data_1MM8
# 
_entry.id   1MM8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1MM8         pdb_00001mm8 10.2210/pdb1mm8/pdb 
NDB   PD0340       ?            ?                   
RCSB  RCSB017014   ?            ?                   
WWPDB D_1000017014 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1F3I 'Crystal Structure Of Tn5 Transposase Complexed With Transposon End DNA' unspecified 
PDB 1L1A 'Tn5 Transposase: 20Mer Outside End 2 Mn Complex'                        unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1MM8 
_pdbx_database_status.recvd_initial_deposition_date   2002-09-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Steiniger-White, M.' 1 
'Bhasin, A.'          2 
'Lovell, S.'          3 
'Rayment, I.'         4 
'Reznikoff, W.S.'     5 
# 
_citation.id                        primary 
_citation.title                     
;Evidence for "unseen" Transposase--DNA contacts
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            322 
_citation.page_first                971 
_citation.page_last                 982 
_citation.year                      2002 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12367522 
_citation.pdbx_database_id_DOI      '10.1016/S0022-2836(02)00877-X' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Steiniger-White, M.' 1 ? 
primary 'Bhasin, A.'          2 ? 
primary 'Lovell, S.'          3 ? 
primary 'Rayment, I.'         4 ? 
primary 'Reznikoff, W.S.'     5 ? 
# 
_cell.entry_id           1MM8 
_cell.length_a           112.500 
_cell.length_b           112.500 
_cell.length_c           233.500 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1MM8 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'ME DNA transferred strand'     6271.091  1   ? ?                          ? ? 
2 polymer     syn 'ME DNA non-transferred strand' 5994.890  1   ? ?                          ? ? 
3 polymer     man 'Tn5 Transposase'               53845.719 1   ? 'E58K, M60A, E349K, L376P' ? ? 
4 non-polymer syn 'MANGANESE (II) ION'            54.938    2   ? ?                          ? ? 
5 water       nat water                           18.015    254 ? ?                          ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DA)(DG)(DA)(DT)(DG)(DT)(DG)(DT)(DA)(DT)(DA)(DA)(DG)(DA)(DG)(DA)(DC)(DA)(DG)' 
GAGATGTGTATAAGAGACAG B ? 
2 polydeoxyribonucleotide no no '(DC)(DT)(DG)(DT)(DC)(DT)(DC)(DT)(DT)(DA)(DT)(DA)(DC)(DA)(DC)(DA)(DT)(DC)(DT)(DC)' 
CTGTCTCTTATACACATCTC C ? 
3 'polypeptide(L)'        no no 
;MVTFMITSALHRAADWAKSVFSSAALGDPRRTARLVNVAAQLAKYSGKSITISSEGSKAAQEGAYRFIRNPNVSAEAIRK
AGAMQTVKLAQEFPELLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFRTVGLLHQEWWMRPDDPAD
ADEKESGKWLAAAATSRLRMGSMMSNVIAVCDREADIHAYLQDKLAHNERFVVRSKHPRKDVESGLYLYDHLKNQPELGG
YQISIPQKGVVDKRGKRKNRPARKASLSLRSGRITLKQGNITLNAVLAEEINPPKGETPLKWLLLTSEPVESLAQALRVI
DIYTHRWRIEEFHKAWKTGAGAERQRMEKPDNLERMVSILSFVAVRLLQLRESFTPPQALRAQGLLKEAEHVESQSAETV
LTPDECQLLGYLDKGKRKRKEKAGSLQWAYMAIARLGGFMDSKRTGIASWGALWEGWEALQSKLDGFLAAKDLMAQGIKI
G
;
;MVTFMITSALHRAADWAKSVFSSAALGDPRRTARLVNVAAQLAKYSGKSITISSEGSKAAQEGAYRFIRNPNVSAEAIRK
AGAMQTVKLAQEFPELLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFRTVGLLHQEWWMRPDDPAD
ADEKESGKWLAAAATSRLRMGSMMSNVIAVCDREADIHAYLQDKLAHNERFVVRSKHPRKDVESGLYLYDHLKNQPELGG
YQISIPQKGVVDKRGKRKNRPARKASLSLRSGRITLKQGNITLNAVLAEEINPPKGETPLKWLLLTSEPVESLAQALRVI
DIYTHRWRIEEFHKAWKTGAGAERQRMEKPDNLERMVSILSFVAVRLLQLRESFTPPQALRAQGLLKEAEHVESQSAETV
LTPDECQLLGYLDKGKRKRKEKAGSLQWAYMAIARLGGFMDSKRTGIASWGALWEGWEALQSKLDGFLAAKDLMAQGIKI
G
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DA  n 
1 3   DG  n 
1 4   DA  n 
1 5   DT  n 
1 6   DG  n 
1 7   DT  n 
1 8   DG  n 
1 9   DT  n 
1 10  DA  n 
1 11  DT  n 
1 12  DA  n 
1 13  DA  n 
1 14  DG  n 
1 15  DA  n 
1 16  DG  n 
1 17  DA  n 
1 18  DC  n 
1 19  DA  n 
1 20  DG  n 
2 1   DC  n 
2 2   DT  n 
2 3   DG  n 
2 4   DT  n 
2 5   DC  n 
2 6   DT  n 
2 7   DC  n 
2 8   DT  n 
2 9   DT  n 
2 10  DA  n 
2 11  DT  n 
2 12  DA  n 
2 13  DC  n 
2 14  DA  n 
2 15  DC  n 
2 16  DA  n 
2 17  DT  n 
2 18  DC  n 
2 19  DT  n 
2 20  DC  n 
3 1   MET n 
3 2   VAL n 
3 3   THR n 
3 4   PHE n 
3 5   MET n 
3 6   ILE n 
3 7   THR n 
3 8   SER n 
3 9   ALA n 
3 10  LEU n 
3 11  HIS n 
3 12  ARG n 
3 13  ALA n 
3 14  ALA n 
3 15  ASP n 
3 16  TRP n 
3 17  ALA n 
3 18  LYS n 
3 19  SER n 
3 20  VAL n 
3 21  PHE n 
3 22  SER n 
3 23  SER n 
3 24  ALA n 
3 25  ALA n 
3 26  LEU n 
3 27  GLY n 
3 28  ASP n 
3 29  PRO n 
3 30  ARG n 
3 31  ARG n 
3 32  THR n 
3 33  ALA n 
3 34  ARG n 
3 35  LEU n 
3 36  VAL n 
3 37  ASN n 
3 38  VAL n 
3 39  ALA n 
3 40  ALA n 
3 41  GLN n 
3 42  LEU n 
3 43  ALA n 
3 44  LYS n 
3 45  TYR n 
3 46  SER n 
3 47  GLY n 
3 48  LYS n 
3 49  SER n 
3 50  ILE n 
3 51  THR n 
3 52  ILE n 
3 53  SER n 
3 54  SER n 
3 55  GLU n 
3 56  GLY n 
3 57  SER n 
3 58  LYS n 
3 59  ALA n 
3 60  ALA n 
3 61  GLN n 
3 62  GLU n 
3 63  GLY n 
3 64  ALA n 
3 65  TYR n 
3 66  ARG n 
3 67  PHE n 
3 68  ILE n 
3 69  ARG n 
3 70  ASN n 
3 71  PRO n 
3 72  ASN n 
3 73  VAL n 
3 74  SER n 
3 75  ALA n 
3 76  GLU n 
3 77  ALA n 
3 78  ILE n 
3 79  ARG n 
3 80  LYS n 
3 81  ALA n 
3 82  GLY n 
3 83  ALA n 
3 84  MET n 
3 85  GLN n 
3 86  THR n 
3 87  VAL n 
3 88  LYS n 
3 89  LEU n 
3 90  ALA n 
3 91  GLN n 
3 92  GLU n 
3 93  PHE n 
3 94  PRO n 
3 95  GLU n 
3 96  LEU n 
3 97  LEU n 
3 98  ALA n 
3 99  ILE n 
3 100 GLU n 
3 101 ASP n 
3 102 THR n 
3 103 THR n 
3 104 SER n 
3 105 LEU n 
3 106 SER n 
3 107 TYR n 
3 108 ARG n 
3 109 HIS n 
3 110 GLN n 
3 111 VAL n 
3 112 ALA n 
3 113 GLU n 
3 114 GLU n 
3 115 LEU n 
3 116 GLY n 
3 117 LYS n 
3 118 LEU n 
3 119 GLY n 
3 120 SER n 
3 121 ILE n 
3 122 GLN n 
3 123 ASP n 
3 124 LYS n 
3 125 SER n 
3 126 ARG n 
3 127 GLY n 
3 128 TRP n 
3 129 TRP n 
3 130 VAL n 
3 131 HIS n 
3 132 SER n 
3 133 VAL n 
3 134 LEU n 
3 135 LEU n 
3 136 LEU n 
3 137 GLU n 
3 138 ALA n 
3 139 THR n 
3 140 THR n 
3 141 PHE n 
3 142 ARG n 
3 143 THR n 
3 144 VAL n 
3 145 GLY n 
3 146 LEU n 
3 147 LEU n 
3 148 HIS n 
3 149 GLN n 
3 150 GLU n 
3 151 TRP n 
3 152 TRP n 
3 153 MET n 
3 154 ARG n 
3 155 PRO n 
3 156 ASP n 
3 157 ASP n 
3 158 PRO n 
3 159 ALA n 
3 160 ASP n 
3 161 ALA n 
3 162 ASP n 
3 163 GLU n 
3 164 LYS n 
3 165 GLU n 
3 166 SER n 
3 167 GLY n 
3 168 LYS n 
3 169 TRP n 
3 170 LEU n 
3 171 ALA n 
3 172 ALA n 
3 173 ALA n 
3 174 ALA n 
3 175 THR n 
3 176 SER n 
3 177 ARG n 
3 178 LEU n 
3 179 ARG n 
3 180 MET n 
3 181 GLY n 
3 182 SER n 
3 183 MET n 
3 184 MET n 
3 185 SER n 
3 186 ASN n 
3 187 VAL n 
3 188 ILE n 
3 189 ALA n 
3 190 VAL n 
3 191 CYS n 
3 192 ASP n 
3 193 ARG n 
3 194 GLU n 
3 195 ALA n 
3 196 ASP n 
3 197 ILE n 
3 198 HIS n 
3 199 ALA n 
3 200 TYR n 
3 201 LEU n 
3 202 GLN n 
3 203 ASP n 
3 204 LYS n 
3 205 LEU n 
3 206 ALA n 
3 207 HIS n 
3 208 ASN n 
3 209 GLU n 
3 210 ARG n 
3 211 PHE n 
3 212 VAL n 
3 213 VAL n 
3 214 ARG n 
3 215 SER n 
3 216 LYS n 
3 217 HIS n 
3 218 PRO n 
3 219 ARG n 
3 220 LYS n 
3 221 ASP n 
3 222 VAL n 
3 223 GLU n 
3 224 SER n 
3 225 GLY n 
3 226 LEU n 
3 227 TYR n 
3 228 LEU n 
3 229 TYR n 
3 230 ASP n 
3 231 HIS n 
3 232 LEU n 
3 233 LYS n 
3 234 ASN n 
3 235 GLN n 
3 236 PRO n 
3 237 GLU n 
3 238 LEU n 
3 239 GLY n 
3 240 GLY n 
3 241 TYR n 
3 242 GLN n 
3 243 ILE n 
3 244 SER n 
3 245 ILE n 
3 246 PRO n 
3 247 GLN n 
3 248 LYS n 
3 249 GLY n 
3 250 VAL n 
3 251 VAL n 
3 252 ASP n 
3 253 LYS n 
3 254 ARG n 
3 255 GLY n 
3 256 LYS n 
3 257 ARG n 
3 258 LYS n 
3 259 ASN n 
3 260 ARG n 
3 261 PRO n 
3 262 ALA n 
3 263 ARG n 
3 264 LYS n 
3 265 ALA n 
3 266 SER n 
3 267 LEU n 
3 268 SER n 
3 269 LEU n 
3 270 ARG n 
3 271 SER n 
3 272 GLY n 
3 273 ARG n 
3 274 ILE n 
3 275 THR n 
3 276 LEU n 
3 277 LYS n 
3 278 GLN n 
3 279 GLY n 
3 280 ASN n 
3 281 ILE n 
3 282 THR n 
3 283 LEU n 
3 284 ASN n 
3 285 ALA n 
3 286 VAL n 
3 287 LEU n 
3 288 ALA n 
3 289 GLU n 
3 290 GLU n 
3 291 ILE n 
3 292 ASN n 
3 293 PRO n 
3 294 PRO n 
3 295 LYS n 
3 296 GLY n 
3 297 GLU n 
3 298 THR n 
3 299 PRO n 
3 300 LEU n 
3 301 LYS n 
3 302 TRP n 
3 303 LEU n 
3 304 LEU n 
3 305 LEU n 
3 306 THR n 
3 307 SER n 
3 308 GLU n 
3 309 PRO n 
3 310 VAL n 
3 311 GLU n 
3 312 SER n 
3 313 LEU n 
3 314 ALA n 
3 315 GLN n 
3 316 ALA n 
3 317 LEU n 
3 318 ARG n 
3 319 VAL n 
3 320 ILE n 
3 321 ASP n 
3 322 ILE n 
3 323 TYR n 
3 324 THR n 
3 325 HIS n 
3 326 ARG n 
3 327 TRP n 
3 328 ARG n 
3 329 ILE n 
3 330 GLU n 
3 331 GLU n 
3 332 PHE n 
3 333 HIS n 
3 334 LYS n 
3 335 ALA n 
3 336 TRP n 
3 337 LYS n 
3 338 THR n 
3 339 GLY n 
3 340 ALA n 
3 341 GLY n 
3 342 ALA n 
3 343 GLU n 
3 344 ARG n 
3 345 GLN n 
3 346 ARG n 
3 347 MET n 
3 348 GLU n 
3 349 LYS n 
3 350 PRO n 
3 351 ASP n 
3 352 ASN n 
3 353 LEU n 
3 354 GLU n 
3 355 ARG n 
3 356 MET n 
3 357 VAL n 
3 358 SER n 
3 359 ILE n 
3 360 LEU n 
3 361 SER n 
3 362 PHE n 
3 363 VAL n 
3 364 ALA n 
3 365 VAL n 
3 366 ARG n 
3 367 LEU n 
3 368 LEU n 
3 369 GLN n 
3 370 LEU n 
3 371 ARG n 
3 372 GLU n 
3 373 SER n 
3 374 PHE n 
3 375 THR n 
3 376 PRO n 
3 377 PRO n 
3 378 GLN n 
3 379 ALA n 
3 380 LEU n 
3 381 ARG n 
3 382 ALA n 
3 383 GLN n 
3 384 GLY n 
3 385 LEU n 
3 386 LEU n 
3 387 LYS n 
3 388 GLU n 
3 389 ALA n 
3 390 GLU n 
3 391 HIS n 
3 392 VAL n 
3 393 GLU n 
3 394 SER n 
3 395 GLN n 
3 396 SER n 
3 397 ALA n 
3 398 GLU n 
3 399 THR n 
3 400 VAL n 
3 401 LEU n 
3 402 THR n 
3 403 PRO n 
3 404 ASP n 
3 405 GLU n 
3 406 CYS n 
3 407 GLN n 
3 408 LEU n 
3 409 LEU n 
3 410 GLY n 
3 411 TYR n 
3 412 LEU n 
3 413 ASP n 
3 414 LYS n 
3 415 GLY n 
3 416 LYS n 
3 417 ARG n 
3 418 LYS n 
3 419 ARG n 
3 420 LYS n 
3 421 GLU n 
3 422 LYS n 
3 423 ALA n 
3 424 GLY n 
3 425 SER n 
3 426 LEU n 
3 427 GLN n 
3 428 TRP n 
3 429 ALA n 
3 430 TYR n 
3 431 MET n 
3 432 ALA n 
3 433 ILE n 
3 434 ALA n 
3 435 ARG n 
3 436 LEU n 
3 437 GLY n 
3 438 GLY n 
3 439 PHE n 
3 440 MET n 
3 441 ASP n 
3 442 SER n 
3 443 LYS n 
3 444 ARG n 
3 445 THR n 
3 446 GLY n 
3 447 ILE n 
3 448 ALA n 
3 449 SER n 
3 450 TRP n 
3 451 GLY n 
3 452 ALA n 
3 453 LEU n 
3 454 TRP n 
3 455 GLU n 
3 456 GLY n 
3 457 TRP n 
3 458 GLU n 
3 459 ALA n 
3 460 LEU n 
3 461 GLN n 
3 462 SER n 
3 463 LYS n 
3 464 LEU n 
3 465 ASP n 
3 466 GLY n 
3 467 PHE n 
3 468 LEU n 
3 469 ALA n 
3 470 ALA n 
3 471 LYS n 
3 472 ASP n 
3 473 LEU n 
3 474 MET n 
3 475 ALA n 
3 476 GLN n 
3 477 GLY n 
3 478 ILE n 
3 479 LYS n 
3 480 ILE n 
3 481 GLY n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 'Tn5 Transposases' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ER2566 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTYB4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 'DNA synthesized by IDT' 
2 1 sample ? ? ? ? ? 'DNA synthesized by IDT' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP Q46731_ECOLI 3 
;MVTFMITSALHRAADWAKSVFSSAALGDPRRTARLVNVAAQLAKYSGKSITISSEGSEAMQEGAYRFIRNPNVSAEAIRK
AGAMQTVKLAQEFPELLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFRTVGLLHQEWWMRPDDPAD
ADEKESGKWLAAAATSRLRMGSMMSNVIAVCDREADIHAYLQDKLAHNERFVVRSKHPRKDVESGLYLYDHLKNQPELGG
YQISIPQKGVVDKRGKRKNRPARKASLSLRSGRITLKQGNITLNAVLAEEINPPKGETPLKWLLLTSEPVESLAQALRVI
DIYTHRWRIEEFHKAWKTGAGAERQRMEEPDNLERMVSILSFVAVRLLQLRESFTLPQALRAQGLLKEAEHVESQSAETV
LTPDECQLLGYLDKGKRKRKEKAGSLQWAYMAIARLGGFMDSKRTGIASWGALWEGWEALQSKLDGFLAAKDLMAQGIKI

;
1 Q46731 ? 
2 PDB 1MM8         1 ? ? 1MM8   ? 
3 PDB 1MM8         2 ? ? 1MM8   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1MM8 A 1 ? 480 ? Q46731 1   ? 480 ? -3  476 
2 2 1MM8 B 1 ? 20  ? 1MM8   101 ? 120 ? 101 120 
3 3 1MM8 C 1 ? 20  ? 1MM8   201 ? 220 ? 201 220 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1MM8 LYS A 58  ? UNP Q46731 GLU 58  'engineered mutation' 54  1 
1 1MM8 ALA A 60  ? UNP Q46731 MET 60  'engineered mutation' 56  2 
1 1MM8 LYS A 349 ? UNP Q46731 GLU 349 'engineered mutation' 345 3 
1 1MM8 PRO A 376 ? UNP Q46731 LEU 376 'engineered mutation' 372 4 
1 1MM8 GLY A 481 ? UNP Q46731 ?   ?   'cloning artifact'    477 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1MM8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   61.60 
_exptl_crystal.density_Matthews      3.20 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8. 
_exptl_crystal_grow.pdbx_details    
'15% Peg 1500, 300 mM Na tartrate, 50 mM Hepes, 5 mM MnCl2, pH 8., VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'Peg 1500'    ? ? ? 
1 2 1 'Na tartrate' ? ? ? 
1 3 1 Hepes         ? ? ? 
1 4 1 MnCl2         ? ? ? 
1 5 2 'Na tartrate' ? ? ? 
1 6 2 MnCl2         ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   2001-03-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Si 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.96486 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.96486 
# 
_reflns.entry_id                     1MM8 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.8 
_reflns.d_resolution_low             500 
_reflns.number_all                   22984 
_reflns.number_obs                   22984 
_reflns.percent_possible_obs         90 
_reflns.pdbx_Rmerge_I_obs            0.145 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_k_min                  ? 
_reflns.observed_criterion_F_min     ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.9 
_reflns_shell.d_res_low              2.8 
_reflns_shell.percent_possible_all   50 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1MM8 
_refine.ls_d_res_high                            2.8 
_refine.ls_d_res_low                             500 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     22984 
_refine.ls_number_reflns_obs                     22984 
_refine.ls_number_reflns_R_free                  1034 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.217 
_refine.ls_R_factor_R_free                       0.271 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3563 
_refine_hist.pdbx_number_atoms_nucleic_acid   814 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             254 
_refine_hist.number_atoms_total               4633 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        500 
# 
_struct.entry_id                  1MM8 
_struct.title                     'Crystal structure of Tn5 Transposase complexed with ME DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MM8 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'protein-DNA complex, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS C 11  ? SER C 22  ? HIS A 7   SER A 18  1 ? 12 
HELX_P HELX_P2  2  ASP C 28  ? TYR C 45  ? ASP A 24  TYR A 41  1 ? 18 
HELX_P HELX_P3  3  SER C 49  ? SER C 54  ? SER A 45  SER A 50  1 ? 6  
HELX_P HELX_P4  4  SER C 57  ? ASN C 70  ? SER A 53  ASN A 66  1 ? 14 
HELX_P HELX_P5  5  SER C 74  ? GLN C 91  ? SER A 70  GLN A 87  1 ? 18 
HELX_P HELX_P6  6  HIS C 109 ? LEU C 115 ? HIS A 105 LEU A 111 5 ? 7  
HELX_P HELX_P7  7  ASP C 157 ? ALA C 161 ? ASP A 153 ALA A 157 5 ? 5  
HELX_P HELX_P8  8  LYS C 164 ? SER C 166 ? LYS A 160 SER A 162 5 ? 3  
HELX_P HELX_P9  9  GLY C 167 ? GLY C 181 ? GLY A 163 GLY A 177 1 ? 15 
HELX_P HELX_P10 10 SER C 182 ? SER C 185 ? SER A 178 SER A 181 5 ? 4  
HELX_P HELX_P11 11 ASP C 192 ? ASP C 196 ? ASP A 188 ASP A 192 5 ? 5  
HELX_P HELX_P12 12 ILE C 197 ? HIS C 207 ? ILE A 193 HIS A 203 1 ? 11 
HELX_P HELX_P13 13 TYR C 227 ? LYS C 233 ? TYR A 223 LYS A 229 1 ? 7  
HELX_P HELX_P14 14 LYS C 277 ? ASN C 280 ? LYS A 273 ASN A 276 5 ? 4  
HELX_P HELX_P15 15 SER C 312 ? HIS C 325 ? SER A 308 HIS A 321 1 ? 14 
HELX_P HELX_P16 16 TRP C 327 ? LYS C 337 ? TRP A 323 LYS A 333 1 ? 11 
HELX_P HELX_P17 17 GLY C 341 ? GLN C 345 ? GLY A 337 GLN A 341 5 ? 5  
HELX_P HELX_P18 18 LYS C 349 ? PHE C 374 ? LYS A 345 PHE A 370 1 ? 26 
HELX_P HELX_P19 19 SER C 396 ? VAL C 400 ? SER A 392 VAL A 396 5 ? 5  
HELX_P HELX_P20 20 THR C 402 ? ASP C 413 ? THR A 398 ASP A 409 1 ? 12 
HELX_P HELX_P21 21 GLN C 427 ? GLY C 438 ? GLN A 423 GLY A 434 1 ? 12 
HELX_P HELX_P22 22 SER C 449 ? ALA C 475 ? SER A 445 ALA A 471 1 ? 27 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A DG  20  "O3'" ? ? ? 1_555 D MN  .  MN ? ? B DG  120 A MN  500 1_555 ? ? ? ? ? ? ?            2.447 ? ? 
metalc2  metalc ? ? C ASP 101 OD2   ? ? ? 1_555 D MN  .  MN ? ? A ASP 97  A MN  500 1_555 ? ? ? ? ? ? ?            2.090 ? ? 
metalc3  metalc ? ? C ASP 101 OD1   ? ? ? 1_555 E MN  .  MN ? ? A ASP 97  A MN  501 1_555 ? ? ? ? ? ? ?            2.683 ? ? 
metalc4  metalc ? ? C ASP 192 OD2   ? ? ? 1_555 E MN  .  MN ? ? A ASP 188 A MN  501 1_555 ? ? ? ? ? ? ?            2.679 ? ? 
metalc5  metalc ? ? C GLU 330 OE1   ? ? ? 1_555 D MN  .  MN ? ? A GLU 326 A MN  500 1_555 ? ? ? ? ? ? ?            2.521 ? ? 
metalc6  metalc ? ? D MN  .   MN    ? ? ? 1_555 H HOH .  O  ? ? A MN  500 A HOH 714 1_555 ? ? ? ? ? ? ?            2.044 ? ? 
hydrog1  hydrog ? ? A DG  1   N1    ? ? ? 1_555 B DC  20 N3 ? ? B DG  101 C DC  220 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2  hydrog ? ? A DG  1   N2    ? ? ? 1_555 B DC  20 O2 ? ? B DG  101 C DC  220 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ? ? A DG  1   O6    ? ? ? 1_555 B DC  20 N4 ? ? B DG  101 C DC  220 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ? ? A DA  2   N1    ? ? ? 1_555 B DT  19 N3 ? ? B DA  102 C DT  219 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5  hydrog ? ? A DA  2   N6    ? ? ? 1_555 B DT  19 O4 ? ? B DA  102 C DT  219 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ? ? A DG  3   N1    ? ? ? 1_555 B DC  18 N3 ? ? B DG  103 C DC  218 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7  hydrog ? ? A DG  3   N2    ? ? ? 1_555 B DC  18 O2 ? ? B DG  103 C DC  218 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ? ? A DG  3   O6    ? ? ? 1_555 B DC  18 N4 ? ? B DG  103 C DC  218 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9  hydrog ? ? A DA  4   N1    ? ? ? 1_555 B DT  17 N3 ? ? B DA  104 C DT  217 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10 hydrog ? ? A DA  4   N6    ? ? ? 1_555 B DT  17 O4 ? ? B DA  104 C DT  217 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11 hydrog ? ? A DT  5   N3    ? ? ? 1_555 B DA  16 N1 ? ? B DT  105 C DA  216 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ? ? A DT  5   O4    ? ? ? 1_555 B DA  16 N6 ? ? B DT  105 C DA  216 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ? ? A DG  6   N1    ? ? ? 1_555 B DC  15 N3 ? ? B DG  106 C DC  215 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14 hydrog ? ? A DG  6   N2    ? ? ? 1_555 B DC  15 O2 ? ? B DG  106 C DC  215 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15 hydrog ? ? A DG  6   O6    ? ? ? 1_555 B DC  15 N4 ? ? B DG  106 C DC  215 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog16 hydrog ? ? A DT  7   N3    ? ? ? 1_555 B DA  14 N1 ? ? B DT  107 C DA  214 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ? ? A DT  7   O4    ? ? ? 1_555 B DA  14 N6 ? ? B DT  107 C DA  214 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ? ? A DG  8   N1    ? ? ? 1_555 B DC  13 N3 ? ? B DG  108 C DC  213 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19 hydrog ? ? A DG  8   N2    ? ? ? 1_555 B DC  13 O2 ? ? B DG  108 C DC  213 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ? ? A DG  8   O6    ? ? ? 1_555 B DC  13 N4 ? ? B DG  108 C DC  213 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ? ? A DT  9   N3    ? ? ? 1_555 B DA  12 N1 ? ? B DT  109 C DA  212 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ? ? A DT  9   O4    ? ? ? 1_555 B DA  12 N6 ? ? B DT  109 C DA  212 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ? ? A DA  10  N1    ? ? ? 1_555 B DT  11 N3 ? ? B DA  110 C DT  211 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24 hydrog ? ? A DA  10  N6    ? ? ? 1_555 B DT  11 O4 ? ? B DA  110 C DT  211 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25 hydrog ? ? A DT  11  N3    ? ? ? 1_555 B DA  10 N1 ? ? B DT  111 C DA  210 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog26 hydrog ? ? A DT  11  O4    ? ? ? 1_555 B DA  10 N6 ? ? B DT  111 C DA  210 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27 hydrog ? ? A DA  12  N1    ? ? ? 1_555 B DT  9  N3 ? ? B DA  112 C DT  209 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog28 hydrog ? ? A DA  12  N6    ? ? ? 1_555 B DT  9  O4 ? ? B DA  112 C DT  209 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog29 hydrog ? ? A DA  13  N1    ? ? ? 1_555 B DT  8  N3 ? ? B DA  113 C DT  208 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog30 hydrog ? ? A DA  13  N6    ? ? ? 1_555 B DT  8  O4 ? ? B DA  113 C DT  208 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog31 hydrog ? ? A DG  14  N1    ? ? ? 1_555 B DC  7  N3 ? ? B DG  114 C DC  207 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog32 hydrog ? ? A DG  14  N2    ? ? ? 1_555 B DC  7  O2 ? ? B DG  114 C DC  207 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog33 hydrog ? ? A DG  14  O6    ? ? ? 1_555 B DC  7  N4 ? ? B DG  114 C DC  207 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog34 hydrog ? ? A DA  15  N1    ? ? ? 1_555 B DT  6  N3 ? ? B DA  115 C DT  206 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog35 hydrog ? ? A DA  15  N6    ? ? ? 1_555 B DT  6  O4 ? ? B DA  115 C DT  206 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog36 hydrog ? ? A DG  16  N1    ? ? ? 1_555 B DC  5  N3 ? ? B DG  116 C DC  205 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog37 hydrog ? ? A DG  16  N2    ? ? ? 1_555 B DC  5  O2 ? ? B DG  116 C DC  205 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog38 hydrog ? ? A DG  16  O6    ? ? ? 1_555 B DC  5  N4 ? ? B DG  116 C DC  205 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog39 hydrog ? ? A DA  17  N1    ? ? ? 1_555 B DT  4  N3 ? ? B DA  117 C DT  204 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog40 hydrog ? ? A DA  17  N6    ? ? ? 1_555 B DT  4  O4 ? ? B DA  117 C DT  204 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog41 hydrog ? ? A DC  18  N3    ? ? ? 1_555 B DG  3  N1 ? ? B DC  118 C DG  203 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog42 hydrog ? ? A DC  18  N4    ? ? ? 1_555 B DG  3  O6 ? ? B DC  118 C DG  203 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog43 hydrog ? ? A DC  18  O2    ? ? ? 1_555 B DG  3  N2 ? ? B DC  118 C DG  203 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 9 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? parallel      
B 7 8 ? anti-parallel 
B 8 9 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY C 239 ? ILE C 245 ? GLY A 235 ILE A 241 
A 2 ARG C 263 ? THR C 275 ? ARG A 259 THR A 271 
A 3 THR C 282 ? ILE C 291 ? THR A 278 ILE A 287 
A 4 LYS C 301 ? THR C 306 ? LYS A 297 THR A 302 
A 5 ARG C 210 ? ARG C 214 ? ARG A 206 ARG A 210 
A 6 VAL C 187 ? CYS C 191 ? VAL A 183 CYS A 187 
A 7 LEU C 96  ? TYR C 107 ? LEU A 92  TYR A 103 
A 8 ARG C 126 ? GLU C 137 ? ARG A 122 GLU A 133 
A 9 GLY C 116 ? LYS C 117 ? GLY A 112 LYS A 113 
B 1 GLY C 239 ? ILE C 245 ? GLY A 235 ILE A 241 
B 2 ARG C 263 ? THR C 275 ? ARG A 259 THR A 271 
B 3 THR C 282 ? ILE C 291 ? THR A 278 ILE A 287 
B 4 LYS C 301 ? THR C 306 ? LYS A 297 THR A 302 
B 5 ARG C 210 ? ARG C 214 ? ARG A 206 ARG A 210 
B 6 VAL C 187 ? CYS C 191 ? VAL A 183 CYS A 187 
B 7 LEU C 96  ? TYR C 107 ? LEU A 92  TYR A 103 
B 8 ARG C 126 ? GLU C 137 ? ARG A 122 GLU A 133 
B 9 THR C 143 ? TRP C 152 ? THR A 139 TRP A 148 
C 1 LYS C 248 ? VAL C 250 ? LYS A 244 VAL A 246 
C 2 LYS C 258 ? ARG C 260 ? LYS A 254 ARG A 256 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE C 243 ? N ILE A 239 O ALA C 265 ? O ALA A 261 
A 2 3 N ILE C 274 ? N ILE A 270 O LEU C 283 ? O LEU A 279 
A 3 4 N ALA C 288 ? N ALA A 284 O TRP C 302 ? O TRP A 298 
A 4 5 O LEU C 305 ? O LEU A 301 N VAL C 213 ? N VAL A 209 
A 5 6 O VAL C 212 ? O VAL A 208 N ALA C 189 ? N ALA A 185 
A 6 7 O ILE C 188 ? O ILE A 184 N ALA C 98  ? N ALA A 94  
A 7 8 N TYR C 107 ? N TYR A 103 O ARG C 126 ? O ARG A 122 
A 8 9 O GLY C 127 ? O GLY A 123 N GLY C 116 ? N GLY A 112 
B 1 2 N ILE C 243 ? N ILE A 239 O ALA C 265 ? O ALA A 261 
B 2 3 N ILE C 274 ? N ILE A 270 O LEU C 283 ? O LEU A 279 
B 3 4 N ALA C 288 ? N ALA A 284 O TRP C 302 ? O TRP A 298 
B 4 5 O LEU C 305 ? O LEU A 301 N VAL C 213 ? N VAL A 209 
B 5 6 O VAL C 212 ? O VAL A 208 N ALA C 189 ? N ALA A 185 
B 6 7 O ILE C 188 ? O ILE A 184 N ALA C 98  ? N ALA A 94  
B 7 8 N TYR C 107 ? N TYR A 103 O ARG C 126 ? O ARG A 122 
B 8 9 N LEU C 135 ? N LEU A 131 O GLY C 145 ? O GLY A 141 
C 1 2 N LYS C 248 ? N LYS A 244 O ARG C 260 ? O ARG A 256 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN 500 ? 5 'BINDING SITE FOR RESIDUE MN A 500' 
AC2 Software A MN 501 ? 4 'BINDING SITE FOR RESIDUE MN A 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 ASP C 101 ? ASP A 97  . ? 1_555 ? 
2 AC1 5 THR C 102 ? THR A 98  . ? 1_555 ? 
3 AC1 5 GLU C 330 ? GLU A 326 . ? 1_555 ? 
4 AC1 5 HOH H .   ? HOH A 714 . ? 1_555 ? 
5 AC1 5 DG  A 20  ? DG  B 120 . ? 1_555 ? 
6 AC2 4 ASP C 101 ? ASP A 97  . ? 1_555 ? 
7 AC2 4 ASP C 192 ? ASP A 188 . ? 1_555 ? 
8 AC2 4 HOH H .   ? HOH A 692 . ? 1_555 ? 
9 AC2 4 HOH H .   ? HOH A 714 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1MM8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1MM8 
_atom_sites.fract_transf_matrix[1][1]   0.008889 
_atom_sites.fract_transf_matrix[1][2]   0.005132 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010264 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004283 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1   ? -15.059 84.714 166.897 1.00 96.78 ? 101 DG  B "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1   ? -15.757 85.070 165.697 1.00 97.26 ? 101 DG  B "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1   ? -17.227 84.725 165.748 1.00 96.54 ? 101 DG  B "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1   ? -17.347 83.303 165.985 1.00 96.37 ? 101 DG  B "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1   ? -17.967 85.383 166.908 1.00 96.28 ? 101 DG  B "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1   ? -19.354 85.537 166.597 1.00 95.81 ? 101 DG  B "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1   ? -17.776 84.392 168.041 1.00 96.46 ? 101 DG  B "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1   ? -17.803 83.054 167.314 1.00 96.05 ? 101 DG  B "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1   ? -16.914 82.061 167.903 1.00 95.41 ? 101 DG  B N9    1 
ATOM   10   C  C8    . DG  A 1 1   ? -15.578 82.220 168.180 1.00 94.94 ? 101 DG  B C8    1 
ATOM   11   N  N7    . DG  A 1 1   ? -15.032 81.157 168.701 1.00 94.88 ? 101 DG  B N7    1 
ATOM   12   C  C5    . DG  A 1 1   ? -16.067 80.237 168.776 1.00 94.80 ? 101 DG  B C5    1 
ATOM   13   C  C6    . DG  A 1 1   ? -16.070 78.907 169.258 1.00 94.46 ? 101 DG  B C6    1 
ATOM   14   O  O6    . DG  A 1 1   ? -15.129 78.258 169.734 1.00 93.91 ? 101 DG  B O6    1 
ATOM   15   N  N1    . DG  A 1 1   ? -17.330 78.331 169.150 1.00 95.01 ? 101 DG  B N1    1 
ATOM   16   C  C2    . DG  A 1 1   ? -18.447 78.954 168.646 1.00 95.06 ? 101 DG  B C2    1 
ATOM   17   N  N2    . DG  A 1 1   ? -19.570 78.219 168.631 1.00 95.02 ? 101 DG  B N2    1 
ATOM   18   N  N3    . DG  A 1 1   ? -18.459 80.201 168.193 1.00 95.08 ? 101 DG  B N3    1 
ATOM   19   C  C4    . DG  A 1 1   ? -17.239 80.778 168.288 1.00 95.21 ? 101 DG  B C4    1 
ATOM   20   P  P     . DA  A 1 2   ? -20.354 86.111 167.716 1.00 96.28 ? 102 DA  B P     1 
ATOM   21   O  OP1   . DA  A 1 2   ? -21.392 86.904 167.017 1.00 95.62 ? 102 DA  B OP1   1 
ATOM   22   O  OP2   . DA  A 1 2   ? -19.528 86.745 168.787 1.00 95.23 ? 102 DA  B OP2   1 
ATOM   23   O  "O5'" . DA  A 1 2   ? -21.057 84.812 168.322 1.00 95.47 ? 102 DA  B "O5'" 1 
ATOM   24   C  "C5'" . DA  A 1 2   ? -21.961 84.041 167.528 1.00 92.33 ? 102 DA  B "C5'" 1 
ATOM   25   C  "C4'" . DA  A 1 2   ? -22.871 83.192 168.392 1.00 89.30 ? 102 DA  B "C4'" 1 
ATOM   26   O  "O4'" . DA  A 1 2   ? -22.104 82.127 169.004 1.00 88.09 ? 102 DA  B "O4'" 1 
ATOM   27   C  "C3'" . DA  A 1 2   ? -23.509 83.941 169.559 1.00 87.83 ? 102 DA  B "C3'" 1 
ATOM   28   O  "O3'" . DA  A 1 2   ? -24.791 83.380 169.868 1.00 87.10 ? 102 DA  B "O3'" 1 
ATOM   29   C  "C2'" . DA  A 1 2   ? -22.498 83.752 170.674 1.00 87.05 ? 102 DA  B "C2'" 1 
ATOM   30   C  "C1'" . DA  A 1 2   ? -21.972 82.353 170.403 1.00 86.81 ? 102 DA  B "C1'" 1 
ATOM   31   N  N9    . DA  A 1 2   ? -20.571 82.141 170.770 1.00 86.59 ? 102 DA  B N9    1 
ATOM   32   C  C8    . DA  A 1 2   ? -19.533 83.042 170.747 1.00 86.25 ? 102 DA  B C8    1 
ATOM   33   N  N7    . DA  A 1 2   ? -18.391 82.543 171.154 1.00 86.09 ? 102 DA  B N7    1 
ATOM   34   C  C5    . DA  A 1 2   ? -18.698 81.225 171.462 1.00 85.81 ? 102 DA  B C5    1 
ATOM   35   C  C6    . DA  A 1 2   ? -17.923 80.160 171.946 1.00 85.34 ? 102 DA  B C6    1 
ATOM   36   N  N6    . DA  A 1 2   ? -16.626 80.252 172.223 1.00 84.47 ? 102 DA  B N6    1 
ATOM   37   N  N1    . DA  A 1 2   ? -18.536 78.976 172.140 1.00 85.63 ? 102 DA  B N1    1 
ATOM   38   C  C2    . DA  A 1 2   ? -19.838 78.879 171.865 1.00 86.14 ? 102 DA  B C2    1 
ATOM   39   N  N3    . DA  A 1 2   ? -20.674 79.804 171.410 1.00 86.11 ? 102 DA  B N3    1 
ATOM   40   C  C4    . DA  A 1 2   ? -20.035 80.966 171.227 1.00 86.06 ? 102 DA  B C4    1 
ATOM   41   P  P     . DG  A 1 3   ? -25.431 83.598 171.330 1.00 86.39 ? 103 DG  B P     1 
ATOM   42   O  OP1   . DG  A 1 3   ? -26.907 83.558 171.187 1.00 84.47 ? 103 DG  B OP1   1 
ATOM   43   O  OP2   . DG  A 1 3   ? -24.788 84.763 171.994 1.00 86.55 ? 103 DG  B OP2   1 
ATOM   44   O  "O5'" . DG  A 1 3   ? -24.975 82.290 172.115 1.00 85.35 ? 103 DG  B "O5'" 1 
ATOM   45   C  "C5'" . DG  A 1 3   ? -24.975 81.035 171.442 1.00 82.43 ? 103 DG  B "C5'" 1 
ATOM   46   C  "C4'" . DG  A 1 3   ? -24.984 79.887 172.425 1.00 80.15 ? 103 DG  B "C4'" 1 
ATOM   47   O  "O4'" . DG  A 1 3   ? -23.634 79.604 172.868 1.00 79.43 ? 103 DG  B "O4'" 1 
ATOM   48   C  "C3'" . DG  A 1 3   ? -25.772 80.182 173.697 1.00 79.09 ? 103 DG  B "C3'" 1 
ATOM   49   O  "O3'" . DG  A 1 3   ? -26.361 78.961 174.169 1.00 78.20 ? 103 DG  B "O3'" 1 
ATOM   50   C  "C2'" . DG  A 1 3   ? -24.714 80.782 174.612 1.00 77.85 ? 103 DG  B "C2'" 1 
ATOM   51   C  "C1'" . DG  A 1 3   ? -23.475 79.984 174.229 1.00 77.87 ? 103 DG  B "C1'" 1 
ATOM   52   N  N9    . DG  A 1 3   ? -22.171 80.625 174.377 1.00 76.10 ? 103 DG  B N9    1 
ATOM   53   C  C8    . DG  A 1 3   ? -21.854 81.949 174.214 1.00 75.31 ? 103 DG  B C8    1 
ATOM   54   N  N7    . DG  A 1 3   ? -20.587 82.200 174.403 1.00 74.44 ? 103 DG  B N7    1 
ATOM   55   C  C5    . DG  A 1 3   ? -20.036 80.966 174.717 1.00 74.62 ? 103 DG  B C5    1 
ATOM   56   C  C6    . DG  A 1 3   ? -18.691 80.601 175.029 1.00 74.08 ? 103 DG  B C6    1 
ATOM   57   O  O6    . DG  A 1 3   ? -17.689 81.319 175.086 1.00 72.78 ? 103 DG  B O6    1 
ATOM   58   N  N1    . DG  A 1 3   ? -18.577 79.238 175.286 1.00 74.29 ? 103 DG  B N1    1 
ATOM   59   C  C2    . DG  A 1 3   ? -19.615 78.338 175.254 1.00 74.69 ? 103 DG  B C2    1 
ATOM   60   N  N2    . DG  A 1 3   ? -19.304 77.068 175.533 1.00 75.03 ? 103 DG  B N2    1 
ATOM   61   N  N3    . DG  A 1 3   ? -20.868 78.664 174.969 1.00 75.39 ? 103 DG  B N3    1 
ATOM   62   C  C4    . DG  A 1 3   ? -21.002 79.985 174.710 1.00 75.60 ? 103 DG  B C4    1 
ATOM   63   P  P     . DA  A 1 4   ? -26.848 78.829 175.690 1.00 76.51 ? 104 DA  B P     1 
ATOM   64   O  OP1   . DA  A 1 4   ? -27.878 77.764 175.724 1.00 77.55 ? 104 DA  B OP1   1 
ATOM   65   O  OP2   . DA  A 1 4   ? -27.146 80.160 176.261 1.00 77.36 ? 104 DA  B OP2   1 
ATOM   66   O  "O5'" . DA  A 1 4   ? -25.563 78.262 176.415 1.00 74.23 ? 104 DA  B "O5'" 1 
ATOM   67   C  "C5'" . DA  A 1 4   ? -25.690 77.451 177.557 1.00 71.95 ? 104 DA  B "C5'" 1 
ATOM   68   C  "C4'" . DA  A 1 4   ? -24.768 76.265 177.451 1.00 69.63 ? 104 DA  B "C4'" 1 
ATOM   69   O  "O4'" . DA  A 1 4   ? -23.469 76.733 177.026 1.00 69.32 ? 104 DA  B "O4'" 1 
ATOM   70   C  "C3'" . DA  A 1 4   ? -24.550 75.628 178.813 1.00 69.14 ? 104 DA  B "C3'" 1 
ATOM   71   O  "O3'" . DA  A 1 4   ? -24.295 74.236 178.704 1.00 66.10 ? 104 DA  B "O3'" 1 
ATOM   72   C  "C2'" . DA  A 1 4   ? -23.376 76.406 179.367 1.00 69.49 ? 104 DA  B "C2'" 1 
ATOM   73   C  "C1'" . DA  A 1 4   ? -22.558 76.718 178.119 1.00 69.83 ? 104 DA  B "C1'" 1 
ATOM   74   N  N9    . DA  A 1 4   ? -21.939 78.041 178.194 1.00 70.87 ? 104 DA  B N9    1 
ATOM   75   C  C8    . DA  A 1 4   ? -22.548 79.265 178.081 1.00 70.04 ? 104 DA  B C8    1 
ATOM   76   N  N7    . DA  A 1 4   ? -21.724 80.275 178.191 1.00 70.96 ? 104 DA  B N7    1 
ATOM   77   C  C5    . DA  A 1 4   ? -20.488 79.678 178.392 1.00 71.61 ? 104 DA  B C5    1 
ATOM   78   C  C6    . DA  A 1 4   ? -19.198 80.207 178.582 1.00 71.88 ? 104 DA  B C6    1 
ATOM   79   N  N6    . DA  A 1 4   ? -18.927 81.513 178.597 1.00 71.47 ? 104 DA  B N6    1 
ATOM   80   N  N1    . DA  A 1 4   ? -18.182 79.337 178.759 1.00 72.34 ? 104 DA  B N1    1 
ATOM   81   C  C2    . DA  A 1 4   ? -18.451 78.027 178.743 1.00 73.00 ? 104 DA  B C2    1 
ATOM   82   N  N3    . DA  A 1 4   ? -19.617 77.409 178.572 1.00 73.19 ? 104 DA  B N3    1 
ATOM   83   C  C4    . DA  A 1 4   ? -20.607 78.302 178.399 1.00 72.04 ? 104 DA  B C4    1 
ATOM   84   P  P     . DT  A 1 5   ? -24.356 73.327 180.022 1.00 63.19 ? 105 DT  B P     1 
ATOM   85   O  OP1   . DT  A 1 5   ? -24.484 71.920 179.536 1.00 63.84 ? 105 DT  B OP1   1 
ATOM   86   O  OP2   . DT  A 1 5   ? -25.384 73.897 180.927 1.00 61.24 ? 105 DT  B OP2   1 
ATOM   87   O  "O5'" . DT  A 1 5   ? -22.917 73.520 180.687 1.00 61.07 ? 105 DT  B "O5'" 1 
ATOM   88   C  "C5'" . DT  A 1 5   ? -21.755 73.087 179.979 1.00 57.45 ? 105 DT  B "C5'" 1 
ATOM   89   C  "C4'" . DT  A 1 5   ? -20.522 73.115 180.855 1.00 55.12 ? 105 DT  B "C4'" 1 
ATOM   90   O  "O4'" . DT  A 1 5   ? -19.910 74.431 180.835 1.00 54.34 ? 105 DT  B "O4'" 1 
ATOM   91   C  "C3'" . DT  A 1 5   ? -20.834 72.835 182.326 1.00 53.29 ? 105 DT  B "C3'" 1 
ATOM   92   O  "O3'" . DT  A 1 5   ? -19.677 72.248 182.941 1.00 49.96 ? 105 DT  B "O3'" 1 
ATOM   93   C  "C2'" . DT  A 1 5   ? -21.090 74.226 182.877 1.00 53.69 ? 105 DT  B "C2'" 1 
ATOM   94   C  "C1'" . DT  A 1 5   ? -20.039 75.020 182.118 1.00 55.40 ? 105 DT  B "C1'" 1 
ATOM   95   N  N1    . DT  A 1 5   ? -20.209 76.483 181.985 1.00 57.37 ? 105 DT  B N1    1 
ATOM   96   C  C2    . DT  A 1 5   ? -19.072 77.246 182.120 1.00 57.17 ? 105 DT  B C2    1 
ATOM   97   O  O2    . DT  A 1 5   ? -17.970 76.764 182.295 1.00 57.75 ? 105 DT  B O2    1 
ATOM   98   N  N3    . DT  A 1 5   ? -19.276 78.594 182.051 1.00 57.31 ? 105 DT  B N3    1 
ATOM   99   C  C4    . DT  A 1 5   ? -20.478 79.242 181.863 1.00 57.85 ? 105 DT  B C4    1 
ATOM   100  O  O4    . DT  A 1 5   ? -20.506 80.464 181.837 1.00 60.13 ? 105 DT  B O4    1 
ATOM   101  C  C5    . DT  A 1 5   ? -21.629 78.384 181.711 1.00 57.44 ? 105 DT  B C5    1 
ATOM   102  C  C7    . DT  A 1 5   ? -22.972 79.002 181.492 1.00 56.38 ? 105 DT  B C7    1 
ATOM   103  C  C6    . DT  A 1 5   ? -21.440 77.063 181.774 1.00 57.59 ? 105 DT  B C6    1 
ATOM   104  P  P     . DG  A 1 6   ? -19.679 71.932 184.515 1.00 48.86 ? 106 DG  B P     1 
ATOM   105  O  OP1   . DG  A 1 6   ? -19.365 70.495 184.621 1.00 47.63 ? 106 DG  B OP1   1 
ATOM   106  O  OP2   . DG  A 1 6   ? -20.919 72.478 185.127 1.00 48.77 ? 106 DG  B OP2   1 
ATOM   107  O  "O5'" . DG  A 1 6   ? -18.447 72.753 185.091 1.00 48.49 ? 106 DG  B "O5'" 1 
ATOM   108  C  "C5'" . DG  A 1 6   ? -17.159 72.532 184.545 1.00 49.32 ? 106 DG  B "C5'" 1 
ATOM   109  C  "C4'" . DG  A 1 6   ? -16.098 73.326 185.273 1.00 48.85 ? 106 DG  B "C4'" 1 
ATOM   110  O  "O4'" . DG  A 1 6   ? -16.236 74.738 184.970 1.00 51.04 ? 106 DG  B "O4'" 1 
ATOM   111  C  "C3'" . DG  A 1 6   ? -16.190 73.228 186.794 1.00 46.63 ? 106 DG  B "C3'" 1 
ATOM   112  O  "O3'" . DG  A 1 6   ? -14.875 73.343 187.356 1.00 43.09 ? 106 DG  B "O3'" 1 
ATOM   113  C  "C2'" . DG  A 1 6   ? -17.106 74.383 187.143 1.00 47.92 ? 106 DG  B "C2'" 1 
ATOM   114  C  "C1'" . DG  A 1 6   ? -16.685 75.436 186.127 1.00 52.27 ? 106 DG  B "C1'" 1 
ATOM   115  N  N9    . DG  A 1 6   ? -17.685 76.428 185.730 1.00 54.96 ? 106 DG  B N9    1 
ATOM   116  C  C8    . DG  A 1 6   ? -18.961 76.222 185.258 1.00 55.57 ? 106 DG  B C8    1 
ATOM   117  N  N7    . DG  A 1 6   ? -19.618 77.333 185.057 1.00 55.99 ? 106 DG  B N7    1 
ATOM   118  C  C5    . DG  A 1 6   ? -18.717 78.330 185.398 1.00 56.50 ? 106 DG  B C5    1 
ATOM   119  C  C6    . DG  A 1 6   ? -18.861 79.748 185.395 1.00 57.18 ? 106 DG  B C6    1 
ATOM   120  O  O6    . DG  A 1 6   ? -19.851 80.424 185.086 1.00 56.28 ? 106 DG  B O6    1 
ATOM   121  N  N1    . DG  A 1 6   ? -17.696 80.380 185.812 1.00 57.95 ? 106 DG  B N1    1 
ATOM   122  C  C2    . DG  A 1 6   ? -16.542 79.738 186.195 1.00 58.09 ? 106 DG  B C2    1 
ATOM   123  N  N2    . DG  A 1 6   ? -15.527 80.518 186.572 1.00 59.42 ? 106 DG  B N2    1 
ATOM   124  N  N3    . DG  A 1 6   ? -16.397 78.423 186.209 1.00 58.53 ? 106 DG  B N3    1 
ATOM   125  C  C4    . DG  A 1 6   ? -17.517 77.787 185.801 1.00 56.59 ? 106 DG  B C4    1 
ATOM   126  P  P     . DT  A 1 7   ? -14.683 73.644 188.921 1.00 43.87 ? 107 DT  B P     1 
ATOM   127  O  OP1   . DT  A 1 7   ? -13.405 73.015 189.347 1.00 41.02 ? 107 DT  B OP1   1 
ATOM   128  O  OP2   . DT  A 1 7   ? -15.927 73.312 189.629 1.00 43.60 ? 107 DT  B OP2   1 
ATOM   129  O  "O5'" . DT  A 1 7   ? -14.497 75.226 188.960 1.00 45.61 ? 107 DT  B "O5'" 1 
ATOM   130  C  "C5'" . DT  A 1 7   ? -13.521 75.856 188.128 1.00 42.60 ? 107 DT  B "C5'" 1 
ATOM   131  C  "C4'" . DT  A 1 7   ? -12.891 77.032 188.840 1.00 40.70 ? 107 DT  B "C4'" 1 
ATOM   132  O  "O4'" . DT  A 1 7   ? -13.741 78.198 188.685 1.00 40.83 ? 107 DT  B "O4'" 1 
ATOM   133  C  "C3'" . DT  A 1 7   ? -12.755 76.828 190.346 1.00 38.11 ? 107 DT  B "C3'" 1 
ATOM   134  O  "O3'" . DT  A 1 7   ? -11.585 77.491 190.840 1.00 35.11 ? 107 DT  B "O3'" 1 
ATOM   135  C  "C2'" . DT  A 1 7   ? -14.071 77.385 190.871 1.00 39.88 ? 107 DT  B "C2'" 1 
ATOM   136  C  "C1'" . DT  A 1 7   ? -14.356 78.540 189.919 1.00 41.98 ? 107 DT  B "C1'" 1 
ATOM   137  N  N1    . DT  A 1 7   ? -15.777 78.861 189.640 1.00 45.29 ? 107 DT  B N1    1 
ATOM   138  C  C2    . DT  A 1 7   ? -16.169 80.188 189.633 1.00 47.21 ? 107 DT  B C2    1 
ATOM   139  O  O2    . DT  A 1 7   ? -15.413 81.114 189.878 1.00 49.37 ? 107 DT  B O2    1 
ATOM   140  N  N3    . DT  A 1 7   ? -17.495 80.396 189.329 1.00 46.82 ? 107 DT  B N3    1 
ATOM   141  C  C4    . DT  A 1 7   ? -18.450 79.439 189.055 1.00 46.95 ? 107 DT  B C4    1 
ATOM   142  O  O4    . DT  A 1 7   ? -19.600 79.782 188.803 1.00 47.97 ? 107 DT  B O4    1 
ATOM   143  C  C5    . DT  A 1 7   ? -17.979 78.069 189.094 1.00 47.37 ? 107 DT  B C5    1 
ATOM   144  C  C7    . DT  A 1 7   ? -18.943 76.957 188.813 1.00 44.83 ? 107 DT  B C7    1 
ATOM   145  C  C6    . DT  A 1 7   ? -16.681 77.856 189.382 1.00 46.96 ? 107 DT  B C6    1 
ATOM   146  P  P     . DG  A 1 8   ? -11.056 77.205 192.339 1.00 38.30 ? 108 DG  B P     1 
ATOM   147  O  OP1   . DG  A 1 8   ? -9.607  76.870 192.283 1.00 39.16 ? 108 DG  B OP1   1 
ATOM   148  O  OP2   . DG  A 1 8   ? -11.990 76.310 193.074 1.00 38.64 ? 108 DG  B OP2   1 
ATOM   149  O  "O5'" . DG  A 1 8   ? -11.182 78.631 193.020 1.00 37.68 ? 108 DG  B "O5'" 1 
ATOM   150  C  "C5'" . DG  A 1 8   ? -12.289 79.434 192.669 1.00 37.18 ? 108 DG  B "C5'" 1 
ATOM   151  C  "C4'" . DG  A 1 8   ? -12.293 80.744 193.426 1.00 35.65 ? 108 DG  B "C4'" 1 
ATOM   152  O  "O4'" . DG  A 1 8   ? -13.519 81.392 193.058 1.00 37.95 ? 108 DG  B "O4'" 1 
ATOM   153  C  "C3'" . DG  A 1 8   ? -12.327 80.673 194.945 1.00 35.34 ? 108 DG  B "C3'" 1 
ATOM   154  O  "O3'" . DG  A 1 8   ? -11.839 81.922 195.452 1.00 35.50 ? 108 DG  B "O3'" 1 
ATOM   155  C  "C2'" . DG  A 1 8   ? -13.808 80.510 195.222 1.00 36.03 ? 108 DG  B "C2'" 1 
ATOM   156  C  "C1'" . DG  A 1 8   ? -14.450 81.323 194.125 1.00 39.99 ? 108 DG  B "C1'" 1 
ATOM   157  N  N9    . DG  A 1 8   ? -15.692 80.755 193.567 1.00 43.36 ? 108 DG  B N9    1 
ATOM   158  C  C8    . DG  A 1 8   ? -15.984 79.441 193.367 1.00 44.83 ? 108 DG  B C8    1 
ATOM   159  N  N7    . DG  A 1 8   ? -17.140 79.269 192.774 1.00 45.08 ? 108 DG  B N7    1 
ATOM   160  C  C5    . DG  A 1 8   ? -17.621 80.550 192.613 1.00 46.26 ? 108 DG  B C5    1 
ATOM   161  C  C6    . DG  A 1 8   ? -18.831 81.023 192.036 1.00 46.50 ? 108 DG  B C6    1 
ATOM   162  O  O6    . DG  A 1 8   ? -19.742 80.366 191.525 1.00 47.12 ? 108 DG  B O6    1 
ATOM   163  N  N1    . DG  A 1 8   ? -18.916 82.413 192.086 1.00 48.93 ? 108 DG  B N1    1 
ATOM   164  C  C2    . DG  A 1 8   ? -17.956 83.250 192.618 1.00 48.08 ? 108 DG  B C2    1 
ATOM   165  N  N2    . DG  A 1 8   ? -18.212 84.563 192.571 1.00 48.52 ? 108 DG  B N2    1 
ATOM   166  N  N3    . DG  A 1 8   ? -16.833 82.823 193.153 1.00 46.36 ? 108 DG  B N3    1 
ATOM   167  C  C4    . DG  A 1 8   ? -16.734 81.496 193.117 1.00 45.48 ? 108 DG  B C4    1 
ATOM   168  P  P     . DT  A 1 9   ? -11.671 82.166 197.038 1.00 39.74 ? 109 DT  B P     1 
ATOM   169  O  OP1   . DT  A 1 9   ? -10.350 82.843 197.225 1.00 41.10 ? 109 DT  B OP1   1 
ATOM   170  O  OP2   . DT  A 1 9   ? -11.978 80.956 197.820 1.00 38.62 ? 109 DT  B OP2   1 
ATOM   171  O  "O5'" . DT  A 1 9   ? -12.780 83.263 197.366 1.00 40.41 ? 109 DT  B "O5'" 1 
ATOM   172  C  "C5'" . DT  A 1 9   ? -14.018 83.253 196.673 1.00 41.29 ? 109 DT  B "C5'" 1 
ATOM   173  C  "C4'" . DT  A 1 9   ? -14.915 84.388 197.122 1.00 41.84 ? 109 DT  B "C4'" 1 
ATOM   174  O  "O4'" . DT  A 1 9   ? -16.143 84.237 196.376 1.00 43.03 ? 109 DT  B "O4'" 1 
ATOM   175  C  "C3'" . DT  A 1 9   ? -15.335 84.353 198.592 1.00 41.67 ? 109 DT  B "C3'" 1 
ATOM   176  O  "O3'" . DT  A 1 9   ? -15.673 85.669 199.059 1.00 40.91 ? 109 DT  B "O3'" 1 
ATOM   177  C  "C2'" . DT  A 1 9   ? -16.553 83.453 198.565 1.00 42.66 ? 109 DT  B "C2'" 1 
ATOM   178  C  "C1'" . DT  A 1 9   ? -17.184 83.779 197.221 1.00 44.05 ? 109 DT  B "C1'" 1 
ATOM   179  N  N1    . DT  A 1 9   ? -17.820 82.618 196.561 1.00 47.20 ? 109 DT  B N1    1 
ATOM   180  C  C2    . DT  A 1 9   ? -18.933 82.867 195.800 1.00 48.46 ? 109 DT  B C2    1 
ATOM   181  O  O2    . DT  A 1 9   ? -19.376 83.988 195.634 1.00 52.19 ? 109 DT  B O2    1 
ATOM   182  N  N3    . DT  A 1 9   ? -19.511 81.754 195.243 1.00 46.71 ? 109 DT  B N3    1 
ATOM   183  C  C4    . DT  A 1 9   ? -19.089 80.444 195.372 1.00 46.28 ? 109 DT  B C4    1 
ATOM   184  O  O4    . DT  A 1 9   ? -19.710 79.548 194.816 1.00 46.56 ? 109 DT  B O4    1 
ATOM   185  C  C5    . DT  A 1 9   ? -17.904 80.251 196.177 1.00 45.55 ? 109 DT  B C5    1 
ATOM   186  C  C7    . DT  A 1 9   ? -17.373 78.866 196.368 1.00 44.84 ? 109 DT  B C7    1 
ATOM   187  C  C6    . DT  A 1 9   ? -17.332 81.333 196.720 1.00 46.79 ? 109 DT  B C6    1 
ATOM   188  P  P     . DA  A 1 10  ? -15.963 85.914 200.626 1.00 43.70 ? 110 DA  B P     1 
ATOM   189  O  OP1   . DA  A 1 10  ? -15.246 87.147 201.023 1.00 41.68 ? 110 DA  B OP1   1 
ATOM   190  O  OP2   . DA  A 1 10  ? -15.703 84.656 201.372 1.00 42.22 ? 110 DA  B OP2   1 
ATOM   191  O  "O5'" . DA  A 1 10  ? -17.533 86.218 200.672 1.00 44.18 ? 110 DA  B "O5'" 1 
ATOM   192  C  "C5'" . DA  A 1 10  ? -18.435 85.543 199.787 1.00 46.18 ? 110 DA  B "C5'" 1 
ATOM   193  C  "C4'" . DA  A 1 10  ? -19.853 86.041 199.965 1.00 47.74 ? 110 DA  B "C4'" 1 
ATOM   194  O  "O4'" . DA  A 1 10  ? -20.660 85.318 199.000 1.00 48.37 ? 110 DA  B "O4'" 1 
ATOM   195  C  "C3'" . DA  A 1 10  ? -20.464 85.716 201.328 1.00 48.00 ? 110 DA  B "C3'" 1 
ATOM   196  O  "O3'" . DA  A 1 10  ? -21.524 86.623 201.671 1.00 46.74 ? 110 DA  B "O3'" 1 
ATOM   197  C  "C2'" . DA  A 1 10  ? -21.035 84.331 201.115 1.00 49.49 ? 110 DA  B "C2'" 1 
ATOM   198  C  "C1'" . DA  A 1 10  ? -21.494 84.375 199.666 1.00 50.10 ? 110 DA  B "C1'" 1 
ATOM   199  N  N9    . DA  A 1 10  ? -21.333 83.070 199.025 1.00 51.09 ? 110 DA  B N9    1 
ATOM   200  C  C8    . DA  A 1 10  ? -20.237 82.242 199.079 1.00 50.03 ? 110 DA  B C8    1 
ATOM   201  N  N7    . DA  A 1 10  ? -20.417 81.090 198.485 1.00 50.35 ? 110 DA  B N7    1 
ATOM   202  C  C5    . DA  A 1 10  ? -21.712 81.168 197.991 1.00 50.85 ? 110 DA  B C5    1 
ATOM   203  C  C6    . DA  A 1 10  ? -22.499 80.263 197.267 1.00 51.39 ? 110 DA  B C6    1 
ATOM   204  N  N6    . DA  A 1 10  ? -22.089 79.042 196.913 1.00 51.86 ? 110 DA  B N6    1 
ATOM   205  N  N1    . DA  A 1 10  ? -23.740 80.658 196.915 1.00 51.03 ? 110 DA  B N1    1 
ATOM   206  C  C2    . DA  A 1 10  ? -24.153 81.877 197.279 1.00 49.44 ? 110 DA  B C2    1 
ATOM   207  N  N3    . DA  A 1 10  ? -23.514 82.809 197.966 1.00 49.23 ? 110 DA  B N3    1 
ATOM   208  C  C4    . DA  A 1 10  ? -22.279 82.389 198.297 1.00 50.83 ? 110 DA  B C4    1 
ATOM   209  P  P     . DT  A 1 11  ? -22.412 86.335 202.988 1.00 46.64 ? 111 DT  B P     1 
ATOM   210  O  OP1   . DT  A 1 11  ? -22.866 87.634 203.514 1.00 48.73 ? 111 DT  B OP1   1 
ATOM   211  O  OP2   . DT  A 1 11  ? -21.700 85.384 203.912 1.00 44.78 ? 111 DT  B OP2   1 
ATOM   212  O  "O5'" . DT  A 1 11  ? -23.684 85.582 202.396 1.00 45.19 ? 111 DT  B "O5'" 1 
ATOM   213  C  "C5'" . DT  A 1 11  ? -24.432 86.182 201.347 1.00 44.13 ? 111 DT  B "C5'" 1 
ATOM   214  C  "C4'" . DT  A 1 11  ? -25.836 85.621 201.285 1.00 45.34 ? 111 DT  B "C4'" 1 
ATOM   215  O  "O4'" . DT  A 1 11  ? -25.811 84.360 200.562 1.00 44.64 ? 111 DT  B "O4'" 1 
ATOM   216  C  "C3'" . DT  A 1 11  ? -26.405 85.291 202.668 1.00 44.84 ? 111 DT  B "C3'" 1 
ATOM   217  O  "O3'" . DT  A 1 11  ? -27.837 85.463 202.734 1.00 40.81 ? 111 DT  B "O3'" 1 
ATOM   218  C  "C2'" . DT  A 1 11  ? -25.968 83.849 202.873 1.00 44.32 ? 111 DT  B "C2'" 1 
ATOM   219  C  "C1'" . DT  A 1 11  ? -26.059 83.280 201.459 1.00 44.94 ? 111 DT  B "C1'" 1 
ATOM   220  N  N1    . DT  A 1 11  ? -25.131 82.181 201.144 1.00 45.70 ? 111 DT  B N1    1 
ATOM   221  C  C2    . DT  A 1 11  ? -25.596 81.146 200.358 1.00 46.06 ? 111 DT  B C2    1 
ATOM   222  O  O2    . DT  A 1 11  ? -26.719 81.122 199.870 1.00 46.99 ? 111 DT  B O2    1 
ATOM   223  N  N3    . DT  A 1 11  ? -24.697 80.130 200.161 1.00 45.43 ? 111 DT  B N3    1 
ATOM   224  C  C4    . DT  A 1 11  ? -23.412 80.047 200.648 1.00 45.39 ? 111 DT  B C4    1 
ATOM   225  O  O4    . DT  A 1 11  ? -22.724 79.064 200.384 1.00 47.63 ? 111 DT  B O4    1 
ATOM   226  C  C5    . DT  A 1 11  ? -22.982 81.177 201.451 1.00 45.10 ? 111 DT  B C5    1 
ATOM   227  C  C7    . DT  A 1 11  ? -21.600 81.178 202.027 1.00 43.16 ? 111 DT  B C7    1 
ATOM   228  C  C6    . DT  A 1 11  ? -23.852 82.176 201.647 1.00 44.53 ? 111 DT  B C6    1 
ATOM   229  P  P     . DA  A 1 12  ? -28.603 85.313 204.150 1.00 41.51 ? 112 DA  B P     1 
ATOM   230  O  OP1   . DA  A 1 12  ? -29.541 86.456 204.292 1.00 43.20 ? 112 DA  B OP1   1 
ATOM   231  O  OP2   . DA  A 1 12  ? -27.674 84.979 205.265 1.00 37.81 ? 112 DA  B OP2   1 
ATOM   232  O  "O5'" . DA  A 1 12  ? -29.534 84.052 203.915 1.00 43.18 ? 112 DA  B "O5'" 1 
ATOM   233  C  "C5'" . DA  A 1 12  ? -29.123 83.006 203.048 1.00 43.45 ? 112 DA  B "C5'" 1 
ATOM   234  C  "C4'" . DA  A 1 12  ? -30.255 82.032 202.856 1.00 42.48 ? 112 DA  B "C4'" 1 
ATOM   235  O  "O4'" . DA  A 1 12  ? -29.700 80.881 202.177 1.00 43.82 ? 112 DA  B "O4'" 1 
ATOM   236  C  "C3'" . DA  A 1 12  ? -30.797 81.508 204.185 1.00 41.55 ? 112 DA  B "C3'" 1 
ATOM   237  O  "O3'" . DA  A 1 12  ? -32.185 81.174 204.054 1.00 40.64 ? 112 DA  B "O3'" 1 
ATOM   238  C  "C2'" . DA  A 1 12  ? -29.912 80.312 204.469 1.00 41.74 ? 112 DA  B "C2'" 1 
ATOM   239  C  "C1'" . DA  A 1 12  ? -29.611 79.778 203.074 1.00 43.57 ? 112 DA  B "C1'" 1 
ATOM   240  N  N9    . DA  A 1 12  ? -28.271 79.208 202.967 1.00 44.35 ? 112 DA  B N9    1 
ATOM   241  C  C8    . DA  A 1 12  ? -27.114 79.640 203.578 1.00 45.30 ? 112 DA  B C8    1 
ATOM   242  N  N7    . DA  A 1 12  ? -26.081 78.867 203.354 1.00 44.49 ? 112 DA  B N7    1 
ATOM   243  C  C5    . DA  A 1 12  ? -26.585 77.873 202.524 1.00 43.30 ? 112 DA  B C5    1 
ATOM   244  C  C6    . DA  A 1 12  ? -25.994 76.749 201.934 1.00 40.78 ? 112 DA  B C6    1 
ATOM   245  N  N6    . DA  A 1 12  ? -24.721 76.408 202.101 1.00 39.79 ? 112 DA  B N6    1 
ATOM   246  N  N1    . DA  A 1 12  ? -26.768 75.971 201.156 1.00 41.50 ? 112 DA  B N1    1 
ATOM   247  C  C2    . DA  A 1 12  ? -28.051 76.301 200.996 1.00 42.78 ? 112 DA  B C2    1 
ATOM   248  N  N3    . DA  A 1 12  ? -28.727 77.325 201.503 1.00 43.19 ? 112 DA  B N3    1 
ATOM   249  C  C4    . DA  A 1 12  ? -27.926 78.083 202.266 1.00 43.80 ? 112 DA  B C4    1 
ATOM   250  P  P     . DA  A 1 13  ? -32.949 80.415 205.249 1.00 40.71 ? 113 DA  B P     1 
ATOM   251  O  OP1   . DA  A 1 13  ? -34.377 80.790 205.121 1.00 39.92 ? 113 DA  B OP1   1 
ATOM   252  O  OP2   . DA  A 1 13  ? -32.246 80.578 206.562 1.00 35.06 ? 113 DA  B OP2   1 
ATOM   253  O  "O5'" . DA  A 1 13  ? -32.824 78.895 204.811 1.00 39.89 ? 113 DA  B "O5'" 1 
ATOM   254  C  "C5'" . DA  A 1 13  ? -33.139 78.507 203.486 1.00 36.30 ? 113 DA  B "C5'" 1 
ATOM   255  C  "C4'" . DA  A 1 13  ? -33.141 77.004 203.381 1.00 35.26 ? 113 DA  B "C4'" 1 
ATOM   256  O  "O4'" . DA  A 1 13  ? -31.794 76.491 203.246 1.00 36.48 ? 113 DA  B "O4'" 1 
ATOM   257  C  "C3'" . DA  A 1 13  ? -33.672 76.385 204.675 1.00 35.29 ? 113 DA  B "C3'" 1 
ATOM   258  O  "O3'" . DA  A 1 13  ? -34.196 75.116 204.323 1.00 36.21 ? 113 DA  B "O3'" 1 
ATOM   259  C  "C2'" . DA  A 1 13  ? -32.422 76.207 205.513 1.00 32.77 ? 113 DA  B "C2'" 1 
ATOM   260  C  "C1'" . DA  A 1 13  ? -31.463 75.770 204.422 1.00 35.35 ? 113 DA  B "C1'" 1 
ATOM   261  N  N9    . DA  A 1 13  ? -30.031 75.867 204.680 1.00 36.27 ? 113 DA  B N9    1 
ATOM   262  C  C8    . DA  A 1 13  ? -29.342 76.731 205.494 1.00 37.02 ? 113 DA  B C8    1 
ATOM   263  N  N7    . DA  A 1 13  ? -28.065 76.449 205.599 1.00 37.26 ? 113 DA  B N7    1 
ATOM   264  C  C5    . DA  A 1 13  ? -27.898 75.345 204.770 1.00 37.05 ? 113 DA  B C5    1 
ATOM   265  C  C6    . DA  A 1 13  ? -26.772 74.554 204.450 1.00 36.89 ? 113 DA  B C6    1 
ATOM   266  N  N6    . DA  A 1 13  ? -25.549 74.747 204.958 1.00 35.82 ? 113 DA  B N6    1 
ATOM   267  N  N1    . DA  A 1 13  ? -26.952 73.536 203.581 1.00 37.35 ? 113 DA  B N1    1 
ATOM   268  C  C2    . DA  A 1 13  ? -28.179 73.329 203.077 1.00 37.58 ? 113 DA  B C2    1 
ATOM   269  N  N3    . DA  A 1 13  ? -29.309 73.988 203.312 1.00 36.78 ? 113 DA  B N3    1 
ATOM   270  C  C4    . DA  A 1 13  ? -29.096 74.996 204.177 1.00 36.47 ? 113 DA  B C4    1 
ATOM   271  P  P     . DG  A 1 14  ? -35.327 74.435 205.218 1.00 34.78 ? 114 DG  B P     1 
ATOM   272  O  OP1   . DG  A 1 14  ? -36.617 75.029 204.819 1.00 36.93 ? 114 DG  B OP1   1 
ATOM   273  O  OP2   . DG  A 1 14  ? -34.912 74.476 206.640 1.00 31.95 ? 114 DG  B OP2   1 
ATOM   274  O  "O5'" . DG  A 1 14  ? -35.296 72.955 204.642 1.00 33.36 ? 114 DG  B "O5'" 1 
ATOM   275  C  "C5'" . DG  A 1 14  ? -35.434 72.752 203.238 1.00 29.67 ? 114 DG  B "C5'" 1 
ATOM   276  C  "C4'" . DG  A 1 14  ? -34.822 71.434 202.821 1.00 32.03 ? 114 DG  B "C4'" 1 
ATOM   277  O  "O4'" . DG  A 1 14  ? -33.387 71.453 203.036 1.00 32.46 ? 114 DG  B "O4'" 1 
ATOM   278  C  "C3'" . DG  A 1 14  ? -35.321 70.252 203.649 1.00 32.30 ? 114 DG  B "C3'" 1 
ATOM   279  O  "O3'" . DG  A 1 14  ? -35.231 69.081 202.826 1.00 30.79 ? 114 DG  B "O3'" 1 
ATOM   280  C  "C2'" . DG  A 1 14  ? -34.331 70.202 204.803 1.00 31.81 ? 114 DG  B "C2'" 1 
ATOM   281  C  "C1'" . DG  A 1 14  ? -33.040 70.577 204.097 1.00 32.77 ? 114 DG  B "C1'" 1 
ATOM   282  N  N9    . DG  A 1 14  ? -32.024 71.230 204.920 1.00 35.63 ? 114 DG  B N9    1 
ATOM   283  C  C8    . DG  A 1 14  ? -32.192 72.304 205.748 1.00 36.20 ? 114 DG  B C8    1 
ATOM   284  N  N7    . DG  A 1 14  ? -31.096 72.629 206.382 1.00 37.05 ? 114 DG  B N7    1 
ATOM   285  C  C5    . DG  A 1 14  ? -30.156 71.716 205.934 1.00 37.16 ? 114 DG  B C5    1 
ATOM   286  C  C6    . DG  A 1 14  ? -28.779 71.557 206.276 1.00 36.81 ? 114 DG  B C6    1 
ATOM   287  O  O6    . DG  A 1 14  ? -28.096 72.226 207.063 1.00 35.46 ? 114 DG  B O6    1 
ATOM   288  N  N1    . DG  A 1 14  ? -28.199 70.494 205.591 1.00 37.47 ? 114 DG  B N1    1 
ATOM   289  C  C2    . DG  A 1 14  ? -28.848 69.687 204.685 1.00 36.86 ? 114 DG  B C2    1 
ATOM   290  N  N2    . DG  A 1 14  ? -28.109 68.723 204.116 1.00 36.71 ? 114 DG  B N2    1 
ATOM   291  N  N3    . DG  A 1 14  ? -30.125 69.823 204.360 1.00 36.59 ? 114 DG  B N3    1 
ATOM   292  C  C4    . DG  A 1 14  ? -30.710 70.845 205.017 1.00 36.44 ? 114 DG  B C4    1 
ATOM   293  P  P     . DA  A 1 15  ? -35.798 67.672 203.350 1.00 29.30 ? 115 DA  B P     1 
ATOM   294  O  OP1   . DA  A 1 15  ? -36.787 67.249 202.339 1.00 31.75 ? 115 DA  B OP1   1 
ATOM   295  O  OP2   . DA  A 1 15  ? -36.155 67.730 204.802 1.00 23.72 ? 115 DA  B OP2   1 
ATOM   296  O  "O5'" . DA  A 1 15  ? -34.575 66.675 203.183 1.00 29.79 ? 115 DA  B "O5'" 1 
ATOM   297  C  "C5'" . DA  A 1 15  ? -33.284 67.090 203.588 1.00 30.72 ? 115 DA  B "C5'" 1 
ATOM   298  C  "C4'" . DA  A 1 15  ? -32.347 65.912 203.694 1.00 29.10 ? 115 DA  B "C4'" 1 
ATOM   299  O  "O4'" . DA  A 1 15  ? -31.197 66.419 204.399 1.00 32.79 ? 115 DA  B "O4'" 1 
ATOM   300  C  "C3'" . DA  A 1 15  ? -32.846 64.729 204.525 1.00 28.93 ? 115 DA  B "C3'" 1 
ATOM   301  O  "O3'" . DA  A 1 15  ? -32.210 63.506 204.046 1.00 26.89 ? 115 DA  B "O3'" 1 
ATOM   302  C  "C2'" . DA  A 1 15  ? -32.459 65.141 205.932 1.00 28.44 ? 115 DA  B "C2'" 1 
ATOM   303  C  "C1'" . DA  A 1 15  ? -31.191 65.949 205.729 1.00 32.33 ? 115 DA  B "C1'" 1 
ATOM   304  N  N9    . DA  A 1 15  ? -31.106 67.120 206.591 1.00 34.20 ? 115 DA  B N9    1 
ATOM   305  C  C8    . DA  A 1 15  ? -32.073 68.016 206.953 1.00 34.05 ? 115 DA  B C8    1 
ATOM   306  N  N7    . DA  A 1 15  ? -31.650 68.938 207.786 1.00 35.25 ? 115 DA  B N7    1 
ATOM   307  C  C5    . DA  A 1 15  ? -30.310 68.625 207.972 1.00 36.65 ? 115 DA  B C5    1 
ATOM   308  C  C6    . DA  A 1 15  ? -29.287 69.205 208.742 1.00 36.03 ? 115 DA  B C6    1 
ATOM   309  N  N6    . DA  A 1 15  ? -29.447 70.273 209.506 1.00 35.37 ? 115 DA  B N6    1 
ATOM   310  N  N1    . DA  A 1 15  ? -28.067 68.636 208.696 1.00 36.39 ? 115 DA  B N1    1 
ATOM   311  C  C2    . DA  A 1 15  ? -27.889 67.563 207.925 1.00 39.10 ? 115 DA  B C2    1 
ATOM   312  N  N3    . DA  A 1 15  ? -28.761 66.927 207.162 1.00 38.51 ? 115 DA  B N3    1 
ATOM   313  C  C4    . DA  A 1 15  ? -29.965 67.516 207.232 1.00 37.08 ? 115 DA  B C4    1 
ATOM   314  P  P     . DG  A 1 16  ? -32.323 62.119 204.878 1.00 26.65 ? 116 DG  B P     1 
ATOM   315  O  OP1   . DG  A 1 16  ? -32.665 61.026 203.937 1.00 25.47 ? 116 DG  B OP1   1 
ATOM   316  O  OP2   . DG  A 1 16  ? -33.118 62.309 206.127 1.00 26.92 ? 116 DG  B OP2   1 
ATOM   317  O  "O5'" . DG  A 1 16  ? -30.840 61.883 205.393 1.00 28.28 ? 116 DG  B "O5'" 1 
ATOM   318  C  "C5'" . DG  A 1 16  ? -30.228 62.875 206.205 1.00 29.73 ? 116 DG  B "C5'" 1 
ATOM   319  C  "C4'" . DG  A 1 16  ? -29.078 62.301 206.987 1.00 29.94 ? 116 DG  B "C4'" 1 
ATOM   320  O  "O4'" . DG  A 1 16  ? -28.540 63.411 207.739 1.00 33.75 ? 116 DG  B "O4'" 1 
ATOM   321  C  "C3'" . DG  A 1 16  ? -29.441 61.248 208.028 1.00 31.35 ? 116 DG  B "C3'" 1 
ATOM   322  O  "O3'" . DG  A 1 16  ? -28.346 60.345 208.204 1.00 29.98 ? 116 DG  B "O3'" 1 
ATOM   323  C  "C2'" . DG  A 1 16  ? -29.747 62.075 209.265 1.00 33.81 ? 116 DG  B "C2'" 1 
ATOM   324  C  "C1'" . DG  A 1 16  ? -28.838 63.288 209.123 1.00 34.63 ? 116 DG  B "C1'" 1 
ATOM   325  N  N9    . DG  A 1 16  ? -29.477 64.517 209.551 1.00 36.25 ? 116 DG  B N9    1 
ATOM   326  C  C8    . DG  A 1 16  ? -30.750 64.940 209.249 1.00 34.74 ? 116 DG  B C8    1 
ATOM   327  N  N7    . DG  A 1 16  ? -31.087 66.036 209.860 1.00 36.35 ? 116 DG  B N7    1 
ATOM   328  C  C5    . DG  A 1 16  ? -29.958 66.382 210.597 1.00 37.11 ? 116 DG  B C5    1 
ATOM   329  C  C6    . DG  A 1 16  ? -29.726 67.477 211.469 1.00 37.88 ? 116 DG  B C6    1 
ATOM   330  O  O6    . DG  A 1 16  ? -30.487 68.392 211.787 1.00 37.56 ? 116 DG  B O6    1 
ATOM   331  N  N1    . DG  A 1 16  ? -28.440 67.440 211.999 1.00 38.03 ? 116 DG  B N1    1 
ATOM   332  C  C2    . DG  A 1 16  ? -27.501 66.485 211.716 1.00 36.94 ? 116 DG  B C2    1 
ATOM   333  N  N2    . DG  A 1 16  ? -26.317 66.621 212.316 1.00 38.30 ? 116 DG  B N2    1 
ATOM   334  N  N3    . DG  A 1 16  ? -27.705 65.468 210.905 1.00 37.64 ? 116 DG  B N3    1 
ATOM   335  C  C4    . DG  A 1 16  ? -28.959 65.474 210.388 1.00 37.39 ? 116 DG  B C4    1 
ATOM   336  P  P     . DA  A 1 17  ? -28.459 59.138 209.265 1.00 29.92 ? 117 DA  B P     1 
ATOM   337  O  OP1   . DA  A 1 17  ? -27.578 58.093 208.704 1.00 30.69 ? 117 DA  B OP1   1 
ATOM   338  O  OP2   . DA  A 1 17  ? -29.881 58.837 209.582 1.00 30.29 ? 117 DA  B OP2   1 
ATOM   339  O  "O5'" . DA  A 1 17  ? -27.809 59.695 210.601 1.00 27.23 ? 117 DA  B "O5'" 1 
ATOM   340  C  "C5'" . DA  A 1 17  ? -26.676 60.533 210.506 1.00 29.62 ? 117 DA  B "C5'" 1 
ATOM   341  C  "C4'" . DA  A 1 17  ? -26.034 60.736 211.854 1.00 31.29 ? 117 DA  B "C4'" 1 
ATOM   342  O  "O4'" . DA  A 1 17  ? -26.405 62.021 212.418 1.00 29.33 ? 117 DA  B "O4'" 1 
ATOM   343  C  "C3'" . DA  A 1 17  ? -26.502 59.702 212.865 1.00 32.09 ? 117 DA  B "C3'" 1 
ATOM   344  O  "O3'" . DA  A 1 17  ? -25.446 59.476 213.806 1.00 35.66 ? 117 DA  B "O3'" 1 
ATOM   345  C  "C2'" . DA  A 1 17  ? -27.712 60.382 213.480 1.00 32.54 ? 117 DA  B "C2'" 1 
ATOM   346  C  "C1'" . DA  A 1 17  ? -27.272 61.833 213.519 1.00 30.65 ? 117 DA  B "C1'" 1 
ATOM   347  N  N9    . DA  A 1 17  ? -28.326 62.839 213.448 1.00 30.81 ? 117 DA  B N9    1 
ATOM   348  C  C8    . DA  A 1 17  ? -29.520 62.812 212.766 1.00 31.76 ? 117 DA  B C8    1 
ATOM   349  N  N7    . DA  A 1 17  ? -30.270 63.867 212.974 1.00 31.30 ? 117 DA  B N7    1 
ATOM   350  C  C5    . DA  A 1 17  ? -29.508 64.647 213.839 1.00 30.94 ? 117 DA  B C5    1 
ATOM   351  C  C6    . DA  A 1 17  ? -29.728 65.899 214.440 1.00 29.75 ? 117 DA  B C6    1 
ATOM   352  N  N6    . DA  A 1 17  ? -30.829 66.621 214.270 1.00 28.18 ? 117 DA  B N6    1 
ATOM   353  N  N1    . DA  A 1 17  ? -28.755 66.390 215.234 1.00 30.16 ? 117 DA  B N1    1 
ATOM   354  C  C2    . DA  A 1 17  ? -27.645 65.668 215.409 1.00 29.14 ? 117 DA  B C2    1 
ATOM   355  N  N3    . DA  A 1 17  ? -27.321 64.491 214.905 1.00 28.79 ? 117 DA  B N3    1 
ATOM   356  C  C4    . DA  A 1 17  ? -28.305 64.029 214.121 1.00 30.28 ? 117 DA  B C4    1 
ATOM   357  P  P     . DC  A 1 18  ? -25.474 58.191 214.771 1.00 37.90 ? 118 DC  B P     1 
ATOM   358  O  OP1   . DC  A 1 18  ? -24.076 57.698 214.726 1.00 38.38 ? 118 DC  B OP1   1 
ATOM   359  O  OP2   . DC  A 1 18  ? -26.592 57.283 214.427 1.00 36.57 ? 118 DC  B OP2   1 
ATOM   360  O  "O5'" . DC  A 1 18  ? -25.677 58.836 216.214 1.00 33.91 ? 118 DC  B "O5'" 1 
ATOM   361  C  "C5'" . DC  A 1 18  ? -24.644 59.666 216.711 1.00 31.57 ? 118 DC  B "C5'" 1 
ATOM   362  C  "C4'" . DC  A 1 18  ? -25.020 60.355 217.999 1.00 31.17 ? 118 DC  B "C4'" 1 
ATOM   363  O  "O4'" . DC  A 1 18  ? -25.972 61.421 217.781 1.00 32.81 ? 118 DC  B "O4'" 1 
ATOM   364  C  "C3'" . DC  A 1 18  ? -25.691 59.436 219.007 1.00 29.25 ? 118 DC  B "C3'" 1 
ATOM   365  O  "O3'" . DC  A 1 18  ? -25.384 59.947 220.292 1.00 27.66 ? 118 DC  B "O3'" 1 
ATOM   366  C  "C2'" . DC  A 1 18  ? -27.163 59.609 218.686 1.00 31.27 ? 118 DC  B "C2'" 1 
ATOM   367  C  "C1'" . DC  A 1 18  ? -27.206 61.090 218.389 1.00 32.95 ? 118 DC  B "C1'" 1 
ATOM   368  N  N1    . DC  A 1 18  ? -28.321 61.680 217.608 1.00 33.29 ? 118 DC  B N1    1 
ATOM   369  C  C2    . DC  A 1 18  ? -28.694 62.987 217.906 1.00 33.65 ? 118 DC  B C2    1 
ATOM   370  O  O2    . DC  A 1 18  ? -28.048 63.598 218.752 1.00 35.20 ? 118 DC  B O2    1 
ATOM   371  N  N3    . DC  A 1 18  ? -29.742 63.552 217.266 1.00 33.98 ? 118 DC  B N3    1 
ATOM   372  C  C4    . DC  A 1 18  ? -30.401 62.858 216.345 1.00 32.74 ? 118 DC  B C4    1 
ATOM   373  N  N4    . DC  A 1 18  ? -31.436 63.443 215.748 1.00 32.12 ? 118 DC  B N4    1 
ATOM   374  C  C5    . DC  A 1 18  ? -30.029 61.532 215.996 1.00 33.00 ? 118 DC  B C5    1 
ATOM   375  C  C6    . DC  A 1 18  ? -28.990 60.983 216.646 1.00 33.53 ? 118 DC  B C6    1 
ATOM   376  P  P     . DA  A 1 19  ? -25.329 58.965 221.549 1.00 28.82 ? 119 DA  B P     1 
ATOM   377  O  OP1   . DA  A 1 19  ? -23.907 58.738 221.941 1.00 31.83 ? 119 DA  B OP1   1 
ATOM   378  O  OP2   . DA  A 1 19  ? -26.178 57.822 221.176 1.00 29.85 ? 119 DA  B OP2   1 
ATOM   379  O  "O5'" . DA  A 1 19  ? -26.040 59.823 222.687 1.00 28.26 ? 119 DA  B "O5'" 1 
ATOM   380  C  "C5'" . DA  A 1 19  ? -26.468 61.143 222.379 1.00 32.06 ? 119 DA  B "C5'" 1 
ATOM   381  C  "C4'" . DA  A 1 19  ? -27.230 61.761 223.527 1.00 34.75 ? 119 DA  B "C4'" 1 
ATOM   382  O  "O4'" . DA  A 1 19  ? -28.061 62.785 222.922 1.00 34.54 ? 119 DA  B "O4'" 1 
ATOM   383  C  "C3'" . DA  A 1 19  ? -28.187 60.775 224.179 1.00 35.78 ? 119 DA  B "C3'" 1 
ATOM   384  O  "O3'" . DA  A 1 19  ? -28.538 61.104 225.518 1.00 38.08 ? 119 DA  B "O3'" 1 
ATOM   385  C  "C2'" . DA  A 1 19  ? -29.416 60.899 223.324 1.00 39.42 ? 119 DA  B "C2'" 1 
ATOM   386  C  "C1'" . DA  A 1 19  ? -29.401 62.370 222.936 1.00 37.10 ? 119 DA  B "C1'" 1 
ATOM   387  N  N9    . DA  A 1 19  ? -29.960 62.509 221.599 1.00 37.69 ? 119 DA  B N9    1 
ATOM   388  C  C8    . DA  A 1 19  ? -29.951 61.601 220.566 1.00 37.03 ? 119 DA  B C8    1 
ATOM   389  N  N7    . DA  A 1 19  ? -30.728 61.936 219.568 1.00 39.43 ? 119 DA  B N7    1 
ATOM   390  C  C5    . DA  A 1 19  ? -31.248 63.163 219.956 1.00 41.25 ? 119 DA  B C5    1 
ATOM   391  C  C6    . DA  A 1 19  ? -32.143 64.042 219.348 1.00 42.99 ? 119 DA  B C6    1 
ATOM   392  N  N6    . DA  A 1 19  ? -32.715 63.810 218.170 1.00 46.51 ? 119 DA  B N6    1 
ATOM   393  N  N1    . DA  A 1 19  ? -32.435 65.189 219.996 1.00 42.69 ? 119 DA  B N1    1 
ATOM   394  C  C2    . DA  A 1 19  ? -31.858 65.422 221.175 1.00 42.37 ? 119 DA  B C2    1 
