68.74  ? 64  ILE D CG2 1 
ATOM   3309 C CD1 . ILE B 2 64  ? 21.332 28.590  66.301 1.00 68.94  ? 64  ILE D CD1 1 
ATOM   3310 N N   . ASP B 2 65  ? 21.525 27.975  72.208 1.00 87.49  ? 65  ASP D N   1 
ATOM   3311 C CA  . ASP B 2 65  ? 20.930 28.267  73.501 1.00 88.28  ? 65  ASP D CA  1 
ATOM   3312 C C   . ASP B 2 65  ? 22.069 28.434  74.490 1.00 87.49  ? 65  ASP D C   1 
ATOM   3313 O O   . ASP B 2 65  ? 21.927 29.116  75.501 1.00 88.29  ? 65  ASP D O   1 
ATOM   3314 C CB  . ASP B 2 65  ? 20.010 27.129  73.947 1.00 90.22  ? 65  ASP D CB  1 
ATOM   3315 C CG  . ASP B 2 65  ? 18.747 27.041  73.108 1.00 92.60  ? 65  ASP D CG  1 
ATOM   3316 O OD1 . ASP B 2 65  ? 18.069 28.083  72.948 1.00 93.04  ? 65  ASP D OD1 1 
ATOM   3317 O OD2 . ASP B 2 65  ? 18.430 25.935  72.614 1.00 94.11  ? 65  ASP D OD2 1 
ATOM   3318 N N   . HIS B 2 66  ? 23.203 27.809  74.187 1.00 86.05  ? 66  HIS D N   1 
ATOM   3319 C CA  . HIS B 2 66  ? 24.377 27.904  75.043 1.00 84.41  ? 66  HIS D CA  1 
ATOM   3320 C C   . HIS B 2 66  ? 25.063 29.235  74.746 1.00 83.41  ? 66  HIS D C   1 
ATOM   3321 O O   . HIS B 2 66  ? 25.334 30.021  75.650 1.00 83.51  ? 66  HIS D O   1 
ATOM   3322 C CB  . HIS B 2 66  ? 25.342 26.744  74.761 1.00 83.90  ? 66  HIS D CB  1 
ATOM   3323 C CG  . HIS B 2 66  ? 26.504 26.675  75.702 1.00 83.65  ? 66  HIS D CG  1 
ATOM   3324 N ND1 . HIS B 2 66  ? 26.424 26.085  76.944 1.00 83.27  ? 66  HIS D ND1 1 
ATOM   3325 C CD2 . HIS B 2 66  ? 27.775 27.134  75.587 1.00 84.46  ? 66  HIS D CD2 1 
ATOM   3326 C CE1 . HIS B 2 66  ? 27.593 26.181  77.553 1.00 83.68  ? 66  HIS D CE1 1 
ATOM   3327 N NE2 . HIS B 2 66  ? 28.430 26.814  76.751 1.00 83.79  ? 66  HIS D NE2 1 
ATOM   3328 N N   . LEU B 2 67  ? 25.321 29.493  73.469 1.00 82.12  ? 67  LEU D N   1 
ATOM   3329 C CA  . LEU B 2 67  ? 25.986 30.722  73.060 1.00 81.17  ? 67  LEU D CA  1 
ATOM   3330 C C   . LEU B 2 67  ? 25.214 31.971  73.464 1.00 81.11  ? 67  LEU D C   1 
ATOM   3331 O O   . LEU B 2 67  ? 25.764 33.072  73.544 1.00 80.29  ? 67  LEU D O   1 
ATOM   3332 C CB  . LEU B 2 67  ? 26.214 30.703  71.549 1.00 80.40  ? 67  LEU D CB  1 
ATOM   3333 C CG  . LEU B 2 67  ? 27.143 29.580  71.083 1.00 79.48  ? 67  LEU D CG  1 
ATOM   3334 C CD1 . LEU B 2 67  ? 27.464 29.741  69.612 1.00 79.34  ? 67  LEU D CD1 1 
ATOM   3335 C CD2 . LEU B 2 67  ? 28.424 29.623  71.894 1.00 79.82  ? 67  LEU D CD2 1 
ATOM   3336 N N   . ASP B 2 68  ? 23.930 31.791  73.728 1.00 81.57  ? 68  ASP D N   1 
ATOM   3337 C CA  . ASP B 2 68  ? 23.083 32.900  74.125 1.00 82.53  ? 68  ASP D CA  1 
ATOM   3338 C C   . ASP B 2 68  ? 23.012 33.072  75.643 1.00 83.47  ? 68  ASP D C   1 
ATOM   3339 O O   . ASP B 2 68  ? 23.150 34.183  76.160 1.00 83.17  ? 68  ASP D O   1 
ATOM   3340 C CB  . ASP B 2 68  ? 21.682 32.708  73.540 1.00 81.29  ? 68  ASP D CB  1 
ATOM   3341 C CG  . ASP B 2 68  ? 21.571 33.241  72.125 1.00 81.01  ? 68  ASP D CG  1 
ATOM   3342 O OD1 . ASP B 2 68  ? 22.616 33.370  71.449 1.00 80.65  ? 68  ASP D OD1 1 
ATOM   3343 O OD2 . ASP B 2 68  ? 20.439 33.529  71.686 1.00 80.00  ? 68  ASP D OD2 1 
ATOM   3344 N N   . LYS B 2 69  ? 22.815 31.976  76.362 1.00 84.13  ? 69  LYS D N   1 
