data_1MMM
# 
_entry.id   1MMM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1MMM         
RCSB  RCSB008360   
WWPDB D_1000008360 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1MMM 
_pdbx_database_status.recvd_initial_deposition_date   1998-08-26 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Edwards, R.A.'   1 
'Whittaker, M.M.' 2 
'Whittaker, J.W.' 3 
'Jameson, G.B.'   4 
'Baker, E.N.'     5 
# 
_citation.id                        primary 
_citation.title                     
'Distinct Metal Environment in Fe-Substituted Manganese Superoxide Dismutase Provides a Structural Basis of Metal Specificity' 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            120 
_citation.page_first                9684 
_citation.page_last                 9685 
_citation.year                      1998 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   -1 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Edwards, R.A.'   1 
primary 'Whittaker, M.M.' 2 
primary 'Whittaker, J.W.' 3 
primary 'Jameson, G.B.'   4 
primary 'Baker, E.N.'     5 
# 
_cell.entry_id           1MMM 
_cell.length_a           46.190 
_cell.length_b           89.040 
_cell.length_c           206.671 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1MMM 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROTEIN (IRON-SUBSTITUTED MANGANESE SUPEROXIDE DISMUTASE)' 22996.877 2   1.15.1.1 ? ? ? 
2 non-polymer syn 'HYDROXIDE ION'                                             17.007    3   ?        ? ? ? 
3 non-polymer syn 'FE (III) ION'                                              55.845    2   ?        ? ? ? 
4 water       nat water                                                       18.015    284 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'FE-MNSOD, FE-MNSD' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASG
FPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHAN
HSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASG
FPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   TYR n 
1 3   THR n 
1 4   LEU n 
1 5   PRO n 
1 6   SER n 
1 7   LEU n 
1 8   PRO n 
1 9   TYR n 
1 10  ALA n 
1 11  TYR n 
1 12  ASP n 
1 13  ALA n 
1 14  LEU n 
1 15  GLU n 
1 16  PRO n 
1 17  HIS n 
1 18  PHE n 
1 19  ASP n 
1 20  LYS n 
1 21  GLN n 
1 22  THR n 
1 23  MET n 
1 24  GLU n 
1 25  ILE n 
1 26  HIS n 
1 27  HIS n 
1 28  THR n 
1 29  LYS n 
1 30  HIS n 
1 31  HIS n 
1 32  GLN n 
1 33  THR n 
1 34  TYR n 
1 35  VAL n 
1 36  ASN n 
1 37  ASN n 
1 38  ALA n 
1 39  ASN n 
1 40  ALA n 
1 41  ALA n 
1 42  LEU n 
1 43  GLU n 
1 44  SER n 
1 45  LEU n 
1 46  PRO n 
1 47  GLU n 
1 48  PHE n 
1 49  ALA n 
1 50  ASN n 
1 51  LEU n 
1 52  PRO n 
1 53  VAL n 
1 54  GLU n 
1 55  GLU n 
1 56  LEU n 
1 57  ILE n 
1 58  THR n 
1 59  LYS n 
1 60  LEU n 
1 61  ASP n 
1 62  GLN n 
1 63  LEU n 
1 64  PRO n 
1 65  ALA n 
1 66  ASP n 
1 67  LYS n 
1 68  LYS n 
1 69  THR n 
1 70  VAL n 
1 71  LEU n 
1 72  ARG n 
1 73  ASN n 
1 74  ASN n 
1 75  ALA n 
1 76  GLY n 
1 77  GLY n 
1 78  HIS n 
1 79  ALA n 
1 80  ASN n 
1 81  HIS n 
1 82  SER n 
1 83  LEU n 
1 84  PHE n 
1 85  TRP n 
1 86  LYS n 
1 87  GLY n 
1 88  LEU n 
1 89  LYS n 
1 90  LYS n 
1 91  GLY n 
1 92  THR n 
1 93  THR n 
1 94  LEU n 
1 95  GLN n 
1 96  GLY n 
1 97  ASP n 
1 98  LEU n 
1 99  LYS n 
1 100 ALA n 
1 101 ALA n 
1 102 ILE n 
1 103 GLU n 
1 104 ARG n 
1 105 ASP n 
1 106 PHE n 
1 107 GLY n 
1 108 SER n 
1 109 VAL n 
1 110 ASP n 
1 111 ASN n 
1 112 PHE n 
1 113 LYS n 
1 114 ALA n 
1 115 GLU n 
1 116 PHE n 
1 117 GLU n 
1 118 LYS n 
1 119 ALA n 
1 120 ALA n 
1 121 ALA n 
1 122 SER n 
1 123 ARG n 
1 124 PHE n 
1 125 GLY n 
1 126 SER n 
1 127 GLY n 
1 128 TRP n 
1 129 ALA n 
1 130 TRP n 
1 131 LEU n 
1 132 VAL n 
1 133 LEU n 
1 134 LYS n 
1 135 GLY n 
1 136 ASP n 
1 137 LYS n 
1 138 LEU n 
1 139 ALA n 
1 140 VAL n 
1 141 VAL n 
1 142 SER n 
1 143 THR n 
1 144 ALA n 
1 145 ASN n 
1 146 GLN n 
1 147 ASP n 
1 148 SER n 
1 149 PRO n 
1 150 LEU n 
1 151 MET n 
1 152 GLY n 
1 153 GLU n 
1 154 ALA n 
1 155 ILE n 
1 156 SER n 
1 157 GLY n 
1 158 ALA n 
1 159 SER n 
1 160 GLY n 
1 161 PHE n 
1 162 PRO n 
1 163 ILE n 
1 164 MET n 
1 165 GLY n 
1 166 LEU n 
1 167 ASP n 
1 168 VAL n 
1 169 TRP n 
1 170 GLU n 
1 171 HIS n 
1 172 ALA n 
1 173 TYR n 
1 174 TYR n 
1 175 LEU n 
1 176 LYS n 
1 177 PHE n 
1 178 GLN n 
1 179 ASN n 
1 180 ARG n 
1 181 ARG n 
1 182 PRO n 
1 183 ASP n 
1 184 TYR n 
1 185 ILE n 
1 186 LYS n 
1 187 GLU n 
1 188 PHE n 
1 189 TRP n 
1 190 ASN n 
1 191 VAL n 
1 192 VAL n 
1 193 ASN n 
1 194 TRP n 
1 195 ASP n 
1 196 GLU n 
1 197 ALA n 
1 198 ALA n 
1 199 ALA n 
1 200 ARG n 
1 201 PHE n 
1 202 ALA n 
1 203 ALA n 
1 204 LYS n 
1 205 LYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Escherichia coli' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      562 
_entity_src_nat.genus                      Escherichia 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     AB2463/PDT1-5 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SODM_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00448 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1MMM A 1 ? 205 ? P00448 1 ? 205 ? 1 205 
2 1 1MMM B 1 ? 205 ? P00448 1 ? 205 ? 1 205 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
FE  non-polymer         . 'FE (III) ION'  ? 'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
OH  non-polymer         . 'HYDROXIDE ION' ? 'H O -1'         17.007  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1MMM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.31 
_exptl_crystal.density_percent_sol   46.73 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.75 
_exptl_crystal_grow.pdbx_details    'pH 8.75' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1998-01-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1MMM 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             100.0 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   20726 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.2 
_reflns.pdbx_Rmerge_I_obs            0.090 
_reflns.pdbx_Rsym_value              0.090 
_reflns.pdbx_netI_over_sigmaI        14.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.2 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.3 
_reflns_shell.percent_possible_all   82.6 
_reflns_shell.Rmerge_I_obs           0.266 
_reflns_shell.pdbx_Rsym_value        0.266 
_reflns_shell.meanI_over_sigI_obs    4.6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1MMM 
_refine.ls_number_reflns_obs                     20683 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             100.0 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    93.2 
_refine.ls_R_factor_obs                          0.1920000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1920000 
_refine.ls_R_factor_R_free                       0.2310000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.0 
_refine.ls_number_reflns_R_free                  1563 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -2.263 
_refine.aniso_B[2][2]                            0.629 
_refine.aniso_B[3][3]                            1.634 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1VEW 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3256 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             284 
_refine_hist.number_atoms_total               3545 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        100.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   RESTRAINTS 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.729903 
_struct_ncs_oper.matrix[1][2]   0.132591 
_struct_ncs_oper.matrix[1][3]   0.670567 
_struct_ncs_oper.matrix[2][1]   0.126001 
_struct_ncs_oper.matrix[2][2]   -0.990294 
_struct_ncs_oper.matrix[2][3]   0.058660 
_struct_ncs_oper.matrix[3][1]   0.671837 
_struct_ncs_oper.matrix[3][2]   0.041676 
_struct_ncs_oper.matrix[3][3]   -0.739526 
_struct_ncs_oper.vector[1]      -17.32900 
_struct_ncs_oper.vector[2]      51.12900 
_struct_ncs_oper.vector[3]      34.36400 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1MMM 
_struct.title                     
'DISTINCT METAL ENVIRONMENT IN IRON-SUBSTITUTED MANGANESE SUPEROXIDE DISMUTASE PROVIDES A STRUCTURAL BASIS OF METAL SPECIFICITY' 
_struct.pdbx_descriptor           'PROTEIN (IRON-SUBSTITUTED MANGANESE SUPEROXIDE DISMUTASE) (1.15.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MMM 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'IRON-SUBSTITUTED MANGANESE SUPEROXIDE DISMUTASE, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 20  ? THR A 28  ? LYS A 20  THR A 28  1 ? 9  
HELX_P HELX_P2  2  HIS A 30  ? LEU A 42  ? HIS A 30  LEU A 42  1 ? 13 
HELX_P HELX_P3  3  PRO A 46  ? ASN A 50  ? PRO A 46  ASN A 50  1 ? 5  
HELX_P HELX_P4  4  VAL A 53  ? THR A 58  ? VAL A 53  THR A 58  1 ? 6  
HELX_P HELX_P5  5  LEU A 60  ? GLN A 62  ? LEU A 60  GLN A 62  5 ? 3  
HELX_P HELX_P6  6  ALA A 65  ? LYS A 86  ? ALA A 65  LYS A 86  1 ? 22 
HELX_P HELX_P7  7  GLY A 96  ? PHE A 106 ? GLY A 96  PHE A 106 1 ? 11 
HELX_P HELX_P8  8  VAL A 109 ? SER A 122 ? VAL A 109 SER A 122 1 ? 14 
HELX_P HELX_P9  9  PRO A 149 ? MET A 151 ? PRO A 149 MET A 151 5 ? 3  
HELX_P HELX_P10 10 GLU A 153 ? SER A 156 ? GLU A 153 SER A 156 1 ? 4  
HELX_P HELX_P11 11 GLU A 170 ? ALA A 172 ? GLU A 170 ALA A 172 5 ? 3  
HELX_P HELX_P12 12 TYR A 174 ? PHE A 177 ? TYR A 174 PHE A 177 1 ? 4  
HELX_P HELX_P13 13 ARG A 181 ? VAL A 191 ? ARG A 181 VAL A 191 1 ? 11 
HELX_P HELX_P14 14 TRP A 194 ? ALA A 203 ? TRP A 194 ALA A 203 1 ? 10 
HELX_P HELX_P15 15 LYS B 20  ? THR B 28  ? LYS B 20  THR B 28  1 ? 9  
HELX_P HELX_P16 16 HIS B 30  ? SER B 44  ? HIS B 30  SER B 44  1 ? 15 
HELX_P HELX_P17 17 PRO B 46  ? ALA B 49  ? PRO B 46  ALA B 49  1 ? 4  
HELX_P HELX_P18 18 VAL B 53  ? THR B 58  ? VAL B 53  THR B 58  1 ? 6  
HELX_P HELX_P19 19 LEU B 60  ? GLN B 62  ? LEU B 60  GLN B 62  5 ? 3  
HELX_P HELX_P20 20 ALA B 65  ? LYS B 86  ? ALA B 65  LYS B 86  1 ? 22 
HELX_P HELX_P21 21 GLY B 96  ? PHE B 106 ? GLY B 96  PHE B 106 1 ? 11 
HELX_P HELX_P22 22 VAL B 109 ? SER B 122 ? VAL B 109 SER B 122 1 ? 14 
HELX_P HELX_P23 23 PRO B 149 ? MET B 151 ? PRO B 149 MET B 151 5 ? 3  
HELX_P HELX_P24 24 GLU B 153 ? SER B 156 ? GLU B 153 SER B 156 1 ? 4  
HELX_P HELX_P25 25 GLU B 170 ? ALA B 172 ? GLU B 170 ALA B 172 5 ? 3  
HELX_P HELX_P26 26 TYR B 174 ? PHE B 177 ? TYR B 174 PHE B 177 1 ? 4  
HELX_P HELX_P27 27 ARG B 181 ? VAL B 191 ? ARG B 181 VAL B 191 1 ? 11 
HELX_P HELX_P28 28 TRP B 194 ? ALA B 203 ? TRP B 194 ALA B 203 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 26  NE2 ? ? ? 1_555 D FE . FE ? ? A HIS 26  A FE 206 1_555 ? ? ? ? ? ? ? 2.160 ? 
metalc2  metalc ? ? A HIS 81  NE2 ? ? ? 1_555 D FE . FE ? ? A HIS 81  A FE 206 1_555 ? ? ? ? ? ? ? 2.055 ? 
metalc3  metalc ? ? A ASP 167 OD2 ? ? ? 1_555 D FE . FE ? ? A ASP 167 A FE 206 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc4  metalc ? ? A HIS 171 NE2 ? ? ? 1_555 D FE . FE ? ? A HIS 171 A FE 206 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc5  metalc ? ? B HIS 26  NE2 ? ? ? 1_555 G FE . FE ? ? B HIS 26  B FE 206 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc6  metalc ? ? B HIS 81  NE2 ? ? ? 1_555 G FE . FE ? ? B HIS 81  B FE 206 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc7  metalc ? ? B ASP 167 OD2 ? ? ? 1_555 G FE . FE ? ? B ASP 167 B FE 206 1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc8  metalc ? ? B HIS 171 NE2 ? ? ? 1_555 G FE . FE ? ? B HIS 171 B FE 206 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc9  metalc ? ? C OH  .   O   ? ? ? 1_555 D FE . FE ? ? A OH  207 A FE 206 1_555 ? ? ? ? ? ? ? 2.219 ? 
metalc10 metalc ? ? E OH  .   O   ? ? ? 1_555 G FE . FE ? ? B OH  207 B FE 206 1_555 ? ? ? ? ? ? ? 2.226 ? 
metalc11 metalc ? ? F OH  .   O   ? ? ? 1_555 G FE . FE ? ? B OH  208 B FE 206 1_555 ? ? ? ? ? ? ? 1.994 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 15 A . ? GLU 15 A PRO 16 A ? PRO 16 A 1 -0.23 
2 GLU 15 B . ? GLU 15 B PRO 16 B ? PRO 16 B 1 -0.03 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 137 ? ALA A 144 ? LYS A 137 ALA A 144 
A 2 GLY A 127 ? LYS A 134 ? GLY A 127 LYS A 134 
A 3 PHE A 161 ? ASP A 167 ? PHE A 161 ASP A 167 
B 1 LYS B 137 ? ALA B 144 ? LYS B 137 ALA B 144 
B 2 GLY B 127 ? LYS B 134 ? GLY B 127 LYS B 134 
B 3 PHE B 161 ? ASP B 167 ? PHE B 161 ASP B 167 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 137 ? O LYS A 137 N LYS A 134 ? N LYS A 134 
A 2 3 O ALA A 129 ? O ALA A 129 N LEU A 166 ? N LEU A 166 
B 1 2 O LYS B 137 ? O LYS B 137 N LYS B 134 ? N LYS B 134 
B 2 3 O ALA B 129 ? O ALA B 129 N LEU B 166 ? N LEU B 166 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
FE1 Author   ? ? ? ? 6 'IRON-SUBSTITUTED ACTIVE SITE CHAIN A. CONTAINS ONE EXOGENOUS LIGAND MODELLED AS HYDROXIDE.'        
FE2 Author   ? ? ? ? 7 'IRON-SUBSTITUTED ACTIVE SITE CHAIN B. CONTAINS TWO EXOGENOUS LIGANDS BOTH MODELLED AS HYDROXIDES.' 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE OH A 207'                                                                 
AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE OH B 207'                                                                 
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE OH B 208'                                                                 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE A 206'                                                                 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FE B 206'                                                                 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  FE1 6 FE  D .   ? FE  A 206 . ? 1_555 ? 