ATOM   395  N  N3    . DA  A 1 19  ? -31.005 64.673 221.851 1.00 41.49 ? 119 DA  B N3    1 
ATOM   396  C  C4    . DA  A 1 19  ? -30.739 63.545 221.180 1.00 40.39 ? 119 DA  B C4    1 
ATOM   397  P  P     . DG  A 1 20  ? -29.558 60.130 226.302 1.00 39.07 ? 120 DG  B P     1 
ATOM   398  O  OP1   . DG  A 1 20  ? -29.846 60.678 227.660 1.00 37.75 ? 120 DG  B OP1   1 
ATOM   399  O  OP2   . DG  A 1 20  ? -28.938 58.777 226.185 1.00 35.59 ? 120 DG  B OP2   1 
ATOM   400  O  "O5'" . DG  A 1 20  ? -30.881 60.167 225.391 1.00 38.84 ? 120 DG  B "O5'" 1 
ATOM   401  C  "C5'" . DG  A 1 20  ? -32.130 60.591 225.924 1.00 42.41 ? 120 DG  B "C5'" 1 
ATOM   402  C  "C4'" . DG  A 1 20  ? -32.223 62.099 225.882 1.00 46.76 ? 120 DG  B "C4'" 1 
ATOM   403  O  "O4'" . DG  A 1 20  ? -32.437 62.571 224.526 1.00 46.12 ? 120 DG  B "O4'" 1 
ATOM   404  C  "C3'" . DG  A 1 20  ? -33.355 62.694 226.721 1.00 47.49 ? 120 DG  B "C3'" 1 
ATOM   405  O  "O3'" . DG  A 1 20  ? -32.927 63.958 227.207 1.00 50.60 ? 120 DG  B "O3'" 1 
ATOM   406  C  "C2'" . DG  A 1 20  ? -34.400 63.054 225.689 1.00 49.77 ? 120 DG  B "C2'" 1 
ATOM   407  C  "C1'" . DG  A 1 20  ? -33.534 63.466 224.521 1.00 49.58 ? 120 DG  B "C1'" 1 
ATOM   408  N  N9    . DG  A 1 20  ? -34.217 63.355 223.240 1.00 53.74 ? 120 DG  B N9    1 
ATOM   409  C  C8    . DG  A 1 20  ? -34.516 62.208 222.549 1.00 53.46 ? 120 DG  B C8    1 
ATOM   410  N  N7    . DG  A 1 20  ? -35.184 62.430 221.451 1.00 55.80 ? 120 DG  B N7    1 
ATOM   411  C  C5    . DG  A 1 20  ? -35.318 63.812 221.405 1.00 56.55 ? 120 DG  B C5    1 
ATOM   412  C  C6    . DG  A 1 20  ? -35.944 64.646 220.442 1.00 58.11 ? 120 DG  B C6    1 
ATOM   413  O  O6    . DG  A 1 20  ? -36.524 64.319 219.402 1.00 59.46 ? 120 DG  B O6    1 
ATOM   414  N  N1    . DG  A 1 20  ? -35.844 65.993 220.787 1.00 58.47 ? 120 DG  B N1    1 
ATOM   415  C  C2    . DG  A 1 20  ? -35.219 66.479 221.912 1.00 58.19 ? 120 DG  B C2    1 
ATOM   416  N  N2    . DG  A 1 20  ? -35.230 67.813 222.068 1.00 57.49 ? 120 DG  B N2    1 
ATOM   417  N  N3    . DG  A 1 20  ? -34.630 65.711 222.817 1.00 56.67 ? 120 DG  B N3    1 
ATOM   418  C  C4    . DG  A 1 20  ? -34.719 64.397 222.500 1.00 55.91 ? 120 DG  B C4    1 
ATOM   419  O  "O5'" . DC  B 2 1   ? -36.997 65.089 229.711 1.00 65.30 ? 201 DC  C "O5'" 1 
ATOM   420  C  "C5'" . DC  B 2 1   ? -37.044 64.924 228.294 1.00 62.05 ? 201 DC  C "C5'" 1 
ATOM   421  C  "C4'" . DC  B 2 1   ? -36.422 66.129 227.629 1.00 61.76 ? 201 DC  C "C4'" 1 
ATOM   422  O  "O4'" . DC  B 2 1   ? -36.442 65.947 226.201 1.00 63.62 ? 201 DC  C "O4'" 1 
ATOM   423  C  "C3'" . DC  B 2 1   ? -37.120 67.465 227.897 1.00 60.67 ? 201 DC  C "C3'" 1 
ATOM   424  O  "O3'" . DC  B 2 1   ? -36.133 68.499 227.992 1.00 57.07 ? 201 DC  C "O3'" 1 
ATOM   425  C  "C2'" . DC  B 2 1   ? -38.005 67.638 226.680 1.00 61.61 ? 201 DC  C "C2'" 1 
ATOM   426  C  "C1'" . DC  B 2 1   ? -37.184 66.984 225.586 1.00 64.38 ? 201 DC  C "C1'" 1 
ATOM   427  N  N1    . DC  B 2 1   ? -37.971 66.378 224.499 1.00 67.79 ? 201 DC  C N1    1 
ATOM   428  C  C2    . DC  B 2 1   ? -38.789 67.203 223.715 1.00 70.15 ? 201 DC  C C2    1 
ATOM   429  O  O2    . DC  B 2 1   ? -38.844 68.420 223.977 1.00 71.36 ? 201 DC  C O2    1 
ATOM   430  N  N3    . DC  B 2 1   ? -39.495 66.656 222.696 1.00 71.58 ? 201 DC  C N3    1 
ATOM   431  C  C4    . DC  B 2 1   ? -39.412 65.344 222.450 1.00 71.43 ? 201 DC  C C4    1 
ATOM   432  N  N4    . DC  B 2 1   ? -40.128 64.859 221.424 1.00 72.48 ? 201 DC  C N4    1 
ATOM   433  C  C5    . DC  B 2 1   ? -38.592 64.478 223.239 1.00 70.58 ? 201 DC  C C5    1 
ATOM   434  C  C6    . DC  B 2 1   ? -37.898 65.032 224.244 1.00 68.63 ? 201 DC  C C6    1 
ATOM   435  P  P     . DT  B 2 2   ? -36.549 69.997 228.417 1.00 53.00 ? 202 DT  C P     1 
ATOM   436  O  OP1   . DT  B 2 2   ? -35.395 70.507 229.189 1.00 54.95 ? 202 DT  C OP1   1 
ATOM   437  O  OP2   . DT  B 2 2   ? -37.871 69.988 229.061 1.00 53.78 ? 202 DT  C OP2   1 
ATOM   438  O  "O5'" . DT  B 2 2   ? -36.586 70.749 227.006 1.00 50.23 ? 202 DT  C "O5'" 1 
ATOM   439  C  "C5'" . DT  B 2 2   ? -37.425 71.871 226.777 1.00 49.48 ? 202 DT  C "C5'" 1 
ATOM   440  C  "C4'" . DT  B 2 2   ? -37.863 71.918 225.326 1.00 52.24 ? 202 DT  C "C4'" 1 
ATOM   441  O  "O4'" . DT  B 2 2   ? -38.658 73.110 225.123 1.00 54.73 ? 202 DT  C "O4'" 1 
ATOM   442  C  "C3'" . DT  B 2 2   ? -36.735 71.999 224.301 1.00 52.50 ? 202 DT  C "C3'" 1 
ATOM   443  O  "O3'" . DT  B 2 2   ? -37.129 71.407 223.057 1.00 51.91 ? 202 DT  C "O3'" 1 
ATOM   444  C  "C2'" . DT  B 2 2   ? -36.578 73.489 224.100 1.00 55.29 ? 202 DT  C "C2'" 1 
ATOM   445  C  "C1'" . DT  B 2 2   ? -38.007 73.997 224.231 1.00 55.91 ? 202 DT  C "C1'" 1 
ATOM   446  N  N1    . DT  B 2 2   ? -38.133 75.369 224.797 1.00 59.08 ? 202 DT  C N1    1 
ATOM   447  C  C2    . DT  B 2 2   ? -37.070 76.246 224.681 1.00 60.20 ? 202 DT  C C2    1 
ATOM   448  O  O2    . DT  B 2 2   ? -36.014 75.955 224.151 1.00 63.91 ? 202 DT  C O2    1 
ATOM   449  N  N3    . DT  B 2 2   ? -37.295 77.490 225.208 1.00 58.74 ? 202 DT  C N3    1 
ATOM   450  C  C4    . DT  B 2 2   ? -38.441 77.942 225.821 1.00 57.70 ? 202 DT  C C4    1 
ATOM   451  O  O4    . DT  B 2 2   ? -38.497 79.093 226.234 1.00 57.50 ? 202 DT  C O4    1 
ATOM   452  C  C5    . DT  B 2 2   ? -39.508 76.979 225.920 1.00 57.20 ? 202 DT  C C5    1 
ATOM   453  C  C7    . DT  B 2 2   ? -40.789 77.383 226.576 1.00 56.02 ? 202 DT  C C7    1 
ATOM   454  C  C6    . DT  B 2 2   ? -39.304 75.756 225.415 1.00 57.82 ? 202 DT  C C6    1 
ATOM   455  P  P     . DG  B 2 3   ? -36.155 71.509 221.774 1.00 50.05 ? 203 DG  C P     1 
ATOM   456  O  OP1   . DG  B 2 3   ? -36.035 72.918 221.376 1.00 49.16 ? 203 DG  C OP1   1 
ATOM   457  O  OP2   . DG  B 2 3   ? -36.484 70.486 220.741 1.00 52.12 ? 203 DG  C OP2   1 
ATOM   458  O  "O5'" . DG  B 2 3   ? -34.741 71.145 222.375 1.00 47.41 ? 203 DG  C "O5'" 1 
ATOM   459  C  "C5'" . DG  B 2 3   ? -33.750 72.132 222.366 1.00 46.83 ? 203 DG  C "C5'" 1 
ATOM   460  C  "C4'" . DG  B 2 3   ? -32.420 71.586 222.790 1.00 44.17 ? 203 DG  C "C4'" 1 
ATOM   461  O  "O4'" . DG  B 2 3   ? -32.274 70.238 222.281 1.00 43.92 ? 203 DG  C "O4'" 1 
ATOM   462  C  "C3'" . DG  B 2 3   ? -31.397 72.429 222.054 1.00 44.33 ? 203 DG  C "C3'" 1 
ATOM   463  O  "O3'" . DG  B 2 3   ? -30.261 72.678 222.843 1.00 42.92 ? 203 DG  C "O3'" 1 
ATOM   464  C  "C2'" . DG  B 2 3   ? -31.180 71.678 220.756 1.00 42.16 ? 203 DG  C "C2'" 1 
ATOM   465  C  "C1'" . DG  B 2 3   ? -31.354 70.224 221.201 1.00 42.07 ? 203 DG  C "C1'" 1 
ATOM   466  N  N9    . DG  B 2 3   ? -31.911 69.382 220.149 1.00 41.60 ? 203 DG  C N9    1 
ATOM   467  C  C8    . DG  B 2 3   ? -33.157 69.471 219.570 1.00 41.08 ? 203 DG  C C8    1 
ATOM   468  N  N7    . DG  B 2 3   ? -33.327 68.617 218.598 1.00 40.77 ? 203 DG  C N7    1 
ATOM   469  C  C5    . DG  B 2 3   ? -32.133 67.909 218.551 1.00 41.82 ? 203 DG  C C5    1 
ATOM   470  C  C6    . DG  B 2 3   ? -31.724 66.836 217.706 1.00 42.57 ? 203 DG  C C6    1 
ATOM   471  O  O6    . DG  B 2 3   ? -32.354 66.287 216.795 1.00 43.65 ? 203 DG  C O6    1 
ATOM   472  N  N1    . DG  B 2 3   ? -30.439 66.407 218.010 1.00 43.00 ? 203 DG  C N1    1 
ATOM   473  C  C2    . DG  B 2 3   ? -29.651 66.938 218.994 1.00 42.72 ? 203 DG  C C2    1 
ATOM   474  N  N2    . DG  B 2 3   ? -28.440 66.401 219.139 1.00 45.61 ? 203 DG  C N2    1 
ATOM   475  N  N3    . DG  B 2 3   ? -30.018 67.927 219.784 1.00 42.40 ? 203 DG  C N3    1 
ATOM   476  C  C4    . DG  B 2 3   ? -31.259 68.360 219.507 1.00 41.66 ? 203 DG  C C4    1 
ATOM   477  P  P     . DT  B 2 4   ? -29.368 73.964 222.531 1.00 42.12 ? 204 DT  C P     1 
ATOM   478  O  OP1   . DT  B 2 4   ? -29.070 74.605 223.851 1.00 42.26 ? 204 DT  C OP1   1 
ATOM   479  O  OP2   . DT  B 2 4   ? -30.003 74.744 221.421 1.00 36.89 ? 204 DT  C OP2   1 
ATOM   480  O  "O5'" . DT  B 2 4   ? -28.032 73.307 221.990 1.00 41.89 ? 204 DT  C "O5'" 1 
ATOM   481  C  "C5'" . DT  B 2 4   ? -28.088 71.995 221.479 1.00 41.33 ? 204 DT  C "C5'" 1 
ATOM   482  C  "C4'" . DT  B 2 4   ? -26.746 71.577 220.940 1.00 39.05 ? 204 DT  C "C4'" 1 
ATOM   483  O  "O4'" . DT  B 2 4   ? -27.016 70.506 220.004 1.00 38.49 ? 204 DT  C "O4'" 1 
ATOM   484  C  "C3'" . DT  B 2 4   ? -26.102 72.688 220.122 1.00 38.22 ? 204 DT  C "C3'" 1 
ATOM   485  O  "O3'" . DT  B 2 4   ? -24.664 72.601 220.183 1.00 38.61 ? 204 DT  C "O3'" 1 
ATOM   486  C  "C2'" . DT  B 2 4   ? -26.687 72.472 218.741 1.00 37.90 ? 204 DT  C "C2'" 1 
ATOM   487  C  "C1'" . DT  B 2 4   ? -26.862 70.967 218.677 1.00 38.54 ? 204 DT  C "C1'" 1 
ATOM   488  N  N1    . DT  B 2 4   ? -28.019 70.498 217.904 1.00 37.57 ? 204 DT  C N1    1 
ATOM   489  C  C2    . DT  B 2 4   ? -27.802 69.468 217.024 1.00 38.26 ? 204 DT  C C2    1 
ATOM   490  O  O2    . DT  B 2 4   ? -26.721 68.926 216.893 1.00 37.92 ? 204 DT  C O2    1 
ATOM   491  N  N3    . DT  B 2 4   ? -28.902 69.093 216.294 1.00 37.50 ? 204 DT  C N3    1 
ATOM   492  C  C4    . DT  B 2 4   ? -30.169 69.633 216.360 1.00 36.52 ? 204 DT  C C4    1 
ATOM   493  O  O4    . DT  B 2 4   ? -31.056 69.200 215.639 1.00 36.44 ? 204 DT  C O4    1 
ATOM   494  C  C5    . DT  B 2 4   ? -30.333 70.701 217.315 1.00 37.77 ? 204 DT  C C5    1 
ATOM   495  C  C7    . DT  B 2 4   ? -31.679 71.344 217.456 1.00 39.26 ? 204 DT  C C7    1 
ATOM   496  C  C6    . DT  B 2 4   ? -29.259 71.074 218.036 1.00 38.02 ? 204 DT  C C6    1 
ATOM   497  P  P     . DC  B 2 5   ? -23.753 73.735 219.480 1.00 36.08 ? 205 DC  C P     1 
ATOM   498  O  OP1   . DC  B 2 5   ? -22.382 73.227 219.353 1.00 37.74 ? 205 DC  C OP1   1 
ATOM   499  O  OP2   . DC  B 2 5   ? -23.984 75.013 220.161 1.00 37.78 ? 205 DC  C OP2   1 
ATOM   500  O  "O5'" . DC  B 2 5   ? -24.357 73.827 218.017 1.00 37.86 ? 205 DC  C "O5'" 1 
ATOM   501  C  "C5'" . DC  B 2 5   ? -23.530 73.793 216.873 1.00 36.26 ? 205 DC  C "C5'" 1 
ATOM   502  C  "C4'" . DC  B 2 5   ? -23.021 72.397 216.612 1.00 35.15 ? 205 DC  C "C4'" 1 
ATOM   503  O  "O4'" . DC  B 2 5   ? -24.174 71.494 216.560 1.00 36.05 ? 205 DC  C "O4'" 1 
ATOM   504  C  "C3'" . DC  B 2 5   ? -22.388 72.355 215.210 1.00 34.92 ? 205 DC  C "C3'" 1 
ATOM   505  O  "O3'" . DC  B 2 5   ? -21.302 71.435 215.055 1.00 30.41 ? 205 DC  C "O3'" 1 
ATOM   506  C  "C2'" . DC  B 2 5   ? -23.544 71.942 214.329 1.00 36.19 ? 205 DC  C "C2'" 1 
ATOM   507  C  "C1'" . DC  B 2 5   ? -24.329 70.993 215.236 1.00 37.03 ? 205 DC  C "C1'" 1 
ATOM   508  N  N1    . DC  B 2 5   ? -25.757 70.932 214.871 1.00 38.88 ? 205 DC  C N1    1 
ATOM   509  C  C2    . DC  B 2 5   ? -26.238 69.773 214.219 1.00 38.82 ? 205 DC  C C2    1 
ATOM   510  O  O2    . DC  B 2 5   ? -25.501 68.786 214.126 1.00 40.36 ? 205 DC  C O2    1 
ATOM   511  N  N3    . DC  B 2 5   ? -27.484 69.768 213.713 1.00 37.29 ? 205 DC  C N3    1 
ATOM   512  C  C4    . DC  B 2 5   ? -28.259 70.844 213.861 1.00 37.65 ? 205 DC  C C4    1 
ATOM   513  N  N4    . DC  B 2 5   ? -29.473 70.827 213.313 1.00 38.30 ? 205 DC  C N4    1 
ATOM   514  C  C5    . DC  B 2 5   ? -27.826 71.998 214.576 1.00 36.72 ? 205 DC  C C5    1 
ATOM   515  C  C6    . DC  B 2 5   ? -26.584 71.998 215.070 1.00 38.23 ? 205 DC  C C6    1 
ATOM   516  P  P     . DT  B 2 6   ? -20.290 71.618 213.809 1.00 30.06 ? 206 DT  C P     1 
ATOM   517  O  OP1   . DT  B 2 6   ? -18.952 71.585 214.447 1.00 27.43 ? 206 DT  C OP1   1 
ATOM   518  O  OP2   . DT  B 2 6   ? -20.699 72.800 212.986 1.00 28.28 ? 206 DT  C OP2   1 
ATOM   519  O  "O5'" . DT  B 2 6   ? -20.523 70.370 212.840 1.00 28.31 ? 206 DT  C "O5'" 1 
ATOM   520  C  "C5'" . DT  B 2 6   ? -20.357 69.054 213.320 1.00 27.24 ? 206 DT  C "C5'" 1 
ATOM   521  C  "C4'" . DT  B 2 6   ? -20.641 68.047 212.234 1.00 27.99 ? 206 DT  C "C4'" 1 
ATOM   522  O  "O4'" . DT  B 2 6   ? -22.065 68.043 211.928 1.00 30.54 ? 206 DT  C "O4'" 1 
ATOM   523  C  "C3'" . DT  B 2 6   ? -19.947 68.374 210.905 1.00 28.22 ? 206 DT  C "C3'" 1 
ATOM   524  O  "O3'" . DT  B 2 6   ? -19.639 67.124 210.245 1.00 24.51 ? 206 DT  C "O3'" 1 
ATOM   525  C  "C2'" . DT  B 2 6   ? -20.988 69.226 210.182 1.00 30.05 ? 206 DT  C "C2'" 1 
ATOM   526  C  "C1'" . DT  B 2 6   ? -22.287 68.555 210.615 1.00 32.39 ? 206 DT  C "C1'" 1 
ATOM   527  N  N1    . DT  B 2 6   ? -23.528 69.361 210.610 1.00 36.18 ? 206 DT  C N1    1 
ATOM   528  C  C2    . DT  B 2 6   ? -24.587 68.891 209.844 1.00 37.47 ? 206 DT  C C2    1 
ATOM   529  O  O2    . DT  B 2 6   ? -24.553 67.839 209.220 1.00 38.13 ? 206 DT  C O2    1 
ATOM   530  N  N3    . DT  B 2 6   ? -25.693 69.710 209.828 1.00 36.30 ? 206 DT  C N3    1 
ATOM   531  C  C4    . DT  B 2 6   ? -25.850 70.914 210.486 1.00 37.89 ? 206 DT  C C4    1 
ATOM   532  O  O4    . DT  B 2 6   ? -26.894 71.538 210.380 1.00 38.74 ? 206 DT  C O4    1 
ATOM   533  C  C5    . DT  B 2 6   ? -24.719 71.340 211.277 1.00 38.58 ? 206 DT  C C5    1 
ATOM   534  C  C7    . DT  B 2 6   ? -24.813 72.642 212.008 1.00 37.19 ? 206 DT  C C7    1 
ATOM   535  C  C6    . DT  B 2 6   ? -23.628 70.547 211.312 1.00 37.59 ? 206 DT  C C6    1 
ATOM   536  P  P     . DC  B 2 7   ? -19.103 67.088 208.725 1.00 29.01 ? 207 DC  C P     1 
ATOM   537  O  OP1   . DC  B 2 7   ? -18.168 65.941 208.768 1.00 29.86 ? 207 DC  C OP1   1 
ATOM   538  O  OP2   . DC  B 2 7   ? -18.644 68.405 208.228 1.00 28.76 ? 207 DC  C OP2   1 
ATOM   539  O  "O5'" . DC  B 2 7   ? -20.366 66.657 207.840 1.00 28.77 ? 207 DC  C "O5'" 1 
ATOM   540  C  "C5'" . DC  B 2 7   ? -21.011 65.416 208.120 1.00 27.71 ? 207 DC  C "C5'" 1 
ATOM   541  C  "C4'" . DC  B 2 7   ? -22.072 65.064 207.105 1.00 26.48 ? 207 DC  C "C4'" 1 
ATOM   542  O  "O4'" . DC  B 2 7   ? -23.173 66.000 207.184 1.00 28.57 ? 207 DC  C "O4'" 1 
ATOM   543  C  "C3'" . DC  B 2 7   ? -21.593 65.123 205.653 1.00 26.04 ? 207 DC  C "C3'" 1 
ATOM   544  O  "O3'" . DC  B 2 7   ? -22.397 64.244 204.845 1.00 24.42 ? 207 DC  C "O3'" 1 
ATOM   545  C  "C2'" . DC  B 2 7   ? -21.890 66.560 205.285 1.00 28.21 ? 207 DC  C "C2'" 1 
ATOM   546  C  "C1'" . DC  B 2 7   ? -23.207 66.776 205.996 1.00 30.90 ? 207 DC  C "C1'" 1 
ATOM   547  N  N1    . DC  B 2 7   ? -23.624 68.139 206.337 1.00 35.27 ? 207 DC  C N1    1 
ATOM   548  C  C2    . DC  B 2 7   ? -24.843 68.593 205.842 1.00 37.22 ? 207 DC  C C2    1 
ATOM   549  O  O2    . DC  B 2 7   ? -25.483 67.861 205.069 1.00 39.00 ? 207 DC  C O2    1 
ATOM   550  N  N3    . DC  B 2 7   ? -25.291 69.813 206.214 1.00 38.33 ? 207 DC  C N3    1 
ATOM   551  C  C4    . DC  B 2 7   ? -24.556 70.575 207.031 1.00 36.87 ? 207 DC  C C4    1 
ATOM   552  N  N4    . DC  B 2 7   ? -25.048 71.753 207.393 1.00 36.80 ? 207 DC  C N4    1 
ATOM   553  C  C5    . DC  B 2 7   ? -23.287 70.153 207.515 1.00 37.26 ? 207 DC  C C5    1 
ATOM   554  C  C6    . DC  B 2 7   ? -22.863 68.939 207.146 1.00 37.57 ? 207 DC  C C6    1 
ATOM   555  P  P     . DT  B 2 8   ? -21.974 63.914 203.329 1.00 25.34 ? 208 DT  C P     1 
ATOM   556  O  OP1   . DT  B 2 8   ? -21.943 62.440 203.217 1.00 27.82 ? 208 DT  C OP1   1 
ATOM   557  O  OP2   . DT  B 2 8   ? -20.786 64.695 202.944 1.00 28.82 ? 208 DT  C OP2   1 
ATOM   558  O  "O5'" . DT  B 2 8   ? -23.204 64.413 202.450 1.00 26.73 ? 208 DT  C "O5'" 1 
ATOM   559  C  "C5'" . DT  B 2 8   ? -23.904 65.601 202.788 1.00 26.70 ? 208 DT  C "C5'" 1 
ATOM   560  C  "C4'" . DT  B 2 8   ? -25.062 65.826 201.843 1.00 26.42 ? 208 DT  C "C4'" 1 
ATOM   561  O  "O4'" . DT  B 2 8   ? -25.657 67.086 202.209 1.00 27.80 ? 208 DT  C "O4'" 1 
ATOM   562  C  "C3'" . DT  B 2 8   ? -24.712 65.982 200.370 1.00 24.68 ? 208 DT  C "C3'" 1 
ATOM   563  O  "O3'" . DT  B 2 8   ? -25.798 65.546 199.548 1.00 25.48 ? 208 DT  C "O3'" 1 
ATOM   564  C  "C2'" . DT  B 2 8   ? -24.402 67.465 200.256 1.00 27.20 ? 208 DT  C "C2'" 1 
ATOM   565  C  "C1'" . DT  B 2 8   ? -25.342 68.098 201.260 1.00 27.53 ? 208 DT  C "C1'" 1 
ATOM   566  N  N1    . DT  B 2 8   ? -24.807 69.254 202.025 1.00 31.16 ? 208 DT  C N1    1 
ATOM   567  C  C2    . DT  B 2 8   ? -25.635 70.342 202.160 1.00 33.63 ? 208 DT  C C2    1 
ATOM   568  O  O2    . DT  B 2 8   ? -26.716 70.419 201.613 1.00 37.24 ? 208 DT  C O2    1 
ATOM   569  N  N3    . DT  B 2 8   ? -25.144 71.348 202.952 1.00 32.57 ? 208 DT  C N3    1 
ATOM   570  C  C4    . DT  B 2 8   ? -23.922 71.387 203.591 1.00 31.71 ? 208 DT  C C4    1 
ATOM   571  O  O4    . DT  B 2 8   ? -23.624 72.363 204.278 1.00 32.59 ? 208 DT  C O4    1 
ATOM   572  C  C5    . DT  B 2 8   ? -23.080 70.228 203.385 1.00 30.73 ? 208 DT  C C5    1 
ATOM   573  C  C7    . DT  B 2 8   ? -21.736 70.187 204.045 1.00 29.60 ? 208 DT  C C7    1 
ATOM   574  C  C6    . DT  B 2 8   ? -23.554 69.234 202.615 1.00 30.32 ? 208 DT  C C6    1 
ATOM   575  P  P     . DT  B 2 9   ? -25.770 65.809 197.960 1.00 28.65 ? 209 DT  C P     1 
ATOM   576  O  OP1   . DT  B 2 9   ? -26.123 64.579 197.210 1.00 30.45 ? 209 DT  C OP1   1 
ATOM   577  O  OP2   . DT  B 2 9   ? -24.530 66.522 197.612 1.00 30.32 ? 209 DT  C OP2   1 
ATOM   578  O  "O5'" . DT  B 2 9   ? -27.026 66.756 197.734 1.00 27.88 ? 209 DT  C "O5'" 1 
ATOM   579  C  "C5'" . DT  B 2 9   ? -27.282 67.804 198.627 1.00 29.98 ? 209 DT  C "C5'" 1 
ATOM   580  C  "C4'" . DT  B 2 9   ? -28.319 68.745 198.068 1.00 30.46 ? 209 DT  C "C4'" 1 
ATOM   581  O  "O4'" . DT  B 2 9   ? -28.185 69.959 198.843 1.00 32.42 ? 209 DT  C "O4'" 1 
ATOM   582  C  "C3'" . DT  B 2 9   ? -28.083 69.163 196.618 1.00 30.33 ? 209 DT  C "C3'" 1 
ATOM   583  O  "O3'" . DT  B 2 9   ? -29.344 69.525 196.028 1.00 34.97 ? 209 DT  C "O3'" 1 
ATOM   584  C  "C2'" . DT  B 2 9   ? -27.124 70.334 196.758 1.00 30.22 ? 209 DT  C "C2'" 1 
ATOM   585  C  "C1'" . DT  B 2 9   ? -27.580 70.978 198.055 1.00 31.22 ? 209 DT  C "C1'" 1 
ATOM   586  N  N1    . DT  B 2 9   ? -26.536 71.624 198.869 1.00 31.40 ? 209 DT  C N1    1 
ATOM   587  C  C2    . DT  B 2 9   ? -26.907 72.790 199.483 1.00 32.50 ? 209 DT  C C2    1 
ATOM   588  O  O2    . DT  B 2 9   ? -28.026 73.254 199.384 1.00 32.69 ? 209 DT  C O2    1 
ATOM   589  N  N3    . DT  B 2 9   ? -25.920 73.396 200.211 1.00 32.35 ? 209 DT  C N3    1 
ATOM   590  C  C4    . DT  B 2 9   ? -24.619 72.967 200.375 1.00 29.67 ? 209 DT  C C4    1 
ATOM   591  O  O4    . DT  B 2 9   ? -23.839 73.636 201.047 1.00 33.07 ? 209 DT  C O4    1 
ATOM   592  C  C5    . DT  B 2 9   ? -24.291 71.730 199.717 1.00 28.71 ? 209 DT  C C5    1 
ATOM   593  C  C7    . DT  B 2 9   ? -22.903 71.190 199.866 1.00 27.55 ? 209 DT  C C7    1 
ATOM   594  C  C6    . DT  B 2 9   ? -25.256 71.117 199.004 1.00 29.16 ? 209 DT  C C6    1 
ATOM   595  P  P     . DA  B 2 10  ? -29.529 69.533 194.419 1.00 40.94 ? 210 DA  C P     1 
ATOM   596  O  OP1   . DA  B 2 10  ? -30.902 69.079 194.087 1.00 43.13 ? 210 DA  C OP1   1 
ATOM   597  O  OP2   . DA  B 2 10  ? -28.368 68.906 193.747 1.00 42.05 ? 210 DA  C OP2   1 
ATOM   598  O  "O5'" . DA  B 2 10  ? -29.489 71.071 194.046 1.00 43.84 ? 210 DA  C "O5'" 1 
ATOM   599  C  "C5'" . DA  B 2 10  ? -29.012 72.011 194.992 1.00 45.17 ? 210 DA  C "C5'" 1 
ATOM   600  C  "C4'" . DA  B 2 10  ? -29.859 73.249 194.959 1.00 45.12 ? 210 DA  C "C4'" 1 
ATOM   601  O  "O4'" . DA  B 2 10  ? -29.481 74.039 196.104 1.00 44.72 ? 210 DA  C "O4'" 1 
ATOM   602  C  "C3'" . DA  B 2 10  ? -29.610 74.129 193.741 1.00 45.92 ? 210 DA  C "C3'" 1 
ATOM   603  O  "O3'" . DA  B 2 10  ? -30.768 74.905 193.430 1.00 48.09 ? 210 DA  C "O3'" 1 
ATOM   604  C  "C2'" . DA  B 2 10  ? -28.460 75.002 194.198 1.00 46.33 ? 210 DA  C "C2'" 1 
ATOM   605  C  "C1'" . DA  B 2 10  ? -28.732 75.170 195.698 1.00 44.56 ? 210 DA  C "C1'" 1 
ATOM   606  N  N9    . DA  B 2 10  ? -27.493 75.176 196.475 1.00 42.81 ? 210 DA  C N9    1 
ATOM   607  C  C8    . DA  B 2 10  ? -26.469 74.264 196.422 1.00 41.41 ? 210 DA  C C8    1 
ATOM   608  N  N7    . DA  B 2 10  ? -25.431 74.598 197.144 1.00 40.97 ? 210 DA  C N7    1 
ATOM   609  C  C5    . DA  B 2 10  ? -25.810 75.797 197.732 1.00 42.24 ? 210 DA  C C5    1 
ATOM   610  C  C6    . DA  B 2 10  ? -25.146 76.678 198.592 1.00 42.75 ? 210 DA  C C6    1 
ATOM   611  N  N6    . DA  B 2 10  ? -23.897 76.497 199.017 1.00 44.07 ? 210 DA  C N6    1 
ATOM   612  N  N1    . DA  B 2 10  ? -25.810 77.775 199.002 1.00 42.78 ? 210 DA  C N1    1 
ATOM   613  C  C2    . DA  B 2 10  ? -27.047 77.969 198.563 1.00 42.66 ? 210 DA  C C2    1 
ATOM   614  N  N3    . DA  B 2 10  ? -27.774 77.225 197.746 1.00 42.89 ? 210 DA  C N3    1 
ATOM   615  C  C4    . DA  B 2 10  ? -27.088 76.142 197.357 1.00 41.93 ? 210 DA  C C4    1 
ATOM   616  P  P     . DT  B 2 11  ? -30.869 75.632 192.007 1.00 49.70 ? 211 DT  C P     1 
ATOM   617  O  OP1   . DT  B 2 11  ? -32.025 75.031 191.311 1.00 51.35 ? 211 DT  C OP1   1 
ATOM   618  O  OP2   . DT  B 2 11  ? -29.524 75.626 191.352 1.00 46.42 ? 211 DT  C OP2   1 
ATOM   619  O  "O5'" . DT  B 2 11  ? -31.237 77.118 192.421 1.00 49.64 ? 211 DT  C "O5'" 1 
ATOM   620  C  "C5'" . DT  B 2 11  ? -30.955 77.571 193.738 1.00 52.06 ? 211 DT  C "C5'" 1 
ATOM   621  C  "C4'" . DT  B 2 11  ? -30.903 79.079 193.767 1.00 52.77 ? 211 DT  C "C4'" 1 
ATOM   622  O  "O4'" . DT  B 2 11  ? -29.842 79.438 194.682 1.00 51.17 ? 211 DT  C "O4'" 1 
ATOM   623  C  "C3'" . DT  B 2 11  ? -30.514 79.679 192.420 1.00 54.06 ? 211 DT  C "C3'" 1 
ATOM   624  O  "O3'" . DT  B 2 11  ? -31.043 80.991 192.279 1.00 57.68 ? 211 DT  C "O3'" 1 
ATOM   625  C  "C2'" . DT  B 2 11  ? -29.005 79.681 192.473 1.00 52.88 ? 211 DT  C "C2'" 1 
ATOM   626  C  "C1'" . DT  B 2 11  ? -28.722 79.930 193.956 1.00 50.56 ? 211 DT  C "C1'" 1 
ATOM   627  N  N1    . DT  B 2 11  ? -27.523 79.187 194.402 1.00 46.95 ? 211 DT  C N1    1 
ATOM   628  C  C2    . DT  B 2 11  ? -26.848 79.637 195.512 1.00 43.90 ? 211 DT  C C2    1 
ATOM   629  O  O2    . DT  B 2 11  ? -27.233 80.567 196.199 1.00 40.50 ? 211 DT  C O2    1 
ATOM   630  N  N3    . DT  B 2 11  ? -25.698 78.945 195.793 1.00 43.37 ? 211 DT  C N3    1 
ATOM   631  C  C4    . DT  B 2 11  ? -25.172 77.868 195.094 1.00 41.64 ? 211 DT  C C4    1 
ATOM   632  O  O4    . DT  B 2 11  ? -24.111 77.368 195.454 1.00 40.70 ? 211 DT  C O4    1 
ATOM   633  C  C5    . DT  B 2 11  ? -25.951 77.428 193.961 1.00 41.41 ? 211 DT  C C5    1 
ATOM   634  C  C7    . DT  B 2 11  ? -25.466 76.276 193.146 1.00 40.33 ? 211 DT  C C7    1 
ATOM   635  C  C6    . DT  B 2 11  ? -27.075 78.088 193.681 1.00 44.16 ? 211 DT  C C6    1 
ATOM   636  P  P     . DA  B 2 12  ? -30.623 81.877 191.002 1.00 60.93 ? 212 DA  C P     1 
ATOM   637  O  OP1   . DA  B 2 12  ? -31.795 82.744 190.692 1.00 62.17 ? 212 DA  C OP1   1 
ATOM   638  O  OP2   . DA  B 2 12  ? -30.066 81.007 189.937 1.00 59.85 ? 212 DA  C OP2   1 
ATOM   639  O  "O5'" . DA  B 2 12  ? -29.441 82.782 191.565 1.00 60.34 ? 212 DA  C "O5'" 1 
ATOM   640  C  "C5'" . DA  B 2 12  ? -29.675 83.595 192.706 1.00 59.72 ? 212 DA  C "C5'" 1 
ATOM   641  C  "C4'" . DA  B 2 12  ? -28.696 84.741 192.747 1.00 59.94 ? 212 DA  C "C4'" 1 
ATOM   642  O  "O4'" . DA  B 2 12  ? -27.469 84.313 193.385 1.00 58.96 ? 212 DA  C "O4'" 1 
ATOM   643  C  "C3'" . DA  B 2 12  ? -28.287 85.195 191.349 1.00 60.87 ? 212 DA  C "C3'" 1 
ATOM   644  O  "O3'" . DA  B 2 12  ? -27.945 86.588 191.358 1.00 62.12 ? 212 DA  C "O3'" 1 
ATOM   645  C  "C2'" . DA  B 2 12  ? -27.079 84.323 191.055 1.00 60.74 ? 212 DA  C "C2'" 1 
ATOM   646  C  "C1'" . DA  B 2 12  ? -26.424 84.228 192.426 1.00 61.34 ? 212 DA  C "C1'" 1 
ATOM   647  N  N9    . DA  B 2 12  ? -25.672 82.998 192.667 1.00 61.69 ? 212 DA  C N9    1 
ATOM   648  C  C8    . DA  B 2 12  ? -25.950 81.730 192.220 1.00 62.20 ? 212 DA  C C8    1 
ATOM   649  N  N7    . DA  B 2 12  ? -25.049 80.843 192.558 1.00 61.99 ? 212 DA  C N7    1 
ATOM   650  C  C5    . DA  B 2 12  ? -24.122 81.572 193.286 1.00 61.86 ? 212 DA  C C5    1 
ATOM   651  C  C6    . DA  B 2 12  ? -22.923 81.208 193.919 1.00 62.31 ? 212 DA  C C6    1 
ATOM   652  N  N6    . DA  B 2 12  ? -22.431 79.963 193.916 1.00 62.11 ? 212 DA  C N6    1 
ATOM   653  N  N1    . DA  B 2 12  ? -22.235 82.177 194.566 1.00 62.10 ? 212 DA  C N1    1 
ATOM   654  C  C2    . DA  B 2 12  ? -22.729 83.424 194.565 1.00 61.39 ? 212 DA  C C2    1 
ATOM   655  N  N3    . DA  B 2 12  ? -23.845 83.889 194.002 1.00 61.36 ? 212 DA  C N3    1 
ATOM   656  C  C4    . DA  B 2 12  ? -24.501 82.900 193.372 1.00 61.54 ? 212 DA  C C4    1 
ATOM   657  P  P     . DC  B 2 13  ? -27.430 87.291 190.008 1.00 63.48 ? 213 DC  C P     1 
ATOM   658  O  OP1   . DC  B 2 13  ? -28.154 88.576 189.932 1.00 62.64 ? 213 DC  C OP1   1 
ATOM   659  O  OP2   . DC  B 2 13  ? -27.475 86.338 188.858 1.00 61.59 ? 213 DC  C OP2   1 
ATOM   660  O  "O5'" . DC  B 2 13  ? -25.902 87.579 190.340 1.00 63.72 ? 213 DC  C "O5'" 1 
ATOM   661  C  "C5'" . DC  B 2 13  ? -25.546 88.257 191.545 1.00 64.31 ? 213 DC  C "C5'" 1 
ATOM   662  C  "C4'" . DC  B 2 13  ? -24.107 88.715 191.492 1.00 65.88 ? 213 DC  C "C4'" 1 
ATOM   663  O  "O4'" . DC  B 2 13  ? -23.240 87.598 191.807 1.00 65.44 ? 213 DC  C "O4'" 1 
ATOM   664  C  "C3'" . DC  B 2 13  ? -23.698 89.167 190.090 1.00 67.43 ? 213 DC  C "C3'" 1 
ATOM   665  O  "O3'" . DC  B 2 13  ? -22.657 90.152 190.165 1.00 68.94 ? 213 DC  C "O3'" 1 
ATOM   666  C  "C2'" . DC  B 2 13  ? -23.202 87.881 189.457 1.00 65.91 ? 213 DC  C "C2'" 1 
ATOM   667  C  "C1'" . DC  B 2 13  ? -22.536 87.193 190.641 1.00 64.91 ? 213 DC  C "C1'" 1 
ATOM   668  N  N1    . DC  B 2 13  ? -22.501 85.724 190.600 1.00 63.33 ? 213 DC  C N1    1 
ATOM   669  C  C2    . DC  B 2 13  ? -21.536 85.063 191.365 1.00 61.72 ? 213 DC  C C2    1 
ATOM   670  O  O2    . DC  B 2 13  ? -20.769 85.735 192.081 1.00 59.00 ? 213 DC  C O2    1 
ATOM   671  N  N3    . DC  B 2 13  ? -21.459 83.715 191.309 1.00 61.41 ? 213 DC  C N3    1 
ATOM   672  C  C4    . DC  B 2 13  ? -22.300 83.028 190.535 1.00 61.88 ? 213 DC  C C4    1 
ATOM   673  N  N4    . DC  B 2 13  ? -22.174 81.698 190.506 1.00 61.50 ? 213 DC  C N4    1 
ATOM   674  C  C5    . DC  B 2 13  ? -23.306 83.673 189.755 1.00 62.54 ? 213 DC  C C5    1 
ATOM   675  C  C6    . DC  B 2 13  ? -23.372 85.011 189.819 1.00 62.93 ? 213 DC  C C6    1 
ATOM   676  P  P     . DA  B 2 14  ? -22.139 90.876 188.821 1.00 69.78 ? 214 DA  C P     1 
ATOM   677  O  OP1   . DA  B 2 14  ? -22.108 92.326 189.124 1.00 68.68 ? 214 DA  C OP1   1 
ATOM   678  O  OP2   . DA  B 2 14  ? -22.882 90.376 187.615 1.00 67.86 ? 214 DA  C OP2   1 
ATOM   679  O  "O5'" . DA  B 2 14  ? -20.640 90.367 188.707 1.00 68.76 ? 214 DA  C "O5'" 1 
ATOM   680  C  "C5'" . DA  B 2 14  ? -19.762 90.466 189.822 1.00 68.44 ? 214 DA  C "C5'" 1 
ATOM   681  C  "C4'" . DA  B 2 14  ? -18.368 90.037 189.432 1.00 67.93 ? 214 DA  C "C4'" 1 
ATOM   682  O  "O4'" . DA  B 2 14  ? -18.293 88.593 189.386 1.00 68.10 ? 214 DA  C "O4'" 1 
ATOM   683  C  "C3'" . DA  B 2 14  ? -18.034 90.504 188.016 1.00 68.08 ? 214 DA  C "C3'" 1 
ATOM   684  O  "O3'" . DA  B 2 14  ? -16.624 90.682 187.882 1.00 68.31 ? 214 DA  C "O3'" 1 
ATOM   685  C  "C2'" . DA  B 2 14  ? -18.532 89.358 187.159 1.00 67.68 ? 214 DA  C "C2'" 1 
ATOM   686  C  "C1'" . DA  B 2 14  ? -18.174 88.168 188.032 1.00 68.04 ? 214 DA  C "C1'" 1 
ATOM   687  N  N9    . DA  B 2 14  ? -18.967 86.955 187.844 1.00 67.66 ? 214 DA  C N9    1 
ATOM   688  C  C8    . DA  B 2 14  ? -20.207 86.795 187.279 1.00 66.40 ? 214 DA  C C8    1 
ATOM   689  N  N7    . DA  B 2 14  ? -20.608 85.547 187.234 1.00 66.54 ? 214 DA  C N7    1 
ATOM   690  C  C5    . DA  B 2 14  ? -19.566 84.841 187.822 1.00 67.56 ? 214 DA  C C5    1 
ATOM   691  C  C6    . DA  B 2 14  ? -19.370 83.471 188.083 1.00 67.67 ? 214 DA  C C6    1 
ATOM   692  N  N6    . DA  B 2 14  ? -20.250 82.517 187.775 1.00 67.56 ? 214 DA  C N6    1 
ATOM   693  N  N1    . DA  B 2 14  ? -18.215 83.107 188.684 1.00 68.26 ? 214 DA  C N1    1 
ATOM   694  C  C2    . DA  B 2 14  ? -17.326 84.058 188.996 1.00 68.38 ? 214 DA  C C2    1 
ATOM   695  N  N3    . DA  B 2 14  ? -17.396 85.369 188.804 1.00 68.46 ? 214 DA  C N3    1 
ATOM   696  C  C4    . DA  B 2 14  ? -18.554 85.698 188.206 1.00 68.07 ? 214 DA  C C4    1 
ATOM   697  P  P     . DC  B 2 15  ? -16.034 91.500 186.631 1.00 68.41 ? 215 DC  C P     1 
ATOM   698  O  OP1   . DC  B 2 15  ? -15.045 92.465 187.196 1.00 68.04 ? 215 DC  C OP1   1 
ATOM   699  O  OP2   . DC  B 2 15  ? -17.132 91.970 185.753 1.00 66.99 ? 215 DC  C OP2   1 
ATOM   700  O  "O5'" . DC  B 2 15  ? -15.235 90.394 185.834 1.00 67.10 ? 215 DC  C "O5'" 1 
ATOM   701  C  "C5'" . DC  B 2 15  ? -15.684 89.066 185.892 1.00 65.96 ? 215 DC  C "C5'" 1 
ATOM   702  C  "C4'" . DC  B 2 15  ? -14.534 88.139 186.176 1.00 64.24 ? 215 DC  C "C4'" 1 
ATOM   703  O  "O4'" . DC  B 2 15  ? -15.097 86.877 186.583 1.00 64.00 ? 215 DC  C "O4'" 1 
ATOM   704  C  "C3'" . DC  B 2 15  ? -13.700 87.851 184.937 1.00 62.99 ? 215 DC  C "C3'" 1 
ATOM   705  O  "O3'" . DC  B 2 15  ? -12.373 87.507 185.312 1.00 59.59 ? 215 DC  C "O3'" 1 
ATOM   706  C  "C2'" . DC  B 2 15  ? -14.431 86.682 184.318 1.00 63.58 ? 215 DC  C "C2'" 1 
ATOM   707  C  "C1'" . DC  B 2 15  ? -14.943 85.928 185.545 1.00 64.84 ? 215 DC  C "C1'" 1 
ATOM   708  N  N1    . DC  B 2 15  ? -16.252 85.299 185.322 1.00 65.66 ? 215 DC  C N1    1 
ATOM   709  C  C2    . DC  B 2 15  ? -16.369 83.938 185.553 1.00 65.37 ? 215 DC  C C2    1 
ATOM   710  O  O2    . DC  B 2 15  ? -15.385 83.325 185.987 1.00 64.50 ? 215 DC  C O2    1 
ATOM   711  N  N3    . DC  B 2 15  ? -17.541 83.322 185.300 1.00 65.88 ? 215 DC  C N3    1 
ATOM   712  C  C4    . DC  B 2 15  ? -18.578 84.024 184.841 1.00 66.22 ? 215 DC  C C4    1 
ATOM   713  N  N4    . DC  B 2 15  ? -19.709 83.369 184.587 1.00 68.35 ? 215 DC  C N4    1 
ATOM   714  C  C5    . DC  B 2 15  ? -18.498 85.428 184.619 1.00 65.16 ? 215 DC  C C5    1 
ATOM   715  C  C6    . DC  B 2 15  ? -17.327 86.023 184.874 1.00 65.39 ? 215 DC  C C6    1 
ATOM   716  P  P     . DA  B 2 16  ? -11.311 87.093 184.180 1.00 58.78 ? 216 DA  C P     1 
ATOM   717  O  OP1   . DA  B 2 16  ? -9.997  87.573 184.703 1.00 58.40 ? 216 DA  C OP1   1 
ATOM   718  O  OP2   . DA  B 2 16  ? -11.774 87.522 182.828 1.00 54.79 ? 216 DA  C OP2   1 
ATOM   719  O  "O5'" . DA  B 2 16  ? -11.321 85.496 184.211 1.00 57.88 ? 216 DA  C "O5'" 1 
ATOM   720  C  "C5'" . DA  B 2 16  ? -10.996 84.806 185.414 1.00 55.31 ? 216 DA  C "C5'" 1 
ATOM   721  C  "C4'" . DA  B 2 16  ? -10.911 83.309 185.193 1.00 54.30 ? 216 DA  C "C4'" 1 
ATOM   722  O  "O4'" . DA  B 2 16  ? -12.223 82.746 184.964 1.00 52.81 ? 216 DA  C "O4'" 1 
ATOM   723  C  "C3'" . DA  B 2 16  ? -10.097 82.914 183.960 1.00 53.48 ? 216 DA  C "C3'" 1 
ATOM   724  O  "O3'" . DA  B 2 16  ? -9.544  81.603 184.169 1.00 53.86 ? 216 DA  C "O3'" 1 
ATOM   725  C  "C2'" . DA  B 2 16  ? -11.150 82.889 182.871 1.00 51.76 ? 216 DA  C "C2'" 1 
ATOM   726  C  "C1'" . DA  B 2 16  ? -12.325 82.309 183.622 1.00 51.65 ? 216 DA  C "C1'" 1 
ATOM   727  N  N9    . DA  B 2 16  ? -13.662 82.618 183.130 1.00 52.21 ? 216 DA  C N9    1 
ATOM   728  C  C8    . DA  B 2 16  ? -14.221 83.842 182.895 1.00 51.61 ? 216 DA  C C8    1 
ATOM   729  N  N7    . DA  B 2 16  ? -15.465 83.783 182.474 1.00 51.79 ? 216 DA  C N7    1 
ATOM   730  C  C5    . DA  B 2 16  ? -15.739 82.424 182.422 1.00 51.64 ? 216 DA  C C5    1 
ATOM   731  C  C6    . DA  B 2 16  ? -16.888 81.699 182.058 1.00 51.00 ? 216 DA  C C6    1 
ATOM   732  N  N6    . DA  B 2 16  ? -18.025 82.259 181.671 1.00 47.96 ? 216 DA  C N6    1 
ATOM   733  N  N1    . DA  B 2 16  ? -16.827 80.353 182.113 1.00 52.23 ? 216 DA  C N1    1 
ATOM   734  C  C2    . DA  B 2 16  ? -15.685 79.782 182.512 1.00 52.84 ? 216 DA  C C2    1 
ATOM   735  N  N3    . DA  B 2 16  ? -14.543 80.350 182.880 1.00 53.34 ? 216 DA  C N3    1 
ATOM   736  C  C4    . DA  B 2 16  ? -14.635 81.692 182.816 1.00 52.89 ? 216 DA  C C4    1 
ATOM   737  P  P     . DT  B 2 17  ? -8.469  80.998 183.139 1.00 53.43 ? 217 DT  C P     1 
ATOM   738  O  OP1   . DT  B 2 17  ? -7.248  80.626 183.920 1.00 52.43 ? 217 DT  C OP1   1 
ATOM   739  O  OP2   . DT  B 2 17  ? -8.376  81.891 181.954 1.00 52.38 ? 217 DT  C OP2   1 
ATOM   740  O  "O5'" . DT  B 2 17  ? -9.147  79.654 182.652 1.00 53.54 ? 217 DT  C "O5'" 1 
ATOM   741  C  "C5'" . DT  B 2 17  ? -10.484 79.667 182.229 1.00 53.52 ? 217 DT  C "C5'" 1 
ATOM   742  C  "C4'" . DT  B 2 17  ? -11.004 78.261 182.138 1.00 54.46 ? 217 DT  C "C4'" 1 
ATOM   743  O  "O4'" . DT  B 2 17  ? -12.417 78.363 181.903 1.00 55.49 ? 217 DT  C "O4'" 1 
ATOM   744  C  "C3'" . DT  B 2 17  ? -10.439 77.461 180.971 1.00 55.47 ? 217 DT  C "C3'" 1 
ATOM   745  O  "O3'" . DT  B 2 17  ? -10.461 76.065 181.290 1.00 56.70 ? 217 DT  C "O3'" 1 
ATOM   746  C  "C2'" . DT  B 2 17  ? -11.375 77.839 179.842 1.00 54.56 ? 217 DT  C "C2'" 1 
ATOM   747  C  "C1'" . DT  B 2 17  ? -12.711 78.039 180.561 1.00 55.91 ? 217 DT  C "C1'" 1 
ATOM   748  N  N1    . DT  B 2 17  ? -13.519 79.146 180.049 1.00 56.06 ? 217 DT  C N1    1 
ATOM   749  C  C2    . DT  B 2 17  ? -14.759 78.837 179.573 1.00 57.65 ? 217 DT  C C2    1 
ATOM   750  O  O2    . DT  B 2 17  ? -15.192 77.698 179.548 1.00 61.50 ? 217 DT  C O2    1 
ATOM   751  N  N3    . DT  B 2 17  ? -15.484 79.908 179.129 1.00 57.39 ? 217 DT  C N3    1 
ATOM   752  C  C4    . DT  B 2 17  ? -15.096 81.230 179.108 1.00 56.57 ? 217 DT  C C4    1 
ATOM   753  O  O4    . DT  B 2 17  ? -15.864 82.086 178.674 1.00 56.41 ? 217 DT  C O4    1 
ATOM   754  C  C5    . DT  B 2 17  ? -13.771 81.486 179.620 1.00 56.59 ? 217 DT  C C5    1 
ATOM   755  C  C7    . DT  B 2 17  ? -13.258 82.890 179.635 1.00 55.94 ? 217 DT  C C7    1 
ATOM   756  C  C6    . DT  B 2 17  ? -13.054 80.444 180.060 1.00 56.12 ? 217 DT  C C6    1 
ATOM   757  P  P     . DC  B 2 18  ? -9.614  75.023 180.407 1.00 58.83 ? 218 DC  C P     1 
ATOM   758  O  OP1   . DC  B 2 18  ? -8.979  74.118 181.384 1.00 59.41 ? 218 DC  C OP1   1 
ATOM   759  O  OP2   . DC  B 2 18  ? -8.770  75.759 179.423 1.00 59.70 ? 218 DC  C OP2   1 
ATOM   760  O  "O5'" . DC  B 2 18  ? -10.741 74.222 179.616 1.00 59.14 ? 218 DC  C "O5'" 1 
ATOM   761  C  "C5'" . DC  B 2 18  ? -11.844 74.940 179.086 1.00 60.50 ? 218 DC  C "C5'" 1 
ATOM   762  C  "C4'" . DC  B 2 18  ? -12.971 74.019 178.692 1.00 61.45 ? 218 DC  C "C4'" 1 
ATOM   763  O  "O4'" . DC  B 2 18  ? -14.145 74.854 178.543 1.00 60.12 ? 218 DC  C "O4'" 1 
ATOM   764  C  "C3'" . DC  B 2 18  ? -12.767 73.333 177.343 1.00 63.61 ? 218 DC  C "C3'" 1 
ATOM   765  O  "O3'" . DC  B 2 18  ? -13.450 72.077 177.276 1.00 67.67 ? 218 DC  C "O3'" 1 
ATOM   766  C  "C2'" . DC  B 2 18  ? -13.341 74.341 176.372 1.00 63.28 ? 218 DC  C "C2'" 1 
ATOM   767  C  "C1'" . DC  B 2 18  ? -14.475 74.996 177.170 1.00 61.01 ? 218 DC  C "C1'" 1 
ATOM   768  N  N1    . DC  B 2 18  ? -14.606 76.437 176.889 1.00 60.66 ? 218 DC  C N1    1 
ATOM   769  C  C2    . DC  B 2 18  ? -15.881 76.981 176.717 1.00 61.61 ? 218 DC  C C2    1 
ATOM   770  O  O2    . DC  B 2 18  ? -16.870 76.256 176.891 1.00 61.46 ? 218 DC  C O2    1 
ATOM   771  N  N3    . DC  B 2 18  ? -16.006 78.288 176.372 1.00 62.41 ? 218 DC  C N3    1 
ATOM   772  C  C4    . DC  B 2 18  ? -14.916 79.046 176.217 1.00 61.37 ? 218 DC  C C4    1 
ATOM   773  N  N4    . DC  B 2 18  ? -15.086 80.324 175.852 1.00 59.34 ? 218 DC  C N4    1 
ATOM   774  C  C5    . DC  B 2 18  ? -13.604 78.525 176.426 1.00 60.39 ? 218 DC  C C5    1 
ATOM   775  C  C6    . DC  B 2 18  ? -13.497 77.230 176.763 1.00 59.91 ? 218 DC  C C6    1 
ATOM   776  P  P     . DT  B 2 19  ? -13.486 71.252 175.884 1.00 69.66 ? 219 DT  C P     1 
ATOM   777  O  OP1   . DT  B 2 19  ? -13.322 69.811 176.219 1.00 69.83 ? 219 DT  C OP1   1 
ATOM   778  O  OP2   . DT  B 2 19  ? -12.554 71.869 174.909 1.00 69.00 ? 219 DT  C OP2   1 
ATOM   779  O  "O5'" . DT  B 2 19  ? -14.972 71.484 175.344 1.00 70.12 ? 219 DT  C "O5'" 1 
ATOM   780  C  "C5'" . DT  B 2 19  ? -16.086 71.340 176.220 1.00 72.49 ? 219 DT  C "C5'" 1 
ATOM   781  C  "C4'" . DT  B 2 19  ? -17.387 71.410 175.453 1.00 74.73 ? 219 DT  C "C4'" 1 
ATOM   782  O  "O4'" . DT  B 2 19  ? -17.694 72.781 175.084 1.00 75.56 ? 219 DT  C "O4'" 1 
ATOM   783  C  "C3'" . DT  B 2 19  ? -17.323 70.654 174.128 1.00 76.44 ? 219 DT  C "C3'" 1 
ATOM   784  O  "O3'" . DT  B 2 19  ? -18.633 70.196 173.773 1.00 79.29 ? 219 DT  C "O3'" 1 
ATOM   785  C  "C2'" . DT  B 2 19  ? -16.835 71.716 173.154 1.00 76.16 ? 219 DT  C "C2'" 1 
ATOM   786  C  "C1'" . DT  B 2 19  ? -17.558 72.954 173.671 1.00 75.42 ? 219 DT  C "C1'" 1 
ATOM   787  N  N1    . DT  B 2 19  ? -16.908 74.258 173.413 1.00 74.53 ? 219 DT  C N1    1 
ATOM   788  C  C2    . DT  B 2 19  ? -17.699 75.325 173.015 1.00 73.86 ? 219 DT  C C2    1 
ATOM   789  O  O2    . DT  B 2 19  ? -18.910 75.241 172.854 1.00 72.66 ? 219 DT  C O2    1 
ATOM   790  N  N3    . DT  B 2 19  ? -17.010 76.501 172.812 1.00 73.01 ? 219 DT  C N3    1 
ATOM   791  C  C4    . DT  B 2 19  ? -15.646 76.707 172.960 1.00 71.93 ? 219 DT  C C4    1 
ATOM   792  O  O4    . DT  B 2 19  ? -15.166 77.817 172.747 1.00 71.21 ? 219 DT  C O4    1 
ATOM   793  C  C5    . DT  B 2 19  ? -14.885 75.545 173.371 1.00 71.95 ? 219 DT  C C5    1 
ATOM   794  C  C7    . DT  B 2 19  ? -13.405 75.674 173.552 1.00 71.44 ? 219 DT  C C7    1 
ATOM   795  C  C6    . DT  B 2 19  ? -15.545 74.397 173.572 1.00 73.21 ? 219 DT  C C6    1 
ATOM   796  P  P     . DC  B 2 20  ? -18.849 69.397 172.396 1.00 81.63 ? 220 DC  C P     1 
ATOM   797  O  OP1   . DC  B 2 20  ? -19.830 68.317 172.688 1.00 80.23 ? 220 DC  C OP1   1 
ATOM   798  O  OP2   . DC  B 2 20  ? -17.502 69.060 171.835 1.00 79.80 ? 220 DC  C OP2   1 
ATOM   799  O  "O5'" . DC  B 2 20  ? -19.546 70.462 171.434 1.00 82.40 ? 220 DC  C "O5'" 1 
ATOM   800  C  "C5'" . DC  B 2 20  ? -20.841 70.977 171.742 1.00 83.92 ? 220 DC  C "C5'" 1 
ATOM   801  C  "C4'" . DC  B 2 20  ? -21.433 71.703 170.555 1.00 84.90 ? 220 DC  C "C4'" 1 
ATOM   802  O  "O4'" . DC  B 2 20  ? -20.704 72.932 170.322 1.00 85.55 ? 220 DC  C "O4'" 1 
ATOM   803  C  "C3'" . DC  B 2 20  ? -21.312 70.914 169.252 1.00 85.44 ? 220 DC  C "C3'" 1 
ATOM   804  O  "O3'" . DC  B 2 20  ? -22.248 71.404 168.287 1.00 86.27 ? 220 DC  C "O3'" 1 
ATOM   805  C  "C2'" . DC  B 2 20  ? -19.954 71.348 168.731 1.00 84.83 ? 220 DC  C "C2'" 1 
ATOM   806  C  "C1'" . DC  B 2 20  ? -19.939 72.818 169.126 1.00 84.67 ? 220 DC  C "C1'" 1 
ATOM   807  N  N1    . DC  B 2 20  ? -18.622 73.447 169.345 1.00 84.18 ? 220 DC  C N1    1 
ATOM   808  C  C2    . DC  B 2 20  ? -18.575 74.833 169.561 1.00 83.49 ? 220 DC  C C2    1 
ATOM   809  O  O2    . DC  B 2 20  ? -19.638 75.480 169.566 1.00 82.88 ? 220 DC  C O2    1 
ATOM   810  N  N3    . DC  B 2 20  ? -17.378 75.431 169.754 1.00 82.48 ? 220 DC  C N3    1 
ATOM   811  C  C4    . DC  B 2 20  ? -16.256 74.704 169.737 1.00 82.40 ? 220 DC  C C4    1 
ATOM   812  N  N4    . DC  B 2 20  ? -15.102 75.339 169.939 1.00 81.27 ? 220 DC  C N4    1 
ATOM   813  C  C5    . DC  B 2 20  ? -16.271 73.293 169.516 1.00 82.73 ? 220 DC  C C5    1 
ATOM   814  C  C6    . DC  B 2 20  ? -17.466 72.710 169.330 1.00 83.40 ? 220 DC  C C6    1 
ATOM   815  N  N     . ALA C 3 9   ? 1.107   73.605 230.520 1.00 84.98 ? 5   ALA A N     1 
ATOM   816  C  CA    . ALA C 3 9   ? -0.248  73.527 229.897 1.00 87.02 ? 5   ALA A CA    1 
ATOM   817  C  C     . ALA C 3 9   ? -0.223  72.567 228.707 1.00 86.96 ? 5   ALA A C     1 
ATOM   818  O  O     . ALA C 3 9   ? -1.141  72.551 227.879 1.00 86.43 ? 5   ALA A O     1 
ATOM   819  C  CB    . ALA C 3 9   ? -0.694  74.915 229.439 1.00 84.93 ? 5   ALA A CB    1 
ATOM   820  N  N     . LEU C 3 10  ? 0.837   71.773 228.616 1.00 85.95 ? 6   LEU A N     1 
ATOM   821  C  CA    . LEU C 3 10  ? 0.966   70.821 227.520 1.00 84.88 ? 6   LEU A CA    1 
ATOM   822  C  C     . LEU C 3 10  ? 0.158   69.539 227.732 1.00 81.79 ? 6   LEU A C     1 
ATOM   823  O  O     . LEU C 3 10  ? -1.026  69.486 227.396 1.00 85.51 ? 6   LEU A O     1 
ATOM   824  C  CB    . LEU C 3 10  ? 2.451   70.477 227.292 1.00 86.87 ? 6   LEU A CB    1 
ATOM   825  C  CG    . LEU C 3 10  ? 3.163   71.266 226.187 1.00 85.16 ? 6   LEU A CG    1 
ATOM   826  C  CD1   . LEU C 3 10  ? 4.656   70.969 226.205 1.00 85.18 ? 6   LEU A CD1   1 
ATOM   827  C  CD2   . LEU C 3 10  ? 2.562   70.893 224.847 1.00 83.42 ? 6   LEU A CD2   1 
ATOM   828  N  N     . HIS C 3 11  ? 0.825   68.517 228.274 1.00 78.62 ? 7   HIS A N     1 
ATOM   829  C  CA    . HIS C 3 11  ? 0.227   67.207 228.553 1.00 74.58 ? 7   HIS A CA    1 
ATOM   830  C  C     . HIS C 3 11  ? -0.790  67.303 229.678 1.00 73.03 ? 7   HIS A C     1 
ATOM   831  O  O     . HIS C 3 11  ? -0.728  66.562 230.672 1.00 71.17 ? 7   HIS A O     1 
ATOM   832  C  CB    . HIS C 3 11  ? 1.308   66.202 228.935 1.00 73.33 ? 7   HIS A CB    1 
ATOM   833  C  CG    . HIS C 3 11  ? 2.372   66.048 227.889 1.00 75.97 ? 7   HIS A CG    1 
ATOM   834  N  ND1   . HIS C 3 11  ? 2.078   65.768 226.569 1.00 75.45 ? 7   HIS A ND1   1 
ATOM   835  C  CD2   . HIS C 3 11  ? 3.725   66.115 227.965 1.00 75.47 ? 7   HIS A CD2   1 
ATOM   836  C  CE1   . HIS C 3 11  ? 3.200   65.663 225.876 1.00 73.55 ? 7   HIS A CE1   1 
ATOM   837  N  NE2   . HIS C 3 11  ? 4.214   65.869 226.700 1.00 74.27 ? 7   HIS A NE2   1 
ATOM   838  N  N     . ARG C 3 12  ? -1.732  68.228 229.495 1.00 68.86 ? 8   ARG A N     1 
ATOM   839  C  CA    . ARG C 3 12  ? -2.791  68.468 230.453 1.00 63.41 ? 8   ARG A CA    1 
ATOM   840  C  C     . ARG C 3 12  ? -3.299  67.120 230.952 1.00 58.01 ? 8   ARG A C     1 
ATOM   841  O  O     . ARG C 3 12  ? -3.302  66.879 232.155 1.00 57.11 ? 8   ARG A O     1 
ATOM   842  C  CB    . ARG C 3 12  ? -3.924  69.279 229.805 1.00 66.25 ? 8   ARG A CB    1 
ATOM   843  C  CG    . ARG C 3 12  ? -4.722  70.086 230.822 1.00 70.69 ? 8   ARG A CG    1 
ATOM   844  C  CD    . ARG C 3 12  ? -5.922  70.792 230.216 1.00 72.94 ? 8   ARG A CD    1 
ATOM   845  N  NE    . ARG C 3 12  ? -5.590  71.516 228.977 1.00 76.68 ? 8   ARG A NE    1 
ATOM   846  C  CZ    . ARG C 3 12  ? -6.271  72.566 228.511 1.00 77.31 ? 8   ARG A CZ    1 
ATOM   847  N  NH1   . ARG C 3 12  ? -7.319  73.032 229.178 1.00 79.85 ? 8   ARG A NH1   1 
ATOM   848  N  NH2   . ARG C 3 12  ? -5.922  73.145 227.370 1.00 74.94 ? 8   ARG A NH2   1 
ATOM   849  N  N     . ALA C 3 13  ? -3.691  66.243 230.024 1.00 52.27 ? 9   ALA A N     1 
ATOM   850  C  CA    . ALA C 3 13  ? -4.202  64.916 230.355 1.00 45.51 ? 9   ALA A CA    1 
ATOM   851  C  C     . ALA C 3 13  ? -3.614  64.393 231.655 1.00 42.61 ? 9   ALA A C     1 
ATOM   852  O  O     . ALA C 3 13  ? -4.333  64.069 232.608 1.00 41.94 ? 9   ALA A O     1 
ATOM   853  C  CB    . ALA C 3 13  ? -3.900  63.952 229.233 1.00 41.93 ? 9   ALA A CB    1 
ATOM   854  N  N     . ALA C 3 14  ? -2.290  64.347 231.693 1.00 41.51 ? 10  ALA A N     1 
ATOM   855  C  CA    . ALA C 3 14  ? -1.548  63.851 232.846 1.00 40.04 ? 10  ALA A CA    1 
ATOM   856  C  C     . ALA C 3 14  ? -1.827  64.639 234.115 1.00 40.25 ? 10  ALA A C     1 
ATOM   857  O  O     . ALA C 3 14  ? -2.106  64.059 235.162 1.00 39.19 ? 10  ALA A O     1 
ATOM   858  C  CB    . ALA C 3 14  ? -0.063  63.865 232.537 1.00 40.75 ? 10  ALA A CB    1 
ATOM   859  N  N     . ASP C 3 15  ? -1.739  65.960 234.038 1.00 41.21 ? 11  ASP A N     1 
ATOM   860  C  CA    . ASP C 3 15  ? -1.999  66.776 235.221 1.00 42.56 ? 11  ASP A CA    1 
ATOM   861  C  C     . ASP C 3 15  ? -3.453  66.671 235.601 1.00 40.74 ? 11  ASP A C     1 
ATOM   862  O  O     . ASP C 3 15  ? -3.803  66.642 236.785 1.00 40.82 ? 11  ASP A O     1 
ATOM   863  C  CB    . ASP C 3 15  ? -1.648  68.235 234.951 1.00 45.99 ? 11  ASP A CB    1 
ATOM   864  C  CG    . ASP C 3 15  ? -0.189  68.415 234.625 1.00 50.03 ? 11  ASP A CG    1 
ATOM   865  O  OD1   . ASP C 3 15  ? 0.643   67.827 235.366 1.00 50.56 ? 11  ASP A OD1   1 
ATOM   866  O  OD2   . ASP C 3 15  ? 0.117   69.142 233.640 1.00 52.78 ? 11  ASP A OD2   1 
ATOM   867  N  N     . TRP C 3 16  ? -4.290  66.627 234.568 1.00 39.20 ? 12  TRP A N     1 
ATOM   868  C  CA    . TRP C 3 16  ? -5.733  66.512 234.714 1.00 36.77 ? 12  TRP A CA    1 
ATOM   869  C  C     . TRP C 3 16  ? -6.075  65.295 235.551 1.00 35.00 ? 12  TRP A C     1 
ATOM   870  O  O     . TRP C 3 16  ? -6.655  65.411 236.628 1.00 33.69 ? 12  TRP A O     1 
ATOM   871  C  CB    . TRP C 3 16  ? -6.385  66.370 233.339 1.00 38.17 ? 12  TRP A CB    1 
ATOM   872  C  CG    . TRP C 3 16  ? -7.856  66.081 233.413 1.00 41.49 ? 12  TRP A CG    1 
ATOM   873  C  CD1   . TRP C 3 16  ? -8.852  66.957 233.747 1.00 41.33 ? 12  TRP A CD1   1 
ATOM   874  C  CD2   . TRP C 3 16  ? -8.493  64.815 233.197 1.00 42.61 ? 12  TRP A CD2   1 
ATOM   875  N  NE1   . TRP C 3 16  ? -10.066 66.316 233.757 1.00 41.55 ? 12  TRP A NE1   1 
ATOM   876  C  CE2   . TRP C 3 16  ? -9.875  64.999 233.427 1.00 43.45 ? 12  TRP A CE2   1 
ATOM   877  C  CE3   . TRP C 3 16  ? -8.029  63.538 232.845 1.00 43.72 ? 12  TRP A CE3   1 
ATOM   878  C  CZ2   . TRP C 3 16  ? -10.804 63.953 233.299 1.00 43.75 ? 12  TRP A CZ2   1 
ATOM   879  C  CZ3   . TRP C 3 16  ? -8.954  62.495 232.720 1.00 44.62 ? 12  TRP A CZ3   1 
ATOM   880  C  CH2   . TRP C 3 16  ? -10.325 62.713 232.953 1.00 44.28 ? 12  TRP A CH2   1 
ATOM   881  N  N     . ALA C 3 17  ? -5.712  64.127 235.034 1.00 34.43 ? 13  ALA A N     1 
ATOM   882  C  CA    . ALA C 3 17  ? -5.983  62.868 235.706 1.00 35.24 ? 13  ALA A CA    1 
ATOM   883  C  C     . ALA C 3 17  ? -5.590  62.947 237.164 1.00 36.20 ? 13  ALA A C     1 
ATOM   884  O  O     . ALA C 3 17  ? -6.320  62.498 238.048 1.00 36.03 ? 13  ALA A O     1 
ATOM   885  C  CB    . ALA C 3 17  ? -5.225  61.739 235.026 1.00 34.39 ? 13  ALA A CB    1 
ATOM   886  N  N     . LYS C 3 18  ? -4.427  63.525 237.427 1.00 38.95 ? 14  LYS A N     1 
ATOM   887  C  CA    . LYS C 3 18  ? -3.963  63.617 238.800 1.00 40.62 ? 14  LYS A CA    1 
ATOM   888  C  C     . LYS C 3 18  ? -4.890  64.452 239.686 1.00 40.06 ? 14  LYS A C     1 
ATOM   889  O  O     . LYS C 3 18  ? -5.249  64.013 240.775 1.00 40.49 ? 14  LYS A O     1 
ATOM   890  C  CB    . LYS C 3 18  ? -2.536  64.180 238.851 1.00 43.10 ? 14  LYS A CB    1 
ATOM   891  C  CG    . LYS C 3 18  ? -1.782  63.784 240.115 1.00 46.73 ? 14  LYS A CG    1 
ATOM   892  C  CD    . LYS C 3 18  ? -0.784  64.846 240.550 1.00 51.09 ? 14  LYS A CD    1 
ATOM   893  C  CE    . LYS C 3 18  ? -0.166  64.483 241.906 1.00 53.62 ? 14  LYS A CE    1 
ATOM   894  N  NZ    . LYS C 3 18  ? 0.705   65.562 242.474 1.00 55.83 ? 14  LYS A NZ    1 
ATOM   895  N  N     . SER C 3 19  ? -5.290  65.641 239.230 1.00 38.85 ? 15  SER A N     1 
ATOM   896  C  CA    . SER C 3 19  ? -6.166  66.497 240.046 1.00 38.66 ? 15  SER A CA    1 
ATOM   897  C  C     . SER C 3 19  ? -7.551  65.894 240.326 1.00 37.83 ? 15  SER A C     1 
ATOM   898  O  O     . SER C 3 19  ? -8.189  66.230 241.329 1.00 37.05 ? 15  SER A O     1 
ATOM   899  C  CB    . SER C 3 19  ? -6.353  67.864 239.389 1.00 39.40 ? 15  SER A CB    1 
ATOM   900  O  OG    . SER C 3 19  ? -7.216  67.770 238.277 1.00 44.40 ? 15  SER A OG    1 
ATOM   901  N  N     . VAL C 3 20  ? -8.002  65.008 239.437 1.00 36.53 ? 16  VAL A N     1 
ATOM   902  C  CA    . VAL C 3 20  ? -9.302  64.356 239.559 1.00 34.78 ? 16  VAL A CA    1 
ATOM   903  C  C     . VAL C 3 20  ? -9.342  63.085 240.406 1.00 34.38 ? 16  VAL A C     1 
ATOM   904  O  O     . VAL C 3 20  ? -10.240 62.921 241.222 1.00 34.24 ? 16  VAL A O     1 
ATOM   905  C  CB    . VAL C 3 20  ? -9.864  63.970 238.187 1.00 33.79 ? 16  VAL A CB    1 
ATOM   906  C  CG1   . VAL C 3 20  ? -11.290 63.480 238.340 1.00 33.90 ? 16  VAL A CG1   1 
ATOM   907  C  CG2   . VAL C 3 20  ? -9.774  65.143 237.229 1.00 35.90 ? 16  VAL A CG2   1 
ATOM   908  N  N     . PHE C 3 21  ? -8.377  62.188 240.211 1.00 34.43 ? 17  PHE A N     1 
ATOM   909  C  CA    . PHE C 3 21  ? -8.374  60.919 240.930 1.00 33.75 ? 17  PHE A CA    1 
ATOM   910  C  C     . PHE C 3 21  ? -7.312  60.670 242.007 1.00 34.70 ? 17  PHE A C     1 
ATOM   911  O  O     . PHE C 3 21  ? -7.292  59.592 242.599 1.00 34.90 ? 17  PHE A O     1 
ATOM   912  C  CB    . PHE C 3 21  ? -8.314  59.759 239.925 1.00 31.69 ? 17  PHE A CB    1 
ATOM   913  C  CG    . PHE C 3 21  ? -9.346  59.830 238.828 1.00 31.38 ? 17  PHE A CG    1 
ATOM   914  C  CD1   . PHE C 3 21  ? -9.076  60.511 237.648 1.00 31.49 ? 17  PHE A CD1   1 
ATOM   915  C  CD2   . PHE C 3 21  ? -10.577 59.175 238.955 1.00 31.62 ? 17  PHE A CD2   1 
ATOM   916  C  CE1   . PHE C 3 21  ? -10.006 60.533 236.600 1.00 30.93 ? 17  PHE A CE1   1 
ATOM   917  C  CE2   . PHE C 3 21  ? -11.524 59.189 237.912 1.00 29.92 ? 17  PHE A CE2   1 
ATOM   918  C  CZ    . PHE C 3 21  ? -11.237 59.869 236.734 1.00 30.05 ? 17  PHE A CZ    1 
ATOM   919  N  N     . SER C 3 22  ? -6.435  61.636 242.265 1.00 36.82 ? 18  SER A N     1 
ATOM   920  C  CA    . SER C 3 22  ? -5.367  61.478 243.269 1.00 37.07 ? 18  SER A CA    1 
ATOM   921  C  C     . SER C 3 22  ? -5.836  61.192 244.685 1.00 38.00 ? 18  SER A C     1 
ATOM   922  O  O     . SER C 3 22  ? -5.057  60.723 245.516 1.00 37.57 ? 18  SER A O     1 
ATOM   923  C  CB    . SER C 3 22  ? -4.504  62.726 243.311 1.00 39.01 ? 18  SER A CB    1 
ATOM   924  O  OG    . SER C 3 22  ? -3.598  62.744 242.221 1.00 45.25 ? 18  SER A OG    1 
ATOM   925  N  N     . SER C 3 23  ? -7.102  61.492 244.960 1.00 38.70 ? 19  SER A N     1 
ATOM   926  C  CA    . SER C 3 23  ? -7.663  61.272 246.279 1.00 39.34 ? 19  SER A CA    1 
ATOM   927  C  C     . SER C 3 23  ? -8.421  59.947 246.346 1.00 38.92 ? 19  SER A C     1 
ATOM   928  O  O     . SER C 3 23  ? -8.874  59.531 247.419 1.00 39.19 ? 19  SER A O     1 
ATOM   929  C  CB    . SER C 3 23  ? -8.582  62.443 246.641 1.00 41.77 ? 19  SER A CB    1 
ATOM   930  O  OG    . SER C 3 23  ? -9.954  62.090 246.507 1.00 43.69 ? 19  SER A OG    1 
ATOM   931  N  N     . ALA C 3 24  ? -8.551  59.290 245.195 1.00 37.76 ? 20  ALA A N     1 
ATOM   932  C  CA    . ALA C 3 24  ? -9.242  58.003 245.107 1.00 37.44 ? 20  ALA A CA    1 
ATOM   933  C  C     . ALA C 3 24  ? -8.790  57.066 246.217 1.00 36.50 ? 20  ALA A C     1 
ATOM   934  O  O     . ALA C 3 24  ? -7.618  56.731 246.309 1.00 37.50 ? 20  ALA A O     1 
ATOM   935  C  CB    . ALA C 3 24  ? -8.971  57.359 243.757 1.00 38.40 ? 20  ALA A CB    1 
ATOM   936  N  N     . ALA C 3 25  ? -9.720  56.648 247.063 1.00 36.03 ? 21  ALA A N     1 
ATOM   937  C  CA    . ALA C 3 25  ? -9.386  55.745 248.154 1.00 34.47 ? 21  ALA A CA    1 
ATOM   938  C  C     . ALA C 3 25  ? -9.691  54.315 247.704 1.00 34.20 ? 21  ALA A C     1 
ATOM   939  O  O     . ALA C 3 25  ? -10.661 53.704 248.144 1.00 33.30 ? 21  ALA A O     1 
ATOM   940  C  CB    . ALA C 3 25  ? -10.188 56.095 249.382 1.00 34.01 ? 21  ALA A CB    1 
ATOM   941  N  N     . LEU C 3 26  ? -8.851  53.803 246.811 1.00 33.73 ? 22  LEU A N     1 
ATOM   942  C  CA    . LEU C 3 26  ? -9.012  52.465 246.282 1.00 33.10 ? 22  LEU A CA    1 
ATOM   943  C  C     . LEU C 3 26  ? -8.522  51.391 247.240 1.00 33.71 ? 22  LEU A C     1 
ATOM   944  O  O     . LEU C 3 26  ? -8.402  50.223 246.869 1.00 33.18 ? 22  LEU A O     1 
ATOM   945  C  CB    . LEU C 3 26  ? -8.274  52.349 244.956 1.00 31.51 ? 22  LEU A CB    1 
ATOM   946  C  CG    . LEU C 3 26  ? -8.532  53.539 244.047 1.00 31.88 ? 22  LEU A CG    1 
ATOM   947  C  CD1   . LEU C 3 26  ? -8.054  53.218 242.638 1.00 31.31 ? 22  LEU A CD1   1 
ATOM   948  C  CD2   . LEU C 3 26  ? -10.039 53.855 244.029 1.00 33.85 ? 22  LEU A CD2   1 
ATOM   949  N  N     . GLY C 3 27  ? -8.239  51.788 248.473 1.00 34.80 ? 23  GLY A N     1 
ATOM   950  C  CA    . GLY C 3 27  ? -7.768  50.833 249.455 1.00 38.01 ? 23  GLY A CA    1 
ATOM   951  C  C     . GLY C 3 27  ? -6.277  50.539 249.399 1.00 39.91 ? 23  GLY A C     1 
ATOM   952  O  O     . GLY C 3 27  ? -5.712  49.960 250.324 1.00 40.64 ? 23  GLY A O     1 
ATOM   953  N  N     . ASP C 3 28  ? -5.637  50.915 248.303 1.00 41.33 ? 24  ASP A N     1 
ATOM   954  C  CA    . ASP C 3 28  ? -4.207  50.711 248.153 1.00 43.25 ? 24  ASP A CA    1 
ATOM   955  C  C     . ASP C 3 28  ? -3.699  51.806 247.223 1.00 42.24 ? 24  ASP A C     1 
ATOM   956  O  O     . ASP C 3 28  ? -4.226  52.002 246.122 1.00 43.02 ? 24  ASP A O     1 
ATOM   957  C  CB    . ASP C 3 28  ? -3.883  49.324 247.564 1.00 47.50 ? 24  ASP A CB    1 
ATOM   958  C  CG    . ASP C 3 28  ? -2.372  49.100 247.373 1.00 49.72 ? 24  ASP A CG    1 
ATOM   959  O  OD1   . ASP C 3 28  ? -1.740  49.893 246.639 1.00 48.90 ? 24  ASP A OD1   1 
ATOM   960  O  OD2   . ASP C 3 28  ? -1.825  48.128 247.948 1.00 51.56 ? 24  ASP A OD2   1 
ATOM   961  N  N     . PRO C 3 29  ? -2.653  52.523 247.653 1.00 40.18 ? 25  PRO A N     1 
ATOM   962  C  CA    . PRO C 3 29  ? -2.039  53.614 246.896 1.00 36.88 ? 25  PRO A CA    1 
ATOM   963  C  C     . PRO C 3 29  ? -1.654  53.200 245.490 1.00 35.11 ? 25  PRO A C     1 
ATOM   964  O  O     . PRO C 3 29  ? -1.835  53.971 244.551 1.00 35.21 ? 25  PRO A O     1 
ATOM   965  C  CB    . PRO C 3 29  ? -0.853  54.001 247.766 1.00 37.28 ? 25  PRO A CB    1 
ATOM   966  C  CG    . PRO C 3 29  ? -0.488  52.705 248.416 1.00 40.92 ? 25  PRO A CG    1 
ATOM   967  C  CD    . PRO C 3 29  ? -1.821  52.151 248.811 1.00 39.89 ? 25  PRO A CD    1 
ATOM   968  N  N     . ARG C 3 30  ? -1.140  51.984 245.332 1.00 33.69 ? 26  ARG A N     1 
ATOM   969  C  CA    . ARG C 3 30  ? -0.757  51.530 244.005 1.00 32.35 ? 26  ARG A CA    1 
ATOM   970  C  C     . ARG C 3 30  ? -1.966  51.562 243.078 1.00 30.11 ? 26  ARG A C     1 
ATOM   971  O  O     . ARG C 3 30  ? -1.872  51.987 241.919 1.00 28.16 ? 26  ARG A O     1 
ATOM   972  C  CB    . ARG C 3 30  ? -0.163  50.117 244.059 1.00 33.48 ? 26  ARG A CB    1 
ATOM   973  C  CG    . ARG C 3 30  ? 1.236   50.051 244.680 1.00 36.62 ? 26  ARG A CG    1 
ATOM   974  C  CD    . ARG C 3 30  ? 1.746   48.622 244.778 1.00 36.85 ? 26  ARG A CD    1 
ATOM   975  N  NE    . ARG C 3 30  ? 1.102   47.885 245.864 1.00 39.07 ? 26  ARG A NE    1 
ATOM   976  C  CZ    . ARG C 3 30  ? 1.288   46.589 246.096 1.00 40.03 ? 26  ARG A CZ    1 
ATOM   977  N  NH1   . ARG C 3 30  ? 2.098   45.891 245.311 1.00 38.98 ? 26  ARG A NH1   1 
ATOM   978  N  NH2   . ARG C 3 30  ? 0.670   45.996 247.113 1.00 39.95 ? 26  ARG A NH2   1 
ATOM   979  N  N     . ARG C 3 31  ? -3.115  51.135 243.596 1.00 29.49 ? 27  ARG A N     1 
ATOM   980  C  CA    . ARG C 3 31  ? -4.346  51.113 242.795 1.00 26.78 ? 27  ARG A CA    1 
ATOM   981  C  C     . ARG C 3 31  ? -4.698  52.540 242.359 1.00 24.16 ? 27  ARG A C     1 
ATOM   982  O  O     . ARG C 3 31  ? -5.014  52.809 241.180 1.00 22.03 ? 27  ARG A O     1 
ATOM   983  C  CB    . ARG C 3 31  ? -5.493  50.505 243.606 1.00 27.12 ? 27  ARG A CB    1 
ATOM   984  C  CG    . ARG C 3 31  ? -5.139  49.197 244.303 1.00 27.43 ? 27  ARG A CG    1 
ATOM   985  C  CD    . ARG C 3 31  ? -6.371  48.351 244.572 1.00 26.62 ? 27  ARG A CD    1 
ATOM   986  N  NE    . ARG C 3 31  ? -6.104  47.161 245.371 1.00 25.88 ? 27  ARG A NE    1 
ATOM   987  C  CZ    . ARG C 3 31  ? -6.400  47.038 246.665 1.00 28.17 ? 27  ARG A CZ    1 
ATOM   988  N  NH1   . ARG C 3 31  ? -6.971  48.034 247.328 1.00 27.90 ? 27  ARG A NH1   1 
ATOM   989  N  NH2   . ARG C 3 31  ? -6.157  45.898 247.305 1.00 28.58 ? 27  ARG A NH2   1 
ATOM   990  N  N     . THR C 3 32  ? -4.641  53.447 243.328 1.00 20.57 ? 28  THR A N     1 
ATOM   991  C  CA    . THR C 3 32  ? -4.924  54.849 243.082 1.00 20.54 ? 28  THR A CA    1 
ATOM   992  C  C     . THR C 3 32  ? -3.990  55.408 242.032 1.00 23.65 ? 28  THR A C     1 
ATOM   993  O  O     . THR C 3 32  ? -4.368  56.232 241.182 1.00 25.01 ? 28  THR A O     1 
ATOM   994  C  CB    . THR C 3 32  ? -4.714  55.672 244.310 1.00 17.49 ? 28  THR A CB    1 
ATOM   995  O  OG1   . THR C 3 32  ? -5.320  55.014 245.426 1.00 15.29 ? 28  THR A OG1   1 
ATOM   996  C  CG2   . THR C 3 32  ? -5.349  57.050 244.120 1.00 15.60 ? 28  THR A CG2   1 
ATOM   997  N  N     . ALA C 3 33  ? -2.750  54.953 242.096 1.00 26.53 ? 29  ALA A N     1 
ATOM   998  C  CA    . ALA C 3 33  ? -1.752  55.413 241.156 1.00 27.74 ? 29  ALA A CA    1 
ATOM   999  C  C     . ALA C 3 33  ? -2.113  54.931 239.769 1.00 27.82 ? 29  ALA A C     1 
ATOM   1000 O  O     . ALA C 3 33  ? -2.255  55.734 238.846 1.00 29.24 ? 29  ALA A O     1 
ATOM   1001 C  CB    . ALA C 3 33  ? -0.390  54.902 241.559 1.00 28.87 ? 29  ALA A CB    1 
ATOM   1002 N  N     . ARG C 3 34  ? -2.281  53.622 239.623 1.00 27.19 ? 30  ARG A N     1 
ATOM   1003 C  CA    . ARG C 3 34  ? -2.630  53.075 238.326 1.00 26.95 ? 30  ARG A CA    1 
ATOM   1004 C  C     . ARG C 3 34  ? -3.858  53.799 237.787 1.00 26.77 ? 30  ARG A C     1 
ATOM   1005 O  O     . ARG C 3 34  ? -3.911  54.134 236.592 1.00 25.61 ? 30  ARG A O     1 
ATOM   1006 C  CB    . ARG C 3 34  ? -2.890  51.571 238.434 1.00 27.31 ? 30  ARG A CB    1 
ATOM   1007 C  CG    . ARG C 3 34  ? -3.224  50.909 237.114 1.00 28.33 ? 30  ARG A CG    1 
ATOM   1008 C  CD    . ARG C 3 34  ? -2.180  51.190 236.049 1.00 30.04 ? 30  ARG A CD    1 
ATOM   1009 N  NE    . ARG C 3 34  ? -0.873  50.629 236.374 1.00 31.73 ? 30  ARG A NE    1 
ATOM   1010 C  CZ    . ARG C 3 34  ? 0.085   50.417 235.476 1.00 31.75 ? 30  ARG A CZ    1 
ATOM   1011 N  NH1   . ARG C 3 34  ? -0.126  50.716 234.198 1.00 29.12 ? 30  ARG A NH1   1 
ATOM   1012 N  NH2   . ARG C 3 34  ? 1.255   49.911 235.857 1.00 30.76 ? 30  ARG A NH2   1 
ATOM   1013 N  N     . LEU C 3 35  ? -4.838  54.062 238.662 1.00 25.81 ? 31  LEU A N     1 
ATOM   1014 C  CA    . LEU C 3 35  ? -6.052  54.775 238.238 1.00 24.13 ? 31  LEU A CA    1 
ATOM   1015 C  C     . LEU C 3 35  ? -5.684  56.067 237.533 1.00 23.56 ? 31  LEU A C     1 
ATOM   1016 O  O     . LEU C 3 35  ? -6.188  56.345 236.445 1.00 23.69 ? 31  LEU A O     1 
ATOM   1017 C  CB    . LEU C 3 35  ? -6.968  55.109 239.431 1.00 23.85 ? 31  LEU A CB    1 
ATOM   1018 C  CG    . LEU C 3 35  ? -8.175  56.057 239.160 1.00 21.50 ? 31  LEU A CG    1 
ATOM   1019 C  CD1   . LEU C 3 35  ? -9.001  55.608 237.964 1.00 16.55 ? 31  LEU A CD1   1 
ATOM   1020 C  CD2   . LEU C 3 35  ? -9.028  56.118 240.404 1.00 19.31 ? 31  LEU A CD2   1 
ATOM   1021 N  N     . VAL C 3 36  ? -4.809  56.854 238.158 1.00 24.26 ? 32  VAL A N     1 
ATOM   1022 C  CA    . VAL C 3 36  ? -4.382  58.108 237.547 1.00 25.25 ? 32  VAL A CA    1 
ATOM   1023 C  C     . VAL C 3 36  ? -3.667  57.922 236.211 1.00 25.39 ? 32  VAL A C     1 
ATOM   1024 O  O     . VAL C 3 36  ? -3.840  58.736 235.298 1.00 25.33 ? 32  VAL A O     1 
ATOM   1025 C  CB    . VAL C 3 36  ? -3.471  58.934 238.460 1.00 26.13 ? 32  VAL A CB    1 
ATOM   1026 C  CG1   . VAL C 3 36  ? -3.236  60.323 237.821 1.00 25.09 ? 32  VAL A CG1   1 
ATOM   1027 C  CG2   . VAL C 3 36  ? -4.107  59.086 239.827 1.00 24.97 ? 32  VAL A CG2   1 
ATOM   1028 N  N     . ASN C 3 37  ? -2.873  56.869 236.055 1.00 25.12 ? 33  ASN A N     1 
ATOM   1029 C  CA    . ASN C 3 37  ? -2.216  56.720 234.761 1.00 26.74 ? 33  ASN A CA    1 
ATOM   1030 C  C     . ASN C 3 37  ? -3.192  56.276 233.720 1.00 27.39 ? 33  ASN A C     1 
ATOM   1031 O  O     . ASN C 3 37  ? -3.163  56.771 232.598 1.00 27.25 ? 33  ASN A O     1 
ATOM   1032 C  CB    . ASN C 3 37  ? -1.052  55.736 234.816 1.00 28.55 ? 33  ASN A CB    1 
ATOM   1033 C  CG    . ASN C 3 37  ? 0.068   56.235 235.681 1.00 29.23 ? 33  ASN A CG    1 
ATOM   1034 O  OD1   . ASN C 3 37  ? 0.613   57.309 235.420 1.00 28.89 ? 33  ASN A OD1   1 
ATOM   1035 N  ND2   . ASN C 3 37  ? 0.413   55.478 236.727 1.00 28.96 ? 33  ASN A ND2   1 
ATOM   1036 N  N     . VAL C 3 38  ? -4.053  55.327 234.075 1.00 28.46 ? 34  VAL A N     1 
ATOM   1037 C  CA    . VAL C 3 38  ? -5.048  54.860 233.119 1.00 28.04 ? 34  VAL A CA    1 
ATOM   1038 C  C     . VAL C 3 38  ? -5.862  56.032 232.591 1.00 26.30 ? 34  VAL A C     1 
ATOM   1039 O  O     . VAL C 3 38  ? -6.047  56.179 231.377 1.00 25.27 ? 34  VAL A O     1 
ATOM   1040 C  CB    . VAL C 3 38  ? -5.983  53.855 233.749 1.00 29.81 ? 34  VAL A CB    1 
ATOM   1041 C  CG1   . VAL C 3 38  ? -6.950  53.341 232.688 1.00 28.88 ? 34  VAL A CG1   1 
ATOM   1042 C  CG2   . VAL C 3 38  ? -5.167  52.709 234.332 1.00 30.59 ? 34  VAL A CG2   1 
ATOM   1043 N  N     . ALA C 3 39  ? -6.329  56.873 233.511 1.00 25.10 ? 35  ALA A N     1 
ATOM   1044 C  CA    . ALA C 3 39  ? -7.112  58.053 233.153 1.00 25.39 ? 35  ALA A CA    1 
ATOM   1045 C  C     . ALA C 3 39  ? -6.336  58.938 232.197 1.00 24.97 ? 35  ALA A C     1 
ATOM   1046 O  O     . ALA C 3 39  ? -6.821  59.292 231.129 1.00 24.43 ? 35  ALA A O     1 
ATOM   1047 C  CB    . ALA C 3 39  ? -7.472  58.834 234.403 1.00 24.14 ? 35  ALA A CB    1 
ATOM   1048 N  N     . ALA C 3 40  ? -5.109  59.270 232.576 1.00 26.73 ? 36  ALA A N     1 
ATOM   1049 C  CA    . ALA C 3 40  ? -4.289  60.134 231.743 1.00 26.83 ? 36  ALA A CA    1 
ATOM   1050 C  C     . ALA C 3 40  ? -4.173  59.645 230.311 1.00 26.49 ? 36  ALA A C     1 
ATOM   1051 O  O     . ALA C 3 40  ? -4.303  60.441 229.385 1.00 29.21 ? 36  ALA A O     1 
ATOM   1052 C  CB    . ALA C 3 40  ? -2.918  60.310 232.363 1.00 27.46 ? 36  ALA A CB    1 
ATOM   1053 N  N     . GLN C 3 41  ? -3.942  58.354 230.097 1.00 26.70 ? 37  GLN A N     1 
ATOM   1054 C  CA    . GLN C 3 41  ? -3.824  57.895 228.711 1.00 27.46 ? 37  GLN A CA    1 
ATOM   1055 C  C     . GLN C 3 41  ? -5.149  57.922 227.973 1.00 27.11 ? 37  GLN A C     1 
ATOM   1056 O  O     . GLN C 3 41  ? -5.208  58.243 226.771 1.00 27.75 ? 37  GLN A O     1 
ATOM   1057 C  CB    . GLN C 3 41  ? -3.180  56.505 228.624 1.00 28.40 ? 37  GLN A CB    1 
ATOM   1058 C  CG    . GLN C 3 41  ? -3.484  55.565 229.762 1.00 32.08 ? 37  GLN A CG    1 
ATOM   1059 C  CD    . GLN C 3 41  ? -2.624  54.303 229.686 1.00 33.43 ? 37  GLN A CD    1 
ATOM   1060 O  OE1   . GLN C 3 41  ? -2.503  53.681 228.613 1.00 33.29 ? 37  GLN A OE1   1 
ATOM   1061 N  NE2   . GLN C 3 41  ? -2.041  53.906 230.824 1.00 32.41 ? 37  GLN A NE2   1 
ATOM   1062 N  N     . LEU C 3 42  ? -6.220  57.600 228.697 1.00 24.87 ? 38  LEU A N     1 
ATOM   1063 C  CA    . LEU C 3 42  ? -7.558  57.620 228.107 1.00 22.17 ? 38  LEU A CA    1 