ATOM   3345 C CA  . LYS B 2 69  ? 22.727 32.063  77.805 1.00 85.23  ? 69  LYS D CA  1 
ATOM   3346 C C   . LYS B 2 69  ? 24.075 32.181  78.482 1.00 86.03  ? 69  LYS D C   1 
ATOM   3347 O O   . LYS B 2 69  ? 24.225 31.781  79.636 1.00 87.34  ? 69  LYS D O   1 
ATOM   3348 C CB  . LYS B 2 69  ? 21.967 30.866  78.369 1.00 86.20  ? 69  LYS D CB  1 
ATOM   3349 C CG  . LYS B 2 69  ? 20.478 30.937  78.098 1.00 88.17  ? 69  LYS D CG  1 
ATOM   3350 C CD  . LYS B 2 69  ? 19.765 29.670  78.522 1.00 88.86  ? 69  LYS D CD  1 
ATOM   3351 C CE  . LYS B 2 69  ? 18.340 29.692  78.009 1.00 89.44  ? 69  LYS D CE  1 
ATOM   3352 N NZ  . LYS B 2 69  ? 18.315 30.009  76.548 1.00 89.55  ? 69  LYS D NZ  1 
ATOM   3353 N N   . GLN B 2 70  ? 25.062 32.723  77.776 1.00 85.92  ? 70  GLN D N   1 
ATOM   3354 C CA  . GLN B 2 70  ? 26.373 32.903  78.381 1.00 85.63  ? 70  GLN D CA  1 
ATOM   3355 C C   . GLN B 2 70  ? 26.812 34.356  78.226 1.00 85.43  ? 70  GLN D C   1 
ATOM   3356 O O   . GLN B 2 70  ? 27.921 34.734  78.613 1.00 86.08  ? 70  GLN D O   1 
ATOM   3357 C CB  . GLN B 2 70  ? 27.405 31.958  77.765 1.00 85.49  ? 70  GLN D CB  1 
ATOM   3358 C CG  . GLN B 2 70  ? 28.065 32.460  76.500 1.00 86.68  ? 70  GLN D CG  1 
ATOM   3359 C CD  . GLN B 2 70  ? 29.375 31.740  76.222 1.00 87.14  ? 70  GLN D CD  1 
ATOM   3360 O OE1 . GLN B 2 70  ? 29.404 30.518  76.036 1.00 86.46  ? 70  GLN D OE1 1 
ATOM   3361 N NE2 . GLN B 2 70  ? 30.470 32.495  76.204 1.00 87.51  ? 70  GLN D NE2 1 
ATOM   3362 N N   . THR B 2 71  ? 25.926 35.168  77.659 1.00 84.93  ? 71  THR D N   1 
ATOM   3363 C CA  . THR B 2 71  ? 26.189 36.594  77.474 1.00 84.38  ? 71  THR D CA  1 
ATOM   3364 C C   . THR B 2 71  ? 24.876 37.364  77.608 1.00 83.35  ? 71  THR D C   1 
ATOM   3365 O O   . THR B 2 71  ? 24.810 38.285  78.450 1.00 82.79  ? 71  THR D O   1 
ATOM   3366 C CB  . THR B 2 71  ? 26.830 36.903  76.085 1.00 84.42  ? 71  THR D CB  1 
ATOM   3367 O OG1 . THR B 2 71  ? 25.997 36.382  75.039 1.00 83.50  ? 71  THR D OG1 1 
ATOM   3368 C CG2 . THR B 2 71  ? 28.236 36.295  75.990 1.00 83.44  ? 71  THR D CG2 1 
HETATM 3369 O O   . HOH C 3 .   ? 34.885 11.031  27.355 1.00 31.67  ? 383 HOH A O   1 
HETATM 3370 O O   . HOH C 3 .   ? 44.525 28.390  50.655 1.00 32.57  ? 384 HOH A O   1 
HETATM 3371 O O   . HOH C 3 .   ? 17.104 11.083  21.520 1.00 33.05  ? 385 HOH A O   1 
HETATM 3372 O O   . HOH C 3 .   ? 17.975 12.546  18.473 1.00 33.95  ? 386 HOH A O   1 
HETATM 3373 O O   . HOH C 3 .   ? 16.871 12.801  41.800 1.00 40.03  ? 387 HOH A O   1 
HETATM 3374 O O   . HOH C 3 .   ? 38.923 -11.964 4.979  1.00 41.59  ? 388 HOH A O   1 
HETATM 3375 O O   . HOH C 3 .   ? 22.144 6.810   29.640 1.00 42.04  ? 389 HOH A O   1 
HETATM 3376 O O   . HOH C 3 .   ? 34.107 35.456  32.562 1.00 42.57  ? 390 HOH A O   1 
HETATM 3377 O O   . HOH C 3 .   ? 47.785 25.217  42.101 1.00 43.31  ? 391 HOH A O   1 
HETATM 3378 O O   . HOH C 3 .   ? 8.043  0.701   50.103 1.00 43.51  ? 392 HOH A O   1 
HETATM 3379 O O   . HOH C 3 .   ? 30.068 -10.880 31.749 1.00 43.71  ? 393 HOH A O   1 
HETATM 3380 O O   . HOH C 3 .   ? 26.818 -7.736  -3.757 1.00 45.13  ? 394 HOH A O   1 