2  FE1 6 HIS A 26  ? HIS A 26  . ? 1_555 ? 
3  FE1 6 HIS A 81  ? HIS A 81  . ? 1_555 ? 
4  FE1 6 ASP A 167 ? ASP A 167 . ? 1_555 ? 
5  FE1 6 HIS A 171 ? HIS A 171 . ? 1_555 ? 
6  FE1 6 OH  C .   ? OH  A 207 . ? 1_555 ? 
7  FE2 7 FE  G .   ? FE  B 206 . ? 1_555 ? 
8  FE2 7 HIS B 26  ? HIS B 26  . ? 1_555 ? 
9  FE2 7 HIS B 81  ? HIS B 81  . ? 1_555 ? 
10 FE2 7 ASP B 167 ? ASP B 167 . ? 1_555 ? 
11 FE2 7 HIS B 171 ? HIS B 171 . ? 1_555 ? 
12 FE2 7 OH  E .   ? OH  B 207 . ? 1_555 ? 
13 FE2 7 OH  F .   ? OH  B 208 . ? 1_555 ? 
14 AC1 6 HIS A 81  ? HIS A 81  . ? 1_555 ? 
15 AC1 6 GLN A 146 ? GLN A 146 . ? 1_555 ? 
16 AC1 6 ASP A 167 ? ASP A 167 . ? 1_555 ? 
17 AC1 6 TRP A 169 ? TRP A 169 . ? 1_555 ? 
18 AC1 6 HIS A 171 ? HIS A 171 . ? 1_555 ? 
19 AC1 6 FE  D .   ? FE  A 206 . ? 1_555 ? 
20 AC2 8 TYR B 34  ? TYR B 34  . ? 1_555 ? 
21 AC2 8 HIS B 81  ? HIS B 81  . ? 1_555 ? 
22 AC2 8 GLN B 146 ? GLN B 146 . ? 1_555 ? 
23 AC2 8 ASP B 167 ? ASP B 167 . ? 1_555 ? 
24 AC2 8 TRP B 169 ? TRP B 169 . ? 1_555 ? 
25 AC2 8 HIS B 171 ? HIS B 171 . ? 1_555 ? 
26 AC2 8 FE  G .   ? FE  B 206 . ? 1_555 ? 
27 AC2 8 OH  F .   ? OH  B 208 . ? 1_555 ? 
28 AC3 7 HIS B 26  ? HIS B 26  . ? 1_555 ? 
29 AC3 7 HIS B 30  ? HIS B 30  . ? 1_555 ? 
30 AC3 7 TYR B 34  ? TYR B 34  . ? 1_555 ? 
31 AC3 7 HIS B 81  ? HIS B 81  . ? 1_555 ? 
32 AC3 7 HIS B 171 ? HIS B 171 . ? 1_555 ? 
33 AC3 7 FE  G .   ? FE  B 206 . ? 1_555 ? 
34 AC3 7 OH  E .   ? OH  B 207 . ? 1_555 ? 
35 AC4 5 HIS A 26  ? HIS A 26  . ? 1_555 ? 
36 AC4 5 HIS A 81  ? HIS A 81  . ? 1_555 ? 
37 AC4 5 ASP A 167 ? ASP A 167 . ? 1_555 ? 
38 AC4 5 HIS A 171 ? HIS A 171 . ? 1_555 ? 
39 AC4 5 OH  C .   ? OH  A 207 . ? 1_555 ? 
40 AC5 6 HIS B 26  ? HIS B 26  . ? 1_555 ? 
41 AC5 6 HIS B 81  ? HIS B 81  . ? 1_555 ? 
42 AC5 6 ASP B 167 ? ASP B 167 . ? 1_555 ? 
43 AC5 6 HIS B 171 ? HIS B 171 . ? 1_555 ? 
44 AC5 6 OH  E .   ? OH  B 207 . ? 1_555 ? 
45 AC5 6 OH  F .   ? OH  B 208 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1MMM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1MMM 
_atom_sites.fract_transf_matrix[1][1]   0.021650 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011231 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004839 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? 21.499  40.611 2.449  1.00 22.43 ? 1   SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? 20.429  40.396 3.460  1.00 21.09 ? 1   SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? 19.751  39.059 3.205  1.00 19.45 ? 1   SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? 19.731  38.564 2.078  1.00 18.85 ? 1   SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? 19.386  41.509 3.365  1.00 23.79 ? 1   SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? 18.728  41.469 2.108  1.00 23.45 ? 1   SER A OG  1 
ATOM   7    N  N   . TYR A 1 2   ? 19.185  38.477 4.253  1.00 16.42 ? 2   TYR A N   1 
ATOM   8    C  CA  . TYR A 1 2   ? 18.510  37.202 4.109  1.00 14.67 ? 2   TYR A CA  1 
ATOM   9    C  C   . TYR A 1 2   ? 17.091  37.387 3.589  1.00 13.64 ? 2   TYR A C   1 
ATOM   10   O  O   . TYR A 1 2   ? 16.532  38.483 3.640  1.00 10.37 ? 2   TYR A O   1 
ATOM   11   C  CB  . TYR A 1 2   ? 18.446  36.471 5.448  1.00 13.87 ? 2   TYR A CB  1 
ATOM   12   C  CG  . TYR A 1 2   ? 19.776  36.276 6.131  1.00 12.94 ? 2   TYR A CG  1 
ATOM   13   C  CD1 . TYR A 1 2   ? 20.902  35.873 5.414  1.00 12.82 ? 2   TYR A CD1 1 
ATOM   14   C  CD2 . TYR A 1 2   ? 19.890  36.416 7.514  1.00 13.93 ? 2   TYR A CD2 1 
ATOM   15   C  CE1 . TYR A 1 2   ? 22.104  35.609 6.057  1.00 11.82 ? 2   TYR A CE1 1 
ATOM   16   C  CE2 . TYR A 1 2   ? 21.087  36.153 8.167  1.00 12.81 ? 2   TYR A CE2 1 
ATOM   17   C  CZ  . TYR A 1 2   ? 22.187  35.749 7.434  1.00 13.22 ? 2   TYR A CZ  1 
ATOM   18   O  OH  . TYR A 1 2   ? 23.363  35.475 8.086  1.00 14.50 ? 2   TYR A OH  1 
ATOM   19   N  N   . THR A 1 3   ? 16.511  36.300 3.093  1.00 12.08 ? 3   THR A N   1 
ATOM   20   C  CA  . THR A 1 3   ? 15.146  36.325 2.590  1.00 11.45 ? 3   THR A CA  1 
ATOM   21   C  C   . THR A 1 3   ? 14.415  35.063 3.047  1.00 11.78 ? 3   THR A C   1 
ATOM   22   O  O   . THR A 1 3   ? 15.041  34.023 3.284  1.00 8.58  ? 3   THR A O   1 
ATOM   23   C  CB  . THR A 1 3   ? 15.115  36.376 1.051  1.00 13.26 ? 3   THR A CB  1 
ATOM   24   O  OG1 . THR A 1 3   ? 15.778  35.220 0.524  1.00 11.45 ? 3   THR A OG1 1 
ATOM   25   C  CG2 . THR A 1 3   ? 15.807  37.643 0.537  1.00 11.97 ? 3   THR A CG2 1 
ATOM   26   N  N   . LEU A 1 4   ? 13.096  35.155 3.195  1.00 11.51 ? 4   LEU A N   1 
ATOM   27   C  CA  . LEU A 1 4   ? 12.314  33.989 3.587  1.00 11.81 ? 4   LEU A CA  1 
ATOM   28   C  C   . LEU A 1 4   ? 12.333  33.103 2.349  1.00 12.42 ? 4   LEU A C   1 
ATOM   29   O  O   . LEU A 1 4   ? 11.852  33.506 1.291  1.00 15.02 ? 4   LEU A O   1 
ATOM   30   C  CB  . LEU A 1 4   ? 10.874  34.378 3.914  1.00 11.00 ? 4   LEU A CB  1 
ATOM   31   C  CG  . LEU A 1 4   ? 9.986   33.211 4.358  1.00 11.55 ? 4   LEU A CG  1 
ATOM   32   C  CD1 . LEU A 1 4   ? 10.534  32.643 5.655  1.00 11.97 ? 4   LEU A CD1 1 
ATOM   33   C  CD2 . LEU A 1 4   ? 8.553   33.681 4.554  1.00 12.37 ? 4   LEU A CD2 1 
ATOM   34   N  N   . PRO A 1 5   ? 12.897  31.892 2.456  1.00 12.08 ? 5   PRO A N   1 
ATOM   35   C  CA  . PRO A 1 5   ? 12.962  30.986 1.307  1.00 11.43 ? 5   PRO A CA  1 
ATOM   36   C  C   . PRO A 1 5   ? 11.604  30.421 0.904  1.00 11.52 ? 5   PRO A C   1 
ATOM   37   O  O   . PRO A 1 5   ? 10.759  30.153 1.759  1.00 9.32  ? 5   PRO A O   1 
ATOM   38   C  CB  . PRO A 1 5   ? 13.904  29.896 1.806  1.00 10.60 ? 5   PRO A CB  1 
ATOM   39   C  CG  . PRO A 1 5   ? 13.464  29.781 3.250  1.00 9.73  ? 5   PRO A CG  1 
ATOM   40   C  CD  . PRO A 1 5   ? 13.527  31.259 3.628  1.00 11.21 ? 5   PRO A CD  1 
ATOM   41   N  N   . SER A 1 6   ? 11.398  30.243 -0.398 1.00 11.57 ? 6   SER A N   1 
ATOM   42   C  CA  . SER A 1 6   ? 10.148  29.668 -0.883 1.00 12.68 ? 6   SER A CA  1 
ATOM   43   C  C   . SER A 1 6   ? 10.191  28.194 -0.491 1.00 11.37 ? 6   SER A C   1 
ATOM   44   O  O   . SER A 1 6   ? 11.259  27.588 -0.467 1.00 12.34 ? 6   SER A O   1 
ATOM   45   C  CB  . SER A 1 6   ? 10.041  29.809 -2.405 1.00 14.77 ? 6   SER A CB  1 
ATOM   46   O  OG  . SER A 1 6   ? 11.112  29.162 -3.062 1.00 16.58 ? 6   SER A OG  1 
ATOM   47   N  N   . LEU A 1 7   ? 9.042   27.619 -0.165 1.00 10.95 ? 7   LEU A N   1 
ATOM   48   C  CA  . LEU A 1 7   ? 9.009   26.220 0.241  1.00 10.78 ? 7   LEU A CA  1 
ATOM   49   C  C   . LEU A 1 7   ? 8.996   25.274 -0.953 1.00 10.80 ? 7   LEU A C   1 
ATOM   50   O  O   . LEU A 1 7   ? 8.628   25.656 -2.065 1.00 10.51 ? 7   LEU A O   1 
ATOM   51   C  CB  . LEU A 1 7   ? 7.779   25.947 1.108  1.00 8.67  ? 7   LEU A CB  1 
ATOM   52   C  CG  . LEU A 1 7   ? 7.617   26.808 2.361  1.00 9.55  ? 7   LEU A CG  1 
ATOM   53   C  CD1 . LEU A 1 7   ? 6.382   26.351 3.117  1.00 9.55  ? 7   LEU A CD1 1 
ATOM   54   C  CD2 . LEU A 1 7   ? 8.844   26.688 3.240  1.00 9.28  ? 7   LEU A CD2 1 
ATOM   55   N  N   . PRO A 1 8   ? 9.436   24.028 -0.741 1.00 10.80 ? 8   PRO A N   1 
ATOM   56   C  CA  . PRO A 1 8   ? 9.468   23.013 -1.795 1.00 11.56 ? 8   PRO A CA  1 
ATOM   57   C  C   . PRO A 1 8   ? 8.051   22.481 -2.048 1.00 11.74 ? 8   PRO A C   1 
ATOM   58   O  O   . PRO A 1 8   ? 7.870   21.525 -2.804 1.00 12.22 ? 8   PRO A O   1 
ATOM   59   C  CB  . PRO A 1 8   ? 10.377  21.928 -1.194 1.00 11.80 ? 8   PRO A CB  1 
ATOM   60   C  CG  . PRO A 1 8   ? 11.155  22.674 -0.092 1.00 11.26 ? 8   PRO A CG  1 
ATOM   61   C  CD  . PRO A 1 8   ? 10.031  23.482 0.488  1.00 11.74 ? 8   PRO A CD  1 
ATOM   62   N  N   . TYR A 1 9   ? 7.056   23.107 -1.419 1.00 10.94 ? 9   TYR A N   1 
ATOM   63   C  CA  . TYR A 1 9   ? 5.667   22.663 -1.541 1.00 9.68  ? 9   TYR A CA  1 
ATOM   64   C  C   . TYR A 1 9   ? 4.665   23.649 -0.952 1.00 10.89 ? 9   TYR A C   1 
ATOM   65   O  O   . TYR A 1 9   ? 5.044   24.649 -0.335 1.00 10.54 ? 9   TYR A O   1 
ATOM   66   C  CB  . TYR A 1 9   ? 5.520   21.320 -0.821 1.00 10.40 ? 9   TYR A CB  1 
ATOM   67   C  CG  . TYR A 1 9   ? 6.207   21.331 0.531  1.00 7.66  ? 9   TYR A CG  1 
ATOM   68   C  CD1 . TYR A 1 9   ? 5.746   22.146 1.564  1.00 4.38  ? 9   TYR A CD1 1 
ATOM   69   C  CD2 . TYR A 1 9   ? 7.379   20.600 0.741  1.00 7.63  ? 9   TYR A CD2 1 
ATOM   70   C  CE1 . TYR A 1 9   ? 6.437   22.246 2.770  1.00 8.14  ? 9   TYR A CE1 1 
ATOM   71   C  CE2 . TYR A 1 9   ? 8.081   20.690 1.948  1.00 9.81  ? 9   TYR A CE2 1 
ATOM   72   C  CZ  . TYR A 1 9   ? 7.605   21.518 2.954  1.00 9.34  ? 9   TYR A CZ  1 
ATOM   73   O  OH  . TYR A 1 9   ? 8.304   21.634 4.133  1.00 10.81 ? 9   TYR A OH  1 
ATOM   74   N  N   . ALA A 1 10  ? 3.382   23.351 -1.143 1.00 9.93  ? 10  ALA A N   1 
ATOM   75   C  CA  . ALA A 1 10  ? 2.303   24.173 -0.607 1.00 10.84 ? 10  ALA A CA  1 
ATOM   76   C  C   . ALA A 1 10  ? 2.194   23.829 0.882  1.00 9.84  ? 10  ALA A C   1 
ATOM   77   O  O   . ALA A 1 10  ? 2.667   22.774 1.299  1.00 8.78  ? 10  ALA A O   1 
ATOM   78   C  CB  . ALA A 1 10  ? 0.994   23.852 -1.328 1.00 9.57  ? 10  ALA A CB  1 
ATOM   79   N  N   . TYR A 1 11  ? 1.570   24.703 1.675  1.00 10.04 ? 11  TYR A N   1 
ATOM   80   C  CA  . TYR A 1 11  ? 1.445   24.477 3.121  1.00 8.85  ? 11  TYR A CA  1 
ATOM   81   C  C   . TYR A 1 11  ? 0.665   23.230 3.540  1.00 8.46  ? 11  TYR A C   1 
ATOM   82   O  O   . TYR A 1 11  ? 0.883   22.702 4.631  1.00 6.42  ? 11  TYR A O   1 
ATOM   83   C  CB  . TYR A 1 11  ? 0.817   25.694 3.817  1.00 9.62  ? 11  TYR A CB  1 
ATOM   84   C  CG  . TYR A 1 11  ? 1.612   26.977 3.708  1.00 7.83  ? 11  TYR A CG  1 
ATOM   85   C  CD1 . TYR A 1 11  ? 2.952   27.034 4.107  1.00 7.79  ? 11  TYR A CD1 1 
ATOM   86   C  CD2 . TYR A 1 11  ? 1.026   28.138 3.198  1.00 6.87  ? 11  TYR A CD2 1 
ATOM   87   C  CE1 . TYR A 1 11  ? 3.693   28.225 3.992  1.00 6.60  ? 11  TYR A CE1 1 
ATOM   88   C  CE2 . TYR A 1 11  ? 1.752   29.327 3.080  1.00 7.15  ? 11  TYR A CE2 1 
ATOM   89   C  CZ  . TYR A 1 11  ? 3.082   29.364 3.475  1.00 5.83  ? 11  TYR A CZ  1 
ATOM   90   O  OH  . TYR A 1 11  ? 3.795   30.533 3.335  1.00 2.79  ? 11  TYR A OH  1 
ATOM   91   N  N   . ASP A 1 12  ? -0.236  22.758 2.684  1.00 6.13  ? 12  ASP A N   1 
ATOM   92   C  CA  . ASP A 1 12  ? -1.035  21.585 3.015  1.00 7.22  ? 12  ASP A CA  1 
ATOM   93   C  C   . ASP A 1 12  ? -0.448  20.277 2.494  1.00 6.28  ? 12  ASP A C   1 
ATOM   94   O  O   . ASP A 1 12  ? -1.082  19.228 2.599  1.00 6.53  ? 12  ASP A O   1 
ATOM   95   C  CB  . ASP A 1 12  ? -2.454  21.757 2.471  1.00 8.67  ? 12  ASP A CB  1 
ATOM   96   C  CG  . ASP A 1 12  ? -2.502  21.761 0.952  1.00 9.55  ? 12  ASP A CG  1 
ATOM   97   O  OD1 . ASP A 1 12  ? -1.432  21.857 0.307  1.00 8.60  ? 12  ASP A OD1 1 
ATOM   98   O  OD2 . ASP A 1 12  ? -3.618  21.683 0.406  1.00 8.31  ? 12  ASP A OD2 1 
ATOM   99   N  N   . ALA A 1 13  ? 0.766   20.335 1.956  1.00 6.80  ? 13  ALA A N   1 
ATOM   100  C  CA  . ALA A 1 13  ? 1.414   19.151 1.397  1.00 7.71  ? 13  ALA A CA  1 
ATOM   101  C  C   . ALA A 1 13  ? 1.780   18.063 2.410  1.00 7.83  ? 13  ALA A C   1 
ATOM   102  O  O   . ALA A 1 13  ? 1.937   16.901 2.044  1.00 8.76  ? 13  ALA A O   1 
ATOM   103  C  CB  . ALA A 1 13  ? 2.661   19.568 0.611  1.00 9.64  ? 13  ALA A CB  1 
ATOM   104  N  N   . LEU A 1 14  ? 1.915   18.421 3.680  1.00 7.36  ? 14  LEU A N   1 
ATOM   105  C  CA  . LEU A 1 14  ? 2.277   17.421 4.670  1.00 6.61  ? 14  LEU A CA  1 
ATOM   106  C  C   . LEU A 1 14  ? 1.065   16.836 5.392  1.00 7.19  ? 14  LEU A C   1 
ATOM   107  O  O   . LEU A 1 14  ? 1.207   16.050 6.331  1.00 7.43  ? 14  LEU A O   1 
ATOM   108  C  CB  . LEU A 1 14  ? 3.290   18.001 5.659  1.00 5.65  ? 14  LEU A CB  1 
ATOM   109  C  CG  . LEU A 1 14  ? 4.569   18.529 4.986  1.00 7.85  ? 14  LEU A CG  1 
ATOM   110  C  CD1 . LEU A 1 14  ? 5.524   19.054 6.048  1.00 6.68  ? 14  LEU A CD1 1 
ATOM   111  C  CD2 . LEU A 1 14  ? 5.247   17.421 4.157  1.00 5.13  ? 14  LEU A CD2 1 
ATOM   112  N  N   . GLU A 1 15  ? -0.129  17.221 4.953  1.00 6.90  ? 15  GLU A N   1 
ATOM   113  C  CA  . GLU A 1 15  ? -1.356  16.674 5.528  1.00 9.04  ? 15  GLU A CA  1 
ATOM   114  C  C   . GLU A 1 15  ? -1.337  15.200 5.128  1.00 9.81  ? 15  GLU A C   1 
ATOM   115  O  O   . GLU A 1 15  ? -0.810  14.848 4.072  1.00 11.18 ? 15  GLU A O   1 
ATOM   116  C  CB  . GLU A 1 15  ? -2.612  17.321 4.912  1.00 8.44  ? 15  GLU A CB  1 
ATOM   117  C  CG  . GLU A 1 15  ? -2.936  18.765 5.317  1.00 10.51 ? 15  GLU A CG  1 
ATOM   118  C  CD  . GLU A 1 15  ? -3.296  18.903 6.791  1.00 11.18 ? 15  GLU A CD  1 
ATOM   119  O  OE1 . GLU A 1 15  ? -3.589  17.866 7.428  1.00 12.79 ? 15  GLU A OE1 1 
ATOM   120  O  OE2 . GLU A 1 15  ? -3.309  20.046 7.306  1.00 8.25  ? 15  GLU A OE2 1 
ATOM   121  N  N   . PRO A 1 16  ? -1.927  14.324 5.949  1.00 8.01  ? 16  PRO A N   1 
ATOM   122  C  CA  . PRO A 1 16  ? -2.601  14.609 7.216  1.00 8.80  ? 16  PRO A CA  1 
ATOM   123  C  C   . PRO A 1 16  ? -1.678  14.454 8.426  1.00 8.68  ? 16  PRO A C   1 