ATOM   1064 C  C     . LEU C 3 42  ? -7.880  59.079 227.711 1.00 22.73 ? 38  LEU A C     1 
ATOM   1065 O  O     . LEU C 3 42  ? -8.270  59.358 226.556 1.00 22.12 ? 38  LEU A O     1 
ATOM   1066 C  CB    . LEU C 3 42  ? -8.594  57.038 229.097 1.00 19.79 ? 38  LEU A CB    1 
ATOM   1067 C  CG    . LEU C 3 42  ? -8.362  55.542 229.420 1.00 16.20 ? 38  LEU A CG    1 
ATOM   1068 C  CD1   . LEU C 3 42  ? -9.223  55.104 230.562 1.00 13.02 ? 38  LEU A CD1   1 
ATOM   1069 C  CD2   . LEU C 3 42  ? -8.599  54.700 228.210 1.00 7.60  ? 38  LEU A CD2   1 
ATOM   1070 N  N     . ALA C 3 43  ? -7.663  60.007 228.644 1.00 20.98 ? 39  ALA A N     1 
ATOM   1071 C  CA    . ALA C 3 43  ? -7.905  61.420 228.383 1.00 22.08 ? 39  ALA A CA    1 
ATOM   1072 C  C     . ALA C 3 43  ? -7.083  61.925 227.215 1.00 23.51 ? 39  ALA A C     1 
ATOM   1073 O  O     . ALA C 3 43  ? -7.539  62.775 226.447 1.00 24.77 ? 39  ALA A O     1 
ATOM   1074 C  CB    . ALA C 3 43  ? -7.602  62.238 229.616 1.00 19.53 ? 39  ALA A CB    1 
ATOM   1075 N  N     . LYS C 3 44  ? -5.869  61.406 227.065 1.00 27.13 ? 40  LYS A N     1 
ATOM   1076 C  CA    . LYS C 3 44  ? -5.007  61.853 225.973 1.00 29.88 ? 40  LYS A CA    1 
ATOM   1077 C  C     . LYS C 3 44  ? -5.515  61.292 224.663 1.00 29.99 ? 40  LYS A C     1 
ATOM   1078 O  O     . LYS C 3 44  ? -5.434  61.944 223.627 1.00 30.61 ? 40  LYS A O     1 
ATOM   1079 C  CB    . LYS C 3 44  ? -3.562  61.402 226.215 1.00 31.13 ? 40  LYS A CB    1 
ATOM   1080 C  CG    . LYS C 3 44  ? -2.575  61.921 225.168 1.00 32.97 ? 40  LYS A CG    1 
ATOM   1081 C  CD    . LYS C 3 44  ? -1.144  61.557 225.526 1.00 35.02 ? 40  LYS A CD    1 
ATOM   1082 C  CE    . LYS C 3 44  ? -0.149  62.075 224.495 1.00 36.01 ? 40  LYS A CE    1 
ATOM   1083 N  NZ    . LYS C 3 44  ? 1.209   61.466 224.672 1.00 35.87 ? 40  LYS A NZ    1 
ATOM   1084 N  N     . TYR C 3 45  ? -6.041  60.073 224.710 1.00 31.11 ? 41  TYR A N     1 
ATOM   1085 C  CA    . TYR C 3 45  ? -6.574  59.438 223.507 1.00 31.02 ? 41  TYR A CA    1 
ATOM   1086 C  C     . TYR C 3 45  ? -8.083  59.277 223.634 1.00 30.95 ? 41  TYR A C     1 
ATOM   1087 O  O     . TYR C 3 45  ? -8.624  58.189 223.461 1.00 32.69 ? 41  TYR A O     1 
ATOM   1088 C  CB    . TYR C 3 45  ? -5.933  58.075 223.309 1.00 31.32 ? 41  TYR A CB    1 
ATOM   1089 C  CG    . TYR C 3 45  ? -4.470  58.170 223.003 1.00 33.17 ? 41  TYR A CG    1 
ATOM   1090 C  CD1   . TYR C 3 45  ? -3.518  58.190 224.029 1.00 33.23 ? 41  TYR A CD1   1 
ATOM   1091 C  CD2   . TYR C 3 45  ? -4.028  58.287 221.676 1.00 33.86 ? 41  TYR A CD2   1 
ATOM   1092 C  CE1   . TYR C 3 45  ? -2.161  58.328 223.738 1.00 33.63 ? 41  TYR A CE1   1 
ATOM   1093 C  CE2   . TYR C 3 45  ? -2.679  58.428 221.373 1.00 33.39 ? 41  TYR A CE2   1 
ATOM   1094 C  CZ    . TYR C 3 45  ? -1.753  58.446 222.402 1.00 33.71 ? 41  TYR A CZ    1 
ATOM   1095 O  OH    . TYR C 3 45  ? -0.423  58.583 222.098 1.00 36.33 ? 41  TYR A OH    1 
ATOM   1096 N  N     . SER C 3 46  ? -8.753  60.379 223.931 1.00 29.63 ? 42  SER A N     1 
ATOM   1097 C  CA    . SER C 3 46  ? -10.180 60.368 224.086 1.00 29.40 ? 42  SER A CA    1 
ATOM   1098 C  C     . SER C 3 46  ? -10.916 59.561 223.018 1.00 28.91 ? 42  SER A C     1 
ATOM   1099 O  O     . SER C 3 46  ? -10.608 59.652 221.830 1.00 26.82 ? 42  SER A O     1 
ATOM   1100 C  CB    . SER C 3 46  ? -10.701 61.801 224.140 1.00 29.81 ? 42  SER A CB    1 
ATOM   1101 O  OG    . SER C 3 46  ? -10.296 62.415 225.348 1.00 31.84 ? 42  SER A OG    1 
ATOM   1102 N  N     . GLY C 3 47  ? -11.876 58.748 223.473 1.00 29.49 ? 43  GLY A N     1 
ATOM   1103 C  CA    . GLY C 3 47  ? -12.675 57.908 222.585 1.00 29.80 ? 43  GLY A CA    1 
ATOM   1104 C  C     . GLY C 3 47  ? -11.922 56.832 221.821 1.00 29.74 ? 43  GLY A C     1 
ATOM   1105 O  O     . GLY C 3 47  ? -12.369 56.382 220.767 1.00 30.62 ? 43  GLY A O     1 
ATOM   1106 N  N     . LYS C 3 48  ? -10.776 56.423 222.353 1.00 28.95 ? 44  LYS A N     1 
ATOM   1107 C  CA    . LYS C 3 48  ? -9.952  55.403 221.729 1.00 27.98 ? 44  LYS A CA    1 
ATOM   1108 C  C     . LYS C 3 48  ? -9.789  54.232 222.680 1.00 27.86 ? 44  LYS A C     1 
ATOM   1109 O  O     . LYS C 3 48  ? -9.908  54.386 223.899 1.00 26.33 ? 44  LYS A O     1 
ATOM   1110 C  CB    . LYS C 3 48  ? -8.575  55.963 221.407 1.00 30.39 ? 44  LYS A CB    1 
ATOM   1111 C  CG    . LYS C 3 48  ? -8.317  56.229 219.960 1.00 30.33 ? 44  LYS A CG    1 
ATOM   1112 C  CD    . LYS C 3 48  ? -9.114  57.402 219.461 1.00 33.32 ? 44  LYS A CD    1 
ATOM   1113 C  CE    . LYS C 3 48  ? -8.662  57.785 218.055 1.00 36.34 ? 44  LYS A CE    1 
ATOM   1114 N  NZ    . LYS C 3 48  ? -7.247  58.280 218.091 1.00 39.29 ? 44  LYS A NZ    1 
ATOM   1115 N  N     . SER C 3 49  ? -9.493  53.069 222.110 1.00 28.06 ? 45  SER A N     1 
ATOM   1116 C  CA    . SER C 3 49  ? -9.309  51.843 222.876 1.00 28.77 ? 45  SER A CA    1 
ATOM   1117 C  C     . SER C 3 49  ? -8.119  51.915 223.808 1.00 29.77 ? 45  SER A C     1 
ATOM   1118 O  O     . SER C 3 49  ? -7.140  52.599 223.538 1.00 30.35 ? 45  SER A O     1 
ATOM   1119 C  CB    . SER C 3 49  ? -9.084  50.668 221.929 1.00 30.85 ? 45  SER A CB    1 
ATOM   1120 O  OG    . SER C 3 49  ? -7.814  50.747 221.287 1.00 28.91 ? 45  SER A OG    1 
ATOM   1121 N  N     . ILE C 3 50  ? -8.199  51.168 224.895 1.00 30.61 ? 46  ILE A N     1 
ATOM   1122 C  CA    . ILE C 3 50  ? -7.116  51.129 225.838 1.00 30.84 ? 46  ILE A CA    1 
ATOM   1123 C  C     . ILE C 3 50  ? -5.805  50.875 225.112 1.00 32.68 ? 46  ILE A C     1 
ATOM   1124 O  O     . ILE C 3 50  ? -4.817  51.561 225.356 1.00 34.16 ? 46  ILE A O     1 
ATOM   1125 C  CB    . ILE C 3 50  ? -7.328  50.034 226.847 1.00 29.70 ? 46  ILE A CB    1 
ATOM   1126 C  CG1   . ILE C 3 50  ? -8.514  50.407 227.719 1.00 28.42 ? 46  ILE A CG1   1 
ATOM   1127 C  CG2   . ILE C 3 50  ? -6.042  49.799 227.629 1.00 29.18 ? 46  ILE A CG2   1 
ATOM   1128 C  CD1   . ILE C 3 50  ? -8.681  49.518 228.901 1.00 28.80 ? 46  ILE A CD1   1 
ATOM   1129 N  N     . THR C 3 51  ? -5.798  49.888 224.224 1.00 32.42 ? 47  THR A N     1 
ATOM   1130 C  CA    . THR C 3 51  ? -4.599  49.565 223.474 1.00 32.88 ? 47  THR A CA    1 
ATOM   1131 C  C     . THR C 3 51  ? -3.931  50.822 222.915 1.00 33.04 ? 47  THR A C     1 
ATOM   1132 O  O     . THR C 3 51  ? -2.814  51.147 223.302 1.00 33.49 ? 47  THR A O     1 
ATOM   1133 C  CB    . THR C 3 51  ? -4.916  48.594 222.311 1.00 34.26 ? 47  THR A CB    1 
ATOM   1134 O  OG1   . THR C 3 51  ? -5.264  47.315 222.847 1.00 35.18 ? 47  THR A OG1   1 
ATOM   1135 C  CG2   . THR C 3 51  ? -3.720  48.447 221.379 1.00 32.85 ? 47  THR A CG2   1 
ATOM   1136 N  N     . ILE C 3 52  ? -4.615  51.523 222.013 1.00 32.33 ? 48  ILE A N     1 
ATOM   1137 C  CA    . ILE C 3 52  ? -4.076  52.741 221.405 1.00 33.04 ? 48  ILE A CA    1 
ATOM   1138 C  C     . ILE C 3 52  ? -3.569  53.734 222.449 1.00 33.38 ? 48  ILE A C     1 
ATOM   1139 O  O     . ILE C 3 52  ? -2.521  54.339 222.277 1.00 34.25 ? 48  ILE A O     1 
ATOM   1140 C  CB    . ILE C 3 52  ? -5.133  53.479 220.568 1.00 33.17 ? 48  ILE A CB    1 
ATOM   1141 C  CG1   . ILE C 3 52  ? -5.730  52.534 219.520 1.00 34.99 ? 48  ILE A CG1   1 
ATOM   1142 C  CG2   . ILE C 3 52  ? -4.517  54.697 219.907 1.00 33.13 ? 48  ILE A CG2   1 
ATOM   1143 C  CD1   . ILE C 3 52  ? -4.752  52.059 218.474 1.00 33.99 ? 48  ILE A CD1   1 
ATOM   1144 N  N     . SER C 3 53  ? -4.307  53.904 223.533 1.00 33.39 ? 49  SER A N     1 
ATOM   1145 C  CA    . SER C 3 53  ? -3.884  54.839 224.543 1.00 34.36 ? 49  SER A CA    1 
ATOM   1146 C  C     . SER C 3 53  ? -2.604  54.380 225.223 1.00 35.84 ? 49  SER A C     1 
ATOM   1147 O  O     . SER C 3 53  ? -1.989  55.136 225.971 1.00 37.29 ? 49  SER A O     1 
ATOM   1148 C  CB    . SER C 3 53  ? -4.977  55.012 225.593 1.00 34.46 ? 49  SER A CB    1 
ATOM   1149 O  OG    . SER C 3 53  ? -4.767  54.145 226.694 1.00 35.39 ? 49  SER A OG    1 
ATOM   1150 N  N     . SER C 3 54  ? -2.206  53.137 224.989 1.00 37.58 ? 50  SER A N     1 
ATOM   1151 C  CA    . SER C 3 54  ? -0.992  52.618 225.615 1.00 39.84 ? 50  SER A CA    1 
ATOM   1152 C  C     . SER C 3 54  ? 0.295   52.998 224.898 1.00 40.73 ? 50  SER A C     1 
ATOM   1153 O  O     . SER C 3 54  ? 1.389   52.857 225.444 1.00 40.35 ? 50  SER A O     1 
ATOM   1154 C  CB    . SER C 3 54  ? -1.071  51.102 225.764 1.00 40.06 ? 50  SER A CB    1 
ATOM   1155 O  OG    . SER C 3 54  ? -1.880  50.780 226.874 1.00 41.56 ? 50  SER A OG    1 
ATOM   1156 N  N     . GLU C 3 55  ? 0.166   53.474 223.669 1.00 43.09 ? 51  GLU A N     1 
ATOM   1157 C  CA    . GLU C 3 55  ? 1.336   53.899 222.919 1.00 44.34 ? 51  GLU A CA    1 
ATOM   1158 C  C     . GLU C 3 55  ? 2.378   52.780 222.842 1.00 43.63 ? 51  GLU A C     1 
ATOM   1159 O  O     . GLU C 3 55  ? 3.527   52.974 223.225 1.00 43.50 ? 51  GLU A O     1 
ATOM   1160 C  CB    . GLU C 3 55  ? 1.922   55.144 223.593 1.00 46.28 ? 51  GLU A CB    1 
ATOM   1161 C  CG    . GLU C 3 55  ? 0.885   56.258 223.833 1.00 49.84 ? 51  GLU A CG    1 
ATOM   1162 C  CD    . GLU C 3 55  ? 1.519   57.574 224.300 1.00 51.05 ? 51  GLU A CD    1 
ATOM   1163 O  OE1   . GLU C 3 55  ? 2.395   58.094 223.573 1.00 53.23 ? 51  GLU A OE1   1 
ATOM   1164 O  OE2   . GLU C 3 55  ? 1.142   58.093 225.377 1.00 50.64 ? 51  GLU A OE2   1 
ATOM   1165 N  N     . GLY C 3 56  ? 1.964   51.614 222.345 1.00 43.07 ? 52  GLY A N     1 
ATOM   1166 C  CA    . GLY C 3 56  ? 2.867   50.476 222.220 1.00 41.36 ? 52  GLY A CA    1 
ATOM   1167 C  C     . GLY C 3 56  ? 3.446   50.001 223.544 1.00 40.43 ? 52  GLY A C     1 
ATOM   1168 O  O     . GLY C 3 56  ? 4.312   49.132 223.573 1.00 41.77 ? 52  GLY A O     1 
ATOM   1169 N  N     . SER C 3 57  ? 2.945   50.537 224.647 1.00 39.05 ? 53  SER A N     1 
ATOM   1170 C  CA    . SER C 3 57  ? 3.466   50.181 225.953 1.00 39.95 ? 53  SER A CA    1 
ATOM   1171 C  C     . SER C 3 57  ? 2.859   48.935 226.610 1.00 40.67 ? 53  SER A C     1 
ATOM   1172 O  O     . SER C 3 57  ? 1.876   49.037 227.344 1.00 41.27 ? 53  SER A O     1 
ATOM   1173 C  CB    . SER C 3 57  ? 3.297   51.386 226.876 1.00 40.77 ? 53  SER A CB    1 
ATOM   1174 O  OG    . SER C 3 57  ? 4.207   51.349 227.953 1.00 41.99 ? 53  SER A OG    1 
ATOM   1175 N  N     . LYS C 3 58  ? 3.451   47.766 226.381 1.00 40.78 ? 54  LYS A N     1 
ATOM   1176 C  CA    . LYS C 3 58  ? 2.919   46.536 226.979 1.00 41.24 ? 54  LYS A CA    1 
ATOM   1177 C  C     . LYS C 3 58  ? 2.655   46.650 228.477 1.00 40.08 ? 54  LYS A C     1 
ATOM   1178 O  O     . LYS C 3 58  ? 1.572   46.313 228.943 1.00 41.60 ? 54  LYS A O     1 
ATOM   1179 C  CB    . LYS C 3 58  ? 3.863   45.353 226.739 1.00 44.47 ? 54  LYS A CB    1 
ATOM   1180 C  CG    . LYS C 3 58  ? 3.955   44.878 225.300 1.00 49.71 ? 54  LYS A CG    1 
ATOM   1181 C  CD    . LYS C 3 58  ? 2.841   43.907 224.920 1.00 53.58 ? 54  LYS A CD    1 
ATOM   1182 C  CE    . LYS C 3 58  ? 2.983   43.473 223.452 1.00 56.31 ? 54  LYS A CE    1 
ATOM   1183 N  NZ    . LYS C 3 58  ? 1.936   42.501 222.998 1.00 56.18 ? 54  LYS A NZ    1 
ATOM   1184 N  N     . ALA C 3 59  ? 3.636   47.117 229.237 1.00 38.80 ? 55  ALA A N     1 
ATOM   1185 C  CA    . ALA C 3 59  ? 3.465   47.239 230.681 1.00 37.53 ? 55  ALA A CA    1 
ATOM   1186 C  C     . ALA C 3 59  ? 2.291   48.153 231.032 1.00 36.56 ? 55  ALA A C     1 
ATOM   1187 O  O     . ALA C 3 59  ? 1.732   48.062 232.117 1.00 35.90 ? 55  ALA A O     1 
ATOM   1188 C  CB    . ALA C 3 59  ? 4.749   47.768 231.307 1.00 37.20 ? 55  ALA A CB    1 
ATOM   1189 N  N     . ALA C 3 60  ? 1.942   49.048 230.114 1.00 36.39 ? 56  ALA A N     1 
ATOM   1190 C  CA    . ALA C 3 60  ? 0.840   49.970 230.326 1.00 35.85 ? 56  ALA A CA    1 
ATOM   1191 C  C     . ALA C 3 60  ? -0.465  49.241 230.034 1.00 35.69 ? 56  ALA A C     1 
ATOM   1192 O  O     . ALA C 3 60  ? -1.336  49.145 230.895 1.00 35.60 ? 56  ALA A O     1 
ATOM   1193 C  CB    . ALA C 3 60  ? 0.980   51.172 229.419 1.00 35.11 ? 56  ALA A CB    1 
ATOM   1194 N  N     . GLN C 3 61  ? -0.596  48.738 228.810 1.00 34.42 ? 57  GLN A N     1 
ATOM   1195 C  CA    . GLN C 3 61  ? -1.786  48.001 228.412 1.00 32.81 ? 57  GLN A CA    1 
ATOM   1196 C  C     . GLN C 3 61  ? -2.133  47.000 229.500 1.00 34.73 ? 57  GLN A C     1 
ATOM   1197 O  O     . GLN C 3 61  ? -3.251  46.992 230.013 1.00 36.40 ? 57  GLN A O     1 
ATOM   1198 C  CB    . GLN C 3 61  ? -1.544  47.262 227.102 1.00 30.03 ? 57  GLN A CB    1 
ATOM   1199 C  CG    . GLN C 3 61  ? -2.781  46.617 226.552 1.00 28.13 ? 57  GLN A CG    1 
ATOM   1200 C  CD    . GLN C 3 61  ? -2.534  45.815 225.290 1.00 27.19 ? 57  GLN A CD    1 
ATOM   1201 O  OE1   . GLN C 3 61  ? -2.072  44.694 225.358 1.00 26.20 ? 57  GLN A OE1   1 
ATOM   1202 N  NE2   . GLN C 3 61  ? -2.833  46.401 224.126 1.00 28.00 ? 57  GLN A NE2   1 
ATOM   1203 N  N     . GLU C 3 62  ? -1.172  46.162 229.869 1.00 36.18 ? 58  GLU A N     1 
ATOM   1204 C  CA    . GLU C 3 62  ? -1.404  45.169 230.908 1.00 36.88 ? 58  GLU A CA    1 
ATOM   1205 C  C     . GLU C 3 62  ? -1.784  45.803 232.232 1.00 36.72 ? 58  GLU A C     1 
ATOM   1206 O  O     . GLU C 3 62  ? -2.495  45.201 233.026 1.00 38.19 ? 58  GLU A O     1 
ATOM   1207 C  CB    . GLU C 3 62  ? -0.164  44.306 231.099 1.00 38.56 ? 58  GLU A CB    1 
ATOM   1208 C  CG    . GLU C 3 62  ? -0.237  42.971 230.384 1.00 44.34 ? 58  GLU A CG    1 
ATOM   1209 C  CD    . GLU C 3 62  ? -1.213  42.019 231.046 1.00 47.66 ? 58  GLU A CD    1 
ATOM   1210 O  OE1   . GLU C 3 62  ? -1.117  41.866 232.291 1.00 49.39 ? 58  GLU A OE1   1 
ATOM   1211 O  OE2   . GLU C 3 62  ? -2.058  41.422 230.329 1.00 48.11 ? 58  GLU A OE2   1 
ATOM   1212 N  N     . GLY C 3 63  ? -1.316  47.023 232.471 1.00 35.96 ? 59  GLY A N     1 
ATOM   1213 C  CA    . GLY C 3 63  ? -1.618  47.693 233.725 1.00 34.16 ? 59  GLY A CA    1 
ATOM   1214 C  C     . GLY C 3 63  ? -3.047  48.172 233.777 1.00 31.82 ? 59  GLY A C     1 
ATOM   1215 O  O     . GLY C 3 63  ? -3.680  48.139 234.832 1.00 31.45 ? 59  GLY A O     1 
ATOM   1216 N  N     . ALA C 3 64  ? -3.528  48.635 232.627 1.00 30.39 ? 60  ALA A N     1 
ATOM   1217 C  CA    . ALA C 3 64  ? -4.886  49.142 232.455 1.00 28.95 ? 60  ALA A CA    1 
ATOM   1218 C  C     . ALA C 3 64  ? -5.902  48.027 232.658 1.00 29.51 ? 60  ALA A C     1 
ATOM   1219 O  O     . ALA C 3 64  ? -6.760  48.092 233.552 1.00 28.97 ? 60  ALA A O     1 
ATOM   1220 C  CB    . ALA C 3 64  ? -5.039  49.701 231.060 1.00 26.73 ? 60  ALA A CB    1 
ATOM   1221 N  N     . TYR C 3 65  ? -5.795  47.004 231.810 1.00 27.80 ? 61  TYR A N     1 
ATOM   1222 C  CA    . TYR C 3 65  ? -6.694  45.866 231.872 1.00 26.16 ? 61  TYR A CA    1 
ATOM   1223 C  C     . TYR C 3 65  ? -6.653  45.228 233.245 1.00 27.92 ? 61  TYR A C     1 
ATOM   1224 O  O     . TYR C 3 65  ? -7.668  44.744 233.738 1.00 30.34 ? 61  TYR A O     1 
ATOM   1225 C  CB    . TYR C 3 65  ? -6.340  44.843 230.801 1.00 23.38 ? 61  TYR A CB    1 
ATOM   1226 C  CG    . TYR C 3 65  ? -6.761  45.299 229.431 1.00 23.34 ? 61  TYR A CG    1 
ATOM   1227 C  CD1   . TYR C 3 65  ? -5.828  45.514 228.430 1.00 19.83 ? 61  TYR A CD1   1 
ATOM   1228 C  CD2   . TYR C 3 65  ? -8.099  45.582 229.155 1.00 22.93 ? 61  TYR A CD2   1 
ATOM   1229 C  CE1   . TYR C 3 65  ? -6.211  45.999 227.187 1.00 20.04 ? 61  TYR A CE1   1 
ATOM   1230 C  CE2   . TYR C 3 65  ? -8.495  46.068 227.915 1.00 20.14 ? 61  TYR A CE2   1 
ATOM   1231 C  CZ    . TYR C 3 65  ? -7.552  46.279 226.940 1.00 21.11 ? 61  TYR A CZ    1 
ATOM   1232 O  OH    . TYR C 3 65  ? -7.950  46.773 225.716 1.00 20.04 ? 61  TYR A OH    1 
ATOM   1233 N  N     . ARG C 3 66  ? -5.496  45.233 233.884 1.00 27.36 ? 62  ARG A N     1 
ATOM   1234 C  CA    . ARG C 3 66  ? -5.430  44.633 235.191 1.00 28.48 ? 62  ARG A CA    1 
ATOM   1235 C  C     . ARG C 3 66  ? -6.223  45.469 236.162 1.00 27.68 ? 62  ARG A C     1 
ATOM   1236 O  O     . ARG C 3 66  ? -6.839  44.956 237.098 1.00 28.32 ? 62  ARG A O     1 
ATOM   1237 C  CB    . ARG C 3 66  ? -3.984  44.523 235.660 1.00 30.30 ? 62  ARG A CB    1 
ATOM   1238 C  CG    . ARG C 3 66  ? -3.258  43.326 235.121 1.00 32.30 ? 62  ARG A CG    1 
ATOM   1239 C  CD    . ARG C 3 66  ? -1.825  43.329 235.586 1.00 36.16 ? 62  ARG A CD    1 
ATOM   1240 N  NE    . ARG C 3 66  ? -1.139  42.091 235.248 1.00 40.23 ? 62  ARG A NE    1 
ATOM   1241 C  CZ    . ARG C 3 66  ? 0.118   41.823 235.580 1.00 42.69 ? 62  ARG A CZ    1 
ATOM   1242 N  NH1   . ARG C 3 66  ? 0.823   42.719 236.258 1.00 44.02 ? 62  ARG A NH1   1 
ATOM   1243 N  NH2   . ARG C 3 66  ? 0.663   40.652 235.252 1.00 42.80 ? 62  ARG A NH2   1 
ATOM   1244 N  N     . PHE C 3 67  ? -6.217  46.769 235.937 1.00 27.73 ? 63  PHE A N     1 
ATOM   1245 C  CA    . PHE C 3 67  ? -6.936  47.671 236.824 1.00 28.97 ? 63  PHE A CA    1 
ATOM   1246 C  C     . PHE C 3 67  ? -8.471  47.566 236.713 1.00 29.15 ? 63  PHE A C     1 
ATOM   1247 O  O     . PHE C 3 67  ? -9.154  47.373 237.719 1.00 26.67 ? 63  PHE A O     1 
ATOM   1248 C  CB    . PHE C 3 67  ? -6.490  49.116 236.571 1.00 27.63 ? 63  PHE A CB    1 
ATOM   1249 C  CG    . PHE C 3 67  ? -7.211  50.127 237.398 1.00 27.92 ? 63  PHE A CG    1 
ATOM   1250 C  CD1   . PHE C 3 67  ? -6.845  50.360 238.717 1.00 27.09 ? 63  PHE A CD1   1 
ATOM   1251 C  CD2   . PHE C 3 67  ? -8.313  50.797 236.876 1.00 27.02 ? 63  PHE A CD2   1 
ATOM   1252 C  CE1   . PHE C 3 67  ? -7.541  51.274 239.482 1.00 27.73 ? 63  PHE A CE1   1 
ATOM   1253 C  CE2   . PHE C 3 67  ? -9.012  51.707 237.636 1.00 25.45 ? 63  PHE A CE2   1 
ATOM   1254 C  CZ    . PHE C 3 67  ? -8.640  51.935 238.946 1.00 25.61 ? 63  PHE A CZ    1 
ATOM   1255 N  N     . ILE C 3 68  ? -9.012  47.680 235.503 1.00 28.72 ? 64  ILE A N     1 
ATOM   1256 C  CA    . ILE C 3 68  ? -10.456 47.602 235.346 1.00 29.54 ? 64  ILE A CA    1 
ATOM   1257 C  C     . ILE C 3 68  ? -11.008 46.223 235.692 1.00 31.14 ? 64  ILE A C     1 
ATOM   1258 O  O     . ILE C 3 68  ? -12.222 46.017 235.760 1.00 31.77 ? 64  ILE A O     1 
ATOM   1259 C  CB    . ILE C 3 68  ? -10.871 47.921 233.933 1.00 28.12 ? 64  ILE A CB    1 
ATOM   1260 C  CG1   . ILE C 3 68  ? -10.331 46.877 232.987 1.00 25.01 ? 64  ILE A CG1   1 
ATOM   1261 C  CG2   . ILE C 3 68  ? -10.360 49.288 233.545 1.00 28.74 ? 64  ILE A CG2   1 
ATOM   1262 C  CD1   . ILE C 3 68  ? -10.685 47.163 231.537 1.00 26.40 ? 64  ILE A CD1   1 
ATOM   1263 N  N     . ARG C 3 69  ? -10.103 45.289 235.944 1.00 32.16 ? 65  ARG A N     1 
ATOM   1264 C  CA    . ARG C 3 69  ? -10.461 43.920 236.261 1.00 31.99 ? 65  ARG A CA    1 
ATOM   1265 C  C     . ARG C 3 69  ? -10.148 43.567 237.694 1.00 31.67 ? 65  ARG A C     1 
ATOM   1266 O  O     . ARG C 3 69  ? -10.543 42.511 238.181 1.00 32.48 ? 65  ARG A O     1 
ATOM   1267 C  CB    . ARG C 3 69  ? -9.692  42.996 235.335 1.00 33.84 ? 65  ARG A CB    1 
ATOM   1268 C  CG    . ARG C 3 69  ? -9.700  41.543 235.717 1.00 37.23 ? 65  ARG A CG    1 
ATOM   1269 C  CD    . ARG C 3 69  ? -8.974  40.735 234.646 1.00 38.42 ? 65  ARG A CD    1 
ATOM   1270 N  NE    . ARG C 3 69  ? -7.527  40.662 234.812 1.00 37.44 ? 65  ARG A NE    1 
ATOM   1271 C  CZ    . ARG C 3 69  ? -6.667  40.891 233.827 1.00 38.36 ? 65  ARG A CZ    1 
ATOM   1272 N  NH1   . ARG C 3 69  ? -7.120  41.225 232.632 1.00 39.91 ? 65  ARG A NH1   1 
ATOM   1273 N  NH2   . ARG C 3 69  ? -5.360  40.732 234.006 1.00 39.25 ? 65  ARG A NH2   1 
ATOM   1274 N  N     . ASN C 3 70  ? -9.450  44.457 238.377 1.00 32.14 ? 66  ASN A N     1 
ATOM   1275 C  CA    . ASN C 3 70  ? -9.074  44.182 239.743 1.00 33.39 ? 66  ASN A CA    1 
ATOM   1276 C  C     . ASN C 3 70  ? -10.236 44.263 240.727 1.00 35.03 ? 66  ASN A C     1 
ATOM   1277 O  O     . ASN C 3 70  ? -10.761 45.353 241.017 1.00 33.78 ? 66  ASN A O     1 
ATOM   1278 C  CB    . ASN C 3 70  ? -7.936  45.113 240.162 1.00 33.91 ? 66  ASN A CB    1 
ATOM   1279 C  CG    . ASN C 3 70  ? -7.610  45.017 241.638 1.00 35.25 ? 66  ASN A CG    1 
ATOM   1280 O  OD1   . ASN C 3 70  ? -7.050  45.945 242.217 1.00 38.65 ? 66  ASN A OD1   1 
ATOM   1281 N  ND2   . ASN C 3 70  ? -7.949  43.897 242.253 1.00 34.98 ? 66  ASN A ND2   1 
ATOM   1282 N  N     . PRO C 3 71  ? -10.648 43.089 241.252 1.00 35.48 ? 67  PRO A N     1 
ATOM   1283 C  CA    . PRO C 3 71  ? -11.720 42.852 242.215 1.00 35.75 ? 67  PRO A CA    1 
ATOM   1284 C  C     . PRO C 3 71  ? -11.553 43.706 243.446 1.00 37.00 ? 67  PRO A C     1 
ATOM   1285 O  O     . PRO C 3 71  ? -12.371 43.653 244.366 1.00 38.39 ? 67  PRO A O     1 
ATOM   1286 C  CB    . PRO C 3 71  ? -11.554 41.381 242.550 1.00 34.61 ? 67  PRO A CB    1 
ATOM   1287 C  CG    . PRO C 3 71  ? -11.094 40.821 241.279 1.00 36.35 ? 67  PRO A CG    1 
ATOM   1288 C  CD    . PRO C 3 71  ? -10.058 41.804 240.840 1.00 35.82 ? 67  PRO A CD    1 
ATOM   1289 N  N     . ASN C 3 72  ? -10.484 44.487 243.490 1.00 37.52 ? 68  ASN A N     1 
ATOM   1290 C  CA    . ASN C 3 72  ? -10.261 45.312 244.662 1.00 37.63 ? 68  ASN A CA    1 
ATOM   1291 C  C     . ASN C 3 72  ? -10.596 46.754 244.415 1.00 37.28 ? 68  ASN A C     1 
ATOM   1292 O  O     . ASN C 3 72  ? -10.570 47.554 245.340 1.00 37.11 ? 68  ASN A O     1 
ATOM   1293 C  CB    . ASN C 3 72  ? -8.819  45.171 245.126 1.00 39.50 ? 68  ASN A CB    1 
ATOM   1294 C  CG    . ASN C 3 72  ? -8.580  43.874 245.857 1.00 41.50 ? 68  ASN A CG    1 
ATOM   1295 O  OD1   . ASN C 3 72  ? -7.495  43.298 245.776 1.00 43.03 ? 68  ASN A OD1   1 
ATOM   1296 N  ND2   . ASN C 3 72  ? -9.592  43.406 246.588 1.00 41.08 ? 68  ASN A ND2   1 
ATOM   1297 N  N     . VAL C 3 73  ? -10.941 47.084 243.178 1.00 36.00 ? 69  VAL A N     1 
ATOM   1298 C  CA    . VAL C 3 73  ? -11.270 48.464 242.858 1.00 37.42 ? 69  VAL A CA    1 
ATOM   1299 C  C     . VAL C 3 73  ? -12.760 48.783 242.773 1.00 37.50 ? 69  VAL A C     1 
ATOM   1300 O  O     . VAL C 3 73  ? -13.449 48.341 241.850 1.00 38.16 ? 69  VAL A O     1 
ATOM   1301 C  CB    . VAL C 3 73  ? -10.626 48.892 241.528 1.00 38.29 ? 69  VAL A CB    1 
ATOM   1302 C  CG1   . VAL C 3 73  ? -10.987 50.335 241.231 1.00 37.80 ? 69  VAL A CG1   1 
ATOM   1303 C  CG2   . VAL C 3 73  ? -9.113  48.728 241.601 1.00 40.53 ? 69  VAL A CG2   1 
ATOM   1304 N  N     . SER C 3 74  ? -13.239 49.580 243.723 1.00 37.09 ? 70  SER A N     1 
ATOM   1305 C  CA    . SER C 3 74  ? -14.636 50.004 243.772 1.00 36.82 ? 70  SER A CA    1 
ATOM   1306 C  C     . SER C 3 74  ? -14.973 51.082 242.762 1.00 36.70 ? 70  SER A C     1 
ATOM   1307 O  O     . SER C 3 74  ? -14.536 52.225 242.897 1.00 35.83 ? 70  SER A O     1 
ATOM   1308 C  CB    . SER C 3 74  ? -14.977 50.553 245.150 1.00 37.99 ? 70  SER A CB    1 
ATOM   1309 O  OG    . SER C 3 74  ? -16.084 51.442 245.062 1.00 39.92 ? 70  SER A OG    1 
ATOM   1310 N  N     . ALA C 3 75  ? -15.770 50.729 241.763 1.00 38.04 ? 71  ALA A N     1 
ATOM   1311 C  CA    . ALA C 3 75  ? -16.165 51.713 240.770 1.00 37.98 ? 71  ALA A CA    1 
ATOM   1312 C  C     . ALA C 3 75  ? -16.779 52.938 241.469 1.00 38.79 ? 71  ALA A C     1 
ATOM   1313 O  O     . ALA C 3 75  ? -16.714 54.045 240.946 1.00 39.50 ? 71  ALA A O     1 
ATOM   1314 C  CB    . ALA C 3 75  ? -17.159 51.108 239.786 1.00 37.18 ? 71  ALA A CB    1 
ATOM   1315 N  N     . GLU C 3 76  ? -17.375 52.747 242.640 1.00 37.36 ? 72  GLU A N     1 
ATOM   1316 C  CA    . GLU C 3 76  ? -17.944 53.879 243.332 1.00 39.26 ? 72  GLU A CA    1 
ATOM   1317 C  C     . GLU C 3 76  ? -16.827 54.782 243.829 1.00 38.44 ? 72  GLU A C     1 
ATOM   1318 O  O     . GLU C 3 76  ? -16.852 55.994 243.602 1.00 39.48 ? 72  GLU A O     1 
ATOM   1319 C  CB    . GLU C 3 76  ? -18.811 53.425 244.498 1.00 42.14 ? 72  GLU A CB    1 
ATOM   1320 C  CG    . GLU C 3 76  ? -20.301 53.389 244.167 1.00 47.29 ? 72  GLU A CG    1 
ATOM   1321 C  CD    . GLU C 3 76  ? -21.119 52.689 245.240 1.00 51.22 ? 72  GLU A CD    1 
ATOM   1322 O  OE1   . GLU C 3 76  ? -20.965 53.058 246.434 1.00 51.74 ? 72  GLU A OE1   1 
ATOM   1323 O  OE2   . GLU C 3 76  ? -21.918 51.775 244.886 1.00 52.79 ? 72  GLU A OE2   1 
ATOM   1324 N  N     . ALA C 3 77  ? -15.843 54.184 244.500 1.00 36.66 ? 73  ALA A N     1 
ATOM   1325 C  CA    . ALA C 3 77  ? -14.694 54.927 245.006 1.00 32.02 ? 73  ALA A CA    1 
ATOM   1326 C  C     . ALA C 3 77  ? -14.116 55.761 243.867 1.00 30.38 ? 73  ALA A C     1 
ATOM   1327 O  O     . ALA C 3 77  ? -13.781 56.933 244.054 1.00 27.29 ? 73  ALA A O     1 
ATOM   1328 C  CB    . ALA C 3 77  ? -13.636 53.975 245.542 1.00 31.09 ? 73  ALA A CB    1 
ATOM   1329 N  N     . ILE C 3 78  ? -14.001 55.177 242.683 1.00 27.74 ? 74  ILE A N     1 
ATOM   1330 C  CA    . ILE C 3 78  ? -13.476 55.960 241.584 1.00 29.65 ? 74  ILE A CA    1 
ATOM   1331 C  C     . ILE C 3 78  ? -14.355 57.179 241.410 1.00 32.22 ? 74  ILE A C     1 
ATOM   1332 O  O     . ILE C 3 78  ? -13.900 58.312 241.564 1.00 33.14 ? 74  ILE A O     1 
ATOM   1333 C  CB    . ILE C 3 78  ? -13.469 55.187 240.253 1.00 27.73 ? 74  ILE A CB    1 
ATOM   1334 C  CG1   . ILE C 3 78  ? -12.437 54.052 240.322 1.00 26.55 ? 74  ILE A CG1   1 
ATOM   1335 C  CG2   . ILE C 3 78  ? -13.189 56.149 239.107 1.00 26.35 ? 74  ILE A CG2   1 
ATOM   1336 C  CD1   . ILE C 3 78  ? -12.326 53.237 239.057 1.00 22.25 ? 74  ILE A CD1   1 
ATOM   1337 N  N     . ARG C 3 79  ? -15.631 56.943 241.106 1.00 34.91 ? 75  ARG A N     1 
ATOM   1338 C  CA    . ARG C 3 79  ? -16.594 58.035 240.900 1.00 33.29 ? 75  ARG A CA    1 
ATOM   1339 C  C     . ARG C 3 79  ? -16.593 59.069 242.023 1.00 33.07 ? 75  ARG A C     1 
ATOM   1340 O  O     . ARG C 3 79  ? -16.686 60.264 241.770 1.00 32.16 ? 75  ARG A O     1 
ATOM   1341 C  CB    . ARG C 3 79  ? -17.992 57.464 240.754 1.00 31.98 ? 75  ARG A CB    1 
ATOM   1342 C  CG    . ARG C 3 79  ? -18.376 57.138 239.342 1.00 30.57 ? 75  ARG A CG    1 
ATOM   1343 C  CD    . ARG C 3 79  ? -19.790 56.624 239.329 1.00 29.72 ? 75  ARG A CD    1 
ATOM   1344 N  NE    . ARG C 3 79  ? -19.840 55.209 238.979 1.00 30.23 ? 75  ARG A NE    1 
ATOM   1345 C  CZ    . ARG C 3 79  ? -20.221 54.234 239.802 1.00 28.83 ? 75  ARG A CZ    1 
ATOM   1346 N  NH1   . ARG C 3 79  ? -20.589 54.501 241.048 1.00 25.86 ? 75  ARG A NH1   1 
ATOM   1347 N  NH2   . ARG C 3 79  ? -20.252 52.985 239.366 1.00 29.62 ? 75  ARG A NH2   1 
ATOM   1348 N  N     . LYS C 3 80  ? -16.508 58.577 243.253 1.00 32.90 ? 76  LYS A N     1 
ATOM   1349 C  CA    . LYS C 3 80  ? -16.479 59.396 244.451 1.00 35.19 ? 76  LYS A CA    1 
ATOM   1350 C  C     . LYS C 3 80  ? -15.324 60.385 244.334 1.00 36.98 ? 76  LYS A C     1 
ATOM   1351 O  O     . LYS C 3 80  ? -15.479 61.583 244.560 1.00 38.77 ? 76  LYS A O     1 
ATOM   1352 C  CB    . LYS C 3 80  ? -16.261 58.486 245.662 1.00 35.96 ? 76  LYS A CB    1 
ATOM   1353 C  CG    . LYS C 3 80  ? -16.648 59.045 247.024 1.00 37.29 ? 76  LYS A CG    1 
ATOM   1354 C  CD    . LYS C 3 80  ? -15.719 60.152 247.488 1.00 39.67 ? 76  LYS A CD    1 
ATOM   1355 C  CE    . LYS C 3 80  ? -15.961 60.494 248.965 1.00 40.13 ? 76  LYS A CE    1 
ATOM   1356 N  NZ    . LYS C 3 80  ? -15.571 59.386 249.894 1.00 41.89 ? 76  LYS A NZ    1 
ATOM   1357 N  N     . ALA C 3 81  ? -14.155 59.868 243.976 1.00 37.74 ? 77  ALA A N     1 
ATOM   1358 C  CA    . ALA C 3 81  ? -12.965 60.692 243.832 1.00 35.62 ? 77  ALA A CA    1 
ATOM   1359 C  C     . ALA C 3 81  ? -13.220 61.846 242.881 1.00 34.67 ? 77  ALA A C     1 
ATOM   1360 O  O     . ALA C 3 81  ? -13.020 63.007 243.234 1.00 36.49 ? 77  ALA A O     1 
ATOM   1361 C  CB    . ALA C 3 81  ? -11.797 59.842 243.330 1.00 35.31 ? 77  ALA A CB    1 
ATOM   1362 N  N     . GLY C 3 82  ? -13.647 61.528 241.669 1.00 34.47 ? 78  GLY A N     1 
ATOM   1363 C  CA    . GLY C 3 82  ? -13.911 62.577 240.700 1.00 36.75 ? 78  GLY A CA    1 
ATOM   1364 C  C     . GLY C 3 82  ? -14.893 63.620 241.210 1.00 37.38 ? 78  GLY A C     1 
ATOM   1365 O  O     . GLY C 3 82  ? -14.795 64.792 240.866 1.00 38.09 ? 78  GLY A O     1 
ATOM   1366 N  N     . ALA C 3 83  ? -15.833 63.201 242.047 1.00 38.01 ? 79  ALA A N     1 
ATOM   1367 C  CA    . ALA C 3 83  ? -16.832 64.119 242.568 1.00 38.44 ? 79  ALA A CA    1 
ATOM   1368 C  C     . ALA C 3 83  ? -16.224 65.112 243.545 1.00 39.25 ? 79  ALA A C     1 
ATOM   1369 O  O     . ALA C 3 83  ? -16.548 66.298 243.524 1.00 39.24 ? 79  ALA A O     1 
ATOM   1370 C  CB    . ALA C 3 83  ? -17.952 63.338 243.252 1.00 39.43 ? 79  ALA A CB    1 
ATOM   1371 N  N     . MET C 3 84  ? -15.345 64.614 244.406 1.00 39.68 ? 80  MET A N     1 
ATOM   1372 C  CA    . MET C 3 84  ? -14.684 65.438 245.412 1.00 40.93 ? 80  MET A CA    1 
ATOM   1373 C  C     . MET C 3 84  ? -13.908 66.568 244.755 1.00 41.37 ? 80  MET A C     1 
ATOM   1374 O  O     . MET C 3 84  ? -13.839 67.684 245.267 1.00 39.95 ? 80  MET A O     1 
ATOM   1375 C  CB    . MET C 3 84  ? -13.755 64.566 246.244 1.00 42.29 ? 80  MET A CB    1 
ATOM   1376 C  CG    . MET C 3 84  ? -14.509 63.499 247.008 1.00 45.37 ? 80  MET A CG    1 
ATOM   1377 S  SD    . MET C 3 84  ? -15.787 64.267 248.084 1.00 51.42 ? 80  MET A SD    1 
ATOM   1378 C  CE    . MET C 3 84  ? -17.185 64.329 246.965 1.00 50.61 ? 80  MET A CE    1 
ATOM   1379 N  N     . GLN C 3 85  ? -13.324 66.266 243.608 1.00 41.70 ? 81  GLN A N     1 
ATOM   1380 C  CA    . GLN C 3 85  ? -12.589 67.262 242.876 1.00 42.38 ? 81  GLN A CA    1 
ATOM   1381 C  C     . GLN C 3 85  ? -13.579 68.337 242.442 1.00 42.10 ? 81  GLN A C     1 
ATOM   1382 O  O     . GLN C 3 85  ? -13.258 69.522 242.422 1.00 42.97 ? 81  GLN A O     1 
ATOM   1383 C  CB    . GLN C 3 85  ? -11.921 66.625 241.659 1.00 43.62 ? 81  GLN A CB    1 
ATOM   1384 C  CG    . GLN C 3 85  ? -11.171 67.600 240.780 1.00 46.19 ? 81  GLN A CG    1 
ATOM   1385 C  CD    . GLN C 3 85  ? -10.091 68.374 241.528 1.00 47.37 ? 81  GLN A CD    1 
ATOM   1386 O  OE1   . GLN C 3 85  ? -9.453  69.260 240.953 1.00 47.80 ? 81  GLN A OE1   1 
ATOM   1387 N  NE2   . GLN C 3 85  ? -9.877  68.043 242.808 1.00 45.07 ? 81  GLN A NE2   1 
ATOM   1388 N  N     . THR C 3 86  ? -14.794 67.924 242.098 1.00 41.88 ? 82  THR A N     1 
ATOM   1389 C  CA    . THR C 3 86  ? -15.810 68.879 241.674 1.00 40.80 ? 82  THR A CA    1 
ATOM   1390 C  C     . THR C 3 86  ? -16.130 69.800 242.850 1.00 40.06 ? 82  THR A C     1 
ATOM   1391 O  O     . THR C 3 86  ? -16.116 71.020 242.709 1.00 40.08 ? 82  THR A O     1 
ATOM   1392 C  CB    . THR C 3 86  ? -17.082 68.152 241.172 1.00 41.11 ? 82  THR A CB    1 
ATOM   1393 O  OG1   . THR C 3 86  ? -16.744 67.348 240.037 1.00 42.15 ? 82  THR A OG1   1 
ATOM   1394 C  CG2   . THR C 3 86  ? -18.146 69.151 240.744 1.00 42.29 ? 82  THR A CG2   1 
ATOM   1395 N  N     . VAL C 3 87  ? -16.404 69.214 244.009 1.00 39.46 ? 83  VAL A N     1 
ATOM   1396 C  CA    . VAL C 3 87  ? -16.691 69.999 245.197 1.00 40.72 ? 83  VAL A CA    1 
ATOM   1397 C  C     . VAL C 3 87  ? -15.588 71.034 245.409 1.00 42.54 ? 83  VAL A C     1 
ATOM   1398 O  O     . VAL C 3 87  ? -15.868 72.199 245.699 1.00 43.93 ? 83  VAL A O     1 
ATOM   1399 C  CB    . VAL C 3 87  ? -16.749 69.114 246.447 1.00 39.90 ? 83  VAL A CB    1 
ATOM   1400 C  CG1   . VAL C 3 87  ? -16.973 69.962 247.675 1.00 37.71 ? 83  VAL A CG1   1 
ATOM   1401 C  CG2   . VAL C 3 87  ? -17.843 68.084 246.289 1.00 41.30 ? 83  VAL A CG2   1 
ATOM   1402 N  N     . LYS C 3 88  ? -14.333 70.611 245.263 1.00 42.94 ? 84  LYS A N     1 
ATOM   1403 C  CA    . LYS C 3 88  ? -13.203 71.519 245.457 1.00 43.18 ? 84  LYS A CA    1 
ATOM   1404 C  C     . LYS C 3 88  ? -13.264 72.710 244.499 1.00 42.13 ? 84  LYS A C     1 
ATOM   1405 O  O     . LYS C 3 88  ? -13.219 73.855 244.935 1.00 43.65 ? 84  LYS A O     1 
ATOM   1406 C  CB    . LYS C 3 88  ? -11.877 70.787 245.267 1.00 45.39 ? 84  LYS A CB    1 
ATOM   1407 C  CG    . LYS C 3 88  ? -10.657 71.595 245.680 1.00 47.19 ? 84  LYS A CG    1 
ATOM   1408 C  CD    . LYS C 3 88  ? -9.388  71.002 245.054 1.00 48.45 ? 84  LYS A CD    1 
ATOM   1409 C  CE    . LYS C 3 88  ? -8.097  71.555 245.680 1.00 48.09 ? 84  LYS A CE    1 
ATOM   1410 N  NZ    . LYS C 3 88  ? -7.870  71.039 247.071 1.00 45.91 ? 84  LYS A NZ    1 
ATOM   1411 N  N     . LEU C 3 89  ? -13.359 72.441 243.202 1.00 39.58 ? 85  LEU A N     1 
ATOM   1412 C  CA    . LEU C 3 89  ? -13.437 73.510 242.222 1.00 39.13 ? 85  LEU A CA    1 
ATOM   1413 C  C     . LEU C 3 89  ? -14.633 74.408 242.466 1.00 40.89 ? 85  LEU A C     1 
ATOM   1414 O  O     . LEU C 3 89  ? -14.603 75.603 242.168 1.00 42.27 ? 85  LEU A O     1 
ATOM   1415 C  CB    . LEU C 3 89  ? -13.554 72.943 240.818 1.00 36.06 ? 85  LEU A CB    1 
ATOM   1416 C  CG    . LEU C 3 89  ? -12.394 72.096 240.329 1.00 34.26 ? 85  LEU A CG    1 
ATOM   1417 C  CD1   . LEU C 3 89  ? -12.693 71.630 238.920 1.00 31.88 ? 85  LEU A CD1   1 
ATOM   1418 C  CD2   . LEU C 3 89  ? -11.114 72.896 240.373 1.00 32.17 ? 85  LEU A CD2   1 
ATOM   1419 N  N     . ALA C 3 90  ? -15.698 73.821 242.992 1.00 42.53 ? 86  ALA A N     1 
ATOM   1420 C  CA    . ALA C 3 90  ? -16.928 74.556 243.257 1.00 44.42 ? 86  ALA A CA    1 
ATOM   1421 C  C     . ALA C 3 90  ? -16.729 75.686 244.254 1.00 45.21 ? 86  ALA A C     1 
ATOM   1422 O  O     . ALA C 3 90  ? -17.414 76.705 244.195 1.00 46.45 ? 86  ALA A O     1 
ATOM   1423 C  CB    . ALA C 3 90  ? -17.989 73.597 243.777 1.00 43.74 ? 86  ALA A CB    1 
ATOM   1424 N  N     . GLN C 3 91  ? -15.790 75.487 245.168 1.00 44.86 ? 87  GLN A N     1 
ATOM   1425 C  CA    . GLN C 3 91  ? -15.496 76.460 246.200 1.00 45.27 ? 87  GLN A CA    1 
ATOM   1426 C  C     . GLN C 3 91  ? -15.199 77.872 245.726 1.00 44.69 ? 87  GLN A C     1 
ATOM   1427 O  O     . GLN C 3 91  ? -15.025 78.751 246.551 1.00 44.77 ? 87  GLN A O     1 
ATOM   1428 C  CB    . GLN C 3 91  ? -14.328 75.970 247.042 1.00 46.38 ? 87  GLN A CB    1 
ATOM   1429 C  CG    . GLN C 3 91  ? -14.708 74.931 248.064 1.00 50.19 ? 87  GLN A CG    1 
ATOM   1430 C  CD    . GLN C 3 91  ? -13.494 74.289 248.707 1.00 52.06 ? 87  GLN A CD    1 
ATOM   1431 O  OE1   . GLN C 3 91  ? -13.588 73.702 249.790 1.00 53.30 ? 87  GLN A OE1   1 
ATOM   1432 N  NE2   . GLN C 3 91  ? -12.343 74.388 248.036 1.00 52.45 ? 87  GLN A NE2   1 
ATOM   1433 N  N     . GLU C 3 92  ? -15.154 78.112 244.423 1.00 43.60 ? 88  GLU A N     1 
ATOM   1434 C  CA    . GLU C 3 92  ? -14.833 79.455 243.972 1.00 44.23 ? 88  GLU A CA    1 
ATOM   1435 C  C     . GLU C 3 92  ? -15.929 80.168 243.215 1.00 43.05 ? 88  GLU A C     1 
ATOM   1436 O  O     . GLU C 3 92  ? -15.667 81.123 242.483 1.00 42.17 ? 88  GLU A O     1 
ATOM   1437 C  CB    . GLU C 3 92  ? -13.592 79.431 243.096 1.00 47.07 ? 88  GLU A CB    1 
ATOM   1438 C  CG    . GLU C 3 92  ? -13.825 78.768 241.781 1.00 51.30 ? 88  GLU A CG    1 
ATOM   1439 C  CD    . GLU C 3 92  ? -12.847 79.237 240.730 1.00 54.58 ? 88  GLU A CD    1 
ATOM   1440 O  OE1   . GLU C 3 92  ? -13.024 80.364 240.210 1.00 55.04 ? 88  GLU A OE1   1 
ATOM   1441 O  OE2   . GLU C 3 92  ? -11.895 78.479 240.431 1.00 57.69 ? 88  GLU A OE2   1 
ATOM   1442 N  N     . PHE C 3 93  ? -17.157 79.703 243.368 1.00 42.07 ? 89  PHE A N     1 
ATOM   1443 C  CA    . PHE C 3 93  ? -18.250 80.343 242.672 1.00 41.11 ? 89  PHE A CA    1 
ATOM   1444 C  C     . PHE C 3 93  ? -19.363 80.704 243.631 1.00 42.45 ? 89  PHE A C     1 
ATOM   1445 O  O     . PHE C 3 93  ? -19.644 79.974 244.586 1.00 42.48 ? 89  PHE A O     1 
ATOM   1446 C  CB    . PHE C 3 93  ? -18.772 79.440 241.567 1.00 38.83 ? 89  PHE A CB    1 
ATOM   1447 C  CG    . PHE C 3 93  ? -17.701 78.974 240.623 1.00 37.69 ? 89  PHE A CG    1 
ATOM   1448 C  CD1   . PHE C 3 93  ? -17.114 77.720 240.779 1.00 36.39 ? 89  PHE A CD1   1 
ATOM   1449 C  CD2   . PHE C 3 93  ? -17.268 79.793 239.583 1.00 36.20 ? 89  PHE A CD2   1 
ATOM   1450 C  CE1   . PHE C 3 93  ? -16.118 77.291 239.909 1.00 35.31 ? 89  PHE A CE1   1 
ATOM   1451 C  CE2   . PHE C 3 93  ? -16.269 79.373 238.706 1.00 35.43 ? 89  PHE A CE2   1 
ATOM   1452 C  CZ    . PHE C 3 93  ? -15.692 78.121 238.866 1.00 34.47 ? 89  PHE A CZ    1 
ATOM   1453 N  N     . PRO C 3 94  ? -20.006 81.858 243.396 1.00 43.29 ? 90  PRO A N     1 
ATOM   1454 C  CA    . PRO C 3 94  ? -21.105 82.360 244.222 1.00 42.77 ? 90  PRO A CA    1 
ATOM   1455 C  C     . PRO C 3 94  ? -22.382 81.548 244.015 1.00 42.96 ? 90  PRO A C     1 
ATOM   1456 O  O     . PRO C 3 94  ? -23.048 81.212 244.986 1.00 42.63 ? 90  PRO A O     1 
ATOM   1457 C  CB    . PRO C 3 94  ? -21.249 83.796 243.743 1.00 43.22 ? 90  PRO A CB    1 
ATOM   1458 C  CG    . PRO C 3 94  ? -20.908 83.676 242.280 1.00 42.97 ? 90  PRO A CG    1 
ATOM   1459 C  CD    . PRO C 3 94  ? -19.682 82.816 242.320 1.00 42.44 ? 90  PRO A CD    1 
ATOM   1460 N  N     . GLU C 3 95  ? -22.699 81.230 242.754 1.00 43.20 ? 91  GLU A N     1 
ATOM   1461 C  CA    . GLU C 3 95  ? -23.904 80.469 242.415 1.00 44.99 ? 91  GLU A CA    1 
ATOM   1462 C  C     . GLU C 3 95  ? -23.645 79.281 241.468 1.00 44.99 ? 91  GLU A C     1 
ATOM   1463 O  O     . GLU C 3 95  ? -23.104 79.448 240.374 1.00 46.15 ? 91  GLU A O     1 
ATOM   1464 C  CB    . GLU C 3 95  ? -24.958 81.404 241.794 1.00 45.43 ? 91  GLU A CB    1 
ATOM   1465 C  CG    . GLU C 3 95  ? -26.408 80.898 241.937 1.00 46.05 ? 91  GLU A CG    1 
ATOM   1466 C  CD    . GLU C 3 95  ? -27.457 81.830 241.311 1.00 46.22 ? 91  GLU A CD    1 
ATOM   1467 O  OE1   . GLU C 3 95  ? -27.555 81.882 240.059 1.00 43.77 ? 91  GLU A OE1   1 
ATOM   1468 O  OE2   . GLU C 3 95  ? -28.188 82.504 242.078 1.00 44.52 ? 91  GLU A OE2   1 
ATOM   1469 N  N     . LEU C 3 96  ? -24.064 78.086 241.888 1.00 44.81 ? 92  LEU A N     1 
ATOM   1470 C  CA    . LEU C 3 96  ? -23.873 76.853 241.112 1.00 41.80 ? 92  LEU A CA    1 
ATOM   1471 C  C     . LEU C 3 96  ? -25.153 76.168 240.634 1.00 40.38 ? 92  LEU A C     1 
ATOM   1472 O  O     . LEU C 3 96  ? -26.141 76.087 241.368 1.00 40.49 ? 92  LEU A O     1 
ATOM   1473 C  CB    . LEU C 3 96  ? -23.106 75.851 241.959 1.00 40.23 ? 92  LEU A CB    1 
ATOM   1474 C  CG    . LEU C 3 96  ? -21.666 76.192 242.245 1.00 38.61 ? 92  LEU A CG    1 
ATOM   1475 C  CD1   . LEU C 3 96  ? -21.159 75.334 243.375 1.00 37.41 ? 92  LEU A CD1   1 
ATOM   1476 C  CD2   . LEU C 3 96  ? -20.866 75.967 240.968 1.00 39.28 ? 92  LEU A CD2   1 
ATOM   1477 N  N     . LEU C 3 97  ? -25.118 75.650 239.411 1.00 38.03 ? 93  LEU A N     1 
ATOM   1478 C  CA    . LEU C 3 97  ? -26.257 74.921 238.860 1.00 35.00 ? 93  LEU A CA    1 
ATOM   1479 C  C     . LEU C 3 97  ? -25.964 73.429 238.907 1.00 34.54 ? 93  LEU A C     1 
ATOM   1480 O  O     . LEU C 3 97  ? -24.909 72.988 238.458 1.00 34.28 ? 93  LEU A O     1 
ATOM   1481 C  CB    . LEU C 3 97  ? -26.522 75.299 237.405 1.00 30.66 ? 93  LEU A CB    1 
ATOM   1482 C  CG    . LEU C 3 97  ? -26.967 76.718 237.107 1.00 29.00 ? 93  LEU A CG    1 
ATOM   1483 C  CD1   . LEU C 3 97  ? -27.617 76.758 235.737 1.00 25.77 ? 93  LEU A CD1   1 
ATOM   1484 C  CD2   . LEU C 3 97  ? -27.946 77.182 238.173 1.00 29.83 ? 93  LEU A CD2   1 
ATOM   1485 N  N     . ALA C 3 98  ? -26.899 72.653 239.435 1.00 34.43 ? 94  ALA A N     1 
ATOM   1486 C  CA    . ALA C 3 98  ? -26.714 71.216 239.503 1.00 33.14 ? 94  ALA A CA    1 
ATOM   1487 C  C     . ALA C 3 98  ? -27.730 70.519 238.595 1.00 31.36 ? 94  ALA A C     1 
ATOM   1488 O  O     . ALA C 3 98  ? -28.829 70.190 239.031 1.00 32.65 ? 94  ALA A O     1 
ATOM   1489 C  CB    . ALA C 3 98  ? -26.883 70.758 240.928 1.00 32.43 ? 94  ALA A CB    1 
ATOM   1490 N  N     . ILE C 3 99  ? -27.370 70.316 237.333 1.00 31.27 ? 95  ILE A N     1 
ATOM   1491 C  CA    . ILE C 3 99  ? -28.254 69.642 236.395 1.00 34.15 ? 95  ILE A CA    1 
ATOM   1492 C  C     . ILE C 3 99  ? -28.381 68.171 236.818 1.00 35.38 ? 95  ILE A C     1 
ATOM   1493 O  O     . ILE C 3 99  ? -27.396 67.522 237.183 1.00 35.53 ? 95  ILE A O     1 
ATOM   1494 C  CB    . ILE C 3 99  ? -27.714 69.733 234.956 1.00 35.92 ? 95  ILE A CB    1 
ATOM   1495 C  CG1   . ILE C 3 99  ? -27.212 71.158 234.691 1.00 38.41 ? 95  ILE A CG1   1 
ATOM   1496 C  CG2   . ILE C 3 99  ? -28.827 69.427 233.950 1.00 36.98 ? 95  ILE A CG2   1 
ATOM   1497 C  CD1   . ILE C 3 99  ? -28.276 72.227 234.854 1.00 38.44 ? 95  ILE A CD1   1 
ATOM   1498 N  N     . GLU C 3 100 ? -29.601 67.648 236.789 1.00 35.43 ? 96  GLU A N     1 
ATOM   1499 C  CA    . GLU C 3 100 ? -29.838 66.278 237.214 1.00 34.54 ? 96  GLU A CA    1 
ATOM   1500 C  C     . GLU C 3 100 ? -30.697 65.542 236.201 1.00 32.90 ? 96  GLU A C     1 
ATOM   1501 O  O     . GLU C 3 100 ? -31.771 66.007 235.819 1.00 33.21 ? 96  GLU A O     1 
ATOM   1502 C  CB    . GLU C 3 100 ? -30.526 66.311 238.563 1.00 35.91 ? 96  GLU A CB    1 
ATOM   1503 C  CG    . GLU C 3 100 ? -30.557 65.002 239.278 1.00 42.88 ? 96  GLU A CG    1 
ATOM   1504 C  CD    . GLU C 3 100 ? -31.153 65.137 240.679 1.00 48.69 ? 96  GLU A CD    1 
ATOM   1505 O  OE1   . GLU C 3 100 ? -31.163 66.273 241.219 1.00 49.53 ? 96  GLU A OE1   1 
ATOM   1506 O  OE2   . GLU C 3 100 ? -31.606 64.109 241.253 1.00 52.85 ? 96  GLU A OE2   1 
ATOM   1507 N  N     . ASP C 3 101 ? -30.232 64.384 235.767 1.00 30.60 ? 97  ASP A N     1 
ATOM   1508 C  CA    . ASP C 3 101 ? -30.986 63.632 234.799 1.00 28.27 ? 97  ASP A CA    1 
ATOM   1509 C  C     . ASP C 3 101 ? -30.443 62.236 234.744 1.00 28.66 ? 97  ASP A C     1 
ATOM   1510 O  O     . ASP C 3 101 ? -29.393 61.941 235.336 1.00 29.15 ? 97  ASP A O     1 
ATOM   1511 C  CB    . ASP C 3 101 ? -30.917 64.286 233.425 1.00 26.78 ? 97  ASP A CB    1 
ATOM   1512 C  CG    . ASP C 3 101 ? -31.860 63.648 232.429 1.00 28.49 ? 97  ASP A CG    1 
ATOM   1513 O  OD1   . ASP C 3 101 ? -32.898 63.096 232.842 1.00 30.54 ? 97  ASP A OD1   1 
ATOM   1514 O  OD2   . ASP C 3 101 ? -31.575 63.705 231.214 1.00 28.89 ? 97  ASP A OD2   1 
ATOM   1515 N  N     . THR C 3 102 ? -31.175 61.390 234.021 1.00 25.85 ? 98  THR A N     1 
ATOM   1516 C  CA    . THR C 3 102 ? -30.858 59.986 233.871 1.00 21.92 ? 98  THR A CA    1 
ATOM   1517 C  C     . THR C 3 102 ? -30.594 59.606 232.444 1.00 21.41 ? 98  THR A C     1 
ATOM   1518 O  O     . THR C 3 102 ? -31.046 60.278 231.526 1.00 22.61 ? 98  THR A O     1 
ATOM   1519 C  CB    . THR C 3 102 ? -32.007 59.134 234.434 1.00 22.13 ? 98  THR A CB    1 
ATOM   1520 O  OG1   . THR C 3 102 ? -31.938 59.105 235.874 1.00 21.75 ? 98  THR A OG1   1 
ATOM   1521 C  CG2   . THR C 3 102 ? -31.952 57.736 233.888 1.00 21.01 ? 98  THR A CG2   1 
ATOM   1522 N  N     . THR C 3 103 ? -29.783 58.569 232.256 1.00 21.77 ? 99  THR A N     1 
ATOM   1523 C  CA    . THR C 3 103 ? -29.501 58.050 230.912 1.00 21.06 ? 99  THR A CA    1 
ATOM   1524 C  C     . THR C 3 103 ? -29.253 56.540 231.076 1.00 22.19 ? 99  THR A C     1 
ATOM   1525 O  O     . THR C 3 103 ? -29.177 56.010 232.197 1.00 20.86 ? 99  THR A O     1 
ATOM   1526 C  CB    . THR C 3 103 ? -28.256 58.723 230.266 1.00 19.67 ? 99  THR A CB    1 
ATOM   1527 O  OG1   . THR C 3 103 ? -28.206 58.362 228.887 1.00 18.06 ? 99  THR A OG1   1 
ATOM   1528 C  CG2   . THR C 3 103 ? -26.942 58.273 230.946 1.00 18.06 ? 99  THR A CG2   1 
ATOM   1529 N  N     . SER C 3 104 ? -29.136 55.836 229.967 1.00 21.49 ? 100 SER A N     1 
ATOM   1530 C  CA    . SER C 3 104 ? -28.856 54.417 230.050 1.00 22.58 ? 100 SER A CA    1 
ATOM   1531 C  C     . SER C 3 104 ? -27.586 54.095 229.275 1.00 23.84 ? 100 SER A C     1 
ATOM   1532 O  O     . SER C 3 104 ? -27.216 54.791 228.321 1.00 22.19 ? 100 SER A O     1 
ATOM   1533 C  CB    . SER C 3 104 ? -30.029 53.583 229.494 1.00 21.74 ? 100 SER A CB    1 
ATOM   1534 O  OG    . SER C 3 104 ? -30.076 53.596 228.072 1.00 19.76 ? 100 SER A OG    1 
ATOM   1535 N  N     . LEU C 3 105 ? -26.913 53.035 229.702 1.00 24.77 ? 101 LEU A N     1 
ATOM   1536 C  CA    . LEU C 3 105 ? -25.704 52.565 229.031 1.00 24.44 ? 101 LEU A CA    1 
ATOM   1537 C  C     . LEU C 3 105 ? -26.172 51.219 228.480 1.00 23.87 ? 101 LEU A C     1 
ATOM   1538 O  O     . LEU C 3 105 ? -26.501 50.324 229.250 1.00 23.39 ? 101 LEU A O     1 
ATOM   1539 C  CB    . LEU C 3 105 ? -24.589 52.358 230.064 1.00 23.86 ? 101 LEU A CB    1 
ATOM   1540 C  CG    . LEU C 3 105 ? -24.190 53.586 230.887 1.00 23.77 ? 101 LEU A CG    1 
ATOM   1541 C  CD1   . LEU C 3 105 ? -23.274 53.191 232.028 1.00 21.93 ? 101 LEU A CD1   1 
ATOM   1542 C  CD2   . LEU C 3 105 ? -23.519 54.594 229.972 1.00 23.25 ? 101 LEU A CD2   1 
ATOM   1543 N  N     . SER C 3 106 ? -26.222 51.079 227.163 1.00 23.29 ? 102 SER A N     1 
ATOM   1544 C  CA    . SER C 3 106 ? -26.693 49.837 226.559 1.00 26.52 ? 102 SER A CA    1 
ATOM   1545 C  C     . SER C 3 106 ? -25.637 49.014 225.818 1.00 28.55 ? 102 SER A C     1 
ATOM   1546 O  O     . SER C 3 106 ? -24.866 49.550 225.009 1.00 26.64 ? 102 SER A O     1 
ATOM   1547 C  CB    . SER C 3 106 ? -27.861 50.132 225.598 1.00 25.24 ? 102 SER A CB    1 
ATOM   1548 O  OG    . SER C 3 106 ? -27.594 49.642 224.286 1.00 25.16 ? 102 SER A OG    1 
ATOM   1549 N  N     . TYR C 3 107 ? -25.629 47.706 226.093 1.00 30.25 ? 103 TYR A N     1 
ATOM   1550 C  CA    . TYR C 3 107 ? -24.700 46.760 225.458 1.00 32.36 ? 103 TYR A CA    1 
ATOM   1551 C  C     . TYR C 3 107 ? -25.410 45.517 224.913 1.00 33.02 ? 103 TYR A C     1 
ATOM   1552 O  O     . TYR C 3 107 ? -26.418 45.076 225.462 1.00 34.88 ? 103 TYR A O     1 
ATOM   1553 C  CB    . TYR C 3 107 ? -23.635 46.321 226.463 1.00 33.89 ? 103 TYR A CB    1 
ATOM   1554 C  CG    . TYR C 3 107 ? -22.936 47.484 227.120 1.00 34.04 ? 103 TYR A CG    1 
ATOM   1555 C  CD1   . TYR C 3 107 ? -23.354 47.963 228.349 1.00 32.76 ? 103 TYR A CD1   1 
ATOM   1556 C  CD2   . TYR C 3 107 ? -21.907 48.158 226.471 1.00 34.48 ? 103 TYR A CD2   1 
ATOM   1557 C  CE1   . TYR C 3 107 ? -22.778 49.093 228.909 1.00 33.37 ? 103 TYR A CE1   1 
ATOM   1558 C  CE2   . TYR C 3 107 ? -21.324 49.293 227.026 1.00 34.61 ? 103 TYR A CE2   1 
ATOM   1559 C  CZ    . TYR C 3 107 ? -21.764 49.749 228.244 1.00 33.77 ? 103 TYR A CZ    1 
ATOM   1560 O  OH    . TYR C 3 107 ? -21.200 50.871 228.792 1.00 36.91 ? 103 TYR A OH    1 
ATOM   1561 N  N     . ARG C 3 108 ? -24.865 44.946 223.844 1.00 33.91 ? 104 ARG A N     1 
ATOM   1562 C  CA    . ARG C 3 108 ? -25.434 43.752 223.223 1.00 33.07 ? 104 ARG A CA    1 
ATOM   1563 C  C     . ARG C 3 108 ? -24.479 42.557 223.096 1.00 31.59 ? 104 ARG A C     1 
ATOM   1564 O  O     . ARG C 3 108 ? -24.737 41.666 222.302 1.00 31.99 ? 104 ARG A O     1 
ATOM   1565 C  CB    . ARG C 3 108 ? -25.971 44.091 221.830 1.00 33.60 ? 104 ARG A CB    1 
ATOM   1566 C  CG    . ARG C 3 108 ? -27.216 44.934 221.853 1.00 38.79 ? 104 ARG A CG    1 
ATOM   1567 C  CD    . ARG C 3 108 ? -27.517 45.524 220.483 1.00 42.10 ? 104 ARG A CD    1 
ATOM   1568 N  NE    . ARG C 3 108 ? -28.005 44.537 219.525 1.00 46.84 ? 104 ARG A NE    1 
ATOM   1569 C  CZ    . ARG C 3 108 ? -29.174 43.905 219.616 1.00 47.99 ? 104 ARG A CZ    1 
ATOM   1570 N  NH1   . ARG C 3 108 ? -29.994 44.146 220.633 1.00 48.16 ? 104 ARG A NH1   1 
ATOM   1571 N  NH2   . ARG C 3 108 ? -29.527 43.036 218.676 1.00 49.27 ? 104 ARG A NH2   1 
ATOM   1572 N  N     . HIS C 3 109 ? -23.370 42.538 223.823 1.00 29.80 ? 105 HIS A N     1 
ATOM   1573 C  CA    . HIS C 3 109 ? -22.491 41.385 223.730 1.00 29.19 ? 105 HIS A CA    1 
ATOM   1574 C  C     . HIS C 3 109 ? -22.715 40.550 225.000 1.00 29.25 ? 105 HIS A C     1 
ATOM   1575 O  O     . HIS C 3 109 ? -23.238 41.061 225.986 1.00 30.45 ? 105 HIS A O     1 
ATOM   1576 C  CB    . HIS C 3 109 ? -20.998 41.794 223.537 1.00 29.16 ? 105 HIS A CB    1 
ATOM   1577 C  CG    . HIS C 3 109 ? -20.437 42.709 224.592 1.00 28.25 ? 105 HIS A CG    1 
ATOM   1578 N  ND1   . HIS C 3 109 ? -20.728 44.058 224.658 1.00 26.65 ? 105 HIS A ND1   1 
ATOM   1579 C  CD2   . HIS C 3 109 ? -19.612 42.455 225.637 1.00 25.56 ? 105 HIS A CD2   1 
ATOM   1580 C  CE1   . HIS C 3 109 ? -20.114 44.587 225.700 1.00 25.35 ? 105 HIS A CE1   1 
ATOM   1581 N  NE2   . HIS C 3 109 ? -19.430 43.634 226.312 1.00 24.25 ? 105 HIS A NE2   1 
ATOM   1582 N  N     . GLN C 3 110 ? -22.322 39.280 224.976 1.00 29.79 ? 106 GLN A N     1 
ATOM   1583 C  CA    . GLN C 3 110 ? -22.536 38.381 226.098 1.00 29.51 ? 106 GLN A CA    1 
ATOM   1584 C  C     . GLN C 3 110 ? -22.722 38.995 227.466 1.00 28.48 ? 106 GLN A C     1 
ATOM   1585 O  O     . GLN C 3 110 ? -23.632 38.607 228.182 1.00 29.36 ? 106 GLN A O     1 
ATOM   1586 C  CB    . GLN C 3 110 ? -21.433 37.335 226.169 1.00 32.59 ? 106 GLN A CB    1 
ATOM   1587 C  CG    . GLN C 3 110 ? -21.643 36.129 225.268 1.00 37.18 ? 106 GLN A CG    1 
ATOM   1588 C  CD    . GLN C 3 110 ? -20.508 35.116 225.416 1.00 41.90 ? 106 GLN A CD    1 
ATOM   1589 O  OE1   . GLN C 3 110 ? -20.204 34.664 226.534 1.00 43.81 ? 106 GLN A OE1   1 
ATOM   1590 N  NE2   . GLN C 3 110 ? -19.874 34.755 224.291 1.00 40.47 ? 106 GLN A NE2   1 
ATOM   1591 N  N     . VAL C 3 111 ? -21.894 39.951 227.854 1.00 27.92 ? 107 VAL A N     1 
ATOM   1592 C  CA    . VAL C 3 111 ? -22.068 40.510 229.190 1.00 28.11 ? 107 VAL A CA    1 
ATOM   1593 C  C     . VAL C 3 111 ? -23.458 41.102 229.438 1.00 29.20 ? 107 VAL A C     1 
ATOM   1594 O  O     . VAL C 3 111 ? -23.846 41.316 230.594 1.00 29.31 ? 107 VAL A O     1 
ATOM   1595 C  CB    . VAL C 3 111 ? -21.028 41.604 229.507 1.00 27.18 ? 107 VAL A CB    1 
ATOM   1596 C  CG1   . VAL C 3 111 ? -21.350 42.875 228.722 1.00 27.04 ? 107 VAL A CG1   1 
ATOM   1597 C  CG2   . VAL C 3 111 ? -21.016 41.884 231.007 1.00 24.76 ? 107 VAL A CG2   1 
ATOM   1598 N  N     . ALA C 3 112 ? -24.199 41.379 228.365 1.00 29.88 ? 108 ALA A N     1 
ATOM   1599 C  CA    . ALA C 3 112 ? -25.544 41.966 228.474 1.00 31.86 ? 108 ALA A CA    1 
ATOM   1600 C  C     . ALA C 3 112 ? -26.456 41.141 229.371 1.00 34.02 ? 108 ALA A C     1 
ATOM   1601 O  O     . ALA C 3 112 ? -27.180 41.671 230.215 1.00 34.66 ? 108 ALA A O     1 
ATOM   1602 C  CB    . ALA C 3 112 ? -26.164 42.097 227.104 1.00 30.17 ? 108 ALA A CB    1 
ATOM   1603 N  N     . GLU C 3 113 ? -26.404 39.835 229.172 1.00 35.08 ? 109 GLU A N     1 
ATOM   1604 C  CA    . GLU C 3 113 ? -27.202 38.901 229.929 1.00 36.17 ? 109 GLU A CA    1 
ATOM   1605 C  C     . GLU C 3 113 ? -27.070 39.082 231.431 1.00 36.09 ? 109 GLU A C     1 
ATOM   1606 O  O     . GLU C 3 113 ? -28.009 38.793 232.172 1.00 36.38 ? 109 GLU A O     1 
ATOM   1607 C  CB    . GLU C 3 113 ? -26.811 37.491 229.516 1.00 40.11 ? 109 GLU A CB    1 
ATOM   1608 C  CG    . GLU C 3 113 ? -26.950 37.279 228.019 1.00 45.36 ? 109 GLU A CG    1 
ATOM   1609 C  CD    . GLU C 3 113 ? -26.296 36.002 227.543 1.00 49.31 ? 109 GLU A CD    1 
ATOM   1610 O  OE1   . GLU C 3 113 ? -26.536 34.944 228.173 1.00 51.61 ? 109 GLU A OE1   1 
ATOM   1611 O  OE2   . GLU C 3 113 ? -25.551 36.060 226.533 1.00 51.71 ? 109 GLU A OE2   1 
ATOM   1612 N  N     . GLU C 3 114 ? -25.922 39.561 231.899 1.00 36.00 ? 110 GLU A N     1 
ATOM   1613 C  CA    . GLU C 3 114 ? -25.753 39.765 233.343 1.00 35.44 ? 110 GLU A CA    1 
ATOM   1614 C  C     . GLU C 3 114 ? -26.112 41.167 233.763 1.00 32.51 ? 110 GLU A C     1 
ATOM   1615 O  O     . GLU C 3 114 ? -25.988 41.529 234.931 1.00 31.32 ? 110 GLU A O     1 
ATOM   1616 C  CB    . GLU C 3 114 ? -24.320 39.522 233.771 1.00 38.84 ? 110 GLU A CB    1 
ATOM   1617 C  CG    . GLU C 3 114 ? -23.799 38.136 233.556 1.00 45.03 ? 110 GLU A CG    1 
ATOM   1618 C  CD    . GLU C 3 114 ? -22.429 37.977 234.178 1.00 49.66 ? 110 GLU A CD    1 
ATOM   1619 O  OE1   . GLU C 3 114 ? -22.308 38.246 235.405 1.00 50.11 ? 110 GLU A OE1   1 
ATOM   1620 O  OE2   . GLU C 3 114 ? -21.481 37.593 233.442 1.00 52.01 ? 110 GLU A OE2   1 
ATOM   1621 N  N     . LEU C 3 115 ? -26.559 41.957 232.799 1.00 31.70 ? 111 LEU A N     1 
ATOM   1622 C  CA    . LEU C 3 115 ? -26.920 43.340 233.059 1.00 30.55 ? 111 LEU A CA    1 
ATOM   1623 C  C     . LEU C 3 115 ? -28.437 43.544 233.199 1.00 32.04 ? 111 LEU A C     1 
ATOM   1624 O  O     . LEU C 3 115 ? -29.235 42.676 232.835 1.00 32.75 ? 111 LEU A O     1 
ATOM   1625 C  CB    . LEU C 3 115 ? -26.348 44.219 231.934 1.00 28.36 ? 111 LEU A CB    1 
ATOM   1626 C  CG    . LEU C 3 115 ? -24.801 44.243 231.841 1.00 25.50 ? 111 LEU A CG    1 
ATOM   1627 C  CD1   . LEU C 3 115 ? -24.346 44.945 230.598 1.00 19.69 ? 111 LEU A CD1   1 
ATOM   1628 C  CD2   . LEU C 3 115 ? -24.226 44.904 233.087 1.00 22.85 ? 111 LEU A CD2   1 
ATOM   1629 N  N     . GLY C 3 116 ? -28.818 44.707 233.725 1.00 32.24 ? 112 GLY A N     1 
ATOM   1630 C  CA    . GLY C 3 116 ? -30.218 45.049 233.932 1.00 29.91 ? 112 GLY A CA    1 
ATOM   1631 C  C     . GLY C 3 116 ? -31.019 45.275 232.667 1.00 29.46 ? 112 GLY A C     1 
ATOM   1632 O  O     . GLY C 3 116 ? -30.453 45.344 231.578 1.00 26.56 ? 112 GLY A O     1 
ATOM   1633 N  N     . LYS C 3 117 ? -32.340 45.394 232.815 1.00 30.25 ? 113 LYS A N     1 
ATOM   1634 C  CA    . LYS C 3 117 ? -33.232 45.592 231.667 1.00 32.74 ? 113 LYS A CA    1 
ATOM   1635 C  C     . LYS C 3 117 ? -33.376 47.054 231.237 1.00 31.89 ? 113 LYS A C     1 
ATOM   1636 O  O     . LYS C 3 117 ? -33.567 47.937 232.061 1.00 34.10 ? 113 LYS A O     1 
ATOM   1637 C  CB    . LYS C 3 117 ? -34.629 45.027 231.965 1.00 36.00 ? 113 LYS A CB    1 
ATOM   1638 C  CG    . LYS C 3 117 ? -35.606 45.199 230.784 1.00 39.59 ? 113 LYS A CG    1 
ATOM   1639 C  CD    . LYS C 3 117 ? -36.986 44.581 231.058 1.00 41.16 ? 113 LYS A CD    1 
ATOM   1640 C  CE    . LYS C 3 117 ? -37.657 45.207 232.276 1.00 41.74 ? 113 LYS A CE    1 
ATOM   1641 N  NZ    . LYS C 3 117 ? -39.046 44.709 232.424 1.00 40.42 ? 113 LYS A NZ    1 
ATOM   1642 N  N     . LEU C 3 118 ? -33.307 47.296 229.939 1.00 30.15 ? 114 LEU A N     1 
ATOM   1643 C  CA    . LEU C 3 118 ? -33.418 48.642 229.427 1.00 31.19 ? 114 LEU A CA    1 
ATOM   1644 C  C     . LEU C 3 118 ? -34.759 48.826 228.729 1.00 34.08 ? 114 LEU A C     1 
ATOM   1645 O  O     . LEU C 3 118 ? -35.327 49.920 228.712 1.00 35.18 ? 114 LEU A O     1 
ATOM   1646 C  CB    . LEU C 3 118 ? -32.287 48.935 228.433 1.00 27.14 ? 114 LEU A CB    1 
ATOM   1647 C  CG    . LEU C 3 118 ? -30.871 48.720 228.952 1.00 24.36 ? 114 LEU A CG    1 
ATOM   1648 C  CD1   . LEU C 3 118 ? -29.898 49.146 227.900 1.00 23.02 ? 114 LEU A CD1   1 
ATOM   1649 C  CD2   . LEU C 3 118 ? -30.659 49.499 230.247 1.00 22.39 ? 114 LEU A CD2   1 
ATOM   1650 N  N     . GLY C 3 119 ? -35.261 47.750 228.140 1.00 36.18 ? 115 GLY A N     1 
ATOM   1651 C  CA    . GLY C 3 119 ? -36.535 47.813 227.447 1.00 38.14 ? 115 GLY A CA    1 
ATOM   1652 C  C     . GLY C 3 119 ? -37.422 46.614 227.739 1.00 40.21 ? 115 GLY A C     1 
ATOM   1653 O  O     . GLY C 3 119 ? -37.766 46.330 228.887 1.00 40.22 ? 115 GLY A O     1 
ATOM   1654 N  N     . SER C 3 120 ? -37.776 45.901 226.678 1.00 42.11 ? 116 SER A N     1 
ATOM   1655 C  CA    . SER C 3 120 ? -38.621 44.728 226.773 1.00 44.32 ? 116 SER A CA    1 
ATOM   1656 C  C     . SER C 3 120 ? -37.827 43.557 227.327 1.00 45.42 ? 116 SER A C     1 
ATOM   1657 O  O     . SER C 3 120 ? -36.663 43.387 226.982 1.00 46.71 ? 116 SER A O     1 
ATOM   1658 C  CB    . SER C 3 120 ? -39.159 44.369 225.391 1.00 45.02 ? 116 SER A CB    1 
ATOM   1659 O  OG    . SER C 3 120 ? -40.142 43.354 225.495 1.00 49.13 ? 116 SER A OG    1 
ATOM   1660 N  N     . ILE C 3 121 ? -38.455 42.743 228.170 1.00 45.75 ? 117 ILE A N     1 
ATOM   1661 C  CA    . ILE C 3 121 ? -37.767 41.606 228.760 1.00 46.15 ? 117 ILE A CA    1 
ATOM   1662 C  C     . ILE C 3 121 ? -37.094 40.721 227.718 1.00 46.13 ? 117 ILE A C     1 
ATOM   1663 O  O     . ILE C 3 121 ? -36.144 40.022 228.031 1.00 46.17 ? 117 ILE A O     1 
ATOM   1664 C  CB    . ILE C 3 121 ? -38.723 40.743 229.599 1.00 46.53 ? 117 ILE A CB    1 
ATOM   1665 C  CG1   . ILE C 3 121 ? -39.496 41.625 230.576 1.00 46.61 ? 117 ILE A CG1   1 
ATOM   1666 C  CG2   . ILE C 3 121 ? -37.928 39.707 230.387 1.00 46.15 ? 117 ILE A CG2   1 
ATOM   1667 C  CD1   . ILE C 3 121 ? -40.488 40.882 231.414 1.00 46.10 ? 117 ILE A CD1   1 
ATOM   1668 N  N     . GLN C 3 122 ? -37.575 40.755 226.482 1.00 47.00 ? 118 GLN A N     1 
ATOM   1669 C  CA    . GLN C 3 122 ? -36.988 39.949 225.423 1.00 48.49 ? 118 GLN A CA    1 
ATOM   1670 C  C     . GLN C 3 122 ? -35.877 40.700 224.687 1.00 47.84 ? 118 GLN A C     1 
ATOM   1671 O  O     . GLN C 3 122 ? -35.115 40.106 223.929 1.00 47.76 ? 118 GLN A O     1 
ATOM   1672 C  CB    . GLN C 3 122 ? -38.066 39.531 224.416 1.00 52.61 ? 118 GLN A CB    1 
ATOM   1673 C  CG    . GLN C 3 122 ? -39.163 38.651 224.999 1.00 60.61 ? 118 GLN A CG    1 
ATOM   1674 C  CD    . GLN C 3 122 ? -40.197 39.441 225.809 1.00 64.49 ? 118 GLN A CD    1 
ATOM   1675 O  OE1   . GLN C 3 122 ? -40.946 38.870 226.620 1.00 65.70 ? 118 GLN A OE1   1 
ATOM   1676 N  NE2   . GLN C 3 122 ? -40.252 40.757 225.579 1.00 66.54 ? 118 GLN A NE2   1 
ATOM   1677 N  N     . ASP C 3 123 ? -35.792 42.011 224.901 1.00 46.68 ? 119 ASP A N     1 
ATOM   1678 C  CA    . ASP C 3 123 ? -34.776 42.829 224.236 1.00 43.88 ? 119 ASP A CA    1 
ATOM   1679 C  C     . ASP C 3 123 ? -33.345 42.336 224.486 1.00 40.53 ? 119 ASP A C     1 
ATOM   1680 O  O     . ASP C 3 123 ? -32.952 42.049 225.619 1.00 36.33 ? 119 ASP A O     1 
ATOM   1681 C  CB    . ASP C 3 123 ? -34.904 44.305 224.657 1.00 46.74 ? 119 ASP A CB    1 
ATOM   1682 C  CG    . ASP C 3 123 ? -36.089 45.006 224.000 1.00 50.30 ? 119 ASP A CG    1 
ATOM   1683 O  OD1   . ASP C 3 123 ? -36.493 44.583 222.893 1.00 52.16 ? 119 ASP A OD1   1 
ATOM   1684 O  OD2   . ASP C 3 123 ? -36.603 45.994 224.572 1.00 52.32 ? 119 ASP A OD2   1 
ATOM   1685 N  N     . LYS C 3 124 ? -32.575 42.234 223.405 1.00 37.21 ? 120 LYS A N     1 
ATOM   1686 C  CA    . LYS C 3 124 ? -31.194 41.793 223.486 1.00 34.03 ? 120 LYS A CA    1 
ATOM   1687 C  C     . LYS C 3 124 ? -30.385 42.868 224.182 1.00 33.51 ? 120 LYS A C     1 
ATOM   1688 O  O     . LYS C 3 124 ? -29.574 42.587 225.064 1.00 34.25 ? 120 LYS A O     1 
ATOM   1689 C  CB    . LYS C 3 124 ? -30.642 41.550 222.097 1.00 33.59 ? 120 LYS A CB    1 
ATOM   1690 N  N     . SER C 3 125 ? -30.634 44.115 223.809 1.00 31.10 ? 121 SER A N     1 
ATOM   1691 C  CA    . SER C 3 125 ? -29.907 45.228 224.389 1.00 27.25 ? 121 SER A CA    1 
ATOM   1692 C  C     . SER C 3 125 ? -30.163 45.431 225.864 1.00 25.26 ? 121 SER A C     1 
ATOM   1693 O  O     . SER C 3 125 ? -31.258 45.776 226.270 1.00 26.81 ? 121 SER A O     1 
ATOM   1694 C  CB    . SER C 3 125 ? -30.257 46.502 223.634 1.00 27.16 ? 121 SER A CB    1 
ATOM   1695 O  OG    . SER C 3 125 ? -29.971 46.345 222.249 1.00 28.70 ? 121 SER A OG    1 
ATOM   1696 N  N     . ARG C 3 126 ? -29.159 45.209 226.687 1.00 23.04 ? 122 ARG A N     1 
ATOM   1697 C  CA    . ARG C 3 126 ? -29.356 45.447 228.105 1.00 20.46 ? 122 ARG A CA    1 
ATOM   1698 C  C     . ARG C 3 126 ? -28.161 46.269 228.622 1.00 20.01 ? 122 ARG A C     1 
ATOM   1699 O  O     . ARG C 3 126 ? -27.190 46.516 227.896 1.00 18.91 ? 122 ARG A O     1 
ATOM   1700 C  CB    . ARG C 3 126 ? -29.471 44.121 228.867 1.00 20.36 ? 122 ARG A CB    1 
ATOM   1701 C  CG    . ARG C 3 126 ? -30.567 43.186 228.381 1.00 14.99 ? 122 ARG A CG    1 
ATOM   1702 C  CD    . ARG C 3 126 ? -30.540 41.869 229.140 1.00 13.18 ? 122 ARG A CD    1 
ATOM   1703 N  NE    . ARG C 3 126 ? -30.655 41.975 230.608 1.00 12.59 ? 122 ARG A NE    1 
ATOM   1704 C  CZ    . ARG C 3 126 ? -31.805 41.995 231.278 1.00 16.35 ? 122 ARG A CZ    1 
ATOM   1705 N  NH1   . ARG C 3 126 ? -32.948 41.932 230.607 1.00 16.59 ? 122 ARG A NH1   1 
ATOM   1706 N  NH2   . ARG C 3 126 ? -31.814 42.022 232.612 1.00 14.28 ? 122 ARG A NH2   1 
ATOM   1707 N  N     . GLY C 3 127 ? -28.239 46.674 229.882 1.00 17.84 ? 123 GLY A N     1 
ATOM   1708 C  CA    . GLY C 3 127 ? -27.184 47.463 230.444 1.00 16.78 ? 123 GLY A CA    1 
ATOM   1709 C  C     . GLY C 3 127 ? -27.504 48.052 231.796 1.00 19.59 ? 123 GLY A C     1 
ATOM   1710 O  O     . GLY C 3 127 ? -28.013 47.362 232.674 1.00 18.99 ? 123 GLY A O     1 
ATOM   1711 N  N     . TRP C 3 128 ? -27.218 49.346 231.962 1.00 20.22 ? 124 TRP A N     1 
ATOM   1712 C  CA    . TRP C 3 128 ? -27.433 50.044 233.238 1.00 18.84 ? 124 TRP A CA    1 
ATOM   1713 C  C     . TRP C 3 128 ? -28.277 51.308 233.077 1.00 19.13 ? 124 TRP A C     1 
ATOM   1714 O  O     . TRP C 3 128 ? -28.409 51.839 231.973 1.00 19.83 ? 124 TRP A O     1 
ATOM   1715 C  CB    . TRP C 3 128 ? -26.086 50.496 233.792 1.00 18.32 ? 124 TRP A CB    1 
ATOM   1716 C  CG    . TRP C 3 128 ? -25.281 49.536 234.556 1.00 17.37 ? 124 TRP A CG    1 
ATOM   1717 C  CD1   . TRP C 3 128 ? -25.419 49.219 235.877 1.00 16.84 ? 124 TRP A CD1   1 
ATOM   1718 C  CD2   . TRP C 3 128 ? -24.111 48.860 234.097 1.00 16.65 ? 124 TRP A CD2   1 
ATOM   1719 N  NE1   . TRP C 3 128 ? -24.399 48.394 236.271 1.00 18.94 ? 124 TRP A NE1   1 
ATOM   1720 C  CE2   . TRP C 3 128 ? -23.584 48.158 235.197 1.00 18.48 ? 124 TRP A CE2   1 
ATOM   1721 C  CE3   . TRP C 3 128 ? -23.460 48.783 232.866 1.00 19.56 ? 124 TRP A CE3   1 
ATOM   1722 C  CZ2   . TRP C 3 128 ? -22.421 47.387 235.098 1.00 18.43 ? 124 TRP A CZ2   1 
ATOM   1723 C  CZ3   . TRP C 3 128 ? -22.304 48.015 232.766 1.00 21.84 ? 124 TRP A CZ3   1 
ATOM   1724 C  CH2   . TRP C 3 128 ? -21.798 47.328 233.877 1.00 21.06 ? 124 TRP A CH2   1 
ATOM   1725 N  N     . TRP C 3 129 ? -28.836 51.773 234.191 1.00 17.27 ? 125 TRP A N     1 
ATOM   1726 C  CA    . TRP C 3 129 ? -29.573 53.033 234.223 1.00 19.37 ? 125 TRP A CA    1 
ATOM   1727 C  C     . TRP C 3 129 ? -28.686 53.945 235.100 1.00 21.62 ? 125 TRP A C     1 
ATOM   1728 O  O     . TRP C 3 129 ? -28.334 53.578 236.239 1.00 21.14 ? 125 TRP A O     1 
ATOM   1729 C  CB    . TRP C 3 129 ? -31.000 52.902 234.853 1.00 21.42 ? 125 TRP A CB    1 
ATOM   1730 C  CG    . TRP C 3 129 ? -32.063 52.395 233.880 1.00 21.74 ? 125 TRP A CG    1 
ATOM   1731 C  CD1   . TRP C 3 129 ? -32.546 51.111 233.793 1.00 20.79 ? 125 TRP A CD1   1 
ATOM   1732 C  CD2   . TRP C 3 129 ? -32.558 53.077 232.711 1.00 20.69 ? 125 TRP A CD2   1 
ATOM   1733 N  NE1   . TRP C 3 129 ? -33.267 50.951 232.636 1.00 21.64 ? 125 TRP A NE1   1 