HETATM 3381 O O   . HOH C 3 .   ? 33.896 11.472  13.059 1.00 45.71  ? 395 HOH A O   1 
HETATM 3382 O O   . HOH C 3 .   ? 42.033 30.147  51.397 1.00 45.84  ? 396 HOH A O   1 
HETATM 3383 O O   . HOH C 3 .   ? 16.864 7.893   27.335 1.00 46.41  ? 397 HOH A O   1 
HETATM 3384 O O   . HOH C 3 .   ? 30.325 -16.923 -5.219 1.00 47.47  ? 398 HOH A O   1 
HETATM 3385 O O   . HOH C 3 .   ? 39.908 31.417  30.185 1.00 47.88  ? 399 HOH A O   1 
HETATM 3386 O O   . HOH C 3 .   ? 36.464 6.601   6.579  1.00 50.41  ? 400 HOH A O   1 
HETATM 3387 O O   . HOH C 3 .   ? 16.246 5.194   25.392 1.00 50.51  ? 401 HOH A O   1 
HETATM 3388 O O   . HOH C 3 .   ? 40.742 10.199  29.863 1.00 50.53  ? 402 HOH A O   1 
HETATM 3389 O O   . HOH C 3 .   ? 10.960 14.190  5.662  1.00 51.10  ? 403 HOH A O   1 
HETATM 3390 O O   . HOH C 3 .   ? 37.715 -4.139  7.055  1.00 51.32  ? 404 HOH A O   1 
HETATM 3391 O O   . HOH C 3 .   ? 14.499 18.027  36.344 1.00 52.32  ? 405 HOH A O   1 
HETATM 3392 O O   . HOH C 3 .   ? 39.973 -8.278  3.766  1.00 54.58  ? 406 HOH A O   1 
HETATM 3393 O O   . HOH C 3 .   ? 34.328 16.921  51.100 1.00 54.62  ? 407 HOH A O   1 
HETATM 3394 O O   . HOH C 3 .   ? 35.834 31.983  51.953 1.00 54.81  ? 408 HOH A O   1 
HETATM 3395 O O   . HOH C 3 .   ? 24.995 -0.004  -0.004 0.50 55.15  ? 409 HOH A O   1 
HETATM 3396 O O   . HOH C 3 .   ? 15.230 7.102   33.929 1.00 55.54  ? 410 HOH A O   1 
HETATM 3397 O O   . HOH C 3 .   ? 16.502 21.582  25.868 1.00 55.63  ? 411 HOH A O   1 
HETATM 3398 O O   . HOH C 3 .   ? 32.352 0.035   24.651 1.00 55.80  ? 412 HOH A O   1 
HETATM 3399 O O   . HOH C 3 .   ? 37.877 -15.695 7.981  1.00 57.35  ? 413 HOH A O   1 
HETATM 3400 O O   . HOH C 3 .   ? 38.107 6.914   21.709 1.00 57.67  ? 414 HOH A O   1 
HETATM 3401 O O   . HOH C 3 .   ? 11.718 18.398  15.172 1.00 57.74  ? 415 HOH A O   1 
HETATM 3402 O O   . HOH C 3 .   ? 19.510 25.335  42.296 1.00 59.01  ? 416 HOH A O   1 
HETATM 3403 O O   . HOH C 3 .   ? 24.123 -9.265  17.029 1.00 60.29  ? 417 HOH A O   1 
HETATM 3404 O O   . HOH D 3 .   ? 26.916 34.048  69.965 1.00 37.80  ? 77  HOH D O   1 
HETATM 3405 O O   . HOH D 3 .   ? 24.448 35.415  70.995 1.00 39.25  ? 78  HOH D O   1 
HETATM 3406 O O   . HOH D 3 .   ? 18.704 31.795  60.090 1.00 40.99  ? 79  HOH D O   1 
HETATM 3407 O O   . HOH D 3 .   ? 19.575 34.969  76.282 1.00 50.20  ? 80  HOH D O   1 
HETATM 3408 O O   . HOH D 3 .   ? 30.544 18.394  57.552 1.00 51.29  ? 81  HOH D O   1 
HETATM 3409 O O   . HOH D 3 .   ? 25.505 32.353  82.694 1.00 55.56  ? 82  HOH D O   1 
HETATM 3410 O O   . HOH D 3 .   ? 23.675 37.237  80.754 1.00 56.03  ? 83  HOH D O   1 
HETATM 3411 O O   . HOH D 3 .   ? 33.147 26.595  76.082 1.00 58.63  ? 84  HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LEU 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   ?   ?   ?   A . n 
A 1 3   LEU 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   LEU 5   5   ?   ?   ?   A . n 
A 1 6   ALA 6   6   ?   ?   ?   A . n 
A 1 7   PRO 7   7   ?   ?   ?   A . n 
A 1 8   ALA 8   8   ?   ?   ?   A . n 
A 1 9   LEU 9   9   ?   ?   ?   A . n 
A 1 10  SER 10  10  ?   ?   ?   A . n 
