data_1MMG
# 
_entry.id   1MMG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1MMG         
WWPDB D_1000175071 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1MMG 
_pdbx_database_status.recvd_initial_deposition_date   1997-07-18 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gulick, A.M.' 1 
'Bauer, C.B.'  2 
'Thoden, J.B.' 3 
'Rayment, I.'  4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'X-ray structures of the MgADP, MgATPgammaS, and MgAMPPNP complexes of the Dictyostelium discoideum myosin motor domain.' 
Biochemistry 36 11619 11628 1997 BICHAW US 0006-2960 0033 ? 9305951 10.1021/bi9712596 
1       
'X-Ray Structures of the Myosin Motor Domain of Dictyostelium Discoideum Complexed with Mgadp(Dot)Befx and Mgadp(Dot)Alf4-' 
Biochemistry 34 8960  ?     1995 BICHAW US 0006-2960 0033 ? ?       ?                 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gulick, A.M.' 1  
primary 'Bauer, C.B.'  2  
primary 'Thoden, J.B.' 3  
primary 'Rayment, I.'  4  
1       'Fisher, A.J.' 5  
1       'Smith, C.A.'  6  
1       'Thoden, J.B.' 7  
1       'Smith, R.'    8  
1       'Sutoh, K.'    9  
1       'Holden, H.M.' 10 
1       'Rayment, I.'  11 
# 
_cell.entry_id           1MMG 
_cell.length_a           103.800 
_cell.length_b           179.900 
_cell.length_c           54.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1MMG 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man MYOSIN                                       86781.086 1   3.6.1.32 'Q760L, R761P, I762N' 'MOTOR DOMAIN' 
'GENETICALLY TRUNCATED HEAD OF MYOSIN FROM DICTYOSTELIUM. LIGANDS MG2+, ATPGS' 
2 non-polymer syn 'MAGNESIUM ION'                              24.305    1   ?        ?                     ?              ? 
3 non-polymer syn 'PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER' 523.247   1   ?        ?                     ?              ? 
4 water       nat water                                        18.015    337 ?        ?                     ?              ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MYOSIN II HEAVY CHAIN' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSFTFKTSDGQDRQVKKDDANQR
NPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISD
VAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFG
KFIEIQFNNAGFISGASIQSYLLEKSRVVFQSTTERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSD
EDEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILA
GRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCSERKAYFIGVLDISGFEIFKVNSFEQLCINYTNEKLQQ
FFNHHMFKVEQEEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQSVFPNATDNTLITKLHSHFSKKNAKYEE
PRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKLFNDPNIASRAKKGANFLTVAAQYKEQLAS
LMATLETTNPHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGVLEAIRITRKGFPNRIIYADFVKRYYDLAPNVPRDAEDSQ
KATDAVLKHLNIDPEQFRFGITKIFFRAGQLARIEEARELPN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSFTFKTSDGQDRQVKKDDANQR
NPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISD
VAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFG
KFIEIQFNNAGFISGASIQSYLLEKSRVVFQSTTERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSD
EDEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILA
GRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCSERKAYFIGVLDISGFEIFKVNSFEQLCINYTNEKLQQ
FFNHHMFKVEQEEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQSVFPNATDNTLITKLHSHFSKKNAKYEE
PRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKLFNDPNIASRAKKGANFLTVAAQYKEQLAS
LMATLETTNPHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGVLEAIRITRKGFPNRIIYADFVKRYYDLAPNVPRDAEDSQ
KATDAVLKHLNIDPEQFRFGITKIFFRAGQLARIEEARELPN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   PRO n 
1 4   ILE n 
1 5   HIS n 
1 6   ASP n 
1 7   ARG n 
1 8   THR n 
1 9   SER n 
1 10  ASP n 
1 11  TYR n 
1 12  HIS n 
1 13  LYS n 
1 14  TYR n 
1 15  LEU n 
1 16  LYS n 
1 17  VAL n 
1 18  LYS n 
1 19  GLN n 
1 20  GLY n 
1 21  ASP n 
1 22  SER n 
1 23  ASP n 
1 24  LEU n 
1 25  PHE n 
1 26  LYS n 
1 27  LEU n 
1 28  THR n 
1 29  VAL n 
1 30  SER n 
1 31  ASP n 
1 32  LYS n 
1 33  ARG n 
1 34  TYR n 
1 35  ILE n 
1 36  TRP n 
1 37  TYR n 
1 38  ASN n 
1 39  PRO n 
1 40  ASP n 
1 41  PRO n 
1 42  LYS n 
1 43  GLU n 
1 44  ARG n 
1 45  ASP n 
1 46  SER n 
1 47  TYR n 
1 48  GLU n 
1 49  CYS n 
1 50  GLY n 
1 51  GLU n 
1 52  ILE n 
1 53  VAL n 
1 54  SER n 
1 55  GLU n 
1 56  THR n 
1 57  SER n 
1 58  ASP n 
1 59  SER n 
1 60  PHE n 
1 61  THR n 
1 62  PHE n 
1 63  LYS n 
1 64  THR n 
1 65  SER n 
1 66  ASP n 
1 67  GLY n 
1 68  GLN n 
1 69  ASP n 
1 70  ARG n 
1 71  GLN n 
1 72  VAL n 
1 73  LYS n 
1 74  LYS n 
1 75  ASP n 
1 76  ASP n 
1 77  ALA n 
1 78  ASN n 
1 79  GLN n 
1 80  ARG n 
1 81  ASN n 
1 82  PRO n 
1 83  ILE n 
1 84  LYS n 
1 85  PHE n 
1 86  ASP n 
1 87  GLY n 
1 88  VAL n 
1 89  GLU n 
1 90  ASP n 
1 91  MET n 
1 92  SER n 
1 93  GLU n 
1 94  LEU n 
1 95  SER n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  GLU n 
1 100 PRO n 
1 101 ALA n 
1 102 VAL n 
1 103 PHE n 
1 104 HIS n 
1 105 ASN n 
1 106 LEU n 
1 107 ARG n 
1 108 VAL n 
1 109 ARG n 
1 110 TYR n 
1 111 ASN n 
1 112 GLN n 
1 113 ASP n 
1 114 LEU n 
1 115 ILE n 
1 116 TYR n 
1 117 THR n 
1 118 TYR n 
1 119 SER n 
1 120 GLY n 
1 121 LEU n 
1 122 PHE n 
1 123 LEU n 
1 124 VAL n 
1 125 ALA n 
1 126 VAL n 
1 127 ASN n 
1 128 PRO n 
1 129 PHE n 
1 130 LYS n 
1 131 ARG n 
1 132 ILE n 
1 133 PRO n 
1 134 ILE n 
1 135 TYR n 
1 136 THR n 
1 137 GLN n 
1 138 GLU n 
1 139 MET n 
1 140 VAL n 
1 141 ASP n 
1 142 ILE n 
1 143 PHE n 
1 144 LYS n 
1 145 GLY n 
1 146 ARG n 
1 147 ARG n 
1 148 ARG n 
1 149 ASN n 
1 150 GLU n 
1 151 VAL n 
1 152 ALA n 
1 153 PRO n 
1 154 HIS n 
1 155 ILE n 
1 156 PHE n 
1 157 ALA n 
1 158 ILE n 
1 159 SER n 
1 160 ASP n 
1 161 VAL n 
1 162 ALA n 
1 163 TYR n 
1 164 ARG n 
1 165 SER n 
1 166 MET n 
1 167 LEU n 
1 168 ASP n 
1 169 ASP n 
1 170 ARG n 
1 171 GLN n 
1 172 ASN n 
1 173 GLN n 
1 174 SER n 
1 175 LEU n 
1 176 LEU n 
1 177 ILE n 
1 178 THR n 
1 179 GLY n 
1 180 GLU n 
1 181 SER n 
1 182 GLY n 
1 183 ALA n 
1 184 GLY n 
1 185 LYS n 
1 186 THR n 
1 187 GLU n 
1 188 ASN n 
1 189 THR n 
1 190 LYS n 
1 191 LYS n 
1 192 VAL n 
1 193 ILE n 
1 194 GLN n 
1 195 TYR n 
1 196 LEU n 
1 197 ALA n 
1 198 SER n 
1 199 VAL n 
1 200 ALA n 
1 201 GLY n 
1 202 ARG n 
1 203 ASN n 
1 204 GLN n 
1 205 ALA n 
1 206 ASN n 
1 207 GLY n 
1 208 SER n 
1 209 GLY n 
1 210 VAL n 
1 211 LEU n 
1 212 GLU n 
1 213 GLN n 
1 214 GLN n 
1 215 ILE n 
1 216 LEU n 
1 217 GLN n 
1 218 ALA n 
1 219 ASN n 
1 220 PRO n 
1 221 ILE n 
1 222 LEU n 
1 223 GLU n 
1 224 ALA n 
1 225 PHE n 
1 226 GLY n 
1 227 ASN n 
1 228 ALA n 
1 229 LYS n 
1 230 THR n 
1 231 THR n 
1 232 ARG n 
1 233 ASN n 
1 234 ASN n 
1 235 ASN n 
1 236 SER n 
1 237 SER n 
1 238 ARG n 
1 239 PHE n 
1 240 GLY n 
1 241 LYS n 
1 242 PHE n 
1 243 ILE n 
1 244 GLU n 
1 245 ILE n 
1 246 GLN n 
1 247 PHE n 
1 248 ASN n 
1 249 ASN n 
1 250 ALA n 
1 251 GLY n 
1 252 PHE n 
1 253 ILE n 
1 254 SER n 
1 255 GLY n 
1 256 ALA n 
1 257 SER n 
1 258 ILE n 
1 259 GLN n 
1 260 SER n 
1 261 TYR n 
1 262 LEU n 
1 263 LEU n 
1 264 GLU n 
1 265 LYS n 
1 266 SER n 
1 267 ARG n 
1 268 VAL n 
1 269 VAL n 
1 270 PHE n 
1 271 GLN n 
1 272 SER n 
1 273 THR n 
1 274 THR n 
1 275 GLU n 
1 276 ARG n 
1 277 ASN n 
1 278 TYR n 
1 279 HIS n 
1 280 ILE n 
1 281 PHE n 
1 282 TYR n 
1 283 GLN n 
1 284 LEU n 
1 285 LEU n 
1 286 ALA n 
1 287 GLY n 
1 288 ALA n 
1 289 THR n 
1 290 ALA n 
1 291 GLU n 
1 292 GLU n 
1 293 LYS n 
1 294 LYS n 
1 295 ALA n 
1 296 LEU n 
1 297 HIS n 
1 298 LEU n 
1 299 ALA n 
1 300 GLY n 
1 301 PRO n 
1 302 GLU n 
1 303 SER n 
1 304 PHE n 
1 305 ASN n 
1 306 TYR n 
1 307 LEU n 
1 308 ASN n 
1 309 GLN n 
1 310 SER n 
1 311 GLY n 
1 312 CYS n 
1 313 VAL n 
1 314 ASP n 
1 315 ILE n 
1 316 LYS n 
1 317 GLY n 
1 318 VAL n 
1 319 SER n 
1 320 ASP n 
1 321 GLU n 
1 322 ASP n 
1 323 GLU n 
1 324 PHE n 
1 325 LYS n 
1 326 ILE n 
1 327 THR n 
1 328 ARG n 
1 329 GLN n 
1 330 ALA n 
1 331 MET n 
1 332 ASP n 
1 333 ILE n 
1 334 VAL n 
1 335 GLY n 
1 336 PHE n 
1 337 SER n 
1 338 GLN n 
1 339 GLU n 
1 340 GLU n 
1 341 GLN n 
1 342 MET n 
1 343 SER n 
1 344 ILE n 
1 345 PHE n 
1 346 LYS n 
1 347 ILE n 
1 348 ILE n 
1 349 ALA n 
1 350 GLY n 
1 351 ILE n 
1 352 LEU n 
1 353 HIS n 
1 354 LEU n 
1 355 GLY n 
1 356 ASN n 
1 357 ILE n 
1 358 LYS n 
1 359 PHE n 
1 360 GLU n 
1 361 LYS n 
1 362 GLY n 
1 363 ALA n 
1 364 GLY n 
1 365 GLU n 
1 366 GLY n 
1 367 ALA n 
1 368 VAL n 
1 369 LEU n 
1 370 LYS n 
1 371 ASP n 
1 372 LYS n 
1 373 THR n 
1 374 ALA n 
1 375 LEU n 
1 376 ASN n 
1 377 ALA n 
1 378 ALA n 
1 379 SER n 
1 380 THR n 
1 381 VAL n 
1 382 PHE n 
1 383 GLY n 
1 384 VAL n 
1 385 ASN n 
1 386 PRO n 
1 387 SER n 
1 388 VAL n 
1 389 LEU n 
1 390 GLU n 
1 391 LYS n 
1 392 ALA n 
1 393 LEU n 
1 394 MET n 
1 395 GLU n 
1 396 PRO n 
1 397 ARG n 
1 398 ILE n 
1 399 LEU n 
1 400 ALA n 
1 401 GLY n 
1 402 ARG n 
1 403 ASP n 
1 404 LEU n 
1 405 VAL n 
1 406 ALA n 
1 407 GLN n 
1 408 HIS n 
1 409 LEU n 
1 410 ASN n 
1 411 VAL n 
1 412 GLU n 
1 413 LYS n 
1 414 SER n 
1 415 SER n 
1 416 SER n 
1 417 SER n 
1 418 ARG n 
1 419 ASP n 
1 420 ALA n 
1 421 LEU n 
1 422 VAL n 
1 423 LYS n 
1 424 ALA n 
1 425 LEU n 
1 426 TYR n 
1 427 GLY n 
1 428 ARG n 
1 429 LEU n 
1 430 PHE n 
1 431 LEU n 
1 432 TRP n 
1 433 LEU n 
1 434 VAL n 
1 435 LYS n 
1 436 LYS n 
1 437 ILE n 
1 438 ASN n 
1 439 ASN n 
1 440 VAL n 
1 441 LEU n 
1 442 CYS n 
1 443 SER n 
1 444 GLU n 
1 445 ARG n 
1 446 LYS n 
1 447 ALA n 
1 448 TYR n 
1 449 PHE n 
1 450 ILE n 
1 451 GLY n 
1 452 VAL n 
1 453 LEU n 
1 454 ASP n 
1 455 ILE n 
1 456 SER n 
1 457 GLY n 
1 458 PHE n 
1 459 GLU n 
1 460 ILE n 
1 461 PHE n 
1 462 LYS n 
1 463 VAL n 
1 464 ASN n 
1 465 SER n 
1 466 PHE n 
1 467 GLU n 
1 468 GLN n 
1 469 LEU n 
1 470 CYS n 
1 471 ILE n 
1 472 ASN n 
1 473 TYR n 
1 474 THR n 
1 475 ASN n 
1 476 GLU n 
1 477 LYS n 
1 478 LEU n 
1 479 GLN n 
1 480 GLN n 
1 481 PHE n 
1 482 PHE n 
1 483 ASN n 
1 484 HIS n 
1 485 HIS n 
1 486 MET n 
1 487 PHE n 
1 488 LYS n 
1 489 VAL n 
1 490 GLU n 
1 491 GLN n 
1 492 GLU n 
1 493 GLU n 
1 494 TYR n 
1 495 LEU n 
1 496 LYS n 
1 497 GLU n 
1 498 LYS n 
1 499 ILE n 
1 500 ASN n 
1 501 TRP n 
1 502 THR n 
1 503 PHE n 
1 504 ILE n 
1 505 ASP n 
1 506 PHE n 
1 507 GLY n 
1 508 LEU n 
1 509 ASP n 
1 510 SER n 
1 511 GLN n 
1 512 ALA n 
1 513 THR n 
1 514 ILE n 
1 515 ASP n 
1 516 LEU n 
1 517 ILE n 
1 518 ASP n 
1 519 GLY n 
1 520 ARG n 
1 521 GLN n 
1 522 PRO n 
1 523 PRO n 
1 524 GLY n 
1 525 ILE n 
1 526 LEU n 
1 527 ALA n 
1 528 LEU n 
1 529 LEU n 
1 530 ASP n 
1 531 GLU n 
1 532 GLN n 
1 533 SER n 
1 534 VAL n 
1 535 PHE n 
1 536 PRO n 
1 537 ASN n 
1 538 ALA n 
1 539 THR n 
1 540 ASP n 
1 541 ASN n 
1 542 THR n 
1 543 LEU n 
1 544 ILE n 
1 545 THR n 
1 546 LYS n 
1 547 LEU n 
1 548 HIS n 
1 549 SER n 
1 550 HIS n 
1 551 PHE n 
1 552 SER n 
1 553 LYS n 
1 554 LYS n 
1 555 ASN n 
1 556 ALA n 
1 557 LYS n 
1 558 TYR n 
1 559 GLU n 
1 560 GLU n 
1 561 PRO n 
1 562 ARG n 
1 563 PHE n 
1 564 SER n 
1 565 LYS n 
1 566 THR n 
1 567 GLU n 
1 568 PHE n 
1 569 GLY n 
1 570 VAL n 
1 571 THR n 
1 572 HIS n 
1 573 TYR n 
1 574 ALA n 
1 575 GLY n 
1 576 GLN n 
1 577 VAL n 
1 578 MET n 
1 579 TYR n 
1 580 GLU n 
1 581 ILE n 
1 582 GLN n 
1 583 ASP n 
1 584 TRP n 
1 585 LEU n 
1 586 GLU n 
1 587 LYS n 
1 588 ASN n 
1 589 LYS n 
1 590 ASP n 
1 591 PRO n 
1 592 LEU n 
1 593 GLN n 
1 594 GLN n 
1 595 ASP n 
1 596 LEU n 
1 597 GLU n 
1 598 LEU n 
1 599 CYS n 
1 600 PHE n 
1 601 LYS n 
1 602 ASP n 
1 603 SER n 
1 604 SER n 
1 605 ASP n 
1 606 ASN n 
1 607 VAL n 
1 608 VAL n 
1 609 THR n 
1 610 LYS n 
1 611 LEU n 
1 612 PHE n 
1 613 ASN n 
1 614 ASP n 
1 615 PRO n 
1 616 ASN n 
1 617 ILE n 
1 618 ALA n 
1 619 SER n 
1 620 ARG n 
1 621 ALA n 
1 622 LYS n 
1 623 LYS n 
1 624 GLY n 
1 625 ALA n 
1 626 ASN n 
1 627 PHE n 
1 628 LEU n 
1 629 THR n 
1 630 VAL n 
1 631 ALA n 
1 632 ALA n 
1 633 GLN n 
1 634 TYR n 
1 635 LYS n 
1 636 GLU n 
1 637 GLN n 
1 638 LEU n 
1 639 ALA n 
1 640 SER n 
1 641 LEU n 
1 642 MET n 
1 643 ALA n 
1 644 THR n 
1 645 LEU n 
1 646 GLU n 
1 647 THR n 
1 648 THR n 
1 649 ASN n 
1 650 PRO n 
1 651 HIS n 
1 652 PHE n 
1 653 VAL n 
1 654 ARG n 
1 655 CYS n 
1 656 ILE n 
1 657 ILE n 
1 658 PRO n 
1 659 ASN n 
1 660 ASN n 
1 661 LYS n 
1 662 GLN n 
1 663 LEU n 
1 664 PRO n 
1 665 ALA n 
1 666 LYS n 
1 667 LEU n 
1 668 GLU n 
1 669 ASP n 
1 670 LYS n 
1 671 VAL n 
1 672 VAL n 
1 673 LEU n 
1 674 ASP n 
1 675 GLN n 
1 676 LEU n 
1 677 ARG n 
1 678 CYS n 
1 679 ASN n 
1 680 GLY n 
1 681 VAL n 
1 682 LEU n 
1 683 GLU n 
1 684 ALA n 
1 685 ILE n 
1 686 ARG n 
1 687 ILE n 
1 688 THR n 
1 689 ARG n 
1 690 LYS n 
1 691 GLY n 
1 692 PHE n 
1 693 PRO n 
1 694 ASN n 
1 695 ARG n 
1 696 ILE n 
1 697 ILE n 
1 698 TYR n 
1 699 ALA n 
1 700 ASP n 
1 701 PHE n 
1 702 VAL n 
1 703 LYS n 
1 704 ARG n 
1 705 TYR n 
1 706 TYR n 
1 707 ASP n 
1 708 LEU n 
1 709 ALA n 
1 710 PRO n 
1 711 ASN n 
1 712 VAL n 
1 713 PRO n 
1 714 ARG n 
1 715 ASP n 
1 716 ALA n 
1 717 GLU n 
1 718 ASP n 
1 719 SER n 
1 720 GLN n 
1 721 LYS n 
1 722 ALA n 
1 723 THR n 
1 724 ASP n 
1 725 ALA n 
1 726 VAL n 
1 727 LEU n 
1 728 LYS n 
1 729 HIS n 
1 730 LEU n 
1 731 ASN n 
1 732 ILE n 
1 733 ASP n 
1 734 PRO n 
1 735 GLU n 
1 736 GLN n 
1 737 PHE n 
1 738 ARG n 
1 739 PHE n 
1 740 GLY n 
1 741 ILE n 
1 742 THR n 
1 743 LYS n 
1 744 ILE n 
1 745 PHE n 
1 746 PHE n 
1 747 ARG n 
1 748 ALA n 
1 749 GLY n 
1 750 GLN n 
1 751 LEU n 
1 752 ALA n 
1 753 ARG n 
1 754 ILE n 
1 755 GLU n 
1 756 GLU n 
1 757 ALA n 
1 758 ARG n 
1 759 GLU n 
1 760 LEU n 
1 761 PRO n 
1 762 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Dictyostelium 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Dictyostelium discoideum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     44689 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Dictyostelium discoideum' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     44689 
_entity_src_gen.host_org_genus                     Dictyostelium 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MYS2_DICDI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P08799 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MNPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSFTFKTVDGQDRQVKKDDANQR
NPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISD
VAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFG
KFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGYVDIKGVSD
SEEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILA
GRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCQERKAYFIGVLDISGFEIFKVNSFEQLCINYTNEKLQQ
FFNHHMFKLEQEEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQSVFPNATDNTLITKLHSHFSKKNAKYEE
PRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCFKDSSDNVVTKLFNDPNIASRAKKGANFITVAAQYKEQLAS
LMATLETTNPHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGVLEGIRITRKGFPNRIIYADFVKRYYLLAPNVPRDAEDSQ
KATDAVLKHLNIDPEQYRFGITKIFFRAGQLARIEEAREQRISEIIKAIQAATRGWIARKVYKQAREHTVAARIIQQNLR
AYIDFKSWPWWKLFSKARPLLKRRNFEKEIKEKEREILELKSNLTDSTTQKDKLEKSLKDTESNVLDLQRQLKAEKETLK
AMYDSKDALEAQKRELEIRVEDMESELDEKKLALENLQNQKRSVEEKVRDLEEELQEEQKLRNTLEKLKKKYEEELEEMK
RVNDGQSDTISRLEKIKDELQKEVEELTESFSEESKDKGVLEKTRVRLQSELDDLTVRLDSETKDKSELLRQKKKLEEEL
KQVQEALAAETAAKLAQEAANKKLQGEYTELNEKFNSEVTARSNVEKSKKTLESQLVAVNNELDEEKKNRDALEKKKKAL
DAMLEEMKDQLESTGGEKKSLYDLKVKQESDMEALRNQISELQSTIAKLEKIKSTLEGEVARLQGELEAEQLAKSNVEKQ
KKKVELDLEDKSAQLAEETAAKQALDKLKKKLEQELSEVQTQLSEANNKNVNSDSTNKHLETSFNNLKLELEAEQKAKQA
LEKKRLGLESELKHVNEQLEEEKKQKESNEKRKVDLEKEVSELKDQIEEEVASKKAVTEAKNKKESELDEIKRQYADVVS
SRDKSVEQLKTLQAKNEELRNTAEEAEGQLDRAERSKKKAEFDLEEAVKNLEEETAKKVKAEKAMKKAETDYRSTKSELD
DAKNVSSEQYVQIKRLNEELSELRSVLEEADERCNSAIKAKKTAESALESLKDEIDAANNAKAKAERKSKELEVRVAELE
ESLEDKSGTVNVEFIRKKDAEIDDLRARLDRETESRIKSDEDKKNTRKQFADLEAKVEEAQREVVTIDRLKKKLESDIID
LSTQLDTETKSRIKIEKSKKKLEQTLAERRAAEEGSSKAADEEIRKQVWQEVDELRAQLDSERAALNASEKKIKSLVAEV
DEVKEQLEDEILAKDKLVKAKRALEVELEEVRDQLEEEEDSRSELEDSKRRLTTEVEDIKKKYDAEVEQNTKLDEAKKKL
TDDVDTLKKQLEDEKKKLNESERAKKRLESENEDFLAKLDAEVKNRSRAEKDRKKYEKDLKDTKYKLNDEAATKTQTEIG
AAKLEDQIDELRSKLEQEQAKATQADKSKKTLEGEIDNLRAQIEDEGKIKMRLEKEKRALEGELEELRETVEEAEDSKSE
AEQSKRLVELELEDARRNLQKEIDAKEIAEDAKSNLQREIVEAKGRLEEESIARTNSDRSRKRLEAEIDALTAQVDAEQK
AKNQQIKENKKIETELKEYRKKFGESEKTKTKEFLVVEKLETDYKRAKKEAADEQQQRLTVENDLRKHLSEISLLKDAID
KLQRDHDKTKRELETETASKIEMQRKMADFFGGFKA
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1MMG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 759 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08799 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  759 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       759 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1MMG SER A 65  ? UNP P08799 VAL 65  CONFLICT 65  1  
1 1MMG THR A 273 ? UNP P08799 GLU 273 CONFLICT 273 2  
1 1MMG CYS A 312 ? UNP P08799 TYR 312 CONFLICT 312 3  
1 1MMG GLU A 321 ? UNP P08799 SER 321 CONFLICT 321 4  
1 1MMG ASP A 322 ? UNP P08799 GLU 322 CONFLICT 322 5  
1 1MMG SER A 443 ? UNP P08799 GLN 443 CONFLICT 443 6  
1 1MMG VAL A 489 ? UNP P08799 LEU 489 CONFLICT 489 7  
1 1MMG LEU A 628 ? UNP P08799 ILE 628 CONFLICT 628 8  
1 1MMG ALA A 684 ? UNP P08799 GLY 684 CONFLICT 684 9  
1 1MMG ASP A 707 ? UNP P08799 LEU 707 CONFLICT 707 10 
1 1MMG PHE A 737 ? UNP P08799 TYR 737 CONFLICT 737 11 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AGS non-polymer         . 'PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER' 
;ATP-GAMMA-S; ADENOSINE 5'-(3-THIOTRIPHOSPHATE); ADENOSINE 5'-(GAMMA-THIOTRIPHOSPHATE); ADENOSINE-5'-DIPHOSPHATE MONOTHIOPHOSPHATE
;
'C10 H16 N5 O12 P3 S' 523.247 
ALA 'L-peptide linking' y ALANINE                                      ? 'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                                     ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                                   ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                              ? 'C4 H7 N O4'          133.103 
CYS 'L-peptide linking' y CYSTEINE                                     ? 'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking' y GLUTAMINE                                    ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                              ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                                      ? 'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE                                    ? 'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                                        ? 'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                   ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                                      ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                                       ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                                   ? 'C5 H11 N O2 S'       149.211 
MG  non-polymer         . 'MAGNESIUM ION'                              ? 'Mg 2'                24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                                      ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE                                       ? 'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE                                    ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                   ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                                     ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                                       ? 'C5 H11 N O2'         117.146 
# 
_exptl.entry_id          1MMG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.90 
_exptl_crystal.density_percent_sol   57.65 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1996-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.908 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             0.908 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1MMG 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20. 
_reflns.d_resolution_high            1.9 
_reflns.number_obs                   58467 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.3 
_reflns.pdbx_Rmerge_I_obs            0.0570000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.6 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.0 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   91.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1MMG 
_refine.ls_number_reflns_obs                     58467 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            2.1 
_refine.ls_percent_reflns_obs                    92. 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1980000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1MMD' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5865 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             337 
_refine_hist.number_atoms_total               6234 
_refine_hist.d_res_high                       2.1 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.017 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        2.6   ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_it               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1MMG 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1980000 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1MMG 
_struct.title                     
'X-RAY STRUCTURES OF THE MGADP, MGATPGAMMAS, AND MGAMPPNP COMPLEXES OF THE DICTYOSTELIUM DISCOIDEUM MYOSIN MOTOR DOMAIN' 
_struct.pdbx_descriptor           'MYOSIN, PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MMG 
_struct_keywords.pdbx_keywords   'COILED COIL' 
_struct_keywords.text            'COILED COIL, MYOSIN, DICTYOSTELIUM, MOTOR, NUCLEOTIDE ANALOGUES, ATPGS, ATPASE, ACTIN-BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 10  ? LEU A 15  ? ASP A 10  LEU A 15  1 ? 6  
HELX_P HELX_P2  2  PHE A 25  ? THR A 28  ? PHE A 25  THR A 28  5 ? 4  
HELX_P HELX_P3  3  LYS A 74  ? ASP A 76  ? LYS A 74  ASP A 76  5 ? 3  
HELX_P HELX_P4  4  ILE A 83  ? PHE A 85  ? ILE A 83  PHE A 85  5 ? 3  
HELX_P HELX_P5  5  MET A 91  ? GLU A 93  ? MET A 91  GLU A 93  5 ? 3  
HELX_P HELX_P6  6  GLU A 99  ? GLN A 112 ? GLU A 99  GLN A 112 1 ? 14 
HELX_P HELX_P7  7  GLN A 137 ? PHE A 143 ? GLN A 137 PHE A 143 1 ? 7  
HELX_P HELX_P8  8  ARG A 148 ? GLU A 150 ? ARG A 148 GLU A 150 5 ? 3  
HELX_P HELX_P9  9  ILE A 155 ? ASP A 169 ? ILE A 155 ASP A 169 1 ? 15 
HELX_P HELX_P10 10 LYS A 185 ? VAL A 199 ? LYS A 185 VAL A 199 1 ? 15 
HELX_P HELX_P11 11 VAL A 210 ? GLY A 226 ? VAL A 210 GLY A 226 1 ? 17 
HELX_P HELX_P12 12 LYS A 265 ? VAL A 268 ? LYS A 265 VAL A 268 5 ? 4  
HELX_P HELX_P13 13 HIS A 279 ? GLY A 287 ? HIS A 279 GLY A 287 1 ? 9  
HELX_P HELX_P14 14 ALA A 290 ? LEU A 296 ? ALA A 290 LEU A 296 1 ? 7  
HELX_P HELX_P15 15 ASP A 320 ? VAL A 334 ? ASP A 320 VAL A 334 1 ? 15 
HELX_P HELX_P16 16 GLN A 338 ? ASN A 356 ? GLN A 338 ASN A 356 1 ? 19 
HELX_P HELX_P17 17 THR A 373 ? PHE A 382 ? THR A 373 PHE A 382 1 ? 10 
HELX_P HELX_P18 18 PRO A 386 ? MET A 394 ? PRO A 386 MET A 394 1 ? 9  
HELX_P HELX_P19 19 VAL A 411 ? LEU A 441 ? VAL A 411 LEU A 441 1 ? 31 
HELX_P HELX_P20 20 PHE A 466 ? GLU A 497 ? PHE A 466 GLU A 497 1 ? 32 
HELX_P HELX_P21 21 ASP A 509 ? ASP A 518 ? ASP A 509 ASP A 518 1 ? 10 
HELX_P HELX_P22 22 ILE A 525 ? VAL A 534 ? ILE A 525 VAL A 534 1 ? 10 
HELX_P HELX_P23 23 ASP A 540 ? PHE A 551 ? ASP A 540 PHE A 551 1 ? 12 
HELX_P HELX_P24 24 TRP A 584 ? LYS A 589 ? TRP A 584 LYS A 589 1 ? 6  
HELX_P HELX_P25 25 GLN A 594 ? LYS A 601 ? GLN A 594 LYS A 601 1 ? 8  
HELX_P HELX_P26 26 ASN A 606 ? ASN A 613 ? ASN A 606 ASN A 613 1 ? 8  
HELX_P HELX_P27 27 PRO A 615 ? ALA A 618 ? PRO A 615 ALA A 618 1 ? 4  
HELX_P HELX_P28 28 VAL A 630 ? THR A 647 ? VAL A 630 THR A 647 1 ? 18 
HELX_P HELX_P29 29 ASP A 669 ? CYS A 678 ? ASP A 669 CYS A 678 1 ? 10 
HELX_P HELX_P30 30 VAL A 681 ? LYS A 690 ? VAL A 681 LYS A 690 1 ? 10 
HELX_P HELX_P31 31 TYR A 698 ? LEU A 708 ? TYR A 698 LEU A 708 1 ? 11 
HELX_P HELX_P32 32 SER A 719 ? HIS A 729 ? SER A 719 HIS A 729 1 ? 11 
HELX_P HELX_P33 33 PRO A 734 ? GLN A 736 ? PRO A 734 GLN A 736 5 ? 3  
HELX_P HELX_P34 34 GLN A 750 ? GLU A 755 ? GLN A 750 GLU A 755 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? D HOH . O  ? ? ? 1_555 B MG  .   MG  ? ? A HOH 9951 A MG  998 1_555 ? ? ? ? ? ? ? 2.102 ? 
metalc2 metalc ? ? D HOH . O  ? ? ? 1_555 B MG  .   MG  ? ? A HOH 9952 A MG  998 1_555 ? ? ? ? ? ? ? 2.060 ? 
metalc3 metalc ? ? B MG  . MG ? ? ? 1_555 A THR 186 OG1 ? ? A MG  998  A THR 186 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc4 metalc ? ? B MG  . MG ? ? ? 1_555 A SER 237 OG  ? ? A MG  998  A SER 237 1_555 ? ? ? ? ? ? ? 1.992 ? 
metalc5 metalc ? ? B MG  . MG ? ? ? 1_555 C AGS .   O3G ? ? A MG  998  A AGS 999 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc6 metalc ? ? B MG  . MG ? ? ? 1_555 C AGS .   O2B ? ? A MG  998  A AGS 999 1_555 ? ? ? ? ? ? ? 1.967 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLN 
_struct_mon_prot_cis.label_seq_id           521 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLN 
_struct_mon_prot_cis.auth_seq_id            521 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    522 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     522 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.49 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 7 ? 
C ? 2 ? 
D ? 3 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 34  ? TYR A 37  ? TYR A 34  TYR A 37  
A 2 GLU A 48  ? THR A 56  ? GLU A 48  THR A 56  
A 3 SER A 59  ? LYS A 63  ? SER A 59  LYS A 63  
A 4 ASP A 69  ? LYS A 73  ? ASP A 69  LYS A 73  
B 1 TYR A 116 ? SER A 119 ? TYR A 116 SER A 119 
B 2 PHE A 122 ? VAL A 126 ? PHE A 122 VAL A 126 
B 3 ASN A 649 ? ILE A 656 ? ASN A 649 ILE A 656 
B 4 GLN A 173 ? GLY A 179 ? GLN A 173 GLY A 179 
B 5 TYR A 448 ? SER A 456 ? TYR A 448 SER A 456 
B 6 GLY A 240 ? PHE A 247 ? GLY A 240 PHE A 247 
B 7 ILE A 253 ? TYR A 261 ? ILE A 253 TYR A 261 
C 1 ARG A 397 ? LEU A 399 ? ARG A 397 LEU A 399 
C 2 LEU A 404 ? ALA A 406 ? LEU A 404 ALA A 406 
D 1 TYR A 558 ? GLU A 560 ? TYR A 558 GLU A 560 
D 2 GLU A 567 ? HIS A 572 ? GLU A 567 HIS A 572 
D 3 GLY A 575 ? GLU A 580 ? GLY A 575 GLU A 580 
E 1 ASN A 694 ? ILE A 697 ? ASN A 694 ILE A 697 
E 2 LYS A 743 ? PHE A 746 ? LYS A 743 PHE A 746 
E 3 PHE A 737 ? PHE A 739 ? PHE A 737 PHE A 739 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 35  ? O ILE A 35  N GLY A 50  ? N GLY A 50  
A 2 3 O GLU A 51  ? O GLU A 51  N LYS A 63  ? N LYS A 63  
A 3 4 O PHE A 60  ? O PHE A 60  N VAL A 72  ? N VAL A 72  
B 1 2 O THR A 117 ? O THR A 117 N VAL A 124 ? N VAL A 124 
B 2 3 O LEU A 123 ? O LEU A 123 N PHE A 652 ? N PHE A 652 
B 3 4 O ASN A 649 ? O ASN A 649 N SER A 174 ? N SER A 174 
B 4 5 O GLN A 173 ? O GLN A 173 N GLY A 451 ? N GLY A 451 
B 5 6 O TYR A 448 ? O TYR A 448 N PHE A 247 ? N PHE A 247 
B 6 7 O GLY A 240 ? O GLY A 240 N TYR A 261 ? N TYR A 261 
C 1 2 O ILE A 398 ? O ILE A 398 N VAL A 405 ? N VAL A 405 
D 1 2 O GLU A 559 ? O GLU A 559 N GLY A 569 ? N GLY A 569 
D 2 3 O PHE A 568 ? O PHE A 568 N TYR A 579 ? N TYR A 579 
E 1 2 O ASN A 694 ? O ASN A 694 N PHE A 746 ? N PHE A 746 
E 2 3 O PHE A 745 ? O PHE A 745 N ARG A 738 ? N ARG A 738 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 998'  
AC2 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE AGS A 999' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  THR A 186 ? THR A 186  . ? 1_555 ? 
2  AC1 5  SER A 237 ? SER A 237  . ? 1_555 ? 
3  AC1 5  AGS C .   ? AGS A 999  . ? 1_555 ? 
4  AC1 5  HOH D .   ? HOH A 9951 . ? 1_555 ? 
5  AC1 5  HOH D .   ? HOH A 9952 . ? 1_555 ? 
6  AC2 22 ASN A 127 ? ASN A 127  . ? 1_555 ? 
7  AC2 22 PRO A 128 ? PRO A 128  . ? 1_555 ? 
8  AC2 22 LYS A 130 ? LYS A 130  . ? 1_555 ? 
9  AC2 22 ARG A 131 ? ARG A 131  . ? 1_555 ? 
10 AC2 22 TYR A 135 ? TYR A 135  . ? 1_555 ? 
11 AC2 22 GLU A 180 ? GLU A 180  . ? 1_555 ? 
12 AC2 22 SER A 181 ? SER A 181  . ? 1_555 ? 
13 AC2 22 GLY A 182 ? GLY A 182  . ? 1_555 ? 
14 AC2 22 ALA A 183 ? ALA A 183  . ? 1_555 ? 
15 AC2 22 GLY A 184 ? GLY A 184  . ? 1_555 ? 
16 AC2 22 LYS A 185 ? LYS A 185  . ? 1_555 ? 
17 AC2 22 THR A 186 ? THR A 186  . ? 1_555 ? 
18 AC2 22 GLU A 187 ? GLU A 187  . ? 1_555 ? 
19 AC2 22 ASN A 233 ? ASN A 233  . ? 1_555 ? 
20 AC2 22 SER A 236 ? SER A 236  . ? 1_555 ? 
21 AC2 22 SER A 237 ? SER A 237  . ? 1_555 ? 
22 AC2 22 MG  B .   ? MG  A 998  . ? 1_555 ? 
23 AC2 22 HOH D .   ? HOH A 8163 . ? 1_555 ? 
24 AC2 22 HOH D .   ? HOH A 8178 . ? 1_555 ? 
25 AC2 22 HOH D .   ? HOH A 8179 . ? 1_555 ? 
26 AC2 22 HOH D .   ? HOH A 9951 . ? 1_555 ? 
27 AC2 22 HOH D .   ? HOH A 9952 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1MMG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1MMG 
_atom_sites.fract_transf_matrix[1][1]   0.009634 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005559 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018519 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASN A 1 2   ? 0.817  45.699 -6.134  1.00 62.37  ? 2    ASN A N     1 
ATOM   2    C  CA    . ASN A 1 2   ? 2.085  45.973 -5.470  1.00 67.63  ? 2    ASN A CA    1 
ATOM   3    C  C     . ASN A 1 2   ? 1.824  46.378 -4.058  1.00 46.57  ? 2    ASN A C     1 
ATOM   4    O  O     . ASN A 1 2   ? 1.624  47.549 -3.725  1.00 81.39  ? 2    ASN A O     1 
ATOM   5    C  CB    . ASN A 1 2   ? 3.026  46.989 -6.131  1.00 48.70  ? 2    ASN A CB    1 
ATOM   6    C  CG    . ASN A 1 2   ? 4.443  46.684 -5.735  1.00 52.88  ? 2    ASN A CG    1 
ATOM   7    O  OD1   . ASN A 1 2   ? 4.698  45.657 -5.062  1.00 87.14  ? 2    ASN A OD1   1 
ATOM   8    N  ND2   . ASN A 1 2   ? 5.376  47.559 -6.161  1.00 62.86  ? 2    ASN A ND2   1 
ATOM   9    N  N     . PRO A 1 3   ? 1.841  45.336 -3.274  1.00 80.71  ? 3    PRO A N     1 
ATOM   10   C  CA    . PRO A 1 3   ? 1.632  45.395 -1.867  1.00 52.84  ? 3    PRO A CA    1 
ATOM   11   C  C     . PRO A 1 3   ? 2.401  46.530 -1.224  1.00 61.00  ? 3    PRO A C     1 
ATOM   12   O  O     . PRO A 1 3   ? 1.901  47.069 -0.226  1.00 34.06  ? 3    PRO A O     1 
ATOM   13   C  CB    . PRO A 1 3   ? 1.967  44.012 -1.325  1.00 51.51  ? 3    PRO A CB    1 
ATOM   14   C  CG    . PRO A 1 3   ? 2.155  43.090 -2.538  1.00 53.54  ? 3    PRO A CG    1 
ATOM   15   C  CD    . PRO A 1 3   ? 2.098  43.965 -3.775  1.00 96.51  ? 3    PRO A CD    1 
ATOM   16   N  N     . ILE A 1 4   ? 3.556  46.914 -1.833  1.00 31.48  ? 4    ILE A N     1 
ATOM   17   C  CA    . ILE A 1 4   ? 4.338  48.018 -1.259  1.00 41.81  ? 4    ILE A CA    1 
ATOM   18   C  C     . ILE A 1 4   ? 3.588  49.302 -1.488  1.00 46.69  ? 4    ILE A C     1 
ATOM   19   O  O     . ILE A 1 4   ? 3.752  50.284 -0.769  1.00 45.01  ? 4    ILE A O     1 
ATOM   20   C  CB    . ILE A 1 4   ? 5.764  48.168 -1.798  1.00 30.01  ? 4    ILE A CB    1 
ATOM   21   C  CG1   . ILE A 1 4   ? 6.688  47.120 -1.247  1.00 32.07  ? 4    ILE A CG1   1 
ATOM   22   C  CG2   . ILE A 1 4   ? 6.322  49.509 -1.447  1.00 37.68  ? 4    ILE A CG2   1 
ATOM   23   C  CD1   . ILE A 1 4   ? 6.432  45.766 -1.901  1.00 60.74  ? 4    ILE A CD1   1 
ATOM   24   N  N     . HIS A 1 5   ? 2.754  49.297 -2.510  1.00 36.53  ? 5    HIS A N     1 
ATOM   25   C  CA    . HIS A 1 5   ? 2.026  50.491 -2.782  1.00 49.39  ? 5    HIS A CA    1 
ATOM   26   C  C     . HIS A 1 5   ? 0.569  50.381 -2.367  1.00 40.03  ? 5    HIS A C     1 
ATOM   27   O  O     . HIS A 1 5   ? -0.104 51.390 -2.157  1.00 100.00 ? 5    HIS A O     1 
ATOM   28   C  CB    . HIS A 1 5   ? 2.247  51.031 -4.193  1.00 100.00 ? 5    HIS A CB    1 
ATOM   29   C  CG    . HIS A 1 5   ? 3.673  50.995 -4.605  1.00 97.97  ? 5    HIS A CG    1 
ATOM   30   N  ND1   . HIS A 1 5   ? 4.143  49.987 -5.441  1.00 86.53  ? 5    HIS A ND1   1 
ATOM   31   C  CD2   . HIS A 1 5   ? 4.699  51.836 -4.306  1.00 37.17  ? 5    HIS A CD2   1 
ATOM   32   C  CE1   . HIS A 1 5   ? 5.441  50.233 -5.638  1.00 100.00 ? 5    HIS A CE1   1 
ATOM   33   N  NE2   . HIS A 1 5   ? 5.809  51.325 -4.964  1.00 100.00 ? 5    HIS A NE2   1 
ATOM   34   N  N     . ASP A 1 6   ? 0.127  49.132 -2.179  1.00 39.42  ? 6    ASP A N     1 
ATOM   35   C  CA    . ASP A 1 6   ? -1.221 48.786 -1.708  1.00 31.72  ? 6    ASP A CA    1 
ATOM   36   C  C     . ASP A 1 6   ? -1.381 48.909 -0.155  1.00 90.15  ? 6    ASP A C     1 
ATOM   37   O  O     . ASP A 1 6   ? -1.179 47.969 0.607   1.00 36.51  ? 6    ASP A O     1 
ATOM   38   C  CB    . ASP A 1 6   ? -1.515 47.357 -2.157  1.00 25.40  ? 6    ASP A CB    1 
ATOM   39   C  CG    . ASP A 1 6   ? -2.801 46.864 -1.616  1.00 49.57  ? 6    ASP A CG    1 
ATOM   40   O  OD1   . ASP A 1 6   ? -3.760 47.590 -1.332  1.00 48.70  ? 6    ASP A OD1   1 
ATOM   41   O  OD2   . ASP A 1 6   ? -2.756 45.576 -1.455  1.00 69.47  ? 6    ASP A OD2   1 
ATOM   42   N  N     . ARG A 1 7   ? -1.772 50.091 0.312   1.00 39.74  ? 7    ARG A N     1 
ATOM   43   C  CA    . ARG A 1 7   ? -1.940 50.449 1.709   1.00 37.97  ? 7    ARG A CA    1 
ATOM   44   C  C     . ARG A 1 7   ? -2.863 49.551 2.497   1.00 34.91  ? 7    ARG A C     1 
ATOM   45   O  O     . ARG A 1 7   ? -3.152 49.743 3.670   1.00 44.72  ? 7    ARG A O     1 
ATOM   46   C  CB    . ARG A 1 7   ? -2.274 51.954 1.852   1.00 39.92  ? 7    ARG A CB    1 
ATOM   47   C  CG    . ARG A 1 7   ? -0.994 52.816 2.085   1.00 51.63  ? 7    ARG A CG    1 
ATOM   48   C  CD    . ARG A 1 7   ? -0.956 54.294 1.644   1.00 100.00 ? 7    ARG A CD    1 
ATOM   49   N  NE    . ARG A 1 7   ? -2.122 55.140 1.999   1.00 100.00 ? 7    ARG A NE    1 
ATOM   50   C  CZ    . ARG A 1 7   ? -2.122 56.482 2.076   1.00 100.00 ? 7    ARG A CZ    1 
ATOM   51   N  NH1   . ARG A 1 7   ? -0.995 57.233 1.915   1.00 55.83  ? 7    ARG A NH1   1 
ATOM   52   N  NH2   . ARG A 1 7   ? -3.298 57.074 2.385   1.00 100.00 ? 7    ARG A NH2   1 
ATOM   53   N  N     . THR A 1 8   ? -3.300 48.507 1.849   1.00 49.57  ? 8    THR A N     1 
ATOM   54   C  CA    . THR A 1 8   ? -4.242 47.604 2.471   1.00 27.17  ? 8    THR A CA    1 
ATOM   55   C  C     . THR A 1 8   ? -3.639 46.234 2.677   1.00 40.59  ? 8    THR A C     1 
ATOM   56   O  O     . THR A 1 8   ? -4.233 45.334 3.311   1.00 37.56  ? 8    THR A O     1 
ATOM   57   C  CB    . THR A 1 8   ? -5.480 47.494 1.534   1.00 100.00 ? 8    THR A CB    1 
ATOM   58   O  OG1   . THR A 1 8   ? -5.181 47.004 0.216   1.00 49.32  ? 8    THR A OG1   1 
ATOM   59   C  CG2   . THR A 1 8   ? -6.087 48.876 1.404   1.00 69.67  ? 8    THR A CG2   1 
ATOM   60   N  N     . SER A 1 9   ? -2.468 46.037 2.094   1.00 19.04  ? 9    SER A N     1 
ATOM   61   C  CA    . SER A 1 9   ? -1.846 44.726 2.264   1.00 28.48  ? 9    SER A CA    1 
ATOM   62   C  C     . SER A 1 9   ? -1.397 44.492 3.730   1.00 36.65  ? 9    SER A C     1 
ATOM   63   O  O     . SER A 1 9   ? -1.269 45.420 4.537   1.00 27.68  ? 9    SER A O     1 
ATOM   64   C  CB    . SER A 1 9   ? -0.610 44.650 1.382   1.00 27.64  ? 9    SER A CB    1 
ATOM   65   O  OG    . SER A 1 9   ? 0.172  45.830 1.620   1.00 35.84  ? 9    SER A OG    1 
ATOM   66   N  N     . ASP A 1 10  ? -1.136 43.241 4.065   1.00 30.63  ? 10   ASP A N     1 
ATOM   67   C  CA    . ASP A 1 10  ? -0.586 42.868 5.343   1.00 37.88  ? 10   ASP A CA    1 
ATOM   68   C  C     . ASP A 1 10  ? 0.816  43.445 5.502   1.00 33.96  ? 10   ASP A C     1 
ATOM   69   O  O     . ASP A 1 10  ? 1.278  43.586 6.593   1.00 33.41  ? 10   ASP A O     1 
ATOM   70   C  CB    . ASP A 1 10  ? -0.491 41.344 5.421   1.00 32.63  ? 10   ASP A CB    1 
ATOM   71   C  CG    . ASP A 1 10  ? -1.843 40.771 5.789   1.00 42.65  ? 10   ASP A CG    1 
ATOM   72   O  OD1   . ASP A 1 10  ? -2.871 41.408 5.638   1.00 44.56  ? 10   ASP A OD1   1 
ATOM   73   O  OD2   . ASP A 1 10  ? -1.792 39.563 6.313   1.00 48.60  ? 10   ASP A OD2   1 
ATOM   74   N  N     . TYR A 1 11  ? 1.468  43.784 4.374   1.00 28.64  ? 11   TYR A N     1 
ATOM   75   C  CA    . TYR A 1 11  ? 2.779  44.388 4.317   1.00 24.03  ? 11   TYR A CA    1 
ATOM   76   C  C     . TYR A 1 11  ? 2.637  45.732 4.934   1.00 19.34  ? 11   TYR A C     1 
ATOM   77   O  O     . TYR A 1 11  ? 3.402  46.247 5.752   1.00 31.13  ? 11   TYR A O     1 
ATOM   78   C  CB    . TYR A 1 11  ? 3.331  44.546 2.852   1.00 25.64  ? 11   TYR A CB    1 
ATOM   79   C  CG    . TYR A 1 11  ? 4.526  45.496 2.779   1.00 22.96  ? 11   TYR A CG    1 
ATOM   80   C  CD1   . TYR A 1 11  ? 5.796  45.025 3.140   1.00 25.25  ? 11   TYR A CD1   1 
ATOM   81   C  CD2   . TYR A 1 11  ? 4.394  46.826 2.381   1.00 21.24  ? 11   TYR A CD2   1 
ATOM   82   C  CE1   . TYR A 1 11  ? 6.925  45.845 3.146   1.00 15.46  ? 11   TYR A CE1   1 
ATOM   83   C  CE2   . TYR A 1 11  ? 5.509  47.664 2.354   1.00 16.28  ? 11   TYR A CE2   1 
ATOM   84   C  CZ    . TYR A 1 11  ? 6.762  47.160 2.726   1.00 18.05  ? 11   TYR A CZ    1 
ATOM   85   O  OH    . TYR A 1 11  ? 7.798  47.994 2.739   1.00 20.67  ? 11   TYR A OH    1 
ATOM   86   N  N     . HIS A 1 12  ? 1.586  46.345 4.517   1.00 21.86  ? 12   HIS A N     1 
ATOM   87   C  CA    . HIS A 1 12  ? 1.366  47.646 5.050   1.00 21.53  ? 12   HIS A CA    1 
ATOM   88   C  C     . HIS A 1 12  ? 0.894  47.533 6.496   1.00 25.93  ? 12   HIS A C     1 
ATOM   89   O  O     . HIS A 1 12  ? 1.373  48.243 7.382   1.00 30.93  ? 12   HIS A O     1 
ATOM   90   C  CB    . HIS A 1 12  ? 0.370  48.378 4.186   1.00 25.16  ? 12   HIS A CB    1 
ATOM   91   C  CG    . HIS A 1 12  ? 1.151  49.218 3.251   1.00 50.00  ? 12   HIS A CG    1 
ATOM   92   N  ND1   . HIS A 1 12  ? 1.617  50.455 3.646   1.00 34.49  ? 12   HIS A ND1   1 
ATOM   93   C  CD2   . HIS A 1 12  ? 1.614  48.950 1.992   1.00 44.57  ? 12   HIS A CD2   1 
ATOM   94   C  CE1   . HIS A 1 12  ? 2.299  50.945 2.611   1.00 49.22  ? 12   HIS A CE1   1 
ATOM   95   N  NE2   . HIS A 1 12  ? 2.337  50.061 1.610   1.00 39.27  ? 12   HIS A NE2   1 
ATOM   96   N  N     . LYS A 1 13  ? 0.017  46.575 6.742   1.00 23.57  ? 13   LYS A N     1 
ATOM   97   C  CA    . LYS A 1 13  ? -0.509 46.334 8.107   1.00 56.48  ? 13   LYS A CA    1 
ATOM   98   C  C     . LYS A 1 13  ? 0.561  46.039 9.167   1.00 40.53  ? 13   LYS A C     1 
ATOM   99   O  O     . LYS A 1 13  ? 0.629  46.624 10.268  1.00 25.72  ? 13   LYS A O     1 
ATOM   100  C  CB    . LYS A 1 13  ? -1.502 45.158 8.131   1.00 35.91  ? 13   LYS A CB    1 
ATOM   101  C  CG    . LYS A 1 13  ? -2.554 45.205 9.242   1.00 49.83  ? 13   LYS A CG    1 
ATOM   102  C  CD    . LYS A 1 13  ? -4.032 45.093 8.806   1.00 41.48  ? 13   LYS A CD    1 
ATOM   103  C  CE    . LYS A 1 13  ? -4.356 45.754 7.463   1.00 100.00 ? 13   LYS A CE    1 
ATOM   104  N  NZ    . LYS A 1 13  ? -3.523 46.937 7.146   1.00 96.57  ? 13   LYS A NZ    1 
ATOM   105  N  N     . TYR A 1 14  ? 1.409  45.082 8.849   1.00 24.97  ? 14   TYR A N     1 
ATOM   106  C  CA    . TYR A 1 14  ? 2.357  44.627 9.820   1.00 20.50  ? 14   TYR A CA    1 
ATOM   107  C  C     . TYR A 1 14  ? 3.775  45.135 9.775   1.00 32.16  ? 14   TYR A C     1 
ATOM   108  O  O     . TYR A 1 14  ? 4.551  44.841 10.717  1.00 21.86  ? 14   TYR A O     1 
ATOM   109  C  CB    . TYR A 1 14  ? 2.407  43.113 9.715   1.00 16.15  ? 14   TYR A CB    1 
ATOM   110  C  CG    . TYR A 1 14  ? 1.114  42.401 9.993   1.00 32.73  ? 14   TYR A CG    1 
ATOM   111  C  CD1   . TYR A 1 14  ? 0.526  42.467 11.266  1.00 25.82  ? 14   TYR A CD1   1 
ATOM   112  C  CD2   . TYR A 1 14  ? 0.541  41.583 9.010   1.00 41.47  ? 14   TYR A CD2   1 
ATOM   113  C  CE1   . TYR A 1 14  ? -0.655 41.773 11.538  1.00 24.75  ? 14   TYR A CE1   1 
ATOM   114  C  CE2   . TYR A 1 14  ? -0.637 40.870 9.269   1.00 44.77  ? 14   TYR A CE2   1 
ATOM   115  C  CZ    . TYR A 1 14  ? -1.225 40.974 10.536  1.00 31.43  ? 14   TYR A CZ    1 
ATOM   116  O  OH    . TYR A 1 14  ? -2.349 40.243 10.816  1.00 25.14  ? 14   TYR A OH    1 
ATOM   117  N  N     . LEU A 1 15  ? 4.144  45.847 8.708   1.00 20.87  ? 15   LEU A N     1 
ATOM   118  C  CA    . LEU A 1 15  ? 5.548  46.282 8.537   1.00 19.19  ? 15   LEU A CA    1 
ATOM   119  C  C     . LEU A 1 15  ? 5.778  47.731 8.438   1.00 23.00  ? 15   LEU A C     1 
ATOM   120  O  O     . LEU A 1 15  ? 6.934  48.152 8.540   1.00 19.19  ? 15   LEU A O     1 
ATOM   121  C  CB    . LEU A 1 15  ? 6.354  45.511 7.499   1.00 18.06  ? 15   LEU A CB    1 
ATOM   122  C  CG    . LEU A 1 15  ? 6.339  44.011 7.771   1.00 21.99  ? 15   LEU A CG    1 
ATOM   123  C  CD1   . LEU A 1 15  ? 6.519  43.242 6.461   1.00 19.03  ? 15   LEU A CD1   1 
ATOM   124  C  CD2   . LEU A 1 15  ? 7.460  43.660 8.755   1.00 27.00  ? 15   LEU A CD2   1 
ATOM   125  N  N     . LYS A 1 16  ? 4.676  48.492 8.274   1.00 14.05  ? 16   LYS A N     1 
ATOM   126  C  CA    . LYS A 1 16  ? 4.829  49.939 8.129   1.00 14.82  ? 16   LYS A CA    1 
ATOM   127  C  C     . LYS A 1 16  ? 4.088  50.764 9.172   1.00 25.15  ? 16   LYS A C     1 
ATOM   128  O  O     . LYS A 1 16  ? 3.101  50.293 9.707   1.00 22.30  ? 16   LYS A O     1 
ATOM   129  C  CB    . LYS A 1 16  ? 4.237  50.390 6.736   1.00 22.10  ? 16   LYS A CB    1 
ATOM   130  C  CG    . LYS A 1 16  ? 5.014  49.797 5.558   1.00 21.09  ? 16   LYS A CG    1 
ATOM   131  C  CD    . LYS A 1 16  ? 6.374  50.480 5.506   1.00 15.88  ? 16   LYS A CD    1 
ATOM   132  C  CE    . LYS A 1 16  ? 6.334  52.002 5.229   1.00 21.86  ? 16   LYS A CE    1 
ATOM   133  N  NZ    . LYS A 1 16  ? 7.646  52.470 4.723   1.00 23.20  ? 16   LYS A NZ    1 
ATOM   134  N  N     . VAL A 1 17  ? 4.473  52.040 9.352   1.00 20.79  ? 17   VAL A N     1 
ATOM   135  C  CA    . VAL A 1 17  ? 3.702  52.915 10.170  1.00 25.09  ? 17   VAL A CA    1 
ATOM   136  C  C     . VAL A 1 17  ? 2.537  53.315 9.273   1.00 40.64  ? 17   VAL A C     1 
ATOM   137  O  O     . VAL A 1 17  ? 2.763  53.660 8.129   1.00 21.97  ? 17   VAL A O     1 
ATOM   138  C  CB    . VAL A 1 17  ? 4.497  54.100 10.635  1.00 20.90  ? 17   VAL A CB    1 
ATOM   139  C  CG1   . VAL A 1 17  ? 3.569  55.133 11.235  1.00 12.68  ? 17   VAL A CG1   1 
ATOM   140  C  CG2   . VAL A 1 17  ? 5.490  53.617 11.728  1.00 25.58  ? 17   VAL A CG2   1 
ATOM   141  N  N     . LYS A 1 18  ? 1.289  53.167 9.733   1.00 25.69  ? 18   LYS A N     1 
ATOM   142  C  CA    . LYS A 1 18  ? 0.129  53.447 8.908   1.00 21.50  ? 18   LYS A CA    1 
ATOM   143  C  C     . LYS A 1 18  ? 0.053  54.872 8.395   1.00 30.49  ? 18   LYS A C     1 
ATOM   144  O  O     . LYS A 1 18  ? 0.255  55.850 9.133   1.00 20.00  ? 18   LYS A O     1 
ATOM   145  C  CB    . LYS A 1 18  ? -1.151 52.917 9.469   1.00 27.80  ? 18   LYS A CB    1 
ATOM   146  C  CG    . LYS A 1 18  ? -2.301 52.952 8.489   1.00 20.40  ? 18   LYS A CG    1 
ATOM   147  C  CD    . LYS A 1 18  ? -3.546 52.458 9.183   1.00 17.64  ? 18   LYS A CD    1 
ATOM   148  C  CE    . LYS A 1 18  ? -4.743 52.584 8.300   1.00 34.22  ? 18   LYS A CE    1 
ATOM   149  N  NZ    . LYS A 1 18  ? -4.727 51.458 7.397   1.00 29.96  ? 18   LYS A NZ    1 
ATOM   150  N  N     . GLN A 1 19  ? -0.230 54.976 7.068   1.00 26.23  ? 19   GLN A N     1 
ATOM   151  C  CA    . GLN A 1 19  ? -0.285 56.290 6.427   1.00 26.70  ? 19   GLN A CA    1 
ATOM   152  C  C     . GLN A 1 19  ? -1.691 56.764 6.124   1.00 24.82  ? 19   GLN A C     1 
ATOM   153  O  O     . GLN A 1 19  ? -2.524 56.000 5.592   1.00 27.80  ? 19   GLN A O     1 
ATOM   154  C  CB    . GLN A 1 19  ? 0.454  56.282 5.064   1.00 50.63  ? 19   GLN A CB    1 
ATOM   155  C  CG    . GLN A 1 19  ? 1.984  56.377 5.127   1.00 43.17  ? 19   GLN A CG    1 
ATOM   156  C  CD    . GLN A 1 19  ? 2.610  55.413 4.131   1.00 100.00 ? 19   GLN A CD    1 
ATOM   157  O  OE1   . GLN A 1 19  ? 2.321  55.459 2.916   1.00 100.00 ? 19   GLN A OE1   1 
ATOM   158  N  NE2   . GLN A 1 19  ? 3.453  54.514 4.640   1.00 100.00 ? 19   GLN A NE2   1 
ATOM   159  N  N     . GLY A 1 20  ? -1.899 58.042 6.429   1.00 37.96  ? 20   GLY A N     1 
ATOM   160  C  CA    . GLY A 1 20  ? -3.153 58.694 6.188   1.00 38.65  ? 20   GLY A CA    1 
ATOM   161  C  C     . GLY A 1 20  ? -3.197 59.338 4.812   1.00 41.69  ? 20   GLY A C     1 
ATOM   162  O  O     . GLY A 1 20  ? -2.396 59.120 3.930   1.00 41.79  ? 20   GLY A O     1 
ATOM   163  N  N     . ASP A 1 21  ? -4.150 60.165 4.642   1.00 35.48  ? 21   ASP A N     1 
ATOM   164  C  CA    . ASP A 1 21  ? -4.392 60.823 3.386   1.00 57.82  ? 21   ASP A CA    1 
ATOM   165  C  C     . ASP A 1 21  ? -3.486 61.953 3.079   1.00 39.08  ? 21   ASP A C     1 
ATOM   166  O  O     . ASP A 1 21  ? -3.114 62.151 1.916   1.00 100.00 ? 21   ASP A O     1 
ATOM   167  C  CB    . ASP A 1 21  ? -5.852 61.258 3.336   1.00 54.94  ? 21   ASP A CB    1 
ATOM   168  C  CG    . ASP A 1 21  ? -6.706 60.007 3.275   1.00 100.00 ? 21   ASP A CG    1 
ATOM   169  O  OD1   . ASP A 1 21  ? -6.004 58.871 3.176   1.00 83.69  ? 21   ASP A OD1   1 
ATOM   170  O  OD2   . ASP A 1 21  ? -7.924 60.055 3.323   1.00 100.00 ? 21   ASP A OD2   1 
ATOM   171  N  N     . SER A 1 22  ? -3.121 62.689 4.131   1.00 100.00 ? 22   SER A N     1 
ATOM   172  C  CA    . SER A 1 22  ? -2.239 63.844 3.997   1.00 100.00 ? 22   SER A CA    1 
ATOM   173  C  C     . SER A 1 22  ? -0.816 63.591 4.477   1.00 68.70  ? 22   SER A C     1 
ATOM   174  O  O     . SER A 1 22  ? -0.547 62.850 5.452   1.00 43.90  ? 22   SER A O     1 
ATOM   175  C  CB    . SER A 1 22  ? -2.811 65.146 4.575   1.00 100.00 ? 22   SER A CB    1 
ATOM   176  O  OG    . SER A 1 22  ? -1.904 66.247 4.431   1.00 47.05  ? 22   SER A OG    1 
ATOM   177  N  N     . ASP A 1 23  ? 0.081  64.247 3.747   1.00 76.03  ? 23   ASP A N     1 
ATOM   178  C  CA    . ASP A 1 23  ? 1.515  64.218 3.989   1.00 100.00 ? 23   ASP A CA    1 
ATOM   179  C  C     . ASP A 1 23  ? 2.053  65.627 4.310   1.00 100.00 ? 23   ASP A C     1 
ATOM   180  O  O     . ASP A 1 23  ? 3.242  65.847 4.642   1.00 98.46  ? 23   ASP A O     1 
ATOM   181  C  CB    . ASP A 1 23  ? 2.278  63.485 2.838   1.00 100.00 ? 23   ASP A CB    1 
ATOM   182  C  CG    . ASP A 1 23  ? 1.943  63.943 1.436   1.00 100.00 ? 23   ASP A CG    1 
ATOM   183  O  OD1   . ASP A 1 23  ? 0.785  64.091 1.006   1.00 100.00 ? 23   ASP A OD1   1 
ATOM   184  O  OD2   . ASP A 1 23  ? 3.061  64.148 0.742   1.00 68.52  ? 23   ASP A OD2   1 
ATOM   185  N  N     . LEU A 1 24  ? 1.107  66.573 4.221   1.00 82.75  ? 24   LEU A N     1 
ATOM   186  C  CA    . LEU A 1 24  ? 1.355  67.975 4.459   1.00 100.00 ? 24   LEU A CA    1 
ATOM   187  C  C     . LEU A 1 24  ? 2.076  68.229 5.746   1.00 73.17  ? 24   LEU A C     1 
ATOM   188  O  O     . LEU A 1 24  ? 1.672  67.753 6.802   1.00 53.08  ? 24   LEU A O     1 
ATOM   189  C  CB    . LEU A 1 24  ? 0.105  68.857 4.304   1.00 89.07  ? 24   LEU A CB    1 
ATOM   190  C  CG    . LEU A 1 24  ? -0.056 69.320 2.860   1.00 88.52  ? 24   LEU A CG    1 
ATOM   191  C  CD1   . LEU A 1 24  ? 0.524  68.272 1.916   1.00 39.05  ? 24   LEU A CD1   1 
ATOM   192  C  CD2   . LEU A 1 24  ? -1.531 69.593 2.582   1.00 47.45  ? 24   LEU A CD2   1 
ATOM   193  N  N     . PHE A 1 25  ? 3.152  68.987 5.588   1.00 69.76  ? 25   PHE A N     1 
ATOM   194  C  CA    . PHE A 1 25  ? 4.058  69.424 6.642   1.00 100.00 ? 25   PHE A CA    1 
ATOM   195  C  C     . PHE A 1 25  ? 3.318  70.022 7.851   1.00 100.00 ? 25   PHE A C     1 
ATOM   196  O  O     . PHE A 1 25  ? 3.697  69.783 9.014   1.00 49.61  ? 25   PHE A O     1 
ATOM   197  C  CB    . PHE A 1 25  ? 5.076  70.454 6.035   1.00 69.40  ? 25   PHE A CB    1 
ATOM   198  C  CG    . PHE A 1 25  ? 6.016  71.168 7.002   1.00 100.00 ? 25   PHE A CG    1 
ATOM   199  C  CD1   . PHE A 1 25  ? 5.645  72.329 7.685   1.00 100.00 ? 25   PHE A CD1   1 
ATOM   200  C  CD2   . PHE A 1 25  ? 7.311  70.684 7.207   1.00 72.12  ? 25   PHE A CD2   1 
ATOM   201  C  CE1   . PHE A 1 25  ? 6.520  72.969 8.568   1.00 100.00 ? 25   PHE A CE1   1 
ATOM   202  C  CE2   . PHE A 1 25  ? 8.207  71.311 8.076   1.00 77.85  ? 25   PHE A CE2   1 
ATOM   203  C  CZ    . PHE A 1 25  ? 7.809  72.461 8.759   1.00 85.41  ? 25   PHE A CZ    1 
ATOM   204  N  N     . LYS A 1 26  ? 2.266  70.811 7.542   1.00 100.00 ? 26   LYS A N     1 
ATOM   205  C  CA    . LYS A 1 26  ? 1.464  71.521 8.524   1.00 69.26  ? 26   LYS A CA    1 
ATOM   206  C  C     . LYS A 1 26  ? 0.795  70.698 9.651   1.00 100.00 ? 26   LYS A C     1 
ATOM   207  O  O     . LYS A 1 26  ? 0.746  71.156 10.813  1.00 46.71  ? 26   LYS A O     1 
ATOM   208  C  CB    . LYS A 1 26  ? 0.585  72.592 7.880   1.00 70.76  ? 26   LYS A CB    1 
ATOM   209  C  CG    . LYS A 1 26  ? -0.500 72.040 6.973   1.00 96.63  ? 26   LYS A CG    1 
ATOM   210  C  CD    . LYS A 1 26  ? -1.778 72.878 7.007   1.00 100.00 ? 26   LYS A CD    1 
ATOM   211  C  CE    . LYS A 1 26  ? -3.030 72.112 6.591   1.00 100.00 ? 26   LYS A CE    1 
ATOM   212  N  NZ    . LYS A 1 26  ? -3.824 71.610 7.732   1.00 93.05  ? 26   LYS A NZ    1 
ATOM   213  N  N     . LEU A 1 27  ? 0.279  69.485 9.330   1.00 45.13  ? 27   LEU A N     1 
ATOM   214  C  CA    . LEU A 1 27  ? -0.397 68.649 10.328  1.00 100.00 ? 27   LEU A CA    1 
ATOM   215  C  C     . LEU A 1 27  ? 0.353  68.531 11.625  1.00 66.90  ? 27   LEU A C     1 
ATOM   216  O  O     . LEU A 1 27  ? -0.227 68.524 12.687  1.00 40.56  ? 27   LEU A O     1 
ATOM   217  C  CB    . LEU A 1 27  ? -0.590 67.206 9.868   1.00 50.81  ? 27   LEU A CB    1 
ATOM   218  C  CG    . LEU A 1 27  ? -0.874 67.061 8.403   1.00 93.77  ? 27   LEU A CG    1 
ATOM   219  C  CD1   . LEU A 1 27  ? -0.607 65.592 8.027   1.00 44.86  ? 27   LEU A CD1   1 
ATOM   220  C  CD2   . LEU A 1 27  ? -2.329 67.487 8.193   1.00 63.49  ? 27   LEU A CD2   1 
ATOM   221  N  N     . THR A 1 28  ? 1.656  68.355 11.472  1.00 47.81  ? 28   THR A N     1 
ATOM   222  C  CA    . THR A 1 28  ? 2.576  68.153 12.558  1.00 100.00 ? 28   THR A CA    1 
ATOM   223  C  C     . THR A 1 28  ? 2.989  69.448 13.208  1.00 100.00 ? 28   THR A C     1 
ATOM   224  O  O     . THR A 1 28  ? 3.875  69.515 14.071  1.00 62.72  ? 28   THR A O     1 
ATOM   225  C  CB    . THR A 1 28  ? 3.778  67.298 12.100  1.00 100.00 ? 28   THR A CB    1 
ATOM   226  O  OG1   . THR A 1 28  ? 4.057  67.504 10.708  1.00 54.86  ? 28   THR A OG1   1 
ATOM   227  C  CG2   . THR A 1 28  ? 3.455  65.826 12.381  1.00 100.00 ? 28   THR A CG2   1 
ATOM   228  N  N     . VAL A 1 29  ? 2.329  70.505 12.776  1.00 41.09  ? 29   VAL A N     1 
ATOM   229  C  CA    . VAL A 1 29  ? 2.655  71.736 13.373  1.00 48.92  ? 29   VAL A CA    1 
ATOM   230  C  C     . VAL A 1 29  ? 2.205  71.770 14.839  1.00 63.30  ? 29   VAL A C     1 
ATOM   231  O  O     . VAL A 1 29  ? 1.127  71.316 15.212  1.00 51.36  ? 29   VAL A O     1 
ATOM   232  C  CB    . VAL A 1 29  ? 2.178  72.893 12.531  1.00 54.07  ? 29   VAL A CB    1 
ATOM   233  C  CG1   . VAL A 1 29  ? 2.337  74.193 13.338  1.00 71.79  ? 29   VAL A CG1   1 
ATOM   234  C  CG2   . VAL A 1 29  ? 3.043  72.918 11.277  1.00 54.49  ? 29   VAL A CG2   1 
ATOM   235  N  N     . SER A 1 30  ? 3.114  72.248 15.666  1.00 77.72  ? 30   SER A N     1 
ATOM   236  C  CA    . SER A 1 30  ? 2.958  72.427 17.100  1.00 100.00 ? 30   SER A CA    1 
ATOM   237  C  C     . SER A 1 30  ? 3.935  73.526 17.548  1.00 100.00 ? 30   SER A C     1 
ATOM   238  O  O     . SER A 1 30  ? 4.995  73.766 16.950  1.00 65.78  ? 30   SER A O     1 
ATOM   239  C  CB    . SER A 1 30  ? 3.049  71.139 17.949  1.00 86.97  ? 30   SER A CB    1 
ATOM   240  O  OG    . SER A 1 30  ? 2.384  71.280 19.211  1.00 50.50  ? 30   SER A OG    1 
ATOM   241  N  N     . ASP A 1 31  ? 3.570  74.228 18.611  1.00 100.00 ? 31   ASP A N     1 
ATOM   242  C  CA    . ASP A 1 31  ? 4.398  75.299 19.139  1.00 100.00 ? 31   ASP A CA    1 
ATOM   243  C  C     . ASP A 1 31  ? 5.399  74.792 20.242  1.00 100.00 ? 31   ASP A C     1 
ATOM   244  O  O     . ASP A 1 31  ? 6.571  75.196 20.332  1.00 72.91  ? 31   ASP A O     1 
ATOM   245  C  CB    . ASP A 1 31  ? 3.475  76.492 19.522  1.00 100.00 ? 31   ASP A CB    1 
ATOM   246  C  CG    . ASP A 1 31  ? 2.196  76.572 18.689  1.00 100.00 ? 31   ASP A CG    1 
ATOM   247  O  OD1   . ASP A 1 31  ? 1.522  75.418 18.633  1.00 100.00 ? 31   ASP A OD1   1 
ATOM   248  O  OD2   . ASP A 1 31  ? 1.823  77.603 18.131  1.00 100.00 ? 31   ASP A OD2   1 
ATOM   249  N  N     . LYS A 1 32  ? 4.917  73.827 21.046  1.00 52.90  ? 32   LYS A N     1 
ATOM   250  C  CA    . LYS A 1 32  ? 5.545  73.087 22.163  1.00 100.00 ? 32   LYS A CA    1 
ATOM   251  C  C     . LYS A 1 32  ? 6.890  72.353 21.870  1.00 100.00 ? 32   LYS A C     1 
ATOM   252  O  O     . LYS A 1 32  ? 7.058  71.727 20.831  1.00 91.93  ? 32   LYS A O     1 
ATOM   253  C  CB    . LYS A 1 32  ? 4.531  72.045 22.677  1.00 76.99  ? 32   LYS A CB    1 
ATOM   254  C  CG    . LYS A 1 32  ? 3.436  72.560 23.624  1.00 70.83  ? 32   LYS A CG    1 
ATOM   255  C  CD    . LYS A 1 32  ? 2.142  73.054 22.973  1.00 100.00 ? 32   LYS A CD    1 
ATOM   256  C  CE    . LYS A 1 32  ? 1.815  74.515 23.328  1.00 100.00 ? 32   LYS A CE    1 
ATOM   257  N  NZ    . LYS A 1 32  ? 1.690  75.456 22.185  1.00 100.00 ? 32   LYS A NZ    1 
ATOM   258  N  N     . ARG A 1 33  ? 7.822  72.391 22.855  1.00 46.89  ? 33   ARG A N     1 
ATOM   259  C  CA    . ARG A 1 33  ? 9.146  71.747 22.813  1.00 50.38  ? 33   ARG A CA    1 
ATOM   260  C  C     . ARG A 1 33  ? 9.339  70.850 23.988  1.00 51.37  ? 33   ARG A C     1 
ATOM   261  O  O     . ARG A 1 33  ? 8.842  71.136 25.065  1.00 100.00 ? 33   ARG A O     1 
ATOM   262  C  CB    . ARG A 1 33  ? 10.313 72.709 22.753  1.00 49.24  ? 33   ARG A CB    1 
ATOM   263  C  CG    . ARG A 1 33  ? 10.380 73.382 21.382  1.00 54.04  ? 33   ARG A CG    1 
ATOM   264  C  CD    . ARG A 1 33  ? 11.821 73.489 20.924  1.00 100.00 ? 33   ARG A CD    1 
ATOM   265  N  NE    . ARG A 1 33  ? 12.633 74.391 21.756  1.00 100.00 ? 33   ARG A NE    1 
ATOM   266  C  CZ    . ARG A 1 33  ? 13.965 74.578 21.618  1.00 100.00 ? 33   ARG A CZ    1 
ATOM   267  N  NH1   . ARG A 1 33  ? 14.701 73.930 20.692  1.00 95.81  ? 33   ARG A NH1   1 
ATOM   268  N  NH2   . ARG A 1 33  ? 14.599 75.443 22.426  1.00 100.00 ? 33   ARG A NH2   1 
ATOM   269  N  N     . TYR A 1 34  ? 10.059 69.755 23.797  1.00 38.69  ? 34   TYR A N     1 
ATOM   270  C  CA    . TYR A 1 34  ? 10.177 68.851 24.899  1.00 28.22  ? 34   TYR A CA    1 
ATOM   271  C  C     . TYR A 1 34  ? 11.555 68.286 25.167  1.00 29.73  ? 34   TYR A C     1 
ATOM   272  O  O     . TYR A 1 34  ? 12.412 68.357 24.339  1.00 28.88  ? 34   TYR A O     1 
ATOM   273  C  CB    . TYR A 1 34  ? 9.112  67.755 24.731  1.00 38.51  ? 34   TYR A CB    1 
ATOM   274  C  CG    . TYR A 1 34  ? 7.669  68.251 24.717  1.00 55.21  ? 34   TYR A CG    1 
ATOM   275  C  CD1   . TYR A 1 34  ? 6.925  68.396 25.893  1.00 49.86  ? 34   TYR A CD1   1 
ATOM   276  C  CD2   . TYR A 1 34  ? 7.022  68.534 23.513  1.00 76.85  ? 34   TYR A CD2   1 
ATOM   277  C  CE1   . TYR A 1 34  ? 5.588  68.795 25.866  1.00 100.00 ? 34   TYR A CE1   1 
ATOM   278  C  CE2   . TYR A 1 34  ? 5.692  68.958 23.465  1.00 78.58  ? 34   TYR A CE2   1 
ATOM   279  C  CZ    . TYR A 1 34  ? 4.969  69.083 24.648  1.00 97.15  ? 34   TYR A CZ    1 
ATOM   280  O  OH    . TYR A 1 34  ? 3.657  69.486 24.592  1.00 92.94  ? 34   TYR A OH    1 
ATOM   281  N  N     . ILE A 1 35  ? 11.753 67.714 26.352  1.00 47.99  ? 35   ILE A N     1 
ATOM   282  C  CA    . ILE A 1 35  ? 13.001 67.063 26.770  1.00 52.19  ? 35   ILE A CA    1 
ATOM   283  C  C     . ILE A 1 35  ? 12.684 65.688 27.357  1.00 67.38  ? 35   ILE A C     1 
ATOM   284  O  O     . ILE A 1 35  ? 11.601 65.406 27.866  1.00 37.96  ? 35   ILE A O     1 
ATOM   285  C  CB    . ILE A 1 35  ? 13.706 67.768 27.949  1.00 49.95  ? 35   ILE A CB    1 
ATOM   286  C  CG1   . ILE A 1 35  ? 12.803 68.198 29.107  1.00 46.96  ? 35   ILE A CG1   1 
ATOM   287  C  CG2   . ILE A 1 35  ? 15.033 68.514 27.764  1.00 37.62  ? 35   ILE A CG2   1 
ATOM   288  C  CD1   . ILE A 1 35  ? 12.247 67.052 29.972  1.00 51.08  ? 35   ILE A CD1   1 
ATOM   289  N  N     . TRP A 1 36  ? 13.673 64.827 27.386  1.00 35.20  ? 36   TRP A N     1 
ATOM   290  C  CA    . TRP A 1 36  ? 13.486 63.572 28.066  1.00 33.16  ? 36   TRP A CA    1 
ATOM   291  C  C     . TRP A 1 36  ? 14.151 63.744 29.445  1.00 56.41  ? 36   TRP A C     1 
ATOM   292  O  O     . TRP A 1 36  ? 15.324 64.122 29.516  1.00 29.16  ? 36   TRP A O     1 
ATOM   293  C  CB    . TRP A 1 36  ? 14.174 62.433 27.288  1.00 37.14  ? 36   TRP A CB    1 
ATOM   294  C  CG    . TRP A 1 36  ? 13.432 62.178 26.036  1.00 45.12  ? 36   TRP A CG    1 
ATOM   295  C  CD1   . TRP A 1 36  ? 13.894 62.374 24.775  1.00 38.03  ? 36   TRP A CD1   1 
ATOM   296  C  CD2   . TRP A 1 36  ? 12.052 61.802 25.923  1.00 50.86  ? 36   TRP A CD2   1 
ATOM   297  N  NE1   . TRP A 1 36  ? 12.894 62.086 23.876  1.00 34.90  ? 36   TRP A NE1   1 
ATOM   298  C  CE2   . TRP A 1 36  ? 11.765 61.682 24.542  1.00 26.87  ? 36   TRP A CE2   1 
ATOM   299  C  CE3   . TRP A 1 36  ? 11.053 61.507 26.842  1.00 28.65  ? 36   TRP A CE3   1 
ATOM   300  C  CZ2   . TRP A 1 36  ? 10.485 61.322 24.083  1.00 33.76  ? 36   TRP A CZ2   1 
ATOM   301  C  CZ3   . TRP A 1 36  ? 9.793  61.126 26.388  1.00 42.51  ? 36   TRP A CZ3   1 
ATOM   302  C  CH2   . TRP A 1 36  ? 9.514  61.038 25.029  1.00 50.09  ? 36   TRP A CH2   1 
ATOM   303  N  N     . TYR A 1 37  ? 13.417 63.542 30.538  1.00 62.60  ? 37   TYR A N     1 
ATOM   304  C  CA    . TYR A 1 37  ? 13.989 63.709 31.887  1.00 46.64  ? 37   TYR A CA    1 
ATOM   305  C  C     . TYR A 1 37  ? 13.760 62.459 32.715  1.00 33.52  ? 37   TYR A C     1 
ATOM   306  O  O     . TYR A 1 37  ? 12.848 61.698 32.392  1.00 49.54  ? 37   TYR A O     1 
ATOM   307  C  CB    . TYR A 1 37  ? 13.425 65.010 32.641  1.00 34.54  ? 37   TYR A CB    1 
ATOM   308  C  CG    . TYR A 1 37  ? 11.969 64.970 33.163  1.00 53.79  ? 37   TYR A CG    1 
ATOM   309  C  CD1   . TYR A 1 37  ? 11.632 64.349 34.375  1.00 53.91  ? 37   TYR A CD1   1 
ATOM   310  C  CD2   . TYR A 1 37  ? 10.929 65.577 32.457  1.00 29.60  ? 37   TYR A CD2   1 
ATOM   311  C  CE1   . TYR A 1 37  ? 10.316 64.298 34.851  1.00 40.51  ? 37   TYR A CE1   1 
ATOM   312  C  CE2   . TYR A 1 37  ? 9.609  65.529 32.918  1.00 52.17  ? 37   TYR A CE2   1 
ATOM   313  C  CZ    . TYR A 1 37  ? 9.292  64.895 34.118  1.00 70.76  ? 37   TYR A CZ    1 
ATOM   314  O  OH    . TYR A 1 37  ? 7.994  64.893 34.557  1.00 57.61  ? 37   TYR A OH    1 
ATOM   315  N  N     . ASN A 1 38  ? 14.532 62.277 33.801  1.00 55.19  ? 38   ASN A N     1 
ATOM   316  C  CA    . ASN A 1 38  ? 14.327 61.189 34.766  1.00 50.76  ? 38   ASN A CA    1 
ATOM   317  C  C     . ASN A 1 38  ? 13.497 61.736 35.944  1.00 39.35  ? 38   ASN A C     1 
ATOM   318  O  O     . ASN A 1 38  ? 13.924 62.684 36.606  1.00 62.85  ? 38   ASN A O     1 
ATOM   319  C  CB    . ASN A 1 38  ? 15.657 60.683 35.333  1.00 38.61  ? 38   ASN A CB    1 
ATOM   320  C  CG    . ASN A 1 38  ? 16.527 59.985 34.315  1.00 49.95  ? 38   ASN A CG    1 
ATOM   321  O  OD1   . ASN A 1 38  ? 17.694 60.367 34.068  1.00 58.50  ? 38   ASN A OD1   1 
ATOM   322  N  ND2   . ASN A 1 38  ? 15.964 58.922 33.729  1.00 68.28  ? 38   ASN A ND2   1 
ATOM   323  N  N     . PRO A 1 39  ? 12.309 61.179 36.213  1.00 86.69  ? 39   PRO A N     1 
ATOM   324  C  CA    . PRO A 1 39  ? 11.495 61.667 37.321  1.00 100.00 ? 39   PRO A CA    1 
ATOM   325  C  C     . PRO A 1 39  ? 12.063 61.176 38.670  1.00 100.00 ? 39   PRO A C     1 
ATOM   326  O  O     . PRO A 1 39  ? 11.526 61.348 39.769  1.00 56.54  ? 39   PRO A O     1 
ATOM   327  C  CB    . PRO A 1 39  ? 10.081 61.120 37.078  1.00 94.37  ? 39   PRO A CB    1 
ATOM   328  C  CG    . PRO A 1 39  ? 10.181 60.093 35.959  1.00 55.18  ? 39   PRO A CG    1 
ATOM   329  C  CD    . PRO A 1 39  ? 11.653 60.005 35.575  1.00 100.00 ? 39   PRO A CD    1 
ATOM   330  N  N     . ASP A 1 40  ? 13.206 60.547 38.544  1.00 65.53  ? 40   ASP A N     1 
ATOM   331  C  CA    . ASP A 1 40  ? 13.937 59.989 39.639  1.00 43.95  ? 40   ASP A CA    1 
ATOM   332  C  C     . ASP A 1 40  ? 15.336 59.741 39.105  1.00 100.00 ? 40   ASP A C     1 
ATOM   333  O  O     . ASP A 1 40  ? 15.546 58.863 38.267  1.00 50.40  ? 40   ASP A O     1 
ATOM   334  C  CB    . ASP A 1 40  ? 13.258 58.682 40.123  1.00 100.00 ? 40   ASP A CB    1 
ATOM   335  C  CG    . ASP A 1 40  ? 13.655 58.203 41.502  1.00 100.00 ? 40   ASP A CG    1 
ATOM   336  O  OD1   . ASP A 1 40  ? 14.949 57.990 41.634  1.00 90.55  ? 40   ASP A OD1   1 
ATOM   337  O  OD2   . ASP A 1 40  ? 12.838 58.007 42.389  1.00 100.00 ? 40   ASP A OD2   1 
ATOM   338  N  N     . PRO A 1 41  ? 16.269 60.583 39.550  1.00 73.39  ? 41   PRO A N     1 
ATOM   339  C  CA    . PRO A 1 41  ? 17.634 60.537 39.074  1.00 54.16  ? 41   PRO A CA    1 
ATOM   340  C  C     . PRO A 1 41  ? 18.421 59.345 39.525  1.00 71.26  ? 41   PRO A C     1 
ATOM   341  O  O     . PRO A 1 41  ? 19.569 59.080 39.111  1.00 62.68  ? 41   PRO A O     1 
ATOM   342  C  CB    . PRO A 1 41  ? 18.220 61.910 39.371  1.00 100.00 ? 41   PRO A CB    1 
ATOM   343  C  CG    . PRO A 1 41  ? 17.008 62.849 39.361  1.00 68.68  ? 41   PRO A CG    1 
ATOM   344  C  CD    . PRO A 1 41  ? 15.799 61.990 39.698  1.00 94.62  ? 41   PRO A CD    1 
ATOM   345  N  N     . LYS A 1 42  ? 17.706 58.600 40.340  1.00 74.15  ? 42   LYS A N     1 
ATOM   346  C  CA    . LYS A 1 42  ? 18.170 57.353 40.859  1.00 100.00 ? 42   LYS A CA    1 
ATOM   347  C  C     . LYS A 1 42  ? 17.993 56.278 39.780  1.00 100.00 ? 42   LYS A C     1 
ATOM   348  O  O     . LYS A 1 42  ? 18.976 55.645 39.372  1.00 100.00 ? 42   LYS A O     1 
ATOM   349  C  CB    . LYS A 1 42  ? 17.482 57.089 42.168  1.00 38.88  ? 42   LYS A CB    1 
ATOM   350  C  CG    . LYS A 1 42  ? 18.369 57.623 43.299  1.00 100.00 ? 42   LYS A CG    1 
ATOM   351  C  CD    . LYS A 1 42  ? 18.795 56.527 44.291  1.00 100.00 ? 42   LYS A CD    1 
ATOM   352  C  CE    . LYS A 1 42  ? 20.072 56.784 45.101  1.00 100.00 ? 42   LYS A CE    1 
ATOM   353  N  NZ    . LYS A 1 42  ? 20.345 55.728 46.109  1.00 100.00 ? 42   LYS A NZ    1 
ATOM   354  N  N     . GLU A 1 43  ? 16.740 56.150 39.272  1.00 100.00 ? 43   GLU A N     1 
ATOM   355  C  CA    . GLU A 1 43  ? 16.365 55.272 38.159  1.00 100.00 ? 43   GLU A CA    1 
ATOM   356  C  C     . GLU A 1 43  ? 16.695 56.094 36.894  1.00 74.16  ? 43   GLU A C     1 
ATOM   357  O  O     . GLU A 1 43  ? 15.911 56.962 36.486  1.00 50.72  ? 43   GLU A O     1 
ATOM   358  C  CB    . GLU A 1 43  ? 14.848 54.891 38.213  1.00 58.54  ? 43   GLU A CB    1 
ATOM   359  C  CG    . GLU A 1 43  ? 13.914 56.107 37.922  1.00 97.36  ? 43   GLU A CG    1 
ATOM   360  C  CD    . GLU A 1 43  ? 12.467 55.924 38.270  1.00 100.00 ? 43   GLU A CD    1 
ATOM   361  O  OE1   . GLU A 1 43  ? 12.273 54.813 38.943  1.00 100.00 ? 43   GLU A OE1   1 
ATOM   362  O  OE2   . GLU A 1 43  ? 11.597 56.739 37.956  1.00 100.00 ? 43   GLU A OE2   1 
ATOM   363  N  N     . ARG A 1 44  ? 17.909 55.900 36.340  1.00 33.05  ? 44   ARG A N     1 
ATOM   364  C  CA    . ARG A 1 44  ? 18.377 56.660 35.180  1.00 35.81  ? 44   ARG A CA    1 
ATOM   365  C  C     . ARG A 1 44  ? 17.743 56.280 33.811  1.00 100.00 ? 44   ARG A C     1 
ATOM   366  O  O     . ARG A 1 44  ? 17.913 56.963 32.782  1.00 71.28  ? 44   ARG A O     1 
ATOM   367  C  CB    . ARG A 1 44  ? 19.906 56.790 35.098  1.00 34.62  ? 44   ARG A CB    1 
ATOM   368  C  CG    . ARG A 1 44  ? 20.621 56.219 33.824  1.00 45.77  ? 44   ARG A CG    1 
ATOM   369  C  CD    . ARG A 1 44  ? 21.505 54.978 34.097  1.00 99.20  ? 44   ARG A CD    1 
ATOM   370  N  NE    . ARG A 1 44  ? 22.762 54.770 33.321  1.00 100.00 ? 44   ARG A NE    1 
ATOM   371  C  CZ    . ARG A 1 44  ? 23.496 55.587 32.509  1.00 100.00 ? 44   ARG A CZ    1 
ATOM   372  N  NH1   . ARG A 1 44  ? 23.154 56.853 32.205  1.00 100.00 ? 44   ARG A NH1   1 
ATOM   373  N  NH2   . ARG A 1 44  ? 24.625 55.091 31.963  1.00 59.08  ? 44   ARG A NH2   1 
ATOM   374  N  N     . ASP A 1 45  ? 17.002 55.178 33.747  1.00 100.00 ? 45   ASP A N     1 
ATOM   375  C  CA    . ASP A 1 45  ? 16.457 54.836 32.459  1.00 37.59  ? 45   ASP A CA    1 
ATOM   376  C  C     . ASP A 1 45  ? 14.998 55.065 32.342  1.00 68.29  ? 45   ASP A C     1 
ATOM   377  O  O     . ASP A 1 45  ? 14.349 54.775 31.316  1.00 58.31  ? 45   ASP A O     1 
ATOM   378  C  CB    . ASP A 1 45  ? 16.972 53.525 31.871  1.00 40.98  ? 45   ASP A CB    1 
ATOM   379  C  CG    . ASP A 1 45  ? 18.487 53.503 31.675  1.00 56.47  ? 45   ASP A CG    1 
ATOM   380  O  OD1   . ASP A 1 45  ? 19.024 54.665 31.273  1.00 61.90  ? 45   ASP A OD1   1 
ATOM   381  O  OD2   . ASP A 1 45  ? 19.154 52.472 31.826  1.00 41.54  ? 45   ASP A OD2   1 
ATOM   382  N  N     . SER A 1 46  ? 14.507 55.647 33.420  1.00 39.70  ? 46   SER A N     1 
ATOM   383  C  CA    . SER A 1 46  ? 13.125 56.022 33.460  1.00 69.92  ? 46   SER A CA    1 
ATOM   384  C  C     . SER A 1 46  ? 13.061 57.504 33.175  1.00 51.01  ? 46   SER A C     1 
ATOM   385  O  O     . SER A 1 46  ? 13.564 58.319 33.940  1.00 85.04  ? 46   SER A O     1 
ATOM   386  C  CB    . SER A 1 46  ? 12.383 55.645 34.739  1.00 100.00 ? 46   SER A CB    1 
ATOM   387  O  OG    . SER A 1 46  ? 11.047 55.262 34.455  1.00 63.86  ? 46   SER A OG    1 
ATOM   388  N  N     . TYR A 1 47  ? 12.489 57.830 32.022  1.00 100.00 ? 47   TYR A N     1 
ATOM   389  C  CA    . TYR A 1 47  ? 12.332 59.210 31.641  1.00 42.67  ? 47   TYR A CA    1 
ATOM   390  C  C     . TYR A 1 47  ? 10.908 59.507 31.449  1.00 29.96  ? 47   TYR A C     1 
ATOM   391  O  O     . TYR A 1 47  ? 10.138 58.603 31.180  1.00 47.84  ? 47   TYR A O     1 
ATOM   392  C  CB    . TYR A 1 47  ? 12.874 59.601 30.292  1.00 41.25  ? 47   TYR A CB    1 
ATOM   393  C  CG    . TYR A 1 47  ? 14.302 59.332 30.161  1.00 24.24  ? 47   TYR A CG    1 
ATOM   394  C  CD1   . TYR A 1 47  ? 14.728 58.013 30.011  1.00 26.93  ? 47   TYR A CD1   1 
ATOM   395  C  CD2   . TYR A 1 47  ? 15.199 60.399 30.154  1.00 31.18  ? 47   TYR A CD2   1 
ATOM   396  C  CE1   . TYR A 1 47  ? 16.090 57.749 29.895  1.00 31.60  ? 47   TYR A CE1   1 
ATOM   397  C  CE2   . TYR A 1 47  ? 16.558 60.139 30.075  1.00 27.35  ? 47   TYR A CE2   1 
ATOM   398  C  CZ    . TYR A 1 47  ? 16.992 58.815 29.944  1.00 30.16  ? 47   TYR A CZ    1 
ATOM   399  O  OH    . TYR A 1 47  ? 18.344 58.546 29.828  1.00 42.66  ? 47   TYR A OH    1 
ATOM   400  N  N     . GLU A 1 48  ? 10.647 60.795 31.508  1.00 31.93  ? 48   GLU A N     1 
ATOM   401  C  CA    . GLU A 1 48  ? 9.360  61.345 31.271  1.00 45.75  ? 48   GLU A CA    1 
ATOM   402  C  C     . GLU A 1 48  ? 9.706  62.447 30.331  1.00 17.29  ? 48   GLU A C     1 
ATOM   403  O  O     . GLU A 1 48  ? 10.907 62.761 30.180  1.00 45.70  ? 48   GLU A O     1 
ATOM   404  C  CB    . GLU A 1 48  ? 8.666  61.871 32.538  1.00 61.22  ? 48   GLU A CB    1 
ATOM   405  N  N     . CYS A 1 49  ? 8.652  62.973 29.700  1.00 43.86  ? 49   CYS A N     1 
ATOM   406  C  CA    . CYS A 1 49  ? 8.783  64.044 28.740  1.00 37.62  ? 49   CYS A CA    1 
ATOM   407  C  C     . CYS A 1 49  ? 8.276  65.259 29.430  1.00 100.00 ? 49   CYS A C     1 
ATOM   408  O  O     . CYS A 1 49  ? 7.227  65.228 30.072  1.00 48.88  ? 49   CYS A O     1 
ATOM   409  C  CB    . CYS A 1 49  ? 8.015  63.764 27.395  1.00 36.25  ? 49   CYS A CB    1 
ATOM   410  S  SG    . CYS A 1 49  ? 7.700  65.252 26.393  1.00 45.77  ? 49   CYS A SG    1 
ATOM   411  N  N     . GLY A 1 50  ? 9.078  66.283 29.347  1.00 36.19  ? 50   GLY A N     1 
ATOM   412  C  CA    . GLY A 1 50  ? 8.727  67.498 29.998  1.00 45.40  ? 50   GLY A CA    1 
ATOM   413  C  C     . GLY A 1 50  ? 8.706  68.561 28.991  1.00 41.28  ? 50   GLY A C     1 
ATOM   414  O  O     . GLY A 1 50  ? 9.580  68.621 28.164  1.00 37.14  ? 50   GLY A O     1 
ATOM   415  N  N     . GLU A 1 51  ? 7.685  69.354 29.015  1.00 50.76  ? 51   GLU A N     1 
ATOM   416  C  CA    . GLU A 1 51  ? 7.687  70.400 28.059  1.00 62.61  ? 51   GLU A CA    1 
ATOM   417  C  C     . GLU A 1 51  ? 8.582  71.469 28.614  1.00 61.10  ? 51   GLU A C     1 
ATOM   418  O  O     . GLU A 1 51  ? 8.682  71.626 29.830  1.00 52.63  ? 51   GLU A O     1 
ATOM   419  C  CB    . GLU A 1 51  ? 6.299  70.962 27.787  1.00 45.01  ? 51   GLU A CB    1 
ATOM   420  C  CG    . GLU A 1 51  ? 6.396  72.355 27.123  1.00 49.91  ? 51   GLU A CG    1 
ATOM   421  C  CD    . GLU A 1 51  ? 5.048  72.975 26.860  1.00 100.00 ? 51   GLU A CD    1 
ATOM   422  O  OE1   . GLU A 1 51  ? 4.053  72.180 27.238  1.00 45.49  ? 51   GLU A OE1   1 
ATOM   423  O  OE2   . GLU A 1 51  ? 4.935  74.107 26.367  1.00 87.39  ? 51   GLU A OE2   1 
ATOM   424  N  N     . ILE A 1 52  ? 9.241  72.173 27.721  1.00 35.17  ? 52   ILE A N     1 
ATOM   425  C  CA    . ILE A 1 52  ? 10.110 73.217 28.122  1.00 32.91  ? 52   ILE A CA    1 
ATOM   426  C  C     . ILE A 1 52  ? 9.313  74.508 28.236  1.00 97.52  ? 52   ILE A C     1 
ATOM   427  O  O     . ILE A 1 52  ? 8.771  74.961 27.226  1.00 98.58  ? 52   ILE A O     1 
ATOM   428  C  CB    . ILE A 1 52  ? 11.163 73.435 27.081  1.00 72.46  ? 52   ILE A CB    1 
ATOM   429  C  CG1   . ILE A 1 52  ? 12.169 72.328 27.182  1.00 49.73  ? 52   ILE A CG1   1 
ATOM   430  C  CG2   . ILE A 1 52  ? 11.834 74.812 27.187  1.00 63.29  ? 52   ILE A CG2   1 
ATOM   431  C  CD1   . ILE A 1 52  ? 12.841 72.106 25.830  1.00 78.70  ? 52   ILE A CD1   1 
ATOM   432  N  N     . VAL A 1 53  ? 9.292  75.071 29.468  1.00 100.00 ? 53   VAL A N     1 
ATOM   433  C  CA    . VAL A 1 53  ? 8.621  76.318 29.862  1.00 100.00 ? 53   VAL A CA    1 
ATOM   434  C  C     . VAL A 1 53  ? 9.421  77.517 29.383  1.00 47.52  ? 53   VAL A C     1 
ATOM   435  O  O     . VAL A 1 53  ? 8.867  78.513 28.870  1.00 100.00 ? 53   VAL A O     1 
ATOM   436  C  CB    . VAL A 1 53  ? 8.425  76.481 31.403  1.00 100.00 ? 53   VAL A CB    1 
ATOM   437  C  CG1   . VAL A 1 53  ? 7.353  77.519 31.722  1.00 100.00 ? 53   VAL A CG1   1 
ATOM   438  C  CG2   . VAL A 1 53  ? 8.126  75.186 32.178  1.00 56.11  ? 53   VAL A CG2   1 
ATOM   439  N  N     . SER A 1 54  ? 10.743 77.411 29.571  1.00 37.73  ? 54   SER A N     1 
ATOM   440  C  CA    . SER A 1 54  ? 11.612 78.508 29.198  1.00 46.09  ? 54   SER A CA    1 
ATOM   441  C  C     . SER A 1 54  ? 13.052 78.127 29.121  1.00 76.07  ? 54   SER A C     1 
ATOM   442  O  O     . SER A 1 54  ? 13.493 77.046 29.569  1.00 47.66  ? 54   SER A O     1 
ATOM   443  C  CB    . SER A 1 54  ? 11.580 79.550 30.305  1.00 100.00 ? 54   SER A CB    1 
ATOM   444  O  OG    . SER A 1 54  ? 12.309 79.061 31.432  1.00 94.63  ? 54   SER A OG    1 
ATOM   445  N  N     . GLU A 1 55  ? 13.769 79.119 28.608  1.00 48.93  ? 55   GLU A N     1 
ATOM   446  C  CA    . GLU A 1 55  ? 15.192 79.053 28.467  1.00 52.82  ? 55   GLU A CA    1 
ATOM   447  C  C     . GLU A 1 55  ? 15.928 80.294 28.891  1.00 100.00 ? 55   GLU A C     1 
ATOM   448  O  O     . GLU A 1 55  ? 15.449 81.447 28.838  1.00 100.00 ? 55   GLU A O     1 
ATOM   449  C  CB    . GLU A 1 55  ? 15.733 78.579 27.108  1.00 59.56  ? 55   GLU A CB    1 
ATOM   450  C  CG    . GLU A 1 55  ? 15.432 79.516 25.922  1.00 68.49  ? 55   GLU A CG    1 
ATOM   451  C  CD    . GLU A 1 55  ? 15.632 78.834 24.597  1.00 100.00 ? 55   GLU A CD    1 
ATOM   452  O  OE1   . GLU A 1 55  ? 14.602 78.054 24.297  1.00 100.00 ? 55   GLU A OE1   1 
ATOM   453  O  OE2   . GLU A 1 55  ? 16.644 78.992 23.886  1.00 79.97  ? 55   GLU A OE2   1 
ATOM   454  N  N     . THR A 1 56  ? 17.143 79.960 29.256  1.00 100.00 ? 56   THR A N     1 
ATOM   455  C  CA    . THR A 1 56  ? 18.145 80.888 29.644  1.00 100.00 ? 56   THR A CA    1 
ATOM   456  C  C     . THR A 1 56  ? 19.223 80.748 28.596  1.00 100.00 ? 56   THR A C     1 
ATOM   457  O  O     . THR A 1 56  ? 19.250 79.798 27.806  1.00 100.00 ? 56   THR A O     1 
ATOM   458  C  CB    . THR A 1 56  ? 18.698 80.611 31.063  1.00 100.00 ? 56   THR A CB    1 
ATOM   459  O  OG1   . THR A 1 56  ? 19.871 79.814 30.989  1.00 54.13  ? 56   THR A OG1   1 
ATOM   460  C  CG2   . THR A 1 56  ? 17.660 79.911 31.939  1.00 100.00 ? 56   THR A CG2   1 
ATOM   461  N  N     . SER A 1 57  ? 20.066 81.731 28.593  1.00 100.00 ? 57   SER A N     1 
ATOM   462  C  CA    . SER A 1 57  ? 21.197 81.814 27.726  1.00 55.69  ? 57   SER A CA    1 
ATOM   463  C  C     . SER A 1 57  ? 21.961 80.484 27.590  1.00 85.87  ? 57   SER A C     1 
ATOM   464  O  O     . SER A 1 57  ? 22.575 80.202 26.537  1.00 68.95  ? 57   SER A O     1 
ATOM   465  C  CB    . SER A 1 57  ? 22.054 82.857 28.442  1.00 100.00 ? 57   SER A CB    1 
ATOM   466  O  OG    . SER A 1 57  ? 21.360 83.340 29.609  1.00 100.00 ? 57   SER A OG    1 
ATOM   467  N  N     . ASP A 1 58  ? 21.882 79.678 28.697  1.00 45.83  ? 58   ASP A N     1 
ATOM   468  C  CA    . ASP A 1 58  ? 22.590 78.397 28.934  1.00 56.16  ? 58   ASP A CA    1 
ATOM   469  C  C     . ASP A 1 58  ? 21.823 77.204 29.529  1.00 69.40  ? 58   ASP A C     1 
ATOM   470  O  O     . ASP A 1 58  ? 22.445 76.226 29.950  1.00 49.85  ? 58   ASP A O     1 
ATOM   471  C  CB    . ASP A 1 58  ? 23.525 78.700 30.115  1.00 100.00 ? 58   ASP A CB    1 
ATOM   472  C  CG    . ASP A 1 58  ? 22.687 79.098 31.329  1.00 100.00 ? 58   ASP A CG    1 
ATOM   473  O  OD1   . ASP A 1 58  ? 22.099 80.279 31.194  1.00 100.00 ? 58   ASP A OD1   1 
ATOM   474  O  OD2   . ASP A 1 58  ? 22.549 78.384 32.334  1.00 100.00 ? 58   ASP A OD2   1 
ATOM   475  N  N     . SER A 1 59  ? 20.511 77.264 29.682  1.00 100.00 ? 59   SER A N     1 
ATOM   476  C  CA    . SER A 1 59  ? 19.832 76.132 30.304  1.00 65.49  ? 59   SER A CA    1 
ATOM   477  C  C     . SER A 1 59  ? 18.397 76.027 29.847  1.00 66.58  ? 59   SER A C     1 
ATOM   478  O  O     . SER A 1 59  ? 17.835 76.914 29.209  1.00 54.68  ? 59   SER A O     1 
ATOM   479  C  CB    . SER A 1 59  ? 19.842 76.284 31.841  1.00 100.00 ? 59   SER A CB    1 
ATOM   480  O  OG    . SER A 1 59  ? 18.623 76.841 32.341  1.00 68.56  ? 59   SER A OG    1 
ATOM   481  N  N     . PHE A 1 60  ? 17.769 74.968 30.258  1.00 36.96  ? 60   PHE A N     1 
ATOM   482  C  CA    . PHE A 1 60  ? 16.378 74.851 29.951  1.00 42.98  ? 60   PHE A CA    1 
ATOM   483  C  C     . PHE A 1 60  ? 15.531 74.733 31.222  1.00 75.80  ? 60   PHE A C     1 
ATOM   484  O  O     . PHE A 1 60  ? 15.874 74.216 32.287  1.00 42.97  ? 60   PHE A O     1 
ATOM   485  C  CB    . PHE A 1 60  ? 16.181 73.629 29.076  1.00 58.30  ? 60   PHE A CB    1 
ATOM   486  C  CG    . PHE A 1 60  ? 16.676 73.778 27.647  1.00 100.00 ? 60   PHE A CG    1 
ATOM   487  C  CD1   . PHE A 1 60  ? 15.960 74.572 26.745  1.00 100.00 ? 60   PHE A CD1   1 
ATOM   488  C  CD2   . PHE A 1 60  ? 17.795 73.083 27.178  1.00 35.41  ? 60   PHE A CD2   1 
ATOM   489  C  CE1   . PHE A 1 60  ? 16.344 74.710 25.409  1.00 100.00 ? 60   PHE A CE1   1 
ATOM   490  C  CE2   . PHE A 1 60  ? 18.189 73.190 25.841  1.00 90.87  ? 60   PHE A CE2   1 
ATOM   491  C  CZ    . PHE A 1 60  ? 17.472 74.015 24.967  1.00 100.00 ? 60   PHE A CZ    1 
ATOM   492  N  N     . THR A 1 61  ? 14.351 75.210 31.159  1.00 42.43  ? 61   THR A N     1 
ATOM   493  C  CA    . THR A 1 61  ? 13.594 75.066 32.366  1.00 62.65  ? 61   THR A CA    1 
ATOM   494  C  C     . THR A 1 61  ? 12.280 74.435 31.956  1.00 54.04  ? 61   THR A C     1 
ATOM   495  O  O     . THR A 1 61  ? 11.542 75.035 31.203  1.00 56.96  ? 61   THR A O     1 
ATOM   496  C  CB    . THR A 1 61  ? 13.426 76.467 33.010  1.00 100.00 ? 61   THR A CB    1 
ATOM   497  O  OG1   . THR A 1 61  ? 14.602 77.245 32.787  1.00 65.79  ? 61   THR A OG1   1 
ATOM   498  C  CG2   . THR A 1 61  ? 13.142 76.377 34.508  1.00 65.88  ? 61   THR A CG2   1 
ATOM   499  N  N     . PHE A 1 62  ? 11.979 73.234 32.388  1.00 27.28  ? 62   PHE A N     1 
ATOM   500  C  CA    . PHE A 1 62  ? 10.720 72.631 31.927  1.00 42.50  ? 62   PHE A CA    1 
ATOM   501  C  C     . PHE A 1 62  ? 9.749  72.164 33.007  1.00 41.46  ? 62   PHE A C     1 
ATOM   502  O  O     . PHE A 1 62  ? 10.062 72.081 34.171  1.00 51.22  ? 62   PHE A O     1 
ATOM   503  C  CB    . PHE A 1 62  ? 11.069 71.406 31.097  1.00 60.20  ? 62   PHE A CB    1 
ATOM   504  C  CG    . PHE A 1 62  ? 11.919 70.483 31.938  1.00 59.04  ? 62   PHE A CG    1 
ATOM   505  C  CD1   . PHE A 1 62  ? 13.307 70.648 32.005  1.00 41.75  ? 62   PHE A CD1   1 
ATOM   506  C  CD2   . PHE A 1 62  ? 11.325 69.466 32.686  1.00 100.00 ? 62   PHE A CD2   1 
ATOM   507  C  CE1   . PHE A 1 62  ? 14.106 69.811 32.787  1.00 22.63  ? 62   PHE A CE1   1 
ATOM   508  C  CE2   . PHE A 1 62  ? 12.100 68.610 33.471  1.00 44.14  ? 62   PHE A CE2   1 
ATOM   509  C  CZ    . PHE A 1 62  ? 13.486 68.798 33.524  1.00 33.62  ? 62   PHE A CZ    1 
ATOM   510  N  N     . LYS A 1 63  ? 8.559  71.789 32.614  1.00 72.31  ? 63   LYS A N     1 
ATOM   511  C  CA    . LYS A 1 63  ? 7.661  71.320 33.624  1.00 55.20  ? 63   LYS A CA    1 
ATOM   512  C  C     . LYS A 1 63  ? 7.564  69.807 33.583  1.00 53.11  ? 63   LYS A C     1 
ATOM   513  O  O     . LYS A 1 63  ? 7.423  69.190 32.535  1.00 54.62  ? 63   LYS A O     1 
ATOM   514  C  CB    . LYS A 1 63  ? 6.294  72.010 33.568  1.00 95.10  ? 63   LYS A CB    1 
ATOM   515  N  N     . THR A 1 64  ? 7.638  69.208 34.738  1.00 51.56  ? 64   THR A N     1 
ATOM   516  C  CA    . THR A 1 64  ? 7.497  67.776 34.862  1.00 61.49  ? 64   THR A CA    1 
ATOM   517  C  C     . THR A 1 64  ? 6.057  67.329 34.646  1.00 100.00 ? 64   THR A C     1 
ATOM   518  O  O     . THR A 1 64  ? 5.127  68.118 34.396  1.00 52.82  ? 64   THR A O     1 
ATOM   519  C  CB    . THR A 1 64  ? 7.897  67.347 36.289  1.00 69.28  ? 64   THR A CB    1 
ATOM   520  O  OG1   . THR A 1 64  ? 6.923  67.803 37.234  1.00 39.70  ? 64   THR A OG1   1 
ATOM   521  C  CG2   . THR A 1 64  ? 9.233  67.981 36.615  1.00 66.00  ? 64   THR A CG2   1 
ATOM   522  N  N     . SER A 1 65  ? 5.874  66.020 34.800  1.00 78.73  ? 65   SER A N     1 
ATOM   523  C  CA    . SER A 1 65  ? 4.559  65.420 34.676  1.00 51.78  ? 65   SER A CA    1 
ATOM   524  C  C     . SER A 1 65  ? 3.610  65.948 35.778  1.00 100.00 ? 65   SER A C     1 
ATOM   525  O  O     . SER A 1 65  ? 2.451  66.296 35.531  1.00 76.18  ? 65   SER A O     1 
ATOM   526  C  CB    . SER A 1 65  ? 4.675  63.899 34.737  1.00 100.00 ? 65   SER A CB    1 
ATOM   527  O  OG    . SER A 1 65  ? 3.400  63.280 34.831  1.00 100.00 ? 65   SER A OG    1 
ATOM   528  N  N     . ASP A 1 66  ? 4.125  66.027 37.013  1.00 100.00 ? 66   ASP A N     1 
ATOM   529  C  CA    . ASP A 1 66  ? 3.372  66.470 38.190  1.00 58.92  ? 66   ASP A CA    1 
ATOM   530  C  C     . ASP A 1 66  ? 3.085  67.954 38.244  1.00 90.12  ? 66   ASP A C     1 
ATOM   531  O  O     . ASP A 1 66  ? 2.514  68.440 39.219  1.00 100.00 ? 66   ASP A O     1 
ATOM   532  C  CB    . ASP A 1 66  ? 4.092  66.006 39.461  1.00 66.83  ? 66   ASP A CB    1 
ATOM   533  C  CG    . ASP A 1 66  ? 4.988  64.863 39.125  1.00 100.00 ? 66   ASP A CG    1 
ATOM   534  O  OD1   . ASP A 1 66  ? 4.347  63.703 39.116  1.00 100.00 ? 66   ASP A OD1   1 
ATOM   535  O  OD2   . ASP A 1 66  ? 6.176  65.017 38.851  1.00 100.00 ? 66   ASP A OD2   1 
ATOM   536  N  N     . GLY A 1 67  ? 3.476  68.666 37.189  1.00 100.00 ? 67   GLY A N     1 
ATOM   537  C  CA    . GLY A 1 67  ? 3.264  70.098 37.121  1.00 94.42  ? 67   GLY A CA    1 
ATOM   538  C  C     . GLY A 1 67  ? 4.425  70.762 37.821  1.00 51.53  ? 67   GLY A C     1 
ATOM   539  O  O     . GLY A 1 67  ? 4.397  71.952 38.095  1.00 80.54  ? 67   GLY A O     1 
ATOM   540  N  N     . GLN A 1 68  ? 5.429  69.926 38.129  1.00 65.99  ? 68   GLN A N     1 
ATOM   541  C  CA    . GLN A 1 68  ? 6.634  70.354 38.796  1.00 97.87  ? 68   GLN A CA    1 
ATOM   542  C  C     . GLN A 1 68  ? 7.601  70.950 37.792  1.00 100.00 ? 68   GLN A C     1 
ATOM   543  O  O     . GLN A 1 68  ? 7.792  70.393 36.705  1.00 100.00 ? 68   GLN A O     1 
ATOM   544  C  CB    . GLN A 1 68  ? 7.252  69.195 39.574  1.00 63.47  ? 68   GLN A CB    1 
ATOM   545  N  N     . ASP A 1 69  ? 8.192  72.091 38.140  1.00 100.00 ? 69   ASP A N     1 
ATOM   546  C  CA    . ASP A 1 69  ? 9.128  72.737 37.241  1.00 62.05  ? 69   ASP A CA    1 
ATOM   547  C  C     . ASP A 1 69  ? 10.583 72.508 37.626  1.00 58.89  ? 69   ASP A C     1 
ATOM   548  O  O     . ASP A 1 69  ? 10.949 72.585 38.803  1.00 84.25  ? 69   ASP A O     1 
ATOM   549  C  CB    . ASP A 1 69  ? 8.817  74.206 37.015  1.00 91.55  ? 69   ASP A CB    1 
ATOM   550  N  N     . ARG A 1 70  ? 11.395 72.232 36.594  1.00 100.00 ? 70   ARG A N     1 
ATOM   551  C  CA    . ARG A 1 70  ? 12.830 71.988 36.713  1.00 70.14  ? 70   ARG A CA    1 
ATOM   552  C  C     . ARG A 1 70  ? 13.662 72.725 35.664  1.00 45.95  ? 70   ARG A C     1 
ATOM   553  O  O     . ARG A 1 70  ? 13.159 73.226 34.649  1.00 58.65  ? 70   ARG A O     1 
ATOM   554  C  CB    . ARG A 1 70  ? 13.213 70.506 36.837  1.00 57.99  ? 70   ARG A CB    1 
ATOM   555  N  N     . GLN A 1 71  ? 14.957 72.792 35.958  1.00 51.23  ? 71   GLN A N     1 
ATOM   556  C  CA    . GLN A 1 71  ? 15.906 73.485 35.120  1.00 62.72  ? 71   GLN A CA    1 
ATOM   557  C  C     . GLN A 1 71  ? 16.987 72.529 34.725  1.00 60.45  ? 71   GLN A C     1 
ATOM   558  O  O     . GLN A 1 71  ? 17.366 71.651 35.491  1.00 56.23  ? 71   GLN A O     1 
ATOM   559  C  CB    . GLN A 1 71  ? 16.543 74.657 35.888  1.00 95.95  ? 71   GLN A CB    1 
ATOM   560  C  CG    . GLN A 1 71  ? 15.808 75.999 35.711  1.00 100.00 ? 71   GLN A CG    1 
ATOM   561  C  CD    . GLN A 1 71  ? 16.685 77.083 35.082  1.00 100.00 ? 71   GLN A CD    1 
ATOM   562  O  OE1   . GLN A 1 71  ? 16.927 77.078 33.835  1.00 100.00 ? 71   GLN A OE1   1 
ATOM   563  N  NE2   . GLN A 1 71  ? 17.167 78.015 35.924  1.00 100.00 ? 71   GLN A NE2   1 
ATOM   564  N  N     . VAL A 1 72  ? 17.470 72.693 33.513  1.00 100.00 ? 72   VAL A N     1 
ATOM   565  C  CA    . VAL A 1 72  ? 18.532 71.836 33.039  1.00 100.00 ? 72   VAL A CA    1 
ATOM   566  C  C     . VAL A 1 72  ? 19.489 72.616 32.189  1.00 65.97  ? 72   VAL A C     1 
ATOM   567  O  O     . VAL A 1 72  ? 19.138 73.658 31.621  1.00 62.92  ? 72   VAL A O     1 
ATOM   568  C  CB    . VAL A 1 72  ? 18.149 70.446 32.439  1.00 100.00 ? 72   VAL A CB    1 
ATOM   569  C  CG1   . VAL A 1 72  ? 16.793 70.375 31.714  1.00 38.76  ? 72   VAL A CG1   1 
ATOM   570  C  CG2   . VAL A 1 72  ? 19.261 69.871 31.567  1.00 50.32  ? 72   VAL A CG2   1 
ATOM   571  N  N     . LYS A 1 73  ? 20.698 72.103 32.151  1.00 43.29  ? 73   LYS A N     1 
ATOM   572  C  CA    . LYS A 1 73  ? 21.697 72.732 31.365  1.00 73.88  ? 73   LYS A CA    1 
ATOM   573  C  C     . LYS A 1 73  ? 21.331 72.318 29.998  1.00 68.84  ? 73   LYS A C     1 
ATOM   574  O  O     . LYS A 1 73  ? 20.961 71.156 29.786  1.00 52.65  ? 73   LYS A O     1 
ATOM   575  C  CB    . LYS A 1 73  ? 23.103 72.322 31.753  1.00 35.94  ? 73   LYS A CB    1 