ATOM   124  O  O   . PRO A 1 16  ? -2.144  14.120 9.512  1.00 8.82  ? 16  PRO A O   1 
ATOM   125  C  CB  . PRO A 1 16  ? -3.710  13.572 7.214  1.00 8.84  ? 16  PRO A CB  1 
ATOM   126  C  CG  . PRO A 1 16  ? -2.931  12.355 6.775  1.00 8.03  ? 16  PRO A CG  1 
ATOM   127  C  CD  . PRO A 1 16  ? -2.116  12.906 5.585  1.00 9.63  ? 16  PRO A CD  1 
ATOM   128  N  N   . HIS A 1 17  ? -0.382  14.702 8.243  1.00 8.42  ? 17  HIS A N   1 
ATOM   129  C  CA  . HIS A 1 17  ? 0.598   14.546 9.322  1.00 9.59  ? 17  HIS A CA  1 
ATOM   130  C  C   . HIS A 1 17  ? 0.911   15.850 10.066 1.00 9.47  ? 17  HIS A C   1 
ATOM   131  O  O   . HIS A 1 17  ? 0.745   15.928 11.284 1.00 7.12  ? 17  HIS A O   1 
ATOM   132  C  CB  . HIS A 1 17  ? 1.878   13.935 8.744  1.00 9.38  ? 17  HIS A CB  1 
ATOM   133  C  CG  . HIS A 1 17  ? 1.636   12.680 7.965  1.00 9.93  ? 17  HIS A CG  1 
ATOM   134  N  ND1 . HIS A 1 17  ? 1.119   11.537 8.537  1.00 8.87  ? 17  HIS A ND1 1 
ATOM   135  C  CD2 . HIS A 1 17  ? 1.791   12.404 6.649  1.00 8.94  ? 17  HIS A CD2 1 
ATOM   136  C  CE1 . HIS A 1 17  ? 0.968   10.611 7.607  1.00 7.26  ? 17  HIS A CE1 1 
ATOM   137  N  NE2 . HIS A 1 17  ? 1.367   11.113 6.452  1.00 9.21  ? 17  HIS A NE2 1 
ATOM   138  N  N   . PHE A 1 18  ? 1.400   16.851 9.337  1.00 7.78  ? 18  PHE A N   1 
ATOM   139  C  CA  . PHE A 1 18  ? 1.682   18.167 9.909  1.00 8.82  ? 18  PHE A CA  1 
ATOM   140  C  C   . PHE A 1 18  ? 0.587   19.079 9.363  1.00 8.47  ? 18  PHE A C   1 
ATOM   141  O  O   . PHE A 1 18  ? 0.389   19.149 8.148  1.00 8.65  ? 18  PHE A O   1 
ATOM   142  C  CB  . PHE A 1 18  ? 3.066   18.679 9.479  1.00 7.58  ? 18  PHE A CB  1 
ATOM   143  C  CG  . PHE A 1 18  ? 4.215   18.106 10.276 1.00 8.80  ? 18  PHE A CG  1 
ATOM   144  C  CD1 . PHE A 1 18  ? 4.030   17.013 11.126 1.00 8.22  ? 18  PHE A CD1 1 
ATOM   145  C  CD2 . PHE A 1 18  ? 5.495   18.641 10.146 1.00 4.73  ? 18  PHE A CD2 1 
ATOM   146  C  CE1 . PHE A 1 18  ? 5.102   16.467 11.828 1.00 8.48  ? 18  PHE A CE1 1 
ATOM   147  C  CE2 . PHE A 1 18  ? 6.571   18.104 10.842 1.00 4.99  ? 18  PHE A CE2 1 
ATOM   148  C  CZ  . PHE A 1 18  ? 6.378   17.015 11.684 1.00 5.11  ? 18  PHE A CZ  1 
ATOM   149  N  N   . ASP A 1 19  ? -0.122  19.767 10.256 1.00 8.15  ? 19  ASP A N   1 
ATOM   150  C  CA  . ASP A 1 19  ? -1.223  20.643 9.862  1.00 9.03  ? 19  ASP A CA  1 
ATOM   151  C  C   . ASP A 1 19  ? -0.792  21.867 9.064  1.00 9.65  ? 19  ASP A C   1 
ATOM   152  O  O   . ASP A 1 19  ? 0.161   22.554 9.426  1.00 10.87 ? 19  ASP A O   1 
ATOM   153  C  CB  . ASP A 1 19  ? -2.019  21.083 11.099 1.00 10.44 ? 19  ASP A CB  1 
ATOM   154  C  CG  . ASP A 1 19  ? -1.172  21.840 12.107 1.00 10.73 ? 19  ASP A CG  1 
ATOM   155  O  OD1 . ASP A 1 19  ? -0.226  21.242 12.671 1.00 9.35  ? 19  ASP A OD1 1 
ATOM   156  O  OD2 . ASP A 1 19  ? -1.455  23.038 12.332 1.00 8.92  ? 19  ASP A OD2 1 
ATOM   157  N  N   . LYS A 1 20  ? -1.519  22.137 7.985  1.00 10.19 ? 20  LYS A N   1 
ATOM   158  C  CA  . LYS A 1 20  ? -1.233  23.264 7.100  1.00 10.84 ? 20  LYS A CA  1 
ATOM   159  C  C   . LYS A 1 20  ? -1.312  24.630 7.781  1.00 10.99 ? 20  LYS A C   1 
ATOM   160  O  O   . LYS A 1 20  ? -0.582  25.549 7.410  1.00 9.88  ? 20  LYS A O   1 
ATOM   161  C  CB  . LYS A 1 20  ? -2.184  23.241 5.899  1.00 12.12 ? 20  LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 20  ? -3.651  23.441 6.257  1.00 14.28 ? 20  LYS A CG  1 
ATOM   163  C  CD  . LYS A 1 20  ? -4.532  23.327 5.024  1.00 17.15 ? 20  LYS A CD  1 
ATOM   164  C  CE  . LYS A 1 20  ? -5.994  23.551 5.371  1.00 20.23 ? 20  LYS A CE  1 
ATOM   165  N  NZ  . LYS A 1 20  ? -6.885  23.392 4.183  1.00 21.37 ? 20  LYS A NZ  1 
ATOM   166  N  N   . GLN A 1 21  ? -2.196  24.772 8.766  1.00 10.57 ? 21  GLN A N   1 
ATOM   167  C  CA  . GLN A 1 21  ? -2.320  26.049 9.473  1.00 12.49 ? 21  GLN A CA  1 
ATOM   168  C  C   . GLN A 1 21  ? -0.998  26.402 10.156 1.00 9.74  ? 21  GLN A C   1 
ATOM   169  O  O   . GLN A 1 21  ? -0.547  27.548 10.105 1.00 7.58  ? 21  GLN A O   1 
ATOM   170  C  CB  . GLN A 1 21  ? -3.432  25.992 10.524 1.00 14.71 ? 21  GLN A CB  1 
ATOM   171  C  CG  . GLN A 1 21  ? -3.668  27.326 11.225 1.00 20.76 ? 21  GLN A CG  1 
ATOM   172  C  CD  . GLN A 1 21  ? -4.719  27.247 12.321 1.00 24.81 ? 21  GLN A CD  1 
ATOM   173  O  OE1 . GLN A 1 21  ? -5.061  28.257 12.941 1.00 29.67 ? 21  GLN A OE1 1 
ATOM   174  N  NE2 . GLN A 1 21  ? -5.233  26.046 12.571 1.00 25.81 ? 21  GLN A NE2 1 
ATOM   175  N  N   . THR A 1 22  ? -0.384  25.409 10.794 1.00 8.94  ? 22  THR A N   1 
ATOM   176  C  CA  . THR A 1 22  ? 0.895   25.609 11.475 1.00 8.80  ? 22  THR A CA  1 
ATOM   177  C  C   . THR A 1 22  ? 1.996   25.871 10.459 1.00 7.82  ? 22  THR A C   1 
ATOM   178  O  O   . THR A 1 22  ? 2.819   26.768 10.643 1.00 7.97  ? 22  THR A O   1 
ATOM   179  C  CB  . THR A 1 22  ? 1.293   24.371 12.319 1.00 7.84  ? 22  THR A CB  1 
ATOM   180  O  OG1 . THR A 1 22  ? 0.398   24.244 13.427 1.00 8.76  ? 22  THR A OG1 1 
ATOM   181  C  CG2 . THR A 1 22  ? 2.724   24.497 12.828 1.00 4.13  ? 22  THR A CG2 1 
ATOM   182  N  N   . MET A 1 23  ? 2.013   25.088 9.386  1.00 7.01  ? 23  MET A N   1 
ATOM   183  C  CA  . MET A 1 23  ? 3.033   25.268 8.363  1.00 9.10  ? 23  MET A CA  1 
ATOM   184  C  C   . MET A 1 23  ? 3.100   26.723 7.909  1.00 8.85  ? 23  MET A C   1 
ATOM   185  O  O   . MET A 1 23  ? 4.177   27.315 7.878  1.00 7.11  ? 23  MET A O   1 
ATOM   186  C  CB  . MET A 1 23  ? 2.765   24.359 7.157  1.00 7.91  ? 23  MET A CB  1 
ATOM   187  C  CG  . MET A 1 23  ? 2.927   22.880 7.446  1.00 8.34  ? 23  MET A CG  1 
ATOM   188  S  SD  . MET A 1 23  ? 4.596   22.417 7.967  1.00 10.89 ? 23  MET A SD  1 
ATOM   189  C  CE  . MET A 1 23  ? 5.551   22.868 6.535  1.00 7.71  ? 23  MET A CE  1 
ATOM   190  N  N   . GLU A 1 24  ? 1.945   27.299 7.584  1.00 9.34  ? 24  GLU A N   1 
ATOM   191  C  CA  . GLU A 1 24  ? 1.872   28.684 7.116  1.00 11.16 ? 24  GLU A CA  1 
ATOM   192  C  C   . GLU A 1 24  ? 2.359   29.711 8.144  1.00 10.77 ? 24  GLU A C   1 
ATOM   193  O  O   . GLU A 1 24  ? 3.130   30.614 7.814  1.00 10.37 ? 24  GLU A O   1 
ATOM   194  C  CB  . GLU A 1 24  ? 0.437   29.030 6.714  1.00 10.55 ? 24  GLU A CB  1 
ATOM   195  C  CG  . GLU A 1 24  ? 0.324   30.346 5.967  1.00 13.95 ? 24  GLU A CG  1 
ATOM   196  C  CD  . GLU A 1 24  ? -1.109  30.707 5.614  1.00 16.91 ? 24  GLU A CD  1 
ATOM   197  O  OE1 . GLU A 1 24  ? -1.862  29.819 5.153  1.00 14.59 ? 24  GLU A OE1 1 
ATOM   198  O  OE2 . GLU A 1 24  ? -1.474  31.890 5.781  1.00 20.06 ? 24  GLU A OE2 1 
ATOM   199  N  N   . ILE A 1 25  ? 1.892   29.581 9.383  1.00 9.99  ? 25  ILE A N   1 
ATOM   200  C  CA  . ILE A 1 25  ? 2.275   30.498 10.454 1.00 9.27  ? 25  ILE A CA  1 
ATOM   201  C  C   . ILE A 1 25  ? 3.757   30.343 10.787 1.00 8.68  ? 25  ILE A C   1 
ATOM   202  O  O   . ILE A 1 25  ? 4.472   31.327 11.001 1.00 8.64  ? 25  ILE A O   1 
ATOM   203  C  CB  . ILE A 1 25  ? 1.449   30.227 11.738 1.00 9.65  ? 25  ILE A CB  1 
ATOM   204  C  CG1 . ILE A 1 25  ? -0.032  30.491 11.459 1.00 11.45 ? 25  ILE A CG1 1 
ATOM   205  C  CG2 . ILE A 1 25  ? 1.958   31.092 12.891 1.00 7.66  ? 25  ILE A CG2 1 
ATOM   206  C  CD1 . ILE A 1 25  ? -0.945  30.174 12.625 1.00 12.83 ? 25  ILE A CD1 1 
ATOM   207  N  N   . HIS A 1 26  ? 4.203   29.096 10.826 1.00 6.62  ? 26  HIS A N   1 
ATOM   208  C  CA  . HIS A 1 26  ? 5.589   28.764 11.141 1.00 6.27  ? 26  HIS A CA  1 
ATOM   209  C  C   . HIS A 1 26  ? 6.498   29.417 10.103 1.00 6.05  ? 26  HIS A C   1 
ATOM   210  O  O   . HIS A 1 26  ? 7.570   29.936 10.435 1.00 5.67  ? 26  HIS A O   1 
ATOM   211  C  CB  . HIS A 1 26  ? 5.758   27.238 11.115 1.00 2.78  ? 26  HIS A CB  1 
ATOM   212  C  CG  . HIS A 1 26  ? 6.962   26.738 11.853 1.00 4.25  ? 26  HIS A CG  1 
ATOM   213  N  ND1 . HIS A 1 26  ? 7.263   25.396 11.958 1.00 3.80  ? 26  HIS A ND1 1 
ATOM   214  C  CD2 . HIS A 1 26  ? 7.912   27.391 12.562 1.00 2.38  ? 26  HIS A CD2 1 
ATOM   215  C  CE1 . HIS A 1 26  ? 8.343   25.245 12.700 1.00 4.41  ? 26  HIS A CE1 1 
ATOM   216  N  NE2 . HIS A 1 26  ? 8.757   26.441 13.080 1.00 3.67  ? 26  HIS A NE2 1 
ATOM   217  N  N   . HIS A 1 27  ? 6.043   29.405 8.851  1.00 6.40  ? 27  HIS A N   1 
ATOM   218  C  CA  . HIS A 1 27  ? 6.793   29.974 7.728  1.00 5.11  ? 27  HIS A CA  1 
ATOM   219  C  C   . HIS A 1 27  ? 6.725   31.494 7.670  1.00 5.86  ? 27  HIS A C   1 
ATOM   220  O  O   . HIS A 1 27  ? 7.731   32.176 7.852  1.00 5.73  ? 27  HIS A O   1 
ATOM   221  C  CB  . HIS A 1 27  ? 6.259   29.427 6.400  1.00 3.61  ? 27  HIS A CB  1 
ATOM   222  C  CG  . HIS A 1 27  ? 7.054   29.853 5.201  1.00 3.48  ? 27  HIS A CG  1 
ATOM   223  N  ND1 . HIS A 1 27  ? 6.465   30.314 4.044  1.00 3.37  ? 27  HIS A ND1 1 
ATOM   224  C  CD2 . HIS A 1 27  ? 8.387   29.831 4.960  1.00 2.76  ? 27  HIS A CD2 1 
ATOM   225  C  CE1 . HIS A 1 27  ? 7.398   30.556 3.141  1.00 2.36  ? 27  HIS A CE1 1 
ATOM   226  N  NE2 . HIS A 1 27  ? 8.573   30.272 3.671  1.00 2.36  ? 27  HIS A NE2 1 
ATOM   227  N  N   . THR A 1 28  ? 5.527   32.012 7.409  1.00 6.74  ? 28  THR A N   1 
ATOM   228  C  CA  . THR A 1 28  ? 5.309   33.445 7.269  1.00 6.91  ? 28  THR A CA  1 
ATOM   229  C  C   . THR A 1 28  ? 5.438   34.308 8.526  1.00 7.10  ? 28  THR A C   1 
ATOM   230  O  O   . THR A 1 28  ? 5.634   35.507 8.408  1.00 7.55  ? 28  THR A O   1 
ATOM   231  C  CB  . THR A 1 28  ? 3.927   33.739 6.633  1.00 6.80  ? 28  THR A CB  1 
ATOM   232  O  OG1 . THR A 1 28  ? 2.881   33.324 7.523  1.00 8.94  ? 28  THR A OG1 1 
ATOM   233  C  CG2 . THR A 1 28  ? 3.785   32.997 5.321  1.00 5.75  ? 28  THR A CG2 1 
ATOM   234  N  N   . LYS A 1 29  ? 5.324   33.728 9.717  1.00 6.95  ? 29  LYS A N   1 
ATOM   235  C  CA  . LYS A 1 29  ? 5.442   34.534 10.937 1.00 8.34  ? 29  LYS A CA  1 
ATOM   236  C  C   . LYS A 1 29  ? 6.745   34.286 11.692 1.00 7.69  ? 29  LYS A C   1 
ATOM   237  O  O   . LYS A 1 29  ? 7.572   35.184 11.820 1.00 7.75  ? 29  LYS A O   1 
ATOM   238  C  CB  . LYS A 1 29  ? 4.259   34.274 11.877 1.00 8.98  ? 29  LYS A CB  1 
ATOM   239  C  CG  . LYS A 1 29  ? 2.898   34.543 11.261 1.00 10.90 ? 29  LYS A CG  1 
ATOM   240  C  CD  . LYS A 1 29  ? 2.742   35.989 10.828 1.00 13.15 ? 29  LYS A CD  1 
ATOM   241  C  CE  . LYS A 1 29  ? 1.350   36.233 10.262 1.00 15.52 ? 29  LYS A CE  1 
ATOM   242  N  NZ  . LYS A 1 29  ? 1.170   37.632 9.799  1.00 18.72 ? 29  LYS A NZ  1 
ATOM   243  N  N   . HIS A 1 30  ? 6.923   33.068 12.196 1.00 7.65  ? 30  HIS A N   1 
ATOM   244  C  CA  . HIS A 1 30  ? 8.131   32.718 12.937 1.00 8.27  ? 30  HIS A CA  1 
ATOM   245  C  C   . HIS A 1 30  ? 9.411   32.829 12.107 1.00 8.34  ? 30  HIS A C   1 
ATOM   246  O  O   . HIS A 1 30  ? 10.352  33.523 12.497 1.00 8.59  ? 30  HIS A O   1 
ATOM   247  C  CB  . HIS A 1 30  ? 8.008   31.298 13.492 1.00 8.11  ? 30  HIS A CB  1 
ATOM   248  C  CG  . HIS A 1 30  ? 6.966   31.154 14.555 1.00 6.85  ? 30  HIS A CG  1 
ATOM   249  N  ND1 . HIS A 1 30  ? 7.188   31.513 15.867 1.00 7.43  ? 30  HIS A ND1 1 
ATOM   250  C  CD2 . HIS A 1 30  ? 5.680   30.738 14.489 1.00 5.98  ? 30  HIS A CD2 1 
ATOM   251  C  CE1 . HIS A 1 30  ? 6.082   31.321 16.565 1.00 8.52  ? 30  HIS A CE1 1 
ATOM   252  N  NE2 . HIS A 1 30  ? 5.152   30.852 15.752 1.00 7.82  ? 30  HIS A NE2 1 
ATOM   253  N  N   . HIS A 1 31  ? 9.452   32.152 10.965 1.00 6.26  ? 31  HIS A N   1 
ATOM   254  C  CA  . HIS A 1 31  ? 10.650  32.186 10.140 1.00 6.26  ? 31  HIS A CA  1 
ATOM   255  C  C   . HIS A 1 31  ? 10.913  33.576 9.568  1.00 5.25  ? 31  HIS A C   1 
ATOM   256  O  O   . HIS A 1 31  ? 12.059  34.011 9.497  1.00 5.52  ? 31  HIS A O   1 
ATOM   257  C  CB  . HIS A 1 31  ? 10.552  31.149 9.015  1.00 6.60  ? 31  HIS A CB  1 
ATOM   258  C  CG  . HIS A 1 31  ? 11.854  30.879 8.326  1.00 7.90  ? 31  HIS A CG  1 
ATOM   259  N  ND1 . HIS A 1 31  ? 12.006  29.879 7.389  1.00 7.34  ? 31  HIS A ND1 1 
ATOM   260  C  CD2 . HIS A 1 31  ? 13.060  31.489 8.423  1.00 8.21  ? 31  HIS A CD2 1 
ATOM   261  C  CE1 . HIS A 1 31  ? 13.248  29.886 6.939  1.00 7.60  ? 31  HIS A CE1 1 
ATOM   262  N  NE2 . HIS A 1 31  ? 13.908  30.853 7.549  1.00 7.86  ? 31  HIS A NE2 1 
ATOM   263  N  N   . GLN A 1 32  ? 9.860   34.279 9.166  1.00 5.57  ? 32  GLN A N   1 
ATOM   264  C  CA  . GLN A 1 32  ? 10.029  35.626 8.623  1.00 5.92  ? 32  GLN A CA  1 
ATOM   265  C  C   . GLN A 1 32  ? 10.696  36.501 9.681  1.00 8.00  ? 32  GLN A C   1 
ATOM   266  O  O   . GLN A 1 32  ? 11.610  37.265 9.382  1.00 10.20 ? 32  GLN A O   1 
ATOM   267  C  CB  . GLN A 1 32  ? 8.678   36.240 8.255  1.00 6.63  ? 32  GLN A CB  1 
ATOM   268  C  CG  . GLN A 1 32  ? 8.773   37.620 7.618  1.00 6.06  ? 32  GLN A CG  1 
ATOM   269  C  CD  . GLN A 1 32  ? 9.383   37.569 6.234  1.00 7.55  ? 32  GLN A CD  1 
ATOM   270  O  OE1 . GLN A 1 32  ? 8.864   36.896 5.350  1.00 7.85  ? 32  GLN A OE1 1 
ATOM   271  N  NE2 . GLN A 1 32  ? 10.487  38.277 6.038  1.00 7.63  ? 32  GLN A NE2 1 