ATOM   1734 C  CE2   . TRP C 3 129 ? -33.282 52.133 231.948 1.00 20.78 ? 125 TRP A CE2   1 
ATOM   1735 C  CE3   . TRP C 3 129 ? -32.428 54.378 232.219 1.00 22.81 ? 125 TRP A CE3   1 
ATOM   1736 C  CZ2   . TRP C 3 129 ? -33.892 52.458 230.724 1.00 20.21 ? 125 TRP A CZ2   1 
ATOM   1737 C  CZ3   . TRP C 3 129 ? -33.041 54.704 230.987 1.00 22.42 ? 125 TRP A CZ3   1 
ATOM   1738 C  CH2   . TRP C 3 129 ? -33.747 53.745 230.257 1.00 20.07 ? 125 TRP A CH2   1 
ATOM   1739 N  N     . VAL C 3 130 ? -28.276 55.106 234.583 1.00 19.91 ? 126 VAL A N     1 
ATOM   1740 C  CA    . VAL C 3 130 ? -27.442 55.988 235.408 1.00 20.15 ? 126 VAL A CA    1 
ATOM   1741 C  C     . VAL C 3 130 ? -28.025 57.355 235.669 1.00 20.88 ? 126 VAL A C     1 
ATOM   1742 O  O     . VAL C 3 130 ? -28.418 58.058 234.742 1.00 21.24 ? 126 VAL A O     1 
ATOM   1743 C  CB    . VAL C 3 130 ? -26.020 56.226 234.818 1.00 20.96 ? 126 VAL A CB    1 
ATOM   1744 C  CG1   . VAL C 3 130 ? -25.190 57.017 235.844 1.00 18.02 ? 126 VAL A CG1   1 
ATOM   1745 C  CG2   . VAL C 3 130 ? -25.339 54.902 234.493 1.00 20.87 ? 126 VAL A CG2   1 
ATOM   1746 N  N     . HIS C 3 131 ? -28.048 57.731 236.938 1.00 19.49 ? 127 HIS A N     1 
ATOM   1747 C  CA    . HIS C 3 131 ? -28.568 59.021 237.316 1.00 22.01 ? 127 HIS A CA    1 
ATOM   1748 C  C     . HIS C 3 131 ? -27.434 59.923 237.781 1.00 23.79 ? 127 HIS A C     1 
ATOM   1749 O  O     . HIS C 3 131 ? -26.859 59.740 238.862 1.00 23.81 ? 127 HIS A O     1 
ATOM   1750 C  CB    . HIS C 3 131 ? -29.611 58.863 238.417 1.00 24.03 ? 127 HIS A CB    1 
ATOM   1751 C  CG    . HIS C 3 131 ? -30.387 60.110 238.680 1.00 22.84 ? 127 HIS A CG    1 
ATOM   1752 N  ND1   . HIS C 3 131 ? -31.122 60.745 237.700 1.00 20.76 ? 127 HIS A ND1   1 
ATOM   1753 C  CD2   . HIS C 3 131 ? -30.500 60.868 239.796 1.00 21.68 ? 127 HIS A CD2   1 
ATOM   1754 C  CE1   . HIS C 3 131 ? -31.649 61.846 238.204 1.00 23.45 ? 127 HIS A CE1   1 
ATOM   1755 N  NE2   . HIS C 3 131 ? -31.286 61.944 239.473 1.00 22.64 ? 127 HIS A NE2   1 
ATOM   1756 N  N     . SER C 3 132 ? -27.122 60.900 236.938 1.00 24.72 ? 128 SER A N     1 
ATOM   1757 C  CA    . SER C 3 132 ? -26.027 61.827 237.191 1.00 25.69 ? 128 SER A CA    1 
ATOM   1758 C  C     . SER C 3 132 ? -26.435 63.242 237.565 1.00 28.05 ? 128 SER A C     1 
ATOM   1759 O  O     . SER C 3 132 ? -27.539 63.702 237.267 1.00 29.60 ? 128 SER A O     1 
ATOM   1760 C  CB    . SER C 3 132 ? -25.121 61.886 235.962 1.00 21.25 ? 128 SER A CB    1 
ATOM   1761 O  OG    . SER C 3 132 ? -25.017 60.613 235.361 1.00 18.96 ? 128 SER A OG    1 
ATOM   1762 N  N     . VAL C 3 133 ? -25.500 63.925 238.206 1.00 29.00 ? 129 VAL A N     1 
ATOM   1763 C  CA    . VAL C 3 133 ? -25.684 65.292 238.635 1.00 29.94 ? 129 VAL A CA    1 
ATOM   1764 C  C     . VAL C 3 133 ? -24.418 66.008 238.194 1.00 30.73 ? 129 VAL A C     1 
ATOM   1765 O  O     . VAL C 3 133 ? -23.359 65.813 238.783 1.00 32.08 ? 129 VAL A O     1 
ATOM   1766 C  CB    . VAL C 3 133 ? -25.786 65.364 240.145 1.00 30.88 ? 129 VAL A CB    1 
ATOM   1767 C  CG1   . VAL C 3 133 ? -26.168 66.766 240.575 1.00 31.01 ? 129 VAL A CG1   1 
ATOM   1768 C  CG2   . VAL C 3 133 ? -26.791 64.335 240.626 1.00 31.14 ? 129 VAL A CG2   1 
ATOM   1769 N  N     . LEU C 3 134 ? -24.537 66.799 237.133 1.00 29.63 ? 130 LEU A N     1 
ATOM   1770 C  CA    . LEU C 3 134 ? -23.432 67.559 236.575 1.00 29.88 ? 130 LEU A CA    1 
ATOM   1771 C  C     . LEU C 3 134 ? -23.455 68.984 237.149 1.00 30.42 ? 130 LEU A C     1 
ATOM   1772 O  O     . LEU C 3 134 ? -24.498 69.634 237.098 1.00 31.98 ? 130 LEU A O     1 
ATOM   1773 C  CB    . LEU C 3 134 ? -23.577 67.619 235.051 1.00 28.62 ? 130 LEU A CB    1 
ATOM   1774 C  CG    . LEU C 3 134 ? -22.373 68.160 234.266 1.00 28.79 ? 130 LEU A CG    1 
ATOM   1775 C  CD1   . LEU C 3 134 ? -21.214 67.209 234.481 1.00 28.04 ? 130 LEU A CD1   1 
ATOM   1776 C  CD2   . LEU C 3 134 ? -22.690 68.289 232.777 1.00 27.50 ? 130 LEU A CD2   1 
ATOM   1777 N  N     . LEU C 3 135 ? -22.331 69.477 237.691 1.00 30.69 ? 131 LEU A N     1 
ATOM   1778 C  CA    . LEU C 3 135 ? -22.285 70.846 238.256 1.00 28.66 ? 131 LEU A CA    1 
ATOM   1779 C  C     . LEU C 3 135 ? -21.789 71.916 237.301 1.00 28.12 ? 131 LEU A C     1 
ATOM   1780 O  O     . LEU C 3 135 ? -20.885 71.678 236.517 1.00 27.23 ? 131 LEU A O     1 
ATOM   1781 C  CB    . LEU C 3 135 ? -21.427 70.901 239.515 1.00 27.84 ? 131 LEU A CB    1 
ATOM   1782 C  CG    . LEU C 3 135 ? -22.198 71.115 240.820 1.00 30.35 ? 131 LEU A CG    1 
ATOM   1783 C  CD1   . LEU C 3 135 ? -21.215 71.214 242.003 1.00 28.54 ? 131 LEU A CD1   1 
ATOM   1784 C  CD2   . LEU C 3 135 ? -23.023 72.378 240.710 1.00 31.75 ? 131 LEU A CD2   1 
ATOM   1785 N  N     . LEU C 3 136 ? -22.400 73.094 237.375 1.00 29.69 ? 132 LEU A N     1 
ATOM   1786 C  CA    . LEU C 3 136 ? -22.020 74.240 236.548 1.00 30.72 ? 132 LEU A CA    1 
ATOM   1787 C  C     . LEU C 3 136 ? -22.009 75.488 237.414 1.00 32.88 ? 132 LEU A C     1 
ATOM   1788 O  O     . LEU C 3 136 ? -22.552 75.481 238.522 1.00 33.95 ? 132 LEU A O     1 
ATOM   1789 C  CB    . LEU C 3 136 ? -23.018 74.453 235.424 1.00 27.89 ? 132 LEU A CB    1 
ATOM   1790 C  CG    . LEU C 3 136 ? -23.390 73.229 234.625 1.00 28.30 ? 132 LEU A CG    1 
ATOM   1791 C  CD1   . LEU C 3 136 ? -24.136 73.693 233.388 1.00 26.27 ? 132 LEU A CD1   1 
ATOM   1792 C  CD2   . LEU C 3 136 ? -22.150 72.444 234.227 1.00 28.55 ? 132 LEU A CD2   1 
ATOM   1793 N  N     . GLU C 3 137 ? -21.401 76.563 236.921 1.00 34.89 ? 133 GLU A N     1 
ATOM   1794 C  CA    . GLU C 3 137 ? -21.403 77.815 237.678 1.00 37.45 ? 133 GLU A CA    1 
ATOM   1795 C  C     . GLU C 3 137 ? -22.484 78.686 237.043 1.00 38.19 ? 133 GLU A C     1 
ATOM   1796 O  O     . GLU C 3 137 ? -22.496 78.891 235.833 1.00 37.18 ? 133 GLU A O     1 
ATOM   1797 C  CB    . GLU C 3 137 ? -20.018 78.480 237.655 1.00 38.29 ? 133 GLU A CB    1 
ATOM   1798 C  CG    . GLU C 3 137 ? -19.273 78.399 236.342 1.00 39.11 ? 133 GLU A CG    1 
ATOM   1799 C  CD    . GLU C 3 137 ? -19.483 79.616 235.467 1.00 41.01 ? 133 GLU A CD    1 
ATOM   1800 O  OE1   . GLU C 3 137 ? -18.861 79.673 234.386 1.00 41.80 ? 133 GLU A OE1   1 
ATOM   1801 O  OE2   . GLU C 3 137 ? -20.263 80.518 235.852 1.00 41.56 ? 133 GLU A OE2   1 
ATOM   1802 N  N     . ALA C 3 138 ? -23.416 79.165 237.861 1.00 39.43 ? 134 ALA A N     1 
ATOM   1803 C  CA    . ALA C 3 138 ? -24.545 79.965 237.367 1.00 42.69 ? 134 ALA A CA    1 
ATOM   1804 C  C     . ALA C 3 138 ? -24.198 81.309 236.736 1.00 44.84 ? 134 ALA A C     1 
ATOM   1805 O  O     . ALA C 3 138 ? -25.073 82.010 236.237 1.00 46.21 ? 134 ALA A O     1 
ATOM   1806 C  CB    . ALA C 3 138 ? -25.545 80.188 238.490 1.00 43.55 ? 134 ALA A CB    1 
ATOM   1807 N  N     . THR C 3 139 ? -22.925 81.666 236.749 1.00 46.08 ? 135 THR A N     1 
ATOM   1808 C  CA    . THR C 3 139 ? -22.502 82.932 236.196 1.00 45.92 ? 135 THR A CA    1 
ATOM   1809 C  C     . THR C 3 139 ? -22.205 82.852 234.713 1.00 45.93 ? 135 THR A C     1 
ATOM   1810 O  O     . THR C 3 139 ? -23.002 83.298 233.889 1.00 46.80 ? 135 THR A O     1 
ATOM   1811 C  CB    . THR C 3 139 ? -21.303 83.410 236.958 1.00 47.22 ? 135 THR A CB    1 
ATOM   1812 O  OG1   . THR C 3 139 ? -20.957 82.410 237.925 1.00 47.67 ? 135 THR A OG1   1 
ATOM   1813 C  CG2   . THR C 3 139 ? -21.629 84.692 237.689 1.00 47.12 ? 135 THR A CG2   1 
ATOM   1814 N  N     . THR C 3 140 ? -21.072 82.266 234.361 1.00 45.91 ? 136 THR A N     1 
ATOM   1815 C  CA    . THR C 3 140 ? -20.710 82.138 232.953 1.00 45.82 ? 136 THR A CA    1 
ATOM   1816 C  C     . THR C 3 140 ? -21.244 80.817 232.402 1.00 45.19 ? 136 THR A C     1 
ATOM   1817 O  O     . THR C 3 140 ? -21.245 80.591 231.192 1.00 44.72 ? 136 THR A O     1 
ATOM   1818 C  CB    . THR C 3 140 ? -19.169 82.173 232.762 1.00 46.36 ? 136 THR A CB    1 
ATOM   1819 O  OG1   . THR C 3 140 ? -18.581 83.070 233.715 1.00 47.19 ? 136 THR A OG1   1 
ATOM   1820 C  CG2   . THR C 3 140 ? -18.838 82.661 231.366 1.00 46.59 ? 136 THR A CG2   1 
ATOM   1821 N  N     . PHE C 3 141 ? -21.695 79.953 233.311 1.00 45.65 ? 137 PHE A N     1 
ATOM   1822 C  CA    . PHE C 3 141 ? -22.242 78.635 232.985 1.00 45.45 ? 137 PHE A CA    1 
ATOM   1823 C  C     . PHE C 3 141 ? -21.209 77.672 232.421 1.00 45.23 ? 137 PHE A C     1 
ATOM   1824 O  O     . PHE C 3 141 ? -21.422 77.081 231.360 1.00 45.72 ? 137 PHE A O     1 
ATOM   1825 C  CB    . PHE C 3 141 ? -23.400 78.748 231.992 1.00 45.37 ? 137 PHE A CB    1 
ATOM   1826 C  CG    . PHE C 3 141 ? -24.503 79.631 232.450 1.00 46.11 ? 137 PHE A CG    1 
ATOM   1827 C  CD1   . PHE C 3 141 ? -24.765 80.817 231.789 1.00 46.80 ? 137 PHE A CD1   1 
ATOM   1828 C  CD2   . PHE C 3 141 ? -25.264 79.295 233.557 1.00 47.81 ? 137 PHE A CD2   1 
ATOM   1829 C  CE1   . PHE C 3 141 ? -25.778 81.660 232.212 1.00 47.81 ? 137 PHE A CE1   1 
ATOM   1830 C  CE2   . PHE C 3 141 ? -26.286 80.132 233.996 1.00 49.41 ? 137 PHE A CE2   1 
ATOM   1831 C  CZ    . PHE C 3 141 ? -26.537 81.320 233.321 1.00 49.76 ? 137 PHE A CZ    1 
ATOM   1832 N  N     . ARG C 3 142 ? -20.089 77.522 233.125 1.00 44.74 ? 138 ARG A N     1 
ATOM   1833 C  CA    . ARG C 3 142 ? -19.024 76.600 232.715 1.00 43.06 ? 138 ARG A CA    1 
ATOM   1834 C  C     . ARG C 3 142 ? -19.224 75.299 233.477 1.00 39.59 ? 138 ARG A C     1 
ATOM   1835 O  O     . ARG C 3 142 ? -19.743 75.298 234.591 1.00 38.42 ? 138 ARG A O     1 
ATOM   1836 C  CB    . ARG C 3 142 ? -17.636 77.158 233.065 1.00 46.66 ? 138 ARG A CB    1 
ATOM   1837 C  CG    . ARG C 3 142 ? -17.234 78.421 232.336 1.00 50.59 ? 138 ARG A CG    1 
ATOM   1838 C  CD    . ARG C 3 142 ? -17.100 78.175 230.853 1.00 55.09 ? 138 ARG A CD    1 
ATOM   1839 N  NE    . ARG C 3 142 ? -17.139 79.419 230.091 1.00 59.67 ? 138 ARG A NE    1 
ATOM   1840 C  CZ    . ARG C 3 142 ? -17.247 79.480 228.765 1.00 62.14 ? 138 ARG A CZ    1 
ATOM   1841 N  NH1   . ARG C 3 142 ? -17.284 80.656 228.150 1.00 63.31 ? 138 ARG A NH1   1 
ATOM   1842 N  NH2   . ARG C 3 142 ? -17.318 78.367 228.047 1.00 63.14 ? 138 ARG A NH2   1 
ATOM   1843 N  N     . THR C 3 143 ? -18.786 74.199 232.884 1.00 36.49 ? 139 THR A N     1 
ATOM   1844 C  CA    . THR C 3 143 ? -18.931 72.893 233.516 1.00 34.67 ? 139 THR A CA    1 
ATOM   1845 C  C     . THR C 3 143 ? -17.884 72.614 234.606 1.00 34.25 ? 139 THR A C     1 
ATOM   1846 O  O     . THR C 3 143 ? -16.722 72.339 234.308 1.00 33.39 ? 139 THR A O     1 
ATOM   1847 C  CB    . THR C 3 143 ? -18.848 71.771 232.468 1.00 33.04 ? 139 THR A CB    1 
ATOM   1848 O  OG1   . THR C 3 143 ? -19.683 72.099 231.355 1.00 32.39 ? 139 THR A OG1   1 
ATOM   1849 C  CG2   . THR C 3 143 ? -19.312 70.459 233.062 1.00 31.64 ? 139 THR A CG2   1 
ATOM   1850 N  N     . VAL C 3 144 ? -18.300 72.671 235.864 1.00 32.83 ? 140 VAL A N     1 
ATOM   1851 C  CA    . VAL C 3 144 ? -17.386 72.412 236.954 1.00 33.39 ? 140 VAL A CA    1 
ATOM   1852 C  C     . VAL C 3 144 ? -17.001 70.937 236.974 1.00 35.33 ? 140 VAL A C     1 
ATOM   1853 O  O     . VAL C 3 144 ? -15.814 70.604 237.041 1.00 35.90 ? 140 VAL A O     1 
ATOM   1854 C  CB    . VAL C 3 144 ? -18.008 72.816 238.303 1.00 33.14 ? 140 VAL A CB    1 
ATOM   1855 C  CG1   . VAL C 3 144 ? -17.009 72.621 239.429 1.00 32.59 ? 140 VAL A CG1   1 
ATOM   1856 C  CG2   . VAL C 3 144 ? -18.447 74.279 238.242 1.00 33.05 ? 140 VAL A CG2   1 
ATOM   1857 N  N     . GLY C 3 145 ? -18.008 70.061 236.901 1.00 36.86 ? 141 GLY A N     1 
ATOM   1858 C  CA    . GLY C 3 145 ? -17.782 68.618 236.905 1.00 35.85 ? 141 GLY A CA    1 
ATOM   1859 C  C     . GLY C 3 145 ? -18.917 67.771 237.475 1.00 35.86 ? 141 GLY A C     1 
ATOM   1860 O  O     . GLY C 3 145 ? -19.920 68.302 237.937 1.00 36.63 ? 141 GLY A O     1 
ATOM   1861 N  N     . LEU C 3 146 ? -18.750 66.447 237.434 1.00 35.22 ? 142 LEU A N     1 
ATOM   1862 C  CA    . LEU C 3 146 ? -19.729 65.480 237.942 1.00 32.09 ? 142 LEU A CA    1 
ATOM   1863 C  C     . LEU C 3 146 ? -19.762 65.465 239.453 1.00 31.98 ? 142 LEU A C     1 
ATOM   1864 O  O     . LEU C 3 146 ? -18.753 65.160 240.092 1.00 32.68 ? 142 LEU A O     1 
ATOM   1865 C  CB    . LEU C 3 146 ? -19.376 64.071 237.460 1.00 31.11 ? 142 LEU A CB    1 
ATOM   1866 C  CG    . LEU C 3 146 ? -19.848 63.703 236.059 1.00 29.83 ? 142 LEU A CG    1 
ATOM   1867 C  CD1   . LEU C 3 146 ? -19.167 62.449 235.555 1.00 26.16 ? 142 LEU A CD1   1 
ATOM   1868 C  CD2   . LEU C 3 146 ? -21.363 63.538 236.111 1.00 29.66 ? 142 LEU A CD2   1 
ATOM   1869 N  N     . LEU C 3 147 ? -20.925 65.748 240.036 1.00 32.31 ? 143 LEU A N     1 
ATOM   1870 C  CA    . LEU C 3 147 ? -21.040 65.766 241.500 1.00 31.02 ? 143 LEU A CA    1 
ATOM   1871 C  C     . LEU C 3 147 ? -21.517 64.453 242.109 1.00 30.90 ? 143 LEU A C     1 
ATOM   1872 O  O     . LEU C 3 147 ? -21.149 64.111 243.229 1.00 32.61 ? 143 LEU A O     1 
ATOM   1873 C  CB    . LEU C 3 147 ? -21.958 66.911 241.927 1.00 27.91 ? 143 LEU A CB    1 
ATOM   1874 C  CG    . LEU C 3 147 ? -22.390 66.998 243.386 1.00 28.30 ? 143 LEU A CG    1 
ATOM   1875 C  CD1   . LEU C 3 147 ? -21.218 66.845 244.323 1.00 27.21 ? 143 LEU A CD1   1 
ATOM   1876 C  CD2   . LEU C 3 147 ? -23.088 68.354 243.597 1.00 27.56 ? 143 LEU A CD2   1 
ATOM   1877 N  N     . HIS C 3 148 ? -22.328 63.716 241.366 1.00 32.41 ? 144 HIS A N     1 
ATOM   1878 C  CA    . HIS C 3 148 ? -22.861 62.452 241.856 1.00 32.60 ? 144 HIS A CA    1 
ATOM   1879 C  C     . HIS C 3 148 ? -23.339 61.608 240.700 1.00 31.67 ? 144 HIS A C     1 
ATOM   1880 O  O     . HIS C 3 148 ? -23.653 62.095 239.607 1.00 30.50 ? 144 HIS A O     1 
ATOM   1881 C  CB    . HIS C 3 148 ? -24.043 62.701 242.808 1.00 35.47 ? 144 HIS A CB    1 
ATOM   1882 C  CG    . HIS C 3 148 ? -24.970 61.528 242.978 1.00 38.21 ? 144 HIS A CG    1 
ATOM   1883 N  ND1   . HIS C 3 148 ? -24.750 60.531 243.906 1.00 38.85 ? 144 HIS A ND1   1 
ATOM   1884 C  CD2   . HIS C 3 148 ? -26.151 61.231 242.380 1.00 37.81 ? 144 HIS A CD2   1 
ATOM   1885 C  CE1   . HIS C 3 148 ? -25.759 59.677 243.877 1.00 38.57 ? 144 HIS A CE1   1 
ATOM   1886 N  NE2   . HIS C 3 148 ? -26.622 60.078 242.961 1.00 38.29 ? 144 HIS A NE2   1 
ATOM   1887 N  N     . GLN C 3 149 ? -23.385 60.315 240.955 1.00 30.93 ? 145 GLN A N     1 
ATOM   1888 C  CA    . GLN C 3 149 ? -23.864 59.377 239.966 1.00 29.94 ? 145 GLN A CA    1 
ATOM   1889 C  C     . GLN C 3 149 ? -24.372 58.146 240.666 1.00 30.30 ? 145 GLN A C     1 
ATOM   1890 O  O     . GLN C 3 149 ? -23.766 57.658 241.625 1.00 30.70 ? 145 GLN A O     1 
ATOM   1891 C  CB    . GLN C 3 149 ? -22.761 59.022 238.962 1.00 27.24 ? 145 GLN A CB    1 
ATOM   1892 C  CG    . GLN C 3 149 ? -23.002 59.641 237.601 1.00 23.06 ? 145 GLN A CG    1 
ATOM   1893 C  CD    . GLN C 3 149 ? -22.156 59.024 236.515 1.00 20.51 ? 145 GLN A CD    1 
ATOM   1894 O  OE1   . GLN C 3 149 ? -22.389 59.254 235.326 1.00 20.06 ? 145 GLN A OE1   1 
ATOM   1895 N  NE2   . GLN C 3 149 ? -21.169 58.233 236.910 1.00 19.50 ? 145 GLN A NE2   1 
ATOM   1896 N  N     . GLU C 3 150 ? -25.522 57.676 240.205 1.00 32.03 ? 146 GLU A N     1 
ATOM   1897 C  CA    . GLU C 3 150 ? -26.117 56.462 240.748 1.00 33.18 ? 146 GLU A CA    1 
ATOM   1898 C  C     . GLU C 3 150 ? -26.257 55.466 239.629 1.00 32.35 ? 146 GLU A C     1 
ATOM   1899 O  O     . GLU C 3 150 ? -26.890 55.741 238.599 1.00 31.90 ? 146 GLU A O     1 
ATOM   1900 C  CB    . GLU C 3 150 ? -27.488 56.710 241.368 1.00 35.89 ? 146 GLU A CB    1 
ATOM   1901 C  CG    . GLU C 3 150 ? -28.145 55.412 241.835 1.00 41.44 ? 146 GLU A CG    1 
ATOM   1902 C  CD    . GLU C 3 150 ? -29.284 55.617 242.844 1.00 43.94 ? 146 GLU A CD    1 
ATOM   1903 O  OE1   . GLU C 3 150 ? -29.784 54.606 243.388 1.00 44.67 ? 146 GLU A OE1   1 
ATOM   1904 O  OE2   . GLU C 3 150 ? -29.682 56.779 243.100 1.00 45.73 ? 146 GLU A OE2   1 
ATOM   1905 N  N     . TRP C 3 151 ? -25.640 54.309 239.830 1.00 31.33 ? 147 TRP A N     1 
ATOM   1906 C  CA    . TRP C 3 151 ? -25.679 53.233 238.841 1.00 31.20 ? 147 TRP A CA    1 
ATOM   1907 C  C     . TRP C 3 151 ? -26.575 52.132 239.387 1.00 29.80 ? 147 TRP A C     1 
ATOM   1908 O  O     . TRP C 3 151 ? -26.536 51.847 240.579 1.00 29.02 ? 147 TRP A O     1 
ATOM   1909 C  CB    . TRP C 3 151 ? -24.264 52.667 238.604 1.00 32.35 ? 147 TRP A CB    1 
ATOM   1910 C  CG    . TRP C 3 151 ? -23.352 53.495 237.721 1.00 32.40 ? 147 TRP A CG    1 
ATOM   1911 C  CD1   . TRP C 3 151 ? -23.069 54.827 237.841 1.00 31.82 ? 147 TRP A CD1   1 
ATOM   1912 C  CD2   . TRP C 3 151 ? -22.602 53.028 236.593 1.00 32.16 ? 147 TRP A CD2   1 
ATOM   1913 N  NE1   . TRP C 3 151 ? -22.177 55.215 236.868 1.00 31.25 ? 147 TRP A NE1   1 
ATOM   1914 C  CE2   . TRP C 3 151 ? -21.853 54.125 236.105 1.00 31.75 ? 147 TRP A CE2   1 
ATOM   1915 C  CE3   . TRP C 3 151 ? -22.443 51.775 235.986 1.00 32.17 ? 147 TRP A CE3   1 
ATOM   1916 C  CZ2   . TRP C 3 151 ? -21.015 54.022 234.991 1.00 31.50 ? 147 TRP A CZ2   1 
ATOM   1917 C  CZ3   . TRP C 3 151 ? -21.607 51.671 234.883 1.00 31.59 ? 147 TRP A CZ3   1 
ATOM   1918 C  CH2   . TRP C 3 151 ? -20.879 52.786 234.414 1.00 31.92 ? 147 TRP A CH2   1 
ATOM   1919 N  N     . TRP C 3 152 ? -27.397 51.538 238.527 1.00 28.85 ? 148 TRP A N     1 
ATOM   1920 C  CA    . TRP C 3 152 ? -28.279 50.452 238.955 1.00 29.07 ? 148 TRP A CA    1 
ATOM   1921 C  C     . TRP C 3 152 ? -28.853 49.696 237.777 1.00 29.08 ? 148 TRP A C     1 
ATOM   1922 O  O     . TRP C 3 152 ? -29.040 50.244 236.677 1.00 27.19 ? 148 TRP A O     1 
ATOM   1923 C  CB    . TRP C 3 152 ? -29.421 50.968 239.866 1.00 29.83 ? 148 TRP A CB    1 
ATOM   1924 C  CG    . TRP C 3 152 ? -30.668 51.375 239.155 1.00 30.90 ? 148 TRP A CG    1 
ATOM   1925 C  CD1   . TRP C 3 152 ? -31.647 50.554 238.683 1.00 30.48 ? 148 TRP A CD1   1 
ATOM   1926 C  CD2   . TRP C 3 152 ? -31.014 52.698 238.729 1.00 32.93 ? 148 TRP A CD2   1 
ATOM   1927 N  NE1   . TRP C 3 152 ? -32.574 51.279 237.975 1.00 31.53 ? 148 TRP A NE1   1 
ATOM   1928 C  CE2   . TRP C 3 152 ? -32.210 52.601 237.986 1.00 31.68 ? 148 TRP A CE2   1 
ATOM   1929 C  CE3   . TRP C 3 152 ? -30.421 53.959 238.897 1.00 32.02 ? 148 TRP A CE3   1 
ATOM   1930 C  CZ2   . TRP C 3 152 ? -32.829 53.708 237.410 1.00 31.41 ? 148 TRP A CZ2   1 
ATOM   1931 C  CZ3   . TRP C 3 152 ? -31.040 55.064 238.320 1.00 32.31 ? 148 TRP A CZ3   1 
ATOM   1932 C  CH2   . TRP C 3 152 ? -32.229 54.928 237.585 1.00 32.29 ? 148 TRP A CH2   1 
ATOM   1933 N  N     . MET C 3 153 ? -29.108 48.416 238.016 1.00 30.57 ? 149 MET A N     1 
ATOM   1934 C  CA    . MET C 3 153 ? -29.672 47.539 237.000 1.00 32.19 ? 149 MET A CA    1 
ATOM   1935 C  C     . MET C 3 153 ? -31.142 47.329 237.300 1.00 31.17 ? 149 MET A C     1 
ATOM   1936 O  O     . MET C 3 153 ? -31.537 47.123 238.445 1.00 30.28 ? 149 MET A O     1 
ATOM   1937 C  CB    . MET C 3 153 ? -28.951 46.190 236.999 1.00 33.25 ? 149 MET A CB    1 
ATOM   1938 C  CG    . MET C 3 153 ? -27.578 46.222 236.394 1.00 36.55 ? 149 MET A CG    1 
ATOM   1939 S  SD    . MET C 3 153 ? -26.706 44.676 236.638 1.00 40.79 ? 149 MET A SD    1 
ATOM   1940 C  CE    . MET C 3 153 ? -26.225 44.841 238.365 1.00 37.29 ? 149 MET A CE    1 
ATOM   1941 N  N     . ARG C 3 154 ? -31.950 47.403 236.260 1.00 30.52 ? 150 ARG A N     1 
ATOM   1942 C  CA    . ARG C 3 154 ? -33.374 47.208 236.405 1.00 31.19 ? 150 ARG A CA    1 
ATOM   1943 C  C     . ARG C 3 154 ? -33.681 45.736 236.189 1.00 32.07 ? 150 ARG A C     1 
ATOM   1944 O  O     . ARG C 3 154 ? -33.314 45.162 235.149 1.00 32.13 ? 150 ARG A O     1 
ATOM   1945 C  CB    . ARG C 3 154 ? -34.109 48.059 235.377 1.00 30.80 ? 150 ARG A CB    1 
ATOM   1946 C  CG    . ARG C 3 154 ? -35.589 47.791 235.252 1.00 26.59 ? 150 ARG A CG    1 
ATOM   1947 C  CD    . ARG C 3 154 ? -36.176 48.657 234.153 1.00 22.33 ? 150 ARG A CD    1 
ATOM   1948 N  NE    . ARG C 3 154 ? -36.069 50.067 234.489 1.00 19.53 ? 150 ARG A NE    1 
ATOM   1949 C  CZ    . ARG C 3 154 ? -36.311 51.061 233.641 1.00 21.01 ? 150 ARG A CZ    1 
ATOM   1950 N  NH1   . ARG C 3 154 ? -36.675 50.784 232.393 1.00 19.73 ? 150 ARG A NH1   1 
ATOM   1951 N  NH2   . ARG C 3 154 ? -36.192 52.336 234.038 1.00 20.00 ? 150 ARG A NH2   1 
ATOM   1952 N  N     . PRO C 3 155 ? -34.342 45.106 237.176 1.00 32.20 ? 151 PRO A N     1 
ATOM   1953 C  CA    . PRO C 3 155 ? -34.707 43.693 237.109 1.00 33.06 ? 151 PRO A CA    1 
ATOM   1954 C  C     . PRO C 3 155 ? -35.743 43.470 236.041 1.00 34.80 ? 151 PRO A C     1 
ATOM   1955 O  O     . PRO C 3 155 ? -36.415 44.411 235.619 1.00 35.20 ? 151 PRO A O     1 
ATOM   1956 C  CB    . PRO C 3 155 ? -35.209 43.397 238.516 1.00 31.96 ? 151 PRO A CB    1 
ATOM   1957 C  CG    . PRO C 3 155 ? -35.721 44.715 238.968 1.00 31.93 ? 151 PRO A CG    1 
ATOM   1958 C  CD    . PRO C 3 155 ? -34.739 45.696 238.465 1.00 31.05 ? 151 PRO A CD    1 
ATOM   1959 N  N     . ASP C 3 156 ? -35.852 42.235 235.572 1.00 37.21 ? 152 ASP A N     1 
ATOM   1960 C  CA    . ASP C 3 156 ? -36.831 41.926 234.538 1.00 41.35 ? 152 ASP A CA    1 
ATOM   1961 C  C     . ASP C 3 156 ? -38.233 42.091 235.125 1.00 42.27 ? 152 ASP A C     1 
ATOM   1962 O  O     . ASP C 3 156 ? -39.130 42.631 234.477 1.00 41.07 ? 152 ASP A O     1 
ATOM   1963 C  CB    . ASP C 3 156 ? -36.596 40.505 234.025 1.00 43.77 ? 152 ASP A CB    1 
ATOM   1964 C  CG    . ASP C 3 156 ? -35.385 40.417 233.099 1.00 46.90 ? 152 ASP A CG    1 
ATOM   1965 O  OD1   . ASP C 3 156 ? -34.575 41.373 233.058 1.00 48.67 ? 152 ASP A OD1   1 
ATOM   1966 O  OD2   . ASP C 3 156 ? -35.240 39.392 232.406 1.00 48.76 ? 152 ASP A OD2   1 
ATOM   1967 N  N     . ASP C 3 157 ? -38.392 41.650 236.369 1.00 43.16 ? 153 ASP A N     1 
ATOM   1968 C  CA    . ASP C 3 157 ? -39.654 41.749 237.070 1.00 44.72 ? 153 ASP A CA    1 
ATOM   1969 C  C     . ASP C 3 157 ? -39.558 42.836 238.140 1.00 45.96 ? 153 ASP A C     1 
ATOM   1970 O  O     . ASP C 3 157 ? -38.796 42.715 239.106 1.00 46.19 ? 153 ASP A O     1 
ATOM   1971 C  CB    . ASP C 3 157 ? -39.996 40.404 237.722 1.00 47.93 ? 153 ASP A CB    1 
ATOM   1972 C  CG    . ASP C 3 157 ? -41.357 40.407 238.399 1.00 49.63 ? 153 ASP A CG    1 
ATOM   1973 O  OD1   . ASP C 3 157 ? -42.330 40.884 237.782 1.00 51.65 ? 153 ASP A OD1   1 
ATOM   1974 O  OD2   . ASP C 3 157 ? -41.457 39.915 239.542 1.00 50.28 ? 153 ASP A OD2   1 
ATOM   1975 N  N     . PRO C 3 158 ? -40.342 43.913 237.986 1.00 47.13 ? 154 PRO A N     1 
ATOM   1976 C  CA    . PRO C 3 158 ? -40.355 45.034 238.932 1.00 47.08 ? 154 PRO A CA    1 
ATOM   1977 C  C     . PRO C 3 158 ? -40.604 44.614 240.364 1.00 48.39 ? 154 PRO A C     1 
ATOM   1978 O  O     . PRO C 3 158 ? -40.298 45.353 241.296 1.00 48.57 ? 154 PRO A O     1 
ATOM   1979 C  CB    . PRO C 3 158 ? -41.453 45.934 238.378 1.00 46.18 ? 154 PRO A CB    1 
ATOM   1980 C  CG    . PRO C 3 158 ? -42.350 44.970 237.647 1.00 45.32 ? 154 PRO A CG    1 
ATOM   1981 C  CD    . PRO C 3 158 ? -41.381 44.082 236.954 1.00 46.10 ? 154 PRO A CD    1 
ATOM   1982 N  N     . ALA C 3 159 ? -41.156 43.420 240.547 1.00 50.65 ? 155 ALA A N     1 
ATOM   1983 C  CA    . ALA C 3 159 ? -41.431 42.941 241.900 1.00 52.43 ? 155 ALA A CA    1 
ATOM   1984 C  C     . ALA C 3 159 ? -40.144 42.569 242.621 1.00 54.29 ? 155 ALA A C     1 
ATOM   1985 O  O     . ALA C 3 159 ? -40.163 42.180 243.791 1.00 54.93 ? 155 ALA A O     1 
ATOM   1986 C  CB    . ALA C 3 159 ? -42.363 41.750 241.853 1.00 52.11 ? 155 ALA A CB    1 
ATOM   1987 N  N     . ASP C 3 160 ? -39.020 42.692 241.924 1.00 55.19 ? 156 ASP A N     1 
ATOM   1988 C  CA    . ASP C 3 160 ? -37.742 42.341 242.525 1.00 55.69 ? 156 ASP A CA    1 
ATOM   1989 C  C     . ASP C 3 160 ? -36.877 43.547 242.844 1.00 54.91 ? 156 ASP A C     1 
ATOM   1990 O  O     . ASP C 3 160 ? -35.851 43.427 243.522 1.00 55.09 ? 156 ASP A O     1 
ATOM   1991 C  CB    . ASP C 3 160 ? -37.002 41.382 241.603 1.00 56.55 ? 156 ASP A CB    1 
ATOM   1992 C  CG    . ASP C 3 160 ? -37.771 40.108 241.382 1.00 57.89 ? 156 ASP A CG    1 
ATOM   1993 O  OD1   . ASP C 3 160 ? -38.057 39.425 242.389 1.00 58.70 ? 156 ASP A OD1   1 
ATOM   1994 O  OD2   . ASP C 3 160 ? -38.096 39.796 240.214 1.00 58.09 ? 156 ASP A OD2   1 
ATOM   1995 N  N     . ALA C 3 161 ? -37.304 44.708 242.358 1.00 53.75 ? 157 ALA A N     1 
ATOM   1996 C  CA    . ALA C 3 161 ? -36.584 45.952 242.591 1.00 52.15 ? 157 ALA A CA    1 
ATOM   1997 C  C     . ALA C 3 161 ? -36.563 46.278 244.082 1.00 51.70 ? 157 ALA A C     1 
ATOM   1998 O  O     . ALA C 3 161 ? -37.603 46.318 244.732 1.00 51.79 ? 157 ALA A O     1 
ATOM   1999 C  CB    . ALA C 3 161 ? -37.233 47.076 241.818 1.00 50.19 ? 157 ALA A CB    1 
ATOM   2000 N  N     . ASP C 3 162 ? -35.367 46.503 244.618 1.00 51.62 ? 158 ASP A N     1 
ATOM   2001 C  CA    . ASP C 3 162 ? -35.198 46.821 246.032 1.00 52.53 ? 158 ASP A CA    1 
ATOM   2002 C  C     . ASP C 3 162 ? -35.834 48.161 246.394 1.00 52.35 ? 158 ASP A C     1 
ATOM   2003 O  O     . ASP C 3 162 ? -36.130 48.429 247.559 1.00 51.80 ? 158 ASP A O     1 
ATOM   2004 C  CB    . ASP C 3 162 ? -33.713 46.843 246.384 1.00 51.88 ? 158 ASP A CB    1 
ATOM   2005 N  N     . GLU C 3 163 ? -36.030 49.001 245.387 1.00 52.18 ? 159 GLU A N     1 
ATOM   2006 C  CA    . GLU C 3 163 ? -36.614 50.317 245.582 1.00 52.77 ? 159 GLU A CA    1 
ATOM   2007 C  C     . GLU C 3 163 ? -37.181 50.848 244.288 1.00 51.62 ? 159 GLU A C     1 
ATOM   2008 O  O     . GLU C 3 163 ? -36.841 50.371 243.196 1.00 50.65 ? 159 GLU A O     1 
ATOM   2009 C  CB    . GLU C 3 163 ? -35.557 51.302 246.094 1.00 56.06 ? 159 GLU A CB    1 
ATOM   2010 C  CG    . GLU C 3 163 ? -35.301 51.255 247.591 1.00 61.34 ? 159 GLU A CG    1 
ATOM   2011 C  CD    . GLU C 3 163 ? -36.503 51.729 248.410 1.00 64.66 ? 159 GLU A CD    1 
ATOM   2012 O  OE1   . GLU C 3 163 ? -36.333 51.949 249.635 1.00 66.83 ? 159 GLU A OE1   1 
ATOM   2013 O  OE2   . GLU C 3 163 ? -37.612 51.877 247.832 1.00 64.70 ? 159 GLU A OE2   1 
ATOM   2014 N  N     . LYS C 3 164 ? -38.039 51.857 244.416 1.00 50.75 ? 160 LYS A N     1 
ATOM   2015 C  CA    . LYS C 3 164 ? -38.659 52.494 243.257 1.00 48.70 ? 160 LYS A CA    1 
ATOM   2016 C  C     . LYS C 3 164 ? -37.644 53.434 242.636 1.00 45.28 ? 160 LYS A C     1 
ATOM   2017 O  O     . LYS C 3 164 ? -37.038 54.264 243.315 1.00 43.56 ? 160 LYS A O     1 
ATOM   2018 C  CB    . LYS C 3 164 ? -39.878 53.302 243.687 1.00 51.96 ? 160 LYS A CB    1 
ATOM   2019 C  CG    . LYS C 3 164 ? -40.892 52.530 244.481 1.00 54.41 ? 160 LYS A CG    1 
ATOM   2020 C  CD    . LYS C 3 164 ? -41.756 51.673 243.587 1.00 57.39 ? 160 LYS A CD    1 
ATOM   2021 C  CE    . LYS C 3 164 ? -42.838 50.979 244.402 1.00 60.14 ? 160 LYS A CE    1 
ATOM   2022 N  NZ    . LYS C 3 164 ? -43.663 50.058 243.561 1.00 62.69 ? 160 LYS A NZ    1 
ATOM   2023 N  N     . GLU C 3 165 ? -37.476 53.309 241.334 1.00 41.90 ? 161 GLU A N     1 
ATOM   2024 C  CA    . GLU C 3 165 ? -36.529 54.149 240.629 1.00 39.12 ? 161 GLU A CA    1 
ATOM   2025 C  C     . GLU C 3 165 ? -36.795 55.636 240.852 1.00 38.82 ? 161 GLU A C     1 
ATOM   2026 O  O     . GLU C 3 165 ? -35.867 56.436 240.961 1.00 40.80 ? 161 GLU A O     1 
ATOM   2027 C  CB    . GLU C 3 165 ? -36.568 53.835 239.137 1.00 35.48 ? 161 GLU A CB    1 
ATOM   2028 C  CG    . GLU C 3 165 ? -36.287 52.385 238.832 1.00 31.09 ? 161 GLU A CG    1 
ATOM   2029 C  CD    . GLU C 3 165 ? -36.200 52.145 237.351 1.00 31.75 ? 161 GLU A CD    1 
ATOM   2030 O  OE1   . GLU C 3 165 ? -36.677 53.015 236.598 1.00 29.29 ? 161 GLU A OE1   1 
ATOM   2031 O  OE2   . GLU C 3 165 ? -35.666 51.095 236.933 1.00 33.10 ? 161 GLU A OE2   1 
ATOM   2032 N  N     . SER C 3 166 ? -38.065 56.007 240.921 1.00 37.29 ? 162 SER A N     1 
ATOM   2033 C  CA    . SER C 3 166 ? -38.455 57.406 241.131 1.00 34.97 ? 162 SER A CA    1 
ATOM   2034 C  C     . SER C 3 166 ? -37.718 58.083 242.300 1.00 33.72 ? 162 SER A C     1 
ATOM   2035 O  O     . SER C 3 166 ? -37.552 59.300 242.311 1.00 34.20 ? 162 SER A O     1 
ATOM   2036 C  CB    . SER C 3 166 ? -39.948 57.474 241.419 1.00 33.36 ? 162 SER A CB    1 
ATOM   2037 O  OG    . SER C 3 166 ? -40.197 56.882 242.681 1.00 31.66 ? 162 SER A OG    1 
ATOM   2038 N  N     . GLY C 3 167 ? -37.308 57.297 243.290 1.00 31.26 ? 163 GLY A N     1 
ATOM   2039 C  CA    . GLY C 3 167 ? -36.623 57.859 244.438 1.00 29.19 ? 163 GLY A CA    1 
ATOM   2040 C  C     . GLY C 3 167 ? -35.196 58.288 244.167 1.00 28.41 ? 163 GLY A C     1 
ATOM   2041 O  O     . GLY C 3 167 ? -34.507 58.816 245.040 1.00 26.84 ? 163 GLY A O     1 
ATOM   2042 N  N     . LYS C 3 168 ? -34.742 58.054 242.945 1.00 27.30 ? 164 LYS A N     1 
ATOM   2043 C  CA    . LYS C 3 168 ? -33.393 58.419 242.568 1.00 25.90 ? 164 LYS A CA    1 
ATOM   2044 C  C     . LYS C 3 168 ? -33.168 59.892 242.858 1.00 27.30 ? 164 LYS A C     1 
ATOM   2045 O  O     . LYS C 3 168 ? -32.165 60.259 243.462 1.00 28.17 ? 164 LYS A O     1 
ATOM   2046 C  CB    . LYS C 3 168 ? -33.167 58.124 241.085 1.00 21.75 ? 164 LYS A CB    1 
ATOM   2047 C  CG    . LYS C 3 168 ? -34.152 58.812 240.129 1.00 17.38 ? 164 LYS A CG    1 
ATOM   2048 C  CD    . LYS C 3 168 ? -34.078 58.199 238.732 1.00 12.44 ? 164 LYS A CD    1 
ATOM   2049 C  CE    . LYS C 3 168 ? -34.878 58.987 237.716 1.00 10.39 ? 164 LYS A CE    1 
ATOM   2050 N  NZ    . LYS C 3 168 ? -34.747 58.444 236.315 1.00 10.10 ? 164 LYS A NZ    1 
ATOM   2051 N  N     . TRP C 3 169 ? -34.121 60.729 242.449 1.00 27.74 ? 165 TRP A N     1 
ATOM   2052 C  CA    . TRP C 3 169 ? -34.027 62.169 242.663 1.00 26.81 ? 165 TRP A CA    1 
ATOM   2053 C  C     . TRP C 3 169 ? -33.750 62.497 244.110 1.00 29.23 ? 165 TRP A C     1 
ATOM   2054 O  O     . TRP C 3 169 ? -32.911 63.345 244.418 1.00 29.30 ? 165 TRP A O     1 
ATOM   2055 C  CB    . TRP C 3 169 ? -35.309 62.866 242.240 1.00 24.41 ? 165 TRP A CB    1 
ATOM   2056 C  CG    . TRP C 3 169 ? -35.698 62.571 240.856 1.00 21.79 ? 165 TRP A CG    1 
ATOM   2057 C  CD1   . TRP C 3 169 ? -36.540 61.593 240.439 1.00 21.17 ? 165 TRP A CD1   1 
ATOM   2058 C  CD2   . TRP C 3 169 ? -35.245 63.247 239.680 1.00 20.16 ? 165 TRP A CD2   1 
ATOM   2059 N  NE1   . TRP C 3 169 ? -36.640 61.611 239.068 1.00 21.93 ? 165 TRP A NE1   1 
ATOM   2060 C  CE2   . TRP C 3 169 ? -35.848 62.612 238.578 1.00 19.45 ? 165 TRP A CE2   1 
ATOM   2061 C  CE3   . TRP C 3 169 ? -34.370 64.310 239.452 1.00 19.57 ? 165 TRP A CE3   1 
ATOM   2062 C  CZ2   . TRP C 3 169 ? -35.624 63.027 237.263 1.00 17.26 ? 165 TRP A CZ2   1 
ATOM   2063 C  CZ3   . TRP C 3 169 ? -34.144 64.719 238.139 1.00 17.50 ? 165 TRP A CZ3   1 
ATOM   2064 C  CH2   . TRP C 3 169 ? -34.767 64.071 237.064 1.00 16.25 ? 165 TRP A CH2   1 
ATOM   2065 N  N     . LEU C 3 170 ? -34.471 61.847 245.009 1.00 32.66 ? 166 LEU A N     1 
ATOM   2066 C  CA    . LEU C 3 170 ? -34.238 62.103 246.418 1.00 36.62 ? 166 LEU A CA    1 
ATOM   2067 C  C     . LEU C 3 170 ? -32.874 61.558 246.793 1.00 37.04 ? 166 LEU A C     1 
ATOM   2068 O  O     . LEU C 3 170 ? -32.249 62.047 247.725 1.00 38.23 ? 166 LEU A O     1 
ATOM   2069 C  CB    . LEU C 3 170 ? -35.298 61.426 247.280 1.00 39.58 ? 166 LEU A CB    1 
ATOM   2070 C  CG    . LEU C 3 170 ? -36.710 61.997 247.251 1.00 43.01 ? 166 LEU A CG    1 
ATOM   2071 C  CD1   . LEU C 3 170 ? -37.618 61.040 248.009 1.00 45.51 ? 166 LEU A CD1   1 
ATOM   2072 C  CD2   . LEU C 3 170 ? -36.752 63.393 247.882 1.00 43.73 ? 166 LEU A CD2   1 
ATOM   2073 N  N     . ALA C 3 171 ? -32.423 60.530 246.076 1.00 37.08 ? 167 ALA A N     1 
ATOM   2074 C  CA    . ALA C 3 171 ? -31.117 59.928 246.348 1.00 37.38 ? 167 ALA A CA    1 
ATOM   2075 C  C     . ALA C 3 171 ? -30.015 60.933 246.022 1.00 38.13 ? 167 ALA A C     1 
ATOM   2076 O  O     . ALA C 3 171 ? -29.146 61.222 246.854 1.00 38.08 ? 167 ALA A O     1 
ATOM   2077 C  CB    . ALA C 3 171 ? -30.927 58.679 245.509 1.00 37.38 ? 167 ALA A CB    1 
ATOM   2078 N  N     . ALA C 3 172 ? -30.077 61.452 244.797 1.00 36.25 ? 168 ALA A N     1 
ATOM   2079 C  CA    . ALA C 3 172 ? -29.129 62.428 244.303 1.00 35.15 ? 168 ALA A CA    1 
ATOM   2080 C  C     . ALA C 3 172 ? -29.057 63.590 245.268 1.00 35.49 ? 168 ALA A C     1 
ATOM   2081 O  O     . ALA C 3 172 ? -27.977 64.035 245.647 1.00 37.49 ? 168 ALA A O     1 
ATOM   2082 C  CB    . ALA C 3 172 ? -29.557 62.917 242.948 1.00 32.81 ? 168 ALA A CB    1 
ATOM   2083 N  N     . ALA C 3 173 ? -30.214 64.076 245.684 1.00 35.93 ? 169 ALA A N     1 
ATOM   2084 C  CA    . ALA C 3 173 ? -30.232 65.200 246.597 1.00 35.69 ? 169 ALA A CA    1 
ATOM   2085 C  C     . ALA C 3 173 ? -29.479 64.852 247.871 1.00 35.23 ? 169 ALA A C     1 
ATOM   2086 O  O     . ALA C 3 173 ? -28.703 65.655 248.367 1.00 34.41 ? 169 ALA A O     1 
ATOM   2087 C  CB    . ALA C 3 173 ? -31.670 65.593 246.924 1.00 36.47 ? 169 ALA A CB    1 
ATOM   2088 N  N     . ALA C 3 174 ? -29.697 63.652 248.394 1.00 34.68 ? 170 ALA A N     1 
ATOM   2089 C  CA    . ALA C 3 174 ? -29.032 63.261 249.626 1.00 35.39 ? 170 ALA A CA    1 
ATOM   2090 C  C     . ALA C 3 174 ? -27.506 63.320 249.546 1.00 36.02 ? 170 ALA A C     1 
ATOM   2091 O  O     . ALA C 3 174 ? -26.855 63.930 250.398 1.00 34.52 ? 170 ALA A O     1 
ATOM   2092 C  CB    . ALA C 3 174 ? -29.475 61.871 250.042 1.00 34.51 ? 170 ALA A CB    1 
ATOM   2093 N  N     . THR C 3 175 ? -26.938 62.672 248.535 1.00 36.56 ? 171 THR A N     1 
ATOM   2094 C  CA    . THR C 3 175 ? -25.494 62.658 248.379 1.00 37.76 ? 171 THR A CA    1 
ATOM   2095 C  C     . THR C 3 175 ? -24.969 64.068 248.087 1.00 36.65 ? 171 THR A C     1 
ATOM   2096 O  O     . THR C 3 175 ? -23.987 64.516 248.683 1.00 37.06 ? 171 THR A O     1 
ATOM   2097 C  CB    . THR C 3 175 ? -25.076 61.668 247.264 1.00 39.41 ? 171 THR A CB    1 
ATOM   2098 O  OG1   . THR C 3 175 ? -25.487 60.345 247.631 1.00 41.33 ? 171 THR A OG1   1 
ATOM   2099 C  CG2   . THR C 3 175 ? -23.561 61.670 247.078 1.00 39.32 ? 171 THR A CG2   1 
ATOM   2100 N  N     . SER C 3 176 ? -25.651 64.775 247.196 1.00 34.44 ? 172 SER A N     1 
ATOM   2101 C  CA    . SER C 3 176 ? -25.270 66.127 246.840 1.00 32.76 ? 172 SER A CA    1 
ATOM   2102 C  C     . SER C 3 176 ? -25.199 67.016 248.073 1.00 34.66 ? 172 SER A C     1 
ATOM   2103 O  O     . SER C 3 176 ? -24.298 67.842 248.217 1.00 36.98 ? 172 SER A O     1 
ATOM   2104 C  CB    . SER C 3 176 ? -26.276 66.692 245.851 1.00 31.13 ? 172 SER A CB    1 
ATOM   2105 O  OG    . SER C 3 176 ? -26.188 66.001 244.615 1.00 31.86 ? 172 SER A OG    1 
ATOM   2106 N  N     . ARG C 3 177 ? -26.159 66.836 248.966 1.00 35.96 ? 173 ARG A N     1 
ATOM   2107 C  CA    . ARG C 3 177 ? -26.244 67.596 250.204 1.00 36.01 ? 173 ARG A CA    1 
ATOM   2108 C  C     . ARG C 3 177 ? -25.064 67.218 251.103 1.00 37.14 ? 173 ARG A C     1 
ATOM   2109 O  O     . ARG C 3 177 ? -24.544 68.046 251.847 1.00 38.34 ? 173 ARG A O     1 
ATOM   2110 C  CB    . ARG C 3 177 ? -27.570 67.246 250.892 1.00 35.81 ? 173 ARG A CB    1 
ATOM   2111 C  CG    . ARG C 3 177 ? -27.894 67.999 252.171 1.00 36.43 ? 173 ARG A CG    1 
ATOM   2112 C  CD    . ARG C 3 177 ? -29.272 67.592 252.687 1.00 36.12 ? 173 ARG A CD    1 
ATOM   2113 N  NE    . ARG C 3 177 ? -30.286 67.709 251.634 1.00 37.12 ? 173 ARG A NE    1 
ATOM   2114 C  CZ    . ARG C 3 177 ? -30.924 66.684 251.066 1.00 34.87 ? 173 ARG A CZ    1 
ATOM   2115 N  NH1   . ARG C 3 177 ? -30.662 65.444 251.447 1.00 34.48 ? 173 ARG A NH1   1 
ATOM   2116 N  NH2   . ARG C 3 177 ? -31.829 66.898 250.113 1.00 31.64 ? 173 ARG A NH2   1 
ATOM   2117 N  N     . LEU C 3 178 ? -24.633 65.965 251.023 1.00 36.98 ? 174 LEU A N     1 
ATOM   2118 C  CA    . LEU C 3 178 ? -23.537 65.501 251.857 1.00 36.61 ? 174 LEU A CA    1 
ATOM   2119 C  C     . LEU C 3 178 ? -22.155 65.940 251.397 1.00 37.67 ? 174 LEU A C     1 
ATOM   2120 O  O     . LEU C 3 178 ? -21.304 66.296 252.211 1.00 39.15 ? 174 LEU A O     1 
ATOM   2121 C  CB    . LEU C 3 178 ? -23.569 63.978 251.965 1.00 34.83 ? 174 LEU A CB    1 
ATOM   2122 C  CG    . LEU C 3 178 ? -22.586 63.337 252.933 1.00 32.98 ? 174 LEU A CG    1 
ATOM   2123 C  CD1   . LEU C 3 178 ? -22.517 64.130 254.226 1.00 34.76 ? 174 LEU A CD1   1 
ATOM   2124 C  CD2   . LEU C 3 178 ? -23.042 61.931 253.209 1.00 33.71 ? 174 LEU A CD2   1 
ATOM   2125 N  N     . ARG C 3 179 ? -21.930 65.923 250.094 1.00 35.77 ? 175 ARG A N     1 
ATOM   2126 C  CA    . ARG C 3 179 ? -20.635 66.288 249.561 1.00 35.36 ? 175 ARG A CA    1 
ATOM   2127 C  C     . ARG C 3 179 ? -20.400 67.790 249.476 1.00 37.25 ? 175 ARG A C     1 
ATOM   2128 O  O     . ARG C 3 179 ? -19.306 68.260 249.777 1.00 37.25 ? 175 ARG A O     1 
ATOM   2129 C  CB    . ARG C 3 179 ? -20.463 65.644 248.193 1.00 32.93 ? 175 ARG A CB    1 
ATOM   2130 C  CG    . ARG C 3 179 ? -20.432 64.141 248.284 1.00 32.41 ? 175 ARG A CG    1 
ATOM   2131 C  CD    . ARG C 3 179 ? -20.473 63.522 246.919 1.00 31.24 ? 175 ARG A CD    1 
ATOM   2132 N  NE    . ARG C 3 179 ? -20.294 62.078 246.997 1.00 30.12 ? 175 ARG A NE    1 
ATOM   2133 C  CZ    . ARG C 3 179 ? -20.285 61.281 245.936 1.00 29.64 ? 175 ARG A CZ    1 
ATOM   2134 N  NH1   . ARG C 3 179 ? -20.449 61.794 244.723 1.00 27.13 ? 175 ARG A NH1   1 
ATOM   2135 N  NH2   . ARG C 3 179 ? -20.102 59.976 246.088 1.00 29.76 ? 175 ARG A NH2   1 
ATOM   2136 N  N     . MET C 3 180 ? -21.427 68.541 249.086 1.00 37.81 ? 176 MET A N     1 
ATOM   2137 C  CA    . MET C 3 180 ? -21.301 69.986 248.968 1.00 38.19 ? 176 MET A CA    1 
ATOM   2138 C  C     . MET C 3 180 ? -21.352 70.699 250.310 1.00 39.00 ? 176 MET A C     1 
ATOM   2139 O  O     . MET C 3 180 ? -20.936 71.857 250.416 1.00 40.16 ? 176 MET A O     1 
ATOM   2140 C  CB    . MET C 3 180 ? -22.394 70.557 248.073 1.00 40.54 ? 176 MET A CB    1 
ATOM   2141 C  CG    . MET C 3 180 ? -22.277 70.162 246.625 1.00 44.25 ? 176 MET A CG    1 
ATOM   2142 S  SD    . MET C 3 180 ? -20.770 70.786 245.863 1.00 48.31 ? 176 MET A SD    1 
ATOM   2143 C  CE    . MET C 3 180 ? -21.363 72.358 245.226 1.00 47.42 ? 176 MET A CE    1 
ATOM   2144 N  N     . GLY C 3 181 ? -21.863 70.020 251.330 1.00 38.44 ? 177 GLY A N     1 
ATOM   2145 C  CA    . GLY C 3 181 ? -21.961 70.629 252.648 1.00 38.89 ? 177 GLY A CA    1 
ATOM   2146 C  C     . GLY C 3 181 ? -22.470 72.066 252.629 1.00 39.12 ? 177 GLY A C     1 
ATOM   2147 O  O     . GLY C 3 181 ? -23.474 72.385 251.985 1.00 39.40 ? 177 GLY A O     1 
ATOM   2148 N  N     . SER C 3 182 ? -21.756 72.942 253.323 1.00 39.77 ? 178 SER A N     1 
ATOM   2149 C  CA    . SER C 3 182 ? -22.132 74.347 253.406 1.00 40.62 ? 178 SER A CA    1 
ATOM   2150 C  C     . SER C 3 182 ? -22.221 75.086 252.074 1.00 39.91 ? 178 SER A C     1 
ATOM   2151 O  O     . SER C 3 182 ? -22.576 76.261 252.051 1.00 39.14 ? 178 SER A O     1 
ATOM   2152 C  CB    . SER C 3 182 ? -21.175 75.098 254.349 1.00 41.92 ? 178 SER A CB    1 
ATOM   2153 O  OG    . SER C 3 182 ? -19.824 75.007 253.909 1.00 42.86 ? 178 SER A OG    1 
ATOM   2154 N  N     . MET C 3 183 ? -21.890 74.428 250.970 1.00 41.00 ? 179 MET A N     1 
ATOM   2155 C  CA    . MET C 3 183 ? -21.991 75.093 249.671 1.00 42.94 ? 179 MET A CA    1 
ATOM   2156 C  C     . MET C 3 183 ? -23.309 74.761 248.995 1.00 43.84 ? 179 MET A C     1 
ATOM   2157 O  O     . MET C 3 183 ? -23.567 75.219 247.877 1.00 44.38 ? 179 MET A O     1 
ATOM   2158 C  CB    . MET C 3 183 ? -20.845 74.694 248.740 1.00 44.57 ? 179 MET A CB    1 
ATOM   2159 C  CG    . MET C 3 183 ? -19.538 75.448 248.954 1.00 47.32 ? 179 MET A CG    1 
ATOM   2160 S  SD    . MET C 3 183 ? -18.354 75.021 247.652 1.00 51.41 ? 179 MET A SD    1 
ATOM   2161 C  CE    . MET C 3 183 ? -17.731 73.458 248.269 1.00 50.19 ? 179 MET A CE    1 
ATOM   2162 N  N     . MET C 3 184 ? -24.142 73.956 249.659 1.00 44.68 ? 180 MET A N     1 
ATOM   2163 C  CA    . MET C 3 184 ? -25.439 73.591 249.085 1.00 44.92 ? 180 MET A CA    1 
ATOM   2164 C  C     . MET C 3 184 ? -26.288 74.836 248.865 1.00 44.14 ? 180 MET A C     1 
ATOM   2165 O  O     . MET C 3 184 ? -27.053 74.918 247.900 1.00 45.02 ? 180 MET A O     1 
ATOM   2166 C  CB    . MET C 3 184 ? -26.193 72.607 249.990 1.00 44.49 ? 180 MET A CB    1 
ATOM   2167 C  CG    . MET C 3 184 ? -26.184 71.177 249.480 1.00 44.95 ? 180 MET A CG    1 
ATOM   2168 S  SD    . MET C 3 184 ? -26.679 71.062 247.732 1.00 45.37 ? 180 MET A SD    1 
ATOM   2169 C  CE    . MET C 3 184 ? -27.859 69.732 247.787 1.00 46.97 ? 180 MET A CE    1 
ATOM   2170 N  N     . SER C 3 185 ? -26.130 75.808 249.760 1.00 43.41 ? 181 SER A N     1 
ATOM   2171 C  CA    . SER C 3 185 ? -26.874 77.057 249.679 1.00 43.00 ? 181 SER A CA    1 
ATOM   2172 C  C     . SER C 3 185 ? -26.600 77.805 248.375 1.00 42.97 ? 181 SER A C     1 
ATOM   2173 O  O     . SER C 3 185 ? -27.452 78.561 247.913 1.00 43.60 ? 181 SER A O     1 
ATOM   2174 C  CB    . SER C 3 185 ? -26.568 77.950 250.892 1.00 43.46 ? 181 SER A CB    1 
ATOM   2175 O  OG    . SER C 3 185 ? -25.186 78.249 251.015 1.00 44.88 ? 181 SER A OG    1 
ATOM   2176 N  N     . ASN C 3 186 ? -25.438 77.577 247.764 1.00 42.30 ? 182 ASN A N     1 
ATOM   2177 C  CA    . ASN C 3 186 ? -25.110 78.253 246.511 1.00 41.52 ? 182 ASN A CA    1 
ATOM   2178 C  C     . ASN C 3 186 ? -25.532 77.436 245.320 1.00 40.85 ? 182 ASN A C     1 
ATOM   2179 O  O     . ASN C 3 186 ? -25.279 77.823 244.176 1.00 40.21 ? 182 ASN A O     1 
ATOM   2180 C  CB    . ASN C 3 186 ? -23.611 78.499 246.386 1.00 44.32 ? 182 ASN A CB    1 
ATOM   2181 C  CG    . ASN C 3 186 ? -23.038 79.188 247.589 1.00 47.46 ? 182 ASN A CG    1 
ATOM   2182 O  OD1   . ASN C 3 186 ? -23.537 80.229 248.025 1.00 50.40 ? 182 ASN A OD1   1 
ATOM   2183 N  ND2   . ASN C 3 186 ? -21.972 78.618 248.137 1.00 49.49 ? 182 ASN A ND2   1 
ATOM   2184 N  N     . VAL C 3 187 ? -26.170 76.300 245.591 1.00 40.32 ? 183 VAL A N     1 
ATOM   2185 C  CA    . VAL C 3 187 ? -26.608 75.366 244.541 1.00 38.01 ? 183 VAL A CA    1 
ATOM   2186 C  C     . VAL C 3 187 ? -28.086 75.476 244.151 1.00 35.88 ? 183 VAL A C     1 
ATOM   2187 O  O     . VAL C 3 187 ? -28.952 75.696 244.991 1.00 35.49 ? 183 VAL A O     1 
ATOM   2188 C  CB    . VAL C 3 187 ? -26.346 73.897 244.981 1.00 38.23 ? 183 VAL A CB    1 
ATOM   2189 C  CG1   . VAL C 3 187 ? -26.671 72.955 243.840 1.00 38.37 ? 183 VAL A CG1   1 
ATOM   2190 C  CG2   . VAL C 3 187 ? -24.906 73.724 245.436 1.00 35.80 ? 183 VAL A CG2   1 
ATOM   2191 N  N     . ILE C 3 188 ? -28.355 75.293 242.867 1.00 34.14 ? 184 ILE A N     1 
ATOM   2192 C  CA    . ILE C 3 188 ? -29.707 75.329 242.331 1.00 32.64 ? 184 ILE A CA    1 
ATOM   2193 C  C     . ILE C 3 188 ? -29.910 74.067 241.472 1.00 33.10 ? 184 ILE A C     1 
ATOM   2194 O  O     . ILE C 3 188 ? -29.315 73.948 240.390 1.00 32.31 ? 184 ILE A O     1 
ATOM   2195 C  CB    . ILE C 3 188 ? -29.904 76.569 241.437 1.00 33.00 ? 184 ILE A CB    1 
ATOM   2196 C  CG1   . ILE C 3 188 ? -29.703 77.847 242.250 1.00 33.74 ? 184 ILE A CG1   1 
ATOM   2197 C  CG2   . ILE C 3 188 ? -31.291 76.574 240.825 1.00 33.32 ? 184 ILE A CG2   1 
ATOM   2198 C  CD1   . ILE C 3 188 ? -29.831 79.122 241.414 1.00 30.98 ? 184 ILE A CD1   1 
ATOM   2199 N  N     . ALA C 3 189 ? -30.730 73.122 241.938 1.00 32.60 ? 185 ALA A N     1 
ATOM   2200 C  CA    . ALA C 3 189 ? -30.965 71.888 241.164 1.00 32.31 ? 185 ALA A CA    1 
ATOM   2201 C  C     . ALA C 3 189 ? -31.790 72.183 239.918 1.00 31.43 ? 185 ALA A C     1 
ATOM   2202 O  O     . ALA C 3 189 ? -32.630 73.067 239.930 1.00 32.85 ? 185 ALA A O     1 
ATOM   2203 C  CB    . ALA C 3 189 ? -31.676 70.846 242.024 1.00 31.52 ? 185 ALA A CB    1 
ATOM   2204 N  N     . VAL C 3 190 ? -31.541 71.473 238.829 1.00 30.51 ? 186 VAL A N     1 
ATOM   2205 C  CA    . VAL C 3 190 ? -32.330 71.708 237.630 1.00 31.90 ? 186 VAL A CA    1 
ATOM   2206 C  C     . VAL C 3 190 ? -32.698 70.358 237.023 1.00 34.38 ? 186 VAL A C     1 
ATOM   2207 O  O     . VAL C 3 190 ? -31.836 69.606 236.569 1.00 35.95 ? 186 VAL A O     1 
ATOM   2208 C  CB    . VAL C 3 190 ? -31.578 72.562 236.607 1.00 30.07 ? 186 VAL A CB    1 
ATOM   2209 C  CG1   . VAL C 3 190 ? -32.458 72.831 235.404 1.00 30.42 ? 186 VAL A CG1   1 
ATOM   2210 C  CG2   . VAL C 3 190 ? -31.152 73.860 237.247 1.00 30.07 ? 186 VAL A CG2   1 
ATOM   2211 N  N     . CYS C 3 191 ? -33.995 70.060 237.023 1.00 35.21 ? 187 CYS A N     1 
ATOM   2212 C  CA    . CYS C 3 191 ? -34.477 68.787 236.527 1.00 34.98 ? 187 CYS A CA    1 
ATOM   2213 C  C     . CYS C 3 191 ? -35.700 68.909 235.610 1.00 36.27 ? 187 CYS A C     1 
ATOM   2214 O  O     . CYS C 3 191 ? -36.528 69.808 235.774 1.00 36.78 ? 187 CYS A O     1 
ATOM   2215 C  CB    . CYS C 3 191 ? -34.818 67.894 237.708 1.00 35.21 ? 187 CYS A CB    1 
ATOM   2216 S  SG    . CYS C 3 191 ? -34.103 68.346 239.287 1.00 34.72 ? 187 CYS A SG    1 
ATOM   2217 N  N     . ASP C 3 192 ? -35.801 67.998 234.642 1.00 36.36 ? 188 ASP A N     1 
ATOM   2218 C  CA    . ASP C 3 192 ? -36.910 67.975 233.691 1.00 37.46 ? 188 ASP A CA    1 
ATOM   2219 C  C     . ASP C 3 192 ? -38.224 67.474 234.333 1.00 37.65 ? 188 ASP A C     1 
ATOM   2220 O  O     . ASP C 3 192 ? -38.272 67.153 235.523 1.00 35.50 ? 188 ASP A O     1 
ATOM   2221 C  CB    . ASP C 3 192 ? -36.546 67.090 232.497 1.00 40.06 ? 188 ASP A CB    1 
ATOM   2222 C  CG    . ASP C 3 192 ? -36.240 65.652 232.903 1.00 44.69 ? 188 ASP A CG    1 
ATOM   2223 O  OD1   . ASP C 3 192 ? -36.721 65.202 233.970 1.00 47.43 ? 188 ASP A OD1   1 
ATOM   2224 O  OD2   . ASP C 3 192 ? -35.527 64.960 232.146 1.00 46.74 ? 188 ASP A OD2   1 
ATOM   2225 N  N     . ARG C 3 193 ? -39.275 67.382 233.525 1.00 37.53 ? 189 ARG A N     1 
ATOM   2226 C  CA    . ARG C 3 193 ? -40.600 66.960 233.986 1.00 39.03 ? 189 ARG A CA    1 
ATOM   2227 C  C     . ARG C 3 193 ? -40.674 65.759 234.908 1.00 39.24 ? 189 ARG A C     1 
ATOM   2228 O  O     . ARG C 3 193 ? -41.367 65.793 235.923 1.00 37.64 ? 189 ARG A O     1 
ATOM   2229 C  CB    . ARG C 3 193 ? -41.502 66.690 232.790 1.00 40.47 ? 189 ARG A CB    1 
ATOM   2230 C  CG    . ARG C 3 193 ? -41.784 67.909 231.971 1.00 43.87 ? 189 ARG A CG    1 
ATOM   2231 C  CD    . ARG C 3 193 ? -42.676 67.592 230.795 1.00 47.53 ? 189 ARG A CD    1 
ATOM   2232 N  NE    . ARG C 3 193 ? -43.886 68.402 230.842 1.00 51.63 ? 189 ARG A NE    1 
ATOM   2233 C  CZ    . ARG C 3 193 ? -44.686 68.607 229.804 1.00 53.72 ? 189 ARG A CZ    1 
ATOM   2234 N  NH1   . ARG C 3 193 ? -44.394 68.056 228.631 1.00 53.92 ? 189 ARG A NH1   1 
ATOM   2235 N  NH2   . ARG C 3 193 ? -45.776 69.359 229.945 1.00 55.10 ? 189 ARG A NH2   1 
ATOM   2236 N  N     . GLU C 3 194 ? -39.981 64.687 234.544 1.00 40.50 ? 190 GLU A N     1 
ATOM   2237 C  CA    . GLU C 3 194 ? -39.999 63.471 235.348 1.00 40.83 ? 190 GLU A CA    1 
ATOM   2238 C  C     . GLU C 3 194 ? -39.657 63.732 236.798 1.00 39.79 ? 190 GLU A C     1 
ATOM   2239 O  O     . GLU C 3 194 ? -39.785 62.848 237.644 1.00 41.98 ? 190 GLU A O     1 
ATOM   2240 C  CB    . GLU C 3 194 ? -39.031 62.438 234.775 1.00 43.98 ? 190 GLU A CB    1 
ATOM   2241 C  CG    . GLU C 3 194 ? -39.311 62.076 233.318 1.00 49.66 ? 190 GLU A CG    1 
ATOM   2242 C  CD    . GLU C 3 194 ? -40.764 61.669 233.087 1.00 53.42 ? 190 GLU A CD    1 
ATOM   2243 O  OE1   . GLU C 3 194 ? -41.291 60.843 233.878 1.00 54.76 ? 190 GLU A OE1   1 
ATOM   2244 O  OE2   . GLU C 3 194 ? -41.377 62.168 232.108 1.00 56.28 ? 190 GLU A OE2   1 
ATOM   2245 N  N     . ALA C 3 195 ? -39.208 64.938 237.103 1.00 38.95 ? 191 ALA A N     1 
ATOM   2246 C  CA    . ALA C 3 195 ? -38.868 65.243 238.485 1.00 37.74 ? 191 ALA A CA    1 
ATOM   2247 C  C     . ALA C 3 195 ? -40.065 65.825 239.240 1.00 37.97 ? 191 ALA A C     1 
ATOM   2248 O  O     . ALA C 3 195 ? -39.991 66.072 240.444 1.00 38.71 ? 191 ALA A O     1 
ATOM   2249 C  CB    . ALA C 3 195 ? -37.693 66.198 238.532 1.00 38.39 ? 191 ALA A CB    1 
ATOM   2250 N  N     . ASP C 3 196 ? -41.168 66.039 238.522 1.00 35.91 ? 192 ASP A N     1 
ATOM   2251 C  CA    . ASP C 3 196 ? -42.409 66.573 239.092 1.00 33.71 ? 192 ASP A CA    1 
ATOM   2252 C  C     . ASP C 3 196 ? -42.924 65.572 240.134 1.00 34.28 ? 192 ASP A C     1 
ATOM   2253 O  O     . ASP C 3 196 ? -43.888 64.856 239.882 1.00 35.66 ? 192 ASP A O     1 
ATOM   2254 C  CB    . ASP C 3 196 ? -43.451 66.729 237.976 1.00 32.87 ? 192 ASP A CB    1 
ATOM   2255 C  CG    . ASP C 3 196 ? -44.624 67.622 238.368 1.00 31.59 ? 192 ASP A CG    1 
ATOM   2256 O  OD1   . ASP C 3 196 ? -44.924 67.737 239.579 1.00 29.79 ? 192 ASP A OD1   1 
ATOM   2257 O  OD2   . ASP C 3 196 ? -45.244 68.196 237.440 1.00 28.67 ? 192 ASP A OD2   1 
ATOM   2258 N  N     . ILE C 3 197 ? -42.299 65.526 241.305 1.00 33.96 ? 193 ILE A N     1 
ATOM   2259 C  CA    . ILE C 3 197 ? -42.704 64.573 242.328 1.00 35.59 ? 193 ILE A CA    1 
ATOM   2260 C  C     . ILE C 3 197 ? -42.797 65.284 243.672 1.00 38.63 ? 193 ILE A C     1 
ATOM   2261 O  O     . ILE C 3 197 ? -41.774 65.557 244.295 1.00 40.25 ? 193 ILE A O     1 
ATOM   2262 C  CB    . ILE C 3 197 ? -41.664 63.431 242.421 1.00 33.65 ? 193 ILE A CB    1 
ATOM   2263 C  CG1   . ILE C 3 197 ? -41.403 62.854 241.031 1.00 33.10 ? 193 ILE A CG1   1 
ATOM   2264 C  CG2   . ILE C 3 197 ? -42.158 62.351 243.345 1.00 34.52 ? 193 ILE A CG2   1 
ATOM   2265 C  CD1   . ILE C 3 197 ? -40.203 61.988 240.966 1.00 33.38 ? 193 ILE A CD1   1 
ATOM   2266 N  N     . HIS C 3 198 ? -44.011 65.569 244.135 1.00 40.99 ? 194 HIS A N     1 
ATOM   2267 C  CA    . HIS C 3 198 ? -44.159 66.290 245.390 1.00 43.15 ? 194 HIS A CA    1 
ATOM   2268 C  C     . HIS C 3 198 ? -43.314 65.740 246.524 1.00 43.49 ? 194 HIS A C     1 
ATOM   2269 O  O     . HIS C 3 198 ? -43.004 66.466 247.464 1.00 45.09 ? 194 HIS A O     1 
ATOM   2270 C  CB    . HIS C 3 198 ? -45.635 66.376 245.834 1.00 45.48 ? 194 HIS A CB    1 
ATOM   2271 C  CG    . HIS C 3 198 ? -46.257 65.054 246.168 1.00 48.45 ? 194 HIS A CG    1 
ATOM   2272 N  ND1   . HIS C 3 198 ? -46.904 64.275 245.230 1.00 48.48 ? 194 HIS A ND1   1 
ATOM   2273 C  CD2   . HIS C 3 198 ? -46.312 64.364 247.333 1.00 48.07 ? 194 HIS A CD2   1 
ATOM   2274 C  CE1   . HIS C 3 198 ? -47.329 63.163 245.803 1.00 49.28 ? 194 HIS A CE1   1 
ATOM   2275 N  NE2   . HIS C 3 198 ? -46.983 63.191 247.079 1.00 49.36 ? 194 HIS A NE2   1 
ATOM   2276 N  N     . ALA C 3 199 ? -42.931 64.472 246.466 1.00 43.55 ? 195 ALA A N     1 
ATOM   2277 C  CA    . ALA C 3 199 ? -42.103 63.941 247.545 1.00 43.88 ? 195 ALA A CA    1 
ATOM   2278 C  C     . ALA C 3 199 ? -40.689 64.519 247.426 1.00 43.99 ? 195 ALA A C     1 
ATOM   2279 O  O     . ALA C 3 199 ? -39.968 64.606 248.410 1.00 43.80 ? 195 ALA A O     1 
ATOM   2280 C  CB    . ALA C 3 199 ? -42.067 62.423 247.493 1.00 44.48 ? 195 ALA A CB    1 
ATOM   2281 N  N     . TYR C 3 200 ? -40.304 64.920 246.217 1.00 45.02 ? 196 TYR A N     1 
ATOM   2282 C  CA    . TYR C 3 200 ? -38.985 65.510 245.969 1.00 46.09 ? 196 TYR A CA    1 
ATOM   2283 C  C     . TYR C 3 200 ? -39.024 66.984 246.359 1.00 45.96 ? 196 TYR A C     1 
ATOM   2284 O  O     . TYR C 3 200 ? -38.277 67.425 247.229 1.00 45.85 ? 196 TYR A O     1 
ATOM   2285 C  CB    . TYR C 3 200 ? -38.629 65.372 244.486 1.00 46.79 ? 196 TYR A CB    1 
ATOM   2286 C  CG    . TYR C 3 200 ? -37.341 66.046 244.059 1.00 47.65 ? 196 TYR A CG    1 
ATOM   2287 C  CD1   . TYR C 3 200 ? -36.123 65.724 244.659 1.00 48.47 ? 196 TYR A CD1   1 
ATOM   2288 C  CD2   . TYR C 3 200 ? -37.340 66.993 243.036 1.00 47.78 ? 196 TYR A CD2   1 
ATOM   2289 C  CE1   . TYR C 3 200 ? -34.934 66.330 244.249 1.00 48.84 ? 196 TYR A CE1   1 
ATOM   2290 C  CE2   . TYR C 3 200 ? -36.161 67.602 242.619 1.00 48.40 ? 196 TYR A CE2   1 
ATOM   2291 C  CZ    . TYR C 3 200 ? -34.964 67.269 243.227 1.00 49.05 ? 196 TYR A CZ    1 
ATOM   2292 O  OH    . TYR C 3 200 ? -33.803 67.871 242.800 1.00 49.40 ? 196 TYR A OH    1 
ATOM   2293 N  N     . LEU C 3 201 ? -39.913 67.728 245.706 1.00 46.22 ? 197 LEU A N     1 
ATOM   2294 C  CA    . LEU C 3 201 ? -40.105 69.149 245.968 1.00 46.91 ? 197 LEU A CA    1 
ATOM   2295 C  C     . LEU C 3 201 ? -40.223 69.379 247.480 1.00 48.29 ? 197 LEU A C     1 
ATOM   2296 O  O     . LEU C 3 201 ? -39.709 70.357 248.016 1.00 49.51 ? 197 LEU A O     1 
ATOM   2297 C  CB    . LEU C 3 201 ? -41.386 69.647 245.283 1.00 45.81 ? 197 LEU A CB    1 
ATOM   2298 C  CG    . LEU C 3 201 ? -41.626 69.472 243.778 1.00 45.50 ? 197 LEU A CG    1 
ATOM   2299 C  CD1   . LEU C 3 201 ? -43.101 69.189 243.538 1.00 44.08 ? 197 LEU A CD1   1 
ATOM   2300 C  CD2   . LEU C 3 201 ? -41.190 70.706 243.012 1.00 43.30 ? 197 LEU A CD2   1 
ATOM   2301 N  N     . GLN C 3 202 ? -40.902 68.474 248.168 1.00 49.91 ? 198 GLN A N     1 
ATOM   2302 C  CA    . GLN C 3 202 ? -41.087 68.611 249.603 1.00 51.30 ? 198 GLN A CA    1 
ATOM   2303 C  C     . GLN C 3 202 ? -39.766 68.512 250.317 1.00 51.07 ? 198 GLN A C     1 
ATOM   2304 O  O     . GLN C 3 202 ? -39.475 69.269 251.244 1.00 51.23 ? 198 GLN A O     1 
ATOM   2305 C  CB    . GLN C 3 202 ? -42.004 67.511 250.116 1.00 52.59 ? 198 GLN A CB    1 
ATOM   2306 C  CG    . GLN C 3 202 ? -42.842 67.937 251.281 1.00 55.52 ? 198 GLN A CG    1 
ATOM   2307 C  CD    . GLN C 3 202 ? -43.927 66.954 251.547 1.00 57.79 ? 198 GLN A CD    1 
ATOM   2308 O  OE1   . GLN C 3 202 ? -44.571 66.472 250.614 1.00 59.27 ? 198 GLN A OE1   1 
ATOM   2309 N  NE2   . GLN C 3 202 ? -44.156 66.647 252.820 1.00 59.33 ? 198 GLN A NE2   1 
ATOM   2310 N  N     . ASP C 3 203 ? -38.970 67.545 249.887 1.00 51.66 ? 199 ASP A N     1 
ATOM   2311 C  CA    . ASP C 3 203 ? -37.664 67.321 250.486 1.00 51.10 ? 199 ASP A CA    1 
ATOM   2312 C  C     . ASP C 3 203 ? -36.815 68.577 250.375 1.00 50.05 ? 199 ASP A C     1 
ATOM   2313 O  O     . ASP C 3 203 ? -36.459 69.179 251.381 1.00 50.71 ? 199 ASP A O     1 
ATOM   2314 C  CB    . ASP C 3 203 ? -36.969 66.161 249.782 1.00 51.26 ? 199 ASP A CB    1 
ATOM   2315 C  CG    . ASP C 3 203 ? -35.688 65.770 250.455 1.00 52.47 ? 199 ASP A CG    1 
ATOM   2316 O  OD1   . ASP C 3 203 ? -35.738 65.366 251.640 1.00 51.59 ? 199 ASP A OD1   1 
ATOM   2317 O  OD2   . ASP C 3 203 ? -34.630 65.879 249.798 1.00 54.84 ? 199 ASP A OD2   1 
ATOM   2318 N  N     . LYS C 3 204 ? -36.507 68.968 249.144 1.00 47.66 ? 200 LYS A N     1 
ATOM   2319 C  CA    . LYS C 3 204 ? -35.705 70.148 248.910 1.00 46.72 ? 200 LYS A CA    1 
ATOM   2320 C  C     . LYS C 3 204 ? -36.168 71.313 249.780 1.00 45.66 ? 200 LYS A C     1 
ATOM   2321 O  O     . LYS C 3 204 ? -35.360 71.941 250.464 1.00 46.72 ? 200 LYS A O     1 
ATOM   2322 C  CB    . LYS C 3 204 ? -35.759 70.529 247.434 1.00 48.61 ? 200 LYS A CB    1 
ATOM   2323 C  CG    . LYS C 3 204 ? -35.231 69.439 246.507 1.00 49.98 ? 200 LYS A CG    1 
ATOM   2324 C  CD    . LYS C 3 204 ? -33.718 69.320 246.580 1.00 51.65 ? 200 LYS A CD    1 
ATOM   2325 C  CE    . LYS C 3 204 ? -33.035 70.529 245.956 1.00 52.43 ? 200 LYS A CE    1 
ATOM   2326 N  NZ    . LYS C 3 204 ? -31.557 70.390 245.997 1.00 53.91 ? 200 LYS A NZ    1 
ATOM   2327 N  N     . LEU C 3 205 ? -37.465 71.597 249.771 1.00 43.26 ? 201 LEU A N     1 
ATOM   2328 C  CA    . LEU C 3 205 ? -37.990 72.688 250.575 1.00 41.45 ? 201 LEU A CA    1 
ATOM   2329 C  C     . LEU C 3 205 ? -37.682 72.498 252.051 1.00 42.04 ? 201 LEU A C     1 
ATOM   2330 O  O     . LEU C 3 205 ? -37.366 73.452 252.757 1.00 42.21 ? 201 LEU A O     1 
ATOM   2331 C  CB    . LEU C 3 205 ? -39.495 72.810 250.390 1.00 39.84 ? 201 LEU A CB    1 
ATOM   2332 C  CG    . LEU C 3 205 ? -39.932 73.223 248.993 1.00 39.47 ? 201 LEU A CG    1 
ATOM   2333 C  CD1   . LEU C 3 205 ? -41.438 73.370 248.987 1.00 40.78 ? 201 LEU A CD1   1 
ATOM   2334 C  CD2   . LEU C 3 205 ? -39.275 74.539 248.597 1.00 39.55 ? 201 LEU A CD2   1 
ATOM   2335 N  N     . ALA C 3 206 ? -37.768 71.262 252.521 1.00 43.17 ? 202 ALA A N     1 
ATOM   2336 C  CA    . ALA C 3 206 ? -37.504 70.972 253.926 1.00 44.14 ? 202 ALA A CA    1 
ATOM   2337 C  C     . ALA C 3 206 ? -36.053 71.249 254.313 1.00 45.27 ? 202 ALA A C     1 
ATOM   2338 O  O     . ALA C 3 206 ? -35.736 71.404 255.493 1.00 45.63 ? 202 ALA A O     1 
ATOM   2339 C  CB    . ALA C 3 206 ? -37.855 69.521 254.220 1.00 43.47 ? 202 ALA A CB    1 
ATOM   2340 N  N     . HIS C 3 207 ? -35.182 71.310 253.309 1.00 46.19 ? 203 HIS A N     1 
ATOM   2341 C  CA    . HIS C 3 207 ? -33.756 71.553 253.515 1.00 47.55 ? 203 HIS A CA    1 
ATOM   2342 C  C     . HIS C 3 207 ? -33.316 72.940 253.027 1.00 47.51 ? 203 HIS A C     1 
ATOM   2343 O  O     . HIS C 3 207 ? -32.125 73.226 252.922 1.00 46.89 ? 203 HIS A O     1 
ATOM   2344 C  CB    . HIS C 3 207 ? -32.939 70.483 252.782 1.00 47.23 ? 203 HIS A CB    1 
ATOM   2345 C  CG    . HIS C 3 207 ? -32.834 69.179 253.512 1.00 47.61 ? 203 HIS A CG    1 
ATOM   2346 N  ND1   . HIS C 3 207 ? -33.294 67.990 252.985 1.00 49.22 ? 203 HIS A ND1   1 
ATOM   2347 C  CD2   . HIS C 3 207 ? -32.255 68.864 254.695 1.00 48.00 ? 203 HIS A CD2   1 
ATOM   2348 C  CE1   . HIS C 3 207 ? -32.999 67.000 253.809 1.00 49.73 ? 203 HIS A CE1   1 
ATOM   2349 N  NE2   . HIS C 3 207 ? -32.367 67.504 254.855 1.00 49.21 ? 203 HIS A NE2   1 
ATOM   2350 N  N     . ASN C 3 208 ? -34.281 73.801 252.735 1.00 48.47 ? 204 ASN A N     1 
ATOM   2351 C  CA    . ASN C 3 208 ? -33.980 75.140 252.250 1.00 48.18 ? 204 ASN A CA    1 
ATOM   2352 C  C     . ASN C 3 208 ? -33.102 75.061 251.020 1.00 47.87 ? 204 ASN A C     1 
ATOM   2353 O  O     . ASN C 3 208 ? -32.330 75.979 250.736 1.00 48.17 ? 204 ASN A O     1 
ATOM   2354 C  CB    . ASN C 3 208 ? -33.285 75.963 253.333 1.00 49.37 ? 204 ASN A CB    1 
ATOM   2355 C  CG    . ASN C 3 208 ? -34.141 76.116 254.579 1.00 52.07 ? 204 ASN A CG    1 
ATOM   2356 O  OD1   . ASN C 3 208 ? -35.298 76.549 254.499 1.00 53.87 ? 204 ASN A OD1   1 
ATOM   2357 N  ND2   . ASN C 3 208 ? -33.583 75.758 255.738 1.00 52.19 ? 204 ASN A ND2   1 
ATOM   2358 N  N     . GLU C 3 209 ? -33.224 73.957 250.289 1.00 46.13 ? 205 GLU A N     1 
ATOM   2359 C  CA    . GLU C 3 209 ? -32.442 73.781 249.081 1.00 44.44 ? 205 GLU A CA    1 
ATOM   2360 C  C     . GLU C 3 209 ? -33.159 74.412 247.896 1.00 42.15 ? 205 GLU A C     1 
ATOM   2361 O  O     . GLU C 3 209 ? -34.373 74.307 247.764 1.00 43.69 ? 205 GLU A O     1 
ATOM   2362 C  CB    . GLU C 3 209 ? -32.185 72.298 248.819 1.00 45.60 ? 205 GLU A CB    1 
ATOM   2363 C  CG    . GLU C 3 209 ? -31.558 71.572 250.001 1.00 48.51 ? 205 GLU A CG    1 
ATOM   2364 C  CD    . GLU C 3 209 ? -30.801 70.309 249.594 1.00 51.00 ? 205 GLU A CD    1 
ATOM   2365 O  OE1   . GLU C 3 209 ? -31.189 69.682 248.571 1.00 52.59 ? 205 GLU A OE1   1 
ATOM   2366 O  OE2   . GLU C 3 209 ? -29.831 69.946 250.309 1.00 49.46 ? 205 GLU A OE2   1 
ATOM   2367 N  N     . ARG C 3 210 ? -32.393 75.085 247.052 1.00 38.95 ? 206 ARG A N     1 
ATOM   2368 C  CA    . ARG C 3 210 ? -32.918 75.749 245.875 1.00 37.36 ? 206 ARG A CA    1 
ATOM   2369 C  C     . ARG C 3 210 ? -33.086 74.723 244.757 1.00 35.74 ? 206 ARG A C     1 
ATOM   2370 O  O     . ARG C 3 210 ? -32.465 73.660 244.797 1.00 37.08 ? 206 ARG A O     1 
ATOM   2371 C  CB    . ARG C 3 210 ? -31.952 76.873 245.467 1.00 38.97 ? 206 ARG A CB    1 
ATOM   2372 C  CG    . ARG C 3 210 ? -31.665 77.860 246.620 1.00 38.68 ? 206 ARG A CG    1 
ATOM   2373 C  CD    . ARG C 3 210 ? -30.437 78.742 246.379 1.00 38.09 ? 206 ARG A CD    1 
ATOM   2374 N  NE    . ARG C 3 210 ? -30.581 79.685 245.271 1.00 37.49 ? 206 ARG A NE    1 
ATOM   2375 C  CZ    . ARG C 3 210 ? -29.549 80.223 244.625 1.00 37.21 ? 206 ARG A CZ    1 
ATOM   2376 N  NH1   . ARG C 3 210 ? -28.313 79.903 244.986 1.00 38.10 ? 206 ARG A NH1   1 
ATOM   2377 N  NH2   . ARG C 3 210 ? -29.740 81.070 243.620 1.00 34.56 ? 206 ARG A NH2   1 
ATOM   2378 N  N     . PHE C 3 211 ? -33.916 75.040 243.763 1.00 33.52 ? 207 PHE A N     1 
ATOM   2379 C  CA    . PHE C 3 211 ? -34.176 74.114 242.662 1.00 30.84 ? 207 PHE A CA    1 
ATOM   2380 C  C     . PHE C 3 211 ? -35.044 74.730 241.588 1.00 31.06 ? 207 PHE A C     1 
ATOM   2381 O  O     . PHE C 3 211 ? -35.702 75.739 241.806 1.00 30.48 ? 207 PHE A O     1 
ATOM   2382 C  CB    . PHE C 3 211 ? -34.918 72.902 243.189 1.00 29.57 ? 207 PHE A CB    1 
ATOM   2383 C  CG    . PHE C 3 211 ? -36.280 73.228 243.748 1.00 28.09 ? 207 PHE A CG    1 
ATOM   2384 C  CD1   . PHE C 3 211 ? -37.398 73.360 242.910 1.00 27.98 ? 207 PHE A CD1   1 
ATOM   2385 C  CD2   . PHE C 3 211 ? -36.446 73.399 245.121 1.00 27.66 ? 207 PHE A CD2   1 
ATOM   2386 C  CE1   . PHE C 3 211 ? -38.663 73.660 243.443 1.00 27.67 ? 207 PHE A CE1   1 
ATOM   2387 C  CE2   . PHE C 3 211 ? -37.696 73.697 245.667 1.00 28.62 ? 207 PHE A CE2   1 
ATOM   2388 C  CZ    . PHE C 3 211 ? -38.815 73.828 244.831 1.00 27.22 ? 207 PHE A CZ    1 
ATOM   2389 N  N     . VAL C 3 212 ? -35.048 74.087 240.429 1.00 31.29 ? 208 VAL A N     1 
ATOM   2390 C  CA    . VAL C 3 212 ? -35.872 74.489 239.296 1.00 31.74 ? 208 VAL A CA    1 
ATOM   2391 C  C     . VAL C 3 212 ? -36.246 73.240 238.504 1.00 32.59 ? 208 VAL A C     1 
ATOM   2392 O  O     . VAL C 3 212 ? -35.427 72.675 237.770 1.00 32.18 ? 208 VAL A O     1 
ATOM   2393 C  CB    . VAL C 3 212 ? -35.180 75.489 238.352 1.00 31.34 ? 208 VAL A CB    1 
ATOM   2394 C  CG1   . VAL C 3 212 ? -36.018 75.660 237.078 1.00 30.27 ? 208 VAL A CG1   1 
ATOM   2395 C  CG2   . VAL C 3 212 ? -35.033 76.833 239.035 1.00 32.01 ? 208 VAL A CG2   1 
ATOM   2396 N  N     . VAL C 3 213 ? -37.505 72.830 238.671 1.00 33.17 ? 209 VAL A N     1 
ATOM   2397 C  CA    . VAL C 3 213 ? -38.051 71.649 238.024 1.00 33.65 ? 209 VAL A CA    1 
ATOM   2398 C  C     . VAL C 3 213 ? -39.169 72.033 237.096 1.00 32.28 ? 209 VAL A C     1 
ATOM   2399 O  O     . VAL C 3 213 ? -39.882 72.981 237.369 1.00 34.11 ? 209 VAL A O     1 
ATOM   2400 C  CB    . VAL C 3 213 ? -38.602 70.661 239.061 1.00 34.52 ? 209 VAL A CB    1 
ATOM   2401 C  CG1   . VAL C 3 213 ? -39.108 69.415 238.356 1.00 34.91 ? 209 VAL A CG1   1 
ATOM   2402 C  CG2   . VAL C 3 213 ? -37.515 70.310 240.080 1.00 34.36 ? 209 VAL A CG2   1 