ATOM   576  N  N     . LYS A 1 74  ? 21.295 73.331 29.153  1.00 100.00 ? 74   LYS A N     1 
ATOM   577  C  CA    . LYS A 1 74  ? 20.963 73.133 27.781  1.00 100.00 ? 74   LYS A CA    1 
ATOM   578  C  C     . LYS A 1 74  ? 21.870 72.002 27.323  1.00 100.00 ? 74   LYS A C     1 
ATOM   579  O  O     . LYS A 1 74  ? 21.468 71.059 26.616  1.00 100.00 ? 74   LYS A O     1 
ATOM   580  C  CB    . LYS A 1 74  ? 21.192 74.428 26.988  1.00 53.49  ? 74   LYS A CB    1 
ATOM   581  C  CG    . LYS A 1 74  ? 20.154 75.496 27.290  1.00 49.01  ? 74   LYS A CG    1 
ATOM   582  C  CD    . LYS A 1 74  ? 20.407 76.784 26.504  1.00 52.40  ? 74   LYS A CD    1 
ATOM   583  C  CE    . LYS A 1 74  ? 19.170 77.343 25.776  1.00 100.00 ? 74   LYS A CE    1 
ATOM   584  N  NZ    . LYS A 1 74  ? 19.186 78.794 25.439  1.00 42.04  ? 74   LYS A NZ    1 
ATOM   585  N  N     . ASP A 1 75  ? 23.102 72.095 27.824  1.00 47.76  ? 75   ASP A N     1 
ATOM   586  C  CA    . ASP A 1 75  ? 24.098 71.119 27.465  1.00 50.87  ? 75   ASP A CA    1 
ATOM   587  C  C     . ASP A 1 75  ? 23.931 69.733 28.056  1.00 63.89  ? 75   ASP A C     1 
ATOM   588  O  O     . ASP A 1 75  ? 24.633 68.758 27.721  1.00 59.18  ? 75   ASP A O     1 
ATOM   589  C  CB    . ASP A 1 75  ? 25.536 71.633 27.261  1.00 100.00 ? 75   ASP A CB    1 
ATOM   590  C  CG    . ASP A 1 75  ? 25.765 72.221 25.880  1.00 100.00 ? 75   ASP A CG    1 
ATOM   591  O  OD1   . ASP A 1 75  ? 25.365 73.356 25.590  1.00 100.00 ? 75   ASP A OD1   1 
ATOM   592  O  OD2   . ASP A 1 75  ? 26.434 71.411 25.035  1.00 100.00 ? 75   ASP A OD2   1 
ATOM   593  N  N     . ASP A 1 76  ? 22.937 69.615 28.906  1.00 100.00 ? 76   ASP A N     1 
ATOM   594  C  CA    . ASP A 1 76  ? 22.689 68.318 29.465  1.00 100.00 ? 76   ASP A CA    1 
ATOM   595  C  C     . ASP A 1 76  ? 21.331 67.807 29.063  1.00 100.00 ? 76   ASP A C     1 
ATOM   596  O  O     . ASP A 1 76  ? 20.918 66.723 29.475  1.00 46.77  ? 76   ASP A O     1 
ATOM   597  C  CB    . ASP A 1 76  ? 22.862 68.302 30.986  1.00 100.00 ? 76   ASP A CB    1 
ATOM   598  C  CG    . ASP A 1 76  ? 24.318 68.270 31.323  1.00 100.00 ? 76   ASP A CG    1 
ATOM   599  O  OD1   . ASP A 1 76  ? 25.128 67.537 30.736  1.00 100.00 ? 76   ASP A OD1   1 
ATOM   600  O  OD2   . ASP A 1 76  ? 24.599 69.135 32.286  1.00 62.21  ? 76   ASP A OD2   1 
ATOM   601  N  N     . ALA A 1 77  ? 20.649 68.613 28.264  1.00 58.64  ? 77   ALA A N     1 
ATOM   602  C  CA    . ALA A 1 77  ? 19.328 68.285 27.840  1.00 91.59  ? 77   ALA A CA    1 
ATOM   603  C  C     . ALA A 1 77  ? 19.312 67.141 26.864  1.00 43.61  ? 77   ALA A C     1 
ATOM   604  O  O     . ALA A 1 77  ? 20.184 67.080 25.976  1.00 49.91  ? 77   ALA A O     1 
ATOM   605  C  CB    . ALA A 1 77  ? 18.683 69.532 27.242  1.00 55.59  ? 77   ALA A CB    1 
ATOM   606  N  N     . ASN A 1 78  ? 18.322 66.256 27.090  1.00 47.19  ? 78   ASN A N     1 
ATOM   607  C  CA    . ASN A 1 78  ? 17.957 65.141 26.215  1.00 43.52  ? 78   ASN A CA    1 
ATOM   608  C  C     . ASN A 1 78  ? 16.697 65.618 25.460  1.00 31.39  ? 78   ASN A C     1 
ATOM   609  O  O     . ASN A 1 78  ? 15.525 65.386 25.839  1.00 30.72  ? 78   ASN A O     1 
ATOM   610  C  CB    . ASN A 1 78  ? 17.634 63.866 26.945  1.00 28.51  ? 78   ASN A CB    1 
ATOM   611  C  CG    . ASN A 1 78  ? 18.845 63.196 27.510  1.00 36.17  ? 78   ASN A CG    1 
ATOM   612  O  OD1   . ASN A 1 78  ? 19.927 63.144 26.902  1.00 35.51  ? 78   ASN A OD1   1 
ATOM   613  N  ND2   . ASN A 1 78  ? 18.651 62.650 28.683  1.00 41.31  ? 78   ASN A ND2   1 
ATOM   614  N  N     . GLN A 1 79  ? 16.979 66.459 24.460  1.00 33.02  ? 79   GLN A N     1 
ATOM   615  C  CA    . GLN A 1 79  ? 15.945 67.034 23.638  1.00 41.97  ? 79   GLN A CA    1 
ATOM   616  C  C     . GLN A 1 79  ? 15.158 65.955 22.919  1.00 30.67  ? 79   GLN A C     1 
ATOM   617  O  O     . GLN A 1 79  ? 15.680 64.874 22.527  1.00 32.87  ? 79   GLN A O     1 
ATOM   618  C  CB    . GLN A 1 79  ? 16.534 68.098 22.758  1.00 40.82  ? 79   GLN A CB    1 
ATOM   619  C  CG    . GLN A 1 79  ? 16.762 69.348 23.603  1.00 34.39  ? 79   GLN A CG    1 
ATOM   620  C  CD    . GLN A 1 79  ? 16.756 70.489 22.675  1.00 40.98  ? 79   GLN A CD    1 
ATOM   621  O  OE1   . GLN A 1 79  ? 17.804 70.798 22.105  1.00 36.61  ? 79   GLN A OE1   1 
ATOM   622  N  NE2   . GLN A 1 79  ? 15.585 71.044 22.488  1.00 43.21  ? 79   GLN A NE2   1 
ATOM   623  N  N     . ARG A 1 80  ? 13.862 66.185 22.854  1.00 33.85  ? 80   ARG A N     1 
ATOM   624  C  CA    . ARG A 1 80  ? 12.990 65.198 22.255  1.00 25.17  ? 80   ARG A CA    1 
ATOM   625  C  C     . ARG A 1 80  ? 12.854 65.552 20.762  1.00 27.62  ? 80   ARG A C     1 
ATOM   626  O  O     . ARG A 1 80  ? 12.690 66.739 20.405  1.00 34.29  ? 80   ARG A O     1 
ATOM   627  C  CB    . ARG A 1 80  ? 11.649 65.098 23.030  1.00 21.73  ? 80   ARG A CB    1 
ATOM   628  C  CG    . ARG A 1 80  ? 10.758 63.930 22.648  1.00 33.47  ? 80   ARG A CG    1 
ATOM   629  C  CD    . ARG A 1 80  ? 9.286  64.230 22.820  1.00 22.62  ? 80   ARG A CD    1 
ATOM   630  N  NE    . ARG A 1 80  ? 8.429  63.387 21.999  1.00 39.32  ? 80   ARG A NE    1 
ATOM   631  C  CZ    . ARG A 1 80  ? 7.157  63.051 22.282  1.00 44.67  ? 80   ARG A CZ    1 
ATOM   632  N  NH1   . ARG A 1 80  ? 6.568  63.476 23.389  1.00 40.36  ? 80   ARG A NH1   1 
ATOM   633  N  NH2   . ARG A 1 80  ? 6.445  62.277 21.429  1.00 25.05  ? 80   ARG A NH2   1 
ATOM   634  N  N     . ASN A 1 81  ? 12.960 64.541 19.896  1.00 29.35  ? 81   ASN A N     1 
ATOM   635  C  CA    . ASN A 1 81  ? 12.813 64.789 18.462  1.00 27.57  ? 81   ASN A CA    1 
ATOM   636  C  C     . ASN A 1 81  ? 11.413 65.263 18.112  1.00 29.07  ? 81   ASN A C     1 
ATOM   637  O  O     . ASN A 1 81  ? 10.455 64.908 18.794  1.00 24.52  ? 81   ASN A O     1 
ATOM   638  C  CB    . ASN A 1 81  ? 13.084 63.513 17.663  1.00 29.72  ? 81   ASN A CB    1 
ATOM   639  C  CG    . ASN A 1 81  ? 14.551 63.409 17.418  1.00 18.50  ? 81   ASN A CG    1 
ATOM   640  O  OD1   . ASN A 1 81  ? 15.113 64.291 16.774  1.00 33.96  ? 81   ASN A OD1   1 
ATOM   641  N  ND2   . ASN A 1 81  ? 15.165 62.377 17.970  1.00 24.51  ? 81   ASN A ND2   1 
ATOM   642  N  N     . PRO A 1 82  ? 11.276 66.044 17.045  1.00 37.26  ? 82   PRO A N     1 
ATOM   643  C  CA    . PRO A 1 82  ? 9.929  66.441 16.591  1.00 33.05  ? 82   PRO A CA    1 
ATOM   644  C  C     . PRO A 1 82  ? 9.080  65.155 16.309  1.00 32.55  ? 82   PRO A C     1 
ATOM   645  O  O     . PRO A 1 82  ? 9.625  64.093 15.924  1.00 31.60  ? 82   PRO A O     1 
ATOM   646  C  CB    . PRO A 1 82  ? 10.200 67.285 15.340  1.00 38.73  ? 82   PRO A CB    1 
ATOM   647  C  CG    . PRO A 1 82  ? 11.668 67.784 15.437  1.00 36.37  ? 82   PRO A CG    1 
ATOM   648  C  CD    . PRO A 1 82  ? 12.383 66.840 16.396  1.00 30.81  ? 82   PRO A CD    1 
ATOM   649  N  N     . ILE A 1 83  ? 7.761  65.189 16.630  1.00 30.28  ? 83   ILE A N     1 
ATOM   650  C  CA    . ILE A 1 83  ? 6.819  64.038 16.504  1.00 35.31  ? 83   ILE A CA    1 
ATOM   651  C  C     . ILE A 1 83  ? 6.837  63.400 15.119  1.00 27.02  ? 83   ILE A C     1 
ATOM   652  O  O     . ILE A 1 83  ? 6.590  62.223 14.957  1.00 28.49  ? 83   ILE A O     1 
ATOM   653  C  CB    . ILE A 1 83  ? 5.412  64.340 17.059  1.00 64.32  ? 83   ILE A CB    1 
ATOM   654  C  CG1   . ILE A 1 83  ? 4.774  63.209 17.838  1.00 41.69  ? 83   ILE A CG1   1 
ATOM   655  C  CG2   . ILE A 1 83  ? 4.455  64.783 15.968  1.00 46.85  ? 83   ILE A CG2   1 
ATOM   656  C  CD1   . ILE A 1 83  ? 4.049  63.738 19.069  1.00 100.00 ? 83   ILE A CD1   1 
ATOM   657  N  N     . LYS A 1 84  ? 7.129  64.217 14.121  1.00 22.76  ? 84   LYS A N     1 
ATOM   658  C  CA    . LYS A 1 84  ? 7.277  63.678 12.816  1.00 24.96  ? 84   LYS A CA    1 
ATOM   659  C  C     . LYS A 1 84  ? 8.302  62.545 12.821  1.00 30.44  ? 84   LYS A C     1 
ATOM   660  O  O     . LYS A 1 84  ? 8.180  61.581 12.093  1.00 32.24  ? 84   LYS A O     1 
ATOM   661  C  CB    . LYS A 1 84  ? 7.766  64.754 11.847  1.00 30.65  ? 84   LYS A CB    1 
ATOM   662  C  CG    . LYS A 1 84  ? 8.274  64.133 10.533  1.00 98.02  ? 84   LYS A CG    1 
ATOM   663  C  CD    . LYS A 1 84  ? 9.323  64.962 9.799   1.00 85.51  ? 84   LYS A CD    1 
ATOM   664  C  CE    . LYS A 1 84  ? 10.640 64.218 9.549   1.00 100.00 ? 84   LYS A CE    1 
ATOM   665  N  NZ    . LYS A 1 84  ? 11.700 65.076 8.969   1.00 66.32  ? 84   LYS A NZ    1 
ATOM   666  N  N     . PHE A 1 85  ? 9.350  62.649 13.659  1.00 29.18  ? 85   PHE A N     1 
ATOM   667  C  CA    . PHE A 1 85  ? 10.356 61.604 13.694  1.00 27.24  ? 85   PHE A CA    1 
ATOM   668  C  C     . PHE A 1 85  ? 9.903  60.361 14.395  1.00 23.24  ? 85   PHE A C     1 
ATOM   669  O  O     . PHE A 1 85  ? 10.552 59.320 14.325  1.00 24.56  ? 85   PHE A O     1 
ATOM   670  C  CB    . PHE A 1 85  ? 11.642 62.050 14.364  1.00 26.27  ? 85   PHE A CB    1 
ATOM   671  C  CG    . PHE A 1 85  ? 12.329 63.131 13.611  1.00 27.51  ? 85   PHE A CG    1 
ATOM   672  C  CD1   . PHE A 1 85  ? 12.064 64.472 13.869  1.00 33.88  ? 85   PHE A CD1   1 
ATOM   673  C  CD2   . PHE A 1 85  ? 13.288 62.822 12.653  1.00 100.00 ? 85   PHE A CD2   1 
ATOM   674  C  CE1   . PHE A 1 85  ? 12.742 65.484 13.190  1.00 69.04  ? 85   PHE A CE1   1 
ATOM   675  C  CE2   . PHE A 1 85  ? 13.954 63.826 11.950  1.00 35.80  ? 85   PHE A CE2   1 
ATOM   676  C  CZ    . PHE A 1 85  ? 13.708 65.163 12.239  1.00 32.11  ? 85   PHE A CZ    1 
ATOM   677  N  N     . ASP A 1 86  ? 8.788  60.461 15.091  1.00 29.59  ? 86   ASP A N     1 
ATOM   678  C  CA    . ASP A 1 86  ? 8.368  59.277 15.812  1.00 22.73  ? 86   ASP A CA    1 
ATOM   679  C  C     . ASP A 1 86  ? 7.980  58.113 14.926  1.00 44.98  ? 86   ASP A C     1 
ATOM   680  O  O     . ASP A 1 86  ? 6.920  58.137 14.275  1.00 33.15  ? 86   ASP A O     1 
ATOM   681  C  CB    . ASP A 1 86  ? 7.233  59.595 16.810  1.00 19.84  ? 86   ASP A CB    1 
ATOM   682  C  CG    . ASP A 1 86  ? 7.709  60.302 18.033  1.00 31.50  ? 86   ASP A CG    1 
ATOM   683  O  OD1   . ASP A 1 86  ? 8.993  60.509 18.047  1.00 25.94  ? 86   ASP A OD1   1 
ATOM   684  O  OD2   . ASP A 1 86  ? 6.975  60.647 18.927  1.00 30.55  ? 86   ASP A OD2   1 
ATOM   685  N  N     . GLY A 1 87  ? 8.778  57.052 14.940  1.00 30.54  ? 87   GLY A N     1 
ATOM   686  C  CA    . GLY A 1 87  ? 8.442  55.900 14.121  1.00 14.22  ? 87   GLY A CA    1 
ATOM   687  C  C     . GLY A 1 87  ? 9.343  55.756 12.899  1.00 21.46  ? 87   GLY A C     1 
ATOM   688  O  O     . GLY A 1 87  ? 9.196  54.780 12.126  1.00 25.91  ? 87   GLY A O     1 
ATOM   689  N  N     . VAL A 1 88  ? 10.319 56.685 12.717  1.00 21.39  ? 88   VAL A N     1 
ATOM   690  C  CA    . VAL A 1 88  ? 11.207 56.479 11.559  1.00 20.51  ? 88   VAL A CA    1 
ATOM   691  C  C     . VAL A 1 88  ? 11.857 55.126 11.542  1.00 15.50  ? 88   VAL A C     1 
ATOM   692  O  O     . VAL A 1 88  ? 12.184 54.489 12.556  1.00 17.35  ? 88   VAL A O     1 
ATOM   693  C  CB    . VAL A 1 88  ? 12.274 57.501 11.364  1.00 23.85  ? 88   VAL A CB    1 
ATOM   694  C  CG1   . VAL A 1 88  ? 11.575 58.816 11.317  1.00 29.39  ? 88   VAL A CG1   1 
ATOM   695  C  CG2   . VAL A 1 88  ? 13.251 57.434 12.558  1.00 25.33  ? 88   VAL A CG2   1 
ATOM   696  N  N     . GLU A 1 89  ? 12.093 54.700 10.315  1.00 17.05  ? 89   GLU A N     1 
ATOM   697  C  CA    . GLU A 1 89  ? 12.635 53.407 10.049  1.00 24.85  ? 89   GLU A CA    1 
ATOM   698  C  C     . GLU A 1 89  ? 14.118 53.256 10.326  1.00 16.55  ? 89   GLU A C     1 
ATOM   699  O  O     . GLU A 1 89  ? 14.568 52.115 10.476  1.00 15.78  ? 89   GLU A O     1 
ATOM   700  C  CB    . GLU A 1 89  ? 12.221 52.965 8.658   1.00 18.67  ? 89   GLU A CB    1 
ATOM   701  C  CG    . GLU A 1 89  ? 10.687 52.753 8.569   1.00 16.75  ? 89   GLU A CG    1 
ATOM   702  C  CD    . GLU A 1 89  ? 10.248 52.324 7.204   1.00 38.71  ? 89   GLU A CD    1 
ATOM   703  O  OE1   . GLU A 1 89  ? 11.118 52.630 6.233   1.00 23.91  ? 89   GLU A OE1   1 
ATOM   704  O  OE2   . GLU A 1 89  ? 9.213  51.741 7.024   1.00 23.31  ? 89   GLU A OE2   1 
ATOM   705  N  N     . ASP A 1 90  ? 14.813 54.393 10.424  1.00 19.56  ? 90   ASP A N     1 
ATOM   706  C  CA    . ASP A 1 90  ? 16.239 54.402 10.697  1.00 24.49  ? 90   ASP A CA    1 
ATOM   707  C  C     . ASP A 1 90  ? 16.524 55.447 11.753  1.00 16.01  ? 90   ASP A C     1 
ATOM   708  O  O     . ASP A 1 90  ? 16.252 56.634 11.608  1.00 21.40  ? 90   ASP A O     1 
ATOM   709  C  CB    . ASP A 1 90  ? 17.101 54.657 9.417   1.00 23.40  ? 90   ASP A CB    1 
ATOM   710  C  CG    . ASP A 1 90  ? 18.556 54.295 9.464   1.00 29.84  ? 90   ASP A CG    1 
ATOM   711  O  OD1   . ASP A 1 90  ? 19.100 54.210 10.669  1.00 28.07  ? 90   ASP A OD1   1 
ATOM   712  O  OD2   . ASP A 1 90  ? 19.153 54.070 8.453   1.00 30.53  ? 90   ASP A OD2   1 
ATOM   713  N  N     . MET A 1 91  ? 17.110 54.968 12.841  1.00 25.13  ? 91   MET A N     1 
ATOM   714  C  CA    . MET A 1 91  ? 17.433 55.873 13.926  1.00 20.52  ? 91   MET A CA    1 
ATOM   715  C  C     . MET A 1 91  ? 18.371 56.965 13.430  1.00 18.21  ? 91   MET A C     1 
ATOM   716  O  O     . MET A 1 91  ? 18.535 58.043 13.944  1.00 24.12  ? 91   MET A O     1 
ATOM   717  C  CB    . MET A 1 91  ? 18.138 54.948 14.934  1.00 29.04  ? 91   MET A CB    1 
ATOM   718  C  CG    . MET A 1 91  ? 17.200 53.855 15.425  1.00 82.43  ? 91   MET A CG    1 
ATOM   719  S  SD    . MET A 1 91  ? 16.164 54.451 16.783  1.00 20.77  ? 91   MET A SD    1 
ATOM   720  C  CE    . MET A 1 91  ? 15.649 52.941 17.529  1.00 12.66  ? 91   MET A CE    1 
ATOM   721  N  N     . SER A 1 92  ? 19.042 56.655 12.361  1.00 30.72  ? 92   SER A N     1 
ATOM   722  C  CA    . SER A 1 92  ? 19.985 57.586 11.743  1.00 31.85  ? 92   SER A CA    1 
ATOM   723  C  C     . SER A 1 92  ? 19.342 58.857 11.221  1.00 30.58  ? 92   SER A C     1 
ATOM   724  O  O     . SER A 1 92  ? 19.984 59.852 10.832  1.00 29.42  ? 92   SER A O     1 
ATOM   725  C  CB    . SER A 1 92  ? 20.698 56.869 10.601  1.00 40.66  ? 92   SER A CB    1 
ATOM   726  O  OG    . SER A 1 92  ? 21.648 55.972 11.149  1.00 49.75  ? 92   SER A OG    1 
ATOM   727  N  N     . GLU A 1 93  ? 18.037 58.782 11.193  1.00 35.31  ? 93   GLU A N     1 
ATOM   728  C  CA    . GLU A 1 93  ? 17.256 59.869 10.698  1.00 28.76  ? 93   GLU A CA    1 
ATOM   729  C  C     . GLU A 1 93  ? 16.876 60.780 11.862  1.00 26.97  ? 93   GLU A C     1 
ATOM   730  O  O     . GLU A 1 93  ? 16.336 61.814 11.619  1.00 40.55  ? 93   GLU A O     1 
ATOM   731  C  CB    . GLU A 1 93  ? 15.967 59.322 10.083  1.00 27.81  ? 93   GLU A CB    1 
ATOM   732  C  CG    . GLU A 1 93  ? 16.102 58.280 8.963   1.00 26.71  ? 93   GLU A CG    1 
ATOM   733  C  CD    . GLU A 1 93  ? 14.690 57.984 8.438   1.00 47.46  ? 93   GLU A CD    1 
ATOM   734  O  OE1   . GLU A 1 93  ? 13.972 59.056 8.251   1.00 56.50  ? 93   GLU A OE1   1 
ATOM   735  O  OE2   . GLU A 1 93  ? 14.221 56.887 8.237   1.00 46.71  ? 93   GLU A OE2   1 
ATOM   736  N  N     . LEU A 1 94  ? 17.159 60.428 13.125  1.00 26.03  ? 94   LEU A N     1 
ATOM   737  C  CA    . LEU A 1 94  ? 16.763 61.332 14.194  1.00 23.94  ? 94   LEU A CA    1 
ATOM   738  C  C     . LEU A 1 94  ? 17.707 62.515 14.275  1.00 25.51  ? 94   LEU A C     1 
ATOM   739  O  O     . LEU A 1 94  ? 18.906 62.323 14.125  1.00 33.73  ? 94   LEU A O     1 
ATOM   740  C  CB    . LEU A 1 94  ? 16.783 60.585 15.564  1.00 20.62  ? 94   LEU A CB    1 
ATOM   741  C  CG    . LEU A 1 94  ? 15.920 59.350 15.560  1.00 21.48  ? 94   LEU A CG    1 
ATOM   742  C  CD1   . LEU A 1 94  ? 16.197 58.574 16.829  1.00 21.66  ? 94   LEU A CD1   1 
ATOM   743  C  CD2   . LEU A 1 94  ? 14.447 59.701 15.441  1.00 24.95  ? 94   LEU A CD2   1 
ATOM   744  N  N     . SER A 1 95  ? 17.191 63.704 14.556  1.00 27.37  ? 95   SER A N     1 
ATOM   745  C  CA    . SER A 1 95  ? 18.068 64.838 14.718  1.00 33.08  ? 95   SER A CA    1 
ATOM   746  C  C     . SER A 1 95  ? 18.770 64.775 16.074  1.00 30.69  ? 95   SER A C     1 
ATOM   747  O  O     . SER A 1 95  ? 20.002 64.811 16.113  1.00 35.67  ? 95   SER A O     1 
ATOM   748  C  CB    . SER A 1 95  ? 17.421 66.204 14.404  1.00 29.28  ? 95   SER A CB    1 
ATOM   749  O  OG    . SER A 1 95  ? 18.316 66.992 13.646  1.00 70.64  ? 95   SER A OG    1 
ATOM   750  N  N     . TYR A 1 96  ? 17.994 64.661 17.175  1.00 44.21  ? 96   TYR A N     1 
ATOM   751  C  CA    . TYR A 1 96  ? 18.482 64.536 18.571  1.00 27.62  ? 96   TYR A CA    1 
ATOM   752  C  C     . TYR A 1 96  ? 18.723 63.059 18.810  1.00 25.80  ? 96   TYR A C     1 
ATOM   753  O  O     . TYR A 1 96  ? 17.809 62.222 18.703  1.00 26.36  ? 96   TYR A O     1 
ATOM   754  C  CB    . TYR A 1 96  ? 17.468 65.107 19.568  1.00 22.34  ? 96   TYR A CB    1 
ATOM   755  C  CG    . TYR A 1 96  ? 17.137 66.560 19.302  1.00 29.30  ? 96   TYR A CG    1 
ATOM   756  C  CD1   . TYR A 1 96  ? 18.125 67.544 19.175  1.00 37.49  ? 96   TYR A CD1   1 
ATOM   757  C  CD2   . TYR A 1 96  ? 15.802 66.965 19.224  1.00 28.57  ? 96   TYR A CD2   1 
ATOM   758  C  CE1   . TYR A 1 96  ? 17.783 68.889 18.990  1.00 41.68  ? 96   TYR A CE1   1 
ATOM   759  C  CE2   . TYR A 1 96  ? 15.447 68.298 19.011  1.00 39.58  ? 96   TYR A CE2   1 
ATOM   760  C  CZ    . TYR A 1 96  ? 16.444 69.269 18.892  1.00 47.14  ? 96   TYR A CZ    1 
ATOM   761  O  OH    . TYR A 1 96  ? 16.088 70.583 18.691  1.00 42.18  ? 96   TYR A OH    1 
ATOM   762  N  N     . LEU A 1 97  ? 19.977 62.695 19.022  1.00 30.40  ? 97   LEU A N     1 
ATOM   763  C  CA    . LEU A 1 97  ? 20.338 61.283 19.120  1.00 53.17  ? 97   LEU A CA    1 
ATOM   764  C  C     . LEU A 1 97  ? 20.721 60.716 20.488  1.00 38.80  ? 97   LEU A C     1 
ATOM   765  O  O     . LEU A 1 97  ? 21.536 59.819 20.632  1.00 100.00 ? 97   LEU A O     1 
ATOM   766  C  CB    . LEU A 1 97  ? 21.317 60.894 17.989  1.00 55.99  ? 97   LEU A CB    1 
ATOM   767  C  CG    . LEU A 1 97  ? 20.669 60.955 16.587  1.00 69.82  ? 97   LEU A CG    1 
ATOM   768  C  CD1   . LEU A 1 97  ? 21.388 61.949 15.672  1.00 55.90  ? 97   LEU A CD1   1 
ATOM   769  C  CD2   . LEU A 1 97  ? 20.666 59.565 15.954  1.00 62.37  ? 97   LEU A CD2   1 
ATOM   770  N  N     . ASN A 1 98  ? 20.068 61.233 21.477  1.00 47.43  ? 98   ASN A N     1 
ATOM   771  C  CA    . ASN A 1 98  ? 20.269 60.840 22.830  1.00 32.09  ? 98   ASN A CA    1 
ATOM   772  C  C     . ASN A 1 98  ? 19.720 59.465 23.131  1.00 39.39  ? 98   ASN A C     1 
ATOM   773  O  O     . ASN A 1 98  ? 19.072 58.839 22.299  1.00 29.39  ? 98   ASN A O     1 
ATOM   774  C  CB    . ASN A 1 98  ? 19.758 61.979 23.770  1.00 39.91  ? 98   ASN A CB    1 
ATOM   775  C  CG    . ASN A 1 98  ? 18.313 62.468 23.617  1.00 29.15  ? 98   ASN A CG    1 
ATOM   776  O  OD1   . ASN A 1 98  ? 17.387 61.821 24.135  1.00 45.19  ? 98   ASN A OD1   1 
ATOM   777  N  ND2   . ASN A 1 98  ? 18.104 63.653 22.995  1.00 23.53  ? 98   ASN A ND2   1 
ATOM   778  N  N     . GLU A 1 99  ? 19.983 58.979 24.320  1.00 23.56  ? 99   GLU A N     1 
ATOM   779  C  CA    . GLU A 1 99  ? 19.518 57.670 24.691  1.00 23.12  ? 99   GLU A CA    1 
ATOM   780  C  C     . GLU A 1 99  ? 17.997 57.594 24.859  1.00 35.01  ? 99   GLU A C     1 
ATOM   781  O  O     . GLU A 1 99  ? 17.403 56.652 24.276  1.00 33.14  ? 99   GLU A O     1 
ATOM   782  C  CB    . GLU A 1 99  ? 20.143 57.097 25.993  1.00 34.37  ? 99   GLU A CB    1 
ATOM   783  C  CG    . GLU A 1 99  ? 21.684 56.865 26.062  1.00 100.00 ? 99   GLU A CG    1 
ATOM   784  C  CD    . GLU A 1 99  ? 22.243 56.169 27.323  1.00 100.00 ? 99   GLU A CD    1 
ATOM   785  O  OE1   . GLU A 1 99  ? 21.606 55.796 28.354  1.00 41.16  ? 99   GLU A OE1   1 
ATOM   786  O  OE2   . GLU A 1 99  ? 23.539 56.009 27.173  1.00 46.48  ? 99   GLU A OE2   1 
ATOM   787  N  N     . PRO A 1 100 ? 17.345 58.452 25.712  1.00 40.35  ? 100  PRO A N     1 
ATOM   788  C  CA    . PRO A 1 100 ? 15.873 58.321 25.893  1.00 26.12  ? 100  PRO A CA    1 
ATOM   789  C  C     . PRO A 1 100 ? 15.146 58.372 24.499  1.00 48.97  ? 100  PRO A C     1 
ATOM   790  O  O     . PRO A 1 100 ? 14.167 57.653 24.211  1.00 33.30  ? 100  PRO A O     1 
ATOM   791  C  CB    . PRO A 1 100 ? 15.467 59.460 26.857  1.00 17.80  ? 100  PRO A CB    1 
ATOM   792  C  CG    . PRO A 1 100 ? 16.563 60.500 26.727  1.00 23.62  ? 100  PRO A CG    1 
ATOM   793  C  CD    . PRO A 1 100 ? 17.807 59.765 26.261  1.00 29.61  ? 100  PRO A CD    1 
ATOM   794  N  N     . ALA A 1 101 ? 15.706 59.233 23.605  1.00 29.52  ? 101  ALA A N     1 
ATOM   795  C  CA    . ALA A 1 101 ? 15.274 59.472 22.230  1.00 27.82  ? 101  ALA A CA    1 
ATOM   796  C  C     . ALA A 1 101 ? 15.332 58.215 21.383  1.00 41.42  ? 101  ALA A C     1 
ATOM   797  O  O     . ALA A 1 101 ? 14.356 57.866 20.745  1.00 35.89  ? 101  ALA A O     1 
ATOM   798  C  CB    . ALA A 1 101 ? 15.950 60.666 21.570  1.00 22.77  ? 101  ALA A CB    1 
ATOM   799  N  N     . VAL A 1 102 ? 16.459 57.505 21.399  1.00 20.10  ? 102  VAL A N     1 
ATOM   800  C  CA    . VAL A 1 102 ? 16.583 56.260 20.688  1.00 17.20  ? 102  VAL A CA    1 
ATOM   801  C  C     . VAL A 1 102 ? 15.595 55.240 21.240  1.00 24.41  ? 102  VAL A C     1 
ATOM   802  O  O     . VAL A 1 102 ? 14.947 54.403 20.522  1.00 19.29  ? 102  VAL A O     1 
ATOM   803  C  CB    . VAL A 1 102 ? 18.027 55.776 20.808  1.00 22.81  ? 102  VAL A CB    1 
ATOM   804  C  CG1   . VAL A 1 102 ? 18.355 54.393 20.210  1.00 22.47  ? 102  VAL A CG1   1 
ATOM   805  C  CG2   . VAL A 1 102 ? 18.917 56.831 20.237  1.00 18.75  ? 102  VAL A CG2   1 
ATOM   806  N  N     . PHE A 1 103 ? 15.481 55.252 22.564  1.00 20.41  ? 103  PHE A N     1 
ATOM   807  C  CA    . PHE A 1 103 ? 14.557 54.297 23.147  1.00 21.20  ? 103  PHE A CA    1 
ATOM   808  C  C     . PHE A 1 103 ? 13.104 54.630 22.714  1.00 13.74  ? 103  PHE A C     1 
ATOM   809  O  O     . PHE A 1 103 ? 12.296 53.718 22.429  1.00 19.44  ? 103  PHE A O     1 
ATOM   810  C  CB    . PHE A 1 103 ? 14.614 54.304 24.677  1.00 23.10  ? 103  PHE A CB    1 
ATOM   811  C  CG    . PHE A 1 103 ? 13.613 53.304 25.254  1.00 23.77  ? 103  PHE A CG    1 
ATOM   812  C  CD1   . PHE A 1 103 ? 13.707 51.925 25.013  1.00 13.93  ? 103  PHE A CD1   1 
ATOM   813  C  CD2   . PHE A 1 103 ? 12.543 53.745 26.054  1.00 32.12  ? 103  PHE A CD2   1 
ATOM   814  C  CE1   . PHE A 1 103 ? 12.786 51.007 25.551  1.00 22.27  ? 103  PHE A CE1   1 
ATOM   815  C  CE2   . PHE A 1 103 ? 11.600 52.841 26.577  1.00 19.96  ? 103  PHE A CE2   1 
ATOM   816  C  CZ    . PHE A 1 103 ? 11.720 51.468 26.337  1.00 22.12  ? 103  PHE A CZ    1 
ATOM   817  N  N     . HIS A 1 104 ? 12.841 55.945 22.713  1.00 12.72  ? 104  HIS A N     1 
ATOM   818  C  CA    . HIS A 1 104 ? 11.509 56.371 22.355  1.00 16.90  ? 104  HIS A CA    1 
ATOM   819  C  C     . HIS A 1 104 ? 11.124 55.939 20.919  1.00 14.41  ? 104  HIS A C     1 
ATOM   820  O  O     . HIS A 1 104 ? 10.003 55.540 20.652  1.00 24.88  ? 104  HIS A O     1 
ATOM   821  C  CB    . HIS A 1 104 ? 11.407 57.869 22.454  1.00 18.09  ? 104  HIS A CB    1 
ATOM   822  C  CG    . HIS A 1 104 ? 10.069 58.391 22.016  1.00 36.68  ? 104  HIS A CG    1 
ATOM   823  N  ND1   . HIS A 1 104 ? 8.931  58.047 22.710  1.00 18.73  ? 104  HIS A ND1   1 
ATOM   824  C  CD2   . HIS A 1 104 ? 9.708  59.228 20.990  1.00 24.08  ? 104  HIS A CD2   1 
ATOM   825  C  CE1   . HIS A 1 104 ? 7.909  58.662 22.085  1.00 19.56  ? 104  HIS A CE1   1 
ATOM   826  N  NE2   . HIS A 1 104 ? 8.351  59.400 21.068  1.00 18.76  ? 104  HIS A NE2   1 
ATOM   827  N  N     . ASN A 1 105 ? 12.030 56.063 19.978  1.00 15.10  ? 105  ASN A N     1 
ATOM   828  C  CA    . ASN A 1 105 ? 11.697 55.665 18.623  1.00 23.09  ? 105  ASN A CA    1 
ATOM   829  C  C     . ASN A 1 105 ? 11.448 54.183 18.554  1.00 20.55  ? 105  ASN A C     1 
ATOM   830  O  O     . ASN A 1 105 ? 10.546 53.647 17.870  1.00 23.07  ? 105  ASN A O     1 
ATOM   831  C  CB    . ASN A 1 105 ? 12.778 56.071 17.569  1.00 27.22  ? 105  ASN A CB    1 
ATOM   832  C  CG    . ASN A 1 105 ? 12.255 55.799 16.143  1.00 33.70  ? 105  ASN A CG    1 
ATOM   833  O  OD1   . ASN A 1 105 ? 12.768 54.993 15.341  1.00 22.26  ? 105  ASN A OD1   1 
ATOM   834  N  ND2   . ASN A 1 105 ? 11.155 56.461 15.856  1.00 19.80  ? 105  ASN A ND2   1 
ATOM   835  N  N     . LEU A 1 106 ? 12.276 53.484 19.290  1.00 16.56  ? 106  LEU A N     1 
ATOM   836  C  CA    . LEU A 1 106 ? 12.120 52.065 19.293  1.00 7.67   ? 106  LEU A CA    1 
ATOM   837  C  C     . LEU A 1 106 ? 10.776 51.555 19.842  1.00 12.24  ? 106  LEU A C     1 
ATOM   838  O  O     . LEU A 1 106 ? 10.188 50.530 19.386  1.00 16.94  ? 106  LEU A O     1 
ATOM   839  C  CB    . LEU A 1 106 ? 13.259 51.556 20.130  1.00 27.36  ? 106  LEU A CB    1 
ATOM   840  C  CG    . LEU A 1 106 ? 13.694 50.156 19.770  1.00 44.47  ? 106  LEU A CG    1 
ATOM   841  C  CD1   . LEU A 1 106 ? 14.423 50.097 18.413  1.00 20.22  ? 106  LEU A CD1   1 
ATOM   842  C  CD2   . LEU A 1 106 ? 14.618 49.666 20.877  1.00 46.91  ? 106  LEU A CD2   1 
ATOM   843  N  N     . ARG A 1 107 ? 10.415 52.226 20.938  1.00 19.36  ? 107  ARG A N     1 
ATOM   844  C  CA    . ARG A 1 107 ? 9.164  51.932 21.649  1.00 14.94  ? 107  ARG A CA    1 
ATOM   845  C  C     . ARG A 1 107 ? 7.917  52.347 20.788  1.00 7.18   ? 107  ARG A C     1 
ATOM   846  O  O     . ARG A 1 107 ? 6.937  51.622 20.711  1.00 19.53  ? 107  ARG A O     1 
ATOM   847  C  CB    . ARG A 1 107 ? 9.172  52.778 22.938  1.00 21.53  ? 107  ARG A CB    1 
ATOM   848  C  CG    . ARG A 1 107 ? 7.881  52.521 23.733  1.00 33.29  ? 107  ARG A CG    1 
ATOM   849  C  CD    . ARG A 1 107 ? 7.800  53.384 24.988  1.00 30.91  ? 107  ARG A CD    1 
ATOM   850  N  NE    . ARG A 1 107 ? 8.323  54.720 24.736  1.00 32.89  ? 107  ARG A NE    1 
ATOM   851  C  CZ    . ARG A 1 107 ? 8.670  55.522 25.777  1.00 100.00 ? 107  ARG A CZ    1 
ATOM   852  N  NH1   . ARG A 1 107 ? 8.479  55.057 27.037  1.00 33.79  ? 107  ARG A NH1   1 
ATOM   853  N  NH2   . ARG A 1 107 ? 9.188  56.787 25.586  1.00 37.37  ? 107  ARG A NH2   1 
ATOM   854  N  N     . VAL A 1 108 ? 7.960  53.578 20.191  1.00 8.61   ? 108  VAL A N     1 
ATOM   855  C  CA    . VAL A 1 108 ? 6.866  53.976 19.296  1.00 18.38  ? 108  VAL A CA    1 
ATOM   856  C  C     . VAL A 1 108 ? 6.595  52.834 18.272  1.00 27.13  ? 108  VAL A C     1 
ATOM   857  O  O     . VAL A 1 108 ? 5.464  52.361 18.031  1.00 17.29  ? 108  VAL A O     1 
ATOM   858  C  CB    . VAL A 1 108 ? 7.240  55.226 18.503  1.00 16.55  ? 108  VAL A CB    1 
ATOM   859  C  CG1   . VAL A 1 108 ? 6.107  55.445 17.531  1.00 23.22  ? 108  VAL A CG1   1 
ATOM   860  C  CG2   . VAL A 1 108 ? 7.290  56.436 19.396  1.00 22.97  ? 108  VAL A CG2   1 
ATOM   861  N  N     . ARG A 1 109 ? 7.692  52.379 17.662  1.00 20.51  ? 109  ARG A N     1 
ATOM   862  C  CA    . ARG A 1 109 ? 7.642  51.301 16.719  1.00 11.73  ? 109  ARG A CA    1 
ATOM   863  C  C     . ARG A 1 109 ? 7.137  50.042 17.326  1.00 22.96  ? 109  ARG A C     1 
ATOM   864  O  O     . ARG A 1 109 ? 6.232  49.426 16.799  1.00 18.20  ? 109  ARG A O     1 
ATOM   865  C  CB    . ARG A 1 109 ? 8.946  51.152 15.902  1.00 13.15  ? 109  ARG A CB    1 
ATOM   866  C  CG    . ARG A 1 109 ? 9.256  52.432 15.139  1.00 13.43  ? 109  ARG A CG    1 
ATOM   867  C  CD    . ARG A 1 109 ? 10.461 52.323 14.192  1.00 12.35  ? 109  ARG A CD    1 
ATOM   868  N  NE    . ARG A 1 109 ? 10.471 51.048 13.456  1.00 15.72  ? 109  ARG A NE    1 
ATOM   869  C  CZ    . ARG A 1 109 ? 9.923  50.905 12.224  1.00 11.93  ? 109  ARG A CZ    1 
ATOM   870  N  NH1   . ARG A 1 109 ? 9.261  51.937 11.653  1.00 19.49  ? 109  ARG A NH1   1 
ATOM   871  N  NH2   . ARG A 1 109 ? 9.983  49.687 11.625  1.00 11.88  ? 109  ARG A NH2   1 
ATOM   872  N  N     . TYR A 1 110 ? 7.699  49.604 18.432  1.00 11.66  ? 110  TYR A N     1 
ATOM   873  C  CA    . TYR A 1 110 ? 7.276  48.352 19.030  1.00 14.03  ? 110  TYR A CA    1 
ATOM   874  C  C     . TYR A 1 110 ? 5.784  48.371 19.443  1.00 10.40  ? 110  TYR A C     1 
ATOM   875  O  O     . TYR A 1 110 ? 5.134  47.310 19.430  1.00 14.20  ? 110  TYR A O     1 
ATOM   876  C  CB    . TYR A 1 110 ? 8.147  48.141 20.291  1.00 17.35  ? 110  TYR A CB    1 
ATOM   877  C  CG    . TYR A 1 110 ? 8.068  46.741 20.897  1.00 21.06  ? 110  TYR A CG    1 
ATOM   878  C  CD1   . TYR A 1 110 ? 8.702  45.645 20.289  1.00 13.59  ? 110  TYR A CD1   1 
ATOM   879  C  CD2   . TYR A 1 110 ? 7.320  46.495 22.056  1.00 10.82  ? 110  TYR A CD2   1 
ATOM   880  C  CE1   . TYR A 1 110 ? 8.652  44.358 20.831  1.00 15.58  ? 110  TYR A CE1   1 
ATOM   881  C  CE2   . TYR A 1 110 ? 7.245  45.201 22.586  1.00 12.52  ? 110  TYR A CE2   1 
ATOM   882  C  CZ    . TYR A 1 110 ? 7.942  44.132 22.023  1.00 9.45   ? 110  TYR A CZ    1 
ATOM   883  O  OH    . TYR A 1 110 ? 7.888  42.850 22.566  1.00 15.95  ? 110  TYR A OH    1 
ATOM   884  N  N     . ASN A 1 111 ? 5.307  49.555 19.799  1.00 15.35  ? 111  ASN A N     1 
ATOM   885  C  CA    . ASN A 1 111 ? 3.873  49.761 20.176  1.00 24.13  ? 111  ASN A CA    1 
ATOM   886  C  C     . ASN A 1 111 ? 2.955  49.471 18.997  1.00 39.07  ? 111  ASN A C     1 
ATOM   887  O  O     . ASN A 1 111 ? 1.817  49.255 19.239  1.00 20.01  ? 111  ASN A O     1 
ATOM   888  C  CB    . ASN A 1 111 ? 3.540  51.199 20.622  1.00 15.79  ? 111  ASN A CB    1 
ATOM   889  C  CG    . ASN A 1 111 ? 4.001  51.532 22.027  1.00 16.56  ? 111  ASN A CG    1 
ATOM   890  O  OD1   . ASN A 1 111 ? 4.310  50.647 22.822  1.00 20.92  ? 111  ASN A OD1   1 
ATOM   891  N  ND2   . ASN A 1 111 ? 4.085  52.796 22.267  1.00 16.35  ? 111  ASN A ND2   1 
ATOM   892  N  N     . GLN A 1 112 ? 3.457  49.483 17.743  1.00 18.77  ? 112  GLN A N     1 
ATOM   893  C  CA    . GLN A 1 112 ? 2.670  49.166 16.547  1.00 12.84  ? 112  GLN A CA    1 
ATOM   894  C  C     . GLN A 1 112 ? 3.038  47.831 16.055  1.00 20.41  ? 112  GLN A C     1 
ATOM   895  O  O     . GLN A 1 112 ? 2.713  47.409 14.956  1.00 23.53  ? 112  GLN A O     1 
ATOM   896  C  CB    . GLN A 1 112 ? 2.917  50.222 15.460  1.00 15.67  ? 112  GLN A CB    1 
ATOM   897  C  CG    . GLN A 1 112 ? 2.386  51.563 15.923  1.00 7.10   ? 112  GLN A CG    1 
ATOM   898  C  CD    . GLN A 1 112 ? 2.759  52.799 15.214  1.00 15.27  ? 112  GLN A CD    1 
ATOM   899  O  OE1   . GLN A 1 112 ? 2.040  53.320 14.371  1.00 20.91  ? 112  GLN A OE1   1 
ATOM   900  N  NE2   . GLN A 1 112 ? 3.783  53.456 15.714  1.00 17.33  ? 112  GLN A NE2   1 
ATOM   901  N  N     . ASP A 1 113 ? 3.746  47.128 16.898  1.00 12.75  ? 113  ASP A N     1 
ATOM   902  C  CA    . ASP A 1 113 ? 4.232  45.813 16.549  1.00 9.73   ? 113  ASP A CA    1 
ATOM   903  C  C     . ASP A 1 113 ? 5.273  45.860 15.430  1.00 10.68  ? 113  ASP A C     1 
ATOM   904  O  O     . ASP A 1 113 ? 5.462  44.898 14.728  1.00 13.38  ? 113  ASP A O     1 
ATOM   905  C  CB    . ASP A 1 113 ? 3.230  44.792 16.186  1.00 20.74  ? 113  ASP A CB    1 
ATOM   906  C  CG    . ASP A 1 113 ? 2.356  44.359 17.300  1.00 35.20  ? 113  ASP A CG    1 
ATOM   907  O  OD1   . ASP A 1 113 ? 2.792  44.656 18.474  1.00 21.05  ? 113  ASP A OD1   1 
ATOM   908  O  OD2   . ASP A 1 113 ? 1.334  43.747 17.090  1.00 28.20  ? 113  ASP A OD2   1 
ATOM   909  N  N     . LEU A 1 114 ? 5.990  46.962 15.327  1.00 12.42  ? 114  LEU A N     1 
ATOM   910  C  CA    . LEU A 1 114 ? 7.070  47.034 14.353  1.00 21.61  ? 114  LEU A CA    1 
ATOM   911  C  C     . LEU A 1 114 ? 8.355  46.723 15.102  1.00 8.02   ? 114  LEU A C     1 
ATOM   912  O  O     . LEU A 1 114 ? 8.881  47.614 15.704  1.00 14.56  ? 114  LEU A O     1 
ATOM   913  C  CB    . LEU A 1 114 ? 7.073  48.406 13.663  1.00 19.42  ? 114  LEU A CB    1 
ATOM   914  C  CG    . LEU A 1 114 ? 5.702  48.822 13.034  1.00 18.23  ? 114  LEU A CG    1 
ATOM   915  C  CD1   . LEU A 1 114 ? 5.726  50.311 12.743  1.00 13.01  ? 114  LEU A CD1   1 
ATOM   916  C  CD2   . LEU A 1 114 ? 5.391  47.990 11.778  1.00 13.92  ? 114  LEU A CD2   1 
ATOM   917  N  N     . ILE A 1 115 ? 8.777  45.485 15.026  1.00 15.47  ? 115  ILE A N     1 
ATOM   918  C  CA    . ILE A 1 115 ? 9.909  44.939 15.745  1.00 12.10  ? 115  ILE A CA    1 
ATOM   919  C  C     . ILE A 1 115 ? 11.284 45.184 15.134  1.00 17.47  ? 115  ILE A C     1 
ATOM   920  O  O     . ILE A 1 115 ? 12.269 45.049 15.826  1.00 23.64  ? 115  ILE A O     1 
ATOM   921  C  CB    . ILE A 1 115 ? 9.711  43.469 16.055  1.00 10.41  ? 115  ILE A CB    1 
ATOM   922  C  CG1   . ILE A 1 115 ? 9.561  42.783 14.738  1.00 11.18  ? 115  ILE A CG1   1 
ATOM   923  C  CG2   . ILE A 1 115 ? 8.408  43.293 16.856  1.00 10.33  ? 115  ILE A CG2   1 
ATOM   924  C  CD1   . ILE A 1 115 ? 9.720  41.268 14.835  1.00 11.27  ? 115  ILE A CD1   1 
ATOM   925  N  N     . TYR A 1 116 ? 11.341 45.570 13.876  1.00 20.64  ? 116  TYR A N     1 
ATOM   926  C  CA    . TYR A 1 116 ? 12.615 45.822 13.165  1.00 17.39  ? 116  TYR A CA    1 
ATOM   927  C  C     . TYR A 1 116 ? 12.771 47.281 12.876  1.00 11.51  ? 116  TYR A C     1 
ATOM   928  O  O     . TYR A 1 116 ? 11.866 47.965 12.416  1.00 15.07  ? 116  TYR A O     1 
ATOM   929  C  CB    . TYR A 1 116 ? 12.641 45.067 11.823  1.00 9.50   ? 116  TYR A CB    1 
ATOM   930  C  CG    . TYR A 1 116 ? 12.593 43.563 11.915  1.00 14.88  ? 116  TYR A CG    1 
ATOM   931  C  CD1   . TYR A 1 116 ? 13.685 42.851 12.417  1.00 13.20  ? 116  TYR A CD1   1 
ATOM   932  C  CD2   . TYR A 1 116 ? 11.500 42.829 11.445  1.00 8.56   ? 116  TYR A CD2   1 
ATOM   933  C  CE1   . TYR A 1 116 ? 13.653 41.458 12.457  1.00 14.40  ? 116  TYR A CE1   1 
ATOM   934  C  CE2   . TYR A 1 116 ? 11.468 41.433 11.455  1.00 6.66   ? 116  TYR A CE2   1 
ATOM   935  C  CZ    . TYR A 1 116 ? 12.552 40.746 11.983  1.00 8.00   ? 116  TYR A CZ    1 
ATOM   936  O  OH    . TYR A 1 116 ? 12.564 39.356 12.020  1.00 14.62  ? 116  TYR A OH    1 
ATOM   937  N  N     . THR A 1 117 ? 13.978 47.783 13.208  1.00 17.73  ? 117  THR A N     1 
ATOM   938  C  CA    . THR A 1 117 ? 14.355 49.190 13.038  1.00 26.41  ? 117  THR A CA    1 
ATOM   939  C  C     . THR A 1 117 ? 15.849 49.210 12.768  1.00 21.43  ? 117  THR A C     1 
ATOM   940  O  O     . THR A 1 117 ? 16.558 48.446 13.388  1.00 14.48  ? 117  THR A O     1 
ATOM   941  C  CB    . THR A 1 117 ? 14.038 50.098 14.306  1.00 11.89  ? 117  THR A CB    1 
ATOM   942  O  OG1   . THR A 1 117 ? 12.776 49.740 14.937  1.00 16.87  ? 117  THR A OG1   1 
ATOM   943  C  CG2   . THR A 1 117 ? 14.238 51.620 14.087  1.00 14.61  ? 117  THR A CG2   1 
ATOM   944  N  N     . TYR A 1 118 ? 16.278 50.046 11.795  1.00 18.60  ? 118  TYR A N     1 
ATOM   945  C  CA    . TYR A 1 118 ? 17.686 50.234 11.512  1.00 22.92  ? 118  TYR A CA    1 
ATOM   946  C  C     . TYR A 1 118 ? 18.255 51.274 12.440  1.00 19.72  ? 118  TYR A C     1 
ATOM   947  O  O     . TYR A 1 118 ? 17.587 52.223 12.861  1.00 17.72  ? 118  TYR A O     1 
ATOM   948  C  CB    . TYR A 1 118 ? 17.935 50.780 10.081  1.00 18.86  ? 118  TYR A CB    1 
ATOM   949  C  CG    . TYR A 1 118 ? 17.502 49.743 9.034   1.00 14.66  ? 118  TYR A CG    1 
ATOM   950  C  CD1   . TYR A 1 118 ? 18.164 48.518 8.989   1.00 13.13  ? 118  TYR A CD1   1 
ATOM   951  C  CD2   . TYR A 1 118 ? 16.460 50.004 8.134   1.00 16.37  ? 118  TYR A CD2   1 
ATOM   952  C  CE1   . TYR A 1 118 ? 17.828 47.535 8.057   1.00 25.66  ? 118  TYR A CE1   1 
ATOM   953  C  CE2   . TYR A 1 118 ? 16.118 49.028 7.192   1.00 13.09  ? 118  TYR A CE2   1 
ATOM   954  C  CZ    . TYR A 1 118 ? 16.782 47.797 7.159   1.00 23.13  ? 118  TYR A CZ    1 
ATOM   955  O  OH    . TYR A 1 118 ? 16.442 46.828 6.247   1.00 17.61  ? 118  TYR A OH    1 
ATOM   956  N  N     . SER A 1 119 ? 19.530 51.080 12.706  1.00 22.51  ? 119  SER A N     1 
ATOM   957  C  CA    . SER A 1 119 ? 20.288 52.075 13.429  1.00 23.44  ? 119  SER A CA    1 
ATOM   958  C  C     . SER A 1 119 ? 21.609 52.125 12.679  1.00 21.92  ? 119  SER A C     1 
ATOM   959  O  O     . SER A 1 119 ? 22.499 51.326 12.965  1.00 18.09  ? 119  SER A O     1 
ATOM   960  C  CB    . SER A 1 119 ? 20.538 51.708 14.870  1.00 22.43  ? 119  SER A CB    1 
ATOM   961  O  OG    . SER A 1 119 ? 20.932 52.924 15.468  1.00 21.38  ? 119  SER A OG    1 
ATOM   962  N  N     . GLY A 1 120 ? 21.641 52.953 11.650  1.00 16.77  ? 120  GLY A N     1 
ATOM   963  C  CA    . GLY A 1 120 ? 22.844 53.023 10.779  1.00 15.45  ? 120  GLY A CA    1 
ATOM   964  C  C     . GLY A 1 120 ? 23.046 51.681 10.172  1.00 21.43  ? 120  GLY A C     1 
ATOM   965  O  O     . GLY A 1 120 ? 22.151 51.089 9.553   1.00 29.05  ? 120  GLY A O     1 
ATOM   966  N  N     . LEU A 1 121 ? 24.253 51.150 10.402  1.00 22.06  ? 121  LEU A N     1 
ATOM   967  C  CA    . LEU A 1 121 ? 24.517 49.847 9.898   1.00 14.37  ? 121  LEU A CA    1 
ATOM   968  C  C     . LEU A 1 121 ? 23.736 48.772 10.587  1.00 23.12  ? 121  LEU A C     1 
ATOM   969  O  O     . LEU A 1 121 ? 23.660 47.668 10.081  1.00 23.74  ? 121  LEU A O     1 
ATOM   970  C  CB    . LEU A 1 121 ? 26.005 49.557 10.040  1.00 20.56  ? 121  LEU A CB    1 
ATOM   971  C  CG    . LEU A 1 121 ? 26.858 50.394 9.082   1.00 36.39  ? 121  LEU A CG    1 
ATOM   972  C  CD1   . LEU A 1 121 ? 28.383 50.169 9.315   1.00 31.10  ? 121  LEU A CD1   1 
ATOM   973  C  CD2   . LEU A 1 121 ? 26.495 50.014 7.649   1.00 32.84  ? 121  LEU A CD2   1 
ATOM   974  N  N     . PHE A 1 122 ? 23.154 49.017 11.765  1.00 18.54  ? 122  PHE A N     1 
ATOM   975  C  CA    . PHE A 1 122 ? 22.513 47.837 12.301  1.00 14.55  ? 122  PHE A CA    1 
ATOM   976  C  C     . PHE A 1 122 ? 21.008 47.730 12.009  1.00 7.05   ? 122  PHE A C     1 
ATOM   977  O  O     . PHE A 1 122 ? 20.313 48.710 11.843  1.00 17.65  ? 122  PHE A O     1 
ATOM   978  C  CB    . PHE A 1 122 ? 22.512 47.945 13.798  1.00 19.53  ? 122  PHE A CB    1 
ATOM   979  C  CG    . PHE A 1 122 ? 23.835 47.897 14.494  1.00 16.72  ? 122  PHE A CG    1 
ATOM   980  C  CD1   . PHE A 1 122 ? 24.465 46.686 14.721  1.00 23.49  ? 122  PHE A CD1   1 
ATOM   981  C  CD2   . PHE A 1 122 ? 24.300 49.058 15.097  1.00 22.52  ? 122  PHE A CD2   1 
ATOM   982  C  CE1   . PHE A 1 122 ? 25.666 46.669 15.429  1.00 25.08  ? 122  PHE A CE1   1 
ATOM   983  C  CE2   . PHE A 1 122 ? 25.460 49.067 15.867  1.00 18.72  ? 122  PHE A CE2   1 
ATOM   984  C  CZ    . PHE A 1 122 ? 26.142 47.857 15.990  1.00 15.99  ? 122  PHE A CZ    1 
ATOM   985  N  N     . LEU A 1 123 ? 20.580 46.508 12.124  1.00 16.15  ? 123  LEU A N     1 
ATOM   986  C  CA    . LEU A 1 123 ? 19.189 46.104 12.131  1.00 25.85  ? 123  LEU A CA    1 
ATOM   987  C  C     . LEU A 1 123 ? 18.943 45.696 13.584  1.00 13.69  ? 123  LEU A C     1 
ATOM   988  O  O     . LEU A 1 123 ? 19.498 44.755 14.133  1.00 17.83  ? 123  LEU A O     1 
ATOM   989  C  CB    . LEU A 1 123 ? 18.795 44.910 11.242  1.00 13.09  ? 123  LEU A CB    1 
ATOM   990  C  CG    . LEU A 1 123 ? 17.345 44.448 11.362  1.00 11.61  ? 123  LEU A CG    1 
ATOM   991  C  CD1   . LEU A 1 123 ? 16.422 45.512 10.875  1.00 12.47  ? 123  LEU A CD1   1 
ATOM   992  C  CD2   . LEU A 1 123 ? 17.094 43.110 10.671  1.00 11.90  ? 123  LEU A CD2   1 
ATOM   993  N  N     . VAL A 1 124 ? 18.122 46.464 14.171  1.00 22.08  ? 124  VAL A N     1 
ATOM   994  C  CA    . VAL A 1 124 ? 17.726 46.163 15.496  1.00 19.90  ? 124  VAL A CA    1 
ATOM   995  C  C     . VAL A 1 124 ? 16.394 45.364 15.467  1.00 16.97  ? 124  VAL A C     1 
ATOM   996  O  O     . VAL A 1 124 ? 15.417 45.697 14.787  1.00 15.85  ? 124  VAL A O     1 
ATOM   997  C  CB    . VAL A 1 124 ? 17.648 47.449 16.318  1.00 25.68  ? 124  VAL A CB    1 
ATOM   998  C  CG1   . VAL A 1 124 ? 17.209 47.042 17.762  1.00 18.84  ? 124  VAL A CG1   1 
ATOM   999  C  CG2   . VAL A 1 124 ? 19.024 48.095 16.350  1.00 18.70  ? 124  VAL A CG2   1 
ATOM   1000 N  N     . ALA A 1 125 ? 16.371 44.267 16.182  1.00 15.25  ? 125  ALA A N     1 
ATOM   1001 C  CA    . ALA A 1 125 ? 15.192 43.484 16.183  1.00 18.14  ? 125  ALA A CA    1 
ATOM   1002 C  C     . ALA A 1 125 ? 14.722 43.284 17.648  1.00 28.40  ? 125  ALA A C     1 
ATOM   1003 O  O     . ALA A 1 125 ? 15.442 42.690 18.400  1.00 20.36  ? 125  ALA A O     1 
ATOM   1004 C  CB    . ALA A 1 125 ? 15.485 42.118 15.515  1.00 14.14  ? 125  ALA A CB    1 
ATOM   1005 N  N     . VAL A 1 126 ? 13.506 43.690 18.049  1.00 21.29  ? 126  VAL A N     1 
ATOM   1006 C  CA    . VAL A 1 126 ? 12.997 43.457 19.438  1.00 19.16  ? 126  VAL A CA    1 
ATOM   1007 C  C     . VAL A 1 126 ? 12.021 42.296 19.494  1.00 19.13  ? 126  VAL A C     1 
ATOM   1008 O  O     . VAL A 1 126 ? 11.036 42.273 18.746  1.00 20.61  ? 126  VAL A O     1 
ATOM   1009 C  CB    . VAL A 1 126 ? 12.393 44.717 20.036  1.00 19.32  ? 126  VAL A CB    1 
ATOM   1010 C  CG1   . VAL A 1 126 ? 12.022 44.579 21.503  1.00 16.11  ? 126  VAL A CG1   1 
ATOM   1011 C  CG2   . VAL A 1 126 ? 13.329 45.872 19.851  1.00 14.96  ? 126  VAL A CG2   1 
ATOM   1012 N  N     . ASN A 1 127 ? 12.300 41.266 20.308  1.00 16.49  ? 127  ASN A N     1 
ATOM   1013 C  CA    . ASN A 1 127 ? 11.425 40.098 20.407  1.00 22.26  ? 127  ASN A CA    1 
ATOM   1014 C  C     . ASN A 1 127 ? 10.042 40.541 20.740  1.00 30.31  ? 127  ASN A C     1 
ATOM   1015 O  O     . ASN A 1 127 ? 9.872  41.254 21.702  1.00 19.56  ? 127  ASN A O     1 
ATOM   1016 C  CB    . ASN A 1 127 ? 11.818 39.110 21.505  1.00 13.68  ? 127  ASN A CB    1 
ATOM   1017 C  CG    . ASN A 1 127 ? 11.304 37.710 21.312  1.00 16.30  ? 127  ASN A CG    1 
ATOM   1018 O  OD1   . ASN A 1 127 ? 10.220 37.484 20.715  1.00 17.94  ? 127  ASN A OD1   1 
ATOM   1019 N  ND2   . ASN A 1 127 ? 12.072 36.722 21.836  1.00 20.38  ? 127  ASN A ND2   1 
ATOM   1020 N  N     . PRO A 1 128 ? 9.087  40.135 19.907  1.00 30.04  ? 128  PRO A N     1 
ATOM   1021 C  CA    . PRO A 1 128 ? 7.678  40.516 20.148  1.00 26.04  ? 128  PRO A CA    1 
ATOM   1022 C  C     . PRO A 1 128 ? 7.013  39.630 21.236  1.00 20.89  ? 128  PRO A C     1 
ATOM   1023 O  O     . PRO A 1 128 ? 6.028  39.984 21.842  1.00 23.94  ? 128  PRO A O     1 
ATOM   1024 C  CB    . PRO A 1 128 ? 6.931  40.182 18.824  1.00 15.15  ? 128  PRO A CB    1 
ATOM   1025 C  CG    . PRO A 1 128 ? 7.820  39.157 18.081  1.00 20.00  ? 128  PRO A CG    1 
ATOM   1026 C  CD    . PRO A 1 128 ? 9.251  39.386 18.598  1.00 17.74  ? 128  PRO A CD    1 
ATOM   1027 N  N     . PHE A 1 129 ? 7.507  38.432 21.367  1.00 17.63  ? 129  PHE A N     1 
ATOM   1028 C  CA    . PHE A 1 129 ? 6.956  37.485 22.282  1.00 27.03  ? 129  PHE A CA    1 
ATOM   1029 C  C     . PHE A 1 129 ? 5.557  37.153 21.902  1.00 35.25  ? 129  PHE A C     1 
ATOM   1030 O  O     . PHE A 1 129 ? 4.764  36.937 22.785  1.00 22.74  ? 129  PHE A O     1 
ATOM   1031 C  CB    . PHE A 1 129 ? 7.078  37.912 23.763  1.00 17.42  ? 129  PHE A CB    1 
ATOM   1032 C  CG    . PHE A 1 129 ? 8.431  37.583 24.298  1.00 12.93  ? 129  PHE A CG    1 
ATOM   1033 C  CD1   . PHE A 1 129 ? 8.936  36.313 24.059  1.00 20.19  ? 129  PHE A CD1   1 
ATOM   1034 C  CD2   . PHE A 1 129 ? 9.174  38.535 25.002  1.00 20.36  ? 129  PHE A CD2   1 
ATOM   1035 C  CE1   . PHE A 1 129 ? 10.194 35.980 24.564  1.00 24.79  ? 129  PHE A CE1   1 
ATOM   1036 C  CE2   . PHE A 1 129 ? 10.457 38.247 25.466  1.00 18.24  ? 129  PHE A CE2   1 
ATOM   1037 C  CZ    . PHE A 1 129 ? 10.942 36.956 25.236  1.00 17.83  ? 129  PHE A CZ    1 
ATOM   1038 N  N     . LYS A 1 130 ? 5.280  37.099 20.610  1.00 24.61  ? 130  LYS A N     1 
ATOM   1039 C  CA    . LYS A 1 130 ? 3.997  36.695 20.027  1.00 18.61  ? 130  LYS A CA    1 
ATOM   1040 C  C     . LYS A 1 130 ? 4.182  36.547 18.559  1.00 36.09  ? 130  LYS A C     1 
ATOM   1041 O  O     . LYS A 1 130 ? 5.148  37.061 18.043  1.00 22.96  ? 130  LYS A O     1 
ATOM   1042 C  CB    . LYS A 1 130 ? 2.836  37.620 20.201  1.00 16.58  ? 130  LYS A CB    1 
ATOM   1043 C  CG    . LYS A 1 130 ? 3.007  38.973 19.528  1.00 15.62  ? 130  LYS A CG    1 
ATOM   1044 C  CD    . LYS A 1 130 ? 1.733  39.738 19.636  1.00 17.38  ? 130  LYS A CD    1 
ATOM   1045 C  CE    . LYS A 1 130 ? 1.788  41.093 19.026  1.00 29.30  ? 130  LYS A CE    1 
ATOM   1046 N  NZ    . LYS A 1 130 ? 0.437  41.736 18.981  1.00 28.77  ? 130  LYS A NZ    1 
ATOM   1047 N  N     . ARG A 1 131 ? 3.253  35.877 17.895  1.00 37.86  ? 131  ARG A N     1 
ATOM   1048 C  CA    . ARG A 1 131 ? 3.346  35.709 16.460  1.00 31.83  ? 131  ARG A CA    1 
ATOM   1049 C  C     . ARG A 1 131 ? 2.849  36.956 15.752  1.00 44.02  ? 131  ARG A C     1 
ATOM   1050 O  O     . ARG A 1 131 ? 1.842  37.567 16.185  1.00 26.34  ? 131  ARG A O     1 
ATOM   1051 C  CB    . ARG A 1 131 ? 2.684  34.420 15.952  1.00 22.26  ? 131  ARG A CB    1 
ATOM   1052 C  CG    . ARG A 1 131 ? 3.416  33.184 16.494  1.00 100.00 ? 131  ARG A CG    1 
ATOM   1053 C  CD    . ARG A 1 131 ? 4.875  33.027 15.984  1.00 100.00 ? 131  ARG A CD    1 
ATOM   1054 N  NE    . ARG A 1 131 ? 5.789  32.116 16.765  1.00 100.00 ? 131  ARG A NE    1 
ATOM   1055 C  CZ    . ARG A 1 131 ? 7.155  31.963 16.625  1.00 100.00 ? 131  ARG A CZ    1 
ATOM   1056 N  NH1   . ARG A 1 131 ? 7.899  32.658 15.716  1.00 100.00 ? 131  ARG A NH1   1 
ATOM   1057 N  NH2   . ARG A 1 131 ? 7.800  31.084 17.438  1.00 79.24  ? 131  ARG A NH2   1 
ATOM   1058 N  N     . ILE A 1 132 ? 3.676  37.336 14.739  1.00 19.21  ? 132  ILE A N     1 
ATOM   1059 C  CA    . ILE A 1 132 ? 3.536  38.423 13.741  1.00 23.02  ? 132  ILE A CA    1 
ATOM   1060 C  C     . ILE A 1 132 ? 3.712  37.752 12.395  1.00 37.30  ? 132  ILE A C     1 
ATOM   1061 O  O     . ILE A 1 132 ? 4.766  37.138 12.158  1.00 22.58  ? 132  ILE A O     1 
ATOM   1062 C  CB    . ILE A 1 132 ? 4.511  39.567 13.883  1.00 20.05  ? 132  ILE A CB    1 
ATOM   1063 C  CG1   . ILE A 1 132 ? 4.221  40.225 15.241  1.00 26.58  ? 132  ILE A CG1   1 
ATOM   1064 C  CG2   . ILE A 1 132 ? 4.258  40.597 12.790  1.00 16.80  ? 132  ILE A CG2   1 
ATOM   1065 C  CD1   . ILE A 1 132 ? 5.093  41.433 15.546  1.00 24.54  ? 132  ILE A CD1   1 
ATOM   1066 N  N     . PRO A 1 133 ? 2.645  37.742 11.553  1.00 32.52  ? 133  PRO A N     1 
ATOM   1067 C  CA    . PRO A 1 133 ? 2.713  37.001 10.275  1.00 22.64  ? 133  PRO A CA    1 
ATOM   1068 C  C     . PRO A 1 133 ? 3.447  37.759 9.168   1.00 27.75  ? 133  PRO A C     1 
ATOM   1069 O  O     . PRO A 1 133 ? 2.824  38.221 8.210   1.00 24.18  ? 133  PRO A O     1 
ATOM   1070 C  CB    . PRO A 1 133 ? 1.251  36.803 9.849   1.00 21.53  ? 133  PRO A CB    1 
ATOM   1071 C  CG    . PRO A 1 133 ? 0.495  37.928 10.514  1.00 25.10  ? 133  PRO A CG    1 
ATOM   1072 C  CD    . PRO A 1 133 ? 1.346  38.479 11.670  1.00 22.06  ? 133  PRO A CD    1 
ATOM   1073 N  N     . ILE A 1 134 ? 4.777  37.897 9.333   1.00 19.46  ? 134  ILE A N     1 
ATOM   1074 C  CA    . ILE A 1 134 ? 5.558  38.590 8.392   1.00 15.89  ? 134  ILE A CA    1 
ATOM   1075 C  C     . ILE A 1 134 ? 6.618  37.698 7.760   1.00 12.51  ? 134  ILE A C     1 
ATOM   1076 O  O     . ILE A 1 134 ? 7.573  38.158 7.159   1.00 20.03  ? 134  ILE A O     1 
ATOM   1077 C  CB    . ILE A 1 134 ? 6.189  39.783 9.051   1.00 23.46  ? 134  ILE A CB    1 
ATOM   1078 C  CG1   . ILE A 1 134 ? 6.928  39.339 10.295  1.00 16.55  ? 134  ILE A CG1   1 
ATOM   1079 C  CG2   . ILE A 1 134 ? 5.154  40.846 9.348   1.00 29.56  ? 134  ILE A CG2   1 
ATOM   1080 C  CD1   . ILE A 1 134 ? 7.743  40.499 10.879  1.00 12.03  ? 134  ILE A CD1   1 
ATOM   1081 N  N     . TYR A 1 135 ? 6.442  36.422 7.919   1.00 16.12  ? 135  TYR A N     1 
ATOM   1082 C  CA    . TYR A 1 135 ? 7.441  35.566 7.406   1.00 20.46  ? 135  TYR A CA    1 
ATOM   1083 C  C     . TYR A 1 135 ? 6.866  34.617 6.392   1.00 32.44  ? 135  TYR A C     1 
ATOM   1084 O  O     . TYR A 1 135 ? 7.384  33.553 6.195   1.00 27.00  ? 135  TYR A O     1 
ATOM   1085 C  CB    . TYR A 1 135 ? 8.043  34.765 8.583   1.00 20.92  ? 135  TYR A CB    1 
ATOM   1086 C  CG    . TYR A 1 135 ? 8.549  35.722 9.651   1.00 19.86  ? 135  TYR A CG    1 
ATOM   1087 C  CD1   . TYR A 1 135 ? 9.687  36.511 9.399   1.00 16.95  ? 135  TYR A CD1   1 
ATOM   1088 C  CD2   . TYR A 1 135 ? 7.931  35.786 10.909  1.00 15.42  ? 135  TYR A CD2   1 
ATOM   1089 C  CE1   . TYR A 1 135 ? 10.204 37.378 10.375  1.00 18.49  ? 135  TYR A CE1   1 
ATOM   1090 C  CE2   . TYR A 1 135 ? 8.437  36.651 11.891  1.00 16.17  ? 135  TYR A CE2   1 
ATOM   1091 C  CZ    . TYR A 1 135 ? 9.569  37.433 11.631  1.00 25.28  ? 135  TYR A CZ    1 
ATOM   1092 O  OH    . TYR A 1 135 ? 10.103 38.241 12.610  1.00 15.70  ? 135  TYR A OH    1 
ATOM   1093 N  N     . THR A 1 136 ? 5.769  34.982 5.771   1.00 25.70  ? 136  THR A N     1 
ATOM   1094 C  CA    . THR A 1 136 ? 5.131  34.138 4.792   1.00 25.04  ? 136  THR A CA    1 
ATOM   1095 C  C     . THR A 1 136 ? 5.868  34.179 3.490   1.00 22.52  ? 136  THR A C     1 
ATOM   1096 O  O     . THR A 1 136 ? 6.652  35.097 3.222   1.00 23.49  ? 136  THR A O     1 
ATOM   1097 C  CB    . THR A 1 136 ? 3.708  34.666 4.488   1.00 14.48  ? 136  THR A CB    1 
ATOM   1098 O  OG1   . THR A 1 136 ? 3.724  35.968 3.994   1.00 25.71  ? 136  THR A OG1   1 
ATOM   1099 C  CG2   . THR A 1 136 ? 2.865  34.605 5.765   1.00 39.83  ? 136  THR A CG2   1 
ATOM   1100 N  N     . GLN A 1 137 ? 5.534  33.188 2.655   1.00 23.43  ? 137  GLN A N     1 
ATOM   1101 C  CA    . GLN A 1 137 ? 6.134  33.190 1.374   1.00 23.84  ? 137  GLN A CA    1 
ATOM   1102 C  C     . GLN A 1 137 ? 5.845  34.446 0.614   1.00 18.28  ? 137  GLN A C     1 
ATOM   1103 O  O     . GLN A 1 137 ? 6.673  34.974 -0.134  1.00 22.98  ? 137  GLN A O     1 
ATOM   1104 C  CB    . GLN A 1 137 ? 5.795  31.982 0.540   1.00 34.54  ? 137  GLN A CB    1 
ATOM   1105 C  CG    . GLN A 1 137 ? 6.406  32.263 -0.819  1.00 32.91  ? 137  GLN A CG    1 
ATOM   1106 C  CD    . GLN A 1 137 ? 7.841  31.891 -0.852  1.00 22.93  ? 137  GLN A CD    1 
ATOM   1107 O  OE1   . GLN A 1 137 ? 8.242  30.846 -0.286  1.00 26.58  ? 137  GLN A OE1   1 
ATOM   1108 N  NE2   . GLN A 1 137 ? 8.605  32.718 -1.527  1.00 23.35  ? 137  GLN A NE2   1 
ATOM   1109 N  N     . GLU A 1 138 ? 4.637  34.936 0.805   1.00 23.61  ? 138  GLU A N     1 
ATOM   1110 C  CA    . GLU A 1 138 ? 4.266  36.159 0.136   1.00 25.37  ? 138  GLU A CA    1 
ATOM   1111 C  C     . GLU A 1 138 ? 5.052  37.294 0.671   1.00 41.01  ? 138  GLU A C     1 
ATOM   1112 O  O     . GLU A 1 138 ? 5.227  38.286 -0.031  1.00 24.39  ? 138  GLU A O     1 
ATOM   1113 C  CB    . GLU A 1 138 ? 2.787  36.483 0.351   1.00 42.46  ? 138  GLU A CB    1 
ATOM   1114 C  CG    . GLU A 1 138 ? 1.933  35.304 -0.106  1.00 36.47  ? 138  GLU A CG    1 
ATOM   1115 C  CD    . GLU A 1 138 ? 1.852  34.197 0.915   1.00 44.12  ? 138  GLU A CD    1 
ATOM   1116 O  OE1   . GLU A 1 138 ? 1.221  34.563 1.998   1.00 100.00 ? 138  GLU A OE1   1 
ATOM   1117 O  OE2   . GLU A 1 138 ? 2.262  33.068 0.733   1.00 51.44  ? 138  GLU A OE2   1 
ATOM   1118 N  N     . MET A 1 139 ? 5.454  37.163 1.948   1.00 28.27  ? 139  MET A N     1 
ATOM   1119 C  CA    . MET A 1 139 ? 6.271  38.197 2.563   1.00 18.61  ? 139  MET A CA    1 
ATOM   1120 C  C     . MET A 1 139 ? 7.671  38.044 1.982   1.00 12.54  ? 139  MET A C     1 
ATOM   1121 O  O     . MET A 1 139 ? 8.305  39.023 1.670   1.00 23.13  ? 139  MET A O     1 
ATOM   1122 C  CB    . MET A 1 139 ? 6.288  38.087 4.108   1.00 24.03  ? 139  MET A CB    1 
ATOM   1123 C  CG    . MET A 1 139 ? 5.009  38.630 4.799   1.00 18.60  ? 139  MET A CG    1 
ATOM   1124 S  SD    . MET A 1 139 ? 4.920  40.427 5.010   1.00 24.76  ? 139  MET A SD    1 
ATOM   1125 C  CE    . MET A 1 139 ? 3.154  40.695 5.508   1.00 19.38  ? 139  MET A CE    1 
ATOM   1126 N  N     . VAL A 1 140 ? 8.114  36.798 1.814   1.00 18.74  ? 140  VAL A N     1 
ATOM   1127 C  CA    . VAL A 1 140 ? 9.423  36.586 1.191   1.00 19.27  ? 140  VAL A CA    1 
ATOM   1128 C  C     . VAL A 1 140 ? 9.515  37.340 -0.138  1.00 25.63  ? 140  VAL A C     1 
ATOM   1129 O  O     . VAL A 1 140 ? 10.415 38.159 -0.378  1.00 28.93  ? 140  VAL A O     1 
ATOM   1130 C  CB    . VAL A 1 140 ? 9.633  35.107 0.981   1.00 21.06  ? 140  VAL A CB    1 
ATOM   1131 C  CG1   . VAL A 1 140 ? 10.735 34.910 -0.049  1.00 20.52  ? 140  VAL A CG1   1 
ATOM   1132 C  CG2   . VAL A 1 140 ? 9.993  34.401 2.311   1.00 22.35  ? 140  VAL A CG2   1 
ATOM   1133 N  N     . ASP A 1 141 ? 8.477  37.093 -0.950  1.00 31.69  ? 141  ASP A N     1 
ATOM   1134 C  CA    . ASP A 1 141 ? 8.313  37.601 -2.292  1.00 24.69  ? 141  ASP A CA    1 
ATOM   1135 C  C     . ASP A 1 141 ? 8.412  39.079 -2.473  1.00 34.38  ? 141  ASP A C     1 
ATOM   1136 O  O     . ASP A 1 141 ? 8.959  39.577 -3.458  1.00 30.92  ? 141  ASP A O     1 
ATOM   1137 C  CB    . ASP A 1 141 ? 7.101  37.033 -3.016  1.00 33.72  ? 141  ASP A CB    1 
ATOM   1138 C  CG    . ASP A 1 141 ? 7.148  35.544 -3.179  1.00 24.97  ? 141  ASP A CG    1 
ATOM   1139 O  OD1   . ASP A 1 141 ? 8.349  35.072 -3.134  1.00 28.74  ? 141  ASP A OD1   1 
ATOM   1140 O  OD2   . ASP A 1 141 ? 6.157  34.849 -3.325  1.00 56.76  ? 141  ASP A OD2   1 
ATOM   1141 N  N     . ILE A 1 142 ? 7.889  39.812 -1.517  1.00 31.17  ? 142  ILE A N     1 
ATOM   1142 C  CA    . ILE A 1 142 ? 7.991  41.271 -1.585  1.00 18.07  ? 142  ILE A CA    1 
ATOM   1143 C  C     . ILE A 1 142 ? 9.434  41.827 -1.477  1.00 26.75  ? 142  ILE A C     1 
ATOM   1144 O  O     . ILE A 1 142 ? 9.758  42.884 -2.022  1.00 27.90  ? 142  ILE A O     1 
ATOM   1145 C  CB    . ILE A 1 142 ? 7.189  41.835 -0.377  1.00 42.23  ? 142  ILE A CB    1 
ATOM   1146 C  CG1   . ILE A 1 142 ? 5.731  41.397 -0.388  1.00 55.43  ? 142  ILE A CG1   1 
ATOM   1147 C  CG2   . ILE A 1 142 ? 7.358  43.341 -0.136  1.00 37.58  ? 142  ILE A CG2   1 
ATOM   1148 C  CD1   . ILE A 1 142 ? 5.272  40.829 0.956   1.00 89.75  ? 142  ILE A CD1   1 
ATOM   1149 N  N     . PHE A 1 143 ? 10.291 41.211 -0.641  1.00 20.60  ? 143  PHE A N     1 
ATOM   1150 C  CA    . PHE A 1 143 ? 11.596 41.789 -0.413  1.00 23.73  ? 143  PHE A CA    1 
ATOM   1151 C  C     . PHE A 1 143 ? 12.566 41.495 -1.553  1.00 30.08  ? 143  PHE A C     1 
ATOM   1152 O  O     . PHE A 1 143 ? 13.714 41.917 -1.496  1.00 36.65  ? 143  PHE A O     1 
ATOM   1153 C  CB    . PHE A 1 143 ? 12.159 41.226 0.942   1.00 28.17  ? 143  PHE A CB    1 
ATOM   1154 C  CG    . PHE A 1 143 ? 11.460 41.887 2.079   1.00 16.49  ? 143  PHE A CG    1 
ATOM   1155 C  CD1   . PHE A 1 143 ? 11.929 43.099 2.561   1.00 21.74  ? 143  PHE A CD1   1 
ATOM   1156 C  CD2   . PHE A 1 143 ? 10.307 41.344 2.618   1.00 21.80  ? 143  PHE A CD2   1 
ATOM   1157 C  CE1   . PHE A 1 143 ? 11.311 43.796 3.594   1.00 27.05  ? 143  PHE A CE1   1 
ATOM   1158 C  CE2   . PHE A 1 143 ? 9.675  42.025 3.654   1.00 25.49  ? 143  PHE A CE2   1 
ATOM   1159 C  CZ    . PHE A 1 143 ? 10.154 43.243 4.128   1.00 25.38  ? 143  PHE A CZ    1 
ATOM   1160 N  N     . LYS A 1 144 ? 12.149 40.698 -2.532  1.00 34.29  ? 144  LYS A N     1 
ATOM   1161 C  CA    . LYS A 1 144 ? 13.063 40.287 -3.593  1.00 23.92  ? 144  LYS A CA    1 
ATOM   1162 C  C     . LYS A 1 144 ? 13.553 41.417 -4.426  1.00 25.78  ? 144  LYS A C     1 
ATOM   1163 O  O     . LYS A 1 144 ? 12.747 42.062 -4.996  1.00 31.92  ? 144  LYS A O     1 
ATOM   1164 C  CB    . LYS A 1 144 ? 12.578 39.079 -4.374  1.00 33.31  ? 144  LYS A CB    1 
ATOM   1165 C  CG    . LYS A 1 144 ? 12.150 37.862 -3.504  1.00 37.97  ? 144  LYS A CG    1 
ATOM   1166 C  CD    . LYS A 1 144 ? 11.471 36.756 -4.345  1.00 100.00 ? 144  LYS A CD    1 
ATOM   1167 C  CE    . LYS A 1 144 ? 11.389 35.339 -3.756  1.00 68.34  ? 144  LYS A CE    1 
ATOM   1168 N  NZ    . LYS A 1 144 ? 10.309 34.555 -4.393  1.00 51.11  ? 144  LYS A NZ    1 
ATOM   1169 N  N     . GLY A 1 145 ? 14.866 41.700 -4.395  1.00 22.75  ? 145  GLY A N     1 
ATOM   1170 C  CA    . GLY A 1 145 ? 15.553 42.711 -5.147  1.00 15.91  ? 145  GLY A CA    1 
ATOM   1171 C  C     . GLY A 1 145 ? 15.371 44.134 -4.736  1.00 23.06  ? 145  GLY A C     1 
ATOM   1172 O  O     . GLY A 1 145 ? 15.779 45.068 -5.428  1.00 32.26  ? 145  GLY A O     1 
ATOM   1173 N  N     . ARG A 1 146 ? 14.744 44.353 -3.585  1.00 30.08  ? 146  ARG A N     1 
ATOM   1174 C  CA    . ARG A 1 146 ? 14.513 45.739 -3.156  1.00 27.77  ? 146  ARG A CA    1 
ATOM   1175 C  C     . ARG A 1 146 ? 15.593 46.295 -2.298  1.00 22.93  ? 146  ARG A C     1 
ATOM   1176 O  O     . ARG A 1 146 ? 16.092 45.569 -1.432  1.00 34.89  ? 146  ARG A O     1 
ATOM   1177 C  CB    . ARG A 1 146 ? 13.268 45.811 -2.343  1.00 26.59  ? 146  ARG A CB    1 
ATOM   1178 C  CG    . ARG A 1 146 ? 12.156 45.217 -3.150  1.00 26.97  ? 146  ARG A CG    1 
ATOM   1179 C  CD    . ARG A 1 146 ? 10.900 45.537 -2.412  1.00 85.39  ? 146  ARG A CD    1 
ATOM   1180 N  NE    . ARG A 1 146 ? 9.740  45.516 -3.278  1.00 100.00 ? 146  ARG A NE    1 
ATOM   1181 C  CZ    . ARG A 1 146 ? 9.559  46.333 -4.308  1.00 51.25  ? 146  ARG A CZ    1 
ATOM   1182 N  NH1   . ARG A 1 146 ? 10.463 47.248 -4.640  1.00 100.00 ? 146  ARG A NH1   1 
ATOM   1183 N  NH2   . ARG A 1 146 ? 8.443  46.199 -5.035  1.00 100.00 ? 146  ARG A NH2   1 
ATOM   1184 N  N     . ARG A 1 147 ? 15.918 47.563 -2.520  1.00 24.46  ? 147  ARG A N     1 
ATOM   1185 C  CA    . ARG A 1 147 ? 16.959 48.210 -1.761  1.00 22.81  ? 147  ARG A CA    1 
ATOM   1186 C  C     . ARG A 1 147 ? 16.484 48.431 -0.318  1.00 100.00 ? 147  ARG A C     1 
ATOM   1187 O  O     . ARG A 1 147 ? 15.293 48.520 -0.069  1.00 21.22  ? 147  ARG A O     1 
ATOM   1188 C  CB    . ARG A 1 147 ? 17.264 49.544 -2.371  1.00 23.47  ? 147  ARG A CB    1 
ATOM   1189 C  CG    . ARG A 1 147 ? 17.830 49.394 -3.756  1.00 49.82  ? 147  ARG A CG    1 
ATOM   1190 C  CD    . ARG A 1 147 ? 18.730 50.549 -4.192  1.00 66.55  ? 147  ARG A CD    1 
ATOM   1191 N  NE    . ARG A 1 147 ? 18.596 50.843 -5.623  1.00 100.00 ? 147  ARG A NE    1 
ATOM   1192 C  CZ    . ARG A 1 147 ? 18.708 49.954 -6.635  1.00 100.00 ? 147  ARG A CZ    1 
ATOM   1193 N  NH1   . ARG A 1 147 ? 18.975 48.635 -6.471  1.00 100.00 ? 147  ARG A NH1   1 
ATOM   1194 N  NH2   . ARG A 1 147 ? 18.548 50.417 -7.877  1.00 100.00 ? 147  ARG A NH2   1 
ATOM   1195 N  N     . ARG A 1 148 ? 17.424 48.494 0.616   1.00 30.49  ? 148  ARG A N     1 
ATOM   1196 C  CA    . ARG A 1 148 ? 17.175 48.730 2.024   1.00 45.85  ? 148  ARG A CA    1 
ATOM   1197 C  C     . ARG A 1 148 ? 16.151 49.843 2.226   1.00 27.94  ? 148  ARG A C     1 
ATOM   1198 O  O     . ARG A 1 148 ? 15.131 49.680 2.900   1.00 35.74  ? 148  ARG A O     1 
ATOM   1199 C  CB    . ARG A 1 148 ? 18.484 49.131 2.666   1.00 39.58  ? 148  ARG A CB    1 
ATOM   1200 C  CG    . ARG A 1 148 ? 18.303 49.735 4.039   1.00 41.49  ? 148  ARG A CG    1 
ATOM   1201 C  CD    . ARG A 1 148 ? 19.433 49.449 5.048   1.00 40.76  ? 148  ARG A CD    1 
ATOM   1202 N  NE    . ARG A 1 148 ? 19.566 50.572 5.992   1.00 36.71  ? 148  ARG A NE    1 
ATOM   1203 C  CZ    . ARG A 1 148 ? 20.298 50.634 7.116   1.00 24.88  ? 148  ARG A CZ    1 
ATOM   1204 N  NH1   . ARG A 1 148 ? 21.098 49.577 7.535   1.00 26.60  ? 148  ARG A NH1   1 
ATOM   1205 N  NH2   . ARG A 1 148 ? 20.212 51.812 7.779   1.00 19.75  ? 148  ARG A NH2   1 
ATOM   1206 N  N     . ASN A 1 149 ? 16.415 50.946 1.560   1.00 29.40  ? 149  ASN A N     1 
ATOM   1207 C  CA    . ASN A 1 149 ? 15.624 52.165 1.547   1.00 31.28  ? 149  ASN A CA    1 
ATOM   1208 C  C     . ASN A 1 149 ? 14.327 52.018 0.732   1.00 29.59  ? 149  ASN A C     1 
ATOM   1209 O  O     . ASN A 1 149 ? 13.472 52.890 0.694   1.00 50.02  ? 149  ASN A O     1 
ATOM   1210 C  CB    . ASN A 1 149 ? 16.497 53.222 0.853   1.00 65.54  ? 149  ASN A CB    1 
ATOM   1211 C  CG    . ASN A 1 149 ? 17.030 52.666 -0.479  1.00 100.00 ? 149  ASN A CG    1 
ATOM   1212 O  OD1   . ASN A 1 149 ? 16.369 52.797 -1.538  1.00 46.82  ? 149  ASN A OD1   1 
ATOM   1213 N  ND2   . ASN A 1 149 ? 18.211 52.018 -0.421  1.00 100.00 ? 149  ASN A ND2   1 
ATOM   1214 N  N     . GLU A 1 150 ? 14.177 50.920 0.060   1.00 28.33  ? 150  GLU A N     1 
ATOM   1215 C  CA    . GLU A 1 150 ? 12.972 50.748 -0.708  1.00 26.77  ? 150  GLU A CA    1 
ATOM   1216 C  C     . GLU A 1 150 ? 11.841 50.032 0.090   1.00 37.17  ? 150  GLU A C     1 
ATOM   1217 O  O     . GLU A 1 150 ? 10.654 50.120 -0.191  1.00 34.08  ? 150  GLU A O     1 
ATOM   1218 C  CB    . GLU A 1 150 ? 13.335 49.852 -1.904  1.00 32.86  ? 150  GLU A CB    1 
ATOM   1219 C  CG    . GLU A 1 150 ? 13.208 50.505 -3.262  1.00 56.22  ? 150  GLU A CG    1 
ATOM   1220 C  CD    . GLU A 1 150 ? 14.210 49.934 -4.222  1.00 100.00 ? 150  GLU A CD    1 
ATOM   1221 O  OE1   . GLU A 1 150 ? 14.008 48.668 -4.499  1.00 39.48  ? 150  GLU A OE1   1 
ATOM   1222 O  OE2   . GLU A 1 150 ? 15.129 50.610 -4.668  1.00 90.41  ? 150  GLU A OE2   1 
ATOM   1223 N  N     . VAL A 1 151 ? 12.196 49.238 1.069   1.00 25.17  ? 151  VAL A N     1 
ATOM   1224 C  CA    . VAL A 1 151 ? 11.229 48.497 1.820   1.00 22.04  ? 151  VAL A CA    1 
ATOM   1225 C  C     . VAL A 1 151 ? 11.423 48.760 3.321   1.00 27.44  ? 151  VAL A C     1 
ATOM   1226 O  O     . VAL A 1 151 ? 12.418 49.332 3.758   1.00 24.80  ? 151  VAL A O     1 
ATOM   1227 C  CB    . VAL A 1 151 ? 11.342 46.994 1.549   1.00 16.44  ? 151  VAL A CB    1 
ATOM   1228 C  CG1   . VAL A 1 151 ? 10.634 46.561 0.310   1.00 32.95  ? 151  VAL A CG1   1 
ATOM   1229 C  CG2   . VAL A 1 151 ? 12.803 46.552 1.587   1.00 19.69  ? 151  VAL A CG2   1 
ATOM   1230 N  N     . ALA A 1 152 ? 10.446 48.306 4.097   1.00 31.11  ? 152  ALA A N     1 
ATOM   1231 C  CA    . ALA A 1 152 ? 10.441 48.425 5.535   1.00 16.97  ? 152  ALA A CA    1 
ATOM   1232 C  C     . ALA A 1 152 ? 11.607 47.597 6.120   1.00 21.51  ? 152  ALA A C     1 
ATOM   1233 O  O     . ALA A 1 152 ? 12.139 46.671 5.488   1.00 21.42  ? 152  ALA A O     1 
ATOM   1234 C  CB    . ALA A 1 152 ? 9.143  47.745 5.996   1.00 13.52  ? 152  ALA A CB    1 
ATOM   1235 N  N     . PRO A 1 153 ? 11.984 47.883 7.393   1.00 23.31  ? 153  PRO A N     1 
ATOM   1236 C  CA    . PRO A 1 153 ? 12.999 47.102 8.042   1.00 11.72  ? 153  PRO A CA    1 
ATOM   1237 C  C     . PRO A 1 153 ? 12.516 45.686 8.187   1.00 11.95  ? 153  PRO A C     1 
ATOM   1238 O  O     . PRO A 1 153 ? 11.326 45.420 8.454   1.00 19.72  ? 153  PRO A O     1 
ATOM   1239 C  CB    . PRO A 1 153 ? 13.189 47.796 9.408   1.00 11.61  ? 153  PRO A CB    1 
ATOM   1240 C  CG    . PRO A 1 153 ? 12.896 49.264 9.132   1.00 10.70  ? 153  PRO A CG    1 
ATOM   1241 C  CD    . PRO A 1 153 ? 11.867 49.224 8.012   1.00 13.46  ? 153  PRO A CD    1 
ATOM   1242 N  N     . HIS A 1 154 ? 13.391 44.738 7.990   1.00 20.45  ? 154  HIS A N     1 
ATOM   1243 C  CA    . HIS A 1 154 ? 13.013 43.320 8.112   1.00 15.23  ? 154  HIS A CA    1 
ATOM   1244 C  C     . HIS A 1 154 ? 14.281 42.452 7.975   1.00 17.08  ? 154  HIS A C     1 
ATOM   1245 O  O     . HIS A 1 154 ? 15.203 42.846 7.255   1.00 17.85  ? 154  HIS A O     1 
ATOM   1246 C  CB    . HIS A 1 154 ? 11.956 42.968 6.993   1.00 14.88  ? 154  HIS A CB    1 
ATOM   1247 C  CG    . HIS A 1 154 ? 11.203 41.696 7.171   1.00 11.99  ? 154  HIS A CG    1 
ATOM   1248 N  ND1   . HIS A 1 154 ? 11.809 40.490 7.207   1.00 12.57  ? 154  HIS A ND1   1 
ATOM   1249 C  CD2   . HIS A 1 154 ? 9.858  41.484 7.371   1.00 19.42  ? 154  HIS A CD2   1 
ATOM   1250 C  CE1   . HIS A 1 154 ? 10.894 39.570 7.423   1.00 10.17  ? 154  HIS A CE1   1 
ATOM   1251 N  NE2   . HIS A 1 154 ? 9.672  40.141 7.511   1.00 12.93  ? 154  HIS A NE2   1 
ATOM   1252 N  N     . ILE A 1 155 ? 14.316 41.311 8.639   1.00 9.01   ? 155  ILE A N     1 
ATOM   1253 C  CA    . ILE A 1 155 ? 15.392 40.360 8.488   1.00 8.08   ? 155  ILE A CA    1 
ATOM   1254 C  C     . ILE A 1 155 ? 15.579 39.941 7.006   1.00 21.76  ? 155  ILE A C     1 
ATOM   1255 O  O     . ILE A 1 155 ? 16.663 39.674 6.480   1.00 14.35  ? 155  ILE A O     1 
ATOM   1256 C  CB    . ILE A 1 155 ? 15.231 39.130 9.399   1.00 11.68  ? 155  ILE A CB    1 
ATOM   1257 C  CG1   . ILE A 1 155 ? 16.508 38.257 9.454   1.00 18.41  ? 155  ILE A CG1   1 
ATOM   1258 C  CG2   . ILE A 1 155 ? 14.020 38.233 9.193   1.00 11.42  ? 155  ILE A CG2   1 
ATOM   1259 C  CD1   . ILE A 1 155 ? 17.747 38.990 10.087  1.00 16.16  ? 155  ILE A CD1   1 
ATOM   1260 N  N     . PHE A 1 156 ? 14.474 39.885 6.315   1.00 20.15  ? 156  PHE A N     1 
ATOM   1261 C  CA    . PHE A 1 156 ? 14.409 39.531 4.898   1.00 14.82  ? 156  PHE A CA    1 
ATOM   1262 C  C     . PHE A 1 156 ? 15.108 40.557 4.072   1.00 10.35  ? 156  PHE A C     1 
ATOM   1263 O  O     . PHE A 1 156 ? 15.768 40.232 3.078   1.00 19.26  ? 156  PHE A O     1 
ATOM   1264 C  CB    . PHE A 1 156 ? 12.966 39.414 4.374   1.00 16.24  ? 156  PHE A CB    1 
ATOM   1265 C  CG    . PHE A 1 156 ? 12.234 38.131 4.760   1.00 14.89  ? 156  PHE A CG    1 
ATOM   1266 C  CD1   . PHE A 1 156 ? 12.820 37.069 5.438   1.00 13.57  ? 156  PHE A CD1   1 
ATOM   1267 C  CD2   . PHE A 1 156 ? 10.859 38.034 4.558   1.00 24.39  ? 156  PHE A CD2   1 
ATOM   1268 C  CE1   . PHE A 1 156 ? 12.103 35.921 5.778   1.00 17.84  ? 156  PHE A CE1   1 
ATOM   1269 C  CE2   . PHE A 1 156 ? 10.119 36.914 4.935   1.00 16.22  ? 156  PHE A CE2   1 
ATOM   1270 C  CZ    . PHE A 1 156 ? 10.731 35.829 5.542   1.00 18.39  ? 156  PHE A CZ    1 
ATOM   1271 N  N     . ALA A 1 157 ? 14.927 41.790 4.452   1.00 13.13  ? 157  ALA A N     1 
ATOM   1272 C  CA    . ALA A 1 157 ? 15.546 42.851 3.781   1.00 16.73  ? 157  ALA A CA    1 
ATOM   1273 C  C     . ALA A 1 157 ? 17.080 42.723 3.831   1.00 41.92  ? 157  ALA A C     1 
ATOM   1274 O  O     . ALA A 1 157 ? 17.776 42.735 2.801   1.00 21.15  ? 157  ALA A O     1 
ATOM   1275 C  CB    . ALA A 1 157 ? 14.979 44.213 4.158   1.00 14.18  ? 157  ALA A CB    1 
ATOM   1276 N  N     . ILE A 1 158 ? 17.616 42.590 5.036   1.00 26.84  ? 158  ILE A N     1 
ATOM   1277 C  CA    . ILE A 1 158 ? 19.068 42.415 5.263   1.00 29.59  ? 158  ILE A CA    1 
ATOM   1278 C  C     . ILE A 1 158 ? 19.611 41.247 4.416   1.00 16.77  ? 158  ILE A C     1 
ATOM   1279 O  O     . ILE A 1 158 ? 20.681 41.362 3.794   1.00 19.15  ? 158  ILE A O     1 
ATOM   1280 C  CB    . ILE A 1 158 ? 19.266 42.200 6.779   1.00 18.93  ? 158  ILE A CB    1 
ATOM   1281 C  CG1   . ILE A 1 158 ? 19.134 43.599 7.304   1.00 28.43  ? 158  ILE A CG1   1 
ATOM   1282 C  CG2   . ILE A 1 158 ? 20.628 41.621 7.135   1.00 43.34  ? 158  ILE A CG2   1 
ATOM   1283 C  CD1   . ILE A 1 158 ? 20.483 44.164 7.721   1.00 92.52  ? 158  ILE A CD1   1 
ATOM   1284 N  N     . SER A 1 159 ? 18.888 40.131 4.496   1.00 14.88  ? 159  SER A N     1 
ATOM   1285 C  CA    . SER A 1 159 ? 19.162 38.948 3.738   1.00 19.50  ? 159  SER A CA    1 
ATOM   1286 C  C     . SER A 1 159 ? 19.194 39.276 2.206   1.00 22.06  ? 159  SER A C     1 
ATOM   1287 O  O     . SER A 1 159 ? 20.047 38.790 1.478   1.00 16.48  ? 159  SER A O     1 
ATOM   1288 C  CB    . SER A 1 159 ? 18.145 37.873 3.964   1.00 18.64  ? 159  SER A CB    1 
ATOM   1289 O  OG    . SER A 1 159 ? 18.035 37.578 5.290   1.00 20.64  ? 159  SER A OG    1 
ATOM   1290 N  N     . ASP A 1 160 ? 18.247 40.036 1.716   1.00 24.26  ? 160  ASP A N     1 
ATOM   1291 C  CA    . ASP A 1 160 ? 18.237 40.360 0.288   1.00 27.09  ? 160  ASP A CA    1 
ATOM   1292 C  C     . ASP A 1 160 ? 19.433 41.224 -0.070  1.00 26.96  ? 160  ASP A C     1 
ATOM   1293 O  O     . ASP A 1 160 ? 20.094 41.014 -1.054  1.00 22.06  ? 160  ASP A O     1 
ATOM   1294 C  CB    . ASP A 1 160 ? 16.924 40.971 -0.257  1.00 29.75  ? 160  ASP A CB    1 
ATOM   1295 C  CG    . ASP A 1 160 ? 16.858 40.827 -1.760  1.00 18.68  ? 160  ASP A CG    1 
ATOM   1296 O  OD1   . ASP A 1 160 ? 16.512 39.606 -2.096  1.00 23.84  ? 160  ASP A OD1   1 
ATOM   1297 O  OD2   . ASP A 1 160 ? 17.147 41.745 -2.531  1.00 24.46  ? 160  ASP A OD2   1 
ATOM   1298 N  N     . VAL A 1 161 ? 19.722 42.211 0.719   1.00 21.48  ? 161  VAL A N     1 
ATOM   1299 C  CA    . VAL A 1 161 ? 20.874 43.076 0.478   1.00 25.22  ? 161  VAL A CA    1 
ATOM   1300 C  C     . VAL A 1 161 ? 22.173 42.262 0.417   1.00 38.33  ? 161  VAL A C     1 
ATOM   1301 O  O     . VAL A 1 161 ? 22.996 42.415 -0.484  1.00 27.16  ? 161  VAL A O     1 
ATOM   1302 C  CB    . VAL A 1 161 ? 20.978 44.192 1.520   1.00 26.61  ? 161  VAL A CB    1 
ATOM   1303 C  CG1   . VAL A 1 161 ? 22.364 44.789 1.585   1.00 29.96  ? 161  VAL A CG1   1 
ATOM   1304 C  CG2   . VAL A 1 161 ? 19.939 45.279 1.254   1.00 24.01  ? 161  VAL A CG2   1 
ATOM   1305 N  N     . ALA A 1 162 ? 22.345 41.373 1.350   1.00 17.12  ? 162  ALA A N     1 
ATOM   1306 C  CA    . ALA A 1 162 ? 23.504 40.562 1.343   1.00 20.06  ? 162  ALA A CA    1 
ATOM   1307 C  C     . ALA A 1 162 ? 23.596 39.694 0.073   1.00 26.44  ? 162  ALA A C     1 
ATOM   1308 O  O     . ALA A 1 162 ? 24.624 39.461 -0.502  1.00 18.83  ? 162  ALA A O     1 
ATOM   1309 C  CB    . ALA A 1 162 ? 23.424 39.597 2.519   1.00 18.86  ? 162  ALA A CB    1 
ATOM   1310 N  N     . TYR A 1 163 ? 22.533 39.091 -0.325  1.00 19.43  ? 163  TYR A N     1 
ATOM   1311 C  CA    . TYR A 1 163 ? 22.523 38.242 -1.499  1.00 18.80  ? 163  TYR A CA    1 
ATOM   1312 C  C     . TYR A 1 163 ? 22.804 39.021 -2.788  1.00 15.37  ? 163  TYR A C     1 
ATOM   1313 O  O     . TYR A 1 163 ? 23.513 38.557 -3.666  1.00 24.19  ? 163  TYR A O     1 
ATOM   1314 C  CB    . TYR A 1 163 ? 21.145 37.656 -1.602  1.00 18.44  ? 163  TYR A CB    1 
ATOM   1315 C  CG    . TYR A 1 163 ? 21.002 36.700 -2.705  1.00 16.59  ? 163  TYR A CG    1 
ATOM   1316 C  CD1   . TYR A 1 163 ? 21.758 35.527 -2.734  1.00 19.29  ? 163  TYR A CD1   1 
ATOM   1317 C  CD2   . TYR A 1 163 ? 20.171 37.007 -3.782  1.00 33.59  ? 163  TYR A CD2   1 
ATOM   1318 C  CE1   . TYR A 1 163 ? 21.623 34.623 -3.792  1.00 20.06  ? 163  TYR A CE1   1 
ATOM   1319 C  CE2   . TYR A 1 163 ? 20.056 36.120 -4.855  1.00 13.90  ? 163  TYR A CE2   1 
ATOM   1320 C  CZ    . TYR A 1 163 ? 20.765 34.925 -4.848  1.00 17.81  ? 163  TYR A CZ    1 
ATOM   1321 O  OH    . TYR A 1 163 ? 20.629 34.011 -5.857  1.00 23.70  ? 163  TYR A OH    1 
ATOM   1322 N  N     . ARG A 1 164 ? 22.292 40.227 -2.926  1.00 18.80  ? 164  ARG A N     1 
ATOM   1323 C  CA    . ARG A 1 164 ? 22.545 40.984 -4.131  1.00 19.41  ? 164  ARG A CA    1 
ATOM   1324 C  C     . ARG A 1 164 ? 23.962 41.449 -4.126  1.00 37.28  ? 164  ARG A C     1 
ATOM   1325 O  O     . ARG A 1 164 ? 24.597 41.626 -5.142  1.00 19.10  ? 164  ARG A O     1 
ATOM   1326 C  CB    . ARG A 1 164 ? 21.746 42.250 -4.115  1.00 16.68  ? 164  ARG A CB    1 
ATOM   1327 C  CG    . ARG A 1 164 ? 20.231 42.086 -4.165  1.00 21.09  ? 164  ARG A CG    1 
ATOM   1328 C  CD    . ARG A 1 164 ? 19.715 41.132 -5.204  1.00 18.19  ? 164  ARG A CD    1 
ATOM   1329 N  NE    . ARG A 1 164 ? 18.392 40.610 -4.875  1.00 24.15  ? 164  ARG A NE    1 
ATOM   1330 C  CZ    . ARG A 1 164 ? 18.077 39.412 -5.309  1.00 28.12  ? 164  ARG A CZ    1 
ATOM   1331 N  NH1   . ARG A 1 164 ? 18.941 38.741 -6.034  1.00 100.00 ? 164  ARG A NH1   1 
ATOM   1332 N  NH2   . ARG A 1 164 ? 16.928 38.823 -5.028  1.00 22.80  ? 164  ARG A NH2   1 
ATOM   1333 N  N     . SER A 1 165 ? 24.434 41.750 -2.931  1.00 22.87  ? 165  SER A N     1 
ATOM   1334 C  CA    . SER A 1 165 ? 25.809 42.208 -2.763  1.00 15.27  ? 165  SER A CA    1 
ATOM   1335 C  C     . SER A 1 165 ? 26.765 41.159 -3.164  1.00 11.13  ? 165  SER A C     1 
ATOM   1336 O  O     . SER A 1 165 ? 27.805 41.439 -3.790  1.00 22.77  ? 165  SER A O     1 
ATOM   1337 C  CB    . SER A 1 165 ? 26.179 42.634 -1.350  1.00 27.81  ? 165  SER A CB    1 
ATOM   1338 O  OG    . SER A 1 165 ? 25.644 43.925 -1.085  1.00 24.15  ? 165  SER A OG    1 
ATOM   1339 N  N     . MET A 1 166 ? 26.410 39.958 -2.836  1.00 11.05  ? 166  MET A N     1 
ATOM   1340 C  CA    . MET A 1 166 ? 27.226 38.832 -3.150  1.00 11.66  ? 166  MET A CA    1 
ATOM   1341 C  C     . MET A 1 166 ? 27.347 38.673 -4.690  1.00 36.43  ? 166  MET A C     1 
ATOM   1342 O  O     . MET A 1 166 ? 28.389 38.475 -5.298  1.00 23.80  ? 166  MET A O     1 
ATOM   1343 C  CB    . MET A 1 166 ? 26.619 37.585 -2.534  1.00 15.88  ? 166  MET A CB    1 
ATOM   1344 C  CG    . MET A 1 166 ? 27.390 36.321 -2.810  1.00 6.54   ? 166  MET A CG    1 
ATOM   1345 S  SD    . MET A 1 166 ? 26.723 34.756 -2.373  1.00 21.56  ? 166  MET A SD    1 
ATOM   1346 C  CE    . MET A 1 166 ? 25.190 34.735 -3.420  1.00 17.85  ? 166  MET A CE    1 
ATOM   1347 N  N     . LEU A 1 167 ? 26.220 38.765 -5.338  1.00 23.40  ? 167  LEU A N     1 
ATOM   1348 C  CA    . LEU A 1 167 ? 26.140 38.576 -6.776  1.00 29.72  ? 167  LEU A CA    1 
ATOM   1349 C  C     . LEU A 1 167 ? 26.743 39.741 -7.503  1.00 21.41  ? 167  LEU A C     1 
ATOM   1350 O  O     . LEU A 1 167 ? 27.383 39.623 -8.544  1.00 31.06  ? 167  LEU A O     1 
ATOM   1351 C  CB    . LEU A 1 167 ? 24.652 38.449 -7.278  1.00 21.69  ? 167  LEU A CB    1 
ATOM   1352 C  CG    . LEU A 1 167 ? 23.771 37.306 -6.749  1.00 20.07  ? 167  LEU A CG    1 
ATOM   1353 C  CD1   . LEU A 1 167 ? 22.328 37.538 -7.175  1.00 43.96  ? 167  LEU A CD1   1 
ATOM   1354 C  CD2   . LEU A 1 167 ? 24.170 35.916 -7.167  1.00 21.61  ? 167  LEU A CD2   1 
ATOM   1355 N  N     . ASP A 1 168 ? 26.483 40.890 -6.942  1.00 22.58  ? 168  ASP A N     1 
ATOM   1356 C  CA    . ASP A 1 168 ? 26.948 42.066 -7.512  1.00 13.67  ? 168  ASP A CA    1 
ATOM   1357 C  C     . ASP A 1 168 ? 28.404 42.297 -7.348  1.00 42.84  ? 168  ASP A C     1 
ATOM   1358 O  O     . ASP A 1 168 ? 29.037 42.718 -8.298  1.00 33.12  ? 168  ASP A O     1 
ATOM   1359 C  CB    . ASP A 1 168 ? 26.218 43.387 -7.199  1.00 19.01  ? 168  ASP A CB    1 
ATOM   1360 C  CG    . ASP A 1 168 ? 24.725 43.319 -7.447  1.00 63.73  ? 168  ASP A CG    1 
ATOM   1361 O  OD1   . ASP A 1 168 ? 24.117 42.388 -7.970  1.00 40.27  ? 168  ASP A OD1   1 
ATOM   1362 O  OD2   . ASP A 1 168 ? 24.142 44.404 -7.048  1.00 30.04  ? 168  ASP A OD2   1 
ATOM   1363 N  N     . ASP A 1 169 ? 28.902 42.123 -6.155  1.00 25.04  ? 169  ASP A N     1 
ATOM   1364 C  CA    . ASP A 1 169 ? 30.280 42.421 -5.849  1.00 18.85  ? 169  ASP A CA    1 
ATOM   1365 C  C     . ASP A 1 169 ? 31.204 41.248 -5.971  1.00 13.10  ? 169  ASP A C     1 
ATOM   1366 O  O     . ASP A 1 169 ? 32.442 41.369 -5.898  1.00 23.25  ? 169  ASP A O     1 
ATOM   1367 C  CB    . ASP A 1 169 ? 30.337 42.917 -4.412  1.00 31.60  ? 169  ASP A CB    1 
ATOM   1368 C  CG    . ASP A 1 169 ? 29.638 44.217 -4.137  1.00 53.52  ? 169  ASP A CG    1 
ATOM   1369 O  OD1   . ASP A 1 169 ? 29.489 45.046 -5.145  1.00 27.27  ? 169  ASP A OD1   1 
ATOM   1370 O  OD2   . ASP A 1 169 ? 29.291 44.477 -3.025  1.00 25.09  ? 169  ASP A OD2   1 
ATOM   1371 N  N     . ARG A 1 170 ? 30.611 40.110 -6.115  1.00 11.64  ? 170  ARG A N     1 
ATOM   1372 C  CA    . ARG A 1 170 ? 31.345 38.880 -6.194  1.00 18.29  ? 170  ARG A CA    1 
ATOM   1373 C  C     . ARG A 1 170 ? 32.230 38.756 -5.001  1.00 34.32  ? 170  ARG A C     1 
ATOM   1374 O  O     . ARG A 1 170 ? 33.385 38.405 -5.118  1.00 21.42  ? 170  ARG A O     1 
ATOM   1375 C  CB    . ARG A 1 170 ? 32.174 38.665 -7.450  1.00 17.81  ? 170  ARG A CB    1 
ATOM   1376 C  CG    . ARG A 1 170 ? 31.602 39.445 -8.592  1.00 37.68  ? 170  ARG A CG    1 
ATOM   1377 C  CD    . ARG A 1 170 ? 30.274 38.863 -9.010  1.00 17.79  ? 170  ARG A CD    1 
ATOM   1378 N  NE    . ARG A 1 170 ? 30.422 37.440 -9.333  1.00 19.87  ? 170  ARG A NE    1 
ATOM   1379 C  CZ    . ARG A 1 170 ? 29.335 36.696 -9.610  1.00 21.08  ? 170  ARG A CZ    1 
ATOM   1380 N  NH1   . ARG A 1 170 ? 28.138 37.222 -9.499  1.00 32.06  ? 170  ARG A NH1   1 
ATOM   1381 N  NH2   . ARG A 1 170 ? 29.400 35.405 -10.004 1.00 24.39  ? 170  ARG A NH2   1 
ATOM   1382 N  N     . GLN A 1 171 ? 31.621 39.016 -3.858  1.00 26.86  ? 171  GLN A N     1 
ATOM   1383 C  CA    . GLN A 1 171 ? 32.246 39.014 -2.539  1.00 18.63  ? 171  GLN A CA    1 
ATOM   1384 C  C     . GLN A 1 171 ? 31.461 38.188 -1.556  1.00 23.79  ? 171  GLN A C     1 
ATOM   1385 O  O     . GLN A 1 171 ? 30.244 38.296 -1.568  1.00 20.24  ? 171  GLN A O     1 
ATOM   1386 C  CB    . GLN A 1 171 ? 32.211 40.488 -2.022  1.00 15.66  ? 171  GLN A CB    1 
ATOM   1387 C  CG    . GLN A 1 171 ? 32.910 40.539 -0.620  1.00 20.42  ? 171  GLN A CG    1 
ATOM   1388 C  CD    . GLN A 1 171 ? 33.204 41.921 -0.119  1.00 17.48  ? 171  GLN A CD    1 
ATOM   1389 O  OE1   . GLN A 1 171 ? 32.460 42.897 -0.385  1.00 28.99  ? 171  GLN A OE1   1 
ATOM   1390 N  NE2   . GLN A 1 171 ? 34.325 42.007 0.595   1.00 29.15  ? 171  GLN A NE2   1 
ATOM   1391 N  N     . ASN A 1 172 ? 32.092 37.353 -0.732  1.00 24.03  ? 172  ASN A N     1 
ATOM   1392 C  CA    . ASN A 1 172 ? 31.348 36.614 0.278   1.00 16.48  ? 172  ASN A CA    1 
ATOM   1393 C  C     . ASN A 1 172 ? 30.749 37.604 1.334   1.00 11.06  ? 172  ASN A C     1 
ATOM   1394 O  O     . ASN A 1 172 ? 31.179 38.749 1.528   1.00 16.89  ? 172  ASN A O     1 
ATOM   1395 C  CB    . ASN A 1 172 ? 32.267 35.605 0.927   1.00 15.14  ? 172  ASN A CB    1 
ATOM   1396 C  CG    . ASN A 1 172 ? 32.697 34.659 -0.108  1.00 27.25  ? 172  ASN A CG    1 
ATOM   1397 O  OD1   . ASN A 1 172 ? 31.896 34.277 -0.972  1.00 27.27  ? 172  ASN A OD1   1 
ATOM   1398 N  ND2   . ASN A 1 172 ? 33.954 34.281 0.009   1.00 26.27  ? 172  ASN A ND2   1 
ATOM   1399 N  N     . GLN A 1 173 ? 29.710 37.160 2.044   1.00 23.89  ? 173  GLN A N     1 
ATOM   1400 C  CA    . GLN A 1 173 ? 29.063 38.034 2.975   1.00 14.02  ? 173  GLN A CA    1 
ATOM   1401 C  C     . GLN A 1 173 ? 28.887 37.328 4.308   1.00 14.57  ? 173  GLN A C     1 
ATOM   1402 O  O     . GLN A 1 173 ? 28.866 36.083 4.358   1.00 14.35  ? 173  GLN A O     1 
ATOM   1403 C  CB    . GLN A 1 173 ? 27.630 38.409 2.486   1.00 24.36  ? 173  GLN A CB    1 
ATOM   1404 C  CG    . GLN A 1 173 ? 27.529 38.818 0.974   1.00 15.07  ? 173  GLN A CG    1 
ATOM   1405 C  CD    . GLN A 1 173 ? 27.901 40.260 0.734   1.00 13.74  ? 173  GLN A CD    1 
ATOM   1406 O  OE1   . GLN A 1 173 ? 27.472 41.207 1.428   1.00 22.16  ? 173  GLN A OE1   1 
ATOM   1407 N  NE2   . GLN A 1 173 ? 28.745 40.512 -0.259  1.00 16.72  ? 173  GLN A NE2   1 
ATOM   1408 N  N     . SER A 1 174 ? 28.610 38.165 5.318   1.00 18.75  ? 174  SER A N     1 
ATOM   1409 C  CA    . SER A 1 174 ? 28.332 37.616 6.640   1.00 23.66  ? 174  SER A CA    1 
ATOM   1410 C  C     . SER A 1 174 ? 27.161 38.378 7.353   1.00 11.65  ? 174  SER A C     1 
ATOM   1411 O  O     . SER A 1 174 ? 26.989 39.597 7.165   1.00 18.95  ? 174  SER A O     1 
ATOM   1412 C  CB    . SER A 1 174 ? 29.611 37.510 7.513   1.00 16.69  ? 174  SER A CB    1 
ATOM   1413 O  OG    . SER A 1 174 ? 30.202 38.769 7.757   1.00 14.53  ? 174  SER A OG    1 
ATOM   1414 N  N     . LEU A 1 175 ? 26.379 37.595 8.144   1.00 15.92  ? 175  LEU A N     1 
ATOM   1415 C  CA    . LEU A 1 175 ? 25.285 38.165 8.949   1.00 18.94  ? 175  LEU A CA    1 
ATOM   1416 C  C     . LEU A 1 175 ? 25.552 37.704 10.389  1.00 7.18   ? 175  LEU A C     1 
ATOM   1417 O  O     . LEU A 1 175 ? 25.653 36.495 10.599  1.00 17.89  ? 175  LEU A O     1 
ATOM   1418 C  CB    . LEU A 1 175 ? 23.824 37.820 8.521   1.00 21.98  ? 175  LEU A CB    1 
ATOM   1419 C  CG    . LEU A 1 175 ? 23.308 38.476 7.205   1.00 26.68  ? 175  LEU A CG    1 
ATOM   1420 C  CD1   . LEU A 1 175 ? 23.691 37.567 6.040   1.00 28.74  ? 175  LEU A CD1   1 
ATOM   1421 C  CD2   . LEU A 1 175 ? 21.803 38.496 7.200   1.00 24.70  ? 175  LEU A CD2   1 
ATOM   1422 N  N     . LEU A 1 176 ? 25.842 38.730 11.222  1.00 16.90  ? 176  LEU A N     1 
ATOM   1423 C  CA    . LEU A 1 176 ? 26.143 38.528 12.623  1.00 16.82  ? 176  LEU A CA    1 
ATOM   1424 C  C     . LEU A 1 176 ? 24.907 38.912 13.461  1.00 5.63   ? 176  LEU A C     1 
ATOM   1425 O  O     . LEU A 1 176 ? 24.620 40.149 13.606  1.00 15.93  ? 176  LEU A O     1 
ATOM   1426 C  CB    . LEU A 1 176 ? 27.291 39.431 12.997  1.00 13.48  ? 176  LEU A CB    1 
ATOM   1427 C  CG    . LEU A 1 176 ? 28.623 38.972 12.356  1.00 16.37  ? 176  LEU A CG    1 
ATOM   1428 C  CD1   . LEU A 1 176 ? 28.645 39.565 10.964  1.00 22.85  ? 176  LEU A CD1   1 
ATOM   1429 C  CD2   . LEU A 1 176 ? 29.748 39.718 13.067  1.00 28.39  ? 176  LEU A CD2   1 
ATOM   1430 N  N     . ILE A 1 177 ? 24.319 37.830 14.015  1.00 13.93  ? 177  ILE A N     1 
ATOM   1431 C  CA    . ILE A 1 177 ? 23.066 37.929 14.816  1.00 26.94  ? 177  ILE A CA    1 
ATOM   1432 C  C     . ILE A 1 177 ? 23.397 37.518 16.269  1.00 8.73   ? 177  ILE A C     1 
ATOM   1433 O  O     . ILE A 1 177 ? 23.659 36.303 16.574  1.00 13.94  ? 177  ILE A O     1 
ATOM   1434 C  CB    . ILE A 1 177 ? 21.944 37.057 14.197  1.00 26.16  ? 177  ILE A CB    1 
ATOM   1435 C  CG1   . ILE A 1 177 ? 21.842 37.298 12.666  1.00 20.43  ? 177  ILE A CG1   1 
ATOM   1436 C  CG2   . ILE A 1 177 ? 20.579 37.262 14.831  1.00 13.39  ? 177  ILE A CG2   1 
ATOM   1437 C  CD1   . ILE A 1 177 ? 20.945 36.268 11.983  1.00 12.77  ? 177  ILE A CD1   1 
ATOM   1438 N  N     . THR A 1 178 ? 23.481 38.578 17.062  1.00 18.46  ? 178  THR A N     1 
ATOM   1439 C  CA    . THR A 1 178 ? 23.863 38.441 18.462  1.00 43.53  ? 178  THR A CA    1 
ATOM   1440 C  C     . THR A 1 178 ? 22.841 39.111 19.365  1.00 34.38  ? 178  THR A C     1 
ATOM   1441 O  O     . THR A 1 178 ? 21.969 39.883 18.929  1.00 16.79  ? 178  THR A O     1 
ATOM   1442 C  CB    . THR A 1 178 ? 25.285 39.049 18.697  1.00 13.41  ? 178  THR A CB    1 
ATOM   1443 O  OG1   . THR A 1 178 ? 25.237 40.483 18.387  1.00 16.73  ? 178  THR A OG1   1 
ATOM   1444 C  CG2   . THR A 1 178 ? 26.321 38.263 17.851  1.00 21.40  ? 178  THR A CG2   1 
ATOM   1445 N  N     . GLY A 1 179 ? 22.996 38.810 20.655  1.00 26.15  ? 179  GLY A N     1 
ATOM   1446 C  CA    . GLY A 1 179 ? 22.139 39.390 21.673  1.00 17.01  ? 179  GLY A CA    1 
ATOM   1447 C  C     . GLY A 1 179 ? 21.894 38.366 22.718  1.00 16.66  ? 179  GLY A C     1 
ATOM   1448 O  O     . GLY A 1 179 ? 22.378 37.223 22.602  1.00 21.41  ? 179  GLY A O     1 
ATOM   1449 N  N     . GLU A 1 180 ? 21.116 38.770 23.731  1.00 20.32  ? 180  GLU A N     1 
ATOM   1450 C  CA    . GLU A 1 180 ? 20.898 37.807 24.804  1.00 16.44  ? 180  GLU A CA    1 
ATOM   1451 C  C     . GLU A 1 180 ? 19.989 36.645 24.617  1.00 15.46  ? 180  GLU A C     1 
ATOM   1452 O  O     . GLU A 1 180 ? 19.249 36.551 23.664  1.00 20.93  ? 180  GLU A O     1 
ATOM   1453 C  CB    . GLU A 1 180 ? 20.814 38.416 26.197  1.00 34.02  ? 180  GLU A CB    1 
ATOM   1454 C  CG    . GLU A 1 180 ? 19.761 39.481 26.354  1.00 27.23  ? 180  GLU A CG    1 
ATOM   1455 C  CD    . GLU A 1 180 ? 19.858 40.000 27.766  1.00 59.46  ? 180  GLU A CD    1 
ATOM   1456 O  OE1   . GLU A 1 180 ? 19.256 39.217 28.633  1.00 40.40  ? 180  GLU A OE1   1 
ATOM   1457 O  OE2   . GLU A 1 180 ? 20.469 41.011 28.067  1.00 41.63  ? 180  GLU A OE2   1 
ATOM   1458 N  N     . SER A 1 181 ? 20.026 35.734 25.599  1.00 18.91  ? 181  SER A N     1 
ATOM   1459 C  CA    . SER A 1 181 ? 19.204 34.541 25.590  1.00 19.36  ? 181  SER A CA    1 
ATOM   1460 C  C     . SER A 1 181 ? 17.746 34.947 25.455  1.00 19.72  ? 181  SER A C     1 