ATOM   272  N  N   . THR A 1 33  ? 10.232  36.381 10.921 1.00 8.68  ? 33  THR A N   1 
ATOM   273  C  CA  . THR A 1 33  ? 10.780  37.166 12.018 1.00 8.82  ? 33  THR A CA  1 
ATOM   274  C  C   . THR A 1 33  ? 12.275  36.914 12.244 1.00 8.20  ? 33  THR A C   1 
ATOM   275  O  O   . THR A 1 33  ? 13.018  37.841 12.570 1.00 6.21  ? 33  THR A O   1 
ATOM   276  C  CB  . THR A 1 33  ? 9.993   36.911 13.330 1.00 8.67  ? 33  THR A CB  1 
ATOM   277  O  OG1 . THR A 1 33  ? 8.652   37.393 13.178 1.00 8.08  ? 33  THR A OG1 1 
ATOM   278  C  CG2 . THR A 1 33  ? 10.641  37.630 14.499 1.00 9.40  ? 33  THR A CG2 1 
ATOM   279  N  N   . TYR A 1 34  ? 12.726  35.674 12.074 1.00 8.00  ? 34  TYR A N   1 
ATOM   280  C  CA  . TYR A 1 34  ? 14.151  35.389 12.259 1.00 8.00  ? 34  TYR A CA  1 
ATOM   281  C  C   . TYR A 1 34  ? 14.954  36.098 11.172 1.00 6.97  ? 34  TYR A C   1 
ATOM   282  O  O   . TYR A 1 34  ? 16.050  36.597 11.418 1.00 6.77  ? 34  TYR A O   1 
ATOM   283  C  CB  . TYR A 1 34  ? 14.433  33.892 12.191 1.00 8.50  ? 34  TYR A CB  1 
ATOM   284  C  CG  . TYR A 1 34  ? 13.718  33.069 13.235 1.00 11.57 ? 34  TYR A CG  1 
ATOM   285  C  CD1 . TYR A 1 34  ? 13.843  33.357 14.595 1.00 12.42 ? 34  TYR A CD1 1 
ATOM   286  C  CD2 . TYR A 1 34  ? 12.930  31.986 12.861 1.00 12.28 ? 34  TYR A CD2 1 
ATOM   287  C  CE1 . TYR A 1 34  ? 13.194  32.578 15.557 1.00 13.84 ? 34  TYR A CE1 1 
ATOM   288  C  CE2 . TYR A 1 34  ? 12.282  31.208 13.808 1.00 15.64 ? 34  TYR A CE2 1 
ATOM   289  C  CZ  . TYR A 1 34  ? 12.415  31.506 15.148 1.00 14.59 ? 34  TYR A CZ  1 
ATOM   290  O  OH  . TYR A 1 34  ? 11.759  30.722 16.065 1.00 18.43 ? 34  TYR A OH  1 
ATOM   291  N  N   . VAL A 1 35  ? 14.398  36.129 9.966  1.00 7.23  ? 35  VAL A N   1 
ATOM   292  C  CA  . VAL A 1 35  ? 15.043  36.783 8.835  1.00 8.71  ? 35  VAL A CA  1 
ATOM   293  C  C   . VAL A 1 35  ? 15.117  38.292 9.042  1.00 9.42  ? 35  VAL A C   1 
ATOM   294  O  O   . VAL A 1 35  ? 16.159  38.905 8.796  1.00 7.74  ? 35  VAL A O   1 
ATOM   295  C  CB  . VAL A 1 35  ? 14.282  36.494 7.514  1.00 8.91  ? 35  VAL A CB  1 
ATOM   296  C  CG1 . VAL A 1 35  ? 14.854  37.329 6.376  1.00 8.27  ? 35  VAL A CG1 1 
ATOM   297  C  CG2 . VAL A 1 35  ? 14.389  35.012 7.174  1.00 8.71  ? 35  VAL A CG2 1 
ATOM   298  N  N   . ASN A 1 36  ? 14.019  38.891 9.502  1.00 9.72  ? 36  ASN A N   1 
ATOM   299  C  CA  . ASN A 1 36  ? 14.003  40.332 9.713  1.00 10.73 ? 36  ASN A CA  1 
ATOM   300  C  C   . ASN A 1 36  ? 14.922  40.760 10.847 1.00 12.55 ? 36  ASN A C   1 
ATOM   301  O  O   . ASN A 1 36  ? 15.686  41.720 10.706 1.00 12.76 ? 36  ASN A O   1 
ATOM   302  C  CB  . ASN A 1 36  ? 12.587  40.839 9.997  1.00 11.88 ? 36  ASN A CB  1 
ATOM   303  C  CG  . ASN A 1 36  ? 11.613  40.512 8.884  1.00 11.72 ? 36  ASN A CG  1 
ATOM   304  O  OD1 . ASN A 1 36  ? 12.007  40.286 7.737  1.00 12.37 ? 36  ASN A OD1 1 
ATOM   305  N  ND2 . ASN A 1 36  ? 10.327  40.516 9.210  1.00 10.72 ? 36  ASN A ND2 1 
ATOM   306  N  N   . ASN A 1 37  ? 14.857  40.057 11.973 1.00 12.37 ? 37  ASN A N   1 
ATOM   307  C  CA  . ASN A 1 37  ? 15.704  40.417 13.098 1.00 12.66 ? 37  ASN A CA  1 
ATOM   308  C  C   . ASN A 1 37  ? 17.170  40.203 12.772 1.00 11.23 ? 37  ASN A C   1 
ATOM   309  O  O   . ASN A 1 37  ? 18.021  40.966 13.225 1.00 11.67 ? 37  ASN A O   1 
ATOM   310  C  CB  . ASN A 1 37  ? 15.324  39.629 14.353 1.00 14.86 ? 37  ASN A CB  1 
ATOM   311  C  CG  . ASN A 1 37  ? 13.918  39.939 14.823 1.00 17.56 ? 37  ASN A CG  1 
ATOM   312  O  OD1 . ASN A 1 37  ? 13.492  41.093 14.815 1.00 16.47 ? 37  ASN A OD1 1 
ATOM   313  N  ND2 . ASN A 1 37  ? 13.199  38.915 15.260 1.00 20.49 ? 37  ASN A ND2 1 
ATOM   314  N  N   . ALA A 1 38  ? 17.467  39.172 11.986 1.00 9.38  ? 38  ALA A N   1 
ATOM   315  C  CA  . ALA A 1 38  ? 18.849  38.902 11.607 1.00 8.98  ? 38  ALA A CA  1 
ATOM   316  C  C   . ALA A 1 38  ? 19.359  40.022 10.702 1.00 8.49  ? 38  ALA A C   1 
ATOM   317  O  O   . ALA A 1 38  ? 20.463  40.535 10.907 1.00 7.29  ? 38  ALA A O   1 
ATOM   318  C  CB  . ALA A 1 38  ? 18.958  37.555 10.895 1.00 11.03 ? 38  ALA A CB  1 
ATOM   319  N  N   . ASN A 1 39  ? 18.561  40.410 9.709  1.00 7.58  ? 39  ASN A N   1 
ATOM   320  C  CA  . ASN A 1 39  ? 18.978  41.487 8.813  1.00 9.58  ? 39  ASN A CA  1 
ATOM   321  C  C   . ASN A 1 39  ? 19.212  42.796 9.569  1.00 10.67 ? 39  ASN A C   1 
ATOM   322  O  O   . ASN A 1 39  ? 20.157  43.529 9.274  1.00 10.18 ? 39  ASN A O   1 
ATOM   323  C  CB  . ASN A 1 39  ? 17.950  41.725 7.694  1.00 7.42  ? 39  ASN A CB  1 
ATOM   324  C  CG  . ASN A 1 39  ? 17.915  40.593 6.678  1.00 6.89  ? 39  ASN A CG  1 
ATOM   325  O  OD1 . ASN A 1 39  ? 18.950  40.034 6.332  1.00 5.67  ? 39  ASN A OD1 1 
ATOM   326  N  ND2 . ASN A 1 39  ? 16.728  40.279 6.171  1.00 6.29  ? 39  ASN A ND2 1 
ATOM   327  N  N   . ALA A 1 40  ? 18.358  43.087 10.545 1.00 12.04 ? 40  ALA A N   1 
ATOM   328  C  CA  . ALA A 1 40  ? 18.501  44.314 11.324 1.00 13.09 ? 40  ALA A CA  1 
ATOM   329  C  C   . ALA A 1 40  ? 19.863  44.336 12.002 1.00 13.69 ? 40  ALA A C   1 
ATOM   330  O  O   . ALA A 1 40  ? 20.576  45.340 11.952 1.00 15.06 ? 40  ALA A O   1 
ATOM   331  C  CB  . ALA A 1 40  ? 17.392  44.411 12.372 1.00 13.80 ? 40  ALA A CB  1 
ATOM   332  N  N   . ALA A 1 41  ? 20.223  43.217 12.621 1.00 13.30 ? 41  ALA A N   1 
ATOM   333  C  CA  . ALA A 1 41  ? 21.497  43.094 13.324 1.00 13.37 ? 41  ALA A CA  1 
ATOM   334  C  C   . ALA A 1 41  ? 22.710  43.107 12.394 1.00 13.25 ? 41  ALA A C   1 
ATOM   335  O  O   . ALA A 1 41  ? 23.797  43.533 12.795 1.00 12.89 ? 41  ALA A O   1 
ATOM   336  C  CB  . ALA A 1 41  ? 21.501  41.818 14.160 1.00 13.06 ? 41  ALA A CB  1 
ATOM   337  N  N   . LEU A 1 42  ? 22.522  42.635 11.162 1.00 11.33 ? 42  LEU A N   1 
ATOM   338  C  CA  . LEU A 1 42  ? 23.596  42.578 10.172 1.00 11.66 ? 42  LEU A CA  1 
ATOM   339  C  C   . LEU A 1 42  ? 23.787  43.875 9.394  1.00 12.58 ? 42  LEU A C   1 
ATOM   340  O  O   . LEU A 1 42  ? 24.728  44.002 8.617  1.00 10.65 ? 42  LEU A O   1 
ATOM   341  C  CB  . LEU A 1 42  ? 23.336  41.442 9.177  1.00 8.27  ? 42  LEU A CB  1 
ATOM   342  C  CG  . LEU A 1 42  ? 23.543  40.012 9.679  1.00 10.52 ? 42  LEU A CG  1 
ATOM   343  C  CD1 . LEU A 1 42  ? 22.927  39.002 8.716  1.00 9.30  ? 42  LEU A CD1 1 
ATOM   344  C  CD2 . LEU A 1 42  ? 25.035  39.770 9.850  1.00 9.29  ? 42  LEU A CD2 1 
ATOM   345  N  N   . GLU A 1 43  ? 22.894  44.833 9.608  1.00 14.42 ? 43  GLU A N   1 
ATOM   346  C  CA  . GLU A 1 43  ? 22.951  46.111 8.908  1.00 18.07 ? 43  GLU A CA  1 
ATOM   347  C  C   . GLU A 1 43  ? 24.285  46.836 9.071  1.00 17.67 ? 43  GLU A C   1 
ATOM   348  O  O   . GLU A 1 43  ? 24.780  47.445 8.127  1.00 17.17 ? 43  GLU A O   1 
ATOM   349  C  CB  . GLU A 1 43  ? 21.811  47.014 9.392  1.00 22.94 ? 43  GLU A CB  1 
ATOM   350  C  CG  . GLU A 1 43  ? 21.662  48.308 8.615  1.00 30.68 ? 43  GLU A CG  1 
ATOM   351  C  CD  . GLU A 1 43  ? 20.520  49.165 9.135  1.00 35.53 ? 43  GLU A CD  1 
ATOM   352  O  OE1 . GLU A 1 43  ? 19.375  48.660 9.182  1.00 37.52 ? 43  GLU A OE1 1 
ATOM   353  O  OE2 . GLU A 1 43  ? 20.764  50.341 9.491  1.00 36.68 ? 43  GLU A OE2 1 
ATOM   354  N  N   . SER A 1 44  ? 24.862  46.778 10.267 1.00 17.59 ? 44  SER A N   1 
ATOM   355  C  CA  . SER A 1 44  ? 26.134  47.445 10.525 1.00 19.05 ? 44  SER A CA  1 
ATOM   356  C  C   . SER A 1 44  ? 27.318  46.496 10.384 1.00 19.52 ? 44  SER A C   1 
ATOM   357  O  O   . SER A 1 44  ? 28.431  46.826 10.791 1.00 18.82 ? 44  SER A O   1 
ATOM   358  C  CB  . SER A 1 44  ? 26.141  48.051 11.931 1.00 20.63 ? 44  SER A CB  1 
ATOM   359  O  OG  . SER A 1 44  ? 25.993  47.043 12.918 1.00 22.74 ? 44  SER A OG  1 
ATOM   360  N  N   . LEU A 1 45  ? 27.076  45.319 9.810  1.00 18.32 ? 45  LEU A N   1 
ATOM   361  C  CA  . LEU A 1 45  ? 28.128  44.324 9.630  1.00 17.04 ? 45  LEU A CA  1 
ATOM   362  C  C   . LEU A 1 45  ? 28.174  43.858 8.172  1.00 16.63 ? 45  LEU A C   1 
ATOM   363  O  O   . LEU A 1 45  ? 27.760  42.744 7.851  1.00 16.72 ? 45  LEU A O   1 
ATOM   364  C  CB  . LEU A 1 45  ? 27.872  43.130 10.557 1.00 17.95 ? 45  LEU A CB  1 
ATOM   365  C  CG  . LEU A 1 45  ? 27.754  43.411 12.064 1.00 18.12 ? 45  LEU A CG  1 
ATOM   366  C  CD1 . LEU A 1 45  ? 27.323  42.149 12.777 1.00 15.73 ? 45  LEU A CD1 1 
ATOM   367  C  CD2 . LEU A 1 45  ? 29.078  43.917 12.621 1.00 17.85 ? 45  LEU A CD2 1 
ATOM   368  N  N   . PRO A 1 46  ? 28.693  44.709 7.270  1.00 16.92 ? 46  PRO A N   1 
ATOM   369  C  CA  . PRO A 1 46  ? 28.800  44.409 5.840  1.00 16.81 ? 46  PRO A CA  1 
ATOM   370  C  C   . PRO A 1 46  ? 29.550  43.123 5.485  1.00 18.05 ? 46  PRO A C   1 
ATOM   371  O  O   . PRO A 1 46  ? 29.124  42.381 4.599  1.00 17.89 ? 46  PRO A O   1 
ATOM   372  C  CB  . PRO A 1 46  ? 29.478  45.667 5.287  1.00 16.55 ? 46  PRO A CB  1 
ATOM   373  C  CG  . PRO A 1 46  ? 30.305  46.143 6.482  1.00 15.38 ? 46  PRO A CG  1 
ATOM   374  C  CD  . PRO A 1 46  ? 29.239  46.050 7.536  1.00 15.63 ? 46  PRO A CD  1 
ATOM   375  N  N   . GLU A 1 47  ? 30.660  42.854 6.163  1.00 18.35 ? 47  GLU A N   1 
ATOM   376  C  CA  . GLU A 1 47  ? 31.421  41.642 5.875  1.00 21.05 ? 47  GLU A CA  1 
ATOM   377  C  C   . GLU A 1 47  ? 30.651  40.364 6.224  1.00 19.04 ? 47  GLU A C   1 
ATOM   378  O  O   . GLU A 1 47  ? 30.634  39.406 5.449  1.00 18.35 ? 47  GLU A O   1 
ATOM   379  C  CB  . GLU A 1 47  ? 32.764  41.665 6.610  1.00 24.95 ? 47  GLU A CB  1 
ATOM   380  C  CG  . GLU A 1 47  ? 33.694  42.781 6.152  1.00 31.04 ? 47  GLU A CG  1 
ATOM   381  C  CD  . GLU A 1 47  ? 35.095  42.658 6.733  1.00 35.29 ? 47  GLU A CD  1 
ATOM   382  O  OE1 . GLU A 1 47  ? 35.746  41.614 6.501  1.00 37.30 ? 47  GLU A OE1 1 
ATOM   383  O  OE2 . GLU A 1 47  ? 35.547  43.604 7.415  1.00 38.43 ? 47  GLU A OE2 1 
ATOM   384  N  N   . PHE A 1 48  ? 30.006  40.356 7.384  1.00 16.50 ? 48  PHE A N   1 
ATOM   385  C  CA  . PHE A 1 48  ? 29.232  39.199 7.820  1.00 13.86 ? 48  PHE A CA  1 
ATOM   386  C  C   . PHE A 1 48  ? 27.946  39.023 7.022  1.00 11.99 ? 48  PHE A C   1 
ATOM   387  O  O   . PHE A 1 48  ? 27.453  37.909 6.874  1.00 12.35 ? 48  PHE A O   1 
ATOM   388  C  CB  . PHE A 1 48  ? 28.891  39.332 9.303  1.00 14.83 ? 48  PHE A CB  1 
ATOM   389  C  CG  . PHE A 1 48  ? 30.077  39.207 10.208 1.00 15.79 ? 48  PHE A CG  1 
ATOM   390  C  CD1 . PHE A 1 48  ? 30.596  37.957 10.525 1.00 16.00 ? 48  PHE A CD1 1 
ATOM   391  C  CD2 . PHE A 1 48  ? 30.699  40.341 10.721 1.00 16.48 ? 48  PHE A CD2 1 
ATOM   392  C  CE1 . PHE A 1 48  ? 31.715  37.835 11.344 1.00 18.35 ? 48  PHE A CE1 1 
ATOM   393  C  CE2 . PHE A 1 48  ? 31.825  40.229 11.542 1.00 17.54 ? 48  PHE A CE2 1 
ATOM   394  C  CZ  . PHE A 1 48  ? 32.332  38.973 11.852 1.00 16.64 ? 48  PHE A CZ  1 
ATOM   395  N  N   . ALA A 1 49  ? 27.407  40.119 6.503  1.00 12.16 ? 49  ALA A N   1 
ATOM   396  C  CA  . ALA A 1 49  ? 26.166  40.065 5.736  1.00 12.93 ? 49  ALA A CA  1 
ATOM   397  C  C   . ALA A 1 49  ? 26.272  39.314 4.404  1.00 12.94 ? 49  ALA A C   1 
ATOM   398  O  O   . ALA A 1 49  ? 25.281  38.779 3.918  1.00 15.43 ? 49  ALA A O   1 
ATOM   399  C  CB  . ALA A 1 49  ? 25.640  41.489 5.497  1.00 12.18 ? 49  ALA A CB  1 
ATOM   400  N  N   . ASN A 1 50  ? 27.461  39.267 3.813  1.00 15.10 ? 50  ASN A N   1 
ATOM   401  C  CA  . ASN A 1 50  ? 27.637  38.573 2.536  1.00 17.24 ? 50  ASN A CA  1 
ATOM   402  C  C   . ASN A 1 50  ? 27.577  37.059 2.657  1.00 15.64 ? 50  ASN A C   1 
ATOM   403  O  O   . ASN A 1 50  ? 27.211  36.369 1.710  1.00 13.71 ? 50  ASN A O   1 
ATOM   404  C  CB  . ASN A 1 50  ? 28.978  38.935 1.890  1.00 21.98 ? 50  ASN A CB  1 
ATOM   405  C  CG  . ASN A 1 50  ? 29.081  40.396 1.530  1.00 24.30 ? 50  ASN A CG  1 
ATOM   406  O  OD1 . ASN A 1 50  ? 28.205  40.943 0.862  1.00 26.94 ? 50  ASN A OD1 1 
ATOM   407  N  ND2 . ASN A 1 50  ? 30.166  41.037 1.955  1.00 27.73 ? 50  ASN A ND2 1 
ATOM   408  N  N   . LEU A 1 51  ? 27.946  36.547 3.824  1.00 14.99 ? 51  LEU A N   1 
ATOM   409  C  CA  . LEU A 1 51  ? 27.965  35.112 4.046  1.00 14.07 ? 51  LEU A CA  1 
ATOM   410  C  C   . LEU A 1 51  ? 26.587  34.464 4.059  1.00 13.23 ? 51  LEU A C   1 
ATOM   411  O  O   . LEU A 1 51  ? 25.605  35.069 4.489  1.00 11.85 ? 51  LEU A O   1 
ATOM   412  C  CB  . LEU A 1 51  ? 28.647  34.788 5.380  1.00 15.17 ? 51  LEU A CB  1 
ATOM   413  C  CG  . LEU A 1 51  ? 30.003  35.414 5.726  1.00 18.78 ? 51  LEU A CG  1 
ATOM   414  C  CD1 . LEU A 1 51  ? 30.466  34.861 7.071  1.00 18.56 ? 51  LEU A CD1 1 
ATOM   415  C  CD2 . LEU A 1 51  ? 31.029  35.116 4.651  1.00 19.65 ? 51  LEU A CD2 1 
ATOM   416  N  N   . PRO A 1 52  ? 26.492  33.233 3.537  1.00 12.29 ? 52  PRO A N   1 
ATOM   417  C  CA  . PRO A 1 52  ? 25.216  32.519 3.530  1.00 11.26 ? 52  PRO A CA  1 
ATOM   418  C  C   . PRO A 1 52  ? 24.974  32.300 5.024  1.00 10.23 ? 52  PRO A C   1 
ATOM   419  O  O   . PRO A 1 52  ? 25.938  32.170 5.783  1.00 9.59  ? 52  PRO A O   1 
ATOM   420  C  CB  . PRO A 1 52  ? 25.568  31.220 2.806  1.00 11.17 ? 52  PRO A CB  1 