A 1 11  THR 11  11  ?   ?   ?   A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  GLN 33  33  33  GLN GLN A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  HIS 35  35  35  HIS HIS A . n 
A 1 36  CYS 36  36  36  CYS CYS A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  CYS 47  47  47  CYS CYS A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  SER 56  56  56  SER SER A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  HIS 60  60  60  HIS HIS A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  CYS 66  66  66  CYS CYS A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  LYS 71  71  71  LYS LYS A . n 
A 1 72  MET 72  72  72  MET MET A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  TRP 76  76  76  TRP TRP A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  ILE 87  87  87  ILE ILE A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 PRO 116 116 116 PRO PRO A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 PRO 120 120 120 PRO PRO A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 TYR 125 125 125 TYR TYR A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 TYR 135 135 135 TYR TYR A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 SER 140 140 140 SER SER A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 ASN 143 143 143 ASN ASN A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 TYR 150 150 150 TYR TYR A . n 
A 1 151 MET 151 151 151 MET MET A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 TRP 154 154 154 TRP TRP A . n 
A 1 155 MET 155 155 155 MET MET A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 PRO 159 159 159 PRO PRO A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 TYR 162 162 162 TYR TYR A . n 
A 1 163 VAL 163 163 163 VAL VAL A . n 
A 1 164 ASP 164 164 164 ASP ASP A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 MET 167 167 167 MET MET A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 THR 169 169 169 THR THR A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 THR 172 172 172 THR THR A . n 
A 1 173 PHE 173 173 173 PHE PHE A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 GLU 175 175 175 GLU GLU A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 TRP 177 177 177 TRP TRP A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 ALA 180 180 180 ALA ALA A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 THR 183 183 183 THR THR A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 MET 185 185 185 MET MET A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 THR 191 191 191 THR THR A . n 
A 1 192 PHE 192 192 192 PHE PHE A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 TRP 194 194 194 TRP TRP A . n 
A 1 195 CYS 195 195 195 CYS CYS A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 ALA 200 200 200 ALA ALA A . n 
A 1 201 ILE 201 201 201 ILE ILE A . n 
A 1 202 SER 202 202 202 SER SER A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 PRO 207 207 207 PRO PRO A . n 
A 1 208 GLN 208 208 208 GLN GLN A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 SER 210 210 210 SER SER A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 ALA 213 213 213 ALA ALA A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 PRO 216 216 216 PRO PRO A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 CYS 218 218 218 CYS CYS A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 ASN 220 220 220 ASN ASN A . n 