ATOM   1461 O  O     . SER A 1 181 ? 17.313 35.888 26.163  1.00 21.52  ? 181  SER A O     1 
ATOM   1462 C  CB    . SER A 1 181 ? 19.407 33.581 26.792  1.00 27.67  ? 181  SER A CB    1 
ATOM   1463 O  OG    . SER A 1 181 ? 18.760 32.344 26.447  1.00 23.76  ? 181  SER A OG    1 
ATOM   1464 N  N     . GLY A 1 182 ? 17.030 34.252 24.572  1.00 21.70  ? 182  GLY A N     1 
ATOM   1465 C  CA    . GLY A 1 182 ? 15.645 34.573 24.360  1.00 14.29  ? 182  GLY A CA    1 
ATOM   1466 C  C     . GLY A 1 182 ? 15.422 35.795 23.550  1.00 17.44  ? 182  GLY A C     1 
ATOM   1467 O  O     . GLY A 1 182 ? 14.260 36.125 23.245  1.00 23.97  ? 182  GLY A O     1 
ATOM   1468 N  N     . ALA A 1 183 ? 16.497 36.485 23.142  1.00 19.22  ? 183  ALA A N     1 
ATOM   1469 C  CA    . ALA A 1 183 ? 16.374 37.670 22.283  1.00 14.87  ? 183  ALA A CA    1 
ATOM   1470 C  C     . ALA A 1 183 ? 15.773 37.386 20.868  1.00 14.79  ? 183  ALA A C     1 
ATOM   1471 O  O     . ALA A 1 183 ? 15.237 38.345 20.297  1.00 26.62  ? 183  ALA A O     1 
ATOM   1472 C  CB    . ALA A 1 183 ? 17.609 38.583 22.200  1.00 19.28  ? 183  ALA A CB    1 
ATOM   1473 N  N     . GLY A 1 184 ? 15.865 36.155 20.324  1.00 25.46  ? 184  GLY A N     1 
ATOM   1474 C  CA    . GLY A 1 184 ? 15.337 35.779 19.011  1.00 21.58  ? 184  GLY A CA    1 
ATOM   1475 C  C     . GLY A 1 184 ? 16.398 35.583 17.931  1.00 26.19  ? 184  GLY A C     1 
ATOM   1476 O  O     . GLY A 1 184 ? 16.047 35.606 16.766  1.00 19.59  ? 184  GLY A O     1 
ATOM   1477 N  N     . LYS A 1 185 ? 17.666 35.392 18.284  1.00 15.13  ? 185  LYS A N     1 
ATOM   1478 C  CA    . LYS A 1 185 ? 18.781 35.148 17.348  1.00 11.72  ? 185  LYS A CA    1 
ATOM   1479 C  C     . LYS A 1 185 ? 18.529 33.992 16.436  1.00 23.16  ? 185  LYS A C     1 
ATOM   1480 O  O     . LYS A 1 185 ? 18.661 34.043 15.204  1.00 18.07  ? 185  LYS A O     1 
ATOM   1481 C  CB    . LYS A 1 185 ? 20.064 34.856 18.097  1.00 13.68  ? 185  LYS A CB    1 
ATOM   1482 C  CG    . LYS A 1 185 ? 20.521 36.075 18.913  1.00 11.00  ? 185  LYS A CG    1 
ATOM   1483 C  CD    . LYS A 1 185 ? 21.834 35.874 19.724  1.00 13.62  ? 185  LYS A CD    1 
ATOM   1484 C  CE    . LYS A 1 185 ? 21.834 34.703 20.708  1.00 15.60  ? 185  LYS A CE    1 
ATOM   1485 N  NZ    . LYS A 1 185 ? 20.807 34.907 21.779  1.00 14.83  ? 185  LYS A NZ    1 
ATOM   1486 N  N     . THR A 1 186 ? 18.125 32.935 17.053  1.00 15.56  ? 186  THR A N     1 
ATOM   1487 C  CA    . THR A 1 186 ? 17.842 31.695 16.371  1.00 10.21  ? 186  THR A CA    1 
ATOM   1488 C  C     . THR A 1 186 ? 16.687 31.800 15.402  1.00 31.57  ? 186  THR A C     1 
ATOM   1489 O  O     . THR A 1 186 ? 16.715 31.309 14.255  1.00 21.64  ? 186  THR A O     1 
ATOM   1490 C  CB    . THR A 1 186 ? 17.696 30.513 17.352  1.00 18.81  ? 186  THR A CB    1 
ATOM   1491 O  OG1   . THR A 1 186 ? 18.882 30.403 18.104  1.00 32.69  ? 186  THR A OG1   1 
ATOM   1492 C  CG2   . THR A 1 186 ? 17.499 29.208 16.616  1.00 19.44  ? 186  THR A CG2   1 
ATOM   1493 N  N     . GLU A 1 187 ? 15.631 32.406 15.883  1.00 18.16  ? 187  GLU A N     1 
ATOM   1494 C  CA    . GLU A 1 187 ? 14.453 32.643 15.047  1.00 27.05  ? 187  GLU A CA    1 
ATOM   1495 C  C     . GLU A 1 187 ? 14.894 33.408 13.764  1.00 21.47  ? 187  GLU A C     1 
ATOM   1496 O  O     . GLU A 1 187 ? 14.610 33.035 12.662  1.00 25.36  ? 187  GLU A O     1 
ATOM   1497 C  CB    . GLU A 1 187 ? 13.385 33.491 15.835  1.00 27.48  ? 187  GLU A CB    1 
ATOM   1498 C  CG    . GLU A 1 187 ? 12.555 32.666 16.847  1.00 29.75  ? 187  GLU A CG    1 
ATOM   1499 C  CD    . GLU A 1 187 ? 12.313 31.254 16.371  1.00 65.29  ? 187  GLU A CD    1 
ATOM   1500 O  OE1   . GLU A 1 187 ? 11.740 31.139 15.161  1.00 47.35  ? 187  GLU A OE1   1 
ATOM   1501 O  OE2   . GLU A 1 187 ? 12.631 30.297 17.050  1.00 71.73  ? 187  GLU A OE2   1 
ATOM   1502 N  N     . ASN A 1 188 ? 15.579 34.522 13.931  1.00 18.61  ? 188  ASN A N     1 
ATOM   1503 C  CA    . ASN A 1 188 ? 16.040 35.311 12.846  1.00 22.91  ? 188  ASN A CA    1 
ATOM   1504 C  C     . ASN A 1 188 ? 16.999 34.600 11.955  1.00 23.03  ? 188  ASN A C     1 
ATOM   1505 O  O     . ASN A 1 188 ? 16.962 34.770 10.744  1.00 18.03  ? 188  ASN A O     1 
ATOM   1506 C  CB    . ASN A 1 188 ? 16.543 36.632 13.309  1.00 12.35  ? 188  ASN A CB    1 
ATOM   1507 C  CG    . ASN A 1 188 ? 15.420 37.575 13.635  1.00 20.63  ? 188  ASN A CG    1 
ATOM   1508 O  OD1   . ASN A 1 188 ? 14.967 38.353 12.832  1.00 20.50  ? 188  ASN A OD1   1 
ATOM   1509 N  ND2   . ASN A 1 188 ? 15.004 37.583 14.860  1.00 25.62  ? 188  ASN A ND2   1 
ATOM   1510 N  N     . THR A 1 189 ? 17.775 33.718 12.540  1.00 17.73  ? 189  THR A N     1 
ATOM   1511 C  CA    . THR A 1 189 ? 18.721 32.942 11.767  1.00 19.20  ? 189  THR A CA    1 
ATOM   1512 C  C     . THR A 1 189 ? 17.994 32.009 10.819  1.00 26.85  ? 189  THR A C     1 
ATOM   1513 O  O     . THR A 1 189 ? 18.290 31.950 9.616   1.00 21.30  ? 189  THR A O     1 
ATOM   1514 C  CB    . THR A 1 189 ? 19.714 32.199 12.683  1.00 11.14  ? 189  THR A CB    1 
ATOM   1515 O  OG1   . THR A 1 189 ? 20.564 33.134 13.344  1.00 14.36  ? 189  THR A OG1   1 
ATOM   1516 C  CG2   . THR A 1 189 ? 20.380 31.103 11.909  1.00 14.00  ? 189  THR A CG2   1 
ATOM   1517 N  N     . LYS A 1 190 ? 16.968 31.350 11.364  1.00 21.08  ? 190  LYS A N     1 
ATOM   1518 C  CA    . LYS A 1 190 ? 16.160 30.452 10.556  1.00 19.77  ? 190  LYS A CA    1 
ATOM   1519 C  C     . LYS A 1 190 ? 15.457 31.207 9.426   1.00 17.56  ? 190  LYS A C     1 
ATOM   1520 O  O     . LYS A 1 190 ? 15.227 30.670 8.376   1.00 22.11  ? 190  LYS A O     1 
ATOM   1521 C  CB    . LYS A 1 190 ? 15.094 29.705 11.358  1.00 24.79  ? 190  LYS A CB    1 
ATOM   1522 C  CG    . LYS A 1 190 ? 15.581 28.578 12.293  1.00 36.82  ? 190  LYS A CG    1 
ATOM   1523 C  CD    . LYS A 1 190 ? 14.805 28.557 13.635  1.00 32.64  ? 190  LYS A CD    1 
ATOM   1524 C  CE    . LYS A 1 190 ? 14.029 27.308 14.056  1.00 88.41  ? 190  LYS A CE    1 
ATOM   1525 N  NZ    . LYS A 1 190 ? 13.586 27.377 15.475  1.00 40.74  ? 190  LYS A NZ    1 
ATOM   1526 N  N     . LYS A 1 191 ? 15.118 32.439 9.638   1.00 13.51  ? 191  LYS A N     1 
ATOM   1527 C  CA    . LYS A 1 191 ? 14.441 33.243 8.599   1.00 22.89  ? 191  LYS A CA    1 
ATOM   1528 C  C     . LYS A 1 191 ? 15.422 33.680 7.498   1.00 29.36  ? 191  LYS A C     1 
ATOM   1529 O  O     . LYS A 1 191 ? 15.093 33.882 6.349   1.00 16.78  ? 191  LYS A O     1 
ATOM   1530 C  CB    . LYS A 1 191 ? 13.794 34.494 9.190   1.00 28.41  ? 191  LYS A CB    1 
ATOM   1531 C  CG    . LYS A 1 191 ? 12.655 34.302 10.230  1.00 17.47  ? 191  LYS A CG    1 
ATOM   1532 C  CD    . LYS A 1 191 ? 11.440 33.449 9.857   1.00 15.19  ? 191  LYS A CD    1 
ATOM   1533 C  CE    . LYS A 1 191 ? 11.612 31.934 9.930   1.00 27.55  ? 191  LYS A CE    1 
ATOM   1534 N  NZ    . LYS A 1 191 ? 10.393 31.213 10.318  1.00 85.73  ? 191  LYS A NZ    1 
ATOM   1535 N  N     . VAL A 1 192 ? 16.642 33.929 7.873   1.00 21.98  ? 192  VAL A N     1 
ATOM   1536 C  CA    . VAL A 1 192 ? 17.653 34.269 6.891   1.00 19.35  ? 192  VAL A CA    1 
ATOM   1537 C  C     . VAL A 1 192 ? 17.835 33.046 5.959   1.00 26.71  ? 192  VAL A C     1 
ATOM   1538 O  O     . VAL A 1 192 ? 17.823 33.163 4.715   1.00 23.61  ? 192  VAL A O     1 
ATOM   1539 C  CB    . VAL A 1 192 ? 18.972 34.567 7.582   1.00 22.23  ? 192  VAL A CB    1 
ATOM   1540 C  CG1   . VAL A 1 192 ? 20.084 34.537 6.525   1.00 15.06  ? 192  VAL A CG1   1 
ATOM   1541 C  CG2   . VAL A 1 192 ? 18.916 35.922 8.244   1.00 8.55   ? 192  VAL A CG2   1 
ATOM   1542 N  N     . ILE A 1 193 ? 17.965 31.854 6.556   1.00 14.26  ? 193  ILE A N     1 
ATOM   1543 C  CA    . ILE A 1 193 ? 18.118 30.665 5.747   1.00 16.09  ? 193  ILE A CA    1 
ATOM   1544 C  C     . ILE A 1 193 ? 16.878 30.406 4.873   1.00 32.20  ? 193  ILE A C     1 
ATOM   1545 O  O     . ILE A 1 193 ? 16.965 29.902 3.781   1.00 24.57  ? 193  ILE A O     1 
ATOM   1546 C  CB    . ILE A 1 193 ? 18.333 29.506 6.661   1.00 24.84  ? 193  ILE A CB    1 
ATOM   1547 C  CG1   . ILE A 1 193 ? 19.298 29.868 7.750   1.00 28.54  ? 193  ILE A CG1   1 
ATOM   1548 C  CG2   . ILE A 1 193 ? 18.647 28.193 5.986   1.00 13.89  ? 193  ILE A CG2   1 
ATOM   1549 C  CD1   . ILE A 1 193 ? 20.699 29.450 7.442   1.00 23.62  ? 193  ILE A CD1   1 
ATOM   1550 N  N     . GLN A 1 194 ? 15.704 30.726 5.409   1.00 16.13  ? 194  GLN A N     1 
ATOM   1551 C  CA    . GLN A 1 194 ? 14.483 30.459 4.757   1.00 13.76  ? 194  GLN A CA    1 
ATOM   1552 C  C     . GLN A 1 194 ? 14.400 31.286 3.553   1.00 16.64  ? 194  GLN A C     1 
ATOM   1553 O  O     . GLN A 1 194 ? 13.964 30.873 2.471   1.00 23.78  ? 194  GLN A O     1 
ATOM   1554 C  CB    . GLN A 1 194 ? 13.307 30.893 5.641   1.00 22.31  ? 194  GLN A CB    1 
ATOM   1555 C  CG    . GLN A 1 194 ? 12.004 31.111 4.810   1.00 39.83  ? 194  GLN A CG    1 
ATOM   1556 C  CD    . GLN A 1 194 ? 10.813 31.752 5.532   1.00 38.67  ? 194  GLN A CD    1 
ATOM   1557 O  OE1   . GLN A 1 194 ? 10.851 31.955 6.742   1.00 36.16  ? 194  GLN A OE1   1 
ATOM   1558 N  NE2   . GLN A 1 194 ? 9.732  32.069 4.805   1.00 30.04  ? 194  GLN A NE2   1 
ATOM   1559 N  N     . TYR A 1 195 ? 14.772 32.477 3.797   1.00 17.68  ? 195  TYR A N     1 
ATOM   1560 C  CA    . TYR A 1 195 ? 14.755 33.423 2.738   1.00 15.78  ? 195  TYR A CA    1 
ATOM   1561 C  C     . TYR A 1 195 ? 15.748 33.058 1.629   1.00 46.08  ? 195  TYR A C     1 
ATOM   1562 O  O     . TYR A 1 195 ? 15.444 33.075 0.435   1.00 21.40  ? 195  TYR A O     1 
ATOM   1563 C  CB    . TYR A 1 195 ? 15.044 34.868 3.258   1.00 17.17  ? 195  TYR A CB    1 
ATOM   1564 C  CG    . TYR A 1 195 ? 14.893 35.981 2.184   1.00 26.36  ? 195  TYR A CG    1 
ATOM   1565 C  CD1   . TYR A 1 195 ? 13.640 36.558 1.949   1.00 20.93  ? 195  TYR A CD1   1 
ATOM   1566 C  CD2   . TYR A 1 195 ? 15.972 36.435 1.409   1.00 16.80  ? 195  TYR A CD2   1 
ATOM   1567 C  CE1   . TYR A 1 195 ? 13.451 37.577 1.010   1.00 20.34  ? 195  TYR A CE1   1 
ATOM   1568 C  CE2   . TYR A 1 195 ? 15.808 37.450 0.465   1.00 20.99  ? 195  TYR A CE2   1 
ATOM   1569 C  CZ    . TYR A 1 195 ? 14.537 37.993 0.239   1.00 26.09  ? 195  TYR A CZ    1 
ATOM   1570 O  OH    . TYR A 1 195 ? 14.390 38.998 -0.685  1.00 32.33  ? 195  TYR A OH    1 
ATOM   1571 N  N     . LEU A 1 196 ? 16.968 32.741 2.014   1.00 20.55  ? 196  LEU A N     1 
ATOM   1572 C  CA    . LEU A 1 196 ? 17.950 32.430 0.987   1.00 28.73  ? 196  LEU A CA    1 
ATOM   1573 C  C     . LEU A 1 196 ? 17.502 31.272 0.142   1.00 32.49  ? 196  LEU A C     1 
ATOM   1574 O  O     . LEU A 1 196 ? 17.641 31.250 -1.060  1.00 30.52  ? 196  LEU A O     1 
ATOM   1575 C  CB    . LEU A 1 196 ? 19.384 32.137 1.526   1.00 23.39  ? 196  LEU A CB    1 
ATOM   1576 C  CG    . LEU A 1 196 ? 20.083 33.371 2.091   1.00 27.94  ? 196  LEU A CG    1 
ATOM   1577 C  CD1   . LEU A 1 196 ? 21.383 32.910 2.698   1.00 30.08  ? 196  LEU A CD1   1 
ATOM   1578 C  CD2   . LEU A 1 196 ? 20.264 34.493 1.049   1.00 19.56  ? 196  LEU A CD2   1 
ATOM   1579 N  N     . ALA A 1 197 ? 17.013 30.289 0.834   1.00 25.40  ? 197  ALA A N     1 
ATOM   1580 C  CA    . ALA A 1 197 ? 16.559 29.059 0.232   1.00 26.40  ? 197  ALA A CA    1 
ATOM   1581 C  C     . ALA A 1 197 ? 15.517 29.296 -0.833  1.00 23.96  ? 197  ALA A C     1 
ATOM   1582 O  O     . ALA A 1 197 ? 15.372 28.534 -1.770  1.00 23.72  ? 197  ALA A O     1 
ATOM   1583 C  CB    . ALA A 1 197 ? 15.953 28.222 1.343   1.00 24.03  ? 197  ALA A CB    1 
ATOM   1584 N  N     . SER A 1 198 ? 14.745 30.340 -0.650  1.00 25.09  ? 198  SER A N     1 
ATOM   1585 C  CA    . SER A 1 198 ? 13.725 30.637 -1.585  1.00 29.99  ? 198  SER A CA    1 
ATOM   1586 C  C     . SER A 1 198 ? 14.260 31.547 -2.667  1.00 27.01  ? 198  SER A C     1 
ATOM   1587 O  O     . SER A 1 198 ? 14.024 31.351 -3.867  1.00 37.03  ? 198  SER A O     1 
ATOM   1588 C  CB    . SER A 1 198 ? 12.478 31.218 -0.919  1.00 24.28  ? 198  SER A CB    1 
ATOM   1589 O  OG    . SER A 1 198 ? 11.868 32.178 -1.777  1.00 38.50  ? 198  SER A OG    1 
ATOM   1590 N  N     . VAL A 1 199 ? 14.969 32.570 -2.303  1.00 25.10  ? 199  VAL A N     1 
ATOM   1591 C  CA    . VAL A 1 199 ? 15.416 33.386 -3.409  1.00 31.98  ? 199  VAL A CA    1 
ATOM   1592 C  C     . VAL A 1 199 ? 16.472 32.764 -4.309  1.00 37.02  ? 199  VAL A C     1 
ATOM   1593 O  O     . VAL A 1 199 ? 16.669 33.265 -5.407  1.00 40.14  ? 199  VAL A O     1 
ATOM   1594 C  CB    . VAL A 1 199 ? 15.896 34.765 -3.015  1.00 22.61  ? 199  VAL A CB    1 
ATOM   1595 C  CG1   . VAL A 1 199 ? 14.745 35.445 -2.344  1.00 36.27  ? 199  VAL A CG1   1 
ATOM   1596 C  CG2   . VAL A 1 199 ? 17.131 34.656 -2.124  1.00 26.48  ? 199  VAL A CG2   1 
ATOM   1597 N  N     . ALA A 1 200 ? 17.138 31.710 -3.851  1.00 19.49  ? 200  ALA A N     1 
ATOM   1598 C  CA    . ALA A 1 200 ? 18.261 31.146 -4.577  1.00 28.07  ? 200  ALA A CA    1 
ATOM   1599 C  C     . ALA A 1 200 ? 18.275 29.666 -4.696  1.00 38.32  ? 200  ALA A C     1 
ATOM   1600 O  O     . ALA A 1 200 ? 19.308 29.060 -4.981  1.00 36.04  ? 200  ALA A O     1 
ATOM   1601 C  CB    . ALA A 1 200 ? 19.515 31.503 -3.788  1.00 23.41  ? 200  ALA A CB    1 
ATOM   1602 N  N     . GLY A 1 201 ? 17.147 29.090 -4.371  1.00 32.78  ? 201  GLY A N     1 
ATOM   1603 C  CA    . GLY A 1 201 ? 17.062 27.646 -4.399  1.00 29.49  ? 201  GLY A CA    1 
ATOM   1604 C  C     . GLY A 1 201 ? 16.687 27.181 -5.790  1.00 100.00 ? 201  GLY A C     1 
ATOM   1605 O  O     . GLY A 1 201 ? 16.139 27.955 -6.625  1.00 40.31  ? 201  GLY A O     1 
ATOM   1606 N  N     . ARG A 1 202 ? 17.012 25.914 -6.021  1.00 69.01  ? 202  ARG A N     1 
ATOM   1607 C  CA    . ARG A 1 202 ? 16.705 25.337 -7.307  1.00 100.00 ? 202  ARG A CA    1 
ATOM   1608 C  C     . ARG A 1 202 ? 15.208 24.996 -7.483  1.00 100.00 ? 202  ARG A C     1 
ATOM   1609 O  O     . ARG A 1 202 ? 14.702 23.943 -7.072  1.00 58.23  ? 202  ARG A O     1 
ATOM   1610 C  CB    . ARG A 1 202 ? 17.858 24.597 -7.992  1.00 94.89  ? 202  ARG A CB    1 
ATOM   1611 C  CG    . ARG A 1 202 ? 19.180 25.285 -7.630  1.00 100.00 ? 202  ARG A CG    1 
ATOM   1612 C  CD    . ARG A 1 202 ? 20.272 25.283 -8.704  1.00 48.39  ? 202  ARG A CD    1 
ATOM   1613 N  NE    . ARG A 1 202 ? 21.414 24.376 -8.394  1.00 100.00 ? 202  ARG A NE    1 
ATOM   1614 C  CZ    . ARG A 1 202 ? 22.481 24.626 -7.571  1.00 100.00 ? 202  ARG A CZ    1 
ATOM   1615 N  NH1   . ARG A 1 202 ? 22.618 25.786 -6.911  1.00 100.00 ? 202  ARG A NH1   1 
ATOM   1616 N  NH2   . ARG A 1 202 ? 23.462 23.701 -7.400  1.00 54.31  ? 202  ARG A NH2   1 
ATOM   1617 N  N     . ASN A 1 203 ? 14.500 26.025 -7.998  1.00 63.07  ? 203  ASN A N     1 
ATOM   1618 C  CA    . ASN A 1 203 ? 13.048 26.103 -8.216  1.00 100.00 ? 203  ASN A CA    1 
ATOM   1619 C  C     . ASN A 1 203 ? 12.387 24.864 -8.834  1.00 100.00 ? 203  ASN A C     1 
ATOM   1620 O  O     . ASN A 1 203 ? 11.287 24.453 -8.428  1.00 100.00 ? 203  ASN A O     1 
ATOM   1621 C  CB    . ASN A 1 203 ? 12.619 27.408 -8.893  1.00 53.32  ? 203  ASN A CB    1 
ATOM   1622 N  N     . GLY A 1 209 ? 13.079 21.398 -3.512  1.00 100.00 ? 209  GLY A N     1 
ATOM   1623 C  CA    . GLY A 1 209 ? 14.494 21.116 -3.643  1.00 84.29  ? 209  GLY A CA    1 
ATOM   1624 C  C     . GLY A 1 209 ? 14.979 20.137 -2.583  1.00 52.15  ? 209  GLY A C     1 
ATOM   1625 O  O     . GLY A 1 209 ? 14.641 20.223 -1.401  1.00 77.26  ? 209  GLY A O     1 
ATOM   1626 N  N     . VAL A 1 210 ? 15.799 19.209 -3.026  1.00 36.61  ? 210  VAL A N     1 
ATOM   1627 C  CA    . VAL A 1 210 ? 16.346 18.188 -2.167  1.00 32.38  ? 210  VAL A CA    1 
ATOM   1628 C  C     . VAL A 1 210 ? 17.419 18.706 -1.199  1.00 77.70  ? 210  VAL A C     1 
ATOM   1629 O  O     . VAL A 1 210 ? 17.364 18.488 0.020   1.00 43.06  ? 210  VAL A O     1 
ATOM   1630 C  CB    . VAL A 1 210 ? 16.907 17.131 -3.068  1.00 30.35  ? 210  VAL A CB    1 
ATOM   1631 C  CG1   . VAL A 1 210 ? 17.149 15.827 -2.299  1.00 52.76  ? 210  VAL A CG1   1 
ATOM   1632 C  CG2   . VAL A 1 210 ? 15.962 16.951 -4.253  1.00 100.00 ? 210  VAL A CG2   1 
ATOM   1633 N  N     . LEU A 1 211 ? 18.416 19.374 -1.768  1.00 37.38  ? 211  LEU A N     1 
ATOM   1634 C  CA    . LEU A 1 211 ? 19.495 19.953 -1.005  1.00 46.64  ? 211  LEU A CA    1 
ATOM   1635 C  C     . LEU A 1 211 ? 18.900 21.010 -0.105  1.00 27.72  ? 211  LEU A C     1 
ATOM   1636 O  O     . LEU A 1 211 ? 19.087 20.964 1.095   1.00 50.51  ? 211  LEU A O     1 
ATOM   1637 C  CB    . LEU A 1 211 ? 20.539 20.542 -1.950  1.00 50.40  ? 211  LEU A CB    1 
ATOM   1638 C  CG    . LEU A 1 211 ? 21.696 21.212 -1.272  1.00 29.60  ? 211  LEU A CG    1 
ATOM   1639 C  CD1   . LEU A 1 211 ? 22.617 20.190 -0.611  1.00 26.88  ? 211  LEU A CD1   1 
ATOM   1640 C  CD2   . LEU A 1 211 ? 22.460 22.012 -2.299  1.00 27.75  ? 211  LEU A CD2   1 
ATOM   1641 N  N     . GLU A 1 212 ? 18.112 21.905 -0.711  1.00 29.81  ? 212  GLU A N     1 
ATOM   1642 C  CA    . GLU A 1 212 ? 17.414 22.917 0.051   1.00 30.73  ? 212  GLU A CA    1 
ATOM   1643 C  C     . GLU A 1 212 ? 16.664 22.281 1.240   1.00 47.40  ? 212  GLU A C     1 
ATOM   1644 O  O     . GLU A 1 212 ? 16.611 22.780 2.361   1.00 39.58  ? 212  GLU A O     1 
ATOM   1645 C  CB    . GLU A 1 212 ? 16.551 23.840 -0.828  1.00 33.36  ? 212  GLU A CB    1 
ATOM   1646 C  CG    . GLU A 1 212 ? 17.398 24.711 -1.817  1.00 61.27  ? 212  GLU A CG    1 
ATOM   1647 C  CD    . GLU A 1 212 ? 17.793 24.073 -3.158  1.00 100.00 ? 212  GLU A CD    1 
ATOM   1648 O  OE1   . GLU A 1 212 ? 17.697 22.869 -3.386  1.00 48.61  ? 212  GLU A OE1   1 
ATOM   1649 O  OE2   . GLU A 1 212 ? 18.285 24.938 -4.069  1.00 55.18  ? 212  GLU A OE2   1 
ATOM   1650 N  N     . GLN A 1 213 ? 16.151 21.104 1.023   1.00 30.22  ? 213  GLN A N     1 
ATOM   1651 C  CA    . GLN A 1 213 ? 15.443 20.440 2.068   1.00 30.23  ? 213  GLN A CA    1 
ATOM   1652 C  C     . GLN A 1 213 ? 16.354 19.937 3.133   1.00 25.25  ? 213  GLN A C     1 
ATOM   1653 O  O     . GLN A 1 213 ? 16.070 19.960 4.315   1.00 38.31  ? 213  GLN A O     1 
ATOM   1654 C  CB    . GLN A 1 213 ? 14.729 19.247 1.470   1.00 42.96  ? 213  GLN A CB    1 
ATOM   1655 C  CG    . GLN A 1 213 ? 13.302 19.597 1.071   1.00 47.38  ? 213  GLN A CG    1 
ATOM   1656 C  CD    . GLN A 1 213 ? 12.442 19.929 2.274   1.00 100.00 ? 213  GLN A CD    1 
ATOM   1657 O  OE1   . GLN A 1 213 ? 11.856 19.019 2.878   1.00 100.00 ? 213  GLN A OE1   1 
ATOM   1658 N  NE2   . GLN A 1 213 ? 12.367 21.216 2.634   1.00 100.00 ? 213  GLN A NE2   1 
ATOM   1659 N  N     . GLN A 1 214 ? 17.428 19.368 2.703   1.00 29.24  ? 214  GLN A N     1 
ATOM   1660 C  CA    . GLN A 1 214 ? 18.329 18.846 3.693   1.00 33.02  ? 214  GLN A CA    1 
ATOM   1661 C  C     . GLN A 1 214 ? 18.968 19.959 4.490   1.00 28.60  ? 214  GLN A C     1 
ATOM   1662 O  O     . GLN A 1 214 ? 19.255 19.840 5.661   1.00 37.16  ? 214  GLN A O     1 
ATOM   1663 C  CB    . GLN A 1 214 ? 19.392 17.985 3.074   1.00 29.63  ? 214  GLN A CB    1 
ATOM   1664 C  CG    . GLN A 1 214 ? 18.877 17.057 1.931   1.00 42.78  ? 214  GLN A CG    1 
ATOM   1665 C  CD    . GLN A 1 214 ? 20.028 16.544 1.055   1.00 37.00  ? 214  GLN A CD    1 
ATOM   1666 O  OE1   . GLN A 1 214 ? 20.636 17.291 0.248   1.00 64.90  ? 214  GLN A OE1   1 
ATOM   1667 N  NE2   . GLN A 1 214 ? 20.376 15.268 1.238   1.00 46.47  ? 214  GLN A NE2   1 
ATOM   1668 N  N     . ILE A 1 215 ? 19.150 21.066 3.860   1.00 30.68  ? 215  ILE A N     1 
ATOM   1669 C  CA    . ILE A 1 215 ? 19.722 22.188 4.533   1.00 32.44  ? 215  ILE A CA    1 
ATOM   1670 C  C     . ILE A 1 215 ? 18.798 22.605 5.658   1.00 74.19  ? 215  ILE A C     1 
ATOM   1671 O  O     . ILE A 1 215 ? 19.178 22.808 6.835   1.00 37.39  ? 215  ILE A O     1 
ATOM   1672 C  CB    . ILE A 1 215 ? 20.011 23.306 3.508   1.00 38.77  ? 215  ILE A CB    1 
ATOM   1673 C  CG1   . ILE A 1 215 ? 21.268 22.926 2.681   1.00 28.61  ? 215  ILE A CG1   1 
ATOM   1674 C  CG2   . ILE A 1 215 ? 20.172 24.677 4.179   1.00 31.76  ? 215  ILE A CG2   1 
ATOM   1675 C  CD1   . ILE A 1 215 ? 21.621 23.831 1.506   1.00 26.01  ? 215  ILE A CD1   1 
ATOM   1676 N  N     . LEU A 1 216 ? 17.540 22.697 5.276   1.00 34.35  ? 216  LEU A N     1 
ATOM   1677 C  CA    . LEU A 1 216 ? 16.555 23.088 6.232   1.00 29.30  ? 216  LEU A CA    1 
ATOM   1678 C  C     . LEU A 1 216 ? 16.396 22.117 7.350   1.00 27.01  ? 216  LEU A C     1 
ATOM   1679 O  O     . LEU A 1 216 ? 16.207 22.519 8.487   1.00 48.68  ? 216  LEU A O     1 
ATOM   1680 C  CB    . LEU A 1 216 ? 15.197 23.442 5.608   1.00 26.30  ? 216  LEU A CB    1 
ATOM   1681 C  CG    . LEU A 1 216 ? 15.350 24.577 4.627   1.00 37.73  ? 216  LEU A CG    1 
ATOM   1682 C  CD1   . LEU A 1 216 ? 14.157 24.655 3.701   1.00 59.60  ? 216  LEU A CD1   1 
ATOM   1683 C  CD2   . LEU A 1 216 ? 15.501 25.884 5.367   1.00 33.79  ? 216  LEU A CD2   1 
ATOM   1684 N  N     . GLN A 1 217 ? 16.449 20.859 7.024   1.00 24.80  ? 217  GLN A N     1 
ATOM   1685 C  CA    . GLN A 1 217 ? 16.241 19.870 8.025   1.00 27.13  ? 217  GLN A CA    1 
ATOM   1686 C  C     . GLN A 1 217 ? 17.411 19.720 8.944   1.00 29.95  ? 217  GLN A C     1 
ATOM   1687 O  O     . GLN A 1 217 ? 17.354 18.938 9.860   1.00 32.65  ? 217  GLN A O     1 
ATOM   1688 C  CB    . GLN A 1 217 ? 15.883 18.509 7.405   1.00 26.95  ? 217  GLN A CB    1 
ATOM   1689 C  CG    . GLN A 1 217 ? 14.653 18.665 6.528   1.00 25.15  ? 217  GLN A CG    1 
ATOM   1690 C  CD    . GLN A 1 217 ? 13.461 19.118 7.328   1.00 59.97  ? 217  GLN A CD    1 
ATOM   1691 O  OE1   . GLN A 1 217 ? 13.053 18.433 8.301   1.00 43.12  ? 217  GLN A OE1   1 
ATOM   1692 N  NE2   . GLN A 1 217 ? 12.880 20.263 6.909   1.00 73.98  ? 217  GLN A NE2   1 
ATOM   1693 N  N     . ALA A 1 218 ? 18.487 20.416 8.675   1.00 31.00  ? 218  ALA A N     1 
ATOM   1694 C  CA    . ALA A 1 218 ? 19.597 20.221 9.552   1.00 36.74  ? 218  ALA A CA    1 
ATOM   1695 C  C     . ALA A 1 218 ? 19.378 20.877 10.902  1.00 35.86  ? 218  ALA A C     1 
ATOM   1696 O  O     . ALA A 1 218 ? 19.742 20.279 11.912  1.00 28.98  ? 218  ALA A O     1 
ATOM   1697 C  CB    . ALA A 1 218 ? 20.870 20.698 8.899   1.00 29.10  ? 218  ALA A CB    1 
ATOM   1698 N  N     . ASN A 1 219 ? 18.767 22.090 10.902  1.00 28.90  ? 219  ASN A N     1 
ATOM   1699 C  CA    . ASN A 1 219 ? 18.526 22.787 12.148  1.00 62.19  ? 219  ASN A CA    1 
ATOM   1700 C  C     . ASN A 1 219 ? 17.838 21.974 13.189  1.00 49.18  ? 219  ASN A C     1 
ATOM   1701 O  O     . ASN A 1 219 ? 18.326 21.735 14.269  1.00 39.84  ? 219  ASN A O     1 
ATOM   1702 C  CB    . ASN A 1 219 ? 17.934 24.192 12.073  1.00 41.63  ? 219  ASN A CB    1 
ATOM   1703 C  CG    . ASN A 1 219 ? 19.116 25.178 12.078  1.00 100.00 ? 219  ASN A CG    1 
ATOM   1704 O  OD1   . ASN A 1 219 ? 19.068 26.222 12.751  1.00 100.00 ? 219  ASN A OD1   1 
ATOM   1705 N  ND2   . ASN A 1 219 ? 20.204 24.850 11.337  1.00 65.40  ? 219  ASN A ND2   1 
ATOM   1706 N  N     . PRO A 1 220 ? 16.690 21.592 12.830  1.00 32.90  ? 220  PRO A N     1 
ATOM   1707 C  CA    . PRO A 1 220 ? 15.824 20.766 13.602  1.00 31.70  ? 220  PRO A CA    1 
ATOM   1708 C  C     . PRO A 1 220 ? 16.545 19.670 14.315  1.00 41.94  ? 220  PRO A C     1 
ATOM   1709 O  O     . PRO A 1 220 ? 16.181 19.329 15.429  1.00 39.63  ? 220  PRO A O     1 
ATOM   1710 C  CB    . PRO A 1 220 ? 14.948 20.080 12.561  1.00 44.72  ? 220  PRO A CB    1 
ATOM   1711 C  CG    . PRO A 1 220 ? 15.305 20.672 11.216  1.00 40.18  ? 220  PRO A CG    1 
ATOM   1712 C  CD    . PRO A 1 220 ? 16.223 21.848 11.472  1.00 54.39  ? 220  PRO A CD    1 
ATOM   1713 N  N     . ILE A 1 221 ? 17.529 19.070 13.640  1.00 27.99  ? 221  ILE A N     1 
ATOM   1714 C  CA    . ILE A 1 221 ? 18.304 17.993 14.194  1.00 23.65  ? 221  ILE A CA    1 
ATOM   1715 C  C     . ILE A 1 221 ? 19.262 18.539 15.275  1.00 32.10  ? 221  ILE A C     1 
ATOM   1716 O  O     . ILE A 1 221 ? 19.460 17.957 16.317  1.00 26.64  ? 221  ILE A O     1 
ATOM   1717 C  CB    . ILE A 1 221 ? 19.190 17.354 13.127  1.00 41.78  ? 221  ILE A CB    1 
ATOM   1718 C  CG1   . ILE A 1 221 ? 18.366 16.648 12.037  1.00 34.90  ? 221  ILE A CG1   1 
ATOM   1719 C  CG2   . ILE A 1 221 ? 20.171 16.372 13.805  1.00 26.70  ? 221  ILE A CG2   1 
ATOM   1720 C  CD1   . ILE A 1 221 ? 19.207 15.919 10.963  1.00 19.76  ? 221  ILE A CD1   1 
ATOM   1721 N  N     . LEU A 1 222 ? 19.891 19.647 14.972  1.00 23.20  ? 222  LEU A N     1 
ATOM   1722 C  CA    . LEU A 1 222 ? 20.805 20.249 15.876  1.00 29.47  ? 222  LEU A CA    1 
ATOM   1723 C  C     . LEU A 1 222 ? 20.084 20.776 17.116  1.00 53.56  ? 222  LEU A C     1 
ATOM   1724 O  O     . LEU A 1 222 ? 20.582 20.799 18.234  1.00 27.12  ? 222  LEU A O     1 
ATOM   1725 C  CB    . LEU A 1 222 ? 21.522 21.391 15.132  1.00 27.02  ? 222  LEU A CB    1 
ATOM   1726 C  CG    . LEU A 1 222 ? 22.534 20.770 14.167  1.00 24.16  ? 222  LEU A CG    1 
ATOM   1727 C  CD1   . LEU A 1 222 ? 23.485 21.831 13.689  1.00 37.21  ? 222  LEU A CD1   1 
ATOM   1728 C  CD2   . LEU A 1 222 ? 23.326 19.629 14.817  1.00 24.03  ? 222  LEU A CD2   1 
ATOM   1729 N  N     . GLU A 1 223 ? 18.880 21.245 16.917  1.00 25.32  ? 223  GLU A N     1 
ATOM   1730 C  CA    . GLU A 1 223 ? 18.132 21.817 18.009  1.00 18.20  ? 223  GLU A CA    1 
ATOM   1731 C  C     . GLU A 1 223 ? 17.681 20.816 19.030  1.00 25.88  ? 223  GLU A C     1 
ATOM   1732 O  O     . GLU A 1 223 ? 17.394 21.143 20.184  1.00 34.97  ? 223  GLU A O     1 
ATOM   1733 C  CB    . GLU A 1 223 ? 16.962 22.612 17.524  1.00 19.99  ? 223  GLU A CB    1 
ATOM   1734 C  CG    . GLU A 1 223 ? 17.494 23.889 16.891  1.00 30.48  ? 223  GLU A CG    1 
ATOM   1735 C  CD    . GLU A 1 223 ? 16.482 25.006 16.796  1.00 32.18  ? 223  GLU A CD    1 
ATOM   1736 O  OE1   . GLU A 1 223 ? 15.268 24.880 16.959  1.00 36.68  ? 223  GLU A OE1   1 
ATOM   1737 O  OE2   . GLU A 1 223 ? 17.086 26.130 16.532  1.00 65.69  ? 223  GLU A OE2   1 
ATOM   1738 N  N     . ALA A 1 224 ? 17.566 19.584 18.586  1.00 21.43  ? 224  ALA A N     1 
ATOM   1739 C  CA    . ALA A 1 224 ? 17.093 18.532 19.457  1.00 23.56  ? 224  ALA A CA    1 
ATOM   1740 C  C     . ALA A 1 224 ? 18.177 18.102 20.397  1.00 40.17  ? 224  ALA A C     1 
ATOM   1741 O  O     . ALA A 1 224 ? 17.941 17.708 21.548  1.00 26.55  ? 224  ALA A O     1 
ATOM   1742 C  CB    . ALA A 1 224 ? 16.651 17.316 18.639  1.00 26.32  ? 224  ALA A CB    1 
ATOM   1743 N  N     . PHE A 1 225 ? 19.392 18.129 19.866  1.00 28.72  ? 225  PHE A N     1 
ATOM   1744 C  CA    . PHE A 1 225 ? 20.507 17.727 20.658  1.00 28.53  ? 225  PHE A CA    1 
ATOM   1745 C  C     . PHE A 1 225 ? 21.199 18.899 21.312  1.00 22.56  ? 225  PHE A C     1 
ATOM   1746 O  O     . PHE A 1 225 ? 21.962 18.666 22.229  1.00 25.55  ? 225  PHE A O     1 
ATOM   1747 C  CB    . PHE A 1 225 ? 21.522 16.990 19.807  1.00 21.30  ? 225  PHE A CB    1 
ATOM   1748 C  CG    . PHE A 1 225 ? 21.032 15.685 19.361  1.00 22.27  ? 225  PHE A CG    1 
ATOM   1749 C  CD1   . PHE A 1 225 ? 20.108 15.557 18.324  1.00 24.15  ? 225  PHE A CD1   1 
ATOM   1750 C  CD2   . PHE A 1 225 ? 21.530 14.536 19.974  1.00 30.54  ? 225  PHE A CD2   1 
ATOM   1751 C  CE1   . PHE A 1 225 ? 19.660 14.293 17.925  1.00 25.28  ? 225  PHE A CE1   1 
ATOM   1752 C  CE2   . PHE A 1 225 ? 21.101 13.267 19.573  1.00 50.93  ? 225  PHE A CE2   1 
ATOM   1753 C  CZ    . PHE A 1 225 ? 20.151 13.145 18.553  1.00 25.69  ? 225  PHE A CZ    1 
ATOM   1754 N  N     . GLY A 1 226 ? 21.002 20.137 20.834  1.00 25.27  ? 226  GLY A N     1 
ATOM   1755 C  CA    . GLY A 1 226 ? 21.752 21.270 21.396  1.00 13.48  ? 226  GLY A CA    1 
ATOM   1756 C  C     . GLY A 1 226 ? 20.938 22.336 21.979  1.00 14.52  ? 226  GLY A C     1 
ATOM   1757 O  O     . GLY A 1 226 ? 21.454 23.357 22.380  1.00 20.79  ? 226  GLY A O     1 
ATOM   1758 N  N     . ASN A 1 227 ? 19.605 22.124 22.026  1.00 21.27  ? 227  ASN A N     1 
ATOM   1759 C  CA    . ASN A 1 227 ? 18.768 23.182 22.593  1.00 18.68  ? 227  ASN A CA    1 
ATOM   1760 C  C     . ASN A 1 227 ? 18.044 22.598 23.788  1.00 19.97  ? 227  ASN A C     1 
ATOM   1761 O  O     . ASN A 1 227 ? 17.845 21.378 23.802  1.00 20.60  ? 227  ASN A O     1 
ATOM   1762 C  CB    . ASN A 1 227 ? 17.685 23.728 21.606  1.00 26.36  ? 227  ASN A CB    1 
ATOM   1763 C  CG    . ASN A 1 227 ? 18.197 24.698 20.586  1.00 31.66  ? 227  ASN A CG    1 
ATOM   1764 O  OD1   . ASN A 1 227 ? 19.355 24.570 20.094  1.00 23.27  ? 227  ASN A OD1   1 
ATOM   1765 N  ND2   . ASN A 1 227 ? 17.330 25.658 20.266  1.00 24.10  ? 227  ASN A ND2   1 
ATOM   1766 N  N     . ALA A 1 228 ? 17.665 23.495 24.732  1.00 33.05  ? 228  ALA A N     1 
ATOM   1767 C  CA    . ALA A 1 228 ? 16.988 23.114 25.939  1.00 31.50  ? 228  ALA A CA    1 
ATOM   1768 C  C     . ALA A 1 228 ? 16.208 24.224 26.518  1.00 23.45  ? 228  ALA A C     1 
ATOM   1769 O  O     . ALA A 1 228 ? 16.380 25.395 26.195  1.00 20.22  ? 228  ALA A O     1 
ATOM   1770 C  CB    . ALA A 1 228 ? 17.984 22.663 27.001  1.00 17.51  ? 228  ALA A CB    1 
ATOM   1771 N  N     . LYS A 1 229 ? 15.321 23.801 27.404  1.00 20.70  ? 229  LYS A N     1 
ATOM   1772 C  CA    . LYS A 1 229 ? 14.526 24.743 28.131  1.00 20.61  ? 229  LYS A CA    1 
ATOM   1773 C  C     . LYS A 1 229 ? 15.333 25.326 29.305  1.00 21.63  ? 229  LYS A C     1 
ATOM   1774 O  O     . LYS A 1 229 ? 15.808 24.628 30.134  1.00 25.65  ? 229  LYS A O     1 
ATOM   1775 C  CB    . LYS A 1 229 ? 13.176 24.173 28.654  1.00 25.54  ? 229  LYS A CB    1 
ATOM   1776 C  CG    . LYS A 1 229 ? 12.455 25.230 29.479  1.00 25.99  ? 229  LYS A CG    1 
ATOM   1777 C  CD    . LYS A 1 229 ? 11.612 24.634 30.587  1.00 24.46  ? 229  LYS A CD    1 
ATOM   1778 C  CE    . LYS A 1 229 ? 10.932 25.714 31.412  1.00 51.69  ? 229  LYS A CE    1 
ATOM   1779 N  NZ    . LYS A 1 229 ? 10.267 25.161 32.607  1.00 45.17  ? 229  LYS A NZ    1 
ATOM   1780 N  N     . THR A 1 230 ? 15.506 26.618 29.344  1.00 16.26  ? 230  THR A N     1 
ATOM   1781 C  CA    . THR A 1 230 ? 16.135 27.190 30.458  1.00 25.50  ? 230  THR A CA    1 
ATOM   1782 C  C     . THR A 1 230 ? 15.097 28.164 31.047  1.00 17.95  ? 230  THR A C     1 
ATOM   1783 O  O     . THR A 1 230 ? 13.943 28.300 30.543  1.00 28.20  ? 230  THR A O     1 
ATOM   1784 C  CB    . THR A 1 230 ? 17.374 27.948 30.023  1.00 28.09  ? 230  THR A CB    1 
ATOM   1785 O  OG1   . THR A 1 230 ? 16.955 29.131 29.422  1.00 22.25  ? 230  THR A OG1   1 
ATOM   1786 C  CG2   . THR A 1 230 ? 18.204 27.123 29.058  1.00 17.09  ? 230  THR A CG2   1 
ATOM   1787 N  N     . THR A 1 231 ? 15.509 28.909 32.066  1.00 19.83  ? 231  THR A N     1 
ATOM   1788 C  CA    . THR A 1 231 ? 14.605 29.891 32.635  1.00 15.59  ? 231  THR A CA    1 
ATOM   1789 C  C     . THR A 1 231 ? 14.371 31.130 31.754  1.00 29.99  ? 231  THR A C     1 
ATOM   1790 O  O     . THR A 1 231 ? 13.420 31.853 31.961  1.00 38.60  ? 231  THR A O     1 
ATOM   1791 C  CB    . THR A 1 231 ? 15.109 30.357 34.026  1.00 29.91  ? 231  THR A CB    1 
ATOM   1792 O  OG1   . THR A 1 231 ? 16.421 30.914 33.910  1.00 32.25  ? 231  THR A OG1   1 
ATOM   1793 C  CG2   . THR A 1 231 ? 15.077 29.175 35.032  1.00 27.25  ? 231  THR A CG2   1 
ATOM   1794 N  N     . ARG A 1 232 ? 15.293 31.448 30.836  1.00 29.36  ? 232  ARG A N     1 
ATOM   1795 C  CA    . ARG A 1 232 ? 15.191 32.588 29.929  1.00 22.85  ? 232  ARG A CA    1 
ATOM   1796 C  C     . ARG A 1 232 ? 14.520 32.279 28.545  1.00 23.53  ? 232  ARG A C     1 
ATOM   1797 O  O     . ARG A 1 232 ? 14.179 33.217 27.794  1.00 25.13  ? 232  ARG A O     1 
ATOM   1798 C  CB    . ARG A 1 232 ? 16.610 33.087 29.652  1.00 16.58  ? 232  ARG A CB    1 
ATOM   1799 C  CG    . ARG A 1 232 ? 17.166 33.465 30.988  1.00 30.44  ? 232  ARG A CG    1 
ATOM   1800 C  CD    . ARG A 1 232 ? 18.650 33.783 30.981  1.00 45.83  ? 232  ARG A CD    1 
ATOM   1801 N  NE    . ARG A 1 232 ? 18.997 34.413 32.233  1.00 100.00 ? 232  ARG A NE    1 
ATOM   1802 C  CZ    . ARG A 1 232 ? 18.516 35.607 32.590  1.00 100.00 ? 232  ARG A CZ    1 
ATOM   1803 N  NH1   . ARG A 1 232 ? 17.678 36.301 31.807  1.00 100.00 ? 232  ARG A NH1   1 
ATOM   1804 N  NH2   . ARG A 1 232 ? 18.870 36.120 33.782  1.00 100.00 ? 232  ARG A NH2   1 
ATOM   1805 N  N     . ASN A 1 233 ? 14.395 30.981 28.231  1.00 23.75  ? 233  ASN A N     1 
ATOM   1806 C  CA    . ASN A 1 233 ? 13.966 30.538 26.963  1.00 18.39  ? 233  ASN A CA    1 
ATOM   1807 C  C     . ASN A 1 233 ? 13.621 29.095 26.959  1.00 16.25  ? 233  ASN A C     1 
ATOM   1808 O  O     . ASN A 1 233 ? 14.421 28.196 27.252  1.00 26.07  ? 233  ASN A O     1 
ATOM   1809 C  CB    . ASN A 1 233 ? 15.164 30.837 25.922  1.00 19.67  ? 233  ASN A CB    1 
ATOM   1810 C  CG    . ASN A 1 233 ? 14.926 30.598 24.433  1.00 23.96  ? 233  ASN A CG    1 
ATOM   1811 O  OD1   . ASN A 1 233 ? 13.822 30.167 23.996  1.00 22.23  ? 233  ASN A OD1   1 
ATOM   1812 N  ND2   . ASN A 1 233 ? 15.962 30.888 23.631  1.00 20.85  ? 233  ASN A ND2   1 
ATOM   1813 N  N     . ASN A 1 234 ? 12.398 28.852 26.477  1.00 20.27  ? 234  ASN A N     1 
ATOM   1814 C  CA    . ASN A 1 234 ? 11.954 27.495 26.308  1.00 28.61  ? 234  ASN A CA    1 
ATOM   1815 C  C     . ASN A 1 234 ? 12.719 26.686 25.277  1.00 22.63  ? 234  ASN A C     1 
ATOM   1816 O  O     . ASN A 1 234 ? 12.697 25.429 25.247  1.00 24.14  ? 234  ASN A O     1 
ATOM   1817 C  CB    . ASN A 1 234 ? 10.483 27.494 25.931  1.00 35.63  ? 234  ASN A CB    1 
ATOM   1818 C  CG    . ASN A 1 234 ? 9.646  28.036 27.064  1.00 83.42  ? 234  ASN A CG    1 
ATOM   1819 O  OD1   . ASN A 1 234 ? 8.506  28.381 26.849  1.00 59.81  ? 234  ASN A OD1   1 
ATOM   1820 N  ND2   . ASN A 1 234 ? 10.186 28.122 28.268  1.00 30.97  ? 234  ASN A ND2   1 
ATOM   1821 N  N     . ASN A 1 235 ? 13.353 27.389 24.376  1.00 25.88  ? 235  ASN A N     1 
ATOM   1822 C  CA    . ASN A 1 235 ? 14.105 26.657 23.371  1.00 21.82  ? 235  ASN A CA    1 
ATOM   1823 C  C     . ASN A 1 235 ? 15.462 27.287 23.201  1.00 40.81  ? 235  ASN A C     1 
ATOM   1824 O  O     . ASN A 1 235 ? 15.832 27.749 22.133  1.00 26.03  ? 235  ASN A O     1 
ATOM   1825 C  CB    . ASN A 1 235 ? 13.299 26.464 22.070  1.00 27.38  ? 235  ASN A CB    1 
ATOM   1826 C  CG    . ASN A 1 235 ? 14.074 25.807 20.925  1.00 28.27  ? 235  ASN A CG    1 
ATOM   1827 O  OD1   . ASN A 1 235 ? 14.530 24.678 21.022  1.00 24.74  ? 235  ASN A OD1   1 
ATOM   1828 N  ND2   . ASN A 1 235 ? 14.229 26.546 19.819  1.00 35.35  ? 235  ASN A ND2   1 
ATOM   1829 N  N     . SER A 1 236 ? 16.219 27.310 24.293  1.00 25.88  ? 236  SER A N     1 
ATOM   1830 C  CA    . SER A 1 236 ? 17.517 27.946 24.268  1.00 21.00  ? 236  SER A CA    1 
ATOM   1831 C  C     . SER A 1 236 ? 18.576 27.155 23.526  1.00 13.35  ? 236  SER A C     1 
ATOM   1832 O  O     . SER A 1 236 ? 18.671 25.920 23.668  1.00 22.98  ? 236  SER A O     1 
ATOM   1833 C  CB    . SER A 1 236 ? 17.942 28.109 25.687  1.00 28.79  ? 236  SER A CB    1 
ATOM   1834 O  OG    . SER A 1 236 ? 19.137 28.818 25.706  1.00 24.60  ? 236  SER A OG    1 
ATOM   1835 N  N     . SER A 1 237 ? 19.392 27.854 22.723  1.00 23.25  ? 237  SER A N     1 
ATOM   1836 C  CA    . SER A 1 237 ? 20.495 27.178 22.039  1.00 14.33  ? 237  SER A CA    1 
ATOM   1837 C  C     . SER A 1 237 ? 21.621 27.083 23.064  1.00 13.01  ? 237  SER A C     1 
ATOM   1838 O  O     . SER A 1 237 ? 22.066 28.124 23.508  1.00 17.23  ? 237  SER A O     1 
ATOM   1839 C  CB    . SER A 1 237 ? 21.070 28.032 20.877  1.00 21.03  ? 237  SER A CB    1 
ATOM   1840 O  OG    . SER A 1 237 ? 20.060 28.701 20.059  1.00 21.69  ? 237  SER A OG    1 
ATOM   1841 N  N     . ARG A 1 238 ? 22.042 25.891 23.423  1.00 14.24  ? 238  ARG A N     1 
ATOM   1842 C  CA    . ARG A 1 238 ? 23.174 25.742 24.347  1.00 15.69  ? 238  ARG A CA    1 
ATOM   1843 C  C     . ARG A 1 238 ? 24.486 25.493 23.564  1.00 18.68  ? 238  ARG A C     1 
ATOM   1844 O  O     . ARG A 1 238 ? 25.395 24.801 24.020  1.00 19.41  ? 238  ARG A O     1 
ATOM   1845 C  CB    . ARG A 1 238 ? 22.994 24.619 25.376  1.00 12.30  ? 238  ARG A CB    1 
ATOM   1846 C  CG    . ARG A 1 238 ? 21.575 24.640 25.849  1.00 20.22  ? 238  ARG A CG    1 
ATOM   1847 C  CD    . ARG A 1 238 ? 21.646 25.356 27.112  1.00 42.11  ? 238  ARG A CD    1 
ATOM   1848 N  NE    . ARG A 1 238 ? 21.523 26.730 26.905  1.00 32.21  ? 238  ARG A NE    1 
ATOM   1849 C  CZ    . ARG A 1 238 ? 22.114 27.646 27.670  1.00 27.38  ? 238  ARG A CZ    1 
ATOM   1850 N  NH1   . ARG A 1 238 ? 22.931 27.396 28.701  1.00 32.19  ? 238  ARG A NH1   1 
ATOM   1851 N  NH2   . ARG A 1 238 ? 21.835 28.902 27.385  1.00 30.24  ? 238  ARG A NH2   1 
ATOM   1852 N  N     . PHE A 1 239 ? 24.575 26.082 22.361  1.00 24.43  ? 239  PHE A N     1 
ATOM   1853 C  CA    . PHE A 1 239 ? 25.776 26.023 21.554  1.00 18.97  ? 239  PHE A CA    1 
ATOM   1854 C  C     . PHE A 1 239 ? 25.725 27.228 20.635  1.00 15.90  ? 239  PHE A C     1 
ATOM   1855 O  O     . PHE A 1 239 ? 24.654 27.788 20.423  1.00 16.37  ? 239  PHE A O     1 
ATOM   1856 C  CB    . PHE A 1 239 ? 26.000 24.665 20.811  1.00 23.04  ? 239  PHE A CB    1 
ATOM   1857 C  CG    . PHE A 1 239 ? 24.918 24.416 19.747  1.00 23.25  ? 239  PHE A CG    1 
ATOM   1858 C  CD1   . PHE A 1 239 ? 23.611 24.073 20.117  1.00 14.78  ? 239  PHE A CD1   1 
ATOM   1859 C  CD2   . PHE A 1 239 ? 25.195 24.605 18.389  1.00 18.68  ? 239  PHE A CD2   1 
ATOM   1860 C  CE1   . PHE A 1 239 ? 22.618 23.876 19.144  1.00 24.99  ? 239  PHE A CE1   1 
ATOM   1861 C  CE2   . PHE A 1 239 ? 24.213 24.486 17.392  1.00 18.08  ? 239  PHE A CE2   1 
ATOM   1862 C  CZ    . PHE A 1 239 ? 22.928 24.085 17.789  1.00 25.83  ? 239  PHE A CZ    1 
ATOM   1863 N  N     . GLY A 1 240 ? 26.876 27.646 20.115  1.00 15.83  ? 240  GLY A N     1 
ATOM   1864 C  CA    . GLY A 1 240 ? 26.942 28.747 19.155  1.00 11.99  ? 240  GLY A CA    1 
ATOM   1865 C  C     . GLY A 1 240 ? 27.173 28.094 17.792  1.00 9.24   ? 240  GLY A C     1 
ATOM   1866 O  O     . GLY A 1 240 ? 27.654 26.914 17.684  1.00 14.00  ? 240  GLY A O     1 
ATOM   1867 N  N     . LYS A 1 241 ? 26.779 28.876 16.763  1.00 17.11  ? 241  LYS A N     1 
ATOM   1868 C  CA    . LYS A 1 241 ? 26.972 28.287 15.445  1.00 28.65  ? 241  LYS A CA    1 
ATOM   1869 C  C     . LYS A 1 241 ? 27.246 29.315 14.374  1.00 15.16  ? 241  LYS A C     1 
ATOM   1870 O  O     . LYS A 1 241 ? 26.911 30.517 14.457  1.00 16.15  ? 241  LYS A O     1 
ATOM   1871 C  CB    . LYS A 1 241 ? 25.819 27.378 15.028  1.00 21.58  ? 241  LYS A CB    1 
ATOM   1872 C  CG    . LYS A 1 241 ? 24.668 28.256 14.531  1.00 25.45  ? 241  LYS A CG    1 
ATOM   1873 C  CD    . LYS A 1 241 ? 23.382 27.503 14.243  1.00 31.13  ? 241  LYS A CD    1 
ATOM   1874 C  CE    . LYS A 1 241 ? 22.125 28.367 14.427  1.00 100.00 ? 241  LYS A CE    1 
ATOM   1875 N  NZ    . LYS A 1 241 ? 21.512 28.366 15.769  1.00 37.23  ? 241  LYS A NZ    1 
ATOM   1876 N  N     . PHE A 1 242 ? 27.954 28.796 13.359  1.00 23.53  ? 242  PHE A N     1 
ATOM   1877 C  CA    . PHE A 1 242 ? 28.259 29.616 12.195  1.00 22.72  ? 242  PHE A CA    1 
ATOM   1878 C  C     . PHE A 1 242 ? 27.878 28.790 10.997  1.00 23.21  ? 242  PHE A C     1 
ATOM   1879 O  O     . PHE A 1 242 ? 28.384 27.661 10.833  1.00 27.05  ? 242  PHE A O     1 
ATOM   1880 C  CB    . PHE A 1 242 ? 29.708 29.972 12.136  1.00 15.94  ? 242  PHE A CB    1 
ATOM   1881 C  CG    . PHE A 1 242 ? 29.961 30.872 10.984  1.00 13.64  ? 242  PHE A CG    1 
ATOM   1882 C  CD1   . PHE A 1 242 ? 29.544 32.186 10.976  1.00 14.44  ? 242  PHE A CD1   1 
ATOM   1883 C  CD2   . PHE A 1 242 ? 30.724 30.387 9.927   1.00 19.09  ? 242  PHE A CD2   1 
ATOM   1884 C  CE1   . PHE A 1 242 ? 29.844 33.035 9.915   1.00 23.88  ? 242  PHE A CE1   1 
ATOM   1885 C  CE2   . PHE A 1 242 ? 31.045 31.216 8.862   1.00 19.69  ? 242  PHE A CE2   1 
ATOM   1886 C  CZ    . PHE A 1 242 ? 30.612 32.536 8.866   1.00 15.58  ? 242  PHE A CZ    1 
ATOM   1887 N  N     . ILE A 1 243 ? 26.856 29.292 10.280  1.00 21.21  ? 243  ILE A N     1 
ATOM   1888 C  CA    . ILE A 1 243 ? 26.343 28.554 9.111   1.00 22.89  ? 243  ILE A CA    1 
ATOM   1889 C  C     . ILE A 1 243 ? 26.820 29.165 7.809   1.00 31.63  ? 243  ILE A C     1 
ATOM   1890 O  O     . ILE A 1 243 ? 26.594 30.349 7.533   1.00 30.02  ? 243  ILE A O     1 
ATOM   1891 C  CB    . ILE A 1 243 ? 24.821 28.573 9.035   1.00 33.69  ? 243  ILE A CB    1 
ATOM   1892 C  CG1   . ILE A 1 243 ? 24.367 28.060 10.376  1.00 31.07  ? 243  ILE A CG1   1 
ATOM   1893 C  CG2   . ILE A 1 243 ? 24.325 27.601 7.932   1.00 24.10  ? 243  ILE A CG2   1 
ATOM   1894 C  CD1   . ILE A 1 243 ? 23.058 27.302 10.334  1.00 44.47  ? 243  ILE A CD1   1 
ATOM   1895 N  N     . GLU A 1 244 ? 27.443 28.306 7.013   1.00 18.43  ? 244  GLU A N     1 
ATOM   1896 C  CA    . GLU A 1 244 ? 27.861 28.798 5.764   1.00 21.18  ? 244  GLU A CA    1 
ATOM   1897 C  C     . GLU A 1 244 ? 26.921 28.289 4.654   1.00 11.79  ? 244  GLU A C     1 
ATOM   1898 O  O     . GLU A 1 244 ? 26.792 27.090 4.464   1.00 19.89  ? 244  GLU A O     1 
ATOM   1899 C  CB    . GLU A 1 244 ? 29.243 28.295 5.569   1.00 26.78  ? 244  GLU A CB    1 
ATOM   1900 C  CG    . GLU A 1 244 ? 29.859 29.057 4.430   1.00 76.25  ? 244  GLU A CG    1 
ATOM   1901 C  CD    . GLU A 1 244 ? 31.186 28.470 4.220   1.00 56.66  ? 244  GLU A CD    1 
ATOM   1902 O  OE1   . GLU A 1 244 ? 32.136 28.757 4.941   1.00 46.38  ? 244  GLU A OE1   1 
ATOM   1903 O  OE2   . GLU A 1 244 ? 31.185 27.583 3.263   1.00 29.52  ? 244  GLU A OE2   1 
ATOM   1904 N  N     . ILE A 1 245 ? 26.200 29.231 4.052   1.00 20.00  ? 245  ILE A N     1 
ATOM   1905 C  CA    . ILE A 1 245 ? 25.319 28.942 2.921   1.00 34.16  ? 245  ILE A CA    1 
ATOM   1906 C  C     . ILE A 1 245 ? 26.151 29.182 1.659   1.00 18.50  ? 245  ILE A C     1 
ATOM   1907 O  O     . ILE A 1 245 ? 26.550 30.354 1.433   1.00 19.59  ? 245  ILE A O     1 
ATOM   1908 C  CB    . ILE A 1 245 ? 24.098 29.839 2.781   1.00 22.17  ? 245  ILE A CB    1 
ATOM   1909 C  CG1   . ILE A 1 245 ? 23.223 29.851 4.075   1.00 16.90  ? 245  ILE A CG1   1 
ATOM   1910 C  CG2   . ILE A 1 245 ? 23.302 29.126 1.681   1.00 18.35  ? 245  ILE A CG2   1 
ATOM   1911 C  CD1   . ILE A 1 245 ? 22.853 28.405 4.479   1.00 19.51  ? 245  ILE A CD1   1 
ATOM   1912 N  N     . GLN A 1 246 ? 26.440 28.064 0.933   1.00 23.88  ? 246  GLN A N     1 
ATOM   1913 C  CA    . GLN A 1 246 ? 27.278 27.995 -0.297  1.00 18.16  ? 246  GLN A CA    1 
ATOM   1914 C  C     . GLN A 1 246 ? 26.478 28.217 -1.571  1.00 21.08  ? 246  GLN A C     1 
ATOM   1915 O  O     . GLN A 1 246 ? 25.335 27.716 -1.697  1.00 25.61  ? 246  GLN A O     1 
ATOM   1916 C  CB    . GLN A 1 246 ? 27.984 26.631 -0.311  1.00 16.93  ? 246  GLN A CB    1 
ATOM   1917 C  CG    . GLN A 1 246 ? 28.939 26.587 0.935   1.00 20.29  ? 246  GLN A CG    1 
ATOM   1918 C  CD    . GLN A 1 246 ? 29.558 25.256 1.192   1.00 23.94  ? 246  GLN A CD    1 
ATOM   1919 O  OE1   . GLN A 1 246 ? 29.254 24.254 0.548   1.00 29.55  ? 246  GLN A OE1   1 
ATOM   1920 N  NE2   . GLN A 1 246 ? 30.470 25.232 2.154   1.00 42.77  ? 246  GLN A NE2   1 
ATOM   1921 N  N     . PHE A 1 247 ? 27.014 29.026 -2.488  1.00 29.08  ? 247  PHE A N     1 
ATOM   1922 C  CA    . PHE A 1 247 ? 26.297 29.312 -3.757  1.00 21.03  ? 247  PHE A CA    1 
ATOM   1923 C  C     . PHE A 1 247 ? 27.211 29.074 -4.934  1.00 31.29  ? 247  PHE A C     1 
ATOM   1924 O  O     . PHE A 1 247 ? 28.413 29.212 -4.808  1.00 19.86  ? 247  PHE A O     1 
ATOM   1925 C  CB    . PHE A 1 247 ? 25.974 30.788 -3.826  1.00 16.18  ? 247  PHE A CB    1 
ATOM   1926 C  CG    . PHE A 1 247 ? 25.044 31.145 -2.699  1.00 47.18  ? 247  PHE A CG    1 
ATOM   1927 C  CD1   . PHE A 1 247 ? 25.517 31.528 -1.435  1.00 19.76  ? 247  PHE A CD1   1 
ATOM   1928 C  CD2   . PHE A 1 247 ? 23.668 31.118 -2.916  1.00 23.49  ? 247  PHE A CD2   1 
ATOM   1929 C  CE1   . PHE A 1 247 ? 24.638 31.905 -0.422  1.00 13.75  ? 247  PHE A CE1   1 
ATOM   1930 C  CE2   . PHE A 1 247 ? 22.771 31.489 -1.911  1.00 25.01  ? 247  PHE A CE2   1 
ATOM   1931 C  CZ    . PHE A 1 247 ? 23.261 31.858 -0.657  1.00 20.11  ? 247  PHE A CZ    1 
ATOM   1932 N  N     . ASN A 1 248 ? 26.677 28.781 -6.104  1.00 27.59  ? 248  ASN A N     1 
ATOM   1933 C  CA    . ASN A 1 248 ? 27.570 28.652 -7.258  1.00 17.31  ? 248  ASN A CA    1 
ATOM   1934 C  C     . ASN A 1 248 ? 27.680 29.995 -7.933  1.00 28.80  ? 248  ASN A C     1 
ATOM   1935 O  O     . ASN A 1 248 ? 27.088 30.957 -7.495  1.00 21.69  ? 248  ASN A O     1 
ATOM   1936 C  CB    . ASN A 1 248 ? 27.113 27.534 -8.181  1.00 22.54  ? 248  ASN A CB    1 
ATOM   1937 C  CG    . ASN A 1 248 ? 25.701 27.815 -8.676  1.00 20.93  ? 248  ASN A CG    1 
ATOM   1938 O  OD1   . ASN A 1 248 ? 25.202 28.968 -8.697  1.00 20.84  ? 248  ASN A OD1   1 
ATOM   1939 N  ND2   . ASN A 1 248 ? 25.091 26.754 -9.098  1.00 28.05  ? 248  ASN A ND2   1 
ATOM   1940 N  N     . ASN A 1 249 ? 28.491 30.138 -8.955  1.00 30.61  ? 249  ASN A N     1 
ATOM   1941 C  CA    . ASN A 1 249 ? 28.769 31.431 -9.623  1.00 24.75  ? 249  ASN A CA    1 
ATOM   1942 C  C     . ASN A 1 249 ? 27.522 32.101 -10.132 1.00 14.29  ? 249  ASN A C     1 
ATOM   1943 O  O     . ASN A 1 249 ? 27.474 33.325 -10.356 1.00 22.50  ? 249  ASN A O     1 
ATOM   1944 C  CB    . ASN A 1 249 ? 29.614 31.020 -10.841 1.00 18.28  ? 249  ASN A CB    1 
ATOM   1945 C  CG    . ASN A 1 249 ? 29.316 29.509 -10.885 1.00 100.00 ? 249  ASN A CG    1 
ATOM   1946 O  OD1   . ASN A 1 249 ? 28.239 29.049 -11.432 1.00 55.74  ? 249  ASN A OD1   1 
ATOM   1947 N  ND2   . ASN A 1 249 ? 30.198 28.725 -10.208 1.00 43.73  ? 249  ASN A ND2   1 
ATOM   1948 N  N     . ALA A 1 250 ? 26.530 31.288 -10.334 1.00 23.33  ? 250  ALA A N     1 
ATOM   1949 C  CA    . ALA A 1 250 ? 25.263 31.798 -10.848 1.00 33.13  ? 250  ALA A CA    1 
ATOM   1950 C  C     . ALA A 1 250 ? 24.316 32.303 -9.783  1.00 31.25  ? 250  ALA A C     1 
ATOM   1951 O  O     . ALA A 1 250 ? 23.297 32.898 -10.087 1.00 30.65  ? 250  ALA A O     1 
ATOM   1952 C  CB    . ALA A 1 250 ? 24.570 30.721 -11.682 1.00 38.86  ? 250  ALA A CB    1 
ATOM   1953 N  N     . GLY A 1 251 ? 24.644 32.011 -8.534  1.00 46.69  ? 251  GLY A N     1 
ATOM   1954 C  CA    . GLY A 1 251 ? 23.817 32.462 -7.431  1.00 30.92  ? 251  GLY A CA    1 
ATOM   1955 C  C     . GLY A 1 251 ? 22.849 31.411 -6.910  1.00 18.15  ? 251  GLY A C     1 
ATOM   1956 O  O     . GLY A 1 251 ? 21.913 31.752 -6.173  1.00 28.71  ? 251  GLY A O     1 
ATOM   1957 N  N     . PHE A 1 252 ? 23.044 30.147 -7.232  1.00 15.75  ? 252  PHE A N     1 
ATOM   1958 C  CA    . PHE A 1 252 ? 22.155 29.178 -6.685  1.00 21.10  ? 252  PHE A CA    1 
ATOM   1959 C  C     . PHE A 1 252 ? 22.840 28.509 -5.571  1.00 34.89  ? 252  PHE A C     1 
ATOM   1960 O  O     . PHE A 1 252 ? 24.056 28.420 -5.594  1.00 26.24  ? 252  PHE A O     1 
ATOM   1961 C  CB    . PHE A 1 252 ? 21.679 28.139 -7.726  1.00 38.59  ? 252  PHE A CB    1 
ATOM   1962 C  CG    . PHE A 1 252 ? 20.894 28.868 -8.760  1.00 61.11  ? 252  PHE A CG    1 
ATOM   1963 C  CD1   . PHE A 1 252 ? 19.816 29.658 -8.360  1.00 56.54  ? 252  PHE A CD1   1 
ATOM   1964 C  CD2   . PHE A 1 252 ? 21.277 28.867 -10.099 1.00 48.99  ? 252  PHE A CD2   1 
ATOM   1965 C  CE1   . PHE A 1 252 ? 19.096 30.434 -9.261  1.00 61.19  ? 252  PHE A CE1   1 
ATOM   1966 C  CE2   . PHE A 1 252 ? 20.557 29.624 -11.019 1.00 100.00 ? 252  PHE A CE2   1 
ATOM   1967 C  CZ    . PHE A 1 252 ? 19.477 30.402 -10.602 1.00 100.00 ? 252  PHE A CZ    1 
ATOM   1968 N  N     . ILE A 1 253 ? 22.025 28.076 -4.614  1.00 30.36  ? 253  ILE A N     1 
ATOM   1969 C  CA    . ILE A 1 253 ? 22.529 27.408 -3.422  1.00 26.12  ? 253  ILE A CA    1 
ATOM   1970 C  C     . ILE A 1 253 ? 23.190 26.175 -3.835  1.00 33.56  ? 253  ILE A C     1 
ATOM   1971 O  O     . ILE A 1 253 ? 22.567 25.358 -4.488  1.00 29.65  ? 253  ILE A O     1 
ATOM   1972 C  CB    . ILE A 1 253 ? 21.417 27.042 -2.432  1.00 39.15  ? 253  ILE A CB    1 
ATOM   1973 C  CG1   . ILE A 1 253 ? 20.903 28.327 -1.803  1.00 35.30  ? 253  ILE A CG1   1 
ATOM   1974 C  CG2   . ILE A 1 253 ? 21.984 26.147 -1.342  1.00 24.71  ? 253  ILE A CG2   1 
ATOM   1975 C  CD1   . ILE A 1 253 ? 19.948 28.130 -0.628  1.00 40.81  ? 253  ILE A CD1   1 
ATOM   1976 N  N     . SER A 1 254 ? 24.413 26.004 -3.413  1.00 24.56  ? 254  SER A N     1 
ATOM   1977 C  CA    . SER A 1 254 ? 25.147 24.828 -3.806  1.00 24.10  ? 254  SER A CA    1 
ATOM   1978 C  C     . SER A 1 254 ? 25.477 23.877 -2.679  1.00 24.53  ? 254  SER A C     1 
ATOM   1979 O  O     . SER A 1 254 ? 25.860 22.735 -2.916  1.00 24.11  ? 254  SER A O     1 
ATOM   1980 C  CB    . SER A 1 254 ? 26.457 25.211 -4.522  1.00 29.18  ? 254  SER A CB    1 
ATOM   1981 O  OG    . SER A 1 254 ? 27.085 26.330 -3.936  1.00 29.60  ? 254  SER A OG    1 
ATOM   1982 N  N     . GLY A 1 255 ? 25.397 24.346 -1.454  1.00 21.68  ? 255  GLY A N     1 
ATOM   1983 C  CA    . GLY A 1 255 ? 25.736 23.454 -0.352  1.00 20.80  ? 255  GLY A CA    1 
ATOM   1984 C  C     . GLY A 1 255 ? 25.629 24.249 0.962   1.00 21.44  ? 255  GLY A C     1 
ATOM   1985 O  O     . GLY A 1 255 ? 25.065 25.364 1.007   1.00 23.65  ? 255  GLY A O     1 
ATOM   1986 N  N     . ALA A 1 256 ? 26.255 23.687 1.998   1.00 27.34  ? 256  ALA A N     1 
ATOM   1987 C  CA    . ALA A 1 256 ? 26.377 24.350 3.289   1.00 28.75  ? 256  ALA A CA    1 
ATOM   1988 C  C     . ALA A 1 256 ? 27.280 23.598 4.226   1.00 14.64  ? 256  ALA A C     1 
ATOM   1989 O  O     . ALA A 1 256 ? 27.567 22.408 4.092   1.00 19.00  ? 256  ALA A O     1 
ATOM   1990 C  CB    . ALA A 1 256 ? 25.030 24.571 3.966   1.00 36.05  ? 256  ALA A CB    1 
ATOM   1991 N  N     . SER A 1 257 ? 27.743 24.360 5.203   1.00 25.61  ? 257  SER A N     1 
ATOM   1992 C  CA    . SER A 1 257 ? 28.541 23.809 6.282   1.00 25.78  ? 257  SER A CA    1 
ATOM   1993 C  C     . SER A 1 257 ? 28.188 24.566 7.559   1.00 18.11  ? 257  SER A C     1 
ATOM   1994 O  O     . SER A 1 257 ? 27.868 25.795 7.569   1.00 20.86  ? 257  SER A O     1 
ATOM   1995 C  CB    . SER A 1 257 ? 30.050 23.811 6.118   1.00 17.13  ? 257  SER A CB    1 
ATOM   1996 O  OG    . SER A 1 257 ? 30.339 25.163 5.982   1.00 49.18  ? 257  SER A OG    1 
ATOM   1997 N  N     . ILE A 1 258 ? 28.291 23.792 8.648   1.00 25.34  ? 258  ILE A N     1 
ATOM   1998 C  CA    . ILE A 1 258 ? 28.029 24.331 9.958   1.00 20.16  ? 258  ILE A CA    1 
ATOM   1999 C  C     . ILE A 1 258 ? 29.170 24.145 10.878  1.00 11.78  ? 258  ILE A C     1 
ATOM   2000 O  O     . ILE A 1 258 ? 29.664 23.035 11.006  1.00 19.79  ? 258  ILE A O     1 
ATOM   2001 C  CB    . ILE A 1 258 ? 26.821 23.641 10.601  1.00 44.45  ? 258  ILE A CB    1 
ATOM   2002 C  CG1   . ILE A 1 258 ? 25.565 23.922 9.793   1.00 29.24  ? 258  ILE A CG1   1 
ATOM   2003 C  CG2   . ILE A 1 258 ? 26.599 24.055 12.046  1.00 23.51  ? 258  ILE A CG2   1 
ATOM   2004 C  CD1   . ILE A 1 258 ? 24.723 22.684 9.755   1.00 23.13  ? 258  ILE A CD1   1 
ATOM   2005 N  N     . GLN A 1 259 ? 29.436 25.210 11.605  1.00 21.42  ? 259  GLN A N     1 
ATOM   2006 C  CA    . GLN A 1 259 ? 30.395 25.093 12.653  1.00 22.95  ? 259  GLN A CA    1 
ATOM   2007 C  C     . GLN A 1 259 ? 29.675 25.359 14.011  1.00 16.61  ? 259  GLN A C     1 
ATOM   2008 O  O     . GLN A 1 259 ? 29.011 26.375 14.113  1.00 18.11  ? 259  GLN A O     1 
ATOM   2009 C  CB    . GLN A 1 259 ? 31.618 26.012 12.460  1.00 18.75  ? 259  GLN A CB    1 
ATOM   2010 C  CG    . GLN A 1 259 ? 32.536 26.036 13.739  1.00 100.00 ? 259  GLN A CG    1 
ATOM   2011 C  CD    . GLN A 1 259 ? 33.637 24.958 13.998  1.00 50.78  ? 259  GLN A CD    1 
ATOM   2012 O  OE1   . GLN A 1 259 ? 34.016 24.644 15.174  1.00 51.86  ? 259  GLN A OE1   1 
ATOM   2013 N  NE2   . GLN A 1 259 ? 34.200 24.422 12.932  1.00 90.51  ? 259  GLN A NE2   1 
ATOM   2014 N  N     . SER A 1 260 ? 29.815 24.419 15.006  1.00 24.85  ? 260  SER A N     1 
ATOM   2015 C  CA    . SER A 1 260 ? 29.276 24.538 16.372  1.00 22.37  ? 260  SER A CA    1 
ATOM   2016 C  C     . SER A 1 260 ? 30.359 24.892 17.404  1.00 27.88  ? 260  SER A C     1 
ATOM   2017 O  O     . SER A 1 260 ? 31.542 24.522 17.266  1.00 20.29  ? 260  SER A O     1 
ATOM   2018 C  CB    . SER A 1 260 ? 28.559 23.312 16.820  1.00 16.58  ? 260  SER A CB    1 
ATOM   2019 O  OG    . SER A 1 260 ? 29.510 22.293 17.015  1.00 23.41  ? 260  SER A OG    1 
ATOM   2020 N  N     . TYR A 1 261 ? 29.981 25.649 18.443  1.00 24.50  ? 261  TYR A N     1 
ATOM   2021 C  CA    . TYR A 1 261 ? 30.959 26.063 19.452  1.00 12.69  ? 261  TYR A CA    1 
ATOM   2022 C  C     . TYR A 1 261 ? 30.364 25.978 20.819  1.00 25.03  ? 261  TYR A C     1 
ATOM   2023 O  O     . TYR A 1 261 ? 29.147 26.169 20.964  1.00 16.72  ? 261  TYR A O     1 
ATOM   2024 C  CB    . TYR A 1 261 ? 31.168 27.559 19.289  1.00 14.09  ? 261  TYR A CB    1 
ATOM   2025 C  CG    . TYR A 1 261 ? 31.725 27.948 17.932  1.00 27.68  ? 261  TYR A CG    1 
ATOM   2026 C  CD1   . TYR A 1 261 ? 33.070 27.803 17.592  1.00 22.31  ? 261  TYR A CD1   1 
ATOM   2027 C  CD2   . TYR A 1 261 ? 30.875 28.521 16.988  1.00 23.01  ? 261  TYR A CD2   1 
ATOM   2028 C  CE1   . TYR A 1 261 ? 33.523 28.171 16.318  1.00 21.48  ? 261  TYR A CE1   1 
ATOM   2029 C  CE2   . TYR A 1 261 ? 31.292 28.888 15.709  1.00 23.75  ? 261  TYR A CE2   1 
ATOM   2030 C  CZ    . TYR A 1 261 ? 32.632 28.707 15.383  1.00 19.87  ? 261  TYR A CZ    1 
ATOM   2031 O  OH    . TYR A 1 261 ? 33.018 29.156 14.130  1.00 26.42  ? 261  TYR A OH    1 
ATOM   2032 N  N     . LEU A 1 262 ? 31.222 25.745 21.794  1.00 24.93  ? 262  LEU A N     1 
ATOM   2033 C  CA    . LEU A 1 262 ? 30.815 25.806 23.215  1.00 28.00  ? 262  LEU A CA    1 
ATOM   2034 C  C     . LEU A 1 262 ? 29.551 25.079 23.630  1.00 11.69  ? 262  LEU A C     1 
ATOM   2035 O  O     . LEU A 1 262 ? 28.703 25.657 24.300  1.00 19.25  ? 262  LEU A O     1 
ATOM   2036 C  CB    . LEU A 1 262 ? 30.516 27.295 23.508  1.00 16.67  ? 262  LEU A CB    1 
ATOM   2037 C  CG    . LEU A 1 262 ? 31.670 28.074 24.082  1.00 30.65  ? 262  LEU A CG    1 
ATOM   2038 C  CD1   . LEU A 1 262 ? 31.129 29.289 24.736  1.00 24.60  ? 262  LEU A CD1   1 
ATOM   2039 C  CD2   . LEU A 1 262 ? 32.333 27.323 25.206  1.00 22.58  ? 262  LEU A CD2   1 
ATOM   2040 N  N     . LEU A 1 263 ? 29.362 23.853 23.242  1.00 15.91  ? 263  LEU A N     1 
ATOM   2041 C  CA    . LEU A 1 263 ? 28.165 23.153 23.630  1.00 24.84  ? 263  LEU A CA    1 
ATOM   2042 C  C     . LEU A 1 263 ? 28.156 22.972 25.171  1.00 33.99  ? 263  LEU A C     1 
ATOM   2043 O  O     . LEU A 1 263 ? 29.171 22.598 25.729  1.00 18.46  ? 263  LEU A O     1 
ATOM   2044 C  CB    . LEU A 1 263 ? 28.122 21.803 22.889  1.00 18.46  ? 263  LEU A CB    1 
ATOM   2045 C  CG    . LEU A 1 263 ? 27.052 20.894 23.460  1.00 14.51  ? 263  LEU A CG    1 
ATOM   2046 C  CD1   . LEU A 1 263 ? 25.666 21.395 23.074  1.00 16.78  ? 263  LEU A CD1   1 
ATOM   2047 C  CD2   . LEU A 1 263 ? 27.282 19.405 23.133  1.00 11.85  ? 263  LEU A CD2   1 
ATOM   2048 N  N     . GLU A 1 264 ? 27.026 23.219 25.853  1.00 21.63  ? 264  GLU A N     1 
ATOM   2049 C  CA    . GLU A 1 264 ? 26.920 23.082 27.311  1.00 20.04  ? 264  GLU A CA    1 
ATOM   2050 C  C     . GLU A 1 264 ? 26.772 21.636 27.767  1.00 14.70  ? 264  GLU A C     1 
ATOM   2051 O  O     . GLU A 1 264 ? 25.685 21.205 28.147  1.00 23.53  ? 264  GLU A O     1 
ATOM   2052 C  CB    . GLU A 1 264 ? 25.700 23.873 27.788  1.00 28.52  ? 264  GLU A CB    1 
ATOM   2053 C  CG    . GLU A 1 264 ? 25.641 23.996 29.324  1.00 16.71  ? 264  GLU A CG    1 
ATOM   2054 C  CD    . GLU A 1 264 ? 24.594 24.991 29.758  1.00 16.87  ? 264  GLU A CD    1 
ATOM   2055 O  OE1   . GLU A 1 264 ? 23.391 24.680 29.444  1.00 20.68  ? 264  GLU A OE1   1 
ATOM   2056 O  OE2   . GLU A 1 264 ? 24.853 25.990 30.360  1.00 31.62  ? 264  GLU A OE2   1 
ATOM   2057 N  N     . LYS A 1 265 ? 27.877 20.870 27.742  1.00 20.75  ? 265  LYS A N     1 
ATOM   2058 C  CA    . LYS A 1 265 ? 27.880 19.452 28.104  1.00 24.22  ? 265  LYS A CA    1 
ATOM   2059 C  C     . LYS A 1 265 ? 27.422 19.220 29.536  1.00 22.72  ? 265  LYS A C     1 
ATOM   2060 O  O     . LYS A 1 265 ? 26.821 18.232 29.866  1.00 26.64  ? 265  LYS A O     1 
ATOM   2061 C  CB    . LYS A 1 265 ? 29.199 18.740 27.840  1.00 15.84  ? 265  LYS A CB    1 
ATOM   2062 C  CG    . LYS A 1 265 ? 29.552 18.825 26.360  1.00 24.29  ? 265  LYS A CG    1 
ATOM   2063 C  CD    . LYS A 1 265 ? 30.960 18.360 25.982  1.00 23.50  ? 265  LYS A CD    1 
ATOM   2064 C  CE    . LYS A 1 265 ? 32.089 19.276 26.417  1.00 37.94  ? 265  LYS A CE    1 
ATOM   2065 N  NZ    . LYS A 1 265 ? 33.385 18.598 26.432  1.00 26.56  ? 265  LYS A NZ    1 
ATOM   2066 N  N     . SER A 1 266 ? 27.684 20.182 30.370  1.00 17.96  ? 266  SER A N     1 
ATOM   2067 C  CA    . SER A 1 266 ? 27.268 20.082 31.757  1.00 34.22  ? 266  SER A CA    1 
ATOM   2068 C  C     . SER A 1 266 ? 25.743 19.792 31.957  1.00 24.07  ? 266  SER A C     1 
ATOM   2069 O  O     . SER A 1 266 ? 25.285 19.023 32.831  1.00 21.43  ? 266  SER A O     1 
ATOM   2070 C  CB    . SER A 1 266 ? 27.694 21.407 32.390  1.00 24.93  ? 266  SER A CB    1 
ATOM   2071 O  OG    . SER A 1 266 ? 28.136 22.279 31.365  1.00 68.46  ? 266  SER A OG    1 
ATOM   2072 N  N     . ARG A 1 267 ? 24.925 20.466 31.165  1.00 25.58  ? 267  ARG A N     1 
ATOM   2073 C  CA    . ARG A 1 267 ? 23.506 20.329 31.291  1.00 17.60  ? 267  ARG A CA    1 
ATOM   2074 C  C     . ARG A 1 267 ? 23.108 18.925 31.142  1.00 22.56  ? 267  ARG A C     1 
ATOM   2075 O  O     . ARG A 1 267 ? 22.046 18.502 31.586  1.00 21.04  ? 267  ARG A O     1 
ATOM   2076 C  CB    . ARG A 1 267 ? 22.818 21.174 30.256  1.00 20.47  ? 267  ARG A CB    1 
ATOM   2077 C  CG    . ARG A 1 267 ? 21.399 20.775 30.057  1.00 17.23  ? 267  ARG A CG    1 
ATOM   2078 C  CD    . ARG A 1 267 ? 20.750 21.792 29.160  1.00 12.02  ? 267  ARG A CD    1 
ATOM   2079 N  NE    . ARG A 1 267 ? 21.069 23.172 29.598  1.00 16.93  ? 267  ARG A NE    1 
ATOM   2080 C  CZ    . ARG A 1 267 ? 20.342 23.994 30.417  1.00 19.74  ? 267  ARG A CZ    1 
ATOM   2081 N  NH1   . ARG A 1 267 ? 19.142 23.664 30.936  1.00 20.76  ? 267  ARG A NH1   1 
ATOM   2082 N  NH2   . ARG A 1 267 ? 20.829 25.212 30.686  1.00 15.48  ? 267  ARG A NH2   1 
ATOM   2083 N  N     . VAL A 1 268 ? 23.960 18.156 30.490  1.00 23.60  ? 268  VAL A N     1 
ATOM   2084 C  CA    . VAL A 1 268 ? 23.558 16.758 30.364  1.00 25.71  ? 268  VAL A CA    1 
ATOM   2085 C  C     . VAL A 1 268 ? 23.418 16.078 31.757  1.00 42.55  ? 268  VAL A C     1 
ATOM   2086 O  O     . VAL A 1 268 ? 22.576 15.258 31.977  1.00 29.00  ? 268  VAL A O     1 
ATOM   2087 C  CB    . VAL A 1 268 ? 24.576 15.985 29.517  1.00 22.68  ? 268  VAL A CB    1 
ATOM   2088 C  CG1   . VAL A 1 268 ? 24.213 14.538 29.576  1.00 21.03  ? 268  VAL A CG1   1 
ATOM   2089 C  CG2   . VAL A 1 268 ? 24.655 16.467 28.064  1.00 16.10  ? 268  VAL A CG2   1 
ATOM   2090 N  N     . VAL A 1 269 ? 24.274 16.403 32.729  1.00 26.98  ? 269  VAL A N     1 
ATOM   2091 C  CA    . VAL A 1 269 ? 24.285 15.753 34.024  1.00 29.61  ? 269  VAL A CA    1 
ATOM   2092 C  C     . VAL A 1 269 ? 23.621 16.565 35.143  1.00 27.27  ? 269  VAL A C     1 
ATOM   2093 O  O     . VAL A 1 269 ? 23.348 16.067 36.237  1.00 56.16  ? 269  VAL A O     1 
ATOM   2094 C  CB    . VAL A 1 269 ? 25.691 15.256 34.441  1.00 27.49  ? 269  VAL A CB    1 
ATOM   2095 C  CG1   . VAL A 1 269 ? 26.363 14.307 33.480  1.00 23.46  ? 269  VAL A CG1   1 
ATOM   2096 C  CG2   . VAL A 1 269 ? 26.647 16.389 34.632  1.00 26.54  ? 269  VAL A CG2   1 
ATOM   2097 N  N     . PHE A 1 270 ? 23.369 17.825 34.868  1.00 33.78  ? 270  PHE A N     1 
ATOM   2098 C  CA    . PHE A 1 270 ? 22.746 18.689 35.809  1.00 23.38  ? 270  PHE A CA    1 
ATOM   2099 C  C     . PHE A 1 270 ? 21.934 19.792 35.196  1.00 18.26  ? 270  PHE A C     1 
ATOM   2100 O  O     . PHE A 1 270 ? 22.445 20.493 34.364  1.00 27.85  ? 270  PHE A O     1 
ATOM   2101 C  CB    . PHE A 1 270 ? 23.820 19.427 36.585  1.00 29.87  ? 270  PHE A CB    1 
ATOM   2102 C  CG    . PHE A 1 270 ? 23.217 20.497 37.489  1.00 35.78  ? 270  PHE A CG    1 
ATOM   2103 C  CD1   . PHE A 1 270 ? 22.550 20.138 38.660  1.00 45.94  ? 270  PHE A CD1   1 
ATOM   2104 C  CD2   . PHE A 1 270 ? 23.256 21.854 37.162  1.00 30.56  ? 270  PHE A CD2   1 
ATOM   2105 C  CE1   . PHE A 1 270 ? 21.982 21.087 39.507  1.00 40.62  ? 270  PHE A CE1   1 
ATOM   2106 C  CE2   . PHE A 1 270 ? 22.680 22.827 37.986  1.00 37.86  ? 270  PHE A CE2   1 
ATOM   2107 C  CZ    . PHE A 1 270 ? 22.028 22.438 39.159  1.00 45.64  ? 270  PHE A CZ    1 
ATOM   2108 N  N     . GLN A 1 271 ? 20.712 20.015 35.724  1.00 22.94  ? 271  GLN A N     1 
ATOM   2109 C  CA    . GLN A 1 271 ? 19.905 21.149 35.290  1.00 19.75  ? 271  GLN A CA    1 
ATOM   2110 C  C     . GLN A 1 271 ? 19.370 21.963 36.493  1.00 30.23  ? 271  GLN A C     1 
ATOM   2111 O  O     . GLN A 1 271 ? 18.957 21.391 37.510  1.00 32.84  ? 271  GLN A O     1 
ATOM   2112 C  CB    . GLN A 1 271 ? 18.759 20.780 34.343  1.00 23.80  ? 271  GLN A CB    1 
ATOM   2113 C  CG    . GLN A 1 271 ? 19.082 19.700 33.317  1.00 22.56  ? 271  GLN A CG    1 
ATOM   2114 C  CD    . GLN A 1 271 ? 19.195 18.305 33.861  1.00 34.80  ? 271  GLN A CD    1 
ATOM   2115 O  OE1   . GLN A 1 271 ? 18.328 17.889 34.608  1.00 46.76  ? 271  GLN A OE1   1 
ATOM   2116 N  NE2   . GLN A 1 271 ? 20.276 17.560 33.507  1.00 27.26  ? 271  GLN A NE2   1 
ATOM   2117 N  N     . SER A 1 272 ? 19.364 23.293 36.385  1.00 39.36  ? 272  SER A N     1 
ATOM   2118 C  CA    . SER A 1 272 ? 18.822 24.135 37.450  1.00 31.53  ? 272  SER A CA    1 
ATOM   2119 C  C     . SER A 1 272 ? 17.320 23.883 37.584  1.00 33.02  ? 272  SER A C     1 
ATOM   2120 O  O     . SER A 1 272 ? 16.615 23.303 36.721  1.00 32.83  ? 272  SER A O     1 
ATOM   2121 C  CB    . SER A 1 272 ? 19.104 25.620 37.220  1.00 25.23  ? 272  SER A CB    1 
ATOM   2122 O  OG    . SER A 1 272 ? 20.468 25.893 37.416  1.00 84.32  ? 272  SER A OG    1 
ATOM   2123 N  N     . THR A 1 273 ? 16.778 24.280 38.691  1.00 53.05  ? 273  THR A N     1 
ATOM   2124 C  CA    . THR A 1 273 ? 15.362 24.030 38.808  1.00 54.39  ? 273  THR A CA    1 
ATOM   2125 C  C     . THR A 1 273 ? 14.507 24.837 37.811  1.00 25.58  ? 273  THR A C     1 
ATOM   2126 O  O     . THR A 1 273 ? 14.742 26.031 37.578  1.00 34.98  ? 273  THR A O     1 
ATOM   2127 C  CB    . THR A 1 273 ? 14.828 24.103 40.247  1.00 100.00 ? 273  THR A CB    1 
ATOM   2128 O  OG1   . THR A 1 273 ? 13.493 23.620 40.292  1.00 100.00 ? 273  THR A OG1   1 
ATOM   2129 C  CG2   . THR A 1 273 ? 14.829 25.525 40.811  1.00 72.69  ? 273  THR A CG2   1 
ATOM   2130 N  N     . THR A 1 274 ? 13.555 24.063 37.270  1.00 27.64  ? 274  THR A N     1 
ATOM   2131 C  CA    . THR A 1 274 ? 12.541 24.478 36.271  1.00 28.30  ? 274  THR A CA    1 
ATOM   2132 C  C     . THR A 1 274 ? 13.062 24.278 34.828  1.00 48.81  ? 274  THR A C     1 
ATOM   2133 O  O     . THR A 1 274 ? 12.285 24.314 33.863  1.00 31.64  ? 274  THR A O     1 
ATOM   2134 C  CB    . THR A 1 274 ? 12.129 25.939 36.468  1.00 24.22  ? 274  THR A CB    1 
ATOM   2135 O  OG1   . THR A 1 274 ? 13.260 26.787 36.310  1.00 29.65  ? 274  THR A OG1   1 
ATOM   2136 C  CG2   . THR A 1 274 ? 11.540 26.214 37.849  1.00 38.65  ? 274  THR A CG2   1 
ATOM   2137 N  N     . GLU A 1 275 ? 14.373 24.060 34.711  1.00 25.60  ? 275  GLU A N     1 
ATOM   2138 C  CA    . GLU A 1 275 ? 15.053 23.850 33.399  1.00 21.21  ? 275  GLU A CA    1 
ATOM   2139 C  C     . GLU A 1 275 ? 14.920 22.442 32.990  1.00 27.59  ? 275  GLU A C     1 
ATOM   2140 O  O     . GLU A 1 275 ? 14.545 21.601 33.796  1.00 28.52  ? 275  GLU A O     1 
ATOM   2141 C  CB    . GLU A 1 275 ? 16.517 24.260 33.513  1.00 16.80  ? 275  GLU A CB    1 
ATOM   2142 C  CG    . GLU A 1 275 ? 16.665 25.737 33.883  1.00 19.39  ? 275  GLU A CG    1 
ATOM   2143 C  CD    . GLU A 1 275 ? 17.867 26.414 33.229  1.00 22.78  ? 275  GLU A CD    1 
ATOM   2144 O  OE1   . GLU A 1 275 ? 18.792 25.701 32.687  1.00 24.44  ? 275  GLU A OE1   1 
ATOM   2145 O  OE2   . GLU A 1 275 ? 17.953 27.701 33.232  1.00 22.94  ? 275  GLU A OE2   1 
ATOM   2146 N  N     . ARG A 1 276 ? 15.221 22.157 31.715  1.00 19.60  ? 276  ARG A N     1 
ATOM   2147 C  CA    . ARG A 1 276 ? 15.171 20.780 31.300  1.00 21.17  ? 276  ARG A CA    1 
ATOM   2148 C  C     . ARG A 1 276 ? 16.544 20.421 30.776  1.00 15.70  ? 276  ARG A C     1 
ATOM   2149 O  O     . ARG A 1 276 ? 17.330 21.312 30.574  1.00 19.93  ? 276  ARG A O     1 
ATOM   2150 C  CB    . ARG A 1 276 ? 14.167 20.547 30.198  1.00 25.88  ? 276  ARG A CB    1 
ATOM   2151 C  CG    . ARG A 1 276 ? 12.723 20.642 30.665  1.00 26.10  ? 276  ARG A CG    1 
ATOM   2152 C  CD    . ARG A 1 276 ? 11.802 19.726 29.855  1.00 33.09  ? 276  ARG A CD    1 
ATOM   2153 N  NE    . ARG A 1 276 ? 12.038 19.762 28.402  1.00 41.53  ? 276  ARG A NE    1 
ATOM   2154 C  CZ    . ARG A 1 276 ? 11.391 19.047 27.448  1.00 47.95  ? 276  ARG A CZ    1 
ATOM   2155 N  NH1   . ARG A 1 276 ? 10.395 18.200 27.711  1.00 28.74  ? 276  ARG A NH1   1 
ATOM   2156 N  NH2   . ARG A 1 276 ? 11.772 19.148 26.169  1.00 36.30  ? 276  ARG A NH2   1 
ATOM   2157 N  N     . ASN A 1 277 ? 16.812 19.149 30.585  1.00 18.20  ? 277  ASN A N     1 
ATOM   2158 C  CA    . ASN A 1 277 ? 18.020 18.698 29.930  1.00 24.66  ? 277  ASN A CA    1 
ATOM   2159 C  C     . ASN A 1 277 ? 17.770 18.972 28.407  1.00 74.08  ? 277  ASN A C     1 
ATOM   2160 O  O     . ASN A 1 277 ? 16.712 19.513 28.065  1.00 28.78  ? 277  ASN A O     1 
ATOM   2161 C  CB    . ASN A 1 277 ? 18.153 17.178 30.181  1.00 18.54  ? 277  ASN A CB    1 
ATOM   2162 C  CG    . ASN A 1 277 ? 19.538 16.587 29.951  1.00 24.34  ? 277  ASN A CG    1 
ATOM   2163 O  OD1   . ASN A 1 277 ? 20.333 17.053 29.123  1.00 26.89  ? 277  ASN A OD1   1 
ATOM   2164 N  ND2   . ASN A 1 277 ? 19.838 15.517 30.672  1.00 30.31  ? 277  ASN A ND2   1 
ATOM   2165 N  N     . TYR A 1 278 ? 18.673 18.599 27.478  1.00 22.07  ? 278  TYR A N     1 
ATOM   2166 C  CA    . TYR A 1 278 ? 18.423 18.760 26.042  1.00 19.56  ? 278  TYR A CA    1 
ATOM   2167 C  C     . TYR A 1 278 ? 17.104 18.038 25.608  1.00 19.28  ? 278  TYR A C     1 
ATOM   2168 O  O     . TYR A 1 278 ? 16.756 16.950 26.069  1.00 26.94  ? 278  TYR A O     1 
ATOM   2169 C  CB    . TYR A 1 278 ? 19.614 18.192 25.220  1.00 29.05  ? 278  TYR A CB    1 
ATOM   2170 C  CG    . TYR A 1 278 ? 20.848 19.008 25.499  1.00 27.49  ? 278  TYR A CG    1 
ATOM   2171 C  CD1   . TYR A 1 278 ? 21.008 20.217 24.813  1.00 27.25  ? 278  TYR A CD1   1 
ATOM   2172 C  CD2   . TYR A 1 278 ? 21.852 18.608 26.396  1.00 19.90  ? 278  TYR A CD2   1 
ATOM   2173 C  CE1   . TYR A 1 278 ? 22.108 21.047 25.037  1.00 18.12  ? 278  TYR A CE1   1 
ATOM   2174 C  CE2   . TYR A 1 278 ? 22.967 19.436 26.622  1.00 19.03  ? 278  TYR A CE2   1 
ATOM   2175 C  CZ    . TYR A 1 278 ? 23.065 20.682 25.981  1.00 14.51  ? 278  TYR A CZ    1 
ATOM   2176 O  OH    . TYR A 1 278 ? 24.107 21.554 26.176  1.00 21.63  ? 278  TYR A OH    1 
ATOM   2177 N  N     . HIS A 1 279 ? 16.357 18.623 24.660  1.00 28.45  ? 279  HIS A N     1 
ATOM   2178 C  CA    . HIS A 1 279 ? 15.064 18.114 24.160  1.00 19.42  ? 279  HIS A CA    1 
ATOM   2179 C  C     . HIS A 1 279 ? 15.000 16.627 23.838  1.00 24.36  ? 279  HIS A C     1 
ATOM   2180 O  O     . HIS A 1 279 ? 14.026 15.954 24.166  1.00 30.34  ? 279  HIS A O     1 
ATOM   2181 C  CB    . HIS A 1 279 ? 14.529 18.958 22.944  1.00 20.38  ? 279  HIS A CB    1 
ATOM   2182 C  CG    . HIS A 1 279 ? 14.440 20.488 23.103  1.00 25.76  ? 279  HIS A CG    1 
ATOM   2183 N  ND1   . HIS A 1 279 ? 13.887 21.115 24.246  1.00 24.20  ? 279  HIS A ND1   1 
ATOM   2184 C  CD2   . HIS A 1 279 ? 14.822 21.517 22.256  1.00 21.74  ? 279  HIS A CD2   1 
ATOM   2185 C  CE1   . HIS A 1 279 ? 13.955 22.457 24.091  1.00 15.29  ? 279  HIS A CE1   1 
ATOM   2186 N  NE2   . HIS A 1 279 ? 14.487 22.737 22.900  1.00 22.01  ? 279  HIS A NE2   1 
ATOM   2187 N  N     . ILE A 1 280 ? 16.067 16.139 23.197  1.00 26.79  ? 280  ILE A N     1 
ATOM   2188 C  CA    . ILE A 1 280 ? 16.220 14.790 22.722  1.00 24.29  ? 280  ILE A CA    1 
ATOM   2189 C  C     . ILE A 1 280 ? 15.888 13.735 23.740  1.00 39.20  ? 280  ILE A C     1 
ATOM   2190 O  O     . ILE A 1 280 ? 15.303 12.701 23.448  1.00 33.29  ? 280  ILE A O     1 
ATOM   2191 C  CB    . ILE A 1 280 ? 17.556 14.542 22.000  1.00 28.24  ? 280  ILE A CB    1 
ATOM   2192 C  CG1   . ILE A 1 280 ? 17.615 13.128 21.456  1.00 23.99  ? 280  ILE A CG1   1 
ATOM   2193 C  CG2   . ILE A 1 280 ? 18.756 14.694 22.941  1.00 25.11  ? 280  ILE A CG2   1 
ATOM   2194 C  CD1   . ILE A 1 280 ? 16.784 12.955 20.213  1.00 38.80  ? 280  ILE A CD1   1 
ATOM   2195 N  N     . PHE A 1 281 ? 16.298 13.989 24.943  1.00 31.86  ? 281  PHE A N     1 
ATOM   2196 C  CA    . PHE A 1 281 ? 16.053 13.018 25.975  1.00 32.48  ? 281  PHE A CA    1 
ATOM   2197 C  C     . PHE A 1 281 ? 14.573 12.751 26.125  1.00 27.17  ? 281  PHE A C     1 
ATOM   2198 O  O     . PHE A 1 281 ? 14.149 11.613 26.162  1.00 38.86  ? 281  PHE A O     1 
ATOM   2199 C  CB    . PHE A 1 281 ? 16.650 13.549 27.280  1.00 28.81  ? 281  PHE A CB    1 
ATOM   2200 C  CG    . PHE A 1 281 ? 18.154 13.458 27.213  1.00 26.35  ? 281  PHE A CG    1 
ATOM   2201 C  CD1   . PHE A 1 281 ? 18.821 12.232 27.180  1.00 35.59  ? 281  PHE A CD1   1 
ATOM   2202 C  CD2   . PHE A 1 281 ? 18.913 14.624 27.132  1.00 20.41  ? 281  PHE A CD2   1 
ATOM   2203 C  CE1   . PHE A 1 281 ? 20.214 12.131 27.123  1.00 31.58  ? 281  PHE A CE1   1 
ATOM   2204 C  CE2   . PHE A 1 281 ? 20.308 14.555 27.100  1.00 30.26  ? 281  PHE A CE2   1 
ATOM   2205 C  CZ    . PHE A 1 281 ? 20.952 13.312 27.118  1.00 23.44  ? 281  PHE A CZ    1 
ATOM   2206 N  N     . TYR A 1 282 ? 13.831 13.845 26.150  1.00 24.18  ? 282  TYR A N     1 
ATOM   2207 C  CA    . TYR A 1 282 ? 12.388 13.875 26.303  1.00 27.65  ? 282  TYR A CA    1 
ATOM   2208 C  C     . TYR A 1 282 ? 11.669 13.476 25.052  1.00 36.11  ? 282  TYR A C     1 
ATOM   2209 O  O     . TYR A 1 282 ? 10.591 12.955 25.107  1.00 30.76  ? 282  TYR A O     1 
ATOM   2210 C  CB    . TYR A 1 282 ? 11.952 15.262 26.750  1.00 27.33  ? 282  TYR A CB    1 
ATOM   2211 C  CG    . TYR A 1 282 ? 12.762 15.766 27.929  1.00 53.07  ? 282  TYR A CG    1 
ATOM   2212 C  CD1   . TYR A 1 282 ? 13.975 16.449 27.774  1.00 34.85  ? 282  TYR A CD1   1 
ATOM   2213 C  CD2   . TYR A 1 282 ? 12.300 15.544 29.228  1.00 36.18  ? 282  TYR A CD2   1 
ATOM   2214 C  CE1   . TYR A 1 282 ? 14.664 16.946 28.883  1.00 44.79  ? 282  TYR A CE1   1 
ATOM   2215 C  CE2   . TYR A 1 282 ? 12.977 16.049 30.339  1.00 43.30  ? 282  TYR A CE2   1 
ATOM   2216 C  CZ    . TYR A 1 282 ? 14.172 16.744 30.172  1.00 26.50  ? 282  TYR A CZ    1 
ATOM   2217 O  OH    . TYR A 1 282 ? 14.854 17.248 31.248  1.00 28.38  ? 282  TYR A OH    1 
ATOM   2218 N  N     . GLN A 1 283 ? 12.276 13.730 23.911  1.00 38.96  ? 283  GLN A N     1 
ATOM   2219 C  CA    . GLN A 1 283 ? 11.667 13.336 22.666  1.00 41.52  ? 283  GLN A CA    1 
ATOM   2220 C  C     . GLN A 1 283 ? 11.744 11.829 22.532  1.00 56.74  ? 283  GLN A C     1 
ATOM   2221 O  O     . GLN A 1 283 ? 10.824 11.117 22.119  1.00 52.42  ? 283  GLN A O     1 
ATOM   2222 C  CB    . GLN A 1 283 ? 12.350 14.040 21.490  1.00 18.71  ? 283  GLN A CB    1 
ATOM   2223 C  CG    . GLN A 1 283 ? 12.102 15.563 21.589  1.00 28.81  ? 283  GLN A CG    1 
ATOM   2224 C  CD    . GLN A 1 283 ? 12.701 16.258 20.402  1.00 29.46  ? 283  GLN A CD    1 
ATOM   2225 O  OE1   . GLN A 1 283 ? 12.697 17.489 20.236  1.00 31.84  ? 283  GLN A OE1   1 
ATOM   2226 N  NE2   . GLN A 1 283 ? 13.224 15.413 19.557  1.00 24.13  ? 283  GLN A NE2   1 
ATOM   2227 N  N     . LEU A 1 284 ? 12.881 11.312 22.924  1.00 29.48  ? 284  LEU A N     1 
ATOM   2228 C  CA    . LEU A 1 284 ? 13.028 9.884  22.842  1.00 36.72  ? 284  LEU A CA    1 
ATOM   2229 C  C     . LEU A 1 284 ? 12.068 9.126  23.756  1.00 49.84  ? 284  LEU A C     1 
ATOM   2230 O  O     . LEU A 1 284 ? 11.470 8.144  23.347  1.00 35.69  ? 284  LEU A O     1 
ATOM   2231 C  CB    . LEU A 1 284 ? 14.443 9.501  23.278  1.00 41.54  ? 284  LEU A CB    1 
ATOM   2232 C  CG    . LEU A 1 284 ? 14.670 8.012  23.241  1.00 32.99  ? 284  LEU A CG    1 
ATOM   2233 C  CD1   . LEU A 1 284 ? 14.226 7.517  21.859  1.00 28.16  ? 284  LEU A CD1   1 
ATOM   2234 C  CD2   . LEU A 1 284 ? 16.150 7.746  23.496  1.00 27.30  ? 284  LEU A CD2   1 
ATOM   2235 N  N     . LEU A 1 285 ? 12.041 9.569  25.018  1.00 33.13  ? 285  LEU A N     1 
ATOM   2236 C  CA    . LEU A 1 285 ? 11.291 9.016  26.124  1.00 32.16  ? 285  LEU A CA    1 
ATOM   2237 C  C     . LEU A 1 285 ? 9.771  9.028  25.885  1.00 41.10  ? 285  LEU A C     1 
ATOM   2238 O  O     . LEU A 1 285 ? 9.038  8.147  26.371  1.00 95.24  ? 285  LEU A O     1 
ATOM   2239 C  CB    . LEU A 1 285 ? 11.605 9.794  27.418  1.00 73.88  ? 285  LEU A CB    1 
ATOM   2240 C  CG    . LEU A 1 285 ? 12.809 9.304  28.215  1.00 28.40  ? 285  LEU A CG    1 
ATOM   2241 C  CD1   . LEU A 1 285 ? 12.543 9.448  29.710  1.00 43.96  ? 285  LEU A CD1   1 
ATOM   2242 C  CD2   . LEU A 1 285 ? 13.120 7.860  27.888  1.00 29.59  ? 285  LEU A CD2   1 
ATOM   2243 N  N     . ALA A 1 286 ? 9.323  10.066 25.176  1.00 52.87  ? 286  ALA A N     1 
ATOM   2244 C  CA    . ALA A 1 286 ? 7.924  10.249 24.846  1.00 44.30  ? 286  ALA A CA    1 
ATOM   2245 C  C     . ALA A 1 286 ? 7.605  9.716  23.472  1.00 66.43  ? 286  ALA A C     1 
ATOM   2246 O  O     . ALA A 1 286 ? 6.450  9.377  23.237  1.00 58.34  ? 286  ALA A O     1 
ATOM   2247 C  CB    . ALA A 1 286 ? 7.504  11.714 24.869  1.00 29.30  ? 286  ALA A CB    1 
ATOM   2248 N  N     . GLY A 1 287 ? 8.615  9.647  22.583  1.00 49.39  ? 287  GLY A N     1 
ATOM   2249 C  CA    . GLY A 1 287 ? 8.406  9.200  21.210  1.00 60.73  ? 287  GLY A CA    1 
ATOM   2250 C  C     . GLY A 1 287 ? 8.797  7.762  20.805  1.00 34.39  ? 287  GLY A C     1 
ATOM   2251 O  O     . GLY A 1 287 ? 8.319  7.286  19.767  1.00 63.32  ? 287  GLY A O     1 
ATOM   2252 N  N     . ALA A 1 288 ? 9.679  7.080  21.549  1.00 45.63  ? 288  ALA A N     1 
ATOM   2253 C  CA    . ALA A 1 288 ? 10.105 5.717  21.206  1.00 37.04  ? 288  ALA A CA    1 
ATOM   2254 C  C     . ALA A 1 288 ? 8.903  4.727  21.128  1.00 100.00 ? 288  ALA A C     1 
ATOM   2255 O  O     . ALA A 1 288 ? 7.904  4.824  21.860  1.00 100.00 ? 288  ALA A O     1 
ATOM   2256 C  CB    . ALA A 1 288 ? 11.161 5.252  22.215  1.00 33.65  ? 288  ALA A CB    1 
ATOM   2257 N  N     . THR A 1 289 ? 8.963  3.749  20.243  1.00 60.92  ? 289  THR A N     1 
ATOM   2258 C  CA    . THR A 1 289 ? 7.859  2.814  20.161  1.00 47.02  ? 289  THR A CA    1 
ATOM   2259 C  C     . THR A 1 289 ? 7.863  1.965  21.403  1.00 49.22  ? 289  THR A C     1 
ATOM   2260 O  O     . THR A 1 289 ? 8.935  1.620  21.906  1.00 69.74  ? 289  THR A O     1 
ATOM   2261 C  CB    . THR A 1 289 ? 8.089  1.947  18.931  1.00 36.64  ? 289  THR A CB    1 
ATOM   2262 O  OG1   . THR A 1 289 ? 9.262  1.190  19.145  1.00 56.95  ? 289  THR A OG1   1 
ATOM   2263 C  CG2   . THR A 1 289 ? 8.302  2.860  17.717  1.00 67.28  ? 289  THR A CG2   1 
ATOM   2264 N  N     . ALA A 1 290 ? 6.687  1.597  21.916  1.00 94.39  ? 290  ALA A N     1 
ATOM   2265 C  CA    . ALA A 1 290 ? 6.620  0.761  23.113  1.00 54.04  ? 290  ALA A CA    1 
ATOM   2266 C  C     . ALA A 1 290 ? 7.625  -0.358 23.044  1.00 32.98  ? 290  ALA A C     1 
ATOM   2267 O  O     . ALA A 1 290 ? 7.995  -0.908 24.077  1.00 68.20  ? 290  ALA A O     1 
ATOM   2268 C  CB    . ALA A 1 290 ? 5.235  0.198  23.354  1.00 63.45  ? 290  ALA A CB    1 
ATOM   2269 N  N     . GLU A 1 291 ? 8.056  -0.596 21.792  1.00 75.90  ? 291  GLU A N     1 
ATOM   2270 C  CA    . GLU A 1 291 ? 9.027  -1.586 21.354  1.00 52.79  ? 291  GLU A CA    1 
ATOM   2271 C  C     . GLU A 1 291 ? 10.452 -1.165 21.590  1.00 97.41  ? 291  GLU A C     1 
ATOM   2272 O  O     . GLU A 1 291 ? 11.246 -1.955 22.086  1.00 100.00 ? 291  GLU A O     1 
ATOM   2273 C  CB    . GLU A 1 291 ? 8.895  -1.900 19.843  1.00 66.40  ? 291  GLU A CB    1 
ATOM   2274 C  CG    . GLU A 1 291 ? 7.438  -1.898 19.337  1.00 100.00 ? 291  GLU A CG    1 
ATOM   2275 C  CD    . GLU A 1 291 ? 7.104  -0.705 18.482  1.00 100.00 ? 291  GLU A CD    1 
ATOM   2276 O  OE1   . GLU A 1 291 ? 7.760  -0.374 17.492  1.00 100.00 ? 291  GLU A OE1   1 
ATOM   2277 O  OE2   . GLU A 1 291 ? 6.049  -0.048 18.927  1.00 95.39  ? 291  GLU A OE2   1 
ATOM   2278 N  N     . GLU A 1 292 ? 10.797 0.056  21.182  1.00 80.01  ? 292  GLU A N     1 
ATOM   2279 C  CA    . GLU A 1 292 ? 12.175 0.497  21.345  1.00 69.50  ? 292  GLU A CA    1 
ATOM   2280 C  C     . GLU A 1 292 ? 12.485 0.717  22.801  1.00 40.59  ? 292  GLU A C     1 
ATOM   2281 O  O     . GLU A 1 292 ? 13.625 0.570  23.264  1.00 57.19  ? 292  GLU A O     1 
ATOM   2282 C  CB    . GLU A 1 292 ? 12.552 1.716  20.472  1.00 100.00 ? 292  GLU A CB    1 
ATOM   2283 C  CG    . GLU A 1 292 ? 12.002 1.663  19.022  1.00 100.00 ? 292  GLU A CG    1 
ATOM   2284 C  CD    . GLU A 1 292 ? 12.123 2.977  18.280  1.00 100.00 ? 292  GLU A CD    1 
ATOM   2285 O  OE1   . GLU A 1 292 ? 11.645 3.994  18.971  1.00 67.65  ? 292  GLU A OE1   1 
ATOM   2286 O  OE2   . GLU A 1 292 ? 12.608 3.084  17.153  1.00 82.91  ? 292  GLU A OE2   1 
ATOM   2287 N  N     . LYS A 1 293 ? 11.408 1.026  23.528  1.00 40.93  ? 293  LYS A N     1 
ATOM   2288 C  CA    . LYS A 1 293 ? 11.530 1.299  24.927  1.00 54.76  ? 293  LYS A CA    1 
ATOM   2289 C  C     . LYS A 1 293 ? 12.197 0.158  25.622  1.00 41.15  ? 293  LYS A C     1 
ATOM   2290 O  O     . LYS A 1 293 ? 13.286 0.302  26.188  1.00 67.92  ? 293  LYS A O     1 
ATOM   2291 C  CB    . LYS A 1 293 ? 10.229 1.792  25.555  1.00 49.28  ? 293  LYS A CB    1 
ATOM   2292 C  CG    . LYS A 1 293 ? 9.564  2.861  24.678  1.00 100.00 ? 293  LYS A CG    1 
ATOM   2293 C  CD    . LYS A 1 293 ? 8.036  2.956  24.741  1.00 100.00 ? 293  LYS A CD    1 
ATOM   2294 C  CE    . LYS A 1 293 ? 7.508  4.383  24.581  1.00 100.00 ? 293  LYS A CE    1 
ATOM   2295 N  NZ    . LYS A 1 293 ? 7.952  5.284  25.666  1.00 100.00 ? 293  LYS A NZ    1 
ATOM   2296 N  N     . LYS A 1 294 ? 11.554 -0.984 25.498  1.00 61.14  ? 294  LYS A N     1 
ATOM   2297 C  CA    . LYS A 1 294 ? 12.040 -2.218 26.065  1.00 93.53  ? 294  LYS A CA    1 
ATOM   2298 C  C     . LYS A 1 294 ? 13.410 -2.572 25.501  1.00 49.75  ? 294  LYS A C     1 
ATOM   2299 O  O     . LYS A 1 294 ? 14.288 -3.109 26.174  1.00 62.87  ? 294  LYS A O     1 
ATOM   2300 C  CB    . LYS A 1 294 ? 11.060 -3.352 25.772  1.00 100.00 ? 294  LYS A CB    1 
ATOM   2301 C  CG    . LYS A 1 294 ? 11.428 -4.679 26.446  1.00 100.00 ? 294  LYS A CG    1 
ATOM   2302 C  CD    . LYS A 1 294 ? 11.107 -5.927 25.618  1.00 100.00 ? 294  LYS A CD    1 
ATOM   2303 C  CE    . LYS A 1 294 ? 10.373 -7.009 26.413  1.00 100.00 ? 294  LYS A CE    1 
ATOM   2304 N  NZ    . LYS A 1 294 ? 9.434  -7.807 25.594  1.00 100.00 ? 294  LYS A NZ    1 
ATOM   2305 N  N     . ALA A 1 295 ? 13.589 -2.299 24.230  1.00 37.98  ? 295  ALA A N     1 
ATOM   2306 C  CA    . ALA A 1 295 ? 14.848 -2.617 23.642  1.00 46.31  ? 295  ALA A CA    1 
ATOM   2307 C  C     . ALA A 1 295 ? 15.887 -1.686 24.207  1.00 91.48  ? 295  ALA A C     1 
ATOM   2308 O  O     . ALA A 1 295 ? 17.071 -2.013 24.194  1.00 55.74  ? 295  ALA A O     1 
ATOM   2309 C  CB    . ALA A 1 295 ? 14.780 -2.457 22.144  1.00 38.22  ? 295  ALA A CB    1 
ATOM   2310 N  N     . LEU A 1 296 ? 15.423 -0.525 24.696  1.00 42.98  ? 296  LEU A N     1 
ATOM   2311 C  CA    . LEU A 1 296 ? 16.331 0.458  25.240  1.00 37.51  ? 296  LEU A CA    1 
ATOM   2312 C  C     . LEU A 1 296 ? 16.296 0.559  26.737  1.00 53.10  ? 296  LEU A C     1 
ATOM   2313 O  O     . LEU A 1 296 ? 17.001 1.353  27.386  1.00 43.25  ? 296  LEU A O     1 
ATOM   2314 C  CB    . LEU A 1 296 ? 16.116 1.809  24.594  1.00 34.23  ? 296  LEU A CB    1 
ATOM   2315 C  CG    . LEU A 1 296 ? 16.519 1.840  23.119  1.00 37.63  ? 296  LEU A CG    1 
ATOM   2316 C  CD1   . LEU A 1 296 ? 16.187 3.186  22.523  1.00 44.12  ? 296  LEU A CD1   1 
ATOM   2317 C  CD2   . LEU A 1 296 ? 18.006 1.625  22.940  1.00 25.03  ? 296  LEU A CD2   1 
ATOM   2318 N  N     . HIS A 1 297 ? 15.458 -0.265 27.308  1.00 33.76  ? 297  HIS A N     1 
ATOM   2319 C  CA    . HIS A 1 297 ? 15.379 -0.267 28.724  1.00 55.93  ? 297  HIS A CA    1 
ATOM   2320 C  C     . HIS A 1 297 ? 14.852 1.039  29.229  1.00 39.24  ? 297  HIS A C     1 
ATOM   2321 O  O     . HIS A 1 297 ? 15.188 1.525  30.325  1.00 67.55  ? 297  HIS A O     1 
ATOM   2322 C  CB    . HIS A 1 297 ? 16.771 -0.567 29.256  1.00 42.64  ? 297  HIS A CB    1 
ATOM   2323 C  CG    . HIS A 1 297 ? 17.125 -1.925 28.798  1.00 52.91  ? 297  HIS A CG    1 
ATOM   2324 N  ND1   . HIS A 1 297 ? 17.873 -2.136 27.656  1.00 97.13  ? 297  HIS A ND1   1 
ATOM   2325 C  CD2   . HIS A 1 297 ? 16.772 -3.126 29.312  1.00 64.82  ? 297  HIS A CD2   1 
ATOM   2326 C  CE1   . HIS A 1 297 ? 17.983 -3.448 27.514  1.00 72.74  ? 297  HIS A CE1   1 
ATOM   2327 N  NE2   . HIS A 1 297 ? 17.333 -4.072 28.493  1.00 100.00 ? 297  HIS A NE2   1 
ATOM   2328 N  N     . LEU A 1 298 ? 13.996 1.600  28.394  1.00 47.21  ? 298  LEU A N     1 
ATOM   2329 C  CA    . LEU A 1 298 ? 13.447 2.892  28.720  1.00 46.04  ? 298  LEU A CA    1 
ATOM   2330 C  C     . LEU A 1 298 ? 12.357 2.969  29.729  1.00 29.75  ? 298  LEU A C     1 
ATOM   2331 O  O     . LEU A 1 298 ? 11.753 1.973  30.088  1.00 100.00 ? 298  LEU A O     1 
ATOM   2332 C  CB    . LEU A 1 298 ? 13.215 3.678  27.463  1.00 53.53  ? 298  LEU A CB    1 
ATOM   2333 C  CG    . LEU A 1 298 ? 14.453 3.382  26.644  1.00 75.37  ? 298  LEU A CG    1 
ATOM   2334 C  CD1   . LEU A 1 298 ? 14.226 3.881  25.234  1.00 100.00 ? 298  LEU A CD1   1 
ATOM   2335 C  CD2   . LEU A 1 298 ? 15.674 4.024  27.315  1.00 49.55  ? 298  LEU A CD2   1 
ATOM   2336 N  N     . ALA A 1 299 ? 12.158 4.175  30.210  1.00 50.43  ? 299  ALA A N     1 
ATOM   2337 C  CA    . ALA A 1 299 ? 11.152 4.467  31.206  1.00 39.03  ? 299  ALA A CA    1 
ATOM   2338 C  C     . ALA A 1 299 ? 10.768 5.947  31.161  1.00 38.63  ? 299  ALA A C     1 
ATOM   2339 O  O     . ALA A 1 299 ? 11.019 6.675  30.193  1.00 100.00 ? 299  ALA A O     1 
ATOM   2340 C  CB    . ALA A 1 299 ? 11.698 4.080  32.583  1.00 74.67  ? 299  ALA A CB    1 
ATOM   2341 N  N     . GLY A 1 300 ? 10.130 6.394  32.225  1.00 39.08  ? 300  GLY A N     1 
ATOM   2342 C  CA    . GLY A 1 300 ? 9.779  7.763  32.287  1.00 34.93  ? 300  GLY A CA    1 
ATOM   2343 C  C     . GLY A 1 300 ? 11.025 8.558  32.592  1.00 33.42  ? 300  GLY A C     1 
ATOM   2344 O  O     . GLY A 1 300 ? 12.106 8.032  32.793  1.00 49.01  ? 300  GLY A O     1 