ATOM   421  C  CG  . PRO A 1 52  ? 26.692  31.666 1.871  1.00 12.69 ? 52  PRO A CG  1 
ATOM   422  C  CD  . PRO A 1 52  ? 27.524  32.423 2.871  1.00 12.31 ? 52  PRO A CD  1 
ATOM   423  N  N   . VAL A 1 53  ? 23.720  32.270 5.454  1.00 7.64  ? 53  VAL A N   1 
ATOM   424  C  CA  . VAL A 1 53  ? 23.429  32.097 6.874  1.00 8.34  ? 53  VAL A CA  1 
ATOM   425  C  C   . VAL A 1 53  ? 24.101  30.866 7.492  1.00 9.60  ? 53  VAL A C   1 
ATOM   426  O  O   . VAL A 1 53  ? 24.539  30.917 8.636  1.00 10.40 ? 53  VAL A O   1 
ATOM   427  C  CB  . VAL A 1 53  ? 21.902  32.033 7.139  1.00 6.08  ? 53  VAL A CB  1 
ATOM   428  C  CG1 . VAL A 1 53  ? 21.308  30.790 6.482  1.00 2.36  ? 53  VAL A CG1 1 
ATOM   429  C  CG2 . VAL A 1 53  ? 21.628  32.058 8.653  1.00 4.72  ? 53  VAL A CG2 1 
ATOM   430  N  N   . GLU A 1 54  ? 24.194  29.775 6.733  1.00 12.23 ? 54  GLU A N   1 
ATOM   431  C  CA  . GLU A 1 54  ? 24.814  28.543 7.224  1.00 12.82 ? 54  GLU A CA  1 
ATOM   432  C  C   . GLU A 1 54  ? 26.280  28.741 7.588  1.00 12.10 ? 54  GLU A C   1 
ATOM   433  O  O   . GLU A 1 54  ? 26.804  28.050 8.464  1.00 10.68 ? 54  GLU A O   1 
ATOM   434  C  CB  . GLU A 1 54  ? 24.741  27.416 6.182  1.00 15.15 ? 54  GLU A CB  1 
ATOM   435  C  CG  . GLU A 1 54  ? 23.358  26.913 5.803  1.00 18.03 ? 54  GLU A CG  1 
ATOM   436  C  CD  . GLU A 1 54  ? 22.542  27.931 5.025  1.00 20.29 ? 54  GLU A CD  1 
ATOM   437  O  OE1 . GLU A 1 54  ? 23.140  28.681 4.219  1.00 15.13 ? 54  GLU A OE1 1 
ATOM   438  O  OE2 . GLU A 1 54  ? 21.301  27.953 5.197  1.00 20.92 ? 54  GLU A OE2 1 
ATOM   439  N  N   . GLU A 1 55  ? 26.946  29.664 6.901  1.00 11.53 ? 55  GLU A N   1 
ATOM   440  C  CA  . GLU A 1 55  ? 28.354  29.923 7.174  1.00 11.99 ? 55  GLU A CA  1 
ATOM   441  C  C   . GLU A 1 55  ? 28.487  30.927 8.311  1.00 12.02 ? 55  GLU A C   1 
ATOM   442  O  O   . GLU A 1 55  ? 29.429  30.864 9.097  1.00 13.01 ? 55  GLU A O   1 
ATOM   443  C  CB  . GLU A 1 55  ? 29.059  30.473 5.936  1.00 10.83 ? 55  GLU A CB  1 
ATOM   444  C  CG  . GLU A 1 55  ? 30.576  30.325 5.983  1.00 10.75 ? 55  GLU A CG  1 
ATOM   445  C  CD  . GLU A 1 55  ? 31.273  30.971 4.800  1.00 14.12 ? 55  GLU A CD  1 
ATOM   446  O  OE1 . GLU A 1 55  ? 30.671  31.023 3.700  1.00 12.69 ? 55  GLU A OE1 1 
ATOM   447  O  OE2 . GLU A 1 55  ? 32.435  31.403 4.966  1.00 13.21 ? 55  GLU A OE2 1 
ATOM   448  N  N   . LEU A 1 56  ? 27.540  31.853 8.397  1.00 11.34 ? 56  LEU A N   1 
ATOM   449  C  CA  . LEU A 1 56  ? 27.573  32.861 9.447  1.00 12.28 ? 56  LEU A CA  1 
ATOM   450  C  C   . LEU A 1 56  ? 27.558  32.239 10.842 1.00 11.80 ? 56  LEU A C   1 
ATOM   451  O  O   . LEU A 1 56  ? 28.378  32.577 11.695 1.00 11.90 ? 56  LEU A O   1 
ATOM   452  C  CB  . LEU A 1 56  ? 26.381  33.814 9.322  1.00 12.79 ? 56  LEU A CB  1 
ATOM   453  C  CG  . LEU A 1 56  ? 26.358  34.865 10.440 1.00 15.74 ? 56  LEU A CG  1 
ATOM   454  C  CD1 . LEU A 1 56  ? 27.542  35.799 10.254 1.00 17.11 ? 56  LEU A CD1 1 
ATOM   455  C  CD2 . LEU A 1 56  ? 25.067  35.649 10.420 1.00 16.42 ? 56  LEU A CD2 1 
ATOM   456  N  N   . ILE A 1 57  ? 26.626  31.325 11.071 1.00 10.51 ? 57  ILE A N   1 
ATOM   457  C  CA  . ILE A 1 57  ? 26.499  30.695 12.375 1.00 10.15 ? 57  ILE A CA  1 
ATOM   458  C  C   . ILE A 1 57  ? 27.715  29.883 12.811 1.00 12.09 ? 57  ILE A C   1 
ATOM   459  O  O   . ILE A 1 57  ? 27.766  29.395 13.939 1.00 11.60 ? 57  ILE A O   1 
ATOM   460  C  CB  . ILE A 1 57  ? 25.237  29.816 12.437 1.00 7.96  ? 57  ILE A CB  1 
ATOM   461  C  CG1 . ILE A 1 57  ? 25.320  28.686 11.411 1.00 6.22  ? 57  ILE A CG1 1 
ATOM   462  C  CG2 . ILE A 1 57  ? 24.011  30.681 12.163 1.00 7.12  ? 57  ILE A CG2 1 
ATOM   463  C  CD1 . ILE A 1 57  ? 24.119  27.758 11.448 1.00 6.73  ? 57  ILE A CD1 1 
ATOM   464  N  N   . THR A 1 58  ? 28.694  29.732 11.926 1.00 13.95 ? 58  THR A N   1 
ATOM   465  C  CA  . THR A 1 58  ? 29.904  28.996 12.285 1.00 15.09 ? 58  THR A CA  1 
ATOM   466  C  C   . THR A 1 58  ? 30.967  29.999 12.734 1.00 16.55 ? 58  THR A C   1 
ATOM   467  O  O   . THR A 1 58  ? 32.104  29.623 13.015 1.00 17.33 ? 58  THR A O   1 
ATOM   468  C  CB  . THR A 1 58  ? 30.491  28.213 11.096 1.00 13.83 ? 58  THR A CB  1 
ATOM   469  O  OG1 . THR A 1 58  ? 30.975  29.134 10.113 1.00 12.54 ? 58  THR A OG1 1 
ATOM   470  C  CG2 . THR A 1 58  ? 29.442  27.310 10.474 1.00 14.06 ? 58  THR A CG2 1 
ATOM   471  N  N   . LYS A 1 59  ? 30.592  31.273 12.806 1.00 17.67 ? 59  LYS A N   1 
ATOM   472  C  CA  . LYS A 1 59  ? 31.535  32.312 13.191 1.00 18.65 ? 59  LYS A CA  1 
ATOM   473  C  C   . LYS A 1 59  ? 30.957  33.312 14.183 1.00 19.95 ? 59  LYS A C   1 
ATOM   474  O  O   . LYS A 1 59  ? 31.328  34.487 14.180 1.00 19.94 ? 59  LYS A O   1 
ATOM   475  C  CB  . LYS A 1 59  ? 32.021  33.044 11.936 1.00 20.89 ? 59  LYS A CB  1 
ATOM   476  C  CG  . LYS A 1 59  ? 32.696  32.127 10.924 1.00 21.43 ? 59  LYS A CG  1 
ATOM   477  C  CD  . LYS A 1 59  ? 33.201  32.897 9.717  1.00 26.14 ? 59  LYS A CD  1 
ATOM   478  C  CE  . LYS A 1 59  ? 33.915  31.977 8.740  1.00 27.25 ? 59  LYS A CE  1 
ATOM   479  N  NZ  . LYS A 1 59  ? 34.403  32.708 7.535  1.00 32.55 ? 59  LYS A NZ  1 
ATOM   480  N  N   . LEU A 1 60  ? 30.062  32.840 15.044 1.00 19.65 ? 60  LEU A N   1 
ATOM   481  C  CA  . LEU A 1 60  ? 29.433  33.703 16.037 1.00 20.36 ? 60  LEU A CA  1 
ATOM   482  C  C   . LEU A 1 60  ? 30.427  34.332 17.018 1.00 22.39 ? 60  LEU A C   1 
ATOM   483  O  O   . LEU A 1 60  ? 30.167  35.403 17.563 1.00 21.82 ? 60  LEU A O   1 
ATOM   484  C  CB  . LEU A 1 60  ? 28.364  32.918 16.804 1.00 17.74 ? 60  LEU A CB  1 
ATOM   485  C  CG  . LEU A 1 60  ? 27.210  32.391 15.944 1.00 16.03 ? 60  LEU A CG  1 
ATOM   486  C  CD1 . LEU A 1 60  ? 26.283  31.538 16.785 1.00 14.89 ? 60  LEU A CD1 1 
ATOM   487  C  CD2 . LEU A 1 60  ? 26.456  33.561 15.330 1.00 14.08 ? 60  LEU A CD2 1 
ATOM   488  N  N   . ASP A 1 61  ? 31.564  33.677 17.242 1.00 24.68 ? 61  ASP A N   1 
ATOM   489  C  CA  . ASP A 1 61  ? 32.562  34.210 18.166 1.00 26.96 ? 61  ASP A CA  1 
ATOM   490  C  C   . ASP A 1 61  ? 33.399  35.345 17.575 1.00 26.20 ? 61  ASP A C   1 
ATOM   491  O  O   . ASP A 1 61  ? 34.112  36.033 18.302 1.00 26.31 ? 61  ASP A O   1 
ATOM   492  C  CB  . ASP A 1 61  ? 33.489  33.094 18.672 1.00 30.53 ? 61  ASP A CB  1 
ATOM   493  C  CG  . ASP A 1 61  ? 32.790  32.132 19.630 1.00 35.36 ? 61  ASP A CG  1 
ATOM   494  O  OD1 . ASP A 1 61  ? 32.254  32.592 20.664 1.00 36.30 ? 61  ASP A OD1 1 
ATOM   495  O  OD2 . ASP A 1 61  ? 32.784  30.911 19.357 1.00 39.72 ? 61  ASP A OD2 1 
ATOM   496  N  N   . GLN A 1 62  ? 33.312  35.545 16.263 1.00 25.55 ? 62  GLN A N   1 
ATOM   497  C  CA  . GLN A 1 62  ? 34.065  36.613 15.611 1.00 25.65 ? 62  GLN A CA  1 
ATOM   498  C  C   . GLN A 1 62  ? 33.240  37.894 15.528 1.00 24.77 ? 62  GLN A C   1 
ATOM   499  O  O   . GLN A 1 62  ? 33.731  38.934 15.091 1.00 24.60 ? 62  GLN A O   1 
ATOM   500  C  CB  . GLN A 1 62  ? 34.469  36.205 14.198 1.00 27.74 ? 62  GLN A CB  1 
ATOM   501  C  CG  . GLN A 1 62  ? 35.290  34.943 14.120 1.00 31.94 ? 62  GLN A CG  1 
ATOM   502  C  CD  . GLN A 1 62  ? 35.755  34.658 12.709 1.00 34.50 ? 62  GLN A CD  1 
ATOM   503  O  OE1 . GLN A 1 62  ? 36.372  33.627 12.444 1.00 37.64 ? 62  GLN A OE1 1 
ATOM   504  N  NE2 . GLN A 1 62  ? 35.469  35.578 11.793 1.00 34.99 ? 62  GLN A NE2 1 
ATOM   505  N  N   . LEU A 1 63  ? 31.981  37.809 15.937 1.00 23.29 ? 63  LEU A N   1 
ATOM   506  C  CA  . LEU A 1 63  ? 31.087  38.957 15.904 1.00 23.27 ? 63  LEU A CA  1 
ATOM   507  C  C   . LEU A 1 63  ? 31.291  39.867 17.102 1.00 24.80 ? 63  LEU A C   1 
ATOM   508  O  O   . LEU A 1 63  ? 31.791  39.441 18.146 1.00 25.60 ? 63  LEU A O   1 
ATOM   509  C  CB  . LEU A 1 63  ? 29.627  38.494 15.890 1.00 20.20 ? 63  LEU A CB  1 
ATOM   510  C  CG  . LEU A 1 63  ? 29.073  37.805 14.645 1.00 18.36 ? 63  LEU A CG  1 
ATOM   511  C  CD1 . LEU A 1 63  ? 27.684  37.256 14.933 1.00 17.72 ? 63  LEU A CD1 1 
ATOM   512  C  CD2 . LEU A 1 63  ? 29.033  38.796 13.501 1.00 17.43 ? 63  LEU A CD2 1 
ATOM   513  N  N   . PRO A 1 64  ? 30.922  41.148 16.961 1.00 24.57 ? 64  PRO A N   1 
ATOM   514  C  CA  . PRO A 1 64  ? 31.074  42.081 18.076 1.00 25.72 ? 64  PRO A CA  1 
ATOM   515  C  C   . PRO A 1 64  ? 30.214  41.547 19.222 1.00 25.57 ? 64  PRO A C   1 
ATOM   516  O  O   . PRO A 1 64  ? 29.159  40.957 18.988 1.00 25.35 ? 64  PRO A O   1 
ATOM   517  C  CB  . PRO A 1 64  ? 30.539  43.389 17.490 1.00 25.34 ? 64  PRO A CB  1 
ATOM   518  C  CG  . PRO A 1 64  ? 30.905  43.247 16.017 1.00 25.99 ? 64  PRO A CG  1 
ATOM   519  C  CD  . PRO A 1 64  ? 30.372  41.847 15.790 1.00 24.87 ? 64  PRO A CD  1 
ATOM   520  N  N   . ALA A 1 65  ? 30.674  41.746 20.451 1.00 25.79 ? 65  ALA A N   1 
ATOM   521  C  CA  . ALA A 1 65  ? 29.964  41.271 21.635 1.00 25.20 ? 65  ALA A CA  1 
ATOM   522  C  C   . ALA A 1 65  ? 28.457  41.522 21.613 1.00 24.54 ? 65  ALA A C   1 
ATOM   523  O  O   . ALA A 1 65  ? 27.663  40.620 21.882 1.00 23.52 ? 65  ALA A O   1 
ATOM   524  C  CB  . ALA A 1 65  ? 30.573  41.902 22.880 1.00 24.93 ? 65  ALA A CB  1 
ATOM   525  N  N   . ASP A 1 66  ? 28.069  42.750 21.291 1.00 23.63 ? 66  ASP A N   1 
ATOM   526  C  CA  . ASP A 1 66  ? 26.662  43.134 21.263 1.00 23.36 ? 66  ASP A CA  1 
ATOM   527  C  C   . ASP A 1 66  ? 25.874  42.583 20.069 1.00 21.82 ? 66  ASP A C   1 
ATOM   528  O  O   . ASP A 1 66  ? 24.691  42.883 19.916 1.00 21.61 ? 66  ASP A O   1 
ATOM   529  C  CB  . ASP A 1 66  ? 26.562  44.659 21.282 1.00 25.03 ? 66  ASP A CB  1 
ATOM   530  C  CG  . ASP A 1 66  ? 27.214  45.296 20.070 1.00 26.94 ? 66  ASP A CG  1 
ATOM   531  O  OD1 . ASP A 1 66  ? 28.389  44.983 19.784 1.00 28.79 ? 66  ASP A OD1 1 
ATOM   532  O  OD2 . ASP A 1 66  ? 26.556  46.117 19.405 1.00 30.81 ? 66  ASP A OD2 1 
ATOM   533  N  N   . LYS A 1 67  ? 26.525  41.781 19.233 1.00 20.53 ? 67  LYS A N   1 
ATOM   534  C  CA  . LYS A 1 67  ? 25.877  41.207 18.053 1.00 20.30 ? 67  LYS A CA  1 
ATOM   535  C  C   . LYS A 1 67  ? 25.714  39.693 18.132 1.00 20.18 ? 67  LYS A C   1 
ATOM   536  O  O   . LYS A 1 67  ? 24.889  39.112 17.423 1.00 19.48 ? 67  LYS A O   1 
ATOM   537  C  CB  . LYS A 1 67  ? 26.690  41.529 16.796 1.00 18.56 ? 67  LYS A CB  1 
ATOM   538  C  CG  . LYS A 1 67  ? 26.733  42.996 16.388 1.00 20.67 ? 67  LYS A CG  1 
ATOM   539  C  CD  . LYS A 1 67  ? 25.371  43.488 15.926 1.00 19.33 ? 67  LYS A CD  1 
ATOM   540  C  CE  . LYS A 1 67  ? 25.474  44.885 15.328 1.00 21.13 ? 67  LYS A CE  1 
ATOM   541  N  NZ  . LYS A 1 67  ? 24.161  45.375 14.823 1.00 20.47 ? 67  LYS A NZ  1 
ATOM   542  N  N   . LYS A 1 68  ? 26.504  39.064 18.996 1.00 19.49 ? 68  LYS A N   1 
ATOM   543  C  CA  . LYS A 1 68  ? 26.499  37.613 19.144 1.00 19.48 ? 68  LYS A CA  1 
ATOM   544  C  C   . LYS A 1 68  ? 25.163  36.959 19.483 1.00 18.23 ? 68  LYS A C   1 
ATOM   545  O  O   . LYS A 1 68  ? 24.735  36.033 18.798 1.00 18.73 ? 68  LYS A O   1 
ATOM   546  C  CB  . LYS A 1 68  ? 27.547  37.198 20.181 1.00 20.37 ? 68  LYS A CB  1 
ATOM   547  C  CG  . LYS A 1 68  ? 27.673  35.694 20.352 1.00 24.66 ? 68  LYS A CG  1 
ATOM   548  C  CD  . LYS A 1 68  ? 28.817  35.308 21.280 1.00 25.13 ? 68  LYS A CD  1 
ATOM   549  C  CE  . LYS A 1 68  ? 28.959  33.789 21.352 1.00 26.12 ? 68  LYS A CE  1 
ATOM   550  N  NZ  . LYS A 1 68  ? 30.122  33.345 22.167 1.00 25.28 ? 68  LYS A NZ  1 
ATOM   551  N  N   . THR A 1 69  ? 24.505  37.433 20.534 1.00 17.33 ? 69  THR A N   1 
ATOM   552  C  CA  . THR A 1 69  ? 23.232  36.856 20.961 1.00 15.11 ? 69  THR A CA  1 
ATOM   553  C  C   . THR A 1 69  ? 22.097  36.996 19.956 1.00 14.33 ? 69  THR A C   1 
ATOM   554  O  O   . THR A 1 69  ? 21.433  36.015 19.624 1.00 13.57 ? 69  THR A O   1 
ATOM   555  C  CB  . THR A 1 69  ? 22.758  37.471 22.291 1.00 15.28 ? 69  THR A CB  1 
ATOM   556  O  OG1 . THR A 1 69  ? 23.751  37.254 23.299 1.00 12.96 ? 69  THR A OG1 1 
ATOM   557  C  CG2 . THR A 1 69  ? 21.448  36.828 22.737 1.00 15.45 ? 69  THR A CG2 1 
ATOM   558  N  N   . VAL A 1 70  ? 21.873  38.213 19.477 1.00 14.53 ? 70  VAL A N   1 
ATOM   559  C  CA  . VAL A 1 70  ? 20.793  38.469 18.532 1.00 13.83 ? 70  VAL A CA  1 
ATOM   560  C  C   . VAL A 1 70  ? 20.941  37.670 17.235 1.00 12.37 ? 70  VAL A C   1 
ATOM   561  O  O   . VAL A 1 70  ? 19.949  37.215 16.667 1.00 13.00 ? 70  VAL A O   1 
ATOM   562  C  CB  . VAL A 1 70  ? 20.689  39.986 18.210 1.00 14.63 ? 70  VAL A CB  1 
ATOM   563  C  CG1 . VAL A 1 70  ? 21.933  40.455 17.470 1.00 13.77 ? 70  VAL A CG1 1 
ATOM   564  C  CG2 . VAL A 1 70  ? 19.423  40.268 17.411 1.00 14.86 ? 70  VAL A CG2 1 
ATOM   565  N  N   . LEU A 1 71  ? 22.176  37.487 16.775 1.00 11.78 ? 71  LEU A N   1 
ATOM   566  C  CA  . LEU A 1 71  ? 22.421  36.733 15.549 1.00 10.30 ? 71  LEU A CA  1 
ATOM   567  C  C   . LEU A 1 71  ? 22.421  35.232 15.805 1.00 10.89 ? 71  LEU A C   1 
ATOM   568  O  O   . LEU A 1 71  ? 21.986  34.455 14.960 1.00 10.87 ? 71  LEU A O   1 
ATOM   569  C  CB  . LEU A 1 71  ? 23.733  37.185 14.899 1.00 8.43  ? 71  LEU A CB  1 