A 1 221 SER 221 221 221 SER SER A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ARG 223 223 223 ARG ARG A . n 
A 1 224 TYR 224 224 224 TYR TYR A . n 
A 1 225 SER 225 225 225 SER SER A . n 
A 1 226 THR 226 226 226 THR THR A . n 
A 1 227 SER 227 227 227 SER SER A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 PHE 229 229 229 PHE PHE A . n 
A 1 230 CYS 230 230 230 CYS CYS A . n 
A 1 231 GLU 231 231 231 GLU GLU A . n 
A 1 232 VAL 232 232 232 VAL VAL A . n 
A 1 233 ASP 233 233 233 ASP ASP A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 CYS 235 235 235 CYS CYS A . n 
A 1 236 THR 236 236 236 THR THR A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 GLU 238 238 238 GLU GLU A . n 
A 1 239 THR 239 239 239 THR THR A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 MET 241 241 241 MET MET A . n 
A 1 242 GLU 242 242 242 GLU GLU A . n 
A 1 243 LYS 243 243 243 LYS LYS A . n 
A 1 244 MET 244 244 244 MET MET A . n 
A 1 245 SER 245 245 245 SER SER A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 PRO 249 249 249 PRO PRO A . n 
A 1 250 PHE 250 250 250 PHE PHE A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 PRO 253 253 253 PRO PRO A . n 
A 1 254 PRO 254 254 254 PRO PRO A . n 
A 1 255 GLN 255 255 255 GLN GLN A . n 
A 1 256 GLN 256 256 256 GLN GLN A . n 
A 1 257 ALA 257 257 257 ALA ALA A . n 
A 1 258 LYS 258 258 258 LYS LYS A . n 
A 1 259 MET 259 259 259 MET MET A . n 
A 1 260 ASN 260 260 260 ASN ASN A . n 
A 1 261 THR 261 261 261 THR THR A . n 
A 1 262 CYS 262 262 262 CYS CYS A . n 
A 1 263 PRO 263 263 263 PRO PRO A . n 
A 1 264 CYS 264 264 264 CYS CYS A . n 
A 1 265 TYR 265 265 265 TYR TYR A . n 
A 1 266 TYR 266 266 266 TYR TYR A . n 
A 1 267 LYS 267 267 267 LYS LYS A . n 
A 1 268 TYR 268 268 268 TYR TYR A . n 
A 1 269 SER 269 269 269 SER SER A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 SER 271 271 271 SER SER A . n 
A 1 272 PRO 272 272 272 PRO PRO A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 PRO 274 274 274 PRO PRO A . n 
A 1 275 ALA 275 275 275 ALA ALA A . n 
A 1 276 MET 276 276 276 MET MET A . n 
A 1 277 ASP 277 277 277 ASP ASP A . n 
A 1 278 HIS 278 278 278 HIS HIS A . n 
A 1 279 LEU 279 279 279 LEU LEU A . n 
A 1 280 ILE 280 280 280 ILE ILE A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 ALA 282 282 282 ALA ALA A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 GLY 286 286 286 GLY GLY A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 ASP 288 288 288 ASP ASP A . n 
A 1 289 SER 289 289 289 SER SER A . n 
A 1 290 LEU 290 290 290 LEU LEU A . n 
A 1 291 THR 291 291 291 THR THR A . n 
A 1 292 SER 292 292 292 SER SER A . n 
A 1 293 PRO 293 293 293 PRO PRO A . n 
A 1 294 VAL 294 294 294 VAL VAL A . n 
A 1 295 TYR 295 295 295 TYR TYR A . n 
A 1 296 VAL 296 296 296 VAL VAL A . n 
A 1 297 MET 297 297 297 MET MET A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 TYR 300 300 300 TYR TYR A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 ASP 302 302 302 ASP ASP A . n 