ATOM   2345 N  N     . PRO A 1 301 ? 10.852 9.840  32.578  1.00 41.26  ? 301  PRO A N     1 
ATOM   2346 C  CA    . PRO A 1 301 ? 11.889 10.773 32.909  1.00 48.42  ? 301  PRO A CA    1 
ATOM   2347 C  C     . PRO A 1 301 ? 12.085 10.804 34.410  1.00 40.16  ? 301  PRO A C     1 
ATOM   2348 O  O     . PRO A 1 301 ? 13.147 11.124 34.983  1.00 37.07  ? 301  PRO A O     1 
ATOM   2349 C  CB    . PRO A 1 301 ? 11.249 12.129 32.546  1.00 53.10  ? 301  PRO A CB    1 
ATOM   2350 C  CG    . PRO A 1 301 ? 9.925  11.857 31.831  1.00 34.58  ? 301  PRO A CG    1 
ATOM   2351 C  CD    . PRO A 1 301 ? 9.967  10.376 31.511  1.00 36.15  ? 301  PRO A CD    1 
ATOM   2352 N  N     . GLU A 1 302 ? 10.966 10.545 35.047  1.00 45.77  ? 302  GLU A N     1 
ATOM   2353 C  CA    . GLU A 1 302 ? 10.930 10.570 36.461  1.00 38.69  ? 302  GLU A CA    1 
ATOM   2354 C  C     . GLU A 1 302 ? 11.820 9.450  36.949  1.00 36.45  ? 302  GLU A C     1 
ATOM   2355 O  O     . GLU A 1 302 ? 12.493 9.523  37.960  1.00 52.50  ? 302  GLU A O     1 
ATOM   2356 C  CB    . GLU A 1 302 ? 9.477  10.633 36.985  1.00 63.60  ? 302  GLU A CB    1 
ATOM   2357 C  CG    . GLU A 1 302 ? 8.548  9.494  36.528  1.00 97.38  ? 302  GLU A CG    1 
ATOM   2358 C  CD    . GLU A 1 302 ? 8.194  9.404  35.060  1.00 100.00 ? 302  GLU A CD    1 
ATOM   2359 O  OE1   . GLU A 1 302 ? 7.835  10.366 34.330  1.00 49.02  ? 302  GLU A OE1   1 
ATOM   2360 O  OE2   . GLU A 1 302 ? 8.274  8.145  34.660  1.00 82.29  ? 302  GLU A OE2   1 
ATOM   2361 N  N     . SER A 1 303 ? 11.939 8.461  36.107  1.00 46.47  ? 303  SER A N     1 
ATOM   2362 C  CA    . SER A 1 303 ? 12.791 7.341  36.391  1.00 32.87  ? 303  SER A CA    1 
ATOM   2363 C  C     . SER A 1 303 ? 14.292 7.606  36.131  1.00 45.31  ? 303  SER A C     1 
ATOM   2364 O  O     . SER A 1 303 ? 15.111 6.718  36.335  1.00 46.64  ? 303  SER A O     1 
ATOM   2365 C  CB    . SER A 1 303 ? 12.283 6.111  35.623  1.00 30.16  ? 303  SER A CB    1 
ATOM   2366 O  OG    . SER A 1 303 ? 13.284 5.525  34.795  1.00 98.94  ? 303  SER A OG    1 
ATOM   2367 N  N     . PHE A 1 304 ? 14.691 8.778  35.656  1.00 36.99  ? 304  PHE A N     1 
ATOM   2368 C  CA    . PHE A 1 304 ? 16.123 8.968  35.375  1.00 35.73  ? 304  PHE A CA    1 
ATOM   2369 C  C     . PHE A 1 304 ? 16.654 10.129 36.103  1.00 28.68  ? 304  PHE A C     1 
ATOM   2370 O  O     . PHE A 1 304 ? 16.059 11.188 36.046  1.00 32.44  ? 304  PHE A O     1 
ATOM   2371 C  CB    . PHE A 1 304 ? 16.418 9.185  33.896  1.00 37.06  ? 304  PHE A CB    1 
ATOM   2372 C  CG    . PHE A 1 304 ? 15.974 8.003  33.089  1.00 29.17  ? 304  PHE A CG    1 
ATOM   2373 C  CD1   . PHE A 1 304 ? 16.787 6.878  33.084  1.00 28.35  ? 304  PHE A CD1   1 
ATOM   2374 C  CD2   . PHE A 1 304 ? 14.793 8.003  32.342  1.00 29.15  ? 304  PHE A CD2   1 
ATOM   2375 C  CE1   . PHE A 1 304 ? 16.439 5.747  32.352  1.00 38.42  ? 304  PHE A CE1   1 
ATOM   2376 C  CE2   . PHE A 1 304 ? 14.440 6.885  31.590  1.00 22.62  ? 304  PHE A CE2   1 
ATOM   2377 C  CZ    . PHE A 1 304 ? 15.268 5.763  31.595  1.00 29.05  ? 304  PHE A CZ    1 
ATOM   2378 N  N     . ASN A 1 305 ? 17.775 9.906  36.781  1.00 34.29  ? 305  ASN A N     1 
ATOM   2379 C  CA    . ASN A 1 305 ? 18.432 10.932 37.581  1.00 21.21  ? 305  ASN A CA    1 
ATOM   2380 C  C     . ASN A 1 305 ? 18.793 12.201 36.821  1.00 38.58  ? 305  ASN A C     1 
ATOM   2381 O  O     . ASN A 1 305 ? 18.753 13.318 37.374  1.00 32.06  ? 305  ASN A O     1 
ATOM   2382 C  CB    . ASN A 1 305 ? 19.737 10.379 38.155  1.00 37.77  ? 305  ASN A CB    1 
ATOM   2383 C  CG    . ASN A 1 305 ? 19.630 10.033 39.617  1.00 100.00 ? 305  ASN A CG    1 
ATOM   2384 O  OD1   . ASN A 1 305 ? 18.724 10.525 40.336  1.00 100.00 ? 305  ASN A OD1   1 
ATOM   2385 N  ND2   . ASN A 1 305 ? 20.567 9.193  40.061  1.00 100.00 ? 305  ASN A ND2   1 
ATOM   2386 N  N     . TYR A 1 306 ? 19.179 12.003 35.556  1.00 42.08  ? 306  TYR A N     1 
ATOM   2387 C  CA    . TYR A 1 306 ? 19.578 13.097 34.696  1.00 34.46  ? 306  TYR A CA    1 
ATOM   2388 C  C     . TYR A 1 306 ? 18.365 13.911 34.204  1.00 34.15  ? 306  TYR A C     1 
ATOM   2389 O  O     . TYR A 1 306 ? 18.563 14.977 33.630  1.00 29.50  ? 306  TYR A O     1 
ATOM   2390 C  CB    . TYR A 1 306 ? 20.433 12.589 33.516  1.00 22.58  ? 306  TYR A CB    1 
ATOM   2391 C  CG    . TYR A 1 306 ? 21.837 12.203 33.816  1.00 22.37  ? 306  TYR A CG    1 
ATOM   2392 C  CD1   . TYR A 1 306 ? 22.492 12.649 34.958  1.00 26.92  ? 306  TYR A CD1   1 
ATOM   2393 C  CD2   . TYR A 1 306 ? 22.565 11.458 32.881  1.00 29.49  ? 306  TYR A CD2   1 
ATOM   2394 C  CE1   . TYR A 1 306 ? 23.835 12.333 35.164  1.00 26.98  ? 306  TYR A CE1   1 
ATOM   2395 C  CE2   . TYR A 1 306 ? 23.904 11.112 33.079  1.00 24.19  ? 306  TYR A CE2   1 
ATOM   2396 C  CZ    . TYR A 1 306 ? 24.538 11.567 34.234  1.00 22.05  ? 306  TYR A CZ    1 
ATOM   2397 O  OH    . TYR A 1 306 ? 25.855 11.272 34.478  1.00 26.99  ? 306  TYR A OH    1 
ATOM   2398 N  N     . LEU A 1 307 ? 17.111 13.404 34.428  1.00 27.53  ? 307  LEU A N     1 
ATOM   2399 C  CA    . LEU A 1 307 ? 15.849 14.078 34.007  1.00 29.24  ? 307  LEU A CA    1 
ATOM   2400 C  C     . LEU A 1 307 ? 14.860 14.343 35.133  1.00 45.96  ? 307  LEU A C     1 
ATOM   2401 O  O     . LEU A 1 307 ? 13.887 15.062 34.973  1.00 33.69  ? 307  LEU A O     1 
ATOM   2402 C  CB    . LEU A 1 307 ? 15.044 13.300 32.969  1.00 23.24  ? 307  LEU A CB    1 
ATOM   2403 C  CG    . LEU A 1 307 ? 15.844 12.826 31.787  1.00 21.40  ? 307  LEU A CG    1 
ATOM   2404 C  CD1   . LEU A 1 307 ? 14.957 11.964 30.891  1.00 33.27  ? 307  LEU A CD1   1 
ATOM   2405 C  CD2   . LEU A 1 307 ? 16.564 13.977 31.035  1.00 23.61  ? 307  LEU A CD2   1 
ATOM   2406 N  N     . ASN A 1 308 ? 15.078 13.742 36.271  1.00 37.24  ? 308  ASN A N     1 
ATOM   2407 C  CA    . ASN A 1 308 ? 14.161 13.880 37.364  1.00 38.26  ? 308  ASN A CA    1 
ATOM   2408 C  C     . ASN A 1 308 ? 14.568 14.874 38.432  1.00 36.55  ? 308  ASN A C     1 
ATOM   2409 O  O     . ASN A 1 308 ? 13.982 14.899 39.509  1.00 57.31  ? 308  ASN A O     1 
ATOM   2410 C  CB    . ASN A 1 308 ? 13.986 12.525 38.000  1.00 36.46  ? 308  ASN A CB    1 
ATOM   2411 C  CG    . ASN A 1 308 ? 15.248 12.164 38.761  1.00 36.25  ? 308  ASN A CG    1 
ATOM   2412 O  OD1   . ASN A 1 308 ? 16.136 12.990 39.049  1.00 34.51  ? 308  ASN A OD1   1 
ATOM   2413 N  ND2   . ASN A 1 308 ? 15.345 10.883 39.067  1.00 52.14  ? 308  ASN A ND2   1 
ATOM   2414 N  N     . GLN A 1 309 ? 15.533 15.716 38.157  1.00 49.29  ? 309  GLN A N     1 
ATOM   2415 C  CA    . GLN A 1 309 ? 15.937 16.664 39.161  1.00 36.17  ? 309  GLN A CA    1 
ATOM   2416 C  C     . GLN A 1 309 ? 15.400 18.099 39.076  1.00 55.57  ? 309  GLN A C     1 
ATOM   2417 O  O     . GLN A 1 309 ? 15.266 18.739 40.124  1.00 63.09  ? 309  GLN A O     1 
ATOM   2418 C  CB    . GLN A 1 309 ? 17.479 16.688 39.397  1.00 100.00 ? 309  GLN A CB    1 
ATOM   2419 C  CG    . GLN A 1 309 ? 18.080 15.387 40.004  1.00 100.00 ? 309  GLN A CG    1 
ATOM   2420 C  CD    . GLN A 1 309 ? 17.938 15.174 41.524  1.00 100.00 ? 309  GLN A CD    1 
ATOM   2421 O  OE1   . GLN A 1 309 ? 17.759 16.122 42.331  1.00 95.84  ? 309  GLN A OE1   1 
ATOM   2422 N  NE2   . GLN A 1 309 ? 18.003 13.901 41.920  1.00 100.00 ? 309  GLN A NE2   1 
ATOM   2423 N  N     . SER A 1 310 ? 15.174 18.658 37.879  1.00 38.98  ? 310  SER A N     1 
ATOM   2424 C  CA    . SER A 1 310 ? 14.776 20.071 37.815  1.00 73.63  ? 310  SER A CA    1 
ATOM   2425 C  C     . SER A 1 310 ? 13.326 20.226 38.157  1.00 57.19  ? 310  SER A C     1 
ATOM   2426 O  O     . SER A 1 310 ? 12.828 21.331 38.358  1.00 54.29  ? 310  SER A O     1 
ATOM   2427 C  CB    . SER A 1 310 ? 14.996 20.728 36.452  1.00 24.88  ? 310  SER A CB    1 
ATOM   2428 O  OG    . SER A 1 310 ? 14.165 19.991 35.575  1.00 33.46  ? 310  SER A OG    1 
ATOM   2429 N  N     . GLY A 1 311 ? 12.620 19.124 38.166  1.00 38.28  ? 311  GLY A N     1 
ATOM   2430 C  CA    . GLY A 1 311 ? 11.240 19.331 38.444  1.00 44.49  ? 311  GLY A CA    1 
ATOM   2431 C  C     . GLY A 1 311 ? 10.495 19.638 37.157  1.00 100.00 ? 311  GLY A C     1 
ATOM   2432 O  O     . GLY A 1 311 ? 9.278  19.487 37.024  1.00 45.87  ? 311  GLY A O     1 
ATOM   2433 N  N     . CYS A 1 312 ? 11.235 20.059 36.166  1.00 67.97  ? 312  CYS A N     1 
ATOM   2434 C  CA    . CYS A 1 312 ? 10.544 20.309 34.926  1.00 36.94  ? 312  CYS A CA    1 
ATOM   2435 C  C     . CYS A 1 312 ? 10.833 19.194 33.914  1.00 38.86  ? 312  CYS A C     1 
ATOM   2436 O  O     . CYS A 1 312 ? 12.000 18.913 33.587  1.00 49.48  ? 312  CYS A O     1 
ATOM   2437 C  CB    . CYS A 1 312 ? 10.819 21.746 34.394  1.00 35.88  ? 312  CYS A CB    1 
ATOM   2438 S  SG    . CYS A 1 312 ? 10.084 22.014 32.768  1.00 42.36  ? 312  CYS A SG    1 
ATOM   2439 N  N     . VAL A 1 313 ? 9.778  18.526 33.421  1.00 26.37  ? 313  VAL A N     1 
ATOM   2440 C  CA    . VAL A 1 313 ? 9.990  17.479 32.419  1.00 29.68  ? 313  VAL A CA    1 
ATOM   2441 C  C     . VAL A 1 313 ? 9.204  17.780 31.142  1.00 27.13  ? 313  VAL A C     1 
ATOM   2442 O  O     . VAL A 1 313 ? 9.254  17.006 30.168  1.00 33.65  ? 313  VAL A O     1 
ATOM   2443 C  CB    . VAL A 1 313 ? 9.757  16.020 32.846  1.00 38.18  ? 313  VAL A CB    1 
ATOM   2444 C  CG1   . VAL A 1 313 ? 10.442 15.675 34.151  1.00 42.90  ? 313  VAL A CG1   1 
ATOM   2445 C  CG2   . VAL A 1 313 ? 8.275  15.698 32.896  1.00 96.58  ? 313  VAL A CG2   1 
ATOM   2446 N  N     . ASP A 1 314 ? 8.450  18.884 31.200  1.00 31.38  ? 314  ASP A N     1 
ATOM   2447 C  CA    . ASP A 1 314 ? 7.659  19.294 30.061  1.00 43.08  ? 314  ASP A CA    1 
ATOM   2448 C  C     . ASP A 1 314 ? 7.597  20.803 29.787  1.00 28.76  ? 314  ASP A C     1 
ATOM   2449 O  O     . ASP A 1 314 ? 7.746  21.637 30.683  1.00 38.22  ? 314  ASP A O     1 
ATOM   2450 C  CB    . ASP A 1 314 ? 6.375  18.499 29.835  1.00 37.35  ? 314  ASP A CB    1 
ATOM   2451 C  CG    . ASP A 1 314 ? 5.318  18.825 30.828  1.00 100.00 ? 314  ASP A CG    1 
ATOM   2452 O  OD1   . ASP A 1 314 ? 5.254  20.112 31.150  1.00 97.59  ? 314  ASP A OD1   1 
ATOM   2453 O  OD2   . ASP A 1 314 ? 4.615  17.956 31.294  1.00 100.00 ? 314  ASP A OD2   1 
ATOM   2454 N  N     . ILE A 1 315 ? 7.454  21.136 28.487  1.00 45.51  ? 315  ILE A N     1 
ATOM   2455 C  CA    . ILE A 1 315 ? 7.411  22.527 28.055  1.00 43.68  ? 315  ILE A CA    1 
ATOM   2456 C  C     . ILE A 1 315 ? 6.038  22.884 27.598  1.00 49.31  ? 315  ILE A C     1 
ATOM   2457 O  O     . ILE A 1 315 ? 5.402  22.162 26.822  1.00 39.23  ? 315  ILE A O     1 
ATOM   2458 C  CB    . ILE A 1 315 ? 8.423  23.009 27.012  1.00 76.20  ? 315  ILE A CB    1 
ATOM   2459 C  CG1   . ILE A 1 315 ? 9.883  22.656 27.370  1.00 39.02  ? 315  ILE A CG1   1 
ATOM   2460 C  CG2   . ILE A 1 315 ? 8.219  24.518 26.830  1.00 28.34  ? 315  ILE A CG2   1 
ATOM   2461 C  CD1   . ILE A 1 315 ? 10.828 22.719 26.166  1.00 25.29  ? 315  ILE A CD1   1 
ATOM   2462 N  N     . LYS A 1 316 ? 5.585  23.992 28.135  1.00 42.19  ? 316  LYS A N     1 
ATOM   2463 C  CA    . LYS A 1 316 ? 4.279  24.431 27.801  1.00 100.00 ? 316  LYS A CA    1 
ATOM   2464 C  C     . LYS A 1 316 ? 4.061  24.496 26.304  1.00 43.11  ? 316  LYS A C     1 
ATOM   2465 O  O     . LYS A 1 316 ? 4.830  25.104 25.527  1.00 63.89  ? 316  LYS A O     1 
ATOM   2466 C  CB    . LYS A 1 316 ? 3.802  25.669 28.572  1.00 100.00 ? 316  LYS A CB    1 
ATOM   2467 C  CG    . LYS A 1 316 ? 4.143  27.036 27.945  1.00 100.00 ? 316  LYS A CG    1 
ATOM   2468 C  CD    . LYS A 1 316 ? 3.090  28.155 28.197  1.00 100.00 ? 316  LYS A CD    1 
ATOM   2469 C  CE    . LYS A 1 316 ? 2.486  28.280 29.621  1.00 100.00 ? 316  LYS A CE    1 
ATOM   2470 N  NZ    . LYS A 1 316 ? 2.352  29.678 30.128  1.00 100.00 ? 316  LYS A NZ    1 
ATOM   2471 N  N     . GLY A 1 317 ? 2.984  23.816 25.932  1.00 61.00  ? 317  GLY A N     1 
ATOM   2472 C  CA    . GLY A 1 317 ? 2.549  23.794 24.576  1.00 33.33  ? 317  GLY A CA    1 
ATOM   2473 C  C     . GLY A 1 317 ? 3.578  23.210 23.685  1.00 39.25  ? 317  GLY A C     1 
ATOM   2474 O  O     . GLY A 1 317 ? 3.881  23.717 22.609  1.00 54.29  ? 317  GLY A O     1 
ATOM   2475 N  N     . VAL A 1 318 ? 4.075  22.104 24.159  1.00 45.02  ? 318  VAL A N     1 
ATOM   2476 C  CA    . VAL A 1 318 ? 5.053  21.399 23.408  1.00 31.25  ? 318  VAL A CA    1 
ATOM   2477 C  C     . VAL A 1 318 ? 4.882  19.891 23.631  1.00 33.91  ? 318  VAL A C     1 
ATOM   2478 O  O     . VAL A 1 318 ? 4.750  19.448 24.797  1.00 42.43  ? 318  VAL A O     1 
ATOM   2479 C  CB    . VAL A 1 318 ? 6.475  21.832 23.764  1.00 69.74  ? 318  VAL A CB    1 
ATOM   2480 C  CG1   . VAL A 1 318 ? 7.407  20.864 23.064  1.00 30.80  ? 318  VAL A CG1   1 
ATOM   2481 C  CG2   . VAL A 1 318 ? 6.817  23.291 23.454  1.00 27.82  ? 318  VAL A CG2   1 
ATOM   2482 N  N     . SER A 1 319 ? 4.926  19.107 22.501  1.00 56.37  ? 319  SER A N     1 
ATOM   2483 C  CA    . SER A 1 319 ? 4.790  17.635 22.463  1.00 80.88  ? 319  SER A CA    1 
ATOM   2484 C  C     . SER A 1 319 ? 6.096  16.976 22.075  1.00 66.21  ? 319  SER A C     1 
ATOM   2485 O  O     . SER A 1 319 ? 6.432  16.955 20.892  1.00 45.43  ? 319  SER A O     1 
ATOM   2486 C  CB    . SER A 1 319 ? 3.728  17.156 21.463  1.00 31.41  ? 319  SER A CB    1 
ATOM   2487 O  OG    . SER A 1 319 ? 3.923  15.778 21.079  1.00 41.80  ? 319  SER A OG    1 
ATOM   2488 N  N     . ASP A 1 320 ? 6.799  16.409 23.053  1.00 42.72  ? 320  ASP A N     1 
ATOM   2489 C  CA    . ASP A 1 320 ? 8.058  15.762 22.767  1.00 48.52  ? 320  ASP A CA    1 
ATOM   2490 C  C     . ASP A 1 320 ? 7.933  14.648 21.752  1.00 34.35  ? 320  ASP A C     1 
ATOM   2491 O  O     . ASP A 1 320 ? 8.812  14.374 20.937  1.00 41.23  ? 320  ASP A O     1 
ATOM   2492 C  CB    . ASP A 1 320 ? 8.833  15.399 24.060  1.00 30.46  ? 320  ASP A CB    1 
ATOM   2493 C  CG    . ASP A 1 320 ? 9.081  16.660 24.849  1.00 56.11  ? 320  ASP A CG    1 
ATOM   2494 O  OD1   . ASP A 1 320 ? 10.091 17.403 24.361  1.00 38.83  ? 320  ASP A OD1   1 
ATOM   2495 O  OD2   . ASP A 1 320 ? 8.381  16.986 25.805  1.00 39.52  ? 320  ASP A OD2   1 
ATOM   2496 N  N     . GLU A 1 321 ? 6.814  13.963 21.811  1.00 43.12  ? 321  GLU A N     1 
ATOM   2497 C  CA    . GLU A 1 321 ? 6.571  12.843 20.933  1.00 36.94  ? 321  GLU A CA    1 
ATOM   2498 C  C     . GLU A 1 321 ? 6.378  13.306 19.521  1.00 35.91  ? 321  GLU A C     1 
ATOM   2499 O  O     . GLU A 1 321 ? 6.838  12.661 18.577  1.00 37.44  ? 321  GLU A O     1 
ATOM   2500 C  CB    . GLU A 1 321 ? 5.287  12.175 21.420  1.00 49.09  ? 321  GLU A CB    1 
ATOM   2501 C  CG    . GLU A 1 321 ? 5.330  12.095 22.963  1.00 100.00 ? 321  GLU A CG    1 
ATOM   2502 C  CD    . GLU A 1 321 ? 4.479  13.120 23.672  1.00 100.00 ? 321  GLU A CD    1 
ATOM   2503 O  OE1   . GLU A 1 321 ? 4.811  14.286 23.843  1.00 100.00 ? 321  GLU A OE1   1 
ATOM   2504 O  OE2   . GLU A 1 321 ? 3.351  12.601 24.119  1.00 100.00 ? 321  GLU A OE2   1 
ATOM   2505 N  N     . ASP A 1 322 ? 5.654  14.421 19.430  1.00 34.08  ? 322  ASP A N     1 
ATOM   2506 C  CA    . ASP A 1 322 ? 5.363  15.040 18.162  1.00 36.92  ? 322  ASP A CA    1 
ATOM   2507 C  C     . ASP A 1 322 ? 6.664  15.598 17.573  1.00 49.98  ? 322  ASP A C     1 
ATOM   2508 O  O     . ASP A 1 322 ? 6.895  15.537 16.366  1.00 46.53  ? 322  ASP A O     1 
ATOM   2509 C  CB    . ASP A 1 322 ? 4.235  16.107 18.331  1.00 44.09  ? 322  ASP A CB    1 
ATOM   2510 C  CG    . ASP A 1 322 ? 2.816  15.672 17.924  1.00 100.00 ? 322  ASP A CG    1 
ATOM   2511 O  OD1   . ASP A 1 322 ? 2.566  14.945 16.958  1.00 100.00 ? 322  ASP A OD1   1 
ATOM   2512 O  OD2   . ASP A 1 322 ? 1.847  16.187 18.683  1.00 66.62  ? 322  ASP A OD2   1 
ATOM   2513 N  N     . GLU A 1 323 ? 7.532  16.089 18.465  1.00 65.40  ? 323  GLU A N     1 
ATOM   2514 C  CA    . GLU A 1 323 ? 8.843  16.677 18.144  1.00 30.39  ? 323  GLU A CA    1 
ATOM   2515 C  C     . GLU A 1 323 ? 9.839  15.606 17.761  1.00 23.23  ? 323  GLU A C     1 
ATOM   2516 O  O     . GLU A 1 323 ? 10.655 15.777 16.857  1.00 34.78  ? 323  GLU A O     1 
ATOM   2517 C  CB    . GLU A 1 323 ? 9.308  17.448 19.357  1.00 38.15  ? 323  GLU A CB    1 
ATOM   2518 C  CG    . GLU A 1 323 ? 8.564  18.780 19.461  1.00 32.46  ? 323  GLU A CG    1 
ATOM   2519 C  CD    . GLU A 1 323 ? 8.536  19.515 18.123  1.00 53.37  ? 323  GLU A CD    1 
ATOM   2520 O  OE1   . GLU A 1 323 ? 9.527  19.657 17.400  1.00 54.92  ? 323  GLU A OE1   1 
ATOM   2521 O  OE2   . GLU A 1 323 ? 7.337  19.961 17.819  1.00 100.00 ? 323  GLU A OE2   1 
ATOM   2522 N  N     . PHE A 1 324 ? 9.673  14.438 18.382  1.00 22.61  ? 324  PHE A N     1 
ATOM   2523 C  CA    . PHE A 1 324 ? 10.487 13.273 18.083  1.00 32.08  ? 324  PHE A CA    1 
ATOM   2524 C  C     . PHE A 1 324 ? 10.348 12.823 16.606  1.00 58.98  ? 324  PHE A C     1 
ATOM   2525 O  O     . PHE A 1 324 ? 11.312 12.463 15.891  1.00 33.41  ? 324  PHE A O     1 
ATOM   2526 C  CB    . PHE A 1 324 ? 10.129 12.121 19.035  1.00 26.51  ? 324  PHE A CB    1 
ATOM   2527 C  CG    . PHE A 1 324 ? 11.168 11.025 18.986  1.00 42.78  ? 324  PHE A CG    1 
ATOM   2528 C  CD1   . PHE A 1 324 ? 12.521 11.351 18.995  1.00 51.88  ? 324  PHE A CD1   1 
ATOM   2529 C  CD2   . PHE A 1 324 ? 10.838 9.673  18.930  1.00 37.03  ? 324  PHE A CD2   1 
ATOM   2530 C  CE1   . PHE A 1 324 ? 13.494 10.352 18.916  1.00 41.51  ? 324  PHE A CE1   1 
ATOM   2531 C  CE2   . PHE A 1 324 ? 11.798 8.656  18.892  1.00 35.96  ? 324  PHE A CE2   1 
ATOM   2532 C  CZ    . PHE A 1 324 ? 13.146 8.997  18.909  1.00 33.67  ? 324  PHE A CZ    1 
ATOM   2533 N  N     . LYS A 1 325 ? 9.087  12.826 16.187  1.00 93.22  ? 325  LYS A N     1 
ATOM   2534 C  CA    . LYS A 1 325 ? 8.661  12.466 14.848  1.00 100.00 ? 325  LYS A CA    1 
ATOM   2535 C  C     . LYS A 1 325 ? 9.398  13.347 13.866  1.00 42.64  ? 325  LYS A C     1 
ATOM   2536 O  O     . LYS A 1 325 ? 10.034 12.887 12.905  1.00 36.13  ? 325  LYS A O     1 
ATOM   2537 C  CB    . LYS A 1 325 ? 7.160  12.734 14.672  1.00 53.93  ? 325  LYS A CB    1 
ATOM   2538 C  CG    . LYS A 1 325 ? 6.188  11.772 15.365  1.00 100.00 ? 325  LYS A CG    1 
ATOM   2539 C  CD    . LYS A 1 325 ? 4.711  12.193 15.164  1.00 100.00 ? 325  LYS A CD    1 
ATOM   2540 C  CE    . LYS A 1 325 ? 3.689  11.705 16.219  1.00 100.00 ? 325  LYS A CE    1 
ATOM   2541 N  NZ    . LYS A 1 325 ? 2.477  12.547 16.347  1.00 95.51  ? 325  LYS A NZ    1 
ATOM   2542 N  N     . ILE A 1 326 ? 9.256  14.636 14.168  1.00 29.16  ? 326  ILE A N     1 
ATOM   2543 C  CA    . ILE A 1 326 ? 9.861  15.663 13.422  1.00 26.97  ? 326  ILE A CA    1 
ATOM   2544 C  C     . ILE A 1 326 ? 11.349 15.472 13.370  1.00 34.16  ? 326  ILE A C     1 
ATOM   2545 O  O     . ILE A 1 326 ? 11.956 15.592 12.331  1.00 41.89  ? 326  ILE A O     1 
ATOM   2546 C  CB    . ILE A 1 326 ? 9.676  16.916 14.159  1.00 28.60  ? 326  ILE A CB    1 
ATOM   2547 C  CG1   . ILE A 1 326 ? 8.295  17.452 13.847  1.00 41.38  ? 326  ILE A CG1   1 
ATOM   2548 C  CG2   . ILE A 1 326 ? 10.759 17.757 13.575  1.00 42.14  ? 326  ILE A CG2   1 
ATOM   2549 C  CD1   . ILE A 1 326 ? 8.098  18.922 14.157  1.00 42.64  ? 326  ILE A CD1   1 
ATOM   2550 N  N     . THR A 1 327 ? 11.916 15.170 14.514  1.00 31.38  ? 327  THR A N     1 
ATOM   2551 C  CA    . THR A 1 327 ? 13.330 14.967 14.583  1.00 28.43  ? 327  THR A CA    1 
ATOM   2552 C  C     . THR A 1 327 ? 13.766 13.771 13.779  1.00 36.82  ? 327  THR A C     1 
ATOM   2553 O  O     . THR A 1 327 ? 14.740 13.733 12.995  1.00 32.38  ? 327  THR A O     1 
ATOM   2554 C  CB    . THR A 1 327 ? 13.786 14.835 16.034  1.00 32.81  ? 327  THR A CB    1 
ATOM   2555 O  OG1   . THR A 1 327 ? 13.543 16.076 16.670  1.00 36.69  ? 327  THR A OG1   1 
ATOM   2556 C  CG2   . THR A 1 327 ? 15.272 14.473 16.095  1.00 30.41  ? 327  THR A CG2   1 
ATOM   2557 N  N     . ARG A 1 328 ? 13.015 12.751 14.003  1.00 38.39  ? 328  ARG A N     1 
ATOM   2558 C  CA    . ARG A 1 328 ? 13.308 11.538 13.305  1.00 32.55  ? 328  ARG A CA    1 
ATOM   2559 C  C     . ARG A 1 328 ? 13.118 11.780 11.812  1.00 41.16  ? 328  ARG A C     1 
ATOM   2560 O  O     . ARG A 1 328 ? 13.842 11.294 10.968  1.00 37.21  ? 328  ARG A O     1 
ATOM   2561 C  CB    . ARG A 1 328 ? 12.398 10.477 13.902  1.00 42.85  ? 328  ARG A CB    1 
ATOM   2562 C  CG    . ARG A 1 328 ? 13.192 9.494  14.750  1.00 46.90  ? 328  ARG A CG    1 
ATOM   2563 C  CD    . ARG A 1 328 ? 12.710 8.059  14.624  1.00 75.84  ? 328  ARG A CD    1 
ATOM   2564 N  NE    . ARG A 1 328 ? 11.564 7.815  15.499  1.00 100.00 ? 328  ARG A NE    1 
ATOM   2565 C  CZ    . ARG A 1 328 ? 11.359 6.691  16.179  1.00 100.00 ? 328  ARG A CZ    1 
ATOM   2566 N  NH1   . ARG A 1 328 ? 12.205 5.671  16.091  1.00 42.14  ? 328  ARG A NH1   1 
ATOM   2567 N  NH2   . ARG A 1 328 ? 10.279 6.578  16.955  1.00 70.64  ? 328  ARG A NH2   1 
ATOM   2568 N  N     . GLN A 1 329 ? 12.166 12.623 11.485  1.00 49.64  ? 329  GLN A N     1 
ATOM   2569 C  CA    . GLN A 1 329 ? 11.928 12.918 10.113  1.00 39.33  ? 329  GLN A CA    1 
ATOM   2570 C  C     . GLN A 1 329 ? 13.094 13.600 9.413   1.00 75.20  ? 329  GLN A C     1 
ATOM   2571 O  O     . GLN A 1 329 ? 13.488 13.291 8.286   1.00 41.33  ? 329  GLN A O     1 
ATOM   2572 C  CB    . GLN A 1 329 ? 10.645 13.710 9.941   1.00 52.41  ? 329  GLN A CB    1 
ATOM   2573 C  CG    . GLN A 1 329 ? 9.991  13.404 8.586   1.00 100.00 ? 329  GLN A CG    1 
ATOM   2574 C  CD    . GLN A 1 329 ? 8.944  14.444 8.255   1.00 100.00 ? 329  GLN A CD    1 
ATOM   2575 O  OE1   . GLN A 1 329 ? 8.448  14.524 7.107   1.00 100.00 ? 329  GLN A OE1   1 
ATOM   2576 N  NE2   . GLN A 1 329 ? 8.622  15.259 9.276   1.00 100.00 ? 329  GLN A NE2   1 
ATOM   2577 N  N     . ALA A 1 330 ? 13.644 14.570 10.066  1.00 30.96  ? 330  ALA A N     1 
ATOM   2578 C  CA    . ALA A 1 330 ? 14.766 15.282 9.488   1.00 32.29  ? 330  ALA A CA    1 
ATOM   2579 C  C     . ALA A 1 330 ? 15.976 14.362 9.323   1.00 26.16  ? 330  ALA A C     1 
ATOM   2580 O  O     . ALA A 1 330 ? 16.723 14.488 8.354   1.00 37.10  ? 330  ALA A O     1 
ATOM   2581 C  CB    . ALA A 1 330 ? 15.122 16.492 10.354  1.00 40.29  ? 330  ALA A CB    1 
ATOM   2582 N  N     . MET A 1 331 ? 16.190 13.454 10.270  1.00 34.80  ? 331  MET A N     1 
ATOM   2583 C  CA    . MET A 1 331 ? 17.345 12.566 10.164  1.00 30.44  ? 331  MET A CA    1 
ATOM   2584 C  C     . MET A 1 331 ? 17.275 11.786 8.888   1.00 38.35  ? 331  MET A C     1 
ATOM   2585 O  O     . MET A 1 331 ? 18.273 11.471 8.238   1.00 36.32  ? 331  MET A O     1 
ATOM   2586 C  CB    . MET A 1 331 ? 17.424 11.593 11.342  1.00 29.79  ? 331  MET A CB    1 
ATOM   2587 C  CG    . MET A 1 331 ? 18.048 12.221 12.577  1.00 58.78  ? 331  MET A CG    1 
ATOM   2588 S  SD    . MET A 1 331 ? 18.328 11.082 13.973  1.00 49.83  ? 331  MET A SD    1 
ATOM   2589 C  CE    . MET A 1 331 ? 17.035 11.678 15.096  1.00 63.79  ? 331  MET A CE    1 
ATOM   2590 N  N     . ASP A 1 332 ? 16.040 11.452 8.581   1.00 51.82  ? 332  ASP A N     1 
ATOM   2591 C  CA    . ASP A 1 332 ? 15.678 10.725 7.389   1.00 40.79  ? 332  ASP A CA    1 
ATOM   2592 C  C     . ASP A 1 332 ? 16.107 11.489 6.132   1.00 37.85  ? 332  ASP A C     1 
ATOM   2593 O  O     . ASP A 1 332 ? 16.847 11.021 5.248   1.00 51.23  ? 332  ASP A O     1 
ATOM   2594 C  CB    . ASP A 1 332 ? 14.138 10.605 7.391   1.00 57.19  ? 332  ASP A CB    1 
ATOM   2595 C  CG    . ASP A 1 332 ? 13.682 9.468  8.227   1.00 37.51  ? 332  ASP A CG    1 
ATOM   2596 O  OD1   . ASP A 1 332 ? 14.566 8.493  8.263   1.00 67.82  ? 332  ASP A OD1   1 
ATOM   2597 O  OD2   . ASP A 1 332 ? 12.629 9.472  8.816   1.00 100.00 ? 332  ASP A OD2   1 
ATOM   2598 N  N     . ILE A 1 333 ? 15.588 12.705 6.062   1.00 34.58  ? 333  ILE A N     1 
ATOM   2599 C  CA    . ILE A 1 333 ? 15.846 13.574 4.956   1.00 24.62  ? 333  ILE A CA    1 
ATOM   2600 C  C     . ILE A 1 333 ? 17.326 13.812 4.723   1.00 49.86  ? 333  ILE A C     1 
ATOM   2601 O  O     . ILE A 1 333 ? 17.878 13.558 3.649   1.00 47.98  ? 333  ILE A O     1 
ATOM   2602 C  CB    . ILE A 1 333 ? 15.099 14.865 5.089   1.00 36.77  ? 333  ILE A CB    1 
ATOM   2603 C  CG1   . ILE A 1 333 ? 13.588 14.569 4.955   1.00 38.91  ? 333  ILE A CG1   1 
ATOM   2604 C  CG2   . ILE A 1 333 ? 15.646 15.844 4.037   1.00 44.68  ? 333  ILE A CG2   1 
ATOM   2605 C  CD1   . ILE A 1 333 ? 12.679 15.659 5.530   1.00 35.28  ? 333  ILE A CD1   1 
ATOM   2606 N  N     . VAL A 1 334 ? 17.960 14.314 5.753   1.00 63.60  ? 334  VAL A N     1 
ATOM   2607 C  CA    . VAL A 1 334 ? 19.368 14.556 5.658   1.00 33.02  ? 334  VAL A CA    1 
ATOM   2608 C  C     . VAL A 1 334 ? 19.999 13.244 5.224   1.00 28.72  ? 334  VAL A C     1 
ATOM   2609 O  O     . VAL A 1 334 ? 20.938 13.192 4.434   1.00 39.16  ? 334  VAL A O     1 
ATOM   2610 C  CB    . VAL A 1 334 ? 19.922 15.179 6.984   1.00 38.49  ? 334  VAL A CB    1 
ATOM   2611 C  CG1   . VAL A 1 334 ? 21.465 15.112 7.067   1.00 38.41  ? 334  VAL A CG1   1 
ATOM   2612 C  CG2   . VAL A 1 334 ? 19.446 16.636 7.087   1.00 24.80  ? 334  VAL A CG2   1 
ATOM   2613 N  N     . GLY A 1 335 ? 19.476 12.132 5.723   1.00 44.71  ? 335  GLY A N     1 
ATOM   2614 C  CA    . GLY A 1 335 ? 20.037 10.874 5.277   1.00 32.26  ? 335  GLY A CA    1 
ATOM   2615 C  C     . GLY A 1 335 ? 20.674 10.022 6.342   1.00 60.12  ? 335  GLY A C     1 
ATOM   2616 O  O     . GLY A 1 335 ? 21.656 9.324  6.095   1.00 56.42  ? 335  GLY A O     1 
ATOM   2617 N  N     . PHE A 1 336 ? 20.128 10.054 7.534   1.00 49.59  ? 336  PHE A N     1 
ATOM   2618 C  CA    . PHE A 1 336 ? 20.740 9.180  8.510   1.00 53.04  ? 336  PHE A CA    1 
ATOM   2619 C  C     . PHE A 1 336 ? 20.142 7.778  8.403   1.00 44.43  ? 336  PHE A C     1 
ATOM   2620 O  O     . PHE A 1 336 ? 18.928 7.572  8.442   1.00 42.95  ? 336  PHE A O     1 
ATOM   2621 C  CB    . PHE A 1 336 ? 20.617 9.687  9.964   1.00 79.04  ? 336  PHE A CB    1 
ATOM   2622 C  CG    . PHE A 1 336 ? 21.611 10.760 10.350  1.00 32.75  ? 336  PHE A CG    1 
ATOM   2623 C  CD1   . PHE A 1 336 ? 21.342 12.098 10.068  1.00 100.00 ? 336  PHE A CD1   1 
ATOM   2624 C  CD2   . PHE A 1 336 ? 22.822 10.448 10.981  1.00 42.10  ? 336  PHE A CD2   1 
ATOM   2625 C  CE1   . PHE A 1 336 ? 22.242 13.101 10.427  1.00 30.70  ? 336  PHE A CE1   1 
ATOM   2626 C  CE2   . PHE A 1 336 ? 23.743 11.441 11.335  1.00 48.73  ? 336  PHE A CE2   1 
ATOM   2627 C  CZ    . PHE A 1 336 ? 23.445 12.774 11.053  1.00 29.80  ? 336  PHE A CZ    1 
ATOM   2628 N  N     . SER A 1 337 ? 21.003 6.804  8.335   1.00 45.07  ? 337  SER A N     1 
ATOM   2629 C  CA    . SER A 1 337 ? 20.518 5.462  8.271   1.00 44.28  ? 337  SER A CA    1 
ATOM   2630 C  C     . SER A 1 337 ? 19.899 5.071  9.564   1.00 40.81  ? 337  SER A C     1 
ATOM   2631 O  O     . SER A 1 337 ? 20.134 5.660  10.604  1.00 44.59  ? 337  SER A O     1 
ATOM   2632 C  CB    . SER A 1 337 ? 21.521 4.463  7.768   1.00 32.58  ? 337  SER A CB    1 
ATOM   2633 O  OG    . SER A 1 337 ? 22.488 4.187  8.733   1.00 45.85  ? 337  SER A OG    1 
ATOM   2634 N  N     . GLN A 1 338 ? 19.035 4.108  9.430   1.00 65.59  ? 338  GLN A N     1 
ATOM   2635 C  CA    . GLN A 1 338 ? 18.235 3.549  10.491  1.00 73.69  ? 338  GLN A CA    1 
ATOM   2636 C  C     . GLN A 1 338 ? 19.086 3.047  11.608  1.00 53.28  ? 338  GLN A C     1 
ATOM   2637 O  O     . GLN A 1 338 ? 18.683 3.088  12.777  1.00 53.27  ? 338  GLN A O     1 
ATOM   2638 C  CB    . GLN A 1 338 ? 17.416 2.391  9.921   1.00 100.00 ? 338  GLN A CB    1 
ATOM   2639 C  CG    . GLN A 1 338 ? 16.294 2.919  9.023   1.00 100.00 ? 338  GLN A CG    1 
ATOM   2640 C  CD    . GLN A 1 338 ? 15.427 3.905  9.784   1.00 100.00 ? 338  GLN A CD    1 
ATOM   2641 O  OE1   . GLN A 1 338 ? 14.677 3.523  10.696  1.00 100.00 ? 338  GLN A OE1   1 
ATOM   2642 N  NE2   . GLN A 1 338 ? 15.545 5.188  9.429   1.00 100.00 ? 338  GLN A NE2   1 
ATOM   2643 N  N     . GLU A 1 339 ? 20.222 2.535  11.160  1.00 31.52  ? 339  GLU A N     1 
ATOM   2644 C  CA    . GLU A 1 339 ? 21.256 2.016  11.991  1.00 62.89  ? 339  GLU A CA    1 
ATOM   2645 C  C     . GLU A 1 339 ? 21.867 3.185  12.734  1.00 37.49  ? 339  GLU A C     1 
ATOM   2646 O  O     . GLU A 1 339 ? 22.067 3.174  13.962  1.00 100.00 ? 339  GLU A O     1 
ATOM   2647 C  CB    . GLU A 1 339 ? 22.356 1.404  11.119  1.00 55.99  ? 339  GLU A CB    1 
ATOM   2648 C  CG    . GLU A 1 339 ? 21.878 0.265  10.207  1.00 100.00 ? 339  GLU A CG    1 
ATOM   2649 C  CD    . GLU A 1 339 ? 21.440 0.754  8.836   1.00 100.00 ? 339  GLU A CD    1 
ATOM   2650 O  OE1   . GLU A 1 339 ? 22.442 0.810  7.943   1.00 100.00 ? 339  GLU A OE1   1 
ATOM   2651 O  OE2   . GLU A 1 339 ? 20.270 1.068  8.586   1.00 100.00 ? 339  GLU A OE2   1 
ATOM   2652 N  N     . GLU A 1 340 ? 22.169 4.209  11.965  1.00 38.56  ? 340  GLU A N     1 
ATOM   2653 C  CA    . GLU A 1 340 ? 22.755 5.336  12.602  1.00 40.84  ? 340  GLU A CA    1 
ATOM   2654 C  C     . GLU A 1 340 ? 21.768 5.864  13.574  1.00 36.63  ? 340  GLU A C     1 
ATOM   2655 O  O     . GLU A 1 340 ? 22.060 6.048  14.742  1.00 43.45  ? 340  GLU A O     1 
ATOM   2656 C  CB    . GLU A 1 340 ? 23.294 6.343  11.596  1.00 66.01  ? 340  GLU A CB    1 
ATOM   2657 C  CG    . GLU A 1 340 ? 24.512 5.734  10.866  1.00 31.72  ? 340  GLU A CG    1 
ATOM   2658 C  CD    . GLU A 1 340 ? 25.027 6.545  9.696   1.00 36.46  ? 340  GLU A CD    1 
ATOM   2659 O  OE1   . GLU A 1 340 ? 24.145 7.372  9.144   1.00 51.69  ? 340  GLU A OE1   1 
ATOM   2660 O  OE2   . GLU A 1 340 ? 26.188 6.442  9.320   1.00 54.38  ? 340  GLU A OE2   1 
ATOM   2661 N  N     . GLN A 1 341 ? 20.563 6.016  13.105  1.00 36.41  ? 341  GLN A N     1 
ATOM   2662 C  CA    . GLN A 1 341 ? 19.564 6.521  13.981  1.00 32.60  ? 341  GLN A CA    1 
ATOM   2663 C  C     . GLN A 1 341 ? 19.405 5.749  15.304  1.00 47.49  ? 341  GLN A C     1 
ATOM   2664 O  O     . GLN A 1 341 ? 19.332 6.301  16.403  1.00 33.55  ? 341  GLN A O     1 
ATOM   2665 C  CB    . GLN A 1 341 ? 18.328 6.632  13.144  1.00 26.01  ? 341  GLN A CB    1 
ATOM   2666 C  CG    . GLN A 1 341 ? 18.576 7.636  12.033  1.00 27.12  ? 341  GLN A CG    1 
ATOM   2667 C  CD    . GLN A 1 341 ? 17.283 7.949  11.343  1.00 41.00  ? 341  GLN A CD    1 
ATOM   2668 O  OE1   . GLN A 1 341 ? 16.198 8.004  11.987  1.00 49.55  ? 341  GLN A OE1   1 
ATOM   2669 N  NE2   . GLN A 1 341 ? 17.376 8.179  10.034  1.00 40.99  ? 341  GLN A NE2   1 
ATOM   2670 N  N     . MET A 1 342 ? 19.390 4.448  15.198  1.00 44.48  ? 342  MET A N     1 
ATOM   2671 C  CA    . MET A 1 342 ? 19.241 3.603  16.357  1.00 40.25  ? 342  MET A CA    1 
ATOM   2672 C  C     . MET A 1 342 ? 20.370 3.791  17.336  1.00 33.41  ? 342  MET A C     1 
ATOM   2673 O  O     . MET A 1 342 ? 20.174 3.938  18.558  1.00 44.47  ? 342  MET A O     1 
ATOM   2674 C  CB    . MET A 1 342 ? 19.197 2.130  15.927  1.00 34.26  ? 342  MET A CB    1 
ATOM   2675 C  CG    . MET A 1 342 ? 18.533 1.213  16.956  1.00 100.00 ? 342  MET A CG    1 
ATOM   2676 S  SD    . MET A 1 342 ? 17.735 2.057  18.373  1.00 100.00 ? 342  MET A SD    1 
ATOM   2677 C  CE    . MET A 1 342 ? 17.049 0.618  19.272  1.00 100.00 ? 342  MET A CE    1 
ATOM   2678 N  N     . SER A 1 343 ? 21.559 3.748  16.757  1.00 39.10  ? 343  SER A N     1 
ATOM   2679 C  CA    . SER A 1 343 ? 22.775 3.917  17.501  1.00 34.63  ? 343  SER A CA    1 
ATOM   2680 C  C     . SER A 1 343 ? 22.840 5.273  18.232  1.00 41.65  ? 343  SER A C     1 
ATOM   2681 O  O     . SER A 1 343 ? 23.351 5.352  19.342  1.00 36.37  ? 343  SER A O     1 
ATOM   2682 C  CB    . SER A 1 343 ? 23.964 3.744  16.587  1.00 41.60  ? 343  SER A CB    1 
ATOM   2683 O  OG    . SER A 1 343 ? 24.112 2.396  16.255  1.00 46.50  ? 343  SER A OG    1 
ATOM   2684 N  N     . ILE A 1 344 ? 22.359 6.341  17.577  1.00 32.13  ? 344  ILE A N     1 
ATOM   2685 C  CA    . ILE A 1 344 ? 22.315 7.667  18.170  1.00 36.59  ? 344  ILE A CA    1 
ATOM   2686 C  C     . ILE A 1 344 ? 21.397 7.574  19.406  1.00 56.15  ? 344  ILE A C     1 
ATOM   2687 O  O     . ILE A 1 344 ? 21.681 8.094  20.467  1.00 28.36  ? 344  ILE A O     1 
ATOM   2688 C  CB    . ILE A 1 344 ? 21.795 8.680  17.124  1.00 34.24  ? 344  ILE A CB    1 
ATOM   2689 C  CG1   . ILE A 1 344 ? 22.824 8.912  16.042  1.00 28.98  ? 344  ILE A CG1   1 
ATOM   2690 C  CG2   . ILE A 1 344 ? 21.429 10.042 17.708  1.00 22.96  ? 344  ILE A CG2   1 
ATOM   2691 C  CD1   . ILE A 1 344 ? 22.240 9.769  14.911  1.00 22.53  ? 344  ILE A CD1   1 
ATOM   2692 N  N     . PHE A 1 345 ? 20.290 6.853  19.271  1.00 36.95  ? 345  PHE A N     1 
ATOM   2693 C  CA    . PHE A 1 345 ? 19.322 6.679  20.336  1.00 33.30  ? 345  PHE A CA    1 
ATOM   2694 C  C     . PHE A 1 345 ? 19.837 5.833  21.427  1.00 34.36  ? 345  PHE A C     1 
ATOM   2695 O  O     . PHE A 1 345 ? 19.526 5.988  22.599  1.00 32.85  ? 345  PHE A O     1 
ATOM   2696 C  CB    . PHE A 1 345 ? 18.116 5.975  19.754  1.00 47.30  ? 345  PHE A CB    1 
ATOM   2697 C  CG    . PHE A 1 345 ? 17.543 6.979  18.840  1.00 40.54  ? 345  PHE A CG    1 
ATOM   2698 C  CD1   . PHE A 1 345 ? 17.691 8.316  19.199  1.00 39.63  ? 345  PHE A CD1   1 
ATOM   2699 C  CD2   . PHE A 1 345 ? 16.960 6.640  17.621  1.00 78.19  ? 345  PHE A CD2   1 
ATOM   2700 C  CE1   . PHE A 1 345 ? 17.197 9.330  18.382  1.00 57.74  ? 345  PHE A CE1   1 
ATOM   2701 C  CE2   . PHE A 1 345 ? 16.476 7.644  16.784  1.00 42.77  ? 345  PHE A CE2   1 
ATOM   2702 C  CZ    . PHE A 1 345 ? 16.596 8.981  17.173  1.00 66.46  ? 345  PHE A CZ    1 
ATOM   2703 N  N     . LYS A 1 346 ? 20.572 4.866  20.985  1.00 33.21  ? 346  LYS A N     1 
ATOM   2704 C  CA    . LYS A 1 346 ? 21.174 3.967  21.909  1.00 38.74  ? 346  LYS A CA    1 
ATOM   2705 C  C     . LYS A 1 346 ? 22.077 4.746  22.857  1.00 37.55  ? 346  LYS A C     1 
ATOM   2706 O  O     . LYS A 1 346 ? 22.179 4.433  24.040  1.00 55.54  ? 346  LYS A O     1 
ATOM   2707 C  CB    . LYS A 1 346 ? 21.963 2.907  21.167  1.00 48.52  ? 346  LYS A CB    1 
ATOM   2708 C  CG    . LYS A 1 346 ? 21.127 1.719  20.718  1.00 30.40  ? 346  LYS A CG    1 
ATOM   2709 C  CD    . LYS A 1 346 ? 21.925 0.462  20.943  1.00 63.05  ? 346  LYS A CD    1 
ATOM   2710 C  CE    . LYS A 1 346 ? 21.575 -0.654 19.999  1.00 94.82  ? 346  LYS A CE    1 
ATOM   2711 N  NZ    . LYS A 1 346 ? 21.804 -0.285 18.600  1.00 47.98  ? 346  LYS A NZ    1 
ATOM   2712 N  N     . ILE A 1 347 ? 22.736 5.756  22.315  1.00 34.38  ? 347  ILE A N     1 
ATOM   2713 C  CA    . ILE A 1 347 ? 23.672 6.589  23.055  1.00 27.91  ? 347  ILE A CA    1 
ATOM   2714 C  C     . ILE A 1 347 ? 22.941 7.499  23.997  1.00 24.27  ? 347  ILE A C     1 
ATOM   2715 O  O     . ILE A 1 347 ? 23.313 7.651  25.134  1.00 30.06  ? 347  ILE A O     1 
ATOM   2716 C  CB    . ILE A 1 347 ? 24.589 7.346  22.118  1.00 44.16  ? 347  ILE A CB    1 
ATOM   2717 C  CG1   . ILE A 1 347 ? 25.448 6.292  21.430  1.00 40.73  ? 347  ILE A CG1   1 
ATOM   2718 C  CG2   . ILE A 1 347 ? 25.468 8.312  22.911  1.00 35.24  ? 347  ILE A CG2   1 
ATOM   2719 C  CD1   . ILE A 1 347 ? 26.433 6.797  20.386  1.00 24.64  ? 347  ILE A CD1   1 
ATOM   2720 N  N     . ILE A 1 348 ? 21.870 8.045  23.492  1.00 29.08  ? 348  ILE A N     1 
ATOM   2721 C  CA    . ILE A 1 348 ? 21.038 8.886  24.282  1.00 28.44  ? 348  ILE A CA    1 
ATOM   2722 C  C     . ILE A 1 348 ? 20.561 8.067  25.469  1.00 31.49  ? 348  ILE A C     1 
ATOM   2723 O  O     . ILE A 1 348 ? 20.507 8.525  26.617  1.00 32.53  ? 348  ILE A O     1 
ATOM   2724 C  CB    . ILE A 1 348 ? 19.901 9.435  23.430  1.00 39.80  ? 348  ILE A CB    1 
ATOM   2725 C  CG1   . ILE A 1 348 ? 20.462 10.447 22.430  1.00 32.19  ? 348  ILE A CG1   1 
ATOM   2726 C  CG2   . ILE A 1 348 ? 18.846 10.112 24.306  1.00 28.38  ? 348  ILE A CG2   1 
ATOM   2727 C  CD1   . ILE A 1 348 ? 21.302 11.528 23.118  1.00 30.42  ? 348  ILE A CD1   1 
ATOM   2728 N  N     . ALA A 1 349 ? 20.262 6.812  25.171  1.00 35.90  ? 349  ALA A N     1 
ATOM   2729 C  CA    . ALA A 1 349 ? 19.760 5.879  26.152  1.00 34.12  ? 349  ALA A CA    1 
ATOM   2730 C  C     . ALA A 1 349 ? 20.808 5.519  27.160  1.00 34.68  ? 349  ALA A C     1 
ATOM   2731 O  O     . ALA A 1 349 ? 20.603 5.702  28.366  1.00 34.69  ? 349  ALA A O     1 
ATOM   2732 C  CB    . ALA A 1 349 ? 19.198 4.637  25.475  1.00 42.94  ? 349  ALA A CB    1 
ATOM   2733 N  N     . GLY A 1 350 ? 21.944 5.033  26.667  1.00 26.05  ? 350  GLY A N     1 
ATOM   2734 C  CA    . GLY A 1 350 ? 23.046 4.666  27.564  1.00 41.98  ? 350  GLY A CA    1 
ATOM   2735 C  C     . GLY A 1 350 ? 23.411 5.783  28.554  1.00 46.11  ? 350  GLY A C     1 
ATOM   2736 O  O     . GLY A 1 350 ? 23.659 5.554  29.755  1.00 39.60  ? 350  GLY A O     1 
ATOM   2737 N  N     . ILE A 1 351 ? 23.483 6.993  28.028  1.00 33.57  ? 351  ILE A N     1 
ATOM   2738 C  CA    . ILE A 1 351 ? 23.837 8.128  28.847  1.00 29.96  ? 351  ILE A CA    1 
ATOM   2739 C  C     . ILE A 1 351 ? 22.852 8.174  29.978  1.00 32.02  ? 351  ILE A C     1 
ATOM   2740 O  O     . ILE A 1 351 ? 23.198 8.360  31.125  1.00 38.49  ? 351  ILE A O     1 
ATOM   2741 C  CB    . ILE A 1 351 ? 23.792 9.446  28.070  1.00 31.05  ? 351  ILE A CB    1 
ATOM   2742 C  CG1   . ILE A 1 351 ? 25.008 9.638  27.133  1.00 37.64  ? 351  ILE A CG1   1 
ATOM   2743 C  CG2   . ILE A 1 351 ? 23.669 10.596 29.037  1.00 26.27  ? 351  ILE A CG2   1 
ATOM   2744 C  CD1   . ILE A 1 351 ? 24.934 10.793 26.118  1.00 19.58  ? 351  ILE A CD1   1 
ATOM   2745 N  N     . LEU A 1 352 ? 21.595 7.961  29.639  1.00 35.35  ? 352  LEU A N     1 
ATOM   2746 C  CA    . LEU A 1 352 ? 20.547 7.971  30.660  1.00 42.94  ? 352  LEU A CA    1 
ATOM   2747 C  C     . LEU A 1 352 ? 20.845 6.930  31.741  1.00 36.12  ? 352  LEU A C     1 
ATOM   2748 O  O     . LEU A 1 352 ? 20.737 7.217  32.928  1.00 31.79  ? 352  LEU A O     1 
ATOM   2749 C  CB    . LEU A 1 352 ? 19.097 7.841  30.080  1.00 51.65  ? 352  LEU A CB    1 
ATOM   2750 C  CG    . LEU A 1 352 ? 18.543 9.119  29.422  1.00 36.26  ? 352  LEU A CG    1 
ATOM   2751 C  CD1   . LEU A 1 352 ? 17.146 8.954  28.801  1.00 26.53  ? 352  LEU A CD1   1 
ATOM   2752 C  CD2   . LEU A 1 352 ? 18.558 10.267 30.426  1.00 32.82  ? 352  LEU A CD2   1 
ATOM   2753 N  N     . HIS A 1 353 ? 21.231 5.747  31.307  1.00 37.14  ? 353  HIS A N     1 
ATOM   2754 C  CA    . HIS A 1 353 ? 21.590 4.640  32.187  1.00 40.64  ? 353  HIS A CA    1 
ATOM   2755 C  C     . HIS A 1 353 ? 22.782 4.961  33.056  1.00 58.02  ? 353  HIS A C     1 
ATOM   2756 O  O     . HIS A 1 353 ? 22.736 4.678  34.243  1.00 34.60  ? 353  HIS A O     1 
ATOM   2757 C  CB    . HIS A 1 353 ? 21.824 3.340  31.395  1.00 42.15  ? 353  HIS A CB    1 
ATOM   2758 C  CG    . HIS A 1 353 ? 20.497 2.852  30.859  1.00 33.40  ? 353  HIS A CG    1 
ATOM   2759 N  ND1   . HIS A 1 353 ? 19.358 2.861  31.671  1.00 63.77  ? 353  HIS A ND1   1 
ATOM   2760 C  CD2   . HIS A 1 353 ? 20.133 2.368  29.629  1.00 72.31  ? 353  HIS A CD2   1 
ATOM   2761 C  CE1   . HIS A 1 353 ? 18.348 2.401  30.924  1.00 100.00 ? 353  HIS A CE1   1 
ATOM   2762 N  NE2   . HIS A 1 353 ? 18.772 2.094  29.691  1.00 39.14  ? 353  HIS A NE2   1 
ATOM   2763 N  N     . LEU A 1 354 ? 23.827 5.553  32.463  1.00 33.28  ? 354  LEU A N     1 
ATOM   2764 C  CA    . LEU A 1 354 ? 25.020 5.889  33.207  1.00 30.08  ? 354  LEU A CA    1 
ATOM   2765 C  C     . LEU A 1 354 ? 24.653 6.790  34.314  1.00 25.91  ? 354  LEU A C     1 
ATOM   2766 O  O     . LEU A 1 354 ? 25.234 6.810  35.369  1.00 44.93  ? 354  LEU A O     1 
ATOM   2767 C  CB    . LEU A 1 354 ? 26.061 6.636  32.365  1.00 41.17  ? 354  LEU A CB    1 
ATOM   2768 C  CG    . LEU A 1 354 ? 26.622 5.847  31.180  1.00 45.71  ? 354  LEU A CG    1 
ATOM   2769 C  CD1   . LEU A 1 354 ? 27.637 6.696  30.396  1.00 23.46  ? 354  LEU A CD1   1 
ATOM   2770 C  CD2   . LEU A 1 354 ? 27.352 4.626  31.708  1.00 32.80  ? 354  LEU A CD2   1 
ATOM   2771 N  N     . GLY A 1 355 ? 23.705 7.605  34.037  1.00 30.31  ? 355  GLY A N     1 
ATOM   2772 C  CA    . GLY A 1 355 ? 23.312 8.557  35.055  1.00 38.27  ? 355  GLY A CA    1 
ATOM   2773 C  C     . GLY A 1 355 ? 22.635 7.883  36.238  1.00 47.93  ? 355  GLY A C     1 
ATOM   2774 O  O     . GLY A 1 355 ? 22.566 8.423  37.329  1.00 33.62  ? 355  GLY A O     1 
ATOM   2775 N  N     . ASN A 1 356 ? 22.134 6.694  35.994  1.00 34.56  ? 356  ASN A N     1 
ATOM   2776 C  CA    . ASN A 1 356 ? 21.421 5.982  37.005  1.00 32.55  ? 356  ASN A CA    1 
ATOM   2777 C  C     . ASN A 1 356 ? 22.275 5.086  37.821  1.00 45.38  ? 356  ASN A C     1 
ATOM   2778 O  O     . ASN A 1 356 ? 21.775 4.391  38.666  1.00 47.06  ? 356  ASN A O     1 
ATOM   2779 C  CB    . ASN A 1 356 ? 20.223 5.263  36.438  1.00 26.84  ? 356  ASN A CB    1 
ATOM   2780 C  CG    . ASN A 1 356 ? 18.965 6.138  36.447  1.00 45.04  ? 356  ASN A CG    1 
ATOM   2781 O  OD1   . ASN A 1 356 ? 18.954 7.324  36.767  1.00 51.85  ? 356  ASN A OD1   1 
ATOM   2782 N  ND2   . ASN A 1 356 ? 17.862 5.524  36.059  1.00 51.04  ? 356  ASN A ND2   1 
ATOM   2783 N  N     . ILE A 1 357 ? 23.561 5.139  37.582  1.00 44.11  ? 357  ILE A N     1 
ATOM   2784 C  CA    . ILE A 1 357 ? 24.507 4.366  38.339  1.00 42.61  ? 357  ILE A CA    1 
ATOM   2785 C  C     . ILE A 1 357 ? 24.695 4.948  39.730  1.00 54.02  ? 357  ILE A C     1 
ATOM   2786 O  O     . ILE A 1 357 ? 25.023 6.129  39.900  1.00 32.05  ? 357  ILE A O     1 
ATOM   2787 C  CB    . ILE A 1 357 ? 25.845 4.312  37.606  1.00 55.67  ? 357  ILE A CB    1 
ATOM   2788 C  CG1   . ILE A 1 357 ? 25.801 3.152  36.655  1.00 32.64  ? 357  ILE A CG1   1 
ATOM   2789 C  CG2   . ILE A 1 357 ? 27.021 4.156  38.548  1.00 37.97  ? 357  ILE A CG2   1 
ATOM   2790 C  CD1   . ILE A 1 357 ? 26.768 3.275  35.490  1.00 33.60  ? 357  ILE A CD1   1 
ATOM   2791 N  N     . LYS A 1 358 ? 24.464 4.100  40.741  1.00 44.63  ? 358  LYS A N     1 
ATOM   2792 C  CA    . LYS A 1 358 ? 24.706 4.533  42.098  1.00 45.00  ? 358  LYS A CA    1 
ATOM   2793 C  C     . LYS A 1 358 ? 25.931 3.915  42.702  1.00 33.38  ? 358  LYS A C     1 
ATOM   2794 O  O     . LYS A 1 358 ? 26.100 2.691  42.762  1.00 57.95  ? 358  LYS A O     1 
ATOM   2795 C  CB    . LYS A 1 358 ? 23.626 4.503  43.158  1.00 41.62  ? 358  LYS A CB    1 
ATOM   2796 C  CG    . LYS A 1 358 ? 24.336 5.079  44.375  1.00 50.43  ? 358  LYS A CG    1 
ATOM   2797 C  CD    . LYS A 1 358 ? 23.723 4.908  45.764  1.00 100.00 ? 358  LYS A CD    1 
ATOM   2798 C  CE    . LYS A 1 358 ? 24.111 6.034  46.770  1.00 100.00 ? 358  LYS A CE    1 
ATOM   2799 N  NZ    . LYS A 1 358 ? 25.542 6.129  47.186  1.00 97.63  ? 358  LYS A NZ    1 
ATOM   2800 N  N     . PHE A 1 359 ? 26.781 4.780  43.178  1.00 38.27  ? 359  PHE A N     1 
ATOM   2801 C  CA    . PHE A 1 359 ? 27.953 4.277  43.801  1.00 47.28  ? 359  PHE A CA    1 
ATOM   2802 C  C     . PHE A 1 359 ? 27.779 4.289  45.304  1.00 44.52  ? 359  PHE A C     1 
ATOM   2803 O  O     . PHE A 1 359 ? 27.333 5.286  45.867  1.00 57.12  ? 359  PHE A O     1 
ATOM   2804 C  CB    . PHE A 1 359 ? 29.176 5.163  43.463  1.00 44.11  ? 359  PHE A CB    1 
ATOM   2805 C  CG    . PHE A 1 359 ? 29.550 5.124  42.021  1.00 48.18  ? 359  PHE A CG    1 
ATOM   2806 C  CD1   . PHE A 1 359 ? 30.113 3.984  41.448  1.00 100.00 ? 359  PHE A CD1   1 
ATOM   2807 C  CD2   . PHE A 1 359 ? 29.292 6.221  41.204  1.00 74.26  ? 359  PHE A CD2   1 
ATOM   2808 C  CE1   . PHE A 1 359 ? 30.434 3.932  40.091  1.00 67.47  ? 359  PHE A CE1   1 
ATOM   2809 C  CE2   . PHE A 1 359 ? 29.606 6.191  39.847  1.00 37.01  ? 359  PHE A CE2   1 
ATOM   2810 C  CZ    . PHE A 1 359 ? 30.173 5.044  39.288  1.00 68.75  ? 359  PHE A CZ    1 
ATOM   2811 N  N     . GLU A 1 360 ? 28.185 3.209  45.970  1.00 53.86  ? 360  GLU A N     1 
ATOM   2812 C  CA    . GLU A 1 360 ? 28.160 3.251  47.413  1.00 100.00 ? 360  GLU A CA    1 
ATOM   2813 C  C     . GLU A 1 360 ? 29.580 3.010  47.930  1.00 100.00 ? 360  GLU A C     1 
ATOM   2814 O  O     . GLU A 1 360 ? 30.493 2.663  47.144  1.00 43.39  ? 360  GLU A O     1 
ATOM   2815 C  CB    . GLU A 1 360 ? 27.080 2.403  48.120  1.00 100.00 ? 360  GLU A CB    1 
ATOM   2816 C  CG    . GLU A 1 360 ? 25.783 2.225  47.310  1.00 43.77  ? 360  GLU A CG    1 
ATOM   2817 C  CD    . GLU A 1 360 ? 25.578 0.800  46.883  1.00 100.00 ? 360  GLU A CD    1 
ATOM   2818 O  OE1   . GLU A 1 360 ? 25.646 -0.159 47.666  1.00 100.00 ? 360  GLU A OE1   1 
ATOM   2819 O  OE2   . GLU A 1 360 ? 25.321 0.714  45.584  1.00 94.92  ? 360  GLU A OE2   1 
ATOM   2820 N  N     . LYS A 1 361 ? 29.778 3.247  49.239  1.00 60.37  ? 361  LYS A N     1 
ATOM   2821 C  CA    . LYS A 1 361 ? 31.076 3.031  49.871  1.00 100.00 ? 361  LYS A CA    1 
ATOM   2822 C  C     . LYS A 1 361 ? 31.037 1.765  50.659  1.00 43.91  ? 361  LYS A C     1 
ATOM   2823 O  O     . LYS A 1 361 ? 30.748 0.679  50.124  1.00 78.59  ? 361  LYS A O     1 
ATOM   2824 C  CB    . LYS A 1 361 ? 31.483 4.109  50.872  1.00 48.23  ? 361  LYS A CB    1 
ATOM   2825 N  N     . GLY A 1 362 ? 31.344 1.995  51.955  1.00 100.00 ? 362  GLY A N     1 
ATOM   2826 C  CA    . GLY A 1 362 ? 31.389 1.006  53.033  1.00 100.00 ? 362  GLY A CA    1 
ATOM   2827 C  C     . GLY A 1 362 ? 32.720 0.272  53.120  1.00 100.00 ? 362  GLY A C     1 
ATOM   2828 O  O     . GLY A 1 362 ? 33.567 0.650  53.963  1.00 100.00 ? 362  GLY A O     1 
ATOM   2829 N  N     . ALA A 1 363 ? 32.816 -0.765 52.227  1.00 100.00 ? 363  ALA A N     1 
ATOM   2830 C  CA    . ALA A 1 363 ? 33.958 -1.648 52.069  1.00 100.00 ? 363  ALA A CA    1 
ATOM   2831 C  C     . ALA A 1 363 ? 35.078 -1.115 52.946  1.00 100.00 ? 363  ALA A C     1 
ATOM   2832 O  O     . ALA A 1 363 ? 35.416 -1.689 54.004  1.00 100.00 ? 363  ALA A O     1 
ATOM   2833 C  CB    . ALA A 1 363 ? 34.349 -1.716 50.591  1.00 100.00 ? 363  ALA A CB    1 
ATOM   2834 N  N     . GLY A 1 364 ? 35.529 0.080  52.519  1.00 100.00 ? 364  GLY A N     1 
ATOM   2835 C  CA    . GLY A 1 364 ? 36.541 0.887  53.164  1.00 100.00 ? 364  GLY A CA    1 
ATOM   2836 C  C     . GLY A 1 364 ? 36.247 2.343  52.845  1.00 100.00 ? 364  GLY A C     1 
ATOM   2837 O  O     . GLY A 1 364 ? 35.431 2.990  53.535  1.00 100.00 ? 364  GLY A O     1 
ATOM   2838 N  N     . GLU A 1 365 ? 36.907 2.821  51.770  1.00 100.00 ? 365  GLU A N     1 
ATOM   2839 C  CA    . GLU A 1 365 ? 36.753 4.186  51.276  1.00 100.00 ? 365  GLU A CA    1 
ATOM   2840 C  C     . GLU A 1 365 ? 36.531 4.209  49.767  1.00 100.00 ? 365  GLU A C     1 
ATOM   2841 O  O     . GLU A 1 365 ? 35.994 5.174  49.207  1.00 100.00 ? 365  GLU A O     1 
ATOM   2842 C  CB    . GLU A 1 365 ? 37.863 5.138  51.744  1.00 63.24  ? 365  GLU A CB    1 
ATOM   2843 N  N     . GLY A 1 366 ? 36.940 3.100  49.145  1.00 100.00 ? 366  GLY A N     1 
ATOM   2844 C  CA    . GLY A 1 366 ? 36.779 2.913  47.728  1.00 45.64  ? 366  GLY A CA    1 
ATOM   2845 C  C     . GLY A 1 366 ? 35.303 2.702  47.476  1.00 91.82  ? 366  GLY A C     1 
ATOM   2846 O  O     . GLY A 1 366 ? 34.548 2.407  48.400  1.00 68.01  ? 366  GLY A O     1 
ATOM   2847 N  N     . ALA A 1 367 ? 34.900 2.875  46.231  1.00 49.28  ? 367  ALA A N     1 
ATOM   2848 C  CA    . ALA A 1 367 ? 33.508 2.741  45.891  1.00 35.06  ? 367  ALA A CA    1 
ATOM   2849 C  C     . ALA A 1 367 ? 33.177 1.385  45.349  1.00 61.90  ? 367  ALA A C     1 
ATOM   2850 O  O     . ALA A 1 367 ? 34.052 0.668  44.837  1.00 49.81  ? 367  ALA A O     1 
ATOM   2851 C  CB    . ALA A 1 367 ? 33.188 3.773  44.808  1.00 70.90  ? 367  ALA A CB    1 
ATOM   2852 N  N     . VAL A 1 368 ? 31.882 1.074  45.412  1.00 79.93  ? 368  VAL A N     1 
ATOM   2853 C  CA    . VAL A 1 368 ? 31.386 -0.183 44.886  1.00 100.00 ? 368  VAL A CA    1 
ATOM   2854 C  C     . VAL A 1 368 ? 29.981 -0.093 44.294  1.00 32.79  ? 368  VAL A C     1 
ATOM   2855 O  O     . VAL A 1 368 ? 29.200 0.813  44.632  1.00 47.98  ? 368  VAL A O     1 
ATOM   2856 C  CB    . VAL A 1 368 ? 31.545 -1.346 45.851  1.00 65.73  ? 368  VAL A CB    1 
ATOM   2857 C  CG1   . VAL A 1 368 ? 32.520 -2.349 45.233  1.00 100.00 ? 368  VAL A CG1   1 
ATOM   2858 C  CG2   . VAL A 1 368 ? 32.034 -0.835 47.212  1.00 71.06  ? 368  VAL A CG2   1 
ATOM   2859 N  N     . LEU A 1 369 ? 29.702 -1.058 43.422  1.00 44.92  ? 369  LEU A N     1 
ATOM   2860 C  CA    . LEU A 1 369 ? 28.453 -1.175 42.754  1.00 36.74  ? 369  LEU A CA    1 
ATOM   2861 C  C     . LEU A 1 369 ? 27.691 -2.387 43.283  1.00 72.40  ? 369  LEU A C     1 
ATOM   2862 O  O     . LEU A 1 369 ? 27.714 -3.482 42.720  1.00 43.75  ? 369  LEU A O     1 
ATOM   2863 C  CB    . LEU A 1 369 ? 28.774 -1.465 41.298  1.00 73.29  ? 369  LEU A CB    1 
ATOM   2864 C  CG    . LEU A 1 369 ? 28.058 -0.531 40.355  1.00 51.59  ? 369  LEU A CG    1 
ATOM   2865 C  CD1   . LEU A 1 369 ? 28.249 0.880  40.880  1.00 36.74  ? 369  LEU A CD1   1 
ATOM   2866 C  CD2   . LEU A 1 369 ? 28.638 -0.708 38.949  1.00 42.56  ? 369  LEU A CD2   1 
ATOM   2867 N  N     . LYS A 1 370 ? 27.005 -2.231 44.380  1.00 61.30  ? 370  LYS A N     1 
ATOM   2868 C  CA    . LYS A 1 370 ? 26.287 -3.386 44.886  1.00 74.99  ? 370  LYS A CA    1 
ATOM   2869 C  C     . LYS A 1 370 ? 25.284 -3.914 43.854  1.00 35.32  ? 370  LYS A C     1 
ATOM   2870 O  O     . LYS A 1 370 ? 25.159 -5.133 43.655  1.00 79.46  ? 370  LYS A O     1 
ATOM   2871 C  CB    . LYS A 1 370 ? 25.717 -3.178 46.291  1.00 52.30  ? 370  LYS A CB    1 
ATOM   2872 C  CG    . LYS A 1 370 ? 25.265 -4.482 46.945  1.00 100.00 ? 370  LYS A CG    1 
ATOM   2873 C  CD    . LYS A 1 370 ? 26.381 -5.519 47.158  1.00 100.00 ? 370  LYS A CD    1 
ATOM   2874 C  CE    . LYS A 1 370 ? 26.402 -6.058 48.584  1.00 100.00 ? 370  LYS A CE    1 
ATOM   2875 N  NZ    . LYS A 1 370 ? 25.685 -5.165 49.519  1.00 100.00 ? 370  LYS A NZ    1 
ATOM   2876 N  N     . ASP A 1 371 ? 24.590 -2.947 43.200  1.00 100.00 ? 371  ASP A N     1 
ATOM   2877 C  CA    . ASP A 1 371 ? 23.591 -3.150 42.134  1.00 36.65  ? 371  ASP A CA    1 
ATOM   2878 C  C     . ASP A 1 371 ? 24.207 -2.755 40.806  1.00 85.17  ? 371  ASP A C     1 
ATOM   2879 O  O     . ASP A 1 371 ? 24.807 -1.684 40.629  1.00 100.00 ? 371  ASP A O     1 
ATOM   2880 C  CB    . ASP A 1 371 ? 22.268 -2.360 42.323  1.00 100.00 ? 371  ASP A CB    1 
ATOM   2881 C  CG    . ASP A 1 371 ? 21.140 -2.740 41.354  1.00 100.00 ? 371  ASP A CG    1 
ATOM   2882 O  OD1   . ASP A 1 371 ? 21.540 -3.467 40.330  1.00 54.09  ? 371  ASP A OD1   1 
ATOM   2883 O  OD2   . ASP A 1 371 ? 19.962 -2.409 41.512  1.00 80.71  ? 371  ASP A OD2   1 
ATOM   2884 N  N     . LYS A 1 372 ? 24.023 -3.649 39.867  1.00 51.22  ? 372  LYS A N     1 
ATOM   2885 C  CA    . LYS A 1 372 ? 24.582 -3.481 38.574  1.00 64.81  ? 372  LYS A CA    1 
ATOM   2886 C  C     . LYS A 1 372 ? 23.540 -3.328 37.490  1.00 78.98  ? 372  LYS A C     1 
ATOM   2887 O  O     . LYS A 1 372 ? 23.860 -3.417 36.320  1.00 39.46  ? 372  LYS A O     1 
ATOM   2888 C  CB    . LYS A 1 372 ? 25.483 -4.671 38.310  1.00 41.97  ? 372  LYS A CB    1 
ATOM   2889 C  CG    . LYS A 1 372 ? 26.872 -4.463 38.923  1.00 41.69  ? 372  LYS A CG    1 
ATOM   2890 C  CD    . LYS A 1 372 ? 27.325 -5.498 39.961  1.00 100.00 ? 372  LYS A CD    1 
ATOM   2891 C  CE    . LYS A 1 372 ? 28.826 -5.441 40.290  1.00 70.66  ? 372  LYS A CE    1 
ATOM   2892 N  NZ    . LYS A 1 372 ? 29.111 -5.044 41.679  1.00 71.74  ? 372  LYS A NZ    1 
ATOM   2893 N  N     . THR A 1 373 ? 22.292 -3.080 37.843  1.00 62.13  ? 373  THR A N     1 
ATOM   2894 C  CA    . THR A 1 373 ? 21.312 -2.950 36.775  1.00 56.17  ? 373  THR A CA    1 
ATOM   2895 C  C     . THR A 1 373 ? 21.679 -1.879 35.743  1.00 51.49  ? 373  THR A C     1 
ATOM   2896 O  O     . THR A 1 373 ? 21.844 -2.167 34.557  1.00 45.66  ? 373  THR A O     1 
ATOM   2897 C  CB    . THR A 1 373 ? 19.865 -2.824 37.284  1.00 100.00 ? 373  THR A CB    1 
ATOM   2898 O  OG1   . THR A 1 373 ? 19.615 -3.784 38.294  1.00 67.70  ? 373  THR A OG1   1 
ATOM   2899 C  CG2   . THR A 1 373 ? 18.891 -3.009 36.127  1.00 100.00 ? 373  THR A CG2   1 
ATOM   2900 N  N     . ALA A 1 374 ? 21.826 -0.639 36.225  1.00 100.00 ? 374  ALA A N     1 
ATOM   2901 C  CA    . ALA A 1 374 ? 22.172 0.500  35.373  1.00 39.35  ? 374  ALA A CA    1 
ATOM   2902 C  C     . ALA A 1 374 ? 23.390 0.209  34.552  1.00 45.20  ? 374  ALA A C     1 
ATOM   2903 O  O     . ALA A 1 374 ? 23.398 0.373  33.321  1.00 42.87  ? 374  ALA A O     1 
ATOM   2904 C  CB    . ALA A 1 374 ? 22.401 1.758  36.196  1.00 100.00 ? 374  ALA A CB    1 
ATOM   2905 N  N     . LEU A 1 375 ? 24.428 -0.204 35.253  1.00 37.48  ? 375  LEU A N     1 
ATOM   2906 C  CA    . LEU A 1 375 ? 25.642 -0.504 34.549  1.00 54.70  ? 375  LEU A CA    1 
ATOM   2907 C  C     . LEU A 1 375 ? 25.354 -1.396 33.345  1.00 46.41  ? 375  LEU A C     1 
ATOM   2908 O  O     . LEU A 1 375 ? 25.691 -1.105 32.199  1.00 42.55  ? 375  LEU A O     1 
ATOM   2909 C  CB    . LEU A 1 375 ? 26.700 -1.099 35.506  1.00 64.85  ? 375  LEU A CB    1 
ATOM   2910 C  CG    . LEU A 1 375 ? 27.941 -1.635 34.785  1.00 35.43  ? 375  LEU A CG    1 
ATOM   2911 C  CD1   . LEU A 1 375 ? 29.126 -0.697 34.928  1.00 42.57  ? 375  LEU A CD1   1 
ATOM   2912 C  CD2   . LEU A 1 375 ? 28.301 -2.980 35.391  1.00 100.00 ? 375  LEU A CD2   1 
ATOM   2913 N  N     . ASN A 1 376 ? 24.641 -2.471 33.621  1.00 54.53  ? 376  ASN A N     1 
ATOM   2914 C  CA    . ASN A 1 376 ? 24.325 -3.450 32.610  1.00 87.64  ? 376  ASN A CA    1 
ATOM   2915 C  C     . ASN A 1 376 ? 23.627 -2.865 31.426  1.00 31.75  ? 376  ASN A C     1 
ATOM   2916 O  O     . ASN A 1 376 ? 23.912 -3.218 30.290  1.00 49.16  ? 376  ASN A O     1 
ATOM   2917 C  CB    . ASN A 1 376 ? 23.574 -4.673 33.167  1.00 100.00 ? 376  ASN A CB    1 
ATOM   2918 C  CG    . ASN A 1 376 ? 24.151 -5.208 34.473  1.00 100.00 ? 376  ASN A CG    1 
ATOM   2919 O  OD1   . ASN A 1 376 ? 25.284 -4.867 34.872  1.00 83.59  ? 376  ASN A OD1   1 
ATOM   2920 N  ND2   . ASN A 1 376 ? 23.360 -6.026 35.175  1.00 100.00 ? 376  ASN A ND2   1 
ATOM   2921 N  N     . ALA A 1 377 ? 22.713 -1.989 31.708  1.00 40.23  ? 377  ALA A N     1 
ATOM   2922 C  CA    . ALA A 1 377 ? 21.937 -1.355 30.680  1.00 32.71  ? 377  ALA A CA    1 
ATOM   2923 C  C     . ALA A 1 377 ? 22.786 -0.397 29.841  1.00 39.49  ? 377  ALA A C     1 
ATOM   2924 O  O     . ALA A 1 377 ? 22.754 -0.406 28.610  1.00 54.03  ? 377  ALA A O     1 
ATOM   2925 C  CB    . ALA A 1 377 ? 20.776 -0.645 31.353  1.00 30.30  ? 377  ALA A CB    1 
ATOM   2926 N  N     . ALA A 1 378 ? 23.554 0.432  30.505  1.00 59.66  ? 378  ALA A N     1 
ATOM   2927 C  CA    . ALA A 1 378 ? 24.357 1.319  29.746  1.00 42.85  ? 378  ALA A CA    1 
ATOM   2928 C  C     . ALA A 1 378 ? 25.256 0.483  28.853  1.00 33.26  ? 378  ALA A C     1 
ATOM   2929 O  O     . ALA A 1 378 ? 25.202 0.629  27.657  1.00 41.02  ? 378  ALA A O     1 
ATOM   2930 C  CB    . ALA A 1 378 ? 25.119 2.267  30.651  1.00 36.31  ? 378  ALA A CB    1 
ATOM   2931 N  N     . SER A 1 379 ? 26.062 -0.410 29.422  1.00 38.30  ? 379  SER A N     1 
ATOM   2932 C  CA    . SER A 1 379 ? 26.995 -1.235 28.632  1.00 43.07  ? 379  SER A CA    1 
ATOM   2933 C  C     . SER A 1 379 ? 26.308 -1.922 27.492  1.00 60.57  ? 379  SER A C     1 
ATOM   2934 O  O     . SER A 1 379 ? 26.774 -2.017 26.343  1.00 49.72  ? 379  SER A O     1 
ATOM   2935 C  CB    . SER A 1 379 ? 27.607 -2.292 29.492  1.00 33.95  ? 379  SER A CB    1 
ATOM   2936 O  OG    . SER A 1 379 ? 27.283 -2.038 30.833  1.00 49.03  ? 379  SER A OG    1 
ATOM   2937 N  N     . THR A 1 380 ? 25.163 -2.425 27.837  1.00 70.18  ? 380  THR A N     1 
ATOM   2938 C  CA    . THR A 1 380 ? 24.397 -3.085 26.834  1.00 54.65  ? 380  THR A CA    1 
ATOM   2939 C  C     . THR A 1 380 ? 24.185 -2.189 25.616  1.00 40.42  ? 380  THR A C     1 
ATOM   2940 O  O     . THR A 1 380 ? 24.653 -2.519 24.539  1.00 69.71  ? 380  THR A O     1 
ATOM   2941 C  CB    . THR A 1 380 ? 23.097 -3.656 27.425  1.00 100.00 ? 380  THR A CB    1 
ATOM   2942 O  OG1   . THR A 1 380 ? 23.378 -4.825 28.182  1.00 100.00 ? 380  THR A OG1   1 
ATOM   2943 C  CG2   . THR A 1 380 ? 22.099 -3.948 26.314  1.00 52.49  ? 380  THR A CG2   1 
ATOM   2944 N  N     . VAL A 1 381 ? 23.552 -1.016 25.809  1.00 79.51  ? 381  VAL A N     1 
ATOM   2945 C  CA    . VAL A 1 381 ? 23.260 -0.087 24.721  1.00 49.76  ? 381  VAL A CA    1 
ATOM   2946 C  C     . VAL A 1 381 ? 24.456 0.418  23.968  1.00 73.77  ? 381  VAL A C     1 
ATOM   2947 O  O     . VAL A 1 381 ? 24.333 0.652  22.756  1.00 57.57  ? 381  VAL A O     1 
ATOM   2948 C  CB    . VAL A 1 381 ? 22.348 1.059  25.110  1.00 54.20  ? 381  VAL A CB    1 
ATOM   2949 C  CG1   . VAL A 1 381 ? 20.943 0.509  25.337  1.00 35.03  ? 381  VAL A CG1   1 
ATOM   2950 C  CG2   . VAL A 1 381 ? 22.894 1.761  26.360  1.00 37.57  ? 381  VAL A CG2   1 
ATOM   2951 N  N     . PHE A 1 382 ? 25.577 0.575  24.703  1.00 42.46  ? 382  PHE A N     1 
ATOM   2952 C  CA    . PHE A 1 382 ? 26.844 1.092  24.153  1.00 28.52  ? 382  PHE A CA    1 
ATOM   2953 C  C     . PHE A 1 382 ? 27.565 0.047  23.395  1.00 41.66  ? 382  PHE A C     1 
ATOM   2954 O  O     . PHE A 1 382 ? 28.226 0.313  22.373  1.00 38.71  ? 382  PHE A O     1 
ATOM   2955 C  CB    . PHE A 1 382 ? 27.813 1.643  25.225  1.00 67.05  ? 382  PHE A CB    1 
ATOM   2956 C  CG    . PHE A 1 382 ? 27.307 2.912  25.861  1.00 58.26  ? 382  PHE A CG    1 
ATOM   2957 C  CD1   . PHE A 1 382 ? 26.890 3.965  25.048  1.00 29.49  ? 382  PHE A CD1   1 
ATOM   2958 C  CD2   . PHE A 1 382 ? 27.198 3.051  27.245  1.00 48.29  ? 382  PHE A CD2   1 
ATOM   2959 C  CE1   . PHE A 1 382 ? 26.389 5.140  25.614  1.00 41.76  ? 382  PHE A CE1   1 
ATOM   2960 C  CE2   . PHE A 1 382 ? 26.681 4.215  27.816  1.00 47.68  ? 382  PHE A CE2   1 
ATOM   2961 C  CZ    . PHE A 1 382 ? 26.276 5.268  26.997  1.00 36.73  ? 382  PHE A CZ    1 
ATOM   2962 N  N     . GLY A 1 383 ? 27.431 -1.154 23.934  1.00 43.05  ? 383  GLY A N     1 
ATOM   2963 C  CA    . GLY A 1 383 ? 28.099 -2.268 23.305  1.00 85.69  ? 383  GLY A CA    1 
ATOM   2964 C  C     . GLY A 1 383 ? 29.536 -2.438 23.791  1.00 36.10  ? 383  GLY A C     1 
ATOM   2965 O  O     . GLY A 1 383 ? 30.404 -2.932 23.071  1.00 100.00 ? 383  GLY A O     1 
ATOM   2966 N  N     . VAL A 1 384 ? 29.770 -2.021 25.030  1.00 43.63  ? 384  VAL A N     1 
ATOM   2967 C  CA    . VAL A 1 384 ? 31.062 -2.117 25.698  1.00 88.76  ? 384  VAL A CA    1 
ATOM   2968 C  C     . VAL A 1 384 ? 31.028 -3.271 26.750  1.00 100.00 ? 384  VAL A C     1 
ATOM   2969 O  O     . VAL A 1 384 ? 29.998 -3.914 26.957  1.00 41.23  ? 384  VAL A O     1 
ATOM   2970 C  CB    . VAL A 1 384 ? 31.401 -0.736 26.281  1.00 34.30  ? 384  VAL A CB    1 
ATOM   2971 C  CG1   . VAL A 1 384 ? 31.404 0.267  25.152  1.00 29.28  ? 384  VAL A CG1   1 
ATOM   2972 C  CG2   . VAL A 1 384 ? 30.309 -0.286 27.266  1.00 48.48  ? 384  VAL A CG2   1 
ATOM   2973 N  N     . ASN A 1 385 ? 32.127 -3.571 27.435  1.00 64.02  ? 385  ASN A N     1 
ATOM   2974 C  CA    . ASN A 1 385 ? 32.090 -4.663 28.430  1.00 53.19  ? 385  ASN A CA    1 
ATOM   2975 C  C     . ASN A 1 385 ? 31.907 -4.255 29.938  1.00 40.19  ? 385  ASN A C     1 
ATOM   2976 O  O     . ASN A 1 385 ? 32.831 -3.853 30.636  1.00 63.53  ? 385  ASN A O     1 
ATOM   2977 C  CB    . ASN A 1 385 ? 33.326 -5.536 28.205  1.00 91.89  ? 385  ASN A CB    1 
ATOM   2978 C  CG    . ASN A 1 385 ? 33.298 -6.819 28.976  1.00 43.07  ? 385  ASN A CG    1 
ATOM   2979 O  OD1   . ASN A 1 385 ? 32.470 -7.028 29.875  1.00 100.00 ? 385  ASN A OD1   1 
ATOM   2980 N  ND2   . ASN A 1 385 ? 34.232 -7.689 28.636  1.00 100.00 ? 385  ASN A ND2   1 
ATOM   2981 N  N     . PRO A 1 386 ? 30.705 -4.419 30.463  1.00 44.52  ? 386  PRO A N     1 
ATOM   2982 C  CA    . PRO A 1 386 ? 30.310 -4.057 31.829  1.00 43.28  ? 386  PRO A CA    1 
ATOM   2983 C  C     . PRO A 1 386 ? 31.366 -4.139 32.901  1.00 46.38  ? 386  PRO A C     1 
ATOM   2984 O  O     . PRO A 1 386 ? 31.506 -3.260 33.770  1.00 53.29  ? 386  PRO A O     1 
ATOM   2985 C  CB    . PRO A 1 386 ? 29.163 -5.003 32.219  1.00 44.14  ? 386  PRO A CB    1 
ATOM   2986 C  CG    . PRO A 1 386 ? 29.083 -6.072 31.137  1.00 100.00 ? 386  PRO A CG    1 
ATOM   2987 C  CD    . PRO A 1 386 ? 30.067 -5.689 30.033  1.00 67.34  ? 386  PRO A CD    1 
ATOM   2988 N  N     . SER A 1 387 ? 32.096 -5.224 32.863  1.00 46.33  ? 387  SER A N     1 
ATOM   2989 C  CA    . SER A 1 387 ? 33.120 -5.415 33.875  1.00 52.46  ? 387  SER A CA    1 
ATOM   2990 C  C     . SER A 1 387 ? 34.292 -4.461 33.672  1.00 47.42  ? 387  SER A C     1 
ATOM   2991 O  O     . SER A 1 387 ? 34.988 -4.017 34.614  1.00 47.76  ? 387  SER A O     1 
ATOM   2992 C  CB    . SER A 1 387 ? 33.552 -6.872 33.935  1.00 100.00 ? 387  SER A CB    1 
ATOM   2993 O  OG    . SER A 1 387 ? 32.479 -7.672 34.415  1.00 100.00 ? 387  SER A OG    1 
ATOM   2994 N  N     . VAL A 1 388 ? 34.504 -4.147 32.403  1.00 42.03  ? 388  VAL A N     1 
ATOM   2995 C  CA    . VAL A 1 388 ? 35.566 -3.246 32.021  1.00 37.37  ? 388  VAL A CA    1 
ATOM   2996 C  C     . VAL A 1 388 ? 35.111 -1.844 32.323  1.00 31.64  ? 388  VAL A C     1 
ATOM   2997 O  O     . VAL A 1 388 ? 35.845 -0.986 32.806  1.00 44.74  ? 388  VAL A O     1 
ATOM   2998 C  CB    . VAL A 1 388 ? 35.855 -3.388 30.542  1.00 64.69  ? 388  VAL A CB    1 
ATOM   2999 C  CG1   . VAL A 1 388 ? 37.229 -2.822 30.224  1.00 49.77  ? 388  VAL A CG1   1 
ATOM   3000 C  CG2   . VAL A 1 388 ? 35.754 -4.859 30.136  1.00 100.00 ? 388  VAL A CG2   1 
ATOM   3001 N  N     . LEU A 1 389 ? 33.836 -1.642 32.079  1.00 40.47  ? 389  LEU A N     1 
ATOM   3002 C  CA    . LEU A 1 389 ? 33.263 -0.377 32.363  1.00 42.61  ? 389  LEU A CA    1 
ATOM   3003 C  C     . LEU A 1 389 ? 33.408 -0.117 33.847  1.00 43.51  ? 389  LEU A C     1 
ATOM   3004 O  O     . LEU A 1 389 ? 33.924 0.918  34.299  1.00 42.44  ? 389  LEU A O     1 
ATOM   3005 C  CB    . LEU A 1 389 ? 31.777 -0.356 31.908  1.00 36.60  ? 389  LEU A CB    1 
ATOM   3006 C  CG    . LEU A 1 389 ? 31.162 1.057  31.927  1.00 79.96  ? 389  LEU A CG    1 
ATOM   3007 C  CD1   . LEU A 1 389 ? 32.167 2.174  31.584  1.00 39.06  ? 389  LEU A CD1   1 
ATOM   3008 C  CD2   . LEU A 1 389 ? 29.921 1.140  31.040  1.00 33.70  ? 389  LEU A CD2   1 
ATOM   3009 N  N     . GLU A 1 390 ? 32.953 -1.105 34.596  1.00 37.20  ? 390  GLU A N     1 
ATOM   3010 C  CA    . GLU A 1 390 ? 32.958 -1.056 36.018  1.00 32.57  ? 390  GLU A CA    1 
ATOM   3011 C  C     . GLU A 1 390 ? 34.305 -0.656 36.565  1.00 40.20  ? 390  GLU A C     1 
ATOM   3012 O  O     . GLU A 1 390 ? 34.478 0.227  37.439  1.00 41.28  ? 390  GLU A O     1 
ATOM   3013 C  CB    . GLU A 1 390 ? 32.505 -2.444 36.541  1.00 47.06  ? 390  GLU A CB    1 
ATOM   3014 C  CG    . GLU A 1 390 ? 31.344 -2.415 37.574  1.00 81.33  ? 390  GLU A CG    1 
ATOM   3015 C  CD    . GLU A 1 390 ? 31.127 -3.729 38.308  1.00 100.00 ? 390  GLU A CD    1 
ATOM   3016 O  OE1   . GLU A 1 390 ? 31.059 -4.767 37.496  1.00 100.00 ? 390  GLU A OE1   1 
ATOM   3017 O  OE2   . GLU A 1 390 ? 31.028 -3.808 39.533  1.00 84.77  ? 390  GLU A OE2   1 
ATOM   3018 N  N     . LYS A 1 391 ? 35.285 -1.329 36.022  1.00 40.55  ? 391  LYS A N     1 
ATOM   3019 C  CA    . LYS A 1 391 ? 36.622 -1.104 36.481  1.00 54.47  ? 391  LYS A CA    1 
ATOM   3020 C  C     . LYS A 1 391 ? 37.177 0.228  36.098  1.00 48.61  ? 391  LYS A C     1 
ATOM   3021 O  O     . LYS A 1 391 ? 37.839 0.884  36.918  1.00 51.16  ? 391  LYS A O     1 
ATOM   3022 C  CB    . LYS A 1 391 ? 37.535 -2.180 35.986  1.00 54.54  ? 391  LYS A CB    1 
ATOM   3023 C  CG    . LYS A 1 391 ? 37.171 -3.501 36.601  1.00 44.77  ? 391  LYS A CG    1 
ATOM   3024 C  CD    . LYS A 1 391 ? 38.327 -4.087 37.378  1.00 100.00 ? 391  LYS A CD    1 
ATOM   3025 C  CE    . LYS A 1 391 ? 37.870 -5.134 38.368  1.00 100.00 ? 391  LYS A CE    1 
ATOM   3026 N  NZ    . LYS A 1 391 ? 38.353 -4.875 39.736  1.00 100.00 ? 391  LYS A NZ    1 
ATOM   3027 N  N     . ALA A 1 392 ? 36.933 0.570  34.831  1.00 41.20  ? 392  ALA A N     1 
ATOM   3028 C  CA    . ALA A 1 392 ? 37.381 1.839  34.291  1.00 38.60  ? 392  ALA A CA    1 
ATOM   3029 C  C     . ALA A 1 392 ? 36.776 2.998  35.075  1.00 36.00  ? 392  ALA A C     1 
ATOM   3030 O  O     . ALA A 1 392 ? 37.406 4.039  35.181  1.00 38.21  ? 392  ALA A O     1 
ATOM   3031 C  CB    . ALA A 1 392 ? 37.113 1.967  32.803  1.00 31.42  ? 392  ALA A CB    1 
ATOM   3032 N  N     . LEU A 1 393 ? 35.588 2.806  35.682  1.00 37.78  ? 393  LEU A N     1 
ATOM   3033 C  CA    . LEU A 1 393 ? 34.931 3.832  36.494  1.00 33.73  ? 393  LEU A CA    1 
ATOM   3034 C  C     . LEU A 1 393 ? 35.450 3.919  37.912  1.00 41.11  ? 393  LEU A C     1 
ATOM   3035 O  O     . LEU A 1 393 ? 35.721 5.010  38.439  1.00 37.00  ? 393  LEU A O     1 
ATOM   3036 C  CB    . LEU A 1 393 ? 33.454 3.518  36.620  1.00 28.30  ? 393  LEU A CB    1 
ATOM   3037 C  CG    . LEU A 1 393 ? 32.720 3.725  35.306  1.00 44.93  ? 393  LEU A CG    1 
ATOM   3038 C  CD1   . LEU A 1 393 ? 31.305 3.154  35.418  1.00 34.81  ? 393  LEU A CD1   1 
ATOM   3039 C  CD2   . LEU A 1 393 ? 32.675 5.208  34.928  1.00 28.81  ? 393  LEU A CD2   1 
ATOM   3040 N  N     . MET A 1 394 ? 35.541 2.769  38.559  1.00 39.94  ? 394  MET A N     1 
ATOM   3041 C  CA    . MET A 1 394 ? 36.003 2.811  39.921  1.00 37.30  ? 394  MET A CA    1 
ATOM   3042 C  C     . MET A 1 394 ? 37.441 2.446  40.149  1.00 26.35  ? 394  MET A C     1 
ATOM   3043 O  O     . MET A 1 394 ? 38.006 2.701  41.192  1.00 43.66  ? 394  MET A O     1 
ATOM   3044 C  CB    . MET A 1 394 ? 35.122 1.955  40.791  1.00 53.45  ? 394  MET A CB    1 
ATOM   3045 C  CG    . MET A 1 394 ? 33.760 2.586  40.949  1.00 47.03  ? 394  MET A CG    1 
ATOM   3046 S  SD    . MET A 1 394 ? 32.517 1.413  41.523  1.00 47.71  ? 394  MET A SD    1 
ATOM   3047 C  CE    . MET A 1 394 ? 32.463 0.297  40.081  1.00 62.73  ? 394  MET A CE    1 
ATOM   3048 N  N     . GLU A 1 395 ? 38.061 1.856  39.182  1.00 53.59  ? 395  GLU A N     1 
ATOM   3049 C  CA    . GLU A 1 395 ? 39.434 1.508  39.431  1.00 39.66  ? 395  GLU A CA    1 
ATOM   3050 C  C     . GLU A 1 395 ? 40.326 1.791  38.256  1.00 71.02  ? 395  GLU A C     1 
ATOM   3051 O  O     . GLU A 1 395 ? 40.961 0.908  37.725  1.00 37.91  ? 395  GLU A O     1 
ATOM   3052 C  CB    . GLU A 1 395 ? 39.529 0.032  39.759  1.00 51.11  ? 395  GLU A CB    1 
ATOM   3053 C  CG    . GLU A 1 395 ? 39.214 -0.269 41.227  1.00 47.07  ? 395  GLU A CG    1 
ATOM   3054 C  CD    . GLU A 1 395 ? 39.590 -1.686 41.502  1.00 55.74  ? 395  GLU A CD    1 
ATOM   3055 O  OE1   . GLU A 1 395 ? 38.834 -2.613 41.308  1.00 66.66  ? 395  GLU A OE1   1 
ATOM   3056 O  OE2   . GLU A 1 395 ? 40.835 -1.809 41.931  1.00 95.86  ? 395  GLU A OE2   1 
ATOM   3057 N  N     . PRO A 1 396 ? 40.381 3.042  37.853  1.00 55.23  ? 396  PRO A N     1 
ATOM   3058 C  CA    . PRO A 1 396 ? 41.198 3.385  36.723  1.00 37.68  ? 396  PRO A CA    1 
ATOM   3059 C  C     . PRO A 1 396 ? 42.674 3.227  36.984  1.00 29.28  ? 396  PRO A C     1 
ATOM   3060 O  O     . PRO A 1 396 ? 43.191 3.668  38.006  1.00 38.96  ? 396  PRO A O     1 
ATOM   3061 C  CB    . PRO A 1 396 ? 40.966 4.881  36.487  1.00 57.20  ? 396  PRO A CB    1 
ATOM   3062 C  CG    . PRO A 1 396 ? 40.399 5.433  37.786  1.00 40.00  ? 396  PRO A CG    1 
ATOM   3063 C  CD    . PRO A 1 396 ? 39.692 4.242  38.417  1.00 49.27  ? 396  PRO A CD    1 
ATOM   3064 N  N     . ARG A 1 397 ? 43.365 2.724  35.974  1.00 42.40  ? 397  ARG A N     1 
ATOM   3065 C  CA    . ARG A 1 397 ? 44.806 2.591  36.030  1.00 34.88  ? 397  ARG A CA    1 
ATOM   3066 C  C     . ARG A 1 397 ? 45.426 3.963  35.845  1.00 51.00  ? 397  ARG A C     1 
ATOM   3067 O  O     . ARG A 1 397 ? 45.095 4.697  34.909  1.00 74.23  ? 397  ARG A O     1 
ATOM   3068 C  CB    . ARG A 1 397 ? 45.297 1.606  34.975  1.00 32.29  ? 397  ARG A CB    1 
ATOM   3069 C  CG    . ARG A 1 397 ? 45.543 0.208  35.492  1.00 35.69  ? 397  ARG A CG    1 
ATOM   3070 C  CD    . ARG A 1 397 ? 45.859 -0.706 34.340  1.00 31.96  ? 397  ARG A CD    1 
ATOM   3071 N  NE    . ARG A 1 397 ? 45.034 -0.353 33.192  1.00 60.87  ? 397  ARG A NE    1 
ATOM   3072 C  CZ    . ARG A 1 397 ? 45.222 -0.798 31.941  1.00 100.00 ? 397  ARG A CZ    1 
ATOM   3073 N  NH1   . ARG A 1 397 ? 46.210 -1.634 31.633  1.00 100.00 ? 397  ARG A NH1   1 
ATOM   3074 N  NH2   . ARG A 1 397 ? 44.403 -0.395 30.961  1.00 75.91  ? 397  ARG A NH2   1 
ATOM   3075 N  N     . ILE A 1 398 ? 46.312 4.349  36.737  1.00 48.17  ? 398  ILE A N     1 
ATOM   3076 C  CA    . ILE A 1 398 ? 46.873 5.670  36.589  1.00 39.49  ? 398  ILE A CA    1 
ATOM   3077 C  C     . ILE A 1 398 ? 48.368 5.632  36.726  1.00 65.42  ? 398  ILE A C     1 
ATOM   3078 O  O     . ILE A 1 398 ? 48.901 5.019  37.653  1.00 51.28  ? 398  ILE A O     1 
ATOM   3079 C  CB    . ILE A 1 398 ? 46.301 6.620  37.632  1.00 36.56  ? 398  ILE A CB    1 
ATOM   3080 C  CG1   . ILE A 1 398 ? 44.851 6.998  37.337  1.00 55.59  ? 398  ILE A CG1   1 
ATOM   3081 C  CG2   . ILE A 1 398 ? 47.186 7.837  37.706  1.00 53.18  ? 398  ILE A CG2   1 
ATOM   3082 C  CD1   . ILE A 1 398 ? 43.825 6.371  38.286  1.00 60.90  ? 398  ILE A CD1   1 
ATOM   3083 N  N     . LEU A 1 399 ? 48.992 6.355  35.791  1.00 31.83  ? 399  LEU A N     1 
ATOM   3084 C  CA    . LEU A 1 399 ? 50.423 6.520  35.643  1.00 37.87  ? 399  LEU A CA    1 
ATOM   3085 C  C     . LEU A 1 399 ? 51.159 7.310  36.736  1.00 73.00  ? 399  LEU A C     1 
ATOM   3086 O  O     . LEU A 1 399 ? 51.062 8.528  36.821  1.00 100.00 ? 399  LEU A O     1 
ATOM   3087 C  CB    . LEU A 1 399 ? 50.739 7.116  34.249  1.00 42.89  ? 399  LEU A CB    1 
ATOM   3088 C  CG    . LEU A 1 399 ? 52.188 6.972  33.763  1.00 58.01  ? 399  LEU A CG    1 
ATOM   3089 C  CD1   . LEU A 1 399 ? 52.947 5.929  34.571  1.00 100.00 ? 399  LEU A CD1   1 
ATOM   3090 C  CD2   . LEU A 1 399 ? 52.173 6.544  32.296  1.00 100.00 ? 399  LEU A CD2   1 
ATOM   3091 N  N     . ALA A 1 400 ? 51.938 6.624  37.561  1.00 100.00 ? 400  ALA A N     1 
ATOM   3092 C  CA    . ALA A 1 400 ? 52.724 7.313  38.562  1.00 58.67  ? 400  ALA A CA    1 
ATOM   3093 C  C     . ALA A 1 400 ? 54.149 7.406  38.044  1.00 57.36  ? 400  ALA A C     1 
ATOM   3094 O  O     . ALA A 1 400 ? 55.146 7.357  38.777  1.00 98.72  ? 400  ALA A O     1 
ATOM   3095 C  CB    . ALA A 1 400 ? 52.611 6.692  39.941  1.00 74.28  ? 400  ALA A CB    1 
ATOM   3096 N  N     . GLY A 1 401 ? 54.230 7.493  36.735  1.00 82.84  ? 401  GLY A N     1 
ATOM   3097 C  CA    . GLY A 1 401 ? 55.519 7.593  36.114  1.00 53.12  ? 401  GLY A CA    1 
ATOM   3098 C  C     . GLY A 1 401 ? 55.936 6.330  35.425  1.00 100.00 ? 401  GLY A C     1 
ATOM   3099 O  O     . GLY A 1 401 ? 55.697 6.150  34.223  1.00 100.00 ? 401  GLY A O     1 
ATOM   3100 N  N     . ARG A 1 402 ? 56.589 5.484  36.208  1.00 54.29  ? 402  ARG A N     1 
ATOM   3101 C  CA    . ARG A 1 402 ? 57.034 4.254  35.610  1.00 100.00 ? 402  ARG A CA    1 
ATOM   3102 C  C     . ARG A 1 402 ? 55.834 3.375  35.597  1.00 29.32  ? 402  ARG A C     1 
ATOM   3103 O  O     . ARG A 1 402 ? 55.419 2.772  34.602  1.00 49.50  ? 402  ARG A O     1 
ATOM   3104 C  CB    . ARG A 1 402 ? 58.142 3.606  36.448  1.00 100.00 ? 402  ARG A CB    1 
ATOM   3105 C  CG    . ARG A 1 402 ? 59.463 4.381  36.392  1.00 100.00 ? 402  ARG A CG    1 
ATOM   3106 C  CD    . ARG A 1 402 ? 60.501 3.799  35.429  1.00 100.00 ? 402  ARG A CD    1 
ATOM   3107 N  NE    . ARG A 1 402 ? 61.515 3.035  36.145  1.00 43.37  ? 402  ARG A NE    1 
ATOM   3108 C  CZ    . ARG A 1 402 ? 61.570 1.708  36.193  1.00 100.00 ? 402  ARG A CZ    1 
ATOM   3109 N  NH1   . ARG A 1 402 ? 60.680 0.927  35.551  1.00 100.00 ? 402  ARG A NH1   1 
ATOM   3110 N  NH2   . ARG A 1 402 ? 62.556 1.144  36.914  1.00 100.00 ? 402  ARG A NH2   1 
ATOM   3111 N  N     . ASP A 1 403 ? 55.273 3.410  36.772  1.00 43.13  ? 403  ASP A N     1 
ATOM   3112 C  CA    . ASP A 1 403 ? 54.137 2.648  37.147  1.00 74.31  ? 403  ASP A CA    1 
ATOM   3113 C  C     . ASP A 1 403 ? 52.835 3.042  36.574  1.00 49.64  ? 403  ASP A C     1 
ATOM   3114 O  O     . ASP A 1 403 ? 52.405 4.169  36.642  1.00 58.70  ? 403  ASP A O     1 
ATOM   3115 C  CB    . ASP A 1 403 ? 53.902 2.746  38.652  1.00 95.30  ? 403  ASP A CB    1 
ATOM   3116 C  CG    . ASP A 1 403 ? 54.970 2.079  39.439  1.00 100.00 ? 403  ASP A CG    1 
ATOM   3117 O  OD1   . ASP A 1 403 ? 56.158 2.571  39.152  1.00 97.51  ? 403  ASP A OD1   1 
ATOM   3118 O  OD2   . ASP A 1 403 ? 54.749 1.183  40.241  1.00 65.51  ? 403  ASP A OD2   1 
ATOM   3119 N  N     . LEU A 1 404 ? 52.157 2.018  36.160  1.00 55.98  ? 404  LEU A N     1 
ATOM   3120 C  CA    . LEU A 1 404 ? 50.820 2.161  35.745  1.00 43.35  ? 404  LEU A CA    1 
ATOM   3121 C  C     . LEU A 1 404 ? 49.994 1.328  36.707  1.00 57.66  ? 404  LEU A C     1 
ATOM   3122 O  O     . LEU A 1 404 ? 49.872 0.115  36.542  1.00 46.45  ? 404  LEU A O     1 
ATOM   3123 C  CB    . LEU A 1 404 ? 50.536 1.750  34.307  1.00 91.97  ? 404  LEU A CB    1 
ATOM   3124 C  CG    . LEU A 1 404 ? 49.041 1.883  34.080  1.00 45.31  ? 404  LEU A CG    1 
ATOM   3125 C  CD1   . LEU A 1 404 ? 48.716 3.241  33.463  1.00 43.85  ? 404  LEU A CD1   1 
ATOM   3126 C  CD2   . LEU A 1 404 ? 48.495 0.721  33.270  1.00 56.88  ? 404  LEU A CD2   1 
ATOM   3127 N  N     . VAL A 1 405 ? 49.443 2.000  37.720  1.00 43.36  ? 405  VAL A N     1 
ATOM   3128 C  CA    . VAL A 1 405 ? 48.650 1.350  38.750  1.00 49.64  ? 405  VAL A CA    1 
ATOM   3129 C  C     . VAL A 1 405 ? 47.192 1.829  38.835  1.00 43.44  ? 405  VAL A C     1 
ATOM   3130 O  O     . VAL A 1 405 ? 46.850 3.015  38.862  1.00 40.90  ? 405  VAL A O     1 
ATOM   3131 C  CB    . VAL A 1 405 ? 49.339 1.557  40.104  1.00 46.88  ? 405  VAL A CB    1 
ATOM   3132 C  CG1   . VAL A 1 405 ? 49.653 3.036  40.279  1.00 57.45  ? 405  VAL A CG1   1 
ATOM   3133 C  CG2   . VAL A 1 405 ? 48.476 1.051  41.260  1.00 37.48  ? 405  VAL A CG2   1 
ATOM   3134 N  N     . ALA A 1 406 ? 46.350 0.844  38.964  1.00 35.52  ? 406  ALA A N     1 
ATOM   3135 C  CA    . ALA A 1 406 ? 44.935 1.004  39.111  1.00 44.08  ? 406  ALA A CA    1 
ATOM   3136 C  C     . ALA A 1 406 ? 44.599 1.658  40.407  1.00 33.92  ? 406  ALA A C     1 
ATOM   3137 O  O     . ALA A 1 406 ? 45.000 1.179  41.466  1.00 57.47  ? 406  ALA A O     1 
ATOM   3138 C  CB    . ALA A 1 406 ? 44.279 -0.361 39.206  1.00 36.76  ? 406  ALA A CB    1 
ATOM   3139 N  N     . GLN A 1 407 ? 43.823 2.723  40.331  1.00 65.12  ? 407  GLN A N     1 
ATOM   3140 C  CA    . GLN A 1 407 ? 43.400 3.385  41.542  1.00 37.76  ? 407  GLN A CA    1 
ATOM   3141 C  C     . GLN A 1 407 ? 41.955 3.042  41.842  1.00 54.17  ? 407  GLN A C     1 
ATOM   3142 O  O     . GLN A 1 407 ? 41.064 2.971  41.003  1.00 58.98  ? 407  GLN A O     1 
ATOM   3143 C  CB    . GLN A 1 407 ? 43.619 4.912  41.569  1.00 55.24  ? 407  GLN A CB    1 
ATOM   3144 C  CG    . GLN A 1 407 ? 44.925 5.387  40.921  1.00 55.64  ? 407  GLN A CG    1 
ATOM   3145 C  CD    . GLN A 1 407 ? 46.175 5.142  41.735  1.00 100.00 ? 407  GLN A CD    1 
ATOM   3146 O  OE1   . GLN A 1 407 ? 46.780 6.079  42.276  1.00 100.00 ? 407  GLN A OE1   1 
ATOM   3147 N  NE2   . GLN A 1 407 ? 46.579 3.880  41.775  1.00 100.00 ? 407  GLN A NE2   1 
ATOM   3148 N  N     . HIS A 1 408 ? 41.704 2.814  43.082  1.00 38.23  ? 408  HIS A N     1 
ATOM   3149 C  CA    . HIS A 1 408 ? 40.367 2.524  43.445  1.00 43.31  ? 408  HIS A CA    1 
ATOM   3150 C  C     . HIS A 1 408 ? 39.708 3.827  43.837  1.00 100.00 ? 408  HIS A C     1 
ATOM   3151 O  O     . HIS A 1 408 ? 40.049 4.405  44.868  1.00 51.37  ? 408  HIS A O     1 
ATOM   3152 C  CB    . HIS A 1 408 ? 40.330 1.549  44.611  1.00 52.68  ? 408  HIS A CB    1 
ATOM   3153 C  CG    . HIS A 1 408 ? 38.951 1.074  44.777  1.00 41.71  ? 408  HIS A CG    1 
ATOM   3154 N  ND1   . HIS A 1 408 ? 37.901 1.781  44.223  1.00 68.27  ? 408  HIS A ND1   1 
ATOM   3155 C  CD2   . HIS A 1 408 ? 38.469 -0.020 45.396  1.00 31.95  ? 408  HIS A CD2   1 
ATOM   3156 C  CE1   . HIS A 1 408 ? 36.801 1.112  44.517  1.00 62.19  ? 408  HIS A CE1   1 
ATOM   3157 N  NE2   . HIS A 1 408 ? 37.109 0.023  45.210  1.00 75.39  ? 408  HIS A NE2   1 
ATOM   3158 N  N     . LEU A 1 409 ? 38.796 4.321  43.008  1.00 67.73  ? 409  LEU A N     1 
ATOM   3159 C  CA    . LEU A 1 409 ? 38.177 5.574  43.348  1.00 45.90  ? 409  LEU A CA    1 
ATOM   3160 C  C     . LEU A 1 409 ? 37.055 5.446  44.338  1.00 29.80  ? 409  LEU A C     1 
ATOM   3161 O  O     . LEU A 1 409 ? 36.256 4.473  44.327  1.00 36.19  ? 409  LEU A O     1 
ATOM   3162 C  CB    . LEU A 1 409 ? 37.632 6.360  42.156  1.00 51.78  ? 409  LEU A CB    1 
ATOM   3163 C  CG    . LEU A 1 409 ? 38.557 6.407  40.986  1.00 30.45  ? 409  LEU A CG    1 
ATOM   3164 C  CD1   . LEU A 1 409 ? 37.814 7.023  39.829  1.00 31.08  ? 409  LEU A CD1   1 
ATOM   3165 C  CD2   . LEU A 1 409 ? 39.697 7.316  41.386  1.00 38.79  ? 409  LEU A CD2   1 
ATOM   3166 N  N     . ASN A 1 410 ? 37.006 6.503  45.144  1.00 30.16  ? 410  ASN A N     1 
ATOM   3167 C  CA    . ASN A 1 410 ? 35.964 6.658  46.125  1.00 45.22  ? 410  ASN A CA    1 
ATOM   3168 C  C     . ASN A 1 410 ? 34.684 6.945  45.402  1.00 39.23  ? 410  ASN A C     1 
ATOM   3169 O  O     . ASN A 1 410 ? 34.648 6.999  44.169  1.00 43.34  ? 410  ASN A O     1 
ATOM   3170 C  CB    . ASN A 1 410 ? 36.251 7.776  47.151  1.00 59.13  ? 410  ASN A CB    1 
ATOM   3171 C  CG    . ASN A 1 410 ? 36.005 9.169  46.635  1.00 46.07  ? 410  ASN A CG    1 
ATOM   3172 O  OD1   . ASN A 1 410 ? 35.431 9.363  45.551  1.00 68.89  ? 410  ASN A OD1   1 
ATOM   3173 N  ND2   . ASN A 1 410 ? 36.451 10.169 47.403  1.00 51.22  ? 410  ASN A ND2   1 
ATOM   3174 N  N     . VAL A 1 411 ? 33.660 7.230  46.175  1.00 42.14  ? 411  VAL A N     1 
ATOM   3175 C  CA    . VAL A 1 411 ? 32.351 7.484  45.608  1.00 66.28  ? 411  VAL A CA    1 
ATOM   3176 C  C     . VAL A 1 411 ? 32.187 8.770  44.765  1.00 34.29  ? 411  VAL A C     1 
ATOM   3177 O  O     . VAL A 1 411 ? 31.783 8.758  43.589  1.00 40.02  ? 411  VAL A O     1 
ATOM   3178 C  CB    . VAL A 1 411 ? 31.257 7.186  46.633  1.00 57.79  ? 411  VAL A CB    1 
ATOM   3179 C  CG1   . VAL A 1 411 ? 30.079 8.127  46.533  1.00 39.84  ? 411  VAL A CG1   1 
ATOM   3180 C  CG2   . VAL A 1 411 ? 30.752 5.755  46.502  1.00 63.60  ? 411  VAL A CG2   1 
ATOM   3181 N  N     . GLU A 1 412 ? 32.494 9.893  45.366  1.00 29.26  ? 412  GLU A N     1 
ATOM   3182 C  CA    . GLU A 1 412 ? 32.356 11.122 44.663  1.00 31.19  ? 412  GLU A CA    1 
ATOM   3183 C  C     . GLU A 1 412 ? 33.224 11.144 43.431  1.00 36.73  ? 412  GLU A C     1 
ATOM   3184 O  O     . GLU A 1 412 ? 32.780 11.552 42.377  1.00 49.28  ? 412  GLU A O     1 
ATOM   3185 C  CB    . GLU A 1 412 ? 32.714 12.322 45.516  1.00 25.32  ? 412  GLU A CB    1 
ATOM   3186 C  CG    . GLU A 1 412 ? 34.249 12.420 45.737  1.00 100.00 ? 412  GLU A CG    1 
ATOM   3187 C  CD    . GLU A 1 412 ? 34.853 13.779 45.474  1.00 100.00 ? 412  GLU A CD    1 
ATOM   3188 O  OE1   . GLU A 1 412 ? 34.240 14.728 46.140  1.00 100.00 ? 412  GLU A OE1   1 
ATOM   3189 O  OE2   . GLU A 1 412 ? 35.801 13.994 44.721  1.00 100.00 ? 412  GLU A OE2   1 
ATOM   3190 N  N     . LYS A 1 413 ? 34.473 10.752 43.597  1.00 42.95  ? 413  LYS A N     1 
ATOM   3191 C  CA    . LYS A 1 413 ? 35.416 10.761 42.508  1.00 27.74  ? 413  LYS A CA    1 
ATOM   3192 C  C     . LYS A 1 413 ? 34.915 9.803  41.442  1.00 51.71  ? 413  LYS A C     1 
ATOM   3193 O  O     . LYS A 1 413 ? 35.018 10.025 40.237  1.00 31.70  ? 413  LYS A O     1 
ATOM   3194 C  CB    . LYS A 1 413 ? 36.821 10.378 42.979  1.00 26.44  ? 413  LYS A CB    1 
ATOM   3195 C  CG    . LYS A 1 413 ? 37.708 11.550 43.430  1.00 37.11  ? 413  LYS A CG    1 
ATOM   3196 C  CD    . LYS A 1 413 ? 39.177 11.178 43.770  1.00 100.00 ? 413  LYS A CD    1 
ATOM   3197 C  CE    . LYS A 1 413 ? 39.690 11.579 45.164  1.00 100.00 ? 413  LYS A CE    1 
ATOM   3198 N  NZ    . LYS A 1 413 ? 39.722 10.455 46.123  1.00 95.92  ? 413  LYS A NZ    1 
ATOM   3199 N  N     . SER A 1 414 ? 34.352 8.712  41.891  1.00 34.77  ? 414  SER A N     1 
ATOM   3200 C  CA    . SER A 1 414 ? 33.862 7.761  40.956  1.00 33.61  ? 414  SER A CA    1 
ATOM   3201 C  C     . SER A 1 414 ? 32.749 8.398  40.117  1.00 39.41  ? 414  SER A C     1 
ATOM   3202 O  O     . SER A 1 414 ? 32.589 8.208  38.910  1.00 40.01  ? 414  SER A O     1 
ATOM   3203 C  CB    . SER A 1 414 ? 33.345 6.530  41.722  1.00 35.64  ? 414  SER A CB    1 
ATOM   3204 O  OG    . SER A 1 414 ? 34.278 5.457  41.715  1.00 34.49  ? 414  SER A OG    1 
ATOM   3205 N  N     . SER A 1 415 ? 31.975 9.177  40.816  1.00 28.22  ? 415  SER A N     1 
ATOM   3206 C  CA    . SER A 1 415 ? 30.815 9.814  40.264  1.00 57.11  ? 415  SER A CA    1 
ATOM   3207 C  C     . SER A 1 415 ? 31.093 10.880 39.217  1.00 25.65  ? 415  SER A C     1 
ATOM   3208 O  O     . SER A 1 415 ? 30.376 10.988 38.208  1.00 23.46  ? 415  SER A O     1 
ATOM   3209 C  CB    . SER A 1 415 ? 29.975 10.344 41.392  1.00 39.15  ? 415  SER A CB    1 
ATOM   3210 O  OG    . SER A 1 415 ? 28.702 10.648 40.857  1.00 45.06  ? 415  SER A OG    1 
ATOM   3211 N  N     . SER A 1 416 ? 32.120 11.655 39.542  1.00 24.86  ? 416  SER A N     1 
ATOM   3212 C  CA    . SER A 1 416 ? 32.596 12.730 38.740  1.00 27.54  ? 416  SER A CA    1 
ATOM   3213 C  C     . SER A 1 416 ? 33.101 12.185 37.423  1.00 35.55  ? 416  SER A C     1 
ATOM   3214 O  O     . SER A 1 416 ? 32.951 12.851 36.413  1.00 33.34  ? 416  SER A O     1 
ATOM   3215 C  CB    . SER A 1 416 ? 33.657 13.527 39.450  1.00 26.69  ? 416  SER A CB    1 
ATOM   3216 O  OG    . SER A 1 416 ? 33.092 14.362 40.439  1.00 78.66  ? 416  SER A OG    1 
ATOM   3217 N  N     . SER A 1 417 ? 33.636 10.957 37.462  1.00 36.18  ? 417  SER A N     1 
ATOM   3218 C  CA    . SER A 1 417 ? 34.178 10.222 36.312  1.00 24.35  ? 417  SER A CA    1 
ATOM   3219 C  C     . SER A 1 417 ? 33.091 9.710  35.362  1.00 26.11  ? 417  SER A C     1 
ATOM   3220 O  O     . SER A 1 417 ? 33.162 9.860  34.147  1.00 26.91  ? 417  SER A O     1 
ATOM   3221 C  CB    . SER A 1 417 ? 35.096 9.159  36.799  1.00 31.95  ? 417  SER A CB    1 
ATOM   3222 O  OG    . SER A 1 417 ? 35.950 8.740  35.750  1.00 29.39  ? 417  SER A OG    1 
ATOM   3223 N  N     . ARG A 1 418 ? 32.073 9.132  35.946  1.00 27.62  ? 418  ARG A N     1 
ATOM   3224 C  CA    . ARG A 1 418 ? 30.950 8.712  35.179  1.00 30.13  ? 418  ARG A CA    1 
ATOM   3225 C  C     . ARG A 1 418 ? 30.347 9.957  34.489  1.00 21.55  ? 418  ARG A C     1 
ATOM   3226 O  O     . ARG A 1 418 ? 29.889 9.937  33.357  1.00 33.75  ? 418  ARG A O     1 
ATOM   3227 C  CB    . ARG A 1 418 ? 29.942 8.092  36.124  1.00 26.96  ? 418  ARG A CB    1 
ATOM   3228 C  CG    . ARG A 1 418 ? 28.652 7.713  35.426  1.00 37.61  ? 418  ARG A CG    1 
ATOM   3229 C  CD    . ARG A 1 418 ? 27.548 8.718  35.681  1.00 31.78  ? 418  ARG A CD    1 