ATOM   570  C  CG  . LEU A 1 71  ? 23.604  38.556 14.219 1.00 8.92  ? 71  LEU A CG  1 
ATOM   571  C  CD1 . LEU A 1 71  ? 24.942  39.041 13.684 1.00 6.57  ? 71  LEU A CD1 1 
ATOM   572  C  CD2 . LEU A 1 71  ? 22.594  38.437 13.081 1.00 8.08  ? 71  LEU A CD2 1 
ATOM   573  N  N   . ARG A 1 72  ? 22.901  34.824 16.975 1.00 10.26 ? 72  ARG A N   1 
ATOM   574  C  CA  . ARG A 1 72  ? 22.910  33.412 17.333 1.00 10.26 ? 72  ARG A CA  1 
ATOM   575  C  C   . ARG A 1 72  ? 21.475  32.895 17.288 1.00 10.31 ? 72  ARG A C   1 
ATOM   576  O  O   . ARG A 1 72  ? 21.199  31.827 16.726 1.00 8.83  ? 72  ARG A O   1 
ATOM   577  C  CB  . ARG A 1 72  ? 23.476  33.231 18.746 1.00 10.40 ? 72  ARG A CB  1 
ATOM   578  C  CG  . ARG A 1 72  ? 23.287  31.845 19.345 1.00 8.47  ? 72  ARG A CG  1 
ATOM   579  C  CD  . ARG A 1 72  ? 23.840  31.818 20.757 1.00 11.14 ? 72  ARG A CD  1 
ATOM   580  N  NE  . ARG A 1 72  ? 23.528  30.589 21.483 1.00 8.52  ? 72  ARG A NE  1 
ATOM   581  C  CZ  . ARG A 1 72  ? 23.976  30.330 22.706 1.00 9.03  ? 72  ARG A CZ  1 
ATOM   582  N  NH1 . ARG A 1 72  ? 24.751  31.217 23.321 1.00 8.83  ? 72  ARG A NH1 1 
ATOM   583  N  NH2 . ARG A 1 72  ? 23.654  29.195 23.314 1.00 5.94  ? 72  ARG A NH2 1 
ATOM   584  N  N   . ASN A 1 73  ? 20.566  33.672 17.875 1.00 8.70  ? 73  ASN A N   1 
ATOM   585  C  CA  . ASN A 1 73  ? 19.154  33.311 17.926 1.00 9.14  ? 73  ASN A CA  1 
ATOM   586  C  C   . ASN A 1 73  ? 18.426  33.408 16.595 1.00 8.86  ? 73  ASN A C   1 
ATOM   587  O  O   . ASN A 1 73  ? 17.667  32.516 16.231 1.00 10.13 ? 73  ASN A O   1 
ATOM   588  C  CB  . ASN A 1 73  ? 18.397  34.189 18.928 1.00 9.72  ? 73  ASN A CB  1 
ATOM   589  C  CG  . ASN A 1 73  ? 18.885  34.020 20.353 1.00 10.88 ? 73  ASN A CG  1 
ATOM   590  O  OD1 . ASN A 1 73  ? 19.172  32.910 20.796 1.00 8.94  ? 73  ASN A OD1 1 
ATOM   591  N  ND2 . ASN A 1 73  ? 18.942  35.123 21.092 1.00 12.08 ? 73  ASN A ND2 1 
ATOM   592  N  N   . ASN A 1 74  ? 18.652  34.500 15.875 1.00 9.22  ? 74  ASN A N   1 
ATOM   593  C  CA  . ASN A 1 74  ? 17.970  34.731 14.613 1.00 9.71  ? 74  ASN A CA  1 
ATOM   594  C  C   . ASN A 1 74  ? 18.622  34.135 13.372 1.00 8.49  ? 74  ASN A C   1 
ATOM   595  O  O   . ASN A 1 74  ? 17.918  33.702 12.467 1.00 9.47  ? 74  ASN A O   1 
ATOM   596  C  CB  . ASN A 1 74  ? 17.728  36.230 14.451 1.00 9.91  ? 74  ASN A CB  1 
ATOM   597  C  CG  . ASN A 1 74  ? 16.769  36.764 15.496 1.00 11.46 ? 74  ASN A CG  1 
ATOM   598  O  OD1 . ASN A 1 74  ? 15.579  36.450 15.473 1.00 10.63 ? 74  ASN A OD1 1 
ATOM   599  N  ND2 . ASN A 1 74  ? 17.285  37.551 16.436 1.00 9.27  ? 74  ASN A ND2 1 
ATOM   600  N  N   . ALA A 1 75  ? 19.951  34.119 13.315 1.00 7.54  ? 75  ALA A N   1 
ATOM   601  C  CA  . ALA A 1 75  ? 20.637  33.515 12.176 1.00 7.64  ? 75  ALA A CA  1 
ATOM   602  C  C   . ALA A 1 75  ? 20.456  32.009 12.359 1.00 7.19  ? 75  ALA A C   1 
ATOM   603  O  O   . ALA A 1 75  ? 20.242  31.272 11.401 1.00 8.10  ? 75  ALA A O   1 
ATOM   604  C  CB  . ALA A 1 75  ? 22.117  33.875 12.182 1.00 5.32  ? 75  ALA A CB  1 
ATOM   605  N  N   . GLY A 1 76  ? 20.539  31.565 13.609 1.00 6.81  ? 76  GLY A N   1 
ATOM   606  C  CA  . GLY A 1 76  ? 20.347  30.160 13.901 1.00 7.14  ? 76  GLY A CA  1 
ATOM   607  C  C   . GLY A 1 76  ? 18.939  29.787 13.493 1.00 7.19  ? 76  GLY A C   1 
ATOM   608  O  O   . GLY A 1 76  ? 18.719  28.762 12.851 1.00 4.71  ? 76  GLY A O   1 
ATOM   609  N  N   . GLY A 1 77  ? 17.982  30.641 13.855 1.00 8.01  ? 77  GLY A N   1 
ATOM   610  C  CA  . GLY A 1 77  ? 16.591  30.392 13.510 1.00 6.98  ? 77  GLY A CA  1 
ATOM   611  C  C   . GLY A 1 77  ? 16.351  30.337 12.010 1.00 7.39  ? 77  GLY A C   1 
ATOM   612  O  O   . GLY A 1 77  ? 15.556  29.528 11.523 1.00 3.62  ? 77  GLY A O   1 
ATOM   613  N  N   . HIS A 1 78  ? 17.032  31.203 11.268 1.00 7.37  ? 78  HIS A N   1 
ATOM   614  C  CA  . HIS A 1 78  ? 16.879  31.230 9.820  1.00 7.87  ? 78  HIS A CA  1 
ATOM   615  C  C   . HIS A 1 78  ? 17.495  29.982 9.193  1.00 8.29  ? 78  HIS A C   1 
ATOM   616  O  O   . HIS A 1 78  ? 16.887  29.338 8.333  1.00 7.43  ? 78  HIS A O   1 
ATOM   617  C  CB  . HIS A 1 78  ? 17.516  32.507 9.254  1.00 8.94  ? 78  HIS A CB  1 
ATOM   618  C  CG  . HIS A 1 78  ? 17.504  32.586 7.758  1.00 8.61  ? 78  HIS A CG  1 
ATOM   619  N  ND1 . HIS A 1 78  ? 16.438  32.157 6.997  1.00 8.95  ? 78  HIS A ND1 1 
ATOM   620  C  CD2 . HIS A 1 78  ? 18.408  33.093 6.887  1.00 9.28  ? 78  HIS A CD2 1 
ATOM   621  C  CE1 . HIS A 1 78  ? 16.686  32.393 5.720  1.00 8.87  ? 78  HIS A CE1 1 
ATOM   622  N  NE2 . HIS A 1 78  ? 17.876  32.961 5.626  1.00 11.10 ? 78  HIS A NE2 1 
ATOM   623  N  N   . ALA A 1 79  ? 18.694  29.625 9.643  1.00 8.29  ? 79  ALA A N   1 
ATOM   624  C  CA  . ALA A 1 79  ? 19.374  28.456 9.112  1.00 7.45  ? 79  ALA A CA  1 
ATOM   625  C  C   . ALA A 1 79  ? 18.646  27.160 9.457  1.00 7.04  ? 79  ALA A C   1 
ATOM   626  O  O   . ALA A 1 79  ? 18.526  26.275 8.607  1.00 5.51  ? 79  ALA A O   1 
ATOM   627  C  CB  . ALA A 1 79  ? 20.812  28.404 9.622  1.00 6.73  ? 79  ALA A CB  1 
ATOM   628  N  N   . ASN A 1 80  ? 18.162  27.042 10.693 1.00 4.77  ? 80  ASN A N   1 
ATOM   629  C  CA  . ASN A 1 80  ? 17.468  25.823 11.092 1.00 5.88  ? 80  ASN A CA  1 
ATOM   630  C  C   . ASN A 1 80  ? 16.179  25.603 10.306 1.00 6.89  ? 80  ASN A C   1 
ATOM   631  O  O   . ASN A 1 80  ? 15.952  24.517 9.771  1.00 8.46  ? 80  ASN A O   1 
ATOM   632  C  CB  . ASN A 1 80  ? 17.149  25.812 12.594 1.00 5.45  ? 80  ASN A CB  1 
ATOM   633  C  CG  . ASN A 1 80  ? 18.394  25.881 13.466 1.00 6.76  ? 80  ASN A CG  1 
ATOM   634  O  OD1 . ASN A 1 80  ? 19.452  25.359 13.109 1.00 5.46  ? 80  ASN A OD1 1 
ATOM   635  N  ND2 . ASN A 1 80  ? 18.260  26.498 14.636 1.00 6.71  ? 80  ASN A ND2 1 
ATOM   636  N  N   . HIS A 1 81  ? 15.332  26.623 10.226 1.00 5.42  ? 81  HIS A N   1 
ATOM   637  C  CA  . HIS A 1 81  ? 14.085  26.471 9.497  1.00 5.92  ? 81  HIS A CA  1 
ATOM   638  C  C   . HIS A 1 81  ? 14.264  26.280 7.995  1.00 6.27  ? 81  HIS A C   1 
ATOM   639  O  O   . HIS A 1 81  ? 13.457  25.596 7.366  1.00 6.04  ? 81  HIS A O   1 
ATOM   640  C  CB  . HIS A 1 81  ? 13.140  27.646 9.784  1.00 5.20  ? 81  HIS A CB  1 
ATOM   641  C  CG  . HIS A 1 81  ? 12.628  27.666 11.189 1.00 5.68  ? 81  HIS A CG  1 
ATOM   642  N  ND1 . HIS A 1 81  ? 13.396  28.077 12.257 1.00 7.61  ? 81  HIS A ND1 1 
ATOM   643  C  CD2 . HIS A 1 81  ? 11.461  27.223 11.716 1.00 5.30  ? 81  HIS A CD2 1 
ATOM   644  C  CE1 . HIS A 1 81  ? 12.726  27.886 13.379 1.00 8.85  ? 81  HIS A CE1 1 
ATOM   645  N  NE2 . HIS A 1 81  ? 11.550  27.368 13.079 1.00 6.71  ? 81  HIS A NE2 1 
ATOM   646  N  N   . SER A 1 82  ? 15.311  26.865 7.415  1.00 3.96  ? 82  SER A N   1 
ATOM   647  C  CA  . SER A 1 82  ? 15.544  26.697 5.983  1.00 3.34  ? 82  SER A CA  1 
ATOM   648  C  C   . SER A 1 82  ? 15.836  25.223 5.721  1.00 3.92  ? 82  SER A C   1 
ATOM   649  O  O   . SER A 1 82  ? 15.372  24.648 4.735  1.00 4.17  ? 82  SER A O   1 
ATOM   650  C  CB  . SER A 1 82  ? 16.730  27.551 5.507  1.00 3.16  ? 82  SER A CB  1 
ATOM   651  O  OG  . SER A 1 82  ? 16.456  28.938 5.631  1.00 2.86  ? 82  SER A OG  1 
ATOM   652  N  N   . LEU A 1 83  ? 16.612  24.616 6.609  1.00 2.36  ? 83  LEU A N   1 
ATOM   653  C  CA  . LEU A 1 83  ? 16.950  23.207 6.476  1.00 4.11  ? 83  LEU A CA  1 
ATOM   654  C  C   . LEU A 1 83  ? 15.716  22.356 6.758  1.00 4.53  ? 83  LEU A C   1 
ATOM   655  O  O   . LEU A 1 83  ? 15.464  21.356 6.080  1.00 4.04  ? 83  LEU A O   1 
ATOM   656  C  CB  . LEU A 1 83  ? 18.084  22.850 7.445  1.00 4.69  ? 83  LEU A CB  1 
ATOM   657  C  CG  . LEU A 1 83  ? 18.587  21.409 7.580  1.00 6.61  ? 83  LEU A CG  1 
ATOM   658  C  CD1 . LEU A 1 83  ? 19.893  21.412 8.356  1.00 8.29  ? 83  LEU A CD1 1 
ATOM   659  C  CD2 . LEU A 1 83  ? 17.549  20.543 8.290  1.00 7.62  ? 83  LEU A CD2 1 
ATOM   660  N  N   . PHE A 1 84  ? 14.932  22.776 7.745  1.00 4.31  ? 84  PHE A N   1 
ATOM   661  C  CA  . PHE A 1 84  ? 13.734  22.042 8.137  1.00 5.99  ? 84  PHE A CA  1 
ATOM   662  C  C   . PHE A 1 84  ? 12.727  21.880 6.999  1.00 7.04  ? 84  PHE A C   1 
ATOM   663  O  O   . PHE A 1 84  ? 12.217  20.785 6.776  1.00 7.87  ? 84  PHE A O   1 
ATOM   664  C  CB  . PHE A 1 84  ? 13.076  22.742 9.332  1.00 7.58  ? 84  PHE A CB  1 
ATOM   665  C  CG  . PHE A 1 84  ? 11.979  21.945 9.986  1.00 7.59  ? 84  PHE A CG  1 
ATOM   666  C  CD1 . PHE A 1 84  ? 12.219  20.653 10.444 1.00 7.89  ? 84  PHE A CD1 1 
ATOM   667  C  CD2 . PHE A 1 84  ? 10.722  22.503 10.189 1.00 5.58  ? 84  PHE A CD2 1 
ATOM   668  C  CE1 . PHE A 1 84  ? 11.225  19.931 11.094 1.00 9.99  ? 84  PHE A CE1 1 
ATOM   669  C  CE2 . PHE A 1 84  ? 9.721   21.793 10.838 1.00 7.06  ? 84  PHE A CE2 1 
ATOM   670  C  CZ  . PHE A 1 84  ? 9.969   20.504 11.293 1.00 7.53  ? 84  PHE A CZ  1 
ATOM   671  N  N   . TRP A 1 85  ? 12.452  22.965 6.278  1.00 6.92  ? 85  TRP A N   1 
ATOM   672  C  CA  . TRP A 1 85  ? 11.497  22.946 5.173  1.00 6.61  ? 85  TRP A CA  1 
ATOM   673  C  C   . TRP A 1 85  ? 11.885  21.916 4.110  1.00 8.09  ? 85  TRP A C   1 
ATOM   674  O  O   . TRP A 1 85  ? 11.051  21.130 3.653  1.00 7.63  ? 85  TRP A O   1 
ATOM   675  C  CB  . TRP A 1 85  ? 11.415  24.334 4.536  1.00 4.96  ? 85  TRP A CB  1 
ATOM   676  C  CG  . TRP A 1 85  ? 11.039  25.443 5.486  1.00 6.60  ? 85  TRP A CG  1 
ATOM   677  C  CD1 . TRP A 1 85  ? 11.542  26.717 5.495  1.00 4.74  ? 85  TRP A CD1 1 
ATOM   678  C  CD2 . TRP A 1 85  ? 10.064  25.393 6.539  1.00 7.45  ? 85  TRP A CD2 1 
ATOM   679  N  NE1 . TRP A 1 85  ? 10.947  27.455 6.486  1.00 7.23  ? 85  TRP A NE1 1 
ATOM   680  C  CE2 . TRP A 1 85  ? 10.036  26.671 7.142  1.00 6.05  ? 85  TRP A CE2 1 
ATOM   681  C  CE3 . TRP A 1 85  ? 9.212   24.393 7.032  1.00 7.86  ? 85  TRP A CE3 1 
ATOM   682  C  CZ2 . TRP A 1 85  ? 9.191   26.976 8.211  1.00 8.28  ? 85  TRP A CZ2 1 
ATOM   683  C  CZ3 . TRP A 1 85  ? 8.372   24.697 8.095  1.00 9.72  ? 85  TRP A CZ3 1 
ATOM   684  C  CH2 . TRP A 1 85  ? 8.369   25.979 8.673  1.00 10.35 ? 85  TRP A CH2 1 
ATOM   685  N  N   . LYS A 1 86  ? 13.152  21.935 3.713  1.00 6.96  ? 86  LYS A N   1 
ATOM   686  C  CA  . LYS A 1 86  ? 13.662  21.006 2.711  1.00 8.39  ? 86  LYS A CA  1 
ATOM   687  C  C   . LYS A 1 86  ? 13.738  19.586 3.261  1.00 7.73  ? 86  LYS A C   1 
ATOM   688  O  O   . LYS A 1 86  ? 13.797  18.620 2.500  1.00 7.09  ? 86  LYS A O   1 
ATOM   689  C  CB  . LYS A 1 86  ? 15.054  21.453 2.243  1.00 9.30  ? 86  LYS A CB  1 
ATOM   690  C  CG  . LYS A 1 86  ? 15.046  22.783 1.504  1.00 13.12 ? 86  LYS A CG  1 
ATOM   691  C  CD  . LYS A 1 86  ? 16.441  23.266 1.131  1.00 14.57 ? 86  LYS A CD  1 
ATOM   692  C  CE  . LYS A 1 86  ? 17.285  23.565 2.365  1.00 17.52 ? 86  LYS A CE  1 
ATOM   693  N  NZ  . LYS A 1 86  ? 18.613  24.131 1.992  1.00 17.83 ? 86  LYS A NZ  1 
ATOM   694  N  N   . GLY A 1 87  ? 13.733  19.471 4.586  1.00 8.34  ? 87  GLY A N   1 
ATOM   695  C  CA  . GLY A 1 87  ? 13.816  18.170 5.224  1.00 7.17  ? 87  GLY A CA  1 
ATOM   696  C  C   . GLY A 1 87  ? 12.477  17.503 5.469  1.00 7.77  ? 87  GLY A C   1 
ATOM   697  O  O   . GLY A 1 87  ? 12.399  16.544 6.232  1.00 7.94  ? 87  GLY A O   1 
ATOM   698  N  N   . LEU A 1 88  ? 11.426  17.999 4.821  1.00 7.48  ? 88  LEU A N   1 
ATOM   699  C  CA  . LEU A 1 88  ? 10.087  17.430 4.974  1.00 7.66  ? 88  LEU A CA  1 
ATOM   700  C  C   . LEU A 1 88  ? 9.469   17.093 3.610  1.00 7.53  ? 88  LEU A C   1 
ATOM   701  O  O   . LEU A 1 88  ? 9.551   17.886 2.668  1.00 6.00  ? 88  LEU A O   1 
ATOM   702  C  CB  . LEU A 1 88  ? 9.173   18.409 5.725  1.00 6.45  ? 88  LEU A CB  1 
ATOM   703  C  CG  . LEU A 1 88  ? 9.564   18.839 7.150  1.00 7.29  ? 88  LEU A CG  1 
ATOM   704  C  CD1 . LEU A 1 88  ? 8.622   19.931 7.632  1.00 6.86  ? 88  LEU A CD1 1 
ATOM   705  C  CD2 . LEU A 1 88  ? 9.528   17.647 8.092  1.00 6.35  ? 88  LEU A CD2 1 
ATOM   706  N  N   . LYS A 1 89  ? 8.869   15.907 3.517  1.00 7.26  ? 89  LYS A N   1 
ATOM   707  C  CA  . LYS A 1 89  ? 8.212   15.429 2.295  1.00 8.01  ? 89  LYS A CA  1 
ATOM   708  C  C   . LYS A 1 89  ? 7.596   14.054 2.546  1.00 8.42  ? 89  LYS A C   1 
ATOM   709  O  O   . LYS A 1 89  ? 8.173   13.226 3.253  1.00 8.52  ? 89  LYS A O   1 
ATOM   710  C  CB  . LYS A 1 89  ? 9.202   15.320 1.125  1.00 7.07  ? 89  LYS A CB  1 
ATOM   711  C  CG  . LYS A 1 89  ? 8.509   15.022 -0.216 1.00 11.72 ? 89  LYS A CG  1 
ATOM   712  C  CD  . LYS A 1 89  ? 9.475   14.932 -1.402 1.00 13.64 ? 89  LYS A CD  1 
ATOM   713  C  CE  . LYS A 1 89  ? 10.392  13.720 -1.302 1.00 14.84 ? 89  LYS A CE  1 
ATOM   714  N  NZ  . LYS A 1 89  ? 11.314  13.607 -2.473 1.00 19.01 ? 89  LYS A NZ  1 
ATOM   715  N  N   . LYS A 1 90  ? 6.423   13.814 1.970  1.00 8.53  ? 90  LYS A N   1 
ATOM   716  C  CA  . LYS A 1 90  ? 5.745   12.532 2.134  1.00 9.37  ? 90  LYS A CA  1 
ATOM   717  C  C   . LYS A 1 90  ? 6.208   11.536 1.076  1.00 9.42  ? 90  LYS A C   1 