ATOM   2403 N  N     . ARG C 3 214 ? -39.295 71.314 235.984 1.00 32.07 ? 210 ARG A N     1 
ATOM   2404 C  CA    . ARG C 3 214 ? -40.359 71.574 235.025 1.00 32.06 ? 210 ARG A CA    1 
ATOM   2405 C  C     . ARG C 3 214 ? -41.604 70.772 235.460 1.00 34.05 ? 210 ARG A C     1 
ATOM   2406 O  O     . ARG C 3 214 ? -41.488 69.675 236.019 1.00 34.17 ? 210 ARG A O     1 
ATOM   2407 C  CB    . ARG C 3 214 ? -39.910 71.167 233.616 1.00 27.70 ? 210 ARG A CB    1 
ATOM   2408 C  CG    . ARG C 3 214 ? -40.981 71.380 232.555 1.00 26.76 ? 210 ARG A CG    1 
ATOM   2409 C  CD    . ARG C 3 214 ? -40.514 71.104 231.117 1.00 25.88 ? 210 ARG A CD    1 
ATOM   2410 N  NE    . ARG C 3 214 ? -41.645 71.187 230.197 1.00 25.97 ? 210 ARG A NE    1 
ATOM   2411 C  CZ    . ARG C 3 214 ? -41.604 70.917 228.895 1.00 28.18 ? 210 ARG A CZ    1 
ATOM   2412 N  NH1   . ARG C 3 214 ? -40.476 70.537 228.312 1.00 27.74 ? 210 ARG A NH1   1 
ATOM   2413 N  NH2   . ARG C 3 214 ? -42.710 71.020 228.169 1.00 28.71 ? 210 ARG A NH2   1 
ATOM   2414 N  N     . SER C 3 215 ? -42.784 71.340 235.220 1.00 36.15 ? 211 SER A N     1 
ATOM   2415 C  CA    . SER C 3 215 ? -44.047 70.714 235.587 1.00 37.52 ? 211 SER A CA    1 
ATOM   2416 C  C     . SER C 3 215 ? -44.479 69.685 234.553 1.00 37.64 ? 211 SER A C     1 
ATOM   2417 O  O     . SER C 3 215 ? -44.277 69.863 233.348 1.00 36.43 ? 211 SER A O     1 
ATOM   2418 C  CB    . SER C 3 215 ? -45.151 71.771 235.731 1.00 38.40 ? 211 SER A CB    1 
ATOM   2419 O  OG    . SER C 3 215 ? -46.343 71.207 236.254 1.00 40.28 ? 211 SER A OG    1 
ATOM   2420 N  N     . LYS C 3 216 ? -45.078 68.603 235.035 1.00 37.88 ? 212 LYS A N     1 
ATOM   2421 C  CA    . LYS C 3 216 ? -45.550 67.540 234.157 1.00 40.26 ? 212 LYS A CA    1 
ATOM   2422 C  C     . LYS C 3 216 ? -47.040 67.308 234.393 1.00 40.52 ? 212 LYS A C     1 
ATOM   2423 O  O     . LYS C 3 216 ? -47.862 67.474 233.497 1.00 38.49 ? 212 LYS A O     1 
ATOM   2424 C  CB    . LYS C 3 216 ? -44.770 66.252 234.445 1.00 40.95 ? 212 LYS A CB    1 
ATOM   2425 C  CG    . LYS C 3 216 ? -45.084 65.094 233.513 1.00 41.41 ? 212 LYS A CG    1 
ATOM   2426 C  CD    . LYS C 3 216 ? -44.333 63.844 233.929 1.00 44.38 ? 212 LYS A CD    1 
ATOM   2427 C  CE    . LYS C 3 216 ? -44.688 62.657 233.039 1.00 46.97 ? 212 LYS A CE    1 
ATOM   2428 N  NZ    . LYS C 3 216 ? -43.967 61.417 233.457 1.00 47.85 ? 212 LYS A NZ    1 
ATOM   2429 N  N     . HIS C 3 217 ? -47.362 66.934 235.623 1.00 42.30 ? 213 HIS A N     1 
ATOM   2430 C  CA    . HIS C 3 217 ? -48.724 66.660 236.024 1.00 45.73 ? 213 HIS A CA    1 
ATOM   2431 C  C     . HIS C 3 217 ? -49.491 67.910 236.417 1.00 47.97 ? 213 HIS A C     1 
ATOM   2432 O  O     . HIS C 3 217 ? -48.920 68.850 236.978 1.00 49.90 ? 213 HIS A O     1 
ATOM   2433 C  CB    . HIS C 3 217 ? -48.718 65.711 237.212 1.00 46.79 ? 213 HIS A CB    1 
ATOM   2434 C  CG    . HIS C 3 217 ? -47.871 64.501 237.003 1.00 49.88 ? 213 HIS A CG    1 
ATOM   2435 N  ND1   . HIS C 3 217 ? -48.027 63.666 235.915 1.00 50.66 ? 213 HIS A ND1   1 
ATOM   2436 C  CD2   . HIS C 3 217 ? -46.844 63.994 237.726 1.00 50.88 ? 213 HIS A CD2   1 
ATOM   2437 C  CE1   . HIS C 3 217 ? -47.129 62.700 235.977 1.00 53.38 ? 213 HIS A CE1   1 
ATOM   2438 N  NE2   . HIS C 3 217 ? -46.399 62.875 237.066 1.00 53.45 ? 213 HIS A NE2   1 
ATOM   2439 N  N     . PRO C 3 218 ? -50.796 67.946 236.108 1.00 48.82 ? 214 PRO A N     1 
ATOM   2440 C  CA    . PRO C 3 218 ? -51.641 69.089 236.451 1.00 48.79 ? 214 PRO A CA    1 
ATOM   2441 C  C     . PRO C 3 218 ? -51.818 69.072 237.955 1.00 48.81 ? 214 PRO A C     1 
ATOM   2442 O  O     . PRO C 3 218 ? -52.263 68.070 238.519 1.00 50.02 ? 214 PRO A O     1 
ATOM   2443 C  CB    . PRO C 3 218 ? -52.946 68.780 235.741 1.00 49.02 ? 214 PRO A CB    1 
ATOM   2444 C  CG    . PRO C 3 218 ? -52.486 68.046 234.533 1.00 50.14 ? 214 PRO A CG    1 
ATOM   2445 C  CD    . PRO C 3 218 ? -51.466 67.096 235.113 1.00 49.65 ? 214 PRO A CD    1 
ATOM   2446 N  N     . ARG C 3 219 ? -51.455 70.164 238.613 1.00 47.41 ? 215 ARG A N     1 
ATOM   2447 C  CA    . ARG C 3 219 ? -51.604 70.233 240.055 1.00 46.64 ? 215 ARG A CA    1 
ATOM   2448 C  C     . ARG C 3 219 ? -52.482 71.416 240.374 1.00 47.55 ? 215 ARG A C     1 
ATOM   2449 O  O     . ARG C 3 219 ? -52.685 72.277 239.529 1.00 46.78 ? 215 ARG A O     1 
ATOM   2450 C  CB    . ARG C 3 219 ? -50.238 70.372 240.705 1.00 45.23 ? 215 ARG A CB    1 
ATOM   2451 C  CG    . ARG C 3 219 ? -49.310 69.281 240.264 1.00 43.43 ? 215 ARG A CG    1 
ATOM   2452 C  CD    . ARG C 3 219 ? -48.129 69.184 241.168 1.00 42.61 ? 215 ARG A CD    1 
ATOM   2453 N  NE    . ARG C 3 219 ? -47.390 67.958 240.913 1.00 41.72 ? 215 ARG A NE    1 
ATOM   2454 C  CZ    . ARG C 3 219 ? -47.148 67.042 241.840 1.00 42.19 ? 215 ARG A CZ    1 
ATOM   2455 N  NH1   . ARG C 3 219 ? -47.590 67.222 243.072 1.00 42.50 ? 215 ARG A NH1   1 
ATOM   2456 N  NH2   . ARG C 3 219 ? -46.461 65.949 241.540 1.00 42.38 ? 215 ARG A NH2   1 
ATOM   2457 N  N     . LYS C 3 220 ? -53.019 71.449 241.583 1.00 49.71 ? 216 LYS A N     1 
ATOM   2458 C  CA    . LYS C 3 220 ? -53.888 72.542 241.972 1.00 53.93 ? 216 LYS A CA    1 
ATOM   2459 C  C     . LYS C 3 220 ? -53.227 73.470 242.974 1.00 55.30 ? 216 LYS A C     1 
ATOM   2460 O  O     . LYS C 3 220 ? -52.222 73.124 243.592 1.00 55.28 ? 216 LYS A O     1 
ATOM   2461 C  CB    . LYS C 3 220 ? -55.185 72.006 242.587 1.00 54.98 ? 216 LYS A CB    1 
ATOM   2462 C  CG    . LYS C 3 220 ? -56.410 72.157 241.707 1.00 56.31 ? 216 LYS A CG    1 
ATOM   2463 C  CD    . LYS C 3 220 ? -57.685 71.930 242.501 1.00 57.76 ? 216 LYS A CD    1 
ATOM   2464 C  CE    . LYS C 3 220 ? -58.894 72.205 241.643 1.00 57.61 ? 216 LYS A CE    1 
ATOM   2465 N  NZ    . LYS C 3 220 ? -58.747 71.475 240.356 1.00 58.48 ? 216 LYS A NZ    1 
ATOM   2466 N  N     . ASP C 3 221 ? -53.808 74.651 243.144 1.00 56.74 ? 217 ASP A N     1 
ATOM   2467 C  CA    . ASP C 3 221 ? -53.281 75.612 244.090 1.00 57.60 ? 217 ASP A CA    1 
ATOM   2468 C  C     . ASP C 3 221 ? -54.256 75.738 245.256 1.00 58.27 ? 217 ASP A C     1 
ATOM   2469 O  O     . ASP C 3 221 ? -55.455 75.924 245.054 1.00 57.94 ? 217 ASP A O     1 
ATOM   2470 C  CB    . ASP C 3 221 ? -53.082 76.954 243.396 1.00 58.92 ? 217 ASP A CB    1 
ATOM   2471 C  CG    . ASP C 3 221 ? -52.512 77.998 244.320 1.00 61.73 ? 217 ASP A CG    1 
ATOM   2472 O  OD1   . ASP C 3 221 ? -51.619 77.651 245.125 1.00 62.13 ? 217 ASP A OD1   1 
ATOM   2473 O  OD2   . ASP C 3 221 ? -52.942 79.168 244.238 1.00 63.70 ? 217 ASP A OD2   1 
ATOM   2474 N  N     . VAL C 3 222 ? -53.738 75.624 246.473 1.00 59.35 ? 218 VAL A N     1 
ATOM   2475 C  CA    . VAL C 3 222 ? -54.563 75.718 247.668 1.00 61.00 ? 218 VAL A CA    1 
ATOM   2476 C  C     . VAL C 3 222 ? -55.499 76.922 247.615 1.00 62.42 ? 218 VAL A C     1 
ATOM   2477 O  O     . VAL C 3 222 ? -56.709 76.775 247.756 1.00 64.18 ? 218 VAL A O     1 
ATOM   2478 C  CB    . VAL C 3 222 ? -53.701 75.830 248.945 1.00 61.48 ? 218 VAL A CB    1 
ATOM   2479 C  CG1   . VAL C 3 222 ? -54.566 75.632 250.179 1.00 62.13 ? 218 VAL A CG1   1 
ATOM   2480 C  CG2   . VAL C 3 222 ? -52.586 74.808 248.916 1.00 61.57 ? 218 VAL A CG2   1 
ATOM   2481 N  N     . GLU C 3 223 ? -54.942 78.112 247.412 1.00 62.94 ? 219 GLU A N     1 
ATOM   2482 C  CA    . GLU C 3 223 ? -55.748 79.328 247.351 1.00 63.72 ? 219 GLU A CA    1 
ATOM   2483 C  C     . GLU C 3 223 ? -56.540 79.380 246.053 1.00 62.24 ? 219 GLU A C     1 
ATOM   2484 O  O     . GLU C 3 223 ? -57.756 79.212 246.043 1.00 62.44 ? 219 GLU A O     1 
ATOM   2485 C  CB    . GLU C 3 223 ? -54.853 80.562 247.425 1.00 66.72 ? 219 GLU A CB    1 
ATOM   2486 C  CG    . GLU C 3 223 ? -53.791 80.506 248.506 1.00 71.17 ? 219 GLU A CG    1 
ATOM   2487 C  CD    . GLU C 3 223 ? -54.377 80.403 249.897 1.00 74.04 ? 219 GLU A CD    1 
ATOM   2488 O  OE1   . GLU C 3 223 ? -54.995 79.359 250.208 1.00 76.38 ? 219 GLU A OE1   1 
ATOM   2489 O  OE2   . GLU C 3 223 ? -54.222 81.368 250.682 1.00 75.79 ? 219 GLU A OE2   1 
ATOM   2490 N  N     . SER C 3 224 ? -55.832 79.612 244.958 1.00 60.53 ? 220 SER A N     1 
ATOM   2491 C  CA    . SER C 3 224 ? -56.448 79.705 243.646 1.00 59.26 ? 220 SER A CA    1 
ATOM   2492 C  C     . SER C 3 224 ? -57.520 78.658 243.371 1.00 58.56 ? 220 SER A C     1 
ATOM   2493 O  O     . SER C 3 224 ? -58.430 78.889 242.575 1.00 59.42 ? 220 SER A O     1 
ATOM   2494 C  CB    . SER C 3 224 ? -55.375 79.607 242.563 1.00 59.45 ? 220 SER A CB    1 
ATOM   2495 O  OG    . SER C 3 224 ? -55.963 79.528 241.274 1.00 59.46 ? 220 SER A OG    1 
ATOM   2496 N  N     . GLY C 3 225 ? -57.413 77.505 244.021 1.00 56.88 ? 221 GLY A N     1 
ATOM   2497 C  CA    . GLY C 3 225 ? -58.381 76.450 243.785 1.00 53.46 ? 221 GLY A CA    1 
ATOM   2498 C  C     . GLY C 3 225 ? -58.366 76.027 242.324 1.00 51.42 ? 221 GLY A C     1 
ATOM   2499 O  O     . GLY C 3 225 ? -59.244 75.296 241.866 1.00 51.92 ? 221 GLY A O     1 
ATOM   2500 N  N     . LEU C 3 226 ? -57.361 76.484 241.585 1.00 48.14 ? 222 LEU A N     1 
ATOM   2501 C  CA    . LEU C 3 226 ? -57.247 76.146 240.177 1.00 46.84 ? 222 LEU A CA    1 
ATOM   2502 C  C     . LEU C 3 226 ? -56.036 75.257 239.870 1.00 47.03 ? 222 LEU A C     1 
ATOM   2503 O  O     . LEU C 3 226 ? -55.278 74.868 240.764 1.00 46.90 ? 222 LEU A O     1 
ATOM   2504 C  CB    . LEU C 3 226 ? -57.147 77.425 239.350 1.00 45.27 ? 222 LEU A CB    1 
ATOM   2505 C  CG    . LEU C 3 226 ? -58.275 78.444 239.438 1.00 44.33 ? 222 LEU A CG    1 
ATOM   2506 C  CD1   . LEU C 3 226 ? -57.875 79.689 238.677 1.00 43.35 ? 222 LEU A CD1   1 
ATOM   2507 C  CD2   . LEU C 3 226 ? -59.557 77.858 238.850 1.00 44.90 ? 222 LEU A CD2   1 
ATOM   2508 N  N     . TYR C 3 227 ? -55.870 74.929 238.595 1.00 47.64 ? 223 TYR A N     1 
ATOM   2509 C  CA    . TYR C 3 227 ? -54.735 74.135 238.160 1.00 48.15 ? 223 TYR A CA    1 
ATOM   2510 C  C     . TYR C 3 227 ? -53.622 75.158 237.951 1.00 47.97 ? 223 TYR A C     1 
ATOM   2511 O  O     . TYR C 3 227 ? -53.879 76.271 237.483 1.00 47.87 ? 223 TYR A O     1 
ATOM   2512 C  CB    . TYR C 3 227 ? -55.056 73.398 236.852 1.00 49.59 ? 223 TYR A CB    1 
ATOM   2513 C  CG    . TYR C 3 227 ? -55.821 72.104 237.048 1.00 51.79 ? 223 TYR A CG    1 
ATOM   2514 C  CD1   . TYR C 3 227 ? -56.568 71.548 236.011 1.00 53.31 ? 223 TYR A CD1   1 
ATOM   2515 C  CD2   . TYR C 3 227 ? -55.790 71.433 238.277 1.00 53.38 ? 223 TYR A CD2   1 
ATOM   2516 C  CE1   . TYR C 3 227 ? -57.269 70.353 236.191 1.00 55.58 ? 223 TYR A CE1   1 
ATOM   2517 C  CE2   . TYR C 3 227 ? -56.481 70.241 238.472 1.00 54.21 ? 223 TYR A CE2   1 
ATOM   2518 C  CZ    . TYR C 3 227 ? -57.221 69.705 237.426 1.00 55.57 ? 223 TYR A CZ    1 
ATOM   2519 O  OH    . TYR C 3 227 ? -57.913 68.523 237.607 1.00 56.49 ? 223 TYR A OH    1 
ATOM   2520 N  N     . LEU C 3 228 ? -52.398 74.785 238.315 1.00 46.02 ? 224 LEU A N     1 
ATOM   2521 C  CA    . LEU C 3 228 ? -51.261 75.678 238.204 1.00 43.53 ? 224 LEU A CA    1 
ATOM   2522 C  C     . LEU C 3 228 ? -51.293 76.470 236.906 1.00 44.20 ? 224 LEU A C     1 
ATOM   2523 O  O     . LEU C 3 228 ? -51.143 77.690 236.909 1.00 44.76 ? 224 LEU A O     1 
ATOM   2524 C  CB    . LEU C 3 228 ? -49.951 74.895 238.296 1.00 42.20 ? 224 LEU A CB    1 
ATOM   2525 C  CG    . LEU C 3 228 ? -49.685 73.990 239.497 1.00 39.93 ? 224 LEU A CG    1 
ATOM   2526 C  CD1   . LEU C 3 228 ? -48.233 73.529 239.436 1.00 36.95 ? 224 LEU A CD1   1 
ATOM   2527 C  CD2   . LEU C 3 228 ? -49.967 74.718 240.800 1.00 37.79 ? 224 LEU A CD2   1 
ATOM   2528 N  N     . TYR C 3 229 ? -51.500 75.790 235.789 1.00 43.27 ? 225 TYR A N     1 
ATOM   2529 C  CA    . TYR C 3 229 ? -51.535 76.497 234.524 1.00 44.90 ? 225 TYR A CA    1 
ATOM   2530 C  C     . TYR C 3 229 ? -52.610 77.578 234.502 1.00 45.93 ? 225 TYR A C     1 
ATOM   2531 O  O     . TYR C 3 229 ? -52.360 78.705 234.077 1.00 45.52 ? 225 TYR A O     1 
ATOM   2532 C  CB    . TYR C 3 229 ? -51.784 75.533 233.372 1.00 44.81 ? 225 TYR A CB    1 
ATOM   2533 C  CG    . TYR C 3 229 ? -51.922 76.250 232.063 1.00 45.68 ? 225 TYR A CG    1 
ATOM   2534 C  CD1   . TYR C 3 229 ? -50.805 76.694 231.367 1.00 46.03 ? 225 TYR A CD1   1 
ATOM   2535 C  CD2   . TYR C 3 229 ? -53.174 76.519 231.535 1.00 46.01 ? 225 TYR A CD2   1 
ATOM   2536 C  CE1   . TYR C 3 229 ? -50.935 77.390 230.170 1.00 46.18 ? 225 TYR A CE1   1 
ATOM   2537 C  CE2   . TYR C 3 229 ? -53.317 77.212 230.348 1.00 46.53 ? 225 TYR A CE2   1 
ATOM   2538 C  CZ    . TYR C 3 229 ? -52.197 77.643 229.666 1.00 46.90 ? 225 TYR A CZ    1 
ATOM   2539 O  OH    . TYR C 3 229 ? -52.355 78.305 228.470 1.00 47.07 ? 225 TYR A OH    1 
ATOM   2540 N  N     . ASP C 3 230 ? -53.813 77.225 234.949 1.00 48.29 ? 226 ASP A N     1 
ATOM   2541 C  CA    . ASP C 3 230 ? -54.941 78.164 234.968 1.00 48.77 ? 226 ASP A CA    1 
ATOM   2542 C  C     . ASP C 3 230 ? -54.760 79.302 235.967 1.00 48.51 ? 226 ASP A C     1 
ATOM   2543 O  O     . ASP C 3 230 ? -55.287 80.392 235.764 1.00 48.13 ? 226 ASP A O     1 
ATOM   2544 C  CB    . ASP C 3 230 ? -56.253 77.425 235.279 1.00 48.20 ? 226 ASP A CB    1 
ATOM   2545 C  CG    . ASP C 3 230 ? -56.620 76.400 234.208 1.00 48.06 ? 226 ASP A CG    1 
ATOM   2546 O  OD1   . ASP C 3 230 ? -56.607 76.757 233.003 1.00 46.15 ? 226 ASP A OD1   1 
ATOM   2547 O  OD2   . ASP C 3 230 ? -56.936 75.243 234.572 1.00 47.06 ? 226 ASP A OD2   1 
ATOM   2548 N  N     . HIS C 3 231 ? -54.030 79.042 237.049 1.00 48.75 ? 227 HIS A N     1 
ATOM   2549 C  CA    . HIS C 3 231 ? -53.793 80.059 238.067 1.00 49.42 ? 227 HIS A CA    1 
ATOM   2550 C  C     . HIS C 3 231 ? -52.740 81.058 237.613 1.00 50.62 ? 227 HIS A C     1 
ATOM   2551 O  O     . HIS C 3 231 ? -52.779 82.223 237.998 1.00 50.27 ? 227 HIS A O     1 
ATOM   2552 C  CB    . HIS C 3 231 ? -53.342 79.403 239.370 1.00 49.94 ? 227 HIS A CB    1 
ATOM   2553 C  CG    . HIS C 3 231 ? -52.870 80.389 240.412 1.00 51.08 ? 227 HIS A CG    1 
ATOM   2554 N  ND1   . HIS C 3 231 ? -53.284 81.687 240.436 1.00 51.42 ? 227 HIS A ND1   1 
ATOM   2555 C  CD2   . HIS C 3 231 ? -52.078 80.203 241.499 1.00 51.35 ? 227 HIS A CD2   1 
ATOM   2556 C  CE1   . HIS C 3 231 ? -52.767 82.292 241.512 1.00 51.20 ? 227 HIS A CE1   1 
ATOM   2557 N  NE2   . HIS C 3 231 ? -52.041 81.416 242.160 1.00 50.28 ? 227 HIS A NE2   1 
ATOM   2558 N  N     . LEU C 3 232 ? -51.798 80.602 236.794 1.00 50.86 ? 228 LEU A N     1 
ATOM   2559 C  CA    . LEU C 3 232 ? -50.745 81.476 236.319 1.00 50.86 ? 228 LEU A CA    1 
ATOM   2560 C  C     . LEU C 3 232 ? -51.198 82.301 235.134 1.00 52.09 ? 228 LEU A C     1 
ATOM   2561 O  O     . LEU C 3 232 ? -50.675 83.385 234.903 1.00 53.22 ? 228 LEU A O     1 
ATOM   2562 C  CB    . LEU C 3 232 ? -49.502 80.664 235.949 1.00 50.25 ? 228 LEU A CB    1 
ATOM   2563 C  CG    . LEU C 3 232 ? -48.762 80.014 237.118 1.00 49.21 ? 228 LEU A CG    1 
ATOM   2564 C  CD1   . LEU C 3 232 ? -47.628 79.168 236.585 1.00 50.44 ? 228 LEU A CD1   1 
ATOM   2565 C  CD2   . LEU C 3 232 ? -48.241 81.087 238.057 1.00 48.60 ? 228 LEU A CD2   1 
ATOM   2566 N  N     . LYS C 3 233 ? -52.170 81.804 234.376 1.00 53.51 ? 229 LYS A N     1 
ATOM   2567 C  CA    . LYS C 3 233 ? -52.658 82.549 233.211 1.00 54.21 ? 229 LYS A CA    1 
ATOM   2568 C  C     . LYS C 3 233 ? -53.369 83.821 233.642 1.00 54.44 ? 229 LYS A C     1 
ATOM   2569 O  O     . LYS C 3 233 ? -53.593 84.712 232.829 1.00 54.42 ? 229 LYS A O     1 
ATOM   2570 C  CB    . LYS C 3 233 ? -53.615 81.695 232.376 1.00 53.52 ? 229 LYS A CB    1 
ATOM   2571 C  CG    . LYS C 3 233 ? -52.926 80.651 231.517 1.00 55.09 ? 229 LYS A CG    1 
ATOM   2572 C  CD    . LYS C 3 233 ? -53.088 80.950 230.037 1.00 55.24 ? 229 LYS A CD    1 
ATOM   2573 C  CE    . LYS C 3 233 ? -52.508 82.308 229.665 1.00 56.72 ? 229 LYS A CE    1 
ATOM   2574 N  NZ    . LYS C 3 233 ? -52.562 82.538 228.186 1.00 56.41 ? 229 LYS A NZ    1 
ATOM   2575 N  N     . ASN C 3 234 ? -53.718 83.899 234.921 1.00 55.74 ? 230 ASN A N     1 
ATOM   2576 C  CA    . ASN C 3 234 ? -54.399 85.072 235.439 1.00 58.35 ? 230 ASN A CA    1 
ATOM   2577 C  C     . ASN C 3 234 ? -53.416 86.164 235.838 1.00 59.18 ? 230 ASN A C     1 
ATOM   2578 O  O     . ASN C 3 234 ? -53.706 87.347 235.706 1.00 60.62 ? 230 ASN A O     1 
ATOM   2579 C  CB    . ASN C 3 234 ? -55.266 84.714 236.647 1.00 59.02 ? 230 ASN A CB    1 
ATOM   2580 C  CG    . ASN C 3 234 ? -56.255 83.604 236.349 1.00 60.65 ? 230 ASN A CG    1 
ATOM   2581 O  OD1   . ASN C 3 234 ? -56.674 83.420 235.201 1.00 62.42 ? 230 ASN A OD1   1 
ATOM   2582 N  ND2   . ASN C 3 234 ? -56.649 82.867 237.386 1.00 59.69 ? 230 ASN A ND2   1 
ATOM   2583 N  N     . GLN C 3 235 ? -52.253 85.769 236.334 1.00 59.36 ? 231 GLN A N     1 
ATOM   2584 C  CA    . GLN C 3 235 ? -51.251 86.737 236.738 1.00 58.17 ? 231 GLN A CA    1 
ATOM   2585 C  C     . GLN C 3 235 ? -50.921 87.667 235.586 1.00 57.89 ? 231 GLN A C     1 
ATOM   2586 O  O     . GLN C 3 235 ? -50.999 87.283 234.417 1.00 57.18 ? 231 GLN A O     1 
ATOM   2587 C  CB    . GLN C 3 235 ? -50.000 86.015 237.195 1.00 58.58 ? 231 GLN A CB    1 
ATOM   2588 C  CG    . GLN C 3 235 ? -50.319 85.008 238.251 1.00 58.36 ? 231 GLN A CG    1 
ATOM   2589 C  CD    . GLN C 3 235 ? -50.919 85.662 239.466 1.00 57.96 ? 231 GLN A CD    1 
ATOM   2590 O  OE1   . GLN C 3 235 ? -51.653 85.033 240.224 1.00 57.23 ? 231 GLN A OE1   1 
ATOM   2591 N  NE2   . GLN C 3 235 ? -50.599 86.937 239.668 1.00 56.86 ? 231 GLN A NE2   1 
ATOM   2592 N  N     . PRO C 3 236 ? -50.541 88.912 235.908 1.00 57.79 ? 232 PRO A N     1 
ATOM   2593 C  CA    . PRO C 3 236 ? -50.196 89.916 234.900 1.00 57.58 ? 232 PRO A CA    1 
ATOM   2594 C  C     . PRO C 3 236 ? -49.002 89.493 234.054 1.00 58.04 ? 232 PRO A C     1 
ATOM   2595 O  O     . PRO C 3 236 ? -48.045 88.911 234.562 1.00 57.61 ? 232 PRO A O     1 
ATOM   2596 C  CB    . PRO C 3 236 ? -49.912 91.152 235.743 1.00 56.92 ? 232 PRO A CB    1 
ATOM   2597 C  CG    . PRO C 3 236 ? -49.351 90.572 237.012 1.00 57.04 ? 232 PRO A CG    1 
ATOM   2598 C  CD    . PRO C 3 236 ? -50.287 89.419 237.272 1.00 57.46 ? 232 PRO A CD    1 
ATOM   2599 N  N     . GLU C 3 237 ? -49.062 89.786 232.760 1.00 58.82 ? 233 GLU A N     1 
ATOM   2600 C  CA    . GLU C 3 237 ? -47.973 89.443 231.852 1.00 59.87 ? 233 GLU A CA    1 
ATOM   2601 C  C     . GLU C 3 237 ? -46.724 90.255 232.215 1.00 59.36 ? 233 GLU A C     1 
ATOM   2602 O  O     . GLU C 3 237 ? -46.635 91.435 231.893 1.00 60.36 ? 233 GLU A O     1 
ATOM   2603 C  CB    . GLU C 3 237 ? -48.391 89.740 230.412 1.00 61.11 ? 233 GLU A CB    1 
ATOM   2604 C  CG    . GLU C 3 237 ? -47.350 89.404 229.368 1.00 65.11 ? 233 GLU A CG    1 
ATOM   2605 C  CD    . GLU C 3 237 ? -47.910 89.515 227.957 1.00 69.12 ? 233 GLU A CD    1 
ATOM   2606 O  OE1   . GLU C 3 237 ? -48.973 88.897 227.694 1.00 71.20 ? 233 GLU A OE1   1 
ATOM   2607 O  OE2   . GLU C 3 237 ? -47.292 90.208 227.109 1.00 70.06 ? 233 GLU A OE2   1 
ATOM   2608 N  N     . LEU C 3 238 ? -45.774 89.618 232.900 1.00 58.00 ? 234 LEU A N     1 
ATOM   2609 C  CA    . LEU C 3 238 ? -44.531 90.267 233.308 1.00 55.89 ? 234 LEU A CA    1 
ATOM   2610 C  C     . LEU C 3 238 ? -43.748 90.777 232.110 1.00 55.87 ? 234 LEU A C     1 
ATOM   2611 O  O     . LEU C 3 238 ? -42.868 91.616 232.248 1.00 56.42 ? 234 LEU A O     1 
ATOM   2612 C  CB    . LEU C 3 238 ? -43.645 89.290 234.076 1.00 56.59 ? 234 LEU A CB    1 
ATOM   2613 C  CG    . LEU C 3 238 ? -43.991 88.963 235.526 1.00 57.57 ? 234 LEU A CG    1 
ATOM   2614 C  CD1   . LEU C 3 238 ? -43.182 87.746 235.986 1.00 56.35 ? 234 LEU A CD1   1 
ATOM   2615 C  CD2   . LEU C 3 238 ? -43.678 90.166 236.401 1.00 57.81 ? 234 LEU A CD2   1 
ATOM   2616 N  N     . GLY C 3 239 ? -44.062 90.263 230.931 1.00 55.11 ? 235 GLY A N     1 
ATOM   2617 C  CA    . GLY C 3 239 ? -43.350 90.694 229.749 1.00 55.45 ? 235 GLY A CA    1 
ATOM   2618 C  C     . GLY C 3 239 ? -43.142 89.521 228.818 1.00 56.40 ? 235 GLY A C     1 
ATOM   2619 O  O     . GLY C 3 239 ? -44.101 88.860 228.417 1.00 58.86 ? 235 GLY A O     1 
ATOM   2620 N  N     . GLY C 3 240 ? -41.891 89.240 228.477 1.00 55.18 ? 236 GLY A N     1 
ATOM   2621 C  CA    . GLY C 3 240 ? -41.633 88.123 227.589 1.00 52.92 ? 236 GLY A CA    1 
ATOM   2622 C  C     . GLY C 3 240 ? -40.217 88.056 227.065 1.00 50.24 ? 236 GLY A C     1 
ATOM   2623 O  O     . GLY C 3 240 ? -39.297 88.628 227.650 1.00 50.56 ? 236 GLY A O     1 
ATOM   2624 N  N     . TYR C 3 241 ? -40.050 87.358 225.949 1.00 47.58 ? 237 TYR A N     1 
ATOM   2625 C  CA    . TYR C 3 241 ? -38.741 87.197 225.343 1.00 45.51 ? 237 TYR A CA    1 
ATOM   2626 C  C     . TYR C 3 241 ? -38.876 86.416 224.061 1.00 44.95 ? 237 TYR A C     1 
ATOM   2627 O  O     . TYR C 3 241 ? -39.951 85.927 223.723 1.00 44.70 ? 237 TYR A O     1 
ATOM   2628 C  CB    . TYR C 3 241 ? -37.817 86.449 226.291 1.00 44.21 ? 237 TYR A CB    1 
ATOM   2629 C  CG    . TYR C 3 241 ? -38.337 85.085 226.666 1.00 44.36 ? 237 TYR A CG    1 
ATOM   2630 C  CD1   . TYR C 3 241 ? -37.942 83.951 225.966 1.00 42.63 ? 237 TYR A CD1   1 
ATOM   2631 C  CD2   . TYR C 3 241 ? -39.221 84.927 227.737 1.00 45.50 ? 237 TYR A CD2   1 
ATOM   2632 C  CE1   . TYR C 3 241 ? -38.405 82.696 226.322 1.00 42.69 ? 237 TYR A CE1   1 
ATOM   2633 C  CE2   . TYR C 3 241 ? -39.692 83.670 228.104 1.00 44.36 ? 237 TYR A CE2   1 
ATOM   2634 C  CZ    . TYR C 3 241 ? -39.274 82.558 227.392 1.00 43.51 ? 237 TYR A CZ    1 
ATOM   2635 O  OH    . TYR C 3 241 ? -39.696 81.309 227.782 1.00 41.51 ? 237 TYR A OH    1 
ATOM   2636 N  N     . GLN C 3 242 ? -37.774 86.286 223.351 1.00 45.10 ? 238 GLN A N     1 
ATOM   2637 C  CA    . GLN C 3 242 ? -37.805 85.564 222.106 1.00 46.50 ? 238 GLN A CA    1 
ATOM   2638 C  C     . GLN C 3 242 ? -36.677 84.555 222.001 1.00 46.56 ? 238 GLN A C     1 
ATOM   2639 O  O     . GLN C 3 242 ? -35.635 84.688 222.649 1.00 47.03 ? 238 GLN A O     1 
ATOM   2640 C  CB    . GLN C 3 242 ? -37.732 86.539 220.943 1.00 47.58 ? 238 GLN A CB    1 
ATOM   2641 C  CG    . GLN C 3 242 ? -38.995 87.334 220.738 1.00 50.70 ? 238 GLN A CG    1 
ATOM   2642 C  CD    . GLN C 3 242 ? -38.959 88.106 219.444 1.00 52.39 ? 238 GLN A CD    1 
ATOM   2643 O  OE1   . GLN C 3 242 ? -39.998 88.488 218.902 1.00 55.34 ? 238 GLN A OE1   1 
ATOM   2644 N  NE2   . GLN C 3 242 ? -37.757 88.348 218.939 1.00 52.93 ? 238 GLN A NE2   1 
ATOM   2645 N  N     . ILE C 3 243 ? -36.900 83.530 221.190 1.00 45.21 ? 239 ILE A N     1 
ATOM   2646 C  CA    . ILE C 3 243 ? -35.893 82.514 220.989 1.00 44.28 ? 239 ILE A CA    1 
ATOM   2647 C  C     . ILE C 3 243 ? -35.903 82.120 219.536 1.00 44.34 ? 239 ILE A C     1 
ATOM   2648 O  O     . ILE C 3 243 ? -36.941 82.171 218.873 1.00 43.82 ? 239 ILE A O     1 
ATOM   2649 C  CB    . ILE C 3 243 ? -36.130 81.266 221.878 1.00 44.77 ? 239 ILE A CB    1 
ATOM   2650 C  CG1   . ILE C 3 243 ? -37.483 80.631 221.587 1.00 45.01 ? 239 ILE A CG1   1 
ATOM   2651 C  CG2   . ILE C 3 243 ? -36.096 81.661 223.355 1.00 45.94 ? 239 ILE A CG2   1 
ATOM   2652 C  CD1   . ILE C 3 243 ? -37.784 79.448 222.497 1.00 45.10 ? 239 ILE A CD1   1 
ATOM   2653 N  N     . SER C 3 244 ? -34.732 81.780 219.020 1.00 43.77 ? 240 SER A N     1 
ATOM   2654 C  CA    . SER C 3 244 ? -34.644 81.362 217.634 1.00 44.25 ? 240 SER A CA    1 
ATOM   2655 C  C     . SER C 3 244 ? -34.578 79.848 217.616 1.00 45.04 ? 240 SER A C     1 
ATOM   2656 O  O     . SER C 3 244 ? -33.657 79.242 218.169 1.00 47.15 ? 240 SER A O     1 
ATOM   2657 C  CB    . SER C 3 244 ? -33.409 81.956 216.965 1.00 43.73 ? 240 SER A CB    1 
ATOM   2658 O  OG    . SER C 3 244 ? -33.792 82.883 215.951 1.00 45.06 ? 240 SER A OG    1 
ATOM   2659 N  N     . ILE C 3 245 ? -35.591 79.233 217.018 1.00 42.52 ? 241 ILE A N     1 
ATOM   2660 C  CA    . ILE C 3 245 ? -35.625 77.786 216.918 1.00 38.10 ? 241 ILE A CA    1 
ATOM   2661 C  C     . ILE C 3 245 ? -34.886 77.468 215.627 1.00 35.31 ? 241 ILE A C     1 
ATOM   2662 O  O     . ILE C 3 245 ? -35.296 77.893 214.543 1.00 36.31 ? 241 ILE A O     1 
ATOM   2663 C  CB    . ILE C 3 245 ? -37.092 77.262 216.904 1.00 38.25 ? 241 ILE A CB    1 
ATOM   2664 C  CG1   . ILE C 3 245 ? -37.642 77.306 218.331 1.00 39.07 ? 241 ILE A CG1   1 
ATOM   2665 C  CG2   . ILE C 3 245 ? -37.158 75.855 216.357 1.00 37.17 ? 241 ILE A CG2   1 
ATOM   2666 C  CD1   . ILE C 3 245 ? -39.145 77.144 218.443 1.00 39.46 ? 241 ILE A CD1   1 
ATOM   2667 N  N     . PRO C 3 246 ? -33.751 76.758 215.742 1.00 31.67 ? 242 PRO A N     1 
ATOM   2668 C  CA    . PRO C 3 246 ? -32.920 76.371 214.602 1.00 28.88 ? 242 PRO A CA    1 
ATOM   2669 C  C     . PRO C 3 246 ? -33.482 75.227 213.777 1.00 29.50 ? 242 PRO A C     1 
ATOM   2670 O  O     . PRO C 3 246 ? -34.108 74.304 214.304 1.00 30.93 ? 242 PRO A O     1 
ATOM   2671 C  CB    . PRO C 3 246 ? -31.597 76.011 215.255 1.00 29.00 ? 242 PRO A CB    1 
ATOM   2672 C  CG    . PRO C 3 246 ? -32.024 75.453 216.571 1.00 29.68 ? 242 PRO A CG    1 
ATOM   2673 C  CD    . PRO C 3 246 ? -33.089 76.425 217.018 1.00 28.70 ? 242 PRO A CD    1 
ATOM   2674 N  N     . GLN C 3 247 ? -33.248 75.285 212.473 1.00 27.25 ? 243 GLN A N     1 
ATOM   2675 C  CA    . GLN C 3 247 ? -33.721 74.239 211.583 1.00 26.26 ? 243 GLN A CA    1 
ATOM   2676 C  C     . GLN C 3 247 ? -33.007 72.924 211.867 1.00 27.04 ? 243 GLN A C     1 
ATOM   2677 O  O     . GLN C 3 247 ? -31.822 72.914 212.196 1.00 27.51 ? 243 GLN A O     1 
ATOM   2678 C  CB    . GLN C 3 247 ? -33.493 74.657 210.134 1.00 24.84 ? 243 GLN A CB    1 
ATOM   2679 C  CG    . GLN C 3 247 ? -33.795 73.598 209.088 1.00 26.86 ? 243 GLN A CG    1 
ATOM   2680 C  CD    . GLN C 3 247 ? -32.776 72.473 209.051 1.00 28.97 ? 243 GLN A CD    1 
ATOM   2681 O  OE1   . GLN C 3 247 ? -31.685 72.588 209.598 1.00 32.11 ? 243 GLN A OE1   1 
ATOM   2682 N  NE2   . GLN C 3 247 ? -33.124 71.386 208.388 1.00 30.81 ? 243 GLN A NE2   1 
ATOM   2683 N  N     . LYS C 3 248 ? -33.739 71.818 211.741 1.00 29.64 ? 244 LYS A N     1 
ATOM   2684 C  CA    . LYS C 3 248 ? -33.177 70.483 211.952 1.00 30.01 ? 244 LYS A CA    1 
ATOM   2685 C  C     . LYS C 3 248 ? -33.967 69.415 211.236 1.00 30.99 ? 244 LYS A C     1 
ATOM   2686 O  O     . LYS C 3 248 ? -35.070 69.657 210.756 1.00 30.54 ? 244 LYS A O     1 
ATOM   2687 C  CB    . LYS C 3 248 ? -33.153 70.106 213.423 1.00 26.99 ? 244 LYS A CB    1 
ATOM   2688 C  CG    . LYS C 3 248 ? -34.504 69.699 213.941 1.00 23.26 ? 244 LYS A CG    1 
ATOM   2689 C  CD    . LYS C 3 248 ? -34.404 69.431 215.421 1.00 20.74 ? 244 LYS A CD    1 
ATOM   2690 C  CE    . LYS C 3 248 ? -35.734 69.142 216.031 1.00 17.87 ? 244 LYS A CE    1 
ATOM   2691 N  NZ    . LYS C 3 248 ? -35.537 68.708 217.433 1.00 18.26 ? 244 LYS A NZ    1 
ATOM   2692 N  N     . GLY C 3 249 ? -33.375 68.227 211.161 1.00 33.42 ? 245 GLY A N     1 
ATOM   2693 C  CA    . GLY C 3 249 ? -34.036 67.096 210.537 1.00 33.06 ? 245 GLY A CA    1 
ATOM   2694 C  C     . GLY C 3 249 ? -34.720 66.355 211.664 1.00 33.48 ? 245 GLY A C     1 
ATOM   2695 O  O     . GLY C 3 249 ? -34.220 66.314 212.797 1.00 31.80 ? 245 GLY A O     1 
ATOM   2696 N  N     . VAL C 3 250 ? -35.880 65.784 211.372 1.00 35.39 ? 246 VAL A N     1 
ATOM   2697 C  CA    . VAL C 3 250 ? -36.621 65.051 212.392 1.00 36.90 ? 246 VAL A CA    1 
ATOM   2698 C  C     . VAL C 3 250 ? -37.076 63.734 211.825 1.00 36.52 ? 246 VAL A C     1 
ATOM   2699 O  O     . VAL C 3 250 ? -37.056 63.542 210.615 1.00 34.73 ? 246 VAL A O     1 
ATOM   2700 C  CB    . VAL C 3 250 ? -37.874 65.823 212.859 1.00 37.10 ? 246 VAL A CB    1 
ATOM   2701 C  CG1   . VAL C 3 250 ? -38.301 65.320 214.222 1.00 38.00 ? 246 VAL A CG1   1 
ATOM   2702 C  CG2   . VAL C 3 250 ? -37.601 67.310 212.885 1.00 36.61 ? 246 VAL A CG2   1 
ATOM   2703 N  N     . VAL C 3 251 ? -37.463 62.826 212.711 1.00 39.60 ? 247 VAL A N     1 
ATOM   2704 C  CA    . VAL C 3 251 ? -37.957 61.520 212.307 1.00 43.55 ? 247 VAL A CA    1 
ATOM   2705 C  C     . VAL C 3 251 ? -39.266 61.232 213.021 1.00 45.74 ? 247 VAL A C     1 
ATOM   2706 O  O     . VAL C 3 251 ? -39.288 61.109 214.244 1.00 45.84 ? 247 VAL A O     1 
ATOM   2707 C  CB    . VAL C 3 251 ? -36.970 60.413 212.652 1.00 43.96 ? 247 VAL A CB    1 
ATOM   2708 C  CG1   . VAL C 3 251 ? -37.563 59.074 212.239 1.00 45.27 ? 247 VAL A CG1   1 
ATOM   2709 C  CG2   . VAL C 3 251 ? -35.643 60.651 211.937 1.00 45.32 ? 247 VAL A CG2   1 
ATOM   2710 N  N     . ASP C 3 252 ? -40.351 61.121 212.258 1.00 48.68 ? 248 ASP A N     1 
ATOM   2711 C  CA    . ASP C 3 252 ? -41.679 60.854 212.824 1.00 53.49 ? 248 ASP A CA    1 
ATOM   2712 C  C     . ASP C 3 252 ? -41.819 59.420 213.348 1.00 56.07 ? 248 ASP A C     1 
ATOM   2713 O  O     . ASP C 3 252 ? -40.987 58.557 213.058 1.00 56.49 ? 248 ASP A O     1 
ATOM   2714 C  CB    . ASP C 3 252 ? -42.765 61.133 211.774 1.00 53.26 ? 248 ASP A CB    1 
ATOM   2715 C  CG    . ASP C 3 252 ? -42.672 60.207 210.571 1.00 53.84 ? 248 ASP A CG    1 
ATOM   2716 O  OD1   . ASP C 3 252 ? -41.761 59.362 210.534 1.00 54.15 ? 248 ASP A OD1   1 
ATOM   2717 O  OD2   . ASP C 3 252 ? -43.515 60.321 209.657 1.00 53.17 ? 248 ASP A OD2   1 
ATOM   2718 N  N     . LYS C 3 253 ? -42.870 59.180 214.131 1.00 59.07 ? 249 LYS A N     1 
ATOM   2719 C  CA    . LYS C 3 253 ? -43.127 57.854 214.697 1.00 61.78 ? 249 LYS A CA    1 
ATOM   2720 C  C     . LYS C 3 253 ? -43.150 56.790 213.598 1.00 62.92 ? 249 LYS A C     1 
ATOM   2721 O  O     . LYS C 3 253 ? -42.696 55.660 213.797 1.00 61.52 ? 249 LYS A O     1 
ATOM   2722 C  CB    . LYS C 3 253 ? -44.452 57.853 215.452 1.00 62.59 ? 249 LYS A CB    1 
ATOM   2723 N  N     . ARG C 3 254 ? -43.669 57.173 212.436 1.00 65.16 ? 250 ARG A N     1 
ATOM   2724 C  CA    . ARG C 3 254 ? -43.758 56.282 211.285 1.00 68.65 ? 250 ARG A CA    1 
ATOM   2725 C  C     . ARG C 3 254 ? -42.360 55.871 210.820 1.00 69.39 ? 250 ARG A C     1 
ATOM   2726 O  O     . ARG C 3 254 ? -42.176 54.789 210.266 1.00 69.83 ? 250 ARG A O     1 
ATOM   2727 C  CB    . ARG C 3 254 ? -44.499 56.980 210.130 1.00 71.02 ? 250 ARG A CB    1 
ATOM   2728 C  CG    . ARG C 3 254 ? -45.915 57.509 210.454 1.00 74.62 ? 250 ARG A CG    1 
ATOM   2729 C  CD    . ARG C 3 254 ? -47.006 56.445 210.306 1.00 77.75 ? 250 ARG A CD    1 
ATOM   2730 N  NE    . ARG C 3 254 ? -47.017 55.463 211.394 1.00 80.77 ? 250 ARG A NE    1 
ATOM   2731 C  CZ    . ARG C 3 254 ? -47.562 55.658 212.596 1.00 81.64 ? 250 ARG A CZ    1 
ATOM   2732 N  NH1   . ARG C 3 254 ? -48.155 56.811 212.882 1.00 81.97 ? 250 ARG A NH1   1 
ATOM   2733 N  NH2   . ARG C 3 254 ? -47.517 54.695 213.515 1.00 81.42 ? 250 ARG A NH2   1 
ATOM   2734 N  N     . GLY C 3 255 ? -41.380 56.743 211.047 1.00 70.40 ? 251 GLY A N     1 
ATOM   2735 C  CA    . GLY C 3 255 ? -40.013 56.452 210.647 1.00 69.87 ? 251 GLY A CA    1 
ATOM   2736 C  C     . GLY C 3 255 ? -39.587 57.164 209.373 1.00 70.54 ? 251 GLY A C     1 
ATOM   2737 O  O     . GLY C 3 255 ? -38.488 56.928 208.870 1.00 70.49 ? 251 GLY A O     1 
ATOM   2738 N  N     . LYS C 3 256 ? -40.455 58.028 208.844 1.00 70.32 ? 252 LYS A N     1 
ATOM   2739 C  CA    . LYS C 3 256 ? -40.156 58.771 207.622 1.00 70.56 ? 252 LYS A CA    1 
ATOM   2740 C  C     . LYS C 3 256 ? -39.177 59.917 207.871 1.00 69.87 ? 252 LYS A C     1 
ATOM   2741 O  O     . LYS C 3 256 ? -38.210 59.762 208.613 1.00 71.71 ? 252 LYS A O     1 
ATOM   2742 C  CB    . LYS C 3 256 ? -41.447 59.295 206.977 1.00 71.63 ? 252 LYS A CB    1 
ATOM   2743 C  CG    . LYS C 3 256 ? -42.139 58.272 206.058 1.00 74.62 ? 252 LYS A CG    1 
ATOM   2744 C  CD    . LYS C 3 256 ? -43.523 58.740 205.570 1.00 75.52 ? 252 LYS A CD    1 
ATOM   2745 C  CE    . LYS C 3 256 ? -44.546 58.846 206.717 1.00 76.82 ? 252 LYS A CE    1 
ATOM   2746 N  NZ    . LYS C 3 256 ? -44.990 57.528 207.273 1.00 75.63 ? 252 LYS A NZ    1 
ATOM   2747 N  N     . ARG C 3 257 ? -39.421 61.070 207.264 1.00 67.80 ? 253 ARG A N     1 
ATOM   2748 C  CA    . ARG C 3 257 ? -38.522 62.195 207.429 1.00 64.35 ? 253 ARG A CA    1 
ATOM   2749 C  C     . ARG C 3 257 ? -39.291 63.502 207.332 1.00 62.03 ? 253 ARG A C     1 
ATOM   2750 O  O     . ARG C 3 257 ? -39.859 63.808 206.289 1.00 61.78 ? 253 ARG A O     1 
ATOM   2751 C  CB    . ARG C 3 257 ? -37.458 62.138 206.335 1.00 67.10 ? 253 ARG A CB    1 
ATOM   2752 C  CG    . ARG C 3 257 ? -36.722 60.792 206.257 1.00 69.10 ? 253 ARG A CG    1 
ATOM   2753 C  CD    . ARG C 3 257 ? -35.523 60.742 207.216 1.00 70.36 ? 253 ARG A CD    1 
ATOM   2754 N  NE    . ARG C 3 257 ? -35.105 59.386 207.551 1.00 68.74 ? 253 ARG A NE    1 
ATOM   2755 C  CZ    . ARG C 3 257 ? -34.754 58.467 206.663 1.00 69.44 ? 253 ARG A CZ    1 
ATOM   2756 N  NH1   . ARG C 3 257 ? -34.770 58.741 205.363 1.00 69.83 ? 253 ARG A NH1   1 
ATOM   2757 N  NH2   . ARG C 3 257 ? -34.373 57.270 207.084 1.00 71.24 ? 253 ARG A NH2   1 
ATOM   2758 N  N     . LYS C 3 258 ? -39.321 64.267 208.417 1.00 58.46 ? 254 LYS A N     1 
ATOM   2759 C  CA    . LYS C 3 258 ? -40.011 65.547 208.408 1.00 55.04 ? 254 LYS A CA    1 
ATOM   2760 C  C     . LYS C 3 258 ? -39.000 66.646 208.752 1.00 52.26 ? 254 LYS A C     1 
ATOM   2761 O  O     . LYS C 3 258 ? -38.089 66.440 209.558 1.00 51.68 ? 254 LYS A O     1 
ATOM   2762 C  CB    . LYS C 3 258 ? -41.153 65.565 209.427 1.00 55.95 ? 254 LYS A CB    1 
ATOM   2763 C  CG    . LYS C 3 258 ? -40.687 65.805 210.859 1.00 59.59 ? 254 LYS A CG    1 
ATOM   2764 C  CD    . LYS C 3 258 ? -41.836 66.098 211.835 1.00 62.81 ? 254 LYS A CD    1 
ATOM   2765 C  CE    . LYS C 3 258 ? -42.573 67.412 211.512 1.00 64.09 ? 254 LYS A CE    1 
ATOM   2766 N  NZ    . LYS C 3 258 ? -43.483 67.287 210.320 1.00 64.04 ? 254 LYS A NZ    1 
ATOM   2767 N  N     . ASN C 3 259 ? -39.180 67.817 208.149 1.00 48.34 ? 255 ASN A N     1 
ATOM   2768 C  CA    . ASN C 3 259 ? -38.291 68.950 208.364 1.00 44.22 ? 255 ASN A CA    1 
ATOM   2769 C  C     . ASN C 3 259 ? -38.863 69.916 209.397 1.00 41.76 ? 255 ASN A C     1 
ATOM   2770 O  O     . ASN C 3 259 ? -40.070 70.134 209.445 1.00 42.37 ? 255 ASN A O     1 
ATOM   2771 C  CB    . ASN C 3 259 ? -38.074 69.682 207.032 1.00 44.00 ? 255 ASN A CB    1 
ATOM   2772 C  CG    . ASN C 3 259 ? -37.080 70.821 207.140 1.00 43.27 ? 255 ASN A CG    1 
ATOM   2773 O  OD1   . ASN C 3 259 ? -35.904 70.611 207.424 1.00 43.45 ? 255 ASN A OD1   1 
ATOM   2774 N  ND2   . ASN C 3 259 ? -37.549 72.035 206.905 1.00 41.91 ? 255 ASN A ND2   1 
ATOM   2775 N  N     . ARG C 3 260 ? -38.000 70.460 210.252 1.00 39.15 ? 256 ARG A N     1 
ATOM   2776 C  CA    . ARG C 3 260 ? -38.438 71.442 211.239 1.00 36.64 ? 256 ARG A CA    1 
ATOM   2777 C  C     . ARG C 3 260 ? -37.751 72.754 210.889 1.00 38.78 ? 256 ARG A C     1 
ATOM   2778 O  O     . ARG C 3 260 ? -36.658 73.042 211.386 1.00 38.75 ? 256 ARG A O     1 
ATOM   2779 C  CB    . ARG C 3 260 ? -38.058 71.075 212.664 1.00 32.21 ? 256 ARG A CB    1 
ATOM   2780 C  CG    . ARG C 3 260 ? -38.375 72.235 213.597 1.00 31.99 ? 256 ARG A CG    1 
ATOM   2781 C  CD    . ARG C 3 260 ? -37.969 72.024 215.039 1.00 32.08 ? 256 ARG A CD    1 
ATOM   2782 N  NE    . ARG C 3 260 ? -36.734 72.729 215.377 1.00 32.73 ? 256 ARG A NE    1 
ATOM   2783 C  CZ    . ARG C 3 260 ? -36.226 72.782 216.604 1.00 34.56 ? 256 ARG A CZ    1 
ATOM   2784 N  NH1   . ARG C 3 260 ? -36.857 72.172 217.603 1.00 35.94 ? 256 ARG A NH1   1 
ATOM   2785 N  NH2   . ARG C 3 260 ? -35.092 73.435 216.835 1.00 33.56 ? 256 ARG A NH2   1 
ATOM   2786 N  N     . PRO C 3 261 ? -38.398 73.581 210.045 1.00 38.20 ? 257 PRO A N     1 
ATOM   2787 C  CA    . PRO C 3 261 ? -37.810 74.860 209.645 1.00 36.73 ? 257 PRO A CA    1 
ATOM   2788 C  C     . PRO C 3 261 ? -37.513 75.789 210.813 1.00 35.27 ? 257 PRO A C     1 
ATOM   2789 O  O     . PRO C 3 261 ? -38.067 75.648 211.906 1.00 35.41 ? 257 PRO A O     1 
ATOM   2790 C  CB    . PRO C 3 261 ? -38.847 75.422 208.688 1.00 36.24 ? 257 PRO A CB    1 
ATOM   2791 C  CG    . PRO C 3 261 ? -40.115 74.921 209.268 1.00 37.82 ? 257 PRO A CG    1 
ATOM   2792 C  CD    . PRO C 3 261 ? -39.805 73.499 209.613 1.00 37.85 ? 257 PRO A CD    1 
ATOM   2793 N  N     . ALA C 3 262 ? -36.625 76.742 210.579 1.00 34.26 ? 258 ALA A N     1 
ATOM   2794 C  CA    . ALA C 3 262 ? -36.262 77.685 211.624 1.00 34.35 ? 258 ALA A CA    1 
ATOM   2795 C  C     . ALA C 3 262 ? -37.334 78.743 211.763 1.00 33.95 ? 258 ALA A C     1 
ATOM   2796 O  O     . ALA C 3 262 ? -38.061 79.035 210.813 1.00 31.59 ? 258 ALA A O     1 
ATOM   2797 C  CB    . ALA C 3 262 ? -34.932 78.341 211.294 1.00 34.96 ? 258 ALA A CB    1 
ATOM   2798 N  N     . ARG C 3 263 ? -37.422 79.319 212.952 1.00 35.40 ? 259 ARG A N     1 
ATOM   2799 C  CA    . ARG C 3 263 ? -38.393 80.351 213.192 1.00 39.19 ? 259 ARG A CA    1 
ATOM   2800 C  C     . ARG C 3 263 ? -38.193 80.937 214.573 1.00 42.18 ? 259 ARG A C     1 
ATOM   2801 O  O     . ARG C 3 263 ? -37.876 80.208 215.519 1.00 43.42 ? 259 ARG A O     1 
ATOM   2802 C  CB    . ARG C 3 263 ? -39.805 79.794 213.050 1.00 40.22 ? 259 ARG A CB    1 
ATOM   2803 C  CG    . ARG C 3 263 ? -40.221 78.866 214.166 1.00 42.02 ? 259 ARG A CG    1 
ATOM   2804 C  CD    . ARG C 3 263 ? -41.722 78.670 214.135 1.00 44.62 ? 259 ARG A CD    1 
ATOM   2805 N  NE    . ARG C 3 263 ? -42.230 78.558 215.493 1.00 45.38 ? 259 ARG A NE    1 
ATOM   2806 C  CZ    . ARG C 3 263 ? -42.167 77.453 216.219 1.00 47.56 ? 259 ARG A CZ    1 
ATOM   2807 N  NH1   . ARG C 3 263 ? -41.625 76.351 215.707 1.00 49.79 ? 259 ARG A NH1   1 
ATOM   2808 N  NH2   . ARG C 3 263 ? -42.624 77.462 217.462 1.00 46.59 ? 259 ARG A NH2   1 
ATOM   2809 N  N     . LYS C 3 264 ? -38.354 82.260 214.676 1.00 45.66 ? 260 LYS A N     1 
ATOM   2810 C  CA    . LYS C 3 264 ? -38.203 82.962 215.950 1.00 48.02 ? 260 LYS A CA    1 
ATOM   2811 C  C     . LYS C 3 264 ? -39.522 82.855 216.691 1.00 47.28 ? 260 LYS A C     1 
ATOM   2812 O  O     . LYS C 3 264 ? -40.572 83.195 216.161 1.00 46.78 ? 260 LYS A O     1 
ATOM   2813 C  CB    . LYS C 3 264 ? -37.857 84.447 215.729 1.00 50.75 ? 260 LYS A CB    1 
ATOM   2814 C  CG    . LYS C 3 264 ? -36.568 84.710 214.931 1.00 55.98 ? 260 LYS A CG    1 
ATOM   2815 C  CD    . LYS C 3 264 ? -36.113 86.189 214.981 1.00 59.14 ? 260 LYS A CD    1 
ATOM   2816 C  CE    . LYS C 3 264 ? -37.166 87.157 214.411 1.00 60.50 ? 260 LYS A CE    1 
ATOM   2817 N  NZ    . LYS C 3 264 ? -36.720 88.588 214.388 1.00 60.83 ? 260 LYS A NZ    1 
ATOM   2818 N  N     . ALA C 3 265 ? -39.459 82.378 217.921 1.00 47.64 ? 261 ALA A N     1 
ATOM   2819 C  CA    . ALA C 3 265 ? -40.651 82.226 218.725 1.00 48.22 ? 261 ALA A CA    1 
ATOM   2820 C  C     . ALA C 3 265 ? -40.714 83.295 219.798 1.00 48.95 ? 261 ALA A C     1 
ATOM   2821 O  O     . ALA C 3 265 ? -39.780 83.463 220.602 1.00 48.91 ? 261 ALA A O     1 
ATOM   2822 C  CB    . ALA C 3 265 ? -40.686 80.842 219.358 1.00 48.91 ? 261 ALA A CB    1 
ATOM   2823 N  N     . SER C 3 266 ? -41.839 84.001 219.810 1.00 47.70 ? 262 SER A N     1 
ATOM   2824 C  CA    . SER C 3 266 ? -42.078 85.077 220.760 1.00 46.44 ? 262 SER A CA    1 
ATOM   2825 C  C     . SER C 3 266 ? -42.844 84.486 221.937 1.00 45.90 ? 262 SER A C     1 
ATOM   2826 O  O     . SER C 3 266 ? -43.852 83.834 221.744 1.00 47.03 ? 262 SER A O     1 
ATOM   2827 C  CB    . SER C 3 266 ? -42.904 86.161 220.072 1.00 45.64 ? 262 SER A CB    1 
ATOM   2828 O  OG    . SER C 3 266 ? -42.538 86.253 218.701 1.00 43.38 ? 262 SER A OG    1 
ATOM   2829 N  N     . LEU C 3 267 ? -42.374 84.701 223.153 1.00 46.18 ? 263 LEU A N     1 
ATOM   2830 C  CA    . LEU C 3 267 ? -43.067 84.136 224.289 1.00 47.02 ? 263 LEU A CA    1 
ATOM   2831 C  C     . LEU C 3 267 ? -43.588 85.141 225.304 1.00 48.65 ? 263 LEU A C     1 
ATOM   2832 O  O     . LEU C 3 267 ? -42.982 86.187 225.536 1.00 50.84 ? 263 LEU A O     1 
ATOM   2833 C  CB    . LEU C 3 267 ? -42.169 83.132 225.006 1.00 46.94 ? 263 LEU A CB    1 
ATOM   2834 C  CG    . LEU C 3 267 ? -41.865 81.863 224.217 1.00 48.27 ? 263 LEU A CG    1 
ATOM   2835 C  CD1   . LEU C 3 267 ? -40.588 82.033 223.397 1.00 48.59 ? 263 LEU A CD1   1 
ATOM   2836 C  CD2   . LEU C 3 267 ? -41.731 80.720 225.187 1.00 48.43 ? 263 LEU A CD2   1 
ATOM   2837 N  N     . SER C 3 268 ? -44.722 84.816 225.907 1.00 48.30 ? 264 SER A N     1 
ATOM   2838 C  CA    . SER C 3 268 ? -45.315 85.659 226.928 1.00 49.35 ? 264 SER A CA    1 
ATOM   2839 C  C     . SER C 3 268 ? -44.925 85.042 228.269 1.00 49.35 ? 264 SER A C     1 
ATOM   2840 O  O     . SER C 3 268 ? -44.959 83.822 228.416 1.00 49.59 ? 264 SER A O     1 
ATOM   2841 C  CB    . SER C 3 268 ? -46.836 85.663 226.766 1.00 50.43 ? 264 SER A CB    1 
ATOM   2842 O  OG    . SER C 3 268 ? -47.495 85.852 228.013 1.00 51.40 ? 264 SER A OG    1 
ATOM   2843 N  N     . LEU C 3 269 ? -44.558 85.864 229.247 1.00 48.15 ? 265 LEU A N     1 
ATOM   2844 C  CA    . LEU C 3 269 ? -44.165 85.311 230.535 1.00 47.99 ? 265 LEU A CA    1 
ATOM   2845 C  C     . LEU C 3 269 ? -44.898 85.871 231.750 1.00 47.92 ? 265 LEU A C     1 
ATOM   2846 O  O     . LEU C 3 269 ? -45.135 87.072 231.862 1.00 47.46 ? 265 LEU A O     1 
ATOM   2847 C  CB    . LEU C 3 269 ? -42.656 85.468 230.728 1.00 49.49 ? 265 LEU A CB    1 
ATOM   2848 C  CG    . LEU C 3 269 ? -41.997 84.740 231.903 1.00 49.86 ? 265 LEU A CG    1 
ATOM   2849 C  CD1   . LEU C 3 269 ? -42.590 83.362 232.131 1.00 51.66 ? 265 LEU A CD1   1 
ATOM   2850 C  CD2   . LEU C 3 269 ? -40.543 84.608 231.588 1.00 51.92 ? 265 LEU A CD2   1 
ATOM   2851 N  N     . ARG C 3 270 ? -45.252 84.972 232.663 1.00 48.28 ? 266 ARG A N     1 
ATOM   2852 C  CA    . ARG C 3 270 ? -45.968 85.330 233.877 1.00 47.77 ? 266 ARG A CA    1 
ATOM   2853 C  C     . ARG C 3 270 ? -45.287 84.683 235.060 1.00 47.49 ? 266 ARG A C     1 
ATOM   2854 O  O     . ARG C 3 270 ? -44.344 83.915 234.894 1.00 48.52 ? 266 ARG A O     1 
ATOM   2855 C  CB    . ARG C 3 270 ? -47.414 84.832 233.808 1.00 47.99 ? 266 ARG A CB    1 
ATOM   2856 C  CG    . ARG C 3 270 ? -48.159 85.274 232.568 1.00 48.52 ? 266 ARG A CG    1 
ATOM   2857 C  CD    . ARG C 3 270 ? -49.626 84.950 232.668 1.00 49.86 ? 266 ARG A CD    1 
ATOM   2858 N  NE    . ARG C 3 270 ? -50.421 85.964 231.993 1.00 51.36 ? 266 ARG A NE    1 
ATOM   2859 C  CZ    . ARG C 3 270 ? -50.423 86.153 230.680 1.00 53.28 ? 266 ARG A CZ    1 
ATOM   2860 N  NH1   . ARG C 3 270 ? -49.680 85.388 229.893 1.00 53.47 ? 266 ARG A NH1   1 
ATOM   2861 N  NH2   . ARG C 3 270 ? -51.145 87.131 230.155 1.00 56.35 ? 266 ARG A NH2   1 
ATOM   2862 N  N     . SER C 3 271 ? -45.786 84.977 236.253 1.00 46.03 ? 267 SER A N     1 
ATOM   2863 C  CA    . SER C 3 271 ? -45.216 84.418 237.459 1.00 45.54 ? 267 SER A CA    1 
ATOM   2864 C  C     . SER C 3 271 ? -46.134 84.585 238.658 1.00 46.35 ? 267 SER A C     1 
ATOM   2865 O  O     . SER C 3 271 ? -47.013 85.448 238.667 1.00 46.31 ? 267 SER A O     1 
ATOM   2866 C  CB    . SER C 3 271 ? -43.884 85.095 237.750 1.00 44.69 ? 267 SER A CB    1 
ATOM   2867 O  OG    . SER C 3 271 ? -43.601 85.060 239.136 1.00 45.55 ? 267 SER A OG    1 
ATOM   2868 N  N     . GLY C 3 272 ? -45.920 83.754 239.674 1.00 45.07 ? 268 GLY A N     1 
ATOM   2869 C  CA    . GLY C 3 272 ? -46.727 83.844 240.874 1.00 45.87 ? 268 GLY A CA    1 
ATOM   2870 C  C     . GLY C 3 272 ? -46.363 82.807 241.915 1.00 46.53 ? 268 GLY A C     1 
ATOM   2871 O  O     . GLY C 3 272 ? -45.444 82.020 241.712 1.00 46.75 ? 268 GLY A O     1 
ATOM   2872 N  N     . ARG C 3 273 ? -47.077 82.810 243.036 1.00 47.35 ? 269 ARG A N     1 
ATOM   2873 C  CA    . ARG C 3 273 ? -46.829 81.845 244.096 1.00 48.73 ? 269 ARG A CA    1 
ATOM   2874 C  C     . ARG C 3 273 ? -47.940 80.809 244.107 1.00 48.34 ? 269 ARG A C     1 
ATOM   2875 O  O     . ARG C 3 273 ? -49.119 81.141 243.960 1.00 48.49 ? 269 ARG A O     1 
ATOM   2876 C  CB    . ARG C 3 273 ? -46.761 82.532 245.460 1.00 50.30 ? 269 ARG A CB    1 
ATOM   2877 C  CG    . ARG C 3 273 ? -46.938 81.572 246.617 1.00 54.65 ? 269 ARG A CG    1 
ATOM   2878 C  CD    . ARG C 3 273 ? -46.702 82.237 247.956 1.00 60.54 ? 269 ARG A CD    1 
ATOM   2879 N  NE    . ARG C 3 273 ? -45.332 82.735 248.075 1.00 65.35 ? 269 ARG A NE    1 
ATOM   2880 C  CZ    . ARG C 3 273 ? -44.654 82.788 249.218 1.00 68.53 ? 269 ARG A CZ    1 
ATOM   2881 N  NH1   . ARG C 3 273 ? -45.217 82.368 250.348 1.00 69.57 ? 269 ARG A NH1   1 
ATOM   2882 N  NH2   . ARG C 3 273 ? -43.412 83.257 249.229 1.00 70.09 ? 269 ARG A NH2   1 
ATOM   2883 N  N     . ILE C 3 274 ? -47.551 79.551 244.280 1.00 47.03 ? 270 ILE A N     1 
ATOM   2884 C  CA    . ILE C 3 274 ? -48.502 78.455 244.313 1.00 46.28 ? 270 ILE A CA    1 
ATOM   2885 C  C     . ILE C 3 274 ? -48.323 77.700 245.625 1.00 46.14 ? 270 ILE A C     1 
ATOM   2886 O  O     . ILE C 3 274 ? -47.382 77.964 246.373 1.00 46.34 ? 270 ILE A O     1 
ATOM   2887 C  CB    . ILE C 3 274 ? -48.290 77.511 243.114 1.00 45.24 ? 270 ILE A CB    1 
ATOM   2888 C  CG1   . ILE C 3 274 ? -46.857 76.975 243.130 1.00 46.40 ? 270 ILE A CG1   1 
ATOM   2889 C  CG2   . ILE C 3 274 ? -48.567 78.258 241.813 1.00 43.41 ? 270 ILE A CG2   1 
ATOM   2890 C  CD1   . ILE C 3 274 ? -46.455 76.168 241.892 1.00 45.48 ? 270 ILE A CD1   1 
ATOM   2891 N  N     . THR C 3 275 ? -49.244 76.788 245.916 1.00 44.93 ? 271 THR A N     1 
ATOM   2892 C  CA    . THR C 3 275 ? -49.190 75.994 247.138 1.00 43.71 ? 271 THR A CA    1 
ATOM   2893 C  C     . THR C 3 275 ? -49.868 74.669 246.827 1.00 43.54 ? 271 THR A C     1 
ATOM   2894 O  O     . THR C 3 275 ? -51.001 74.646 246.367 1.00 45.28 ? 271 THR A O     1 
ATOM   2895 C  CB    . THR C 3 275 ? -49.928 76.703 248.295 1.00 44.00 ? 271 THR A CB    1 
ATOM   2896 O  OG1   . THR C 3 275 ? -49.516 78.076 248.359 1.00 44.36 ? 271 THR A OG1   1 
ATOM   2897 C  CG2   . THR C 3 275 ? -49.602 76.034 249.629 1.00 43.00 ? 271 THR A CG2   1 
ATOM   2898 N  N     . LEU C 3 276 ? -49.163 73.568 247.053 1.00 43.45 ? 272 LEU A N     1 
ATOM   2899 C  CA    . LEU C 3 276 ? -49.705 72.248 246.773 1.00 43.53 ? 272 LEU A CA    1 
ATOM   2900 C  C     . LEU C 3 276 ? -50.337 71.644 248.014 1.00 44.89 ? 272 LEU A C     1 
ATOM   2901 O  O     . LEU C 3 276 ? -49.976 71.997 249.135 1.00 44.93 ? 272 LEU A O     1 
ATOM   2902 C  CB    . LEU C 3 276 ? -48.592 71.343 246.271 1.00 41.50 ? 272 LEU A CB    1 
ATOM   2903 C  CG    . LEU C 3 276 ? -47.691 72.036 245.249 1.00 39.31 ? 272 LEU A CG    1 
ATOM   2904 C  CD1   . LEU C 3 276 ? -46.506 71.139 244.953 1.00 39.77 ? 272 LEU A CD1   1 
ATOM   2905 C  CD2   . LEU C 3 276 ? -48.471 72.374 243.999 1.00 37.56 ? 272 LEU A CD2   1 
ATOM   2906 N  N     . LYS C 3 277 ? -51.266 70.716 247.815 1.00 46.20 ? 273 LYS A N     1 
ATOM   2907 C  CA    . LYS C 3 277 ? -51.950 70.085 248.936 1.00 47.38 ? 273 LYS A CA    1 
ATOM   2908 C  C     . LYS C 3 277 ? -50.991 69.392 249.894 1.00 48.79 ? 273 LYS A C     1 
ATOM   2909 O  O     . LYS C 3 277 ? -50.845 69.806 251.046 1.00 49.30 ? 273 LYS A O     1 
ATOM   2910 C  CB    . LYS C 3 277 ? -52.978 69.101 248.423 1.00 46.11 ? 273 LYS A CB    1 
ATOM   2911 N  N     . GLN C 3 278 ? -50.332 68.341 249.411 1.00 50.69 ? 274 GLN A N     1 
ATOM   2912 C  CA    . GLN C 3 278 ? -49.402 67.570 250.236 1.00 51.72 ? 274 GLN A CA    1 
ATOM   2913 C  C     . GLN C 3 278 ? -48.360 68.427 250.945 1.00 52.48 ? 274 GLN A C     1 
ATOM   2914 O  O     . GLN C 3 278 ? -47.697 69.264 250.331 1.00 52.30 ? 274 GLN A O     1 
ATOM   2915 C  CB    . GLN C 3 278 ? -48.716 66.483 249.400 1.00 51.65 ? 274 GLN A CB    1 
ATOM   2916 C  CG    . GLN C 3 278 ? -48.340 66.893 247.995 1.00 52.56 ? 274 GLN A CG    1 
ATOM   2917 C  CD    . GLN C 3 278 ? -49.535 66.996 247.065 1.00 52.16 ? 274 GLN A CD    1 
ATOM   2918 O  OE1   . GLN C 3 278 ? -50.144 68.059 246.935 1.00 52.40 ? 274 GLN A OE1   1 
ATOM   2919 N  NE2   . GLN C 3 278 ? -49.880 65.885 246.412 1.00 51.95 ? 274 GLN A NE2   1 
ATOM   2920 N  N     . GLY C 3 279 ? -48.228 68.205 252.252 1.00 53.42 ? 275 GLY A N     1 
ATOM   2921 C  CA    . GLY C 3 279 ? -47.281 68.954 253.061 1.00 53.79 ? 275 GLY A CA    1 
ATOM   2922 C  C     . GLY C 3 279 ? -47.605 70.435 253.054 1.00 53.71 ? 275 GLY A C     1 
ATOM   2923 O  O     . GLY C 3 279 ? -46.945 71.222 253.725 1.00 53.44 ? 275 GLY A O     1 
ATOM   2924 N  N     . ASN C 3 280 ? -48.644 70.799 252.308 1.00 55.05 ? 276 ASN A N     1 
ATOM   2925 C  CA    . ASN C 3 280 ? -49.083 72.185 252.158 1.00 56.21 ? 276 ASN A CA    1 
ATOM   2926 C  C     . ASN C 3 280 ? -47.880 73.077 251.869 1.00 54.71 ? 276 ASN A C     1 
ATOM   2927 O  O     . ASN C 3 280 ? -47.747 74.175 252.414 1.00 54.39 ? 276 ASN A O     1 
ATOM   2928 C  CB    . ASN C 3 280 ? -49.825 72.676 253.406 1.00 58.89 ? 276 ASN A CB    1 
ATOM   2929 C  CG    . ASN C 3 280 ? -51.185 73.288 253.067 1.00 62.12 ? 276 ASN A CG    1 
ATOM   2930 O  OD1   . ASN C 3 280 ? -52.119 72.581 252.676 1.00 63.68 ? 276 ASN A OD1   1 
ATOM   2931 N  ND2   . ASN C 3 280 ? -51.295 74.608 253.202 1.00 64.14 ? 276 ASN A ND2   1 
ATOM   2932 N  N     . ILE C 3 281 ? -47.009 72.584 250.992 1.00 51.58 ? 277 ILE A N     1 
ATOM   2933 C  CA    . ILE C 3 281 ? -45.809 73.301 250.601 1.00 48.47 ? 277 ILE A CA    1 
ATOM   2934 C  C     . ILE C 3 281 ? -46.120 74.473 249.677 1.00 47.69 ? 277 ILE A C     1 
ATOM   2935 O  O     . ILE C 3 281 ? -47.057 74.424 248.882 1.00 47.57 ? 277 ILE A O     1 
ATOM   2936 C  CB    . ILE C 3 281 ? -44.822 72.379 249.883 1.00 47.72 ? 277 ILE A CB    1 
ATOM   2937 C  CG1   . ILE C 3 281 ? -45.503 71.758 248.669 1.00 47.34 ? 277 ILE A CG1   1 
ATOM   2938 C  CG2   . ILE C 3 281 ? -44.322 71.300 250.836 1.00 46.49 ? 277 ILE A CG2   1 
ATOM   2939 C  CD1   . ILE C 3 281 ? -44.564 71.021 247.757 1.00 47.57 ? 277 ILE A CD1   1 
ATOM   2940 N  N     . THR C 3 282 ? -45.302 75.515 249.780 1.00 46.36 ? 278 THR A N     1 
ATOM   2941 C  CA    . THR C 3 282 ? -45.462 76.731 248.991 1.00 44.45 ? 278 THR A CA    1 
ATOM   2942 C  C     . THR C 3 282 ? -44.190 77.044 248.183 1.00 42.96 ? 278 THR A C     1 
ATOM   2943 O  O     . THR C 3 282 ? -43.083 76.782 248.638 1.00 43.31 ? 278 THR A O     1 
ATOM   2944 C  CB    . THR C 3 282 ? -45.730 77.932 249.926 1.00 44.92 ? 278 THR A CB    1 
ATOM   2945 O  OG1   . THR C 3 282 ? -46.680 77.561 250.932 1.00 45.83 ? 278 THR A OG1   1 
ATOM   2946 C  CG2   . THR C 3 282 ? -46.262 79.115 249.143 1.00 44.21 ? 278 THR A CG2   1 
ATOM   2947 N  N     . LEU C 3 283 ? -44.347 77.613 246.996 1.00 40.76 ? 279 LEU A N     1 
ATOM   2948 C  CA    . LEU C 3 283 ? -43.201 77.972 246.178 1.00 39.76 ? 279 LEU A CA    1 
ATOM   2949 C  C     . LEU C 3 283 ? -43.642 78.890 245.043 1.00 40.69 ? 279 LEU A C     1 
ATOM   2950 O  O     . LEU C 3 283 ? -44.837 79.173 244.892 1.00 42.04 ? 279 LEU A O     1 
ATOM   2951 C  CB    . LEU C 3 283 ? -42.535 76.729 245.595 1.00 38.93 ? 279 LEU A CB    1 
ATOM   2952 C  CG    . LEU C 3 283 ? -43.448 75.847 244.751 1.00 38.03 ? 279 LEU A CG    1 
ATOM   2953 C  CD1   . LEU C 3 283 ? -42.643 75.171 243.654 1.00 37.55 ? 279 LEU A CD1   1 
ATOM   2954 C  CD2   . LEU C 3 283 ? -44.137 74.833 245.643 1.00 38.99 ? 279 LEU A CD2   1 
ATOM   2955 N  N     . ASN C 3 284 ? -42.694 79.356 244.237 1.00 39.64 ? 280 ASN A N     1 
ATOM   2956 C  CA    . ASN C 3 284 ? -43.065 80.237 243.140 1.00 40.43 ? 280 ASN A CA    1 
ATOM   2957 C  C     . ASN C 3 284 ? -43.132 79.409 241.892 1.00 39.19 ? 280 ASN A C     1 
ATOM   2958 O  O     . ASN C 3 284 ? -42.648 78.285 241.877 1.00 40.09 ? 280 ASN A O     1 
ATOM   2959 C  CB    . ASN C 3 284 ? -42.064 81.390 242.968 1.00 41.83 ? 280 ASN A CB    1 
ATOM   2960 C  CG    . ASN C 3 284 ? -41.783 82.111 244.281 1.00 43.93 ? 280 ASN A CG    1 
ATOM   2961 O  OD1   . ASN C 3 284 ? -42.711 82.552 244.970 1.00 44.73 ? 280 ASN A OD1   1 
ATOM   2962 N  ND2   . ASN C 3 284 ? -40.506 82.221 244.639 1.00 43.49 ? 280 ASN A ND2   1 
ATOM   2963 N  N     . ALA C 3 285 ? -43.759 79.953 240.854 1.00 37.49 ? 281 ALA A N     1 
ATOM   2964 C  CA    . ALA C 3 285 ? -43.904 79.238 239.596 1.00 36.59 ? 281 ALA A CA    1 
ATOM   2965 C  C     . ALA C 3 285 ? -43.816 80.241 238.472 1.00 36.68 ? 281 ALA A C     1 
ATOM   2966 O  O     . ALA C 3 285 ? -44.016 81.433 238.681 1.00 37.89 ? 281 ALA A O     1 
ATOM   2967 C  CB    . ALA C 3 285 ? -45.240 78.507 239.550 1.00 35.35 ? 281 ALA A CB    1 
ATOM   2968 N  N     . VAL C 3 286 ? -43.505 79.754 237.281 1.00 36.82 ? 282 VAL A N     1 
ATOM   2969 C  CA    . VAL C 3 286 ? -43.376 80.610 236.125 1.00 37.83 ? 282 VAL A CA    1 
ATOM   2970 C  C     . VAL C 3 286 ? -44.020 79.890 234.946 1.00 39.87 ? 282 VAL A C     1 
ATOM   2971 O  O     . VAL C 3 286 ? -43.872 78.680 234.794 1.00 40.63 ? 282 VAL A O     1 
ATOM   2972 C  CB    . VAL C 3 286 ? -41.886 80.900 235.855 1.00 37.26 ? 282 VAL A CB    1 
ATOM   2973 C  CG1   . VAL C 3 286 ? -41.715 81.762 234.633 1.00 37.17 ? 282 VAL A CG1   1 
ATOM   2974 C  CG2   . VAL C 3 286 ? -41.279 81.580 237.068 1.00 38.25 ? 282 VAL A CG2   1 
ATOM   2975 N  N     . LEU C 3 287 ? -44.753 80.635 234.127 1.00 41.18 ? 283 LEU A N     1 
ATOM   2976 C  CA    . LEU C 3 287 ? -45.426 80.060 232.982 1.00 43.49 ? 283 LEU A CA    1 
ATOM   2977 C  C     . LEU C 3 287 ? -45.051 80.831 231.733 1.00 45.51 ? 283 LEU A C     1 
ATOM   2978 O  O     . LEU C 3 287 ? -45.429 81.989 231.583 1.00 46.89 ? 283 LEU A O     1 
ATOM   2979 C  CB    . LEU C 3 287 ? -46.938 80.124 233.174 1.00 44.00 ? 283 LEU A CB    1 
ATOM   2980 C  CG    . LEU C 3 287 ? -47.749 79.791 231.918 1.00 44.77 ? 283 LEU A CG    1 
ATOM   2981 C  CD1   . LEU C 3 287 ? -47.702 78.293 231.673 1.00 47.12 ? 283 LEU A CD1   1 
ATOM   2982 C  CD2   . LEU C 3 287 ? -49.185 80.258 232.081 1.00 45.98 ? 283 LEU A CD2   1 
ATOM   2983 N  N     . ALA C 3 288 ? -44.298 80.198 230.842 1.00 46.17 ? 284 ALA A N     1 
ATOM   2984 C  CA    . ALA C 3 288 ? -43.899 80.849 229.611 1.00 48.52 ? 284 ALA A CA    1 
ATOM   2985 C  C     . ALA C 3 288 ? -44.628 80.186 228.454 1.00 51.42 ? 284 ALA A C     1 
ATOM   2986 O  O     . ALA C 3 288 ? -44.447 78.997 228.198 1.00 52.22 ? 284 ALA A O     1 
ATOM   2987 C  CB    . ALA C 3 288 ? -42.400 80.736 229.426 1.00 49.11 ? 284 ALA A CB    1 
ATOM   2988 N  N     . GLU C 3 289 ? -45.464 80.948 227.756 1.00 55.19 ? 285 GLU A N     1 
ATOM   2989 C  CA    . GLU C 3 289 ? -46.213 80.399 226.632 1.00 57.50 ? 285 GLU A CA    1 
ATOM   2990 C  C     . GLU C 3 289 ? -45.980 81.158 225.326 1.00 58.32 ? 285 GLU A C     1 
ATOM   2991 O  O     . GLU C 3 289 ? -46.046 82.383 225.281 1.00 57.29 ? 285 GLU A O     1 
ATOM   2992 C  CB    . GLU C 3 289 ? -47.705 80.374 226.966 1.00 58.03 ? 285 GLU A CB    1 
ATOM   2993 C  CG    . GLU C 3 289 ? -48.531 79.595 225.961 1.00 59.59 ? 285 GLU A CG    1 
ATOM   2994 C  CD    . GLU C 3 289 ? -49.709 78.900 226.606 1.00 60.48 ? 285 GLU A CD    1 
ATOM   2995 O  OE1   . GLU C 3 289 ? -50.303 78.010 225.958 1.00 60.75 ? 285 GLU A OE1   1 
ATOM   2996 O  OE2   . GLU C 3 289 ? -50.040 79.245 227.760 1.00 61.33 ? 285 GLU A OE2   1 
ATOM   2997 N  N     . GLU C 3 290 ? -45.713 80.402 224.267 1.00 61.17 ? 286 GLU A N     1 
ATOM   2998 C  CA    . GLU C 3 290 ? -45.450 80.942 222.939 1.00 65.07 ? 286 GLU A CA    1 
ATOM   2999 C  C     . GLU C 3 290 ? -46.455 81.991 222.501 1.00 67.58 ? 286 GLU A C     1 
ATOM   3000 O  O     . GLU C 3 290 ? -47.462 82.213 223.166 1.00 68.63 ? 286 GLU A O     1 
ATOM   3001 C  CB    . GLU C 3 290 ? -45.427 79.803 221.923 1.00 66.21 ? 286 GLU A CB    1 
ATOM   3002 C  CG    . GLU C 3 290 ? -44.806 80.155 220.588 1.00 68.91 ? 286 GLU A CG    1 
ATOM   3003 C  CD    . GLU C 3 290 ? -44.367 78.922 219.835 1.00 71.31 ? 286 GLU A CD    1 
ATOM   3004 O  OE1   . GLU C 3 290 ? -45.239 78.129 219.426 1.00 74.21 ? 286 GLU A OE1   1 
ATOM   3005 O  OE2   . GLU C 3 290 ? -43.147 78.739 219.661 1.00 73.17 ? 286 GLU A OE2   1 
ATOM   3006 N  N     . ILE C 3 291 ? -46.179 82.632 221.369 1.00 71.05 ? 287 ILE A N     1 
ATOM   3007 C  CA    . ILE C 3 291 ? -47.054 83.674 220.846 1.00 74.26 ? 287 ILE A CA    1 
ATOM   3008 C  C     . ILE C 3 291 ? -47.327 83.520 219.351 1.00 76.70 ? 287 ILE A C     1 
ATOM   3009 O  O     . ILE C 3 291 ? -46.418 83.636 218.527 1.00 77.66 ? 287 ILE A O     1 
ATOM   3010 C  CB    . ILE C 3 291 ? -46.449 85.076 221.122 1.00 74.15 ? 287 ILE A CB    1 
ATOM   3011 C  CG1   . ILE C 3 291 ? -46.555 85.392 222.618 1.00 74.17 ? 287 ILE A CG1   1 
ATOM   3012 C  CG2   . ILE C 3 291 ? -47.151 86.134 220.291 1.00 73.76 ? 287 ILE A CG2   1 
ATOM   3013 C  CD1   . ILE C 3 291 ? -45.873 86.674 223.039 1.00 74.51 ? 287 ILE A CD1   1 
ATOM   3014 N  N     . ASN C 3 292 ? -48.589 83.280 219.007 1.00 78.28 ? 288 ASN A N     1 
ATOM   3015 C  CA    . ASN C 3 292 ? -48.988 83.116 217.615 1.00 80.39 ? 288 ASN A CA    1 
ATOM   3016 C  C     . ASN C 3 292 ? -48.160 82.043 216.923 1.00 81.07 ? 288 ASN A C     1 
ATOM   3017 O  O     . ASN C 3 292 ? -47.426 82.324 215.974 1.00 81.12 ? 288 ASN A O     1 
ATOM   3018 C  CB    . ASN C 3 292 ? -48.843 84.441 216.864 1.00 81.78 ? 288 ASN A CB    1 
ATOM   3019 C  CG    . ASN C 3 292 ? -49.689 85.539 217.467 1.00 83.75 ? 288 ASN A CG    1 
ATOM   3020 O  OD1   . ASN C 3 292 ? -50.905 85.394 217.593 1.00 85.00 ? 288 ASN A OD1   1 
ATOM   3021 N  ND2   . ASN C 3 292 ? -49.054 86.643 217.847 1.00 84.46 ? 288 ASN A ND2   1 
ATOM   3022 N  N     . PRO C 3 293 ? -48.273 80.792 217.387 1.00 81.76 ? 289 PRO A N     1 
ATOM   3023 C  CA    . PRO C 3 293 ? -47.534 79.669 216.813 1.00 83.29 ? 289 PRO A CA    1 
ATOM   3024 C  C     . PRO C 3 293 ? -48.047 79.269 215.437 1.00 85.16 ? 289 PRO A C     1 
ATOM   3025 O  O     . PRO C 3 293 ? -49.237 79.391 215.144 1.00 85.25 ? 289 PRO A O     1 
ATOM   3026 C  CB    . PRO C 3 293 ? -47.738 78.570 217.846 1.00 82.47 ? 289 PRO A CB    1 
ATOM   3027 C  CG    . PRO C 3 293 ? -49.116 78.845 218.331 1.00 81.61 ? 289 PRO A CG    1 
ATOM   3028 C  CD    . PRO C 3 293 ? -49.092 80.344 218.524 1.00 81.29 ? 289 PRO A CD    1 
ATOM   3029 N  N     . PRO C 3 294 ? -47.146 78.788 214.570 1.00 87.02 ? 290 PRO A N     1 
ATOM   3030 C  CA    . PRO C 3 294 ? -47.493 78.360 213.211 1.00 88.88 ? 290 PRO A CA    1 
ATOM   3031 C  C     . PRO C 3 294 ? -48.600 77.303 213.182 1.00 90.39 ? 290 PRO A C     1 
ATOM   3032 O  O     . PRO C 3 294 ? -48.758 76.520 214.125 1.00 91.38 ? 290 PRO A O     1 
ATOM   3033 C  CB    . PRO C 3 294 ? -46.167 77.829 212.669 1.00 88.74 ? 290 PRO A CB    1 
ATOM   3034 C  CG    . PRO C 3 294 ? -45.163 78.703 213.358 1.00 88.23 ? 290 PRO A CG    1 
ATOM   3035 C  CD    . PRO C 3 294 ? -45.689 78.735 214.777 1.00 87.42 ? 290 PRO A CD    1 
ATOM   3036 N  N     . LYS C 3 295 ? -49.360 77.286 212.091 1.00 90.98 ? 291 LYS A N     1 
ATOM   3037 C  CA    . LYS C 3 295 ? -50.458 76.339 211.930 1.00 91.34 ? 291 LYS A CA    1 
ATOM   3038 C  C     . LYS C 3 295 ? -50.012 74.908 212.229 1.00 91.23 ? 291 LYS A C     1 
ATOM   3039 O  O     . LYS C 3 295 ? -50.582 74.244 213.097 1.00 90.56 ? 291 LYS A O     1 
ATOM   3040 C  CB    . LYS C 3 295 ? -51.028 76.437 210.504 1.00 92.50 ? 291 LYS A CB    1 
ATOM   3041 C  CG    . LYS C 3 295 ? -51.589 77.822 210.140 1.00 93.19 ? 291 LYS A CG    1 
ATOM   3042 C  CD    . LYS C 3 295 ? -53.088 77.783 209.820 1.00 92.69 ? 291 LYS A CD    1 
ATOM   3043 C  CE    . LYS C 3 295 ? -53.375 77.128 208.467 1.00 92.45 ? 291 LYS A CE    1 
ATOM   3044 N  NZ    . LYS C 3 295 ? -52.886 77.946 207.315 1.00 91.84 ? 291 LYS A NZ    1 
ATOM   3045 N  N     . GLY C 3 296 ? -48.981 74.451 211.521 1.00 91.05 ? 292 GLY A N     1 
ATOM   3046 C  CA    . GLY C 3 296 ? -48.479 73.101 211.715 1.00 90.83 ? 292 GLY A CA    1 
ATOM   3047 C  C     . GLY C 3 296 ? -47.370 72.979 212.745 1.00 90.60 ? 292 GLY A C     1 
ATOM   3048 O  O     . GLY C 3 296 ? -46.340 72.344 212.495 1.00 91.18 ? 292 GLY A O     1 
ATOM   3049 N  N     . GLU C 3 297 ? -47.578 73.591 213.909 1.00 89.78 ? 293 GLU A N     1 
ATOM   3050 C  CA    . GLU C 3 297 ? -46.597 73.552 214.996 1.00 88.18 ? 293 GLU A CA    1 
ATOM   3051 C  C     . GLU C 3 297 ? -47.296 73.657 216.350 1.00 85.74 ? 293 GLU A C     1 
ATOM   3052 O  O     . GLU C 3 297 ? -48.285 74.381 216.490 1.00 85.74 ? 293 GLU A O     1 
ATOM   3053 C  CB    . GLU C 3 297 ? -45.570 74.691 214.835 1.00 89.08 ? 293 GLU A CB    1 
ATOM   3054 C  CG    . GLU C 3 297 ? -44.665 74.550 213.605 1.00 90.58 ? 293 GLU A CG    1 
ATOM   3055 C  CD    . GLU C 3 297 ? -43.727 73.347 213.686 1.00 91.40 ? 293 GLU A CD    1 
ATOM   3056 O  OE1   . GLU C 3 297 ? -43.293 72.857 212.620 1.00 91.19 ? 293 GLU A OE1   1 
ATOM   3057 O  OE2   . GLU C 3 297 ? -43.417 72.900 214.813 1.00 91.91 ? 293 GLU A OE2   1 
ATOM   3058 N  N     . THR C 3 298 ? -46.786 72.910 217.330 1.00 82.65 ? 294 THR A N     1 
ATOM   3059 C  CA    . THR C 3 298 ? -47.337 72.907 218.688 1.00 79.61 ? 294 THR A CA    1 
ATOM   3060 C  C     . THR C 3 298 ? -46.889 74.166 219.447 1.00 76.77 ? 294 THR A C     1 
ATOM   3061 O  O     . THR C 3 298 ? -45.701 74.501 219.463 1.00 76.34 ? 294 THR A O     1 
ATOM   3062 C  CB    . THR C 3 298 ? -46.881 71.644 219.481 1.00 80.21 ? 294 THR A CB    1 
ATOM   3063 O  OG1   . THR C 3 298 ? -45.455 71.517 219.402 1.00 80.06 ? 294 THR A OG1   1 
ATOM   3064 C  CG2   . THR C 3 298 ? -47.532 70.382 218.916 1.00 79.63 ? 294 THR A CG2   1 
ATOM   3065 N  N     . PRO C 3 299 ? -47.841 74.879 220.083 1.00 73.61 ? 295 PRO A N     1 
ATOM   3066 C  CA    . PRO C 3 299 ? -47.557 76.105 220.845 1.00 70.36 ? 295 PRO A CA    1 
ATOM   3067 C  C     . PRO C 3 299 ? -46.587 75.864 221.996 1.00 66.39 ? 295 PRO A C     1 
ATOM   3068 O  O     . PRO C 3 299 ? -46.939 75.256 223.009 1.00 65.98 ? 295 PRO A O     1 
ATOM   3069 C  CB    . PRO C 3 299 ? -48.938 76.541 221.326 1.00 71.40 ? 295 PRO A CB    1 
ATOM   3070 C  CG    . PRO C 3 299 ? -49.635 75.230 221.518 1.00 73.04 ? 295 PRO A CG    1 
ATOM   3071 C  CD    . PRO C 3 299 ? -49.250 74.483 220.254 1.00 73.32 ? 295 PRO A CD    1 
ATOM   3072 N  N     . LEU C 3 300 ? -45.362 76.348 221.817 1.00 61.38 ? 296 LEU A N     1 