ATOM   3230 N  NE    . ARG A 1 418 ? 27.560 9.158  37.050  1.00 33.48  ? 418  ARG A NE    1 
ATOM   3231 C  CZ    . ARG A 1 418 ? 26.873 8.519  37.981  1.00 31.29  ? 418  ARG A CZ    1 
ATOM   3232 N  NH1   . ARG A 1 418 ? 26.141 7.450  37.700  1.00 29.79  ? 418  ARG A NH1   1 
ATOM   3233 N  NH2   . ARG A 1 418 ? 26.920 8.983  39.237  1.00 43.15  ? 418  ARG A NH2   1 
ATOM   3234 N  N     . ASP A 1 419 ? 30.353 11.071 35.194  1.00 20.17  ? 419  ASP A N     1 
ATOM   3235 C  CA    . ASP A 1 419 ? 29.808 12.270 34.643  1.00 24.09  ? 419  ASP A CA    1 
ATOM   3236 C  C     . ASP A 1 419 ? 30.640 12.761 33.483  1.00 36.85  ? 419  ASP A C     1 
ATOM   3237 O  O     . ASP A 1 419 ? 30.136 13.212 32.437  1.00 25.60  ? 419  ASP A O     1 
ATOM   3238 C  CB    . ASP A 1 419 ? 29.747 13.334 35.714  1.00 25.42  ? 419  ASP A CB    1 
ATOM   3239 C  CG    . ASP A 1 419 ? 28.477 13.228 36.524  1.00 25.17  ? 419  ASP A CG    1 
ATOM   3240 O  OD1   . ASP A 1 419 ? 27.571 12.403 36.329  1.00 30.43  ? 419  ASP A OD1   1 
ATOM   3241 O  OD2   . ASP A 1 419 ? 28.470 14.164 37.446  1.00 38.92  ? 419  ASP A OD2   1 
ATOM   3242 N  N     . ALA A 1 420 ? 31.945 12.657 33.689  1.00 25.83  ? 420  ALA A N     1 
ATOM   3243 C  CA    . ALA A 1 420 ? 32.896 13.012 32.643  1.00 22.71  ? 420  ALA A CA    1 
ATOM   3244 C  C     . ALA A 1 420 ? 32.669 12.126 31.400  1.00 45.50  ? 420  ALA A C     1 
ATOM   3245 O  O     . ALA A 1 420 ? 32.751 12.608 30.276  1.00 26.24  ? 420  ALA A O     1 
ATOM   3246 C  CB    . ALA A 1 420 ? 34.348 12.930 33.094  1.00 17.05  ? 420  ALA A CB    1 
ATOM   3247 N  N     . LEU A 1 421 ? 32.386 10.833 31.600  1.00 30.21  ? 421  LEU A N     1 
ATOM   3248 C  CA    . LEU A 1 421 ? 32.149 9.902  30.504  1.00 27.81  ? 421  LEU A CA    1 
ATOM   3249 C  C     . LEU A 1 421 ? 30.928 10.360 29.707  1.00 25.44  ? 421  LEU A C     1 
ATOM   3250 O  O     . LEU A 1 421 ? 30.892 10.425 28.481  1.00 23.00  ? 421  LEU A O     1 
ATOM   3251 C  CB    . LEU A 1 421 ? 31.927 8.472  31.044  1.00 20.83  ? 421  LEU A CB    1 
ATOM   3252 C  CG    . LEU A 1 421 ? 31.400 7.517  29.945  1.00 29.75  ? 421  LEU A CG    1 
ATOM   3253 C  CD1   . LEU A 1 421 ? 32.419 7.435  28.797  1.00 34.32  ? 421  LEU A CD1   1 
ATOM   3254 C  CD2   . LEU A 1 421 ? 31.161 6.123  30.518  1.00 28.76  ? 421  LEU A CD2   1 
ATOM   3255 N  N     . VAL A 1 422 ? 29.904 10.638 30.454  1.00 26.10  ? 422  VAL A N     1 
ATOM   3256 C  CA    . VAL A 1 422 ? 28.678 11.099 29.882  1.00 25.49  ? 422  VAL A CA    1 
ATOM   3257 C  C     . VAL A 1 422 ? 28.909 12.358 29.024  1.00 36.72  ? 422  VAL A C     1 
ATOM   3258 O  O     . VAL A 1 422 ? 28.489 12.446 27.885  1.00 31.26  ? 422  VAL A O     1 
ATOM   3259 C  CB    . VAL A 1 422 ? 27.682 11.316 31.032  1.00 51.09  ? 422  VAL A CB    1 
ATOM   3260 C  CG1   . VAL A 1 422 ? 26.562 12.291 30.688  1.00 33.24  ? 422  VAL A CG1   1 
ATOM   3261 C  CG2   . VAL A 1 422 ? 27.122 9.976  31.505  1.00 28.80  ? 422  VAL A CG2   1 
ATOM   3262 N  N     . LYS A 1 423 ? 29.537 13.374 29.590  1.00 27.45  ? 423  LYS A N     1 
ATOM   3263 C  CA    . LYS A 1 423 ? 29.792 14.609 28.852  1.00 18.23  ? 423  LYS A CA    1 
ATOM   3264 C  C     . LYS A 1 423 ? 30.543 14.412 27.575  1.00 18.47  ? 423  LYS A C     1 
ATOM   3265 O  O     . LYS A 1 423 ? 30.221 15.095 26.621  1.00 26.50  ? 423  LYS A O     1 
ATOM   3266 C  CB    . LYS A 1 423 ? 30.363 15.741 29.680  1.00 17.32  ? 423  LYS A CB    1 
ATOM   3267 C  CG    . LYS A 1 423 ? 29.407 15.983 30.848  1.00 16.77  ? 423  LYS A CG    1 
ATOM   3268 C  CD    . LYS A 1 423 ? 29.870 17.094 31.768  1.00 32.07  ? 423  LYS A CD    1 
ATOM   3269 C  CE    . LYS A 1 423 ? 31.149 16.823 32.529  1.00 41.94  ? 423  LYS A CE    1 
ATOM   3270 N  NZ    . LYS A 1 423 ? 31.738 18.086 32.982  1.00 39.11  ? 423  LYS A NZ    1 
ATOM   3271 N  N     . ALA A 1 424 ? 31.508 13.499 27.568  1.00 24.82  ? 424  ALA A N     1 
ATOM   3272 C  CA    . ALA A 1 424 ? 32.326 13.193 26.380  1.00 27.88  ? 424  ALA A CA    1 
ATOM   3273 C  C     . ALA A 1 424 ? 31.509 12.510 25.328  1.00 25.72  ? 424  ALA A C     1 
ATOM   3274 O  O     . ALA A 1 424 ? 31.644 12.727 24.141  1.00 25.06  ? 424  ALA A O     1 
ATOM   3275 C  CB    . ALA A 1 424 ? 33.429 12.259 26.769  1.00 22.95  ? 424  ALA A CB    1 
ATOM   3276 N  N     . LEU A 1 425 ? 30.651 11.637 25.806  1.00 27.05  ? 425  LEU A N     1 
ATOM   3277 C  CA    . LEU A 1 425 ? 29.776 10.928 24.920  1.00 23.56  ? 425  LEU A CA    1 
ATOM   3278 C  C     . LEU A 1 425 ? 28.904 11.909 24.188  1.00 25.92  ? 425  LEU A C     1 
ATOM   3279 O  O     . LEU A 1 425 ? 28.896 11.961 22.959  1.00 33.10  ? 425  LEU A O     1 
ATOM   3280 C  CB    . LEU A 1 425 ? 28.984 9.896  25.723  1.00 24.00  ? 425  LEU A CB    1 
ATOM   3281 C  CG    . LEU A 1 425 ? 29.863 8.674  26.008  1.00 49.27  ? 425  LEU A CG    1 
ATOM   3282 C  CD1   . LEU A 1 425 ? 29.192 7.845  27.076  1.00 27.35  ? 425  LEU A CD1   1 
ATOM   3283 C  CD2   . LEU A 1 425 ? 30.056 7.819  24.750  1.00 28.84  ? 425  LEU A CD2   1 
ATOM   3284 N  N     . TYR A 1 426 ? 28.224 12.764 24.957  1.00 24.84  ? 426  TYR A N     1 
ATOM   3285 C  CA    . TYR A 1 426 ? 27.364 13.827 24.445  1.00 23.52  ? 426  TYR A CA    1 
ATOM   3286 C  C     . TYR A 1 426 ? 28.058 14.814 23.505  1.00 22.15  ? 426  TYR A C     1 
ATOM   3287 O  O     . TYR A 1 426 ? 27.621 15.108 22.395  1.00 27.36  ? 426  TYR A O     1 
ATOM   3288 C  CB    . TYR A 1 426 ? 26.599 14.601 25.551  1.00 20.75  ? 426  TYR A CB    1 
ATOM   3289 C  CG    . TYR A 1 426 ? 25.253 15.097 25.048  1.00 24.72  ? 426  TYR A CG    1 
ATOM   3290 C  CD1   . TYR A 1 426 ? 24.150 14.246 24.882  1.00 24.12  ? 426  TYR A CD1   1 
ATOM   3291 C  CD2   . TYR A 1 426 ? 25.128 16.411 24.586  1.00 23.63  ? 426  TYR A CD2   1 
ATOM   3292 C  CE1   . TYR A 1 426 ? 22.926 14.670 24.358  1.00 18.39  ? 426  TYR A CE1   1 
ATOM   3293 C  CE2   . TYR A 1 426 ? 23.917 16.847 24.036  1.00 21.91  ? 426  TYR A CE2   1 
ATOM   3294 C  CZ    . TYR A 1 426 ? 22.824 15.988 23.915  1.00 19.72  ? 426  TYR A CZ    1 
ATOM   3295 O  OH    . TYR A 1 426 ? 21.635 16.489 23.401  1.00 25.25  ? 426  TYR A OH    1 
ATOM   3296 N  N     . GLY A 1 427 ? 29.143 15.355 23.968  1.00 28.95  ? 427  GLY A N     1 
ATOM   3297 C  CA    . GLY A 1 427 ? 29.885 16.327 23.193  1.00 22.68  ? 427  GLY A CA    1 
ATOM   3298 C  C     . GLY A 1 427 ? 30.417 15.738 21.911  1.00 30.59  ? 427  GLY A C     1 
ATOM   3299 O  O     . GLY A 1 427 ? 30.389 16.390 20.851  1.00 24.46  ? 427  GLY A O     1 
ATOM   3300 N  N     . ARG A 1 428 ? 30.914 14.516 22.021  1.00 25.66  ? 428  ARG A N     1 
ATOM   3301 C  CA    . ARG A 1 428 ? 31.430 13.818 20.844  1.00 24.64  ? 428  ARG A CA    1 
ATOM   3302 C  C     . ARG A 1 428 ? 30.317 13.455 19.852  1.00 41.83  ? 428  ARG A C     1 
ATOM   3303 O  O     . ARG A 1 428 ? 30.441 13.590 18.633  1.00 33.47  ? 428  ARG A O     1 
ATOM   3304 C  CB    . ARG A 1 428 ? 32.168 12.567 21.225  1.00 20.84  ? 428  ARG A CB    1 
ATOM   3305 C  CG    . ARG A 1 428 ? 33.454 12.932 21.881  1.00 27.88  ? 428  ARG A CG    1 
ATOM   3306 C  CD    . ARG A 1 428 ? 34.156 11.705 22.336  1.00 28.35  ? 428  ARG A CD    1 
ATOM   3307 N  NE    . ARG A 1 428 ? 35.214 12.095 23.254  1.00 35.28  ? 428  ARG A NE    1 
ATOM   3308 C  CZ    . ARG A 1 428 ? 36.247 11.332 23.536  1.00 40.02  ? 428  ARG A CZ    1 
ATOM   3309 N  NH1   . ARG A 1 428 ? 36.447 10.118 22.992  1.00 29.02  ? 428  ARG A NH1   1 
ATOM   3310 N  NH2   . ARG A 1 428 ? 37.085 11.815 24.436  1.00 33.56  ? 428  ARG A NH2   1 
ATOM   3311 N  N     . LEU A 1 429 ? 29.214 12.974 20.372  1.00 33.32  ? 429  LEU A N     1 
ATOM   3312 C  CA    . LEU A 1 429 ? 28.073 12.668 19.535  1.00 33.61  ? 429  LEU A CA    1 
ATOM   3313 C  C     . LEU A 1 429 ? 27.617 13.922 18.786  1.00 28.79  ? 429  LEU A C     1 
ATOM   3314 O  O     . LEU A 1 429 ? 27.270 13.894 17.626  1.00 31.81  ? 429  LEU A O     1 
ATOM   3315 C  CB    . LEU A 1 429 ? 26.907 12.138 20.413  1.00 23.95  ? 429  LEU A CB    1 
ATOM   3316 C  CG    . LEU A 1 429 ? 25.554 12.128 19.674  1.00 48.76  ? 429  LEU A CG    1 
ATOM   3317 C  CD1   . LEU A 1 429 ? 25.602 11.317 18.361  1.00 27.27  ? 429  LEU A CD1   1 
ATOM   3318 C  CD2   . LEU A 1 429 ? 24.397 11.679 20.582  1.00 33.82  ? 429  LEU A CD2   1 
ATOM   3319 N  N     . PHE A 1 430 ? 27.570 15.037 19.473  1.00 20.50  ? 430  PHE A N     1 
ATOM   3320 C  CA    . PHE A 1 430 ? 27.154 16.222 18.865  1.00 16.27  ? 430  PHE A CA    1 
ATOM   3321 C  C     . PHE A 1 430 ? 28.074 16.586 17.738  1.00 26.73  ? 430  PHE A C     1 
ATOM   3322 O  O     . PHE A 1 430 ? 27.640 16.960 16.651  1.00 26.49  ? 430  PHE A O     1 
ATOM   3323 C  CB    . PHE A 1 430 ? 27.041 17.309 19.915  1.00 18.14  ? 430  PHE A CB    1 
ATOM   3324 C  CG    . PHE A 1 430 ? 26.261 18.506 19.448  1.00 22.72  ? 430  PHE A CG    1 
ATOM   3325 C  CD1   . PHE A 1 430 ? 24.877 18.552 19.559  1.00 24.62  ? 430  PHE A CD1   1 
ATOM   3326 C  CD2   . PHE A 1 430 ? 26.918 19.601 18.892  1.00 21.60  ? 430  PHE A CD2   1 
ATOM   3327 C  CE1   . PHE A 1 430 ? 24.158 19.662 19.133  1.00 19.91  ? 430  PHE A CE1   1 
ATOM   3328 C  CE2   . PHE A 1 430 ? 26.232 20.731 18.469  1.00 21.89  ? 430  PHE A CE2   1 
ATOM   3329 C  CZ    . PHE A 1 430 ? 24.845 20.746 18.590  1.00 21.60  ? 430  PHE A CZ    1 
ATOM   3330 N  N     . LEU A 1 431 ? 29.363 16.502 17.980  1.00 21.34  ? 431  LEU A N     1 
ATOM   3331 C  CA    . LEU A 1 431 ? 30.377 16.807 16.932  1.00 28.75  ? 431  LEU A CA    1 
ATOM   3332 C  C     . LEU A 1 431 ? 30.184 15.964 15.668  1.00 21.00  ? 431  LEU A C     1 
ATOM   3333 O  O     . LEU A 1 431 ? 30.299 16.421 14.550  1.00 27.13  ? 431  LEU A O     1 
ATOM   3334 C  CB    . LEU A 1 431 ? 31.791 16.415 17.401  1.00 24.04  ? 431  LEU A CB    1 
ATOM   3335 C  CG    . LEU A 1 431 ? 32.405 17.361 18.409  1.00 100.00 ? 431  LEU A CG    1 
ATOM   3336 C  CD1   . LEU A 1 431 ? 33.844 16.939 18.652  1.00 50.23  ? 431  LEU A CD1   1 
ATOM   3337 C  CD2   . LEU A 1 431 ? 32.361 18.787 17.865  1.00 44.09  ? 431  LEU A CD2   1 
ATOM   3338 N  N     . TRP A 1 432 ? 29.975 14.685 15.924  1.00 26.73  ? 432  TRP A N     1 
ATOM   3339 C  CA    . TRP A 1 432 ? 29.690 13.641 14.963  1.00 25.34  ? 432  TRP A CA    1 
ATOM   3340 C  C     . TRP A 1 432 ? 28.400 13.957 14.183  1.00 27.37  ? 432  TRP A C     1 
ATOM   3341 O  O     . TRP A 1 432 ? 28.320 13.864 12.980  1.00 29.96  ? 432  TRP A O     1 
ATOM   3342 C  CB    . TRP A 1 432 ? 29.612 12.304 15.722  1.00 22.48  ? 432  TRP A CB    1 
ATOM   3343 C  CG    . TRP A 1 432 ? 29.312 11.224 14.761  1.00 94.02  ? 432  TRP A CG    1 
ATOM   3344 C  CD1   . TRP A 1 432 ? 30.232 10.538 14.055  1.00 38.98  ? 432  TRP A CD1   1 
ATOM   3345 C  CD2   . TRP A 1 432 ? 28.027 10.775 14.303  1.00 35.32  ? 432  TRP A CD2   1 
ATOM   3346 N  NE1   . TRP A 1 432 ? 29.608 9.637  13.238  1.00 34.12  ? 432  TRP A NE1   1 
ATOM   3347 C  CE2   . TRP A 1 432 ? 28.259 9.767  13.371  1.00 71.56  ? 432  TRP A CE2   1 
ATOM   3348 C  CE3   . TRP A 1 432 ? 26.715 11.066 14.650  1.00 46.16  ? 432  TRP A CE3   1 
ATOM   3349 C  CZ2   . TRP A 1 432 ? 27.217 9.094  12.750  1.00 33.96  ? 432  TRP A CZ2   1 
ATOM   3350 C  CZ3   . TRP A 1 432 ? 25.691 10.368 14.069  1.00 30.78  ? 432  TRP A CZ3   1 
ATOM   3351 C  CH2   . TRP A 1 432 ? 25.939 9.422  13.101  1.00 34.89  ? 432  TRP A CH2   1 
ATOM   3352 N  N     . LEU A 1 433 ? 27.348 14.367 14.841  1.00 27.04  ? 433  LEU A N     1 
ATOM   3353 C  CA    . LEU A 1 433 ? 26.150 14.683 14.106  1.00 17.27  ? 433  LEU A CA    1 
ATOM   3354 C  C     . LEU A 1 433 ? 26.493 15.781 13.170  1.00 33.86  ? 433  LEU A C     1 
ATOM   3355 O  O     . LEU A 1 433 ? 26.105 15.739 12.033  1.00 35.27  ? 433  LEU A O     1 
ATOM   3356 C  CB    . LEU A 1 433 ? 25.021 15.240 14.984  1.00 29.30  ? 433  LEU A CB    1 
ATOM   3357 C  CG    . LEU A 1 433 ? 24.428 14.209 15.931  1.00 32.82  ? 433  LEU A CG    1 
ATOM   3358 C  CD1   . LEU A 1 433 ? 23.631 14.909 17.037  1.00 22.29  ? 433  LEU A CD1   1 
ATOM   3359 C  CD2   . LEU A 1 433 ? 23.477 13.341 15.126  1.00 34.58  ? 433  LEU A CD2   1 
ATOM   3360 N  N     . VAL A 1 434 ? 27.210 16.774 13.684  1.00 27.98  ? 434  VAL A N     1 
ATOM   3361 C  CA    . VAL A 1 434 ? 27.570 17.909 12.868  1.00 23.67  ? 434  VAL A CA    1 
ATOM   3362 C  C     . VAL A 1 434 ? 28.372 17.517 11.649  1.00 29.78  ? 434  VAL A C     1 
ATOM   3363 O  O     . VAL A 1 434 ? 28.114 17.987 10.551  1.00 23.90  ? 434  VAL A O     1 
ATOM   3364 C  CB    . VAL A 1 434 ? 28.260 19.013 13.653  1.00 22.50  ? 434  VAL A CB    1 
ATOM   3365 C  CG1   . VAL A 1 434 ? 28.729 20.192 12.777  1.00 20.37  ? 434  VAL A CG1   1 
ATOM   3366 C  CG2   . VAL A 1 434 ? 27.292 19.502 14.723  1.00 28.73  ? 434  VAL A CG2   1 
ATOM   3367 N  N     . LYS A 1 435 ? 29.379 16.691 11.852  1.00 29.56  ? 435  LYS A N     1 
ATOM   3368 C  CA    . LYS A 1 435 ? 30.252 16.285 10.753  1.00 31.24  ? 435  LYS A CA    1 
ATOM   3369 C  C     . LYS A 1 435 ? 29.444 15.475 9.741   1.00 28.72  ? 435  LYS A C     1 
ATOM   3370 O  O     . LYS A 1 435 ? 29.613 15.604 8.536   1.00 32.55  ? 435  LYS A O     1 
ATOM   3371 C  CB    . LYS A 1 435 ? 31.450 15.488 11.252  1.00 25.16  ? 435  LYS A CB    1 
ATOM   3372 C  CG    . LYS A 1 435 ? 32.486 16.281 12.062  1.00 46.05  ? 435  LYS A CG    1 
ATOM   3373 C  CD    . LYS A 1 435 ? 33.854 15.587 12.251  1.00 62.61  ? 435  LYS A CD    1 
ATOM   3374 C  CE    . LYS A 1 435 ? 34.337 14.826 10.992  1.00 100.00 ? 435  LYS A CE    1 
ATOM   3375 N  NZ    . LYS A 1 435 ? 35.760 14.357 11.022  1.00 63.71  ? 435  LYS A NZ    1 
ATOM   3376 N  N     . LYS A 1 436 ? 28.565 14.639 10.255  1.00 33.18  ? 436  LYS A N     1 
ATOM   3377 C  CA    . LYS A 1 436 ? 27.693 13.808 9.445   1.00 33.22  ? 436  LYS A CA    1 
ATOM   3378 C  C     . LYS A 1 436 ? 26.912 14.736 8.503   1.00 59.38  ? 436  LYS A C     1 
ATOM   3379 O  O     . LYS A 1 436 ? 26.873 14.569 7.303   1.00 32.57  ? 436  LYS A O     1 
ATOM   3380 C  CB    . LYS A 1 436 ? 26.684 13.046 10.316  1.00 27.15  ? 436  LYS A CB    1 
ATOM   3381 C  CG    . LYS A 1 436 ? 27.127 11.699 10.806  1.00 51.38  ? 436  LYS A CG    1 
ATOM   3382 C  CD    . LYS A 1 436 ? 26.908 10.650 9.740   1.00 85.07  ? 436  LYS A CD    1 
ATOM   3383 C  CE    . LYS A 1 436 ? 28.215 10.304 9.051   1.00 100.00 ? 436  LYS A CE    1 
ATOM   3384 N  NZ    . LYS A 1 436 ? 28.493 8.866  9.020   1.00 100.00 ? 436  LYS A NZ    1 
ATOM   3385 N  N     . ILE A 1 437 ? 26.245 15.736 9.050   1.00 24.27  ? 437  ILE A N     1 
ATOM   3386 C  CA    . ILE A 1 437 ? 25.471 16.657 8.249   1.00 19.92  ? 437  ILE A CA    1 
ATOM   3387 C  C     . ILE A 1 437 ? 26.302 17.429 7.225   1.00 27.03  ? 437  ILE A C     1 
ATOM   3388 O  O     . ILE A 1 437 ? 25.884 17.722 6.133   1.00 31.72  ? 437  ILE A O     1 
ATOM   3389 C  CB    . ILE A 1 437 ? 24.849 17.644 9.198   1.00 21.08  ? 437  ILE A CB    1 
ATOM   3390 C  CG1   . ILE A 1 437 ? 23.934 16.985 10.213  1.00 26.45  ? 437  ILE A CG1   1 
ATOM   3391 C  CG2   . ILE A 1 437 ? 24.196 18.784 8.464   1.00 25.38  ? 437  ILE A CG2   1 
ATOM   3392 C  CD1   . ILE A 1 437 ? 23.427 18.010 11.254  1.00 35.29  ? 437  ILE A CD1   1 
ATOM   3393 N  N     . ASN A 1 438 ? 27.486 17.791 7.591   1.00 25.29  ? 438  ASN A N     1 
ATOM   3394 C  CA    . ASN A 1 438 ? 28.291 18.552 6.729   1.00 19.11  ? 438  ASN A CA    1 
ATOM   3395 C  C     . ASN A 1 438 ? 28.699 17.752 5.540   1.00 24.93  ? 438  ASN A C     1 
ATOM   3396 O  O     . ASN A 1 438 ? 28.822 18.245 4.444   1.00 26.39  ? 438  ASN A O     1 
ATOM   3397 C  CB    . ASN A 1 438 ? 29.523 18.930 7.503   1.00 25.04  ? 438  ASN A CB    1 
ATOM   3398 C  CG    . ASN A 1 438 ? 29.293 20.214 8.322   1.00 40.62  ? 438  ASN A CG    1 
ATOM   3399 O  OD1   . ASN A 1 438 ? 28.354 20.973 8.102   1.00 31.00  ? 438  ASN A OD1   1 
ATOM   3400 N  ND2   . ASN A 1 438 ? 30.172 20.501 9.279   1.00 27.49  ? 438  ASN A ND2   1 
ATOM   3401 N  N     . ASN A 1 439 ? 28.928 16.503 5.792   1.00 31.09  ? 439  ASN A N     1 
ATOM   3402 C  CA    . ASN A 1 439 ? 29.303 15.559 4.742   1.00 42.62  ? 439  ASN A CA    1 
ATOM   3403 C  C     . ASN A 1 439 ? 28.289 15.623 3.623   1.00 31.72  ? 439  ASN A C     1 
ATOM   3404 O  O     . ASN A 1 439 ? 28.564 15.844 2.441   1.00 42.23  ? 439  ASN A O     1 
ATOM   3405 C  CB    . ASN A 1 439 ? 29.306 14.149 5.335   1.00 34.86  ? 439  ASN A CB    1 
ATOM   3406 C  CG    . ASN A 1 439 ? 30.606 13.868 6.087   1.00 34.94  ? 439  ASN A CG    1 
ATOM   3407 O  OD1   . ASN A 1 439 ? 30.726 12.876 6.845   1.00 96.92  ? 439  ASN A OD1   1 
ATOM   3408 N  ND2   . ASN A 1 439 ? 31.586 14.766 5.878   1.00 39.20  ? 439  ASN A ND2   1 
ATOM   3409 N  N     . VAL A 1 440 ? 27.101 15.491 4.062   1.00 27.77  ? 440  VAL A N     1 
ATOM   3410 C  CA    . VAL A 1 440 ? 26.005 15.581 3.192   1.00 25.99  ? 440  VAL A CA    1 
ATOM   3411 C  C     . VAL A 1 440 ? 25.861 16.928 2.578   1.00 34.19  ? 440  VAL A C     1 
ATOM   3412 O  O     . VAL A 1 440 ? 25.660 17.046 1.413   1.00 37.99  ? 440  VAL A O     1 
ATOM   3413 C  CB    . VAL A 1 440 ? 24.719 15.277 3.920   1.00 22.21  ? 440  VAL A CB    1 
ATOM   3414 C  CG1   . VAL A 1 440 ? 23.525 15.686 3.067   1.00 32.64  ? 440  VAL A CG1   1 
ATOM   3415 C  CG2   . VAL A 1 440 ? 24.644 13.804 4.151   1.00 25.34  ? 440  VAL A CG2   1 
ATOM   3416 N  N     . LEU A 1 441 ? 25.881 17.962 3.356   1.00 39.07  ? 441  LEU A N     1 
ATOM   3417 C  CA    . LEU A 1 441 ? 25.560 19.225 2.789   1.00 21.62  ? 441  LEU A CA    1 
ATOM   3418 C  C     . LEU A 1 441 ? 26.666 19.995 2.102   1.00 27.98  ? 441  LEU A C     1 
ATOM   3419 O  O     . LEU A 1 441 ? 26.444 20.834 1.173   1.00 33.46  ? 441  LEU A O     1 
ATOM   3420 C  CB    . LEU A 1 441 ? 25.030 20.101 3.930   1.00 21.55  ? 441  LEU A CB    1 
ATOM   3421 C  CG    . LEU A 1 441 ? 23.767 19.628 4.678   1.00 26.05  ? 441  LEU A CG    1 
ATOM   3422 C  CD1   . LEU A 1 441 ? 23.439 20.711 5.692   1.00 18.55  ? 441  LEU A CD1   1 
ATOM   3423 C  CD2   . LEU A 1 441 ? 22.569 19.593 3.723   1.00 25.79  ? 441  LEU A CD2   1 
ATOM   3424 N  N     . CYS A 1 442 ? 27.843 19.814 2.657   1.00 36.07  ? 442  CYS A N     1 
ATOM   3425 C  CA    . CYS A 1 442 ? 28.972 20.594 2.262   1.00 24.49  ? 442  CYS A CA    1 
ATOM   3426 C  C     . CYS A 1 442 ? 29.550 20.357 0.920   1.00 100.00 ? 442  CYS A C     1 
ATOM   3427 O  O     . CYS A 1 442 ? 29.696 19.191 0.562   1.00 42.65  ? 442  CYS A O     1 
ATOM   3428 C  CB    . CYS A 1 442 ? 30.089 20.607 3.288   1.00 36.39  ? 442  CYS A CB    1 
ATOM   3429 S  SG    . CYS A 1 442 ? 31.187 21.992 2.883   1.00 51.84  ? 442  CYS A SG    1 
ATOM   3430 N  N     . SER A 1 443 ? 29.941 21.498 0.260   1.00 50.91  ? 443  SER A N     1 
ATOM   3431 C  CA    . SER A 1 443 ? 30.614 21.586 -1.054  1.00 100.00 ? 443  SER A CA    1 
ATOM   3432 C  C     . SER A 1 443 ? 32.065 22.073 -0.932  1.00 49.96  ? 443  SER A C     1 
ATOM   3433 O  O     . SER A 1 443 ? 32.345 23.183 -0.446  1.00 100.00 ? 443  SER A O     1 
ATOM   3434 C  CB    . SER A 1 443 ? 29.852 22.194 -2.259  1.00 69.50  ? 443  SER A CB    1 
ATOM   3435 O  OG    . SER A 1 443 ? 29.523 23.577 -2.121  1.00 81.64  ? 443  SER A OG    1 
ATOM   3436 N  N     . GLU A 1 444 ? 32.990 21.200 -1.347  1.00 100.00 ? 444  GLU A N     1 
ATOM   3437 C  CA    . GLU A 1 444 ? 34.426 21.474 -1.322  1.00 100.00 ? 444  GLU A CA    1 
ATOM   3438 C  C     . GLU A 1 444 ? 34.681 22.722 -2.149  1.00 100.00 ? 444  GLU A C     1 
ATOM   3439 O  O     . GLU A 1 444 ? 35.193 23.785 -1.715  1.00 100.00 ? 444  GLU A O     1 
ATOM   3440 C  CB    . GLU A 1 444 ? 35.193 20.274 -1.940  1.00 100.00 ? 444  GLU A CB    1 
ATOM   3441 C  CG    . GLU A 1 444 ? 34.676 18.879 -1.471  1.00 100.00 ? 444  GLU A CG    1 
ATOM   3442 C  CD    . GLU A 1 444 ? 34.820 17.709 -2.463  1.00 100.00 ? 444  GLU A CD    1 
ATOM   3443 O  OE1   . GLU A 1 444 ? 35.763 17.593 -3.270  1.00 100.00 ? 444  GLU A OE1   1 
ATOM   3444 O  OE2   . GLU A 1 444 ? 33.829 16.822 -2.348  1.00 100.00 ? 444  GLU A OE2   1 
ATOM   3445 N  N     . ARG A 1 445 ? 34.240 22.523 -3.380  1.00 100.00 ? 445  ARG A N     1 
ATOM   3446 C  CA    . ARG A 1 445 ? 34.293 23.500 -4.405  1.00 50.26  ? 445  ARG A CA    1 
ATOM   3447 C  C     . ARG A 1 445 ? 32.983 24.235 -4.461  1.00 99.59  ? 445  ARG A C     1 
ATOM   3448 O  O     . ARG A 1 445 ? 31.963 23.652 -4.850  1.00 77.56  ? 445  ARG A O     1 
ATOM   3449 C  CB    . ARG A 1 445 ? 34.517 22.762 -5.719  1.00 100.00 ? 445  ARG A CB    1 
ATOM   3450 N  N     . LYS A 1 446 ? 33.035 25.485 -4.008  1.00 66.80  ? 446  LYS A N     1 
ATOM   3451 C  CA    . LYS A 1 446 ? 31.914 26.421 -4.037  1.00 71.32  ? 446  LYS A CA    1 
ATOM   3452 C  C     . LYS A 1 446 ? 32.478 27.734 -4.495  1.00 55.20  ? 446  LYS A C     1 
ATOM   3453 O  O     . LYS A 1 446 ? 33.706 27.997 -4.307  1.00 38.46  ? 446  LYS A O     1 
ATOM   3454 C  CB    . LYS A 1 446 ? 31.076 26.622 -2.764  1.00 45.33  ? 446  LYS A CB    1 
ATOM   3455 C  CG    . LYS A 1 446 ? 31.883 26.670 -1.484  1.00 38.60  ? 446  LYS A CG    1 
ATOM   3456 C  CD    . LYS A 1 446 ? 32.232 28.085 -1.076  1.00 28.80  ? 446  LYS A CD    1 
ATOM   3457 C  CE    . LYS A 1 446 ? 33.281 28.136 0.041   1.00 100.00 ? 446  LYS A CE    1 
ATOM   3458 N  NZ    . LYS A 1 446 ? 33.426 26.877 0.812   1.00 100.00 ? 446  LYS A NZ    1 
ATOM   3459 N  N     . ALA A 1 447 ? 31.593 28.539 -5.100  1.00 27.54  ? 447  ALA A N     1 
ATOM   3460 C  CA    . ALA A 1 447 ? 32.039 29.827 -5.555  1.00 28.06  ? 447  ALA A CA    1 
ATOM   3461 C  C     . ALA A 1 447 ? 31.971 30.940 -4.495  1.00 42.76  ? 447  ALA A C     1 
ATOM   3462 O  O     . ALA A 1 447 ? 32.954 31.662 -4.281  1.00 27.21  ? 447  ALA A O     1 
ATOM   3463 C  CB    . ALA A 1 447 ? 31.434 30.257 -6.898  1.00 31.06  ? 447  ALA A CB    1 
ATOM   3464 N  N     . TYR A 1 448 ? 30.794 31.101 -3.857  1.00 26.54  ? 448  TYR A N     1 
ATOM   3465 C  CA    . TYR A 1 448 ? 30.570 32.156 -2.880  1.00 20.05  ? 448  TYR A CA    1 
ATOM   3466 C  C     . TYR A 1 448 ? 29.866 31.567 -1.649  1.00 15.39  ? 448  TYR A C     1 
ATOM   3467 O  O     . TYR A 1 448 ? 29.491 30.362 -1.602  1.00 17.70  ? 448  TYR A O     1 
ATOM   3468 C  CB    . TYR A 1 448 ? 29.855 33.397 -3.485  1.00 15.45  ? 448  TYR A CB    1 
ATOM   3469 C  CG    . TYR A 1 448 ? 30.649 33.989 -4.667  1.00 52.06  ? 448  TYR A CG    1 
ATOM   3470 C  CD1   . TYR A 1 448 ? 31.706 34.878 -4.436  1.00 32.93  ? 448  TYR A CD1   1 
ATOM   3471 C  CD2   . TYR A 1 448 ? 30.411 33.593 -5.993  1.00 32.46  ? 448  TYR A CD2   1 
ATOM   3472 C  CE1   . TYR A 1 448 ? 32.499 35.408 -5.466  1.00 23.11  ? 448  TYR A CE1   1 
ATOM   3473 C  CE2   . TYR A 1 448 ? 31.212 34.076 -7.040  1.00 24.45  ? 448  TYR A CE2   1 
ATOM   3474 C  CZ    . TYR A 1 448 ? 32.261 34.966 -6.772  1.00 25.83  ? 448  TYR A CZ    1 
ATOM   3475 O  OH    . TYR A 1 448 ? 33.088 35.405 -7.783  1.00 29.59  ? 448  TYR A OH    1 
ATOM   3476 N  N     . PHE A 1 449 ? 29.781 32.393 -0.634  1.00 19.67  ? 449  PHE A N     1 
ATOM   3477 C  CA    . PHE A 1 449 ? 29.038 31.934 0.570   1.00 19.10  ? 449  PHE A CA    1 
ATOM   3478 C  C     . PHE A 1 449 ? 28.548 33.153 1.307   1.00 13.66  ? 449  PHE A C     1 
ATOM   3479 O  O     . PHE A 1 449 ? 29.007 34.299 1.107   1.00 16.43  ? 449  PHE A O     1 
ATOM   3480 C  CB    . PHE A 1 449 ? 29.742 30.956 1.498   1.00 18.99  ? 449  PHE A CB    1 
ATOM   3481 C  CG    . PHE A 1 449 ? 30.810 31.712 2.304   1.00 41.93  ? 449  PHE A CG    1 
ATOM   3482 C  CD1   . PHE A 1 449 ? 30.507 32.349 3.514   1.00 31.69  ? 449  PHE A CD1   1 
ATOM   3483 C  CD2   . PHE A 1 449 ? 32.127 31.788 1.838   1.00 10.89  ? 449  PHE A CD2   1 
ATOM   3484 C  CE1   . PHE A 1 449 ? 31.474 33.066 4.226   1.00 16.55  ? 449  PHE A CE1   1 
ATOM   3485 C  CE2   . PHE A 1 449 ? 33.112 32.507 2.526   1.00 20.85  ? 449  PHE A CE2   1 
ATOM   3486 C  CZ    . PHE A 1 449 ? 32.779 33.138 3.727   1.00 27.67  ? 449  PHE A CZ    1 
ATOM   3487 N  N     . ILE A 1 450 ? 27.539 32.893 2.081   1.00 23.15  ? 450  ILE A N     1 
ATOM   3488 C  CA    . ILE A 1 450 ? 26.933 33.883 2.949   1.00 20.42  ? 450  ILE A CA    1 
ATOM   3489 C  C     . ILE A 1 450 ? 26.829 33.137 4.309   1.00 14.40  ? 450  ILE A C     1 
ATOM   3490 O  O     . ILE A 1 450 ? 26.262 32.050 4.408   1.00 19.39  ? 450  ILE A O     1 
ATOM   3491 C  CB    . ILE A 1 450 ? 25.565 34.318 2.475   1.00 28.70  ? 450  ILE A CB    1 
ATOM   3492 C  CG1   . ILE A 1 450 ? 25.651 35.106 1.174   1.00 20.61  ? 450  ILE A CG1   1 
ATOM   3493 C  CG2   . ILE A 1 450 ? 25.038 35.232 3.571   1.00 21.72  ? 450  ILE A CG2   1 
ATOM   3494 C  CD1   . ILE A 1 450 ? 24.270 35.489 0.732   1.00 14.57  ? 450  ILE A CD1   1 
ATOM   3495 N  N     . GLY A 1 451 ? 27.580 33.582 5.285   1.00 19.90  ? 451  GLY A N     1 
ATOM   3496 C  CA    . GLY A 1 451 ? 27.634 32.875 6.550   1.00 20.25  ? 451  GLY A CA    1 
ATOM   3497 C  C     . GLY A 1 451 ? 26.831 33.651 7.601   1.00 12.80  ? 451  GLY A C     1 
ATOM   3498 O  O     . GLY A 1 451 ? 26.801 34.898 7.655   1.00 20.21  ? 451  GLY A O     1 
ATOM   3499 N  N     . VAL A 1 452 ? 26.144 32.847 8.357   1.00 16.39  ? 452  VAL A N     1 
ATOM   3500 C  CA    . VAL A 1 452 ? 25.333 33.358 9.452   1.00 25.72  ? 452  VAL A CA    1 
ATOM   3501 C  C     . VAL A 1 452 ? 25.853 32.866 10.852  1.00 13.23  ? 452  VAL A C     1 
ATOM   3502 O  O     . VAL A 1 452 ? 25.999 31.637 11.122  1.00 18.98  ? 452  VAL A O     1 
ATOM   3503 C  CB    . VAL A 1 452 ? 23.860 33.007 9.271   1.00 37.09  ? 452  VAL A CB    1 
ATOM   3504 C  CG1   . VAL A 1 452 ? 23.012 33.864 10.232  1.00 15.15  ? 452  VAL A CG1   1 
ATOM   3505 C  CG2   . VAL A 1 452 ? 23.403 33.251 7.818   1.00 19.50  ? 452  VAL A CG2   1 
ATOM   3506 N  N     . LEU A 1 453 ? 26.098 33.875 11.687  1.00 13.49  ? 453  LEU A N     1 
ATOM   3507 C  CA    . LEU A 1 453 ? 26.587 33.558 12.990  1.00 20.82  ? 453  LEU A CA    1 
ATOM   3508 C  C     . LEU A 1 453 ? 25.435 33.829 13.968  1.00 11.89  ? 453  LEU A C     1 
ATOM   3509 O  O     . LEU A 1 453 ? 24.971 34.983 14.029  1.00 16.33  ? 453  LEU A O     1 
ATOM   3510 C  CB    . LEU A 1 453 ? 27.760 34.525 13.267  1.00 21.43  ? 453  LEU A CB    1 
ATOM   3511 C  CG    . LEU A 1 453 ? 28.460 34.298 14.617  1.00 19.19  ? 453  LEU A CG    1 
ATOM   3512 C  CD1   . LEU A 1 453 ? 29.320 33.059 14.603  1.00 12.05  ? 453  LEU A CD1   1 
ATOM   3513 C  CD2   . LEU A 1 453 ? 29.251 35.528 14.988  1.00 18.80  ? 453  LEU A CD2   1 
ATOM   3514 N  N     . ASP A 1 454 ? 25.123 32.794 14.721  1.00 15.64  ? 454  ASP A N     1 
ATOM   3515 C  CA    . ASP A 1 454 ? 24.089 32.821 15.712  1.00 14.54  ? 454  ASP A CA    1 
ATOM   3516 C  C     . ASP A 1 454 ? 24.746 32.368 17.036  1.00 15.34  ? 454  ASP A C     1 
ATOM   3517 O  O     . ASP A 1 454 ? 24.941 31.141 17.305  1.00 15.85  ? 454  ASP A O     1 
ATOM   3518 C  CB    . ASP A 1 454 ? 23.007 31.837 15.323  1.00 17.27  ? 454  ASP A CB    1 
ATOM   3519 C  CG    . ASP A 1 454 ? 21.952 31.607 16.380  1.00 27.19  ? 454  ASP A CG    1 
ATOM   3520 O  OD1   . ASP A 1 454 ? 21.894 32.541 17.310  1.00 17.86  ? 454  ASP A OD1   1 
ATOM   3521 O  OD2   . ASP A 1 454 ? 21.186 30.670 16.341  1.00 23.74  ? 454  ASP A OD2   1 
ATOM   3522 N  N     . ILE A 1 455 ? 25.164 33.401 17.805  1.00 19.79  ? 455  ILE A N     1 
ATOM   3523 C  CA    . ILE A 1 455 ? 25.827 33.181 19.061  1.00 23.54  ? 455  ILE A CA    1 
ATOM   3524 C  C     . ILE A 1 455 ? 25.388 34.282 20.016  1.00 8.48   ? 455  ILE A C     1 
ATOM   3525 O  O     . ILE A 1 455 ? 25.002 35.389 19.624  1.00 22.30  ? 455  ILE A O     1 
ATOM   3526 C  CB    . ILE A 1 455 ? 27.405 33.192 18.953  1.00 20.50  ? 455  ILE A CB    1 
ATOM   3527 C  CG1   . ILE A 1 455 ? 27.891 34.517 18.475  1.00 20.57  ? 455  ILE A CG1   1 
ATOM   3528 C  CG2   . ILE A 1 455 ? 28.035 32.115 18.115  1.00 17.80  ? 455  ILE A CG2   1 
ATOM   3529 C  CD1   . ILE A 1 455 ? 29.324 34.807 18.909  1.00 34.64  ? 455  ILE A CD1   1 
ATOM   3530 N  N     . SER A 1 456 ? 25.552 33.979 21.316  1.00 20.60  ? 456  SER A N     1 
ATOM   3531 C  CA    . SER A 1 456 ? 25.199 35.038 22.307  1.00 20.94  ? 456  SER A CA    1 
ATOM   3532 C  C     . SER A 1 456 ? 26.117 36.204 22.218  1.00 18.41  ? 456  SER A C     1 
ATOM   3533 O  O     . SER A 1 456 ? 27.316 36.059 21.864  1.00 28.71  ? 456  SER A O     1 
ATOM   3534 C  CB    . SER A 1 456 ? 25.255 34.541 23.769  1.00 34.31  ? 456  SER A CB    1 
ATOM   3535 O  OG    . SER A 1 456 ? 25.592 35.602 24.701  1.00 44.14  ? 456  SER A OG    1 
ATOM   3536 N  N     . GLY A 1 457 ? 25.542 37.319 22.630  1.00 10.46  ? 457  GLY A N     1 
ATOM   3537 C  CA    . GLY A 1 457 ? 26.267 38.560 22.775  1.00 9.25   ? 457  GLY A CA    1 
ATOM   3538 C  C     . GLY A 1 457 ? 27.014 38.400 24.178  1.00 12.07  ? 457  GLY A C     1 
ATOM   3539 O  O     . GLY A 1 457 ? 27.152 37.279 24.684  1.00 15.99  ? 457  GLY A O     1 
ATOM   3540 N  N     . PHE A 1 458 ? 27.460 39.508 24.744  1.00 13.10  ? 458  PHE A N     1 
ATOM   3541 C  CA    . PHE A 1 458 ? 28.156 39.499 26.030  1.00 13.20  ? 458  PHE A CA    1 
ATOM   3542 C  C     . PHE A 1 458 ? 27.250 38.891 27.037  1.00 29.84  ? 458  PHE A C     1 
ATOM   3543 O  O     . PHE A 1 458 ? 26.057 39.155 26.995  1.00 26.25  ? 458  PHE A O     1 
ATOM   3544 C  CB    . PHE A 1 458 ? 28.464 40.934 26.509  1.00 12.64  ? 458  PHE A CB    1 
ATOM   3545 C  CG    . PHE A 1 458 ? 29.654 41.529 25.824  1.00 33.27  ? 458  PHE A CG    1 
ATOM   3546 C  CD1   . PHE A 1 458 ? 30.926 41.084 26.198  1.00 28.33  ? 458  PHE A CD1   1 
ATOM   3547 C  CD2   . PHE A 1 458 ? 29.529 42.474 24.786  1.00 23.35  ? 458  PHE A CD2   1 
ATOM   3548 C  CE1   . PHE A 1 458 ? 32.055 41.573 25.529  1.00 30.09  ? 458  PHE A CE1   1 
ATOM   3549 C  CE2   . PHE A 1 458 ? 30.637 43.004 24.118  1.00 20.42  ? 458  PHE A CE2   1 
ATOM   3550 C  CZ    . PHE A 1 458 ? 31.901 42.550 24.528  1.00 35.67  ? 458  PHE A CZ    1 
ATOM   3551 N  N     . GLU A 1 459 ? 27.820 38.074 27.902  1.00 26.67  ? 459  GLU A N     1 
ATOM   3552 C  CA    . GLU A 1 459 ? 27.084 37.412 28.971  1.00 25.40  ? 459  GLU A CA    1 
ATOM   3553 C  C     . GLU A 1 459 ? 27.534 37.947 30.356  1.00 23.67  ? 459  GLU A C     1 
ATOM   3554 O  O     . GLU A 1 459 ? 28.697 37.784 30.722  1.00 21.25  ? 459  GLU A O     1 
ATOM   3555 C  CB    . GLU A 1 459 ? 27.491 35.942 29.026  1.00 27.28  ? 459  GLU A CB    1 
ATOM   3556 C  CG    . GLU A 1 459 ? 26.859 35.150 27.895  1.00 28.27  ? 459  GLU A CG    1 
ATOM   3557 C  CD    . GLU A 1 459 ? 26.944 33.687 28.155  1.00 47.54  ? 459  GLU A CD    1 
ATOM   3558 O  OE1   . GLU A 1 459 ? 27.687 33.129 28.953  1.00 35.79  ? 459  GLU A OE1   1 
ATOM   3559 O  OE2   . GLU A 1 459 ? 26.095 33.083 27.409  1.00 33.58  ? 459  GLU A OE2   1 
ATOM   3560 N  N     . ILE A 1 460 ? 26.646 38.532 31.130  1.00 23.13  ? 460  ILE A N     1 
ATOM   3561 C  CA    . ILE A 1 460 ? 27.006 38.957 32.478  1.00 21.26  ? 460  ILE A CA    1 
ATOM   3562 C  C     . ILE A 1 460 ? 25.959 38.454 33.473  1.00 20.84  ? 460  ILE A C     1 
ATOM   3563 O  O     . ILE A 1 460 ? 24.946 39.031 33.630  1.00 27.03  ? 460  ILE A O     1 
ATOM   3564 C  CB    . ILE A 1 460 ? 27.131 40.452 32.475  1.00 27.01  ? 460  ILE A CB    1 
ATOM   3565 C  CG1   . ILE A 1 460 ? 27.906 40.844 31.212  1.00 59.42  ? 460  ILE A CG1   1 
ATOM   3566 C  CG2   . ILE A 1 460 ? 27.871 40.892 33.711  1.00 28.65  ? 460  ILE A CG2   1 
ATOM   3567 C  CD1   . ILE A 1 460 ? 28.253 42.341 31.117  1.00 52.85  ? 460  ILE A CD1   1 
ATOM   3568 N  N     . PHE A 1 461 ? 26.130 37.303 34.073  1.00 20.97  ? 461  PHE A N     1 
ATOM   3569 C  CA    . PHE A 1 461 ? 25.173 36.745 35.006  1.00 17.66  ? 461  PHE A CA    1 
ATOM   3570 C  C     . PHE A 1 461 ? 25.639 36.968 36.440  1.00 30.07  ? 461  PHE A C     1 
ATOM   3571 O  O     . PHE A 1 461 ? 26.591 37.722 36.673  1.00 27.37  ? 461  PHE A O     1 
ATOM   3572 C  CB    . PHE A 1 461 ? 25.283 35.255 34.851  1.00 17.30  ? 461  PHE A CB    1 
ATOM   3573 C  CG    . PHE A 1 461 ? 25.033 34.832 33.438  1.00 28.08  ? 461  PHE A CG    1 
ATOM   3574 C  CD1   . PHE A 1 461 ? 24.044 35.463 32.688  1.00 46.33  ? 461  PHE A CD1   1 
ATOM   3575 C  CD2   . PHE A 1 461 ? 25.732 33.766 32.876  1.00 39.67  ? 461  PHE A CD2   1 
ATOM   3576 C  CE1   . PHE A 1 461 ? 23.786 35.065 31.379  1.00 56.36  ? 461  PHE A CE1   1 
ATOM   3577 C  CE2   . PHE A 1 461 ? 25.462 33.332 31.582  1.00 48.82  ? 461  PHE A CE2   1 
ATOM   3578 C  CZ    . PHE A 1 461 ? 24.490 33.993 30.826  1.00 26.63  ? 461  PHE A CZ    1 
ATOM   3579 N  N     . LYS A 1 462 ? 24.967 36.234 37.359  1.00 54.87  ? 462  LYS A N     1 
ATOM   3580 C  CA    . LYS A 1 462 ? 25.231 36.230 38.807  1.00 46.06  ? 462  LYS A CA    1 
ATOM   3581 C  C     . LYS A 1 462 ? 26.629 35.714 38.977  1.00 21.26  ? 462  LYS A C     1 
ATOM   3582 O  O     . LYS A 1 462 ? 27.526 36.358 39.496  1.00 64.82  ? 462  LYS A O     1 
ATOM   3583 C  CB    . LYS A 1 462 ? 24.383 35.192 39.559  1.00 49.99  ? 462  LYS A CB    1 
ATOM   3584 C  CG    . LYS A 1 462 ? 22.864 35.164 39.427  1.00 100.00 ? 462  LYS A CG    1 
ATOM   3585 C  CD    . LYS A 1 462 ? 22.257 34.106 40.374  1.00 100.00 ? 462  LYS A CD    1 
ATOM   3586 C  CE    . LYS A 1 462 ? 20.745 34.206 40.614  1.00 100.00 ? 462  LYS A CE    1 
ATOM   3587 N  NZ    . LYS A 1 462 ? 20.359 35.131 41.707  1.00 100.00 ? 462  LYS A NZ    1 
ATOM   3588 N  N     . VAL A 1 463 ? 26.753 34.500 38.426  1.00 25.09  ? 463  VAL A N     1 
ATOM   3589 C  CA    . VAL A 1 463 ? 27.967 33.776 38.419  1.00 25.32  ? 463  VAL A CA    1 
ATOM   3590 C  C     . VAL A 1 463 ? 28.516 33.688 37.016  1.00 30.26  ? 463  VAL A C     1 
ATOM   3591 O  O     . VAL A 1 463 ? 27.847 33.157 36.140  1.00 29.86  ? 463  VAL A O     1 
ATOM   3592 C  CB    . VAL A 1 463 ? 27.760 32.356 38.970  1.00 31.77  ? 463  VAL A CB    1 
ATOM   3593 C  CG1   . VAL A 1 463 ? 29.116 31.657 39.239  1.00 26.89  ? 463  VAL A CG1   1 
ATOM   3594 C  CG2   . VAL A 1 463 ? 26.982 32.411 40.265  1.00 39.76  ? 463  VAL A CG2   1 
ATOM   3595 N  N     . ASN A 1 464 ? 29.735 34.134 36.828  1.00 24.45  ? 464  ASN A N     1 
ATOM   3596 C  CA    . ASN A 1 464 ? 30.375 34.028 35.520  1.00 22.76  ? 464  ASN A CA    1 
ATOM   3597 C  C     . ASN A 1 464 ? 31.575 33.110 35.634  1.00 20.55  ? 464  ASN A C     1 
ATOM   3598 O  O     . ASN A 1 464 ? 32.424 33.348 36.451  1.00 18.18  ? 464  ASN A O     1 
ATOM   3599 C  CB    . ASN A 1 464 ? 30.764 35.391 34.920  1.00 10.87  ? 464  ASN A CB    1 
ATOM   3600 C  CG    . ASN A 1 464 ? 29.574 36.268 34.838  1.00 15.54  ? 464  ASN A CG    1 
ATOM   3601 O  OD1   . ASN A 1 464 ? 28.621 35.939 34.084  1.00 17.45  ? 464  ASN A OD1   1 
ATOM   3602 N  ND2   . ASN A 1 464 ? 29.624 37.372 35.584  1.00 16.19  ? 464  ASN A ND2   1 
ATOM   3603 N  N     . SER A 1 465 ? 31.595 32.020 34.844  1.00 18.29  ? 465  SER A N     1 
ATOM   3604 C  CA    . SER A 1 465 ? 32.642 31.031 34.801  1.00 19.87  ? 465  SER A CA    1 
ATOM   3605 C  C     . SER A 1 465 ? 33.452 31.043 33.488  1.00 10.28  ? 465  SER A C     1 
ATOM   3606 O  O     . SER A 1 465 ? 33.443 32.030 32.767  1.00 14.84  ? 465  SER A O     1 
ATOM   3607 C  CB    . SER A 1 465 ? 32.171 29.658 35.180  1.00 13.62  ? 465  SER A CB    1 
ATOM   3608 O  OG    . SER A 1 465 ? 33.262 28.898 35.666  1.00 27.54  ? 465  SER A OG    1 
ATOM   3609 N  N     . PHE A 1 466 ? 34.193 29.986 33.285  1.00 13.30  ? 466  PHE A N     1 
ATOM   3610 C  CA    . PHE A 1 466 ? 35.125 29.897 32.182  1.00 20.36  ? 466  PHE A CA    1 
ATOM   3611 C  C     . PHE A 1 466 ? 34.488 30.133 30.826  1.00 17.74  ? 466  PHE A C     1 
ATOM   3612 O  O     . PHE A 1 466 ? 35.025 30.887 30.042  1.00 18.47  ? 466  PHE A O     1 
ATOM   3613 C  CB    . PHE A 1 466 ? 35.899 28.628 32.280  1.00 19.05  ? 466  PHE A CB    1 
ATOM   3614 C  CG    . PHE A 1 466 ? 36.837 28.483 31.127  1.00 24.26  ? 466  PHE A CG    1 
ATOM   3615 C  CD1   . PHE A 1 466 ? 37.879 29.393 30.927  1.00 24.77  ? 466  PHE A CD1   1 
ATOM   3616 C  CD2   . PHE A 1 466 ? 36.654 27.415 30.240  1.00 29.08  ? 466  PHE A CD2   1 
ATOM   3617 C  CE1   . PHE A 1 466 ? 38.757 29.165 29.857  1.00 36.35  ? 466  PHE A CE1   1 
ATOM   3618 C  CE2   . PHE A 1 466 ? 37.502 27.179 29.155  1.00 23.77  ? 466  PHE A CE2   1 
ATOM   3619 C  CZ    . PHE A 1 466 ? 38.560 28.077 28.988  1.00 24.25  ? 466  PHE A CZ    1 
ATOM   3620 N  N     . GLU A 1 467 ? 33.310 29.557 30.658  1.00 17.15  ? 467  GLU A N     1 
ATOM   3621 C  CA    . GLU A 1 467 ? 32.512 29.676 29.411  1.00 14.44  ? 467  GLU A CA    1 
ATOM   3622 C  C     . GLU A 1 467 ? 32.067 31.063 29.144  1.00 24.40  ? 467  GLU A C     1 
ATOM   3623 O  O     . GLU A 1 467 ? 32.044 31.432 27.966  1.00 17.73  ? 467  GLU A O     1 
ATOM   3624 C  CB    . GLU A 1 467 ? 31.304 28.786 29.395  1.00 23.92  ? 467  GLU A CB    1 
ATOM   3625 C  CG    . GLU A 1 467 ? 31.656 27.289 29.497  1.00 24.79  ? 467  GLU A CG    1 
ATOM   3626 C  CD    . GLU A 1 467 ? 32.233 26.861 30.829  1.00 100.00 ? 467  GLU A CD    1 
ATOM   3627 O  OE1   . GLU A 1 467 ? 32.147 27.453 31.891  1.00 22.89  ? 467  GLU A OE1   1 
ATOM   3628 O  OE2   . GLU A 1 467 ? 32.838 25.729 30.719  1.00 29.71  ? 467  GLU A OE2   1 
ATOM   3629 N  N     . GLN A 1 468 ? 31.687 31.826 30.207  1.00 13.58  ? 468  GLN A N     1 
ATOM   3630 C  CA    . GLN A 1 468 ? 31.364 33.249 30.060  1.00 11.85  ? 468  GLN A CA    1 
ATOM   3631 C  C     . GLN A 1 468 ? 32.582 34.056 29.558  1.00 12.00  ? 468  GLN A C     1 
ATOM   3632 O  O     . GLN A 1 468 ? 32.510 35.086 28.847  1.00 14.97  ? 468  GLN A O     1 
ATOM   3633 C  CB    . GLN A 1 468 ? 30.778 33.965 31.289  1.00 11.92  ? 468  GLN A CB    1 
ATOM   3634 C  CG    . GLN A 1 468 ? 29.309 33.627 31.664  1.00 17.47  ? 468  GLN A CG    1 
ATOM   3635 C  CD    . GLN A 1 468 ? 29.130 32.154 31.928  1.00 29.14  ? 468  GLN A CD    1 
ATOM   3636 O  OE1   . GLN A 1 468 ? 29.697 31.561 32.857  1.00 25.28  ? 468  GLN A OE1   1 
ATOM   3637 N  NE2   . GLN A 1 468 ? 28.329 31.513 31.083  1.00 29.59  ? 468  GLN A NE2   1 
ATOM   3638 N  N     . LEU A 1 469 ? 33.760 33.695 30.063  1.00 17.62  ? 469  LEU A N     1 
ATOM   3639 C  CA    . LEU A 1 469 ? 34.931 34.421 29.653  1.00 12.55  ? 469  LEU A CA    1 
ATOM   3640 C  C     . LEU A 1 469 ? 35.171 34.177 28.133  1.00 10.14  ? 469  LEU A C     1 
ATOM   3641 O  O     . LEU A 1 469 ? 35.474 35.083 27.402  1.00 16.64  ? 469  LEU A O     1 
ATOM   3642 C  CB    . LEU A 1 469 ? 36.169 33.992 30.495  1.00 13.64  ? 469  LEU A CB    1 
ATOM   3643 C  CG    . LEU A 1 469 ? 37.461 34.727 30.056  1.00 13.69  ? 469  LEU A CG    1 
ATOM   3644 C  CD1   . LEU A 1 469 ? 37.435 36.242 30.223  1.00 11.28  ? 469  LEU A CD1   1 
ATOM   3645 C  CD2   . LEU A 1 469 ? 38.717 34.083 30.697  1.00 14.64  ? 469  LEU A CD2   1 
ATOM   3646 N  N     . CYS A 1 470 ? 35.018 32.947 27.758  1.00 14.58  ? 470  CYS A N     1 
ATOM   3647 C  CA    . CYS A 1 470 ? 35.148 32.590 26.381  1.00 18.89  ? 470  CYS A CA    1 
ATOM   3648 C  C     . CYS A 1 470 ? 34.221 33.421 25.496  1.00 19.41  ? 470  CYS A C     1 
ATOM   3649 O  O     . CYS A 1 470 ? 34.636 34.101 24.571  1.00 17.63  ? 470  CYS A O     1 
ATOM   3650 C  CB    . CYS A 1 470 ? 34.875 31.098 26.261  1.00 12.73  ? 470  CYS A CB    1 
ATOM   3651 S  SG    . CYS A 1 470 ? 36.265 30.069 26.854  1.00 19.29  ? 470  CYS A SG    1 
ATOM   3652 N  N     . ILE A 1 471 ? 32.932 33.318 25.762  1.00 20.25  ? 471  ILE A N     1 
ATOM   3653 C  CA    . ILE A 1 471 ? 31.938 34.036 24.992  1.00 9.39   ? 471  ILE A CA    1 
ATOM   3654 C  C     . ILE A 1 471 ? 32.186 35.512 25.017  1.00 13.08  ? 471  ILE A C     1 
ATOM   3655 O  O     . ILE A 1 471 ? 31.924 36.217 24.067  1.00 14.06  ? 471  ILE A O     1 
ATOM   3656 C  CB    . ILE A 1 471 ? 30.484 33.664 25.481  1.00 30.47  ? 471  ILE A CB    1 
ATOM   3657 C  CG1   . ILE A 1 471 ? 29.399 33.975 24.474  1.00 22.93  ? 471  ILE A CG1   1 
ATOM   3658 C  CG2   . ILE A 1 471 ? 30.071 34.558 26.654  1.00 32.64  ? 471  ILE A CG2   1 
ATOM   3659 C  CD1   . ILE A 1 471 ? 29.754 33.763 23.042  1.00 25.39  ? 471  ILE A CD1   1 
ATOM   3660 N  N     . ASN A 1 472 ? 32.657 36.041 26.151  1.00 9.46   ? 472  ASN A N     1 
ATOM   3661 C  CA    . ASN A 1 472 ? 32.834 37.441 26.260  1.00 7.44   ? 472  ASN A CA    1 
ATOM   3662 C  C     . ASN A 1 472 ? 34.065 37.946 25.482  1.00 12.58  ? 472  ASN A C     1 
ATOM   3663 O  O     . ASN A 1 472 ? 34.099 39.106 24.966  1.00 12.18  ? 472  ASN A O     1 
ATOM   3664 C  CB    . ASN A 1 472 ? 32.927 37.743 27.756  1.00 21.64  ? 472  ASN A CB    1 
ATOM   3665 C  CG    . ASN A 1 472 ? 31.551 37.789 28.363  1.00 42.23  ? 472  ASN A CG    1 
ATOM   3666 O  OD1   . ASN A 1 472 ? 30.572 37.780 27.631  1.00 16.01  ? 472  ASN A OD1   1 
ATOM   3667 N  ND2   . ASN A 1 472 ? 31.461 37.867 29.694  1.00 17.12  ? 472  ASN A ND2   1 
ATOM   3668 N  N     . TYR A 1 473 ? 35.021 37.030 25.408  1.00 20.72  ? 473  TYR A N     1 
ATOM   3669 C  CA    . TYR A 1 473 ? 36.267 37.193 24.608  1.00 18.75  ? 473  TYR A CA    1 
ATOM   3670 C  C     . TYR A 1 473 ? 35.879 37.262 23.116  1.00 10.32  ? 473  TYR A C     1 
ATOM   3671 O  O     . TYR A 1 473 ? 36.247 38.232 22.432  1.00 16.98  ? 473  TYR A O     1 
ATOM   3672 C  CB    . TYR A 1 473 ? 37.186 35.999 24.899  1.00 13.88  ? 473  TYR A CB    1 
ATOM   3673 C  CG    . TYR A 1 473 ? 38.409 35.796 24.010  1.00 22.15  ? 473  TYR A CG    1 
ATOM   3674 C  CD1   . TYR A 1 473 ? 39.125 36.896 23.521  1.00 16.50  ? 473  TYR A CD1   1 
ATOM   3675 C  CD2   . TYR A 1 473 ? 38.824 34.503 23.670  1.00 14.31  ? 473  TYR A CD2   1 
ATOM   3676 C  CE1   . TYR A 1 473 ? 40.252 36.715 22.706  1.00 21.02  ? 473  TYR A CE1   1 
ATOM   3677 C  CE2   . TYR A 1 473 ? 39.943 34.306 22.845  1.00 18.73  ? 473  TYR A CE2   1 
ATOM   3678 C  CZ    . TYR A 1 473 ? 40.653 35.419 22.375  1.00 14.03  ? 473  TYR A CZ    1 
ATOM   3679 O  OH    . TYR A 1 473 ? 41.794 35.212 21.617  1.00 18.52  ? 473  TYR A OH    1 
ATOM   3680 N  N     . THR A 1 474 ? 35.077 36.292 22.686  1.00 19.39  ? 474  THR A N     1 
ATOM   3681 C  CA    . THR A 1 474 ? 34.549 36.320 21.314  1.00 18.24  ? 474  THR A CA    1 
ATOM   3682 C  C     . THR A 1 474 ? 33.846 37.660 21.057  1.00 18.42  ? 474  THR A C     1 
ATOM   3683 O  O     . THR A 1 474 ? 33.989 38.389 20.034  1.00 16.80  ? 474  THR A O     1 
ATOM   3684 C  CB    . THR A 1 474 ? 33.585 35.160 21.142  1.00 13.01  ? 474  THR A CB    1 
ATOM   3685 O  OG1   . THR A 1 474 ? 34.238 33.886 21.275  1.00 16.04  ? 474  THR A OG1   1 
ATOM   3686 C  CG2   . THR A 1 474 ? 32.818 35.307 19.791  1.00 16.11  ? 474  THR A CG2   1 
ATOM   3687 N  N     . ASN A 1 475 ? 33.002 38.063 22.026  1.00 20.46  ? 475  ASN A N     1 
ATOM   3688 C  CA    . ASN A 1 475 ? 32.295 39.306 21.889  1.00 11.41  ? 475  ASN A CA    1 
ATOM   3689 C  C     . ASN A 1 475 ? 33.139 40.537 21.719  1.00 19.75  ? 475  ASN A C     1 
ATOM   3690 O  O     . ASN A 1 475 ? 32.800 41.451 20.937  1.00 17.56  ? 475  ASN A O     1 
ATOM   3691 C  CB    . ASN A 1 475 ? 31.074 39.407 22.842  1.00 14.84  ? 475  ASN A CB    1 
ATOM   3692 C  CG    . ASN A 1 475 ? 29.894 38.483 22.276  1.00 22.98  ? 475  ASN A CG    1 
ATOM   3693 O  OD1   . ASN A 1 475 ? 29.157 38.892 21.346  1.00 23.84  ? 475  ASN A OD1   1 
ATOM   3694 N  ND2   . ASN A 1 475 ? 29.666 37.262 22.761  1.00 18.88  ? 475  ASN A ND2   1 
ATOM   3695 N  N     . GLU A 1 476 ? 34.301 40.573 22.436  1.00 21.14  ? 476  GLU A N     1 
ATOM   3696 C  CA    . GLU A 1 476 ? 35.231 41.689 22.337  1.00 16.83  ? 476  GLU A CA    1 
ATOM   3697 C  C     . GLU A 1 476 ? 35.788 41.785 20.896  1.00 8.14   ? 476  GLU A C     1 
ATOM   3698 O  O     . GLU A 1 476 ? 36.025 42.885 20.339  1.00 16.29  ? 476  GLU A O     1 
ATOM   3699 C  CB    . GLU A 1 476 ? 36.457 41.357 23.173  1.00 20.41  ? 476  GLU A CB    1 
ATOM   3700 C  CG    . GLU A 1 476 ? 36.324 41.731 24.644  1.00 20.72  ? 476  GLU A CG    1 
ATOM   3701 C  CD    . GLU A 1 476 ? 35.905 43.126 25.077  1.00 22.00  ? 476  GLU A CD    1 
ATOM   3702 O  OE1   . GLU A 1 476 ? 36.277 44.173 24.382  1.00 23.01  ? 476  GLU A OE1   1 
ATOM   3703 O  OE2   . GLU A 1 476 ? 35.294 43.283 26.117  1.00 25.93  ? 476  GLU A OE2   1 
ATOM   3704 N  N     . LYS A 1 477 ? 36.055 40.582 20.405  1.00 11.19  ? 477  LYS A N     1 
ATOM   3705 C  CA    . LYS A 1 477 ? 36.571 40.472 19.005  1.00 23.85  ? 477  LYS A CA    1 
ATOM   3706 C  C     . LYS A 1 477 ? 35.547 40.959 17.993  1.00 15.20  ? 477  LYS A C     1 
ATOM   3707 O  O     . LYS A 1 477 ? 35.862 41.761 17.102  1.00 18.33  ? 477  LYS A O     1 
ATOM   3708 C  CB    . LYS A 1 477 ? 37.160 39.109 18.671  1.00 14.10  ? 477  LYS A CB    1 
ATOM   3709 C  CG    . LYS A 1 477 ? 38.621 39.057 19.154  1.00 23.10  ? 477  LYS A CG    1 
ATOM   3710 C  CD    . LYS A 1 477 ? 39.480 37.907 18.672  1.00 20.79  ? 477  LYS A CD    1 
ATOM   3711 C  CE    . LYS A 1 477 ? 41.003 38.181 18.741  1.00 26.67  ? 477  LYS A CE    1 
ATOM   3712 N  NZ    . LYS A 1 477 ? 41.829 37.055 18.267  1.00 23.90  ? 477  LYS A NZ    1 
ATOM   3713 N  N     . LEU A 1 478 ? 34.287 40.497 18.146  1.00 18.04  ? 478  LEU A N     1 
ATOM   3714 C  CA    . LEU A 1 478 ? 33.244 40.939 17.211  1.00 14.21  ? 478  LEU A CA    1 
ATOM   3715 C  C     . LEU A 1 478 ? 32.977 42.396 17.349  1.00 20.56  ? 478  LEU A C     1 
ATOM   3716 O  O     . LEU A 1 478 ? 32.691 43.073 16.378  1.00 20.99  ? 478  LEU A O     1 
ATOM   3717 C  CB    . LEU A 1 478 ? 31.974 40.131 17.401  1.00 19.88  ? 478  LEU A CB    1 
ATOM   3718 C  CG    . LEU A 1 478 ? 32.190 38.647 17.243  1.00 18.57  ? 478  LEU A CG    1 
ATOM   3719 C  CD1   . LEU A 1 478 ? 30.924 37.955 17.597  1.00 17.36  ? 478  LEU A CD1   1 
ATOM   3720 C  CD2   . LEU A 1 478 ? 32.565 38.290 15.785  1.00 19.19  ? 478  LEU A CD2   1 
ATOM   3721 N  N     . GLN A 1 479 ? 33.058 42.962 18.568  1.00 20.97  ? 479  GLN A N     1 
ATOM   3722 C  CA    . GLN A 1 479 ? 32.800 44.390 18.707  1.00 11.45  ? 479  GLN A CA    1 
ATOM   3723 C  C     . GLN A 1 479 ? 33.882 45.253 18.061  1.00 11.12  ? 479  GLN A C     1 
ATOM   3724 O  O     . GLN A 1 479 ? 33.675 46.328 17.475  1.00 14.16  ? 479  GLN A O     1 
ATOM   3725 C  CB    . GLN A 1 479 ? 32.536 44.759 20.211  1.00 11.93  ? 479  GLN A CB    1 
ATOM   3726 C  CG    . GLN A 1 479 ? 32.195 46.243 20.453  1.00 24.06  ? 479  GLN A CG    1 
ATOM   3727 C  CD    . GLN A 1 479 ? 30.994 46.833 19.676  1.00 23.51  ? 479  GLN A CD    1 
ATOM   3728 O  OE1   . GLN A 1 479 ? 29.856 46.319 19.703  1.00 22.04  ? 479  GLN A OE1   1 
ATOM   3729 N  NE2   . GLN A 1 479 ? 31.215 47.954 18.982  1.00 29.44  ? 479  GLN A NE2   1 
ATOM   3730 N  N     . GLN A 1 480 ? 35.096 44.800 18.255  1.00 17.87  ? 480  GLN A N     1 
ATOM   3731 C  CA    . GLN A 1 480 ? 36.223 45.479 17.673  1.00 15.07  ? 480  GLN A CA    1 
ATOM   3732 C  C     . GLN A 1 480 ? 36.089 45.356 16.079  1.00 11.87  ? 480  GLN A C     1 
ATOM   3733 O  O     . GLN A 1 480 ? 36.341 46.353 15.382  1.00 23.69  ? 480  GLN A O     1 
ATOM   3734 C  CB    . GLN A 1 480 ? 37.477 44.741 18.217  1.00 15.32  ? 480  GLN A CB    1 
ATOM   3735 C  CG    . GLN A 1 480 ? 38.730 45.110 17.357  1.00 20.25  ? 480  GLN A CG    1 
ATOM   3736 C  CD    . GLN A 1 480 ? 40.022 44.414 17.759  1.00 13.40  ? 480  GLN A CD    1 
ATOM   3737 O  OE1   . GLN A 1 480 ? 40.137 43.171 17.702  1.00 17.98  ? 480  GLN A OE1   1 
ATOM   3738 N  NE2   . GLN A 1 480 ? 40.963 45.254 18.190  1.00 18.51  ? 480  GLN A NE2   1 
ATOM   3739 N  N     . PHE A 1 481 ? 35.671 44.183 15.565  1.00 16.46  ? 481  PHE A N     1 
ATOM   3740 C  CA    . PHE A 1 481 ? 35.371 43.965 14.128  1.00 9.96   ? 481  PHE A CA    1 
ATOM   3741 C  C     . PHE A 1 481 ? 34.344 44.994 13.637  1.00 23.84  ? 481  PHE A C     1 
ATOM   3742 O  O     . PHE A 1 481 ? 34.504 45.748 12.643  1.00 20.02  ? 481  PHE A O     1 
ATOM   3743 C  CB    . PHE A 1 481 ? 34.947 42.539 13.934  1.00 10.24  ? 481  PHE A CB    1 
ATOM   3744 C  CG    . PHE A 1 481 ? 34.530 42.145 12.536  1.00 26.25  ? 481  PHE A CG    1 
ATOM   3745 C  CD1   . PHE A 1 481 ? 35.487 41.851 11.556  1.00 30.93  ? 481  PHE A CD1   1 
ATOM   3746 C  CD2   . PHE A 1 481 ? 33.187 41.979 12.192  1.00 21.51  ? 481  PHE A CD2   1 
ATOM   3747 C  CE1   . PHE A 1 481 ? 35.152 41.468 10.246  1.00 18.68  ? 481  PHE A CE1   1 
ATOM   3748 C  CE2   . PHE A 1 481 ? 32.823 41.584 10.898  1.00 25.14  ? 481  PHE A CE2   1 
ATOM   3749 C  CZ    . PHE A 1 481 ? 33.800 41.317 9.935   1.00 14.39  ? 481  PHE A CZ    1 
ATOM   3750 N  N     . PHE A 1 482 ? 33.269 45.145 14.392  1.00 23.81  ? 482  PHE A N     1 
ATOM   3751 C  CA    . PHE A 1 482 ? 32.307 46.146 14.049  1.00 13.33  ? 482  PHE A CA    1 
ATOM   3752 C  C     . PHE A 1 482 ? 32.864 47.561 13.947  1.00 25.12  ? 482  PHE A C     1 
ATOM   3753 O  O     . PHE A 1 482 ? 32.638 48.318 12.962  1.00 20.79  ? 482  PHE A O     1 
ATOM   3754 C  CB    . PHE A 1 482 ? 31.075 46.089 15.010  1.00 9.95   ? 482  PHE A CB    1 
ATOM   3755 C  CG    . PHE A 1 482 ? 30.123 47.189 14.630  1.00 12.52  ? 482  PHE A CG    1 
ATOM   3756 C  CD1   . PHE A 1 482 ? 29.223 47.007 13.571  1.00 22.98  ? 482  PHE A CD1   1 
ATOM   3757 C  CD2   . PHE A 1 482 ? 30.183 48.451 15.222  1.00 17.43  ? 482  PHE A CD2   1 
ATOM   3758 C  CE1   . PHE A 1 482 ? 28.379 48.047 13.155  1.00 25.15  ? 482  PHE A CE1   1 
ATOM   3759 C  CE2   . PHE A 1 482 ? 29.359 49.506 14.812  1.00 18.77  ? 482  PHE A CE2   1 
ATOM   3760 C  CZ    . PHE A 1 482 ? 28.435 49.305 13.772  1.00 17.46  ? 482  PHE A CZ    1 
ATOM   3761 N  N     . ASN A 1 483 ? 33.603 47.948 14.988  1.00 22.28  ? 483  ASN A N     1 
ATOM   3762 C  CA    . ASN A 1 483 ? 34.159 49.277 15.072  1.00 18.89  ? 483  ASN A CA    1 
ATOM   3763 C  C     . ASN A 1 483 ? 35.104 49.597 13.935  1.00 21.91  ? 483  ASN A C     1 
ATOM   3764 O  O     . ASN A 1 483 ? 35.069 50.704 13.406  1.00 23.61  ? 483  ASN A O     1 
ATOM   3765 C  CB    . ASN A 1 483 ? 34.811 49.595 16.419  1.00 24.82  ? 483  ASN A CB    1 
ATOM   3766 C  CG    . ASN A 1 483 ? 33.797 49.889 17.531  1.00 49.30  ? 483  ASN A CG    1 
ATOM   3767 O  OD1   . ASN A 1 483 ? 32.702 50.447 17.311  1.00 37.05  ? 483  ASN A OD1   1 
ATOM   3768 N  ND2   . ASN A 1 483 ? 34.180 49.509 18.757  1.00 38.13  ? 483  ASN A ND2   1 
ATOM   3769 N  N     . HIS A 1 484 ? 35.923 48.629 13.594  1.00 18.49  ? 484  HIS A N     1 
ATOM   3770 C  CA    . HIS A 1 484 ? 36.811 48.835 12.458  1.00 30.86  ? 484  HIS A CA    1 
ATOM   3771 C  C     . HIS A 1 484 ? 36.046 48.990 11.163  1.00 28.68  ? 484  HIS A C     1 
ATOM   3772 O  O     . HIS A 1 484 ? 36.325 49.850 10.348  1.00 29.09  ? 484  HIS A O     1 
ATOM   3773 C  CB    . HIS A 1 484 ? 37.776 47.699 12.327  1.00 37.30  ? 484  HIS A CB    1 
ATOM   3774 C  CG    . HIS A 1 484 ? 38.830 47.997 13.288  1.00 100.00 ? 484  HIS A CG    1 
ATOM   3775 N  ND1   . HIS A 1 484 ? 38.546 48.029 14.641  1.00 100.00 ? 484  HIS A ND1   1 
ATOM   3776 C  CD2   . HIS A 1 484 ? 40.111 48.421 13.089  1.00 100.00 ? 484  HIS A CD2   1 
ATOM   3777 C  CE1   . HIS A 1 484 ? 39.679 48.353 15.252  1.00 100.00 ? 484  HIS A CE1   1 
ATOM   3778 N  NE2   . HIS A 1 484 ? 40.634 48.602 14.350  1.00 100.00 ? 484  HIS A NE2   1 
ATOM   3779 N  N     . HIS A 1 485 ? 35.051 48.135 11.016  1.00 24.20  ? 485  HIS A N     1 
ATOM   3780 C  CA    . HIS A 1 485 ? 34.197 48.202 9.876   1.00 26.76  ? 485  HIS A CA    1 
ATOM   3781 C  C     . HIS A 1 485 ? 33.532 49.547 9.765   1.00 32.53  ? 485  HIS A C     1 
ATOM   3782 O  O     . HIS A 1 485 ? 33.552 50.207 8.726   1.00 28.80  ? 485  HIS A O     1 
ATOM   3783 C  CB    . HIS A 1 485 ? 33.102 47.174 10.022  1.00 24.88  ? 485  HIS A CB    1 
ATOM   3784 C  CG    . HIS A 1 485 ? 32.264 47.088 8.805   1.00 60.29  ? 485  HIS A CG    1 
ATOM   3785 N  ND1   . HIS A 1 485 ? 32.814 46.664 7.602   1.00 25.16  ? 485  HIS A ND1   1 
ATOM   3786 C  CD2   . HIS A 1 485 ? 30.927 47.361 8.634   1.00 38.87  ? 485  HIS A CD2   1 
ATOM   3787 C  CE1   . HIS A 1 485 ? 31.793 46.735 6.722   1.00 30.30  ? 485  HIS A CE1   1 
ATOM   3788 N  NE2   . HIS A 1 485 ? 30.653 47.131 7.310   1.00 38.58  ? 485  HIS A NE2   1 
ATOM   3789 N  N     . MET A 1 486 ? 32.861 49.895 10.836  1.00 33.21  ? 486  MET A N     1 
ATOM   3790 C  CA    . MET A 1 486 ? 32.128 51.139 10.923  1.00 38.48  ? 486  MET A CA    1 
ATOM   3791 C  C     . MET A 1 486 ? 33.014 52.280 10.540  1.00 29.48  ? 486  MET A C     1 
ATOM   3792 O  O     . MET A 1 486 ? 32.618 53.295 9.959   1.00 44.10  ? 486  MET A O     1 
ATOM   3793 C  CB    . MET A 1 486 ? 31.505 51.388 12.313  1.00 25.29  ? 486  MET A CB    1 
ATOM   3794 C  CG    . MET A 1 486 ? 30.545 52.583 12.349  1.00 60.71  ? 486  MET A CG    1 
ATOM   3795 S  SD    . MET A 1 486 ? 30.272 53.263 14.059  1.00 48.38  ? 486  MET A SD    1 
ATOM   3796 C  CE    . MET A 1 486 ? 29.428 54.879 13.823  1.00 68.02  ? 486  MET A CE    1 
ATOM   3797 N  N     . PHE A 1 487 ? 34.258 52.090 10.841  1.00 31.37  ? 487  PHE A N     1 
ATOM   3798 C  CA    . PHE A 1 487 ? 35.219 53.114 10.554  1.00 26.09  ? 487  PHE A CA    1 
ATOM   3799 C  C     . PHE A 1 487 ? 35.488 53.317 9.058   1.00 53.08  ? 487  PHE A C     1 
ATOM   3800 O  O     . PHE A 1 487 ? 35.408 54.429 8.535   1.00 60.30  ? 487  PHE A O     1 
ATOM   3801 C  CB    . PHE A 1 487 ? 36.465 52.646 11.271  1.00 48.07  ? 487  PHE A CB    1 
ATOM   3802 C  CG    . PHE A 1 487 ? 37.644 53.483 10.983  1.00 49.18  ? 487  PHE A CG    1 
ATOM   3803 C  CD1   . PHE A 1 487 ? 37.906 54.638 11.722  1.00 100.00 ? 487  PHE A CD1   1 
ATOM   3804 C  CD2   . PHE A 1 487 ? 38.547 53.074 10.006  1.00 100.00 ? 487  PHE A CD2   1 
ATOM   3805 C  CE1   . PHE A 1 487 ? 39.046 55.401 11.480  1.00 79.85  ? 487  PHE A CE1   1 
ATOM   3806 C  CE2   . PHE A 1 487 ? 39.695 53.828 9.757   1.00 100.00 ? 487  PHE A CE2   1 
ATOM   3807 C  CZ    . PHE A 1 487 ? 39.943 54.988 10.494  1.00 89.91  ? 487  PHE A CZ    1 
ATOM   3808 N  N     . LYS A 1 488 ? 35.801 52.244 8.336   1.00 44.36  ? 488  LYS A N     1 
ATOM   3809 C  CA    . LYS A 1 488 ? 35.992 52.358 6.879   1.00 32.29  ? 488  LYS A CA    1 
ATOM   3810 C  C     . LYS A 1 488 ? 34.718 52.840 6.132   1.00 35.56  ? 488  LYS A C     1 
ATOM   3811 O  O     . LYS A 1 488 ? 34.660 53.825 5.366   1.00 33.89  ? 488  LYS A O     1 
ATOM   3812 C  CB    . LYS A 1 488 ? 36.442 51.009 6.405   1.00 58.84  ? 488  LYS A CB    1 
ATOM   3813 C  CG    . LYS A 1 488 ? 37.551 50.445 7.278   1.00 46.26  ? 488  LYS A CG    1 
ATOM   3814 C  CD    . LYS A 1 488 ? 37.904 49.023 6.834   1.00 100.00 ? 488  LYS A CD    1 
ATOM   3815 C  CE    . LYS A 1 488 ? 36.719 48.226 6.265   1.00 100.00 ? 488  LYS A CE    1 
ATOM   3816 N  NZ    . LYS A 1 488 ? 36.590 48.207 4.785   1.00 99.05  ? 488  LYS A NZ    1 
ATOM   3817 N  N     . VAL A 1 489 ? 33.628 52.160 6.442   1.00 36.91  ? 489  VAL A N     1 
ATOM   3818 C  CA    . VAL A 1 489 ? 32.347 52.509 5.911   1.00 25.47  ? 489  VAL A CA    1 
ATOM   3819 C  C     . VAL A 1 489 ? 31.868 53.944 6.116   1.00 58.93  ? 489  VAL A C     1 
ATOM   3820 O  O     . VAL A 1 489 ? 31.295 54.614 5.248   1.00 46.56  ? 489  VAL A O     1 
ATOM   3821 C  CB    . VAL A 1 489 ? 31.427 51.396 5.386   1.00 45.02  ? 489  VAL A CB    1 
ATOM   3822 C  CG1   . VAL A 1 489 ? 32.263 50.253 4.843   1.00 39.12  ? 489  VAL A CG1   1 
ATOM   3823 C  CG2   . VAL A 1 489 ? 30.515 50.846 6.466   1.00 34.90  ? 489  VAL A CG2   1 
ATOM   3824 N  N     . GLU A 1 490 ? 32.135 54.439 7.309   1.00 66.09  ? 490  GLU A N     1 
ATOM   3825 C  CA    . GLU A 1 490 ? 31.767 55.797 7.573   1.00 67.83  ? 490  GLU A CA    1 
ATOM   3826 C  C     . GLU A 1 490 ? 32.734 56.678 6.841   1.00 100.00 ? 490  GLU A C     1 
ATOM   3827 O  O     . GLU A 1 490 ? 32.331 57.723 6.368   1.00 49.99  ? 490  GLU A O     1 
ATOM   3828 C  CB    . GLU A 1 490 ? 31.724 56.181 9.048   1.00 67.96  ? 490  GLU A CB    1 
ATOM   3829 C  CG    . GLU A 1 490 ? 30.389 55.804 9.714   1.00 100.00 ? 490  GLU A CG    1 
ATOM   3830 C  CD    . GLU A 1 490 ? 29.206 56.485 9.099   1.00 57.41  ? 490  GLU A CD    1 
ATOM   3831 O  OE1   . GLU A 1 490 ? 29.049 57.728 9.532   1.00 44.22  ? 490  GLU A OE1   1 
ATOM   3832 O  OE2   . GLU A 1 490 ? 28.468 55.913 8.307   1.00 93.33  ? 490  GLU A OE2   1 
ATOM   3833 N  N     . GLN A 1 491 ? 33.995 56.221 6.733   1.00 33.32  ? 491  GLN A N     1 
ATOM   3834 C  CA    . GLN A 1 491 ? 35.014 56.972 6.037   1.00 39.52  ? 491  GLN A CA    1 
ATOM   3835 C  C     . GLN A 1 491 ? 34.750 56.974 4.508   1.00 100.00 ? 491  GLN A C     1 
ATOM   3836 O  O     . GLN A 1 491 ? 34.868 57.980 3.803   1.00 47.40  ? 491  GLN A O     1 
ATOM   3837 C  CB    . GLN A 1 491 ? 36.262 56.175 6.288   1.00 34.07  ? 491  GLN A CB    1 
ATOM   3838 C  CG    . GLN A 1 491 ? 37.392 56.898 6.977   1.00 53.32  ? 491  GLN A CG    1 
ATOM   3839 C  CD    . GLN A 1 491 ? 38.582 56.278 6.336   1.00 50.60  ? 491  GLN A CD    1 
ATOM   3840 O  OE1   . GLN A 1 491 ? 39.539 55.868 7.009   1.00 97.18  ? 491  GLN A OE1   1 
ATOM   3841 N  NE2   . GLN A 1 491 ? 38.451 56.124 5.007   1.00 85.28  ? 491  GLN A NE2   1 
ATOM   3842 N  N     . GLU A 1 492 ? 34.369 55.820 3.971   1.00 46.86  ? 492  GLU A N     1 
ATOM   3843 C  CA    . GLU A 1 492 ? 34.114 55.699 2.548   1.00 57.18  ? 492  GLU A CA    1 
ATOM   3844 C  C     . GLU A 1 492 ? 33.181 56.737 2.033   1.00 48.25  ? 492  GLU A C     1 
ATOM   3845 O  O     . GLU A 1 492 ? 33.417 57.356 0.994   1.00 71.70  ? 492  GLU A O     1 
ATOM   3846 C  CB    . GLU A 1 492 ? 33.350 54.409 2.292   1.00 25.90  ? 492  GLU A CB    1 
ATOM   3847 C  CG    . GLU A 1 492 ? 34.239 53.213 1.931   1.00 57.75  ? 492  GLU A CG    1 
ATOM   3848 C  CD    . GLU A 1 492 ? 33.361 52.173 1.289   1.00 100.00 ? 492  GLU A CD    1 
ATOM   3849 O  OE1   . GLU A 1 492 ? 32.078 52.487 1.432   1.00 52.52  ? 492  GLU A OE1   1 
ATOM   3850 O  OE2   . GLU A 1 492 ? 33.777 51.182 0.672   1.00 100.00 ? 492  GLU A OE2   1 
ATOM   3851 N  N     . GLU A 1 493 ? 32.070 56.818 2.774   1.00 47.24  ? 493  GLU A N     1 
ATOM   3852 C  CA    . GLU A 1 493 ? 30.935 57.680 2.521   1.00 100.00 ? 493  GLU A CA    1 
ATOM   3853 C  C     . GLU A 1 493 ? 31.237 59.166 2.441   1.00 100.00 ? 493  GLU A C     1 
ATOM   3854 O  O     . GLU A 1 493 ? 30.786 59.827 1.514   1.00 55.24  ? 493  GLU A O     1 
ATOM   3855 C  CB    . GLU A 1 493 ? 29.782 57.415 3.495   1.00 39.62  ? 493  GLU A CB    1 
ATOM   3856 N  N     . TYR A 1 494 ? 31.959 59.705 3.421   1.00 42.48  ? 494  TYR A N     1 
ATOM   3857 C  CA    . TYR A 1 494 ? 32.230 61.123 3.431   1.00 100.00 ? 494  TYR A CA    1 
ATOM   3858 C  C     . TYR A 1 494 ? 32.970 61.445 2.157   1.00 70.55  ? 494  TYR A C     1 
ATOM   3859 O  O     . TYR A 1 494 ? 32.725 62.428 1.429   1.00 44.51  ? 494  TYR A O     1 
ATOM   3860 C  CB    . TYR A 1 494 ? 33.008 61.486 4.698   1.00 88.11  ? 494  TYR A CB    1 
ATOM   3861 N  N     . LEU A 1 495 ? 33.868 60.520 1.877   1.00 80.32  ? 495  LEU A N     1 
ATOM   3862 C  CA    . LEU A 1 495 ? 34.714 60.600 0.727   1.00 65.76  ? 495  LEU A CA    1 
ATOM   3863 C  C     . LEU A 1 495 ? 33.935 60.676 -0.573  1.00 100.00 ? 495  LEU A C     1 
ATOM   3864 O  O     . LEU A 1 495 ? 34.257 61.525 -1.429  1.00 77.47  ? 495  LEU A O     1 
ATOM   3865 C  CB    . LEU A 1 495 ? 35.723 59.462 0.713   1.00 33.33  ? 495  LEU A CB    1 
ATOM   3866 C  CG    . LEU A 1 495 ? 36.707 59.438 1.912   1.00 100.00 ? 495  LEU A CG    1 
ATOM   3867 C  CD1   . LEU A 1 495 ? 36.278 60.242 3.173   1.00 48.16  ? 495  LEU A CD1   1 
ATOM   3868 C  CD2   . LEU A 1 495 ? 37.060 57.988 2.262   1.00 100.00 ? 495  LEU A CD2   1 
ATOM   3869 N  N     . LYS A 1 496 ? 32.910 59.793 -0.690  1.00 44.86  ? 496  LYS A N     1 
ATOM   3870 C  CA    . LYS A 1 496 ? 32.051 59.687 -1.879  1.00 100.00 ? 496  LYS A CA    1 
ATOM   3871 C  C     . LYS A 1 496 ? 31.108 60.870 -2.173  1.00 100.00 ? 496  LYS A C     1 
ATOM   3872 O  O     . LYS A 1 496 ? 30.516 60.958 -3.252  1.00 96.23  ? 496  LYS A O     1 
ATOM   3873 C  CB    . LYS A 1 496 ? 31.320 58.355 -1.955  1.00 37.52  ? 496  LYS A CB    1 
ATOM   3874 C  CG    . LYS A 1 496 ? 32.265 57.187 -2.208  1.00 100.00 ? 496  LYS A CG    1 
ATOM   3875 C  CD    . LYS A 1 496 ? 31.826 55.884 -1.547  1.00 100.00 ? 496  LYS A CD    1 
ATOM   3876 C  CE    . LYS A 1 496 ? 31.276 54.861 -2.543  1.00 100.00 ? 496  LYS A CE    1 
ATOM   3877 N  NZ    . LYS A 1 496 ? 31.101 53.514 -1.954  1.00 79.30  ? 496  LYS A NZ    1 
ATOM   3878 N  N     . GLU A 1 497 ? 30.973 61.775 -1.206  1.00 76.38  ? 497  GLU A N     1 
ATOM   3879 C  CA    . GLU A 1 497 ? 30.111 62.936 -1.318  1.00 76.54  ? 497  GLU A CA    1 
ATOM   3880 C  C     . GLU A 1 497 ? 30.962 64.199 -1.357  1.00 100.00 ? 497  GLU A C     1 
ATOM   3881 O  O     . GLU A 1 497 ? 30.487 65.323 -1.676  1.00 77.69  ? 497  GLU A O     1 
ATOM   3882 C  CB    . GLU A 1 497 ? 29.092 62.946 -0.153  1.00 100.00 ? 497  GLU A CB    1 
ATOM   3883 C  CG    . GLU A 1 497 ? 28.103 61.764 -0.214  1.00 44.93  ? 497  GLU A CG    1 
ATOM   3884 C  CD    . GLU A 1 497 ? 26.935 62.031 -1.127  1.00 67.21  ? 497  GLU A CD    1 
ATOM   3885 O  OE1   . GLU A 1 497 ? 26.538 63.300 -1.073  1.00 46.96  ? 497  GLU A OE1   1 
ATOM   3886 O  OE2   . GLU A 1 497 ? 26.416 61.158 -1.817  1.00 60.42  ? 497  GLU A OE2   1 
ATOM   3887 N  N     . LYS A 1 498 ? 32.248 63.947 -1.021  1.00 45.09  ? 498  LYS A N     1 
ATOM   3888 C  CA    . LYS A 1 498 ? 33.284 64.953 -1.010  1.00 77.77  ? 498  LYS A CA    1 
ATOM   3889 C  C     . LYS A 1 498 ? 33.149 65.785 0.245   1.00 100.00 ? 498  LYS A C     1 
ATOM   3890 O  O     . LYS A 1 498 ? 33.285 67.030 0.255   1.00 100.00 ? 498  LYS A O     1 
ATOM   3891 C  CB    . LYS A 1 498 ? 33.332 65.795 -2.306  1.00 100.00 ? 498  LYS A CB    1 
ATOM   3892 C  CG    . LYS A 1 498 ? 34.280 67.019 -2.276  1.00 100.00 ? 498  LYS A CG    1 
ATOM   3893 C  CD    . LYS A 1 498 ? 33.767 68.261 -3.030  1.00 100.00 ? 498  LYS A CD    1 
ATOM   3894 C  CE    . LYS A 1 498 ? 33.113 69.312 -2.122  1.00 100.00 ? 498  LYS A CE    1 
ATOM   3895 N  NZ    . LYS A 1 498 ? 32.404 70.384 -2.852  1.00 100.00 ? 498  LYS A NZ    1 
ATOM   3896 N  N     . ILE A 1 499 ? 32.824 65.082 1.321   1.00 64.98  ? 499  ILE A N     1 
ATOM   3897 C  CA    . ILE A 1 499 ? 32.710 65.776 2.586   1.00 100.00 ? 499  ILE A CA    1 
ATOM   3898 C  C     . ILE A 1 499 ? 34.058 65.547 3.277   1.00 43.32  ? 499  ILE A C     1 
ATOM   3899 O  O     . ILE A 1 499 ? 34.805 64.625 2.892   1.00 100.00 ? 499  ILE A O     1 
ATOM   3900 C  CB    . ILE A 1 499 ? 31.398 65.512 3.406   1.00 45.68  ? 499  ILE A CB    1 
ATOM   3901 C  CG1   . ILE A 1 499 ? 30.181 65.320 2.505   1.00 61.41  ? 499  ILE A CG1   1 
ATOM   3902 C  CG2   . ILE A 1 499 ? 31.032 66.711 4.282   1.00 36.97  ? 499  ILE A CG2   1 
ATOM   3903 C  CD1   . ILE A 1 499 ? 28.988 66.216 2.881   1.00 64.29  ? 499  ILE A CD1   1 
ATOM   3904 N  N     . ASN A 1 500 ? 34.431 66.414 4.208   1.00 100.00 ? 500  ASN A N     1 
ATOM   3905 C  CA    . ASN A 1 500 ? 35.703 66.280 4.941   1.00 100.00 ? 500  ASN A CA    1 
ATOM   3906 C  C     . ASN A 1 500 ? 35.648 65.087 5.954   1.00 100.00 ? 500  ASN A C     1 
ATOM   3907 O  O     . ASN A 1 500 ? 36.219 65.006 7.067   1.00 76.18  ? 500  ASN A O     1 
ATOM   3908 C  CB    . ASN A 1 500 ? 36.074 67.615 5.576   1.00 100.00 ? 500  ASN A CB    1 
ATOM   3909 N  N     . LEU A 1 508 ? 42.732 48.806 20.328  1.00 70.64  ? 508  LEU A N     1 
ATOM   3910 C  CA    . LEU A 1 508 ? 42.310 49.944 21.115  1.00 34.02  ? 508  LEU A CA    1 
ATOM   3911 C  C     . LEU A 1 508 ? 42.136 49.669 22.655  1.00 100.00 ? 508  LEU A C     1 
ATOM   3912 O  O     . LEU A 1 508 ? 43.083 49.282 23.490  1.00 31.83  ? 508  LEU A O     1 
ATOM   3913 C  CB    . LEU A 1 508 ? 41.002 50.498 20.557  1.00 36.84  ? 508  LEU A CB    1 
ATOM   3914 N  N     . ASP A 1 509 ? 40.862 49.940 23.047  1.00 100.00 ? 509  ASP A N     1 
ATOM   3915 C  CA    . ASP A 1 509 ? 40.468 49.684 24.420  1.00 46.37  ? 509  ASP A CA    1 
ATOM   3916 C  C     . ASP A 1 509 ? 40.115 48.261 24.361  1.00 59.26  ? 509  ASP A C     1 
ATOM   3917 O  O     . ASP A 1 509 ? 40.267 47.479 25.346  1.00 31.89  ? 509  ASP A O     1 
ATOM   3918 C  CB    . ASP A 1 509 ? 39.299 50.554 24.946  1.00 100.00 ? 509  ASP A CB    1 
ATOM   3919 C  CG    . ASP A 1 509 ? 39.477 51.155 26.349  1.00 50.22  ? 509  ASP A CG    1 
ATOM   3920 O  OD1   . ASP A 1 509 ? 40.100 52.197 26.601  1.00 100.00 ? 509  ASP A OD1   1 
ATOM   3921 O  OD2   . ASP A 1 509 ? 38.824 50.477 27.263  1.00 100.00 ? 509  ASP A OD2   1 
ATOM   3922 N  N     . SER A 1 510 ? 39.690 47.998 23.108  1.00 38.63  ? 510  SER A N     1 
ATOM   3923 C  CA    . SER A 1 510 ? 39.340 46.647 22.765  1.00 34.13  ? 510  SER A CA    1 
ATOM   3924 C  C     . SER A 1 510 ? 40.603 45.853 22.796  1.00 19.99  ? 510  SER A C     1 
ATOM   3925 O  O     . SER A 1 510 ? 40.621 44.703 23.206  1.00 25.83  ? 510  SER A O     1 
ATOM   3926 C  CB    . SER A 1 510 ? 38.855 46.602 21.354  1.00 30.07  ? 510  SER A CB    1 
ATOM   3927 O  OG    . SER A 1 510 ? 37.467 46.425 21.315  1.00 39.37  ? 510  SER A OG    1 
ATOM   3928 N  N     . GLN A 1 511 ? 41.681 46.473 22.220  1.00 19.38  ? 511  GLN A N     1 
ATOM   3929 C  CA    . GLN A 1 511 ? 42.867 45.693 22.179  1.00 17.13  ? 511  GLN A CA    1 
ATOM   3930 C  C     . GLN A 1 511 ? 43.369 45.329 23.540  1.00 9.20   ? 511  GLN A C     1 
ATOM   3931 O  O     . GLN A 1 511 ? 43.821 44.235 23.717  1.00 17.30  ? 511  GLN A O     1 
ATOM   3932 C  CB    . GLN A 1 511 ? 44.019 46.228 21.329  1.00 17.85  ? 511  GLN A CB    1 
ATOM   3933 C  CG    . GLN A 1 511 ? 44.975 45.046 21.088  1.00 12.90  ? 511  GLN A CG    1 
ATOM   3934 C  CD    . GLN A 1 511 ? 44.417 44.013 20.136  1.00 17.92  ? 511  GLN A CD    1 
ATOM   3935 O  OE1   . GLN A 1 511 ? 43.789 44.370 19.157  1.00 26.01  ? 511  GLN A OE1   1 
ATOM   3936 N  NE2   . GLN A 1 511 ? 44.580 42.727 20.404  1.00 24.87  ? 511  GLN A NE2   1 
ATOM   3937 N  N     . ALA A 1 512 ? 43.307 46.276 24.439  1.00 17.18  ? 512  ALA A N     1 
ATOM   3938 C  CA    . ALA A 1 512 ? 43.828 46.021 25.793  1.00 18.35  ? 512  ALA A CA    1 
ATOM   3939 C  C     . ALA A 1 512 ? 43.088 44.906 26.492  1.00 17.24  ? 512  ALA A C     1 
ATOM   3940 O  O     . ALA A 1 512 ? 43.694 44.026 27.147  1.00 22.17  ? 512  ALA A O     1 
ATOM   3941 C  CB    . ALA A 1 512 ? 43.778 47.285 26.611  1.00 19.07  ? 512  ALA A CB    1 
ATOM   3942 N  N     . THR A 1 513 ? 41.747 44.913 26.382  1.00 13.87  ? 513  THR A N     1 
ATOM   3943 C  CA    . THR A 1 513 ? 40.993 43.840 27.016  1.00 14.29  ? 513  THR A CA    1 
ATOM   3944 C  C     . THR A 1 513 ? 41.340 42.548 26.336  1.00 18.76  ? 513  THR A C     1 
ATOM   3945 O  O     . THR A 1 513 ? 41.556 41.513 26.918  1.00 12.77  ? 513  THR A O     1 
ATOM   3946 C  CB    . THR A 1 513 ? 39.427 44.093 26.996  1.00 19.13  ? 513  THR A CB    1 
ATOM   3947 O  OG1   . THR A 1 513 ? 39.115 45.311 27.601  1.00 25.59  ? 513  THR A OG1   1 
ATOM   3948 C  CG2   . THR A 1 513 ? 38.607 42.999 27.674  1.00 17.26  ? 513  THR A CG2   1 
ATOM   3949 N  N     . ILE A 1 514 ? 41.370 42.590 25.000  1.00 20.64  ? 514  ILE A N     1 
ATOM   3950 C  CA    . ILE A 1 514 ? 41.681 41.369 24.253  1.00 15.79  ? 514  ILE A CA    1 
ATOM   3951 C  C     . ILE A 1 514 ? 43.025 40.757 24.719  1.00 7.86   ? 514  ILE A C     1 
ATOM   3952 O  O     . ILE A 1 514 ? 43.170 39.533 24.946  1.00 16.37  ? 514  ILE A O     1 
ATOM   3953 C  CB    . ILE A 1 514 ? 41.668 41.679 22.716  1.00 15.69  ? 514  ILE A CB    1 
ATOM   3954 C  CG1   . ILE A 1 514 ? 40.184 41.830 22.223  1.00 12.05  ? 514  ILE A CG1   1 
ATOM   3955 C  CG2   . ILE A 1 514 ? 42.272 40.491 21.988  1.00 16.02  ? 514  ILE A CG2   1 
ATOM   3956 C  CD1   . ILE A 1 514 ? 40.066 42.458 20.845  1.00 19.83  ? 514  ILE A CD1   1 
ATOM   3957 N  N     . ASP A 1 515 ? 44.008 41.628 24.782  1.00 13.35  ? 515  ASP A N     1 
ATOM   3958 C  CA    . ASP A 1 515 ? 45.344 41.178 25.192  1.00 13.03  ? 515  ASP A CA    1 
ATOM   3959 C  C     . ASP A 1 515 ? 45.368 40.604 26.609  1.00 15.04  ? 515  ASP A C     1 
ATOM   3960 O  O     . ASP A 1 515 ? 46.014 39.583 26.884  1.00 20.13  ? 515  ASP A O     1 
ATOM   3961 C  CB    . ASP A 1 515 ? 46.222 42.390 25.201  1.00 12.53  ? 515  ASP A CB    1 
ATOM   3962 C  CG    . ASP A 1 515 ? 46.569 42.935 23.814  1.00 58.03  ? 515  ASP A CG    1 
ATOM   3963 O  OD1   . ASP A 1 515 ? 46.372 42.094 22.805  1.00 24.58  ? 515  ASP A OD1   1 
ATOM   3964 O  OD2   . ASP A 1 515 ? 47.027 44.062 23.658  1.00 32.84  ? 515  ASP A OD2   1 
ATOM   3965 N  N     . LEU A 1 516 ? 44.629 41.294 27.491  1.00 25.47  ? 516  LEU A N     1 
ATOM   3966 C  CA    . LEU A 1 516 ? 44.521 40.814 28.843  1.00 15.27  ? 516  LEU A CA    1 
ATOM   3967 C  C     . LEU A 1 516 ? 44.100 39.344 28.848  1.00 10.26  ? 516  LEU A C     1 
ATOM   3968 O  O     . LEU A 1 516 ? 44.565 38.462 29.573  1.00 13.74  ? 516  LEU A O     1 
ATOM   3969 C  CB    . LEU A 1 516 ? 43.636 41.746 29.710  1.00 14.89  ? 516  LEU A CB    1 
ATOM   3970 C  CG    . LEU A 1 516 ? 43.394 41.175 31.140  1.00 16.13  ? 516  LEU A CG    1 
ATOM   3971 C  CD1   . LEU A 1 516 ? 44.681 41.022 31.985  1.00 9.01   ? 516  LEU A CD1   1 
ATOM   3972 C  CD2   . LEU A 1 516 ? 42.411 42.038 31.882  1.00 18.36  ? 516  LEU A CD2   1 
ATOM   3973 N  N     . ILE A 1 517 ? 43.160 38.982 27.961  1.00 10.60  ? 517  ILE A N     1 
ATOM   3974 C  CA    . ILE A 1 517 ? 42.713 37.614 27.884  1.00 12.04  ? 517  ILE A CA    1 
ATOM   3975 C  C     . ILE A 1 517 ? 43.609 36.698 27.136  1.00 10.85  ? 517  ILE A C     1 
ATOM   3976 O  O     . ILE A 1 517 ? 44.036 35.619 27.611  1.00 14.11  ? 517  ILE A O     1 
ATOM   3977 C  CB    . ILE A 1 517 ? 41.330 37.587 27.194  1.00 17.05  ? 517  ILE A CB    1 
ATOM   3978 C  CG1   . ILE A 1 517 ? 40.327 38.437 28.047  1.00 18.05  ? 517  ILE A CG1   1 
ATOM   3979 C  CG2   . ILE A 1 517 ? 40.845 36.165 27.056  1.00 10.82  ? 517  ILE A CG2   1 
ATOM   3980 C  CD1   . ILE A 1 517 ? 39.017 38.911 27.399  1.00 14.98  ? 517  ILE A CD1   1 
ATOM   3981 N  N     . ASP A 1 518 ? 43.896 37.122 25.893  1.00 19.02  ? 518  ASP A N     1 
ATOM   3982 C  CA    . ASP A 1 518 ? 44.659 36.172 25.082  1.00 24.42  ? 518  ASP A CA    1 
ATOM   3983 C  C     . ASP A 1 518 ? 46.142 36.393 24.855  1.00 21.78  ? 518  ASP A C     1 
ATOM   3984 O  O     . ASP A 1 518 ? 46.739 35.598 24.121  1.00 20.26  ? 518  ASP A O     1 
ATOM   3985 C  CB    . ASP A 1 518 ? 43.960 35.878 23.726  1.00 21.08  ? 518  ASP A CB    1 
ATOM   3986 C  CG    . ASP A 1 518 ? 44.113 37.037 22.769  1.00 26.96  ? 518  ASP A CG    1 
ATOM   3987 O  OD1   . ASP A 1 518 ? 44.840 37.993 22.983  1.00 20.46  ? 518  ASP A OD1   1 
ATOM   3988 O  OD2   . ASP A 1 518 ? 43.358 36.892 21.681  1.00 21.32  ? 518  ASP A OD2   1 
ATOM   3989 N  N     . GLY A 1 519 ? 46.710 37.462 25.419  1.00 21.60  ? 519  GLY A N     1 
ATOM   3990 C  CA    . GLY A 1 519 ? 48.131 37.757 25.283  1.00 25.23  ? 519  GLY A CA    1 
ATOM   3991 C  C     . GLY A 1 519 ? 49.101 36.554 25.529  1.00 19.55  ? 519  GLY A C     1 
ATOM   3992 O  O     . GLY A 1 519 ? 48.897 35.593 26.322  1.00 16.55  ? 519  GLY A O     1 
ATOM   3993 N  N     . ARG A 1 520 ? 50.204 36.600 24.752  1.00 19.05  ? 520  ARG A N     1 
ATOM   3994 C  CA    . ARG A 1 520 ? 51.227 35.579 24.897  1.00 20.01  ? 520  ARG A CA    1 
ATOM   3995 C  C     . ARG A 1 520 ? 52.465 36.134 25.711  1.00 22.37  ? 520  ARG A C     1 
ATOM   3996 O  O     . ARG A 1 520 ? 53.026 35.440 26.566  1.00 27.10  ? 520  ARG A O     1 
ATOM   3997 C  CB    . ARG A 1 520 ? 51.563 34.870 23.589  1.00 46.26  ? 520  ARG A CB    1 
ATOM   3998 C  CG    . ARG A 1 520 ? 51.096 33.423 23.598  1.00 49.28  ? 520  ARG A CG    1 
ATOM   3999 C  CD    . ARG A 1 520 ? 51.620 32.582 22.427  1.00 100.00 ? 520  ARG A CD    1 
ATOM   4000 N  NE    . ARG A 1 520 ? 51.520 31.144 22.739  1.00 100.00 ? 520  ARG A NE    1 
ATOM   4001 C  CZ    . ARG A 1 520 ? 52.190 30.118 22.168  1.00 100.00 ? 520  ARG A CZ    1 
ATOM   4002 N  NH1   . ARG A 1 520 ? 53.066 30.294 21.176  1.00 100.00 ? 520  ARG A NH1   1 
ATOM   4003 N  NH2   . ARG A 1 520 ? 51.974 28.864 22.610  1.00 100.00 ? 520  ARG A NH2   1 
ATOM   4004 N  N     . GLN A 1 521 ? 52.828 37.383 25.512  1.00 20.14  ? 521  GLN A N     1 
ATOM   4005 C  CA    . GLN A 1 521 ? 53.899 37.984 26.234  1.00 21.23  ? 521  GLN A CA    1 
ATOM   4006 C  C     . GLN A 1 521 ? 53.699 39.433 26.301  1.00 21.99  ? 521  GLN A C     1 
ATOM   4007 O  O     . GLN A 1 521 ? 53.803 40.094 25.274  1.00 31.67  ? 521  GLN A O     1 
ATOM   4008 C  CB    . GLN A 1 521 ? 55.264 37.714 25.607  1.00 25.92  ? 521  GLN A CB    1 
ATOM   4009 C  CG    . GLN A 1 521 ? 55.864 36.379 26.081  1.00 43.10  ? 521  GLN A CG    1 
ATOM   4010 C  CD    . GLN A 1 521 ? 56.315 36.400 27.554  1.00 28.38  ? 521  GLN A CD    1 
ATOM   4011 O  OE1   . GLN A 1 521 ? 56.507 37.493 28.159  1.00 34.27  ? 521  GLN A OE1   1 
ATOM   4012 N  NE2   . GLN A 1 521 ? 56.514 35.170 28.070  1.00 23.16  ? 521  GLN A NE2   1 
ATOM   4013 N  N     . PRO A 1 522 ? 53.431 39.960 27.499  1.00 34.99  ? 522  PRO A N     1 
ATOM   4014 C  CA    . PRO A 1 522 ? 53.298 39.206 28.702  1.00 26.16  ? 522  PRO A CA    1 
ATOM   4015 C  C     . PRO A 1 522 ? 52.105 38.300 28.561  1.00 23.29  ? 522  PRO A C     1 
ATOM   4016 O  O     . PRO A 1 522 ? 51.199 38.465 27.756  1.00 16.77  ? 522  PRO A O     1 
ATOM   4017 C  CB    . PRO A 1 522 ? 53.014 40.240 29.770  1.00 20.06  ? 522  PRO A CB    1 
ATOM   4018 C  CG    . PRO A 1 522 ? 52.734 41.588 29.117  1.00 15.05  ? 522  PRO A CG    1 
ATOM   4019 C  CD    . PRO A 1 522 ? 53.150 41.397 27.677  1.00 22.02  ? 522  PRO A CD    1 
ATOM   4020 N  N     . PRO A 1 523 ? 52.095 37.315 29.337  1.00 19.86  ? 523  PRO A N     1 
ATOM   4021 C  CA    . PRO A 1 523 ? 51.034 36.361 29.247  1.00 22.78  ? 523  PRO A CA    1 
ATOM   4022 C  C     . PRO A 1 523 ? 49.715 36.900 29.774  1.00 33.87  ? 523  PRO A C     1 
ATOM   4023 O  O     . PRO A 1 523 ? 49.682 37.668 30.754  1.00 19.38  ? 523  PRO A O     1 
ATOM   4024 C  CB    . PRO A 1 523 ? 51.514 35.156 30.055  1.00 21.94  ? 523  PRO A CB    1 
ATOM   4025 C  CG    . PRO A 1 523 ? 52.711 35.648 30.857  1.00 22.61  ? 523  PRO A CG    1 
ATOM   4026 C  CD    . PRO A 1 523 ? 53.003 37.091 30.471  1.00 23.27  ? 523  PRO A CD    1 
ATOM   4027 N  N     . GLY A 1 524 ? 48.631 36.523 29.102  1.00 18.13  ? 524  GLY A N     1 
ATOM   4028 C  CA    . GLY A 1 524 ? 47.323 36.964 29.541  1.00 14.03  ? 524  GLY A CA    1 
ATOM   4029 C  C     . GLY A 1 524 ? 46.667 35.854 30.398  1.00 12.61  ? 524  GLY A C     1 
ATOM   4030 O  O     . GLY A 1 524 ? 47.313 34.834 30.799  1.00 14.55  ? 524  GLY A O     1 
ATOM   4031 N  N     . ILE A 1 525 ? 45.356 36.065 30.659  1.00 17.33  ? 525  ILE A N     1 
ATOM   4032 C  CA    . ILE A 1 525 ? 44.619 35.080 31.464  1.00 12.05  ? 525  ILE A CA    1 
ATOM   4033 C  C     . ILE A 1 525 ? 44.696 33.704 30.892  1.00 22.22  ? 525  ILE A C     1 
ATOM   4034 O  O     . ILE A 1 525 ? 45.015 32.676 31.544  1.00 13.47  ? 525  ILE A O     1 
ATOM   4035 C  CB    . ILE A 1 525 ? 43.139 35.504 31.625  1.00 13.43  ? 525  ILE A CB    1 
ATOM   4036 C  CG1   . ILE A 1 525 ? 43.090 36.858 32.297  1.00 12.17  ? 525  ILE A CG1   1 
ATOM   4037 C  CG2   . ILE A 1 525 ? 42.324 34.396 32.338  1.00 13.06  ? 525  ILE A CG2   1 
ATOM   4038 C  CD1   . ILE A 1 525 ? 41.819 37.683 32.092  1.00 12.56  ? 525  ILE A CD1   1 
ATOM   4039 N  N     . LEU A 1 526 ? 44.365 33.578 29.618  1.00 13.56  ? 526  LEU A N     1 
ATOM   4040 C  CA    . LEU A 1 526 ? 44.409 32.223 29.159  1.00 5.27   ? 526  LEU A CA    1 
ATOM   4041 C  C     . LEU A 1 526 ? 45.802 31.531 29.129  1.00 9.47   ? 526  LEU A C     1 
ATOM   4042 O  O     . LEU A 1 526 ? 45.901 30.282 29.302  1.00 15.81  ? 526  LEU A O     1 
ATOM   4043 C  CB    . LEU A 1 526 ? 43.764 32.102 27.725  1.00 23.58  ? 526  LEU A CB    1 
ATOM   4044 C  CG    . LEU A 1 526 ? 42.351 32.646 27.513  1.00 22.33  ? 526  LEU A CG    1 
ATOM   4045 C  CD1   . LEU A 1 526 ? 41.995 32.596 25.984  1.00 14.87  ? 526  LEU A CD1   1 
ATOM   4046 C  CD2   . LEU A 1 526 ? 41.410 31.793 28.341  1.00 16.49  ? 526  LEU A CD2   1 
ATOM   4047 N  N     . ALA A 1 527 ? 46.856 32.290 28.830  1.00 16.97  ? 527  ALA A N     1 
ATOM   4048 C  CA    . ALA A 1 527 ? 48.197 31.692 28.773  1.00 12.20  ? 527  ALA A CA    1 
ATOM   4049 C  C     . ALA A 1 527 ? 48.554 31.233 30.201  1.00 13.70  ? 527  ALA A C     1 
ATOM   4050 O  O     . ALA A 1 527 ? 49.026 30.153 30.426  1.00 19.27  ? 527  ALA A O     1 
ATOM   4051 C  CB    . ALA A 1 527 ? 49.104 32.847 28.474  1.00 13.79  ? 527  ALA A CB    1 
ATOM   4052 N  N     . LEU A 1 528 ? 48.259 32.082 31.213  1.00 18.09  ? 528  LEU A N     1 
ATOM   4053 C  CA    . LEU A 1 528 ? 48.506 31.632 32.586  1.00 12.10  ? 528  LEU A CA    1 
ATOM   4054 C  C     . LEU A 1 528 ? 47.727 30.408 32.969  1.00 15.71  ? 528  LEU A C     1 
ATOM   4055 O  O     . LEU A 1 528 ? 48.203 29.514 33.703  1.00 23.07  ? 528  LEU A O     1 
ATOM   4056 C  CB    . LEU A 1 528 ? 48.262 32.734 33.643  1.00 18.11  ? 528  LEU A CB    1 
ATOM   4057 C  CG    . LEU A 1 528 ? 49.165 33.930 33.390  1.00 21.05  ? 528  LEU A CG    1 
ATOM   4058 C  CD1   . LEU A 1 528 ? 48.763 35.120 34.283  1.00 20.63  ? 528  LEU A CD1   1 
ATOM   4059 C  CD2   . LEU A 1 528 ? 50.587 33.462 33.610  1.00 17.55  ? 528  LEU A CD2   1 
ATOM   4060 N  N     . LEU A 1 529 ? 46.485 30.357 32.545  1.00 26.80  ? 529  LEU A N     1 
ATOM   4061 C  CA    . LEU A 1 529 ? 45.642 29.212 32.822  1.00 19.77  ? 529  LEU A CA    1 
ATOM   4062 C  C     . LEU A 1 529 ? 46.240 27.965 32.152  1.00 21.63  ? 529  LEU A C     1 
ATOM   4063 O  O     . LEU A 1 529 ? 46.314 26.840 32.728  1.00 18.34  ? 529  LEU A O     1 
ATOM   4064 C  CB    . LEU A 1 529 ? 44.190 29.501 32.346  1.00 19.70  ? 529  LEU A CB    1 
ATOM   4065 C  CG    . LEU A 1 529 ? 43.264 28.282 32.186  1.00 37.28  ? 529  LEU A CG    1 
ATOM   4066 C  CD1   . LEU A 1 529 ? 42.815 27.615 33.500  1.00 18.17  ? 529  LEU A CD1   1 
ATOM   4067 C  CD2   . LEU A 1 529 ? 42.030 28.786 31.484  1.00 26.87  ? 529  LEU A CD2   1 
ATOM   4068 N  N     . ASP A 1 530 ? 46.757 28.138 30.922  1.00 16.05  ? 530  ASP A N     1 
ATOM   4069 C  CA    . ASP A 1 530 ? 47.347 26.941 30.323  1.00 13.63  ? 530  ASP A CA    1 
ATOM   4070 C  C     . ASP A 1 530 ? 48.542 26.466 31.107  1.00 15.61  ? 530  ASP A C     1 
ATOM   4071 O  O     . ASP A 1 530 ? 48.747 25.278 31.268  1.00 24.02  ? 530  ASP A O     1 
ATOM   4072 C  CB    . ASP A 1 530 ? 47.892 27.185 28.899  1.00 13.93  ? 530  ASP A CB    1 
ATOM   4073 C  CG    . ASP A 1 530 ? 46.787 27.127 27.863  1.00 36.89  ? 530  ASP A CG    1 
ATOM   4074 O  OD1   . ASP A 1 530 ? 45.731 26.490 28.280  1.00 23.19  ? 530  ASP A OD1   1 
ATOM   4075 O  OD2   . ASP A 1 530 ? 46.849 27.684 26.768  1.00 34.47  ? 530  ASP A OD2   1 
ATOM   4076 N  N     . GLU A 1 531 ? 49.320 27.433 31.560  1.00 19.06  ? 531  GLU A N     1 
ATOM   4077 C  CA    . GLU A 1 531 ? 50.545 27.113 32.311  1.00 21.26  ? 531  GLU A CA    1 
ATOM   4078 C  C     . GLU A 1 531 ? 50.272 26.297 33.550  1.00 33.11  ? 531  GLU A C     1 
ATOM   4079 O  O     . GLU A 1 531 ? 50.908 25.279 33.841  1.00 26.93  ? 531  GLU A O     1 
ATOM   4080 C  CB    . GLU A 1 531 ? 51.144 28.427 32.736  1.00 21.20  ? 531  GLU A CB    1 
ATOM   4081 C  CG    . GLU A 1 531 ? 52.382 28.178 33.605  1.00 100.00 ? 531  GLU A CG    1 
ATOM   4082 C  CD    . GLU A 1 531 ? 53.619 28.801 33.022  1.00 100.00 ? 531  GLU A CD    1 
ATOM   4083 O  OE1   . GLU A 1 531 ? 53.499 30.125 32.922  1.00 100.00 ? 531  GLU A OE1   1 
ATOM   4084 O  OE2   . GLU A 1 531 ? 54.604 28.132 32.671  1.00 89.58  ? 531  GLU A OE2   1 
ATOM   4085 N  N     . GLN A 1 532 ? 49.276 26.768 34.283  1.00 30.48  ? 532  GLN A N     1 
ATOM   4086 C  CA    . GLN A 1 532 ? 48.827 26.077 35.497  1.00 22.92  ? 532  GLN A CA    1 
ATOM   4087 C  C     . GLN A 1 532 ? 48.323 24.708 35.131  1.00 33.68  ? 532  GLN A C     1 
ATOM   4088 O  O     . GLN A 1 532 ? 48.371 23.783 35.918  1.00 32.02  ? 532  GLN A O     1 
ATOM   4089 C  CB    . GLN A 1 532 ? 47.670 26.869 36.103  1.00 18.85  ? 532  GLN A CB    1 
ATOM   4090 C  CG    . GLN A 1 532 ? 48.161 28.163 36.773  1.00 28.18  ? 532  GLN A CG    1 
ATOM   4091 C  CD    . GLN A 1 532 ? 48.530 27.739 38.181  1.00 35.74  ? 532  GLN A CD    1 
ATOM   4092 O  OE1   . GLN A 1 532 ? 49.328 28.358 38.862  1.00 34.07  ? 532  GLN A OE1   1 
ATOM   4093 N  NE2   . GLN A 1 532 ? 47.927 26.617 38.559  1.00 75.00  ? 532  GLN A NE2   1 
ATOM   4094 N  N     . SER A 1 533 ? 47.819 24.590 33.918  1.00 32.20  ? 533  SER A N     1 
ATOM   4095 C  CA    . SER A 1 533 ? 47.264 23.329 33.496  1.00 48.54  ? 533  SER A CA    1 
ATOM   4096 C  C     . SER A 1 533 ? 48.206 22.131 33.439  1.00 34.37  ? 533  SER A C     1 
ATOM   4097 O  O     . SER A 1 533 ? 47.758 20.981 33.493  1.00 50.40  ? 533  SER A O     1 
ATOM   4098 C  CB    . SER A 1 533 ? 46.242 23.400 32.349  1.00 32.38  ? 533  SER A CB    1 
ATOM   4099 O  OG    . SER A 1 533 ? 45.197 24.298 32.664  1.00 29.33  ? 533  SER A OG    1 
ATOM   4100 N  N     . VAL A 1 534 ? 49.501 22.321 33.326  1.00 41.34  ? 534  VAL A N     1 
ATOM   4101 C  CA    . VAL A 1 534 ? 50.401 21.140 33.262  1.00 52.04  ? 534  VAL A CA    1 
ATOM   4102 C  C     . VAL A 1 534 ? 50.593 20.336 34.557  1.00 39.91  ? 534  VAL A C     1 
ATOM   4103 O  O     . VAL A 1 534 ? 50.803 19.125 34.570  1.00 68.98  ? 534  VAL A O     1 
ATOM   4104 C  CB    . VAL A 1 534 ? 51.760 21.616 32.839  1.00 39.03  ? 534  VAL A CB    1 
ATOM   4105 C  CG1   . VAL A 1 534 ? 52.636 20.392 32.549  1.00 76.23  ? 534  VAL A CG1   1 
ATOM   4106 C  CG2   . VAL A 1 534 ? 51.501 22.478 31.623  1.00 40.65  ? 534  VAL A CG2   1 
ATOM   4107 N  N     . PHE A 1 535 ? 50.637 21.083 35.632  1.00 49.49  ? 535  PHE A N     1 
ATOM   4108 C  CA    . PHE A 1 535 ? 50.804 20.624 36.969  1.00 32.88  ? 535  PHE A CA    1 
ATOM   4109 C  C     . PHE A 1 535 ? 49.570 19.953 37.501  1.00 100.00 ? 535  PHE A C     1 
ATOM   4110 O  O     . PHE A 1 535 ? 48.516 20.575 37.706  1.00 38.57  ? 535  PHE A O     1 
ATOM   4111 C  CB    . PHE A 1 535 ? 51.090 21.875 37.750  1.00 26.25  ? 535  PHE A CB    1 
ATOM   4112 C  CG    . PHE A 1 535 ? 52.303 22.330 37.078  1.00 32.76  ? 535  PHE A CG    1 
ATOM   4113 C  CD1   . PHE A 1 535 ? 53.483 21.677 37.428  1.00 56.42  ? 535  PHE A CD1   1 
ATOM   4114 C  CD2   . PHE A 1 535 ? 52.291 23.257 36.033  1.00 39.51  ? 535  PHE A CD2   1 