A 1 303 SER 303 303 303 SER SER A . n 
A 1 304 THR 304 304 304 THR THR A . n 
A 1 305 HIS 305 305 305 HIS HIS A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 ASN 307 307 307 ASN ASN A . n 
A 1 308 PRO 308 308 308 PRO PRO A . n 
A 1 309 VAL 309 309 309 VAL VAL A . n 
A 1 310 ARG 310 310 310 ARG ARG A . n 
A 1 311 PRO 311 311 311 PRO PRO A . n 
A 1 312 SER 312 312 312 SER SER A . n 
A 1 313 SER 313 313 313 SER SER A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 TYR 316 316 316 TYR TYR A . n 
A 1 317 HIS 317 317 317 HIS HIS A . n 
A 1 318 CYS 318 318 318 CYS CYS A . n 
A 1 319 ALA 319 319 319 ALA ALA A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 GLN 321 321 321 GLN GLN A . n 
A 1 322 MET 322 322 322 MET MET A . n 
A 1 323 THR 323 323 323 THR THR A . n 
A 1 324 SER 324 324 324 SER SER A . n 
A 1 325 HIS 325 325 325 HIS HIS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLY 327 327 327 GLY GLY A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 TRP 329 329 329 TRP TRP A . n 
A 1 330 THR 330 330 330 THR THR A . n 
A 1 331 SER 331 331 331 SER SER A . n 
A 1 332 THR 332 332 332 THR THR A . n 
A 1 333 SER 333 333 333 SER SER A . n 
A 1 334 SER 334 334 334 SER SER A . n 
A 1 335 GLU 335 335 335 GLU GLU A . n 
A 1 336 GLN 336 336 336 GLN GLN A . n 
A 1 337 CYS 337 337 337 CYS CYS A . n 
A 1 338 PRO 338 338 338 PRO PRO A . n 
A 1 339 ILE 339 339 339 ILE ILE A . n 
A 1 340 ARG 340 340 340 ARG ARG A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 VAL 342 342 342 VAL VAL A . n 
A 1 343 GLU 343 343 343 GLU GLU A . n 
A 1 344 GLY 344 344 344 GLY GLY A . n 
A 1 345 GLN 345 345 345 GLN GLN A . n 
A 1 346 SER 346 346 346 SER SER A . n 
A 1 347 GLN 347 347 347 GLN GLN A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 VAL 349 349 349 VAL VAL A . n 
A 1 350 LEU 350 350 350 LEU LEU A . n 
A 1 351 GLN 351 351 351 GLN GLN A . n 
A 1 352 VAL 352 352 352 VAL VAL A . n 
A 1 353 ARG 353 353 353 ARG ARG A . n 
A 1 354 VAL 354 354 354 VAL VAL A . n 
A 1 355 ALA 355 355 355 ALA ALA A . n 
A 1 356 PRO 356 356 356 PRO PRO A . n 
A 1 357 THR 357 357 357 THR THR A . n 
A 1 358 SER 358 358 358 SER SER A . n 
A 1 359 MET 359 359 359 MET MET A . n 
A 1 360 PRO 360 360 360 PRO PRO A . n 
A 1 361 ASN 361 361 361 ASN ASN A . n 
A 1 362 LEU 362 362 362 LEU LEU A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 GLY 364 364 364 GLY GLY A . n 
A 1 365 VAL 365 365 365 VAL VAL A . n 
A 1 366 SER 366 366 366 SER SER A . n 
A 1 367 LEU 367 367 367 LEU LEU A . n 
A 1 368 MET 368 368 368 MET MET A . n 
A 1 369 LEU 369 369 369 LEU LEU A . n 
A 1 370 GLU 370 370 370 GLU GLU A . n 
A 1 371 GLY 371 371 371 GLY GLY A . n 
A 1 372 GLN 372 372 372 GLN GLN A . n 
A 1 373 GLN 373 373 373 GLN GLN A . n 
A 1 374 TYR 374 374 374 TYR TYR A . n 
A 1 375 ARG 375 375 375 ARG ARG A . n 
A 1 376 LEU 376 376 376 LEU LEU A . n 
A 1 377 GLU 377 377 377 GLU GLU A . n 
A 1 378 TYR 378 378 378 TYR TYR A . n 
A 1 379 PHE 379 379 379 PHE PHE A . n 
A 1 380 GLY 380 380 380 GLY GLY A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 HIS 382 382 382 HIS HIS A . n 
B 2 1   GLN 1   1   ?   ?   ?   D . n 
B 2 2   PRO 2   2   ?   ?   ?   D . n 