ATOM   3073 C  CA    . LEU C 3 300 ? -44.304 76.192 222.805 1.00 56.39 ? 296 LEU A CA    1 
ATOM   3074 C  C     . LEU C 3 300 ? -44.725 76.697 224.178 1.00 52.86 ? 296 LEU A C     1 
ATOM   3075 O  O     . LEU C 3 300 ? -45.380 77.728 224.297 1.00 52.20 ? 296 LEU A O     1 
ATOM   3076 C  CB    . LEU C 3 300 ? -43.060 76.921 222.326 1.00 56.03 ? 296 LEU A CB    1 
ATOM   3077 C  CG    . LEU C 3 300 ? -41.731 76.447 222.899 1.00 56.70 ? 296 LEU A CG    1 
ATOM   3078 C  CD1   . LEU C 3 300 ? -41.723 74.937 223.097 1.00 57.52 ? 296 LEU A CD1   1 
ATOM   3079 C  CD2   . LEU C 3 300 ? -40.639 76.876 221.924 1.00 56.85 ? 296 LEU A CD2   1 
ATOM   3080 N  N     . LYS C 3 301 ? -44.344 75.969 225.219 1.00 48.82 ? 297 LYS A N     1 
ATOM   3081 C  CA    . LYS C 3 301 ? -44.736 76.349 226.561 1.00 45.62 ? 297 LYS A CA    1 
ATOM   3082 C  C     . LYS C 3 301 ? -43.881 75.685 227.626 1.00 44.15 ? 297 LYS A C     1 
ATOM   3083 O  O     . LYS C 3 301 ? -43.351 74.593 227.421 1.00 43.66 ? 297 LYS A O     1 
ATOM   3084 C  CB    . LYS C 3 301 ? -46.216 76.006 226.779 1.00 45.26 ? 297 LYS A CB    1 
ATOM   3085 C  CG    . LYS C 3 301 ? -46.579 75.600 228.203 1.00 47.56 ? 297 LYS A CG    1 
ATOM   3086 C  CD    . LYS C 3 301 ? -48.079 75.675 228.468 1.00 48.64 ? 297 LYS A CD    1 
ATOM   3087 C  CE    . LYS C 3 301 ? -48.897 74.756 227.560 1.00 50.57 ? 297 LYS A CE    1 
ATOM   3088 N  NZ    . LYS C 3 301 ? -50.369 74.899 227.807 1.00 51.52 ? 297 LYS A NZ    1 
ATOM   3089 N  N     . TRP C 3 302 ? -43.747 76.369 228.760 1.00 42.91 ? 298 TRP A N     1 
ATOM   3090 C  CA    . TRP C 3 302 ? -42.975 75.895 229.906 1.00 41.57 ? 298 TRP A CA    1 
ATOM   3091 C  C     . TRP C 3 302 ? -43.641 76.377 231.164 1.00 40.32 ? 298 TRP A C     1 
ATOM   3092 O  O     . TRP C 3 302 ? -44.074 77.519 231.237 1.00 40.31 ? 298 TRP A O     1 
ATOM   3093 C  CB    . TRP C 3 302 ? -41.568 76.480 229.927 1.00 45.01 ? 298 TRP A CB    1 
ATOM   3094 C  CG    . TRP C 3 302 ? -40.545 75.656 229.256 1.00 48.28 ? 298 TRP A CG    1 
ATOM   3095 C  CD1   . TRP C 3 302 ? -40.741 74.469 228.622 1.00 49.60 ? 298 TRP A CD1   1 
ATOM   3096 C  CD2   . TRP C 3 302 ? -39.166 75.991 229.069 1.00 50.01 ? 298 TRP A CD2   1 
ATOM   3097 N  NE1   . TRP C 3 302 ? -39.574 74.046 228.040 1.00 51.18 ? 298 TRP A NE1   1 
ATOM   3098 C  CE2   . TRP C 3 302 ? -38.589 74.961 228.298 1.00 50.87 ? 298 TRP A CE2   1 
ATOM   3099 C  CE3   . TRP C 3 302 ? -38.361 77.066 229.471 1.00 50.60 ? 298 TRP A CE3   1 
ATOM   3100 C  CZ2   . TRP C 3 302 ? -37.244 74.972 227.916 1.00 51.21 ? 298 TRP A CZ2   1 
ATOM   3101 C  CZ3   . TRP C 3 302 ? -37.022 77.078 229.092 1.00 49.60 ? 298 TRP A CZ3   1 
ATOM   3102 C  CH2   . TRP C 3 302 ? -36.479 76.037 228.320 1.00 51.18 ? 298 TRP A CH2   1 
ATOM   3103 N  N     . LEU C 3 303 ? -43.712 75.514 232.162 1.00 38.66 ? 299 LEU A N     1 
ATOM   3104 C  CA    . LEU C 3 303 ? -44.283 75.904 233.426 1.00 36.68 ? 299 LEU A CA    1 
ATOM   3105 C  C     . LEU C 3 303 ? -43.306 75.285 234.403 1.00 35.16 ? 299 LEU A C     1 
ATOM   3106 O  O     . LEU C 3 303 ? -43.255 74.067 234.542 1.00 34.41 ? 299 LEU A O     1 
ATOM   3107 C  CB    . LEU C 3 303 ? -45.683 75.328 233.583 1.00 37.64 ? 299 LEU A CB    1 
ATOM   3108 C  CG    . LEU C 3 303 ? -46.531 75.888 234.734 1.00 38.91 ? 299 LEU A CG    1 
ATOM   3109 C  CD1   . LEU C 3 303 ? -47.946 75.361 234.599 1.00 38.78 ? 299 LEU A CD1   1 
ATOM   3110 C  CD2   . LEU C 3 303 ? -45.934 75.494 236.077 1.00 38.61 ? 299 LEU A CD2   1 
ATOM   3111 N  N     . LEU C 3 304 ? -42.509 76.128 235.056 1.00 33.89 ? 300 LEU A N     1 
ATOM   3112 C  CA    . LEU C 3 304 ? -41.487 75.655 235.986 1.00 32.75 ? 300 LEU A CA    1 
ATOM   3113 C  C     . LEU C 3 304 ? -41.796 76.000 237.424 1.00 33.23 ? 300 LEU A C     1 
ATOM   3114 O  O     . LEU C 3 304 ? -42.226 77.107 237.716 1.00 35.81 ? 300 LEU A O     1 
ATOM   3115 C  CB    . LEU C 3 304 ? -40.148 76.279 235.616 1.00 30.65 ? 300 LEU A CB    1 
ATOM   3116 C  CG    . LEU C 3 304 ? -39.971 76.464 234.109 1.00 30.31 ? 300 LEU A CG    1 
ATOM   3117 C  CD1   . LEU C 3 304 ? -38.851 77.442 233.841 1.00 30.73 ? 300 LEU A CD1   1 
ATOM   3118 C  CD2   . LEU C 3 304 ? -39.718 75.122 233.448 1.00 31.13 ? 300 LEU A CD2   1 
ATOM   3119 N  N     . LEU C 3 305 ? -41.576 75.049 238.322 1.00 33.18 ? 301 LEU A N     1 
ATOM   3120 C  CA    . LEU C 3 305 ? -41.797 75.274 239.743 1.00 35.53 ? 301 LEU A CA    1 
ATOM   3121 C  C     . LEU C 3 305 ? -40.395 75.484 240.290 1.00 37.91 ? 301 LEU A C     1 
ATOM   3122 O  O     . LEU C 3 305 ? -39.457 74.843 239.815 1.00 38.95 ? 301 LEU A O     1 
ATOM   3123 C  CB    . LEU C 3 305 ? -42.409 74.039 240.409 1.00 34.94 ? 301 LEU A CB    1 
ATOM   3124 C  CG    . LEU C 3 305 ? -43.340 73.220 239.516 1.00 34.71 ? 301 LEU A CG    1 
ATOM   3125 C  CD1   . LEU C 3 305 ? -43.743 71.945 240.220 1.00 34.52 ? 301 LEU A CD1   1 
ATOM   3126 C  CD2   . LEU C 3 305 ? -44.545 74.057 239.145 1.00 34.25 ? 301 LEU A CD2   1 
ATOM   3127 N  N     . THR C 3 306 ? -40.244 76.374 241.271 1.00 40.06 ? 302 THR A N     1 
ATOM   3128 C  CA    . THR C 3 306 ? -38.933 76.673 241.858 1.00 43.04 ? 302 THR A CA    1 
ATOM   3129 C  C     . THR C 3 306 ? -39.013 77.517 243.106 1.00 43.57 ? 302 THR A C     1 
ATOM   3130 O  O     . THR C 3 306 ? -40.024 78.160 243.373 1.00 43.79 ? 302 THR A O     1 
ATOM   3131 C  CB    . THR C 3 306 ? -38.021 77.450 240.879 1.00 44.07 ? 302 THR A CB    1 
ATOM   3132 O  OG1   . THR C 3 306 ? -37.474 76.556 239.909 1.00 49.22 ? 302 THR A OG1   1 
ATOM   3133 C  CG2   . THR C 3 306 ? -36.889 78.138 241.604 1.00 43.62 ? 302 THR A CG2   1 
ATOM   3134 N  N     . SER C 3 307 ? -37.925 77.494 243.869 1.00 45.11 ? 303 SER A N     1 
ATOM   3135 C  CA    . SER C 3 307 ? -37.792 78.283 245.092 1.00 47.47 ? 303 SER A CA    1 
ATOM   3136 C  C     . SER C 3 307 ? -37.269 79.692 244.771 1.00 48.40 ? 303 SER A C     1 
ATOM   3137 O  O     . SER C 3 307 ? -37.516 80.642 245.516 1.00 47.85 ? 303 SER A O     1 
ATOM   3138 C  CB    . SER C 3 307 ? -36.816 77.592 246.029 1.00 47.93 ? 303 SER A CB    1 
ATOM   3139 O  OG    . SER C 3 307 ? -35.711 77.101 245.283 1.00 49.82 ? 303 SER A OG    1 
ATOM   3140 N  N     . GLU C 3 308 ? -36.542 79.815 243.665 1.00 48.98 ? 304 GLU A N     1 
ATOM   3141 C  CA    . GLU C 3 308 ? -35.994 81.099 243.257 1.00 51.40 ? 304 GLU A CA    1 
ATOM   3142 C  C     . GLU C 3 308 ? -37.080 82.155 243.099 1.00 52.64 ? 304 GLU A C     1 
ATOM   3143 O  O     . GLU C 3 308 ? -38.172 81.869 242.609 1.00 53.53 ? 304 GLU A O     1 
ATOM   3144 C  CB    . GLU C 3 308 ? -35.239 80.963 241.928 1.00 50.70 ? 304 GLU A CB    1 
ATOM   3145 C  CG    . GLU C 3 308 ? -34.101 79.978 242.001 1.00 48.56 ? 304 GLU A CG    1 
ATOM   3146 C  CD    . GLU C 3 308 ? -33.261 80.172 243.240 1.00 47.79 ? 304 GLU A CD    1 
ATOM   3147 O  OE1   . GLU C 3 308 ? -32.574 81.210 243.331 1.00 46.82 ? 304 GLU A OE1   1 
ATOM   3148 O  OE2   . GLU C 3 308 ? -33.311 79.296 244.134 1.00 47.22 ? 304 GLU A OE2   1 
ATOM   3149 N  N     . PRO C 3 309 ? -36.792 83.394 243.515 1.00 53.34 ? 305 PRO A N     1 
ATOM   3150 C  CA    . PRO C 3 309 ? -37.767 84.476 243.399 1.00 53.76 ? 305 PRO A CA    1 
ATOM   3151 C  C     . PRO C 3 309 ? -38.048 84.777 241.938 1.00 53.84 ? 305 PRO A C     1 
ATOM   3152 O  O     . PRO C 3 309 ? -37.171 84.624 241.092 1.00 53.47 ? 305 PRO A O     1 
ATOM   3153 C  CB    . PRO C 3 309 ? -37.078 85.631 244.117 1.00 54.16 ? 305 PRO A CB    1 
ATOM   3154 C  CG    . PRO C 3 309 ? -35.630 85.360 243.866 1.00 54.05 ? 305 PRO A CG    1 
ATOM   3155 C  CD    . PRO C 3 309 ? -35.548 83.878 244.134 1.00 53.35 ? 305 PRO A CD    1 
ATOM   3156 N  N     . VAL C 3 310 ? -39.271 85.206 241.645 1.00 55.14 ? 306 VAL A N     1 
ATOM   3157 C  CA    . VAL C 3 310 ? -39.654 85.513 240.272 1.00 56.80 ? 306 VAL A CA    1 
ATOM   3158 C  C     . VAL C 3 310 ? -40.608 86.695 240.148 1.00 56.87 ? 306 VAL A C     1 
ATOM   3159 O  O     . VAL C 3 310 ? -41.228 86.876 239.104 1.00 56.95 ? 306 VAL A O     1 
ATOM   3160 C  CB    . VAL C 3 310 ? -40.308 84.284 239.602 1.00 57.81 ? 306 VAL A CB    1 
ATOM   3161 C  CG1   . VAL C 3 310 ? -39.258 83.209 239.335 1.00 59.21 ? 306 VAL A CG1   1 
ATOM   3162 C  CG2   . VAL C 3 310 ? -41.402 83.727 240.503 1.00 57.57 ? 306 VAL A CG2   1 
ATOM   3163 N  N     . GLU C 3 311 ? -40.713 87.503 241.200 1.00 57.58 ? 307 GLU A N     1 
ATOM   3164 C  CA    . GLU C 3 311 ? -41.607 88.663 241.191 1.00 57.77 ? 307 GLU A CA    1 
ATOM   3165 C  C     . GLU C 3 311 ? -41.406 89.688 240.067 1.00 56.94 ? 307 GLU A C     1 
ATOM   3166 O  O     . GLU C 3 311 ? -42.335 90.422 239.730 1.00 56.67 ? 307 GLU A O     1 
ATOM   3167 C  CB    . GLU C 3 311 ? -41.550 89.378 242.541 1.00 59.77 ? 307 GLU A CB    1 
ATOM   3168 C  CG    . GLU C 3 311 ? -42.634 88.932 243.513 1.00 65.37 ? 307 GLU A CG    1 
ATOM   3169 C  CD    . GLU C 3 311 ? -42.463 89.519 244.915 1.00 69.28 ? 307 GLU A CD    1 
ATOM   3170 O  OE1   . GLU C 3 311 ? -42.183 90.738 245.029 1.00 71.97 ? 307 GLU A OE1   1 
ATOM   3171 O  OE2   . GLU C 3 311 ? -42.620 88.761 245.906 1.00 70.81 ? 307 GLU A OE2   1 
ATOM   3172 N  N     . SER C 3 312 ? -40.215 89.736 239.478 1.00 55.39 ? 308 SER A N     1 
ATOM   3173 C  CA    . SER C 3 312 ? -39.948 90.689 238.408 1.00 53.92 ? 308 SER A CA    1 
ATOM   3174 C  C     . SER C 3 312 ? -39.565 90.011 237.101 1.00 53.30 ? 308 SER A C     1 
ATOM   3175 O  O     . SER C 3 312 ? -39.027 88.907 237.105 1.00 53.36 ? 308 SER A O     1 
ATOM   3176 C  CB    . SER C 3 312 ? -38.821 91.616 238.823 1.00 53.73 ? 308 SER A CB    1 
ATOM   3177 O  OG    . SER C 3 312 ? -37.653 90.862 239.088 1.00 55.01 ? 308 SER A OG    1 
ATOM   3178 N  N     . LEU C 3 313 ? -39.825 90.692 235.987 1.00 52.58 ? 309 LEU A N     1 
ATOM   3179 C  CA    . LEU C 3 313 ? -39.508 90.171 234.658 1.00 51.16 ? 309 LEU A CA    1 
ATOM   3180 C  C     . LEU C 3 313 ? -38.066 89.721 234.565 1.00 50.75 ? 309 LEU A C     1 
ATOM   3181 O  O     . LEU C 3 313 ? -37.706 88.934 233.692 1.00 50.85 ? 309 LEU A O     1 
ATOM   3182 C  CB    . LEU C 3 313 ? -39.752 91.242 233.596 1.00 50.03 ? 309 LEU A CB    1 
ATOM   3183 C  CG    . LEU C 3 313 ? -39.232 90.915 232.197 1.00 50.20 ? 309 LEU A CG    1 
ATOM   3184 C  CD1   . LEU C 3 313 ? -39.954 89.703 231.639 1.00 50.23 ? 309 LEU A CD1   1 
ATOM   3185 C  CD2   . LEU C 3 313 ? -39.431 92.121 231.286 1.00 50.39 ? 309 LEU A CD2   1 
ATOM   3186 N  N     . ALA C 3 314 ? -37.233 90.241 235.453 1.00 50.34 ? 310 ALA A N     1 
ATOM   3187 C  CA    . ALA C 3 314 ? -35.828 89.883 235.448 1.00 49.55 ? 310 ALA A CA    1 
ATOM   3188 C  C     . ALA C 3 314 ? -35.664 88.617 236.269 1.00 49.22 ? 310 ALA A C     1 
ATOM   3189 O  O     . ALA C 3 314 ? -35.053 87.655 235.821 1.00 50.48 ? 310 ALA A O     1 
ATOM   3190 C  CB    . ALA C 3 314 ? -34.998 91.014 236.046 1.00 49.98 ? 310 ALA A CB    1 
ATOM   3191 N  N     . GLN C 3 315 ? -36.216 88.621 237.474 1.00 47.40 ? 311 GLN A N     1 
ATOM   3192 C  CA    . GLN C 3 315 ? -36.117 87.459 238.330 1.00 47.42 ? 311 GLN A CA    1 
ATOM   3193 C  C     . GLN C 3 315 ? -36.718 86.207 237.677 1.00 47.68 ? 311 GLN A C     1 
ATOM   3194 O  O     . GLN C 3 315 ? -36.307 85.086 237.976 1.00 46.75 ? 311 GLN A O     1 
ATOM   3195 C  CB    . GLN C 3 315 ? -36.823 87.722 239.653 1.00 47.42 ? 311 GLN A CB    1 
ATOM   3196 C  CG    . GLN C 3 315 ? -36.178 88.777 240.501 1.00 48.09 ? 311 GLN A CG    1 
ATOM   3197 C  CD    . GLN C 3 315 ? -36.884 88.920 241.829 1.00 49.30 ? 311 GLN A CD    1 
ATOM   3198 O  OE1   . GLN C 3 315 ? -38.063 89.299 241.875 1.00 48.37 ? 311 GLN A OE1   1 
ATOM   3199 N  NE2   . GLN C 3 315 ? -36.178 88.603 242.922 1.00 48.40 ? 311 GLN A NE2   1 
ATOM   3200 N  N     . ALA C 3 316 ? -37.691 86.399 236.791 1.00 47.50 ? 312 ALA A N     1 
ATOM   3201 C  CA    . ALA C 3 316 ? -38.349 85.285 236.114 1.00 47.26 ? 312 ALA A CA    1 
ATOM   3202 C  C     . ALA C 3 316 ? -37.524 84.829 234.929 1.00 46.23 ? 312 ALA A C     1 
ATOM   3203 O  O     . ALA C 3 316 ? -37.476 83.644 234.604 1.00 48.06 ? 312 ALA A O     1 
ATOM   3204 C  CB    . ALA C 3 316 ? -39.737 85.694 235.639 1.00 47.20 ? 312 ALA A CB    1 
ATOM   3205 N  N     . LEU C 3 317 ? -36.891 85.788 234.272 1.00 43.95 ? 313 LEU A N     1 
ATOM   3206 C  CA    . LEU C 3 317 ? -36.051 85.503 233.116 1.00 41.23 ? 313 LEU A CA    1 
ATOM   3207 C  C     . LEU C 3 317 ? -34.828 84.747 233.581 1.00 39.70 ? 313 LEU A C     1 
ATOM   3208 O  O     . LEU C 3 317 ? -34.156 84.092 232.799 1.00 40.42 ? 313 LEU A O     1 
ATOM   3209 C  CB    . LEU C 3 317 ? -35.643 86.811 232.445 1.00 40.04 ? 313 LEU A CB    1 
ATOM   3210 C  CG    . LEU C 3 317 ? -36.384 87.098 231.143 1.00 39.92 ? 313 LEU A CG    1 
ATOM   3211 C  CD1   . LEU C 3 317 ? -36.403 88.581 230.862 1.00 38.88 ? 313 LEU A CD1   1 
ATOM   3212 C  CD2   . LEU C 3 317 ? -35.722 86.324 230.018 1.00 40.63 ? 313 LEU A CD2   1 
ATOM   3213 N  N     . ARG C 3 318 ? -34.553 84.847 234.869 1.00 37.19 ? 314 ARG A N     1 
ATOM   3214 C  CA    . ARG C 3 318 ? -33.423 84.174 235.435 1.00 36.83 ? 314 ARG A CA    1 
ATOM   3215 C  C     . ARG C 3 318 ? -33.766 82.676 235.527 1.00 38.10 ? 314 ARG A C     1 
ATOM   3216 O  O     . ARG C 3 318 ? -32.946 81.814 235.190 1.00 39.37 ? 314 ARG A O     1 
ATOM   3217 C  CB    . ARG C 3 318 ? -33.124 84.792 236.800 1.00 34.92 ? 314 ARG A CB    1 
ATOM   3218 C  CG    . ARG C 3 318 ? -31.958 84.192 237.546 1.00 33.43 ? 314 ARG A CG    1 
ATOM   3219 C  CD    . ARG C 3 318 ? -30.709 84.122 236.685 1.00 32.09 ? 314 ARG A CD    1 
ATOM   3220 N  NE    . ARG C 3 318 ? -29.632 83.506 237.442 1.00 31.15 ? 314 ARG A NE    1 
ATOM   3221 C  CZ    . ARG C 3 318 ? -28.436 83.241 236.949 1.00 30.31 ? 314 ARG A CZ    1 
ATOM   3222 N  NH1   . ARG C 3 318 ? -28.169 83.543 235.679 1.00 31.02 ? 314 ARG A NH1   1 
ATOM   3223 N  NH2   . ARG C 3 318 ? -27.521 82.686 237.737 1.00 28.33 ? 314 ARG A NH2   1 
ATOM   3224 N  N     . VAL C 3 319 ? -34.992 82.377 235.951 1.00 36.83 ? 315 VAL A N     1 
ATOM   3225 C  CA    . VAL C 3 319 ? -35.464 81.000 236.064 1.00 35.93 ? 315 VAL A CA    1 
ATOM   3226 C  C     . VAL C 3 319 ? -35.524 80.328 234.694 1.00 35.43 ? 315 VAL A C     1 
ATOM   3227 O  O     . VAL C 3 319 ? -35.074 79.198 234.523 1.00 35.25 ? 315 VAL A O     1 
ATOM   3228 C  CB    . VAL C 3 319 ? -36.861 80.942 236.707 1.00 35.48 ? 315 VAL A CB    1 
ATOM   3229 C  CG1   . VAL C 3 319 ? -37.452 79.542 236.567 1.00 35.81 ? 315 VAL A CG1   1 
ATOM   3230 C  CG2   . VAL C 3 319 ? -36.752 81.317 238.167 1.00 35.18 ? 315 VAL A CG2   1 
ATOM   3231 N  N     . ILE C 3 320 ? -36.079 81.031 233.720 1.00 34.62 ? 316 ILE A N     1 
ATOM   3232 C  CA    . ILE C 3 320 ? -36.176 80.503 232.378 1.00 35.99 ? 316 ILE A CA    1 
ATOM   3233 C  C     . ILE C 3 320 ? -34.773 80.268 231.870 1.00 38.82 ? 316 ILE A C     1 
ATOM   3234 O  O     . ILE C 3 320 ? -34.494 79.272 231.202 1.00 40.16 ? 316 ILE A O     1 
ATOM   3235 C  CB    . ILE C 3 320 ? -36.868 81.501 231.431 1.00 36.13 ? 316 ILE A CB    1 
ATOM   3236 C  CG1   . ILE C 3 320 ? -38.307 81.731 231.880 1.00 37.38 ? 316 ILE A CG1   1 
ATOM   3237 C  CG2   . ILE C 3 320 ? -36.850 80.983 230.004 1.00 35.25 ? 316 ILE A CG2   1 
ATOM   3238 C  CD1   . ILE C 3 320 ? -39.186 80.515 231.719 1.00 38.87 ? 316 ILE A CD1   1 
ATOM   3239 N  N     . ASP C 3 321 ? -33.872 81.183 232.199 1.00 40.87 ? 317 ASP A N     1 
ATOM   3240 C  CA    . ASP C 3 321 ? -32.501 81.062 231.724 1.00 40.92 ? 317 ASP A CA    1 
ATOM   3241 C  C     . ASP C 3 321 ? -31.769 79.872 232.324 1.00 39.53 ? 317 ASP A C     1 
ATOM   3242 O  O     . ASP C 3 321 ? -31.081 79.134 231.618 1.00 39.25 ? 317 ASP A O     1 
ATOM   3243 C  CB    . ASP C 3 321 ? -31.723 82.330 232.031 1.00 44.29 ? 317 ASP A CB    1 
ATOM   3244 C  CG    . ASP C 3 321 ? -30.447 82.396 231.259 1.00 49.42 ? 317 ASP A CG    1 
ATOM   3245 O  OD1   . ASP C 3 321 ? -30.537 82.568 230.019 1.00 51.30 ? 317 ASP A OD1   1 
ATOM   3246 O  OD2   . ASP C 3 321 ? -29.364 82.250 231.880 1.00 51.66 ? 317 ASP A OD2   1 
ATOM   3247 N  N     . ILE C 3 322 ? -31.901 79.725 233.638 1.00 37.48 ? 318 ILE A N     1 
ATOM   3248 C  CA    . ILE C 3 322 ? -31.291 78.636 234.375 1.00 35.39 ? 318 ILE A CA    1 
ATOM   3249 C  C     . ILE C 3 322 ? -31.785 77.301 233.818 1.00 36.02 ? 318 ILE A C     1 
ATOM   3250 O  O     . ILE C 3 322 ? -30.990 76.445 233.430 1.00 35.45 ? 318 ILE A O     1 
ATOM   3251 C  CB    . ILE C 3 322 ? -31.667 78.728 235.868 1.00 34.10 ? 318 ILE A CB    1 
ATOM   3252 C  CG1   . ILE C 3 322 ? -31.034 79.970 236.486 1.00 33.74 ? 318 ILE A CG1   1 
ATOM   3253 C  CG2   . ILE C 3 322 ? -31.274 77.472 236.590 1.00 33.45 ? 318 ILE A CG2   1 
ATOM   3254 C  CD1   . ILE C 3 322 ? -31.173 80.059 237.991 1.00 33.67 ? 318 ILE A CD1   1 
ATOM   3255 N  N     . TYR C 3 323 ? -33.103 77.127 233.755 1.00 36.15 ? 319 TYR A N     1 
ATOM   3256 C  CA    . TYR C 3 323 ? -33.637 75.871 233.239 1.00 35.07 ? 319 TYR A CA    1 
ATOM   3257 C  C     . TYR C 3 323 ? -33.170 75.611 231.803 1.00 34.17 ? 319 TYR A C     1 
ATOM   3258 O  O     . TYR C 3 323 ? -33.016 74.466 231.405 1.00 36.60 ? 319 TYR A O     1 
ATOM   3259 C  CB    . TYR C 3 323 ? -35.181 75.830 233.290 1.00 33.14 ? 319 TYR A CB    1 
ATOM   3260 C  CG    . TYR C 3 323 ? -35.758 74.489 232.855 1.00 31.01 ? 319 TYR A CG    1 
ATOM   3261 C  CD1   . TYR C 3 323 ? -35.739 73.381 233.707 1.00 30.19 ? 319 TYR A CD1   1 
ATOM   3262 C  CD2   . TYR C 3 323 ? -36.223 74.308 231.552 1.00 30.55 ? 319 TYR A CD2   1 
ATOM   3263 C  CE1   . TYR C 3 323 ? -36.158 72.112 233.268 1.00 28.50 ? 319 TYR A CE1   1 
ATOM   3264 C  CE2   . TYR C 3 323 ? -36.641 73.056 231.101 1.00 30.99 ? 319 TYR A CE2   1 
ATOM   3265 C  CZ    . TYR C 3 323 ? -36.602 71.955 231.970 1.00 30.45 ? 319 TYR A CZ    1 
ATOM   3266 O  OH    . TYR C 3 323 ? -36.978 70.712 231.493 1.00 30.55 ? 319 TYR A OH    1 
ATOM   3267 N  N     . THR C 3 324 ? -32.925 76.654 231.027 1.00 32.25 ? 320 THR A N     1 
ATOM   3268 C  CA    . THR C 3 324 ? -32.495 76.445 229.654 1.00 34.00 ? 320 THR A CA    1 
ATOM   3269 C  C     . THR C 3 324 ? -31.174 75.689 229.546 1.00 34.92 ? 320 THR A C     1 
ATOM   3270 O  O     . THR C 3 324 ? -30.892 75.060 228.530 1.00 34.95 ? 320 THR A O     1 
ATOM   3271 C  CB    . THR C 3 324 ? -32.343 77.777 228.909 1.00 34.34 ? 320 THR A CB    1 
ATOM   3272 O  OG1   . THR C 3 324 ? -33.619 78.414 228.821 1.00 35.83 ? 320 THR A OG1   1 
ATOM   3273 C  CG2   . THR C 3 324 ? -31.807 77.550 227.509 1.00 35.82 ? 320 THR A CG2   1 
ATOM   3274 N  N     . HIS C 3 325 ? -30.364 75.753 230.589 1.00 35.33 ? 321 HIS A N     1 
ATOM   3275 C  CA    . HIS C 3 325 ? -29.088 75.072 230.578 1.00 37.27 ? 321 HIS A CA    1 
ATOM   3276 C  C     . HIS C 3 325 ? -29.160 73.605 231.013 1.00 36.90 ? 321 HIS A C     1 
ATOM   3277 O  O     . HIS C 3 325 ? -28.167 72.883 230.931 1.00 37.46 ? 321 HIS A O     1 
ATOM   3278 C  CB    . HIS C 3 325 ? -28.093 75.843 231.459 1.00 39.33 ? 321 HIS A CB    1 
ATOM   3279 C  CG    . HIS C 3 325 ? -27.606 77.116 230.835 1.00 41.15 ? 321 HIS A CG    1 
ATOM   3280 N  ND1   . HIS C 3 325 ? -27.693 78.336 231.470 1.00 41.94 ? 321 HIS A ND1   1 
ATOM   3281 C  CD2   . HIS C 3 325 ? -27.063 77.360 229.618 1.00 41.48 ? 321 HIS A CD2   1 
ATOM   3282 C  CE1   . HIS C 3 325 ? -27.230 79.276 230.667 1.00 42.63 ? 321 HIS A CE1   1 
ATOM   3283 N  NE2   . HIS C 3 325 ? -26.840 78.712 229.538 1.00 40.84 ? 321 HIS A NE2   1 
ATOM   3284 N  N     . ARG C 3 326 ? -30.325 73.154 231.464 1.00 36.26 ? 322 ARG A N     1 
ATOM   3285 C  CA    . ARG C 3 326 ? -30.468 71.759 231.901 1.00 33.45 ? 322 ARG A CA    1 
ATOM   3286 C  C     . ARG C 3 326 ? -30.038 70.818 230.781 1.00 31.64 ? 322 ARG A C     1 
ATOM   3287 O  O     . ARG C 3 326 ? -29.629 69.695 231.033 1.00 30.42 ? 322 ARG A O     1 
ATOM   3288 C  CB    . ARG C 3 326 ? -31.923 71.442 232.268 1.00 31.88 ? 322 ARG A CB    1 
ATOM   3289 C  CG    . ARG C 3 326 ? -32.157 70.036 232.854 1.00 27.40 ? 322 ARG A CG    1 
ATOM   3290 C  CD    . ARG C 3 326 ? -33.533 69.558 232.478 1.00 21.42 ? 322 ARG A CD    1 
ATOM   3291 N  NE    . ARG C 3 326 ? -33.638 69.349 231.047 1.00 13.27 ? 322 ARG A NE    1 
ATOM   3292 C  CZ    . ARG C 3 326 ? -33.293 68.231 230.423 1.00 13.91 ? 322 ARG A CZ    1 
ATOM   3293 N  NH1   . ARG C 3 326 ? -32.815 67.191 231.097 1.00 10.75 ? 322 ARG A NH1   1 
ATOM   3294 N  NH2   . ARG C 3 326 ? -33.413 68.163 229.104 1.00 12.22 ? 322 ARG A NH2   1 
ATOM   3295 N  N     . TRP C 3 327 ? -30.121 71.299 229.551 1.00 29.42 ? 323 TRP A N     1 
ATOM   3296 C  CA    . TRP C 3 327 ? -29.750 70.505 228.407 1.00 31.20 ? 323 TRP A CA    1 
ATOM   3297 C  C     . TRP C 3 327 ? -28.254 70.190 228.342 1.00 31.68 ? 323 TRP A C     1 
ATOM   3298 O  O     . TRP C 3 327 ? -27.783 69.473 227.453 1.00 33.27 ? 323 TRP A O     1 
ATOM   3299 C  CB    . TRP C 3 327 ? -30.161 71.225 227.135 1.00 32.03 ? 323 TRP A CB    1 
ATOM   3300 C  CG    . TRP C 3 327 ? -30.131 70.342 225.973 1.00 36.04 ? 323 TRP A CG    1 
ATOM   3301 C  CD1   . TRP C 3 327 ? -29.132 70.222 225.060 1.00 36.70 ? 323 TRP A CD1   1 
ATOM   3302 C  CD2   . TRP C 3 327 ? -31.129 69.384 225.615 1.00 37.76 ? 323 TRP A CD2   1 
ATOM   3303 N  NE1   . TRP C 3 327 ? -29.451 69.253 224.134 1.00 39.05 ? 323 TRP A NE1   1 
ATOM   3304 C  CE2   . TRP C 3 327 ? -30.683 68.741 224.439 1.00 39.04 ? 323 TRP A CE2   1 
ATOM   3305 C  CE3   . TRP C 3 327 ? -32.383 69.047 226.142 1.00 37.74 ? 323 TRP A CE3   1 
ATOM   3306 C  CZ2   . TRP C 3 327 ? -31.416 67.730 223.819 1.00 39.48 ? 323 TRP A CZ2   1 
ATOM   3307 C  CZ3   . TRP C 3 327 ? -33.114 68.049 225.528 1.00 38.65 ? 323 TRP A CZ3   1 
ATOM   3308 C  CH2   . TRP C 3 327 ? -32.640 67.417 224.358 1.00 39.93 ? 323 TRP A CH2   1 
ATOM   3309 N  N     . ARG C 3 328 ? -27.492 70.731 229.271 1.00 31.06 ? 324 ARG A N     1 
ATOM   3310 C  CA    . ARG C 3 328 ? -26.070 70.478 229.253 1.00 30.29 ? 324 ARG A CA    1 
ATOM   3311 C  C     . ARG C 3 328 ? -25.835 69.006 229.548 1.00 30.13 ? 324 ARG A C     1 
ATOM   3312 O  O     . ARG C 3 328 ? -24.981 68.359 228.926 1.00 32.34 ? 324 ARG A O     1 
ATOM   3313 C  CB    . ARG C 3 328 ? -25.355 71.369 230.286 1.00 30.41 ? 324 ARG A CB    1 
ATOM   3314 C  CG    . ARG C 3 328 ? -23.824 71.276 230.290 1.00 30.79 ? 324 ARG A CG    1 
ATOM   3315 C  CD    . ARG C 3 328 ? -23.236 71.563 228.904 1.00 31.15 ? 324 ARG A CD    1 
ATOM   3316 N  NE    . ARG C 3 328 ? -23.646 72.862 228.384 1.00 31.77 ? 324 ARG A NE    1 
ATOM   3317 C  CZ    . ARG C 3 328 ? -23.333 74.031 228.942 1.00 31.67 ? 324 ARG A CZ    1 
ATOM   3318 N  NH1   . ARG C 3 328 ? -22.601 74.050 230.032 1.00 25.75 ? 324 ARG A NH1   1 
ATOM   3319 N  NH2   . ARG C 3 328 ? -23.764 75.182 228.415 1.00 33.42 ? 324 ARG A NH2   1 
ATOM   3320 N  N     . ILE C 3 329 ? -26.599 68.465 230.492 1.00 26.92 ? 325 ILE A N     1 
ATOM   3321 C  CA    . ILE C 3 329 ? -26.453 67.058 230.837 1.00 23.11 ? 325 ILE A CA    1 
ATOM   3322 C  C     . ILE C 3 329 ? -26.778 66.152 229.645 1.00 23.61 ? 325 ILE A C     1 
ATOM   3323 O  O     . ILE C 3 329 ? -26.356 65.003 229.610 1.00 23.24 ? 325 ILE A O     1 
ATOM   3324 C  CB    . ILE C 3 329 ? -27.331 66.686 232.000 1.00 20.58 ? 325 ILE A CB    1 
ATOM   3325 C  CG1   . ILE C 3 329 ? -26.766 65.446 232.650 1.00 18.85 ? 325 ILE A CG1   1 
ATOM   3326 C  CG2   . ILE C 3 329 ? -28.760 66.469 231.532 1.00 20.00 ? 325 ILE A CG2   1 
ATOM   3327 C  CD1   . ILE C 3 329 ? -27.151 65.376 234.115 1.00 21.94 ? 325 ILE A CD1   1 
ATOM   3328 N  N     . GLU C 3 330 ? -27.485 66.685 228.654 1.00 24.46 ? 326 GLU A N     1 
ATOM   3329 C  CA    . GLU C 3 330 ? -27.800 65.902 227.484 1.00 28.09 ? 326 GLU A CA    1 
ATOM   3330 C  C     . GLU C 3 330 ? -26.533 65.831 226.674 1.00 28.40 ? 326 GLU A C     1 
ATOM   3331 O  O     . GLU C 3 330 ? -26.228 64.801 226.071 1.00 31.15 ? 326 GLU A O     1 
ATOM   3332 C  CB    . GLU C 3 330 ? -28.928 66.536 226.646 1.00 31.14 ? 326 GLU A CB    1 
ATOM   3333 C  CG    . GLU C 3 330 ? -30.297 66.643 227.356 1.00 35.39 ? 326 GLU A CG    1 
ATOM   3334 C  CD    . GLU C 3 330 ? -30.752 65.352 228.028 1.00 37.66 ? 326 GLU A CD    1 
ATOM   3335 O  OE1   . GLU C 3 330 ? -31.661 65.440 228.897 1.00 37.35 ? 326 GLU A OE1   1 
ATOM   3336 O  OE2   . GLU C 3 330 ? -30.204 64.272 227.688 1.00 38.52 ? 326 GLU A OE2   1 
ATOM   3337 N  N     . GLU C 3 331 ? -25.784 66.929 226.650 1.00 30.46 ? 327 GLU A N     1 
ATOM   3338 C  CA    . GLU C 3 331 ? -24.521 66.952 225.902 1.00 30.10 ? 327 GLU A CA    1 
ATOM   3339 C  C     . GLU C 3 331 ? -23.496 66.091 226.633 1.00 27.93 ? 327 GLU A C     1 
ATOM   3340 O  O     . GLU C 3 331 ? -22.658 65.433 226.014 1.00 27.60 ? 327 GLU A O     1 
ATOM   3341 C  CB    . GLU C 3 331 ? -24.013 68.376 225.740 1.00 32.75 ? 327 GLU A CB    1 
ATOM   3342 C  CG    . GLU C 3 331 ? -24.841 69.176 224.760 1.00 40.70 ? 327 GLU A CG    1 
ATOM   3343 C  CD    . GLU C 3 331 ? -24.188 70.504 224.367 1.00 46.92 ? 327 GLU A CD    1 
ATOM   3344 O  OE1   . GLU C 3 331 ? -24.244 71.473 225.179 1.00 49.68 ? 327 GLU A OE1   1 
ATOM   3345 O  OE2   . GLU C 3 331 ? -23.616 70.570 223.245 1.00 49.12 ? 327 GLU A OE2   1 
ATOM   3346 N  N     . PHE C 3 332 ? -23.578 66.081 227.954 1.00 25.98 ? 328 PHE A N     1 
ATOM   3347 C  CA    . PHE C 3 332 ? -22.681 65.243 228.707 1.00 25.98 ? 328 PHE A CA    1 
ATOM   3348 C  C     . PHE C 3 332 ? -22.884 63.798 228.244 1.00 26.72 ? 328 PHE A C     1 
ATOM   3349 O  O     . PHE C 3 332 ? -21.922 63.083 227.928 1.00 26.59 ? 328 PHE A O     1 
ATOM   3350 C  CB    . PHE C 3 332 ? -22.989 65.350 230.184 1.00 25.01 ? 328 PHE A CB    1 
ATOM   3351 C  CG    . PHE C 3 332 ? -22.507 64.194 230.990 1.00 26.29 ? 328 PHE A CG    1 
ATOM   3352 C  CD1   . PHE C 3 332 ? -21.201 63.761 230.895 1.00 25.87 ? 328 PHE A CD1   1 
ATOM   3353 C  CD2   . PHE C 3 332 ? -23.367 63.532 231.849 1.00 27.06 ? 328 PHE A CD2   1 
ATOM   3354 C  CE1   . PHE C 3 332 ? -20.754 62.731 231.688 1.00 25.84 ? 328 PHE A CE1   1 
ATOM   3355 C  CE2   . PHE C 3 332 ? -22.916 62.496 232.644 1.00 25.39 ? 328 PHE A CE2   1 
ATOM   3356 C  CZ    . PHE C 3 332 ? -21.622 62.081 232.547 1.00 24.73 ? 328 PHE A CZ    1 
ATOM   3357 N  N     . HIS C 3 333 ? -24.148 63.376 228.209 1.00 24.99 ? 329 HIS A N     1 
ATOM   3358 C  CA    . HIS C 3 333 ? -24.480 62.023 227.784 1.00 22.19 ? 329 HIS A CA    1 
ATOM   3359 C  C     . HIS C 3 333 ? -23.918 61.713 226.418 1.00 24.01 ? 329 HIS A C     1 
ATOM   3360 O  O     . HIS C 3 333 ? -23.281 60.662 226.218 1.00 25.86 ? 329 HIS A O     1 
ATOM   3361 C  CB    . HIS C 3 333 ? -25.984 61.811 227.784 1.00 15.91 ? 329 HIS A CB    1 
ATOM   3362 C  CG    . HIS C 3 333 ? -26.577 61.805 229.154 1.00 9.48  ? 329 HIS A CG    1 
ATOM   3363 N  ND1   . HIS C 3 333 ? -27.829 62.314 229.421 1.00 7.47  ? 329 HIS A ND1   1 
ATOM   3364 C  CD2   . HIS C 3 333 ? -26.060 61.426 230.348 1.00 6.28  ? 329 HIS A CD2   1 
ATOM   3365 C  CE1   . HIS C 3 333 ? -28.053 62.260 230.724 1.00 6.65  ? 329 HIS A CE1   1 
ATOM   3366 N  NE2   . HIS C 3 333 ? -26.996 61.728 231.308 1.00 4.89  ? 329 HIS A NE2   1 
ATOM   3367 N  N     . LYS C 3 334 ? -24.124 62.608 225.462 1.00 21.93 ? 330 LYS A N     1 
ATOM   3368 C  CA    . LYS C 3 334 ? -23.572 62.315 224.154 1.00 22.44 ? 330 LYS A CA    1 
ATOM   3369 C  C     . LYS C 3 334 ? -22.047 62.209 224.243 1.00 24.89 ? 330 LYS A C     1 
ATOM   3370 O  O     . LYS C 3 334 ? -21.435 61.393 223.543 1.00 27.52 ? 330 LYS A O     1 
ATOM   3371 C  CB    . LYS C 3 334 ? -23.963 63.373 223.127 1.00 19.61 ? 330 LYS A CB    1 
ATOM   3372 C  CG    . LYS C 3 334 ? -23.337 63.081 221.772 1.00 20.56 ? 330 LYS A CG    1 
ATOM   3373 C  CD    . LYS C 3 334 ? -23.673 64.126 220.720 1.00 19.12 ? 330 LYS A CD    1 
ATOM   3374 C  CE    . LYS C 3 334 ? -24.881 63.698 219.909 1.00 19.91 ? 330 LYS A CE    1 
ATOM   3375 N  NZ    . LYS C 3 334 ? -24.908 64.273 218.520 1.00 18.76 ? 330 LYS A NZ    1 
ATOM   3376 N  N     . ALA C 3 335 ? -21.433 63.020 225.105 1.00 25.03 ? 331 ALA A N     1 
ATOM   3377 C  CA    . ALA C 3 335 ? -19.979 62.994 225.251 1.00 25.08 ? 331 ALA A CA    1 
ATOM   3378 C  C     . ALA C 3 335 ? -19.503 61.685 225.880 1.00 23.97 ? 331 ALA A C     1 
ATOM   3379 O  O     . ALA C 3 335 ? -18.445 61.168 225.534 1.00 23.52 ? 331 ALA A O     1 
ATOM   3380 C  CB    . ALA C 3 335 ? -19.513 64.186 226.096 1.00 25.38 ? 331 ALA A CB    1 
ATOM   3381 N  N     . TRP C 3 336 ? -20.291 61.175 226.819 1.00 23.62 ? 332 TRP A N     1 
ATOM   3382 C  CA    . TRP C 3 336 ? -19.983 59.927 227.503 1.00 22.31 ? 332 TRP A CA    1 
ATOM   3383 C  C     . TRP C 3 336 ? -20.054 58.756 226.535 1.00 23.39 ? 332 TRP A C     1 
ATOM   3384 O  O     . TRP C 3 336 ? -19.296 57.805 226.659 1.00 23.74 ? 332 TRP A O     1 
ATOM   3385 C  CB    . TRP C 3 336 ? -20.967 59.700 228.628 1.00 19.95 ? 332 TRP A CB    1 
ATOM   3386 C  CG    . TRP C 3 336 ? -20.555 58.671 229.591 1.00 19.12 ? 332 TRP A CG    1 
ATOM   3387 C  CD1   . TRP C 3 336 ? -19.355 58.016 229.652 1.00 19.05 ? 332 TRP A CD1   1 
ATOM   3388 C  CD2   . TRP C 3 336 ? -21.309 58.227 230.721 1.00 19.44 ? 332 TRP A CD2   1 
ATOM   3389 N  NE1   . TRP C 3 336 ? -19.304 57.221 230.781 1.00 18.69 ? 332 TRP A NE1   1 
ATOM   3390 C  CE2   . TRP C 3 336 ? -20.480 57.363 231.472 1.00 19.53 ? 332 TRP A CE2   1 
ATOM   3391 C  CE3   . TRP C 3 336 ? -22.581 58.552 231.222 1.00 17.82 ? 332 TRP A CE3   1 
ATOM   3392 C  CZ2   . TRP C 3 336 ? -20.919 56.735 232.655 1.00 22.92 ? 332 TRP A CZ2   1 
ATOM   3393 C  CZ3   . TRP C 3 336 ? -23.019 57.939 232.403 1.00 18.86 ? 332 TRP A CZ3   1 
ATOM   3394 C  CH2   . TRP C 3 336 ? -22.177 57.071 233.127 1.00 19.94 ? 332 TRP A CH2   1 
ATOM   3395 N  N     . LYS C 3 337 ? -20.966 58.823 225.574 1.00 24.12 ? 333 LYS A N     1 
ATOM   3396 C  CA    . LYS C 3 337 ? -21.093 57.747 224.615 1.00 25.69 ? 333 LYS A CA    1 
ATOM   3397 C  C     . LYS C 3 337 ? -20.296 58.038 223.374 1.00 26.34 ? 333 LYS A C     1 
ATOM   3398 O  O     . LYS C 3 337 ? -19.111 57.720 223.323 1.00 30.60 ? 333 LYS A O     1 
ATOM   3399 C  CB    . LYS C 3 337 ? -22.562 57.502 224.280 1.00 25.51 ? 333 LYS A CB    1 
ATOM   3400 C  CG    . LYS C 3 337 ? -23.227 56.569 225.287 1.00 24.29 ? 333 LYS A CG    1 
ATOM   3401 C  CD    . LYS C 3 337 ? -24.737 56.662 225.272 1.00 22.75 ? 333 LYS A CD    1 
ATOM   3402 C  CE    . LYS C 3 337 ? -25.209 57.283 226.585 1.00 21.39 ? 333 LYS A CE    1 
ATOM   3403 N  NZ    . LYS C 3 337 ? -26.688 57.297 226.740 1.00 19.99 ? 333 LYS A NZ    1 
ATOM   3404 N  N     . THR C 3 338 ? -20.915 58.650 222.374 1.00 24.59 ? 334 THR A N     1 
ATOM   3405 C  CA    . THR C 3 338 ? -20.187 58.958 221.158 1.00 25.70 ? 334 THR A CA    1 
ATOM   3406 C  C     . THR C 3 338 ? -18.805 59.536 221.461 1.00 25.82 ? 334 THR A C     1 
ATOM   3407 O  O     . THR C 3 338 ? -17.859 59.294 220.723 1.00 27.11 ? 334 THR A O     1 
ATOM   3408 C  CB    . THR C 3 338 ? -20.943 59.973 220.282 1.00 28.20 ? 334 THR A CB    1 
ATOM   3409 O  OG1   . THR C 3 338 ? -22.252 59.467 219.980 1.00 28.91 ? 334 THR A OG1   1 
ATOM   3410 C  CG2   . THR C 3 338 ? -20.179 60.199 218.973 1.00 26.76 ? 334 THR A CG2   1 
ATOM   3411 N  N     . GLY C 3 339 ? -18.693 60.309 222.538 1.00 24.78 ? 335 GLY A N     1 
ATOM   3412 C  CA    . GLY C 3 339 ? -17.411 60.887 222.882 1.00 20.68 ? 335 GLY A CA    1 
ATOM   3413 C  C     . GLY C 3 339 ? -16.394 59.913 223.442 1.00 19.89 ? 335 GLY A C     1 
ATOM   3414 O  O     . GLY C 3 339 ? -15.636 59.318 222.695 1.00 21.32 ? 335 GLY A O     1 
ATOM   3415 N  N     . ALA C 3 340 ? -16.368 59.766 224.758 1.00 19.26 ? 336 ALA A N     1 
ATOM   3416 C  CA    . ALA C 3 340 ? -15.431 58.878 225.416 1.00 21.17 ? 336 ALA A CA    1 
ATOM   3417 C  C     . ALA C 3 340 ? -15.601 57.419 225.001 1.00 22.78 ? 336 ALA A C     1 
ATOM   3418 O  O     . ALA C 3 340 ? -14.725 56.583 225.268 1.00 23.89 ? 336 ALA A O     1 
ATOM   3419 C  CB    . ALA C 3 340 ? -15.578 59.006 226.940 1.00 21.26 ? 336 ALA A CB    1 
ATOM   3420 N  N     . GLY C 3 341 ? -16.738 57.109 224.386 1.00 21.50 ? 337 GLY A N     1 
ATOM   3421 C  CA    . GLY C 3 341 ? -17.004 55.752 223.943 1.00 22.43 ? 337 GLY A CA    1 
ATOM   3422 C  C     . GLY C 3 341 ? -17.457 54.773 225.017 1.00 23.60 ? 337 GLY A C     1 
ATOM   3423 O  O     . GLY C 3 341 ? -17.003 53.632 225.035 1.00 24.50 ? 337 GLY A O     1 
ATOM   3424 N  N     . ALA C 3 342 ? -18.353 55.196 225.903 1.00 24.68 ? 338 ALA A N     1 
ATOM   3425 C  CA    . ALA C 3 342 ? -18.848 54.302 226.949 1.00 26.19 ? 338 ALA A CA    1 
ATOM   3426 C  C     . ALA C 3 342 ? -19.458 53.038 226.335 1.00 26.70 ? 338 ALA A C     1 
ATOM   3427 O  O     . ALA C 3 342 ? -19.120 51.925 226.726 1.00 27.64 ? 338 ALA A O     1 
ATOM   3428 C  CB    . ALA C 3 342 ? -19.899 55.012 227.825 1.00 25.06 ? 338 ALA A CB    1 
ATOM   3429 N  N     . GLU C 3 343 ? -20.357 53.213 225.377 1.00 25.90 ? 339 GLU A N     1 
ATOM   3430 C  CA    . GLU C 3 343 ? -20.998 52.076 224.740 1.00 25.83 ? 339 GLU A CA    1 
ATOM   3431 C  C     . GLU C 3 343 ? -20.143 51.341 223.710 1.00 25.97 ? 339 GLU A C     1 
ATOM   3432 O  O     . GLU C 3 343 ? -20.629 50.446 223.011 1.00 26.87 ? 339 GLU A O     1 
ATOM   3433 C  CB    . GLU C 3 343 ? -22.322 52.534 224.121 1.00 25.76 ? 339 GLU A CB    1 
ATOM   3434 C  CG    . GLU C 3 343 ? -23.344 52.788 225.209 1.00 28.45 ? 339 GLU A CG    1 
ATOM   3435 C  CD    . GLU C 3 343 ? -24.648 53.400 224.741 1.00 31.14 ? 339 GLU A CD    1 
ATOM   3436 O  OE1   . GLU C 3 343 ? -24.780 53.732 223.527 1.00 30.53 ? 339 GLU A OE1   1 
ATOM   3437 O  OE2   . GLU C 3 343 ? -25.542 53.547 225.620 1.00 32.13 ? 339 GLU A OE2   1 
ATOM   3438 N  N     . ARG C 3 344 ? -18.866 51.702 223.614 1.00 25.19 ? 340 ARG A N     1 
ATOM   3439 C  CA    . ARG C 3 344 ? -17.973 51.044 222.652 1.00 23.93 ? 340 ARG A CA    1 
ATOM   3440 C  C     . ARG C 3 344 ? -17.083 50.001 223.325 1.00 23.25 ? 340 ARG A C     1 
ATOM   3441 O  O     . ARG C 3 344 ? -16.516 49.141 222.663 1.00 22.16 ? 340 ARG A O     1 
ATOM   3442 C  CB    . ARG C 3 344 ? -17.115 52.076 221.929 1.00 21.38 ? 340 ARG A CB    1 
ATOM   3443 C  CG    . ARG C 3 344 ? -17.814 52.671 220.737 1.00 24.65 ? 340 ARG A CG    1 
ATOM   3444 C  CD    . ARG C 3 344 ? -16.827 53.390 219.848 1.00 24.57 ? 340 ARG A CD    1 
ATOM   3445 N  NE    . ARG C 3 344 ? -16.085 54.378 220.635 1.00 28.51 ? 340 ARG A NE    1 
ATOM   3446 C  CZ    . ARG C 3 344 ? -16.407 55.667 220.708 1.00 29.77 ? 340 ARG A CZ    1 
ATOM   3447 N  NH1   . ARG C 3 344 ? -17.443 56.133 220.030 1.00 31.19 ? 340 ARG A NH1   1 
ATOM   3448 N  NH2   . ARG C 3 344 ? -15.726 56.481 221.494 1.00 30.64 ? 340 ARG A NH2   1 
ATOM   3449 N  N     . GLN C 3 345 ? -16.988 50.095 224.646 1.00 21.10 ? 341 GLN A N     1 
ATOM   3450 C  CA    . GLN C 3 345 ? -16.202 49.179 225.433 1.00 23.72 ? 341 GLN A CA    1 
ATOM   3451 C  C     . GLN C 3 345 ? -16.779 47.779 225.293 1.00 24.36 ? 341 GLN A C     1 
ATOM   3452 O  O     . GLN C 3 345 ? -17.970 47.623 225.015 1.00 25.93 ? 341 GLN A O     1 
ATOM   3453 C  CB    . GLN C 3 345 ? -16.218 49.636 226.891 1.00 24.94 ? 341 GLN A CB    1 
ATOM   3454 C  CG    . GLN C 3 345 ? -15.623 51.050 227.048 1.00 27.98 ? 341 GLN A CG    1 
ATOM   3455 C  CD    . GLN C 3 345 ? -14.317 51.190 226.278 1.00 29.80 ? 341 GLN A CD    1 
ATOM   3456 O  OE1   . GLN C 3 345 ? -13.357 50.482 226.562 1.00 32.48 ? 341 GLN A OE1   1 
ATOM   3457 N  NE2   . GLN C 3 345 ? -14.284 52.077 225.284 1.00 27.58 ? 341 GLN A NE2   1 
ATOM   3458 N  N     . ARG C 3 346 ? -15.940 46.764 225.471 1.00 24.04 ? 342 ARG A N     1 
ATOM   3459 C  CA    . ARG C 3 346 ? -16.393 45.396 225.335 1.00 21.80 ? 342 ARG A CA    1 
ATOM   3460 C  C     . ARG C 3 346 ? -15.903 44.507 226.438 1.00 22.72 ? 342 ARG A C     1 
ATOM   3461 O  O     . ARG C 3 346 ? -15.577 43.342 226.211 1.00 22.99 ? 342 ARG A O     1 
ATOM   3462 C  CB    . ARG C 3 346 ? -15.945 44.817 224.008 1.00 20.24 ? 342 ARG A CB    1 
ATOM   3463 C  CG    . ARG C 3 346 ? -16.665 45.389 222.831 1.00 19.94 ? 342 ARG A CG    1 
ATOM   3464 C  CD    . ARG C 3 346 ? -18.161 45.106 222.906 1.00 21.82 ? 342 ARG A CD    1 
ATOM   3465 N  NE    . ARG C 3 346 ? -18.851 45.619 221.717 1.00 18.50 ? 342 ARG A NE    1 
ATOM   3466 C  CZ    . ARG C 3 346 ? -19.551 46.745 221.693 1.00 17.38 ? 342 ARG A CZ    1 
ATOM   3467 N  NH1   . ARG C 3 346 ? -19.667 47.480 222.799 1.00 13.84 ? 342 ARG A NH1   1 
ATOM   3468 N  NH2   . ARG C 3 346 ? -20.113 47.124 220.560 1.00 14.66 ? 342 ARG A NH2   1 
ATOM   3469 N  N     . MET C 3 347 ? -15.823 45.064 227.635 1.00 24.72 ? 343 MET A N     1 
ATOM   3470 C  CA    . MET C 3 347 ? -15.414 44.273 228.765 1.00 26.95 ? 343 MET A CA    1 
ATOM   3471 C  C     . MET C 3 347 ? -16.432 43.110 228.790 1.00 29.97 ? 343 MET A C     1 
ATOM   3472 O  O     . MET C 3 347 ? -17.550 43.239 228.261 1.00 28.70 ? 343 MET A O     1 
ATOM   3473 C  CB    . MET C 3 347 ? -15.472 45.114 230.046 1.00 28.63 ? 343 MET A CB    1 
ATOM   3474 C  CG    . MET C 3 347 ? -14.218 45.948 230.323 1.00 32.75 ? 343 MET A CG    1 
ATOM   3475 S  SD    . MET C 3 347 ? -14.018 47.467 229.325 1.00 36.76 ? 343 MET A SD    1 
ATOM   3476 C  CE    . MET C 3 347 ? -12.995 46.904 227.905 1.00 34.92 ? 343 MET A CE    1 
ATOM   3477 N  N     . GLU C 3 348 ? -16.030 41.975 229.370 1.00 31.45 ? 344 GLU A N     1 
ATOM   3478 C  CA    . GLU C 3 348 ? -16.864 40.776 229.448 1.00 32.38 ? 344 GLU A CA    1 
ATOM   3479 C  C     . GLU C 3 348 ? -17.433 40.469 230.836 1.00 33.29 ? 344 GLU A C     1 
ATOM   3480 O  O     . GLU C 3 348 ? -17.938 39.377 231.072 1.00 34.85 ? 344 GLU A O     1 
ATOM   3481 C  CB    . GLU C 3 348 ? -16.055 39.584 228.955 1.00 34.70 ? 344 GLU A CB    1 
ATOM   3482 C  CG    . GLU C 3 348 ? -15.101 39.915 227.812 1.00 39.26 ? 344 GLU A CG    1 
ATOM   3483 C  CD    . GLU C 3 348 ? -14.381 38.678 227.255 1.00 43.07 ? 344 GLU A CD    1 
ATOM   3484 O  OE1   . GLU C 3 348 ? -13.964 37.793 228.058 1.00 43.73 ? 344 GLU A OE1   1 
ATOM   3485 O  OE2   . GLU C 3 348 ? -14.230 38.598 226.011 1.00 44.41 ? 344 GLU A OE2   1 
ATOM   3486 N  N     . LYS C 3 349 ? -17.344 41.418 231.756 1.00 33.87 ? 345 LYS A N     1 
ATOM   3487 C  CA    . LYS C 3 349 ? -17.893 41.222 233.094 1.00 34.95 ? 345 LYS A CA    1 
ATOM   3488 C  C     . LYS C 3 349 ? -18.441 42.545 233.602 1.00 35.25 ? 345 LYS A C     1 
ATOM   3489 O  O     . LYS C 3 349 ? -17.809 43.582 233.448 1.00 37.01 ? 345 LYS A O     1 
ATOM   3490 C  CB    . LYS C 3 349 ? -16.824 40.735 234.054 1.00 38.46 ? 345 LYS A CB    1 
ATOM   3491 C  CG    . LYS C 3 349 ? -16.235 39.389 233.729 1.00 41.80 ? 345 LYS A CG    1 
ATOM   3492 C  CD    . LYS C 3 349 ? -16.809 38.295 234.613 1.00 45.82 ? 345 LYS A CD    1 
ATOM   3493 C  CE    . LYS C 3 349 ? -17.953 37.580 233.918 1.00 48.42 ? 345 LYS A CE    1 
ATOM   3494 N  NZ    . LYS C 3 349 ? -19.049 38.521 233.574 1.00 50.29 ? 345 LYS A NZ    1 
ATOM   3495 N  N     . PRO C 3 350 ? -19.611 42.526 234.246 1.00 34.13 ? 346 PRO A N     1 
ATOM   3496 C  CA    . PRO C 3 350 ? -20.218 43.754 234.762 1.00 32.52 ? 346 PRO A CA    1 
ATOM   3497 C  C     . PRO C 3 350 ? -19.278 44.714 235.484 1.00 32.59 ? 346 PRO A C     1 
ATOM   3498 O  O     . PRO C 3 350 ? -19.093 45.845 235.040 1.00 32.28 ? 346 PRO A O     1 
ATOM   3499 C  CB    . PRO C 3 350 ? -21.319 43.225 235.668 1.00 31.33 ? 346 PRO A CB    1 
ATOM   3500 C  CG    . PRO C 3 350 ? -21.754 42.017 234.944 1.00 31.05 ? 346 PRO A CG    1 
ATOM   3501 C  CD    . PRO C 3 350 ? -20.436 41.364 234.599 1.00 33.01 ? 346 PRO A CD    1 
ATOM   3502 N  N     . ASP C 3 351 ? -18.691 44.257 236.591 1.00 32.22 ? 347 ASP A N     1 
ATOM   3503 C  CA    . ASP C 3 351 ? -17.783 45.088 237.375 1.00 31.91 ? 347 ASP A CA    1 
ATOM   3504 C  C     . ASP C 3 351 ? -16.708 45.704 236.490 1.00 31.17 ? 347 ASP A C     1 
ATOM   3505 O  O     . ASP C 3 351 ? -16.400 46.897 236.599 1.00 29.01 ? 347 ASP A O     1 
ATOM   3506 C  CB    . ASP C 3 351 ? -17.165 44.273 238.512 1.00 32.58 ? 347 ASP A CB    1 
ATOM   3507 C  CG    . ASP C 3 351 ? -18.195 43.866 239.541 1.00 36.45 ? 347 ASP A CG    1 
ATOM   3508 O  OD1   . ASP C 3 351 ? -19.366 43.669 239.149 1.00 36.92 ? 347 ASP A OD1   1 
ATOM   3509 O  OD2   . ASP C 3 351 ? -17.849 43.732 240.740 1.00 38.82 ? 347 ASP A OD2   1 
ATOM   3510 N  N     . ASN C 3 352 ? -16.155 44.904 235.590 1.00 30.57 ? 348 ASN A N     1 
ATOM   3511 C  CA    . ASN C 3 352 ? -15.120 45.411 234.702 1.00 30.85 ? 348 ASN A CA    1 
ATOM   3512 C  C     . ASN C 3 352 ? -15.609 46.568 233.862 1.00 30.77 ? 348 ASN A C     1 
ATOM   3513 O  O     . ASN C 3 352 ? -15.006 47.644 233.849 1.00 33.01 ? 348 ASN A O     1 
ATOM   3514 C  CB    . ASN C 3 352 ? -14.631 44.314 233.774 1.00 29.60 ? 348 ASN A CB    1 
ATOM   3515 C  CG    . ASN C 3 352 ? -13.962 43.211 234.513 1.00 28.19 ? 348 ASN A CG    1 
ATOM   3516 O  OD1   . ASN C 3 352 ? -13.691 43.325 235.716 1.00 25.20 ? 348 ASN A OD1   1 
ATOM   3517 N  ND2   . ASN C 3 352 ? -13.673 42.128 233.806 1.00 28.05 ? 348 ASN A ND2   1 
ATOM   3518 N  N     . LEU C 3 353 ? -16.719 46.342 233.170 1.00 29.55 ? 349 LEU A N     1 
ATOM   3519 C  CA    . LEU C 3 353 ? -17.291 47.362 232.308 1.00 27.83 ? 349 LEU A CA    1 
ATOM   3520 C  C     . LEU C 3 353 ? -17.604 48.618 233.121 1.00 25.05 ? 349 LEU A C     1 
ATOM   3521 O  O     . LEU C 3 353 ? -17.360 49.738 232.673 1.00 22.14 ? 349 LEU A O     1 
ATOM   3522 C  CB    . LEU C 3 353 ? -18.547 46.815 231.632 1.00 29.09 ? 349 LEU A CB    1 
ATOM   3523 C  CG    . LEU C 3 353 ? -19.208 47.616 230.517 1.00 29.06 ? 349 LEU A CG    1 
ATOM   3524 C  CD1   . LEU C 3 353 ? -18.189 48.037 229.488 1.00 29.38 ? 349 LEU A CD1   1 
ATOM   3525 C  CD2   . LEU C 3 353 ? -20.301 46.751 229.898 1.00 29.70 ? 349 LEU A CD2   1 
ATOM   3526 N  N     . GLU C 3 354 ? -18.123 48.425 234.325 1.00 24.59 ? 350 GLU A N     1 
ATOM   3527 C  CA    . GLU C 3 354 ? -18.447 49.549 235.179 1.00 25.10 ? 350 GLU A CA    1 
ATOM   3528 C  C     . GLU C 3 354 ? -17.167 50.335 235.464 1.00 25.36 ? 350 GLU A C     1 
ATOM   3529 O  O     . GLU C 3 354 ? -17.135 51.547 235.297 1.00 25.92 ? 350 GLU A O     1 
ATOM   3530 C  CB    . GLU C 3 354 ? -19.060 49.066 236.489 1.00 22.62 ? 350 GLU A CB    1 
ATOM   3531 C  CG    . GLU C 3 354 ? -19.773 50.166 237.260 1.00 25.34 ? 350 GLU A CG    1 
ATOM   3532 C  CD    . GLU C 3 354 ? -20.215 49.736 238.640 1.00 27.51 ? 350 GLU A CD    1 
ATOM   3533 O  OE1   . GLU C 3 354 ? -20.339 48.513 238.868 1.00 29.42 ? 350 GLU A OE1   1 
ATOM   3534 O  OE2   . GLU C 3 354 ? -20.456 50.618 239.493 1.00 25.66 ? 350 GLU A OE2   1 
ATOM   3535 N  N     . ARG C 3 355 ? -16.111 49.641 235.883 1.00 26.52 ? 351 ARG A N     1 
ATOM   3536 C  CA    . ARG C 3 355 ? -14.846 50.309 236.168 1.00 25.76 ? 351 ARG A CA    1 
ATOM   3537 C  C     . ARG C 3 355 ? -14.353 51.132 234.958 1.00 24.61 ? 351 ARG A C     1 
ATOM   3538 O  O     . ARG C 3 355 ? -13.957 52.285 235.122 1.00 24.17 ? 351 ARG A O     1 
ATOM   3539 C  CB    . ARG C 3 355 ? -13.778 49.296 236.642 1.00 25.22 ? 351 ARG A CB    1 
ATOM   3540 C  CG    . ARG C 3 355 ? -13.888 48.958 238.140 1.00 23.86 ? 351 ARG A CG    1 
ATOM   3541 C  CD    . ARG C 3 355 ? -12.811 48.004 238.611 1.00 23.52 ? 351 ARG A CD    1 
ATOM   3542 N  NE    . ARG C 3 355 ? -13.017 46.655 238.119 1.00 21.07 ? 351 ARG A NE    1 
ATOM   3543 C  CZ    . ARG C 3 355 ? -13.511 45.661 238.844 1.00 20.55 ? 351 ARG A CZ    1 
ATOM   3544 N  NH1   . ARG C 3 355 ? -13.854 45.866 240.115 1.00 13.53 ? 351 ARG A NH1   1 
ATOM   3545 N  NH2   . ARG C 3 355 ? -13.648 44.459 238.279 1.00 22.32 ? 351 ARG A NH2   1 
ATOM   3546 N  N     . MET C 3 356 ? -14.388 50.577 233.752 1.00 22.90 ? 352 MET A N     1 
ATOM   3547 C  CA    . MET C 3 356 ? -13.959 51.359 232.598 1.00 25.71 ? 352 MET A CA    1 
ATOM   3548 C  C     . MET C 3 356 ? -14.855 52.582 232.361 1.00 27.00 ? 352 MET A C     1 
ATOM   3549 O  O     . MET C 3 356 ? -14.389 53.717 232.407 1.00 26.85 ? 352 MET A O     1 
ATOM   3550 C  CB    . MET C 3 356 ? -13.958 50.511 231.329 1.00 26.38 ? 352 MET A CB    1 
ATOM   3551 C  CG    . MET C 3 356 ? -12.579 50.347 230.706 1.00 31.37 ? 352 MET A CG    1 
ATOM   3552 S  SD    . MET C 3 356 ? -11.713 51.894 230.349 1.00 31.62 ? 352 MET A SD    1 
ATOM   3553 C  CE    . MET C 3 356 ? -11.666 51.859 228.538 1.00 27.24 ? 352 MET A CE    1 
ATOM   3554 N  N     . VAL C 3 357 ? -16.149 52.333 232.133 1.00 27.93 ? 353 VAL A N     1 
ATOM   3555 C  CA    . VAL C 3 357 ? -17.129 53.371 231.850 1.00 24.03 ? 353 VAL A CA    1 
ATOM   3556 C  C     . VAL C 3 357 ? -17.204 54.445 232.940 1.00 21.98 ? 353 VAL A C     1 
ATOM   3557 O  O     . VAL C 3 357 ? -17.522 55.594 232.650 1.00 21.85 ? 353 VAL A O     1 
ATOM   3558 C  CB    . VAL C 3 357 ? -18.504 52.704 231.563 1.00 23.67 ? 353 VAL A CB    1 
ATOM   3559 C  CG1   . VAL C 3 357 ? -19.551 53.745 231.199 1.00 25.05 ? 353 VAL A CG1   1 
ATOM   3560 C  CG2   . VAL C 3 357 ? -18.346 51.723 230.402 1.00 22.80 ? 353 VAL A CG2   1 
ATOM   3561 N  N     . SER C 3 358 ? -16.882 54.074 234.177 1.00 20.81 ? 354 SER A N     1 
ATOM   3562 C  CA    . SER C 3 358 ? -16.887 55.023 235.292 1.00 23.01 ? 354 SER A CA    1 
ATOM   3563 C  C     . SER C 3 358 ? -15.790 56.068 235.102 1.00 25.72 ? 354 SER A C     1 
ATOM   3564 O  O     . SER C 3 358 ? -15.980 57.268 235.358 1.00 26.49 ? 354 SER A O     1 
ATOM   3565 C  CB    . SER C 3 358 ? -16.650 54.321 236.628 1.00 22.77 ? 354 SER A CB    1 
ATOM   3566 O  OG    . SER C 3 358 ? -17.822 53.662 237.076 1.00 28.56 ? 354 SER A OG    1 
ATOM   3567 N  N     . ILE C 3 359 ? -14.623 55.602 234.676 1.00 24.54 ? 355 ILE A N     1 
ATOM   3568 C  CA    . ILE C 3 359 ? -13.512 56.493 234.428 1.00 22.94 ? 355 ILE A CA    1 
ATOM   3569 C  C     . ILE C 3 359 ? -13.923 57.378 233.252 1.00 22.17 ? 355 ILE A C     1 
ATOM   3570 O  O     . ILE C 3 359 ? -13.795 58.595 233.311 1.00 25.85 ? 355 ILE A O     1 
ATOM   3571 C  CB    . ILE C 3 359 ? -12.230 55.678 234.123 1.00 22.52 ? 355 ILE A CB    1 
ATOM   3572 C  CG1   . ILE C 3 359 ? -11.789 54.975 235.405 1.00 22.25 ? 355 ILE A CG1   1 
ATOM   3573 C  CG2   . ILE C 3 359 ? -11.122 56.578 233.590 1.00 21.37 ? 355 ILE A CG2   1 
ATOM   3574 C  CD1   . ILE C 3 359 ? -10.658 54.009 235.222 1.00 19.91 ? 355 ILE A CD1   1 
ATOM   3575 N  N     . LEU C 3 360 ? -14.450 56.769 232.202 1.00 21.58 ? 356 LEU A N     1 
ATOM   3576 C  CA    . LEU C 3 360 ? -14.882 57.518 231.047 1.00 22.34 ? 356 LEU A CA    1 
ATOM   3577 C  C     . LEU C 3 360 ? -15.907 58.600 231.339 1.00 23.17 ? 356 LEU A C     1 
ATOM   3578 O  O     . LEU C 3 360 ? -16.071 59.508 230.520 1.00 21.15 ? 356 LEU A O     1 
ATOM   3579 C  CB    . LEU C 3 360 ? -15.468 56.585 230.002 1.00 24.87 ? 356 LEU A CB    1 
ATOM   3580 C  CG    . LEU C 3 360 ? -14.483 55.602 229.377 1.00 28.44 ? 356 LEU A CG    1 
ATOM   3581 C  CD1   . LEU C 3 360 ? -15.048 55.146 228.015 1.00 30.49 ? 356 LEU A CD1   1 
ATOM   3582 C  CD2   . LEU C 3 360 ? -13.123 56.268 229.145 1.00 30.44 ? 356 LEU A CD2   1 
ATOM   3583 N  N     . SER C 3 361 ? -16.620 58.534 232.467 1.00 21.77 ? 357 SER A N     1 
ATOM   3584 C  CA    . SER C 3 361 ? -17.607 59.590 232.695 1.00 22.68 ? 357 SER A CA    1 
ATOM   3585 C  C     . SER C 3 361 ? -16.856 60.900 232.819 1.00 23.50 ? 357 SER A C     1 
ATOM   3586 O  O     . SER C 3 361 ? -17.254 61.924 232.258 1.00 24.09 ? 357 SER A O     1 
ATOM   3587 C  CB    . SER C 3 361 ? -18.464 59.339 233.940 1.00 21.45 ? 357 SER A CB    1 
ATOM   3588 O  OG    . SER C 3 361 ? -17.678 59.275 235.105 1.00 24.46 ? 357 SER A OG    1 
ATOM   3589 N  N     . PHE C 3 362 ? -15.728 60.852 233.516 1.00 25.40 ? 358 PHE A N     1 
ATOM   3590 C  CA    . PHE C 3 362 ? -14.922 62.046 233.704 1.00 25.52 ? 358 PHE A CA    1 
ATOM   3591 C  C     . PHE C 3 362 ? -14.172 62.401 232.431 1.00 27.07 ? 358 PHE A C     1 
ATOM   3592 O  O     . PHE C 3 362 ? -14.034 63.582 232.084 1.00 28.64 ? 358 PHE A O     1 
ATOM   3593 C  CB    . PHE C 3 362 ? -13.984 61.845 234.869 1.00 23.54 ? 358 PHE A CB    1 
ATOM   3594 C  CG    . PHE C 3 362 ? -14.690 61.489 236.125 1.00 23.31 ? 358 PHE A CG    1 
ATOM   3595 C  CD1   . PHE C 3 362 ? -14.851 60.161 236.497 1.00 26.48 ? 358 PHE A CD1   1 
ATOM   3596 C  CD2   . PHE C 3 362 ? -15.177 62.477 236.958 1.00 21.81 ? 358 PHE A CD2   1 
ATOM   3597 C  CE1   . PHE C 3 362 ? -15.492 59.821 237.703 1.00 28.42 ? 358 PHE A CE1   1 
ATOM   3598 C  CE2   . PHE C 3 362 ? -15.815 62.154 238.159 1.00 24.74 ? 358 PHE A CE2   1 
ATOM   3599 C  CZ    . PHE C 3 362 ? -15.970 60.821 238.540 1.00 25.37 ? 358 PHE A CZ    1 
ATOM   3600 N  N     . VAL C 3 363 ? -13.730 61.389 231.701 1.00 25.53 ? 359 VAL A N     1 
ATOM   3601 C  CA    . VAL C 3 363 ? -13.033 61.660 230.461 1.00 25.78 ? 359 VAL A CA    1 
ATOM   3602 C  C     . VAL C 3 363 ? -14.066 62.202 229.493 1.00 27.47 ? 359 VAL A C     1 
ATOM   3603 O  O     . VAL C 3 363 ? -13.739 62.605 228.385 1.00 29.49 ? 359 VAL A O     1 
ATOM   3604 C  CB    . VAL C 3 363 ? -12.413 60.378 229.869 1.00 24.33 ? 359 VAL A CB    1 
ATOM   3605 C  CG1   . VAL C 3 363 ? -11.674 60.690 228.576 1.00 19.81 ? 359 VAL A CG1   1 
ATOM   3606 C  CG2   . VAL C 3 363 ? -11.496 59.736 230.878 1.00 23.99 ? 359 VAL A CG2   1 
ATOM   3607 N  N     . ALA C 3 364 ? -15.328 62.199 229.901 1.00 29.05 ? 360 ALA A N     1 
ATOM   3608 C  CA    . ALA C 3 364 ? -16.374 62.700 229.010 1.00 30.64 ? 360 ALA A CA    1 
ATOM   3609 C  C     . ALA C 3 364 ? -16.662 64.178 229.272 1.00 29.95 ? 360 ALA A C     1 
ATOM   3610 O  O     . ALA C 3 364 ? -16.999 64.929 228.351 1.00 29.43 ? 360 ALA A O     1 
ATOM   3611 C  CB    . ALA C 3 364 ? -17.630 61.878 229.181 1.00 32.89 ? 360 ALA A CB    1 
ATOM   3612 N  N     . VAL C 3 365 ? -16.529 64.569 230.536 1.00 29.45 ? 361 VAL A N     1 
ATOM   3613 C  CA    . VAL C 3 365 ? -16.728 65.944 230.969 1.00 30.45 ? 361 VAL A CA    1 
ATOM   3614 C  C     . VAL C 3 365 ? -15.639 66.837 230.354 1.00 32.62 ? 361 VAL A C     1 
ATOM   3615 O  O     . VAL C 3 365 ? -15.919 67.925 229.823 1.00 32.76 ? 361 VAL A O     1 
ATOM   3616 C  CB    . VAL C 3 365 ? -16.618 66.053 232.503 1.00 29.98 ? 361 VAL A CB    1 
ATOM   3617 C  CG1   . VAL C 3 365 ? -16.745 67.500 232.932 1.00 28.88 ? 361 VAL A CG1   1 
ATOM   3618 C  CG2   . VAL C 3 365 ? -17.677 65.191 233.165 1.00 28.12 ? 361 VAL A CG2   1 
ATOM   3619 N  N     . ARG C 3 366 ? -14.397 66.360 230.441 1.00 32.50 ? 362 ARG A N     1 
ATOM   3620 C  CA    . ARG C 3 366 ? -13.225 67.064 229.918 1.00 31.66 ? 362 ARG A CA    1 
ATOM   3621 C  C     . ARG C 3 366 ? -13.390 67.545 228.470 1.00 30.20 ? 362 ARG A C     1 
ATOM   3622 O  O     . ARG C 3 366 ? -12.914 68.618 228.116 1.00 29.10 ? 362 ARG A O     1 
ATOM   3623 C  CB    . ARG C 3 366 ? -11.976 66.159 230.056 1.00 32.04 ? 362 ARG A CB    1 
ATOM   3624 C  CG    . ARG C 3 366 ? -10.682 66.750 229.504 1.00 29.52 ? 362 ARG A CG    1 
ATOM   3625 C  CD    . ARG C 3 366 ? -9.453  66.048 230.068 1.00 29.52 ? 362 ARG A CD    1 
ATOM   3626 N  NE    . ARG C 3 366 ? -8.241  66.509 229.378 1.00 30.46 ? 362 ARG A NE    1 
ATOM   3627 C  CZ    . ARG C 3 366 ? -7.718  65.908 228.317 1.00 30.07 ? 362 ARG A CZ    1 
ATOM   3628 N  NH1   . ARG C 3 366 ? -8.290  64.812 227.841 1.00 31.64 ? 362 ARG A NH1   1 
ATOM   3629 N  NH2   . ARG C 3 366 ? -6.661  66.421 227.704 1.00 29.66 ? 362 ARG A NH2   1 
ATOM   3630 N  N     . LEU C 3 367 ? -14.068 66.759 227.643 1.00 29.16 ? 363 LEU A N     1 
ATOM   3631 C  CA    . LEU C 3 367 ? -14.277 67.121 226.250 1.00 29.20 ? 363 LEU A CA    1 
ATOM   3632 C  C     . LEU C 3 367 ? -15.132 68.352 226.198 1.00 28.97 ? 363 LEU A C     1 
ATOM   3633 O  O     . LEU C 3 367 ? -14.953 69.203 225.337 1.00 28.32 ? 363 LEU A O     1 
ATOM   3634 C  CB    . LEU C 3 367 ? -14.992 66.004 225.509 1.00 30.21 ? 363 LEU A CB    1 
ATOM   3635 C  CG    . LEU C 3 367 ? -14.173 64.804 225.054 1.00 31.32 ? 363 LEU A CG    1 
ATOM   3636 C  CD1   . LEU C 3 367 ? -15.139 63.662 224.812 1.00 30.76 ? 363 LEU A CD1   1 
ATOM   3637 C  CD2   . LEU C 3 367 ? -13.384 65.137 223.772 1.00 32.10 ? 363 LEU A CD2   1 
ATOM   3638 N  N     . LEU C 3 368 ? -16.091 68.414 227.117 1.00 29.15 ? 364 LEU A N     1 
ATOM   3639 C  CA    . LEU C 3 368 ? -16.991 69.547 227.203 1.00 28.08 ? 364 LEU A CA    1 
ATOM   3640 C  C     . LEU C 3 368 ? -16.137 70.736 227.641 1.00 27.75 ? 364 LEU A C     1 
ATOM   3641 O  O     . LEU C 3 368 ? -16.022 71.743 226.935 1.00 28.64 ? 364 LEU A O     1 
ATOM   3642 C  CB    . LEU C 3 368 ? -18.083 69.259 228.236 1.00 26.61 ? 364 LEU A CB    1 
ATOM   3643 C  CG    . LEU C 3 368 ? -19.027 68.093 227.934 1.00 26.01 ? 364 LEU A CG    1 
ATOM   3644 C  CD1   . LEU C 3 368 ? -20.078 68.016 229.028 1.00 23.70 ? 364 LEU A CD1   1 
ATOM   3645 C  CD2   . LEU C 3 368 ? -19.682 68.280 226.581 1.00 24.39 ? 364 LEU A CD2   1 
ATOM   3646 N  N     . GLN C 3 369 ? -15.516 70.574 228.802 1.00 26.34 ? 365 GLN A N     1 
ATOM   3647 C  CA    . GLN C 3 369 ? -14.645 71.572 229.394 1.00 26.51 ? 365 GLN A CA    1 
ATOM   3648 C  C     . GLN C 3 369 ? -13.579 72.135 228.445 1.00 27.76 ? 365 GLN A C     1 
ATOM   3649 O  O     . GLN C 3 369 ? -13.231 73.310 228.519 1.00 27.47 ? 365 GLN A O     1 
ATOM   3650 C  CB    . GLN C 3 369 ? -13.976 70.974 230.613 1.00 24.10 ? 365 GLN A CB    1 
ATOM   3651 C  CG    . GLN C 3 369 ? -14.963 70.656 231.680 1.00 22.05 ? 365 GLN A CG    1 
ATOM   3652 C  CD    . GLN C 3 369 ? -14.299 70.153 232.917 1.00 23.39 ? 365 GLN A CD    1 
ATOM   3653 O  OE1   . GLN C 3 369 ? -13.386 69.329 232.845 1.00 23.98 ? 365 GLN A OE1   1 
ATOM   3654 N  NE2   . GLN C 3 369 ? -14.746 70.637 234.072 1.00 22.77 ? 365 GLN A NE2   1 
ATOM   3655 N  N     . LEU C 3 370 ? -13.071 71.287 227.564 1.00 28.13 ? 366 LEU A N     1 
ATOM   3656 C  CA    . LEU C 3 370 ? -12.077 71.676 226.604 1.00 29.47 ? 366 LEU A CA    1 
ATOM   3657 C  C     . LEU C 3 370 ? -12.643 72.724 225.684 1.00 31.63 ? 366 LEU A C     1 
ATOM   3658 O  O     . LEU C 3 370 ? -12.029 73.770 225.473 1.00 35.27 ? 366 LEU A O     1 
ATOM   3659 C  CB    . LEU C 3 370 ? -11.650 70.470 225.789 1.00 30.91 ? 366 LEU A CB    1 
ATOM   3660 C  CG    . LEU C 3 370 ? -10.175 70.088 225.894 1.00 32.39 ? 366 LEU A CG    1 
ATOM   3661 C  CD1   . LEU C 3 370 ? -9.325  71.165 225.238 1.00 34.00 ? 366 LEU A CD1   1 
ATOM   3662 C  CD2   . LEU C 3 370 ? -9.798  69.916 227.361 1.00 30.81 ? 366 LEU A CD2   1 
ATOM   3663 N  N     . ARG C 3 371 ? -13.816 72.466 225.119 1.00 33.23 ? 367 ARG A N     1 
ATOM   3664 C  CA    . ARG C 3 371 ? -14.410 73.452 224.210 1.00 34.89 ? 367 ARG A CA    1 
ATOM   3665 C  C     . ARG C 3 371 ? -14.709 74.754 224.941 1.00 35.18 ? 367 ARG A C     1 
ATOM   3666 O  O     . ARG C 3 371 ? -14.563 75.824 224.370 1.00 33.55 ? 367 ARG A O     1 
ATOM   3667 C  CB    . ARG C 3 371 ? -15.709 72.938 223.572 1.00 34.40 ? 367 ARG A CB    1 
ATOM   3668 C  CG    . ARG C 3 371 ? -16.314 73.977 222.634 1.00 34.87 ? 367 ARG A CG    1 
ATOM   3669 C  CD    . ARG C 3 371 ? -17.654 73.567 222.039 1.00 35.91 ? 367 ARG A CD    1 
ATOM   3670 N  NE    . ARG C 3 371 ? -18.633 73.200 223.070 1.00 35.92 ? 367 ARG A NE    1 
ATOM   3671 C  CZ    . ARG C 3 371 ? -19.927 72.995 222.835 1.00 36.90 ? 367 ARG A CZ    1 
ATOM   3672 N  NH1   . ARG C 3 371 ? -20.413 73.131 221.596 1.00 35.18 ? 367 ARG A NH1   1 
ATOM   3673 N  NH2   . ARG C 3 371 ? -20.721 72.633 223.840 1.00 37.25 ? 367 ARG A NH2   1 
ATOM   3674 N  N     . GLU C 3 372 ? -15.125 74.650 226.198 1.00 35.61 ? 368 GLU A N     1 
ATOM   3675 C  CA    . GLU C 3 372 ? -15.450 75.826 226.974 1.00 39.66 ? 368 GLU A CA    1 
ATOM   3676 C  C     . GLU C 3 372 ? -14.230 76.686 227.260 1.00 41.67 ? 368 GLU A C     1 
ATOM   3677 O  O     . GLU C 3 372 ? -14.311 77.914 227.258 1.00 42.62 ? 368 GLU A O     1 
ATOM   3678 C  CB    . GLU C 3 372 ? -16.122 75.415 228.282 1.00 40.45 ? 368 GLU A CB    1 
ATOM   3679 C  CG    . GLU C 3 372 ? -17.577 75.024 228.108 1.00 42.49 ? 368 GLU A CG    1 
ATOM   3680 C  CD    . GLU C 3 372 ? -18.129 74.251 229.285 1.00 44.76 ? 368 GLU A CD    1 
ATOM   3681 O  OE1   . GLU C 3 372 ? -17.894 74.667 230.440 1.00 44.29 ? 368 GLU A OE1   1 
ATOM   3682 O  OE2   . GLU C 3 372 ? -18.809 73.227 229.046 1.00 47.08 ? 368 GLU A OE2   1 
ATOM   3683 N  N     . SER C 3 373 ? -13.096 76.038 227.497 1.00 43.43 ? 369 SER A N     1 
ATOM   3684 C  CA    . SER C 3 373 ? -11.858 76.749 227.795 1.00 44.52 ? 369 SER A CA    1 
ATOM   3685 C  C     . SER C 3 373 ? -11.435 77.676 226.660 1.00 46.83 ? 369 SER A C     1 
ATOM   3686 O  O     . SER C 3 373 ? -10.739 78.665 226.888 1.00 48.10 ? 369 SER A O     1 
ATOM   3687 C  CB    . SER C 3 373 ? -10.730 75.762 228.084 1.00 42.44 ? 369 SER A CB    1 
ATOM   3688 O  OG    . SER C 3 373 ? -10.410 75.018 226.928 1.00 40.33 ? 369 SER A OG    1 
ATOM   3689 N  N     . PHE C 3 374 ? -11.848 77.361 225.439 1.00 48.94 ? 370 PHE A N     1 
ATOM   3690 C  CA    . PHE C 3 374 ? -11.498 78.206 224.308 1.00 52.14 ? 370 PHE A CA    1 
ATOM   3691 C  C     . PHE C 3 374 ? -12.647 79.135 223.955 1.00 54.04 ? 370 PHE A C     1 
ATOM   3692 O  O     . PHE C 3 374 ? -12.665 79.740 222.885 1.00 54.66 ? 370 PHE A O     1 
ATOM   3693 C  CB    . PHE C 3 374 ? -11.134 77.365 223.084 1.00 52.46 ? 370 PHE A CB    1 
ATOM   3694 C  CG    . PHE C 3 374 ? -9.914  76.510 223.277 1.00 54.97 ? 370 PHE A CG    1 
ATOM   3695 C  CD1   . PHE C 3 374 ? -10.015 75.241 223.846 1.00 55.90 ? 370 PHE A CD1   1 
ATOM   3696 C  CD2   . PHE C 3 374 ? -8.658  76.974 222.903 1.00 55.06 ? 370 PHE A CD2   1 
ATOM   3697 C  CE1   . PHE C 3 374 ? -8.883  74.454 224.040 1.00 56.19 ? 370 PHE A CE1   1 
ATOM   3698 C  CE2   . PHE C 3 374 ? -7.523  76.194 223.095 1.00 56.14 ? 370 PHE A CE2   1 
ATOM   3699 C  CZ    . PHE C 3 374 ? -7.636  74.931 223.662 1.00 56.11 ? 370 PHE A CZ    1 
ATOM   3700 N  N     . THR C 3 375 ? -13.606 79.253 224.861 1.00 55.49 ? 371 THR A N     1 
ATOM   3701 C  CA    . THR C 3 375 ? -14.751 80.104 224.613 1.00 58.61 ? 371 THR A CA    1 
ATOM   3702 C  C     . THR C 3 375 ? -14.841 81.191 225.671 1.00 61.01 ? 371 THR A C     1 
ATOM   3703 O  O     . THR C 3 375 ? -14.726 80.913 226.861 1.00 61.65 ? 371 THR A O     1 
ATOM   3704 C  CB    . THR C 3 375 ? -16.038 79.280 224.615 1.00 58.26 ? 371 THR A CB    1 
ATOM   3705 O  OG1   . THR C 3 375 ? -15.895 78.192 223.697 1.00 58.26 ? 371 THR A OG1   1 
ATOM   3706 C  CG2   . THR C 3 375 ? -17.210 80.132 224.180 1.00 59.64 ? 371 THR A CG2   1 
ATOM   3707 N  N     . PRO C 3 376 ? -15.039 82.452 225.249 1.00 63.17 ? 372 PRO A N     1 
ATOM   3708 C  CA    . PRO C 3 376 ? -15.140 83.574 226.193 1.00 64.17 ? 372 PRO A CA    1 
ATOM   3709 C  C     . PRO C 3 376 ? -16.286 83.458 227.204 1.00 64.84 ? 372 PRO A C     1 
ATOM   3710 O  O     . PRO C 3 376 ? -17.279 84.185 227.130 1.00 64.94 ? 372 PRO A O     1 
ATOM   3711 C  CB    . PRO C 3 376 ? -15.296 84.786 225.277 1.00 64.57 ? 372 PRO A CB    1 
ATOM   3712 C  CG    . PRO C 3 376 ? -15.976 84.217 224.064 1.00 64.78 ? 372 PRO A CG    1 
ATOM   3713 C  CD    . PRO C 3 376 ? -15.223 82.916 223.861 1.00 64.17 ? 372 PRO A CD    1 
ATOM   3714 N  N     . GLN C 3 395 ? -9.802  87.378 225.543 1.00 80.97 ? 391 GLN A N     1 
ATOM   3715 C  CA    . GLN C 3 395 ? -8.427  87.539 226.003 1.00 81.39 ? 391 GLN A CA    1 
ATOM   3716 C  C     . GLN C 3 395 ? -7.431  87.189 224.900 1.00 80.79 ? 391 GLN A C     1 
ATOM   3717 O  O     . GLN C 3 395 ? -7.686  87.424 223.719 1.00 81.53 ? 391 GLN A O     1 
ATOM   3718 C  CB    . GLN C 3 395 ? -8.165  86.644 227.222 1.00 83.13 ? 391 GLN A CB    1 
ATOM   3719 C  CG    . GLN C 3 395 ? -8.739  87.151 228.538 1.00 85.49 ? 391 GLN A CG    1 
ATOM   3720 C  CD    . GLN C 3 395 ? -8.416  86.224 229.701 1.00 87.13 ? 391 GLN A CD    1 
ATOM   3721 O  OE1   . GLN C 3 395 ? -8.461  86.624 230.867 1.00 87.79 ? 391 GLN A OE1   1 
ATOM   3722 N  NE2   . GLN C 3 395 ? -8.096  84.971 229.384 1.00 88.20 ? 391 GLN A NE2   1 
ATOM   3723 N  N     . SER C 3 396 ? -6.299  86.616 225.306 1.00 79.59 ? 392 SER A N     1 
ATOM   3724 C  CA    . SER C 3 396 ? -5.236  86.218 224.385 1.00 77.59 ? 392 SER A CA    1 
ATOM   3725 C  C     . SER C 3 396 ? -5.065  84.698 224.381 1.00 76.50 ? 392 SER A C     1 
ATOM   3726 O  O     . SER C 3 396 ? -5.566  84.008 225.265 1.00 76.07 ? 392 SER A O     1 
ATOM   3727 C  CB    . SER C 3 396 ? -3.913  86.864 224.802 1.00 76.70 ? 392 SER A CB    1 
ATOM   3728 O  OG    . SER C 3 396 ? -3.531  86.446 226.102 1.00 74.67 ? 392 SER A OG    1 
ATOM   3729 N  N     . ALA C 3 397 ? -4.351  84.177 223.391 1.00 74.30 ? 393 ALA A N     1 
ATOM   3730 C  CA    . ALA C 3 397 ? -4.135  82.743 223.315 1.00 72.87 ? 393 ALA A CA    1 
ATOM   3731 C  C     . ALA C 3 397 ? -3.121  82.307 224.361 1.00 72.18 ? 393 ALA A C     1 
ATOM   3732 O  O     . ALA C 3 397 ? -3.248  81.234 224.948 1.00 72.65 ? 393 ALA A O     1 
ATOM   3733 C  CB    . ALA C 3 397 ? -3.654  82.356 221.929 1.00 72.62 ? 393 ALA A CB    1 
ATOM   3734 N  N     . GLU C 3 398 ? -2.121  83.147 224.603 1.00 71.32 ? 394 GLU A N     1 
ATOM   3735 C  CA    . GLU C 3 398 ? -1.075  82.834 225.571 1.00 70.70 ? 394 GLU A CA    1 
ATOM   3736 C  C     . GLU C 3 398 ? -1.631  82.450 226.942 1.00 70.40 ? 394 GLU A C     1 
ATOM   3737 O  O     . GLU C 3 398 ? -0.921  81.877 227.769 1.00 70.47 ? 394 GLU A O     1 
ATOM   3738 C  CB    . GLU C 3 398 ? -0.120  84.019 225.700 1.00 70.75 ? 394 GLU A CB    1 
ATOM   3739 N  N     . THR C 3 399 ? -2.905  82.755 227.172 1.00 70.33 ? 395 THR A N     1 
ATOM   3740 C  CA    . THR C 3 399 ? -3.562  82.454 228.445 1.00 70.13 ? 395 THR A CA    1 
ATOM   3741 C  C     . THR C 3 399 ? -3.794  80.957 228.680 1.00 68.96 ? 395 THR A C     1 