ATOM   4115 C  CE1   . PHE A 1 535 ? 54.684 22.025 36.812  1.00 45.07  ? 535  PHE A CE1   1 
ATOM   4116 C  CE2   . PHE A 1 535 ? 53.485 23.608 35.393  1.00 69.80  ? 535  PHE A CE2   1 
ATOM   4117 C  CZ    . PHE A 1 535 ? 54.672 22.983 35.792  1.00 100.00 ? 535  PHE A CZ    1 
ATOM   4118 N  N     . PRO A 1 536 ? 49.744 18.663 37.730  1.00 100.00 ? 536  PRO A N     1 
ATOM   4119 C  CA    . PRO A 1 536 ? 48.725 17.795 38.267  1.00 88.27  ? 536  PRO A CA    1 
ATOM   4120 C  C     . PRO A 1 536 ? 48.154 18.344 39.563  1.00 100.00 ? 536  PRO A C     1 
ATOM   4121 O  O     . PRO A 1 536 ? 46.953 18.276 39.812  1.00 47.55  ? 536  PRO A O     1 
ATOM   4122 C  CB    . PRO A 1 536 ? 49.434 16.465 38.595  1.00 77.68  ? 536  PRO A CB    1 
ATOM   4123 C  CG    . PRO A 1 536 ? 50.900 16.623 38.210  1.00 100.00 ? 536  PRO A CG    1 
ATOM   4124 C  CD    . PRO A 1 536 ? 50.994 17.926 37.433  1.00 45.47  ? 536  PRO A CD    1 
ATOM   4125 N  N     . ASN A 1 537 ? 49.031 18.896 40.388  1.00 44.08  ? 537  ASN A N     1 
ATOM   4126 C  CA    . ASN A 1 537 ? 48.670 19.405 41.693  1.00 65.81  ? 537  ASN A CA    1 
ATOM   4127 C  C     . ASN A 1 537 ? 48.246 20.864 41.832  1.00 100.00 ? 537  ASN A C     1 
ATOM   4128 O  O     . ASN A 1 537 ? 47.998 21.308 42.970  1.00 42.63  ? 537  ASN A O     1 
ATOM   4129 C  CB    . ASN A 1 537 ? 49.743 18.989 42.699  1.00 50.89  ? 537  ASN A CB    1 
ATOM   4130 C  CG    . ASN A 1 537 ? 49.997 17.501 42.577  1.00 44.54  ? 537  ASN A CG    1 
ATOM   4131 O  OD1   . ASN A 1 537 ? 49.039 16.710 42.489  1.00 50.35  ? 537  ASN A OD1   1 
ATOM   4132 N  ND2   . ASN A 1 537 ? 51.276 17.118 42.504  1.00 79.09  ? 537  ASN A ND2   1 
ATOM   4133 N  N     . ALA A 1 538 ? 48.129 21.604 40.700  1.00 32.83  ? 538  ALA A N     1 
ATOM   4134 C  CA    . ALA A 1 538 ? 47.694 22.991 40.824  1.00 31.64  ? 538  ALA A CA    1 
ATOM   4135 C  C     . ALA A 1 538 ? 46.234 23.003 41.225  1.00 22.89  ? 538  ALA A C     1 
ATOM   4136 O  O     . ALA A 1 538 ? 45.515 21.997 41.041  1.00 32.78  ? 538  ALA A O     1 
ATOM   4137 C  CB    . ALA A 1 538 ? 47.959 23.925 39.634  1.00 29.23  ? 538  ALA A CB    1 
ATOM   4138 N  N     . THR A 1 539 ? 45.830 24.148 41.792  1.00 37.16  ? 539  THR A N     1 
ATOM   4139 C  CA    . THR A 1 539 ? 44.501 24.352 42.320  1.00 27.16  ? 539  THR A CA    1 
ATOM   4140 C  C     . THR A 1 539 ? 43.951 25.653 41.853  1.00 19.08  ? 539  THR A C     1 
ATOM   4141 O  O     . THR A 1 539 ? 44.659 26.533 41.398  1.00 23.51  ? 539  THR A O     1 
ATOM   4142 C  CB    . THR A 1 539 ? 44.579 24.422 43.890  1.00 18.81  ? 539  THR A CB    1 
ATOM   4143 O  OG1   . THR A 1 539 ? 45.184 25.650 44.350  1.00 26.45  ? 539  THR A OG1   1 
ATOM   4144 C  CG2   . THR A 1 539 ? 45.347 23.209 44.442  1.00 18.02  ? 539  THR A CG2   1 
ATOM   4145 N  N     . ASP A 1 540 ? 42.668 25.800 42.076  1.00 32.95  ? 540  ASP A N     1 
ATOM   4146 C  CA    . ASP A 1 540 ? 42.040 27.060 41.779  1.00 100.00 ? 540  ASP A CA    1 
ATOM   4147 C  C     . ASP A 1 540 ? 42.722 28.186 42.581  1.00 35.84  ? 540  ASP A C     1 
ATOM   4148 O  O     . ASP A 1 540 ? 42.787 29.327 42.115  1.00 28.14  ? 540  ASP A O     1 
ATOM   4149 C  CB    . ASP A 1 540 ? 40.521 27.035 42.054  1.00 58.60  ? 540  ASP A CB    1 
ATOM   4150 C  CG    . ASP A 1 540 ? 39.738 25.935 41.354  1.00 51.53  ? 540  ASP A CG    1 
ATOM   4151 O  OD1   . ASP A 1 540 ? 40.268 25.404 40.208  1.00 38.32  ? 540  ASP A OD1   1 
ATOM   4152 O  OD2   . ASP A 1 540 ? 38.680 25.578 41.854  1.00 49.53  ? 540  ASP A OD2   1 
ATOM   4153 N  N     . ASN A 1 541 ? 43.257 27.901 43.795  1.00 22.43  ? 541  ASN A N     1 
ATOM   4154 C  CA    . ASN A 1 541 ? 43.945 28.950 44.537  1.00 27.84  ? 541  ASN A CA    1 
ATOM   4155 C  C     . ASN A 1 541 ? 45.306 29.443 43.911  1.00 11.74  ? 541  ASN A C     1 
ATOM   4156 O  O     . ASN A 1 541 ? 45.640 30.639 43.852  1.00 20.33  ? 541  ASN A O     1 
ATOM   4157 C  CB    . ASN A 1 541 ? 44.092 28.533 46.017  1.00 32.12  ? 541  ASN A CB    1 
ATOM   4158 C  CG    . ASN A 1 541 ? 44.898 29.548 46.808  1.00 27.90  ? 541  ASN A CG    1 
ATOM   4159 O  OD1   . ASN A 1 541 ? 46.050 29.258 47.181  1.00 44.75  ? 541  ASN A OD1   1 
ATOM   4160 N  ND2   . ASN A 1 541 ? 44.318 30.770 46.997  1.00 26.32  ? 541  ASN A ND2   1 
ATOM   4161 N  N     . THR A 1 542 ? 46.026 28.456 43.403  1.00 19.20  ? 542  THR A N     1 
ATOM   4162 C  CA    . THR A 1 542 ? 47.311 28.634 42.726  1.00 17.80  ? 542  THR A CA    1 
ATOM   4163 C  C     . THR A 1 542 ? 47.010 29.475 41.509  1.00 14.87  ? 542  THR A C     1 
ATOM   4164 O  O     . THR A 1 542 ? 47.505 30.588 41.299  1.00 23.27  ? 542  THR A O     1 
ATOM   4165 C  CB    . THR A 1 542 ? 47.659 27.192 42.385  1.00 18.78  ? 542  THR A CB    1 
ATOM   4166 O  OG1   . THR A 1 542 ? 48.609 26.674 43.250  1.00 43.77  ? 542  THR A OG1   1 
ATOM   4167 C  CG2   . THR A 1 542 ? 47.924 26.898 40.967  1.00 36.35  ? 542  THR A CG2   1 
ATOM   4168 N  N     . LEU A 1 543 ? 46.041 29.020 40.755  1.00 24.13  ? 543  LEU A N     1 
ATOM   4169 C  CA    . LEU A 1 543 ? 45.627 29.801 39.571  1.00 16.25  ? 543  LEU A CA    1 
ATOM   4170 C  C     . LEU A 1 543 ? 45.223 31.233 39.852  1.00 14.29  ? 543  LEU A C     1 
ATOM   4171 O  O     . LEU A 1 543 ? 45.719 32.209 39.271  1.00 22.09  ? 543  LEU A O     1 
ATOM   4172 C  CB    . LEU A 1 543 ? 44.467 29.028 38.902  1.00 16.86  ? 543  LEU A CB    1 
ATOM   4173 C  CG    . LEU A 1 543 ? 43.854 29.774 37.752  1.00 24.65  ? 543  LEU A CG    1 
ATOM   4174 C  CD1   . LEU A 1 543 ? 44.917 30.032 36.650  1.00 18.53  ? 543  LEU A CD1   1 
ATOM   4175 C  CD2   . LEU A 1 543 ? 42.709 28.869 37.231  1.00 33.01  ? 543  LEU A CD2   1 
ATOM   4176 N  N     . ILE A 1 544 ? 44.223 31.437 40.736  1.00 24.50  ? 544  ILE A N     1 
ATOM   4177 C  CA    . ILE A 1 544 ? 43.789 32.808 40.968  1.00 17.92  ? 544  ILE A CA    1 
ATOM   4178 C  C     . ILE A 1 544 ? 44.879 33.737 41.548  1.00 15.87  ? 544  ILE A C     1 
ATOM   4179 O  O     . ILE A 1 544 ? 44.898 34.979 41.304  1.00 14.28  ? 544  ILE A O     1 
ATOM   4180 C  CB    . ILE A 1 544 ? 42.485 32.914 41.795  1.00 28.56  ? 544  ILE A CB    1 
ATOM   4181 C  CG1   . ILE A 1 544 ? 42.095 34.384 41.868  1.00 33.22  ? 544  ILE A CG1   1 
ATOM   4182 C  CG2   . ILE A 1 544 ? 42.742 32.366 43.225  1.00 19.59  ? 544  ILE A CG2   1 
ATOM   4183 C  CD1   . ILE A 1 544 ? 40.768 34.795 41.287  1.00 24.96  ? 544  ILE A CD1   1 
ATOM   4184 N  N     . THR A 1 545 ? 45.744 33.144 42.386  1.00 22.58  ? 545  THR A N     1 
ATOM   4185 C  CA    . THR A 1 545 ? 46.872 33.901 42.989  1.00 19.91  ? 545  THR A CA    1 
ATOM   4186 C  C     . THR A 1 545 ? 47.844 34.324 41.868  1.00 12.74  ? 545  THR A C     1 
ATOM   4187 O  O     . THR A 1 545 ? 48.291 35.451 41.822  1.00 15.70  ? 545  THR A O     1 
ATOM   4188 C  CB    . THR A 1 545 ? 47.659 32.990 43.978  1.00 18.60  ? 545  THR A CB    1 
ATOM   4189 O  OG1   . THR A 1 545 ? 46.829 32.472 44.984  1.00 22.82  ? 545  THR A OG1   1 
ATOM   4190 C  CG2   . THR A 1 545 ? 48.862 33.692 44.550  1.00 16.46  ? 545  THR A CG2   1 
ATOM   4191 N  N     . LYS A 1 546 ? 48.121 33.371 40.946  1.00 12.67  ? 546  LYS A N     1 
ATOM   4192 C  CA    . LYS A 1 546 ? 49.002 33.759 39.807  1.00 16.77  ? 546  LYS A CA    1 
ATOM   4193 C  C     . LYS A 1 546 ? 48.428 34.902 38.968  1.00 19.51  ? 546  LYS A C     1 
ATOM   4194 O  O     . LYS A 1 546 ? 49.138 35.811 38.530  1.00 18.31  ? 546  LYS A O     1 
ATOM   4195 C  CB    . LYS A 1 546 ? 49.264 32.536 38.951  1.00 19.86  ? 546  LYS A CB    1 
ATOM   4196 C  CG    . LYS A 1 546 ? 50.239 32.907 37.881  1.00 28.76  ? 546  LYS A CG    1 
ATOM   4197 C  CD    . LYS A 1 546 ? 51.246 31.808 37.596  1.00 40.31  ? 546  LYS A CD    1 
ATOM   4198 C  CE    . LYS A 1 546 ? 52.686 32.164 37.967  1.00 75.87  ? 546  LYS A CE    1 
ATOM   4199 N  NZ    . LYS A 1 546 ? 53.655 32.185 36.848  1.00 100.00 ? 546  LYS A NZ    1 
ATOM   4200 N  N     . LEU A 1 547 ? 47.066 34.837 38.746  1.00 20.62  ? 547  LEU A N     1 
ATOM   4201 C  CA    . LEU A 1 547 ? 46.313 35.846 38.029  1.00 9.72   ? 547  LEU A CA    1 
ATOM   4202 C  C     . LEU A 1 547 ? 46.430 37.175 38.712  1.00 16.82  ? 547  LEU A C     1 
ATOM   4203 O  O     . LEU A 1 547 ? 46.811 38.167 38.184  1.00 14.76  ? 547  LEU A O     1 
ATOM   4204 C  CB    . LEU A 1 547 ? 44.779 35.472 37.850  1.00 14.61  ? 547  LEU A CB    1 
ATOM   4205 C  CG    . LEU A 1 547 ? 44.518 34.245 36.923  1.00 25.33  ? 547  LEU A CG    1 
ATOM   4206 C  CD1   . LEU A 1 547 ? 43.026 34.077 36.750  1.00 18.60  ? 547  LEU A CD1   1 
ATOM   4207 C  CD2   . LEU A 1 547 ? 45.137 34.460 35.532  1.00 12.22  ? 547  LEU A CD2   1 
ATOM   4208 N  N     . HIS A 1 548 ? 46.123 37.234 39.976  1.00 16.40  ? 548  HIS A N     1 
ATOM   4209 C  CA    . HIS A 1 548 ? 46.281 38.482 40.714  1.00 10.59  ? 548  HIS A CA    1 
ATOM   4210 C  C     . HIS A 1 548 ? 47.761 38.973 40.719  1.00 7.39   ? 548  HIS A C     1 
ATOM   4211 O  O     . HIS A 1 548 ? 47.957 40.218 40.658  1.00 15.35  ? 548  HIS A O     1 
ATOM   4212 C  CB    . HIS A 1 548 ? 45.856 38.193 42.191  1.00 20.34  ? 548  HIS A CB    1 
ATOM   4213 C  CG    . HIS A 1 548 ? 44.362 37.960 42.369  1.00 12.71  ? 548  HIS A CG    1 
ATOM   4214 N  ND1   . HIS A 1 548 ? 43.425 38.554 41.550  1.00 18.17  ? 548  HIS A ND1   1 
ATOM   4215 C  CD2   . HIS A 1 548 ? 43.700 37.241 43.290  1.00 21.74  ? 548  HIS A CD2   1 
ATOM   4216 C  CE1   . HIS A 1 548 ? 42.225 38.202 41.977  1.00 17.36  ? 548  HIS A CE1   1 
ATOM   4217 N  NE2   . HIS A 1 548 ? 42.344 37.428 43.022  1.00 16.29  ? 548  HIS A NE2   1 
ATOM   4218 N  N     . SER A 1 549 ? 48.703 37.992 40.865  1.00 14.25  ? 549  SER A N     1 
ATOM   4219 C  CA    . SER A 1 549 ? 50.159 38.264 40.868  1.00 9.51   ? 549  SER A CA    1 
ATOM   4220 C  C     . SER A 1 549 ? 50.537 38.987 39.588  1.00 20.24  ? 549  SER A C     1 
ATOM   4221 O  O     . SER A 1 549 ? 51.223 40.001 39.575  1.00 16.07  ? 549  SER A O     1 
ATOM   4222 C  CB    . SER A 1 549 ? 50.981 37.008 40.968  1.00 18.78  ? 549  SER A CB    1 
ATOM   4223 O  OG    . SER A 1 549 ? 52.253 37.515 41.379  1.00 19.27  ? 549  SER A OG    1 
ATOM   4224 N  N     . HIS A 1 550 ? 50.003 38.535 38.474  1.00 19.37  ? 550  HIS A N     1 
ATOM   4225 C  CA    . HIS A 1 550 ? 50.368 39.264 37.286  1.00 13.34  ? 550  HIS A CA    1 
ATOM   4226 C  C     . HIS A 1 550 ? 49.570 40.476 36.976  1.00 11.96  ? 550  HIS A C     1 
ATOM   4227 O  O     . HIS A 1 550 ? 50.099 41.335 36.339  1.00 21.71  ? 550  HIS A O     1 
ATOM   4228 C  CB    . HIS A 1 550 ? 50.185 38.373 36.084  1.00 13.60  ? 550  HIS A CB    1 
ATOM   4229 C  CG    . HIS A 1 550 ? 51.194 37.340 36.015  1.00 18.00  ? 550  HIS A CG    1 
ATOM   4230 N  ND1   . HIS A 1 550 ? 52.153 37.367 35.005  1.00 15.38  ? 550  HIS A ND1   1 
ATOM   4231 C  CD2   . HIS A 1 550 ? 51.331 36.210 36.739  1.00 11.65  ? 550  HIS A CD2   1 
ATOM   4232 C  CE1   . HIS A 1 550 ? 52.884 36.279 35.160  1.00 9.56   ? 550  HIS A CE1   1 
ATOM   4233 N  NE2   . HIS A 1 550 ? 52.440 35.560 36.208  1.00 18.24  ? 550  HIS A NE2   1 
ATOM   4234 N  N     . PHE A 1 551 ? 48.268 40.613 37.355  1.00 14.24  ? 551  PHE A N     1 
ATOM   4235 C  CA    . PHE A 1 551 ? 47.473 41.771 36.889  1.00 9.81   ? 551  PHE A CA    1 
ATOM   4236 C  C     . PHE A 1 551 ? 46.897 42.724 37.905  1.00 13.39  ? 551  PHE A C     1 
ATOM   4237 O  O     . PHE A 1 551 ? 46.565 43.854 37.528  1.00 16.63  ? 551  PHE A O     1 
ATOM   4238 C  CB    . PHE A 1 551 ? 46.220 41.247 36.076  1.00 17.49  ? 551  PHE A CB    1 
ATOM   4239 C  CG    . PHE A 1 551 ? 46.585 40.197 35.062  1.00 11.74  ? 551  PHE A CG    1 
ATOM   4240 C  CD1   . PHE A 1 551 ? 47.494 40.518 34.051  1.00 22.12  ? 551  PHE A CD1   1 
ATOM   4241 C  CD2   . PHE A 1 551 ? 46.110 38.897 35.131  1.00 7.48   ? 551  PHE A CD2   1 
ATOM   4242 C  CE1   . PHE A 1 551 ? 47.927 39.535 33.155  1.00 15.71  ? 551  PHE A CE1   1 
ATOM   4243 C  CE2   . PHE A 1 551 ? 46.513 37.915 34.225  1.00 18.04  ? 551  PHE A CE2   1 
ATOM   4244 C  CZ    . PHE A 1 551 ? 47.435 38.235 33.230  1.00 10.43  ? 551  PHE A CZ    1 
ATOM   4245 N  N     . SER A 1 552 ? 46.757 42.288 39.182  1.00 21.12  ? 552  SER A N     1 
ATOM   4246 C  CA    . SER A 1 552 ? 46.206 43.182 40.233  1.00 20.96  ? 552  SER A CA    1 
ATOM   4247 C  C     . SER A 1 552 ? 46.992 44.498 40.404  1.00 17.41  ? 552  SER A C     1 
ATOM   4248 O  O     . SER A 1 552 ? 48.125 44.470 40.882  1.00 23.77  ? 552  SER A O     1 
ATOM   4249 C  CB    . SER A 1 552 ? 45.980 42.441 41.604  1.00 14.61  ? 552  SER A CB    1 
ATOM   4250 O  OG    . SER A 1 552 ? 45.494 43.457 42.488  1.00 18.67  ? 552  SER A OG    1 
ATOM   4251 N  N     . LYS A 1 553 ? 46.422 45.661 40.038  1.00 15.23  ? 553  LYS A N     1 
ATOM   4252 C  CA    . LYS A 1 553 ? 47.053 47.000 40.039  1.00 19.90  ? 553  LYS A CA    1 
ATOM   4253 C  C     . LYS A 1 553 ? 48.137 47.088 38.990  1.00 16.95  ? 553  LYS A C     1 
ATOM   4254 O  O     . LYS A 1 553 ? 48.965 47.973 39.002  1.00 18.69  ? 553  LYS A O     1 
ATOM   4255 C  CB    . LYS A 1 553 ? 47.681 47.389 41.382  1.00 20.75  ? 553  LYS A CB    1 
ATOM   4256 C  CG    . LYS A 1 553 ? 46.743 47.071 42.488  1.00 27.77  ? 553  LYS A CG    1 
ATOM   4257 C  CD    . LYS A 1 553 ? 45.991 48.272 43.021  1.00 44.22  ? 553  LYS A CD    1 
ATOM   4258 C  CE    . LYS A 1 553 ? 45.865 48.198 44.560  1.00 100.00 ? 553  LYS A CE    1 
ATOM   4259 N  NZ    . LYS A 1 553 ? 46.743 49.113 45.349  1.00 78.26  ? 553  LYS A NZ    1 
ATOM   4260 N  N     . LYS A 1 554 ? 48.214 46.089 38.143  1.00 18.24  ? 554  LYS A N     1 
ATOM   4261 C  CA    . LYS A 1 554 ? 49.267 46.053 37.137  1.00 14.47  ? 554  LYS A CA    1 
ATOM   4262 C  C     . LYS A 1 554 ? 48.649 46.225 35.715  1.00 46.04  ? 554  LYS A C     1 
ATOM   4263 O  O     . LYS A 1 554 ? 49.218 46.788 34.814  1.00 31.63  ? 554  LYS A O     1 
ATOM   4264 C  CB    . LYS A 1 554 ? 50.019 44.753 37.320  1.00 13.78  ? 554  LYS A CB    1 
ATOM   4265 C  CG    . LYS A 1 554 ? 50.792 44.794 38.629  1.00 13.66  ? 554  LYS A CG    1 
ATOM   4266 C  CD    . LYS A 1 554 ? 51.435 43.500 39.039  1.00 13.26  ? 554  LYS A CD    1 
ATOM   4267 C  CE    . LYS A 1 554 ? 52.242 43.788 40.318  1.00 17.52  ? 554  LYS A CE    1 
ATOM   4268 N  NZ    . LYS A 1 554 ? 52.624 42.518 40.937  1.00 16.25  ? 554  LYS A NZ    1 
ATOM   4269 N  N     . ASN A 1 555 ? 47.431 45.752 35.512  1.00 19.82  ? 555  ASN A N     1 
ATOM   4270 C  CA    . ASN A 1 555 ? 46.776 45.899 34.238  1.00 19.59  ? 555  ASN A CA    1 
ATOM   4271 C  C     . ASN A 1 555 ? 45.525 46.664 34.456  1.00 16.32  ? 555  ASN A C     1 
ATOM   4272 O  O     . ASN A 1 555 ? 44.685 46.280 35.210  1.00 16.84  ? 555  ASN A O     1 
ATOM   4273 C  CB    . ASN A 1 555 ? 46.466 44.509 33.647  1.00 16.75  ? 555  ASN A CB    1 
ATOM   4274 C  CG    . ASN A 1 555 ? 45.856 44.595 32.238  1.00 22.86  ? 555  ASN A CG    1 
ATOM   4275 O  OD1   . ASN A 1 555 ? 44.770 45.140 32.035  1.00 22.87  ? 555  ASN A OD1   1 
ATOM   4276 N  ND2   . ASN A 1 555 ? 46.553 44.055 31.265  1.00 18.81  ? 555  ASN A ND2   1 
ATOM   4277 N  N     . ALA A 1 556 ? 45.378 47.763 33.796  1.00 16.30  ? 556  ALA A N     1 
ATOM   4278 C  CA    . ALA A 1 556 ? 44.194 48.558 33.972  1.00 17.02  ? 556  ALA A CA    1 
ATOM   4279 C  C     . ALA A 1 556 ? 42.795 47.938 33.713  1.00 17.38  ? 556  ALA A C     1 
ATOM   4280 O  O     . ALA A 1 556 ? 41.796 48.519 34.151  1.00 27.75  ? 556  ALA A O     1 
ATOM   4281 C  CB    . ALA A 1 556 ? 44.381 49.805 33.143  1.00 19.74  ? 556  ALA A CB    1 
ATOM   4282 N  N     . LYS A 1 557 ? 42.699 46.809 33.006  1.00 19.04  ? 557  LYS A N     1 
ATOM   4283 C  CA    . LYS A 1 557 ? 41.431 46.141 32.669  1.00 16.39  ? 557  LYS A CA    1 
ATOM   4284 C  C     . LYS A 1 557 ? 41.082 45.097 33.692  1.00 20.05  ? 557  LYS A C     1 
ATOM   4285 O  O     . LYS A 1 557 ? 40.086 44.452 33.591  1.00 17.44  ? 557  LYS A O     1 
ATOM   4286 C  CB    . LYS A 1 557 ? 41.513 45.465 31.283  1.00 16.06  ? 557  LYS A CB    1 
ATOM   4287 C  CG    . LYS A 1 557 ? 41.796 46.514 30.217  1.00 11.97  ? 557  LYS A CG    1 
ATOM   4288 C  CD    . LYS A 1 557 ? 40.584 47.359 30.029  1.00 16.62  ? 557  LYS A CD    1 
ATOM   4289 C  CE    . LYS A 1 557 ? 40.793 48.234 28.842  1.00 26.20  ? 557  LYS A CE    1 
ATOM   4290 N  NZ    . LYS A 1 557 ? 39.651 49.105 28.673  1.00 25.42  ? 557  LYS A NZ    1 
ATOM   4291 N  N     . TYR A 1 558 ? 41.978 44.890 34.669  1.00 20.67  ? 558  TYR A N     1 
ATOM   4292 C  CA    . TYR A 1 558 ? 41.808 43.865 35.659  1.00 11.37  ? 558  TYR A CA    1 
ATOM   4293 C  C     . TYR A 1 558 ? 41.468 44.436 37.051  1.00 17.95  ? 558  TYR A C     1 
ATOM   4294 O  O     . TYR A 1 558 ? 41.866 45.530 37.405  1.00 24.06  ? 558  TYR A O     1 
ATOM   4295 C  CB    . TYR A 1 558 ? 43.104 43.062 35.805  1.00 11.88  ? 558  TYR A CB    1 
ATOM   4296 C  CG    . TYR A 1 558 ? 43.051 41.814 36.671  1.00 16.32  ? 558  TYR A CG    1 
ATOM   4297 C  CD1   . TYR A 1 558 ? 43.346 41.822 38.050  1.00 14.77  ? 558  TYR A CD1   1 
ATOM   4298 C  CD2   . TYR A 1 558 ? 42.762 40.579 36.085  1.00 17.52  ? 558  TYR A CD2   1 
ATOM   4299 C  CE1   . TYR A 1 558 ? 43.380 40.626 38.777  1.00 8.63   ? 558  TYR A CE1   1 
ATOM   4300 C  CE2   . TYR A 1 558 ? 42.760 39.386 36.807  1.00 26.08  ? 558  TYR A CE2   1 
ATOM   4301 C  CZ    . TYR A 1 558 ? 43.085 39.408 38.171  1.00 12.93  ? 558  TYR A CZ    1 
ATOM   4302 O  OH    . TYR A 1 558 ? 43.151 38.200 38.863  1.00 13.22  ? 558  TYR A OH    1 
ATOM   4303 N  N     . GLU A 1 559 ? 40.698 43.641 37.830  1.00 17.47  ? 559  GLU A N     1 
ATOM   4304 C  CA    . GLU A 1 559 ? 40.411 43.981 39.190  1.00 21.21  ? 559  GLU A CA    1 
ATOM   4305 C  C     . GLU A 1 559 ? 40.455 42.778 40.107  1.00 19.09  ? 559  GLU A C     1 
ATOM   4306 O  O     . GLU A 1 559 ? 39.782 41.767 39.914  1.00 14.72  ? 559  GLU A O     1 
ATOM   4307 C  CB    . GLU A 1 559 ? 39.153 44.800 39.425  1.00 31.97  ? 559  GLU A CB    1 
ATOM   4308 C  CG    . GLU A 1 559 ? 38.687 44.738 40.902  1.00 47.19  ? 559  GLU A CG    1 
ATOM   4309 C  CD    . GLU A 1 559 ? 37.867 45.933 41.348  1.00 73.29  ? 559  GLU A CD    1 
ATOM   4310 O  OE1   . GLU A 1 559 ? 36.994 46.336 40.466  1.00 25.92  ? 559  GLU A OE1   1 
ATOM   4311 O  OE2   . GLU A 1 559 ? 37.974 46.468 42.433  1.00 56.71  ? 559  GLU A OE2   1 
ATOM   4312 N  N     . GLU A 1 560 ? 41.295 42.881 41.147  1.00 18.48  ? 560  GLU A N     1 
ATOM   4313 C  CA    . GLU A 1 560 ? 41.297 41.826 42.180  1.00 14.41  ? 560  GLU A CA    1 
ATOM   4314 C  C     . GLU A 1 560 ? 40.202 42.317 43.205  1.00 17.48  ? 560  GLU A C     1 
ATOM   4315 O  O     . GLU A 1 560 ? 40.182 43.502 43.617  1.00 17.90  ? 560  GLU A O     1 
ATOM   4316 C  CB    . GLU A 1 560 ? 42.674 41.868 42.899  1.00 16.14  ? 560  GLU A CB    1 
ATOM   4317 C  CG    . GLU A 1 560 ? 42.719 41.048 44.207  1.00 10.96  ? 560  GLU A CG    1 
ATOM   4318 C  CD    . GLU A 1 560 ? 44.110 40.961 44.751  1.00 14.99  ? 560  GLU A CD    1 
ATOM   4319 O  OE1   . GLU A 1 560 ? 45.025 41.643 44.331  1.00 21.73  ? 560  GLU A OE1   1 
ATOM   4320 O  OE2   . GLU A 1 560 ? 44.244 40.012 45.643  1.00 26.96  ? 560  GLU A OE2   1 
ATOM   4321 N  N     . PRO A 1 561 ? 39.230 41.467 43.547  1.00 13.99  ? 561  PRO A N     1 
ATOM   4322 C  CA    . PRO A 1 561 ? 38.131 41.867 44.456  1.00 22.07  ? 561  PRO A CA    1 
ATOM   4323 C  C     . PRO A 1 561 ? 38.591 42.265 45.852  1.00 25.10  ? 561  PRO A C     1 
ATOM   4324 O  O     . PRO A 1 561 ? 39.643 41.801 46.283  1.00 14.90  ? 561  PRO A O     1 
ATOM   4325 C  CB    . PRO A 1 561 ? 37.312 40.619 44.605  1.00 19.00  ? 561  PRO A CB    1 
ATOM   4326 C  CG    . PRO A 1 561 ? 37.862 39.562 43.666  1.00 28.21  ? 561  PRO A CG    1 
ATOM   4327 C  CD    . PRO A 1 561 ? 39.250 40.026 43.294  1.00 10.55  ? 561  PRO A CD    1 
ATOM   4328 N  N     . ARG A 1 562 ? 37.847 43.157 46.541  1.00 24.25  ? 562  ARG A N     1 
ATOM   4329 C  CA    . ARG A 1 562 ? 38.318 43.505 47.869  1.00 23.27  ? 562  ARG A CA    1 
ATOM   4330 C  C     . ARG A 1 562 ? 38.276 42.358 48.824  1.00 19.91  ? 562  ARG A C     1 
ATOM   4331 O  O     . ARG A 1 562 ? 39.134 42.202 49.658  1.00 29.02  ? 562  ARG A O     1 
ATOM   4332 C  CB    . ARG A 1 562 ? 37.528 44.543 48.510  1.00 25.99  ? 562  ARG A CB    1 
ATOM   4333 C  CG    . ARG A 1 562 ? 37.401 45.738 47.654  1.00 36.99  ? 562  ARG A CG    1 
ATOM   4334 C  CD    . ARG A 1 562 ? 36.643 46.752 48.477  1.00 40.52  ? 562  ARG A CD    1 
ATOM   4335 N  NE    . ARG A 1 562 ? 35.186 46.653 48.401  1.00 100.00 ? 562  ARG A NE    1 
ATOM   4336 C  CZ    . ARG A 1 562 ? 34.363 46.933 49.419  1.00 100.00 ? 562  ARG A CZ    1 
ATOM   4337 N  NH1   . ARG A 1 562 ? 34.838 47.324 50.643  1.00 50.00  ? 562  ARG A NH1   1 
ATOM   4338 N  NH2   . ARG A 1 562 ? 33.034 46.823 49.177  1.00 44.18  ? 562  ARG A NH2   1 
ATOM   4339 N  N     . PHE A 1 563 ? 37.292 41.524 48.710  1.00 15.75  ? 563  PHE A N     1 
ATOM   4340 C  CA    . PHE A 1 563 ? 37.239 40.426 49.608  1.00 16.15  ? 563  PHE A CA    1 
ATOM   4341 C  C     . PHE A 1 563 ? 37.213 39.012 48.983  1.00 25.88  ? 563  PHE A C     1 
ATOM   4342 O  O     . PHE A 1 563 ? 37.731 38.037 49.547  1.00 23.29  ? 563  PHE A O     1 
ATOM   4343 C  CB    . PHE A 1 563 ? 36.025 40.628 50.618  1.00 19.35  ? 563  PHE A CB    1 
ATOM   4344 C  CG    . PHE A 1 563 ? 35.839 42.049 51.120  1.00 33.32  ? 563  PHE A CG    1 
ATOM   4345 C  CD1   . PHE A 1 563 ? 36.643 42.537 52.150  1.00 26.94  ? 563  PHE A CD1   1 
ATOM   4346 C  CD2   . PHE A 1 563 ? 34.821 42.872 50.624  1.00 16.18  ? 563  PHE A CD2   1 
ATOM   4347 C  CE1   . PHE A 1 563 ? 36.500 43.845 52.606  1.00 17.29  ? 563  PHE A CE1   1 
ATOM   4348 C  CE2   . PHE A 1 563 ? 34.667 44.184 51.054  1.00 15.91  ? 563  PHE A CE2   1 
ATOM   4349 C  CZ    . PHE A 1 563 ? 35.532 44.657 52.034  1.00 16.88  ? 563  PHE A CZ    1 
ATOM   4350 N  N     . SER A 1 564 ? 36.461 38.794 47.919  1.00 19.99  ? 564  SER A N     1 
ATOM   4351 C  CA    . SER A 1 564 ? 36.453 37.417 47.422  1.00 15.00  ? 564  SER A CA    1 
ATOM   4352 C  C     . SER A 1 564 ? 37.882 36.980 47.109  1.00 17.09  ? 564  SER A C     1 
ATOM   4353 O  O     . SER A 1 564 ? 38.731 37.771 46.682  1.00 17.87  ? 564  SER A O     1 
ATOM   4354 C  CB    . SER A 1 564 ? 35.642 37.262 46.068  1.00 10.84  ? 564  SER A CB    1 
ATOM   4355 O  OG    . SER A 1 564 ? 35.590 35.880 45.749  1.00 16.03  ? 564  SER A OG    1 
ATOM   4356 N  N     . LYS A 1 565 ? 38.095 35.700 47.306  1.00 30.03  ? 565  LYS A N     1 
ATOM   4357 C  CA    . LYS A 1 565 ? 39.356 35.055 47.008  1.00 32.21  ? 565  LYS A CA    1 
ATOM   4358 C  C     . LYS A 1 565 ? 39.225 34.146 45.791  1.00 21.54  ? 565  LYS A C     1 
ATOM   4359 O  O     . LYS A 1 565 ? 40.149 33.406 45.473  1.00 19.66  ? 565  LYS A O     1 
ATOM   4360 C  CB    . LYS A 1 565 ? 39.773 34.181 48.186  1.00 20.20  ? 565  LYS A CB    1 
ATOM   4361 C  CG    . LYS A 1 565 ? 40.446 35.087 49.206  1.00 32.44  ? 565  LYS A CG    1 
ATOM   4362 C  CD    . LYS A 1 565 ? 39.751 35.191 50.536  1.00 56.52  ? 565  LYS A CD    1 
ATOM   4363 C  CE    . LYS A 1 565 ? 40.338 36.335 51.357  1.00 100.00 ? 565  LYS A CE    1 
ATOM   4364 N  NZ    . LYS A 1 565 ? 41.650 36.019 51.946  1.00 100.00 ? 565  LYS A NZ    1 
ATOM   4365 N  N     . THR A 1 566 ? 38.041 34.099 45.183  1.00 16.45  ? 566  THR A N     1 
ATOM   4366 C  CA    . THR A 1 566 ? 37.920 33.148 44.103  1.00 17.44  ? 566  THR A CA    1 
ATOM   4367 C  C     . THR A 1 566 ? 37.461 33.796 42.802  1.00 11.58  ? 566  THR A C     1 
ATOM   4368 O  O     . THR A 1 566 ? 37.156 33.109 41.857  1.00 18.30  ? 566  THR A O     1 
ATOM   4369 C  CB    . THR A 1 566 ? 36.921 32.027 44.449  1.00 16.67  ? 566  THR A CB    1 
ATOM   4370 O  OG1   . THR A 1 566 ? 35.827 32.677 44.989  1.00 21.93  ? 566  THR A OG1   1 
ATOM   4371 C  CG2   . THR A 1 566 ? 37.444 31.030 45.489  1.00 20.79  ? 566  THR A CG2   1 
ATOM   4372 N  N     . GLU A 1 567 ? 37.437 35.095 42.798  1.00 11.24  ? 567  GLU A N     1 
ATOM   4373 C  CA    . GLU A 1 567 ? 36.948 35.833 41.662  1.00 15.94  ? 567  GLU A CA    1 
ATOM   4374 C  C     . GLU A 1 567 ? 37.897 36.913 41.245  1.00 29.29  ? 567  GLU A C     1 
ATOM   4375 O  O     . GLU A 1 567 ? 38.767 37.318 41.996  1.00 19.53  ? 567  GLU A O     1 
ATOM   4376 C  CB    . GLU A 1 567 ? 35.663 36.605 42.061  1.00 13.60  ? 567  GLU A CB    1 
ATOM   4377 C  CG    . GLU A 1 567 ? 34.485 35.623 42.219  1.00 18.08  ? 567  GLU A CG    1 
ATOM   4378 C  CD    . GLU A 1 567 ? 33.214 36.127 42.919  1.00 24.38  ? 567  GLU A CD    1 
ATOM   4379 O  OE1   . GLU A 1 567 ? 32.838 37.296 43.036  1.00 22.99  ? 567  GLU A OE1   1 
ATOM   4380 O  OE2   . GLU A 1 567 ? 32.547 35.087 43.390  1.00 29.27  ? 567  GLU A OE2   1 
ATOM   4381 N  N     . PHE A 1 568 ? 37.659 37.418 40.044  1.00 14.28  ? 568  PHE A N     1 
ATOM   4382 C  CA    . PHE A 1 568 ? 38.418 38.490 39.471  1.00 12.48  ? 568  PHE A CA    1 
ATOM   4383 C  C     . PHE A 1 568 ? 37.553 39.111 38.413  1.00 18.92  ? 568  PHE A C     1 
ATOM   4384 O  O     . PHE A 1 568 ? 36.679 38.425 37.855  1.00 23.08  ? 568  PHE A O     1 
ATOM   4385 C  CB    . PHE A 1 568 ? 39.771 38.005 38.896  1.00 14.39  ? 568  PHE A CB    1 
ATOM   4386 C  CG    . PHE A 1 568 ? 39.630 37.248 37.581  1.00 18.44  ? 568  PHE A CG    1 
ATOM   4387 C  CD1   . PHE A 1 568 ? 39.663 37.919 36.353  1.00 15.46  ? 568  PHE A CD1   1 
ATOM   4388 C  CD2   . PHE A 1 568 ? 39.456 35.866 37.621  1.00 15.22  ? 568  PHE A CD2   1 
ATOM   4389 C  CE1   . PHE A 1 568 ? 39.530 37.160 35.191  1.00 11.97  ? 568  PHE A CE1   1 
ATOM   4390 C  CE2   . PHE A 1 568 ? 39.225 35.110 36.475  1.00 29.49  ? 568  PHE A CE2   1 
ATOM   4391 C  CZ    . PHE A 1 568 ? 39.284 35.785 35.255  1.00 10.68  ? 568  PHE A CZ    1 
ATOM   4392 N  N     . GLY A 1 569 ? 37.813 40.394 38.181  1.00 17.12  ? 569  GLY A N     1 
ATOM   4393 C  CA    . GLY A 1 569 ? 37.047 41.200 37.256  1.00 22.73  ? 569  GLY A CA    1 
ATOM   4394 C  C     . GLY A 1 569 ? 37.816 41.646 36.029  1.00 33.51  ? 569  GLY A C     1 
ATOM   4395 O  O     . GLY A 1 569 ? 39.014 41.919 36.057  1.00 17.88  ? 569  GLY A O     1 
ATOM   4396 N  N     . VAL A 1 570 ? 37.094 41.684 34.931  1.00 19.99  ? 570  VAL A N     1 
ATOM   4397 C  CA    . VAL A 1 570 ? 37.580 42.158 33.655  1.00 15.16  ? 570  VAL A CA    1 
ATOM   4398 C  C     . VAL A 1 570 ? 36.726 43.285 33.183  1.00 14.21  ? 570  VAL A C     1 
ATOM   4399 O  O     . VAL A 1 570 ? 35.510 43.187 33.170  1.00 17.44  ? 570  VAL A O     1 
ATOM   4400 C  CB    . VAL A 1 570 ? 37.711 41.107 32.537  1.00 25.00  ? 570  VAL A CB    1 
ATOM   4401 C  CG1   . VAL A 1 570 ? 38.316 41.767 31.274  1.00 13.90  ? 570  VAL A CG1   1 
ATOM   4402 C  CG2   . VAL A 1 570 ? 38.628 39.971 32.951  1.00 15.02  ? 570  VAL A CG2   1 
ATOM   4403 N  N     . THR A 1 571 ? 37.356 44.374 32.833  1.00 17.31  ? 571  THR A N     1 
ATOM   4404 C  CA    . THR A 1 571 ? 36.602 45.441 32.259  1.00 13.43  ? 571  THR A CA    1 
ATOM   4405 C  C     . THR A 1 571 ? 36.511 45.195 30.754  1.00 25.56  ? 571  THR A C     1 
ATOM   4406 O  O     . THR A 1 571 ? 37.488 45.259 29.968  1.00 17.92  ? 571  THR A O     1 
ATOM   4407 C  CB    . THR A 1 571 ? 37.210 46.775 32.521  1.00 20.25  ? 571  THR A CB    1 
ATOM   4408 O  OG1   . THR A 1 571 ? 37.435 46.954 33.906  1.00 25.77  ? 571  THR A OG1   1 
ATOM   4409 C  CG2   . THR A 1 571 ? 36.333 47.857 31.894  1.00 26.25  ? 571  THR A CG2   1 
ATOM   4410 N  N     . HIS A 1 572 ? 35.304 44.837 30.425  1.00 24.50  ? 572  HIS A N     1 
ATOM   4411 C  CA    . HIS A 1 572 ? 34.917 44.505 29.091  1.00 13.18  ? 572  HIS A CA    1 
ATOM   4412 C  C     . HIS A 1 572 ? 34.297 45.661 28.414  1.00 18.12  ? 572  HIS A C     1 
ATOM   4413 O  O     . HIS A 1 572 ? 34.133 46.746 28.976  1.00 20.34  ? 572  HIS A O     1 
ATOM   4414 C  CB    . HIS A 1 572 ? 34.011 43.333 28.961  1.00 6.98   ? 572  HIS A CB    1 
ATOM   4415 C  CG    . HIS A 1 572 ? 34.592 41.998 29.182  1.00 10.01  ? 572  HIS A CG    1 
ATOM   4416 N  ND1   . HIS A 1 572 ? 35.215 41.341 28.177  1.00 12.95  ? 572  HIS A ND1   1 
ATOM   4417 C  CD2   . HIS A 1 572 ? 34.574 41.211 30.286  1.00 10.66  ? 572  HIS A CD2   1 
ATOM   4418 C  CE1   . HIS A 1 572 ? 35.551 40.179 28.665  1.00 11.06  ? 572  HIS A CE1   1 
ATOM   4419 N  NE2   . HIS A 1 572 ? 35.147 40.045 29.925  1.00 12.90  ? 572  HIS A NE2   1 
ATOM   4420 N  N     . TYR A 1 573 ? 34.074 45.467 27.133  1.00 22.06  ? 573  TYR A N     1 
ATOM   4421 C  CA    . TYR A 1 573 ? 33.502 46.542 26.314  1.00 23.57  ? 573  TYR A CA    1 
ATOM   4422 C  C     . TYR A 1 573 ? 32.156 46.994 26.937  1.00 14.02  ? 573  TYR A C     1 
ATOM   4423 O  O     . TYR A 1 573 ? 31.867 48.190 27.059  1.00 22.00  ? 573  TYR A O     1 
ATOM   4424 C  CB    . TYR A 1 573 ? 33.156 45.960 24.903  1.00 27.65  ? 573  TYR A CB    1 
ATOM   4425 C  CG    . TYR A 1 573 ? 32.361 46.958 24.143  1.00 22.95  ? 573  TYR A CG    1 
ATOM   4426 C  CD1   . TYR A 1 573 ? 33.018 48.011 23.498  1.00 34.25  ? 573  TYR A CD1   1 
ATOM   4427 C  CD2   . TYR A 1 573 ? 30.966 46.886 24.111  1.00 23.23  ? 573  TYR A CD2   1 
ATOM   4428 C  CE1   . TYR A 1 573 ? 32.316 48.977 22.770  1.00 38.48  ? 573  TYR A CE1   1 
ATOM   4429 C  CE2   . TYR A 1 573 ? 30.245 47.891 23.453  1.00 22.75  ? 573  TYR A CE2   1 
ATOM   4430 C  CZ    . TYR A 1 573 ? 30.918 48.909 22.766  1.00 42.95  ? 573  TYR A CZ    1 
ATOM   4431 O  OH    . TYR A 1 573 ? 30.171 49.867 22.092  1.00 38.37  ? 573  TYR A OH    1 
ATOM   4432 N  N     . ALA A 1 574 ? 31.379 45.973 27.254  1.00 19.58  ? 574  ALA A N     1 
ATOM   4433 C  CA    . ALA A 1 574 ? 30.048 46.085 27.861  1.00 26.52  ? 574  ALA A CA    1 
ATOM   4434 C  C     . ALA A 1 574 ? 30.119 46.445 29.325  1.00 55.86  ? 574  ALA A C     1 
ATOM   4435 O  O     . ALA A 1 574 ? 29.070 46.513 29.923  1.00 34.99  ? 574  ALA A O     1 
ATOM   4436 C  CB    . ALA A 1 574 ? 29.434 44.701 27.841  1.00 36.40  ? 574  ALA A CB    1 
ATOM   4437 N  N     . GLY A 1 575 ? 31.332 46.588 29.899  1.00 37.81  ? 575  GLY A N     1 
ATOM   4438 C  CA    . GLY A 1 575 ? 31.553 46.915 31.300  1.00 17.67  ? 575  GLY A CA    1 
ATOM   4439 C  C     . GLY A 1 575 ? 32.224 45.782 32.088  1.00 16.03  ? 575  GLY A C     1 
ATOM   4440 O  O     . GLY A 1 575 ? 32.530 44.745 31.594  1.00 14.64  ? 575  GLY A O     1 
ATOM   4441 N  N     . GLN A 1 576 ? 32.446 45.962 33.397  1.00 19.15  ? 576  GLN A N     1 
ATOM   4442 C  CA    . GLN A 1 576 ? 33.084 44.894 34.157  1.00 21.03  ? 576  GLN A CA    1 
ATOM   4443 C  C     . GLN A 1 576 ? 32.277 43.630 34.383  1.00 22.39  ? 576  GLN A C     1 
ATOM   4444 O  O     . GLN A 1 576 ? 31.091 43.619 34.707  1.00 25.53  ? 576  GLN A O     1 
ATOM   4445 C  CB    . GLN A 1 576 ? 33.515 45.415 35.564  1.00 26.74  ? 576  GLN A CB    1 
ATOM   4446 C  CG    . GLN A 1 576 ? 34.157 44.288 36.386  1.00 18.89  ? 576  GLN A CG    1 
ATOM   4447 C  CD    . GLN A 1 576 ? 34.701 44.858 37.645  1.00 55.50  ? 576  GLN A CD    1 
ATOM   4448 O  OE1   . GLN A 1 576 ? 33.898 45.167 38.514  1.00 23.58  ? 576  GLN A OE1   1 
ATOM   4449 N  NE2   . GLN A 1 576 ? 36.013 45.052 37.729  1.00 18.94  ? 576  GLN A NE2   1 
ATOM   4450 N  N     . VAL A 1 577 ? 32.958 42.522 34.285  1.00 15.92  ? 577  VAL A N     1 
ATOM   4451 C  CA    . VAL A 1 577 ? 32.407 41.227 34.573  1.00 20.09  ? 577  VAL A CA    1 
ATOM   4452 C  C     . VAL A 1 577 ? 33.271 40.586 35.643  1.00 22.41  ? 577  VAL A C     1 
ATOM   4453 O  O     . VAL A 1 577 ? 34.495 40.443 35.509  1.00 20.83  ? 577  VAL A O     1 
ATOM   4454 C  CB    . VAL A 1 577 ? 32.372 40.299 33.356  1.00 10.36  ? 577  VAL A CB    1 
ATOM   4455 C  CG1   . VAL A 1 577 ? 31.830 38.921 33.678  1.00 12.45  ? 577  VAL A CG1   1 
ATOM   4456 C  CG2   . VAL A 1 577 ? 31.626 40.949 32.209  1.00 14.19  ? 577  VAL A CG2   1 
ATOM   4457 N  N     . MET A 1 578 ? 32.630 40.077 36.668  1.00 18.34  ? 578  MET A N     1 
ATOM   4458 C  CA    . MET A 1 578 ? 33.366 39.320 37.646  1.00 14.52  ? 578  MET A CA    1 
ATOM   4459 C  C     . MET A 1 578 ? 33.248 37.866 37.333  1.00 15.84  ? 578  MET A C     1 
ATOM   4460 O  O     . MET A 1 578 ? 32.119 37.395 37.142  1.00 20.30  ? 578  MET A O     1 
ATOM   4461 C  CB    . MET A 1 578 ? 32.892 39.536 39.112  1.00 19.36  ? 578  MET A CB    1 
ATOM   4462 C  CG    . MET A 1 578 ? 33.329 40.895 39.682  1.00 42.43  ? 578  MET A CG    1 
ATOM   4463 S  SD    . MET A 1 578 ? 35.083 41.105 40.122  1.00 29.81  ? 578  MET A SD    1 
ATOM   4464 C  CE    . MET A 1 578 ? 35.618 39.437 40.575  1.00 100.00 ? 578  MET A CE    1 
ATOM   4465 N  N     . TYR A 1 579 ? 34.417 37.172 37.302  1.00 14.76  ? 579  TYR A N     1 
ATOM   4466 C  CA    . TYR A 1 579 ? 34.529 35.748 37.061  1.00 9.15   ? 579  TYR A CA    1 
ATOM   4467 C  C     . TYR A 1 579 ? 35.029 35.058 38.297  1.00 11.80  ? 579  TYR A C     1 
ATOM   4468 O  O     . TYR A 1 579 ? 35.723 35.626 39.079  1.00 25.43  ? 579  TYR A O     1 
ATOM   4469 C  CB    . TYR A 1 579 ? 35.591 35.494 35.968  1.00 12.37  ? 579  TYR A CB    1 
ATOM   4470 C  CG    . TYR A 1 579 ? 35.217 36.128 34.622  1.00 12.46  ? 579  TYR A CG    1 
ATOM   4471 C  CD1   . TYR A 1 579 ? 34.369 35.438 33.744  1.00 15.76  ? 579  TYR A CD1   1 
ATOM   4472 C  CD2   . TYR A 1 579 ? 35.668 37.415 34.288  1.00 13.58  ? 579  TYR A CD2   1 
ATOM   4473 C  CE1   . TYR A 1 579 ? 33.979 36.016 32.531  1.00 7.56   ? 579  TYR A CE1   1 
ATOM   4474 C  CE2   . TYR A 1 579 ? 35.351 37.966 33.048  1.00 13.15  ? 579  TYR A CE2   1 
ATOM   4475 C  CZ    . TYR A 1 579 ? 34.493 37.265 32.186  1.00 12.72  ? 579  TYR A CZ    1 
ATOM   4476 O  OH    . TYR A 1 579 ? 34.117 37.824 30.963  1.00 14.86  ? 579  TYR A OH    1 
ATOM   4477 N  N     . GLU A 1 580 ? 34.596 33.849 38.423  1.00 12.88  ? 580  GLU A N     1 
ATOM   4478 C  CA    . GLU A 1 580 ? 34.838 32.951 39.492  1.00 15.73  ? 580  GLU A CA    1 
ATOM   4479 C  C     . GLU A 1 580 ? 35.661 31.874 38.849  1.00 25.52  ? 580  GLU A C     1 
ATOM   4480 O  O     . GLU A 1 580 ? 35.393 31.455 37.721  1.00 32.80  ? 580  GLU A O     1 
ATOM   4481 C  CB    . GLU A 1 580 ? 33.467 32.449 39.952  1.00 15.41  ? 580  GLU A CB    1 
ATOM   4482 C  CG    . GLU A 1 580 ? 33.540 31.043 40.484  1.00 38.82  ? 580  GLU A CG    1 
ATOM   4483 C  CD    . GLU A 1 580 ? 32.199 30.479 40.646  1.00 100.00 ? 580  GLU A CD    1 
ATOM   4484 O  OE1   . GLU A 1 580 ? 31.380 31.060 41.312  1.00 100.00 ? 580  GLU A OE1   1 
ATOM   4485 O  OE2   . GLU A 1 580 ? 32.006 29.333 40.003  1.00 53.64  ? 580  GLU A OE2   1 
ATOM   4486 N  N     . ILE A 1 581 ? 36.657 31.441 39.586  1.00 21.98  ? 581  ILE A N     1 
ATOM   4487 C  CA    . ILE A 1 581 ? 37.656 30.533 39.106  1.00 17.35  ? 581  ILE A CA    1 
ATOM   4488 C  C     . ILE A 1 581 ? 37.458 29.099 39.369  1.00 21.63  ? 581  ILE A C     1 
ATOM   4489 O  O     . ILE A 1 581 ? 38.235 28.276 38.887  1.00 16.24  ? 581  ILE A O     1 
ATOM   4490 C  CB    . ILE A 1 581 ? 38.943 31.012 39.778  1.00 61.27  ? 581  ILE A CB    1 
ATOM   4491 C  CG1   . ILE A 1 581 ? 40.070 30.810 38.807  1.00 39.24  ? 581  ILE A CG1   1 
ATOM   4492 C  CG2   . ILE A 1 581 ? 39.213 30.512 41.236  1.00 21.14  ? 581  ILE A CG2   1 
ATOM   4493 C  CD1   . ILE A 1 581 ? 40.138 32.023 37.874  1.00 28.21  ? 581  ILE A CD1   1 
ATOM   4494 N  N     . GLN A 1 582 ? 36.419 28.754 40.113  1.00 12.64  ? 582  GLN A N     1 
ATOM   4495 C  CA    . GLN A 1 582 ? 36.305 27.329 40.420  1.00 12.87  ? 582  GLN A CA    1 
ATOM   4496 C  C     . GLN A 1 582 ? 36.261 26.463 39.242  1.00 24.80  ? 582  GLN A C     1 
ATOM   4497 O  O     . GLN A 1 582 ? 35.490 26.739 38.306  1.00 23.49  ? 582  GLN A O     1 
ATOM   4498 C  CB    . GLN A 1 582 ? 35.074 26.959 41.307  1.00 19.20  ? 582  GLN A CB    1 
ATOM   4499 C  CG    . GLN A 1 582 ? 35.182 27.573 42.697  1.00 100.00 ? 582  GLN A CG    1 
ATOM   4500 C  CD    . GLN A 1 582 ? 34.841 29.065 43.015  1.00 100.00 ? 582  GLN A CD    1 
ATOM   4501 O  OE1   . GLN A 1 582 ? 35.217 30.050 42.263  1.00 14.36  ? 582  GLN A OE1   1 
ATOM   4502 N  NE2   . GLN A 1 582 ? 34.177 29.205 44.188  1.00 31.24  ? 582  GLN A NE2   1 
ATOM   4503 N  N     . ASP A 1 583 ? 37.013 25.369 39.366  1.00 18.98  ? 583  ASP A N     1 
ATOM   4504 C  CA    . ASP A 1 583 ? 37.131 24.285 38.371  1.00 17.55  ? 583  ASP A CA    1 
ATOM   4505 C  C     . ASP A 1 583 ? 37.806 24.646 37.027  1.00 13.37  ? 583  ASP A C     1 
ATOM   4506 O  O     . ASP A 1 583 ? 37.730 23.817 36.132  1.00 25.29  ? 583  ASP A O     1 
ATOM   4507 C  CB    . ASP A 1 583 ? 35.741 23.700 37.989  1.00 23.33  ? 583  ASP A CB    1 
ATOM   4508 C  CG    . ASP A 1 583 ? 34.991 23.213 39.185  1.00 35.70  ? 583  ASP A CG    1 
ATOM   4509 O  OD1   . ASP A 1 583 ? 35.689 22.365 39.888  1.00 33.69  ? 583  ASP A OD1   1 
ATOM   4510 O  OD2   . ASP A 1 583 ? 33.872 23.609 39.484  1.00 47.60  ? 583  ASP A OD2   1 
ATOM   4511 N  N     . TRP A 1 584 ? 38.342 25.850 36.857  1.00 21.34  ? 584  TRP A N     1 
ATOM   4512 C  CA    . TRP A 1 584 ? 38.906 26.195 35.580  1.00 19.18  ? 584  TRP A CA    1 
ATOM   4513 C  C     . TRP A 1 584 ? 39.924 25.217 35.078  1.00 25.41  ? 584  TRP A C     1 
ATOM   4514 O  O     . TRP A 1 584 ? 39.954 24.922 33.901  1.00 22.12  ? 584  TRP A O     1 
ATOM   4515 C  CB    . TRP A 1 584 ? 39.421 27.628 35.543  1.00 16.36  ? 584  TRP A CB    1 
ATOM   4516 C  CG    . TRP A 1 584 ? 38.273 28.620 35.473  1.00 15.46  ? 584  TRP A CG    1 
ATOM   4517 C  CD1   . TRP A 1 584 ? 37.010 28.433 35.915  1.00 14.74  ? 584  TRP A CD1   1 
ATOM   4518 C  CD2   . TRP A 1 584 ? 38.293 29.910 34.956  1.00 13.77  ? 584  TRP A CD2   1 
ATOM   4519 N  NE1   . TRP A 1 584 ? 36.268 29.558 35.726  1.00 13.29  ? 584  TRP A NE1   1 
ATOM   4520 C  CE2   . TRP A 1 584 ? 37.019 30.478 35.141  1.00 10.71  ? 584  TRP A CE2   1 
ATOM   4521 C  CE3   . TRP A 1 584 ? 39.282 30.655 34.328  1.00 20.47  ? 584  TRP A CE3   1 
ATOM   4522 C  CZ2   . TRP A 1 584 ? 36.691 31.752 34.763  1.00 11.71  ? 584  TRP A CZ2   1 
ATOM   4523 C  CZ3   . TRP A 1 584 ? 38.936 31.949 33.927  1.00 19.33  ? 584  TRP A CZ3   1 
ATOM   4524 C  CH2   . TRP A 1 584 ? 37.672 32.493 34.136  1.00 16.41  ? 584  TRP A CH2   1 
ATOM   4525 N  N     . LEU A 1 585 ? 40.788 24.719 35.990  1.00 19.98  ? 585  LEU A N     1 
ATOM   4526 C  CA    . LEU A 1 585 ? 41.823 23.794 35.582  1.00 19.71  ? 585  LEU A CA    1 
ATOM   4527 C  C     . LEU A 1 585 ? 41.262 22.575 34.915  1.00 28.92  ? 585  LEU A C     1 
ATOM   4528 O  O     . LEU A 1 585 ? 41.760 22.128 33.885  1.00 21.65  ? 585  LEU A O     1 
ATOM   4529 C  CB    . LEU A 1 585 ? 42.878 23.479 36.696  1.00 23.43  ? 585  LEU A CB    1 
ATOM   4530 C  CG    . LEU A 1 585 ? 43.540 24.714 37.410  1.00 22.74  ? 585  LEU A CG    1 
ATOM   4531 C  CD1   . LEU A 1 585 ? 44.151 24.345 38.785  1.00 30.21  ? 585  LEU A CD1   1 
ATOM   4532 C  CD2   . LEU A 1 585 ? 44.692 25.326 36.614  1.00 24.97  ? 585  LEU A CD2   1 
ATOM   4533 N  N     . GLU A 1 586 ? 40.204 22.038 35.531  1.00 20.92  ? 586  GLU A N     1 
ATOM   4534 C  CA    . GLU A 1 586 ? 39.504 20.868 35.067  1.00 21.50  ? 586  GLU A CA    1 
ATOM   4535 C  C     . GLU A 1 586 ? 38.854 21.156 33.753  1.00 18.39  ? 586  GLU A C     1 
ATOM   4536 O  O     . GLU A 1 586 ? 38.997 20.381 32.803  1.00 22.18  ? 586  GLU A O     1 
ATOM   4537 C  CB    . GLU A 1 586 ? 38.377 20.586 36.042  1.00 25.59  ? 586  GLU A CB    1 
ATOM   4538 C  CG    . GLU A 1 586 ? 37.714 19.275 35.632  1.00 23.91  ? 586  GLU A CG    1 
ATOM   4539 C  CD    . GLU A 1 586 ? 36.858 18.649 36.707  1.00 100.00 ? 586  GLU A CD    1 
ATOM   4540 O  OE1   . GLU A 1 586 ? 36.510 19.217 37.735  1.00 90.31  ? 586  GLU A OE1   1 
ATOM   4541 O  OE2   . GLU A 1 586 ? 36.541 17.416 36.375  1.00 61.61  ? 586  GLU A OE2   1 
ATOM   4542 N  N     . LYS A 1 587 ? 38.170 22.296 33.745  1.00 17.57  ? 587  LYS A N     1 
ATOM   4543 C  CA    . LYS A 1 587 ? 37.523 22.751 32.532  1.00 23.15  ? 587  LYS A CA    1 
ATOM   4544 C  C     . LYS A 1 587 ? 38.550 22.835 31.398  1.00 33.73  ? 587  LYS A C     1 
ATOM   4545 O  O     . LYS A 1 587 ? 38.260 22.474 30.246  1.00 25.32  ? 587  LYS A O     1 
ATOM   4546 C  CB    . LYS A 1 587 ? 36.868 24.132 32.640  1.00 18.69  ? 587  LYS A CB    1 
ATOM   4547 C  CG    . LYS A 1 587 ? 35.506 24.112 33.337  1.00 22.20  ? 587  LYS A CG    1 
ATOM   4548 C  CD    . LYS A 1 587 ? 35.060 25.459 33.924  1.00 16.16  ? 587  LYS A CD    1 
ATOM   4549 C  CE    . LYS A 1 587 ? 33.829 25.288 34.788  1.00 26.42  ? 587  LYS A CE    1 
ATOM   4550 N  NZ    . LYS A 1 587 ? 32.852 26.299 34.418  1.00 60.61  ? 587  LYS A NZ    1 
ATOM   4551 N  N     . ASN A 1 588 ? 39.727 23.347 31.743  1.00 24.21  ? 588  ASN A N     1 
ATOM   4552 C  CA    . ASN A 1 588 ? 40.785 23.575 30.767  1.00 28.29  ? 588  ASN A CA    1 
ATOM   4553 C  C     . ASN A 1 588 ? 41.334 22.302 30.202  1.00 28.23  ? 588  ASN A C     1 
ATOM   4554 O  O     . ASN A 1 588 ? 41.708 22.234 29.042  1.00 25.73  ? 588  ASN A O     1 
ATOM   4555 C  CB    . ASN A 1 588 ? 41.917 24.526 31.225  1.00 17.92  ? 588  ASN A CB    1 
ATOM   4556 C  CG    . ASN A 1 588 ? 42.679 25.117 30.042  1.00 33.10  ? 588  ASN A CG    1 
ATOM   4557 O  OD1   . ASN A 1 588 ? 42.091 25.515 29.013  1.00 27.22  ? 588  ASN A OD1   1 
ATOM   4558 N  ND2   . ASN A 1 588 ? 44.003 25.235 30.159  1.00 19.31  ? 588  ASN A ND2   1 
ATOM   4559 N  N     . LYS A 1 589 ? 41.381 21.282 31.021  1.00 25.73  ? 589  LYS A N     1 
ATOM   4560 C  CA    . LYS A 1 589 ? 41.911 20.008 30.578  1.00 21.52  ? 589  LYS A CA    1 
ATOM   4561 C  C     . LYS A 1 589 ? 40.810 19.105 30.004  1.00 32.14  ? 589  LYS A C     1 
ATOM   4562 O  O     . LYS A 1 589 ? 41.064 18.293 29.114  1.00 28.46  ? 589  LYS A O     1 
ATOM   4563 C  CB    . LYS A 1 589 ? 42.626 19.255 31.742  1.00 26.90  ? 589  LYS A CB    1 
ATOM   4564 C  CG    . LYS A 1 589 ? 43.638 20.027 32.640  1.00 58.58  ? 589  LYS A CG    1 
ATOM   4565 C  CD    . LYS A 1 589 ? 44.110 19.260 33.927  1.00 34.52  ? 589  LYS A CD    1 
ATOM   4566 C  CE    . LYS A 1 589 ? 45.407 19.756 34.606  1.00 84.81  ? 589  LYS A CE    1 
ATOM   4567 N  NZ    . LYS A 1 589 ? 45.221 20.328 35.969  1.00 81.31  ? 589  LYS A NZ    1 
ATOM   4568 N  N     . ASP A 1 590 ? 39.594 19.221 30.544  1.00 18.21  ? 590  ASP A N     1 
ATOM   4569 C  CA    . ASP A 1 590 ? 38.495 18.406 30.112  1.00 22.87  ? 590  ASP A CA    1 
ATOM   4570 C  C     . ASP A 1 590 ? 38.841 16.911 30.106  1.00 42.04  ? 590  ASP A C     1 
ATOM   4571 O  O     . ASP A 1 590 ? 38.621 16.156 29.129  1.00 27.69  ? 590  ASP A O     1 
ATOM   4572 C  CB    . ASP A 1 590 ? 37.998 18.894 28.761  1.00 34.31  ? 590  ASP A CB    1 
ATOM   4573 C  CG    . ASP A 1 590 ? 36.649 18.356 28.460  1.00 34.36  ? 590  ASP A CG    1 
ATOM   4574 O  OD1   . ASP A 1 590 ? 35.917 18.259 29.557  1.00 34.24  ? 590  ASP A OD1   1 
ATOM   4575 O  OD2   . ASP A 1 590 ? 36.305 18.034 27.327  1.00 32.44  ? 590  ASP A OD2   1 
ATOM   4576 N  N     . PRO A 1 591 ? 39.396 16.474 31.228  1.00 31.58  ? 591  PRO A N     1 
ATOM   4577 C  CA    . PRO A 1 591 ? 39.864 15.105 31.424  1.00 29.88  ? 591  PRO A CA    1 
ATOM   4578 C  C     . PRO A 1 591 ? 38.831 13.970 31.341  1.00 42.15  ? 591  PRO A C     1 
ATOM   4579 O  O     . PRO A 1 591 ? 37.686 14.085 31.749  1.00 27.54  ? 591  PRO A O     1 
ATOM   4580 C  CB    . PRO A 1 591 ? 40.441 15.103 32.829  1.00 23.71  ? 591  PRO A CB    1 
ATOM   4581 C  CG    . PRO A 1 591 ? 39.753 16.239 33.534  1.00 21.69  ? 591  PRO A CG    1 
ATOM   4582 C  CD    . PRO A 1 591 ? 39.143 17.149 32.507  1.00 27.81  ? 591  PRO A CD    1 
ATOM   4583 N  N     . LEU A 1 592 ? 39.271 12.836 30.812  1.00 23.07  ? 592  LEU A N     1 
ATOM   4584 C  CA    . LEU A 1 592 ? 38.534 11.595 30.762  1.00 20.39  ? 592  LEU A CA    1 
ATOM   4585 C  C     . LEU A 1 592 ? 39.535 10.474 31.013  1.00 32.90  ? 592  LEU A C     1 
ATOM   4586 O  O     . LEU A 1 592 ? 40.583 10.473 30.371  1.00 44.33  ? 592  LEU A O     1 
ATOM   4587 C  CB    . LEU A 1 592 ? 37.763 11.367 29.470  1.00 23.96  ? 592  LEU A CB    1 
ATOM   4588 C  CG    . LEU A 1 592 ? 36.972 10.042 29.453  1.00 27.95  ? 592  LEU A CG    1 
ATOM   4589 C  CD1   . LEU A 1 592 ? 35.793 10.088 30.414  1.00 23.82  ? 592  LEU A CD1   1 
ATOM   4590 C  CD2   . LEU A 1 592 ? 36.452 9.682  28.037  1.00 29.10  ? 592  LEU A CD2   1 
ATOM   4591 N  N     . GLN A 1 593 ? 39.264 9.541  31.943  1.00 26.05  ? 593  GLN A N     1 
ATOM   4592 C  CA    . GLN A 1 593 ? 40.197 8.479  32.237  1.00 29.86  ? 593  GLN A CA    1 
ATOM   4593 C  C     . GLN A 1 593 ? 40.564 7.657  31.009  1.00 44.39  ? 593  GLN A C     1 
ATOM   4594 O  O     . GLN A 1 593 ? 39.684 7.263  30.286  1.00 26.44  ? 593  GLN A O     1 
ATOM   4595 C  CB    . GLN A 1 593 ? 39.596 7.564  33.316  1.00 25.04  ? 593  GLN A CB    1 
ATOM   4596 C  CG    . GLN A 1 593 ? 39.852 8.087  34.761  1.00 32.56  ? 593  GLN A CG    1 
ATOM   4597 C  CD    . GLN A 1 593 ? 41.326 8.289  35.161  1.00 44.66  ? 593  GLN A CD    1 
ATOM   4598 O  OE1   . GLN A 1 593 ? 42.304 7.906  34.482  1.00 49.09  ? 593  GLN A OE1   1 
ATOM   4599 N  NE2   . GLN A 1 593 ? 41.500 8.929  36.290  1.00 27.04  ? 593  GLN A NE2   1 
ATOM   4600 N  N     . GLN A 1 594 ? 41.853 7.363  30.774  1.00 24.78  ? 594  GLN A N     1 
ATOM   4601 C  CA    . GLN A 1 594 ? 42.219 6.546  29.616  1.00 28.70  ? 594  GLN A CA    1 
ATOM   4602 C  C     . GLN A 1 594 ? 41.532 5.186  29.523  1.00 27.20  ? 594  GLN A C     1 
ATOM   4603 O  O     . GLN A 1 594 ? 41.191 4.713  28.433  1.00 40.56  ? 594  GLN A O     1 
ATOM   4604 C  CB    . GLN A 1 594 ? 43.739 6.414  29.466  1.00 44.40  ? 594  GLN A CB    1 
ATOM   4605 C  CG    . GLN A 1 594 ? 44.125 5.321  28.465  1.00 48.43  ? 594  GLN A CG    1 
ATOM   4606 C  CD    . GLN A 1 594 ? 44.130 5.828  27.041  1.00 100.00 ? 594  GLN A CD    1 
ATOM   4607 O  OE1   . GLN A 1 594 ? 44.015 5.035  26.086  1.00 93.51  ? 594  GLN A OE1   1 
ATOM   4608 N  NE2   . GLN A 1 594 ? 44.255 7.154  26.914  1.00 75.99  ? 594  GLN A NE2   1 
ATOM   4609 N  N     . ASP A 1 595 ? 41.325 4.525  30.668  1.00 36.98  ? 595  ASP A N     1 
ATOM   4610 C  CA    . ASP A 1 595 ? 40.624 3.251  30.651  1.00 20.41  ? 595  ASP A CA    1 
ATOM   4611 C  C     . ASP A 1 595 ? 39.218 3.484  30.196  1.00 39.79  ? 595  ASP A C     1 
ATOM   4612 O  O     . ASP A 1 595 ? 38.573 2.601  29.698  1.00 49.05  ? 595  ASP A O     1 
ATOM   4613 C  CB    . ASP A 1 595 ? 40.554 2.534  32.006  1.00 32.23  ? 595  ASP A CB    1 
ATOM   4614 C  CG    . ASP A 1 595 ? 41.878 1.931  32.378  1.00 40.75  ? 595  ASP A CG    1 
ATOM   4615 O  OD1   . ASP A 1 595 ? 42.814 2.170  31.507  1.00 38.83  ? 595  ASP A OD1   1 
ATOM   4616 O  OD2   . ASP A 1 595 ? 42.045 1.291  33.385  1.00 42.80  ? 595  ASP A OD2   1 
ATOM   4617 N  N     . LEU A 1 596 ? 38.707 4.685  30.374  1.00 34.89  ? 596  LEU A N     1 
ATOM   4618 C  CA    . LEU A 1 596 ? 37.382 4.834  29.870  1.00 45.39  ? 596  LEU A CA    1 
ATOM   4619 C  C     . LEU A 1 596 ? 37.428 4.894  28.331  1.00 39.96  ? 596  LEU A C     1 
ATOM   4620 O  O     . LEU A 1 596 ? 36.597 4.341  27.639  1.00 34.79  ? 596  LEU A O     1 
ATOM   4621 C  CB    . LEU A 1 596 ? 36.636 5.964  30.568  1.00 37.40  ? 596  LEU A CB    1 
ATOM   4622 C  CG    . LEU A 1 596 ? 36.190 5.530  31.938  1.00 22.92  ? 596  LEU A CG    1 
ATOM   4623 C  CD1   . LEU A 1 596 ? 36.004 6.771  32.771  1.00 38.07  ? 596  LEU A CD1   1 
ATOM   4624 C  CD2   . LEU A 1 596 ? 34.865 4.802  31.828  1.00 23.57  ? 596  LEU A CD2   1 
ATOM   4625 N  N     . GLU A 1 597 ? 38.443 5.546  27.804  1.00 23.70  ? 597  GLU A N     1 
ATOM   4626 C  CA    . GLU A 1 597 ? 38.674 5.637  26.373  1.00 43.43  ? 597  GLU A CA    1 
ATOM   4627 C  C     . GLU A 1 597 ? 38.876 4.263  25.775  1.00 41.85  ? 597  GLU A C     1 
ATOM   4628 O  O     . GLU A 1 597 ? 38.377 3.909  24.695  1.00 31.39  ? 597  GLU A O     1 
ATOM   4629 C  CB    . GLU A 1 597 ? 39.963 6.425  26.095  1.00 36.98  ? 597  GLU A CB    1 
ATOM   4630 C  CG    . GLU A 1 597 ? 39.859 7.905  26.504  1.00 47.81  ? 597  GLU A CG    1 
ATOM   4631 C  CD    . GLU A 1 597 ? 38.953 8.719  25.581  1.00 44.11  ? 597  GLU A CD    1 
ATOM   4632 O  OE1   . GLU A 1 597 ? 38.051 8.272  24.875  1.00 53.98  ? 597  GLU A OE1   1 
ATOM   4633 O  OE2   . GLU A 1 597 ? 39.253 9.976  25.619  1.00 40.84  ? 597  GLU A OE2   1 
ATOM   4634 N  N     . LEU A 1 598 ? 39.658 3.486  26.480  1.00 39.78  ? 598  LEU A N     1 
ATOM   4635 C  CA    . LEU A 1 598 ? 39.921 2.133  26.062  1.00 36.93  ? 598  LEU A CA    1 
ATOM   4636 C  C     . LEU A 1 598 ? 38.639 1.338  25.976  1.00 56.61  ? 598  LEU A C     1 
ATOM   4637 O  O     . LEU A 1 598 ? 38.344 0.703  24.963  1.00 37.36  ? 598  LEU A O     1 
ATOM   4638 C  CB    . LEU A 1 598 ? 40.849 1.459  27.067  1.00 25.63  ? 598  LEU A CB    1 
ATOM   4639 C  CG    . LEU A 1 598 ? 42.206 2.091  27.029  1.00 26.23  ? 598  LEU A CG    1 
ATOM   4640 C  CD1   . LEU A 1 598 ? 43.000 1.337  28.068  1.00 35.07  ? 598  LEU A CD1   1 
ATOM   4641 C  CD2   . LEU A 1 598 ? 42.810 2.002  25.639  1.00 28.05  ? 598  LEU A CD2   1 
ATOM   4642 N  N     . CYS A 1 599 ? 37.895 1.362  27.084  1.00 38.79  ? 599  CYS A N     1 
ATOM   4643 C  CA    . CYS A 1 599 ? 36.627 0.664  27.198  1.00 25.68  ? 599  CYS A CA    1 
ATOM   4644 C  C     . CYS A 1 599 ? 35.724 0.945  26.000  1.00 35.80  ? 599  CYS A C     1 
ATOM   4645 O  O     . CYS A 1 599 ? 35.261 0.068  25.288  1.00 47.91  ? 599  CYS A O     1 
ATOM   4646 C  CB    . CYS A 1 599 ? 35.947 1.061  28.505  1.00 41.89  ? 599  CYS A CB    1 
ATOM   4647 S  SG    . CYS A 1 599 ? 34.400 0.188  28.821  1.00 48.66  ? 599  CYS A SG    1 
ATOM   4648 N  N     . PHE A 1 600 ? 35.468 2.197  25.766  1.00 40.80  ? 600  PHE A N     1 
ATOM   4649 C  CA    . PHE A 1 600 ? 34.610 2.597  24.687  1.00 32.40  ? 600  PHE A CA    1 
ATOM   4650 C  C     . PHE A 1 600 ? 35.176 2.422  23.284  1.00 42.59  ? 600  PHE A C     1 
ATOM   4651 O  O     . PHE A 1 600 ? 34.438 2.307  22.305  1.00 43.51  ? 600  PHE A O     1 
ATOM   4652 C  CB    . PHE A 1 600 ? 34.174 4.048  24.951  1.00 38.23  ? 600  PHE A CB    1 
ATOM   4653 C  CG    . PHE A 1 600 ? 33.043 3.994  25.921  1.00 47.68  ? 600  PHE A CG    1 
ATOM   4654 C  CD1   . PHE A 1 600 ? 33.310 3.926  27.287  1.00 25.04  ? 600  PHE A CD1   1 
ATOM   4655 C  CD2   . PHE A 1 600 ? 31.719 3.914  25.473  1.00 37.96  ? 600  PHE A CD2   1 
ATOM   4656 C  CE1   . PHE A 1 600 ? 32.244 3.836  28.181  1.00 43.86  ? 600  PHE A CE1   1 
ATOM   4657 C  CE2   . PHE A 1 600 ? 30.643 3.807  26.358  1.00 56.78  ? 600  PHE A CE2   1 
ATOM   4658 C  CZ    . PHE A 1 600 ? 30.922 3.771  27.722  1.00 38.33  ? 600  PHE A CZ    1 
ATOM   4659 N  N     . LYS A 1 601 ? 36.497 2.443  23.152  1.00 33.03  ? 601  LYS A N     1 
ATOM   4660 C  CA    . LYS A 1 601 ? 37.071 2.299  21.824  1.00 41.42  ? 601  LYS A CA    1 
ATOM   4661 C  C     . LYS A 1 601 ? 36.645 0.985  21.142  1.00 44.85  ? 601  LYS A C     1 
ATOM   4662 O  O     . LYS A 1 601 ? 36.426 0.903  19.920  1.00 64.18  ? 601  LYS A O     1 
ATOM   4663 C  CB    . LYS A 1 601 ? 38.587 2.352  21.966  1.00 37.92  ? 601  LYS A CB    1 
ATOM   4664 C  CG    . LYS A 1 601 ? 39.170 3.752  21.833  1.00 37.07  ? 601  LYS A CG    1 
ATOM   4665 C  CD    . LYS A 1 601 ? 40.670 3.713  21.571  1.00 26.71  ? 601  LYS A CD    1 
ATOM   4666 C  CE    . LYS A 1 601 ? 41.339 5.072  21.589  1.00 62.91  ? 601  LYS A CE    1 
ATOM   4667 N  NZ    . LYS A 1 601 ? 42.782 5.027  21.873  1.00 57.54  ? 601  LYS A NZ    1 
ATOM   4668 N  N     . ASP A 1 602 ? 36.542 -0.029 22.004  1.00 52.56  ? 602  ASP A N     1 
ATOM   4669 C  CA    . ASP A 1 602 ? 36.205 -1.395 21.710  1.00 45.94  ? 602  ASP A CA    1 
ATOM   4670 C  C     . ASP A 1 602 ? 34.712 -1.601 21.393  1.00 68.55  ? 602  ASP A C     1 
ATOM   4671 O  O     . ASP A 1 602 ? 34.292 -2.652 20.909  1.00 85.52  ? 602  ASP A O     1 
ATOM   4672 C  CB    . ASP A 1 602 ? 36.724 -2.246 22.910  1.00 54.59  ? 602  ASP A CB    1 
ATOM   4673 C  CG    . ASP A 1 602 ? 36.758 -3.742 22.718  1.00 100.00 ? 602  ASP A CG    1 
ATOM   4674 O  OD1   . ASP A 1 602 ? 37.486 -4.276 21.886  1.00 100.00 ? 602  ASP A OD1   1 
ATOM   4675 O  OD2   . ASP A 1 602 ? 35.943 -4.406 23.547  1.00 100.00 ? 602  ASP A OD2   1 
ATOM   4676 N  N     . SER A 1 603 ? 33.918 -0.577 21.663  1.00 56.11  ? 603  SER A N     1 
ATOM   4677 C  CA    . SER A 1 603 ? 32.499 -0.650 21.436  1.00 51.65  ? 603  SER A CA    1 
ATOM   4678 C  C     . SER A 1 603 ? 32.153 -1.429 20.199  1.00 62.16  ? 603  SER A C     1 
ATOM   4679 O  O     . SER A 1 603 ? 32.735 -1.227 19.122  1.00 97.32  ? 603  SER A O     1 
ATOM   4680 C  CB    . SER A 1 603 ? 31.825 0.707  21.309  1.00 31.17  ? 603  SER A CB    1 
ATOM   4681 O  OG    . SER A 1 603 ? 30.421 0.503  21.357  1.00 34.17  ? 603  SER A OG    1 
ATOM   4682 N  N     . SER A 1 604 ? 31.181 -2.305 20.401  1.00 41.17  ? 604  SER A N     1 
ATOM   4683 C  CA    . SER A 1 604 ? 30.589 -3.082 19.339  1.00 70.02  ? 604  SER A CA    1 
ATOM   4684 C  C     . SER A 1 604 ? 29.837 -2.123 18.431  1.00 100.00 ? 604  SER A C     1 
ATOM   4685 O  O     . SER A 1 604 ? 29.704 -2.352 17.239  1.00 56.25  ? 604  SER A O     1 
ATOM   4686 C  CB    . SER A 1 604 ? 29.579 -4.073 19.894  1.00 40.83  ? 604  SER A CB    1 
ATOM   4687 O  OG    . SER A 1 604 ? 28.774 -3.427 20.868  1.00 100.00 ? 604  SER A OG    1 
ATOM   4688 N  N     . ASP A 1 605 ? 29.317 -1.038 19.022  1.00 70.52  ? 605  ASP A N     1 
ATOM   4689 C  CA    . ASP A 1 605 ? 28.560 -0.035 18.310  1.00 49.05  ? 605  ASP A CA    1 
ATOM   4690 C  C     . ASP A 1 605 ? 29.390 0.664  17.293  1.00 32.01  ? 605  ASP A C     1 
ATOM   4691 O  O     . ASP A 1 605 ? 30.498 1.140  17.556  1.00 43.66  ? 605  ASP A O     1 
ATOM   4692 C  CB    . ASP A 1 605 ? 27.885 1.029  19.165  1.00 49.86  ? 605  ASP A CB    1 
ATOM   4693 C  CG    . ASP A 1 605 ? 26.820 1.712  18.368  1.00 40.35  ? 605  ASP A CG    1 
ATOM   4694 O  OD1   . ASP A 1 605 ? 25.844 0.877  18.223  1.00 46.73  ? 605  ASP A OD1   1 
ATOM   4695 O  OD2   . ASP A 1 605 ? 26.857 2.875  17.900  1.00 33.63  ? 605  ASP A OD2   1 
ATOM   4696 N  N     . ASN A 1 606 ? 28.759 0.757  16.136  1.00 48.29  ? 606  ASN A N     1 
ATOM   4697 C  CA    . ASN A 1 606 ? 29.378 1.358  15.006  1.00 39.08  ? 606  ASN A CA    1 
ATOM   4698 C  C     . ASN A 1 606 ? 29.598 2.828  15.043  1.00 85.15  ? 606  ASN A C     1 
ATOM   4699 O  O     . ASN A 1 606 ? 30.571 3.370  14.486  1.00 42.63  ? 606  ASN A O     1 
ATOM   4700 C  CB    . ASN A 1 606 ? 29.098 0.682  13.681  1.00 99.45  ? 606  ASN A CB    1 
ATOM   4701 C  CG    . ASN A 1 606 ? 29.938 -0.586 13.694  1.00 100.00 ? 606  ASN A CG    1 
ATOM   4702 O  OD1   . ASN A 1 606 ? 29.427 -1.711 13.494  1.00 100.00 ? 606  ASN A OD1   1 
ATOM   4703 N  ND2   . ASN A 1 606 ? 31.254 -0.423 13.986  1.00 100.00 ? 606  ASN A ND2   1 
ATOM   4704 N  N     . VAL A 1 607 ? 28.689 3.460  15.752  1.00 55.38  ? 607  VAL A N     1 
ATOM   4705 C  CA    . VAL A 1 607 ? 28.777 4.875  15.919  1.00 39.86  ? 607  VAL A CA    1 
ATOM   4706 C  C     . VAL A 1 607 ? 29.650 5.166  17.112  1.00 44.07  ? 607  VAL A C     1 
ATOM   4707 O  O     . VAL A 1 607 ? 30.560 6.009  17.036  1.00 36.74  ? 607  VAL A O     1 
ATOM   4708 C  CB    . VAL A 1 607 ? 27.440 5.513  16.010  1.00 47.98  ? 607  VAL A CB    1 
ATOM   4709 C  CG1   . VAL A 1 607 ? 27.674 7.002  16.113  1.00 67.45  ? 607  VAL A CG1   1 
ATOM   4710 C  CG2   . VAL A 1 607 ? 26.687 5.197  14.727  1.00 39.30  ? 607  VAL A CG2   1 
ATOM   4711 N  N     . VAL A 1 608 ? 29.474 4.372  18.167  1.00 34.75  ? 608  VAL A N     1 
ATOM   4712 C  CA    . VAL A 1 608 ? 30.317 4.576  19.320  1.00 36.90  ? 608  VAL A CA    1 
ATOM   4713 C  C     . VAL A 1 608 ? 31.771 4.497  18.983  1.00 43.11  ? 608  VAL A C     1 
ATOM   4714 O  O     . VAL A 1 608 ? 32.623 5.245  19.478  1.00 37.22  ? 608  VAL A O     1 
ATOM   4715 C  CB    . VAL A 1 608 ? 29.960 3.724  20.505  1.00 47.78  ? 608  VAL A CB    1 
ATOM   4716 C  CG1   . VAL A 1 608 ? 30.868 4.078  21.671  1.00 33.69  ? 608  VAL A CG1   1 
ATOM   4717 C  CG2   . VAL A 1 608 ? 28.527 4.047  20.881  1.00 41.10  ? 608  VAL A CG2   1 
ATOM   4718 N  N     . THR A 1 609 ? 32.042 3.535  18.163  1.00 43.57  ? 609  THR A N     1 
ATOM   4719 C  CA    . THR A 1 609 ? 33.383 3.332  17.749  1.00 32.70  ? 609  THR A CA    1 
ATOM   4720 C  C     . THR A 1 609 ? 33.953 4.626  17.176  1.00 28.55  ? 609  THR A C     1 
ATOM   4721 O  O     . THR A 1 609 ? 35.083 5.063  17.493  1.00 48.94  ? 609  THR A O     1 
ATOM   4722 C  CB    . THR A 1 609 ? 33.371 2.169  16.760  1.00 40.77  ? 609  THR A CB    1 
ATOM   4723 O  OG1   . THR A 1 609 ? 33.625 0.984  17.502  1.00 69.64  ? 609  THR A OG1   1 
ATOM   4724 C  CG2   . THR A 1 609 ? 34.456 2.423  15.731  1.00 75.41  ? 609  THR A CG2   1 
ATOM   4725 N  N     . LYS A 1 610 ? 33.129 5.334  16.394  1.00 38.43  ? 610  LYS A N     1 
ATOM   4726 C  CA    . LYS A 1 610 ? 33.616 6.584  15.832  1.00 41.52  ? 610  LYS A CA    1 
ATOM   4727 C  C     . LYS A 1 610 ? 34.037 7.653  16.844  1.00 46.79  ? 610  LYS A C     1 
ATOM   4728 O  O     . LYS A 1 610 ? 35.133 8.220  16.765  1.00 30.57  ? 610  LYS A O     1 
ATOM   4729 C  CB    . LYS A 1 610 ? 32.742 7.126  14.719  1.00 29.45  ? 610  LYS A CB    1 
ATOM   4730 C  CG    . LYS A 1 610 ? 32.826 6.234  13.467  1.00 62.17  ? 610  LYS A CG    1 
ATOM   4731 C  CD    . LYS A 1 610 ? 33.932 6.581  12.452  1.00 100.00 ? 610  LYS A CD    1 
ATOM   4732 C  CE    . LYS A 1 610 ? 34.687 7.879  12.739  1.00 100.00 ? 610  LYS A CE    1 
ATOM   4733 N  NZ    . LYS A 1 610 ? 34.454 8.944  11.747  1.00 68.79  ? 610  LYS A NZ    1 
ATOM   4734 N  N     . LEU A 1 611 ? 33.117 7.921  17.763  1.00 55.09  ? 611  LEU A N     1 
ATOM   4735 C  CA    . LEU A 1 611 ? 33.313 8.896  18.824  1.00 33.44  ? 611  LEU A CA    1 
ATOM   4736 C  C     . LEU A 1 611 ? 34.645 8.706  19.531  1.00 21.43  ? 611  LEU A C     1 
ATOM   4737 O  O     . LEU A 1 611 ? 35.231 9.660  20.004  1.00 29.85  ? 611  LEU A O     1 
ATOM   4738 C  CB    . LEU A 1 611 ? 32.161 8.787  19.822  1.00 18.24  ? 611  LEU A CB    1 
ATOM   4739 C  CG    . LEU A 1 611 ? 30.826 8.911  19.134  1.00 18.26  ? 611  LEU A CG    1 
ATOM   4740 C  CD1   . LEU A 1 611 ? 29.804 9.264  20.214  1.00 25.34  ? 611  LEU A CD1   1 
ATOM   4741 C  CD2   . LEU A 1 611 ? 30.899 10.015 18.085  1.00 26.70  ? 611  LEU A CD2   1 
ATOM   4742 N  N     . PHE A 1 612 ? 35.129 7.447  19.615  1.00 32.83  ? 612  PHE A N     1 
ATOM   4743 C  CA    . PHE A 1 612 ? 36.382 7.198  20.325  1.00 36.00  ? 612  PHE A CA    1 
ATOM   4744 C  C     . PHE A 1 612 ? 37.516 6.844  19.440  1.00 72.27  ? 612  PHE A C     1 
ATOM   4745 O  O     . PHE A 1 612 ? 38.648 6.954  19.862  1.00 35.11  ? 612  PHE A O     1 
ATOM   4746 C  CB    . PHE A 1 612 ? 36.344 6.114  21.421  1.00 22.29  ? 612  PHE A CB    1 
ATOM   4747 C  CG    . PHE A 1 612 ? 35.417 6.517  22.507  1.00 25.27  ? 612  PHE A CG    1 
ATOM   4748 C  CD1   . PHE A 1 612 ? 34.040 6.429  22.305  1.00 27.81  ? 612  PHE A CD1   1 
ATOM   4749 C  CD2   . PHE A 1 612 ? 35.897 7.135  23.665  1.00 47.25  ? 612  PHE A CD2   1 
ATOM   4750 C  CE1   . PHE A 1 612 ? 33.142 6.889  23.271  1.00 33.09  ? 612  PHE A CE1   1 
ATOM   4751 C  CE2   . PHE A 1 612 ? 35.010 7.592  24.650  1.00 43.02  ? 612  PHE A CE2   1 
ATOM   4752 C  CZ    . PHE A 1 612 ? 33.635 7.457  24.449  1.00 38.52  ? 612  PHE A CZ    1 
ATOM   4753 N  N     . ASN A 1 613 ? 37.230 6.385  18.244  1.00 42.51  ? 613  ASN A N     1 
ATOM   4754 C  CA    . ASN A 1 613 ? 38.332 5.987  17.409  1.00 57.13  ? 613  ASN A CA    1 
ATOM   4755 C  C     . ASN A 1 613 ? 38.884 7.053  16.454  1.00 40.77  ? 613  ASN A C     1 
ATOM   4756 O  O     . ASN A 1 613 ? 40.021 6.943  16.012  1.00 100.00 ? 613  ASN A O     1 
ATOM   4757 C  CB    . ASN A 1 613 ? 38.120 4.568  16.824  1.00 44.47  ? 613  ASN A CB    1 
ATOM   4758 C  CG    . ASN A 1 613 ? 38.326 3.458  17.869  1.00 23.56  ? 613  ASN A CG    1 
ATOM   4759 O  OD1   . ASN A 1 613 ? 37.367 2.808  18.344  1.00 48.69  ? 613  ASN A OD1   1 
ATOM   4760 N  ND2   . ASN A 1 613 ? 39.599 3.257  18.260  1.00 36.74  ? 613  ASN A ND2   1 
ATOM   4761 N  N     . ASP A 1 614 ? 38.078 8.101  16.189  1.00 56.32  ? 614  ASP A N     1 
ATOM   4762 C  CA    . ASP A 1 614 ? 38.451 9.202  15.304  1.00 34.73  ? 614  ASP A CA    1 
ATOM   4763 C  C     . ASP A 1 614 ? 39.075 10.454 16.008  1.00 32.38  ? 614  ASP A C     1 
ATOM   4764 O  O     . ASP A 1 614 ? 38.426 11.229 16.671  1.00 38.32  ? 614  ASP A O     1 
ATOM   4765 C  CB    . ASP A 1 614 ? 37.254 9.540  14.409  1.00 22.52  ? 614  ASP A CB    1 
ATOM   4766 C  CG    . ASP A 1 614 ? 37.559 10.677 13.467  1.00 41.01  ? 614  ASP A CG    1 
ATOM   4767 O  OD1   . ASP A 1 614 ? 38.636 11.261 13.383  1.00 45.71  ? 614  ASP A OD1   1 
ATOM   4768 O  OD2   . ASP A 1 614 ? 36.525 10.963 12.716  1.00 47.53  ? 614  ASP A OD2   1 
ATOM   4769 N  N     . PRO A 1 615 ? 40.365 10.683 15.843  1.00 41.13  ? 615  PRO A N     1 
ATOM   4770 C  CA    . PRO A 1 615 ? 41.032 11.784 16.495  1.00 43.09  ? 615  PRO A CA    1 
ATOM   4771 C  C     . PRO A 1 615 ? 40.391 13.091 16.192  1.00 32.30  ? 615  PRO A C     1 
ATOM   4772 O  O     . PRO A 1 615 ? 40.705 14.113 16.815  1.00 43.36  ? 615  PRO A O     1 
ATOM   4773 C  CB    . PRO A 1 615 ? 42.412 11.901 15.850  1.00 55.55  ? 615  PRO A CB    1 
ATOM   4774 C  CG    . PRO A 1 615 ? 42.313 11.189 14.512  1.00 69.75  ? 615  PRO A CG    1 
ATOM   4775 C  CD    . PRO A 1 615 ? 41.036 10.362 14.554  1.00 48.29  ? 615  PRO A CD    1 
ATOM   4776 N  N     . ASN A 1 616 ? 39.587 13.085 15.165  1.00 37.47  ? 616  ASN A N     1 
ATOM   4777 C  CA    . ASN A 1 616 ? 38.984 14.338 14.789  1.00 36.60  ? 616  ASN A CA    1 
ATOM   4778 C  C     . ASN A 1 616 ? 37.783 14.623 15.652  1.00 50.86  ? 616  ASN A C     1 
ATOM   4779 O  O     . ASN A 1 616 ? 37.283 15.746 15.754  1.00 33.45  ? 616  ASN A O     1 
ATOM   4780 C  CB    . ASN A 1 616 ? 38.692 14.393 13.300  1.00 38.96  ? 616  ASN A CB    1 
ATOM   4781 C  CG    . ASN A 1 616 ? 40.001 14.383 12.568  1.00 45.61  ? 616  ASN A CG    1 
ATOM   4782 O  OD1   . ASN A 1 616 ? 40.821 15.272 12.784  1.00 48.76  ? 616  ASN A OD1   1 
ATOM   4783 N  ND2   . ASN A 1 616 ? 40.219 13.357 11.739  1.00 100.00 ? 616  ASN A ND2   1 
ATOM   4784 N  N     . ILE A 1 617 ? 37.355 13.552 16.285  1.00 34.83  ? 617  ILE A N     1 
ATOM   4785 C  CA    . ILE A 1 617 ? 36.240 13.544 17.184  1.00 40.22  ? 617  ILE A CA    1 
ATOM   4786 C  C     . ILE A 1 617 ? 36.750 13.304 18.612  1.00 28.38  ? 617  ILE A C     1 
ATOM   4787 O  O     . ILE A 1 617 ? 36.460 14.054 19.526  1.00 31.09  ? 617  ILE A O     1 
ATOM   4788 C  CB    . ILE A 1 617 ? 35.118 12.567 16.726  1.00 26.04  ? 617  ILE A CB    1 
ATOM   4789 C  CG1   . ILE A 1 617 ? 34.389 13.160 15.510  1.00 31.49  ? 617  ILE A CG1   1 
ATOM   4790 C  CG2   . ILE A 1 617 ? 34.047 12.292 17.784  1.00 33.98  ? 617  ILE A CG2   1 
ATOM   4791 C  CD1   . ILE A 1 617 ? 33.402 12.151 14.928  1.00 44.19  ? 617  ILE A CD1   1 
ATOM   4792 N  N     . ALA A 1 618 ? 37.555 12.303 18.788  1.00 26.17  ? 618  ALA A N     1 
ATOM   4793 C  CA    . ALA A 1 618 ? 38.024 11.957 20.084  1.00 39.54  ? 618  ALA A CA    1 
ATOM   4794 C  C     . ALA A 1 618 ? 38.988 12.913 20.729  1.00 31.96  ? 618  ALA A C     1 
ATOM   4795 O  O     . ALA A 1 618 ? 39.195 12.816 21.926  1.00 43.63  ? 618  ALA A O     1 
ATOM   4796 C  CB    . ALA A 1 618 ? 38.541 10.533 20.087  1.00 31.51  ? 618  ALA A CB    1 
ATOM   4797 N  N     . SER A 1 619 ? 39.612 13.803 19.968  1.00 46.58  ? 619  SER A N     1 
ATOM   4798 C  CA    . SER A 1 619 ? 40.636 14.688 20.537  1.00 46.15  ? 619  SER A CA    1 
ATOM   4799 C  C     . SER A 1 619 ? 40.673 16.085 19.994  1.00 79.47  ? 619  SER A C     1 
ATOM   4800 O  O     . SER A 1 619 ? 40.210 16.379 18.888  1.00 45.29  ? 619  SER A O     1 
ATOM   4801 C  CB    . SER A 1 619 ? 42.107 14.219 20.414  1.00 71.01  ? 619  SER A CB    1 
ATOM   4802 O  OG    . SER A 1 619 ? 42.277 12.826 20.252  1.00 46.90  ? 619  SER A OG    1 
ATOM   4803 N  N     . ARG A 1 620 ? 41.351 16.892 20.791  1.00 32.62  ? 620  ARG A N     1 
ATOM   4804 C  CA    . ARG A 1 620 ? 41.571 18.273 20.537  1.00 49.27  ? 620  ARG A CA    1 
ATOM   4805 C  C     . ARG A 1 620 ? 42.646 18.585 19.515  1.00 34.87  ? 620  ARG A C     1 
ATOM   4806 O  O     . ARG A 1 620 ? 42.561 19.573 18.801  1.00 75.04  ? 620  ARG A O     1 
ATOM   4807 C  CB    . ARG A 1 620 ? 41.681 19.129 21.807  1.00 31.45  ? 620  ARG A CB    1 
ATOM   4808 C  CG    . ARG A 1 620 ? 40.363 19.192 22.582  1.00 22.71  ? 620  ARG A CG    1 
ATOM   4809 C  CD    . ARG A 1 620 ? 40.355 20.270 23.693  1.00 26.94  ? 620  ARG A CD    1 
ATOM   4810 N  NE    . ARG A 1 620 ? 41.356 20.006 24.689  1.00 21.71  ? 620  ARG A NE    1 
ATOM   4811 C  CZ    . ARG A 1 620 ? 41.208 19.176 25.727  1.00 31.57  ? 620  ARG A CZ    1 
ATOM   4812 N  NH1   . ARG A 1 620 ? 40.088 18.513 25.967  1.00 33.61  ? 620  ARG A NH1   1 
ATOM   4813 N  NH2   . ARG A 1 620 ? 42.226 19.006 26.561  1.00 28.52  ? 620  ARG A NH2   1 
ATOM   4814 N  N     . ALA A 1 621 ? 43.669 17.808 19.406  1.00 83.73  ? 621  ALA A N     1 
ATOM   4815 C  CA    . ALA A 1 621 ? 44.606 18.272 18.423  1.00 70.63  ? 621  ALA A CA    1 
ATOM   4816 C  C     . ALA A 1 621 ? 44.884 17.228 17.323  1.00 100.00 ? 621  ALA A C     1 
ATOM   4817 O  O     . ALA A 1 621 ? 44.016 16.425 16.924  1.00 100.00 ? 621  ALA A O     1 
ATOM   4818 C  CB    . ALA A 1 621 ? 45.827 18.813 19.172  1.00 24.77  ? 621  ALA A CB    1 
ATOM   4819 N  N     . PHE A 1 627 ? 49.028 17.893 22.380  1.00 43.89  ? 627  PHE A N     1 
ATOM   4820 C  CA    . PHE A 1 627 ? 47.717 18.127 22.998  1.00 96.96  ? 627  PHE A CA    1 
ATOM   4821 C  C     . PHE A 1 627 ? 47.423 19.497 23.614  1.00 100.00 ? 627  PHE A C     1 
ATOM   4822 O  O     . PHE A 1 627 ? 47.937 19.909 24.657  1.00 100.00 ? 627  PHE A O     1 
ATOM   4823 C  CB    . PHE A 1 627 ? 47.028 16.964 23.691  1.00 96.76  ? 627  PHE A CB    1 
ATOM   4824 N  N     . LEU A 1 628 ? 46.496 20.123 22.909  1.00 38.96  ? 628  LEU A N     1 
ATOM   4825 C  CA    . LEU A 1 628 ? 45.889 21.446 23.025  1.00 26.98  ? 628  LEU A CA    1 
ATOM   4826 C  C     . LEU A 1 628 ? 44.999 21.629 24.252  1.00 17.52  ? 628  LEU A C     1 
ATOM   4827 O  O     . LEU A 1 628 ? 44.185 20.744 24.473  1.00 24.31  ? 628  LEU A O     1 
ATOM   4828 C  CB    . LEU A 1 628 ? 44.850 21.413 21.876  1.00 42.54  ? 628  LEU A CB    1 
ATOM   4829 C  CG    . LEU A 1 628 ? 44.485 22.808 21.589  1.00 35.47  ? 628  LEU A CG    1 
ATOM   4830 C  CD1   . LEU A 1 628 ? 45.813 23.512 21.637  1.00 40.80  ? 628  LEU A CD1   1 
ATOM   4831 C  CD2   . LEU A 1 628 ? 43.821 22.918 20.236  1.00 26.43  ? 628  LEU A CD2   1 
ATOM   4832 N  N     . THR A 1 629 ? 45.007 22.781 24.931  1.00 24.52  ? 629  THR A N     1 
ATOM   4833 C  CA    . THR A 1 629 ? 44.030 22.869 25.991  1.00 23.33  ? 629  THR A CA    1 
ATOM   4834 C  C     . THR A 1 629 ? 42.668 23.293 25.417  1.00 27.13  ? 629  THR A C     1 
ATOM   4835 O  O     . THR A 1 629 ? 42.519 23.663 24.228  1.00 23.18  ? 629  THR A O     1 
ATOM   4836 C  CB    . THR A 1 629 ? 44.409 23.938 26.993  1.00 20.41  ? 629  THR A CB    1 
ATOM   4837 O  OG1   . THR A 1 629 ? 44.585 25.122 26.286  1.00 18.09  ? 629  THR A OG1   1 
ATOM   4838 C  CG2   . THR A 1 629 ? 45.672 23.549 27.764  1.00 23.04  ? 629  THR A CG2   1 
ATOM   4839 N  N     . VAL A 1 630 ? 41.659 23.326 26.301  1.00 27.27  ? 630  VAL A N     1 
ATOM   4840 C  CA    . VAL A 1 630 ? 40.351 23.758 25.889  1.00 22.89  ? 630  VAL A CA    1 
ATOM   4841 C  C     . VAL A 1 630 ? 40.409 25.264 25.528  1.00 19.02  ? 630  VAL A C     1 
ATOM   4842 O  O     . VAL A 1 630 ? 39.856 25.761 24.507  1.00 19.56  ? 630  VAL A O     1 
ATOM   4843 C  CB    . VAL A 1 630 ? 39.258 23.352 26.909  1.00 17.62  ? 630  VAL A CB    1 
ATOM   4844 C  CG1   . VAL A 1 630 ? 37.980 24.076 26.595  1.00 36.75  ? 630  VAL A CG1   1 
ATOM   4845 C  CG2   . VAL A 1 630 ? 38.980 21.853 27.035  1.00 13.01  ? 630  VAL A CG2   1 
ATOM   4846 N  N     . ALA A 1 631 ? 41.172 26.036 26.322  1.00 14.22  ? 631  ALA A N     1 
ATOM   4847 C  CA    . ALA A 1 631 ? 41.368 27.483 26.036  1.00 14.77  ? 631  ALA A CA    1 
ATOM   4848 C  C     . ALA A 1 631 ? 42.103 27.763 24.723  1.00 24.90  ? 631  ALA A C     1 
ATOM   4849 O  O     . ALA A 1 631 ? 41.772 28.727 24.014  1.00 20.05  ? 631  ALA A O     1 
ATOM   4850 C  CB    . ALA A 1 631 ? 42.275 28.141 27.059  1.00 14.90  ? 631  ALA A CB    1 
ATOM   4851 N  N     . ALA A 1 632 ? 43.141 26.943 24.482  1.00 20.53  ? 632  ALA A N     1 
ATOM   4852 C  CA    . ALA A 1 632 ? 43.979 27.025 23.277  1.00 25.35  ? 632  ALA A CA    1 
ATOM   4853 C  C     . ALA A 1 632 ? 43.086 26.723 22.058  1.00 14.58  ? 632  ALA A C     1 
ATOM   4854 O  O     . ALA A 1 632 ? 43.139 27.427 21.041  1.00 23.01  ? 632  ALA A O     1 
ATOM   4855 C  CB    . ALA A 1 632 ? 45.144 26.041 23.355  1.00 18.03  ? 632  ALA A CB    1 
ATOM   4856 N  N     . GLN A 1 633 ? 42.272 25.665 22.198  1.00 16.25  ? 633  GLN A N     1 
ATOM   4857 C  CA    . GLN A 1 633 ? 41.341 25.330 21.131  1.00 19.92  ? 633  GLN A CA    1 
ATOM   4858 C  C     . GLN A 1 633 ? 40.351 26.461 20.857  1.00 29.95  ? 633  GLN A C     1 
ATOM   4859 O  O     . GLN A 1 633 ? 40.085 26.842 19.718  1.00 24.88  ? 633  GLN A O     1 
ATOM   4860 C  CB    . GLN A 1 633 ? 40.716 23.960 21.371  1.00 24.35  ? 633  GLN A CB    1 
ATOM   4861 C  CG    . GLN A 1 633 ? 39.518 23.699 20.436  1.00 27.50  ? 633  GLN A CG    1 
ATOM   4862 C  CD    . GLN A 1 633 ? 38.696 22.521 20.925  1.00 31.80  ? 633  GLN A CD    1 
ATOM   4863 O  OE1   . GLN A 1 633 ? 38.697 21.449 20.278  1.00 40.92  ? 633  GLN A OE1   1 
ATOM   4864 N  NE2   . GLN A 1 633 ? 38.015 22.665 22.088  1.00 32.49  ? 633  GLN A NE2   1 
ATOM   4865 N  N     . TYR A 1 634 ? 39.834 27.065 21.921  1.00 21.01  ? 634  TYR A N     1 
ATOM   4866 C  CA    . TYR A 1 634 ? 38.902 28.142 21.804  1.00 14.68  ? 634  TYR A CA    1 
ATOM   4867 C  C     . TYR A 1 634 ? 39.498 29.300 21.127  1.00 16.66  ? 634  TYR A C     1 
ATOM   4868 O  O     . TYR A 1 634 ? 38.848 29.976 20.316  1.00 18.88  ? 634  TYR A O     1 
ATOM   4869 C  CB    . TYR A 1 634 ? 38.263 28.650 23.173  1.00 14.34  ? 634  TYR A CB    1 
ATOM   4870 C  CG    . TYR A 1 634 ? 37.038 29.581 23.000  1.00 8.37   ? 634  TYR A CG    1 
ATOM   4871 C  CD1   . TYR A 1 634 ? 37.147 30.955 22.832  1.00 11.25  ? 634  TYR A CD1   1 
ATOM   4872 C  CD2   . TYR A 1 634 ? 35.764 29.005 22.993  1.00 19.93  ? 634  TYR A CD2   1 
ATOM   4873 C  CE1   . TYR A 1 634 ? 36.007 31.728 22.616  1.00 17.41  ? 634  TYR A CE1   1 
ATOM   4874 C  CE2   . TYR A 1 634 ? 34.606 29.741 22.790  1.00 12.83  ? 634  TYR A CE2   1 
ATOM   4875 C  CZ    . TYR A 1 634 ? 34.760 31.101 22.602  1.00 14.99  ? 634  TYR A CZ    1 
ATOM   4876 O  OH    . TYR A 1 634 ? 33.648 31.843 22.510  1.00 14.68  ? 634  TYR A OH    1 
ATOM   4877 N  N     . LYS A 1 635 ? 40.705 29.619 21.521  1.00 15.40  ? 635  LYS A N     1 
ATOM   4878 C  CA    . LYS A 1 635 ? 41.329 30.786 20.916  1.00 14.26  ? 635  LYS A CA    1 
ATOM   4879 C  C     . LYS A 1 635 ? 41.584 30.551 19.386  1.00 11.36  ? 635  LYS A C     1 
ATOM   4880 O  O     . LYS A 1 635 ? 41.521 31.450 18.562  1.00 19.12  ? 635  LYS A O     1 
ATOM   4881 C  CB    . LYS A 1 635 ? 42.695 30.901 21.586  1.00 13.92  ? 635  LYS A CB    1 
ATOM   4882 C  CG    . LYS A 1 635 ? 43.513 32.071 21.061  1.00 16.54  ? 635  LYS A CG    1 
ATOM   4883 C  CD    . LYS A 1 635 ? 44.714 32.313 21.984  1.00 29.52  ? 635  LYS A CD    1 
ATOM   4884 C  CE    . LYS A 1 635 ? 45.698 33.354 21.452  1.00 32.63  ? 635  LYS A CE    1 
ATOM   4885 N  NZ    . LYS A 1 635 ? 46.938 33.503 22.287  1.00 30.67  ? 635  LYS A NZ    1 
ATOM   4886 N  N     . GLU A 1 636 ? 41.944 29.326 19.114  1.00 13.94  ? 636  GLU A N     1 
ATOM   4887 C  CA    . GLU A 1 636 ? 42.265 28.945 17.771  1.00 18.36  ? 636  GLU A CA    1 
ATOM   4888 C  C     . GLU A 1 636 ? 41.049 29.055 16.906  1.00 18.41  ? 636  GLU A C     1 
ATOM   4889 O  O     . GLU A 1 636 ? 41.088 29.597 15.844  1.00 21.10  ? 636  GLU A O     1 
ATOM   4890 C  CB    . GLU A 1 636 ? 42.702 27.516 17.849  1.00 20.38  ? 636  GLU A CB    1 
ATOM   4891 C  CG    . GLU A 1 636 ? 43.274 26.903 16.566  1.00 79.77  ? 636  GLU A CG    1 
ATOM   4892 C  CD    . GLU A 1 636 ? 43.613 25.444 16.833  1.00 100.00 ? 636  GLU A CD    1 
ATOM   4893 O  OE1   . GLU A 1 636 ? 42.541 24.643 16.802  1.00 100.00 ? 636  GLU A OE1   1 
ATOM   4894 O  OE2   . GLU A 1 636 ? 44.763 25.049 17.089  1.00 92.56  ? 636  GLU A OE2   1 
ATOM   4895 N  N     . GLN A 1 637 ? 39.962 28.521 17.350  1.00 19.77  ? 637  GLN A N     1 
ATOM   4896 C  CA    . GLN A 1 637 ? 38.713 28.593 16.584  1.00 18.33  ? 637  GLN A CA    1 
ATOM   4897 C  C     . GLN A 1 637 ? 38.129 29.988 16.452  1.00 19.78  ? 637  GLN A C     1 
ATOM   4898 O  O     . GLN A 1 637 ? 37.380 30.300 15.534  1.00 23.63  ? 637  GLN A O     1 
ATOM   4899 C  CB    . GLN A 1 637 ? 37.661 27.586 17.100  1.00 17.61  ? 637  GLN A CB    1 
ATOM   4900 C  CG    . GLN A 1 637 ? 38.169 26.150 17.179  1.00 17.17  ? 637  GLN A CG    1 
ATOM   4901 C  CD    . GLN A 1 637 ? 37.170 25.091 17.661  1.00 20.16  ? 637  GLN A CD    1 
ATOM   4902 O  OE1   . GLN A 1 637 ? 36.211 25.351 18.402  1.00 38.34  ? 637  GLN A OE1   1 
ATOM   4903 N  NE2   . GLN A 1 637 ? 37.426 23.843 17.277  1.00 25.86  ? 637  GLN A NE2   1 
ATOM   4904 N  N     . LEU A 1 638 ? 38.397 30.855 17.395  1.00 22.25  ? 638  LEU A N     1 
ATOM   4905 C  CA    . LEU A 1 638 ? 37.876 32.173 17.323  1.00 19.24  ? 638  LEU A CA    1 
ATOM   4906 C  C     . LEU A 1 638 ? 38.690 32.890 16.238  1.00 16.61  ? 638  LEU A C     1 
ATOM   4907 O  O     . LEU A 1 638 ? 38.206 33.744 15.478  1.00 17.46  ? 638  LEU A O     1 
ATOM   4908 C  CB    . LEU A 1 638 ? 37.940 32.926 18.744  1.00 13.87  ? 638  LEU A CB    1 
ATOM   4909 C  CG    . LEU A 1 638 ? 37.695 34.437 18.702  1.00 15.88  ? 638  LEU A CG    1 
ATOM   4910 C  CD1   . LEU A 1 638 ? 36.334 34.812 18.081  1.00 15.17  ? 638  LEU A CD1   1 
ATOM   4911 C  CD2   . LEU A 1 638 ? 37.797 35.053 20.081  1.00 14.80  ? 638  LEU A CD2   1 
ATOM   4912 N  N     . ALA A 1 639 ? 39.985 32.628 16.232  1.00 17.39  ? 639  ALA A N     1 
ATOM   4913 C  CA    . ALA A 1 639 ? 40.842 33.277 15.228  1.00 26.64  ? 639  ALA A CA    1 
ATOM   4914 C  C     . ALA A 1 639 ? 40.429 32.855 13.758  1.00 11.66  ? 639  ALA A C     1 
ATOM   4915 O  O     . ALA A 1 639 ? 40.387 33.720 12.875  1.00 21.07  ? 639  ALA A O     1 
ATOM   4916 C  CB    . ALA A 1 639 ? 42.335 32.990 15.469  1.00 17.81  ? 639  ALA A CB    1 
ATOM   4917 N  N     . SER A 1 640 ? 40.136 31.579 13.538  1.00 16.30  ? 640  SER A N     1 
ATOM   4918 C  CA    . SER A 1 640 ? 39.727 31.196 12.183  1.00 18.71  ? 640  SER A CA    1 
ATOM   4919 C  C     . SER A 1 640 ? 38.447 31.875 11.826  1.00 23.38  ? 640  SER A C     1 
ATOM   4920 O  O     . SER A 1 640 ? 38.262 32.389 10.726  1.00 20.54  ? 640  SER A O     1 
ATOM   4921 C  CB    . SER A 1 640 ? 39.452 29.732 12.053  1.00 15.33  ? 640  SER A CB    1 
ATOM   4922 O  OG    . SER A 1 640 ? 40.221 29.026 12.964  1.00 45.33  ? 640  SER A OG    1 
ATOM   4923 N  N     . LEU A 1 641 ? 37.559 31.867 12.831  1.00 16.98  ? 641  LEU A N     1 
ATOM   4924 C  CA    . LEU A 1 641 ? 36.321 32.552 12.707  1.00 15.77  ? 641  LEU A CA    1 
ATOM   4925 C  C     . LEU A 1 641 ? 36.546 33.972 12.231  1.00 18.05  ? 641  LEU A C     1 
ATOM   4926 O  O     . LEU A 1 641 ? 36.012 34.416 11.228  1.00 18.88  ? 641  LEU A O     1 
ATOM   4927 C  CB    . LEU A 1 641 ? 35.371 32.419 13.965  1.00 12.14  ? 641  LEU A CB    1 
ATOM   4928 C  CG    . LEU A 1 641 ? 34.137 33.317 13.886  1.00 16.72  ? 641  LEU A CG    1 
ATOM   4929 C  CD1   . LEU A 1 641 ? 33.206 32.757 12.819  1.00 17.58  ? 641  LEU A CD1   1 
ATOM   4930 C  CD2   . LEU A 1 641 ? 33.366 33.261 15.215  1.00 12.76  ? 641  LEU A CD2   1 
ATOM   4931 N  N     . MET A 1 642 ? 37.264 34.748 12.968  1.00 13.26  ? 642  MET A N     1 
ATOM   4932 C  CA    . MET A 1 642 ? 37.415 36.079 12.585  1.00 8.72   ? 642  MET A CA    1 
ATOM   4933 C  C     . MET A 1 642 ? 38.104 36.174 11.239  1.00 27.29  ? 642  MET A C     1 
ATOM   4934 O  O     . MET A 1 642 ? 37.906 37.125 10.479  1.00 17.22  ? 642  MET A O     1 
ATOM   4935 C  CB    . MET A 1 642 ? 38.298 36.801 13.594  1.00 18.41  ? 642  MET A CB    1 
ATOM   4936 C  CG    . MET A 1 642 ? 37.673 36.816 14.971  1.00 27.76  ? 642  MET A CG    1 
ATOM   4937 S  SD    . MET A 1 642 ? 36.022 37.570 15.046  1.00 20.59  ? 642  MET A SD    1 
ATOM   4938 C  CE    . MET A 1 642 ? 36.249 39.178 14.340  1.00 14.70  ? 642  MET A CE    1 
ATOM   4939 N  N     . ALA A 1 643 ? 38.987 35.230 10.993  1.00 19.29  ? 643  ALA A N     1 
ATOM   4940 C  CA    . ALA A 1 643 ? 39.692 35.273 9.717   1.00 34.34  ? 643  ALA A CA    1 
ATOM   4941 C  C     . ALA A 1 643 ? 38.687 35.227 8.579   1.00 20.95  ? 643  ALA A C     1 
ATOM   4942 O  O     . ALA A 1 643 ? 38.732 36.030 7.669   1.00 26.53  ? 643  ALA A O     1 
ATOM   4943 C  CB    . ALA A 1 643 ? 40.580 34.079 9.598   1.00 17.48  ? 643  ALA A CB    1 
ATOM   4944 N  N     . THR A 1 644 ? 37.781 34.289 8.671   1.00 20.63  ? 644  THR A N     1 
ATOM   4945 C  CA    . THR A 1 644 ? 36.746 34.174 7.694   1.00 19.26  ? 644  THR A CA    1 
ATOM   4946 C  C     . THR A 1 644 ? 35.952 35.442 7.561   1.00 25.57  ? 644  THR A C     1 
ATOM   4947 O  O     . THR A 1 644 ? 35.743 36.005 6.512   1.00 24.60  ? 644  THR A O     1 
ATOM   4948 C  CB    . THR A 1 644 ? 35.866 33.065 8.144   1.00 26.58  ? 644  THR A CB    1 
ATOM   4949 O  OG1   . THR A 1 644 ? 36.671 31.939 8.102   1.00 19.64  ? 644  THR A OG1   1 
ATOM   4950 C  CG2   . THR A 1 644 ? 34.663 32.897 7.205   1.00 20.32  ? 644  THR A CG2   1 
ATOM   4951 N  N     . LEU A 1 645 ? 35.512 35.953 8.661   1.00 22.33  ? 645  LEU A N     1 
ATOM   4952 C  CA    . LEU A 1 645 ? 34.714 37.142 8.617   1.00 12.28  ? 645  LEU A CA    1 
ATOM   4953 C  C     . LEU A 1 645 ? 35.375 38.297 7.938   1.00 16.41  ? 645  LEU A C     1 
ATOM   4954 O  O     . LEU A 1 645 ? 34.710 39.092 7.338   1.00 18.05  ? 645  LEU A O     1 
ATOM   4955 C  CB    . LEU A 1 645 ? 34.237 37.567 10.035  1.00 15.28  ? 645  LEU A CB    1 
ATOM   4956 C  CG    . LEU A 1 645 ? 33.329 36.488 10.679  1.00 15.88  ? 645  LEU A CG    1 
ATOM   4957 C  CD1   . LEU A 1 645 ? 33.010 36.895 12.133  1.00 22.10  ? 645  LEU A CD1   1 
ATOM   4958 C  CD2   . LEU A 1 645 ? 31.973 36.376 9.930   1.00 13.12  ? 645  LEU A CD2   1 
ATOM   4959 N  N     . GLU A 1 646 ? 36.702 38.365 8.123   1.00 18.56  ? 646  GLU A N     1 
ATOM   4960 C  CA    . GLU A 1 646 ? 37.537 39.410 7.581   1.00 25.40  ? 646  GLU A CA    1 
ATOM   4961 C  C     . GLU A 1 646 ? 37.506 39.458 6.070   1.00 21.82  ? 646  GLU A C     1 
ATOM   4962 O  O     . GLU A 1 646 ? 37.724 40.544 5.474   1.00 35.53  ? 646  GLU A O     1 
ATOM   4963 C  CB    . GLU A 1 646 ? 38.949 39.596 8.219   1.00 21.75  ? 646  GLU A CB    1 
ATOM   4964 C  CG    . GLU A 1 646 ? 38.945 40.890 9.160   1.00 29.53  ? 646  GLU A CG    1 
ATOM   4965 C  CD    . GLU A 1 646 ? 39.008 40.478 10.631  1.00 84.39  ? 646  GLU A CD    1 
ATOM   4966 O  OE1   . GLU A 1 646 ? 38.482 39.283 10.835  1.00 100.00 ? 646  GLU A OE1   1 
ATOM   4967 O  OE2   . GLU A 1 646 ? 39.509 41.134 11.545  1.00 54.10  ? 646  GLU A OE2   1 
ATOM   4968 N  N     . THR A 1 647 ? 37.177 38.290 5.525   1.00 19.12  ? 647  THR A N     1 
ATOM   4969 C  CA    . THR A 1 647 ? 36.971 38.079 4.105   1.00 25.56  ? 647  THR A CA    1 
ATOM   4970 C  C     . THR A 1 647 ? 35.583 38.417 3.572   1.00 61.98  ? 647  THR A C     1 
ATOM   4971 O  O     . THR A 1 647 ? 35.398 38.301 2.362   1.00 30.12  ? 647  THR A O     1 
ATOM   4972 C  CB    . THR A 1 647 ? 37.199 36.622 3.722   1.00 18.56  ? 647  THR A CB    1 
ATOM   4973 O  OG1   . THR A 1 647 ? 36.182 35.701 4.045   1.00 23.76  ? 647  THR A OG1   1 
ATOM   4974 C  CG2   . THR A 1 647 ? 38.574 36.110 4.075   1.00 23.18  ? 647  THR A CG2   1 
ATOM   4975 N  N     . THR A 1 648 ? 34.605 38.763 4.423   1.00 28.23  ? 648  THR A N     1 
ATOM   4976 C  CA    . THR A 1 648 ? 33.283 38.992 3.920   1.00 12.62  ? 648  THR A CA    1 
ATOM   4977 C  C     . THR A 1 648 ? 32.904 40.395 4.023   1.00 11.91  ? 648  THR A C     1 
ATOM   4978 O  O     . THR A 1 648 ? 33.609 41.230 4.594   1.00 15.72  ? 648  THR A O     1 
ATOM   4979 C  CB    . THR A 1 648 ? 32.323 38.223 4.799   1.00 15.15  ? 648  THR A CB    1 
ATOM   4980 O  OG1   . THR A 1 648 ? 32.338 38.751 6.109   1.00 18.46  ? 648  THR A OG1   1 
ATOM   4981 C  CG2   . THR A 1 648 ? 32.771 36.817 4.870   1.00 9.52   ? 648  THR A CG2   1 
ATOM   4982 N  N     . ASN A 1 649 ? 31.730 40.700 3.425   1.00 16.12  ? 649  ASN A N     1 
ATOM   4983 C  CA    . ASN A 1 649 ? 31.159 42.006 3.617   1.00 18.07  ? 649  ASN A CA    1 
ATOM   4984 C  C     . ASN A 1 649 ? 30.141 41.747 4.786   1.00 18.35  ? 649  ASN A C     1 
ATOM   4985 O  O     . ASN A 1 649 ? 29.248 40.967 4.591   1.00 19.09  ? 649  ASN A O     1 
ATOM   4986 C  CB    . ASN A 1 649 ? 30.395 42.503 2.377   1.00 20.49  ? 649  ASN A CB    1 
ATOM   4987 C  CG    . ASN A 1 649 ? 29.561 43.740 2.669   1.00 19.92  ? 649  ASN A CG    1 
ATOM   4988 O  OD1   . ASN A 1 649 ? 29.974 44.628 3.422   1.00 25.10  ? 649  ASN A OD1   1 
ATOM   4989 N  ND2   . ASN A 1 649 ? 28.358 43.836 2.022   1.00 22.46  ? 649  ASN A ND2   1 
ATOM   4990 N  N     . PRO A 1 650 ? 30.312 42.270 6.017   1.00 21.64  ? 650  PRO A N     1 
ATOM   4991 C  CA    . PRO A 1 650 ? 29.431 41.917 7.104   1.00 23.97  ? 650  PRO A CA    1 
ATOM   4992 C  C     . PRO A 1 650 ? 28.158 42.738 7.236   1.00 12.19  ? 650  PRO A C     1 
ATOM   4993 O  O     . PRO A 1 650 ? 28.069 43.896 6.830   1.00 15.29  ? 650  PRO A O     1 
ATOM   4994 C  CB    . PRO A 1 650 ? 30.259 42.201 8.351   1.00 19.25  ? 650  PRO A CB    1 
ATOM   4995 C  CG    . PRO A 1 650 ? 31.077 43.438 7.992   1.00 16.16  ? 650  PRO A CG    1 
ATOM   4996 C  CD    . PRO A 1 650 ? 31.251 43.331 6.491   1.00 19.18  ? 650  PRO A CD    1 
ATOM   4997 N  N     . HIS A 1 651 ? 27.163 42.085 7.913   1.00 13.89  ? 651  HIS A N     1 
ATOM   4998 C  CA    . HIS A 1 651 ? 25.882 42.673 8.183   1.00 18.86  ? 651  HIS A CA    1 
ATOM   4999 C  C     . HIS A 1 651 ? 25.574 42.341 9.635   1.00 10.77  ? 651  HIS A C     1 