ATOM   718  O  O   . LYS A 1 90  ? 6.767   11.924 0.050  1.00 8.32  ? 90  LYS A O   1 
ATOM   719  C  CB  . LYS A 1 90  ? 4.230   12.711 2.014  1.00 8.23  ? 90  LYS A CB  1 
ATOM   720  C  CG  . LYS A 1 90  ? 3.602   13.559 3.102  1.00 9.63  ? 90  LYS A CG  1 
ATOM   721  C  CD  . LYS A 1 90  ? 2.111   13.781 2.839  1.00 8.68  ? 90  LYS A CD  1 
ATOM   722  C  CE  . LYS A 1 90  ? 1.326   12.481 2.840  1.00 7.02  ? 90  LYS A CE  1 
ATOM   723  N  NZ  . LYS A 1 90  ? -0.094  12.677 2.457  1.00 5.76  ? 90  LYS A NZ  1 
ATOM   724  N  N   . GLY A 1 91  ? 5.987   10.252 1.346  1.00 8.48  ? 91  GLY A N   1 
ATOM   725  C  CA  . GLY A 1 91  ? 6.335   9.210  0.394  1.00 8.98  ? 91  GLY A CA  1 
ATOM   726  C  C   . GLY A 1 91  ? 7.776   8.760  0.234  1.00 8.92  ? 91  GLY A C   1 
ATOM   727  O  O   . GLY A 1 91  ? 8.068   7.993  -0.679 1.00 10.09 ? 91  GLY A O   1 
ATOM   728  N  N   . THR A 1 92  ? 8.678   9.204  1.101  1.00 9.57  ? 92  THR A N   1 
ATOM   729  C  CA  . THR A 1 92  ? 10.077  8.794  0.987  1.00 9.22  ? 92  THR A CA  1 
ATOM   730  C  C   . THR A 1 92  ? 10.337  7.506  1.759  1.00 9.55  ? 92  THR A C   1 
ATOM   731  O  O   . THR A 1 92  ? 9.560   7.117  2.629  1.00 9.05  ? 92  THR A O   1 
ATOM   732  C  CB  . THR A 1 92  ? 11.034  9.874  1.524  1.00 7.01  ? 92  THR A CB  1 
ATOM   733  O  OG1 . THR A 1 92  ? 10.861  10.003 2.938  1.00 5.03  ? 92  THR A OG1 1 
ATOM   734  C  CG2 . THR A 1 92  ? 10.735  11.215 0.872  1.00 4.66  ? 92  THR A CG2 1 
ATOM   735  N  N   . THR A 1 93  ? 11.439  6.847  1.429  1.00 9.79  ? 93  THR A N   1 
ATOM   736  C  CA  . THR A 1 93  ? 11.824  5.607  2.082  1.00 9.39  ? 93  THR A CA  1 
ATOM   737  C  C   . THR A 1 93  ? 13.307  5.665  2.411  1.00 9.21  ? 93  THR A C   1 
ATOM   738  O  O   . THR A 1 93  ? 14.121  5.995  1.551  1.00 10.16 ? 93  THR A O   1 
ATOM   739  C  CB  . THR A 1 93  ? 11.543  4.387  1.160  1.00 10.34 ? 93  THR A CB  1 
ATOM   740  O  OG1 . THR A 1 93  ? 10.128  4.252  0.970  1.00 10.28 ? 93  THR A OG1 1 
ATOM   741  C  CG2 . THR A 1 93  ? 12.093  3.107  1.760  1.00 7.64  ? 93  THR A CG2 1 
ATOM   742  N  N   . LEU A 1 94  ? 13.650  5.378  3.663  1.00 8.81  ? 94  LEU A N   1 
ATOM   743  C  CA  . LEU A 1 94  ? 15.048  5.368  4.085  1.00 8.86  ? 94  LEU A CA  1 
ATOM   744  C  C   . LEU A 1 94  ? 15.698  4.222  3.319  1.00 8.45  ? 94  LEU A C   1 
ATOM   745  O  O   . LEU A 1 94  ? 15.185  3.106  3.328  1.00 7.12  ? 94  LEU A O   1 
ATOM   746  C  CB  . LEU A 1 94  ? 15.154  5.119  5.596  1.00 7.12  ? 94  LEU A CB  1 
ATOM   747  C  CG  . LEU A 1 94  ? 16.572  4.920  6.150  1.00 6.81  ? 94  LEU A CG  1 
ATOM   748  C  CD1 . LEU A 1 94  ? 17.433  6.138  5.861  1.00 3.56  ? 94  LEU A CD1 1 
ATOM   749  C  CD2 . LEU A 1 94  ? 16.499  4.659  7.650  1.00 6.16  ? 94  LEU A CD2 1 
ATOM   750  N  N   . GLN A 1 95  ? 16.823  4.485  2.665  1.00 8.77  ? 95  GLN A N   1 
ATOM   751  C  CA  . GLN A 1 95  ? 17.474  3.447  1.872  1.00 10.48 ? 95  GLN A CA  1 
ATOM   752  C  C   . GLN A 1 95  ? 18.929  3.761  1.531  1.00 9.75  ? 95  GLN A C   1 
ATOM   753  O  O   . GLN A 1 95  ? 19.485  4.760  1.981  1.00 7.65  ? 95  GLN A O   1 
ATOM   754  C  CB  . GLN A 1 95  ? 16.689  3.272  0.574  1.00 12.14 ? 95  GLN A CB  1 
ATOM   755  C  CG  . GLN A 1 95  ? 16.558  4.586  -0.200 1.00 12.40 ? 95  GLN A CG  1 
ATOM   756  C  CD  . GLN A 1 95  ? 15.679  4.468  -1.431 1.00 14.56 ? 95  GLN A CD  1 
ATOM   757  O  OE1 . GLN A 1 95  ? 15.978  3.710  -2.353 1.00 13.77 ? 95  GLN A OE1 1 
ATOM   758  N  NE2 . GLN A 1 95  ? 14.585  5.218  -1.448 1.00 11.01 ? 95  GLN A NE2 1 
ATOM   759  N  N   . GLY A 1 96  ? 19.534  2.890  0.727  1.00 7.11  ? 96  GLY A N   1 
ATOM   760  C  CA  . GLY A 1 96  ? 20.908  3.090  0.298  1.00 8.06  ? 96  GLY A CA  1 
ATOM   761  C  C   . GLY A 1 96  ? 21.973  3.277  1.364  1.00 7.36  ? 96  GLY A C   1 
ATOM   762  O  O   . GLY A 1 96  ? 21.938  2.638  2.418  1.00 4.37  ? 96  GLY A O   1 
ATOM   763  N  N   . ASP A 1 97  ? 22.926  4.165  1.082  1.00 7.23  ? 97  ASP A N   1 
ATOM   764  C  CA  . ASP A 1 97  ? 24.030  4.425  1.996  1.00 7.80  ? 97  ASP A CA  1 
ATOM   765  C  C   . ASP A 1 97  ? 23.634  5.028  3.336  1.00 7.68  ? 97  ASP A C   1 
ATOM   766  O  O   . ASP A 1 97  ? 24.266  4.745  4.352  1.00 8.12  ? 97  ASP A O   1 
ATOM   767  C  CB  . ASP A 1 97  ? 25.076  5.322  1.328  1.00 10.79 ? 97  ASP A CB  1 
ATOM   768  C  CG  . ASP A 1 97  ? 25.684  4.689  0.089  1.00 12.00 ? 97  ASP A CG  1 
ATOM   769  O  OD1 . ASP A 1 97  ? 26.068  3.504  0.155  1.00 13.38 ? 97  ASP A OD1 1 
ATOM   770  O  OD2 . ASP A 1 97  ? 25.795  5.377  -0.943 1.00 12.50 ? 97  ASP A OD2 1 
ATOM   771  N  N   . LEU A 1 98  ? 22.598  5.857  3.353  1.00 6.90  ? 98  LEU A N   1 
ATOM   772  C  CA  . LEU A 1 98  ? 22.185  6.464  4.606  1.00 9.06  ? 98  LEU A CA  1 
ATOM   773  C  C   . LEU A 1 98  ? 21.589  5.403  5.525  1.00 9.67  ? 98  LEU A C   1 
ATOM   774  O  O   . LEU A 1 98  ? 21.828  5.417  6.729  1.00 10.06 ? 98  LEU A O   1 
ATOM   775  C  CB  . LEU A 1 98  ? 21.175  7.593  4.362  1.00 6.37  ? 98  LEU A CB  1 
ATOM   776  C  CG  . LEU A 1 98  ? 20.666  8.306  5.622  1.00 6.83  ? 98  LEU A CG  1 
ATOM   777  C  CD1 . LEU A 1 98  ? 21.840  8.783  6.477  1.00 5.76  ? 98  LEU A CD1 1 
ATOM   778  C  CD2 . LEU A 1 98  ? 19.774  9.480  5.223  1.00 4.60  ? 98  LEU A CD2 1 
ATOM   779  N  N   . LYS A 1 99  ? 20.824  4.478  4.954  1.00 9.26  ? 99  LYS A N   1 
ATOM   780  C  CA  . LYS A 1 99  ? 20.220  3.417  5.746  1.00 10.23 ? 99  LYS A CA  1 
ATOM   781  C  C   . LYS A 1 99  ? 21.320  2.543  6.344  1.00 11.25 ? 99  LYS A C   1 
ATOM   782  O  O   . LYS A 1 99  ? 21.306  2.245  7.539  1.00 10.56 ? 99  LYS A O   1 
ATOM   783  C  CB  . LYS A 1 99  ? 19.285  2.569  4.873  1.00 9.36  ? 99  LYS A CB  1 
ATOM   784  C  CG  . LYS A 1 99  ? 18.523  1.480  5.629  1.00 12.30 ? 99  LYS A CG  1 
ATOM   785  C  CD  . LYS A 1 99  ? 17.447  0.851  4.747  1.00 13.21 ? 99  LYS A CD  1 
ATOM   786  C  CE  . LYS A 1 99  ? 16.642  -0.230 5.475  1.00 14.63 ? 99  LYS A CE  1 
ATOM   787  N  NZ  . LYS A 1 99  ? 17.444  -1.441 5.800  1.00 17.76 ? 99  LYS A NZ  1 
ATOM   788  N  N   . ALA A 1 100 ? 22.281  2.152  5.507  1.00 10.85 ? 100 ALA A N   1 
ATOM   789  C  CA  . ALA A 1 100 ? 23.389  1.307  5.946  1.00 11.62 ? 100 ALA A CA  1 
ATOM   790  C  C   . ALA A 1 100 ? 24.232  1.996  7.011  1.00 11.09 ? 100 ALA A C   1 
ATOM   791  O  O   . ALA A 1 100 ? 24.649  1.368  7.980  1.00 11.98 ? 100 ALA A O   1 
ATOM   792  C  CB  . ALA A 1 100 ? 24.263  0.925  4.752  1.00 8.83  ? 100 ALA A CB  1 
ATOM   793  N  N   . ALA A 1 101 ? 24.478  3.291  6.828  1.00 11.43 ? 101 ALA A N   1 
ATOM   794  C  CA  . ALA A 1 101 ? 25.270  4.061  7.779  1.00 10.25 ? 101 ALA A CA  1 
ATOM   795  C  C   . ALA A 1 101 ? 24.595  4.104  9.152  1.00 11.56 ? 101 ALA A C   1 
ATOM   796  O  O   . ALA A 1 101 ? 25.253  3.987  10.190 1.00 11.36 ? 101 ALA A O   1 
ATOM   797  C  CB  . ALA A 1 101 ? 25.480  5.471  7.254  1.00 11.48 ? 101 ALA A CB  1 
ATOM   798  N  N   . ILE A 1 102 ? 23.278  4.274  9.153  1.00 11.04 ? 102 ILE A N   1 
ATOM   799  C  CA  . ILE A 1 102 ? 22.521  4.330  10.396 1.00 10.18 ? 102 ILE A CA  1 
ATOM   800  C  C   . ILE A 1 102 ? 22.594  2.990  11.119 1.00 10.33 ? 102 ILE A C   1 
ATOM   801  O  O   . ILE A 1 102 ? 22.807  2.937  12.331 1.00 10.17 ? 102 ILE A O   1 
ATOM   802  C  CB  . ILE A 1 102 ? 21.042  4.716  10.122 1.00 9.27  ? 102 ILE A CB  1 
ATOM   803  C  CG1 . ILE A 1 102 ? 20.974  6.193  9.714  1.00 8.11  ? 102 ILE A CG1 1 
ATOM   804  C  CG2 . ILE A 1 102 ? 20.172  4.426  11.345 1.00 8.68  ? 102 ILE A CG2 1 
ATOM   805  C  CD1 . ILE A 1 102 ? 19.575  6.703  9.418  1.00 5.01  ? 102 ILE A CD1 1 
ATOM   806  N  N   . GLU A 1 103 ? 22.426  1.909  10.369 1.00 10.00 ? 103 GLU A N   1 
ATOM   807  C  CA  . GLU A 1 103 ? 22.483  0.577  10.948 1.00 11.46 ? 103 GLU A CA  1 
ATOM   808  C  C   . GLU A 1 103 ? 23.888  0.318  11.484 1.00 10.69 ? 103 GLU A C   1 
ATOM   809  O  O   . GLU A 1 103 ? 24.067  -0.368 12.485 1.00 10.11 ? 103 GLU A O   1 
ATOM   810  C  CB  . GLU A 1 103 ? 22.104  -0.465 9.891  1.00 11.00 ? 103 GLU A CB  1 
ATOM   811  C  CG  . GLU A 1 103 ? 20.766  -0.157 9.242  1.00 12.29 ? 103 GLU A CG  1 
ATOM   812  C  CD  . GLU A 1 103 ? 20.329  -1.190 8.230  1.00 12.61 ? 103 GLU A CD  1 
ATOM   813  O  OE1 . GLU A 1 103 ? 21.103  -1.495 7.300  1.00 13.05 ? 103 GLU A OE1 1 
ATOM   814  O  OE2 . GLU A 1 103 ? 19.194  -1.685 8.359  1.00 16.23 ? 103 GLU A OE2 1 
ATOM   815  N  N   . ARG A 1 104 ? 24.883  0.890  10.819 1.00 12.17 ? 104 ARG A N   1 
ATOM   816  C  CA  . ARG A 1 104 ? 26.272  0.723  11.226 1.00 11.90 ? 104 ARG A CA  1 
ATOM   817  C  C   . ARG A 1 104 ? 26.613  1.482  12.506 1.00 13.12 ? 104 ARG A C   1 
ATOM   818  O  O   . ARG A 1 104 ? 27.287  0.949  13.390 1.00 11.97 ? 104 ARG A O   1 
ATOM   819  C  CB  . ARG A 1 104 ? 27.197  1.206  10.111 1.00 14.16 ? 104 ARG A CB  1 
ATOM   820  C  CG  . ARG A 1 104 ? 28.686  1.100  10.416 1.00 12.63 ? 104 ARG A CG  1 
ATOM   821  C  CD  . ARG A 1 104 ? 29.452  1.907  9.395  1.00 15.04 ? 104 ARG A CD  1 
ATOM   822  N  NE  . ARG A 1 104 ? 29.168  3.330  9.558  1.00 15.66 ? 104 ARG A NE  1 
ATOM   823  C  CZ  . ARG A 1 104 ? 29.378  4.252  8.626  1.00 18.00 ? 104 ARG A CZ  1 
ATOM   824  N  NH1 . ARG A 1 104 ? 29.877  3.904  7.448  1.00 16.95 ? 104 ARG A NH1 1 
ATOM   825  N  NH2 . ARG A 1 104 ? 29.090  5.524  8.873  1.00 17.90 ? 104 ARG A NH2 1 
ATOM   826  N  N   . ASP A 1 105 ? 26.153  2.726  12.613 1.00 13.76 ? 105 ASP A N   1 
ATOM   827  C  CA  . ASP A 1 105 ? 26.477  3.530  13.788 1.00 15.25 ? 105 ASP A CA  1 
ATOM   828  C  C   . ASP A 1 105 ? 25.499  3.444  14.959 1.00 14.25 ? 105 ASP A C   1 
ATOM   829  O  O   . ASP A 1 105 ? 25.860  3.768  16.090 1.00 13.96 ? 105 ASP A O   1 
ATOM   830  C  CB  . ASP A 1 105 ? 26.668  5.003  13.393 1.00 14.51 ? 105 ASP A CB  1 
ATOM   831  C  CG  . ASP A 1 105 ? 27.753  5.195  12.343 1.00 14.89 ? 105 ASP A CG  1 
ATOM   832  O  OD1 . ASP A 1 105 ? 28.786  4.498  12.411 1.00 14.62 ? 105 ASP A OD1 1 
ATOM   833  O  OD2 . ASP A 1 105 ? 27.587  6.067  11.462 1.00 16.16 ? 105 ASP A OD2 1 
ATOM   834  N  N   . PHE A 1 106 ? 24.272  3.007  14.694 1.00 14.82 ? 106 PHE A N   1 
ATOM   835  C  CA  . PHE A 1 106 ? 23.260  2.895  15.746 1.00 14.26 ? 106 PHE A CA  1 
ATOM   836  C  C   . PHE A 1 106 ? 22.889  1.444  16.033 1.00 14.63 ? 106 PHE A C   1 
ATOM   837  O  O   . PHE A 1 106 ? 22.191  1.156  17.005 1.00 15.35 ? 106 PHE A O   1 
ATOM   838  C  CB  . PHE A 1 106 ? 22.003  3.675  15.346 1.00 13.58 ? 106 PHE A CB  1 
ATOM   839  C  CG  . PHE A 1 106 ? 22.214  5.160  15.254 1.00 14.16 ? 106 PHE A CG  1 
ATOM   840  C  CD1 . PHE A 1 106 ? 22.396  5.923  16.408 1.00 14.92 ? 106 PHE A CD1 1 
ATOM   841  C  CD2 . PHE A 1 106 ? 22.248  5.796  14.015 1.00 13.06 ? 106 PHE A CD2 1 
ATOM   842  C  CE1 . PHE A 1 106 ? 22.609  7.302  16.330 1.00 14.45 ? 106 PHE A CE1 1 
ATOM   843  C  CE2 . PHE A 1 106 ? 22.461  7.176  13.924 1.00 14.56 ? 106 PHE A CE2 1 
ATOM   844  C  CZ  . PHE A 1 106 ? 22.641  7.930  15.084 1.00 13.88 ? 106 PHE A CZ  1 
ATOM   845  N  N   . GLY A 1 107 ? 23.356  0.537  15.181 1.00 15.10 ? 107 GLY A N   1 
ATOM   846  C  CA  . GLY A 1 107 ? 23.057  -0.874 15.354 1.00 14.95 ? 107 GLY A CA  1 
ATOM   847  C  C   . GLY A 1 107 ? 21.895  -1.306 14.480 1.00 15.13 ? 107 GLY A C   1 
ATOM   848  O  O   . GLY A 1 107 ? 21.875  -2.417 13.953 1.00 15.37 ? 107 GLY A O   1 
ATOM   849  N  N   . SER A 1 108 ? 20.923  -0.415 14.327 1.00 15.56 ? 108 SER A N   1 
ATOM   850  C  CA  . SER A 1 108 ? 19.743  -0.681 13.514 1.00 14.18 ? 108 SER A CA  1 
ATOM   851  C  C   . SER A 1 108 ? 18.928  0.592  13.405 1.00 13.47 ? 108 SER A C   1 
ATOM   852  O  O   . SER A 1 108 ? 19.122  1.532  14.177 1.00 13.20 ? 108 SER A O   1 
ATOM   853  C  CB  . SER A 1 108 ? 18.886  -1.773 14.153 1.00 16.21 ? 108 SER A CB  1 
ATOM   854  O  OG  . SER A 1 108 ? 18.433  -1.373 15.436 1.00 18.27 ? 108 SER A OG  1 
ATOM   855  N  N   . VAL A 1 109 ? 18.022  0.630  12.436 1.00 13.84 ? 109 VAL A N   1 
ATOM   856  C  CA  . VAL A 1 109 ? 17.173  1.796  12.262 1.00 13.98 ? 109 VAL A CA  1 
ATOM   857  C  C   . VAL A 1 109 ? 16.349  2.005  13.535 1.00 14.00 ? 109 VAL A C   1 
ATOM   858  O  O   . VAL A 1 109 ? 16.119  3.138  13.953 1.00 14.57 ? 109 VAL A O   1 
ATOM   859  C  CB  . VAL A 1 109 ? 16.230  1.626  11.051 1.00 12.45 ? 109 VAL A CB  1 
ATOM   860  C  CG1 . VAL A 1 109 ? 15.266  2.796  10.975 1.00 10.21 ? 109 VAL A CG1 1 
ATOM   861  C  CG2 . VAL A 1 109 ? 17.048  1.541  9.765  1.00 11.96 ? 109 VAL A CG2 1 
ATOM   862  N  N   . ASP A 1 110 ? 15.921  0.911  14.158 1.00 14.41 ? 110 ASP A N   1 
ATOM   863  C  CA  . ASP A 1 110 ? 15.131  1.001  15.382 1.00 15.87 ? 110 ASP A CA  1 
ATOM   864  C  C   . ASP A 1 110 ? 15.869  1.654  16.544 1.00 14.69 ? 110 ASP A C   1 
ATOM   865  O  O   . ASP A 1 110 ? 15.284  2.477  17.251 1.00 14.69 ? 110 ASP A O   1 
ATOM   866  C  CB  . ASP A 1 110 ? 14.620  -0.379 15.796 1.00 21.19 ? 110 ASP A CB  1 