B 2 3   ASP 3   3   ?   ?   ?   D . n 
B 2 4   ALA 4   4   ?   ?   ?   D . n 
B 2 5   ILE 5   5   ?   ?   ?   D . n 
B 2 6   ASN 6   6   ?   ?   ?   D . n 
B 2 7   ALA 7   7   ?   ?   ?   D . n 
B 2 8   ALA 8   8   8   ALA ALA D . n 
B 2 9   VAL 9   9   9   VAL VAL D . n 
B 2 10  THR 10  10  10  THR THR D . n 
B 2 11  CYS 11  11  11  CYS CYS D . n 
B 2 12  CYS 12  12  12  CYS CYS D . n 
B 2 13  TYR 13  13  13  TYR TYR D . n 
B 2 14  ASN 14  14  14  ASN ASN D . n 
B 2 15  PHE 15  15  15  PHE PHE D . n 
B 2 16  THR 16  16  16  THR THR D . n 
B 2 17  ASN 17  17  17  ASN ASN D . n 
B 2 18  ARG 18  18  18  ARG ARG D . n 
B 2 19  LYS 19  19  19  LYS LYS D . n 
B 2 20  ILE 20  20  20  ILE ILE D . n 
B 2 21  SER 21  21  21  SER SER D . n 
B 2 22  VAL 22  22  22  VAL VAL D . n 
B 2 23  GLN 23  23  23  GLN GLN D . n 
B 2 24  ARG 24  24  24  ARG ARG D . n 
B 2 25  LEU 25  25  25  LEU LEU D . n 
B 2 26  ALA 26  26  26  ALA ALA D . n 
B 2 27  SER 27  27  27  SER SER D . n 
B 2 28  TYR 28  28  28  TYR TYR D . n 
B 2 29  ARG 29  29  29  ARG ARG D . n 
B 2 30  ARG 30  30  30  ARG ARG D . n 
B 2 31  ILE 31  31  31  ILE ILE D . n 
B 2 32  THR 32  32  32  THR THR D . n 
B 2 33  SER 33  33  33  SER SER D . n 
B 2 34  SER 34  34  34  SER SER D . n 
B 2 35  LYS 35  35  35  LYS LYS D . n 
B 2 36  CYS 36  36  36  CYS CYS D . n 
B 2 37  PRO 37  37  37  PRO PRO D . n 
B 2 38  LYS 38  38  38  LYS LYS D . n 
B 2 39  GLU 39  39  39  GLU GLU D . n 
B 2 40  ALA 40  40  40  ALA ALA D . n 
B 2 41  VAL 41  41  41  VAL VAL D . n 
B 2 42  ILE 42  42  42  ILE ILE D . n 
B 2 43  PHE 43  43  43  PHE PHE D . n 
B 2 44  LYS 44  44  44  LYS LYS D . n 
B 2 45  THR 45  45  45  THR THR D . n 
B 2 46  ILE 46  46  46  ILE ILE D . n 
B 2 47  VAL 47  47  47  VAL VAL D . n 
B 2 48  ALA 48  48  48  ALA ALA D . n 
B 2 49  LYS 49  49  49  LYS LYS D . n 
B 2 50  GLU 50  50  50  GLU GLU D . n 
B 2 51  ILE 51  51  51  ILE ILE D . n 
B 2 52  CYS 52  52  52  CYS CYS D . n 
B 2 53  ALA 53  53  53  ALA ALA D . n 
B 2 54  ASP 54  54  54  ASP ASP D . n 
B 2 55  PRO 55  55  55  PRO PRO D . n 
B 2 56  LYS 56  56  56  LYS LYS D . n 
B 2 57  GLN 57  57  57  GLN GLN D . n 
B 2 58  LYS 58  58  58  LYS LYS D . n 
B 2 59  TRP 59  59  59  TRP TRP D . n 
B 2 60  VAL 60  60  60  VAL VAL D . n 
B 2 61  GLN 61  61  61  GLN GLN D . n 
B 2 62  ASP 62  62  62  ASP ASP D . n 
B 2 63  SER 63  63  63  SER SER D . n 
B 2 64  ILE 64  64  64  ILE ILE D . n 
B 2 65  ASP 65  65  65  ASP ASP D . n 
B 2 66  HIS 66  66  66  HIS HIS D . n 
B 2 67  LEU 67  67  67  LEU LEU D . n 
B 2 68  ASP 68  68  68  ASP ASP D . n 
B 2 69  LYS 69  69  69  LYS LYS D . n 
B 2 70  GLN 70  70  70  GLN GLN D . n 
B 2 71  THR 71  71  71  THR THR D . n 
B 2 72  GLN 72  72  ?   ?   ?   D . n 
B 2 73  THR 73  73  ?   ?   ?   D . n 
B 2 74  PRO 74  74  ?   ?   ?   D . n 
B 2 75  LYS 75  75  ?   ?   ?   D . n 
B 2 76  THR 76  76  ?   ?   ?   D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric  4  
2 software_defined_assembly            PQS  dodecameric 12 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2         A,B,C,D 
2 1,3,4,5,2,6 A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6840  ? 