ATOM   5000 O  O     . HIS A 1 651 ? 25.678 41.200 10.031  1.00 17.51  ? 651  HIS A O     1 
ATOM   5001 C  CB    . HIS A 1 651 ? 24.716 42.103 7.268   1.00 17.17  ? 651  HIS A CB    1 
ATOM   5002 C  CG    . HIS A 1 651 ? 25.114 42.219 5.815   1.00 19.48  ? 651  HIS A CG    1 
ATOM   5003 N  ND1   . HIS A 1 651 ? 24.899 43.378 5.100   1.00 25.75  ? 651  HIS A ND1   1 
ATOM   5004 C  CD2   . HIS A 1 651 ? 25.848 41.360 5.021   1.00 20.29  ? 651  HIS A CD2   1 
ATOM   5005 C  CE1   . HIS A 1 651 ? 25.431 43.190 3.868   1.00 12.85  ? 651  HIS A CE1   1 
ATOM   5006 N  NE2   . HIS A 1 651 ? 26.021 41.997 3.801   1.00 16.11  ? 651  HIS A NE2   1 
ATOM   5007 N  N     . PHE A 1 652 ? 25.147 43.368 10.362  1.00 16.71  ? 652  PHE A N     1 
ATOM   5008 C  CA    . PHE A 1 652 ? 24.913 43.242 11.798  1.00 15.59  ? 652  PHE A CA    1 
ATOM   5009 C  C     . PHE A 1 652 ? 23.496 43.316 12.277  1.00 14.89  ? 652  PHE A C     1 
ATOM   5010 O  O     . PHE A 1 652 ? 22.877 44.345 12.148  1.00 16.25  ? 652  PHE A O     1 
ATOM   5011 C  CB    . PHE A 1 652 ? 25.701 44.383 12.512  1.00 13.94  ? 652  PHE A CB    1 
ATOM   5012 C  CG    . PHE A 1 652 ? 27.192 44.326 12.177  1.00 20.06  ? 652  PHE A CG    1 
ATOM   5013 C  CD1   . PHE A 1 652 ? 28.025 43.434 12.860  1.00 18.42  ? 652  PHE A CD1   1 
ATOM   5014 C  CD2   . PHE A 1 652 ? 27.731 45.109 11.145  1.00 31.37  ? 652  PHE A CD2   1 
ATOM   5015 C  CE1   . PHE A 1 652 ? 29.372 43.329 12.504  1.00 22.98  ? 652  PHE A CE1   1 
ATOM   5016 C  CE2   . PHE A 1 652 ? 29.086 45.051 10.795  1.00 23.40  ? 652  PHE A CE2   1 
ATOM   5017 C  CZ    . PHE A 1 652 ? 29.899 44.164 11.504  1.00 13.52  ? 652  PHE A CZ    1 
ATOM   5018 N  N     . VAL A 1 653 ? 23.102 42.242 12.926  1.00 18.33  ? 653  VAL A N     1 
ATOM   5019 C  CA    . VAL A 1 653 ? 21.786 42.170 13.553  1.00 23.93  ? 653  VAL A CA    1 
ATOM   5020 C  C     . VAL A 1 653 ? 21.921 42.071 15.129  1.00 14.77  ? 653  VAL A C     1 
ATOM   5021 O  O     . VAL A 1 653 ? 22.509 41.107 15.642  1.00 16.60  ? 653  VAL A O     1 
ATOM   5022 C  CB    . VAL A 1 653 ? 20.961 40.988 12.988  1.00 27.89  ? 653  VAL A CB    1 
ATOM   5023 C  CG1   . VAL A 1 653 ? 19.494 41.008 13.476  1.00 13.80  ? 653  VAL A CG1   1 
ATOM   5024 C  CG2   . VAL A 1 653 ? 21.019 40.906 11.441  1.00 21.56  ? 653  VAL A CG2   1 
ATOM   5025 N  N     . ARG A 1 654 ? 21.319 43.095 15.780  1.00 17.45  ? 654  ARG A N     1 
ATOM   5026 C  CA    . ARG A 1 654 ? 21.231 43.223 17.204  1.00 15.66  ? 654  ARG A CA    1 
ATOM   5027 C  C     . ARG A 1 654 ? 19.819 42.811 17.678  1.00 12.49  ? 654  ARG A C     1 
ATOM   5028 O  O     . ARG A 1 654 ? 18.881 43.575 17.608  1.00 17.52  ? 654  ARG A O     1 
ATOM   5029 C  CB    . ARG A 1 654 ? 21.497 44.654 17.605  1.00 10.76  ? 654  ARG A CB    1 
ATOM   5030 C  CG    . ARG A 1 654 ? 22.824 45.126 17.116  1.00 17.90  ? 654  ARG A CG    1 
ATOM   5031 C  CD    . ARG A 1 654 ? 23.735 43.942 17.255  1.00 22.65  ? 654  ARG A CD    1 
ATOM   5032 N  NE    . ARG A 1 654 ? 25.036 44.357 17.685  1.00 39.97  ? 654  ARG A NE    1 
ATOM   5033 C  CZ    . ARG A 1 654 ? 26.144 43.938 17.131  1.00 100.00 ? 654  ARG A CZ    1 
ATOM   5034 N  NH1   . ARG A 1 654 ? 26.117 43.055 16.152  1.00 38.77  ? 654  ARG A NH1   1 
ATOM   5035 N  NH2   . ARG A 1 654 ? 27.299 44.412 17.583  1.00 32.58  ? 654  ARG A NH2   1 
ATOM   5036 N  N     . CYS A 1 655 ? 19.689 41.629 18.161  1.00 13.40  ? 655  CYS A N     1 
ATOM   5037 C  CA    . CYS A 1 655 ? 18.407 41.130 18.753  1.00 13.88  ? 655  CYS A CA    1 
ATOM   5038 C  C     . CYS A 1 655 ? 18.332 41.529 20.203  1.00 24.04  ? 655  CYS A C     1 
ATOM   5039 O  O     . CYS A 1 655 ? 19.284 41.266 20.941  1.00 16.51  ? 655  CYS A O     1 
ATOM   5040 C  CB    . CYS A 1 655 ? 18.255 39.619 18.734  1.00 12.83  ? 655  CYS A CB    1 
ATOM   5041 S  SG    . CYS A 1 655 ? 18.196 39.022 16.995  1.00 19.55  ? 655  CYS A SG    1 
ATOM   5042 N  N     . ILE A 1 656 ? 17.177 42.134 20.583  1.00 19.17  ? 656  ILE A N     1 
ATOM   5043 C  CA    . ILE A 1 656 ? 16.843 42.724 21.917  1.00 21.82  ? 656  ILE A CA    1 
ATOM   5044 C  C     . ILE A 1 656 ? 15.667 42.039 22.582  1.00 25.59  ? 656  ILE A C     1 
ATOM   5045 O  O     . ILE A 1 656 ? 14.637 41.769 21.995  1.00 18.45  ? 656  ILE A O     1 
ATOM   5046 C  CB    . ILE A 1 656 ? 16.631 44.215 21.769  1.00 12.14  ? 656  ILE A CB    1 
ATOM   5047 C  CG1   . ILE A 1 656 ? 18.047 44.771 21.559  1.00 38.16  ? 656  ILE A CG1   1 
ATOM   5048 C  CG2   . ILE A 1 656 ? 16.118 44.879 23.032  1.00 14.25  ? 656  ILE A CG2   1 
ATOM   5049 C  CD1   . ILE A 1 656 ? 18.094 46.033 20.728  1.00 48.84  ? 656  ILE A CD1   1 
ATOM   5050 N  N     . ILE A 1 657 ? 15.865 41.651 23.802  1.00 16.74  ? 657  ILE A N     1 
ATOM   5051 C  CA    . ILE A 1 657 ? 14.775 41.069 24.597  1.00 19.72  ? 657  ILE A CA    1 
ATOM   5052 C  C     . ILE A 1 657 ? 14.003 42.289 25.229  1.00 13.11  ? 657  ILE A C     1 
ATOM   5053 O  O     . ILE A 1 657 ? 14.593 43.283 25.722  1.00 18.23  ? 657  ILE A O     1 
ATOM   5054 C  CB    . ILE A 1 657 ? 15.402 40.063 25.587  1.00 32.50  ? 657  ILE A CB    1 
ATOM   5055 C  CG1   . ILE A 1 657 ? 14.438 38.946 25.781  1.00 16.30  ? 657  ILE A CG1   1 
ATOM   5056 C  CG2   . ILE A 1 657 ? 15.950 40.683 26.919  1.00 18.05  ? 657  ILE A CG2   1 
ATOM   5057 C  CD1   . ILE A 1 657 ? 14.988 37.717 26.494  1.00 34.14  ? 657  ILE A CD1   1 
ATOM   5058 N  N     . PRO A 1 658 ? 12.642 42.343 25.149  1.00 24.21  ? 658  PRO A N     1 
ATOM   5059 C  CA    . PRO A 1 658 ? 11.968 43.530 25.678  1.00 17.63  ? 658  PRO A CA    1 
ATOM   5060 C  C     . PRO A 1 658 ? 11.830 43.595 27.248  1.00 12.00  ? 658  PRO A C     1 
ATOM   5061 O  O     . PRO A 1 658 ? 11.548 44.688 27.766  1.00 15.13  ? 658  PRO A O     1 
ATOM   5062 C  CB    . PRO A 1 658 ? 10.553 43.456 25.088  1.00 18.44  ? 658  PRO A CB    1 
ATOM   5063 C  CG    . PRO A 1 658 ? 10.285 41.993 24.828  1.00 13.32  ? 658  PRO A CG    1 
ATOM   5064 C  CD    . PRO A 1 658 ? 11.643 41.354 24.583  1.00 19.24  ? 658  PRO A CD    1 
ATOM   5065 N  N     . ASN A 1 659 ? 11.929 42.424 27.887  1.00 19.32  ? 659  ASN A N     1 
ATOM   5066 C  CA    . ASN A 1 659 ? 11.804 42.252 29.328  1.00 26.51  ? 659  ASN A CA    1 
ATOM   5067 C  C     . ASN A 1 659 ? 12.299 40.924 29.701  1.00 28.41  ? 659  ASN A C     1 
ATOM   5068 O  O     . ASN A 1 659 ? 12.608 40.061 28.850  1.00 20.51  ? 659  ASN A O     1 
ATOM   5069 C  CB    . ASN A 1 659 ? 10.301 42.261 29.738  1.00 18.46  ? 659  ASN A CB    1 
ATOM   5070 C  CG    . ASN A 1 659 ? 9.419  41.230 29.051  1.00 16.53  ? 659  ASN A CG    1 
ATOM   5071 O  OD1   . ASN A 1 659 ? 9.434  40.001 29.312  1.00 20.70  ? 659  ASN A OD1   1 
ATOM   5072 N  ND2   . ASN A 1 659 ? 8.580  41.768 28.163  1.00 20.64  ? 659  ASN A ND2   1 
ATOM   5073 N  N     . ASN A 1 660 ? 12.292 40.702 31.010  1.00 26.00  ? 660  ASN A N     1 
ATOM   5074 C  CA    . ASN A 1 660 ? 12.764 39.387 31.509  1.00 32.89  ? 660  ASN A CA    1 
ATOM   5075 C  C     . ASN A 1 660 ? 11.679 38.349 31.753  1.00 32.94  ? 660  ASN A C     1 
ATOM   5076 O  O     . ASN A 1 660 ? 11.890 37.301 32.358  1.00 32.63  ? 660  ASN A O     1 
ATOM   5077 C  CB    . ASN A 1 660 ? 13.703 39.542 32.733  1.00 22.34  ? 660  ASN A CB    1 
ATOM   5078 C  CG    . ASN A 1 660 ? 14.951 40.213 32.246  1.00 26.63  ? 660  ASN A CG    1 
ATOM   5079 O  OD1   . ASN A 1 660 ? 15.579 39.711 31.305  1.00 34.33  ? 660  ASN A OD1   1 
ATOM   5080 N  ND2   . ASN A 1 660 ? 15.286 41.357 32.809  1.00 26.06  ? 660  ASN A ND2   1 
ATOM   5081 N  N     . LYS A 1 661 ? 10.517 38.613 31.238  1.00 24.84  ? 661  LYS A N     1 
ATOM   5082 C  CA    . LYS A 1 661 ? 9.438  37.721 31.516  1.00 24.21  ? 661  LYS A CA    1 
ATOM   5083 C  C     . LYS A 1 661 ? 8.862  36.978 30.363  1.00 35.65  ? 661  LYS A C     1 
ATOM   5084 O  O     . LYS A 1 661 ? 7.854  36.282 30.529  1.00 27.34  ? 661  LYS A O     1 
ATOM   5085 C  CB    . LYS A 1 661 ? 8.335  38.506 32.229  1.00 42.95  ? 661  LYS A CB    1 
ATOM   5086 C  CG    . LYS A 1 661 ? 8.843  39.300 33.428  1.00 62.28  ? 661  LYS A CG    1 
ATOM   5087 C  CD    . LYS A 1 661 ? 8.328  40.717 33.587  1.00 47.60  ? 661  LYS A CD    1 
ATOM   5088 C  CE    . LYS A 1 661 ? 8.601  41.257 35.001  1.00 100.00 ? 661  LYS A CE    1 
ATOM   5089 N  NZ    . LYS A 1 661 ? 9.007  42.681 35.064  1.00 100.00 ? 661  LYS A NZ    1 
ATOM   5090 N  N     . GLN A 1 662 ? 9.439  37.096 29.199  1.00 25.34  ? 662  GLN A N     1 
ATOM   5091 C  CA    . GLN A 1 662 ? 8.795  36.357 28.142  1.00 21.56  ? 662  GLN A CA    1 
ATOM   5092 C  C     . GLN A 1 662 ? 7.360  36.827 27.795  1.00 19.55  ? 662  GLN A C     1 
ATOM   5093 O  O     . GLN A 1 662 ? 6.542  36.062 27.243  1.00 24.98  ? 662  GLN A O     1 
ATOM   5094 C  CB    . GLN A 1 662 ? 8.880  34.849 28.263  1.00 22.11  ? 662  GLN A CB    1 
ATOM   5095 C  CG    . GLN A 1 662 ? 10.326 34.417 28.529  1.00 24.15  ? 662  GLN A CG    1 
ATOM   5096 C  CD    . GLN A 1 662 ? 10.494 32.937 28.623  1.00 29.99  ? 662  GLN A CD    1 
ATOM   5097 O  OE1   . GLN A 1 662 ? 11.057 32.447 29.597  1.00 32.45  ? 662  GLN A OE1   1 
ATOM   5098 N  NE2   . GLN A 1 662 ? 10.020 32.221 27.627  1.00 35.10  ? 662  GLN A NE2   1 
ATOM   5099 N  N     . LEU A 1 663 ? 7.136  38.129 28.009  1.00 17.11  ? 663  LEU A N     1 
ATOM   5100 C  CA    . LEU A 1 663 ? 5.860  38.756 27.721  1.00 17.16  ? 663  LEU A CA    1 
ATOM   5101 C  C     . LEU A 1 663 ? 5.864  39.777 26.560  1.00 11.14  ? 663  LEU A C     1 
ATOM   5102 O  O     . LEU A 1 663 ? 6.741  40.640 26.386  1.00 23.31  ? 663  LEU A O     1 
ATOM   5103 C  CB    . LEU A 1 663 ? 5.394  39.525 29.007  1.00 18.98  ? 663  LEU A CB    1 
ATOM   5104 C  CG    . LEU A 1 663 ? 5.015  38.585 30.191  1.00 32.75  ? 663  LEU A CG    1 
ATOM   5105 C  CD1   . LEU A 1 663 ? 4.717  39.386 31.440  1.00 32.43  ? 663  LEU A CD1   1 
ATOM   5106 C  CD2   . LEU A 1 663 ? 3.823  37.659 29.884  1.00 28.61  ? 663  LEU A CD2   1 
ATOM   5107 N  N     . PRO A 1 664 ? 4.715  39.784 25.829  1.00 27.71  ? 664  PRO A N     1 
ATOM   5108 C  CA    . PRO A 1 664 ? 4.471  40.738 24.749  1.00 19.20  ? 664  PRO A CA    1 
ATOM   5109 C  C     . PRO A 1 664 ? 3.966  42.010 25.308  1.00 25.12  ? 664  PRO A C     1 
ATOM   5110 O  O     . PRO A 1 664 ? 3.486  42.060 26.444  1.00 28.15  ? 664  PRO A O     1 
ATOM   5111 C  CB    . PRO A 1 664 ? 3.313  40.161 23.923  1.00 19.91  ? 664  PRO A CB    1 
ATOM   5112 C  CG    . PRO A 1 664 ? 2.746  39.011 24.715  1.00 21.61  ? 664  PRO A CG    1 
ATOM   5113 C  CD    . PRO A 1 664 ? 3.749  38.680 25.806  1.00 25.77  ? 664  PRO A CD    1 
ATOM   5114 N  N     . ALA A 1 665 ? 4.001  43.033 24.527  1.00 18.84  ? 665  ALA A N     1 
ATOM   5115 C  CA    . ALA A 1 665 ? 3.465  44.339 24.914  1.00 15.80  ? 665  ALA A CA    1 
ATOM   5116 C  C     . ALA A 1 665 ? 4.072  44.852 26.190  1.00 28.34  ? 665  ALA A C     1 
ATOM   5117 O  O     . ALA A 1 665 ? 3.502  45.654 26.922  1.00 25.61  ? 665  ALA A O     1 
ATOM   5118 C  CB    . ALA A 1 665 ? 1.917  44.298 24.940  1.00 15.24  ? 665  ALA A CB    1 
ATOM   5119 N  N     . LYS A 1 666 ? 5.299  44.423 26.467  1.00 24.54  ? 666  LYS A N     1 
ATOM   5120 C  CA    . LYS A 1 666 ? 5.930  44.864 27.723  1.00 17.18  ? 666  LYS A CA    1 
ATOM   5121 C  C     . LYS A 1 666 ? 7.401  45.240 27.538  1.00 16.16  ? 666  LYS A C     1 
ATOM   5122 O  O     . LYS A 1 666 ? 8.282  44.514 27.963  1.00 34.92  ? 666  LYS A O     1 
ATOM   5123 C  CB    . LYS A 1 666 ? 5.801  43.767 28.813  1.00 31.80  ? 666  LYS A CB    1 
ATOM   5124 C  CG    . LYS A 1 666 ? 4.958  44.140 30.051  1.00 67.27  ? 666  LYS A CG    1 
ATOM   5125 C  CD    . LYS A 1 666 ? 5.791  44.571 31.275  1.00 100.00 ? 666  LYS A CD    1 
ATOM   5126 C  CE    . LYS A 1 666 ? 5.375  45.920 31.889  1.00 100.00 ? 666  LYS A CE    1 
ATOM   5127 N  NZ    . LYS A 1 666 ? 6.391  46.573 32.751  1.00 53.96  ? 666  LYS A NZ    1 
ATOM   5128 N  N     . LEU A 1 667 ? 7.631  46.380 26.913  1.00 19.71  ? 667  LEU A N     1 
ATOM   5129 C  CA    . LEU A 1 667 ? 8.943  46.903 26.622  1.00 19.43  ? 667  LEU A CA    1 
ATOM   5130 C  C     . LEU A 1 667 ? 9.415  47.767 27.805  1.00 22.83  ? 667  LEU A C     1 
ATOM   5131 O  O     . LEU A 1 667 ? 8.980  48.927 28.000  1.00 30.27  ? 667  LEU A O     1 
ATOM   5132 C  CB    . LEU A 1 667 ? 8.916  47.716 25.296  1.00 18.05  ? 667  LEU A CB    1 
ATOM   5133 C  CG    . LEU A 1 667 ? 10.283 48.158 24.815  1.00 21.89  ? 667  LEU A CG    1 
ATOM   5134 C  CD1   . LEU A 1 667 ? 10.857 46.981 24.039  1.00 18.84  ? 667  LEU A CD1   1 
ATOM   5135 C  CD2   . LEU A 1 667 ? 10.159 49.448 23.986  1.00 18.66  ? 667  LEU A CD2   1 
ATOM   5136 N  N     . GLU A 1 668 ? 10.348 47.168 28.564  1.00 34.01  ? 668  GLU A N     1 
ATOM   5137 C  CA    . GLU A 1 668 ? 10.969 47.746 29.763  1.00 19.89  ? 668  GLU A CA    1 
ATOM   5138 C  C     . GLU A 1 668 ? 12.235 48.485 29.412  1.00 18.61  ? 668  GLU A C     1 
ATOM   5139 O  O     . GLU A 1 668 ? 13.171 47.899 28.935  1.00 24.89  ? 668  GLU A O     1 
ATOM   5140 C  CB    . GLU A 1 668 ? 11.235 46.581 30.738  1.00 22.56  ? 668  GLU A CB    1 
ATOM   5141 C  CG    . GLU A 1 668 ? 9.977  46.299 31.575  1.00 39.42  ? 668  GLU A CG    1 
ATOM   5142 C  CD    . GLU A 1 668 ? 9.971  44.969 32.254  1.00 100.00 ? 668  GLU A CD    1 
ATOM   5143 O  OE1   . GLU A 1 668 ? 10.992 44.382 32.595  1.00 56.24  ? 668  GLU A OE1   1 
ATOM   5144 O  OE2   . GLU A 1 668 ? 8.736  44.510 32.422  1.00 71.00  ? 668  GLU A OE2   1 
ATOM   5145 N  N     . ASP A 1 669 ? 12.233 49.782 29.655  1.00 20.72  ? 669  ASP A N     1 
ATOM   5146 C  CA    . ASP A 1 669 ? 13.306 50.720 29.381  1.00 40.49  ? 669  ASP A CA    1 
ATOM   5147 C  C     . ASP A 1 669 ? 14.660 50.356 29.946  1.00 39.34  ? 669  ASP A C     1 
ATOM   5148 O  O     . ASP A 1 669 ? 15.687 50.555 29.285  1.00 31.79  ? 669  ASP A O     1 
ATOM   5149 C  CB    . ASP A 1 669 ? 12.958 52.139 29.870  1.00 49.43  ? 669  ASP A CB    1 
ATOM   5150 C  CG    . ASP A 1 669 ? 11.901 52.165 30.929  1.00 94.35  ? 669  ASP A CG    1 
ATOM   5151 O  OD1   . ASP A 1 669 ? 12.311 51.575 32.034  1.00 50.25  ? 669  ASP A OD1   1 
ATOM   5152 O  OD2   . ASP A 1 669 ? 10.800 52.674 30.760  1.00 62.19  ? 669  ASP A OD2   1 
ATOM   5153 N  N     . LYS A 1 670 ? 14.642 49.941 31.200  1.00 22.96  ? 670  LYS A N     1 
ATOM   5154 C  CA    . LYS A 1 670 ? 15.854 49.549 31.863  1.00 29.34  ? 670  LYS A CA    1 
ATOM   5155 C  C     . LYS A 1 670 ? 16.421 48.344 31.142  1.00 21.45  ? 670  LYS A C     1 
ATOM   5156 O  O     . LYS A 1 670 ? 17.588 48.331 30.767  1.00 32.18  ? 670  LYS A O     1 
ATOM   5157 C  CB    . LYS A 1 670 ? 15.575 49.287 33.352  1.00 25.44  ? 670  LYS A CB    1 
ATOM   5158 N  N     . VAL A 1 671 ? 15.580 47.337 30.948  1.00 20.56  ? 671  VAL A N     1 
ATOM   5159 C  CA    . VAL A 1 671 ? 15.987 46.122 30.254  1.00 22.67  ? 671  VAL A CA    1 
ATOM   5160 C  C     . VAL A 1 671 ? 16.565 46.443 28.882  1.00 34.67  ? 671  VAL A C     1 
ATOM   5161 O  O     . VAL A 1 671 ? 17.650 46.044 28.486  1.00 25.66  ? 671  VAL A O     1 
ATOM   5162 C  CB    . VAL A 1 671 ? 14.795 45.158 30.140  1.00 21.90  ? 671  VAL A CB    1 
ATOM   5163 C  CG1   . VAL A 1 671 ? 15.073 43.872 29.338  1.00 14.09  ? 671  VAL A CG1   1 
ATOM   5164 C  CG2   . VAL A 1 671 ? 14.398 44.727 31.544  1.00 32.46  ? 671  VAL A CG2   1 
ATOM   5165 N  N     . VAL A 1 672 ? 15.810 47.196 28.153  1.00 22.71  ? 672  VAL A N     1 
ATOM   5166 C  CA    . VAL A 1 672 ? 16.173 47.539 26.810  1.00 24.04  ? 672  VAL A CA    1 
ATOM   5167 C  C     . VAL A 1 672 ? 17.465 48.328 26.675  1.00 15.07  ? 672  VAL A C     1 
ATOM   5168 O  O     . VAL A 1 672 ? 18.368 47.901 25.933  1.00 21.45  ? 672  VAL A O     1 
ATOM   5169 C  CB    . VAL A 1 672 ? 14.944 48.139 26.135  1.00 35.42  ? 672  VAL A CB    1 
ATOM   5170 C  CG1   . VAL A 1 672 ? 15.351 48.733 24.790  1.00 36.23  ? 672  VAL A CG1   1 
ATOM   5171 C  CG2   . VAL A 1 672 ? 13.970 46.992 25.924  1.00 16.02  ? 672  VAL A CG2   1 
ATOM   5172 N  N     . LEU A 1 673 ? 17.527 49.451 27.415  1.00 18.52  ? 673  LEU A N     1 
ATOM   5173 C  CA    . LEU A 1 673 ? 18.627 50.420 27.499  1.00 18.71  ? 673  LEU A CA    1 
ATOM   5174 C  C     . LEU A 1 673 ? 19.958 49.799 27.793  1.00 20.70  ? 673  LEU A C     1 
ATOM   5175 O  O     . LEU A 1 673 ? 20.988 49.996 27.117  1.00 23.65  ? 673  LEU A O     1 
ATOM   5176 C  CB    . LEU A 1 673 ? 18.287 51.642 28.324  1.00 23.30  ? 673  LEU A CB    1 
ATOM   5177 C  CG    . LEU A 1 673 ? 17.394 52.538 27.489  1.00 18.84  ? 673  LEU A CG    1 
ATOM   5178 C  CD1   . LEU A 1 673 ? 16.525 53.379 28.368  1.00 25.02  ? 673  LEU A CD1   1 
ATOM   5179 C  CD2   . LEU A 1 673 ? 18.219 53.362 26.529  1.00 21.22  ? 673  LEU A CD2   1 
ATOM   5180 N  N     . ASP A 1 674 ? 19.847 48.884 28.707  1.00 20.51  ? 674  ASP A N     1 
ATOM   5181 C  CA    . ASP A 1 674 ? 20.985 48.084 29.050  1.00 32.30  ? 674  ASP A CA    1 
ATOM   5182 C  C     . ASP A 1 674 ? 21.503 47.338 27.885  1.00 45.46  ? 674  ASP A C     1 
ATOM   5183 O  O     . ASP A 1 674 ? 22.743 47.257 27.755  1.00 27.28  ? 674  ASP A O     1 
ATOM   5184 C  CB    . ASP A 1 674 ? 20.704 47.104 30.168  1.00 23.79  ? 674  ASP A CB    1 
ATOM   5185 C  CG    . ASP A 1 674 ? 21.132 47.794 31.380  1.00 100.00 ? 674  ASP A CG    1 
ATOM   5186 O  OD1   . ASP A 1 674 ? 22.218 48.524 31.138  1.00 100.00 ? 674  ASP A OD1   1 
ATOM   5187 O  OD2   . ASP A 1 674 ? 20.507 47.711 32.433  1.00 100.00 ? 674  ASP A OD2   1 
ATOM   5188 N  N     . GLN A 1 675 ? 20.566 46.749 27.102  1.00 21.14  ? 675  GLN A N     1 
ATOM   5189 C  CA    . GLN A 1 675 ? 21.004 46.017 25.919  1.00 20.75  ? 675  GLN A CA    1 
ATOM   5190 C  C     . GLN A 1 675 ? 21.683 46.890 24.881  1.00 28.06  ? 675  GLN A C     1 
ATOM   5191 O  O     . GLN A 1 675 ? 22.687 46.465 24.270  1.00 24.92  ? 675  GLN A O     1 
ATOM   5192 C  CB    . GLN A 1 675 ? 19.879 45.273 25.288  1.00 27.95  ? 675  GLN A CB    1 
ATOM   5193 C  CG    . GLN A 1 675 ? 19.656 44.037 26.132  1.00 19.25  ? 675  GLN A CG    1 
ATOM   5194 C  CD    . GLN A 1 675 ? 18.358 43.380 25.777  1.00 17.30  ? 675  GLN A CD    1 
ATOM   5195 O  OE1   . GLN A 1 675 ? 18.349 42.376 25.006  1.00 18.93  ? 675  GLN A OE1   1 
ATOM   5196 N  NE2   . GLN A 1 675 ? 17.313 43.949 26.393  1.00 10.96  ? 675  GLN A NE2   1 
ATOM   5197 N  N     . LEU A 1 676 ? 21.137 48.093 24.722  1.00 21.08  ? 676  LEU A N     1 
ATOM   5198 C  CA    . LEU A 1 676 ? 21.640 49.031 23.752  1.00 22.95  ? 676  LEU A CA    1 
ATOM   5199 C  C     . LEU A 1 676 ? 22.990 49.585 24.126  1.00 36.82  ? 676  LEU A C     1 
ATOM   5200 O  O     . LEU A 1 676 ? 23.835 49.920 23.277  1.00 27.40  ? 676  LEU A O     1 
ATOM   5201 C  CB    . LEU A 1 676 ? 20.651 50.154 23.481  1.00 15.69  ? 676  LEU A CB    1 
ATOM   5202 C  CG    . LEU A 1 676 ? 19.266 49.651 23.057  1.00 22.12  ? 676  LEU A CG    1 
ATOM   5203 C  CD1   . LEU A 1 676 ? 18.414 50.842 22.691  1.00 27.46  ? 676  LEU A CD1   1 
ATOM   5204 C  CD2   . LEU A 1 676 ? 19.343 48.686 21.902  1.00 23.58  ? 676  LEU A CD2   1 
ATOM   5205 N  N     . ARG A 1 677 ? 23.208 49.688 25.415  1.00 22.41  ? 677  ARG A N     1 
ATOM   5206 C  CA    . ARG A 1 677 ? 24.521 50.125 25.856  1.00 41.56  ? 677  ARG A CA    1 
ATOM   5207 C  C     . ARG A 1 677 ? 25.619 49.069 25.521  1.00 22.68  ? 677  ARG A C     1 
ATOM   5208 O  O     . ARG A 1 677 ? 26.682 49.332 24.920  1.00 47.23  ? 677  ARG A O     1 
ATOM   5209 C  CB    . ARG A 1 677 ? 24.513 50.390 27.361  1.00 25.25  ? 677  ARG A CB    1 
ATOM   5210 C  CG    . ARG A 1 677 ? 24.104 51.828 27.708  1.00 34.90  ? 677  ARG A CG    1 
ATOM   5211 C  CD    . ARG A 1 677 ? 23.981 52.085 29.214  1.00 22.99  ? 677  ARG A CD    1 
ATOM   5212 N  NE    . ARG A 1 677 ? 22.839 52.890 29.606  1.00 30.34  ? 677  ARG A NE    1 
ATOM   5213 C  CZ    . ARG A 1 677 ? 21.855 52.373 30.330  1.00 44.47  ? 677  ARG A CZ    1 
ATOM   5214 N  NH1   . ARG A 1 677 ? 21.897 51.113 30.704  1.00 36.30  ? 677  ARG A NH1   1 
ATOM   5215 N  NH2   . ARG A 1 677 ? 20.809 53.117 30.680  1.00 33.80  ? 677  ARG A NH2   1 
ATOM   5216 N  N     . CYS A 1 678 ? 25.336 47.818 25.916  1.00 36.88  ? 678  CYS A N     1 
ATOM   5217 C  CA    . CYS A 1 678 ? 26.273 46.720 25.748  1.00 29.80  ? 678  CYS A CA    1 
ATOM   5218 C  C     . CYS A 1 678 ? 26.497 46.232 24.397  1.00 94.87  ? 678  CYS A C     1 
ATOM   5219 O  O     . CYS A 1 678 ? 27.535 45.642 24.263  1.00 28.31  ? 678  CYS A O     1 
ATOM   5220 C  CB    . CYS A 1 678 ? 25.937 45.421 26.547  1.00 34.53  ? 678  CYS A CB    1 
ATOM   5221 S  SG    . CYS A 1 678 ? 25.600 45.779 28.304  1.00 53.65  ? 678  CYS A SG    1 
ATOM   5222 N  N     . ASN A 1 679 ? 25.491 46.364 23.522  1.00 37.79  ? 679  ASN A N     1 
ATOM   5223 C  CA    . ASN A 1 679 ? 25.576 45.817 22.210  1.00 22.59  ? 679  ASN A CA    1 
ATOM   5224 C  C     . ASN A 1 679 ? 26.179 46.732 21.159  1.00 29.79  ? 679  ASN A C     1 
ATOM   5225 O  O     . ASN A 1 679 ? 26.263 46.297 20.015  1.00 36.13  ? 679  ASN A O     1 
ATOM   5226 C  CB    . ASN A 1 679 ? 24.286 45.115 21.800  1.00 14.78  ? 679  ASN A CB    1 
ATOM   5227 C  CG    . ASN A 1 679 ? 23.245 46.137 21.370  1.00 23.25  ? 679  ASN A CG    1 
ATOM   5228 O  OD1   . ASN A 1 679 ? 23.450 47.370 21.501  1.00 29.39  ? 679  ASN A OD1   1 
ATOM   5229 N  ND2   . ASN A 1 679 ? 22.108 45.625 20.836  1.00 25.95  ? 679  ASN A ND2   1 
ATOM   5230 N  N     . GLY A 1 680 ? 26.631 47.940 21.525  1.00 21.60  ? 680  GLY A N     1 
ATOM   5231 C  CA    . GLY A 1 680 ? 27.255 48.787 20.533  1.00 18.95  ? 680  GLY A CA    1 
ATOM   5232 C  C     . GLY A 1 680 ? 26.294 49.679 19.794  1.00 28.31  ? 680  GLY A C     1 
ATOM   5233 O  O     . GLY A 1 680 ? 26.736 50.527 19.057  1.00 27.77  ? 680  GLY A O     1 
ATOM   5234 N  N     . VAL A 1 681 ? 24.980 49.525 19.980  1.00 31.50  ? 681  VAL A N     1 
ATOM   5235 C  CA    . VAL A 1 681 ? 24.033 50.415 19.311  1.00 18.06  ? 681  VAL A CA    1 
ATOM   5236 C  C     . VAL A 1 681 ? 24.108 51.892 19.781  1.00 23.57  ? 681  VAL A C     1 
ATOM   5237 O  O     . VAL A 1 681 ? 24.153 52.865 19.011  1.00 24.38  ? 681  VAL A O     1 
ATOM   5238 C  CB    . VAL A 1 681 ? 22.646 49.845 19.462  1.00 18.62  ? 681  VAL A CB    1 
ATOM   5239 C  CG1   . VAL A 1 681 ? 21.668 50.885 19.036  1.00 20.60  ? 681  VAL A CG1   1 
ATOM   5240 C  CG2   . VAL A 1 681 ? 22.492 48.506 18.691  1.00 20.80  ? 681  VAL A CG2   1 
ATOM   5241 N  N     . LEU A 1 682 ? 24.170 52.138 21.103  1.00 27.11  ? 682  LEU A N     1 
ATOM   5242 C  CA    . LEU A 1 682 ? 24.225 53.516 21.588  1.00 15.72  ? 682  LEU A CA    1 
ATOM   5243 C  C     . LEU A 1 682 ? 25.578 54.166 21.294  1.00 16.85  ? 682  LEU A C     1 
ATOM   5244 O  O     . LEU A 1 682 ? 25.655 55.390 21.076  1.00 30.89  ? 682  LEU A O     1 
ATOM   5245 C  CB    . LEU A 1 682 ? 24.055 53.541 23.133  1.00 34.51  ? 682  LEU A CB    1 
ATOM   5246 C  CG    . LEU A 1 682 ? 22.696 53.072 23.641  1.00 67.53  ? 682  LEU A CG    1 
ATOM   5247 C  CD1   . LEU A 1 682 ? 22.547 53.394 25.129  1.00 22.16  ? 682  LEU A CD1   1 
ATOM   5248 C  CD2   . LEU A 1 682 ? 21.600 53.802 22.882  1.00 32.17  ? 682  LEU A CD2   1 
ATOM   5249 N  N     . GLU A 1 683 ? 26.652 53.337 21.336  1.00 32.09  ? 683  GLU A N     1 
ATOM   5250 C  CA    . GLU A 1 683 ? 28.007 53.827 21.037  1.00 24.46  ? 683  GLU A CA    1 
ATOM   5251 C  C     . GLU A 1 683 ? 28.069 54.322 19.582  1.00 31.00  ? 683  GLU A C     1 
ATOM   5252 O  O     . GLU A 1 683 ? 28.539 55.426 19.281  1.00 38.43  ? 683  GLU A O     1 
ATOM   5253 C  CB    . GLU A 1 683 ? 29.147 52.815 21.298  1.00 29.19  ? 683  GLU A CB    1 
ATOM   5254 C  CG    . GLU A 1 683 ? 30.534 53.508 21.528  1.00 61.29  ? 683  GLU A CG    1 
ATOM   5255 C  CD    . GLU A 1 683 ? 31.865 52.854 21.049  1.00 100.00 ? 683  GLU A CD    1 
ATOM   5256 O  OE1   . GLU A 1 683 ? 31.859 51.543 20.756  1.00 52.90  ? 683  GLU A OE1   1 
ATOM   5257 O  OE2   . GLU A 1 683 ? 32.903 53.520 20.971  1.00 53.37  ? 683  GLU A OE2   1 
ATOM   5258 N  N     . ALA A 1 684 ? 27.555 53.490 18.674  1.00 27.95  ? 684  ALA A N     1 
ATOM   5259 C  CA    . ALA A 1 684 ? 27.580 53.838 17.280  1.00 33.54  ? 684  ALA A CA    1 
ATOM   5260 C  C     . ALA A 1 684 ? 26.921 55.146 17.058  1.00 40.42  ? 684  ALA A C     1 
ATOM   5261 O  O     . ALA A 1 684 ? 27.256 55.912 16.152  1.00 45.09  ? 684  ALA A O     1 
ATOM   5262 C  CB    . ALA A 1 684 ? 26.835 52.794 16.487  1.00 100.00 ? 684  ALA A CB    1 
ATOM   5263 N  N     . ILE A 1 685 ? 25.910 55.339 17.869  1.00 21.47  ? 685  ILE A N     1 
ATOM   5264 C  CA    . ILE A 1 685 ? 25.197 56.556 17.694  1.00 28.65  ? 685  ILE A CA    1 
ATOM   5265 C  C     . ILE A 1 685 ? 25.947 57.738 18.208  1.00 44.31  ? 685  ILE A C     1 
ATOM   5266 O  O     . ILE A 1 685 ? 26.122 58.668 17.448  1.00 35.72  ? 685  ILE A O     1 
ATOM   5267 C  CB    . ILE A 1 685 ? 23.891 56.418 18.411  1.00 54.12  ? 685  ILE A CB    1 
ATOM   5268 C  CG1   . ILE A 1 685 ? 23.069 55.520 17.558  1.00 30.03  ? 685  ILE A CG1   1 
ATOM   5269 C  CG2   . ILE A 1 685 ? 23.188 57.750 18.495  1.00 33.57  ? 685  ILE A CG2   1 
ATOM   5270 C  CD1   . ILE A 1 685 ? 21.809 55.167 18.273  1.00 30.70  ? 685  ILE A CD1   1 
ATOM   5271 N  N     . ARG A 1 686 ? 26.331 57.686 19.499  1.00 32.50  ? 686  ARG A N     1 
ATOM   5272 C  CA    . ARG A 1 686 ? 27.069 58.756 20.107  1.00 35.83  ? 686  ARG A CA    1 
ATOM   5273 C  C     . ARG A 1 686 ? 28.087 59.295 19.129  1.00 100.00 ? 686  ARG A C     1 
ATOM   5274 O  O     . ARG A 1 686 ? 28.284 60.511 18.989  1.00 58.58  ? 686  ARG A O     1 
ATOM   5275 C  CB    . ARG A 1 686 ? 27.925 58.227 21.211  1.00 34.49  ? 686  ARG A CB    1 
ATOM   5276 C  CG    . ARG A 1 686 ? 27.179 57.707 22.410  1.00 100.00 ? 686  ARG A CG    1 
ATOM   5277 C  CD    . ARG A 1 686 ? 28.207 57.179 23.413  1.00 100.00 ? 686  ARG A CD    1 
ATOM   5278 N  NE    . ARG A 1 686 ? 27.794 55.911 24.027  1.00 100.00 ? 686  ARG A NE    1 
ATOM   5279 C  CZ    . ARG A 1 686 ? 28.569 54.849 24.296  1.00 100.00 ? 686  ARG A CZ    1 
ATOM   5280 N  NH1   . ARG A 1 686 ? 29.886 54.814 24.011  1.00 100.00 ? 686  ARG A NH1   1 
ATOM   5281 N  NH2   . ARG A 1 686 ? 27.969 53.784 24.863  1.00 57.84  ? 686  ARG A NH2   1 
ATOM   5282 N  N     . ILE A 1 687 ? 28.759 58.322 18.496  1.00 36.20  ? 687  ILE A N     1 
ATOM   5283 C  CA    . ILE A 1 687 ? 29.808 58.527 17.483  1.00 47.79  ? 687  ILE A CA    1 
ATOM   5284 C  C     . ILE A 1 687 ? 29.319 59.168 16.205  1.00 46.00  ? 687  ILE A C     1 
ATOM   5285 O  O     . ILE A 1 687 ? 29.928 60.056 15.598  1.00 56.73  ? 687  ILE A O     1 
ATOM   5286 C  CB    . ILE A 1 687 ? 30.325 57.209 16.979  1.00 96.01  ? 687  ILE A CB    1 
ATOM   5287 C  CG1   . ILE A 1 687 ? 31.281 56.550 17.966  1.00 50.23  ? 687  ILE A CG1   1 
ATOM   5288 C  CG2   . ILE A 1 687 ? 31.049 57.518 15.682  1.00 38.63  ? 687  ILE A CG2   1 
ATOM   5289 C  CD1   . ILE A 1 687 ? 31.830 55.256 17.386  1.00 35.92  ? 687  ILE A CD1   1 
ATOM   5290 N  N     . THR A 1 688 ? 28.238 58.622 15.749  1.00 36.85  ? 688  THR A N     1 
ATOM   5291 C  CA    . THR A 1 688 ? 27.640 59.139 14.559  1.00 100.00 ? 688  THR A CA    1 
ATOM   5292 C  C     . THR A 1 688 ? 27.185 60.617 14.844  1.00 100.00 ? 688  THR A C     1 
ATOM   5293 O  O     . THR A 1 688 ? 27.518 61.619 14.153  1.00 32.01  ? 688  THR A O     1 
ATOM   5294 C  CB    . THR A 1 688 ? 26.605 58.036 14.236  1.00 38.11  ? 688  THR A CB    1 
ATOM   5295 O  OG1   . THR A 1 688 ? 27.294 56.973 13.585  1.00 50.91  ? 688  THR A OG1   1 
ATOM   5296 C  CG2   . THR A 1 688 ? 25.386 58.479 13.429  1.00 100.00 ? 688  THR A CG2   1 
ATOM   5297 N  N     . ARG A 1 689 ? 26.477 60.760 15.958  1.00 48.66  ? 689  ARG A N     1 
ATOM   5298 C  CA    . ARG A 1 689 ? 26.006 62.029 16.500  1.00 58.97  ? 689  ARG A CA    1 
ATOM   5299 C  C     . ARG A 1 689 ? 27.108 63.114 16.424  1.00 100.00 ? 689  ARG A C     1 
ATOM   5300 O  O     . ARG A 1 689 ? 26.902 64.267 15.981  1.00 67.47  ? 689  ARG A O     1 
ATOM   5301 C  CB    . ARG A 1 689 ? 25.612 61.735 17.969  1.00 73.83  ? 689  ARG A CB    1 
ATOM   5302 C  CG    . ARG A 1 689 ? 24.938 62.828 18.827  1.00 54.70  ? 689  ARG A CG    1 
ATOM   5303 C  CD    . ARG A 1 689 ? 23.803 62.301 19.747  1.00 100.00 ? 689  ARG A CD    1 
ATOM   5304 N  NE    . ARG A 1 689 ? 24.096 62.076 21.190  1.00 100.00 ? 689  ARG A NE    1 
ATOM   5305 C  CZ    . ARG A 1 689 ? 24.373 60.878 21.803  1.00 100.00 ? 689  ARG A CZ    1 
ATOM   5306 N  NH1   . ARG A 1 689 ? 24.469 59.706 21.149  1.00 100.00 ? 689  ARG A NH1   1 
ATOM   5307 N  NH2   . ARG A 1 689 ? 24.560 60.849 23.120  1.00 78.80  ? 689  ARG A NH2   1 
ATOM   5308 N  N     . LYS A 1 690 ? 28.307 62.736 16.869  1.00 68.06  ? 690  LYS A N     1 
ATOM   5309 C  CA    . LYS A 1 690 ? 29.418 63.655 16.861  1.00 47.83  ? 690  LYS A CA    1 
ATOM   5310 C  C     . LYS A 1 690 ? 29.637 64.335 15.526  1.00 94.75  ? 690  LYS A C     1 
ATOM   5311 O  O     . LYS A 1 690 ? 29.866 65.545 15.497  1.00 67.15  ? 690  LYS A O     1 
ATOM   5312 C  CB    . LYS A 1 690 ? 30.683 63.011 17.349  1.00 61.23  ? 690  LYS A CB    1 
ATOM   5313 C  CG    . LYS A 1 690 ? 30.753 62.835 18.860  1.00 40.54  ? 690  LYS A CG    1 
ATOM   5314 C  CD    . LYS A 1 690 ? 32.163 62.372 19.181  1.00 100.00 ? 690  LYS A CD    1 
ATOM   5315 C  CE    . LYS A 1 690 ? 33.025 62.413 17.905  1.00 100.00 ? 690  LYS A CE    1 
ATOM   5316 N  NZ    . LYS A 1 690 ? 33.898 61.241 17.688  1.00 100.00 ? 690  LYS A NZ    1 
ATOM   5317 N  N     . GLY A 1 691 ? 29.556 63.560 14.434  1.00 47.04  ? 691  GLY A N     1 
ATOM   5318 C  CA    . GLY A 1 691 ? 29.777 64.112 13.103  1.00 100.00 ? 691  GLY A CA    1 
ATOM   5319 C  C     . GLY A 1 691 ? 28.601 64.857 12.463  1.00 73.50  ? 691  GLY A C     1 
ATOM   5320 O  O     . GLY A 1 691 ? 28.185 65.967 12.890  1.00 44.78  ? 691  GLY A O     1 
ATOM   5321 N  N     . PHE A 1 692 ? 28.125 64.233 11.373  1.00 48.88  ? 692  PHE A N     1 
ATOM   5322 C  CA    . PHE A 1 692 ? 27.007 64.727 10.566  1.00 64.87  ? 692  PHE A CA    1 
ATOM   5323 C  C     . PHE A 1 692 ? 26.058 63.534 10.356  1.00 45.00  ? 692  PHE A C     1 
ATOM   5324 O  O     . PHE A 1 692 ? 26.123 62.852 9.314   1.00 46.70  ? 692  PHE A O     1 
ATOM   5325 C  CB    . PHE A 1 692 ? 27.455 65.335 9.174   1.00 86.77  ? 692  PHE A CB    1 
ATOM   5326 C  CG    . PHE A 1 692 ? 28.048 66.760 9.139   1.00 42.68  ? 692  PHE A CG    1 
ATOM   5327 C  CD1   . PHE A 1 692 ? 27.258 67.896 9.256   1.00 30.81  ? 692  PHE A CD1   1 
ATOM   5328 C  CD2   . PHE A 1 692 ? 29.404 66.935 8.878   1.00 100.00 ? 692  PHE A CD2   1 
ATOM   5329 C  CE1   . PHE A 1 692 ? 27.818 69.177 9.210   1.00 31.52  ? 692  PHE A CE1   1 
ATOM   5330 C  CE2   . PHE A 1 692 ? 29.995 68.184 8.793   1.00 39.06  ? 692  PHE A CE2   1 
ATOM   5331 C  CZ    . PHE A 1 692 ? 29.164 69.313 8.837   1.00 100.00 ? 692  PHE A CZ    1 
ATOM   5332 N  N     . PRO A 1 693 ? 25.218 63.293 11.386  1.00 75.88  ? 693  PRO A N     1 
ATOM   5333 C  CA    . PRO A 1 693 ? 24.263 62.179 11.503  1.00 100.00 ? 693  PRO A CA    1 
ATOM   5334 C  C     . PRO A 1 693 ? 23.179 62.082 10.439  1.00 100.00 ? 693  PRO A C     1 
ATOM   5335 O  O     . PRO A 1 693 ? 22.853 60.962 9.999   1.00 49.19  ? 693  PRO A O     1 
ATOM   5336 C  CB    . PRO A 1 693 ? 23.588 62.313 12.886  1.00 47.67  ? 693  PRO A CB    1 
ATOM   5337 C  CG    . PRO A 1 693 ? 23.831 63.755 13.315  1.00 51.12  ? 693  PRO A CG    1 
ATOM   5338 C  CD    . PRO A 1 693 ? 24.903 64.348 12.388  1.00 100.00 ? 693  PRO A CD    1 
ATOM   5339 N  N     . ASN A 1 694 ? 22.601 63.253 10.094  1.00 60.16  ? 694  ASN A N     1 
ATOM   5340 C  CA    . ASN A 1 694 ? 21.544 63.392 9.114   1.00 56.40  ? 694  ASN A CA    1 
ATOM   5341 C  C     . ASN A 1 694 ? 22.218 63.689 7.775   1.00 33.91  ? 694  ASN A C     1 
ATOM   5342 O  O     . ASN A 1 694 ? 23.120 64.525 7.682   1.00 47.34  ? 694  ASN A O     1 
ATOM   5343 C  CB    . ASN A 1 694 ? 20.511 64.447 9.584   1.00 42.05  ? 694  ASN A CB    1 
ATOM   5344 C  CG    . ASN A 1 694 ? 20.150 64.325 11.078  1.00 51.04  ? 694  ASN A CG    1 
ATOM   5345 O  OD1   . ASN A 1 694 ? 20.052 65.326 11.861  1.00 53.02  ? 694  ASN A OD1   1 
ATOM   5346 N  ND2   . ASN A 1 694 ? 19.977 63.074 11.483  1.00 42.93  ? 694  ASN A ND2   1 
ATOM   5347 N  N     . ARG A 1 695 ? 21.883 62.908 6.776   1.00 34.57  ? 695  ARG A N     1 
ATOM   5348 C  CA    . ARG A 1 695 ? 22.493 63.027 5.444   1.00 68.62  ? 695  ARG A CA    1 
ATOM   5349 C  C     . ARG A 1 695 ? 21.419 62.758 4.419   1.00 41.49  ? 695  ARG A C     1 
ATOM   5350 O  O     . ARG A 1 695 ? 21.223 61.609 4.011   1.00 64.31  ? 695  ARG A O     1 
ATOM   5351 C  CB    . ARG A 1 695 ? 23.592 61.973 5.323   1.00 34.35  ? 695  ARG A CB    1 
ATOM   5352 C  CG    . ARG A 1 695 ? 24.434 61.934 6.607   1.00 50.47  ? 695  ARG A CG    1 
ATOM   5353 C  CD    . ARG A 1 695 ? 25.430 60.783 6.685   1.00 46.11  ? 695  ARG A CD    1 
ATOM   5354 N  NE    . ARG A 1 695 ? 26.395 60.969 7.780   1.00 33.62  ? 695  ARG A NE    1 
ATOM   5355 C  CZ    . ARG A 1 695 ? 27.340 60.101 8.152   1.00 100.00 ? 695  ARG A CZ    1 
ATOM   5356 N  NH1   . ARG A 1 695 ? 27.514 58.927 7.526   1.00 50.62  ? 695  ARG A NH1   1 
ATOM   5357 N  NH2   . ARG A 1 695 ? 28.133 60.419 9.180   1.00 58.50  ? 695  ARG A NH2   1 
ATOM   5358 N  N     . ILE A 1 696 ? 20.694 63.824 4.062   1.00 65.47  ? 696  ILE A N     1 
ATOM   5359 C  CA    . ILE A 1 696 ? 19.528 63.777 3.179   1.00 39.62  ? 696  ILE A CA    1 
ATOM   5360 C  C     . ILE A 1 696 ? 19.792 64.041 1.703   1.00 100.00 ? 696  ILE A C     1 
ATOM   5361 O  O     . ILE A 1 696 ? 20.701 64.810 1.325   1.00 44.27  ? 696  ILE A O     1 
ATOM   5362 C  CB    . ILE A 1 696 ? 18.446 64.748 3.688   1.00 64.32  ? 696  ILE A CB    1 
ATOM   5363 C  CG1   . ILE A 1 696 ? 18.100 64.498 5.168   1.00 35.85  ? 696  ILE A CG1   1 
ATOM   5364 C  CG2   . ILE A 1 696 ? 17.197 64.808 2.803   1.00 33.06  ? 696  ILE A CG2   1 
ATOM   5365 C  CD1   . ILE A 1 696 ? 19.054 65.241 6.095   1.00 63.10  ? 696  ILE A CD1   1 
ATOM   5366 N  N     . ILE A 1 697 ? 18.943 63.379 0.893   1.00 54.92  ? 697  ILE A N     1 
ATOM   5367 C  CA    . ILE A 1 697 ? 18.932 63.545 -0.549  1.00 39.85  ? 697  ILE A CA    1 
ATOM   5368 C  C     . ILE A 1 697 ? 18.296 64.915 -0.782  1.00 59.71  ? 697  ILE A C     1 
ATOM   5369 O  O     . ILE A 1 697 ? 17.223 65.213 -0.237  1.00 53.88  ? 697  ILE A O     1 
ATOM   5370 C  CB    . ILE A 1 697 ? 18.113 62.486 -1.262  1.00 91.04  ? 697  ILE A CB    1 
ATOM   5371 C  CG1   . ILE A 1 697 ? 18.706 61.091 -1.033  1.00 56.71  ? 697  ILE A CG1   1 
ATOM   5372 C  CG2   . ILE A 1 697 ? 18.002 62.854 -2.750  1.00 58.60  ? 697  ILE A CG2   1 
ATOM   5373 C  CD1   . ILE A 1 697 ? 20.047 60.874 -1.715  1.00 42.25  ? 697  ILE A CD1   1 
ATOM   5374 N  N     . TYR A 1 698 ? 18.997 65.763 -1.531  1.00 54.34  ? 698  TYR A N     1 
ATOM   5375 C  CA    . TYR A 1 698 ? 18.589 67.126 -1.852  1.00 100.00 ? 698  TYR A CA    1 
ATOM   5376 C  C     . TYR A 1 698 ? 17.130 67.225 -2.253  1.00 100.00 ? 698  TYR A C     1 
ATOM   5377 O  O     . TYR A 1 698 ? 16.359 68.091 -1.803  1.00 55.17  ? 698  TYR A O     1 
ATOM   5378 C  CB    . TYR A 1 698 ? 19.475 67.684 -2.994  1.00 61.89  ? 698  TYR A CB    1 
ATOM   5379 C  CG    . TYR A 1 698 ? 20.878 68.008 -2.522  1.00 42.31  ? 698  TYR A CG    1 
ATOM   5380 C  CD1   . TYR A 1 698 ? 21.078 69.083 -1.662  1.00 48.29  ? 698  TYR A CD1   1 
ATOM   5381 C  CD2   . TYR A 1 698 ? 21.977 67.222 -2.876  1.00 63.62  ? 698  TYR A CD2   1 
ATOM   5382 C  CE1   . TYR A 1 698 ? 22.343 69.396 -1.178  1.00 45.71  ? 698  TYR A CE1   1 
ATOM   5383 C  CE2   . TYR A 1 698 ? 23.262 67.530 -2.431  1.00 37.42  ? 698  TYR A CE2   1 
ATOM   5384 C  CZ    . TYR A 1 698 ? 23.428 68.618 -1.570  1.00 39.93  ? 698  TYR A CZ    1 
ATOM   5385 O  OH    . TYR A 1 698 ? 24.660 68.949 -1.080  1.00 54.49  ? 698  TYR A OH    1 
ATOM   5386 N  N     . ALA A 1 699 ? 16.782 66.325 -3.164  1.00 72.95  ? 699  ALA A N     1 
ATOM   5387 C  CA    . ALA A 1 699 ? 15.439 66.254 -3.677  1.00 60.60  ? 699  ALA A CA    1 
ATOM   5388 C  C     . ALA A 1 699 ? 14.398 66.079 -2.552  1.00 100.00 ? 699  ALA A C     1 
ATOM   5389 O  O     . ALA A 1 699 ? 13.387 66.811 -2.519  1.00 59.34  ? 699  ALA A O     1 
ATOM   5390 C  CB    . ALA A 1 699 ? 15.385 65.164 -4.747  1.00 44.41  ? 699  ALA A CB    1 
ATOM   5391 N  N     . ASP A 1 700 ? 14.690 65.113 -1.630  1.00 100.00 ? 700  ASP A N     1 
ATOM   5392 C  CA    . ASP A 1 700 ? 13.890 64.750 -0.447  1.00 73.61  ? 700  ASP A CA    1 
ATOM   5393 C  C     . ASP A 1 700 ? 13.716 65.931 0.497   1.00 100.00 ? 700  ASP A C     1 
ATOM   5394 O  O     . ASP A 1 700 ? 12.603 66.232 0.969   1.00 41.17  ? 700  ASP A O     1 
ATOM   5395 C  CB    . ASP A 1 700 ? 14.438 63.509 0.292   1.00 45.65  ? 700  ASP A CB    1 
ATOM   5396 C  CG    . ASP A 1 700 ? 14.740 62.373 -0.640  1.00 100.00 ? 700  ASP A CG    1 
ATOM   5397 O  OD1   . ASP A 1 700 ? 14.109 62.494 -1.788  1.00 65.19  ? 700  ASP A OD1   1 
ATOM   5398 O  OD2   . ASP A 1 700 ? 15.490 61.443 -0.355  1.00 100.00 ? 700  ASP A OD2   1 
ATOM   5399 N  N     . PHE A 1 701 ? 14.839 66.608 0.746   1.00 39.40  ? 701  PHE A N     1 
ATOM   5400 C  CA    . PHE A 1 701 ? 14.811 67.804 1.562   1.00 100.00 ? 701  PHE A CA    1 
ATOM   5401 C  C     . PHE A 1 701 ? 13.734 68.786 1.054   1.00 49.55  ? 701  PHE A C     1 
ATOM   5402 O  O     . PHE A 1 701 ? 12.771 69.088 1.782   1.00 51.42  ? 701  PHE A O     1 
ATOM   5403 C  CB    . PHE A 1 701 ? 16.207 68.475 1.632   1.00 46.92  ? 701  PHE A CB    1 
ATOM   5404 C  CG    . PHE A 1 701 ? 16.169 69.718 2.506   1.00 88.47  ? 701  PHE A CG    1 
ATOM   5405 C  CD1   . PHE A 1 701 ? 15.748 69.603 3.831   1.00 100.00 ? 701  PHE A CD1   1 
ATOM   5406 C  CD2   . PHE A 1 701 ? 16.507 70.989 2.031   1.00 42.63  ? 701  PHE A CD2   1 
ATOM   5407 C  CE1   . PHE A 1 701 ? 15.675 70.717 4.672   1.00 100.00 ? 701  PHE A CE1   1 
ATOM   5408 C  CE2   . PHE A 1 701 ? 16.469 72.108 2.869   1.00 100.00 ? 701  PHE A CE2   1 
ATOM   5409 C  CZ    . PHE A 1 701 ? 16.037 71.981 4.191   1.00 54.59  ? 701  PHE A CZ    1 
ATOM   5410 N  N     . VAL A 1 702 ? 13.928 69.254 -0.201  1.00 75.04  ? 702  VAL A N     1 
ATOM   5411 C  CA    . VAL A 1 702 ? 13.061 70.212 -0.894  1.00 52.64  ? 702  VAL A CA    1 
ATOM   5412 C  C     . VAL A 1 702 ? 11.614 69.830 -0.840  1.00 39.24  ? 702  VAL A C     1 
ATOM   5413 O  O     . VAL A 1 702 ? 10.781 70.683 -0.539  1.00 65.79  ? 702  VAL A O     1 
ATOM   5414 C  CB    . VAL A 1 702 ? 13.430 70.499 -2.348  1.00 50.83  ? 702  VAL A CB    1 
ATOM   5415 C  CG1   . VAL A 1 702 ? 12.571 71.703 -2.773  1.00 38.98  ? 702  VAL A CG1   1 
ATOM   5416 C  CG2   . VAL A 1 702 ? 14.939 70.738 -2.517  1.00 26.80  ? 702  VAL A CG2   1 
ATOM   5417 N  N     . LYS A 1 703 ? 11.325 68.564 -1.189  1.00 34.85  ? 703  LYS A N     1 
ATOM   5418 C  CA    . LYS A 1 703 ? 9.945  68.138 -1.156  1.00 97.07  ? 703  LYS A CA    1 
ATOM   5419 C  C     . LYS A 1 703 ? 9.308  68.569 0.163   1.00 50.50  ? 703  LYS A C     1 
ATOM   5420 O  O     . LYS A 1 703 ? 8.326  69.310 0.168   1.00 100.00 ? 703  LYS A O     1 
ATOM   5421 C  CB    . LYS A 1 703 ? 9.717  66.660 -1.491  1.00 40.86  ? 703  LYS A CB    1 
ATOM   5422 C  CG    . LYS A 1 703 ? 8.864  65.921 -0.450  1.00 100.00 ? 703  LYS A CG    1 
ATOM   5423 C  CD    . LYS A 1 703 ? 9.642  65.553 0.836   1.00 100.00 ? 703  LYS A CD    1 
ATOM   5424 C  CE    . LYS A 1 703 ? 9.457  64.112 1.334   1.00 100.00 ? 703  LYS A CE    1 
ATOM   5425 N  NZ    . LYS A 1 703 ? 10.731 63.369 1.524   1.00 100.00 ? 703  LYS A NZ    1 
ATOM   5426 N  N     . ARG A 1 704 ? 9.946  68.169 1.281   1.00 100.00 ? 704  ARG A N     1 
ATOM   5427 C  CA    . ARG A 1 704 ? 9.463  68.471 2.613   1.00 67.93  ? 704  ARG A CA    1 
ATOM   5428 C  C     . ARG A 1 704 ? 9.622  69.917 3.031   1.00 73.03  ? 704  ARG A C     1 
ATOM   5429 O  O     . ARG A 1 704 ? 8.896  70.414 3.890   1.00 72.45  ? 704  ARG A O     1 
ATOM   5430 C  CB    . ARG A 1 704 ? 10.008 67.556 3.717   1.00 64.65  ? 704  ARG A CB    1 
ATOM   5431 C  CG    . ARG A 1 704 ? 9.403  67.866 5.106   1.00 100.00 ? 704  ARG A CG    1 
ATOM   5432 C  CD    . ARG A 1 704 ? 9.287  66.718 6.158   1.00 47.15  ? 704  ARG A CD    1 
ATOM   5433 N  NE    . ARG A 1 704 ? 8.381  67.033 7.301   1.00 46.63  ? 704  ARG A NE    1 
ATOM   5434 C  CZ    . ARG A 1 704 ? 7.069  66.736 7.352   1.00 49.78  ? 704  ARG A CZ    1 
ATOM   5435 N  NH1   . ARG A 1 704 ? 6.441  66.090 6.364   1.00 100.00 ? 704  ARG A NH1   1 
ATOM   5436 N  NH2   . ARG A 1 704 ? 6.348  67.099 8.407   1.00 46.75  ? 704  ARG A NH2   1 
ATOM   5437 N  N     . TYR A 1 705 ? 10.572 70.623 2.463   1.00 41.91  ? 705  TYR A N     1 
ATOM   5438 C  CA    . TYR A 1 705 ? 10.707 71.955 3.012   1.00 50.66  ? 705  TYR A CA    1 
ATOM   5439 C  C     . TYR A 1 705 ? 10.521 73.173 2.153   1.00 62.66  ? 705  TYR A C     1 
ATOM   5440 O  O     . TYR A 1 705 ? 10.532 74.280 2.687   1.00 53.74  ? 705  TYR A O     1 
ATOM   5441 C  CB    . TYR A 1 705 ? 11.981 72.048 3.842   1.00 67.81  ? 705  TYR A CB    1 
ATOM   5442 C  CG    . TYR A 1 705 ? 12.011 70.966 4.895   1.00 100.00 ? 705  TYR A CG    1 
ATOM   5443 C  CD1   . TYR A 1 705 ? 11.272 71.113 6.072   1.00 49.59  ? 705  TYR A CD1   1 
ATOM   5444 C  CD2   . TYR A 1 705 ? 12.753 69.795 4.705   1.00 53.60  ? 705  TYR A CD2   1 
ATOM   5445 C  CE1   . TYR A 1 705 ? 11.313 70.122 7.053   1.00 45.68  ? 705  TYR A CE1   1 
ATOM   5446 C  CE2   . TYR A 1 705 ? 12.809 68.794 5.677   1.00 86.39  ? 705  TYR A CE2   1 
ATOM   5447 C  CZ    . TYR A 1 705 ? 12.080 68.970 6.855   1.00 100.00 ? 705  TYR A CZ    1 
ATOM   5448 O  OH    . TYR A 1 705 ? 12.108 67.974 7.809   1.00 84.72  ? 705  TYR A OH    1 
ATOM   5449 N  N     . TYR A 1 706 ? 10.380 72.979 0.847   1.00 100.00 ? 706  TYR A N     1 
ATOM   5450 C  CA    . TYR A 1 706 ? 10.215 74.085 -0.088  1.00 52.04  ? 706  TYR A CA    1 
ATOM   5451 C  C     . TYR A 1 706 ? 9.392  75.262 0.444   1.00 72.79  ? 706  TYR A C     1 
ATOM   5452 O  O     . TYR A 1 706 ? 9.717  76.451 0.225   1.00 85.44  ? 706  TYR A O     1 
ATOM   5453 C  CB    . TYR A 1 706 ? 9.656  73.565 -1.425  1.00 61.11  ? 706  TYR A CB    1 
ATOM   5454 C  CG    . TYR A 1 706 ? 8.170  73.254 -1.377  1.00 68.23  ? 706  TYR A CG    1 
ATOM   5455 C  CD1   . TYR A 1 706 ? 7.672  72.081 -0.795  1.00 45.82  ? 706  TYR A CD1   1 
ATOM   5456 C  CD2   . TYR A 1 706 ? 7.268  74.141 -1.966  1.00 85.58  ? 706  TYR A CD2   1 
ATOM   5457 C  CE1   . TYR A 1 706 ? 6.299  71.812 -0.783  1.00 52.85  ? 706  TYR A CE1   1 
ATOM   5458 C  CE2   . TYR A 1 706 ? 5.894  73.895 -1.957  1.00 100.00 ? 706  TYR A CE2   1 
ATOM   5459 C  CZ    . TYR A 1 706 ? 5.413  72.724 -1.363  1.00 100.00 ? 706  TYR A CZ    1 
ATOM   5460 O  OH    . TYR A 1 706 ? 4.066  72.448 -1.372  1.00 100.00 ? 706  TYR A OH    1 
ATOM   5461 N  N     . ASP A 1 707 ? 8.323  74.893 1.153   1.00 66.98  ? 707  ASP A N     1 
ATOM   5462 C  CA    . ASP A 1 707 ? 7.333  75.796 1.743   1.00 73.24  ? 707  ASP A CA    1 
ATOM   5463 C  C     . ASP A 1 707 ? 7.871  76.827 2.728   1.00 49.99  ? 707  ASP A C     1 
ATOM   5464 O  O     . ASP A 1 707 ? 7.259  77.908 2.895   1.00 61.62  ? 707  ASP A O     1 
ATOM   5465 C  CB    . ASP A 1 707 ? 6.228  74.968 2.438   1.00 100.00 ? 707  ASP A CB    1 
ATOM   5466 C  CG    . ASP A 1 707 ? 6.762  74.149 3.600   1.00 100.00 ? 707  ASP A CG    1 
ATOM   5467 O  OD1   . ASP A 1 707 ? 7.524  73.180 3.460   1.00 80.38  ? 707  ASP A OD1   1 
ATOM   5468 O  OD2   . ASP A 1 707 ? 6.331  74.603 4.771   1.00 100.00 ? 707  ASP A OD2   1 
ATOM   5469 N  N     . LEU A 1 708 ? 8.995  76.437 3.386   1.00 60.69  ? 708  LEU A N     1 
ATOM   5470 C  CA    . LEU A 1 708 ? 9.693  77.207 4.441   1.00 100.00 ? 708  LEU A CA    1 
ATOM   5471 C  C     . LEU A 1 708 ? 10.432 78.425 3.909   1.00 100.00 ? 708  LEU A C     1 
ATOM   5472 O  O     . LEU A 1 708 ? 10.868 79.298 4.662   1.00 78.37  ? 708  LEU A O     1 
ATOM   5473 C  CB    . LEU A 1 708 ? 10.665 76.345 5.319   1.00 59.08  ? 708  LEU A CB    1 
ATOM   5474 C  CG    . LEU A 1 708 ? 10.013 75.177 6.087   1.00 100.00 ? 708  LEU A CG    1 
ATOM   5475 C  CD1   . LEU A 1 708 ? 11.044 74.377 6.893   1.00 46.49  ? 708  LEU A CD1   1 
ATOM   5476 C  CD2   . LEU A 1 708 ? 8.923  75.696 7.015   1.00 47.67  ? 708  LEU A CD2   1 
ATOM   5477 N  N     . ALA A 1 709 ? 10.589 78.450 2.595   1.00 69.04  ? 709  ALA A N     1 
ATOM   5478 C  CA    . ALA A 1 709 ? 11.281 79.547 1.990   1.00 74.18  ? 709  ALA A CA    1 
ATOM   5479 C  C     . ALA A 1 709 ? 10.446 80.280 0.973   1.00 100.00 ? 709  ALA A C     1 
ATOM   5480 O  O     . ALA A 1 709 ? 9.873  79.639 0.068   1.00 88.12  ? 709  ALA A O     1 
ATOM   5481 C  CB    . ALA A 1 709 ? 12.573 79.103 1.326   1.00 44.03  ? 709  ALA A CB    1 
ATOM   5482 N  N     . PRO A 1 710 ? 10.385 81.615 1.163   1.00 100.00 ? 710  PRO A N     1 
ATOM   5483 C  CA    . PRO A 1 710 ? 9.789  82.489 0.199   1.00 100.00 ? 710  PRO A CA    1 
ATOM   5484 C  C     . PRO A 1 710 ? 10.779 82.397 -0.919  1.00 100.00 ? 710  PRO A C     1 
ATOM   5485 O  O     . PRO A 1 710 ? 11.754 83.168 -0.911  1.00 100.00 ? 710  PRO A O     1 
ATOM   5486 C  CB    . PRO A 1 710 ? 9.833  83.897 0.821   1.00 100.00 ? 710  PRO A CB    1 
ATOM   5487 C  CG    . PRO A 1 710 ? 9.713  83.638 2.317   1.00 100.00 ? 710  PRO A CG    1 
ATOM   5488 C  CD    . PRO A 1 710 ? 10.010 82.142 2.517   1.00 100.00 ? 710  PRO A CD    1 
ATOM   5489 N  N     . ASN A 1 711 ? 10.550 81.382 -1.790  1.00 100.00 ? 711  ASN A N     1 
ATOM   5490 C  CA    . ASN A 1 711 ? 11.438 81.055 -2.906  1.00 100.00 ? 711  ASN A CA    1 
ATOM   5491 C  C     . ASN A 1 711 ? 11.004 79.839 -3.746  1.00 100.00 ? 711  ASN A C     1 
ATOM   5492 O  O     . ASN A 1 711 ? 10.300 79.963 -4.758  1.00 67.52  ? 711  ASN A O     1 
ATOM   5493 C  CB    . ASN A 1 711 ? 12.843 80.690 -2.333  1.00 100.00 ? 711  ASN A CB    1 
ATOM   5494 C  CG    . ASN A 1 711 ? 13.888 81.811 -2.276  1.00 100.00 ? 711  ASN A CG    1 
ATOM   5495 O  OD1   . ASN A 1 711 ? 14.273 82.388 -3.334  1.00 100.00 ? 711  ASN A OD1   1 
ATOM   5496 N  ND2   . ASN A 1 711 ? 14.364 82.101 -1.041  1.00 100.00 ? 711  ASN A ND2   1 
ATOM   5497 N  N     . VAL A 1 712 ? 11.547 78.695 -3.253  1.00 100.00 ? 712  VAL A N     1 
ATOM   5498 C  CA    . VAL A 1 712 ? 11.522 77.299 -3.711  1.00 71.10  ? 712  VAL A CA    1 
ATOM   5499 C  C     . VAL A 1 712 ? 10.182 76.607 -3.901  1.00 100.00 ? 712  VAL A C     1 
ATOM   5500 O  O     . VAL A 1 712 ? 9.240  76.715 -3.080  1.00 80.75  ? 712  VAL A O     1 
ATOM   5501 C  CB    . VAL A 1 712 ? 12.419 76.453 -2.798  1.00 47.95  ? 712  VAL A CB    1 
ATOM   5502 C  CG1   . VAL A 1 712 ? 12.325 74.944 -3.068  1.00 50.41  ? 712  VAL A CG1   1 
ATOM   5503 C  CG2   . VAL A 1 712 ? 13.854 76.956 -2.805  1.00 78.93  ? 712  VAL A CG2   1 
ATOM   5504 N  N     . PRO A 1 713 ? 10.177 75.848 -5.002  1.00 100.00 ? 713  PRO A N     1 
ATOM   5505 C  CA    . PRO A 1 713 ? 9.081  75.034 -5.464  1.00 99.48  ? 713  PRO A CA    1 
ATOM   5506 C  C     . PRO A 1 713 ? 9.374  73.553 -5.185  1.00 100.00 ? 713  PRO A C     1 
ATOM   5507 O  O     . PRO A 1 713 ? 10.497 73.053 -5.445  1.00 48.23  ? 713  PRO A O     1 
ATOM   5508 C  CB    . PRO A 1 713 ? 8.797  75.350 -6.931  1.00 92.16  ? 713  PRO A CB    1 
ATOM   5509 N  N     . ARG A 1 714 ? 8.347  72.883 -4.622  1.00 73.47  ? 714  ARG A N     1 
ATOM   5510 C  CA    . ARG A 1 714 ? 8.399  71.477 -4.217  1.00 49.19  ? 714  ARG A CA    1 
ATOM   5511 C  C     . ARG A 1 714 ? 9.348  70.646 -5.044  1.00 100.00 ? 714  ARG A C     1 
ATOM   5512 O  O     . ARG A 1 714 ? 10.337 70.148 -4.502  1.00 60.36  ? 714  ARG A O     1 
ATOM   5513 C  CB    . ARG A 1 714 ? 7.026  70.823 -4.070  1.00 76.93  ? 714  ARG A CB    1 
ATOM   5514 N  N     . ASP A 1 715 ? 9.018  70.542 -6.355  1.00 100.00 ? 715  ASP A N     1 
ATOM   5515 C  CA    . ASP A 1 715 ? 9.805  69.801 -7.353  1.00 100.00 ? 715  ASP A CA    1 
ATOM   5516 C  C     . ASP A 1 715 ? 10.634 70.718 -8.263  1.00 100.00 ? 715  ASP A C     1 
ATOM   5517 O  O     . ASP A 1 715 ? 10.116 71.417 -9.143  1.00 100.00 ? 715  ASP A O     1 
ATOM   5518 C  CB    . ASP A 1 715 ? 9.017  68.747 -8.145  1.00 91.69  ? 715  ASP A CB    1 
ATOM   5519 N  N     . ALA A 1 716 ? 11.941 70.691 -8.020  1.00 100.00 ? 716  ALA A N     1 
ATOM   5520 C  CA    . ALA A 1 716 ? 12.891 71.496 -8.732  1.00 84.35  ? 716  ALA A CA    1 
ATOM   5521 C  C     . ALA A 1 716 ? 13.973 70.595 -9.312  1.00 71.03  ? 716  ALA A C     1 
ATOM   5522 O  O     . ALA A 1 716 ? 14.408 69.631 -8.661  1.00 100.00 ? 716  ALA A O     1 
ATOM   5523 C  CB    . ALA A 1 716 ? 13.433 72.506 -7.718  1.00 43.53  ? 716  ALA A CB    1 
ATOM   5524 N  N     . GLU A 1 717 ? 14.423 70.855 -10.524 1.00 100.00 ? 717  GLU A N     1 
ATOM   5525 C  CA    . GLU A 1 717 ? 15.461 69.967 -10.962 1.00 100.00 ? 717  GLU A CA    1 
ATOM   5526 C  C     . GLU A 1 717 ? 16.764 70.316 -10.258 1.00 100.00 ? 717  GLU A C     1 
ATOM   5527 O  O     . GLU A 1 717 ? 17.571 69.427 -9.978  1.00 100.00 ? 717  GLU A O     1 
ATOM   5528 C  CB    . GLU A 1 717 ? 15.556 69.765 -12.480 1.00 100.00 ? 717  GLU A CB    1 
ATOM   5529 C  CG    . GLU A 1 717 ? 15.852 71.072 -13.222 1.00 100.00 ? 717  GLU A CG    1 
ATOM   5530 C  CD    . GLU A 1 717 ? 16.187 70.841 -14.666 1.00 100.00 ? 717  GLU A CD    1 
ATOM   5531 O  OE1   . GLU A 1 717 ? 16.964 69.965 -15.058 1.00 100.00 ? 717  GLU A OE1   1 
ATOM   5532 O  OE2   . GLU A 1 717 ? 15.566 71.696 -15.443 1.00 100.00 ? 717  GLU A OE2   1 
ATOM   5533 N  N     . ASP A 1 718 ? 16.924 71.608 -9.904  1.00 64.92  ? 718  ASP A N     1 
ATOM   5534 C  CA    . ASP A 1 718 ? 18.123 72.080 -9.189  1.00 100.00 ? 718  ASP A CA    1 
ATOM   5535 C  C     . ASP A 1 718 ? 18.058 71.946 -7.655  1.00 59.68  ? 718  ASP A C     1 
ATOM   5536 O  O     . ASP A 1 718 ? 18.318 72.900 -6.926  1.00 47.20  ? 718  ASP A O     1 
ATOM   5537 C  CB    . ASP A 1 718 ? 18.610 73.479 -9.660  1.00 100.00 ? 718  ASP A CB    1 
ATOM   5538 C  CG    . ASP A 1 718 ? 20.124 73.594 -9.737  1.00 100.00 ? 718  ASP A CG    1 
ATOM   5539 O  OD1   . ASP A 1 718 ? 20.886 72.876 -9.064  1.00 87.67  ? 718  ASP A OD1   1 
ATOM   5540 O  OD2   . ASP A 1 718 ? 20.529 74.540 -10.594 1.00 100.00 ? 718  ASP A OD2   1 
ATOM   5541 N  N     . SER A 1 719 ? 17.705 70.749 -7.182  1.00 63.04  ? 719  SER A N     1 
ATOM   5542 C  CA    . SER A 1 719 ? 17.547 70.430 -5.769  1.00 55.53  ? 719  SER A CA    1 
ATOM   5543 C  C     . SER A 1 719 ? 18.669 70.906 -4.800  1.00 60.60  ? 719  SER A C     1 
ATOM   5544 O  O     . SER A 1 719 ? 18.405 71.401 -3.708  1.00 69.13  ? 719  SER A O     1 
ATOM   5545 C  CB    . SER A 1 719 ? 16.995 69.025 -5.566  1.00 71.93  ? 719  SER A CB    1 
ATOM   5546 O  OG    . SER A 1 719 ? 15.640 68.979 -5.987  1.00 68.23  ? 719  SER A OG    1 
ATOM   5547 N  N     . GLN A 1 720 ? 19.937 70.802 -5.194  1.00 47.97  ? 720  GLN A N     1 
ATOM   5548 C  CA    . GLN A 1 720 ? 21.011 71.265 -4.329  1.00 46.63  ? 720  GLN A CA    1 
ATOM   5549 C  C     . GLN A 1 720 ? 20.839 72.766 -4.095  1.00 86.04  ? 720  GLN A C     1 
ATOM   5550 O  O     . GLN A 1 720 ? 20.942 73.302 -2.974  1.00 41.94  ? 720  GLN A O     1 
ATOM   5551 C  CB    . GLN A 1 720 ? 22.398 70.977 -4.955  1.00 39.36  ? 720  GLN A CB    1 
ATOM   5552 C  CG    . GLN A 1 720 ? 23.279 69.918 -4.266  1.00 62.29  ? 720  GLN A CG    1 
ATOM   5553 C  CD    . GLN A 1 720 ? 24.768 70.020 -4.591  1.00 100.00 ? 720  GLN A CD    1 
ATOM   5554 O  OE1   . GLN A 1 720 ? 25.459 70.904 -4.065  1.00 57.54  ? 720  GLN A OE1   1 
ATOM   5555 N  NE2   . GLN A 1 720 ? 25.269 69.121 -5.455  1.00 100.00 ? 720  GLN A NE2   1 
ATOM   5556 N  N     . LYS A 1 721 ? 20.580 73.446 -5.214  1.00 76.73  ? 721  LYS A N     1 
ATOM   5557 C  CA    . LYS A 1 721 ? 20.358 74.879 -5.211  1.00 88.97  ? 721  LYS A CA    1 
ATOM   5558 C  C     . LYS A 1 721 ? 19.102 75.151 -4.410  1.00 55.73  ? 721  LYS A C     1 
ATOM   5559 O  O     . LYS A 1 721 ? 19.107 75.971 -3.511  1.00 62.70  ? 721  LYS A O     1 
ATOM   5560 C  CB    . LYS A 1 721 ? 20.231 75.457 -6.610  1.00 58.69  ? 721  LYS A CB    1 
ATOM   5561 C  CG    . LYS A 1 721 ? 20.818 76.847 -6.777  1.00 82.58  ? 721  LYS A CG    1 
ATOM   5562 C  CD    . LYS A 1 721 ? 20.691 77.358 -8.206  1.00 100.00 ? 721  LYS A CD    1 
ATOM   5563 C  CE    . LYS A 1 721 ? 19.421 78.168 -8.441  1.00 100.00 ? 721  LYS A CE    1 
ATOM   5564 N  NZ    . LYS A 1 721 ? 18.380 77.420 -9.176  1.00 97.16  ? 721  LYS A NZ    1 
ATOM   5565 N  N     . ALA A 1 722 ? 18.039 74.413 -4.731  1.00 51.37  ? 722  ALA A N     1 
ATOM   5566 C  CA    . ALA A 1 722 ? 16.796 74.514 -4.025  1.00 34.74  ? 722  ALA A CA    1 
ATOM   5567 C  C     . ALA A 1 722 ? 17.083 74.341 -2.538  1.00 100.00 ? 722  ALA A C     1 
ATOM   5568 O  O     . ALA A 1 722 ? 16.462 75.026 -1.733  1.00 79.29  ? 722  ALA A O     1 
ATOM   5569 C  CB    . ALA A 1 722 ? 15.820 73.456 -4.521  1.00 64.18  ? 722  ALA A CB    1 
ATOM   5570 N  N     . THR A 1 723 ? 18.060 73.448 -2.201  1.00 99.87  ? 723  THR A N     1 
ATOM   5571 C  CA    . THR A 1 723 ? 18.484 73.159 -0.814  1.00 71.30  ? 723  THR A CA    1 
ATOM   5572 C  C     . THR A 1 723 ? 19.167 74.340 -0.129  1.00 100.00 ? 723  THR A C     1 
ATOM   5573 O  O     . THR A 1 723 ? 18.933 74.654 1.034   1.00 78.20  ? 723  THR A O     1 
ATOM   5574 C  CB    . THR A 1 723 ? 19.342 71.889 -0.696  1.00 84.73  ? 723  THR A CB    1 
ATOM   5575 O  OG1   . THR A 1 723 ? 18.453 70.785 -0.820  1.00 41.39  ? 723  THR A OG1   1 
ATOM   5576 C  CG2   . THR A 1 723 ? 20.152 71.851 0.627   1.00 38.65  ? 723  THR A CG2   1 
ATOM   5577 N  N     . ASP A 1 724 ? 20.030 74.987 -0.877  1.00 100.00 ? 724  ASP A N     1 
ATOM   5578 C  CA    . ASP A 1 724 ? 20.753 76.144 -0.408  1.00 59.55  ? 724  ASP A CA    1 
ATOM   5579 C  C     . ASP A 1 724 ? 19.832 77.336 -0.129  1.00 97.12  ? 724  ASP A C     1 
ATOM   5580 O  O     . ASP A 1 724 ? 20.203 78.244 0.648   1.00 70.56  ? 724  ASP A O     1 
ATOM   5581 C  CB    . ASP A 1 724 ? 21.800 76.497 -1.488  1.00 91.03  ? 724  ASP A CB    1 
ATOM   5582 C  CG    . ASP A 1 724 ? 22.640 77.726 -1.235  1.00 77.67  ? 724  ASP A CG    1 
ATOM   5583 O  OD1   . ASP A 1 724 ? 22.845 77.978 0.052   1.00 59.41  ? 724  ASP A OD1   1 
ATOM   5584 O  OD2   . ASP A 1 724 ? 23.089 78.405 -2.161  1.00 82.70  ? 724  ASP A OD2   1 
ATOM   5585 N  N     . ALA A 1 725 ? 18.644 77.314 -0.788  1.00 75.38  ? 725  ALA A N     1 
ATOM   5586 C  CA    . ALA A 1 725 ? 17.593 78.357 -0.709  1.00 100.00 ? 725  ALA A CA    1 
ATOM   5587 C  C     . ALA A 1 725 ? 16.913 78.469 0.650   1.00 55.33  ? 725  ALA A C     1 
ATOM   5588 O  O     . ALA A 1 725 ? 16.954 79.511 1.323   1.00 53.50  ? 725  ALA A O     1 
ATOM   5589 C  CB    . ALA A 1 725 ? 16.519 78.218 -1.797  1.00 80.49  ? 725  ALA A CB    1 
ATOM   5590 N  N     . VAL A 1 726 ? 16.245 77.372 0.998   1.00 56.36  ? 726  VAL A N     1 
ATOM   5591 C  CA    . VAL A 1 726 ? 15.547 77.278 2.249   1.00 96.21  ? 726  VAL A CA    1 
ATOM   5592 C  C     . VAL A 1 726 ? 16.513 77.675 3.355   1.00 55.27  ? 726  VAL A C     1 
ATOM   5593 O  O     . VAL A 1 726 ? 16.227 78.606 4.119   1.00 41.94  ? 726  VAL A O     1 
ATOM   5594 C  CB    . VAL A 1 726 ? 15.002 75.867 2.427   1.00 67.73  ? 726  VAL A CB    1 
ATOM   5595 C  CG1   . VAL A 1 726 ? 13.869 75.882 3.437   1.00 55.47  ? 726  VAL A CG1   1 
ATOM   5596 C  CG2   . VAL A 1 726 ? 14.515 75.289 1.087   1.00 44.77  ? 726  VAL A CG2   1 
ATOM   5597 N  N     . LEU A 1 727 ? 17.681 76.981 3.351   1.00 46.89  ? 727  LEU A N     1 
ATOM   5598 C  CA    . LEU A 1 727 ? 18.807 77.148 4.276   1.00 46.58  ? 727  LEU A CA    1 
ATOM   5599 C  C     . LEU A 1 727 ? 19.139 78.605 4.436   1.00 61.11  ? 727  LEU A C     1 
ATOM   5600 O  O     . LEU A 1 727 ? 19.186 79.161 5.531   1.00 62.01  ? 727  LEU A O     1 
ATOM   5601 C  CB    . LEU A 1 727 ? 20.059 76.341 3.853   1.00 40.34  ? 727  LEU A CB    1 
ATOM   5602 C  CG    . LEU A 1 727 ? 20.166 74.952 4.560   1.00 77.07  ? 727  LEU A CG    1 
ATOM   5603 C  CD1   . LEU A 1 727 ? 18.796 74.286 4.779   1.00 56.76  ? 727  LEU A CD1   1 
ATOM   5604 C  CD2   . LEU A 1 727 ? 21.008 73.967 3.748   1.00 52.89  ? 727  LEU A CD2   1 
ATOM   5605 N  N     . LYS A 1 728 ? 19.337 79.215 3.290   1.00 100.00 ? 728  LYS A N     1 
ATOM   5606 C  CA    . LYS A 1 728 ? 19.599 80.616 3.217   1.00 100.00 ? 728  LYS A CA    1 
ATOM   5607 C  C     . LYS A 1 728 ? 18.368 81.391 3.653   1.00 100.00 ? 728  LYS A C     1 
ATOM   5608 O  O     . LYS A 1 728 ? 18.463 82.371 4.410   1.00 98.10  ? 728  LYS A O     1 
ATOM   5609 C  CB    . LYS A 1 728 ? 19.996 80.956 1.797   1.00 100.00 ? 728  LYS A CB    1 
ATOM   5610 C  CG    . LYS A 1 728 ? 21.439 81.390 1.737   1.00 100.00 ? 728  LYS A CG    1 
ATOM   5611 C  CD    . LYS A 1 728 ? 22.077 81.245 0.379   1.00 78.36  ? 728  LYS A CD    1 
ATOM   5612 C  CE    . LYS A 1 728 ? 23.579 81.249 0.576   1.00 100.00 ? 728  LYS A CE    1 
ATOM   5613 N  NZ    . LYS A 1 728 ? 23.946 81.199 2.010   1.00 98.74  ? 728  LYS A NZ    1 
ATOM   5614 N  N     . HIS A 1 729 ? 17.213 80.927 3.166   1.00 47.15  ? 729  HIS A N     1 
ATOM   5615 C  CA    . HIS A 1 729 ? 15.995 81.575 3.543   1.00 33.69  ? 729  HIS A CA    1 
ATOM   5616 C  C     . HIS A 1 729 ? 16.001 81.686 5.051   1.00 87.20  ? 729  HIS A C     1 
ATOM   5617 O  O     . HIS A 1 729 ? 15.944 82.776 5.652   1.00 64.43  ? 729  HIS A O     1 
ATOM   5618 C  CB    . HIS A 1 729 ? 14.750 80.821 3.079   1.00 46.30  ? 729  HIS A CB    1 
ATOM   5619 C  CG    . HIS A 1 729 ? 13.681 81.725 3.512   1.00 100.00 ? 729  HIS A CG    1 
ATOM   5620 N  ND1   . HIS A 1 729 ? 13.398 82.864 2.777   1.00 97.41  ? 729  HIS A ND1   1 
ATOM   5621 C  CD2   . HIS A 1 729 ? 12.973 81.751 4.681   1.00 100.00 ? 729  HIS A CD2   1 
ATOM   5622 C  CE1   . HIS A 1 729 ? 12.481 83.525 3.470   1.00 100.00 ? 729  HIS A CE1   1 
ATOM   5623 N  NE2   . HIS A 1 729 ? 12.205 82.887 4.622   1.00 100.00 ? 729  HIS A NE2   1 
ATOM   5624 N  N     . LEU A 1 730 ? 16.168 80.489 5.606   1.00 100.00 ? 730  LEU A N     1 
ATOM   5625 C  CA    . LEU A 1 730 ? 16.248 80.202 7.015   1.00 68.82  ? 730  LEU A CA    1 
ATOM   5626 C  C     . LEU A 1 730 ? 17.440 80.843 7.716   1.00 54.14  ? 730  LEU A C     1 
ATOM   5627 O  O     . LEU A 1 730 ? 17.448 80.903 8.949   1.00 100.00 ? 730  LEU A O     1 
ATOM   5628 C  CB    . LEU A 1 730 ? 16.317 78.686 7.192   1.00 39.12  ? 730  LEU A CB    1 
ATOM   5629 C  CG    . LEU A 1 730 ? 15.084 77.979 6.662   1.00 85.71  ? 730  LEU A CG    1 
ATOM   5630 C  CD1   . LEU A 1 730 ? 15.102 76.530 7.125   1.00 49.73  ? 730  LEU A CD1   1 
ATOM   5631 C  CD2   . LEU A 1 730 ? 13.846 78.693 7.200   1.00 83.27  ? 730  LEU A CD2   1 
ATOM   5632 N  N     . ASN A 1 731 ? 18.455 81.294 6.941   1.00 83.95  ? 731  ASN A N     1 
ATOM   5633 C  CA    . ASN A 1 731 ? 19.635 81.911 7.546   1.00 72.47  ? 731  ASN A CA    1 
ATOM   5634 C  C     . ASN A 1 731 ? 20.267 80.921 8.540   1.00 78.68  ? 731  ASN A C     1 
ATOM   5635 O  O     . ASN A 1 731 ? 20.604 81.251 9.683   1.00 92.20  ? 731  ASN A O     1 
ATOM   5636 C  CB    . ASN A 1 731 ? 19.248 83.284 8.203   1.00 100.00 ? 731  ASN A CB    1 
ATOM   5637 C  CG    . ASN A 1 731 ? 20.315 84.099 8.991   1.00 100.00 ? 731  ASN A CG    1 
ATOM   5638 O  OD1   . ASN A 1 731 ? 20.009 84.718 10.044  1.00 100.00 ? 731  ASN A OD1   1 
ATOM   5639 N  ND2   . ASN A 1 731 ? 21.563 84.151 8.488   1.00 55.93  ? 731  ASN A ND2   1 
ATOM   5640 N  N     . ILE A 1 732 ? 20.395 79.671 8.111   1.00 100.00 ? 732  ILE A N     1 
ATOM   5641 C  CA    . ILE A 1 732 ? 20.974 78.652 8.973   1.00 58.06  ? 732  ILE A CA    1 
ATOM   5642 C  C     . ILE A 1 732 ? 22.499 78.736 8.980   1.00 100.00 ? 732  ILE A C     1 
ATOM   5643 O  O     . ILE A 1 732 ? 23.092 79.165 7.973   1.00 62.74  ? 732  ILE A O     1 
ATOM   5644 C  CB    . ILE A 1 732 ? 20.478 77.227 8.661   1.00 90.59  ? 732  ILE A CB    1 
ATOM   5645 C  CG1   . ILE A 1 732 ? 19.018 77.089 9.096   1.00 37.03  ? 732  ILE A CG1   1 
ATOM   5646 C  CG2   . ILE A 1 732 ? 21.362 76.151 9.343   1.00 38.27  ? 732  ILE A CG2   1 
ATOM   5647 C  CD1   . ILE A 1 732 ? 18.102 76.577 7.989   1.00 100.00 ? 732  ILE A CD1   1 
ATOM   5648 N  N     . ASP A 1 733 ? 23.099 78.327 10.128  1.00 59.18  ? 733  ASP A N     1 
ATOM   5649 C  CA    . ASP A 1 733 ? 24.543 78.325 10.326  1.00 100.00 ? 733  ASP A CA    1 
ATOM   5650 C  C     . ASP A 1 733 ? 25.282 77.325 9.420   1.00 48.45  ? 733  ASP A C     1 
ATOM   5651 O  O     . ASP A 1 733 ? 24.954 76.125 9.396   1.00 77.36  ? 733  ASP A O     1 
ATOM   5652 C  CB    . ASP A 1 733 ? 24.864 78.115 11.825  1.00 43.08  ? 733  ASP A CB    1 
ATOM   5653 C  CG    . ASP A 1 733 ? 26.324 78.029 12.193  1.00 100.00 ? 733  ASP A CG    1 
ATOM   5654 O  OD1   . ASP A 1 733 ? 27.141 78.486 11.257  1.00 48.57  ? 733  ASP A OD1   1 
ATOM   5655 O  OD2   . ASP A 1 733 ? 26.686 77.588 13.276  1.00 57.76  ? 733  ASP A OD2   1 
ATOM   5656 N  N     . PRO A 1 734 ? 26.295 77.839 8.684   1.00 100.00 ? 734  PRO A N     1 
ATOM   5657 C  CA    . PRO A 1 734 ? 27.140 77.053 7.803   1.00 100.00 ? 734  PRO A CA    1 
ATOM   5658 C  C     . PRO A 1 734 ? 27.820 75.868 8.462   1.00 100.00 ? 734  PRO A C     1 
ATOM   5659 O  O     . PRO A 1 734 ? 27.849 74.790 7.874   1.00 66.74  ? 734  PRO A O     1 
ATOM   5660 C  CB    . PRO A 1 734 ? 28.172 78.019 7.215   1.00 100.00 ? 734  PRO A CB    1 
ATOM   5661 C  CG    . PRO A 1 734 ? 27.492 79.378 7.244   1.00 100.00 ? 734  PRO A CG    1 
ATOM   5662 C  CD    . PRO A 1 734 ? 26.300 79.249 8.196   1.00 73.69  ? 734  PRO A CD    1 
ATOM   5663 N  N     . GLU A 1 735 ? 28.349 76.011 9.674   1.00 45.58  ? 735  GLU A N     1 
ATOM   5664 C  CA    . GLU A 1 735 ? 28.938 74.804 10.224  1.00 44.22  ? 735  GLU A CA    1 
ATOM   5665 C  C     . GLU A 1 735 ? 27.960 73.713 10.531  1.00 37.62  ? 735  GLU A C     1 
ATOM   5666 O  O     . GLU A 1 735 ? 28.373 72.573 10.664  1.00 79.63  ? 735  GLU A O     1 
ATOM   5667 C  CB    . GLU A 1 735 ? 29.988 74.867 11.339  1.00 58.72  ? 735  GLU A CB    1 
ATOM   5668 C  CG    . GLU A 1 735 ? 30.450 76.289 11.610  1.00 100.00 ? 735  GLU A CG    1 
ATOM   5669 C  CD    . GLU A 1 735 ? 30.347 76.603 13.071  1.00 100.00 ? 735  GLU A CD    1 
ATOM   5670 O  OE1   . GLU A 1 735 ? 29.104 76.474 13.524  1.00 100.00 ? 735  GLU A OE1   1 
ATOM   5671 O  OE2   . GLU A 1 735 ? 31.327 76.915 13.761  1.00 100.00 ? 735  GLU A OE2   1 
ATOM   5672 N  N     . GLN A 1 736 ? 26.675 74.065 10.663  1.00 51.10  ? 736  GLN A N     1 
ATOM   5673 C  CA    . GLN A 1 736 ? 25.635 73.089 10.978  1.00 100.00 ? 736  GLN A CA    1 
ATOM   5674 C  C     . GLN A 1 736 ? 25.257 72.130 9.865   1.00 100.00 ? 736  GLN A C     1 
ATOM   5675 O  O     . GLN A 1 736 ? 24.519 71.170 10.078  1.00 50.08  ? 736  GLN A O     1 
ATOM   5676 C  CB    . GLN A 1 736 ? 24.355 73.784 11.453  1.00 39.36  ? 736  GLN A CB    1 
ATOM   5677 C  CG    . GLN A 1 736 ? 24.466 74.257 12.906  1.00 100.00 ? 736  GLN A CG    1 
ATOM   5678 C  CD    . GLN A 1 736 ? 25.288 73.298 13.743  1.00 100.00 ? 736  GLN A CD    1 
ATOM   5679 O  OE1   . GLN A 1 736 ? 26.473 73.605 14.050  1.00 70.05  ? 736  GLN A OE1   1 
ATOM   5680 N  NE2   . GLN A 1 736 ? 24.663 72.147 14.099  1.00 92.85  ? 736  GLN A NE2   1 
ATOM   5681 N  N     . PHE A 1 737 ? 25.736 72.404 8.674   1.00 38.03  ? 737  PHE A N     1 
ATOM   5682 C  CA    . PHE A 1 737 ? 25.359 71.573 7.554   1.00 57.68  ? 737  PHE A CA    1 
ATOM   5683 C  C     . PHE A 1 737 ? 26.490 71.453 6.529   1.00 100.00 ? 737  PHE A C     1 
ATOM   5684 O  O     . PHE A 1 737 ? 27.308 72.376 6.383   1.00 71.69  ? 737  PHE A O     1 
ATOM   5685 C  CB    . PHE A 1 737 ? 23.995 72.065 6.988   1.00 33.91  ? 737  PHE A CB    1 
ATOM   5686 C  CG    . PHE A 1 737 ? 23.881 73.546 6.574   1.00 100.00 ? 737  PHE A CG    1 
ATOM   5687 C  CD1   . PHE A 1 737 ? 24.431 74.020 5.376   1.00 100.00 ? 737  PHE A CD1   1 
ATOM   5688 C  CD2   . PHE A 1 737 ? 23.167 74.460 7.357   1.00 86.17  ? 737  PHE A CD2   1 
ATOM   5689 C  CE1   . PHE A 1 737 ? 24.313 75.358 4.978   1.00 67.70  ? 737  PHE A CE1   1 
ATOM   5690 C  CE2   . PHE A 1 737 ? 23.035 75.798 6.967   1.00 100.00 ? 737  PHE A CE2   1 
ATOM   5691 C  CZ    . PHE A 1 737 ? 23.608 76.258 5.778   1.00 53.41  ? 737  PHE A CZ    1 
ATOM   5692 N  N     . ARG A 1 738 ? 26.599 70.300 5.847   1.00 53.64  ? 738  ARG A N     1 
ATOM   5693 C  CA    . ARG A 1 738 ? 27.677 70.177 4.879   1.00 57.85  ? 738  ARG A CA    1 
ATOM   5694 C  C     . ARG A 1 738 ? 27.110 69.734 3.559   1.00 100.00 ? 738  ARG A C     1 
ATOM   5695 O  O     . ARG A 1 738 ? 26.432 68.713 3.508   1.00 78.46  ? 738  ARG A O     1 
ATOM   5696 C  CB    . ARG A 1 738 ? 28.835 69.252 5.291   1.00 39.98  ? 738  ARG A CB    1 
ATOM   5697 C  CG    . ARG A 1 738 ? 30.068 69.958 5.858   1.00 91.60  ? 738  ARG A CG    1 
ATOM   5698 C  CD    . ARG A 1 738 ? 30.080 71.497 5.763   1.00 79.48  ? 738  ARG A CD    1 
ATOM   5699 N  NE    . ARG A 1 738 ? 29.826 72.235 7.024   1.00 60.28  ? 738  ARG A NE    1 
ATOM   5700 C  CZ    . ARG A 1 738 ? 30.658 72.365 8.075   1.00 93.25  ? 738  ARG A CZ    1 
ATOM   5701 N  NH1   . ARG A 1 738 ? 31.865 71.817 8.123   1.00 56.99  ? 738  ARG A NH1   1 
ATOM   5702 N  NH2   . ARG A 1 738 ? 30.284 73.069 9.128   1.00 91.62  ? 738  ARG A NH2   1 
ATOM   5703 N  N     . PHE A 1 739 ? 27.402 70.512 2.503   1.00 100.00 ? 739  PHE A N     1 
ATOM   5704 C  CA    . PHE A 1 739 ? 26.963 70.204 1.139   1.00 92.07  ? 739  PHE A CA    1 
ATOM   5705 C  C     . PHE A 1 739 ? 27.749 69.012 0.532   1.00 100.00 ? 739  PHE A C     1 
ATOM   5706 O  O     . PHE A 1 739 ? 28.980 69.036 0.238   1.00 61.37  ? 739  PHE A O     1 
ATOM   5707 C  CB    . PHE A 1 739 ? 26.802 71.444 0.182   1.00 60.32  ? 739  PHE A CB    1 
ATOM   5708 C  CG    . PHE A 1 739 ? 25.452 72.189 0.199   1.00 100.00 ? 739  PHE A CG    1 
ATOM   5709 C  CD1   . PHE A 1 739 ? 24.333 71.645 -0.438  1.00 75.85  ? 739  PHE A CD1   1 
ATOM   5710 C  CD2   . PHE A 1 739 ? 25.301 73.438 0.813   1.00 71.19  ? 739  PHE A CD2   1 
ATOM   5711 C  CE1   . PHE A 1 739 ? 23.090 72.281 -0.432  1.00 73.95  ? 739  PHE A CE1   1 
ATOM   5712 C  CE2   . PHE A 1 739 ? 24.067 74.096 0.837   1.00 44.86  ? 739  PHE A CE2   1 
ATOM   5713 C  CZ    . PHE A 1 739 ? 22.961 73.512 0.209   1.00 100.00 ? 739  PHE A CZ    1 
ATOM   5714 N  N     . GLY A 1 740 ? 27.009 67.914 0.397   1.00 67.61  ? 740  GLY A N     1 
ATOM   5715 C  CA    . GLY A 1 740 ? 27.543 66.701 -0.171  1.00 61.87  ? 740  GLY A CA    1 
ATOM   5716 C  C     . GLY A 1 740 ? 27.036 66.537 -1.597  1.00 63.82  ? 740  GLY A C     1 
ATOM   5717 O  O     . GLY A 1 740 ? 25.922 66.902 -1.940  1.00 69.53  ? 740  GLY A O     1 
ATOM   5718 N  N     . ILE A 1 741 ? 27.877 65.992 -2.434  1.00 40.94  ? 741  ILE A N     1 
ATOM   5719 C  CA    . ILE A 1 741 ? 27.538 65.759 -3.820  1.00 100.00 ? 741  ILE A CA    1 
ATOM   5720 C  C     . ILE A 1 741 ? 26.073 65.349 -4.058  1.00 72.45  ? 741  ILE A C     1 
ATOM   5721 O  O     . ILE A 1 741 ? 25.385 65.857 -4.947  1.00 87.83  ? 741  ILE A O     1 
ATOM   5722 C  CB    . ILE A 1 741 ? 28.527 64.713 -4.328  1.00 56.91  ? 741  ILE A CB    1 
ATOM   5723 C  CG1   . ILE A 1 741 ? 29.745 65.382 -4.950  1.00 70.73  ? 741  ILE A CG1   1 
ATOM   5724 C  CG2   . ILE A 1 741 ? 27.903 63.669 -5.249  1.00 67.20  ? 741  ILE A CG2   1 
ATOM   5725 C  CD1   . ILE A 1 741 ? 31.006 64.512 -4.957  1.00 100.00 ? 741  ILE A CD1   1 
ATOM   5726 N  N     . THR A 1 742 ? 25.584 64.458 -3.204  1.00 62.89  ? 742  THR A N     1 
ATOM   5727 C  CA    . THR A 1 742 ? 24.248 63.895 -3.317  1.00 100.00 ? 742  THR A CA    1 
ATOM   5728 C  C     . THR A 1 742 ? 23.289 64.196 -2.188  1.00 56.82  ? 742  THR A C     1 
ATOM   5729 O  O     . THR A 1 742 ? 22.063 64.189 -2.354  1.00 47.03  ? 742  THR A O     1 
ATOM   5730 C  CB    . THR A 1 742 ? 24.462 62.372 -3.334  1.00 65.35  ? 742  THR A CB    1 
ATOM   5731 O  OG1   . THR A 1 742 ? 24.757 61.964 -4.651  1.00 89.73  ? 742  THR A OG1   1 
ATOM   5732 C  CG2   . THR A 1 742 ? 23.302 61.542 -2.728  1.00 36.68  ? 742  THR A CG2   1 
ATOM   5733 N  N     . LYS A 1 743 ? 23.887 64.362 -1.027  1.00 100.00 ? 743  LYS A N     1 
ATOM   5734 C  CA    . LYS A 1 743 ? 23.157 64.568 0.187   1.00 43.37  ? 743  LYS A CA    1 
ATOM   5735 C  C     . LYS A 1 743 ? 23.572 65.863 0.880   1.00 100.00 ? 743  LYS A C     1 
ATOM   5736 O  O     . LYS A 1 743 ? 24.621 66.514 0.684   1.00 36.61  ? 743  LYS A O     1 
ATOM   5737 C  CB    . LYS A 1 743 ? 23.413 63.353 1.122   1.00 51.77  ? 743  LYS A CB    1 
ATOM   5738 C  CG    . LYS A 1 743 ? 22.703 62.037 0.769   1.00 79.93  ? 743  LYS A CG    1 
ATOM   5739 C  CD    . LYS A 1 743 ? 23.597 60.905 0.248   1.00 57.89  ? 743  LYS A CD    1 
ATOM   5740 C  CE    . LYS A 1 743 ? 23.425 59.550 0.934   1.00 85.61  ? 743  LYS A CE    1 
ATOM   5741 N  NZ    . LYS A 1 743 ? 24.571 59.159 1.798   1.00 65.58  ? 743  LYS A NZ    1 
ATOM   5742 N  N     . ILE A 1 744 ? 22.687 66.257 1.733   1.00 53.50  ? 744  ILE A N     1 
ATOM   5743 C  CA    . ILE A 1 744 ? 22.966 67.392 2.546   1.00 100.00 ? 744  ILE A CA    1 
ATOM   5744 C  C     . ILE A 1 744 ? 23.195 66.761 3.908   1.00 43.26  ? 744  ILE A C     1 
ATOM   5745 O  O     . ILE A 1 744 ? 22.362 65.960 4.414   1.00 45.51  ? 744  ILE A O     1 
ATOM   5746 C  CB    . ILE A 1 744 ? 21.880 68.476 2.472   1.00 100.00 ? 744  ILE A CB    1 
ATOM   5747 C  CG1   . ILE A 1 744 ? 22.333 69.957 2.570   1.00 62.26  ? 744  ILE A CG1   1 
ATOM   5748 C  CG2   . ILE A 1 744 ? 20.583 68.107 3.187   1.00 52.37  ? 744  ILE A CG2   1 
ATOM   5749 C  CD1   . ILE A 1 744 ? 23.125 70.358 3.801   1.00 42.30  ? 744  ILE A CD1   1 
ATOM   5750 N  N     . PHE A 1 745 ? 24.380 67.031 4.422   1.00 100.00 ? 745  PHE A N     1 
ATOM   5751 C  CA    . PHE A 1 745 ? 24.807 66.538 5.710   1.00 48.10  ? 745  PHE A CA    1 
ATOM   5752 C  C     . PHE A 1 745 ? 24.498 67.608 6.742   1.00 100.00 ? 745  PHE A C     1 
ATOM   5753 O  O     . PHE A 1 745 ? 24.973 68.770 6.634   1.00 31.14  ? 745  PHE A O     1 
ATOM   5754 C  CB    . PHE A 1 745 ? 26.311 66.281 5.709   1.00 53.26  ? 745  PHE A CB    1 
ATOM   5755 C  CG    . PHE A 1 745 ? 26.588 64.987 5.061   1.00 34.32  ? 745  PHE A CG    1 
ATOM   5756 C  CD1   . PHE A 1 745 ? 25.999 64.703 3.834   1.00 82.94  ? 745  PHE A CD1   1 
ATOM   5757 C  CD2   . PHE A 1 745 ? 27.401 64.034 5.665   1.00 81.19  ? 745  PHE A CD2   1 
ATOM   5758 C  CE1   . PHE A 1 745 ? 26.236 63.497 3.184   1.00 49.78  ? 745  PHE A CE1   1 
ATOM   5759 C  CE2   . PHE A 1 745 ? 27.653 62.819 5.031   1.00 100.00 ? 745  PHE A CE2   1 
ATOM   5760 C  CZ    . PHE A 1 745 ? 27.066 62.556 3.792   1.00 100.00 ? 745  PHE A CZ    1 
ATOM   5761 N  N     . PHE A 1 746 ? 23.687 67.167 7.721   1.00 35.57  ? 746  PHE A N     1 
ATOM   5762 C  CA    . PHE A 1 746 ? 23.218 67.965 8.831   1.00 48.24  ? 746  PHE A CA    1 
ATOM   5763 C  C     . PHE A 1 746 ? 23.682 67.410 10.123  1.00 66.20  ? 746  PHE A C     1 
ATOM   5764 O  O     . PHE A 1 746 ? 23.424 66.239 10.426  1.00 49.07  ? 746  PHE A O     1 
ATOM   5765 C  CB    . PHE A 1 746 ? 21.683 67.983 8.962   1.00 46.19  ? 746  PHE A CB    1 
ATOM   5766 C  CG    . PHE A 1 746 ? 21.057 69.061 8.120   1.00 86.24  ? 746  PHE A CG    1 
ATOM   5767 C  CD1   . PHE A 1 746 ? 21.425 70.403 8.272   1.00 55.57  ? 746  PHE A CD1   1 
ATOM   5768 C  CD2   . PHE A 1 746 ? 20.104 68.721 7.160   1.00 64.08  ? 746  PHE A CD2   1 
ATOM   5769 C  CE1   . PHE A 1 746 ? 20.835 71.405 7.504   1.00 82.72  ? 746  PHE A CE1   1 
ATOM   5770 C  CE2   . PHE A 1 746 ? 19.514 69.710 6.375   1.00 100.00 ? 746  PHE A CE2   1 
ATOM   5771 C  CZ    . PHE A 1 746 ? 19.878 71.048 6.554   1.00 78.17  ? 746  PHE A CZ    1 
ATOM   5772 N  N     . ARG A 1 747 ? 24.323 68.290 10.875  1.00 54.45  ? 747  ARG A N     1 
ATOM   5773 C  CA    . ARG A 1 747 ? 24.726 67.936 12.199  1.00 100.00 ? 747  ARG A CA    1 
ATOM   5774 C  C     . ARG A 1 747 ? 23.486 67.794 13.093  1.00 100.00 ? 747  ARG A C     1 
ATOM   5775 O  O     . ARG A 1 747 ? 22.325 68.010 12.681  1.00 42.15  ? 747  ARG A O     1 
ATOM   5776 C  CB    . ARG A 1 747 ? 25.775 68.872 12.738  1.00 34.34  ? 747  ARG A CB    1 
ATOM   5777 C  CG    . ARG A 1 747 ? 27.031 68.621 11.925  1.00 52.33  ? 747  ARG A CG    1 
ATOM   5778 C  CD    . ARG A 1 747 ? 28.319 68.627 12.732  1.00 99.05  ? 747  ARG A CD    1 
ATOM   5779 N  NE    . ARG A 1 747 ? 28.889 69.960 12.789  1.00 72.11  ? 747  ARG A NE    1 
ATOM   5780 C  CZ    . ARG A 1 747 ? 30.079 70.284 12.311  1.00 54.85  ? 747  ARG A CZ    1 
ATOM   5781 N  NH1   . ARG A 1 747 ? 30.879 69.363 11.745  1.00 100.00 ? 747  ARG A NH1   1 
ATOM   5782 N  NH2   . ARG A 1 747 ? 30.479 71.575 12.406  1.00 100.00 ? 747  ARG A NH2   1 
ATOM   5783 N  N     . ALA A 1 748 ? 23.743 67.401 14.336  1.00 100.00 ? 748  ALA A N     1 
ATOM   5784 C  CA    . ALA A 1 748 ? 22.702 67.158 15.331  1.00 64.05  ? 748  ALA A CA    1 
ATOM   5785 C  C     . ALA A 1 748 ? 21.859 68.371 15.758  1.00 100.00 ? 748  ALA A C     1 
ATOM   5786 O  O     . ALA A 1 748 ? 22.395 69.457 16.004  1.00 100.00 ? 748  ALA A O     1 
ATOM   5787 C  CB    . ALA A 1 748 ? 23.261 66.394 16.522  1.00 57.19  ? 748  ALA A CB    1 
ATOM   5788 N  N     . GLY A 1 749 ? 20.523 68.145 15.827  1.00 37.54  ? 749  GLY A N     1 
ATOM   5789 C  CA    . GLY A 1 749 ? 19.483 69.098 16.205  1.00 100.00 ? 749  GLY A CA    1 
ATOM   5790 C  C     . GLY A 1 749 ? 19.067 70.037 15.090  1.00 38.58  ? 749  GLY A C     1 
ATOM   5791 O  O     . GLY A 1 749 ? 17.956 70.583 15.065  1.00 46.66  ? 749  GLY A O     1 
ATOM   5792 N  N     . GLN A 1 750 ? 20.002 70.255 14.184  1.00 51.17  ? 750  GLN A N     1 
ATOM   5793 C  CA    . GLN A 1 750 ? 19.803 71.149 13.067  1.00 100.00 ? 750  GLN A CA    1 
ATOM   5794 C  C     . GLN A 1 750 ? 18.462 70.917 12.351  1.00 40.66  ? 750  GLN A C     1 
ATOM   5795 O  O     . GLN A 1 750 ? 17.609 71.797 12.186  1.00 59.34  ? 750  GLN A O     1 
ATOM   5796 C  CB    . GLN A 1 750 ? 21.011 71.059 12.083  1.00 55.47  ? 750  GLN A CB    1 
ATOM   5797 C  CG    . GLN A 1 750 ? 20.949 72.198 11.046  1.00 73.24  ? 750  GLN A CG    1 
ATOM   5798 C  CD    . GLN A 1 750 ? 20.472 73.496 11.681  1.00 100.00 ? 750  GLN A CD    1 
ATOM   5799 O  OE1   . GLN A 1 750 ? 21.291 74.335 12.070  1.00 45.58  ? 750  GLN A OE1   1 
ATOM   5800 N  NE2   . GLN A 1 750 ? 19.149 73.667 11.825  1.00 36.38  ? 750  GLN A NE2   1 
ATOM   5801 N  N     . LEU A 1 751 ? 18.334 69.703 11.871  1.00 35.26  ? 751  LEU A N     1 
ATOM   5802 C  CA    . LEU A 1 751 ? 17.203 69.304 11.110  1.00 36.29  ? 751  LEU A CA    1 
ATOM   5803 C  C     . LEU A 1 751 ? 15.959 69.402 11.978  1.00 100.00 ? 751  LEU A C     1 
ATOM   5804 O  O     . LEU A 1 751 ? 14.891 69.732 11.485  1.00 39.28  ? 751  LEU A O     1 
ATOM   5805 C  CB    . LEU A 1 751 ? 17.503 67.908 10.494  1.00 26.35  ? 751  LEU A CB    1 
ATOM   5806 C  CG    . LEU A 1 751 ? 16.349 67.228 9.753   1.00 100.00 ? 751  LEU A CG    1 
ATOM   5807 C  CD1   . LEU A 1 751 ? 15.979 68.009 8.490   1.00 63.33  ? 751  LEU A CD1   1 
ATOM   5808 C  CD2   . LEU A 1 751 ? 16.738 65.795 9.391   1.00 34.89  ? 751  LEU A CD2   1 
ATOM   5809 N  N     . ALA A 1 752 ? 16.105 69.179 13.292  1.00 53.22  ? 752  ALA A N     1 
ATOM   5810 C  CA    . ALA A 1 752 ? 14.953 69.259 14.185  1.00 39.72  ? 752  ALA A CA    1 
ATOM   5811 C  C     . ALA A 1 752 ? 14.427 70.682 14.264  1.00 88.48  ? 752  ALA A C     1 
ATOM   5812 O  O     . ALA A 1 752 ? 13.224 70.912 14.275  1.00 54.69  ? 752  ALA A O     1 
ATOM   5813 C  CB    . ALA A 1 752 ? 15.276 68.733 15.580  1.00 51.33  ? 752  ALA A CB    1 
ATOM   5814 N  N     . ARG A 1 753 ? 15.358 71.638 14.292  1.00 39.53  ? 753  ARG A N     1 
ATOM   5815 C  CA    . ARG A 1 753 ? 15.092 73.083 14.343  1.00 51.43  ? 753  ARG A CA    1 
ATOM   5816 C  C     . ARG A 1 753 ? 14.309 73.481 13.120  1.00 55.51  ? 753  ARG A C     1 
ATOM   5817 O  O     . ARG A 1 753 ? 13.272 74.146 13.182  1.00 52.76  ? 753  ARG A O     1 
ATOM   5818 C  CB    . ARG A 1 753 ? 16.418 73.866 14.328  1.00 57.44  ? 753  ARG A CB    1 
ATOM   5819 C  CG    . ARG A 1 753 ? 17.168 73.783 15.662  1.00 67.14  ? 753  ARG A CG    1 
ATOM   5820 C  CD    . ARG A 1 753 ? 16.271 73.255 16.800  1.00 100.00 ? 753  ARG A CD    1 
ATOM   5821 N  NE    . ARG A 1 753 ? 16.872 73.234 18.152  1.00 100.00 ? 753  ARG A NE    1 
ATOM   5822 C  CZ    . ARG A 1 753 ? 17.941 72.494 18.496  1.00 100.00 ? 753  ARG A CZ    1 
ATOM   5823 N  NH1   . ARG A 1 753 ? 18.542 71.695 17.605  1.00 87.60  ? 753  ARG A NH1   1 
ATOM   5824 N  NH2   . ARG A 1 753 ? 18.400 72.541 19.753  1.00 88.22  ? 753  ARG A NH2   1 
ATOM   5825 N  N     . ILE A 1 754 ? 14.902 73.053 12.006  1.00 38.27  ? 754  ILE A N     1 
ATOM   5826 C  CA    . ILE A 1 754 ? 14.436 73.235 10.652  1.00 100.00 ? 754  ILE A CA    1 
ATOM   5827 C  C     . ILE A 1 754 ? 13.035 72.678 10.480  1.00 35.59  ? 754  ILE A C     1 
ATOM   5828 O  O     . ILE A 1 754 ? 12.169 73.258 9.869   1.00 50.17  ? 754  ILE A O     1 
ATOM   5829 C  CB    . ILE A 1 754 ? 15.380 72.474 9.724   1.00 56.81  ? 754  ILE A CB    1 
ATOM   5830 C  CG1   . ILE A 1 754 ? 16.687 73.245 9.557   1.00 44.67  ? 754  ILE A CG1   1 
ATOM   5831 C  CG2   . ILE A 1 754 ? 14.686 72.229 8.383   1.00 54.63  ? 754  ILE A CG2   1 
ATOM   5832 C  CD1   . ILE A 1 754 ? 17.658 72.614 8.562   1.00 44.97  ? 754  ILE A CD1   1 
ATOM   5833 N  N     . GLU A 1 755 ? 12.863 71.496 11.000  1.00 73.13  ? 755  GLU A N     1 
ATOM   5834 C  CA    . GLU A 1 755 ? 11.591 70.863 10.917  1.00 68.56  ? 755  GLU A CA    1 
ATOM   5835 C  C     . GLU A 1 755 ? 10.658 71.803 11.664  1.00 63.45  ? 755  GLU A C     1 
ATOM   5836 O  O     . GLU A 1 755 ? 9.527  72.062 11.198  1.00 71.69  ? 755  GLU A O     1 
ATOM   5837 C  CB    . GLU A 1 755 ? 11.719 69.397 11.462  1.00 56.66  ? 755  GLU A CB    1 
ATOM   5838 C  CG    . GLU A 1 755 ? 10.406 68.632 11.804  1.00 55.86  ? 755  GLU A CG    1 
ATOM   5839 C  CD    . GLU A 1 755 ? 9.529  68.232 10.639  1.00 91.80  ? 755  GLU A CD    1 
ATOM   5840 O  OE1   . GLU A 1 755 ? 10.073 68.481 9.472   1.00 60.71  ? 755  GLU A OE1   1 
ATOM   5841 O  OE2   . GLU A 1 755 ? 8.420  67.745 10.778  1.00 50.08  ? 755  GLU A OE2   1 
ATOM   5842 N  N     . GLU A 1 756 ? 11.240 72.365 12.765  1.00 92.26  ? 756  GLU A N     1 
ATOM   5843 C  CA    . GLU A 1 756 ? 10.635 73.289 13.740  1.00 62.96  ? 756  GLU A CA    1 
ATOM   5844 C  C     . GLU A 1 756 ? 10.296 74.696 13.234  1.00 100.00 ? 756  GLU A C     1 
ATOM   5845 O  O     . GLU A 1 756 ? 9.786  75.501 14.012  1.00 100.00 ? 756  GLU A O     1 
ATOM   5846 C  CB    . GLU A 1 756 ? 11.449 73.332 15.063  1.00 97.17  ? 756  GLU A CB    1 
ATOM   5847 C  CG    . GLU A 1 756 ? 11.205 72.113 15.990  1.00 75.90  ? 756  GLU A CG    1 
ATOM   5848 C  CD    . GLU A 1 756 ? 12.225 71.970 17.093  1.00 100.00 ? 756  GLU A CD    1 
ATOM   5849 O  OE1   . GLU A 1 756 ? 12.847 73.089 17.373  1.00 93.42  ? 756  GLU A OE1   1 
ATOM   5850 O  OE2   . GLU A 1 756 ? 12.459 70.909 17.640  1.00 86.96  ? 756  GLU A OE2   1 
ATOM   5851 N  N     . ALA A 1 757 ? 10.560 74.972 11.935  1.00 92.06  ? 757  ALA A N     1 
ATOM   5852 C  CA    . ALA A 1 757 ? 10.321 76.260 11.256  1.00 94.94  ? 757  ALA A CA    1 
ATOM   5853 C  C     . ALA A 1 757 ? 8.884  76.483 10.683  1.00 53.53  ? 757  ALA A C     1 
ATOM   5854 O  O     . ALA A 1 757 ? 8.143  75.524 10.410  1.00 75.46  ? 757  ALA A O     1 
ATOM   5855 C  CB    . ALA A 1 757 ? 11.404 76.468 10.201  1.00 48.17  ? 757  ALA A CB    1 
ATOM   5856 N  N     . ARG A 1 758 ? 8.474  77.781 10.527  1.00 100.00 ? 758  ARG A N     1 
ATOM   5857 C  CA    . ARG A 1 758 ? 7.144  78.179 10.013  1.00 100.00 ? 758  ARG A CA    1 
ATOM   5858 C  C     . ARG A 1 758 ? 7.059  78.203 8.483   1.00 100.00 ? 758  ARG A C     1 
ATOM   5859 O  O     . ARG A 1 758 ? 8.020  78.614 7.787   1.00 71.95  ? 758  ARG A O     1 
ATOM   5860 C  CB    . ARG A 1 758 ? 6.652  79.489 10.623  1.00 72.92  ? 758  ARG A CB    1 
ATOM   5861 N  N     . GLU A 1 759 ? 5.914  77.718 7.972   1.00 68.72  ? 759  GLU A N     1 
ATOM   5862 C  CA    . GLU A 1 759 ? 5.688  77.677 6.528   1.00 100.00 ? 759  GLU A CA    1 
ATOM   5863 C  C     . GLU A 1 759 ? 5.259  79.049 5.919   1.00 100.00 ? 759  GLU A C     1 
ATOM   5864 O  O     . GLU A 1 759 ? 6.091  79.588 5.052   1.00 100.00 ? 759  GLU A O     1 
ATOM   5865 C  CB    . GLU A 1 759 ? 4.818  76.489 6.118   1.00 51.17  ? 759  GLU A CB    1 
HETATM 5866 MG MG    . MG  B 2 .   ? 19.220 30.505 20.138  1.00 19.06  ? 998  MG  A MG    1 
HETATM 5867 P  PG    . AGS C 3 .   ? 19.268 31.770 23.126  1.00 35.05  ? 999  AGS A PG    1 
HETATM 5868 S  S1G   . AGS C 3 .   ? 21.065 32.639 23.413  1.00 49.44  ? 999  AGS A S1G   1 
HETATM 5869 O  O2G   . AGS C 3 .   ? 18.713 31.367 24.546  1.00 37.72  ? 999  AGS A O2G   1 
HETATM 5870 O  O3G   . AGS C 3 .   ? 19.419 30.562 22.220  1.00 14.73  ? 999  AGS A O3G   1 
HETATM 5871 P  PB    . AGS C 3 .   ? 17.866 33.370 21.089  1.00 17.26  ? 999  AGS A PB    1 
HETATM 5872 O  O1B   . AGS C 3 .   ? 18.381 34.736 20.924  1.00 11.01  ? 999  AGS A O1B   1 
HETATM 5873 O  O2B   . AGS C 3 .   ? 18.364 32.276 20.112  1.00 16.97  ? 999  AGS A O2B   1 
HETATM 5874 O  O3B   . AGS C 3 .   ? 18.173 32.841 22.584  1.00 24.80  ? 999  AGS A O3B   1 
HETATM 5875 P  PA    . AGS C 3 .   ? 15.223 32.680 20.323  1.00 34.39  ? 999  AGS A PA    1 
HETATM 5876 O  O1A   . AGS C 3 .   ? 15.301 32.939 18.769  1.00 23.91  ? 999  AGS A O1A   1 
HETATM 5877 O  O2A   . AGS C 3 .   ? 15.270 31.169 20.572  1.00 27.81  ? 999  AGS A O2A   1 
HETATM 5878 O  O3A   . AGS C 3 .   ? 16.296 33.429 21.145  1.00 19.67  ? 999  AGS A O3A   1 
HETATM 5879 O  "O5'" . AGS C 3 .   ? 13.895 33.409 20.870  1.00 39.31  ? 999  AGS A "O5'" 1 
HETATM 5880 C  "C5'" . AGS C 3 .   ? 13.156 32.787 21.952  1.00 32.25  ? 999  AGS A "C5'" 1 
HETATM 5881 C  "C4'" . AGS C 3 .   ? 11.671 32.879 21.645  1.00 29.12  ? 999  AGS A "C4'" 1 
HETATM 5882 O  "O4'" . AGS C 3 .   ? 11.338 34.239 21.298  1.00 40.36  ? 999  AGS A "O4'" 1 
HETATM 5883 C  "C3'" . AGS C 3 .   ? 11.203 32.098 20.420  1.00 58.52  ? 999  AGS A "C3'" 1 
HETATM 5884 O  "O3'" . AGS C 3 .   ? 11.227 30.645 20.593  1.00 53.96  ? 999  AGS A "O3'" 1 