ATOM   3742 O  O     . THR C 3 399 ? -3.582  80.451 229.785 1.00 69.12 ? 395 THR A O     1 
ATOM   3743 C  CB    . THR C 3 399 ? -4.918  83.198 228.550 1.00 70.90 ? 395 THR A CB    1 
ATOM   3744 O  OG1   . THR C 3 399 ? -5.687  82.960 227.364 1.00 71.61 ? 395 THR A OG1   1 
ATOM   3745 C  CG2   . THR C 3 399 ? -4.696  84.696 228.708 1.00 71.55 ? 395 THR A CG2   1 
ATOM   3746 N  N     . VAL C 3 400 ? -4.226  80.250 227.639 1.00 67.70 ? 396 VAL A N     1 
ATOM   3747 C  CA    . VAL C 3 400 ? -4.493  78.815 227.739 1.00 65.53 ? 396 VAL A CA    1 
ATOM   3748 C  C     . VAL C 3 400 ? -3.433  77.992 226.989 1.00 63.19 ? 396 VAL A C     1 
ATOM   3749 O  O     . VAL C 3 400 ? -3.003  76.940 227.466 1.00 60.89 ? 396 VAL A O     1 
ATOM   3750 C  CB    . VAL C 3 400 ? -5.922  78.493 227.190 1.00 65.88 ? 396 VAL A CB    1 
ATOM   3751 C  CG1   . VAL C 3 400 ? -6.032  78.912 225.734 1.00 66.11 ? 396 VAL A CG1   1 
ATOM   3752 C  CG2   . VAL C 3 400 ? -6.234  77.010 227.348 1.00 66.74 ? 396 VAL A CG2   1 
ATOM   3753 N  N     . LEU C 3 401 ? -3.014  78.495 225.826 1.00 61.57 ? 397 LEU A N     1 
ATOM   3754 C  CA    . LEU C 3 401 ? -2.011  77.839 224.984 1.00 60.91 ? 397 LEU A CA    1 
ATOM   3755 C  C     . LEU C 3 401 ? -0.581  78.173 225.397 1.00 60.41 ? 397 LEU A C     1 
ATOM   3756 O  O     . LEU C 3 401 ? -0.303  79.258 225.907 1.00 61.20 ? 397 LEU A O     1 
ATOM   3757 C  CB    . LEU C 3 401 ? -2.198  78.251 223.524 1.00 60.11 ? 397 LEU A CB    1 
ATOM   3758 C  CG    . LEU C 3 401 ? -3.498  77.827 222.854 1.00 59.93 ? 397 LEU A CG    1 
ATOM   3759 C  CD1   . LEU C 3 401 ? -3.591  78.446 221.464 1.00 60.06 ? 397 LEU A CD1   1 
ATOM   3760 C  CD2   . LEU C 3 401 ? -3.535  76.317 222.776 1.00 59.17 ? 397 LEU A CD2   1 
ATOM   3761 N  N     . THR C 3 402 ? 0.332   77.239 225.173 1.00 58.86 ? 398 THR A N     1 
ATOM   3762 C  CA    . THR C 3 402 ? 1.721   77.480 225.516 1.00 58.03 ? 398 THR A CA    1 
ATOM   3763 C  C     . THR C 3 402 ? 2.345   78.188 224.318 1.00 57.89 ? 398 THR A C     1 
ATOM   3764 O  O     . THR C 3 402 ? 1.827   78.105 223.202 1.00 57.42 ? 398 THR A O     1 
ATOM   3765 C  CB    . THR C 3 402 ? 2.465   76.180 225.745 1.00 56.82 ? 398 THR A CB    1 
ATOM   3766 O  OG1   . THR C 3 402 ? 2.854   75.633 224.481 1.00 58.81 ? 398 THR A OG1   1 
ATOM   3767 C  CG2   . THR C 3 402 ? 1.575   75.189 226.455 1.00 55.52 ? 398 THR A CG2   1 
ATOM   3768 N  N     . PRO C 3 403 ? 3.468   78.890 224.531 1.00 57.95 ? 399 PRO A N     1 
ATOM   3769 C  CA    . PRO C 3 403 ? 4.123   79.601 223.429 1.00 57.90 ? 399 PRO A CA    1 
ATOM   3770 C  C     . PRO C 3 403 ? 4.461   78.687 222.256 1.00 56.97 ? 399 PRO A C     1 
ATOM   3771 O  O     . PRO C 3 403 ? 4.363   79.081 221.093 1.00 56.25 ? 399 PRO A O     1 
ATOM   3772 C  CB    . PRO C 3 403 ? 5.360   80.207 224.094 1.00 57.21 ? 399 PRO A CB    1 
ATOM   3773 C  CG    . PRO C 3 403 ? 5.649   79.258 225.210 1.00 57.64 ? 399 PRO A CG    1 
ATOM   3774 C  CD    . PRO C 3 403 ? 4.285   78.951 225.756 1.00 58.21 ? 399 PRO A CD    1 
ATOM   3775 N  N     . ASP C 3 404 ? 4.846   77.456 222.564 1.00 56.92 ? 400 ASP A N     1 
ATOM   3776 C  CA    . ASP C 3 404 ? 5.191   76.500 221.522 1.00 56.29 ? 400 ASP A CA    1 
ATOM   3777 C  C     . ASP C 3 404 ? 4.007   76.147 220.639 1.00 54.85 ? 400 ASP A C     1 
ATOM   3778 O  O     . ASP C 3 404 ? 4.050   76.360 219.423 1.00 54.11 ? 400 ASP A O     1 
ATOM   3779 C  CB    . ASP C 3 404 ? 5.764   75.240 222.147 1.00 58.56 ? 400 ASP A CB    1 
ATOM   3780 C  CG    . ASP C 3 404 ? 7.218   75.064 221.828 1.00 61.45 ? 400 ASP A CG    1 
ATOM   3781 O  OD1   . ASP C 3 404 ? 7.528   74.894 220.626 1.00 63.16 ? 400 ASP A OD1   1 
ATOM   3782 O  OD2   . ASP C 3 404 ? 8.045   75.107 222.769 1.00 63.67 ? 400 ASP A OD2   1 
ATOM   3783 N  N     . GLU C 3 405 ? 2.954   75.602 221.246 1.00 52.98 ? 401 GLU A N     1 
ATOM   3784 C  CA    . GLU C 3 405 ? 1.767   75.238 220.485 1.00 51.94 ? 401 GLU A CA    1 
ATOM   3785 C  C     . GLU C 3 405 ? 1.081   76.478 219.889 1.00 51.19 ? 401 GLU A C     1 
ATOM   3786 O  O     . GLU C 3 405 ? 0.594   76.443 218.752 1.00 50.74 ? 401 GLU A O     1 
ATOM   3787 C  CB    . GLU C 3 405 ? 0.799   74.397 221.351 1.00 50.64 ? 401 GLU A CB    1 
ATOM   3788 C  CG    . GLU C 3 405 ? 0.541   74.919 222.750 1.00 51.20 ? 401 GLU A CG    1 
ATOM   3789 C  CD    . GLU C 3 405 ? -0.214  73.925 223.667 1.00 50.82 ? 401 GLU A CD    1 
ATOM   3790 O  OE1   . GLU C 3 405 ? 0.276   72.806 223.934 1.00 50.96 ? 401 GLU A OE1   1 
ATOM   3791 O  OE2   . GLU C 3 405 ? -1.307  74.273 224.142 1.00 51.60 ? 401 GLU A OE2   1 
ATOM   3792 N  N     . CYS C 3 406 ? 1.074   77.585 220.629 1.00 50.59 ? 402 CYS A N     1 
ATOM   3793 C  CA    . CYS C 3 406 ? 0.459   78.822 220.127 1.00 49.92 ? 402 CYS A CA    1 
ATOM   3794 C  C     . CYS C 3 406 ? 1.103   79.256 218.816 1.00 49.69 ? 402 CYS A C     1 
ATOM   3795 O  O     . CYS C 3 406 ? 0.441   79.792 217.921 1.00 49.87 ? 402 CYS A O     1 
ATOM   3796 C  CB    . CYS C 3 406 ? 0.605   79.967 221.134 1.00 49.43 ? 402 CYS A CB    1 
ATOM   3797 S  SG    . CYS C 3 406 ? -0.021  81.551 220.495 1.00 48.58 ? 402 CYS A SG    1 
ATOM   3798 N  N     . GLN C 3 407 ? 2.408   79.031 218.727 1.00 49.02 ? 403 GLN A N     1 
ATOM   3799 C  CA    . GLN C 3 407 ? 3.178   79.374 217.547 1.00 47.23 ? 403 GLN A CA    1 
ATOM   3800 C  C     . GLN C 3 407 ? 2.800   78.406 216.435 1.00 46.21 ? 403 GLN A C     1 
ATOM   3801 O  O     . GLN C 3 407 ? 2.515   78.819 215.314 1.00 46.13 ? 403 GLN A O     1 
ATOM   3802 C  CB    . GLN C 3 407 ? 4.672   79.264 217.869 1.00 48.58 ? 403 GLN A CB    1 
ATOM   3803 C  CG    . GLN C 3 407 ? 5.613   79.556 216.705 1.00 48.41 ? 403 GLN A CG    1 
ATOM   3804 C  CD    . GLN C 3 407 ? 7.071   79.231 217.031 1.00 49.20 ? 403 GLN A CD    1 
ATOM   3805 O  OE1   . GLN C 3 407 ? 7.950   79.328 216.167 1.00 50.10 ? 403 GLN A OE1   1 
ATOM   3806 N  NE2   . GLN C 3 407 ? 7.332   78.840 218.281 1.00 47.09 ? 403 GLN A NE2   1 
ATOM   3807 N  N     . LEU C 3 408 ? 2.785   77.114 216.752 1.00 44.63 ? 404 LEU A N     1 
ATOM   3808 C  CA    . LEU C 3 408 ? 2.442   76.101 215.758 1.00 42.98 ? 404 LEU A CA    1 
ATOM   3809 C  C     . LEU C 3 408 ? 1.037   76.324 215.207 1.00 42.12 ? 404 LEU A C     1 
ATOM   3810 O  O     . LEU C 3 408 ? 0.820   76.280 213.993 1.00 40.99 ? 404 LEU A O     1 
ATOM   3811 C  CB    . LEU C 3 408 ? 2.549   74.704 216.365 1.00 41.95 ? 404 LEU A CB    1 
ATOM   3812 C  CG    . LEU C 3 408 ? 2.220   73.532 215.444 1.00 41.02 ? 404 LEU A CG    1 
ATOM   3813 C  CD1   . LEU C 3 408 ? 2.812   73.727 214.068 1.00 41.00 ? 404 LEU A CD1   1 
ATOM   3814 C  CD2   . LEU C 3 408 ? 2.739   72.260 216.094 1.00 42.62 ? 404 LEU A CD2   1 
ATOM   3815 N  N     . LEU C 3 409 ? 0.080   76.559 216.098 1.00 40.47 ? 405 LEU A N     1 
ATOM   3816 C  CA    . LEU C 3 409 ? -1.282  76.800 215.656 1.00 40.50 ? 405 LEU A CA    1 
ATOM   3817 C  C     . LEU C 3 409 ? -1.271  77.958 214.664 1.00 40.87 ? 405 LEU A C     1 
ATOM   3818 O  O     . LEU C 3 409 ? -1.928  77.898 213.623 1.00 41.28 ? 405 LEU A O     1 
ATOM   3819 C  CB    . LEU C 3 409 ? -2.182  77.134 216.846 1.00 39.51 ? 405 LEU A CB    1 
ATOM   3820 C  CG    . LEU C 3 409 ? -3.614  77.571 216.516 1.00 36.98 ? 405 LEU A CG    1 
ATOM   3821 C  CD1   . LEU C 3 409 ? -4.297  76.539 215.647 1.00 36.99 ? 405 LEU A CD1   1 
ATOM   3822 C  CD2   . LEU C 3 409 ? -4.352  77.790 217.798 1.00 35.43 ? 405 LEU A CD2   1 
ATOM   3823 N  N     . GLY C 3 410 ? -0.519  79.007 214.992 1.00 40.52 ? 406 GLY A N     1 
ATOM   3824 C  CA    . GLY C 3 410 ? -0.417  80.150 214.104 1.00 40.09 ? 406 GLY A CA    1 
ATOM   3825 C  C     . GLY C 3 410 ? 0.162   79.764 212.753 1.00 40.81 ? 406 GLY A C     1 
ATOM   3826 O  O     . GLY C 3 410 ? -0.283  80.249 211.711 1.00 40.05 ? 406 GLY A O     1 
ATOM   3827 N  N     . TYR C 3 411 ? 1.164   78.894 212.759 1.00 41.61 ? 407 TYR A N     1 
ATOM   3828 C  CA    . TYR C 3 411 ? 1.771   78.461 211.510 1.00 43.58 ? 407 TYR A CA    1 
ATOM   3829 C  C     . TYR C 3 411 ? 0.709   77.731 210.713 1.00 44.42 ? 407 TYR A C     1 
ATOM   3830 O  O     . TYR C 3 411 ? 0.429   78.079 209.570 1.00 45.63 ? 407 TYR A O     1 
ATOM   3831 C  CB    . TYR C 3 411 ? 2.945   77.519 211.785 1.00 46.55 ? 407 TYR A CB    1 
ATOM   3832 C  CG    . TYR C 3 411 ? 3.623   76.980 210.545 1.00 49.55 ? 407 TYR A CG    1 
ATOM   3833 C  CD1   . TYR C 3 411 ? 4.886   77.423 210.168 1.00 51.28 ? 407 TYR A CD1   1 
ATOM   3834 C  CD2   . TYR C 3 411 ? 3.008   76.013 209.757 1.00 51.38 ? 407 TYR A CD2   1 
ATOM   3835 C  CE1   . TYR C 3 411 ? 5.524   76.907 209.042 1.00 52.88 ? 407 TYR A CE1   1 
ATOM   3836 C  CE2   . TYR C 3 411 ? 3.632   75.493 208.632 1.00 52.23 ? 407 TYR A CE2   1 
ATOM   3837 C  CZ    . TYR C 3 411 ? 4.888   75.939 208.279 1.00 53.32 ? 407 TYR A CZ    1 
ATOM   3838 O  OH    . TYR C 3 411 ? 5.522   75.397 207.182 1.00 54.29 ? 407 TYR A OH    1 
ATOM   3839 N  N     . LEU C 3 412 ? 0.112   76.717 211.333 1.00 44.39 ? 408 LEU A N     1 
ATOM   3840 C  CA    . LEU C 3 412 ? -0.916  75.906 210.682 1.00 43.69 ? 408 LEU A CA    1 
ATOM   3841 C  C     . LEU C 3 412 ? -2.123  76.700 210.203 1.00 44.78 ? 408 LEU A C     1 
ATOM   3842 O  O     . LEU C 3 412 ? -2.640  76.451 209.119 1.00 44.48 ? 408 LEU A O     1 
ATOM   3843 C  CB    . LEU C 3 412 ? -1.372  74.790 211.630 1.00 40.39 ? 408 LEU A CB    1 
ATOM   3844 C  CG    . LEU C 3 412 ? -0.370  73.653 211.809 1.00 37.53 ? 408 LEU A CG    1 
ATOM   3845 C  CD1   . LEU C 3 412 ? -0.659  72.909 213.071 1.00 35.47 ? 408 LEU A CD1   1 
ATOM   3846 C  CD2   . LEU C 3 412 ? -0.420  72.746 210.594 1.00 37.31 ? 408 LEU A CD2   1 
ATOM   3847 N  N     . ASP C 3 413 ? -2.558  77.661 211.010 1.00 47.15 ? 409 ASP A N     1 
ATOM   3848 C  CA    . ASP C 3 413 ? -3.720  78.472 210.679 1.00 50.71 ? 409 ASP A CA    1 
ATOM   3849 C  C     . ASP C 3 413 ? -3.392  79.638 209.761 1.00 53.56 ? 409 ASP A C     1 
ATOM   3850 O  O     . ASP C 3 413 ? -4.235  80.503 209.522 1.00 54.24 ? 409 ASP A O     1 
ATOM   3851 C  CB    . ASP C 3 413 ? -4.349  79.009 211.960 1.00 51.10 ? 409 ASP A CB    1 
ATOM   3852 C  CG    . ASP C 3 413 ? -5.799  79.375 211.781 1.00 53.21 ? 409 ASP A CG    1 
ATOM   3853 O  OD1   . ASP C 3 413 ? -6.560  78.495 211.310 1.00 53.67 ? 409 ASP A OD1   1 
ATOM   3854 O  OD2   . ASP C 3 413 ? -6.173  80.532 212.110 1.00 53.07 ? 409 ASP A OD2   1 
ATOM   3855 N  N     . LYS C 3 414 ? -2.173  79.661 209.237 1.00 57.35 ? 410 LYS A N     1 
ATOM   3856 C  CA    . LYS C 3 414 ? -1.764  80.751 208.367 1.00 60.90 ? 410 LYS A CA    1 
ATOM   3857 C  C     . LYS C 3 414 ? -2.666  80.916 207.150 1.00 61.99 ? 410 LYS A C     1 
ATOM   3858 O  O     . LYS C 3 414 ? -2.882  79.978 206.382 1.00 61.61 ? 410 LYS A O     1 
ATOM   3859 C  CB    . LYS C 3 414 ? -0.309  80.562 207.920 1.00 62.39 ? 410 LYS A CB    1 
ATOM   3860 C  CG    . LYS C 3 414 ? 0.152   81.554 206.852 1.00 63.77 ? 410 LYS A CG    1 
ATOM   3861 C  CD    . LYS C 3 414 ? 1.650   81.465 206.546 1.00 65.34 ? 410 LYS A CD    1 
ATOM   3862 C  CE    . LYS C 3 414 ? 2.103   80.064 206.099 1.00 65.53 ? 410 LYS A CE    1 
ATOM   3863 N  NZ    . LYS C 3 414 ? 2.352   79.115 207.242 1.00 64.84 ? 410 LYS A NZ    1 
ATOM   3864 N  N     . GLY C 3 415 ? -3.193  82.127 206.994 1.00 63.89 ? 411 GLY A N     1 
ATOM   3865 C  CA    . GLY C 3 415 ? -4.056  82.436 205.870 1.00 66.05 ? 411 GLY A CA    1 
ATOM   3866 C  C     . GLY C 3 415 ? -5.391  81.735 205.905 1.00 67.89 ? 411 GLY A C     1 
ATOM   3867 O  O     . GLY C 3 415 ? -5.807  81.152 204.905 1.00 68.61 ? 411 GLY A O     1 
ATOM   3868 N  N     . LYS C 3 416 ? -6.061  81.791 207.054 1.00 69.48 ? 412 LYS A N     1 
ATOM   3869 C  CA    . LYS C 3 416 ? -7.368  81.162 207.216 1.00 69.96 ? 412 LYS A CA    1 
ATOM   3870 C  C     . LYS C 3 416 ? -8.253  81.893 208.212 1.00 70.97 ? 412 LYS A C     1 
ATOM   3871 O  O     . LYS C 3 416 ? -9.437  81.582 208.322 1.00 71.16 ? 412 LYS A O     1 
ATOM   3872 C  CB    . LYS C 3 416 ? -7.215  79.699 207.654 1.00 69.42 ? 412 LYS A CB    1 
ATOM   3873 C  CG    . LYS C 3 416 ? -6.899  78.736 206.517 1.00 68.67 ? 412 LYS A CG    1 
ATOM   3874 C  CD    . LYS C 3 416 ? -6.864  77.301 206.999 1.00 68.56 ? 412 LYS A CD    1 
ATOM   3875 C  CE    . LYS C 3 416 ? -6.540  76.355 205.864 1.00 68.44 ? 412 LYS A CE    1 
ATOM   3876 N  NZ    . LYS C 3 416 ? -6.386  74.962 206.360 1.00 70.35 ? 412 LYS A NZ    1 
ATOM   3877 N  N     . ARG C 3 417 ? -7.692  82.864 208.930 1.00 71.90 ? 413 ARG A N     1 
ATOM   3878 C  CA    . ARG C 3 417 ? -8.481  83.597 209.915 1.00 73.79 ? 413 ARG A CA    1 
ATOM   3879 C  C     . ARG C 3 417 ? -9.248  84.760 209.305 1.00 74.72 ? 413 ARG A C     1 
ATOM   3880 O  O     . ARG C 3 417 ? -8.780  85.396 208.364 1.00 75.29 ? 413 ARG A O     1 
ATOM   3881 C  CB    . ARG C 3 417 ? -7.595  84.114 211.057 1.00 74.05 ? 413 ARG A CB    1 
ATOM   3882 C  CG    . ARG C 3 417 ? -6.841  85.398 210.769 1.00 74.36 ? 413 ARG A CG    1 
ATOM   3883 C  CD    . ARG C 3 417 ? -6.087  85.883 212.006 1.00 74.68 ? 413 ARG A CD    1 
ATOM   3884 N  NE    . ARG C 3 417 ? -5.442  87.181 211.786 1.00 76.07 ? 413 ARG A NE    1 
ATOM   3885 C  CZ    . ARG C 3 417 ? -6.097  88.330 211.618 1.00 76.09 ? 413 ARG A CZ    1 
ATOM   3886 N  NH1   . ARG C 3 417 ? -7.422  88.349 211.649 1.00 77.19 ? 413 ARG A NH1   1 
ATOM   3887 N  NH2   . ARG C 3 417 ? -5.431  89.459 211.412 1.00 75.42 ? 413 ARG A NH2   1 
ATOM   3888 N  N     . LYS C 3 418 ? -10.434 85.032 209.841 1.00 75.54 ? 414 LYS A N     1 
ATOM   3889 C  CA    . LYS C 3 418 ? -11.247 86.132 209.345 1.00 76.28 ? 414 LYS A CA    1 
ATOM   3890 C  C     . LYS C 3 418 ? -10.857 87.386 210.107 1.00 76.79 ? 414 LYS A C     1 
ATOM   3891 O  O     . LYS C 3 418 ? -10.470 87.315 211.275 1.00 76.31 ? 414 LYS A O     1 
ATOM   3892 C  CB    . LYS C 3 418 ? -12.738 85.860 209.555 1.00 76.33 ? 414 LYS A CB    1 
ATOM   3893 C  CG    . LYS C 3 418 ? -13.068 84.437 209.948 1.00 76.46 ? 414 LYS A CG    1 
ATOM   3894 C  CD    . LYS C 3 418 ? -12.691 83.438 208.878 1.00 76.02 ? 414 LYS A CD    1 
ATOM   3895 C  CE    . LYS C 3 418 ? -13.597 83.545 207.680 1.00 75.74 ? 414 LYS A CE    1 
ATOM   3896 N  NZ    . LYS C 3 418 ? -13.318 82.436 206.733 1.00 75.92 ? 414 LYS A NZ    1 
ATOM   3897 N  N     . ARG C 3 419 ? -10.961 88.532 209.436 1.00 77.86 ? 415 ARG A N     1 
ATOM   3898 C  CA    . ARG C 3 419 ? -10.622 89.824 210.030 1.00 78.31 ? 415 ARG A CA    1 
ATOM   3899 C  C     . ARG C 3 419 ? -11.462 90.027 211.287 1.00 77.24 ? 415 ARG A C     1 
ATOM   3900 O  O     . ARG C 3 419 ? -11.188 90.917 212.086 1.00 77.71 ? 415 ARG A O     1 
ATOM   3901 C  CB    . ARG C 3 419 ? -10.882 90.950 209.013 1.00 80.40 ? 415 ARG A CB    1 
ATOM   3902 C  CG    . ARG C 3 419 ? -10.328 92.333 209.391 1.00 83.73 ? 415 ARG A CG    1 
ATOM   3903 C  CD    . ARG C 3 419 ? -10.162 93.232 208.150 1.00 85.62 ? 415 ARG A CD    1 
ATOM   3904 N  NE    . ARG C 3 419 ? -9.651  94.568 208.467 1.00 87.24 ? 415 ARG A NE    1 
ATOM   3905 C  CZ    . ARG C 3 419 ? -10.390 95.564 208.952 1.00 88.00 ? 415 ARG A CZ    1 
ATOM   3906 N  NH1   . ARG C 3 419 ? -11.683 95.380 209.175 1.00 88.57 ? 415 ARG A NH1   1 
ATOM   3907 N  NH2   . ARG C 3 419 ? -9.838  96.743 209.218 1.00 87.46 ? 415 ARG A NH2   1 
ATOM   3908 N  N     . LYS C 3 420 ? -12.474 89.182 211.461 1.00 75.76 ? 416 LYS A N     1 
ATOM   3909 C  CA    . LYS C 3 420 ? -13.359 89.261 212.617 1.00 73.58 ? 416 LYS A CA    1 
ATOM   3910 C  C     . LYS C 3 420 ? -12.627 88.932 213.911 1.00 71.78 ? 416 LYS A C     1 
ATOM   3911 O  O     . LYS C 3 420 ? -13.000 89.407 214.980 1.00 71.27 ? 416 LYS A O     1 
ATOM   3912 C  CB    . LYS C 3 420 ? -14.554 88.313 212.431 1.00 74.33 ? 416 LYS A CB    1 
ATOM   3913 C  CG    . LYS C 3 420 ? -15.507 88.236 213.628 1.00 74.26 ? 416 LYS A CG    1 
ATOM   3914 C  CD    . LYS C 3 420 ? -16.852 87.608 213.255 1.00 74.90 ? 416 LYS A CD    1 
ATOM   3915 C  CE    . LYS C 3 420 ? -16.696 86.218 212.653 1.00 75.90 ? 416 LYS A CE    1 
ATOM   3916 N  NZ    . LYS C 3 420 ? -17.993 85.616 212.211 1.00 75.60 ? 416 LYS A NZ    1 
ATOM   3917 N  N     . GLU C 3 421 ? -11.584 88.118 213.812 1.00 70.68 ? 417 GLU A N     1 
ATOM   3918 C  CA    . GLU C 3 421 ? -10.812 87.729 214.987 1.00 69.77 ? 417 GLU A CA    1 
ATOM   3919 C  C     . GLU C 3 421 ? -9.452  88.413 215.047 1.00 69.30 ? 417 GLU A C     1 
ATOM   3920 O  O     . GLU C 3 421 ? -8.815  88.651 214.020 1.00 68.73 ? 417 GLU A O     1 
ATOM   3921 C  CB    . GLU C 3 421 ? -10.647 86.205 215.022 1.00 70.05 ? 417 GLU A CB    1 
ATOM   3922 C  CG    . GLU C 3 421 ? -10.529 85.551 213.648 1.00 70.71 ? 417 GLU A CG    1 
ATOM   3923 C  CD    . GLU C 3 421 ? -10.549 84.025 213.702 1.00 71.01 ? 417 GLU A CD    1 
ATOM   3924 O  OE1   . GLU C 3 421 ? -10.542 83.392 212.620 1.00 69.35 ? 417 GLU A OE1   1 
ATOM   3925 O  OE2   . GLU C 3 421 ? -10.569 83.460 214.822 1.00 71.44 ? 417 GLU A OE2   1 
ATOM   3926 N  N     . LYS C 3 422 ? -9.018  88.737 216.261 1.00 68.49 ? 418 LYS A N     1 
ATOM   3927 C  CA    . LYS C 3 422 ? -7.740  89.400 216.462 1.00 68.73 ? 418 LYS A CA    1 
ATOM   3928 C  C     . LYS C 3 422 ? -6.588  88.600 215.871 1.00 69.00 ? 418 LYS A C     1 
ATOM   3929 O  O     . LYS C 3 422 ? -6.796  87.585 215.207 1.00 70.47 ? 418 LYS A O     1 
ATOM   3930 C  CB    . LYS C 3 422 ? -7.495  89.635 217.942 1.00 67.83 ? 418 LYS A CB    1 
ATOM   3931 N  N     . ALA C 3 423 ? -5.371  89.082 216.113 1.00 68.38 ? 419 ALA A N     1 
ATOM   3932 C  CA    . ALA C 3 423 ? -4.155  88.446 215.621 1.00 65.83 ? 419 ALA A CA    1 
ATOM   3933 C  C     . ALA C 3 423 ? -3.865  87.151 216.370 1.00 64.03 ? 419 ALA A C     1 
ATOM   3934 O  O     . ALA C 3 423 ? -3.696  86.095 215.758 1.00 64.48 ? 419 ALA A O     1 
ATOM   3935 C  CB    . ALA C 3 423 ? -2.989  89.399 215.769 1.00 67.35 ? 419 ALA A CB    1 
ATOM   3936 N  N     . GLY C 3 424 ? -3.808  87.237 217.694 1.00 60.00 ? 420 GLY A N     1 
ATOM   3937 C  CA    . GLY C 3 424 ? -3.525  86.060 218.489 1.00 57.65 ? 420 GLY A CA    1 
ATOM   3938 C  C     . GLY C 3 424 ? -4.374  85.991 219.738 1.00 55.96 ? 420 GLY A C     1 
ATOM   3939 O  O     . GLY C 3 424 ? -3.876  85.729 220.832 1.00 54.77 ? 420 GLY A O     1 
ATOM   3940 N  N     . SER C 3 425 ? -5.670  86.216 219.566 1.00 55.00 ? 421 SER A N     1 
ATOM   3941 C  CA    . SER C 3 425 ? -6.615  86.201 220.676 1.00 53.98 ? 421 SER A CA    1 
ATOM   3942 C  C     . SER C 3 425 ? -7.173  84.823 220.995 1.00 53.71 ? 421 SER A C     1 
ATOM   3943 O  O     . SER C 3 425 ? -7.071  83.897 220.186 1.00 53.64 ? 421 SER A O     1 
ATOM   3944 C  CB    . SER C 3 425 ? -7.774  87.128 220.356 1.00 54.15 ? 421 SER A CB    1 
ATOM   3945 O  OG    . SER C 3 425 ? -8.213  86.882 219.033 1.00 54.45 ? 421 SER A OG    1 
ATOM   3946 N  N     . LEU C 3 426 ? -7.772  84.708 222.181 1.00 52.01 ? 422 LEU A N     1 
ATOM   3947 C  CA    . LEU C 3 426 ? -8.392  83.469 222.642 1.00 50.10 ? 422 LEU A CA    1 
ATOM   3948 C  C     . LEU C 3 426 ? -9.605  83.166 221.765 1.00 50.03 ? 422 LEU A C     1 
ATOM   3949 O  O     . LEU C 3 426 ? -10.198 82.101 221.881 1.00 50.17 ? 422 LEU A O     1 
ATOM   3950 C  CB    . LEU C 3 426 ? -8.847  83.602 224.102 1.00 49.48 ? 422 LEU A CB    1 
ATOM   3951 C  CG    . LEU C 3 426 ? -9.428  82.333 224.745 1.00 49.47 ? 422 LEU A CG    1 
ATOM   3952 C  CD1   . LEU C 3 426 ? -8.348  81.267 224.766 1.00 50.92 ? 422 LEU A CD1   1 
ATOM   3953 C  CD2   . LEU C 3 426 ? -9.913  82.615 226.170 1.00 48.36 ? 422 LEU A CD2   1 
ATOM   3954 N  N     . GLN C 3 427 ? -9.960  84.100 220.883 1.00 49.88 ? 423 GLN A N     1 
ATOM   3955 C  CA    . GLN C 3 427 ? -11.092 83.937 219.972 1.00 49.12 ? 423 GLN A CA    1 
ATOM   3956 C  C     . GLN C 3 427 ? -10.574 83.360 218.663 1.00 47.45 ? 423 GLN A C     1 
ATOM   3957 O  O     . GLN C 3 427 ? -11.289 82.674 217.941 1.00 49.12 ? 423 GLN A O     1 
ATOM   3958 C  CB    . GLN C 3 427 ? -11.750 85.289 219.693 1.00 51.77 ? 423 GLN A CB    1 
ATOM   3959 C  CG    . GLN C 3 427 ? -13.261 85.299 219.837 1.00 55.32 ? 423 GLN A CG    1 
ATOM   3960 C  CD    . GLN C 3 427 ? -13.979 84.448 218.797 1.00 57.49 ? 423 GLN A CD    1 
ATOM   3961 O  OE1   . GLN C 3 427 ? -13.940 84.735 217.594 1.00 58.41 ? 423 GLN A OE1   1 
ATOM   3962 N  NE2   . GLN C 3 427 ? -14.645 83.395 219.260 1.00 56.40 ? 423 GLN A NE2   1 
ATOM   3963 N  N     . TRP C 3 428 ? -9.316  83.649 218.366 1.00 44.94 ? 424 TRP A N     1 
ATOM   3964 C  CA    . TRP C 3 428 ? -8.678  83.168 217.153 1.00 41.49 ? 424 TRP A CA    1 
ATOM   3965 C  C     . TRP C 3 428 ? -8.337  81.684 217.293 1.00 41.62 ? 424 TRP A C     1 
ATOM   3966 O  O     . TRP C 3 428 ? -8.645  80.873 216.415 1.00 40.95 ? 424 TRP A O     1 
ATOM   3967 C  CB    . TRP C 3 428 ? -7.401  83.969 216.895 1.00 37.62 ? 424 TRP A CB    1 
ATOM   3968 C  CG    . TRP C 3 428 ? -6.473  83.291 215.980 1.00 30.00 ? 424 TRP A CG    1 
ATOM   3969 C  CD1   . TRP C 3 428 ? -6.623  83.129 214.635 1.00 29.29 ? 424 TRP A CD1   1 
ATOM   3970 C  CD2   . TRP C 3 428 ? -5.303  82.563 216.354 1.00 26.38 ? 424 TRP A CD2   1 
ATOM   3971 N  NE1   . TRP C 3 428 ? -5.619  82.330 214.143 1.00 28.16 ? 424 TRP A NE1   1 
ATOM   3972 C  CE2   . TRP C 3 428 ? -4.796  81.970 215.177 1.00 25.85 ? 424 TRP A CE2   1 
ATOM   3973 C  CE3   . TRP C 3 428 ? -4.639  82.349 217.569 1.00 23.59 ? 424 TRP A CE3   1 
ATOM   3974 C  CZ2   . TRP C 3 428 ? -3.648  81.172 215.184 1.00 23.48 ? 424 TRP A CZ2   1 
ATOM   3975 C  CZ3   . TRP C 3 428 ? -3.500  81.554 217.573 1.00 21.55 ? 424 TRP A CZ3   1 
ATOM   3976 C  CH2   . TRP C 3 428 ? -3.017  80.976 216.387 1.00 22.31 ? 424 TRP A CH2   1 
ATOM   3977 N  N     . ALA C 3 429 ? -7.688  81.346 218.402 1.00 41.05 ? 425 ALA A N     1 
ATOM   3978 C  CA    . ALA C 3 429 ? -7.310  79.969 218.694 1.00 41.22 ? 425 ALA A CA    1 
ATOM   3979 C  C     . ALA C 3 429 ? -8.537  79.072 218.573 1.00 42.20 ? 425 ALA A C     1 
ATOM   3980 O  O     . ALA C 3 429 ? -8.465  77.948 218.073 1.00 43.61 ? 425 ALA A O     1 
ATOM   3981 C  CB    . ALA C 3 429 ? -6.735  79.878 220.106 1.00 38.99 ? 425 ALA A CB    1 
ATOM   3982 N  N     . TYR C 3 430 ? -9.668  79.572 219.048 1.00 42.58 ? 426 TYR A N     1 
ATOM   3983 C  CA    . TYR C 3 430 ? -10.904 78.819 218.967 1.00 42.28 ? 426 TYR A CA    1 
ATOM   3984 C  C     . TYR C 3 430 ? -11.154 78.419 217.512 1.00 42.00 ? 426 TYR A C     1 
ATOM   3985 O  O     . TYR C 3 430 ? -11.229 77.241 217.189 1.00 43.44 ? 426 TYR A O     1 
ATOM   3986 C  CB    . TYR C 3 430 ? -12.065 79.668 219.460 1.00 42.49 ? 426 TYR A CB    1 
ATOM   3987 C  CG    . TYR C 3 430 ? -13.398 78.979 219.365 1.00 43.07 ? 426 TYR A CG    1 
ATOM   3988 C  CD1   . TYR C 3 430 ? -13.955 78.362 220.472 1.00 43.98 ? 426 TYR A CD1   1 
ATOM   3989 C  CD2   . TYR C 3 430 ? -14.121 78.983 218.178 1.00 43.59 ? 426 TYR A CD2   1 
ATOM   3990 C  CE1   . TYR C 3 430 ? -15.202 77.780 220.412 1.00 44.62 ? 426 TYR A CE1   1 
ATOM   3991 C  CE2   . TYR C 3 430 ? -15.372 78.400 218.101 1.00 44.13 ? 426 TYR A CE2   1 
ATOM   3992 C  CZ    . TYR C 3 430 ? -15.909 77.804 219.228 1.00 45.10 ? 426 TYR A CZ    1 
ATOM   3993 O  OH    . TYR C 3 430 ? -17.176 77.262 219.196 1.00 46.00 ? 426 TYR A OH    1 
ATOM   3994 N  N     . MET C 3 431 ? -11.272 79.404 216.638 1.00 40.20 ? 427 MET A N     1 
ATOM   3995 C  CA    . MET C 3 431 ? -11.531 79.129 215.248 1.00 41.05 ? 427 MET A CA    1 
ATOM   3996 C  C     . MET C 3 431 ? -10.396 78.422 214.543 1.00 42.15 ? 427 MET A C     1 
ATOM   3997 O  O     . MET C 3 431 ? -10.607 77.746 213.531 1.00 42.95 ? 427 MET A O     1 
ATOM   3998 C  CB    . MET C 3 431 ? -11.834 80.426 214.524 1.00 41.77 ? 427 MET A CB    1 
ATOM   3999 C  CG    . MET C 3 431 ? -12.961 81.209 215.158 1.00 42.49 ? 427 MET A CG    1 
ATOM   4000 S  SD    . MET C 3 431 ? -14.511 80.328 215.043 1.00 39.72 ? 427 MET A SD    1 
ATOM   4001 C  CE    . MET C 3 431 ? -14.801 80.351 213.247 1.00 36.12 ? 427 MET A CE    1 
ATOM   4002 N  N     . ALA C 3 432 ? -9.182  78.581 215.049 1.00 43.06 ? 428 ALA A N     1 
ATOM   4003 C  CA    . ALA C 3 432 ? -8.031  77.939 214.410 1.00 42.32 ? 428 ALA A CA    1 
ATOM   4004 C  C     . ALA C 3 432 ? -8.025  76.460 214.751 1.00 40.65 ? 428 ALA A C     1 
ATOM   4005 O  O     . ALA C 3 432 ? -7.876  75.608 213.872 1.00 41.48 ? 428 ALA A O     1 
ATOM   4006 C  CB    . ALA C 3 432 ? -6.735  78.595 214.884 1.00 43.75 ? 428 ALA A CB    1 
ATOM   4007 N  N     . ILE C 3 433 ? -8.170  76.166 216.036 1.00 37.79 ? 429 ILE A N     1 
ATOM   4008 C  CA    . ILE C 3 433 ? -8.203  74.792 216.499 1.00 37.07 ? 429 ILE A CA    1 
ATOM   4009 C  C     . ILE C 3 433 ? -9.417  74.115 215.855 1.00 38.82 ? 429 ILE A C     1 
ATOM   4010 O  O     . ILE C 3 433 ? -9.324  73.008 215.305 1.00 38.83 ? 429 ILE A O     1 
ATOM   4011 C  CB    . ILE C 3 433 ? -8.321  74.762 218.017 1.00 33.80 ? 429 ILE A CB    1 
ATOM   4012 C  CG1   . ILE C 3 433 ? -7.039  75.322 218.624 1.00 31.08 ? 429 ILE A CG1   1 
ATOM   4013 C  CG2   . ILE C 3 433 ? -8.622  73.360 218.492 1.00 34.09 ? 429 ILE A CG2   1 
ATOM   4014 C  CD1   . ILE C 3 433 ? -7.187  75.811 220.032 1.00 27.81 ? 429 ILE A CD1   1 
ATOM   4015 N  N     . ALA C 3 434 ? -10.549 74.814 215.904 1.00 38.55 ? 430 ALA A N     1 
ATOM   4016 C  CA    . ALA C 3 434 ? -11.789 74.323 215.317 1.00 37.64 ? 430 ALA A CA    1 
ATOM   4017 C  C     . ALA C 3 434 ? -11.596 74.050 213.828 1.00 36.24 ? 430 ALA A C     1 
ATOM   4018 O  O     . ALA C 3 434 ? -12.060 73.035 213.307 1.00 35.77 ? 430 ALA A O     1 
ATOM   4019 C  CB    . ALA C 3 434 ? -12.908 75.342 215.520 1.00 37.53 ? 430 ALA A CB    1 
ATOM   4020 N  N     . ARG C 3 435 ? -10.911 74.956 213.143 1.00 35.59 ? 431 ARG A N     1 
ATOM   4021 C  CA    . ARG C 3 435 ? -10.673 74.779 211.718 1.00 36.58 ? 431 ARG A CA    1 
ATOM   4022 C  C     . ARG C 3 435 ? -9.860  73.522 211.454 1.00 36.25 ? 431 ARG A C     1 
ATOM   4023 O  O     . ARG C 3 435 ? -9.954  72.930 210.382 1.00 36.31 ? 431 ARG A O     1 
ATOM   4024 C  CB    . ARG C 3 435 ? -9.943  75.990 211.131 1.00 38.62 ? 431 ARG A CB    1 
ATOM   4025 C  CG    . ARG C 3 435 ? -10.859 77.076 210.599 1.00 39.42 ? 431 ARG A CG    1 
ATOM   4026 C  CD    . ARG C 3 435 ? -10.071 78.054 209.765 1.00 42.33 ? 431 ARG A CD    1 
ATOM   4027 N  NE    . ARG C 3 435 ? -9.249  78.938 210.588 1.00 44.58 ? 431 ARG A NE    1 
ATOM   4028 C  CZ    . ARG C 3 435 ? -9.723  79.993 211.247 1.00 45.56 ? 431 ARG A CZ    1 
ATOM   4029 N  NH1   . ARG C 3 435 ? -11.012 80.290 211.169 1.00 46.21 ? 431 ARG A NH1   1 
ATOM   4030 N  NH2   . ARG C 3 435 ? -8.919  80.750 211.986 1.00 46.42 ? 431 ARG A NH2   1 
ATOM   4031 N  N     . LEU C 3 436 ? -9.034  73.125 212.416 1.00 34.85 ? 432 LEU A N     1 
ATOM   4032 C  CA    . LEU C 3 436 ? -8.261  71.905 212.242 1.00 34.10 ? 432 LEU A CA    1 
ATOM   4033 C  C     . LEU C 3 436 ? -9.263  70.761 212.284 1.00 35.47 ? 432 LEU A C     1 
ATOM   4034 O  O     . LEU C 3 436 ? -9.165  69.806 211.517 1.00 36.20 ? 432 LEU A O     1 
ATOM   4035 C  CB    . LEU C 3 436 ? -7.248  71.726 213.371 1.00 31.58 ? 432 LEU A CB    1 
ATOM   4036 C  CG    . LEU C 3 436 ? -5.903  72.456 213.327 1.00 29.64 ? 432 LEU A CG    1 
ATOM   4037 C  CD1   . LEU C 3 436 ? -5.095  71.994 214.525 1.00 27.31 ? 432 LEU A CD1   1 
ATOM   4038 C  CD2   . LEU C 3 436 ? -5.152  72.168 212.034 1.00 25.01 ? 432 LEU A CD2   1 
ATOM   4039 N  N     . GLY C 3 437 ? -10.230 70.889 213.192 1.00 36.46 ? 433 GLY A N     1 
ATOM   4040 C  CA    . GLY C 3 437 ? -11.271 69.894 213.359 1.00 35.70 ? 433 GLY A CA    1 
ATOM   4041 C  C     . GLY C 3 437 ? -12.187 69.771 212.158 1.00 34.76 ? 433 GLY A C     1 
ATOM   4042 O  O     . GLY C 3 437 ? -12.977 68.835 212.085 1.00 35.87 ? 433 GLY A O     1 
ATOM   4043 N  N     . GLY C 3 438 ? -12.087 70.704 211.216 1.00 33.58 ? 434 GLY A N     1 
ATOM   4044 C  CA    . GLY C 3 438 ? -12.925 70.639 210.030 1.00 33.61 ? 434 GLY A CA    1 
ATOM   4045 C  C     . GLY C 3 438 ? -14.063 71.638 210.004 1.00 33.98 ? 434 GLY A C     1 
ATOM   4046 O  O     . GLY C 3 438 ? -14.721 71.801 208.983 1.00 33.65 ? 434 GLY A O     1 
ATOM   4047 N  N     . PHE C 3 439 ? -14.298 72.305 211.128 1.00 35.27 ? 435 PHE A N     1 
ATOM   4048 C  CA    . PHE C 3 439 ? -15.363 73.291 211.229 1.00 36.28 ? 435 PHE A CA    1 
ATOM   4049 C  C     . PHE C 3 439 ? -15.427 74.187 210.020 1.00 37.06 ? 435 PHE A C     1 
ATOM   4050 O  O     . PHE C 3 439 ? -14.457 74.864 209.702 1.00 38.79 ? 435 PHE A O     1 
ATOM   4051 C  CB    . PHE C 3 439 ? -15.140 74.177 212.438 1.00 39.14 ? 435 PHE A CB    1 
ATOM   4052 C  CG    . PHE C 3 439 ? -16.267 75.119 212.710 1.00 41.79 ? 435 PHE A CG    1 
ATOM   4053 C  CD1   . PHE C 3 439 ? -17.523 74.625 213.023 1.00 42.28 ? 435 PHE A CD1   1 
ATOM   4054 C  CD2   . PHE C 3 439 ? -16.062 76.496 212.733 1.00 41.87 ? 435 PHE A CD2   1 
ATOM   4055 C  CE1   . PHE C 3 439 ? -18.564 75.482 213.366 1.00 44.01 ? 435 PHE A CE1   1 
ATOM   4056 C  CE2   . PHE C 3 439 ? -17.103 77.365 213.076 1.00 42.96 ? 435 PHE A CE2   1 
ATOM   4057 C  CZ    . PHE C 3 439 ? -18.354 76.854 213.397 1.00 43.82 ? 435 PHE A CZ    1 
ATOM   4058 N  N     . MET C 3 440 ? -16.564 74.200 209.340 1.00 37.58 ? 436 MET A N     1 
ATOM   4059 C  CA    . MET C 3 440 ? -16.720 75.079 208.194 1.00 36.14 ? 436 MET A CA    1 
ATOM   4060 C  C     . MET C 3 440 ? -17.927 75.997 208.451 1.00 35.12 ? 436 MET A C     1 
ATOM   4061 O  O     . MET C 3 440 ? -18.404 76.662 207.540 1.00 35.26 ? 436 MET A O     1 
ATOM   4062 C  CB    . MET C 3 440 ? -16.918 74.267 206.912 1.00 37.17 ? 436 MET A CB    1 
ATOM   4063 C  CG    . MET C 3 440 ? -15.742 73.375 206.490 1.00 38.09 ? 436 MET A CG    1 
ATOM   4064 S  SD    . MET C 3 440 ? -14.418 74.203 205.591 1.00 38.85 ? 436 MET A SD    1 
ATOM   4065 C  CE    . MET C 3 440 ? -14.994 74.135 203.885 1.00 33.90 ? 436 MET A CE    1 
ATOM   4066 N  N     . ASP C 3 441 ? -18.411 76.022 209.695 1.00 36.45 ? 437 ASP A N     1 
ATOM   4067 C  CA    . ASP C 3 441 ? -19.553 76.860 210.090 1.00 38.35 ? 437 ASP A CA    1 
ATOM   4068 C  C     . ASP C 3 441 ? -20.669 76.802 209.035 1.00 38.25 ? 437 ASP A C     1 
ATOM   4069 O  O     . ASP C 3 441 ? -21.124 77.834 208.545 1.00 37.21 ? 437 ASP A O     1 
ATOM   4070 C  CB    . ASP C 3 441 ? -19.070 78.306 210.302 1.00 39.89 ? 437 ASP A CB    1 
ATOM   4071 C  CG    . ASP C 3 441 ? -20.052 79.163 211.113 1.00 41.45 ? 437 ASP A CG    1 
ATOM   4072 O  OD1   . ASP C 3 441 ? -20.539 78.707 212.172 1.00 42.09 ? 437 ASP A OD1   1 
ATOM   4073 O  OD2   . ASP C 3 441 ? -20.310 80.317 210.704 1.00 42.56 ? 437 ASP A OD2   1 
ATOM   4074 N  N     . SER C 3 442 ? -21.109 75.580 208.712 1.00 38.55 ? 438 SER A N     1 
ATOM   4075 C  CA    . SER C 3 442 ? -22.145 75.343 207.698 1.00 37.64 ? 438 SER A CA    1 
ATOM   4076 C  C     . SER C 3 442 ? -23.419 76.147 207.933 1.00 36.53 ? 438 SER A C     1 
ATOM   4077 O  O     . SER C 3 442 ? -24.045 76.633 206.990 1.00 35.44 ? 438 SER A O     1 
ATOM   4078 C  CB    . SER C 3 442 ? -22.507 73.853 207.624 1.00 38.44 ? 438 SER A CB    1 
ATOM   4079 O  OG    . SER C 3 442 ? -23.126 73.403 208.824 1.00 39.70 ? 438 SER A OG    1 
ATOM   4080 N  N     . LYS C 3 443 ? -23.812 76.265 209.191 1.00 35.18 ? 439 LYS A N     1 
ATOM   4081 C  CA    . LYS C 3 443 ? -25.010 77.008 209.524 1.00 36.76 ? 439 LYS A CA    1 
ATOM   4082 C  C     . LYS C 3 443 ? -24.664 78.423 209.931 1.00 37.94 ? 439 LYS A C     1 
ATOM   4083 O  O     . LYS C 3 443 ? -25.502 79.151 210.468 1.00 39.08 ? 439 LYS A O     1 
ATOM   4084 C  CB    . LYS C 3 443 ? -25.773 76.325 210.661 1.00 36.51 ? 439 LYS A CB    1 
ATOM   4085 C  CG    . LYS C 3 443 ? -26.528 75.087 210.235 1.00 34.93 ? 439 LYS A CG    1 
ATOM   4086 C  CD    . LYS C 3 443 ? -27.539 75.413 209.151 1.00 32.72 ? 439 LYS A CD    1 
ATOM   4087 C  CE    . LYS C 3 443 ? -28.591 74.321 209.079 1.00 33.98 ? 439 LYS A CE    1 
ATOM   4088 N  NZ    . LYS C 3 443 ? -29.497 74.497 207.910 1.00 35.23 ? 439 LYS A NZ    1 
ATOM   4089 N  N     . ARG C 3 444 ? -23.418 78.810 209.698 1.00 38.69 ? 440 ARG A N     1 
ATOM   4090 C  CA    . ARG C 3 444 ? -22.977 80.155 210.038 1.00 37.81 ? 440 ARG A CA    1 
ATOM   4091 C  C     . ARG C 3 444 ? -23.515 80.623 211.396 1.00 36.58 ? 440 ARG A C     1 
ATOM   4092 O  O     . ARG C 3 444 ? -24.207 81.634 211.475 1.00 36.35 ? 440 ARG A O     1 
ATOM   4093 C  CB    . ARG C 3 444 ? -23.415 81.127 208.941 1.00 38.83 ? 440 ARG A CB    1 
ATOM   4094 C  CG    . ARG C 3 444 ? -22.743 80.897 207.591 1.00 44.04 ? 440 ARG A CG    1 
ATOM   4095 C  CD    . ARG C 3 444 ? -23.314 81.834 206.546 1.00 50.20 ? 440 ARG A CD    1 
ATOM   4096 N  NE    . ARG C 3 444 ? -24.726 81.538 206.282 1.00 57.77 ? 440 ARG A NE    1 
ATOM   4097 C  CZ    . ARG C 3 444 ? -25.693 82.453 206.181 1.00 60.24 ? 440 ARG A CZ    1 
ATOM   4098 N  NH1   . ARG C 3 444 ? -25.399 83.744 206.325 1.00 61.35 ? 440 ARG A NH1   1 
ATOM   4099 N  NH2   . ARG C 3 444 ? -26.950 82.076 205.945 1.00 58.65 ? 440 ARG A NH2   1 
ATOM   4100 N  N     . THR C 3 445 ? -23.211 79.879 212.457 1.00 35.45 ? 441 THR A N     1 
ATOM   4101 C  CA    . THR C 3 445 ? -23.662 80.252 213.794 1.00 35.00 ? 441 THR A CA    1 
ATOM   4102 C  C     . THR C 3 445 ? -22.451 80.635 214.637 1.00 35.21 ? 441 THR A C     1 
ATOM   4103 O  O     . THR C 3 445 ? -22.585 81.247 215.697 1.00 33.44 ? 441 THR A O     1 
ATOM   4104 C  CB    . THR C 3 445 ? -24.409 79.092 214.512 1.00 34.92 ? 441 THR A CB    1 
ATOM   4105 O  OG1   . THR C 3 445 ? -23.466 78.122 214.989 1.00 34.59 ? 441 THR A OG1   1 
ATOM   4106 C  CG2   . THR C 3 445 ? -25.385 78.426 213.559 1.00 36.25 ? 441 THR A CG2   1 
ATOM   4107 N  N     . GLY C 3 446 ? -21.269 80.256 214.164 1.00 35.44 ? 442 GLY A N     1 
ATOM   4108 C  CA    . GLY C 3 446 ? -20.055 80.570 214.886 1.00 36.24 ? 442 GLY A CA    1 
ATOM   4109 C  C     . GLY C 3 446 ? -19.681 79.496 215.882 1.00 37.16 ? 442 GLY A C     1 
ATOM   4110 O  O     . GLY C 3 446 ? -18.497 79.218 216.071 1.00 39.90 ? 442 GLY A O     1 
ATOM   4111 N  N     . ILE C 3 447 ? -20.672 78.883 216.525 1.00 36.86 ? 443 ILE A N     1 
ATOM   4112 C  CA    . ILE C 3 447 ? -20.366 77.828 217.492 1.00 36.64 ? 443 ILE A CA    1 
ATOM   4113 C  C     . ILE C 3 447 ? -19.945 76.520 216.805 1.00 36.19 ? 443 ILE A C     1 
ATOM   4114 O  O     . ILE C 3 447 ? -20.546 76.105 215.821 1.00 34.63 ? 443 ILE A O     1 
ATOM   4115 C  CB    . ILE C 3 447 ? -21.546 77.497 218.411 1.00 36.69 ? 443 ILE A CB    1 
ATOM   4116 C  CG1   . ILE C 3 447 ? -22.077 78.768 219.102 1.00 37.17 ? 443 ILE A CG1   1 
ATOM   4117 C  CG2   . ILE C 3 447 ? -21.074 76.501 219.460 1.00 37.23 ? 443 ILE A CG2   1 
ATOM   4118 C  CD1   . ILE C 3 447 ? -22.915 79.671 218.202 1.00 35.91 ? 443 ILE A CD1   1 
ATOM   4119 N  N     . ALA C 3 448 ? -18.895 75.891 217.331 1.00 35.06 ? 444 ALA A N     1 
ATOM   4120 C  CA    . ALA C 3 448 ? -18.392 74.628 216.808 1.00 33.37 ? 444 ALA A CA    1 
ATOM   4121 C  C     . ALA C 3 448 ? -18.692 73.536 217.832 1.00 33.88 ? 444 ALA A C     1 
ATOM   4122 O  O     . ALA C 3 448 ? -18.612 73.764 219.047 1.00 33.19 ? 444 ALA A O     1 
ATOM   4123 C  CB    . ALA C 3 448 ? -16.905 74.710 216.564 1.00 33.23 ? 444 ALA A CB    1 
ATOM   4124 N  N     . SER C 3 449 ? -19.057 72.354 217.345 1.00 34.13 ? 445 SER A N     1 
ATOM   4125 C  CA    . SER C 3 449 ? -19.369 71.239 218.236 1.00 35.96 ? 445 SER A CA    1 
ATOM   4126 C  C     . SER C 3 449 ? -18.148 70.891 219.077 1.00 37.16 ? 445 SER A C     1 
ATOM   4127 O  O     . SER C 3 449 ? -17.011 71.020 218.617 1.00 38.12 ? 445 SER A O     1 
ATOM   4128 C  CB    . SER C 3 449 ? -19.764 70.011 217.426 1.00 37.26 ? 445 SER A CB    1 
ATOM   4129 O  OG    . SER C 3 449 ? -18.669 69.549 216.654 1.00 36.31 ? 445 SER A OG    1 
ATOM   4130 N  N     . TRP C 3 450 ? -18.375 70.440 220.307 1.00 36.36 ? 446 TRP A N     1 
ATOM   4131 C  CA    . TRP C 3 450 ? -17.253 70.067 221.153 1.00 35.12 ? 446 TRP A CA    1 
ATOM   4132 C  C     . TRP C 3 450 ? -16.454 68.977 220.441 1.00 34.41 ? 446 TRP A C     1 
ATOM   4133 O  O     . TRP C 3 450 ? -15.238 68.867 220.606 1.00 34.63 ? 446 TRP A O     1 
ATOM   4134 C  CB    . TRP C 3 450 ? -17.736 69.563 222.503 1.00 36.22 ? 446 TRP A CB    1 
ATOM   4135 C  CG    . TRP C 3 450 ? -18.812 68.540 222.412 1.00 41.60 ? 446 TRP A CG    1 
ATOM   4136 C  CD1   . TRP C 3 450 ? -20.157 68.758 222.496 1.00 42.66 ? 446 TRP A CD1   1 
ATOM   4137 C  CD2   . TRP C 3 450 ? -18.641 67.123 222.291 1.00 42.69 ? 446 TRP A CD2   1 
ATOM   4138 N  NE1   . TRP C 3 450 ? -20.837 67.566 222.448 1.00 44.10 ? 446 TRP A NE1   1 
ATOM   4139 C  CE2   . TRP C 3 450 ? -19.929 66.543 222.323 1.00 44.08 ? 446 TRP A CE2   1 
ATOM   4140 C  CE3   . TRP C 3 450 ? -17.524 66.286 222.162 1.00 41.61 ? 446 TRP A CE3   1 
ATOM   4141 C  CZ2   . TRP C 3 450 ? -20.130 65.155 222.234 1.00 43.63 ? 446 TRP A CZ2   1 
ATOM   4142 C  CZ3   . TRP C 3 450 ? -17.725 64.909 222.072 1.00 42.18 ? 446 TRP A CZ3   1 
ATOM   4143 C  CH2   . TRP C 3 450 ? -19.019 64.359 222.111 1.00 41.82 ? 446 TRP A CH2   1 
ATOM   4144 N  N     . GLY C 3 451 ? -17.140 68.202 219.612 1.00 33.60 ? 447 GLY A N     1 
ATOM   4145 C  CA    . GLY C 3 451 ? -16.484 67.136 218.888 1.00 33.63 ? 447 GLY A CA    1 
ATOM   4146 C  C     . GLY C 3 451 ? -15.537 67.636 217.823 1.00 33.62 ? 447 GLY A C     1 
ATOM   4147 O  O     . GLY C 3 451 ? -14.484 67.047 217.612 1.00 34.14 ? 447 GLY A O     1 
ATOM   4148 N  N     . ALA C 3 452 ? -15.907 68.703 217.128 1.00 35.91 ? 448 ALA A N     1 
ATOM   4149 C  CA    . ALA C 3 452 ? -15.029 69.237 216.101 1.00 38.15 ? 448 ALA A CA    1 
ATOM   4150 C  C     . ALA C 3 452 ? -13.894 69.974 216.801 1.00 40.16 ? 448 ALA A C     1 
ATOM   4151 O  O     . ALA C 3 452 ? -12.757 69.962 216.330 1.00 40.91 ? 448 ALA A O     1 
ATOM   4152 C  CB    . ALA C 3 452 ? -15.786 70.173 215.184 1.00 37.43 ? 448 ALA A CB    1 
ATOM   4153 N  N     . LEU C 3 453 ? -14.187 70.618 217.926 1.00 40.94 ? 449 LEU A N     1 
ATOM   4154 C  CA    . LEU C 3 453 ? -13.126 71.308 218.629 1.00 41.71 ? 449 LEU A CA    1 
ATOM   4155 C  C     . LEU C 3 453 ? -12.155 70.305 219.213 1.00 41.81 ? 449 LEU A C     1 
ATOM   4156 O  O     . LEU C 3 453 ? -10.991 70.630 219.438 1.00 42.50 ? 449 LEU A O     1 
ATOM   4157 C  CB    . LEU C 3 453 ? -13.672 72.215 219.730 1.00 41.72 ? 449 LEU A CB    1 
ATOM   4158 C  CG    . LEU C 3 453 ? -13.469 73.686 219.330 1.00 43.11 ? 449 LEU A CG    1 
ATOM   4159 C  CD1   . LEU C 3 453 ? -14.154 74.582 220.320 1.00 44.40 ? 449 LEU A CD1   1 
ATOM   4160 C  CD2   . LEU C 3 453 ? -11.979 74.006 219.246 1.00 43.75 ? 449 LEU A CD2   1 
ATOM   4161 N  N     . TRP C 3 454 ? -12.615 69.081 219.464 1.00 41.13 ? 450 TRP A N     1 
ATOM   4162 C  CA    . TRP C 3 454 ? -11.696 68.082 220.003 1.00 39.08 ? 450 TRP A CA    1 
ATOM   4163 C  C     . TRP C 3 454 ? -10.763 67.566 218.915 1.00 39.12 ? 450 TRP A C     1 
ATOM   4164 O  O     . TRP C 3 454 ? -9.566  67.421 219.148 1.00 37.91 ? 450 TRP A O     1 
ATOM   4165 C  CB    . TRP C 3 454 ? -12.433 66.903 220.633 1.00 37.46 ? 450 TRP A CB    1 
ATOM   4166 C  CG    . TRP C 3 454 ? -11.526 65.716 220.787 1.00 37.30 ? 450 TRP A CG    1 
ATOM   4167 C  CD1   . TRP C 3 454 ? -11.417 64.647 219.932 1.00 36.48 ? 450 TRP A CD1   1 
ATOM   4168 C  CD2   . TRP C 3 454 ? -10.524 65.522 221.794 1.00 35.67 ? 450 TRP A CD2   1 
ATOM   4169 N  NE1   . TRP C 3 454 ? -10.410 63.805 220.348 1.00 34.65 ? 450 TRP A NE1   1 
ATOM   4170 C  CE2   . TRP C 3 454 ? -9.847  64.315 221.489 1.00 34.48 ? 450 TRP A CE2   1 
ATOM   4171 C  CE3   . TRP C 3 454 ? -10.132 66.250 222.927 1.00 35.40 ? 450 TRP A CE3   1 
ATOM   4172 C  CZ2   . TRP C 3 454 ? -8.796  63.820 222.268 1.00 34.58 ? 450 TRP A CZ2   1 
ATOM   4173 C  CZ3   . TRP C 3 454 ? -9.083  65.761 223.710 1.00 36.03 ? 450 TRP A CZ3   1 
ATOM   4174 C  CH2   . TRP C 3 454 ? -8.428  64.547 223.374 1.00 35.80 ? 450 TRP A CH2   1 
ATOM   4175 N  N     . GLU C 3 455 ? -11.302 67.287 217.732 1.00 39.32 ? 451 GLU A N     1 
ATOM   4176 C  CA    . GLU C 3 455 ? -10.466 66.794 216.649 1.00 41.27 ? 451 GLU A CA    1 
ATOM   4177 C  C     . GLU C 3 455 ? -9.307  67.772 216.485 1.00 40.07 ? 451 GLU A C     1 
ATOM   4178 O  O     . GLU C 3 455 ? -8.152  67.366 216.384 1.00 38.34 ? 451 GLU A O     1 
ATOM   4179 C  CB    . GLU C 3 455 ? -11.268 66.697 215.348 1.00 43.62 ? 451 GLU A CB    1 
ATOM   4180 C  CG    . GLU C 3 455 ? -12.325 65.606 215.337 1.00 49.27 ? 451 GLU A CG    1 
ATOM   4181 C  CD    . GLU C 3 455 ? -11.741 64.210 215.180 1.00 53.99 ? 451 GLU A CD    1 
ATOM   4182 O  OE1   . GLU C 3 455 ? -11.075 63.957 214.148 1.00 56.39 ? 451 GLU A OE1   1 
ATOM   4183 O  OE2   . GLU C 3 455 ? -11.946 63.361 216.084 1.00 56.28 ? 451 GLU A OE2   1 
ATOM   4184 N  N     . GLY C 3 456 ? -9.633  69.062 216.485 1.00 40.20 ? 452 GLY A N     1 
ATOM   4185 C  CA    . GLY C 3 456 ? -8.622  70.097 216.346 1.00 40.39 ? 452 GLY A CA    1 
ATOM   4186 C  C     . GLY C 3 456 ? -7.550  69.999 217.415 1.00 39.66 ? 452 GLY A C     1 
ATOM   4187 O  O     . GLY C 3 456 ? -6.367  69.933 217.104 1.00 41.35 ? 452 GLY A O     1 
ATOM   4188 N  N     . TRP C 3 457 ? -7.964  69.992 218.675 1.00 38.17 ? 453 TRP A N     1 
ATOM   4189 C  CA    . TRP C 3 457 ? -7.032  69.888 219.779 1.00 38.92 ? 453 TRP A CA    1 
ATOM   4190 C  C     . TRP C 3 457 ? -6.171  68.647 219.591 1.00 41.27 ? 453 TRP A C     1 
ATOM   4191 O  O     . TRP C 3 457 ? -4.954  68.684 219.772 1.00 42.56 ? 453 TRP A O     1 
ATOM   4192 C  CB    . TRP C 3 457 ? -7.787  69.785 221.093 1.00 36.43 ? 453 TRP A CB    1 
ATOM   4193 C  CG    . TRP C 3 457 ? -6.906  69.677 222.274 1.00 36.50 ? 453 TRP A CG    1 
ATOM   4194 C  CD1   . TRP C 3 457 ? -6.768  68.600 223.091 1.00 37.43 ? 453 TRP A CD1   1 
ATOM   4195 C  CD2   . TRP C 3 457 ? -6.068  70.702 222.812 1.00 37.47 ? 453 TRP A CD2   1 
ATOM   4196 N  NE1   . TRP C 3 457 ? -5.897  68.888 224.118 1.00 37.96 ? 453 TRP A NE1   1 
ATOM   4197 C  CE2   . TRP C 3 457 ? -5.455  70.174 223.970 1.00 37.53 ? 453 TRP A CE2   1 
ATOM   4198 C  CE3   . TRP C 3 457 ? -5.777  72.016 222.430 1.00 37.65 ? 453 TRP A CE3   1 
ATOM   4199 C  CZ2   . TRP C 3 457 ? -4.569  70.913 224.753 1.00 38.61 ? 453 TRP A CZ2   1 
ATOM   4200 C  CZ3   . TRP C 3 457 ? -4.891  72.754 223.211 1.00 39.28 ? 453 TRP A CZ3   1 
ATOM   4201 C  CH2   . TRP C 3 457 ? -4.298  72.197 224.362 1.00 39.21 ? 453 TRP A CH2   1 
ATOM   4202 N  N     . GLU C 3 458 ? -6.803  67.545 219.220 1.00 42.73 ? 454 GLU A N     1 
ATOM   4203 C  CA    . GLU C 3 458 ? -6.078  66.305 219.008 1.00 43.80 ? 454 GLU A CA    1 
ATOM   4204 C  C     . GLU C 3 458 ? -5.079  66.480 217.871 1.00 41.45 ? 454 GLU A C     1 
ATOM   4205 O  O     . GLU C 3 458 ? -3.941  66.044 217.973 1.00 41.16 ? 454 GLU A O     1 
ATOM   4206 C  CB    . GLU C 3 458 ? -7.054  65.178 218.669 1.00 48.14 ? 454 GLU A CB    1 
ATOM   4207 C  CG    . GLU C 3 458 ? -6.392  63.826 218.448 1.00 54.73 ? 454 GLU A CG    1 
ATOM   4208 C  CD    . GLU C 3 458 ? -7.265  62.875 217.636 1.00 59.61 ? 454 GLU A CD    1 
ATOM   4209 O  OE1   . GLU C 3 458 ? -7.656  63.258 216.498 1.00 61.53 ? 454 GLU A OE1   1 
ATOM   4210 O  OE2   . GLU C 3 458 ? -7.542  61.745 218.129 1.00 61.43 ? 454 GLU A OE2   1 
ATOM   4211 N  N     . ALA C 3 459 ? -5.507  67.111 216.786 1.00 40.01 ? 455 ALA A N     1 
ATOM   4212 C  CA    . ALA C 3 459 ? -4.612  67.323 215.653 1.00 41.23 ? 455 ALA A CA    1 
ATOM   4213 C  C     . ALA C 3 459 ? -3.444  68.213 216.055 1.00 42.29 ? 455 ALA A C     1 
ATOM   4214 O  O     . ALA C 3 459 ? -2.280  67.854 215.864 1.00 43.21 ? 455 ALA A O     1 
ATOM   4215 C  CB    . ALA C 3 459 ? -5.355  67.950 214.490 1.00 37.25 ? 455 ALA A CB    1 
ATOM   4216 N  N     . LEU C 3 460 ? -3.758  69.376 216.615 1.00 41.89 ? 456 LEU A N     1 
ATOM   4217 C  CA    . LEU C 3 460 ? -2.728  70.303 217.034 1.00 41.15 ? 456 LEU A CA    1 
ATOM   4218 C  C     . LEU C 3 460 ? -1.690  69.599 217.888 1.00 41.13 ? 456 LEU A C     1 
ATOM   4219 O  O     . LEU C 3 460 ? -0.494  69.683 217.619 1.00 43.08 ? 456 LEU A O     1 
ATOM   4220 C  CB    . LEU C 3 460 ? -3.331  71.460 217.824 1.00 40.66 ? 456 LEU A CB    1 
ATOM   4221 C  CG    . LEU C 3 460 ? -2.323  72.512 218.301 1.00 40.87 ? 456 LEU A CG    1 
ATOM   4222 C  CD1   . LEU C 3 460 ? -1.497  73.028 217.119 1.00 40.09 ? 456 LEU A CD1   1 
ATOM   4223 C  CD2   . LEU C 3 460 ? -3.073  73.643 218.958 1.00 39.48 ? 456 LEU A CD2   1 
ATOM   4224 N  N     . GLN C 3 461 ? -2.148  68.897 218.914 1.00 39.47 ? 457 GLN A N     1 
ATOM   4225 C  CA    . GLN C 3 461 ? -1.232  68.197 219.790 1.00 38.32 ? 457 GLN A CA    1 
ATOM   4226 C  C     . GLN C 3 461 ? -0.431  67.160 219.021 1.00 39.35 ? 457 GLN A C     1 
ATOM   4227 O  O     . GLN C 3 461 ? 0.764   67.014 219.250 1.00 40.30 ? 457 GLN A O     1 
ATOM   4228 C  CB    . GLN C 3 461 ? -1.994  67.529 220.925 1.00 36.60 ? 457 GLN A CB    1 
ATOM   4229 C  CG    . GLN C 3 461 ? -2.609  68.513 221.902 1.00 38.05 ? 457 GLN A CG    1 
ATOM   4230 C  CD    . GLN C 3 461 ? -1.548  69.373 222.590 1.00 39.00 ? 457 GLN A CD    1 
ATOM   4231 O  OE1   . GLN C 3 461 ? -0.550  68.855 223.107 1.00 38.92 ? 457 GLN A OE1   1 
ATOM   4232 N  NE2   . GLN C 3 461 ? -1.762  70.688 222.607 1.00 37.79 ? 457 GLN A NE2   1 
ATOM   4233 N  N     . SER C 3 462 ? -1.077  66.438 218.113 1.00 39.77 ? 458 SER A N     1 
ATOM   4234 C  CA    . SER C 3 462 ? -0.373  65.426 217.346 1.00 40.22 ? 458 SER A CA    1 
ATOM   4235 C  C     . SER C 3 462 ? 0.748   66.103 216.601 1.00 41.37 ? 458 SER A C     1 
ATOM   4236 O  O     . SER C 3 462 ? 1.890   65.648 216.631 1.00 42.93 ? 458 SER A O     1 
ATOM   4237 C  CB    . SER C 3 462 ? -1.299  64.757 216.342 1.00 40.78 ? 458 SER A CB    1 
ATOM   4238 O  OG    . SER C 3 462 ? -0.594  63.788 215.577 1.00 40.77 ? 458 SER A OG    1 
ATOM   4239 N  N     . LYS C 3 463 ? 0.410   67.192 215.918 1.00 41.14 ? 459 LYS A N     1 
ATOM   4240 C  CA    . LYS C 3 463 ? 1.391   67.962 215.161 1.00 40.95 ? 459 LYS A CA    1 
ATOM   4241 C  C     . LYS C 3 463 ? 2.481   68.513 216.082 1.00 41.84 ? 459 LYS A C     1 
ATOM   4242 O  O     . LYS C 3 463 ? 3.635   68.631 215.676 1.00 42.20 ? 459 LYS A O     1 
ATOM   4243 C  CB    . LYS C 3 463 ? 0.719   69.131 214.446 1.00 39.13 ? 459 LYS A CB    1 
ATOM   4244 C  CG    . LYS C 3 463 ? 0.141   68.800 213.100 1.00 38.03 ? 459 LYS A CG    1 
ATOM   4245 C  CD    . LYS C 3 463 ? -1.225  68.180 213.191 1.00 39.22 ? 459 LYS A CD    1 
ATOM   4246 C  CE    . LYS C 3 463 ? -1.994  68.437 211.905 1.00 39.22 ? 459 LYS A CE    1 
ATOM   4247 N  NZ    . LYS C 3 463 ? -1.277  67.901 210.725 1.00 40.73 ? 459 LYS A NZ    1 
ATOM   4248 N  N     . LEU C 3 464 ? 2.106   68.843 217.317 1.00 41.90 ? 460 LEU A N     1 
ATOM   4249 C  CA    . LEU C 3 464 ? 3.050   69.382 218.280 1.00 42.52 ? 460 LEU A CA    1 
ATOM   4250 C  C     . LEU C 3 464 ? 4.154   68.381 218.558 1.00 44.65 ? 460 LEU A C     1 
ATOM   4251 O  O     . LEU C 3 464 ? 5.243   68.753 218.982 1.00 47.25 ? 460 LEU A O     1 
ATOM   4252 C  CB    . LEU C 3 464 ? 2.355   69.753 219.596 1.00 39.80 ? 460 LEU A CB    1 
ATOM   4253 C  CG    . LEU C 3 464 ? 3.151   70.761 220.439 1.00 38.47 ? 460 LEU A CG    1 
ATOM   4254 C  CD1   . LEU C 3 464 ? 3.451   71.964 219.556 1.00 39.19 ? 460 LEU A CD1   1 
ATOM   4255 C  CD2   . LEU C 3 464 ? 2.397   71.197 221.677 1.00 35.70 ? 460 LEU A CD2   1 
ATOM   4256 N  N     . ASP C 3 465 ? 3.876   67.108 218.326 1.00 45.71 ? 461 ASP A N     1 
ATOM   4257 C  CA    . ASP C 3 465 ? 4.870   66.073 218.555 1.00 47.12 ? 461 ASP A CA    1 
ATOM   4258 C  C     . ASP C 3 465 ? 6.006   66.215 217.573 1.00 46.67 ? 461 ASP A C     1 
ATOM   4259 O  O     . ASP C 3 465 ? 7.171   66.105 217.942 1.00 45.43 ? 461 ASP A O     1 
ATOM   4260 C  CB    . ASP C 3 465 ? 4.235   64.694 218.408 1.00 49.34 ? 461 ASP A CB    1 
ATOM   4261 C  CG    . ASP C 3 465 ? 3.623   64.205 219.695 1.00 51.67 ? 461 ASP A CG    1 
ATOM   4262 O  OD1   . ASP C 3 465 ? 3.123   65.062 220.468 1.00 54.14 ? 461 ASP A OD1   1 
ATOM   4263 O  OD2   . ASP C 3 465 ? 3.637   62.972 219.932 1.00 51.96 ? 461 ASP A OD2   1 
ATOM   4264 N  N     . GLY C 3 466 ? 5.653   66.449 216.317 1.00 47.19 ? 462 GLY A N     1 
ATOM   4265 C  CA    . GLY C 3 466 ? 6.664   66.613 215.296 1.00 49.73 ? 462 GLY A CA    1 
ATOM   4266 C  C     . GLY C 3 466 ? 7.329   67.966 215.435 1.00 50.34 ? 462 GLY A C     1 
ATOM   4267 O  O     . GLY C 3 466 ? 8.532   68.102 215.235 1.00 51.31 ? 462 GLY A O     1 
ATOM   4268 N  N     . PHE C 3 467 ? 6.542   68.971 215.791 1.00 50.55 ? 463 PHE A N     1 
ATOM   4269 C  CA    . PHE C 3 467 ? 7.071   70.313 215.951 1.00 51.64 ? 463 PHE A CA    1 
ATOM   4270 C  C     . PHE C 3 467 ? 8.119   70.315 217.047 1.00 53.10 ? 463 PHE A C     1 
ATOM   4271 O  O     . PHE C 3 467 ? 9.163   70.936 216.910 1.00 53.41 ? 463 PHE A O     1 
ATOM   4272 C  CB    . PHE C 3 467 ? 5.956   71.279 216.325 1.00 50.30 ? 463 PHE A CB    1 
ATOM   4273 C  CG    . PHE C 3 467 ? 6.379   72.715 216.357 1.00 48.30 ? 463 PHE A CG    1 
ATOM   4274 C  CD1   . PHE C 3 467 ? 6.381   73.479 215.193 1.00 48.01 ? 463 PHE A CD1   1 
ATOM   4275 C  CD2   . PHE C 3 467 ? 6.744   73.316 217.558 1.00 47.53 ? 463 PHE A CD2   1 
ATOM   4276 C  CE1   . PHE C 3 467 ? 6.734   74.826 215.225 1.00 46.78 ? 463 PHE A CE1   1 
ATOM   4277 C  CE2   . PHE C 3 467 ? 7.099   74.661 217.606 1.00 46.18 ? 463 PHE A CE2   1 
ATOM   4278 C  CZ    . PHE C 3 467 ? 7.093   75.419 216.436 1.00 46.42 ? 463 PHE A CZ    1 
ATOM   4279 N  N     . LEU C 3 468 ? 7.832   69.621 218.140 1.00 54.58 ? 464 LEU A N     1 
ATOM   4280 C  CA    . LEU C 3 468 ? 8.769   69.555 219.245 1.00 55.95 ? 464 LEU A CA    1 
ATOM   4281 C  C     . LEU C 3 468 ? 9.883   68.567 218.970 1.00 57.49 ? 464 LEU A C     1 
ATOM   4282 O  O     . LEU C 3 468 ? 10.945  68.652 219.572 1.00 60.11 ? 464 LEU A O     1 
ATOM   4283 C  CB    . LEU C 3 468 ? 8.056   69.151 220.530 1.00 54.90 ? 464 LEU A CB    1 
ATOM   4284 C  CG    . LEU C 3 468 ? 7.136   70.206 221.139 1.00 56.03 ? 464 LEU A CG    1 
ATOM   4285 C  CD1   . LEU C 3 468 ? 6.509   69.632 222.397 1.00 55.78 ? 464 LEU A CD1   1 
ATOM   4286 C  CD2   . LEU C 3 468 ? 7.922   71.473 221.470 1.00 55.88 ? 464 LEU A CD2   1 
ATOM   4287 N  N     . ALA C 3 469 ? 9.648   67.624 218.068 1.00 58.75 ? 465 ALA A N     1 
ATOM   4288 C  CA    . ALA C 3 469 ? 10.672  66.633 217.759 1.00 59.79 ? 465 ALA A CA    1 
ATOM   4289 C  C     . ALA C 3 469 ? 11.788  67.285 216.962 1.00 61.06 ? 465 ALA A C     1 
ATOM   4290 O  O     . ALA C 3 469 ? 12.962  67.175 217.317 1.00 61.26 ? 465 ALA A O     1 
ATOM   4291 C  CB    . ALA C 3 469 ? 10.073  65.485 216.972 1.00 59.44 ? 465 ALA A CB    1 
ATOM   4292 N  N     . ALA C 3 470 ? 11.413  67.959 215.879 1.00 62.08 ? 466 ALA A N     1 
ATOM   4293 C  CA    . ALA C 3 470 ? 12.378  68.643 215.029 1.00 63.05 ? 466 ALA A CA    1 
ATOM   4294 C  C     . ALA C 3 470 ? 13.209  69.575 215.894 1.00 63.88 ? 466 ALA A C     1 
ATOM   4295 O  O     . ALA C 3 470 ? 14.420  69.678 215.731 1.00 64.46 ? 466 ALA A O     1 
ATOM   4296 C  CB    . ALA C 3 470 ? 11.658  69.438 213.953 1.00 62.63 ? 466 ALA A CB    1 
ATOM   4297 N  N     . LYS C 3 471 ? 12.541  70.250 216.818 1.00 64.33 ? 467 LYS A N     1 
ATOM   4298 C  CA    . LYS C 3 471 ? 13.207  71.161 217.722 1.00 65.24 ? 467 LYS A CA    1 
ATOM   4299 C  C     . LYS C 3 471 ? 14.250  70.435 218.575 1.00 66.43 ? 467 LYS A C     1 
ATOM   4300 O  O     . LYS C 3 471 ? 15.412  70.834 218.619 1.00 66.81 ? 467 LYS A O     1 
ATOM   4301 C  CB    . LYS C 3 471 ? 12.165  71.844 218.607 1.00 64.74 ? 467 LYS A CB    1 
ATOM   4302 C  CG    . LYS C 3 471 ? 12.708  72.482 219.858 1.00 65.19 ? 467 LYS A CG    1 
ATOM   4303 C  CD    . LYS C 3 471 ? 11.606  73.189 220.608 1.00 65.53 ? 467 LYS A CD    1 
ATOM   4304 C  CE    . LYS C 3 471 ? 12.054  73.560 222.011 1.00 65.87 ? 467 LYS A CE    1 
ATOM   4305 N  NZ    . LYS C 3 471 ? 10.918  74.082 222.824 1.00 65.24 ? 467 LYS A NZ    1 
ATOM   4306 N  N     . ASP C 3 472 ? 13.839  69.360 219.237 1.00 67.79 ? 468 ASP A N     1 
ATOM   4307 C  CA    . ASP C 3 472 ? 14.745  68.598 220.091 1.00 69.24 ? 468 ASP A CA    1 
ATOM   4308 C  C     . ASP C 3 472 ? 16.001  68.133 219.356 1.00 70.71 ? 468 ASP A C     1 
ATOM   4309 O  O     . ASP C 3 472 ? 17.092  68.134 219.924 1.00 71.06 ? 468 ASP A O     1 
ATOM   4310 C  CB    . ASP C 3 472 ? 14.017  67.388 220.671 1.00 68.72 ? 468 ASP A CB    1 
ATOM   4311 C  CG    . ASP C 3 472 ? 14.864  66.620 221.661 1.00 69.07 ? 468 ASP A CG    1 
ATOM   4312 O  OD1   . ASP C 3 472 ? 15.972  66.191 221.290 1.00 69.10 ? 468 ASP A OD1   1 
ATOM   4313 O  OD2   . ASP C 3 472 ? 14.424  66.445 222.817 1.00 69.93 ? 468 ASP A OD2   1 
ATOM   4314 N  N     . LEU C 3 473 ? 15.848  67.733 218.097 1.00 72.66 ? 469 LEU A N     1 
ATOM   4315 C  CA    . LEU C 3 473 ? 16.985  67.266 217.313 1.00 74.05 ? 469 LEU A CA    1 
ATOM   4316 C  C     . LEU C 3 473 ? 17.898  68.410 216.876 1.00 76.19 ? 469 LEU A C     1 
ATOM   4317 O  O     . LEU C 3 473 ? 19.118  68.265 216.867 1.00 76.30 ? 469 LEU A O     1 
ATOM   4318 C  CB    . LEU C 3 473 ? 16.511  66.486 216.080 1.00 71.70 ? 469 LEU A CB    1 
ATOM   4319 C  CG    . LEU C 3 473 ? 15.859  65.127 216.311 1.00 70.13 ? 469 LEU A CG    1 
ATOM   4320 C  CD1   . LEU C 3 473 ? 15.557  64.504 214.971 1.00 69.88 ? 469 LEU A CD1   1 
ATOM   4321 C  CD2   . LEU C 3 473 ? 16.778  64.220 217.121 1.00 68.78 ? 469 LEU A CD2   1 
ATOM   4322 N  N     . MET C 3 474 ? 17.315  69.547 216.513 1.00 78.98 ? 470 MET A N     1 
ATOM   4323 C  CA    . MET C 3 474 ? 18.124  70.678 216.082 1.00 81.37 ? 470 MET A CA    1 
ATOM   4324 C  C     . MET C 3 474 ? 18.807  71.283 217.303 1.00 82.06 ? 470 MET A C     1 
ATOM   4325 O  O     . MET C 3 474 ? 19.876  71.872 217.191 1.00 83.13 ? 470 MET A O     1 
ATOM   4326 C  CB    . MET C 3 474 ? 17.264  71.744 215.392 1.00 83.22 ? 470 MET A CB    1 
ATOM   4327 C  CG    . MET C 3 474 ? 16.453  72.603 216.357 1.00 86.41 ? 470 MET A CG    1 
ATOM   4328 S  SD    . MET C 3 474 ? 15.590  73.981 215.557 1.00 89.73 ? 470 MET A SD    1 
ATOM   4329 C  CE    . MET C 3 474 ? 13.941  73.275 215.321 1.00 89.94 ? 470 MET A CE    1 
ATOM   4330 N  N     . ALA C 3 475 ? 18.189  71.134 218.470 1.00 82.39 ? 471 ALA A N     1 
ATOM   4331 C  CA    . ALA C 3 475 ? 18.764  71.676 219.692 1.00 82.48 ? 471 ALA A CA    1 
ATOM   4332 C  C     . ALA C 3 475 ? 19.972  70.856 220.129 1.00 82.75 ? 471 ALA A C     1 
ATOM   4333 O  O     . ALA C 3 475 ? 20.665  71.219 221.075 1.00 83.50 ? 471 ALA A O     1 
ATOM   4334 C  CB    . ALA C 3 475 ? 17.719  71.712 220.799 1.00 82.58 ? 471 ALA A CB    1 
ATOM   4335 N  N     . GLN C 3 476 ? 20.225  69.748 219.445 1.00 83.03 ? 472 GLN A N     1 
ATOM   4336 C  CA    . GLN C 3 476 ? 21.372  68.913 219.772 1.00 83.92 ? 472 GLN A CA    1 
ATOM   4337 C  C     . GLN C 3 476 ? 22.210  68.718 218.518 1.00 84.26 ? 472 GLN A C     1 
ATOM   4338 O  O     . GLN C 3 476 ? 23.131  67.903 218.489 1.00 83.96 ? 472 GLN A O     1 
ATOM   4339 C  CB    . GLN C 3 476 ? 20.912  67.568 220.320 1.00 84.62 ? 472 GLN A CB    1 
ATOM   4340 C  CG    . GLN C 3 476 ? 19.965  66.833 219.412 1.00 86.13 ? 472 GLN A CG    1 
ATOM   4341 C  CD    . GLN C 3 476 ? 19.383  65.603 220.064 1.00 86.54 ? 472 GLN A CD    1 
ATOM   4342 O  OE1   . GLN C 3 476 ? 18.765  65.678 221.128 1.00 86.52 ? 472 GLN A OE1   1 
ATOM   4343 N  NE2   . GLN C 3 476 ? 19.578  64.456 219.430 1.00 87.75 ? 472 GLN A NE2   1 
ATOM   4344 N  N     . GLY C 3 477 ? 21.872  69.481 217.482 1.00 84.67 ? 473 GLY A N     1 
ATOM   4345 C  CA    . GLY C 3 477 ? 22.598  69.424 216.226 1.00 85.19 ? 473 GLY A CA    1 
ATOM   4346 C  C     . GLY C 3 477 ? 22.380  68.181 215.387 1.00 86.37 ? 473 GLY A C     1 
ATOM   4347 O  O     . GLY C 3 477 ? 23.096  67.192 215.534 1.00 88.09 ? 473 GLY A O     1 
ATOM   4348 N  N     . ILE C 3 478 ? 21.399  68.234 214.493 1.00 85.78 ? 474 ILE A N     1 
ATOM   4349 C  CA    . ILE C 3 478 ? 21.098  67.106 213.624 1.00 84.50 ? 474 ILE A CA    1 
ATOM   4350 C  C     . ILE C 3 478 ? 20.372  67.602 212.382 1.00 85.49 ? 474 ILE A C     1 
ATOM   4351 O  O     . ILE C 3 478 ? 19.451  68.411 212.475 1.00 85.25 ? 474 ILE A O     1 
ATOM   4352 C  CB    . ILE C 3 478 ? 20.224  66.059 214.355 1.00 84.81 ? 474 ILE A CB    1 
ATOM   4353 C  CG1   . ILE C 3 478 ? 21.054  65.336 215.421 1.00 84.77 ? 474 ILE A CG1   1 
ATOM   4354 C  CG2   . ILE C 3 478 ? 19.653  65.070 213.358 1.00 85.73 ? 474 ILE A CG2   1 
ATOM   4355 C  CD1   . ILE C 3 478 ? 20.281  64.347 216.256 1.00 85.19 ? 474 ILE A CD1   1 
ATOM   4356 N  N     . LYS C 3 479 ? 20.799  67.125 211.218 1.00 85.01 ? 475 LYS A N     1 
ATOM   4357 C  CA    . LYS C 3 479 ? 20.185  67.524 209.953 1.00 83.94 ? 475 LYS A CA    1 
ATOM   4358 C  C     . LYS C 3 479 ? 18.703  67.142 209.912 1.00 82.77 ? 475 LYS A C     1 
ATOM   4359 O  O     . LYS C 3 479 ? 18.359  65.960 209.944 1.00 83.35 ? 475 LYS A O     1 
ATOM   4360 C  CB    . LYS C 3 479 ? 20.927  66.863 208.782 1.00 86.34 ? 475 LYS A CB    1 
ATOM   4361 C  CG    . LYS C 3 479 ? 20.426  67.270 207.395 1.00 87.91 ? 475 LYS A CG    1 
ATOM   4362 C  CD    . LYS C 3 479 ? 21.209  66.570 206.288 1.00 88.40 ? 475 LYS A CD    1 
ATOM   4363 C  CE    . LYS C 3 479 ? 20.840  67.104 204.911 1.00 88.82 ? 475 LYS A CE    1 
ATOM   4364 N  NZ    . LYS C 3 479 ? 21.633  66.481 203.812 1.00 89.45 ? 475 LYS A NZ    1 
ATOM   4365 N  N     . ILE C 3 480 ? 17.832  68.146 209.834 1.00 80.40 ? 476 ILE A N     1 
ATOM   4366 C  CA    . ILE C 3 480 ? 16.387  67.916 209.796 1.00 77.95 ? 476 ILE A CA    1 
ATOM   4367 C  C     . ILE C 3 480 ? 15.785  68.140 208.406 1.00 78.38 ? 476 ILE A C     1 
ATOM   4368 O  O     . ILE C 3 480 ? 14.570  68.212 208.250 1.00 74.31 ? 476 ILE A O     1 
ATOM   4369 C  CB    . ILE C 3 480 ? 15.639  68.817 210.826 1.00 78.07 ? 476 ILE A CB    1 
ATOM   4370 C  CG1   . ILE C 3 480 ? 16.196  70.244 210.796 1.00 75.36 ? 476 ILE A CG1   1 
ATOM   4371 C  CG2   . ILE C 3 480 ? 15.781  68.244 212.225 1.00 76.24 ? 476 ILE A CG2   1 
ATOM   4372 C  CD1   . ILE C 3 480 ? 15.913  71.008 209.510 1.00 74.23 ? 476 ILE A CD1   1 
ATOM   4373 N  N     . GLY C 3 481 ? 16.650  68.253 207.401 1.00 77.37 ? 477 GLY A N     1 
ATOM   4374 C  CA    . GLY C 3 481 ? 16.205  68.460 206.027 1.00 76.20 ? 477 GLY A CA    1 
ATOM   4375 C  C     . GLY C 3 481 ? 17.358  68.676 205.057 1.00 78.56 ? 477 GLY A C     1 
ATOM   4376 O  O     . GLY C 3 481 ? 18.500  68.874 205.540 1.00 78.16 ? 477 GLY A O     1 
ATOM   4377 O  OXT   . GLY C 3 481 ? 17.118  68.646 203.823 1.00 78.28 ? 477 GLY A OXT   1 
HETATM 4378 MN MN    . MN  D 4 .   ? -32.186 63.014 229.339 1.00 50.48 ? 500 MN  A MN    1 
HETATM 4379 MN MN    . MN  E 4 .   ? -35.379 62.286 232.221 0.50 58.48 ? 501 MN  A MN    1 
HETATM 4380 O  O     . HOH F 5 .   ? -34.158 63.059 209.122 1.00 1.00  ? 502 HOH B O     1 
HETATM 4381 O  O     . HOH F 5 .   ? -16.566 70.839 190.567 1.00 21.66 ? 515 HOH B O     1 
HETATM 4382 O  O     . HOH F 5 .   ? -21.157 75.051 175.824 1.00 57.89 ? 520 HOH B O     1 
HETATM 4383 O  O     . HOH F 5 .   ? -25.544 63.721 207.177 1.00 5.39  ? 526 HOH B O     1 
HETATM 4384 O  O     . HOH F 5 .   ? -32.404 61.435 209.784 1.00 19.41 ? 532 HOH B O     1 
HETATM 4385 O  O     . HOH F 5 .   ? -27.057 64.936 205.443 1.00 18.11 ? 537 HOH B O     1 
HETATM 4386 O  O     . HOH F 5 .   ? -16.225 74.649 191.704 1.00 21.47 ? 541 HOH B O     1 
HETATM 4387 O  O     . HOH F 5 .   ? -12.972 82.051 169.687 1.00 28.63 ? 551 HOH B O     1 
HETATM 4388 O  O     . HOH F 5 .   ? -21.536 74.455 187.511 1.00 24.98 ? 557 HOH B O     1 
HETATM 4389 O  O     . HOH F 5 .   ? -23.895 78.824 204.690 1.00 32.61 ? 561 HOH B O     1 
HETATM 4390 O  O     . HOH F 5 .   ? -28.015 55.496 212.430 1.00 25.79 ? 566 HOH B O     1 
HETATM 4391 O  O     . HOH F 5 .   ? -35.341 67.867 207.255 1.00 45.29 ? 574 HOH B O     1 
HETATM 4392 O  O     . HOH F 5 .   ? -26.618 78.453 206.785 1.00 30.85 ? 576 HOH B O     1 
HETATM 4393 O  O     . HOH F 5 .   ? -32.179 59.407 219.066 1.00 29.43 ? 577 HOH B O     1 
HETATM 4394 O  O     . HOH F 5 .   ? -33.517 62.519 214.367 1.00 21.66 ? 583 HOH B O     1 
HETATM 4395 O  O     . HOH F 5 .   ? -33.333 63.085 211.811 1.00 13.00 ? 592 HOH B O     1 
HETATM 4396 O  O     . HOH F 5 .   ? -31.680 73.980 201.793 1.00 35.95 ? 593 HOH B O     1 
HETATM 4397 O  O     . HOH F 5 .   ? -24.909 64.224 209.792 1.00 31.29 ? 595 HOH B O     1 
HETATM 4398 O  O     . HOH F 5 .   ? -35.617 76.207 208.240 1.00 61.61 ? 604 HOH B O     1 
HETATM 4399 O  O     . HOH F 5 .   ? -13.047 87.894 202.812 1.00 28.61 ? 611 HOH B O     1 
HETATM 4400 O  O     . HOH F 5 .   ? -28.953 55.683 207.291 1.00 10.41 ? 613 HOH B O     1 
HETATM 4401 O  O     . HOH F 5 .   ? -31.455 61.346 202.160 1.00 28.79 ? 614 HOH B O     1 
HETATM 4402 O  O     . HOH F 5 .   ? -8.551  78.809 189.970 1.00 48.72 ? 615 HOH B O     1 
HETATM 4403 O  O     . HOH F 5 .   ? -10.862 79.190 199.842 1.00 40.34 ? 628 HOH B O     1 
HETATM 4404 O  O     . HOH F 5 .   ? -13.088 78.831 168.704 1.00 45.76 ? 634 HOH B O     1 
HETATM 4405 O  O     . HOH F 5 .   ? -19.492 86.572 194.934 1.00 37.45 ? 642 HOH B O     1 
HETATM 4406 O  O     . HOH F 5 .   ? -28.684 57.853 215.639 1.00 42.26 ? 648 HOH B O     1 
HETATM 4407 O  O     . HOH F 5 .   ? -32.336 60.279 222.856 1.00 51.01 ? 658 HOH B O     1 
HETATM 4408 O  O     . HOH F 5 .   ? -32.941 58.268 221.636 1.00 46.52 ? 660 HOH B O     1 
HETATM 4409 O  O     . HOH F 5 .   ? -31.361 60.485 212.126 1.00 50.73 ? 662 HOH B O     1 
HETATM 4410 O  O     . HOH F 5 .   ? -30.950 77.210 200.212 1.00 43.85 ? 677 HOH B O     1 
HETATM 4411 O  O     . HOH F 5 .   ? -21.791 78.043 187.595 1.00 34.63 ? 686 HOH B O     1 