1 MORE         -41   ? 
1 'SSA (A^2)'  37310 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 5_556 x-y,-y,-z+1  1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  
-1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 78.9000000000 
3 'crystal symmetry operation' 2_555 -y,x-y,z     -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038  
-0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
4 'crystal symmetry operation' 3_555 -x+y,-x,z    -0.5000000000 0.8660254038  0.0000000000 0.0000000000 -0.8660254038 
-0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
5 'crystal symmetry operation' 4_556 y,x,-z+1     -0.5000000000 0.8660254038  0.0000000000 0.0000000000 0.8660254038  0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 78.9000000000 
6 'crystal symmetry operation' 6_556 -x,-x+y,-z+1 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 78.9000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     409 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-11-13 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
CNS       refinement       . ? 4 
CNS       phasing          . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 25  ? ? -95.00  34.24   
2  1 LYS A 27  ? ? -37.06  117.71  
3  1 ALA A 40  ? ? -86.54  -113.85 
4  1 THR A 42  ? ? -87.57  36.83   
5  1 ASP A 103 ? ? -95.55  -143.15 
6  1 LEU A 134 ? ? -92.69  -70.60  
7  1 LEU A 139 ? ? -59.31  98.01   
8  1 PHE A 146 ? ? -177.40 148.10  
9  1 SER A 205 ? ? -30.63  146.55  
10 1 PRO A 209 ? ? -69.46  -170.49 
11 1 CYS A 218 ? ? -113.69 63.70   
12 1 ASN A 220 ? ? 55.25   72.23   
13 1 GLU A 238 ? ? -63.65  -74.90  
14 1 PRO A 253 ? ? -47.16  173.84  
15 1 ARG A 310 ? ? -159.92 70.90   
16 1 PRO A 311 ? ? -60.37  98.78   
17 1 SER A 346 ? ? -113.80 -149.55 
18 1 GLU A 370 ? ? -35.31  112.69  
19 1 ALA D 26  ? ? -67.76  -83.27  
20 1 SER D 27  ? ? -114.09 -168.47 
21 1 TYR D 28  ? ? -171.77 137.17  
22 1 LYS D 69  ? ? -78.96  26.63   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LEU 1  ? A LEU 1  
2  1 Y 1 A THR 2  ? A THR 2  
3  1 Y 1 A LEU 3  ? A LEU 3  
4  1 Y 1 A GLY 4  ? A GLY 4  
5  1 Y 1 A LEU 5  ? A LEU 5  
6  1 Y 1 A ALA 6  ? A ALA 6  
7  1 Y 1 A PRO 7  ? A PRO 7  
8  1 Y 1 A ALA 8  ? A ALA 8  
9  1 Y 1 A LEU 9  ? A LEU 9  
10 1 Y 1 A SER 10 ? A SER 10 
11 1 Y 1 A THR 11 ? A THR 11 
12 1 Y 1 D GLN 1  ? B GLN 1  
13 1 Y 1 D PRO 2  ? B PRO 2  
14 1 Y 1 D ASP 3  ? B ASP 3  
15 1 Y 1 D ALA 4  ? B ALA 4  
16 1 Y 1 D ILE 5  ? B ILE 5  
17 1 Y 1 D ASN 6  ? B ASN 6  
18 1 Y 1 D ALA 7  ? B ALA 7  
19 1 Y 1 D GLN 72 ? B GLN 72 
20 1 Y 1 D THR 73 ? B THR 73 
21 1 Y 1 D PRO 74 ? B PRO 74 
22 1 Y 1 D LYS 75 ? B LYS 75 
23 1 Y 1 D THR 76 ? B THR 76 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  383 1  HOH HOH A . 
C 3 HOH 2  384 2  HOH HOH A . 
C 3 HOH 3  385 3  HOH HOH A . 
C 3 HOH 4  386 4  HOH HOH A . 
C 3 HOH 5  387 7  HOH HOH A . 
C 3 HOH 6  388 9  HOH HOH A . 
C 3 HOH 7  389 10 HOH HOH A . 
C 3 HOH 8  390 11 HOH HOH A . 
C 3 HOH 9  391 12 HOH HOH A . 
C 3 HOH 10 392 13 HOH HOH A . 
C 3 HOH 11 393 14 HOH HOH A . 
C 3 HOH 12 394 15 HOH HOH A . 
C 3 HOH 13 395 16 HOH HOH A . 
C 3 HOH 14 396 17 HOH HOH A . 
C 3 HOH 15 397 18 HOH HOH A . 
C 3 HOH 16 398 19 HOH HOH A . 
C 3 HOH 17 399 20 HOH HOH A . 
C 3 HOH 18 400 22 HOH HOH A . 
C 3 HOH 19 401 23 HOH HOH A . 
C 3 HOH 20 402 24 HOH HOH A . 
C 3 HOH 21 403 25 HOH HOH A . 
C 3 HOH 22 404 27 HOH HOH A . 
C 3 HOH 23 405 28 HOH HOH A . 
C 3 HOH 24 406 29 HOH HOH A . 
C 3 HOH 25 407 30 HOH HOH A . 
C 3 HOH 26 408 31 HOH HOH A . 
C 3 HOH 27 409 32 HOH HOH A . 
C 3 HOH 28 410 33 HOH HOH A . 
C 3 HOH 29 411 35 HOH HOH A . 
C 3 HOH 30 412 36 HOH HOH A . 
C 3 HOH 31 413 38 HOH HOH A . 
C 3 HOH 32 414 39 HOH HOH A . 
C 3 HOH 33 415 40 HOH HOH A . 
C 3 HOH 34 416 42 HOH HOH A . 
C 3 HOH 35 417 43 HOH HOH A . 
D 3 HOH 1  77  5  HOH HOH D . 
D 3 HOH 2  78  6  HOH HOH D . 
D 3 HOH 3  79  8  HOH HOH D . 
D 3 HOH 4  80  21 HOH HOH D . 
D 3 HOH 5  81  26 HOH HOH D . 
D 3 HOH 6  82  34 HOH HOH D . 
D 3 HOH 7  83  37 HOH HOH D . 
D 3 HOH 8  84  41 HOH HOH D . 
#