HETATM 5885 C  "C2'" . AGS C 3 .   ? 9.870  32.845 20.212  1.00 42.04  ? 999  AGS A "C2'" 1 
HETATM 5886 O  "O2'" . AGS C 3 .   ? 8.853  32.591 21.205  1.00 100.00 ? 999  AGS A "O2'" 1 
HETATM 5887 C  "C1'" . AGS C 3 .   ? 10.315 34.261 20.396  1.00 74.03  ? 999  AGS A "C1'" 1 
HETATM 5888 N  N9    . AGS C 3 .   ? 10.700 34.897 19.153  1.00 44.16  ? 999  AGS A N9    1 
HETATM 5889 C  C8    . AGS C 3 .   ? 11.902 35.271 18.665  1.00 41.35  ? 999  AGS A C8    1 
HETATM 5890 N  N7    . AGS C 3 .   ? 11.791 36.062 17.588  1.00 42.25  ? 999  AGS A N7    1 
HETATM 5891 C  C5    . AGS C 3 .   ? 10.424 36.081 17.338  1.00 100.00 ? 999  AGS A C5    1 
HETATM 5892 C  C6    . AGS C 3 .   ? 9.656  36.702 16.326  1.00 100.00 ? 999  AGS A C6    1 
HETATM 5893 N  N6    . AGS C 3 .   ? 10.064 37.403 15.377  1.00 29.60  ? 999  AGS A N6    1 
HETATM 5894 N  N1    . AGS C 3 .   ? 8.322  36.453 16.468  1.00 39.54  ? 999  AGS A N1    1 
HETATM 5895 C  C2    . AGS C 3 .   ? 7.752  35.743 17.494  1.00 100.00 ? 999  AGS A C2    1 
HETATM 5896 N  N3    . AGS C 3 .   ? 8.432  35.156 18.440  1.00 38.02  ? 999  AGS A N3    1 
HETATM 5897 C  C4    . AGS C 3 .   ? 9.762  35.345 18.288  1.00 100.00 ? 999  AGS A C4    1 
HETATM 5898 O  O     . HOH D 4 .   ? 13.591 50.884 5.503   1.00 21.00  ? 8010 HOH A O     1 
HETATM 5899 O  O     . HOH D 4 .   ? 4.356  59.986 19.050  1.00 32.29  ? 8011 HOH A O     1 
HETATM 5900 O  O     . HOH D 4 .   ? 10.029 62.377 19.783  1.00 25.44  ? 8012 HOH A O     1 
HETATM 5901 O  O     . HOH D 4 .   ? 11.260 59.646 17.325  1.00 25.79  ? 8013 HOH A O     1 
HETATM 5902 O  O     . HOH D 4 .   ? 6.906  58.646 10.788  1.00 44.04  ? 8014 HOH A O     1 
HETATM 5903 O  O     . HOH D 4 .   ? 8.114  55.008 9.488   1.00 25.33  ? 8015 HOH A O     1 
HETATM 5904 O  O     . HOH D 4 .   ? 6.773  53.276 8.238   1.00 24.28  ? 8016 HOH A O     1 
HETATM 5905 O  O     . HOH D 4 .   ? 8.302  50.503 9.299   1.00 20.50  ? 8017 HOH A O     1 
HETATM 5906 O  O     . HOH D 4 .   ? 4.738  54.979 6.840   1.00 36.06  ? 8018 HOH A O     1 
HETATM 5907 O  O     . HOH D 4 .   ? 11.308 56.175 7.828   1.00 37.84  ? 8019 HOH A O     1 
HETATM 5908 O  O     . HOH D 4 .   ? 12.996 47.617 16.455  1.00 13.28  ? 8020 HOH A O     1 
HETATM 5909 O  O     . HOH D 4 .   ? 15.535 52.786 5.927   1.00 45.58  ? 8021 HOH A O     1 
HETATM 5910 O  O     . HOH D 4 .   ? 18.190 52.994 6.048   1.00 33.22  ? 8022 HOH A O     1 
HETATM 5911 O  O     . HOH D 4 .   ? 21.737 54.947 7.837   1.00 30.90  ? 8023 HOH A O     1 
HETATM 5912 O  O     . HOH D 4 .   ? 22.346 55.438 14.210  1.00 28.81  ? 8024 HOH A O     1 
HETATM 5913 O  O     . HOH D 4 .   ? 12.470 61.840 20.999  1.00 23.23  ? 8025 HOH A O     1 
HETATM 5914 O  O     . HOH D 4 .   ? 13.329 59.956 19.265  1.00 23.59  ? 8026 HOH A O     1 
HETATM 5915 O  O     . HOH D 4 .   ? 7.982  53.133 28.033  1.00 25.46  ? 8027 HOH A O     1 
HETATM 5916 O  O     . HOH D 4 .   ? 11.908 57.737 26.563  1.00 49.84  ? 8028 HOH A O     1 
HETATM 5917 O  O     . HOH D 4 .   ? 10.710 48.231 18.060  1.00 17.30  ? 8029 HOH A O     1 
HETATM 5918 O  O     . HOH D 4 .   ? 21.392 46.774 4.997   1.00 43.40  ? 8030 HOH A O     1 
HETATM 5919 O  O     . HOH D 4 .   ? 5.151  44.395 19.970  1.00 21.44  ? 8031 HOH A O     1 
HETATM 5920 O  O     . HOH D 4 .   ? 3.196  46.289 22.009  1.00 30.27  ? 8032 HOH A O     1 
HETATM 5921 O  O     . HOH D 4 .   ? 4.352  47.745 23.631  1.00 25.91  ? 8033 HOH A O     1 
HETATM 5922 O  O     . HOH D 4 .   ? 5.233  48.297 26.390  1.00 24.37  ? 8034 HOH A O     1 
HETATM 5923 O  O     . HOH D 4 .   ? 5.526  48.225 29.673  1.00 52.41  ? 8035 HOH A O     1 
HETATM 5924 O  O     . HOH D 4 .   ? 9.283  47.105 9.820   1.00 17.24  ? 8036 HOH A O     1 
HETATM 5925 O  O     . HOH D 4 .   ? 9.043  45.615 12.001  1.00 12.45  ? 8037 HOH A O     1 
HETATM 5926 O  O     . HOH D 4 .   ? 6.701  44.033 12.294  1.00 17.30  ? 8038 HOH A O     1 
HETATM 5927 O  O     . HOH D 4 .   ? 24.588 45.787 8.826   1.00 33.46  ? 8039 HOH A O     1 
HETATM 5928 O  O     . HOH D 4 .   ? 0.899  34.374 19.460  1.00 35.57  ? 8040 HOH A O     1 
HETATM 5929 O  O     . HOH D 4 .   ? 23.824 46.017 5.966   1.00 28.55  ? 8041 HOH A O     1 
HETATM 5930 O  O     . HOH D 4 .   ? 27.674 46.206 7.595   1.00 33.91  ? 8042 HOH A O     1 
HETATM 5931 O  O     . HOH D 4 .   ? 27.775 47.021 4.557   1.00 52.65  ? 8043 HOH A O     1 
HETATM 5932 O  O     . HOH D 4 .   ? 4.674  42.396 21.682  1.00 17.15  ? 8044 HOH A O     1 
HETATM 5933 O  O     . HOH D 4 .   ? 7.133  42.624 25.198  1.00 16.88  ? 8045 HOH A O     1 
HETATM 5934 O  O     . HOH D 4 .   ? -0.087 40.002 14.885  1.00 42.54  ? 8046 HOH A O     1 
HETATM 5935 O  O     . HOH D 4 .   ? -1.969 38.847 13.476  1.00 38.29  ? 8047 HOH A O     1 
HETATM 5936 O  O     . HOH D 4 .   ? -1.721 40.251 17.472  1.00 36.11  ? 8048 HOH A O     1 
HETATM 5937 O  O     . HOH D 4 .   ? 1.382  42.472 14.947  1.00 22.82  ? 8049 HOH A O     1 
HETATM 5938 O  O     . HOH D 4 .   ? 27.016 46.215 -2.314  1.00 42.43  ? 8050 HOH A O     1 
HETATM 5939 O  O     . HOH D 4 .   ? 2.194  35.683 23.161  1.00 34.21  ? 8051 HOH A O     1 
HETATM 5940 O  O     . HOH D 4 .   ? 4.530  34.746 8.977   1.00 16.76  ? 8052 HOH A O     1 
HETATM 5941 O  O     . HOH D 4 .   ? 3.862  38.790 -2.625  1.00 51.02  ? 8053 HOH A O     1 
HETATM 5942 O  O     . HOH D 4 .   ? 14.691 43.624 0.345   1.00 19.28  ? 8054 HOH A O     1 
HETATM 5943 O  O     . HOH D 4 .   ? 14.608 47.403 4.522   1.00 16.76  ? 8055 HOH A O     1 
HETATM 5944 O  O     . HOH D 4 .   ? 10.584 52.244 3.099   1.00 32.03  ? 8056 HOH A O     1 
HETATM 5945 O  O     . HOH D 4 .   ? 18.353 43.872 -1.874  1.00 21.97  ? 8057 HOH A O     1 
HETATM 5946 O  O     . HOH D 4 .   ? 25.968 45.522 1.470   1.00 35.03  ? 8058 HOH A O     1 
HETATM 5947 O  O     . HOH D 4 .   ? 23.059 45.219 -1.963  1.00 28.17  ? 8059 HOH A O     1 
HETATM 5948 O  O     . HOH D 4 .   ? 23.973 39.842 24.769  1.00 35.85  ? 8060 HOH A O     1 
HETATM 5949 O  O     . HOH D 4 .   ? 29.843 42.849 -0.994  1.00 24.24  ? 8061 HOH A O     1 
HETATM 5950 O  O     . HOH D 4 .   ? 24.348 45.299 -4.612  1.00 33.80  ? 8062 HOH A O     1 
HETATM 5951 O  O     . HOH D 4 .   ? 33.763 41.567 -9.243  1.00 22.38  ? 8063 HOH A O     1 
HETATM 5952 O  O     . HOH D 4 .   ? 32.570 45.766 -0.136  1.00 37.86  ? 8064 HOH A O     1 
HETATM 5953 O  O     . HOH D 4 .   ? 35.075 41.113 -6.752  1.00 17.47  ? 8065 HOH A O     1 
HETATM 5954 O  O     . HOH D 4 .   ? 34.835 37.666 -0.634  1.00 33.23  ? 8066 HOH A O     1 
HETATM 5955 O  O     . HOH D 4 .   ? 25.627 41.157 15.679  1.00 22.37  ? 8067 HOH A O     1 
HETATM 5956 O  O     . HOH D 4 .   ? 28.270 40.659 16.374  1.00 29.35  ? 8068 HOH A O     1 
HETATM 5957 O  O     . HOH D 4 .   ? 29.555 42.938 16.641  1.00 38.92  ? 8069 HOH A O     1 
HETATM 5958 O  O     . HOH D 4 .   ? 13.876 35.605 29.502  1.00 31.05  ? 8070 HOH A O     1 
HETATM 5959 O  O     . HOH D 4 .   ? 20.317 41.549 23.575  1.00 15.99  ? 8071 HOH A O     1 
HETATM 5960 O  O     . HOH D 4 .   ? 25.938 41.836 23.414  1.00 30.62  ? 8072 HOH A O     1 
HETATM 5961 O  O     . HOH D 4 .   ? 24.203 41.698 20.582  1.00 28.50  ? 8073 HOH A O     1 
HETATM 5962 O  O     . HOH D 4 .   ? 18.081 36.907 28.626  1.00 22.12  ? 8074 HOH A O     1 
HETATM 5963 O  O     . HOH D 4 .   ? 18.010 41.334 30.372  1.00 28.36  ? 8075 HOH A O     1 
HETATM 5964 O  O     . HOH D 4 .   ? 15.600 37.296 30.286  1.00 30.04  ? 8076 HOH A O     1 
HETATM 5965 O  O     . HOH D 4 .   ? 11.785 29.462 29.971  1.00 38.18  ? 8077 HOH A O     1 
HETATM 5966 O  O     . HOH D 4 .   ? 12.014 34.300 31.176  1.00 52.41  ? 8078 HOH A O     1 
HETATM 5967 O  O     . HOH D 4 .   ? 11.930 37.746 28.629  1.00 23.55  ? 8079 HOH A O     1 
HETATM 5968 O  O     . HOH D 4 .   ? 31.172 22.376 21.252  1.00 46.91  ? 8080 HOH A O     1 
HETATM 5969 O  O     . HOH D 4 .   ? 14.815 28.150 7.910   1.00 38.74  ? 8081 HOH A O     1 
HETATM 5970 O  O     . HOH D 4 .   ? 16.884 26.315 9.173   1.00 29.03  ? 8082 HOH A O     1 
HETATM 5971 O  O     . HOH D 4 .   ? 12.306 29.234 1.759   1.00 30.91  ? 8083 HOH A O     1 
HETATM 5972 O  O     . HOH D 4 .   ? 9.645  30.637 2.174   1.00 33.67  ? 8084 HOH A O     1 
HETATM 5973 O  O     . HOH D 4 .   ? 18.869 24.886 8.664   1.00 31.16  ? 8085 HOH A O     1 
HETATM 5974 O  O     . HOH D 4 .   ? 20.018 26.378 18.471  1.00 26.09  ? 8086 HOH A O     1 
HETATM 5975 O  O     . HOH D 4 .   ? 14.564 20.886 26.980  1.00 24.80  ? 8087 HOH A O     1 
HETATM 5976 O  O     . HOH D 4 .   ? 10.571 31.061 25.310  1.00 38.76  ? 8088 HOH A O     1 
HETATM 5977 O  O     . HOH D 4 .   ? 30.509 21.516 19.335  1.00 30.64  ? 8089 HOH A O     1 
HETATM 5978 O  O     . HOH D 4 .   ? 37.655 25.034 23.143  1.00 23.54  ? 8090 HOH A O     1 
HETATM 5979 O  O     . HOH D 4 .   ? 31.871 20.096 22.896  1.00 29.75  ? 8091 HOH A O     1 
HETATM 5980 O  O     . HOH D 4 .   ? 30.603 26.683 8.921   1.00 32.81  ? 8092 HOH A O     1 
HETATM 5981 O  O     . HOH D 4 .   ? 25.964 35.413 -11.030 1.00 62.13  ? 8093 HOH A O     1 
HETATM 5982 O  O     . HOH D 4 .   ? 32.435 21.594 12.163  1.00 44.42  ? 8094 HOH A O     1 
HETATM 5983 O  O     . HOH D 4 .   ? 32.805 18.809 9.940   1.00 50.38  ? 8095 HOH A O     1 
HETATM 5984 O  O     . HOH D 4 .   ? 33.994 25.599 21.797  1.00 18.18  ? 8096 HOH A O     1 
HETATM 5985 O  O     . HOH D 4 .   ? 35.299 27.338 20.125  1.00 23.31  ? 8097 HOH A O     1 
HETATM 5986 O  O     . HOH D 4 .   ? 35.970 29.795 19.624  1.00 16.60  ? 8098 HOH A O     1 
HETATM 5987 O  O     . HOH D 4 .   ? 35.290 25.645 24.434  1.00 24.14  ? 8099 HOH A O     1 
HETATM 5988 O  O     . HOH D 4 .   ? 6.740  19.326 26.918  1.00 35.50  ? 8100 HOH A O     1 
HETATM 5989 O  O     . HOH D 4 .   ? 34.853 21.246 26.585  1.00 24.38  ? 8101 HOH A O     1 
HETATM 5990 O  O     . HOH D 4 .   ? 33.432 22.907 20.071  1.00 72.61  ? 8102 HOH A O     1 
HETATM 5991 O  O     . HOH D 4 .   ? 26.719 31.659 22.157  1.00 31.56  ? 8103 HOH A O     1 
HETATM 5992 O  O     . HOH D 4 .   ? 22.533 22.784 33.210  1.00 34.72  ? 8104 HOH A O     1 
HETATM 5993 O  O     . HOH D 4 .   ? 24.637 22.831 33.658  1.00 47.05  ? 8105 HOH A O     1 
HETATM 5994 O  O     . HOH D 4 .   ? 20.808 24.520 34.483  1.00 23.99  ? 8106 HOH A O     1 
HETATM 5995 O  O     . HOH D 4 .   ? 11.345 18.504 22.057  1.00 38.37  ? 8107 HOH A O     1 
HETATM 5996 O  O     . HOH D 4 .   ? 13.914 17.216 33.383  1.00 27.55  ? 8108 HOH A O     1 
HETATM 5997 O  O     . HOH D 4 .   ? 6.718  19.701 33.750  1.00 46.99  ? 8109 HOH A O     1 
HETATM 5998 O  O     . HOH D 4 .   ? 31.459 21.832 14.961  1.00 25.03  ? 8110 HOH A O     1 
HETATM 5999 O  O     . HOH D 4 .   ? 37.115 10.269 33.720  1.00 25.43  ? 8111 HOH A O     1 
HETATM 6000 O  O     . HOH D 4 .   ? 33.924 15.174 29.524  1.00 27.97  ? 8112 HOH A O     1 
HETATM 6001 O  O     . HOH D 4 .   ? 34.747 16.915 33.741  1.00 34.48  ? 8113 HOH A O     1 
HETATM 6002 O  O     . HOH D 4 .   ? 35.901 16.230 31.426  1.00 25.63  ? 8114 HOH A O     1 
HETATM 6003 O  O     . HOH D 4 .   ? 33.258 17.534 29.009  1.00 27.66  ? 8115 HOH A O     1 
HETATM 6004 O  O     . HOH D 4 .   ? 37.663 18.402 25.386  1.00 23.09  ? 8116 HOH A O     1 
HETATM 6005 O  O     . HOH D 4 .   ? 34.981 15.665 27.093  1.00 32.46  ? 8117 HOH A O     1 
HETATM 6006 O  O     . HOH D 4 .   ? 35.097 14.725 24.702  1.00 26.36  ? 8118 HOH A O     1 
HETATM 6007 O  O     . HOH D 4 .   ? 31.920 19.823 30.400  1.00 45.25  ? 8119 HOH A O     1 
HETATM 6008 O  O     . HOH D 4 .   ? 44.126 37.895 19.301  1.00 19.55  ? 8120 HOH A O     1 
HETATM 6009 O  O     . HOH D 4 .   ? 28.984 30.156 21.108  1.00 21.26  ? 8121 HOH A O     1 
HETATM 6010 O  O     . HOH D 4 .   ? 29.683 40.603 36.992  1.00 14.35  ? 8122 HOH A O     1 
HETATM 6011 O  O     . HOH D 4 .   ? 31.089 35.246 39.113  1.00 18.70  ? 8123 HOH A O     1 
HETATM 6012 O  O     . HOH D 4 .   ? 30.176 36.919 40.231  1.00 48.71  ? 8124 HOH A O     1 
HETATM 6013 O  O     . HOH D 4 .   ? 38.486 41.725 15.969  1.00 20.35  ? 8125 HOH A O     1 
HETATM 6014 O  O     . HOH D 4 .   ? 38.995 43.789 13.350  1.00 33.58  ? 8126 HOH A O     1 
HETATM 6015 O  O     . HOH D 4 .   ? 29.418 50.457 18.148  1.00 28.21  ? 8127 HOH A O     1 
HETATM 6016 O  O     . HOH D 4 .   ? 46.073 39.847 21.773  1.00 30.85  ? 8128 HOH A O     1 
HETATM 6017 O  O     . HOH D 4 .   ? 44.143 40.414 18.842  1.00 29.80  ? 8129 HOH A O     1 
HETATM 6018 O  O     . HOH D 4 .   ? 51.075 29.153 28.304  1.00 29.86  ? 8130 HOH A O     1 
HETATM 6019 O  O     . HOH D 4 .   ? 45.911 44.423 28.420  1.00 18.84  ? 8131 HOH A O     1 
HETATM 6020 O  O     . HOH D 4 .   ? 49.106 41.897 27.450  1.00 31.83  ? 8132 HOH A O     1 
HETATM 6021 O  O     . HOH D 4 .   ? 48.580 40.914 29.276  1.00 34.77  ? 8133 HOH A O     1 
HETATM 6022 O  O     . HOH D 4 .   ? 50.152 40.407 26.059  1.00 30.95  ? 8134 HOH A O     1 
HETATM 6023 O  O     . HOH D 4 .   ? 46.489 34.603 27.138  1.00 17.33  ? 8135 HOH A O     1 
HETATM 6024 O  O     . HOH D 4 .   ? 51.489 38.671 23.017  1.00 29.95  ? 8136 HOH A O     1 
HETATM 6025 O  O     . HOH D 4 .   ? 45.808 29.702 25.054  1.00 26.89  ? 8137 HOH A O     1 
HETATM 6026 O  O     . HOH D 4 .   ? 46.909 32.424 25.185  1.00 26.01  ? 8138 HOH A O     1 
HETATM 6027 O  O     . HOH D 4 .   ? 49.243 29.348 25.987  1.00 30.28  ? 8139 HOH A O     1 
HETATM 6028 O  O     . HOH D 4 .   ? 3.153  44.135 13.062  1.00 23.79  ? 8140 HOH A O     1 
HETATM 6029 O  O     . HOH D 4 .   ? 41.480 34.334 19.030  1.00 18.33  ? 8141 HOH A O     1 
HETATM 6030 O  O     . HOH D 4 .   ? 40.045 36.648 44.218  1.00 17.27  ? 8142 HOH A O     1 
HETATM 6031 O  O     . HOH D 4 .   ? 34.441 32.039 19.308  1.00 19.19  ? 8143 HOH A O     1 
HETATM 6032 O  O     . HOH D 4 .   ? 35.979 28.672 13.662  1.00 19.54  ? 8144 HOH A O     1 
HETATM 6033 O  O     . HOH D 4 .   ? 32.880 31.338 18.780  1.00 20.66  ? 8145 HOH A O     1 
HETATM 6034 O  O     . HOH D 4 .   ? 33.632 28.146 37.904  1.00 21.63  ? 8146 HOH A O     1 
HETATM 6035 O  O     . HOH D 4 .   ? 43.228 45.021 41.279  1.00 21.60  ? 8147 HOH A O     1 
HETATM 6036 O  O     . HOH D 4 .   ? 37.298 46.641 25.587  1.00 25.00  ? 8148 HOH A O     1 
HETATM 6037 O  O     . HOH D 4 .   ? 31.624 31.258 20.259  1.00 20.80  ? 8149 HOH A O     1 
HETATM 6038 O  O     . HOH D 4 .   ? 41.160 37.532 15.450  1.00 27.98  ? 8150 HOH A O     1 
HETATM 6039 O  O     . HOH D 4 .   ? 38.029 45.083 35.881  1.00 26.52  ? 8151 HOH A O     1 
HETATM 6040 O  O     . HOH D 4 .   ? 37.088 47.927 27.995  1.00 26.69  ? 8152 HOH A O     1 
HETATM 6041 O  O     . HOH D 4 .   ? 44.546 46.480 38.158  1.00 25.27  ? 8153 HOH A O     1 
HETATM 6042 O  O     . HOH D 4 .   ? 1.533  49.943 11.798  1.00 27.70  ? 8154 HOH A O     1 
HETATM 6043 O  O     . HOH D 4 .   ? -0.518 48.845 20.615  1.00 26.34  ? 8155 HOH A O     1 
HETATM 6044 O  O     . HOH D 4 .   ? 49.671 41.980 41.553  1.00 23.29  ? 8156 HOH A O     1 
HETATM 6045 O  O     . HOH D 4 .   ? -0.252 56.576 11.819  1.00 25.34  ? 8157 HOH A O     1 
HETATM 6046 O  O     . HOH D 4 .   ? 35.868 22.307 29.276  1.00 26.27  ? 8158 HOH A O     1 
HETATM 6047 O  O     . HOH D 4 .   ? 50.445 31.103 42.247  1.00 22.17  ? 8159 HOH A O     1 
HETATM 6048 O  O     . HOH D 4 .   ? 7.434  50.361 1.735   1.00 33.98  ? 8160 HOH A O     1 
HETATM 6049 O  O     . HOH D 4 .   ? 42.671 35.544 45.956  1.00 23.01  ? 8161 HOH A O     1 
HETATM 6050 O  O     . HOH D 4 .   ? 47.377 24.248 24.845  1.00 30.59  ? 8162 HOH A O     1 
HETATM 6051 O  O     . HOH D 4 .   ? 6.463  36.229 14.933  1.00 32.69  ? 8163 HOH A O     1 
HETATM 6052 O  O     . HOH D 4 .   ? 15.849 17.487 35.880  1.00 39.60  ? 8164 HOH A O     1 
HETATM 6053 O  O     . HOH D 4 .   ? 21.747 65.049 20.069  1.00 27.13  ? 8165 HOH A O     1 
HETATM 6054 O  O     . HOH D 4 .   ? 35.612 44.509 44.865  1.00 30.32  ? 8166 HOH A O     1 
HETATM 6055 O  O     . HOH D 4 .   ? 45.582 28.690 20.406  1.00 18.55  ? 8167 HOH A O     1 
HETATM 6056 O  O     . HOH D 4 .   ? 42.524 37.938 46.454  1.00 24.44  ? 8168 HOH A O     1 
HETATM 6057 O  O     . HOH D 4 .   ? 35.920 34.439 49.575  1.00 33.60  ? 8169 HOH A O     1 
HETATM 6058 O  O     . HOH D 4 .   ? 3.600  55.096 20.871  1.00 25.55  ? 8170 HOH A O     1 
HETATM 6059 O  O     . HOH D 4 .   ? 41.971 35.869 13.128  1.00 28.00  ? 8171 HOH A O     1 
HETATM 6060 O  O     . HOH D 4 .   ? 45.321 47.484 30.096  1.00 31.92  ? 8172 HOH A O     1 
HETATM 6061 O  O     . HOH D 4 .   ? 23.539 52.412 16.432  1.00 26.67  ? 8173 HOH A O     1 
HETATM 6062 O  O     . HOH D 4 .   ? 0.701  37.696 6.854   1.00 33.93  ? 8174 HOH A O     1 
HETATM 6063 O  O     . HOH D 4 .   ? 42.412 5.229  33.285  1.00 33.57  ? 8175 HOH A O     1 
HETATM 6064 O  O     . HOH D 4 .   ? 40.168 39.764 14.847  1.00 33.48  ? 8176 HOH A O     1 
HETATM 6065 O  O     . HOH D 4 .   ? 41.305 10.777 27.867  1.00 35.97  ? 8177 HOH A O     1 
HETATM 6066 O  O     . HOH D 4 .   ? 13.752 29.430 19.340  1.00 26.78  ? 8178 HOH A O     1 
HETATM 6067 O  O     . HOH D 4 .   ? 12.720 38.599 16.773  1.00 30.91  ? 8179 HOH A O     1 
HETATM 6068 O  O     . HOH D 4 .   ? 33.764 46.102 41.210  1.00 42.55  ? 8180 HOH A O     1 
HETATM 6069 O  O     . HOH D 4 .   ? 47.501 48.327 31.911  1.00 35.51  ? 8181 HOH A O     1 
HETATM 6070 O  O     . HOH D 4 .   ? 23.971 53.162 6.861   1.00 38.18  ? 8182 HOH A O     1 
HETATM 6071 O  O     . HOH D 4 .   ? 31.584 25.070 37.701  1.00 32.83  ? 8183 HOH A O     1 
HETATM 6072 O  O     . HOH D 4 .   ? 22.772 27.774 17.878  1.00 33.73  ? 8184 HOH A O     1 
HETATM 6073 O  O     . HOH D 4 .   ? 1.372  33.405 8.878   1.00 45.13  ? 8185 HOH A O     1 
HETATM 6074 O  O     . HOH D 4 .   ? 39.503 45.880 44.325  1.00 36.35  ? 8186 HOH A O     1 
HETATM 6075 O  O     . HOH D 4 .   ? 23.405 10.864 38.780  1.00 44.88  ? 8187 HOH A O     1 
HETATM 6076 O  O     . HOH D 4 .   ? 24.745 56.748 10.140  1.00 40.18  ? 8188 HOH A O     1 
HETATM 6077 O  O     . HOH D 4 .   ? 11.691 55.988 5.001   1.00 65.78  ? 8189 HOH A O     1 
HETATM 6078 O  O     . HOH D 4 .   ? 47.057 29.340 22.383  1.00 27.87  ? 8190 HOH A O     1 
HETATM 6079 O  O     . HOH D 4 .   ? 36.041 34.357 1.787   1.00 52.15  ? 8191 HOH A O     1 
HETATM 6080 O  O     . HOH D 4 .   ? 19.972 40.321 -8.624  1.00 40.71  ? 8192 HOH A O     1 
HETATM 6081 O  O     . HOH D 4 .   ? 20.014 27.903 32.396  1.00 54.85  ? 8193 HOH A O     1 
HETATM 6082 O  O     . HOH D 4 .   ? 18.852 30.666 28.860  1.00 40.18  ? 8194 HOH A O     1 
HETATM 6083 O  O     . HOH D 4 .   ? 35.489 36.152 -3.049  1.00 37.95  ? 8195 HOH A O     1 
HETATM 6084 O  O     . HOH D 4 .   ? 30.881 21.810 28.902  1.00 34.61  ? 8196 HOH A O     1 
HETATM 6085 O  O     . HOH D 4 .   ? 35.142 19.963 31.335  1.00 34.00  ? 8197 HOH A O     1 
HETATM 6086 O  O     . HOH D 4 .   ? 28.312 60.203 11.774  1.00 46.94  ? 8198 HOH A O     1 
HETATM 6087 O  O     . HOH D 4 .   ? 1.597  42.745 21.548  1.00 39.01  ? 8199 HOH A O     1 
HETATM 6088 O  O     . HOH D 4 .   ? 46.540 25.432 47.073  1.00 41.24  ? 8200 HOH A O     1 
HETATM 6089 O  O     . HOH D 4 .   ? 30.416 16.407 37.545  1.00 41.50  ? 8201 HOH A O     1 
HETATM 6090 O  O     . HOH D 4 .   ? 37.732 16.292 23.810  1.00 41.86  ? 8202 HOH A O     1 
HETATM 6091 O  O     . HOH D 4 .   ? 35.031 32.238 47.612  1.00 25.29  ? 8203 HOH A O     1 
HETATM 6092 O  O     . HOH D 4 .   ? 35.483 26.791 26.723  1.00 36.83  ? 8204 HOH A O     1 
HETATM 6093 O  O     . HOH D 4 .   ? 44.895 34.540 46.245  1.00 49.09  ? 8205 HOH A O     1 
HETATM 6094 O  O     . HOH D 4 .   ? 34.431 25.010 28.694  1.00 30.91  ? 8206 HOH A O     1 
HETATM 6095 O  O     . HOH D 4 .   ? -4.075 40.633 18.388  1.00 38.07  ? 8207 HOH A O     1 
HETATM 6096 O  O     . HOH D 4 .   ? 31.770 23.991 26.753  1.00 59.41  ? 8208 HOH A O     1 
HETATM 6097 O  O     . HOH D 4 .   ? 42.219 44.276 46.696  1.00 42.17  ? 8209 HOH A O     1 
HETATM 6098 O  O     . HOH D 4 .   ? 2.242  58.004 8.902   1.00 47.22  ? 8210 HOH A O     1 
HETATM 6099 O  O     . HOH D 4 .   ? 35.629 53.484 14.558  1.00 52.06  ? 8211 HOH A O     1 
HETATM 6100 O  O     . HOH D 4 .   ? 14.465 39.642 17.945  1.00 39.40  ? 8212 HOH A O     1 
HETATM 6101 O  O     . HOH D 4 .   ? 33.625 22.952 25.012  1.00 30.62  ? 8213 HOH A O     1 
HETATM 6102 O  O     . HOH D 4 .   ? 4.324  56.450 14.947  1.00 31.50  ? 8214 HOH A O     1 
HETATM 6103 O  O     . HOH D 4 .   ? 43.454 9.119  31.942  1.00 40.98  ? 8215 HOH A O     1 
HETATM 6104 O  O     . HOH D 4 .   ? -1.604 43.597 -1.538  1.00 44.80  ? 8216 HOH A O     1 
HETATM 6105 O  O     . HOH D 4 .   ? -1.267 44.452 -5.324  1.00 48.07  ? 8217 HOH A O     1 
HETATM 6106 O  O     . HOH D 4 .   ? -2.956 53.265 4.903   1.00 47.09  ? 8218 HOH A O     1 
HETATM 6107 O  O     . HOH D 4 .   ? -2.108 50.874 5.725   1.00 44.48  ? 8219 HOH A O     1 
HETATM 6108 O  O     . HOH D 4 .   ? 13.208 70.577 19.678  1.00 58.77  ? 8220 HOH A O     1 
HETATM 6109 O  O     . HOH D 4 .   ? 7.210  54.432 4.316   1.00 49.90  ? 8221 HOH A O     1 
HETATM 6110 O  O     . HOH D 4 .   ? 0.017  49.910 9.145   1.00 34.07  ? 8222 HOH A O     1 
HETATM 6111 O  O     . HOH D 4 .   ? -2.260 49.343 10.163  1.00 28.52  ? 8223 HOH A O     1 
HETATM 6112 O  O     . HOH D 4 .   ? 1.079  55.865 14.113  1.00 33.92  ? 8224 HOH A O     1 
HETATM 6113 O  O     . HOH D 4 .   ? -0.591 60.451 1.387   1.00 68.00  ? 8225 HOH A O     1 
HETATM 6114 O  O     . HOH D 4 .   ? 41.167 31.147 46.414  1.00 37.72  ? 8226 HOH A O     1 
HETATM 6115 O  O     . HOH D 4 .   ? 48.186 27.934 47.153  1.00 42.24  ? 8227 HOH A O     1 
HETATM 6116 O  O     . HOH D 4 .   ? 50.256 29.614 45.059  1.00 35.76  ? 8228 HOH A O     1 
HETATM 6117 O  O     . HOH D 4 .   ? -0.718 70.321 13.631  1.00 31.28  ? 8229 HOH A O     1 
HETATM 6118 O  O     . HOH D 4 .   ? 25.234 54.527 14.418  1.00 43.05  ? 8230 HOH A O     1 
HETATM 6119 O  O     . HOH D 4 .   ? 13.151 70.033 22.051  1.00 59.04  ? 8231 HOH A O     1 
HETATM 6120 O  O     . HOH D 4 .   ? 10.404 68.855 21.010  1.00 37.70  ? 8232 HOH A O     1 
HETATM 6121 O  O     . HOH D 4 .   ? 17.108 66.279 29.512  1.00 39.00  ? 8233 HOH A O     1 
HETATM 6122 O  O     . HOH D 4 .   ? 22.649 64.117 25.597  1.00 51.78  ? 8234 HOH A O     1 
HETATM 6123 O  O     . HOH D 4 .   ? 14.172 55.251 6.236   1.00 53.95  ? 8235 HOH A O     1 
HETATM 6124 O  O     . HOH D 4 .   ? 20.779 65.169 22.258  1.00 45.46  ? 8236 HOH A O     1 
HETATM 6125 O  O     . HOH D 4 .   ? 19.444 66.944 23.070  1.00 41.23  ? 8237 HOH A O     1 
HETATM 6126 O  O     . HOH D 4 .   ? 1.050  45.233 20.619  1.00 44.72  ? 8238 HOH A O     1 
HETATM 6127 O  O     . HOH D 4 .   ? 23.731 50.430 5.387   1.00 45.35  ? 8239 HOH A O     1 
HETATM 6128 O  O     . HOH D 4 .   ? 20.414 48.292 -0.443  1.00 30.96  ? 8240 HOH A O     1 
HETATM 6129 O  O     . HOH D 4 .   ? 7.568  31.433 7.889   1.00 55.12  ? 8241 HOH A O     1 
HETATM 6130 O  O     . HOH D 4 .   ? 5.202  31.412 8.249   1.00 38.84  ? 8242 HOH A O     1 
HETATM 6131 O  O     . HOH D 4 .   ? 4.411  33.359 9.456   1.00 26.78  ? 8243 HOH A O     1 
HETATM 6132 O  O     . HOH D 4 .   ? 8.545  39.000 -6.139  1.00 50.90  ? 8244 HOH A O     1 
HETATM 6133 O  O     . HOH D 4 .   ? 18.787 45.930 4.728   1.00 61.97  ? 8245 HOH A O     1 
HETATM 6134 O  O     . HOH D 4 .   ? 21.982 48.314 2.537   1.00 43.97  ? 8246 HOH A O     1 
HETATM 6135 O  O     . HOH D 4 .   ? 20.740 46.193 -2.641  1.00 45.55  ? 8247 HOH A O     1 
HETATM 6136 O  O     . HOH D 4 .   ? 23.669 47.585 -0.951  1.00 42.70  ? 8248 HOH A O     1 
HETATM 6137 O  O     . HOH D 4 .   ? 24.598 47.661 1.465   1.00 58.17  ? 8249 HOH A O     1 
HETATM 6138 O  O     . HOH D 4 .   ? 12.075 33.222 25.116  1.00 46.52  ? 8250 HOH A O     1 
HETATM 6139 O  O     . HOH D 4 .   ? 25.462 47.087 -5.400  1.00 72.45  ? 8251 HOH A O     1 
HETATM 6140 O  O     . HOH D 4 .   ? 31.652 43.350 -9.637  1.00 36.76  ? 8252 HOH A O     1 
HETATM 6141 O  O     . HOH D 4 .   ? 34.168 39.459 -10.819 1.00 30.53  ? 8253 HOH A O     1 
HETATM 6142 O  O     . HOH D 4 .   ? 33.347 44.503 -6.287  1.00 40.62  ? 8254 HOH A O     1 
HETATM 6143 O  O     . HOH D 4 .   ? 37.944 34.958 -0.830  1.00 54.68  ? 8255 HOH A O     1 
HETATM 6144 O  O     . HOH D 4 .   ? 22.009 43.081 20.689  1.00 42.64  ? 8256 HOH A O     1 
HETATM 6145 O  O     . HOH D 4 .   ? 23.776 30.790 21.820  1.00 54.65  ? 8257 HOH A O     1 
HETATM 6146 O  O     . HOH D 4 .   ? 22.618 36.498 27.863  1.00 34.47  ? 8258 HOH A O     1 
HETATM 6147 O  O     . HOH D 4 .   ? 23.610 38.335 29.965  1.00 44.58  ? 8259 HOH A O     1 
HETATM 6148 O  O     . HOH D 4 .   ? 35.588 21.123 18.095  1.00 59.48  ? 8260 HOH A O     1 
HETATM 6149 O  O     . HOH D 4 .   ? 11.870 26.904 -0.162  1.00 48.54  ? 8261 HOH A O     1 
HETATM 6150 O  O     . HOH D 4 .   ? 16.527 36.393 -6.702  1.00 56.31  ? 8262 HOH A O     1 
HETATM 6151 O  O     . HOH D 4 .   ? 13.393 23.621 17.674  1.00 48.58  ? 8263 HOH A O     1 
HETATM 6152 O  O     . HOH D 4 .   ? 8.921  26.293 22.790  1.00 55.60  ? 8264 HOH A O     1 
HETATM 6153 O  O     . HOH D 4 .   ? 10.888 24.042 23.305  1.00 53.23  ? 8265 HOH A O     1 
HETATM 6154 O  O     . HOH D 4 .   ? 23.623 29.609 18.812  1.00 36.08  ? 8266 HOH A O     1 
HETATM 6155 O  O     . HOH D 4 .   ? 30.355 19.141 21.050  1.00 33.22  ? 8267 HOH A O     1 
HETATM 6156 O  O     . HOH D 4 .   ? 34.111 18.678 22.822  1.00 43.01  ? 8268 HOH A O     1 
HETATM 6157 O  O     . HOH D 4 .   ? 34.058 21.736 15.830  1.00 53.33  ? 8269 HOH A O     1 
HETATM 6158 O  O     . HOH D 4 .   ? 44.213 9.298  34.703  1.00 54.05  ? 8270 HOH A O     1 
HETATM 6159 O  O     . HOH D 4 .   ? 28.627 26.042 27.427  1.00 47.19  ? 8271 HOH A O     1 
HETATM 6160 O  O     . HOH D 4 .   ? 29.042 24.222 30.693  1.00 63.69  ? 8272 HOH A O     1 
HETATM 6161 O  O     . HOH D 4 .   ? 24.511 14.706 38.204  1.00 48.07  ? 8273 HOH A O     1 
HETATM 6162 O  O     . HOH D 4 .   ? 25.885 12.268 38.743  1.00 43.00  ? 8274 HOH A O     1 
HETATM 6163 O  O     . HOH D 4 .   ? 32.741 15.514 35.989  1.00 41.25  ? 8275 HOH A O     1 
HETATM 6164 O  O     . HOH D 4 .   ? 13.064 29.887 38.131  1.00 44.85  ? 8276 HOH A O     1 
HETATM 6165 O  O     . HOH D 4 .   ? 9.621  12.601 28.089  1.00 45.49  ? 8277 HOH A O     1 
HETATM 6166 O  O     . HOH D 4 .   ? 3.423  20.268 27.198  1.00 51.84  ? 8278 HOH A O     1 
HETATM 6167 O  O     . HOH D 4 .   ? 38.782 -0.944 32.954  1.00 44.67  ? 8279 HOH A O     1 
HETATM 6168 O  O     . HOH D 4 .   ? 28.298 41.187 19.428  1.00 33.02  ? 8280 HOH A O     1 
HETATM 6169 O  O     . HOH D 4 .   ? 43.473 10.699 37.275  1.00 71.26  ? 8281 HOH A O     1 
HETATM 6170 O  O     . HOH D 4 .   ? 46.279 6.551  32.722  1.00 63.36  ? 8282 HOH A O     1 
HETATM 6171 O  O     . HOH D 4 .   ? 33.051 10.055 48.436  1.00 48.53  ? 8283 HOH A O     1 
HETATM 6172 O  O     . HOH D 4 .   ? 29.139 13.921 40.384  1.00 57.58  ? 8284 HOH A O     1 
HETATM 6173 O  O     . HOH D 4 .   ? 31.134 13.788 42.397  1.00 51.67  ? 8285 HOH A O     1 
HETATM 6174 O  O     . HOH D 4 .   ? 33.325 16.672 23.313  1.00 31.54  ? 8286 HOH A O     1 
HETATM 6175 O  O     . HOH D 4 .   ? 37.125 16.323 21.156  1.00 50.85  ? 8287 HOH A O     1 
HETATM 6176 O  O     . HOH D 4 .   ? 32.522 16.652 8.013   1.00 54.52  ? 8288 HOH A O     1 
HETATM 6177 O  O     . HOH D 4 .   ? 39.874 7.903  22.285  1.00 40.29  ? 8289 HOH A O     1 
HETATM 6178 O  O     . HOH D 4 .   ? 28.565 45.120 33.674  1.00 53.75  ? 8290 HOH A O     1 
HETATM 6179 O  O     . HOH D 4 .   ? 35.608 45.062 21.957  1.00 24.20  ? 8291 HOH A O     1 
HETATM 6180 O  O     . HOH D 4 .   ? 40.508 48.135 18.801  1.00 31.42  ? 8292 HOH A O     1 
HETATM 6181 O  O     . HOH D 4 .   ? 49.964 44.957 27.791  1.00 53.21  ? 8293 HOH A O     1 
HETATM 6182 O  O     . HOH D 4 .   ? 52.620 44.633 25.949  1.00 36.22  ? 8294 HOH A O     1 
HETATM 6183 O  O     . HOH D 4 .   ? 51.568 38.611 32.515  1.00 23.65  ? 8295 HOH A O     1 
HETATM 6184 O  O     . HOH D 4 .   ? 45.856 49.458 37.502  1.00 39.99  ? 8296 HOH A O     1 
HETATM 6185 O  O     . HOH D 4 .   ? 39.359 49.084 33.733  1.00 41.88  ? 8297 HOH A O     1 
HETATM 6186 O  O     . HOH D 4 .   ? 35.639 48.185 34.972  1.00 43.64  ? 8298 HOH A O     1 
HETATM 6187 O  O     . HOH D 4 .   ? 40.099 47.770 37.348  1.00 49.42  ? 8299 HOH A O     1 
HETATM 6188 O  O     . HOH D 4 .   ? 13.283 42.333 34.851  1.00 46.77  ? 8300 HOH A O     1 
HETATM 6189 O  O     . HOH D 4 .   ? 37.677 12.671 34.293  1.00 41.76  ? 8301 HOH A O     1 
HETATM 6190 O  O     . HOH D 4 .   ? 36.355 14.362 36.291  1.00 42.07  ? 8302 HOH A O     1 
HETATM 6191 O  O     . HOH D 4 .   ? 40.195 12.479 35.352  1.00 36.82  ? 8303 HOH A O     1 
HETATM 6192 O  O     . HOH D 4 .   ? 41.849 11.358 33.654  1.00 40.44  ? 8304 HOH A O     1 
HETATM 6193 O  O     . HOH D 4 .   ? 42.265 13.035 30.769  1.00 64.52  ? 8305 HOH A O     1 
HETATM 6194 O  O     . HOH D 4 .   ? 40.785 26.085 14.090  1.00 43.53  ? 8306 HOH A O     1 
HETATM 6195 O  O     . HOH D 4 .   ? 39.432 30.656 8.629   1.00 37.65  ? 8307 HOH A O     1 
HETATM 6196 O  O     . HOH D 4 .   ? 41.761 37.889 11.285  1.00 42.22  ? 8308 HOH A O     1 
HETATM 6197 O  O     . HOH D 4 .   ? 11.129 42.205 33.065  1.00 25.43  ? 8309 HOH A O     1 
HETATM 6198 O  O     . HOH D 4 .   ? 48.771 31.427 21.578  1.00 37.40  ? 8310 HOH A O     1 
HETATM 6199 O  O     . HOH D 4 .   ? 19.047 43.758 30.087  1.00 36.83  ? 8311 HOH A O     1 
HETATM 6200 O  O     . HOH D 4 .   ? 26.466 50.450 22.784  1.00 35.46  ? 8312 HOH A O     1 
HETATM 6201 O  O     . HOH D 4 .   ? 26.078 52.415 13.327  1.00 37.90  ? 8313 HOH A O     1 
HETATM 6202 O  O     . HOH D 4 .   ? 41.157 36.701 6.738   1.00 27.84  ? 8314 HOH A O     1 
HETATM 6203 O  O     . HOH D 4 .   ? 33.105 32.566 43.393  1.00 31.83  ? 8315 HOH A O     1 
HETATM 6204 O  O     . HOH D 4 .   ? 34.517 31.657 -1.580  1.00 28.82  ? 8316 HOH A O     1 
HETATM 6205 O  O     . HOH D 4 .   ? -0.111 40.301 22.827  1.00 40.28  ? 8317 HOH A O     1 
HETATM 6206 O  O     . HOH D 4 .   ? 49.299 31.665 25.271  1.00 51.55  ? 8318 HOH A O     1 
HETATM 6207 O  O     . HOH D 4 .   ? 19.668 34.216 -8.933  1.00 43.58  ? 8319 HOH A O     1 
HETATM 6208 O  O     . HOH D 4 .   ? 1.382  37.509 3.365   1.00 70.26  ? 8320 HOH A O     1 
HETATM 6209 O  O     . HOH D 4 .   ? 19.886 9.165  34.563  1.00 38.96  ? 8321 HOH A O     1 
HETATM 6210 O  O     . HOH D 4 .   ? 36.635 20.308 24.392  1.00 44.33  ? 8322 HOH A O     1 
HETATM 6211 O  O     . HOH D 4 .   ? 39.968 22.708 38.451  1.00 43.38  ? 8323 HOH A O     1 
HETATM 6212 O  O     . HOH D 4 .   ? 48.519 35.622 20.857  1.00 46.03  ? 8324 HOH A O     1 
HETATM 6213 O  O     . HOH D 4 .   ? 5.243  60.091 13.862  1.00 49.79  ? 8325 HOH A O     1 
HETATM 6214 O  O     . HOH D 4 .   ? 6.777  15.741 27.518  1.00 72.36  ? 8326 HOH A O     1 
HETATM 6215 O  O     . HOH D 4 .   ? 39.626 -0.427 30.163  1.00 51.00  ? 8327 HOH A O     1 
HETATM 6216 O  O     . HOH D 4 .   ? 29.008 31.284 27.224  1.00 42.70  ? 8328 HOH A O     1 
HETATM 6217 O  O     . HOH D 4 .   ? 36.030 29.123 -4.616  1.00 49.55  ? 8329 HOH A O     1 
HETATM 6218 O  O     . HOH D 4 .   ? 32.695 27.921 7.847   1.00 50.33  ? 8330 HOH A O     1 
HETATM 6219 O  O     . HOH D 4 .   ? 43.430 29.799 14.029  1.00 49.64  ? 8331 HOH A O     1 
HETATM 6220 O  O     . HOH D 4 .   ? 41.241 22.939 42.796  1.00 49.63  ? 8332 HOH A O     1 
HETATM 6221 O  O     . HOH D 4 .   ? -0.882 36.900 19.857  1.00 63.20  ? 8333 HOH A O     1 
HETATM 6222 O  O     . HOH D 4 .   ? 42.056 41.306 17.654  1.00 53.77  ? 8334 HOH A O     1 
HETATM 6223 O  O     . HOH D 4 .   ? 37.145 11.518 39.052  1.00 39.89  ? 8335 HOH A O     1 
HETATM 6224 O  O     . HOH D 4 .   ? 4.120  30.814 3.808   1.00 66.28  ? 8336 HOH A O     1 
HETATM 6225 O  O     . HOH D 4 .   ? 1.787  41.170 28.250  1.00 44.37  ? 8337 HOH A O     1 
HETATM 6226 O  O     . HOH D 4 .   ? 37.814 20.570 39.412  1.00 69.19  ? 8338 HOH A O     1 
HETATM 6227 O  O     . HOH D 4 .   ? 39.565 10.599 37.554  1.00 41.82  ? 8339 HOH A O     1 
HETATM 6228 O  O     . HOH D 4 .   ? 45.339 30.838 17.930  1.00 53.94  ? 8341 HOH A O     1 
HETATM 6229 O  O     . HOH D 4 .   ? 37.257 6.320  36.589  1.00 52.90  ? 8342 HOH A O     1 
HETATM 6230 O  O     . HOH D 4 .   ? 14.055 67.096 -8.881  1.00 56.73  ? 8343 HOH A O     1 
HETATM 6231 O  O     . HOH D 4 .   ? 9.054  27.419 34.107  1.00 68.28  ? 8344 HOH A O     1 
HETATM 6232 O  O     . HOH D 4 .   ? 25.924 19.422 -1.754  1.00 62.48  ? 8345 HOH A O     1 
HETATM 6233 O  O     . HOH D 4 .   ? 17.343 29.575 20.309  1.00 21.79  ? 9951 HOH A O     1 
HETATM 6234 O  O     . HOH D 4 .   ? 21.027 31.337 19.603  1.00 15.35  ? 9952 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   PRO 3   3   3   PRO PRO A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   HIS 5   5   5   HIS HIS A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   ARG 7   7   7   ARG ARG A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  TYR 11  11  11  TYR TYR A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ARG 33  33  33  ARG ARG A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  TRP 36  36  36  TRP TRP A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  TYR 47  47  47  TYR TYR A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  CYS 49  49  49  CYS CYS A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  GLN 79  79  79  GLN GLN A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  PHE 85  85  85  PHE PHE A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  ASP 90  90  90  ASP ASP A . n 
A 1 91  MET 91  91  91  MET MET A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 HIS 104 104 104 HIS HIS A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 GLN 112 112 112 GLN GLN A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 THR 117 117 117 THR THR A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 PHE 122 122 122 PHE PHE A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 ILE 134 134 134 ILE ILE A . n 
A 1 135 TYR 135 135 135 TYR TYR A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 MET 139 139 139 MET MET A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 ARG 146 146 146 ARG ARG A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PRO 153 153 153 PRO PRO A . n 
A 1 154 HIS 154 154 154 HIS HIS A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 ARG 164 164 164 ARG ARG A . n 
A 1 165 SER 165 165 165 SER SER A . n 
A 1 166 MET 166 166 166 MET MET A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 ASP 168 168 168 ASP ASP A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 THR 178 178 178 THR THR A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 SER 181 181 181 SER SER A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 LYS 185 185 185 LYS LYS A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 ILE 193 193 193 ILE ILE A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 VAL 199 199 199 VAL VAL A . n 
A 1 200 ALA 200 200 200 ALA ALA A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 ARG 202 202 202 ARG ARG A . n 
A 1 203 ASN 203 203 203 ASN ASN A . n 
A 1 204 GLN 204 204 ?   ?   ?   A . n 
A 1 205 ALA 205 205 ?   ?   ?   A . n 
A 1 206 ASN 206 206 ?   ?   ?   A . n 
A 1 207 GLY 207 207 ?   ?   ?   A . n 
A 1 208 SER 208 208 ?   ?   ?   A . n 
A 1 209 GLY 209 209 209 GLY GLY A . n 
A 1 210 VAL 210 210 210 VAL VAL A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 GLN 213 213 213 GLN GLN A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 GLN 217 217 217 GLN GLN A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 ASN 219 219 219 ASN ASN A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 ILE 221 221 221 ILE ILE A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 ASN 227 227 227 ASN ASN A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 THR 230 230 230 THR THR A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 ASN 235 235 235 ASN ASN A . n 
A 1 236 SER 236 236 236 SER SER A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 PHE 239 239 239 PHE PHE A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 LYS 241 241 241 LYS LYS A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 ILE 243 243 243 ILE ILE A . n 
A 1 244 GLU 244 244 244 GLU GLU A . n 
A 1 245 ILE 245 245 245 ILE ILE A . n 
A 1 246 GLN 246 246 246 GLN GLN A . n 
A 1 247 PHE 247 247 247 PHE PHE A . n 
A 1 248 ASN 248 248 248 ASN ASN A . n 
A 1 249 ASN 249 249 249 ASN ASN A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 PHE 252 252 252 PHE PHE A . n 
A 1 253 ILE 253 253 253 ILE ILE A . n 
A 1 254 SER 254 254 254 SER SER A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 SER 257 257 257 SER SER A . n 
A 1 258 ILE 258 258 258 ILE ILE A . n 
A 1 259 GLN 259 259 259 GLN GLN A . n 
A 1 260 SER 260 260 260 SER SER A . n 
A 1 261 TYR 261 261 261 TYR TYR A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 LYS 265 265 265 LYS LYS A . n 
A 1 266 SER 266 266 266 SER SER A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 VAL 268 268 268 VAL VAL A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 PHE 270 270 270 PHE PHE A . n 
A 1 271 GLN 271 271 271 GLN GLN A . n 
A 1 272 SER 272 272 272 SER SER A . n 
A 1 273 THR 273 273 273 THR THR A . n 
A 1 274 THR 274 274 274 THR THR A . n 
A 1 275 GLU 275 275 275 GLU GLU A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 ASN 277 277 277 ASN ASN A . n 
A 1 278 TYR 278 278 278 TYR TYR A . n 
A 1 279 HIS 279 279 279 HIS HIS A . n 
A 1 280 ILE 280 280 280 ILE ILE A . n 
A 1 281 PHE 281 281 281 PHE PHE A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 GLN 283 283 283 GLN GLN A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 GLY 287 287 287 GLY GLY A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 THR 289 289 289 THR THR A . n 
A 1 290 ALA 290 290 290 ALA ALA A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 LYS 293 293 293 LYS LYS A . n 
A 1 294 LYS 294 294 294 LYS LYS A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 HIS 297 297 297 HIS HIS A . n 
A 1 298 LEU 298 298 298 LEU LEU A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 GLY 300 300 300 GLY GLY A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 SER 303 303 303 SER SER A . n 
A 1 304 PHE 304 304 304 PHE PHE A . n 
A 1 305 ASN 305 305 305 ASN ASN A . n 
A 1 306 TYR 306 306 306 TYR TYR A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 ASN 308 308 308 ASN ASN A . n 
A 1 309 GLN 309 309 309 GLN GLN A . n 
A 1 310 SER 310 310 310 SER SER A . n 
A 1 311 GLY 311 311 311 GLY GLY A . n 
A 1 312 CYS 312 312 312 CYS CYS A . n 
A 1 313 VAL 313 313 313 VAL VAL A . n 
A 1 314 ASP 314 314 314 ASP ASP A . n 
A 1 315 ILE 315 315 315 ILE ILE A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 GLY 317 317 317 GLY GLY A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 SER 319 319 319 SER SER A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 GLU 321 321 321 GLU GLU A . n 
A 1 322 ASP 322 322 322 ASP ASP A . n 
A 1 323 GLU 323 323 323 GLU GLU A . n 
A 1 324 PHE 324 324 324 PHE PHE A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 THR 327 327 327 THR THR A . n 
A 1 328 ARG 328 328 328 ARG ARG A . n 
A 1 329 GLN 329 329 329 GLN GLN A . n 
A 1 330 ALA 330 330 330 ALA ALA A . n 
A 1 331 MET 331 331 331 MET MET A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 ILE 333 333 333 ILE ILE A . n 
A 1 334 VAL 334 334 334 VAL VAL A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 PHE 336 336 336 PHE PHE A . n 
A 1 337 SER 337 337 337 SER SER A . n 
A 1 338 GLN 338 338 338 GLN GLN A . n 
A 1 339 GLU 339 339 339 GLU GLU A . n 
A 1 340 GLU 340 340 340 GLU GLU A . n 
A 1 341 GLN 341 341 341 GLN GLN A . n 
A 1 342 MET 342 342 342 MET MET A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 ILE 344 344 344 ILE ILE A . n 
A 1 345 PHE 345 345 345 PHE PHE A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 ILE 348 348 348 ILE ILE A . n 
A 1 349 ALA 349 349 349 ALA ALA A . n 
A 1 350 GLY 350 350 350 GLY GLY A . n 
A 1 351 ILE 351 351 351 ILE ILE A . n 
A 1 352 LEU 352 352 352 LEU LEU A . n 
A 1 353 HIS 353 353 353 HIS HIS A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 ASN 356 356 356 ASN ASN A . n 
A 1 357 ILE 357 357 357 ILE ILE A . n 
A 1 358 LYS 358 358 358 LYS LYS A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 GLU 360 360 360 GLU GLU A . n 
A 1 361 LYS 361 361 361 LYS LYS A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 GLY 364 364 364 GLY GLY A . n 
A 1 365 GLU 365 365 365 GLU GLU A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 ALA 367 367 367 ALA ALA A . n 
A 1 368 VAL 368 368 368 VAL VAL A . n 
A 1 369 LEU 369 369 369 LEU LEU A . n 
A 1 370 LYS 370 370 370 LYS LYS A . n 
A 1 371 ASP 371 371 371 ASP ASP A . n 
A 1 372 LYS 372 372 372 LYS LYS A . n 
A 1 373 THR 373 373 373 THR THR A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 LEU 375 375 375 LEU LEU A . n 
A 1 376 ASN 376 376 376 ASN ASN A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 ALA 378 378 378 ALA ALA A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 THR 380 380 380 THR THR A . n 
A 1 381 VAL 381 381 381 VAL VAL A . n 
A 1 382 PHE 382 382 382 PHE PHE A . n 
A 1 383 GLY 383 383 383 GLY GLY A . n 
A 1 384 VAL 384 384 384 VAL VAL A . n 
A 1 385 ASN 385 385 385 ASN ASN A . n 
A 1 386 PRO 386 386 386 PRO PRO A . n 
A 1 387 SER 387 387 387 SER SER A . n 
A 1 388 VAL 388 388 388 VAL VAL A . n 
A 1 389 LEU 389 389 389 LEU LEU A . n 
A 1 390 GLU 390 390 390 GLU GLU A . n 
A 1 391 LYS 391 391 391 LYS LYS A . n 
A 1 392 ALA 392 392 392 ALA ALA A . n 
A 1 393 LEU 393 393 393 LEU LEU A . n 
A 1 394 MET 394 394 394 MET MET A . n 
A 1 395 GLU 395 395 395 GLU GLU A . n 
A 1 396 PRO 396 396 396 PRO PRO A . n 
A 1 397 ARG 397 397 397 ARG ARG A . n 
A 1 398 ILE 398 398 398 ILE ILE A . n 
A 1 399 LEU 399 399 399 LEU LEU A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 GLY 401 401 401 GLY GLY A . n 
A 1 402 ARG 402 402 402 ARG ARG A . n 
A 1 403 ASP 403 403 403 ASP ASP A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 VAL 405 405 405 VAL VAL A . n 
A 1 406 ALA 406 406 406 ALA ALA A . n 
A 1 407 GLN 407 407 407 GLN GLN A . n 
A 1 408 HIS 408 408 408 HIS HIS A . n 
A 1 409 LEU 409 409 409 LEU LEU A . n 
A 1 410 ASN 410 410 410 ASN ASN A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 GLU 412 412 412 GLU GLU A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 SER 414 414 414 SER SER A . n 
A 1 415 SER 415 415 415 SER SER A . n 
A 1 416 SER 416 416 416 SER SER A . n 
A 1 417 SER 417 417 417 SER SER A . n 
A 1 418 ARG 418 418 418 ARG ARG A . n 
A 1 419 ASP 419 419 419 ASP ASP A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 LEU 421 421 421 LEU LEU A . n 
A 1 422 VAL 422 422 422 VAL VAL A . n 
A 1 423 LYS 423 423 423 LYS LYS A . n 
A 1 424 ALA 424 424 424 ALA ALA A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 GLY 427 427 427 GLY GLY A . n 
A 1 428 ARG 428 428 428 ARG ARG A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 LEU 431 431 431 LEU LEU A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 LEU 433 433 433 LEU LEU A . n 
A 1 434 VAL 434 434 434 VAL VAL A . n 
A 1 435 LYS 435 435 435 LYS LYS A . n 
A 1 436 LYS 436 436 436 LYS LYS A . n 
A 1 437 ILE 437 437 437 ILE ILE A . n 
A 1 438 ASN 438 438 438 ASN ASN A . n 
A 1 439 ASN 439 439 439 ASN ASN A . n 
A 1 440 VAL 440 440 440 VAL VAL A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 CYS 442 442 442 CYS CYS A . n 
A 1 443 SER 443 443 443 SER SER A . n 
A 1 444 GLU 444 444 444 GLU GLU A . n 
A 1 445 ARG 445 445 445 ARG ARG A . n 
A 1 446 LYS 446 446 446 LYS LYS A . n 
A 1 447 ALA 447 447 447 ALA ALA A . n 
A 1 448 TYR 448 448 448 TYR TYR A . n 
A 1 449 PHE 449 449 449 PHE PHE A . n 
A 1 450 ILE 450 450 450 ILE ILE A . n 
A 1 451 GLY 451 451 451 GLY GLY A . n 
A 1 452 VAL 452 452 452 VAL VAL A . n 
A 1 453 LEU 453 453 453 LEU LEU A . n 
A 1 454 ASP 454 454 454 ASP ASP A . n 
A 1 455 ILE 455 455 455 ILE ILE A . n 
A 1 456 SER 456 456 456 SER SER A . n 
A 1 457 GLY 457 457 457 GLY GLY A . n 
A 1 458 PHE 458 458 458 PHE PHE A . n 
A 1 459 GLU 459 459 459 GLU GLU A . n 
A 1 460 ILE 460 460 460 ILE ILE A . n 
A 1 461 PHE 461 461 461 PHE PHE A . n 
A 1 462 LYS 462 462 462 LYS LYS A . n 
A 1 463 VAL 463 463 463 VAL VAL A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 SER 465 465 465 SER SER A . n 
A 1 466 PHE 466 466 466 PHE PHE A . n 
A 1 467 GLU 467 467 467 GLU GLU A . n 
A 1 468 GLN 468 468 468 GLN GLN A . n 
A 1 469 LEU 469 469 469 LEU LEU A . n 
A 1 470 CYS 470 470 470 CYS CYS A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 ASN 472 472 472 ASN ASN A . n 
A 1 473 TYR 473 473 473 TYR TYR A . n 
A 1 474 THR 474 474 474 THR THR A . n 
A 1 475 ASN 475 475 475 ASN ASN A . n 
A 1 476 GLU 476 476 476 GLU GLU A . n 
A 1 477 LYS 477 477 477 LYS LYS A . n 
A 1 478 LEU 478 478 478 LEU LEU A . n 
A 1 479 GLN 479 479 479 GLN GLN A . n 
A 1 480 GLN 480 480 480 GLN GLN A . n 
A 1 481 PHE 481 481 481 PHE PHE A . n 
A 1 482 PHE 482 482 482 PHE PHE A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 HIS 484 484 484 HIS HIS A . n 
A 1 485 HIS 485 485 485 HIS HIS A . n 
A 1 486 MET 486 486 486 MET MET A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 LYS 488 488 488 LYS LYS A . n 
A 1 489 VAL 489 489 489 VAL VAL A . n 
A 1 490 GLU 490 490 490 GLU GLU A . n 
A 1 491 GLN 491 491 491 GLN GLN A . n 
A 1 492 GLU 492 492 492 GLU GLU A . n 
A 1 493 GLU 493 493 493 GLU GLU A . n 
A 1 494 TYR 494 494 494 TYR TYR A . n 
A 1 495 LEU 495 495 495 LEU LEU A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 GLU 497 497 497 GLU GLU A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 ILE 499 499 499 ILE ILE A . n 
A 1 500 ASN 500 500 500 ASN ASN A . n 
A 1 501 TRP 501 501 ?   ?   ?   A . n 
A 1 502 THR 502 502 ?   ?   ?   A . n 
A 1 503 PHE 503 503 ?   ?   ?   A . n 
A 1 504 ILE 504 504 ?   ?   ?   A . n 
A 1 505 ASP 505 505 ?   ?   ?   A . n 
A 1 506 PHE 506 506 ?   ?   ?   A . n 
A 1 507 GLY 507 507 ?   ?   ?   A . n 
A 1 508 LEU 508 508 508 LEU LEU A . n 
A 1 509 ASP 509 509 509 ASP ASP A . n 
A 1 510 SER 510 510 510 SER SER A . n 
A 1 511 GLN 511 511 511 GLN GLN A . n 
A 1 512 ALA 512 512 512 ALA ALA A . n 
A 1 513 THR 513 513 513 THR THR A . n 
A 1 514 ILE 514 514 514 ILE ILE A . n 
A 1 515 ASP 515 515 515 ASP ASP A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ILE 517 517 517 ILE ILE A . n 
A 1 518 ASP 518 518 518 ASP ASP A . n 
A 1 519 GLY 519 519 519 GLY GLY A . n 
A 1 520 ARG 520 520 520 ARG ARG A . n 
A 1 521 GLN 521 521 521 GLN GLN A . n 
A 1 522 PRO 522 522 522 PRO PRO A . n 
A 1 523 PRO 523 523 523 PRO PRO A . n 
A 1 524 GLY 524 524 524 GLY GLY A . n 
A 1 525 ILE 525 525 525 ILE ILE A . n 
A 1 526 LEU 526 526 526 LEU LEU A . n 
A 1 527 ALA 527 527 527 ALA ALA A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 LEU 529 529 529 LEU LEU A . n 
A 1 530 ASP 530 530 530 ASP ASP A . n 
A 1 531 GLU 531 531 531 GLU GLU A . n 
A 1 532 GLN 532 532 532 GLN GLN A . n 
A 1 533 SER 533 533 533 SER SER A . n 
A 1 534 VAL 534 534 534 VAL VAL A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 PRO 536 536 536 PRO PRO A . n 
A 1 537 ASN 537 537 537 ASN ASN A . n 
A 1 538 ALA 538 538 538 ALA ALA A . n 
A 1 539 THR 539 539 539 THR THR A . n 
A 1 540 ASP 540 540 540 ASP ASP A . n 
A 1 541 ASN 541 541 541 ASN ASN A . n 
A 1 542 THR 542 542 542 THR THR A . n 
A 1 543 LEU 543 543 543 LEU LEU A . n 
A 1 544 ILE 544 544 544 ILE ILE A . n 
A 1 545 THR 545 545 545 THR THR A . n 
A 1 546 LYS 546 546 546 LYS LYS A . n 
A 1 547 LEU 547 547 547 LEU LEU A . n 
A 1 548 HIS 548 548 548 HIS HIS A . n 
A 1 549 SER 549 549 549 SER SER A . n 
A 1 550 HIS 550 550 550 HIS HIS A . n 
A 1 551 PHE 551 551 551 PHE PHE A . n 
A 1 552 SER 552 552 552 SER SER A . n 
A 1 553 LYS 553 553 553 LYS LYS A . n 
A 1 554 LYS 554 554 554 LYS LYS A . n 
A 1 555 ASN 555 555 555 ASN ASN A . n 
A 1 556 ALA 556 556 556 ALA ALA A . n 
A 1 557 LYS 557 557 557 LYS LYS A . n 
A 1 558 TYR 558 558 558 TYR TYR A . n 
A 1 559 GLU 559 559 559 GLU GLU A . n 
A 1 560 GLU 560 560 560 GLU GLU A . n 
A 1 561 PRO 561 561 561 PRO PRO A . n 
A 1 562 ARG 562 562 562 ARG ARG A . n 
A 1 563 PHE 563 563 563 PHE PHE A . n 
A 1 564 SER 564 564 564 SER SER A . n 
A 1 565 LYS 565 565 565 LYS LYS A . n 
A 1 566 THR 566 566 566 THR THR A . n 
A 1 567 GLU 567 567 567 GLU GLU A . n 
A 1 568 PHE 568 568 568 PHE PHE A . n 
A 1 569 GLY 569 569 569 GLY GLY A . n 
A 1 570 VAL 570 570 570 VAL VAL A . n 
A 1 571 THR 571 571 571 THR THR A . n 
A 1 572 HIS 572 572 572 HIS HIS A . n 
A 1 573 TYR 573 573 573 TYR TYR A . n 
A 1 574 ALA 574 574 574 ALA ALA A . n 
A 1 575 GLY 575 575 575 GLY GLY A . n 
A 1 576 GLN 576 576 576 GLN GLN A . n 
A 1 577 VAL 577 577 577 VAL VAL A . n 
A 1 578 MET 578 578 578 MET MET A . n 
A 1 579 TYR 579 579 579 TYR TYR A . n 
A 1 580 GLU 580 580 580 GLU GLU A . n 
A 1 581 ILE 581 581 581 ILE ILE A . n 
A 1 582 GLN 582 582 582 GLN GLN A . n 
A 1 583 ASP 583 583 583 ASP ASP A . n 
A 1 584 TRP 584 584 584 TRP TRP A . n 
A 1 585 LEU 585 585 585 LEU LEU A . n 
A 1 586 GLU 586 586 586 GLU GLU A . n 
A 1 587 LYS 587 587 587 LYS LYS A . n 
A 1 588 ASN 588 588 588 ASN ASN A . n 
A 1 589 LYS 589 589 589 LYS LYS A . n 
A 1 590 ASP 590 590 590 ASP ASP A . n 
A 1 591 PRO 591 591 591 PRO PRO A . n 
A 1 592 LEU 592 592 592 LEU LEU A . n 
A 1 593 GLN 593 593 593 GLN GLN A . n 
A 1 594 GLN 594 594 594 GLN GLN A . n 
A 1 595 ASP 595 595 595 ASP ASP A . n 
A 1 596 LEU 596 596 596 LEU LEU A . n 
A 1 597 GLU 597 597 597 GLU GLU A . n 
A 1 598 LEU 598 598 598 LEU LEU A . n 
A 1 599 CYS 599 599 599 CYS CYS A . n 
A 1 600 PHE 600 600 600 PHE PHE A . n 
A 1 601 LYS 601 601 601 LYS LYS A . n 
A 1 602 ASP 602 602 602 ASP ASP A . n 
A 1 603 SER 603 603 603 SER SER A . n 
A 1 604 SER 604 604 604 SER SER A . n 
A 1 605 ASP 605 605 605 ASP ASP A . n 
A 1 606 ASN 606 606 606 ASN ASN A . n 
A 1 607 VAL 607 607 607 VAL VAL A . n 
A 1 608 VAL 608 608 608 VAL VAL A . n 
A 1 609 THR 609 609 609 THR THR A . n 
A 1 610 LYS 610 610 610 LYS LYS A . n 
A 1 611 LEU 611 611 611 LEU LEU A . n 
A 1 612 PHE 612 612 612 PHE PHE A . n 
A 1 613 ASN 613 613 613 ASN ASN A . n 
A 1 614 ASP 614 614 614 ASP ASP A . n 
A 1 615 PRO 615 615 615 PRO PRO A . n 
A 1 616 ASN 616 616 616 ASN ASN A . n 
A 1 617 ILE 617 617 617 ILE ILE A . n 
A 1 618 ALA 618 618 618 ALA ALA A . n 
A 1 619 SER 619 619 619 SER SER A . n 
A 1 620 ARG 620 620 620 ARG ARG A . n 
A 1 621 ALA 621 621 621 ALA ALA A . n 
A 1 622 LYS 622 622 ?   ?   ?   A . n 
A 1 623 LYS 623 623 ?   ?   ?   A . n 
A 1 624 GLY 624 624 ?   ?   ?   A . n 
A 1 625 ALA 625 625 ?   ?   ?   A . n 
A 1 626 ASN 626 626 ?   ?   ?   A . n 
A 1 627 PHE 627 627 627 PHE PHE A . n 
A 1 628 LEU 628 628 628 LEU LEU A . n 
A 1 629 THR 629 629 629 THR THR A . n 
A 1 630 VAL 630 630 630 VAL VAL A . n 
A 1 631 ALA 631 631 631 ALA ALA A . n 
A 1 632 ALA 632 632 632 ALA ALA A . n 
A 1 633 GLN 633 633 633 GLN GLN A . n 
A 1 634 TYR 634 634 634 TYR TYR A . n 
A 1 635 LYS 635 635 635 LYS LYS A . n 
A 1 636 GLU 636 636 636 GLU GLU A . n 
A 1 637 GLN 637 637 637 GLN GLN A . n 
A 1 638 LEU 638 638 638 LEU LEU A . n 
A 1 639 ALA 639 639 639 ALA ALA A . n 
A 1 640 SER 640 640 640 SER SER A . n 
A 1 641 LEU 641 641 641 LEU LEU A . n 
A 1 642 MET 642 642 642 MET MET A . n 
A 1 643 ALA 643 643 643 ALA ALA A . n 
A 1 644 THR 644 644 644 THR THR A . n 
A 1 645 LEU 645 645 645 LEU LEU A . n 
A 1 646 GLU 646 646 646 GLU GLU A . n 
A 1 647 THR 647 647 647 THR THR A . n 
A 1 648 THR 648 648 648 THR THR A . n 
A 1 649 ASN 649 649 649 ASN ASN A . n 
A 1 650 PRO 650 650 650 PRO PRO A . n 
A 1 651 HIS 651 651 651 HIS HIS A . n 
A 1 652 PHE 652 652 652 PHE PHE A . n 
A 1 653 VAL 653 653 653 VAL VAL A . n 
A 1 654 ARG 654 654 654 ARG ARG A . n 
A 1 655 CYS 655 655 655 CYS CYS A . n 
A 1 656 ILE 656 656 656 ILE ILE A . n 
A 1 657 ILE 657 657 657 ILE ILE A . n 
A 1 658 PRO 658 658 658 PRO PRO A . n 
A 1 659 ASN 659 659 659 ASN ASN A . n 
A 1 660 ASN 660 660 660 ASN ASN A . n 
A 1 661 LYS 661 661 661 LYS LYS A . n 
A 1 662 GLN 662 662 662 GLN GLN A . n 
A 1 663 LEU 663 663 663 LEU LEU A . n 
A 1 664 PRO 664 664 664 PRO PRO A . n 
A 1 665 ALA 665 665 665 ALA ALA A . n 
A 1 666 LYS 666 666 666 LYS LYS A . n 
A 1 667 LEU 667 667 667 LEU LEU A . n 
A 1 668 GLU 668 668 668 GLU GLU A . n 
A 1 669 ASP 669 669 669 ASP ASP A . n 
A 1 670 LYS 670 670 670 LYS LYS A . n 
A 1 671 VAL 671 671 671 VAL VAL A . n 
A 1 672 VAL 672 672 672 VAL VAL A . n 
A 1 673 LEU 673 673 673 LEU LEU A . n 
A 1 674 ASP 674 674 674 ASP ASP A . n 
A 1 675 GLN 675 675 675 GLN GLN A . n 
A 1 676 LEU 676 676 676 LEU LEU A . n 
A 1 677 ARG 677 677 677 ARG ARG A . n 
A 1 678 CYS 678 678 678 CYS CYS A . n 
A 1 679 ASN 679 679 679 ASN ASN A . n 
A 1 680 GLY 680 680 680 GLY GLY A . n 
A 1 681 VAL 681 681 681 VAL VAL A . n 
A 1 682 LEU 682 682 682 LEU LEU A . n 
A 1 683 GLU 683 683 683 GLU GLU A . n 
A 1 684 ALA 684 684 684 ALA ALA A . n 
A 1 685 ILE 685 685 685 ILE ILE A . n 
A 1 686 ARG 686 686 686 ARG ARG A . n 
A 1 687 ILE 687 687 687 ILE ILE A . n 
A 1 688 THR 688 688 688 THR THR A . n 
A 1 689 ARG 689 689 689 ARG ARG A . n 
A 1 690 LYS 690 690 690 LYS LYS A . n 
A 1 691 GLY 691 691 691 GLY GLY A . n 
A 1 692 PHE 692 692 692 PHE PHE A . n 
A 1 693 PRO 693 693 693 PRO PRO A . n 
A 1 694 ASN 694 694 694 ASN ASN A . n 
A 1 695 ARG 695 695 695 ARG ARG A . n 
A 1 696 ILE 696 696 696 ILE ILE A . n 
A 1 697 ILE 697 697 697 ILE ILE A . n 
A 1 698 TYR 698 698 698 TYR TYR A . n 
A 1 699 ALA 699 699 699 ALA ALA A . n 
A 1 700 ASP 700 700 700 ASP ASP A . n 
A 1 701 PHE 701 701 701 PHE PHE A . n 
A 1 702 VAL 702 702 702 VAL VAL A . n 
A 1 703 LYS 703 703 703 LYS LYS A . n 
A 1 704 ARG 704 704 704 ARG ARG A . n 
A 1 705 TYR 705 705 705 TYR TYR A . n 
A 1 706 TYR 706 706 706 TYR TYR A . n 
A 1 707 ASP 707 707 707 ASP ASP A . n 
A 1 708 LEU 708 708 708 LEU LEU A . n 
A 1 709 ALA 709 709 709 ALA ALA A . n 
A 1 710 PRO 710 710 710 PRO PRO A . n 
A 1 711 ASN 711 711 711 ASN ASN A . n 
A 1 712 VAL 712 712 712 VAL VAL A . n 
A 1 713 PRO 713 713 713 PRO PRO A . n 
A 1 714 ARG 714 714 714 ARG ARG A . n 
A 1 715 ASP 715 715 715 ASP ASP A . n 
A 1 716 ALA 716 716 716 ALA ALA A . n 
A 1 717 GLU 717 717 717 GLU GLU A . n 
A 1 718 ASP 718 718 718 ASP ASP A . n 
A 1 719 SER 719 719 719 SER SER A . n 
A 1 720 GLN 720 720 720 GLN GLN A . n 
A 1 721 LYS 721 721 721 LYS LYS A . n 
A 1 722 ALA 722 722 722 ALA ALA A . n 
A 1 723 THR 723 723 723 THR THR A . n 
A 1 724 ASP 724 724 724 ASP ASP A . n 
A 1 725 ALA 725 725 725 ALA ALA A . n 
A 1 726 VAL 726 726 726 VAL VAL A . n 
A 1 727 LEU 727 727 727 LEU LEU A . n 
A 1 728 LYS 728 728 728 LYS LYS A . n 
A 1 729 HIS 729 729 729 HIS HIS A . n 
A 1 730 LEU 730 730 730 LEU LEU A . n 
A 1 731 ASN 731 731 731 ASN ASN A . n 
A 1 732 ILE 732 732 732 ILE ILE A . n 
A 1 733 ASP 733 733 733 ASP ASP A . n 
A 1 734 PRO 734 734 734 PRO PRO A . n 
A 1 735 GLU 735 735 735 GLU GLU A . n 
A 1 736 GLN 736 736 736 GLN GLN A . n 
A 1 737 PHE 737 737 737 PHE PHE A . n 
A 1 738 ARG 738 738 738 ARG ARG A . n 
A 1 739 PHE 739 739 739 PHE PHE A . n 
A 1 740 GLY 740 740 740 GLY GLY A . n 
A 1 741 ILE 741 741 741 ILE ILE A . n 
A 1 742 THR 742 742 742 THR THR A . n 
A 1 743 LYS 743 743 743 LYS LYS A . n 
A 1 744 ILE 744 744 744 ILE ILE A . n 
A 1 745 PHE 745 745 745 PHE PHE A . n 
A 1 746 PHE 746 746 746 PHE PHE A . n 
A 1 747 ARG 747 747 747 ARG ARG A . n 
A 1 748 ALA 748 748 748 ALA ALA A . n 
A 1 749 GLY 749 749 749 GLY GLY A . n 
A 1 750 GLN 750 750 750 GLN GLN A . n 
A 1 751 LEU 751 751 751 LEU LEU A . n 
A 1 752 ALA 752 752 752 ALA ALA A . n 
A 1 753 ARG 753 753 753 ARG ARG A . n 
A 1 754 ILE 754 754 754 ILE ILE A . n 
A 1 755 GLU 755 755 755 GLU GLU A . n 
A 1 756 GLU 756 756 756 GLU GLU A . n 
A 1 757 ALA 757 757 757 ALA ALA A . n 
A 1 758 ARG 758 758 758 ARG ARG A . n 
A 1 759 GLU 759 759 759 GLU GLU A . n 
A 1 760 LEU 760 760 ?   ?   ?   A . n 
A 1 761 PRO 761 761 ?   ?   ?   A . n 
A 1 762 ASN 762 762 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? D HOH .   ? A HOH 9951 ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 O   ? D HOH .   ? A HOH 9952 ? 1_555 169.5 ? 
2  O   ? D HOH .   ? A HOH 9951 ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 OG1 ? A THR 186 ? A THR 186  ? 1_555 85.0  ? 
3  O   ? D HOH .   ? A HOH 9952 ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 OG1 ? A THR 186 ? A THR 186  ? 1_555 84.7  ? 
4  O   ? D HOH .   ? A HOH 9951 ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 OG  ? A SER 237 ? A SER 237  ? 1_555 88.8  ? 
5  O   ? D HOH .   ? A HOH 9952 ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 OG  ? A SER 237 ? A SER 237  ? 1_555 89.2  ? 
6  OG1 ? A THR 186 ? A THR 186  ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 OG  ? A SER 237 ? A SER 237  ? 1_555 89.2  ? 
7  O   ? D HOH .   ? A HOH 9951 ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 O3G ? C AGS .   ? A AGS 999  ? 1_555 90.9  ? 
8  O   ? D HOH .   ? A HOH 9952 ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 O3G ? C AGS .   ? A AGS 999  ? 1_555 99.4  ? 
9  OG1 ? A THR 186 ? A THR 186  ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 O3G ? C AGS .   ? A AGS 999  ? 1_555 175.8 ? 
10 OG  ? A SER 237 ? A SER 237  ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 O3G ? C AGS .   ? A AGS 999  ? 1_555 91.4  ? 
11 O   ? D HOH .   ? A HOH 9951 ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 O2B ? C AGS .   ? A AGS 999  ? 1_555 90.6  ? 
12 O   ? D HOH .   ? A HOH 9952 ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 O2B ? C AGS .   ? A AGS 999  ? 1_555 90.8  ? 
13 OG1 ? A THR 186 ? A THR 186  ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 O2B ? C AGS .   ? A AGS 999  ? 1_555 87.7  ? 
14 OG  ? A SER 237 ? A SER 237  ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 O2B ? C AGS .   ? A AGS 999  ? 1_555 176.9 ? 
15 O3G ? C AGS .   ? A AGS 999  ? 1_555 MG ? B MG . ? A MG 998 ? 1_555 O2B ? C AGS .   ? A AGS 999  ? 1_555 91.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-12-03 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE phasing    . ? 1 
TNT   refinement . ? 2 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A HOH 8052 ? ? O   A HOH 8243 ? ? 1.47 
2  1 O   A HOH 8143 ? ? O   A HOH 8145 ? ? 1.79 
3  1 O   A HOH 8145 ? ? O   A HOH 8149 ? ? 1.94 
4  1 NH1 A ARG 654  ? ? O   A HOH 8067 ? ? 2.02 
5  1 NZ  A LYS 16   ? ? O   A HOH 8221 ? ? 2.05 
6  1 O   A LEU 27   ? ? O   A HOH 8229 ? ? 2.09 
7  1 OD2 A ASP 45   ? ? NH2 A ARG 677  ? ? 2.11 
8  1 OD2 A ASP 509  ? ? NZ  A LYS 557  ? ? 2.13 
9  1 OG  A SER 181  ? ? O2G A AGS 999  ? ? 2.14 
10 1 O   A HOH 8132 ? ? O   A HOH 8133 ? ? 2.14 
11 1 O   A HOH 8104 ? ? O   A HOH 8105 ? ? 2.15 
12 1 OD1 A ASP 6    ? ? OG1 A THR 8    ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CD A GLU 51  ? ? OE1 A GLU 51  ? ? 1.329 1.252 0.077 0.011 N 
2  1 CD A GLU 55  ? ? OE1 A GLU 55  ? ? 1.326 1.252 0.074 0.011 N 
3  1 CD A GLU 89  ? ? OE1 A GLU 89  ? ? 1.339 1.252 0.087 0.011 N 
4  1 CD A GLU 187 ? ? OE1 A GLU 187 ? ? 1.344 1.252 0.092 0.011 N 
5  1 CD A GLU 212 ? ? OE2 A GLU 212 ? ? 1.349 1.252 0.097 0.011 N 
6  1 CD A GLU 291 ? ? OE2 A GLU 291 ? ? 1.320 1.252 0.068 0.011 N 
7  1 CD A GLU 292 ? ? OE1 A GLU 292 ? ? 1.319 1.252 0.067 0.011 N 
8  1 CD A GLU 302 ? ? OE2 A GLU 302 ? ? 1.323 1.252 0.071 0.011 N 
9  1 CD A GLU 321 ? ? OE2 A GLU 321 ? ? 1.320 1.252 0.068 0.011 N 
10 1 CD A GLU 339 ? ? OE1 A GLU 339 ? ? 1.343 1.252 0.091 0.011 N 
11 1 CD A GLU 340 ? ? OE1 A GLU 340 ? ? 1.329 1.252 0.077 0.011 N 
12 1 CD A GLU 360 ? ? OE2 A GLU 360 ? ? 1.327 1.252 0.075 0.011 N 
13 1 CD A GLU 390 ? ? OE1 A GLU 390 ? ? 1.320 1.252 0.068 0.011 N 
14 1 CD A GLU 395 ? ? OE2 A GLU 395 ? ? 1.323 1.252 0.071 0.011 N 
15 1 CD A GLU 444 ? ? OE2 A GLU 444 ? ? 1.335 1.252 0.083 0.011 N 
16 1 CD A GLU 490 ? ? OE1 A GLU 490 ? ? 1.326 1.252 0.074 0.011 N 
17 1 CD A GLU 492 ? ? OE1 A GLU 492 ? ? 1.329 1.252 0.077 0.011 N 
18 1 CD A GLU 497 ? ? OE1 A GLU 497 ? ? 1.331 1.252 0.079 0.011 N 
19 1 CD A GLU 531 ? ? OE1 A GLU 531 ? ? 1.333 1.252 0.081 0.011 N 
20 1 CD A GLU 567 ? ? OE2 A GLU 567 ? ? 1.322 1.252 0.070 0.011 N 
21 1 CD A GLU 580 ? ? OE2 A GLU 580 ? ? 1.328 1.252 0.076 0.011 N 
22 1 CD A GLU 636 ? ? OE1 A GLU 636 ? ? 1.339 1.252 0.087 0.011 N 
23 1 CD A GLU 646 ? ? OE1 A GLU 646 ? ? 1.321 1.252 0.069 0.011 N 
24 1 CD A GLU 668 ? ? OE2 A GLU 668 ? ? 1.328 1.252 0.076 0.011 N 
25 1 CD A GLU 683 ? ? OE1 A GLU 683 ? ? 1.343 1.252 0.091 0.011 N 
26 1 CD A GLU 735 ? ? OE1 A GLU 735 ? ? 1.329 1.252 0.077 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A ASP 6   ? ? CG A ASP 6   ? ? OD1 A ASP 6   ? ? 124.24 118.30 5.94   0.90 N 
2  1 CB A ASP 6   ? ? CG A ASP 6   ? ? OD2 A ASP 6   ? ? 110.22 118.30 -8.08  0.90 N 
3  1 NE A ARG 7   ? ? CZ A ARG 7   ? ? NH2 A ARG 7   ? ? 116.75 120.30 -3.55  0.50 N 
4  1 CB A ASP 23  ? ? CG A ASP 23  ? ? OD1 A ASP 23  ? ? 124.23 118.30 5.93   0.90 N 
5  1 CB A ASP 23  ? ? CG A ASP 23  ? ? OD2 A ASP 23  ? ? 110.10 118.30 -8.20  0.90 N 
6  1 C  A ASP 40  ? ? N  A PRO 41  ? ? CD  A PRO 41  ? ? 114.11 128.40 -14.29 2.10 Y 
7  1 CD A ARG 44  ? ? NE A ARG 44  ? ? CZ  A ARG 44  ? ? 132.74 123.60 9.14   1.40 N 
8  1 NE A ARG 44  ? ? CZ A ARG 44  ? ? NH1 A ARG 44  ? ? 124.07 120.30 3.77   0.50 N 
9  1 CB A ASP 66  ? ? CG A ASP 66  ? ? OD1 A ASP 66  ? ? 112.45 118.30 -5.85  0.90 N 
10 1 CB A ASP 76  ? ? CG A ASP 76  ? ? OD2 A ASP 76  ? ? 110.89 118.30 -7.41  0.90 N 
11 1 NE A ARG 131 ? ? CZ A ARG 131 ? ? NH1 A ARG 131 ? ? 123.37 120.30 3.07   0.50 N 
12 1 CB A ASP 141 ? ? CG A ASP 141 ? ? OD1 A ASP 141 ? ? 112.87 118.30 -5.43  0.90 N 
13 1 NE A ARG 147 ? ? CZ A ARG 147 ? ? NH1 A ARG 147 ? ? 124.45 120.30 4.15   0.50 N 
14 1 NE A ARG 147 ? ? CZ A ARG 147 ? ? NH2 A ARG 147 ? ? 117.29 120.30 -3.01  0.50 N 
15 1 NE A ARG 148 ? ? CZ A ARG 148 ? ? NH2 A ARG 148 ? ? 114.54 120.30 -5.76  0.50 N 
16 1 CB A ASP 160 ? ? CG A ASP 160 ? ? OD1 A ASP 160 ? ? 110.77 118.30 -7.53  0.90 N 
17 1 CB A ASP 168 ? ? CG A ASP 168 ? ? OD1 A ASP 168 ? ? 126.25 118.30 7.95   0.90 N 
18 1 CB A ASP 168 ? ? CG A ASP 168 ? ? OD2 A ASP 168 ? ? 110.84 118.30 -7.46  0.90 N 
19 1 NE A ARG 170 ? ? CZ A ARG 170 ? ? NH2 A ARG 170 ? ? 123.31 120.30 3.01   0.50 N 
20 1 CB A ARG 202 ? ? CA A ARG 202 ? ? C   A ARG 202 ? ? 124.86 110.40 14.46  2.00 N 
21 1 NE A ARG 238 ? ? CZ A ARG 238 ? ? NH1 A ARG 238 ? ? 125.78 120.30 5.48   0.50 N 
22 1 NE A ARG 238 ? ? CZ A ARG 238 ? ? NH2 A ARG 238 ? ? 115.94 120.30 -4.36  0.50 N 
23 1 NE A ARG 267 ? ? CZ A ARG 267 ? ? NH1 A ARG 267 ? ? 123.76 120.30 3.46   0.50 N 
24 1 NE A ARG 276 ? ? CZ A ARG 276 ? ? NH1 A ARG 276 ? ? 123.52 120.30 3.22   0.50 N 
25 1 CB A ASP 322 ? ? CG A ASP 322 ? ? OD1 A ASP 322 ? ? 124.06 118.30 5.76   0.90 N 
26 1 CB A ASP 332 ? ? CG A ASP 332 ? ? OD1 A ASP 332 ? ? 112.13 118.30 -6.17  0.90 N 
27 1 N  A LYS 358 ? ? CA A LYS 358 ? ? CB  A LYS 358 ? ? 122.16 110.60 11.56  1.80 N 
28 1 C  A ASN 385 ? ? N  A PRO 386 ? ? CD  A PRO 386 ? ? 112.45 128.40 -15.95 2.10 Y 
29 1 CB A ASP 403 ? ? CG A ASP 403 ? ? OD1 A ASP 403 ? ? 111.43 118.30 -6.87  0.90 N 
30 1 CB A ASP 419 ? ? CG A ASP 419 ? ? OD1 A ASP 419 ? ? 125.20 118.30 6.90   0.90 N 
31 1 CB A ASP 419 ? ? CG A ASP 419 ? ? OD2 A ASP 419 ? ? 109.32 118.30 -8.98  0.90 N 
32 1 NE A ARG 428 ? ? CZ A ARG 428 ? ? NH1 A ARG 428 ? ? 123.62 120.30 3.32   0.50 N 
33 1 NE A ARG 428 ? ? CZ A ARG 428 ? ? NH2 A ARG 428 ? ? 115.61 120.30 -4.69  0.50 N 
34 1 CB A ASP 509 ? ? CG A ASP 509 ? ? OD1 A ASP 509 ? ? 124.92 118.30 6.62   0.90 N 
35 1 CB A ASP 509 ? ? CG A ASP 509 ? ? OD2 A ASP 509 ? ? 112.10 118.30 -6.20  0.90 N 
36 1 CB A ASP 518 ? ? CG A ASP 518 ? ? OD2 A ASP 518 ? ? 112.11 118.30 -6.19  0.90 N 
37 1 CB A PHE 535 ? ? CG A PHE 535 ? ? CD1 A PHE 535 ? ? 116.24 120.80 -4.56  0.70 N 
38 1 NE A ARG 562 ? ? CZ A ARG 562 ? ? NH2 A ARG 562 ? ? 116.75 120.30 -3.55  0.50 N 
39 1 CB A ASP 583 ? ? CG A ASP 583 ? ? OD1 A ASP 583 ? ? 112.02 118.30 -6.28  0.90 N 
40 1 CB A ASP 590 ? ? CG A ASP 590 ? ? OD1 A ASP 590 ? ? 111.21 118.30 -7.09  0.90 N 
41 1 CB A ASP 605 ? ? CG A ASP 605 ? ? OD1 A ASP 605 ? ? 107.61 118.30 -10.69 0.90 N 
42 1 CB A ASP 605 ? ? CG A ASP 605 ? ? OD2 A ASP 605 ? ? 126.97 118.30 8.67   0.90 N 
43 1 CB A ASP 614 ? ? CG A ASP 614 ? ? OD1 A ASP 614 ? ? 125.37 118.30 7.07   0.90 N 
44 1 CB A ASP 614 ? ? CG A ASP 614 ? ? OD2 A ASP 614 ? ? 111.30 118.30 -7.00  0.90 N 
45 1 CB A ASP 669 ? ? CG A ASP 669 ? ? OD1 A ASP 669 ? ? 111.46 118.30 -6.84  0.90 N 
46 1 CB A ASP 674 ? ? CG A ASP 674 ? ? OD1 A ASP 674 ? ? 110.35 118.30 -7.95  0.90 N 
47 1 NE A ARG 686 ? ? CZ A ARG 686 ? ? NH2 A ARG 686 ? ? 116.92 120.30 -3.38  0.50 N 
48 1 NE A ARG 689 ? ? CZ A ARG 689 ? ? NH1 A ARG 689 ? ? 123.85 120.30 3.55   0.50 N 
49 1 CB A ASP 700 ? ? CG A ASP 700 ? ? OD1 A ASP 700 ? ? 112.08 118.30 -6.22  0.90 N 
50 1 CB A ASP 707 ? ? CG A ASP 707 ? ? OD2 A ASP 707 ? ? 112.10 118.30 -6.20  0.90 N 
51 1 CB A ASP 718 ? ? CG A ASP 718 ? ? OD2 A ASP 718 ? ? 112.77 118.30 -5.53  0.90 N 
52 1 CA A HIS 729 ? ? CB A HIS 729 ? ? CG  A HIS 729 ? ? 101.55 113.60 -12.05 1.70 N 
53 1 NE A ARG 738 ? ? CZ A ARG 738 ? ? NH1 A ARG 738 ? ? 123.40 120.30 3.10   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 7   ? ? -55.08  5.50    
2  1 ASP A 40  ? ? -163.82 106.93  
3  1 ASN A 78  ? ? -101.98 77.96   
4  1 HIS A 154 ? ? -173.94 148.76  
5  1 PRO A 220 ? ? -39.95  -39.64  
6  1 ARG A 238 ? ? -97.12  32.27   
7  1 THR A 274 ? ? 89.71   -13.80  
8  1 ALA A 290 ? ? -43.27  -18.98  
9  1 LYS A 361 ? ? -103.44 -122.52 
10 1 ALA A 363 ? ? -6.65   -66.26  
11 1 PHE A 461 ? ? -101.18 -166.31 
12 1 SER A 465 ? ? -111.00 -165.12 
13 1 LYS A 498 ? ? 78.15   39.17   
14 1 SER A 603 ? ? -36.95  133.40  
15 1 PRO A 710 ? ? -69.18  87.89   
16 1 ASN A 711 ? ? 178.43  -90.32  
17 1 ARG A 714 ? ? -29.20  -63.60  
18 1 GLU A 756 ? ? -68.44  0.89    
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    VAL 
_pdbx_validate_chiral.auth_seq_id     489 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 48  ? CG  ? A GLU 48  CG  
2  1 Y 1 A GLU 48  ? CD  ? A GLU 48  CD  
3  1 Y 1 A GLU 48  ? OE1 ? A GLU 48  OE1 
4  1 Y 1 A GLU 48  ? OE2 ? A GLU 48  OE2 
5  1 Y 1 A LYS 63  ? CG  ? A LYS 63  CG  
6  1 Y 1 A LYS 63  ? CD  ? A LYS 63  CD  
7  1 Y 1 A LYS 63  ? CE  ? A LYS 63  CE  
8  1 Y 1 A LYS 63  ? NZ  ? A LYS 63  NZ  
9  1 Y 1 A GLN 68  ? CG  ? A GLN 68  CG  
10 1 Y 1 A GLN 68  ? CD  ? A GLN 68  CD  
11 1 Y 1 A GLN 68  ? OE1 ? A GLN 68  OE1 
12 1 Y 1 A GLN 68  ? NE2 ? A GLN 68  NE2 
13 1 Y 1 A ASP 69  ? CG  ? A ASP 69  CG  
14 1 Y 1 A ASP 69  ? OD1 ? A ASP 69  OD1 
15 1 Y 1 A ASP 69  ? OD2 ? A ASP 69  OD2 
16 1 Y 1 A ARG 70  ? CG  ? A ARG 70  CG  
17 1 Y 1 A ARG 70  ? CD  ? A ARG 70  CD  
18 1 Y 1 A ARG 70  ? NE  ? A ARG 70  NE  
19 1 Y 1 A ARG 70  ? CZ  ? A ARG 70  CZ  
20 1 Y 1 A ARG 70  ? NH1 ? A ARG 70  NH1 
21 1 Y 1 A ARG 70  ? NH2 ? A ARG 70  NH2 
22 1 Y 1 A LYS 73  ? CG  ? A LYS 73  CG  
23 1 Y 1 A LYS 73  ? CD  ? A LYS 73  CD  
24 1 Y 1 A LYS 73  ? CE  ? A LYS 73  CE  
25 1 Y 1 A LYS 73  ? NZ  ? A LYS 73  NZ  
26 1 Y 1 A ASN 203 ? CG  ? A ASN 203 CG  
27 1 Y 1 A ASN 203 ? OD1 ? A ASN 203 OD1 
28 1 Y 1 A ASN 203 ? ND2 ? A ASN 203 ND2 
29 1 Y 1 A LYS 361 ? CG  ? A LYS 361 CG  
30 1 Y 1 A LYS 361 ? CD  ? A LYS 361 CD  
31 1 Y 1 A LYS 361 ? CE  ? A LYS 361 CE  
32 1 Y 1 A LYS 361 ? NZ  ? A LYS 361 NZ  
33 1 Y 1 A GLU 365 ? CG  ? A GLU 365 CG  
34 1 Y 1 A GLU 365 ? CD  ? A GLU 365 CD  
35 1 Y 1 A GLU 365 ? OE1 ? A GLU 365 OE1 
36 1 Y 1 A GLU 365 ? OE2 ? A GLU 365 OE2 
37 1 Y 1 A ARG 445 ? CG  ? A ARG 445 CG  
38 1 Y 1 A ARG 445 ? CD  ? A ARG 445 CD  
39 1 Y 1 A ARG 445 ? NE  ? A ARG 445 NE  
40 1 Y 1 A ARG 445 ? CZ  ? A ARG 445 CZ  
41 1 Y 1 A ARG 445 ? NH1 ? A ARG 445 NH1 
42 1 Y 1 A ARG 445 ? NH2 ? A ARG 445 NH2 
43 1 Y 1 A GLU 493 ? CG  ? A GLU 493 CG  
44 1 Y 1 A GLU 493 ? CD  ? A GLU 493 CD  
45 1 Y 1 A GLU 493 ? OE1 ? A GLU 493 OE1 
46 1 Y 1 A GLU 493 ? OE2 ? A GLU 493 OE2 
47 1 Y 1 A TYR 494 ? CG  ? A TYR 494 CG  
48 1 Y 1 A TYR 494 ? CD1 ? A TYR 494 CD1 
49 1 Y 1 A TYR 494 ? CD2 ? A TYR 494 CD2 
50 1 Y 1 A TYR 494 ? CE1 ? A TYR 494 CE1 
51 1 Y 1 A TYR 494 ? CE2 ? A TYR 494 CE2 
52 1 Y 1 A TYR 494 ? CZ  ? A TYR 494 CZ  
53 1 Y 1 A TYR 494 ? OH  ? A TYR 494 OH  
54 1 Y 1 A ASN 500 ? CG  ? A ASN 500 CG  
55 1 Y 1 A ASN 500 ? OD1 ? A ASN 500 OD1 
56 1 Y 1 A ASN 500 ? ND2 ? A ASN 500 ND2 
57 1 Y 1 A LEU 508 ? CG  ? A LEU 508 CG  
58 1 Y 1 A LEU 508 ? CD1 ? A LEU 508 CD1 
59 1 Y 1 A LEU 508 ? CD2 ? A LEU 508 CD2 
60 1 Y 1 A PHE 627 ? CG  ? A PHE 627 CG  
61 1 Y 1 A PHE 627 ? CD1 ? A PHE 627 CD1 
62 1 Y 1 A PHE 627 ? CD2 ? A PHE 627 CD2 
63 1 Y 1 A PHE 627 ? CE1 ? A PHE 627 CE1 
64 1 Y 1 A PHE 627 ? CE2 ? A PHE 627 CE2 
65 1 Y 1 A PHE 627 ? CZ  ? A PHE 627 CZ  
66 1 Y 1 A LYS 670 ? CG  ? A LYS 670 CG  
67 1 Y 1 A LYS 670 ? CD  ? A LYS 670 CD  
68 1 Y 1 A LYS 670 ? CE  ? A LYS 670 CE  
69 1 Y 1 A LYS 670 ? NZ  ? A LYS 670 NZ  
70 1 Y 1 A PRO 713 ? CG  ? A PRO 713 CG  
71 1 Y 1 A PRO 713 ? CD  ? A PRO 713 CD  
72 1 Y 1 A ARG 714 ? CG  ? A ARG 714 CG  
73 1 Y 1 A ARG 714 ? CD  ? A ARG 714 CD  
74 1 Y 1 A ARG 714 ? NE  ? A ARG 714 NE  
75 1 Y 1 A ARG 714 ? CZ  ? A ARG 714 CZ  
76 1 Y 1 A ARG 714 ? NH1 ? A ARG 714 NH1 
77 1 Y 1 A ARG 714 ? NH2 ? A ARG 714 NH2 
78 1 Y 1 A ASP 715 ? CG  ? A ASP 715 CG  
79 1 Y 1 A ASP 715 ? OD1 ? A ASP 715 OD1 
80 1 Y 1 A ASP 715 ? OD2 ? A ASP 715 OD2 
81 1 Y 1 A ARG 758 ? CG  ? A ARG 758 CG  
82 1 Y 1 A ARG 758 ? CD  ? A ARG 758 CD  
83 1 Y 1 A ARG 758 ? NE  ? A ARG 758 NE  
84 1 Y 1 A ARG 758 ? CZ  ? A ARG 758 CZ  
85 1 Y 1 A ARG 758 ? NH1 ? A ARG 758 NH1 
86 1 Y 1 A ARG 758 ? NH2 ? A ARG 758 NH2 
87 1 Y 1 A GLU 759 ? CG  ? A GLU 759 CG  
88 1 Y 1 A GLU 759 ? CD  ? A GLU 759 CD  
89 1 Y 1 A GLU 759 ? OE1 ? A GLU 759 OE1 
90 1 Y 1 A GLU 759 ? OE2 ? A GLU 759 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLN 204 ? A GLN 204 
3  1 Y 1 A ALA 205 ? A ALA 205 
4  1 Y 1 A ASN 206 ? A ASN 206 
5  1 Y 1 A GLY 207 ? A GLY 207 
6  1 Y 1 A SER 208 ? A SER 208 
7  1 Y 1 A TRP 501 ? A TRP 501 
8  1 Y 1 A THR 502 ? A THR 502 
9  1 Y 1 A PHE 503 ? A PHE 503 
10 1 Y 1 A ILE 504 ? A ILE 504 
11 1 Y 1 A ASP 505 ? A ASP 505 
12 1 Y 1 A PHE 506 ? A PHE 506 
13 1 Y 1 A GLY 507 ? A GLY 507 
14 1 Y 1 A LYS 622 ? A LYS 622 
15 1 Y 1 A LYS 623 ? A LYS 623 
16 1 Y 1 A GLY 624 ? A GLY 624 
17 1 Y 1 A ALA 625 ? A ALA 625 
18 1 Y 1 A ASN 626 ? A ASN 626 
19 1 Y 1 A LEU 760 ? A LEU 760 
20 1 Y 1 A PRO 761 ? A PRO 761 
21 1 Y 1 A ASN 762 ? A ASN 762 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                              MG  
3 'PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER' AGS 
4 water                                        HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   998  998  MG  MG  A . 
C 3 AGS 1   999  999  AGS AGS A . 
D 4 HOH 1   8010 8010 HOH HOH A . 
D 4 HOH 2   8011 8011 HOH HOH A . 
D 4 HOH 3   8012 8012 HOH HOH A . 
D 4 HOH 4   8013 8013 HOH HOH A . 
D 4 HOH 5   8014 8014 HOH HOH A . 
D 4 HOH 6   8015 8015 HOH HOH A . 
D 4 HOH 7   8016 8016 HOH HOH A . 
D 4 HOH 8   8017 8017 HOH HOH A . 
D 4 HOH 9   8018 8018 HOH HOH A . 
D 4 HOH 10  8019 8019 HOH HOH A . 
D 4 HOH 11  8020 8020 HOH HOH A . 
D 4 HOH 12  8021 8021 HOH HOH A . 
D 4 HOH 13  8022 8022 HOH HOH A . 
D 4 HOH 14  8023 8023 HOH HOH A . 
D 4 HOH 15  8024 8024 HOH HOH A . 
D 4 HOH 16  8025 8025 HOH HOH A . 
D 4 HOH 17  8026 8026 HOH HOH A . 
D 4 HOH 18  8027 8027 HOH HOH A . 
D 4 HOH 19  8028 8028 HOH HOH A . 
D 4 HOH 20  8029 8029 HOH HOH A . 
D 4 HOH 21  8030 8030 HOH HOH A . 
D 4 HOH 22  8031 8031 HOH HOH A . 
D 4 HOH 23  8032 8032 HOH HOH A . 
D 4 HOH 24  8033 8033 HOH HOH A . 
D 4 HOH 25  8034 8034 HOH HOH A . 
D 4 HOH 26  8035 8035 HOH HOH A . 
D 4 HOH 27  8036 8036 HOH HOH A . 
D 4 HOH 28  8037 8037 HOH HOH A . 
D 4 HOH 29  8038 8038 HOH HOH A . 
D 4 HOH 30  8039 8039 HOH HOH A . 
D 4 HOH 31  8040 8040 HOH HOH A . 
D 4 HOH 32  8041 8041 HOH HOH A . 
D 4 HOH 33  8042 8042 HOH HOH A . 
D 4 HOH 34  8043 8043 HOH HOH A . 
D 4 HOH 35  8044 8044 HOH HOH A . 
D 4 HOH 36  8045 8045 HOH HOH A . 
D 4 HOH 37  8046 8046 HOH HOH A . 
D 4 HOH 38  8047 8047 HOH HOH A . 
D 4 HOH 39  8048 8048 HOH HOH A . 
D 4 HOH 40  8049 8049 HOH HOH A . 
D 4 HOH 41  8050 8050 HOH HOH A . 
D 4 HOH 42  8051 8051 HOH HOH A . 
D 4 HOH 43  8052 8052 HOH HOH A . 
D 4 HOH 44  8053 8053 HOH HOH A . 
D 4 HOH 45  8054 8054 HOH HOH A . 
D 4 HOH 46  8055 8055 HOH HOH A . 
D 4 HOH 47  8056 8056 HOH HOH A . 
D 4 HOH 48  8057 8057 HOH HOH A . 
D 4 HOH 49  8058 8058 HOH HOH A . 
D 4 HOH 50  8059 8059 HOH HOH A . 
D 4 HOH 51  8060 8060 HOH HOH A . 
D 4 HOH 52  8061 8061 HOH HOH A . 
D 4 HOH 53  8062 8062 HOH HOH A . 
D 4 HOH 54  8063 8063 HOH HOH A . 
D 4 HOH 55  8064 8064 HOH HOH A . 
D 4 HOH 56  8065 8065 HOH HOH A . 
D 4 HOH 57  8066 8066 HOH HOH A . 
D 4 HOH 58  8067 8067 HOH HOH A . 
D 4 HOH 59  8068 8068 HOH HOH A . 
D 4 HOH 60  8069 8069 HOH HOH A . 
D 4 HOH 61  8070 8070 HOH HOH A . 
D 4 HOH 62  8071 8071 HOH HOH A . 
D 4 HOH 63  8072 8072 HOH HOH A . 
D 4 HOH 64  8073 8073 HOH HOH A . 
D 4 HOH 65  8074 8074 HOH HOH A . 
D 4 HOH 66  8075 8075 HOH HOH A . 
D 4 HOH 67  8076 8076 HOH HOH A . 
D 4 HOH 68  8077 8077 HOH HOH A . 
D 4 HOH 69  8078 8078 HOH HOH A . 
D 4 HOH 70  8079 8079 HOH HOH A . 
D 4 HOH 71  8080 8080 HOH HOH A . 
D 4 HOH 72  8081 8081 HOH HOH A . 
D 4 HOH 73  8082 8082 HOH HOH A . 
D 4 HOH 74  8083 8083 HOH HOH A . 
D 4 HOH 75  8084 8084 HOH HOH A . 
D 4 HOH 76  8085 8085 HOH HOH A . 
D 4 HOH 77  8086 8086 HOH HOH A . 
D 4 HOH 78  8087 8087 HOH HOH A . 
D 4 HOH 79  8088 8088 HOH HOH A . 
D 4 HOH 80  8089 8089 HOH HOH A . 
D 4 HOH 81  8090 8090 HOH HOH A . 
D 4 HOH 82  8091 8091 HOH HOH A . 
D 4 HOH 83  8092 8092 HOH HOH A . 
D 4 HOH 84  8093 8093 HOH HOH A . 
D 4 HOH 85  8094 8094 HOH HOH A . 
D 4 HOH 86  8095 8095 HOH HOH A . 
D 4 HOH 87  8096 8096 HOH HOH A . 
D 4 HOH 88  8097 8097 HOH HOH A . 
D 4 HOH 89  8098 8098 HOH HOH A . 
D 4 HOH 90  8099 8099 HOH HOH A . 
D 4 HOH 91  8100 8100 HOH HOH A . 
D 4 HOH 92  8101 8101 HOH HOH A . 
D 4 HOH 93  8102 8102 HOH HOH A . 
D 4 HOH 94  8103 8103 HOH HOH A . 
D 4 HOH 95  8104 8104 HOH HOH A . 
D 4 HOH 96  8105 8105 HOH HOH A . 
D 4 HOH 97  8106 8106 HOH HOH A . 
D 4 HOH 98  8107 8107 HOH HOH A . 
D 4 HOH 99  8108 8108 HOH HOH A . 
D 4 HOH 100 8109 8109 HOH HOH A . 
D 4 HOH 101 8110 8110 HOH HOH A . 
D 4 HOH 102 8111 8111 HOH HOH A . 
D 4 HOH 103 8112 8112 HOH HOH A . 
D 4 HOH 104 8113 8113 HOH HOH A . 
D 4 HOH 105 8114 8114 HOH HOH A . 
D 4 HOH 106 8115 8115 HOH HOH A . 
D 4 HOH 107 8116 8116 HOH HOH A . 
D 4 HOH 108 8117 8117 HOH HOH A . 
D 4 HOH 109 8118 8118 HOH HOH A . 
D 4 HOH 110 8119 8119 HOH HOH A . 
D 4 HOH 111 8120 8120 HOH HOH A . 
D 4 HOH 112 8121 8121 HOH HOH A . 
D 4 HOH 113 8122 8122 HOH HOH A . 
D 4 HOH 114 8123 8123 HOH HOH A . 
D 4 HOH 115 8124 8124 HOH HOH A . 
D 4 HOH 116 8125 8125 HOH HOH A . 
D 4 HOH 117 8126 8126 HOH HOH A . 
D 4 HOH 118 8127 8127 HOH HOH A . 
D 4 HOH 119 8128 8128 HOH HOH A . 
D 4 HOH 120 8129 8129 HOH HOH A . 
D 4 HOH 121 8130 8130 HOH HOH A . 
D 4 HOH 122 8131 8131 HOH HOH A . 
D 4 HOH 123 8132 8132 HOH HOH A . 
D 4 HOH 124 8133 8133 HOH HOH A . 
D 4 HOH 125 8134 8134 HOH HOH A . 
D 4 HOH 126 8135 8135 HOH HOH A . 
D 4 HOH 127 8136 8136 HOH HOH A . 
D 4 HOH 128 8137 8137 HOH HOH A . 
D 4 HOH 129 8138 8138 HOH HOH A . 
D 4 HOH 130 8139 8139 HOH HOH A . 
D 4 HOH 131 8140 8140 HOH HOH A . 
D 4 HOH 132 8141 8141 HOH HOH A . 
D 4 HOH 133 8142 8142 HOH HOH A . 
D 4 HOH 134 8143 8143 HOH HOH A . 
D 4 HOH 135 8144 8144 HOH HOH A . 
D 4 HOH 136 8145 8145 HOH HOH A . 
D 4 HOH 137 8146 8146 HOH HOH A . 
D 4 HOH 138 8147 8147 HOH HOH A . 
D 4 HOH 139 8148 8148 HOH HOH A . 
D 4 HOH 140 8149 8149 HOH HOH A . 
D 4 HOH 141 8150 8150 HOH HOH A . 
D 4 HOH 142 8151 8151 HOH HOH A . 
D 4 HOH 143 8152 8152 HOH HOH A . 
D 4 HOH 144 8153 8153 HOH HOH A . 
D 4 HOH 145 8154 8154 HOH HOH A . 
D 4 HOH 146 8155 8155 HOH HOH A . 
D 4 HOH 147 8156 8156 HOH HOH A . 
D 4 HOH 148 8157 8157 HOH HOH A . 
D 4 HOH 149 8158 8158 HOH HOH A . 
D 4 HOH 150 8159 8159 HOH HOH A . 
D 4 HOH 151 8160 8160 HOH HOH A . 
D 4 HOH 152 8161 8161 HOH HOH A . 
D 4 HOH 153 8162 8162 HOH HOH A . 
D 4 HOH 154 8163 8163 HOH HOH A . 
D 4 HOH 155 8164 8164 HOH HOH A . 
D 4 HOH 156 8165 8165 HOH HOH A . 
D 4 HOH 157 8166 8166 HOH HOH A . 
D 4 HOH 158 8167 8167 HOH HOH A . 
D 4 HOH 159 8168 8168 HOH HOH A . 
D 4 HOH 160 8169 8169 HOH HOH A . 
D 4 HOH 161 8170 8170 HOH HOH A . 
D 4 HOH 162 8171 8171 HOH HOH A . 
D 4 HOH 163 8172 8172 HOH HOH A . 
D 4 HOH 164 8173 8173 HOH HOH A . 
D 4 HOH 165 8174 8174 HOH HOH A . 
D 4 HOH 166 8175 8175 HOH HOH A . 
D 4 HOH 167 8176 8176 HOH HOH A . 
D 4 HOH 168 8177 8177 HOH HOH A . 
D 4 HOH 169 8178 8178 HOH HOH A . 
D 4 HOH 170 8179 8179 HOH HOH A . 
D 4 HOH 171 8180 8180 HOH HOH A . 
D 4 HOH 172 8181 8181 HOH HOH A . 
D 4 HOH 173 8182 8182 HOH HOH A . 
D 4 HOH 174 8183 8183 HOH HOH A . 
D 4 HOH 175 8184 8184 HOH HOH A . 
D 4 HOH 176 8185 8185 HOH HOH A . 
D 4 HOH 177 8186 8186 HOH HOH A . 
D 4 HOH 178 8187 8187 HOH HOH A . 
D 4 HOH 179 8188 8188 HOH HOH A . 
D 4 HOH 180 8189 8189 HOH HOH A . 
D 4 HOH 181 8190 8190 HOH HOH A . 
D 4 HOH 182 8191 8191 HOH HOH A . 
D 4 HOH 183 8192 8192 HOH HOH A . 
D 4 HOH 184 8193 8193 HOH HOH A . 
D 4 HOH 185 8194 8194 HOH HOH A . 
D 4 HOH 186 8195 8195 HOH HOH A . 
D 4 HOH 187 8196 8196 HOH HOH A . 
D 4 HOH 188 8197 8197 HOH HOH A . 
D 4 HOH 189 8198 8198 HOH HOH A . 
D 4 HOH 190 8199 8199 HOH HOH A . 
D 4 HOH 191 8200 8200 HOH HOH A . 
D 4 HOH 192 8201 8201 HOH HOH A . 
D 4 HOH 193 8202 8202 HOH HOH A . 
D 4 HOH 194 8203 8203 HOH HOH A . 
D 4 HOH 195 8204 8204 HOH HOH A . 
D 4 HOH 196 8205 8205 HOH HOH A . 
D 4 HOH 197 8206 8206 HOH HOH A . 
D 4 HOH 198 8207 8207 HOH HOH A . 
D 4 HOH 199 8208 8208 HOH HOH A . 
D 4 HOH 200 8209 8209 HOH HOH A . 
D 4 HOH 201 8210 8210 HOH HOH A . 
D 4 HOH 202 8211 8211 HOH HOH A . 
D 4 HOH 203 8212 8212 HOH HOH A . 
D 4 HOH 204 8213 8213 HOH HOH A . 
D 4 HOH 205 8214 8214 HOH HOH A . 
D 4 HOH 206 8215 8215 HOH HOH A . 
D 4 HOH 207 8216 8216 HOH HOH A . 
D 4 HOH 208 8217 8217 HOH HOH A . 
D 4 HOH 209 8218 8218 HOH HOH A . 
D 4 HOH 210 8219 8219 HOH HOH A . 
D 4 HOH 211 8220 8220 HOH HOH A . 
D 4 HOH 212 8221 8221 HOH HOH A . 
D 4 HOH 213 8222 8222 HOH HOH A . 
D 4 HOH 214 8223 8223 HOH HOH A . 
D 4 HOH 215 8224 8224 HOH HOH A . 
D 4 HOH 216 8225 8225 HOH HOH A . 
D 4 HOH 217 8226 8226 HOH HOH A . 
D 4 HOH 218 8227 8227 HOH HOH A . 
D 4 HOH 219 8228 8228 HOH HOH A . 
D 4 HOH 220 8229 8229 HOH HOH A . 
D 4 HOH 221 8230 8230 HOH HOH A . 
D 4 HOH 222 8231 8231 HOH HOH A . 
D 4 HOH 223 8232 8232 HOH HOH A . 
D 4 HOH 224 8233 8233 HOH HOH A . 
D 4 HOH 225 8234 8234 HOH HOH A . 
D 4 HOH 226 8235 8235 HOH HOH A . 
D 4 HOH 227 8236 8236 HOH HOH A . 
D 4 HOH 228 8237 8237 HOH HOH A . 
D 4 HOH 229 8238 8238 HOH HOH A . 
D 4 HOH 230 8239 8239 HOH HOH A . 
D 4 HOH 231 8240 8240 HOH HOH A . 
D 4 HOH 232 8241 8241 HOH HOH A . 
D 4 HOH 233 8242 8242 HOH HOH A . 
D 4 HOH 234 8243 8243 HOH HOH A . 
D 4 HOH 235 8244 8244 HOH HOH A . 
D 4 HOH 236 8245 8245 HOH HOH A . 
D 4 HOH 237 8246 8246 HOH HOH A . 
D 4 HOH 238 8247 8247 HOH HOH A . 
D 4 HOH 239 8248 8248 HOH HOH A . 
D 4 HOH 240 8249 8249 HOH HOH A . 
D 4 HOH 241 8250 8250 HOH HOH A . 
D 4 HOH 242 8251 8251 HOH HOH A . 
D 4 HOH 243 8252 8252 HOH HOH A . 
D 4 HOH 244 8253 8253 HOH HOH A . 
D 4 HOH 245 8254 8254 HOH HOH A . 
D 4 HOH 246 8255 8255 HOH HOH A . 
D 4 HOH 247 8256 8256 HOH HOH A . 
D 4 HOH 248 8257 8257 HOH HOH A . 
D 4 HOH 249 8258 8258 HOH HOH A . 
D 4 HOH 250 8259 8259 HOH HOH A . 
D 4 HOH 251 8260 8260 HOH HOH A . 
D 4 HOH 252 8261 8261 HOH HOH A . 
D 4 HOH 253 8262 8262 HOH HOH A . 
D 4 HOH 254 8263 8263 HOH HOH A . 
D 4 HOH 255 8264 8264 HOH HOH A . 
D 4 HOH 256 8265 8265 HOH HOH A . 
D 4 HOH 257 8266 8266 HOH HOH A . 
D 4 HOH 258 8267 8267 HOH HOH A . 
D 4 HOH 259 8268 8268 HOH HOH A . 
D 4 HOH 260 8269 8269 HOH HOH A . 
D 4 HOH 261 8270 8270 HOH HOH A . 
D 4 HOH 262 8271 8271 HOH HOH A . 
D 4 HOH 263 8272 8272 HOH HOH A . 
D 4 HOH 264 8273 8273 HOH HOH A . 
D 4 HOH 265 8274 8274 HOH HOH A . 
D 4 HOH 266 8275 8275 HOH HOH A . 
D 4 HOH 267 8276 8276 HOH HOH A . 
D 4 HOH 268 8277 8277 HOH HOH A . 
D 4 HOH 269 8278 8278 HOH HOH A . 
D 4 HOH 270 8279 8279 HOH HOH A . 
D 4 HOH 271 8280 8280 HOH HOH A . 
D 4 HOH 272 8281 8281 HOH HOH A . 
D 4 HOH 273 8282 8282 HOH HOH A . 
D 4 HOH 274 8283 8283 HOH HOH A . 
D 4 HOH 275 8284 8284 HOH HOH A . 
D 4 HOH 276 8285 8285 HOH HOH A . 
D 4 HOH 277 8286 8286 HOH HOH A . 
D 4 HOH 278 8287 8287 HOH HOH A . 
D 4 HOH 279 8288 8288 HOH HOH A . 
D 4 HOH 280 8289 8289 HOH HOH A . 
D 4 HOH 281 8290 8290 HOH HOH A . 
D 4 HOH 282 8291 8291 HOH HOH A . 
D 4 HOH 283 8292 8292 HOH HOH A . 
D 4 HOH 284 8293 8293 HOH HOH A . 
D 4 HOH 285 8294 8294 HOH HOH A . 
D 4 HOH 286 8295 8295 HOH HOH A . 
D 4 HOH 287 8296 8296 HOH HOH A . 
D 4 HOH 288 8297 8297 HOH HOH A . 
D 4 HOH 289 8298 8298 HOH HOH A . 
D 4 HOH 290 8299 8299 HOH HOH A . 
D 4 HOH 291 8300 8300 HOH HOH A . 
D 4 HOH 292 8301 8301 HOH HOH A . 
D 4 HOH 293 8302 8302 HOH HOH A . 
D 4 HOH 294 8303 8303 HOH HOH A . 
D 4 HOH 295 8304 8304 HOH HOH A . 
D 4 HOH 296 8305 8305 HOH HOH A . 
D 4 HOH 297 8306 8306 HOH HOH A . 
D 4 HOH 298 8307 8307 HOH HOH A . 
D 4 HOH 299 8308 8308 HOH HOH A . 
D 4 HOH 300 8309 8309 HOH HOH A . 
D 4 HOH 301 8310 8310 HOH HOH A . 
D 4 HOH 302 8311 8311 HOH HOH A . 
D 4 HOH 303 8312 8312 HOH HOH A . 
D 4 HOH 304 8313 8313 HOH HOH A . 
D 4 HOH 305 8314 8314 HOH HOH A . 
D 4 HOH 306 8315 8315 HOH HOH A . 
D 4 HOH 307 8316 8316 HOH HOH A . 
D 4 HOH 308 8317 8317 HOH HOH A . 
D 4 HOH 309 8318 8318 HOH HOH A . 
D 4 HOH 310 8319 8319 HOH HOH A . 
D 4 HOH 311 8320 8320 HOH HOH A . 
D 4 HOH 312 8321 8321 HOH HOH A . 
D 4 HOH 313 8322 8322 HOH HOH A . 
D 4 HOH 314 8323 8323 HOH HOH A . 
D 4 HOH 315 8324 8324 HOH HOH A . 
D 4 HOH 316 8325 8325 HOH HOH A . 
D 4 HOH 317 8326 8326 HOH HOH A . 
D 4 HOH 318 8327 8327 HOH HOH A . 
D 4 HOH 319 8328 8328 HOH HOH A . 
D 4 HOH 320 8329 8329 HOH HOH A . 
D 4 HOH 321 8330 8330 HOH HOH A . 
D 4 HOH 322 8331 8331 HOH HOH A . 
D 4 HOH 323 8332 8332 HOH HOH A . 
D 4 HOH 324 8333 8333 HOH HOH A . 
D 4 HOH 325 8334 8334 HOH HOH A . 
D 4 HOH 326 8335 8335 HOH HOH A . 
D 4 HOH 327 8336 8336 HOH HOH A . 
D 4 HOH 328 8337 8337 HOH HOH A . 
D 4 HOH 329 8338 8338 HOH HOH A . 
D 4 HOH 330 8339 8339 HOH HOH A . 
D 4 HOH 331 8341 8341 HOH HOH A . 
D 4 HOH 332 8342 8342 HOH HOH A . 
D 4 HOH 333 8343 8343 HOH HOH A . 
D 4 HOH 334 8344 8344 HOH HOH A . 
D 4 HOH 335 8345 8345 HOH HOH A . 
D 4 HOH 336 9951 9951 HOH HOH A . 
D 4 HOH 337 9952 9952 HOH HOH A . 
#