HETATM 4412 O  O     . HOH F 5 .   ? -17.779 82.452 201.693 1.00 36.06 ? 694 HOH B O     1 
HETATM 4413 O  O     . HOH F 5 .   ? -29.172 52.910 213.573 1.00 59.56 ? 697 HOH B O     1 
HETATM 4414 O  O     . HOH F 5 .   ? -31.474 56.881 207.949 1.00 45.33 ? 715 HOH B O     1 
HETATM 4415 O  O     . HOH F 5 .   ? -23.734 65.225 212.604 1.00 32.71 ? 722 HOH B O     1 
HETATM 4416 O  O     . HOH F 5 .   ? -10.031 80.015 169.118 1.00 51.98 ? 724 HOH B O     1 
HETATM 4417 O  O     . HOH G 5 .   ? -34.712 72.646 219.569 1.00 25.72 ? 503 HOH C O     1 
HETATM 4418 O  O     . HOH G 5 .   ? -30.316 71.859 200.717 1.00 34.78 ? 506 HOH C O     1 
HETATM 4419 O  O     . HOH G 5 .   ? -21.958 61.497 205.383 1.00 17.82 ? 511 HOH C O     1 
HETATM 4420 O  O     . HOH G 5 .   ? -17.301 71.101 212.185 1.00 6.14  ? 522 HOH C O     1 
HETATM 4421 O  O     . HOH G 5 .   ? -37.695 68.772 219.693 1.00 57.34 ? 568 HOH C O     1 
HETATM 4422 O  O     . HOH G 5 .   ? -22.650 75.540 194.358 1.00 31.58 ? 571 HOH C O     1 
HETATM 4423 O  O     . HOH G 5 .   ? -40.872 65.775 225.440 1.00 39.31 ? 579 HOH C O     1 
HETATM 4424 O  O     . HOH G 5 .   ? -27.399 72.821 224.971 1.00 43.93 ? 581 HOH C O     1 
HETATM 4425 O  O     . HOH G 5 .   ? -27.920 73.800 190.010 1.00 55.95 ? 587 HOH C O     1 
HETATM 4426 O  O     . HOH G 5 .   ? -25.782 91.209 187.873 1.00 39.87 ? 601 HOH C O     1 
HETATM 4427 O  O     . HOH G 5 .   ? -12.363 80.536 186.899 1.00 33.90 ? 622 HOH C O     1 
HETATM 4428 O  O     . HOH G 5 .   ? -24.522 67.567 218.674 1.00 26.80 ? 630 HOH C O     1 
HETATM 4429 O  O     . HOH G 5 .   ? -33.253 82.760 193.114 1.00 55.75 ? 645 HOH C O     1 
HETATM 4430 O  O     . HOH G 5 .   ? -25.028 76.349 216.967 1.00 40.91 ? 649 HOH C O     1 
HETATM 4431 O  O     . HOH G 5 .   ? -33.562 72.354 229.525 1.00 38.03 ? 656 HOH C O     1 
HETATM 4432 O  O     . HOH G 5 .   ? -23.110 61.917 207.595 1.00 13.36 ? 664 HOH C O     1 
HETATM 4433 O  O     . HOH G 5 .   ? -33.182 74.661 225.612 1.00 26.33 ? 666 HOH C O     1 
HETATM 4434 O  O     . HOH G 5 .   ? -25.511 75.202 214.695 1.00 33.89 ? 669 HOH C O     1 
HETATM 4435 O  O     . HOH G 5 .   ? -40.513 70.453 222.914 1.00 34.42 ? 670 HOH C O     1 
HETATM 4436 O  O     . HOH G 5 .   ? -33.228 75.180 219.833 1.00 38.37 ? 703 HOH C O     1 
HETATM 4437 O  O     . HOH G 5 .   ? -25.219 78.423 191.065 1.00 38.30 ? 717 HOH C O     1 
HETATM 4438 O  O     . HOH G 5 .   ? -15.479 86.894 190.053 1.00 40.57 ? 723 HOH C O     1 
HETATM 4439 O  O     . HOH H 5 .   ? -23.544 83.227 204.350 1.00 45.49 ? 504 HOH A O     1 
HETATM 4440 O  O     . HOH H 5 .   ? -8.816  43.199 231.707 1.00 62.41 ? 505 HOH A O     1 
HETATM 4441 O  O     . HOH H 5 .   ? -22.312 45.300 223.109 1.00 13.73 ? 507 HOH A O     1 
HETATM 4442 O  O     . HOH H 5 .   ? -22.362 76.755 211.426 1.00 26.48 ? 508 HOH A O     1 
HETATM 4443 O  O     . HOH H 5 .   ? -21.096 73.396 210.421 1.00 29.57 ? 509 HOH A O     1 
HETATM 4444 O  O     . HOH H 5 .   ? -39.016 67.256 230.759 1.00 26.55 ? 510 HOH A O     1 
HETATM 4445 O  O     . HOH H 5 .   ? -33.794 42.809 228.112 1.00 28.80 ? 512 HOH A O     1 
HETATM 4446 O  O     . HOH H 5 .   ? -12.688 67.393 234.669 1.00 7.15  ? 513 HOH A O     1 
HETATM 4447 O  O     . HOH H 5 .   ? -25.412 80.741 249.947 1.00 20.11 ? 514 HOH A O     1 
HETATM 4448 O  O     . HOH H 5 .   ? -52.150 71.192 245.325 1.00 36.63 ? 516 HOH A O     1 
HETATM 4449 O  O     . HOH H 5 .   ? -7.757  48.284 222.887 1.00 66.26 ? 517 HOH A O     1 
HETATM 4450 O  O     . HOH H 5 .   ? -20.131 54.551 219.408 1.00 15.76 ? 518 HOH A O     1 
HETATM 4451 O  O     . HOH H 5 .   ? -18.527 41.362 237.245 1.00 36.44 ? 519 HOH A O     1 
HETATM 4452 O  O     . HOH H 5 .   ? -20.476 57.039 241.920 1.00 25.24 ? 521 HOH A O     1 
HETATM 4453 O  O     . HOH H 5 .   ? -38.522 46.229 236.792 1.00 7.89  ? 523 HOH A O     1 
HETATM 4454 O  O     . HOH H 5 .   ? -14.993 40.816 224.943 1.00 33.32 ? 524 HOH A O     1 
HETATM 4455 O  O     . HOH H 5 .   ? -46.879 88.116 236.741 1.00 27.81 ? 525 HOH A O     1 
HETATM 4456 O  O     . HOH H 5 .   ? -1.901  51.211 232.248 1.00 47.33 ? 527 HOH A O     1 
HETATM 4457 O  O     . HOH H 5 .   ? -19.931 54.611 223.011 1.00 31.11 ? 528 HOH A O     1 
HETATM 4458 O  O     . HOH H 5 .   ? -33.608 73.306 227.450 1.00 23.71 ? 529 HOH A O     1 
HETATM 4459 O  O     . HOH H 5 .   ? -24.517 81.890 217.118 1.00 45.81 ? 530 HOH A O     1 
HETATM 4460 O  O     . HOH H 5 .   ? -44.120 72.085 231.160 1.00 44.40 ? 531 HOH A O     1 
HETATM 4461 O  O     . HOH H 5 .   ? -40.872 69.987 225.534 1.00 30.75 ? 533 HOH A O     1 
HETATM 4462 O  O     . HOH H 5 .   ? -43.127 81.290 247.248 1.00 36.10 ? 534 HOH A O     1 
HETATM 4463 O  O     . HOH H 5 .   ? -11.095 49.993 225.132 1.00 19.74 ? 535 HOH A O     1 
HETATM 4464 O  O     . HOH H 5 .   ? -20.529 45.804 237.994 1.00 48.17 ? 536 HOH A O     1 
HETATM 4465 O  O     . HOH H 5 .   ? -0.232  70.200 230.424 1.00 20.82 ? 538 HOH A O     1 
HETATM 4466 O  O     . HOH H 5 .   ? -11.462 57.591 225.644 1.00 19.87 ? 539 HOH A O     1 
HETATM 4467 O  O     . HOH H 5 .   ? -23.201 48.433 223.235 1.00 19.64 ? 540 HOH A O     1 
HETATM 4468 O  O     . HOH H 5 .   ? -44.826 60.147 235.760 1.00 37.35 ? 542 HOH A O     1 
HETATM 4469 O  O     . HOH H 5 .   ? 0.710   54.130 231.782 1.00 42.65 ? 543 HOH A O     1 
HETATM 4470 O  O     . HOH H 5 .   ? -6.346  45.951 250.125 1.00 24.48 ? 544 HOH A O     1 
HETATM 4471 O  O     . HOH H 5 .   ? -32.456 87.920 234.096 1.00 33.28 ? 545 HOH A O     1 
HETATM 4472 O  O     . HOH H 5 .   ? 3.304   39.802 223.075 1.00 29.29 ? 546 HOH A O     1 
HETATM 4473 O  O     . HOH H 5 .   ? 4.125   46.355 243.656 1.00 44.55 ? 547 HOH A O     1 
HETATM 4474 O  O     . HOH H 5 .   ? -26.384 47.883 222.442 1.00 23.13 ? 548 HOH A O     1 
HETATM 4475 O  O     . HOH H 5 .   ? -35.403 55.380 235.421 1.00 15.66 ? 549 HOH A O     1 
HETATM 4476 O  O     . HOH H 5 .   ? -33.495 45.463 227.600 1.00 21.81 ? 550 HOH A O     1 
HETATM 4477 O  O     . HOH H 5 .   ? -18.151 71.696 209.573 1.00 16.82 ? 552 HOH A O     1 
HETATM 4478 O  O     . HOH H 5 .   ? -24.142 53.645 242.280 1.00 48.49 ? 553 HOH A O     1 
HETATM 4479 O  O     . HOH H 5 .   ? -26.443 60.646 233.290 1.00 27.39 ? 554 HOH A O     1 
HETATM 4480 O  O     . HOH H 5 .   ? -13.493 53.727 221.529 1.00 8.59  ? 555 HOH A O     1 
HETATM 4481 O  O     . HOH H 5 .   ? 2.779   51.139 233.442 1.00 31.22 ? 556 HOH A O     1 
HETATM 4482 O  O     . HOH H 5 .   ? -6.028  42.492 238.550 1.00 35.99 ? 558 HOH A O     1 
HETATM 4483 O  O     . HOH H 5 .   ? -32.590 44.871 221.517 1.00 37.47 ? 559 HOH A O     1 
HETATM 4484 O  O     . HOH H 5 .   ? -12.996 54.439 223.936 1.00 24.80 ? 560 HOH A O     1 
HETATM 4485 O  O     . HOH H 5 .   ? -18.484 73.012 255.264 1.00 41.81 ? 562 HOH A O     1 
HETATM 4486 O  O     . HOH H 5 .   ? -6.185  53.771 247.763 1.00 39.89 ? 563 HOH A O     1 
HETATM 4487 O  O     . HOH H 5 .   ? -39.603 51.889 239.699 1.00 35.72 ? 564 HOH A O     1 
HETATM 4488 O  O     . HOH H 5 .   ? 2.617   69.918 231.329 1.00 37.10 ? 565 HOH A O     1 
HETATM 4489 O  O     . HOH H 5 .   ? -15.026 66.346 238.585 1.00 17.18 ? 567 HOH A O     1 
HETATM 4490 O  O     . HOH H 5 .   ? -22.412 75.262 213.894 1.00 33.13 ? 569 HOH A O     1 
HETATM 4491 O  O     . HOH H 5 .   ? -19.006 60.264 237.401 1.00 25.83 ? 570 HOH A O     1 
HETATM 4492 O  O     . HOH H 5 .   ? -0.402  51.554 220.836 1.00 44.95 ? 572 HOH A O     1 
HETATM 4493 O  O     . HOH H 5 .   ? -35.727 92.622 240.391 1.00 35.19 ? 573 HOH A O     1 
HETATM 4494 O  O     . HOH H 5 .   ? -31.581 66.077 243.712 1.00 40.96 ? 575 HOH A O     1 
HETATM 4495 O  O     . HOH H 5 .   ? -39.959 56.356 215.244 1.00 49.31 ? 578 HOH A O     1 
HETATM 4496 O  O     . HOH H 5 .   ? -4.017  68.363 227.117 1.00 49.32 ? 580 HOH A O     1 
HETATM 4497 O  O     . HOH H 5 .   ? -14.412 85.650 228.341 1.00 39.16 ? 582 HOH A O     1 
HETATM 4498 O  O     . HOH H 5 .   ? -19.917 47.445 240.859 1.00 18.83 ? 584 HOH A O     1 
HETATM 4499 O  O     . HOH H 5 .   ? -18.701 49.830 243.197 1.00 27.82 ? 585 HOH A O     1 
HETATM 4500 O  O     . HOH H 5 .   ? -5.881  74.791 210.223 1.00 41.72 ? 586 HOH A O     1 
HETATM 4501 O  O     . HOH H 5 .   ? -29.162 39.978 226.523 1.00 54.23 ? 588 HOH A O     1 
HETATM 4502 O  O     . HOH H 5 .   ? -40.985 44.635 229.876 1.00 37.06 ? 589 HOH A O     1 
HETATM 4503 O  O     . HOH H 5 .   ? -32.967 66.637 233.335 1.00 20.84 ? 590 HOH A O     1 
HETATM 4504 O  O     . HOH H 5 .   ? -45.056 90.452 225.705 1.00 42.99 ? 591 HOH A O     1 
HETATM 4505 O  O     . HOH H 5 .   ? -13.077 68.222 247.529 1.00 26.25 ? 594 HOH A O     1 
HETATM 4506 O  O     . HOH H 5 .   ? -50.186 84.133 242.773 1.00 42.21 ? 596 HOH A O     1 
HETATM 4507 O  O     . HOH H 5 .   ? -33.096 55.523 242.904 1.00 43.38 ? 597 HOH A O     1 
HETATM 4508 O  O     . HOH H 5 .   ? -29.282 79.054 250.348 1.00 39.76 ? 598 HOH A O     1 
HETATM 4509 O  O     . HOH H 5 .   ? -15.701 68.612 212.136 1.00 14.56 ? 599 HOH A O     1 
HETATM 4510 O  O     . HOH H 5 .   ? -25.947 73.284 227.112 1.00 26.00 ? 600 HOH A O     1 
HETATM 4511 O  O     . HOH H 5 .   ? -29.513 59.295 242.252 1.00 43.55 ? 602 HOH A O     1 
HETATM 4512 O  O     . HOH H 5 .   ? -29.714 75.491 247.392 1.00 56.63 ? 603 HOH A O     1 
HETATM 4513 O  O     . HOH H 5 .   ? 2.604   61.828 222.364 1.00 46.31 ? 605 HOH A O     1 
HETATM 4514 O  O     . HOH H 5 .   ? -48.673 52.962 211.206 1.00 51.07 ? 606 HOH A O     1 
HETATM 4515 O  O     . HOH H 5 .   ? 0.009   57.094 227.560 1.00 31.45 ? 607 HOH A O     1 
HETATM 4516 O  O     . HOH H 5 .   ? -58.134 75.118 236.839 1.00 34.38 ? 608 HOH A O     1 
HETATM 4517 O  O     . HOH H 5 .   ? -33.082 63.669 250.042 1.00 15.63 ? 609 HOH A O     1 
HETATM 4518 O  O     . HOH H 5 .   ? -15.094 43.231 241.171 1.00 26.28 ? 610 HOH A O     1 
HETATM 4519 O  O     . HOH H 5 .   ? -20.026 49.585 245.498 1.00 37.03 ? 612 HOH A O     1 
HETATM 4520 O  O     . HOH H 5 .   ? -10.939 63.692 227.383 1.00 32.85 ? 616 HOH A O     1 
HETATM 4521 O  O     . HOH H 5 .   ? -19.440 77.547 246.496 1.00 27.28 ? 617 HOH A O     1 
HETATM 4522 O  O     . HOH H 5 .   ? -44.327 62.124 245.425 1.00 32.82 ? 618 HOH A O     1 
HETATM 4523 O  O     . HOH H 5 .   ? -30.248 83.085 239.868 1.00 41.34 ? 619 HOH A O     1 
HETATM 4524 O  O     . HOH H 5 .   ? -25.739 75.359 252.228 1.00 42.14 ? 620 HOH A O     1 
HETATM 4525 O  O     . HOH H 5 .   ? -35.660 49.587 239.422 1.00 34.85 ? 621 HOH A O     1 
HETATM 4526 O  O     . HOH H 5 .   ? -28.631 47.862 240.534 1.00 32.07 ? 623 HOH A O     1 
HETATM 4527 O  O     . HOH H 5 .   ? -31.056 48.340 233.793 1.00 52.16 ? 624 HOH A O     1 
HETATM 4528 O  O     . HOH H 5 .   ? -11.921 36.510 226.077 1.00 42.71 ? 625 HOH A O     1 
HETATM 4529 O  O     . HOH H 5 .   ? -5.282  66.346 225.236 1.00 40.59 ? 626 HOH A O     1 
HETATM 4530 O  O     . HOH H 5 .   ? -14.743 69.406 222.947 1.00 19.51 ? 627 HOH A O     1 
HETATM 4531 O  O     . HOH H 5 .   ? -45.645 62.577 243.308 1.00 43.34 ? 629 HOH A O     1 
HETATM 4532 O  O     . HOH H 5 .   ? -44.004 82.847 218.096 1.00 31.82 ? 631 HOH A O     1 
HETATM 4533 O  O     . HOH H 5 .   ? -39.965 63.951 230.428 1.00 57.49 ? 632 HOH A O     1 
HETATM 4534 O  O     . HOH H 5 .   ? -15.869 73.864 231.688 1.00 53.98 ? 633 HOH A O     1 
HETATM 4535 O  O     . HOH H 5 .   ? -19.198 60.630 240.226 1.00 22.87 ? 635 HOH A O     1 
HETATM 4536 O  O     . HOH H 5 .   ? -11.700 50.142 245.589 1.00 35.34 ? 636 HOH A O     1 
HETATM 4537 O  O     . HOH H 5 .   ? -33.266 39.821 235.100 1.00 57.14 ? 637 HOH A O     1 
HETATM 4538 O  O     . HOH H 5 .   ? -42.911 64.201 251.993 1.00 65.03 ? 638 HOH A O     1 
HETATM 4539 O  O     . HOH H 5 .   ? -14.232 65.051 234.147 1.00 29.12 ? 639 HOH A O     1 
HETATM 4540 O  O     . HOH H 5 .   ? -4.664  63.243 216.377 1.00 30.43 ? 640 HOH A O     1 
HETATM 4541 O  O     . HOH H 5 .   ? -13.037 61.017 216.129 1.00 54.85 ? 641 HOH A O     1 
HETATM 4542 O  O     . HOH H 5 .   ? -26.782 43.062 217.801 1.00 38.00 ? 643 HOH A O     1 
HETATM 4543 O  O     . HOH H 5 .   ? -36.957 48.316 223.028 1.00 38.86 ? 644 HOH A O     1 
HETATM 4544 O  O     . HOH H 5 .   ? -19.762 37.857 236.110 1.00 42.73 ? 646 HOH A O     1 
HETATM 4545 O  O     . HOH H 5 .   ? -36.762 39.584 237.664 1.00 52.57 ? 647 HOH A O     1 
HETATM 4546 O  O     . HOH H 5 .   ? -11.772 89.182 225.147 1.00 67.11 ? 650 HOH A O     1 
HETATM 4547 O  O     . HOH H 5 .   ? -10.384 61.652 217.652 1.00 55.81 ? 651 HOH A O     1 
HETATM 4548 O  O     . HOH H 5 .   ? -45.231 72.611 228.886 1.00 29.34 ? 652 HOH A O     1 
HETATM 4549 O  O     . HOH H 5 .   ? -13.901 76.956 230.785 1.00 66.64 ? 653 HOH A O     1 
HETATM 4550 O  O     . HOH H 5 .   ? -16.182 69.383 209.811 1.00 21.70 ? 654 HOH A O     1 
HETATM 4551 O  O     . HOH H 5 .   ? -17.165 47.780 241.370 1.00 22.20 ? 657 HOH A O     1 
HETATM 4552 O  O     . HOH H 5 .   ? -32.974 53.021 242.065 1.00 31.32 ? 659 HOH A O     1 
HETATM 4553 O  O     . HOH H 5 .   ? -34.109 47.249 221.082 1.00 44.08 ? 661 HOH A O     1 
HETATM 4554 O  O     . HOH H 5 .   ? -15.825 66.015 236.390 1.00 13.50 ? 663 HOH A O     1 
HETATM 4555 O  O     . HOH H 5 .   ? -21.130 56.872 218.661 1.00 31.44 ? 665 HOH A O     1 
HETATM 4556 O  O     . HOH H 5 .   ? -19.943 56.713 244.379 1.00 23.04 ? 667 HOH A O     1 
HETATM 4557 O  O     . HOH H 5 .   ? -9.068  62.626 243.757 1.00 31.78 ? 668 HOH A O     1 
HETATM 4558 O  O     . HOH H 5 .   ? -22.719 69.612 220.179 1.00 43.96 ? 671 HOH A O     1 
HETATM 4559 O  O     . HOH H 5 .   ? -29.300 39.807 234.900 1.00 36.84 ? 672 HOH A O     1 
HETATM 4560 O  O     . HOH H 5 .   ? 1.869   55.607 228.586 1.00 42.50 ? 673 HOH A O     1 
HETATM 4561 O  O     . HOH H 5 .   ? -13.187 68.009 237.207 1.00 19.95 ? 674 HOH A O     1 
HETATM 4562 O  O     . HOH H 5 .   ? 4.206   73.439 224.321 1.00 53.66 ? 675 HOH A O     1 
HETATM 4563 O  O     . HOH H 5 .   ? -12.822 51.512 222.691 1.00 36.31 ? 676 HOH A O     1 
HETATM 4564 O  O     . HOH H 5 .   ? -33.027 42.384 219.308 1.00 36.48 ? 678 HOH A O     1 
HETATM 4565 O  O     . HOH H 5 .   ? -41.564 43.070 227.950 1.00 44.77 ? 679 HOH A O     1 
HETATM 4566 O  O     . HOH H 5 .   ? -4.831  39.511 236.937 1.00 50.14 ? 680 HOH A O     1 
HETATM 4567 O  O     . HOH H 5 .   ? -42.593 47.010 230.604 1.00 38.09 ? 681 HOH A O     1 
HETATM 4568 O  O     . HOH H 5 .   ? -36.365 63.083 215.305 1.00 46.51 ? 682 HOH A O     1 
HETATM 4569 O  O     . HOH H 5 .   ? -2.266  65.819 226.758 1.00 40.11 ? 683 HOH A O     1 
HETATM 4570 O  O     . HOH H 5 .   ? -4.408  64.278 214.123 1.00 34.67 ? 684 HOH A O     1 
HETATM 4571 O  O     . HOH H 5 .   ? -0.830  54.199 219.419 1.00 45.32 ? 685 HOH A O     1 
HETATM 4572 O  O     . HOH H 5 .   ? -2.768  64.009 219.735 1.00 43.90 ? 687 HOH A O     1 
HETATM 4573 O  O     . HOH H 5 .   ? -20.647 50.369 220.248 1.00 35.87 ? 688 HOH A O     1 
HETATM 4574 O  O     . HOH H 5 .   ? 0.496   52.252 239.998 1.00 41.96 ? 689 HOH A O     1 
HETATM 4575 O  O     . HOH H 5 .   ? -35.713 55.916 233.021 1.00 31.36 ? 690 HOH A O     1 
HETATM 4576 O  O     . HOH H 5 .   ? -32.467 81.904 220.469 1.00 46.59 ? 691 HOH A O     1 
HETATM 4577 O  O     . HOH H 5 .   ? -36.115 60.866 234.648 1.00 50.68 ? 692 HOH A O     1 
HETATM 4578 O  O     . HOH H 5 .   ? -20.594 82.270 212.240 1.00 56.75 ? 693 HOH A O     1 
HETATM 4579 O  O     . HOH H 5 .   ? -20.698 51.285 241.831 1.00 49.15 ? 695 HOH A O     1 
HETATM 4580 O  O     . HOH H 5 .   ? -4.976  46.352 239.898 1.00 43.88 ? 696 HOH A O     1 
HETATM 4581 O  O     . HOH H 5 .   ? 6.920   51.610 228.889 1.00 47.28 ? 698 HOH A O     1 
HETATM 4582 O  O     . HOH H 5 .   ? -10.060 66.549 245.232 1.00 39.07 ? 699 HOH A O     1 
HETATM 4583 O  O     . HOH H 5 .   ? -12.943 57.569 246.174 1.00 31.20 ? 700 HOH A O     1 
HETATM 4584 O  O     . HOH H 5 .   ? -21.333 53.337 221.365 1.00 61.20 ? 701 HOH A O     1 
HETATM 4585 O  O     . HOH H 5 .   ? -4.481  65.024 222.887 1.00 38.16 ? 702 HOH A O     1 
HETATM 4586 O  O     . HOH H 5 .   ? -19.534 53.483 217.216 1.00 46.43 ? 704 HOH A O     1 
HETATM 4587 O  O     . HOH H 5 .   ? -33.773 47.554 225.637 1.00 45.57 ? 705 HOH A O     1 
HETATM 4588 O  O     . HOH H 5 .   ? -49.536 68.551 244.369 1.00 42.61 ? 706 HOH A O     1 
HETATM 4589 O  O     . HOH H 5 .   ? -40.647 86.306 243.753 1.00 43.63 ? 707 HOH A O     1 
HETATM 4590 O  O     . HOH H 5 .   ? -43.953 62.201 238.664 1.00 40.56 ? 708 HOH A O     1 
HETATM 4591 O  O     . HOH H 5 .   ? -49.867 80.512 247.285 1.00 53.94 ? 709 HOH A O     1 
HETATM 4592 O  O     . HOH H 5 .   ? -36.877 90.813 221.665 1.00 50.76 ? 710 HOH A O     1 
HETATM 4593 O  O     . HOH H 5 .   ? -36.855 36.634 232.843 1.00 62.69 ? 711 HOH A O     1 
HETATM 4594 O  O     . HOH H 5 .   ? -0.360  59.471 229.157 1.00 45.44 ? 712 HOH A O     1 
HETATM 4595 O  O     . HOH H 5 .   ? -12.893 70.946 249.358 1.00 53.13 ? 713 HOH A O     1 
HETATM 4596 O  O     . HOH H 5 .   ? -33.838 63.663 230.353 1.00 32.33 ? 714 HOH A O     1 
HETATM 4597 O  O     . HOH H 5 .   ? -34.731 50.406 222.765 1.00 40.70 ? 716 HOH A O     1 
HETATM 4598 O  O     . HOH H 5 .   ? -14.922 42.069 244.109 1.00 33.56 ? 718 HOH A O     1 
HETATM 4599 O  O     . HOH H 5 .   ? -56.330 66.556 238.386 1.00 50.72 ? 719 HOH A O     1 
HETATM 4600 O  O     . HOH H 5 .   ? -30.661 76.977 209.144 1.00 61.72 ? 720 HOH A O     1 
HETATM 4601 O  O     . HOH H 5 .   ? -39.651 46.635 234.533 1.00 32.58 ? 721 HOH A O     1 
HETATM 4602 O  O     . HOH H 5 .   ? -13.010 58.147 251.294 1.00 32.02 ? 725 HOH A O     1 
HETATM 4603 O  O     . HOH H 5 .   ? -8.072  65.062 214.716 1.00 53.46 ? 726 HOH A O     1 
HETATM 4604 O  O     . HOH H 5 .   ? -45.256 70.092 210.027 1.00 54.44 ? 727 HOH A O     1 
HETATM 4605 O  O     . HOH H 5 .   ? -12.039 73.866 208.647 1.00 47.26 ? 728 HOH A O     1 
HETATM 4606 O  O     . HOH H 5 .   ? -9.327  81.690 219.931 1.00 36.73 ? 729 HOH A O     1 
HETATM 4607 O  O     . HOH H 5 .   ? -12.779 82.849 212.228 1.00 51.62 ? 730 HOH A O     1 
HETATM 4608 O  O     . HOH H 5 .   ? -4.017  77.569 207.667 1.00 69.05 ? 731 HOH A O     1 
HETATM 4609 O  O     . HOH H 5 .   ? 6.007   76.438 224.969 1.00 38.87 ? 732 HOH A O     1 
HETATM 4610 O  O     . HOH H 5 .   ? -1.903  74.580 226.395 1.00 59.36 ? 733 HOH A O     1 
HETATM 4611 O  O     . HOH H 5 .   ? -8.918  89.778 224.020 1.00 49.09 ? 734 HOH A O     1 
HETATM 4612 O  O     . HOH H 5 .   ? -17.831 82.583 225.300 1.00 46.18 ? 735 HOH A O     1 
HETATM 4613 O  O     . HOH H 5 .   ? -14.393 64.623 227.933 1.00 47.35 ? 736 HOH A O     1 
HETATM 4614 O  O     . HOH H 5 .   ? -16.754 48.756 219.589 1.00 21.49 ? 737 HOH A O     1 
HETATM 4615 O  O     . HOH H 5 .   ? -38.566 86.131 232.495 1.00 41.10 ? 738 HOH A O     1 
HETATM 4616 O  O     . HOH H 5 .   ? -39.177 79.407 240.101 1.00 45.93 ? 739 HOH A O     1 
HETATM 4617 O  O     . HOH H 5 .   ? -52.302 78.401 212.932 1.00 49.76 ? 740 HOH A O     1 
HETATM 4618 O  O     . HOH H 5 .   ? -44.077 79.914 217.539 1.00 29.39 ? 741 HOH A O     1 
HETATM 4619 O  O     . HOH H 5 .   ? -49.404 83.743 222.111 1.00 55.49 ? 742 HOH A O     1 
HETATM 4620 O  O     . HOH H 5 .   ? -39.687 61.374 209.940 1.00 30.42 ? 743 HOH A O     1 
HETATM 4621 O  O     . HOH H 5 .   ? -42.605 89.161 225.119 1.00 61.50 ? 744 HOH A O     1 
HETATM 4622 O  O     . HOH H 5 .   ? -53.768 72.862 247.542 1.00 51.81 ? 745 HOH A O     1 
HETATM 4623 O  O     . HOH H 5 .   ? -20.468 60.266 242.278 1.00 33.74 ? 746 HOH A O     1 
HETATM 4624 O  O     . HOH H 5 .   ? -21.773 73.991 231.852 1.00 47.01 ? 747 HOH A O     1 
HETATM 4625 O  O     . HOH H 5 .   ? -34.806 43.737 220.949 1.00 63.27 ? 748 HOH A O     1 
HETATM 4626 O  O     . HOH H 5 .   ? -35.406 61.147 228.567 1.00 52.20 ? 749 HOH A O     1 
HETATM 4627 O  O     . HOH H 5 .   ? -21.232 81.675 240.167 1.00 49.68 ? 750 HOH A O     1 
HETATM 4628 O  O     . HOH H 5 .   ? -8.044  65.625 243.999 1.00 43.11 ? 751 HOH A O     1 
HETATM 4629 O  O     . HOH H 5 .   ? -11.136 63.291 245.128 1.00 34.42 ? 752 HOH A O     1 
HETATM 4630 O  O     . HOH H 5 .   ? -12.850 41.653 246.811 1.00 36.76 ? 753 HOH A O     1 
HETATM 4631 O  O     . HOH H 5 .   ? -11.303 40.648 232.345 1.00 49.37 ? 754 HOH A O     1 
HETATM 4632 O  O     . HOH H 5 .   ? 4.157   49.574 229.011 1.00 37.42 ? 755 HOH A O     1 
HETATM 4633 O  O     . HOH H 5 .   ? -9.037  56.301 226.326 1.00 32.10 ? 756 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   101 101 DG  GUA B . n 
A 1 2   DA  2   102 102 DA  ADE B . n 
A 1 3   DG  3   103 103 DG  GUA B . n 
A 1 4   DA  4   104 104 DA  ADE B . n 
A 1 5   DT  5   105 105 DT  THY B . n 
A 1 6   DG  6   106 106 DG  GUA B . n 
A 1 7   DT  7   107 107 DT  THY B . n 
A 1 8   DG  8   108 108 DG  GUA B . n 
A 1 9   DT  9   109 109 DT  THY B . n 
A 1 10  DA  10  110 110 DA  ADE B . n 
A 1 11  DT  11  111 111 DT  THY B . n 
A 1 12  DA  12  112 112 DA  ADE B . n 
A 1 13  DA  13  113 113 DA  ADE B . n 
A 1 14  DG  14  114 114 DG  GUA B . n 
A 1 15  DA  15  115 115 DA  ADE B . n 
A 1 16  DG  16  116 116 DG  GUA B . n 
A 1 17  DA  17  117 117 DA  ADE B . n 
A 1 18  DC  18  118 118 DC  CYT B . n 
A 1 19  DA  19  119 119 DA  ADE B . n 
A 1 20  DG  20  120 120 DG  GUA B . n 
B 2 1   DC  1   201 201 DC  CYT C . n 
B 2 2   DT  2   202 202 DT  THY C . n 
B 2 3   DG  3   203 203 DG  GUA C . n 
B 2 4   DT  4   204 204 DT  THY C . n 
B 2 5   DC  5   205 205 DC  CYT C . n 
B 2 6   DT  6   206 206 DT  THY C . n 
B 2 7   DC  7   207 207 DC  CYT C . n 
B 2 8   DT  8   208 208 DT  THY C . n 
B 2 9   DT  9   209 209 DT  THY C . n 
B 2 10  DA  10  210 210 DA  ADE C . n 
B 2 11  DT  11  211 211 DT  THY C . n 
B 2 12  DA  12  212 212 DA  ADE C . n 
B 2 13  DC  13  213 213 DC  CYT C . n 
B 2 14  DA  14  214 214 DA  ADE C . n 
B 2 15  DC  15  215 215 DC  CYT C . n 
B 2 16  DA  16  216 216 DA  ADE C . n 
B 2 17  DT  17  217 217 DT  THY C . n 
B 2 18  DC  18  218 218 DC  CYT C . n 
B 2 19  DT  19  219 219 DT  THY C . n 
B 2 20  DC  20  220 220 DC  CYT C . n 
C 3 1   MET 1   -3  ?   ?   ?   A . n 
C 3 2   VAL 2   -2  ?   ?   ?   A . n 
C 3 3   THR 3   -1  ?   ?   ?   A . n 
C 3 4   PHE 4   0   ?   ?   ?   A . n 
C 3 5   MET 5   1   ?   ?   ?   A . n 
C 3 6   ILE 6   2   ?   ?   ?   A . n 
C 3 7   THR 7   3   ?   ?   ?   A . n 
C 3 8   SER 8   4   ?   ?   ?   A . n 
C 3 9   ALA 9   5   5   ALA ALA A . n 
C 3 10  LEU 10  6   6   LEU LEU A . n 
C 3 11  HIS 11  7   7   HIS HIS A . n 
C 3 12  ARG 12  8   8   ARG ARG A . n 
C 3 13  ALA 13  9   9   ALA ALA A . n 
C 3 14  ALA 14  10  10  ALA ALA A . n 
C 3 15  ASP 15  11  11  ASP ASP A . n 
C 3 16  TRP 16  12  12  TRP TRP A . n 
C 3 17  ALA 17  13  13  ALA ALA A . n 
C 3 18  LYS 18  14  14  LYS LYS A . n 
C 3 19  SER 19  15  15  SER SER A . n 
C 3 20  VAL 20  16  16  VAL VAL A . n 
C 3 21  PHE 21  17  17  PHE PHE A . n 
C 3 22  SER 22  18  18  SER SER A . n 
C 3 23  SER 23  19  19  SER SER A . n 
C 3 24  ALA 24  20  20  ALA ALA A . n 
C 3 25  ALA 25  21  21  ALA ALA A . n 
C 3 26  LEU 26  22  22  LEU LEU A . n 
C 3 27  GLY 27  23  23  GLY GLY A . n 
C 3 28  ASP 28  24  24  ASP ASP A . n 
C 3 29  PRO 29  25  25  PRO PRO A . n 
C 3 30  ARG 30  26  26  ARG ARG A . n 
C 3 31  ARG 31  27  27  ARG ARG A . n 
C 3 32  THR 32  28  28  THR THR A . n 
C 3 33  ALA 33  29  29  ALA ALA A . n 
C 3 34  ARG 34  30  30  ARG ARG A . n 
C 3 35  LEU 35  31  31  LEU LEU A . n 
C 3 36  VAL 36  32  32  VAL VAL A . n 
C 3 37  ASN 37  33  33  ASN ASN A . n 
C 3 38  VAL 38  34  34  VAL VAL A . n 
C 3 39  ALA 39  35  35  ALA ALA A . n 
C 3 40  ALA 40  36  36  ALA ALA A . n 
C 3 41  GLN 41  37  37  GLN GLN A . n 
C 3 42  LEU 42  38  38  LEU LEU A . n 
C 3 43  ALA 43  39  39  ALA ALA A . n 
C 3 44  LYS 44  40  40  LYS LYS A . n 
C 3 45  TYR 45  41  41  TYR TYR A . n 
C 3 46  SER 46  42  42  SER SER A . n 
C 3 47  GLY 47  43  43  GLY GLY A . n 
C 3 48  LYS 48  44  44  LYS LYS A . n 
C 3 49  SER 49  45  45  SER SER A . n 
C 3 50  ILE 50  46  46  ILE ILE A . n 
C 3 51  THR 51  47  47  THR THR A . n 
C 3 52  ILE 52  48  48  ILE ILE A . n 
C 3 53  SER 53  49  49  SER SER A . n 
C 3 54  SER 54  50  50  SER SER A . n 
C 3 55  GLU 55  51  51  GLU GLU A . n 
C 3 56  GLY 56  52  52  GLY GLY A . n 
C 3 57  SER 57  53  53  SER SER A . n 
C 3 58  LYS 58  54  54  LYS LYS A . n 
C 3 59  ALA 59  55  55  ALA ALA A . n 
C 3 60  ALA 60  56  56  ALA ALA A . n 
C 3 61  GLN 61  57  57  GLN GLN A . n 
C 3 62  GLU 62  58  58  GLU GLU A . n 
C 3 63  GLY 63  59  59  GLY GLY A . n 
C 3 64  ALA 64  60  60  ALA ALA A . n 
C 3 65  TYR 65  61  61  TYR TYR A . n 
C 3 66  ARG 66  62  62  ARG ARG A . n 
C 3 67  PHE 67  63  63  PHE PHE A . n 
C 3 68  ILE 68  64  64  ILE ILE A . n 
C 3 69  ARG 69  65  65  ARG ARG A . n 
C 3 70  ASN 70  66  66  ASN ASN A . n 
C 3 71  PRO 71  67  67  PRO PRO A . n 
C 3 72  ASN 72  68  68  ASN ASN A . n 
C 3 73  VAL 73  69  69  VAL VAL A . n 
C 3 74  SER 74  70  70  SER SER A . n 
C 3 75  ALA 75  71  71  ALA ALA A . n 
C 3 76  GLU 76  72  72  GLU GLU A . n 
C 3 77  ALA 77  73  73  ALA ALA A . n 
C 3 78  ILE 78  74  74  ILE ILE A . n 
C 3 79  ARG 79  75  75  ARG ARG A . n 
C 3 80  LYS 80  76  76  LYS LYS A . n 
C 3 81  ALA 81  77  77  ALA ALA A . n 
C 3 82  GLY 82  78  78  GLY GLY A . n 
C 3 83  ALA 83  79  79  ALA ALA A . n 
C 3 84  MET 84  80  80  MET MET A . n 
C 3 85  GLN 85  81  81  GLN GLN A . n 
C 3 86  THR 86  82  82  THR THR A . n 
C 3 87  VAL 87  83  83  VAL VAL A . n 
C 3 88  LYS 88  84  84  LYS LYS A . n 
C 3 89  LEU 89  85  85  LEU LEU A . n 
C 3 90  ALA 90  86  86  ALA ALA A . n 
C 3 91  GLN 91  87  87  GLN GLN A . n 
C 3 92  GLU 92  88  88  GLU GLU A . n 
C 3 93  PHE 93  89  89  PHE PHE A . n 
C 3 94  PRO 94  90  90  PRO PRO A . n 
C 3 95  GLU 95  91  91  GLU GLU A . n 
C 3 96  LEU 96  92  92  LEU LEU A . n 
C 3 97  LEU 97  93  93  LEU LEU A . n 
C 3 98  ALA 98  94  94  ALA ALA A . n 
C 3 99  ILE 99  95  95  ILE ILE A . n 
C 3 100 GLU 100 96  96  GLU GLU A . n 
C 3 101 ASP 101 97  97  ASP ASP A . n 
C 3 102 THR 102 98  98  THR THR A . n 
C 3 103 THR 103 99  99  THR THR A . n 
C 3 104 SER 104 100 100 SER SER A . n 
C 3 105 LEU 105 101 101 LEU LEU A . n 
C 3 106 SER 106 102 102 SER SER A . n 
C 3 107 TYR 107 103 103 TYR TYR A . n 
C 3 108 ARG 108 104 104 ARG ARG A . n 
C 3 109 HIS 109 105 105 HIS HIS A . n 
C 3 110 GLN 110 106 106 GLN GLN A . n 
C 3 111 VAL 111 107 107 VAL VAL A . n 
C 3 112 ALA 112 108 108 ALA ALA A . n 
C 3 113 GLU 113 109 109 GLU GLU A . n 
C 3 114 GLU 114 110 110 GLU GLU A . n 
C 3 115 LEU 115 111 111 LEU LEU A . n 
C 3 116 GLY 116 112 112 GLY GLY A . n 
C 3 117 LYS 117 113 113 LYS LYS A . n 
C 3 118 LEU 118 114 114 LEU LEU A . n 
C 3 119 GLY 119 115 115 GLY GLY A . n 
C 3 120 SER 120 116 116 SER SER A . n 
C 3 121 ILE 121 117 117 ILE ILE A . n 
C 3 122 GLN 122 118 118 GLN GLN A . n 
C 3 123 ASP 123 119 119 ASP ASP A . n 
C 3 124 LYS 124 120 120 LYS ALA A . n 
C 3 125 SER 125 121 121 SER SER A . n 
C 3 126 ARG 126 122 122 ARG ARG A . n 
C 3 127 GLY 127 123 123 GLY GLY A . n 
C 3 128 TRP 128 124 124 TRP TRP A . n 
C 3 129 TRP 129 125 125 TRP TRP A . n 
C 3 130 VAL 130 126 126 VAL VAL A . n 
C 3 131 HIS 131 127 127 HIS HIS A . n 
C 3 132 SER 132 128 128 SER SER A . n 
C 3 133 VAL 133 129 129 VAL VAL A . n 
C 3 134 LEU 134 130 130 LEU LEU A . n 
C 3 135 LEU 135 131 131 LEU LEU A . n 
C 3 136 LEU 136 132 132 LEU LEU A . n 
C 3 137 GLU 137 133 133 GLU GLU A . n 
C 3 138 ALA 138 134 134 ALA ALA A . n 
C 3 139 THR 139 135 135 THR THR A . n 
C 3 140 THR 140 136 136 THR THR A . n 
C 3 141 PHE 141 137 137 PHE PHE A . n 
C 3 142 ARG 142 138 138 ARG ARG A . n 
C 3 143 THR 143 139 139 THR THR A . n 
C 3 144 VAL 144 140 140 VAL VAL A . n 
C 3 145 GLY 145 141 141 GLY GLY A . n 
C 3 146 LEU 146 142 142 LEU LEU A . n 
C 3 147 LEU 147 143 143 LEU LEU A . n 
C 3 148 HIS 148 144 144 HIS HIS A . n 
C 3 149 GLN 149 145 145 GLN GLN A . n 
C 3 150 GLU 150 146 146 GLU GLU A . n 
C 3 151 TRP 151 147 147 TRP TRP A . n 
C 3 152 TRP 152 148 148 TRP TRP A . n 
C 3 153 MET 153 149 149 MET MET A . n 
C 3 154 ARG 154 150 150 ARG ARG A . n 
C 3 155 PRO 155 151 151 PRO PRO A . n 
C 3 156 ASP 156 152 152 ASP ASP A . n 
C 3 157 ASP 157 153 153 ASP ASP A . n 
C 3 158 PRO 158 154 154 PRO PRO A . n 
C 3 159 ALA 159 155 155 ALA ALA A . n 
C 3 160 ASP 160 156 156 ASP ASP A . n 
C 3 161 ALA 161 157 157 ALA ALA A . n 
C 3 162 ASP 162 158 158 ASP ALA A . n 
C 3 163 GLU 163 159 159 GLU GLU A . n 
C 3 164 LYS 164 160 160 LYS LYS A . n 
C 3 165 GLU 165 161 161 GLU GLU A . n 
C 3 166 SER 166 162 162 SER SER A . n 
C 3 167 GLY 167 163 163 GLY GLY A . n 
C 3 168 LYS 168 164 164 LYS LYS A . n 
C 3 169 TRP 169 165 165 TRP TRP A . n 
C 3 170 LEU 170 166 166 LEU LEU A . n 
C 3 171 ALA 171 167 167 ALA ALA A . n 
C 3 172 ALA 172 168 168 ALA ALA A . n 
C 3 173 ALA 173 169 169 ALA ALA A . n 
C 3 174 ALA 174 170 170 ALA ALA A . n 
C 3 175 THR 175 171 171 THR THR A . n 
C 3 176 SER 176 172 172 SER SER A . n 
C 3 177 ARG 177 173 173 ARG ARG A . n 
C 3 178 LEU 178 174 174 LEU LEU A . n 
C 3 179 ARG 179 175 175 ARG ARG A . n 
C 3 180 MET 180 176 176 MET MET A . n 
C 3 181 GLY 181 177 177 GLY GLY A . n 
C 3 182 SER 182 178 178 SER SER A . n 
C 3 183 MET 183 179 179 MET MET A . n 
C 3 184 MET 184 180 180 MET MET A . n 
C 3 185 SER 185 181 181 SER SER A . n 
C 3 186 ASN 186 182 182 ASN ASN A . n 
C 3 187 VAL 187 183 183 VAL VAL A . n 
C 3 188 ILE 188 184 184 ILE ILE A . n 
C 3 189 ALA 189 185 185 ALA ALA A . n 
C 3 190 VAL 190 186 186 VAL VAL A . n 
C 3 191 CYS 191 187 187 CYS CYS A . n 
C 3 192 ASP 192 188 188 ASP ASP A . n 
C 3 193 ARG 193 189 189 ARG ARG A . n 
C 3 194 GLU 194 190 190 GLU GLU A . n 
C 3 195 ALA 195 191 191 ALA ALA A . n 
C 3 196 ASP 196 192 192 ASP ASP A . n 
C 3 197 ILE 197 193 193 ILE ILE A . n 
C 3 198 HIS 198 194 194 HIS HIS A . n 
C 3 199 ALA 199 195 195 ALA ALA A . n 
C 3 200 TYR 200 196 196 TYR TYR A . n 
C 3 201 LEU 201 197 197 LEU LEU A . n 
C 3 202 GLN 202 198 198 GLN GLN A . n 
C 3 203 ASP 203 199 199 ASP ASP A . n 
C 3 204 LYS 204 200 200 LYS LYS A . n 
C 3 205 LEU 205 201 201 LEU LEU A . n 
C 3 206 ALA 206 202 202 ALA ALA A . n 
C 3 207 HIS 207 203 203 HIS HIS A . n 
C 3 208 ASN 208 204 204 ASN ASN A . n 
C 3 209 GLU 209 205 205 GLU GLU A . n 
C 3 210 ARG 210 206 206 ARG ARG A . n 
C 3 211 PHE 211 207 207 PHE PHE A . n 
C 3 212 VAL 212 208 208 VAL VAL A . n 
C 3 213 VAL 213 209 209 VAL VAL A . n 
C 3 214 ARG 214 210 210 ARG ARG A . n 
C 3 215 SER 215 211 211 SER SER A . n 
C 3 216 LYS 216 212 212 LYS LYS A . n 
C 3 217 HIS 217 213 213 HIS HIS A . n 
C 3 218 PRO 218 214 214 PRO PRO A . n 
C 3 219 ARG 219 215 215 ARG ARG A . n 
C 3 220 LYS 220 216 216 LYS LYS A . n 
C 3 221 ASP 221 217 217 ASP ASP A . n 
C 3 222 VAL 222 218 218 VAL VAL A . n 
C 3 223 GLU 223 219 219 GLU GLU A . n 
C 3 224 SER 224 220 220 SER SER A . n 
C 3 225 GLY 225 221 221 GLY GLY A . n 
C 3 226 LEU 226 222 222 LEU LEU A . n 
C 3 227 TYR 227 223 223 TYR TYR A . n 
C 3 228 LEU 228 224 224 LEU LEU A . n 
C 3 229 TYR 229 225 225 TYR TYR A . n 
C 3 230 ASP 230 226 226 ASP ASP A . n 
C 3 231 HIS 231 227 227 HIS HIS A . n 
C 3 232 LEU 232 228 228 LEU LEU A . n 
C 3 233 LYS 233 229 229 LYS LYS A . n 
C 3 234 ASN 234 230 230 ASN ASN A . n 
C 3 235 GLN 235 231 231 GLN GLN A . n 
C 3 236 PRO 236 232 232 PRO PRO A . n 
C 3 237 GLU 237 233 233 GLU GLU A . n 
C 3 238 LEU 238 234 234 LEU LEU A . n 
C 3 239 GLY 239 235 235 GLY GLY A . n 
C 3 240 GLY 240 236 236 GLY GLY A . n 
C 3 241 TYR 241 237 237 TYR TYR A . n 
C 3 242 GLN 242 238 238 GLN GLN A . n 
C 3 243 ILE 243 239 239 ILE ILE A . n 
C 3 244 SER 244 240 240 SER SER A . n 
C 3 245 ILE 245 241 241 ILE ILE A . n 
C 3 246 PRO 246 242 242 PRO PRO A . n 
C 3 247 GLN 247 243 243 GLN GLN A . n 
C 3 248 LYS 248 244 244 LYS LYS A . n 
C 3 249 GLY 249 245 245 GLY GLY A . n 
C 3 250 VAL 250 246 246 VAL VAL A . n 
C 3 251 VAL 251 247 247 VAL VAL A . n 
C 3 252 ASP 252 248 248 ASP ASP A . n 
C 3 253 LYS 253 249 249 LYS ALA A . n 
C 3 254 ARG 254 250 250 ARG ARG A . n 
C 3 255 GLY 255 251 251 GLY GLY A . n 
C 3 256 LYS 256 252 252 LYS LYS A . n 
C 3 257 ARG 257 253 253 ARG ARG A . n 
C 3 258 LYS 258 254 254 LYS LYS A . n 
C 3 259 ASN 259 255 255 ASN ASN A . n 
C 3 260 ARG 260 256 256 ARG ARG A . n 
C 3 261 PRO 261 257 257 PRO PRO A . n 
C 3 262 ALA 262 258 258 ALA ALA A . n 
C 3 263 ARG 263 259 259 ARG ARG A . n 
C 3 264 LYS 264 260 260 LYS LYS A . n 
C 3 265 ALA 265 261 261 ALA ALA A . n 
C 3 266 SER 266 262 262 SER SER A . n 
C 3 267 LEU 267 263 263 LEU LEU A . n 
C 3 268 SER 268 264 264 SER SER A . n 
C 3 269 LEU 269 265 265 LEU LEU A . n 
C 3 270 ARG 270 266 266 ARG ARG A . n 
C 3 271 SER 271 267 267 SER SER A . n 
C 3 272 GLY 272 268 268 GLY GLY A . n 
C 3 273 ARG 273 269 269 ARG ARG A . n 
C 3 274 ILE 274 270 270 ILE ILE A . n 
C 3 275 THR 275 271 271 THR THR A . n 
C 3 276 LEU 276 272 272 LEU LEU A . n 
C 3 277 LYS 277 273 273 LYS ALA A . n 
C 3 278 GLN 278 274 274 GLN GLN A . n 
C 3 279 GLY 279 275 275 GLY GLY A . n 
C 3 280 ASN 280 276 276 ASN ASN A . n 
C 3 281 ILE 281 277 277 ILE ILE A . n 
C 3 282 THR 282 278 278 THR THR A . n 
C 3 283 LEU 283 279 279 LEU LEU A . n 
C 3 284 ASN 284 280 280 ASN ASN A . n 
C 3 285 ALA 285 281 281 ALA ALA A . n 
C 3 286 VAL 286 282 282 VAL VAL A . n 
C 3 287 LEU 287 283 283 LEU LEU A . n 
C 3 288 ALA 288 284 284 ALA ALA A . n 
C 3 289 GLU 289 285 285 GLU GLU A . n 
C 3 290 GLU 290 286 286 GLU GLU A . n 
C 3 291 ILE 291 287 287 ILE ILE A . n 
C 3 292 ASN 292 288 288 ASN ASN A . n 
C 3 293 PRO 293 289 289 PRO PRO A . n 
C 3 294 PRO 294 290 290 PRO PRO A . n 
C 3 295 LYS 295 291 291 LYS LYS A . n 
C 3 296 GLY 296 292 292 GLY GLY A . n 
C 3 297 GLU 297 293 293 GLU GLU A . n 
C 3 298 THR 298 294 294 THR THR A . n 
C 3 299 PRO 299 295 295 PRO PRO A . n 
C 3 300 LEU 300 296 296 LEU LEU A . n 
C 3 301 LYS 301 297 297 LYS LYS A . n 
C 3 302 TRP 302 298 298 TRP TRP A . n 
C 3 303 LEU 303 299 299 LEU LEU A . n 
C 3 304 LEU 304 300 300 LEU LEU A . n 
C 3 305 LEU 305 301 301 LEU LEU A . n 
C 3 306 THR 306 302 302 THR THR A . n 
C 3 307 SER 307 303 303 SER SER A . n 
C 3 308 GLU 308 304 304 GLU GLU A . n 
C 3 309 PRO 309 305 305 PRO PRO A . n 
C 3 310 VAL 310 306 306 VAL VAL A . n 
C 3 311 GLU 311 307 307 GLU GLU A . n 
C 3 312 SER 312 308 308 SER SER A . n 
C 3 313 LEU 313 309 309 LEU LEU A . n 
C 3 314 ALA 314 310 310 ALA ALA A . n 
C 3 315 GLN 315 311 311 GLN GLN A . n 
C 3 316 ALA 316 312 312 ALA ALA A . n 
C 3 317 LEU 317 313 313 LEU LEU A . n 
C 3 318 ARG 318 314 314 ARG ARG A . n 
C 3 319 VAL 319 315 315 VAL VAL A . n 
C 3 320 ILE 320 316 316 ILE ILE A . n 
C 3 321 ASP 321 317 317 ASP ASP A . n 
C 3 322 ILE 322 318 318 ILE ILE A . n 
C 3 323 TYR 323 319 319 TYR TYR A . n 
C 3 324 THR 324 320 320 THR THR A . n 
C 3 325 HIS 325 321 321 HIS HIS A . n 
C 3 326 ARG 326 322 322 ARG ARG A . n 
C 3 327 TRP 327 323 323 TRP TRP A . n 
C 3 328 ARG 328 324 324 ARG ARG A . n 
C 3 329 ILE 329 325 325 ILE ILE A . n 
C 3 330 GLU 330 326 326 GLU GLU A . n 
C 3 331 GLU 331 327 327 GLU GLU A . n 
C 3 332 PHE 332 328 328 PHE PHE A . n 
C 3 333 HIS 333 329 329 HIS HIS A . n 
C 3 334 LYS 334 330 330 LYS LYS A . n 
C 3 335 ALA 335 331 331 ALA ALA A . n 
C 3 336 TRP 336 332 332 TRP TRP A . n 
C 3 337 LYS 337 333 333 LYS LYS A . n 
C 3 338 THR 338 334 334 THR THR A . n 
C 3 339 GLY 339 335 335 GLY GLY A . n 
C 3 340 ALA 340 336 336 ALA ALA A . n 
C 3 341 GLY 341 337 337 GLY GLY A . n 
C 3 342 ALA 342 338 338 ALA ALA A . n 
C 3 343 GLU 343 339 339 GLU GLU A . n 
C 3 344 ARG 344 340 340 ARG ARG A . n 
C 3 345 GLN 345 341 341 GLN GLN A . n 
C 3 346 ARG 346 342 342 ARG ARG A . n 
C 3 347 MET 347 343 343 MET MET A . n 
C 3 348 GLU 348 344 344 GLU GLU A . n 
C 3 349 LYS 349 345 345 LYS LYS A . n 
C 3 350 PRO 350 346 346 PRO PRO A . n 
C 3 351 ASP 351 347 347 ASP ASP A . n 
C 3 352 ASN 352 348 348 ASN ASN A . n 
C 3 353 LEU 353 349 349 LEU LEU A . n 
C 3 354 GLU 354 350 350 GLU GLU A . n 
C 3 355 ARG 355 351 351 ARG ARG A . n 
C 3 356 MET 356 352 352 MET MET A . n 
C 3 357 VAL 357 353 353 VAL VAL A . n 
C 3 358 SER 358 354 354 SER SER A . n 
C 3 359 ILE 359 355 355 ILE ILE A . n 
C 3 360 LEU 360 356 356 LEU LEU A . n 
C 3 361 SER 361 357 357 SER SER A . n 
C 3 362 PHE 362 358 358 PHE PHE A . n 
C 3 363 VAL 363 359 359 VAL VAL A . n 
C 3 364 ALA 364 360 360 ALA ALA A . n 
C 3 365 VAL 365 361 361 VAL VAL A . n 
C 3 366 ARG 366 362 362 ARG ARG A . n 
C 3 367 LEU 367 363 363 LEU LEU A . n 
C 3 368 LEU 368 364 364 LEU LEU A . n 
C 3 369 GLN 369 365 365 GLN GLN A . n 
C 3 370 LEU 370 366 366 LEU LEU A . n 
C 3 371 ARG 371 367 367 ARG ARG A . n 
C 3 372 GLU 372 368 368 GLU GLU A . n 
C 3 373 SER 373 369 369 SER SER A . n 
C 3 374 PHE 374 370 370 PHE PHE A . n 
C 3 375 THR 375 371 371 THR THR A . n 
C 3 376 PRO 376 372 372 PRO PRO A . n 
C 3 377 PRO 377 373 ?   ?   ?   A . n 
C 3 378 GLN 378 374 ?   ?   ?   A . n 
C 3 379 ALA 379 375 ?   ?   ?   A . n 
C 3 380 LEU 380 376 ?   ?   ?   A . n 
C 3 381 ARG 381 377 ?   ?   ?   A . n 
C 3 382 ALA 382 378 ?   ?   ?   A . n 
C 3 383 GLN 383 379 ?   ?   ?   A . n 
C 3 384 GLY 384 380 ?   ?   ?   A . n 
C 3 385 LEU 385 381 ?   ?   ?   A . n 
C 3 386 LEU 386 382 ?   ?   ?   A . n 
C 3 387 LYS 387 383 ?   ?   ?   A . n 
C 3 388 GLU 388 384 ?   ?   ?   A . n 
C 3 389 ALA 389 385 ?   ?   ?   A . n 
C 3 390 GLU 390 386 ?   ?   ?   A . n 
C 3 391 HIS 391 387 ?   ?   ?   A . n 
C 3 392 VAL 392 388 ?   ?   ?   A . n 
C 3 393 GLU 393 389 ?   ?   ?   A . n 
C 3 394 SER 394 390 ?   ?   ?   A . n 
C 3 395 GLN 395 391 391 GLN GLN A . n 
C 3 396 SER 396 392 392 SER SER A . n 
C 3 397 ALA 397 393 393 ALA ALA A . n 
C 3 398 GLU 398 394 394 GLU ALA A . n 
C 3 399 THR 399 395 395 THR THR A . n 
C 3 400 VAL 400 396 396 VAL VAL A . n 
C 3 401 LEU 401 397 397 LEU LEU A . n 
C 3 402 THR 402 398 398 THR THR A . n 
C 3 403 PRO 403 399 399 PRO PRO A . n 
C 3 404 ASP 404 400 400 ASP ASP A . n 
C 3 405 GLU 405 401 401 GLU GLU A . n 
C 3 406 CYS 406 402 402 CYS CYS A . n 
C 3 407 GLN 407 403 403 GLN GLN A . n 
C 3 408 LEU 408 404 404 LEU LEU A . n 
C 3 409 LEU 409 405 405 LEU LEU A . n 
C 3 410 GLY 410 406 406 GLY GLY A . n 
C 3 411 TYR 411 407 407 TYR TYR A . n 
C 3 412 LEU 412 408 408 LEU LEU A . n 
C 3 413 ASP 413 409 409 ASP ASP A . n 
C 3 414 LYS 414 410 410 LYS LYS A . n 
C 3 415 GLY 415 411 411 GLY GLY A . n 
C 3 416 LYS 416 412 412 LYS LYS A . n 
C 3 417 ARG 417 413 413 ARG ARG A . n 
C 3 418 LYS 418 414 414 LYS LYS A . n 
C 3 419 ARG 419 415 415 ARG ARG A . n 
C 3 420 LYS 420 416 416 LYS LYS A . n 
C 3 421 GLU 421 417 417 GLU GLU A . n 
C 3 422 LYS 422 418 418 LYS ALA A . n 
C 3 423 ALA 423 419 419 ALA ALA A . n 
C 3 424 GLY 424 420 420 GLY GLY A . n 
C 3 425 SER 425 421 421 SER SER A . n 
C 3 426 LEU 426 422 422 LEU LEU A . n 
C 3 427 GLN 427 423 423 GLN GLN A . n 
C 3 428 TRP 428 424 424 TRP TRP A . n 
C 3 429 ALA 429 425 425 ALA ALA A . n 
C 3 430 TYR 430 426 426 TYR TYR A . n 
C 3 431 MET 431 427 427 MET MET A . n 
C 3 432 ALA 432 428 428 ALA ALA A . n 
C 3 433 ILE 433 429 429 ILE ILE A . n 
C 3 434 ALA 434 430 430 ALA ALA A . n 
C 3 435 ARG 435 431 431 ARG ARG A . n 
C 3 436 LEU 436 432 432 LEU LEU A . n 
C 3 437 GLY 437 433 433 GLY GLY A . n 
C 3 438 GLY 438 434 434 GLY GLY A . n 
C 3 439 PHE 439 435 435 PHE PHE A . n 
C 3 440 MET 440 436 436 MET MET A . n 
C 3 441 ASP 441 437 437 ASP ASP A . n 
C 3 442 SER 442 438 438 SER SER A . n 
C 3 443 LYS 443 439 439 LYS LYS A . n 
C 3 444 ARG 444 440 440 ARG ARG A . n 
C 3 445 THR 445 441 441 THR THR A . n 
C 3 446 GLY 446 442 442 GLY GLY A . n 
C 3 447 ILE 447 443 443 ILE ILE A . n 
C 3 448 ALA 448 444 444 ALA ALA A . n 
C 3 449 SER 449 445 445 SER SER A . n 
C 3 450 TRP 450 446 446 TRP TRP A . n 
C 3 451 GLY 451 447 447 GLY GLY A . n 
C 3 452 ALA 452 448 448 ALA ALA A . n 
C 3 453 LEU 453 449 449 LEU LEU A . n 
C 3 454 TRP 454 450 450 TRP TRP A . n 
C 3 455 GLU 455 451 451 GLU GLU A . n 
C 3 456 GLY 456 452 452 GLY GLY A . n 
C 3 457 TRP 457 453 453 TRP TRP A . n 
C 3 458 GLU 458 454 454 GLU GLU A . n 
C 3 459 ALA 459 455 455 ALA ALA A . n 
C 3 460 LEU 460 456 456 LEU LEU A . n 
C 3 461 GLN 461 457 457 GLN GLN A . n 
C 3 462 SER 462 458 458 SER SER A . n 
C 3 463 LYS 463 459 459 LYS LYS A . n 
C 3 464 LEU 464 460 460 LEU LEU A . n 
C 3 465 ASP 465 461 461 ASP ASP A . n 
C 3 466 GLY 466 462 462 GLY GLY A . n 
C 3 467 PHE 467 463 463 PHE PHE A . n 
C 3 468 LEU 468 464 464 LEU LEU A . n 
C 3 469 ALA 469 465 465 ALA ALA A . n 
C 3 470 ALA 470 466 466 ALA ALA A . n 
C 3 471 LYS 471 467 467 LYS LYS A . n 
C 3 472 ASP 472 468 468 ASP ASP A . n 
C 3 473 LEU 473 469 469 LEU LEU A . n 
C 3 474 MET 474 470 470 MET MET A . n 
C 3 475 ALA 475 471 471 ALA ALA A . n 
C 3 476 GLN 476 472 472 GLN GLN A . n 
C 3 477 GLY 477 473 473 GLY GLY A . n 
C 3 478 ILE 478 474 474 ILE ILE A . n 
C 3 479 LYS 479 475 475 LYS LYS A . n 
C 3 480 ILE 480 476 476 ILE ILE A . n 
C 3 481 GLY 481 477 477 GLY GLY A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MN  1   500 500 MN  MN2 A . 
E 4 MN  1   501 501 MN  MN2 A . 
F 5 HOH 1   502 502 HOH WAT B . 
F 5 HOH 2   515 515 HOH WAT B . 
F 5 HOH 3   520 520 HOH WAT B . 
F 5 HOH 4   526 526 HOH WAT B . 
F 5 HOH 5   532 532 HOH WAT B . 
F 5 HOH 6   537 537 HOH WAT B . 
F 5 HOH 7   541 541 HOH WAT B . 
F 5 HOH 8   551 551 HOH WAT B . 
F 5 HOH 9   557 557 HOH WAT B . 
F 5 HOH 10  561 561 HOH WAT B . 
F 5 HOH 11  566 566 HOH WAT B . 
F 5 HOH 12  574 574 HOH WAT B . 
F 5 HOH 13  576 576 HOH WAT B . 
F 5 HOH 14  577 577 HOH WAT B . 
F 5 HOH 15  583 583 HOH WAT B . 
F 5 HOH 16  592 592 HOH WAT B . 
F 5 HOH 17  593 593 HOH WAT B . 
F 5 HOH 18  595 595 HOH WAT B . 
F 5 HOH 19  604 604 HOH WAT B . 
F 5 HOH 20  611 611 HOH WAT B . 
F 5 HOH 21  613 613 HOH WAT B . 
F 5 HOH 22  614 614 HOH WAT B . 
F 5 HOH 23  615 615 HOH WAT B . 
F 5 HOH 24  628 628 HOH WAT B . 
F 5 HOH 25  634 634 HOH WAT B . 
F 5 HOH 26  642 642 HOH WAT B . 
F 5 HOH 27  648 648 HOH WAT B . 
F 5 HOH 28  658 658 HOH WAT B . 
F 5 HOH 29  660 660 HOH WAT B . 
F 5 HOH 30  662 662 HOH WAT B . 
F 5 HOH 31  677 677 HOH WAT B . 
F 5 HOH 32  686 686 HOH WAT B . 
F 5 HOH 33  694 694 HOH WAT B . 
F 5 HOH 34  697 697 HOH WAT B . 
F 5 HOH 35  715 715 HOH WAT B . 
F 5 HOH 36  722 722 HOH WAT B . 
F 5 HOH 37  724 724 HOH WAT B . 
G 5 HOH 1   503 503 HOH WAT C . 
G 5 HOH 2   506 506 HOH WAT C . 
G 5 HOH 3   511 511 HOH WAT C . 
G 5 HOH 4   522 522 HOH WAT C . 
G 5 HOH 5   568 568 HOH WAT C . 
G 5 HOH 6   571 571 HOH WAT C . 
G 5 HOH 7   579 579 HOH WAT C . 
G 5 HOH 8   581 581 HOH WAT C . 
G 5 HOH 9   587 587 HOH WAT C . 
G 5 HOH 10  601 601 HOH WAT C . 
G 5 HOH 11  622 622 HOH WAT C . 
G 5 HOH 12  630 630 HOH WAT C . 
G 5 HOH 13  645 645 HOH WAT C . 
G 5 HOH 14  649 649 HOH WAT C . 
G 5 HOH 15  656 656 HOH WAT C . 
G 5 HOH 16  664 664 HOH WAT C . 
G 5 HOH 17  666 666 HOH WAT C . 
G 5 HOH 18  669 669 HOH WAT C . 
G 5 HOH 19  670 670 HOH WAT C . 
G 5 HOH 20  703 703 HOH WAT C . 
G 5 HOH 21  717 717 HOH WAT C . 
G 5 HOH 22  723 723 HOH WAT C . 
H 5 HOH 1   504 504 HOH WAT A . 
H 5 HOH 2   505 505 HOH WAT A . 
H 5 HOH 3   507 507 HOH WAT A . 
H 5 HOH 4   508 508 HOH WAT A . 
H 5 HOH 5   509 509 HOH WAT A . 
H 5 HOH 6   510 510 HOH WAT A . 
H 5 HOH 7   512 512 HOH WAT A . 
H 5 HOH 8   513 513 HOH WAT A . 
H 5 HOH 9   514 514 HOH WAT A . 
H 5 HOH 10  516 516 HOH WAT A . 
H 5 HOH 11  517 517 HOH WAT A . 
H 5 HOH 12  518 518 HOH WAT A . 
H 5 HOH 13  519 519 HOH WAT A . 
H 5 HOH 14  521 521 HOH WAT A . 
H 5 HOH 15  523 523 HOH WAT A . 
H 5 HOH 16  524 524 HOH WAT A . 
H 5 HOH 17  525 525 HOH WAT A . 
H 5 HOH 18  527 527 HOH WAT A . 
H 5 HOH 19  528 528 HOH WAT A . 
H 5 HOH 20  529 529 HOH WAT A . 
H 5 HOH 21  530 530 HOH WAT A . 
H 5 HOH 22  531 531 HOH WAT A . 
H 5 HOH 23  533 533 HOH WAT A . 
H 5 HOH 24  534 534 HOH WAT A . 
H 5 HOH 25  535 535 HOH WAT A . 
H 5 HOH 26  536 536 HOH WAT A . 
H 5 HOH 27  538 538 HOH WAT A . 
H 5 HOH 28  539 539 HOH WAT A . 
H 5 HOH 29  540 540 HOH WAT A . 
H 5 HOH 30  542 542 HOH WAT A . 
H 5 HOH 31  543 543 HOH WAT A . 
H 5 HOH 32  544 544 HOH WAT A . 
H 5 HOH 33  545 545 HOH WAT A . 
H 5 HOH 34  546 546 HOH WAT A . 
H 5 HOH 35  547 547 HOH WAT A . 
H 5 HOH 36  548 548 HOH WAT A . 
H 5 HOH 37  549 549 HOH WAT A . 
H 5 HOH 38  550 550 HOH WAT A . 
H 5 HOH 39  552 552 HOH WAT A . 
H 5 HOH 40  553 553 HOH WAT A . 
H 5 HOH 41  554 554 HOH WAT A . 
H 5 HOH 42  555 555 HOH WAT A . 
H 5 HOH 43  556 556 HOH WAT A . 
H 5 HOH 44  558 558 HOH WAT A . 
H 5 HOH 45  559 559 HOH WAT A . 
H 5 HOH 46  560 560 HOH WAT A . 
H 5 HOH 47  562 562 HOH WAT A . 
H 5 HOH 48  563 563 HOH WAT A . 
H 5 HOH 49  564 564 HOH WAT A . 
H 5 HOH 50  565 565 HOH WAT A . 
H 5 HOH 51  567 567 HOH WAT A . 
H 5 HOH 52  569 569 HOH WAT A . 
H 5 HOH 53  570 570 HOH WAT A . 
H 5 HOH 54  572 572 HOH WAT A . 
H 5 HOH 55  573 573 HOH WAT A . 
H 5 HOH 56  575 575 HOH WAT A . 
H 5 HOH 57  578 578 HOH WAT A . 
H 5 HOH 58  580 580 HOH WAT A . 
H 5 HOH 59  582 582 HOH WAT A . 
H 5 HOH 60  584 584 HOH WAT A . 
H 5 HOH 61  585 585 HOH WAT A . 
H 5 HOH 62  586 586 HOH WAT A . 
H 5 HOH 63  588 588 HOH WAT A . 
H 5 HOH 64  589 589 HOH WAT A . 
H 5 HOH 65  590 590 HOH WAT A . 
H 5 HOH 66  591 591 HOH WAT A . 
H 5 HOH 67  594 594 HOH WAT A . 
H 5 HOH 68  596 596 HOH WAT A . 
H 5 HOH 69  597 597 HOH WAT A . 
H 5 HOH 70  598 598 HOH WAT A . 
H 5 HOH 71  599 599 HOH WAT A . 
H 5 HOH 72  600 600 HOH WAT A . 
H 5 HOH 73  602 602 HOH WAT A . 
H 5 HOH 74  603 603 HOH WAT A . 
H 5 HOH 75  605 605 HOH WAT A . 
H 5 HOH 76  606 606 HOH WAT A . 
H 5 HOH 77  607 607 HOH WAT A . 
H 5 HOH 78  608 608 HOH WAT A . 
H 5 HOH 79  609 609 HOH WAT A . 
H 5 HOH 80  610 610 HOH WAT A . 
H 5 HOH 81  612 612 HOH WAT A . 
H 5 HOH 82  616 616 HOH WAT A . 
H 5 HOH 83  617 617 HOH WAT A . 
H 5 HOH 84  618 618 HOH WAT A . 
H 5 HOH 85  619 619 HOH WAT A . 
H 5 HOH 86  620 620 HOH WAT A . 
H 5 HOH 87  621 621 HOH WAT A . 
H 5 HOH 88  623 623 HOH WAT A . 
H 5 HOH 89  624 624 HOH WAT A . 
H 5 HOH 90  625 625 HOH WAT A . 
H 5 HOH 91  626 626 HOH WAT A . 
H 5 HOH 92  627 627 HOH WAT A . 
H 5 HOH 93  629 629 HOH WAT A . 
H 5 HOH 94  631 631 HOH WAT A . 
H 5 HOH 95  632 632 HOH WAT A . 
H 5 HOH 96  633 633 HOH WAT A . 
H 5 HOH 97  635 635 HOH WAT A . 
H 5 HOH 98  636 636 HOH WAT A . 
H 5 HOH 99  637 637 HOH WAT A . 
H 5 HOH 100 638 638 HOH WAT A . 
H 5 HOH 101 639 639 HOH WAT A . 
H 5 HOH 102 640 640 HOH WAT A . 
H 5 HOH 103 641 641 HOH WAT A . 
H 5 HOH 104 643 643 HOH WAT A . 
H 5 HOH 105 644 644 HOH WAT A . 
H 5 HOH 106 646 646 HOH WAT A . 
H 5 HOH 107 647 647 HOH WAT A . 
H 5 HOH 108 650 650 HOH WAT A . 
H 5 HOH 109 651 651 HOH WAT A . 
H 5 HOH 110 652 652 HOH WAT A . 
H 5 HOH 111 653 653 HOH WAT A . 
H 5 HOH 112 654 654 HOH WAT A . 
H 5 HOH 113 657 657 HOH WAT A . 
H 5 HOH 114 659 659 HOH WAT A . 
H 5 HOH 115 661 661 HOH WAT A . 
H 5 HOH 116 663 663 HOH WAT A . 
H 5 HOH 117 665 665 HOH WAT A . 
H 5 HOH 118 667 667 HOH WAT A . 
H 5 HOH 119 668 668 HOH WAT A . 
H 5 HOH 120 671 671 HOH WAT A . 
H 5 HOH 121 672 672 HOH WAT A . 
H 5 HOH 122 673 673 HOH WAT A . 
H 5 HOH 123 674 674 HOH WAT A . 
H 5 HOH 124 675 675 HOH WAT A . 
H 5 HOH 125 676 676 HOH WAT A . 
H 5 HOH 126 678 678 HOH WAT A . 
H 5 HOH 127 679 679 HOH WAT A . 
H 5 HOH 128 680 680 HOH WAT A . 
H 5 HOH 129 681 681 HOH WAT A . 
H 5 HOH 130 682 682 HOH WAT A . 
H 5 HOH 131 683 683 HOH WAT A . 
H 5 HOH 132 684 684 HOH WAT A . 
H 5 HOH 133 685 685 HOH WAT A . 
H 5 HOH 134 687 687 HOH WAT A . 
H 5 HOH 135 688 688 HOH WAT A . 
H 5 HOH 136 689 689 HOH WAT A . 
H 5 HOH 137 690 690 HOH WAT A . 
H 5 HOH 138 691 691 HOH WAT A . 
H 5 HOH 139 692 692 HOH WAT A . 
H 5 HOH 140 693 693 HOH WAT A . 
H 5 HOH 141 695 695 HOH WAT A . 
H 5 HOH 142 696 696 HOH WAT A . 
H 5 HOH 143 698 698 HOH WAT A . 
H 5 HOH 144 699 699 HOH WAT A . 
H 5 HOH 145 700 700 HOH WAT A . 
H 5 HOH 146 701 701 HOH WAT A . 
H 5 HOH 147 702 702 HOH WAT A . 
H 5 HOH 148 704 704 HOH WAT A . 
H 5 HOH 149 705 705 HOH WAT A . 
H 5 HOH 150 706 706 HOH WAT A . 
H 5 HOH 151 707 707 HOH WAT A . 
H 5 HOH 152 708 708 HOH WAT A . 
H 5 HOH 153 709 709 HOH WAT A . 
H 5 HOH 154 710 710 HOH WAT A . 
H 5 HOH 155 711 711 HOH WAT A . 
H 5 HOH 156 712 712 HOH WAT A . 
H 5 HOH 157 713 713 HOH WAT A . 
H 5 HOH 158 714 714 HOH WAT A . 
H 5 HOH 159 716 716 HOH WAT A . 
H 5 HOH 160 718 718 HOH WAT A . 
H 5 HOH 161 719 719 HOH WAT A . 
H 5 HOH 162 720 720 HOH WAT A . 
H 5 HOH 163 721 721 HOH WAT A . 
H 5 HOH 164 725 725 HOH WAT A . 
H 5 HOH 165 726 726 HOH WAT A . 
H 5 HOH 166 727 727 HOH WAT A . 
H 5 HOH 167 728 728 HOH WAT A . 
H 5 HOH 168 729 729 HOH WAT A . 
H 5 HOH 169 730 730 HOH WAT A . 
H 5 HOH 170 731 731 HOH WAT A . 
H 5 HOH 171 732 732 HOH WAT A . 
H 5 HOH 172 733 733 HOH WAT A . 
H 5 HOH 173 734 734 HOH WAT A . 
H 5 HOH 174 735 735 HOH WAT A . 
H 5 HOH 175 736 736 HOH WAT A . 
H 5 HOH 176 737 737 HOH WAT A . 
H 5 HOH 177 738 738 HOH WAT A . 
H 5 HOH 178 739 739 HOH WAT A . 
H 5 HOH 179 740 740 HOH WAT A . 
H 5 HOH 180 741 741 HOH WAT A . 
H 5 HOH 181 742 742 HOH WAT A . 
H 5 HOH 182 743 743 HOH WAT A . 
H 5 HOH 183 744 744 HOH WAT A . 
H 5 HOH 184 745 745 HOH WAT A . 
H 5 HOH 185 746 746 HOH WAT A . 
H 5 HOH 186 747 747 HOH WAT A . 
H 5 HOH 187 748 748 HOH WAT A . 
H 5 HOH 188 749 749 HOH WAT A . 
H 5 HOH 189 750 750 HOH WAT A . 
H 5 HOH 190 751 751 HOH WAT A . 
H 5 HOH 191 752 752 HOH WAT A . 
H 5 HOH 192 753 753 HOH WAT A . 
H 5 HOH 193 754 754 HOH WAT A . 
H 5 HOH 194 755 755 HOH WAT A . 
H 5 HOH 195 756 756 HOH WAT A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z           1.0000000000 0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 12_566 x,x-y+1,-z+11/6 0.5000000000 0.8660254038 0.0000000000 -56.2500000000 0.8660254038 
-0.5000000000 0.0000000000 97.4278579257 0.0000000000 0.0000000000 -1.0000000000 428.0833333333 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 "O3'" ? A DG  20  ? B DG  120 ? 1_555 MN ? D MN . ? A MN 500 ? 1_555 OD2 ? C ASP 101 ? A ASP 97  ? 1_555 138.0 ? 
2 "O3'" ? A DG  20  ? B DG  120 ? 1_555 MN ? D MN . ? A MN 500 ? 1_555 OE1 ? C GLU 330 ? A GLU 326 ? 1_555 62.5  ? 
3 OD2   ? C ASP 101 ? A ASP 97  ? 1_555 MN ? D MN . ? A MN 500 ? 1_555 OE1 ? C GLU 330 ? A GLU 326 ? 1_555 77.2  ? 
4 "O3'" ? A DG  20  ? B DG  120 ? 1_555 MN ? D MN . ? A MN 500 ? 1_555 O   ? H HOH .   ? A HOH 714 ? 1_555 93.7  ? 
5 OD2   ? C ASP 101 ? A ASP 97  ? 1_555 MN ? D MN . ? A MN 500 ? 1_555 O   ? H HOH .   ? A HOH 714 ? 1_555 71.7  ? 
6 OE1   ? C GLU 330 ? A GLU 326 ? 1_555 MN ? D MN . ? A MN 500 ? 1_555 O   ? H HOH .   ? A HOH 714 ? 1_555 87.1  ? 
7 OD1   ? C ASP 101 ? A ASP 97  ? 1_555 MN ? E MN . ? A MN 501 ? 1_555 OD2 ? C ASP 192 ? A ASP 188 ? 1_555 75.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-12-13 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2             
2 4 'Structure model' pdbx_struct_conn_angle 
3 4 'Structure model' struct_conn            
4 4 'Structure model' struct_ref             
5 4 'Structure model' struct_ref_seq_dif     
6 4 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                        
2  4 'Structure model' '_database_2.pdbx_database_accession'         
3  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
4  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
15 4 'Structure model' '_pdbx_struct_conn_angle.value'               
16 4 'Structure model' '_struct_conn.pdbx_dist_value'                
17 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
24 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
25 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
26 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
27 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
28 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
29 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
30 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
31 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code'        
32 4 'Structure model' '_struct_ref_seq_dif.details'                 
33 4 'Structure model' '_struct_site.pdbx_auth_asym_id'              
34 4 'Structure model' '_struct_site.pdbx_auth_comp_id'              
35 4 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
EPMR      phasing           . ? 3 
CNS       refinement        . ? 4 
HKL-2000  'data reduction'  . ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NH1 A ARG 324 ? ? O A HOH 747 ? ? 2.00 
2 1 OG  A SER 53  ? ? O A HOH 755 ? ? 2.07 
3 1 O   A VAL 359 ? ? O A HOH 736 ? ? 2.17 
4 1 OP1 B DG  116 ? ? O B HOH 614 ? ? 2.17 
5 1 O   A LEU 422 ? ? O A HOH 729 ? ? 2.17 
6 1 OG  A SER 19  ? ? O A HOH 752 ? ? 2.18 
7 1 N   A LEU 363 ? ? O A HOH 736 ? ? 2.18 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    "O5'" 
_pdbx_validate_symm_contact.auth_asym_id_1    C 
_pdbx_validate_symm_contact.auth_comp_id_1    DT 
_pdbx_validate_symm_contact.auth_seq_id_1     209 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     754 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   12_566 
_pdbx_validate_symm_contact.dist              2.10 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DC  205 ? ? "C1'" C DC  205 ? ? N1 C DC  205 ? ? 110.48 108.30 2.18 0.30 N 
2 1 C     A ASN 66  ? ? N     A PRO 67  ? ? CA A PRO 67  ? ? 128.42 119.30 9.12 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 6   ? ? -80.26  -94.65  
2  1 HIS A 7   ? ? -68.75  53.44   
3  1 ALA A 9   ? ? -28.89  -56.15  
4  1 TYR A 41  ? ? -113.22 53.18   
5  1 PRO A 67  ? ? -53.31  -1.73   
6  1 GLN A 87  ? ? -53.38  -3.59   
7  1 GLN A 106 ? ? -22.98  -46.14  
8  1 THR A 135 ? ? -87.56  -75.23  
9  1 SER A 178 ? ? -58.81  -3.34   
10 1 GLU A 190 ? ? -52.56  -9.53   
11 1 ASP A 192 ? ? -62.78  75.41   
12 1 LYS A 212 ? ? -123.72 -60.84  
13 1 GLU A 219 ? ? -72.51  -71.56  
14 1 LYS A 252 ? ? -75.70  -138.33 
15 1 ARG A 259 ? ? -174.22 140.87  
16 1 GLU A 286 ? ? -47.44  172.35  
17 1 VAL A 306 ? ? -144.26 16.55   
18 1 LYS A 333 ? ? -94.54  -92.21  
19 1 LYS A 412 ? ? -149.50 -9.00   
20 1 LYS A 418 ? ? -56.98  -174.47 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DA B 119 ? ? 0.070 'SIDE CHAIN' 
2 1 DC C 205 ? ? 0.070 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 120 ? CG  ? C LYS 124 CG  
2  1 Y 1 A LYS 120 ? CD  ? C LYS 124 CD  
3  1 Y 1 A LYS 120 ? CE  ? C LYS 124 CE  
4  1 Y 1 A LYS 120 ? NZ  ? C LYS 124 NZ  
5  1 Y 1 A ASP 158 ? CG  ? C ASP 162 CG  
6  1 Y 1 A ASP 158 ? OD1 ? C ASP 162 OD1 
7  1 Y 1 A ASP 158 ? OD2 ? C ASP 162 OD2 
8  1 Y 1 A LYS 249 ? CG  ? C LYS 253 CG  
9  1 Y 1 A LYS 249 ? CD  ? C LYS 253 CD  
10 1 Y 1 A LYS 249 ? CE  ? C LYS 253 CE  
11 1 Y 1 A LYS 249 ? NZ  ? C LYS 253 NZ  
12 1 Y 1 A LYS 273 ? CG  ? C LYS 277 CG  
13 1 Y 1 A LYS 273 ? CD  ? C LYS 277 CD  
14 1 Y 1 A LYS 273 ? CE  ? C LYS 277 CE  
15 1 Y 1 A LYS 273 ? NZ  ? C LYS 277 NZ  
16 1 Y 1 A GLU 394 ? CG  ? C GLU 398 CG  
17 1 Y 1 A GLU 394 ? CD  ? C GLU 398 CD  
18 1 Y 1 A GLU 394 ? OE1 ? C GLU 398 OE1 
19 1 Y 1 A GLU 394 ? OE2 ? C GLU 398 OE2 
20 1 Y 1 A LYS 418 ? CG  ? C LYS 422 CG  
21 1 Y 1 A LYS 418 ? CD  ? C LYS 422 CD  
22 1 Y 1 A LYS 418 ? CE  ? C LYS 422 CE  
23 1 Y 1 A LYS 418 ? NZ  ? C LYS 422 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -3  ? C MET 1   
2  1 Y 1 A VAL -2  ? C VAL 2   
3  1 Y 1 A THR -1  ? C THR 3   
4  1 Y 1 A PHE 0   ? C PHE 4   
5  1 Y 1 A MET 1   ? C MET 5   
6  1 Y 1 A ILE 2   ? C ILE 6   
7  1 Y 1 A THR 3   ? C THR 7   
8  1 Y 1 A SER 4   ? C SER 8   
9  1 Y 1 A PRO 373 ? C PRO 377 
10 1 Y 1 A GLN 374 ? C GLN 378 
11 1 Y 1 A ALA 375 ? C ALA 379 
12 1 Y 1 A LEU 376 ? C LEU 380 
13 1 Y 1 A ARG 377 ? C ARG 381 
14 1 Y 1 A ALA 378 ? C ALA 382 
15 1 Y 1 A GLN 379 ? C GLN 383 
16 1 Y 1 A GLY 380 ? C GLY 384 
17 1 Y 1 A LEU 381 ? C LEU 385 
18 1 Y 1 A LEU 382 ? C LEU 386 
19 1 Y 1 A LYS 383 ? C LYS 387 
20 1 Y 1 A GLU 384 ? C GLU 388 
21 1 Y 1 A ALA 385 ? C ALA 389 
22 1 Y 1 A GLU 386 ? C GLU 390 
23 1 Y 1 A HIS 387 ? C HIS 391 
24 1 Y 1 A VAL 388 ? C VAL 392 
25 1 Y 1 A GLU 389 ? C GLU 393 
26 1 Y 1 A SER 390 ? C SER 394 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1MM8 'double helix'        
1MM8 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC 20 1_555 -0.330 -0.030 -0.579 -25.919 -14.103 -0.661 1  B_DG101:DC220_C B 101 ? C 220 ? 19 1 
1 A DA 2  1_555 B DT 19 1_555 0.177  -0.016 0.250  -3.099  -3.466  -5.020 2  B_DA102:DT219_C B 102 ? C 219 ? 20 1 
1 A DG 3  1_555 B DC 18 1_555 -0.093 -0.112 -0.554 -4.316  -7.737  0.071  3  B_DG103:DC218_C B 103 ? C 218 ? 19 1 
1 A DA 4  1_555 B DT 17 1_555 0.065  -0.129 0.614  12.629  -7.954  5.114  4  B_DA104:DT217_C B 104 ? C 217 ? 20 1 
1 A DT 5  1_555 B DA 16 1_555 -0.101 0.021  0.398  7.747   -6.788  -1.792 5  B_DT105:DA216_C B 105 ? C 216 ? 20 1 
1 A DG 6  1_555 B DC 15 1_555 -0.181 -0.036 0.140  -11.496 0.262   0.429  6  B_DG106:DC215_C B 106 ? C 215 ? 19 1 
1 A DT 7  1_555 B DA 14 1_555 -0.133 -0.068 0.581  -13.605 -7.846  -0.286 7  B_DT107:DA214_C B 107 ? C 214 ? 20 1 
1 A DG 8  1_555 B DC 13 1_555 -0.070 -0.101 -0.737 -10.802 -8.252  1.498  8  B_DG108:DC213_C B 108 ? C 213 ? 19 1 
1 A DT 9  1_555 B DA 12 1_555 0.056  -0.255 -0.877 4.224   -4.874  0.516  9  B_DT109:DA212_C B 109 ? C 212 ? 20 1 
1 A DA 10 1_555 B DT 11 1_555 -0.034 -0.199 -1.202 -21.309 -7.434  4.205  10 B_DA110:DT211_C B 110 ? C 211 ? 20 1 
1 A DT 11 1_555 B DA 10 1_555 -0.079 -0.113 -0.555 -4.027  0.906   5.813  11 B_DT111:DA210_C B 111 ? C 210 ? 20 1 
1 A DA 12 1_555 B DT 9  1_555 -0.129 -0.103 -0.357 2.822   1.995   3.904  12 B_DA112:DT209_C B 112 ? C 209 ? 20 1 
1 A DA 13 1_555 B DT 8  1_555 0.153  0.034  0.118  15.680  3.326   4.510  13 B_DA113:DT208_C B 113 ? C 208 ? 20 1 
1 A DG 14 1_555 B DC 7  1_555 -0.117 0.054  0.494  14.721  -9.316  0.250  14 B_DG114:DC207_C B 114 ? C 207 ? 19 1 
1 A DA 15 1_555 B DT 6  1_555 0.190  -0.138 0.554  4.025   -8.512  -0.254 15 B_DA115:DT206_C B 115 ? C 206 ? 20 1 
1 A DG 16 1_555 B DC 5  1_555 -0.050 0.049  -0.102 -8.940  -4.841  -0.155 16 B_DG116:DC205_C B 116 ? C 205 ? 19 1 
1 A DA 17 1_555 B DT 4  1_555 -0.019 -0.120 0.790  12.688  10.817  0.284  17 B_DA117:DT204_C B 117 ? C 204 ? 20 1 
1 A DC 18 1_555 B DG 3  1_555 0.162  0.062  0.208  22.263  6.185   5.144  18 B_DC118:DG203_C B 118 ? C 203 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC 20 1_555 A DA 2  1_555 B DT 19 1_555 -0.539 0.719  2.711 -9.736 0.103  38.342 1.053  -0.177 2.763 0.155   
14.539 39.514 1  BB_DG101DA102:DT219DC220_CC B 101 ? C 220 ? B 102 ? C 219 ? 
1 A DA 2  1_555 B DT 19 1_555 A DG 3  1_555 B DC 18 1_555 0.489  -0.303 3.479 4.891  0.770  33.007 -0.665 0.019  3.506 1.346   
-8.548 33.366 2  BB_DA102DG103:DC218DT219_CC B 102 ? C 219 ? B 103 ? C 218 ? 
1 A DG 3  1_555 B DC 18 1_555 A DA 4  1_555 B DT 17 1_555 0.072  -0.534 2.819 -7.279 -9.405 36.524 0.224  -0.912 2.803 -14.540 
11.253 38.349 3  BB_DG103DA104:DT217DC218_CC B 103 ? C 218 ? B 104 ? C 217 ? 
1 A DA 4  1_555 B DT 17 1_555 A DT 5  1_555 B DA 16 1_555 -0.196 -1.005 3.414 0.808  -3.237 34.509 -1.162 0.460  3.486 -5.441  
-1.358 34.665 4  BB_DA104DT105:DA216DT217_CC B 104 ? C 217 ? B 105 ? C 216 ? 
1 A DT 5  1_555 B DA 16 1_555 A DG 6  1_555 B DC 15 1_555 -0.031 -0.574 3.580 0.165  5.376  38.583 -1.567 0.069  3.472 8.088   
-0.248 38.942 5  BB_DT105DG106:DC215DA216_CC B 105 ? C 216 ? B 106 ? C 215 ? 
1 A DG 6  1_555 B DC 15 1_555 A DT 7  1_555 B DA 14 1_555 -0.895 -1.034 3.332 -2.487 1.472  32.397 -2.108 1.155  3.340 2.633   
4.446  32.522 6  BB_DG106DT107:DA214DC215_CC B 106 ? C 215 ? B 107 ? C 214 ? 
1 A DT 7  1_555 B DA 14 1_555 A DG 8  1_555 B DC 13 1_555 -0.023 0.351  3.347 4.788  13.981 32.144 -1.594 0.782  3.188 23.746  
-8.132 35.297 7  BB_DT107DG108:DC213DA214_CC B 107 ? C 214 ? B 108 ? C 213 ? 
1 A DG 8  1_555 B DC 13 1_555 A DT 9  1_555 B DA 12 1_555 0.291  -0.064 2.887 -1.720 4.977  31.545 -0.908 -0.802 2.824 9.075   
3.137  31.970 8  BB_DG108DT109:DA212DC213_CC B 108 ? C 213 ? B 109 ? C 212 ? 
1 A DT 9  1_555 B DA 12 1_555 A DA 10 1_555 B DT 11 1_555 0.523  -0.551 4.044 2.554  21.886 28.383 -4.678 -0.410 2.933 38.196  
-4.456 35.793 9  BB_DT109DA110:DT211DA212_CC B 109 ? C 212 ? B 110 ? C 211 ? 
1 A DA 10 1_555 B DT 11 1_555 A DT 11 1_555 B DA 10 1_555 0.147  -0.173 2.858 -5.948 3.201  32.311 -0.776 -1.136 2.759 5.675   
10.545 32.991 10 BB_DA110DT111:DA210DT211_CC B 110 ? C 211 ? B 111 ? C 210 ? 
1 A DT 11 1_555 B DA 10 1_555 A DA 12 1_555 B DT 9  1_555 0.042  -0.935 3.262 1.938  5.750  26.772 -3.344 0.375  2.995 12.220  
-4.118 27.439 11 BB_DT111DA112:DT209DA210_CC B 111 ? C 210 ? B 112 ? C 209 ? 
1 A DA 12 1_555 B DT 9  1_555 A DA 13 1_555 B DT 8  1_555 0.499  -0.680 3.012 -1.090 -2.452 27.449 -0.873 -1.293 3.038 -5.152  
2.291  27.577 12 BB_DA112DA113:DT208DT209_CC B 112 ? C 209 ? B 113 ? C 208 ? 
1 A DA 13 1_555 B DT 8  1_555 A DG 14 1_555 B DC 7  1_555 -0.711 -0.386 3.499 -2.614 -1.737 38.633 -0.352 0.726  3.551 -2.620  
3.943  38.755 13 BB_DA113DG114:DC207DT208_CC B 113 ? C 208 ? B 114 ? C 207 ? 
1 A DG 14 1_555 B DC 7  1_555 A DA 15 1_555 B DT 6  1_555 0.237  -0.676 3.379 2.770  -1.237 41.023 -0.823 -0.025 3.405 -1.762  
-3.946 41.130 14 BB_DG114DA115:DT206DC207_CC B 114 ? C 207 ? B 115 ? C 206 ? 
1 A DA 15 1_555 B DT 6  1_555 A DG 16 1_555 B DC 5  1_555 0.455  -0.825 3.670 2.293  4.552  36.433 -1.996 -0.374 3.566 7.237   
-3.645 36.776 15 BB_DA115DG116:DC205DT206_CC B 115 ? C 206 ? B 116 ? C 205 ? 
1 A DG 16 1_555 B DC 5  1_555 A DA 17 1_555 B DT 4  1_555 -0.391 -0.578 2.648 -6.710 -1.603 24.290 -0.934 -0.736 2.689 -3.715  
15.550 25.237 16 BB_DG116DA117:DT204DC205_CC B 116 ? C 205 ? B 117 ? C 204 ? 
1 A DA 17 1_555 B DT 4  1_555 A DC 18 1_555 B DG 3  1_555 0.158  -0.301 3.159 3.007  10.495 30.704 -2.289 0.219  2.905 19.080  
-5.467 32.543 17 BB_DA117DC118:DG203DT204_CC B 117 ? C 204 ? B 118 ? C 203 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MANGANESE (II) ION' MN  
5 water                HOH 
#