ATOM   867  C  CG  . ASP A 1 110 ? 13.416  -0.815 14.986 1.00 26.96 ? 110 ASP A CG  1 
ATOM   868  O  OD1 . ASP A 1 110 ? 12.357  -0.154 15.100 1.00 29.11 ? 110 ASP A OD1 1 
ATOM   869  O  OD2 . ASP A 1 110 ? 13.528  -1.807 14.232 1.00 28.96 ? 110 ASP A OD2 1 
ATOM   870  N  N   . ASN A 1 111 ? 17.133  1.293  16.757 1.00 11.16 ? 111 ASN A N   1 
ATOM   871  C  CA  . ASN A 1 111 ? 17.886  1.917  17.837 1.00 12.17 ? 111 ASN A CA  1 
ATOM   872  C  C   . ASN A 1 111 ? 17.980  3.399  17.514 1.00 12.00 ? 111 ASN A C   1 
ATOM   873  O  O   . ASN A 1 111 ? 17.866  4.244  18.401 1.00 12.98 ? 111 ASN A O   1 
ATOM   874  C  CB  . ASN A 1 111 ? 19.305  1.337  17.979 1.00 11.43 ? 111 ASN A CB  1 
ATOM   875  C  CG  . ASN A 1 111 ? 19.310  -0.114 18.454 1.00 13.02 ? 111 ASN A CG  1 
ATOM   876  O  OD1 . ASN A 1 111 ? 18.357  -0.581 19.075 1.00 11.29 ? 111 ASN A OD1 1 
ATOM   877  N  ND2 . ASN A 1 111 ? 20.407  -0.818 18.195 1.00 8.44  ? 111 ASN A ND2 1 
ATOM   878  N  N   . PHE A 1 112 ? 18.185  3.708  16.237 1.00 12.41 ? 112 PHE A N   1 
ATOM   879  C  CA  . PHE A 1 112 ? 18.276  5.097  15.798 1.00 13.14 ? 112 PHE A CA  1 
ATOM   880  C  C   . PHE A 1 112 ? 17.020  5.887  16.157 1.00 12.94 ? 112 PHE A C   1 
ATOM   881  O  O   . PHE A 1 112 ? 17.096  6.922  16.822 1.00 11.11 ? 112 PHE A O   1 
ATOM   882  C  CB  . PHE A 1 112 ? 18.475  5.185  14.284 1.00 12.15 ? 112 PHE A CB  1 
ATOM   883  C  CG  . PHE A 1 112 ? 18.125  6.534  13.718 1.00 13.99 ? 112 PHE A CG  1 
ATOM   884  C  CD1 . PHE A 1 112 ? 18.868  7.665  14.053 1.00 13.98 ? 112 PHE A CD1 1 
ATOM   885  C  CD2 . PHE A 1 112 ? 16.995  6.689  12.920 1.00 13.03 ? 112 PHE A CD2 1 
ATOM   886  C  CE1 . PHE A 1 112 ? 18.484  8.933  13.604 1.00 14.31 ? 112 PHE A CE1 1 
ATOM   887  C  CE2 . PHE A 1 112 ? 16.603  7.953  12.467 1.00 12.93 ? 112 PHE A CE2 1 
ATOM   888  C  CZ  . PHE A 1 112 ? 17.349  9.075  12.811 1.00 12.03 ? 112 PHE A CZ  1 
ATOM   889  N  N   . LYS A 1 113 ? 15.870  5.403  15.694 1.00 11.84 ? 113 LYS A N   1 
ATOM   890  C  CA  . LYS A 1 113 ? 14.609  6.078  15.951 1.00 11.53 ? 113 LYS A CA  1 
ATOM   891  C  C   . LYS A 1 113 ? 14.311  6.248  17.436 1.00 11.14 ? 113 LYS A C   1 
ATOM   892  O  O   . LYS A 1 113 ? 13.884  7.319  17.861 1.00 9.32  ? 113 LYS A O   1 
ATOM   893  C  CB  . LYS A 1 113 ? 13.462  5.350  15.243 1.00 11.79 ? 113 LYS A CB  1 
ATOM   894  C  CG  . LYS A 1 113 ? 13.538  5.460  13.720 1.00 13.61 ? 113 LYS A CG  1 
ATOM   895  C  CD  . LYS A 1 113 ? 12.310  4.866  13.037 1.00 17.60 ? 113 LYS A CD  1 
ATOM   896  C  CE  . LYS A 1 113 ? 12.347  5.103  11.530 1.00 19.34 ? 113 LYS A CE  1 
ATOM   897  N  NZ  . LYS A 1 113 ? 11.155  4.527  10.839 1.00 24.00 ? 113 LYS A NZ  1 
ATOM   898  N  N   . ALA A 1 114 ? 14.553  5.205  18.225 1.00 10.85 ? 114 ALA A N   1 
ATOM   899  C  CA  . ALA A 1 114 ? 14.314  5.275  19.663 1.00 9.81  ? 114 ALA A CA  1 
ATOM   900  C  C   . ALA A 1 114 ? 15.201  6.336  20.291 1.00 11.21 ? 114 ALA A C   1 
ATOM   901  O  O   . ALA A 1 114 ? 14.763  7.078  21.167 1.00 11.63 ? 114 ALA A O   1 
ATOM   902  C  CB  . ALA A 1 114 ? 14.588  3.930  20.314 1.00 10.14 ? 114 ALA A CB  1 
ATOM   903  N  N   . GLU A 1 115 ? 16.451  6.409  19.841 1.00 11.79 ? 115 GLU A N   1 
ATOM   904  C  CA  . GLU A 1 115 ? 17.387  7.384  20.381 1.00 12.17 ? 115 GLU A CA  1 
ATOM   905  C  C   . GLU A 1 115 ? 16.982  8.797  19.954 1.00 11.70 ? 115 GLU A C   1 
ATOM   906  O  O   . GLU A 1 115 ? 17.061  9.736  20.749 1.00 12.70 ? 115 GLU A O   1 
ATOM   907  C  CB  . GLU A 1 115 ? 18.809  7.084  19.900 1.00 13.12 ? 115 GLU A CB  1 
ATOM   908  C  CG  . GLU A 1 115 ? 19.887  7.758  20.734 1.00 16.70 ? 115 GLU A CG  1 
ATOM   909  C  CD  . GLU A 1 115 ? 21.285  7.559  20.177 1.00 17.09 ? 115 GLU A CD  1 
ATOM   910  O  OE1 . GLU A 1 115 ? 21.645  6.416  19.837 1.00 18.36 ? 115 GLU A OE1 1 
ATOM   911  O  OE2 . GLU A 1 115 ? 22.035  8.549  20.094 1.00 19.69 ? 115 GLU A OE2 1 
ATOM   912  N  N   . PHE A 1 116 ? 16.539  8.945  18.707 1.00 8.89  ? 116 PHE A N   1 
ATOM   913  C  CA  . PHE A 1 116 ? 16.122  10.251 18.197 1.00 8.71  ? 116 PHE A CA  1 
ATOM   914  C  C   . PHE A 1 116 ? 14.876  10.740 18.939 1.00 9.37  ? 116 PHE A C   1 
ATOM   915  O  O   . PHE A 1 116 ? 14.782  11.907 19.330 1.00 6.30  ? 116 PHE A O   1 
ATOM   916  C  CB  . PHE A 1 116 ? 15.802  10.176 16.699 1.00 8.41  ? 116 PHE A CB  1 
ATOM   917  C  CG  . PHE A 1 116 ? 15.587  11.525 16.052 1.00 8.35  ? 116 PHE A CG  1 
ATOM   918  C  CD1 . PHE A 1 116 ? 16.673  12.341 15.735 1.00 7.34  ? 116 PHE A CD1 1 
ATOM   919  C  CD2 . PHE A 1 116 ? 14.304  11.981 15.765 1.00 7.54  ? 116 PHE A CD2 1 
ATOM   920  C  CE1 . PHE A 1 116 ? 16.485  13.590 15.136 1.00 6.56  ? 116 PHE A CE1 1 
ATOM   921  C  CE2 . PHE A 1 116 ? 14.103  13.233 15.165 1.00 7.66  ? 116 PHE A CE2 1 
ATOM   922  C  CZ  . PHE A 1 116 ? 15.196  14.036 14.849 1.00 5.94  ? 116 PHE A CZ  1 
ATOM   923  N  N   . GLU A 1 117 ? 13.918  9.838  19.126 1.00 10.87 ? 117 GLU A N   1 
ATOM   924  C  CA  . GLU A 1 117 ? 12.677  10.178 19.811 1.00 13.08 ? 117 GLU A CA  1 
ATOM   925  C  C   . GLU A 1 117 ? 12.934  10.638 21.239 1.00 12.99 ? 117 GLU A C   1 
ATOM   926  O  O   . GLU A 1 117 ? 12.331  11.604 21.707 1.00 11.52 ? 117 GLU A O   1 
ATOM   927  C  CB  . GLU A 1 117 ? 11.728  8.980  19.803 1.00 14.00 ? 117 GLU A CB  1 
ATOM   928  C  CG  . GLU A 1 117 ? 11.359  8.532  18.404 1.00 17.97 ? 117 GLU A CG  1 
ATOM   929  C  CD  . GLU A 1 117 ? 10.352  7.402  18.395 1.00 21.69 ? 117 GLU A CD  1 
ATOM   930  O  OE1 . GLU A 1 117 ? 10.624  6.354  19.015 1.00 23.23 ? 117 GLU A OE1 1 
ATOM   931  O  OE2 . GLU A 1 117 ? 9.289   7.563  17.762 1.00 24.88 ? 117 GLU A OE2 1 
ATOM   932  N  N   . LYS A 1 118 ? 13.837  9.949  21.925 1.00 13.75 ? 118 LYS A N   1 
ATOM   933  C  CA  . LYS A 1 118 ? 14.174  10.305 23.295 1.00 15.25 ? 118 LYS A CA  1 
ATOM   934  C  C   . LYS A 1 118 ? 14.809  11.691 23.334 1.00 14.11 ? 118 LYS A C   1 
ATOM   935  O  O   . LYS A 1 118 ? 14.479  12.507 24.194 1.00 14.99 ? 118 LYS A O   1 
ATOM   936  C  CB  . LYS A 1 118 ? 15.143  9.281  23.886 1.00 18.94 ? 118 LYS A CB  1 
ATOM   937  C  CG  . LYS A 1 118 ? 15.568  9.573  25.319 1.00 20.75 ? 118 LYS A CG  1 
ATOM   938  C  CD  . LYS A 1 118 ? 16.542  8.513  25.807 1.00 25.52 ? 118 LYS A CD  1 
ATOM   939  C  CE  . LYS A 1 118 ? 16.989  8.768  27.235 1.00 27.06 ? 118 LYS A CE  1 
ATOM   940  N  NZ  . LYS A 1 118 ? 17.914  7.701  27.712 1.00 28.04 ? 118 LYS A NZ  1 
ATOM   941  N  N   . ALA A 1 119 ? 15.723  11.952 22.404 1.00 12.11 ? 119 ALA A N   1 
ATOM   942  C  CA  . ALA A 1 119 ? 16.392  13.249 22.343 1.00 9.95  ? 119 ALA A CA  1 
ATOM   943  C  C   . ALA A 1 119 ? 15.361  14.339 22.088 1.00 8.26  ? 119 ALA A C   1 
ATOM   944  O  O   . ALA A 1 119 ? 15.395  15.400 22.708 1.00 7.67  ? 119 ALA A O   1 
ATOM   945  C  CB  . ALA A 1 119 ? 17.442  13.252 21.233 1.00 9.42  ? 119 ALA A CB  1 
ATOM   946  N  N   . ALA A 1 120 ? 14.445  14.057 21.171 1.00 7.49  ? 120 ALA A N   1 
ATOM   947  C  CA  . ALA A 1 120 ? 13.381  14.988 20.800 1.00 8.90  ? 120 ALA A CA  1 
ATOM   948  C  C   . ALA A 1 120 ? 12.431  15.254 21.961 1.00 9.03  ? 120 ALA A C   1 
ATOM   949  O  O   . ALA A 1 120 ? 12.037  16.394 22.206 1.00 8.71  ? 120 ALA A O   1 
ATOM   950  C  CB  . ALA A 1 120 ? 12.595  14.430 19.612 1.00 4.90  ? 120 ALA A CB  1 
ATOM   951  N  N   . ALA A 1 121 ? 12.073  14.193 22.674 1.00 9.84  ? 121 ALA A N   1 
ATOM   952  C  CA  . ALA A 1 121 ? 11.152  14.298 23.797 1.00 9.25  ? 121 ALA A CA  1 
ATOM   953  C  C   . ALA A 1 121 ? 11.760  14.888 25.066 1.00 9.65  ? 121 ALA A C   1 
ATOM   954  O  O   . ALA A 1 121 ? 11.094  15.633 25.777 1.00 9.25  ? 121 ALA A O   1 
ATOM   955  C  CB  . ALA A 1 121 ? 10.554  12.922 24.101 1.00 9.45  ? 121 ALA A CB  1 
ATOM   956  N  N   . SER A 1 122 ? 13.019  14.569 25.349 1.00 9.53  ? 122 SER A N   1 
ATOM   957  C  CA  . SER A 1 122 ? 13.661  15.062 26.563 1.00 10.16 ? 122 SER A CA  1 
ATOM   958  C  C   . SER A 1 122 ? 14.203  16.494 26.499 1.00 10.94 ? 122 SER A C   1 
ATOM   959  O  O   . SER A 1 122 ? 14.618  17.045 27.521 1.00 11.07 ? 122 SER A O   1 
ATOM   960  C  CB  . SER A 1 122 ? 14.771  14.098 27.003 1.00 9.82  ? 122 SER A CB  1 
ATOM   961  O  OG  . SER A 1 122 ? 15.772  13.960 26.010 1.00 16.96 ? 122 SER A OG  1 
ATOM   962  N  N   . ARG A 1 123 ? 14.211  17.094 25.312 1.00 9.47  ? 123 ARG A N   1 
ATOM   963  C  CA  . ARG A 1 123 ? 14.673  18.477 25.168 1.00 10.58 ? 123 ARG A CA  1 
ATOM   964  C  C   . ARG A 1 123 ? 13.693  19.373 25.933 1.00 10.74 ? 123 ARG A C   1 
ATOM   965  O  O   . ARG A 1 123 ? 12.598  19.660 25.451 1.00 10.46 ? 123 ARG A O   1 
ATOM   966  C  CB  . ARG A 1 123 ? 14.720  18.858 23.679 1.00 9.51  ? 123 ARG A CB  1 
ATOM   967  C  CG  . ARG A 1 123 ? 14.772  20.355 23.372 1.00 8.84  ? 123 ARG A CG  1 
ATOM   968  C  CD  . ARG A 1 123 ? 15.842  21.076 24.162 1.00 10.06 ? 123 ARG A CD  1 
ATOM   969  N  NE  . ARG A 1 123 ? 17.171  20.497 23.994 1.00 9.42  ? 123 ARG A NE  1 
ATOM   970  C  CZ  . ARG A 1 123 ? 18.255  20.960 24.608 1.00 9.04  ? 123 ARG A CZ  1 
ATOM   971  N  NH1 . ARG A 1 123 ? 18.155  22.002 25.422 1.00 7.66  ? 123 ARG A NH1 1 
ATOM   972  N  NH2 . ARG A 1 123 ? 19.432  20.379 24.422 1.00 7.98  ? 123 ARG A NH2 1 
ATOM   973  N  N   . PHE A 1 124 ? 14.091  19.803 27.129 1.00 10.40 ? 124 PHE A N   1 
ATOM   974  C  CA  . PHE A 1 124 ? 13.230  20.624 27.974 1.00 9.27  ? 124 PHE A CA  1 
ATOM   975  C  C   . PHE A 1 124 ? 13.183  22.092 27.554 1.00 7.27  ? 124 PHE A C   1 
ATOM   976  O  O   . PHE A 1 124 ? 14.199  22.780 27.534 1.00 6.60  ? 124 PHE A O   1 
ATOM   977  C  CB  . PHE A 1 124 ? 13.680  20.522 29.429 1.00 9.69  ? 124 PHE A CB  1 
ATOM   978  C  CG  . PHE A 1 124 ? 12.669  21.049 30.403 1.00 10.44 ? 124 PHE A CG  1 
ATOM   979  C  CD1 . PHE A 1 124 ? 11.463  20.381 30.596 1.00 10.03 ? 124 PHE A CD1 1 
ATOM   980  C  CD2 . PHE A 1 124 ? 12.900  22.229 31.101 1.00 9.25  ? 124 PHE A CD2 1 
ATOM   981  C  CE1 . PHE A 1 124 ? 10.500  20.879 31.470 1.00 10.17 ? 124 PHE A CE1 1 
ATOM   982  C  CE2 . PHE A 1 124 ? 11.942  22.734 31.979 1.00 10.38 ? 124 PHE A CE2 1 
ATOM   983  C  CZ  . PHE A 1 124 ? 10.739  22.057 32.161 1.00 8.98  ? 124 PHE A CZ  1 
ATOM   984  N  N   . GLY A 1 125 ? 11.985  22.570 27.247 1.00 7.15  ? 125 GLY A N   1 
ATOM   985  C  CA  . GLY A 1 125 ? 11.830  23.941 26.799 1.00 7.18  ? 125 GLY A CA  1 
ATOM   986  C  C   . GLY A 1 125 ? 11.803  23.954 25.280 1.00 7.72  ? 125 GLY A C   1 
ATOM   987  O  O   . GLY A 1 125 ? 11.263  23.031 24.663 1.00 7.33  ? 125 GLY A O   1 
ATOM   988  N  N   . SER A 1 126 ? 12.386  24.985 24.672 1.00 7.36  ? 126 SER A N   1 
ATOM   989  C  CA  . SER A 1 126 ? 12.420  25.104 23.213 1.00 7.33  ? 126 SER A CA  1 
ATOM   990  C  C   . SER A 1 126 ? 13.734  24.546 22.677 1.00 7.45  ? 126 SER A C   1 
ATOM   991  O  O   . SER A 1 126 ? 14.771  24.673 23.325 1.00 8.35  ? 126 SER A O   1 
ATOM   992  C  CB  . SER A 1 126 ? 12.292  26.576 22.787 1.00 7.73  ? 126 SER A CB  1 
ATOM   993  O  OG  . SER A 1 126 ? 11.095  27.169 23.270 1.00 4.88  ? 126 SER A OG  1 
ATOM   994  N  N   . GLY A 1 127 ? 13.693  23.935 21.496 1.00 6.76  ? 127 GLY A N   1 
ATOM   995  C  CA  . GLY A 1 127 ? 14.911  23.388 20.922 1.00 6.14  ? 127 GLY A CA  1 
ATOM   996  C  C   . GLY A 1 127 ? 14.717  22.505 19.703 1.00 6.16  ? 127 GLY A C   1 
ATOM   997  O  O   . GLY A 1 127 ? 13.630  22.443 19.133 1.00 5.51  ? 127 GLY A O   1 
ATOM   998  N  N   . TRP A 1 128 ? 15.791  21.825 19.304 1.00 7.57  ? 128 TRP A N   1 
ATOM   999  C  CA  . TRP A 1 128 ? 15.787  20.931 18.144 1.00 6.40  ? 128 TRP A CA  1 
ATOM   1000 C  C   . TRP A 1 128 ? 16.479  19.608 18.455 1.00 6.59  ? 128 TRP A C   1 
ATOM   1001 O  O   . TRP A 1 128 ? 17.346  19.541 19.315 1.00 5.93  ? 128 TRP A O   1 
ATOM   1002 C  CB  . TRP A 1 128 ? 16.536  21.561 16.963 1.00 6.12  ? 128 TRP A CB  1 
ATOM   1003 C  CG  . TRP A 1 128 ? 15.932  22.807 16.405 1.00 6.72  ? 128 TRP A CG  1 
ATOM   1004 C  CD1 . TRP A 1 128 ? 15.877  24.035 16.996 1.00 5.29  ? 128 TRP A CD1 1 
ATOM   1005 C  CD2 . TRP A 1 128 ? 15.261  22.933 15.148 1.00 6.30  ? 128 TRP A CD2 1 
ATOM   1006 N  NE1 . TRP A 1 128 ? 15.209  24.921 16.183 1.00 7.56  ? 128 TRP A NE1 1 
ATOM   1007 C  CE2 . TRP A 1 128 ? 14.820  24.270 15.042 1.00 5.96  ? 128 TRP A CE2 1 
ATOM   1008 C  CE3 . TRP A 1 128 ? 14.988  22.043 14.101 1.00 6.45  ? 128 TRP A CE3 1 
ATOM   1009 C  CZ2 . TRP A 1 128 ? 14.119  24.741 13.928 1.00 5.77  ? 128 TRP A CZ2 1 
ATOM   1010 C  CZ3 . TRP A 1 128 ? 14.290  22.510 12.995 1.00 7.48  ? 128 TRP A CZ3 1 
ATOM   1011 C  CH2 . TRP A 1 128 ? 13.863  23.851 12.919 1.00 7.37  ? 128 TRP A CH2 1 
ATOM   1012 N  N   . ALA A 1 129 ? 16.088  18.562 17.736 1.00 8.23  ? 129 ALA A N   1 
ATOM   1013 C  CA  . ALA A 1 129 ? 16.700  17.242 17.875 1.00 8.39  ? 129 ALA A CA  1 
ATOM   1014 C  C   . ALA A 1 129 ? 17.342  17.018 16.510 1.00 8.08  ? 129 ALA A C   1 
ATOM   1015 O  O   . ALA A 1 129 ? 16.722  17.312 15.490 1.00 8.24  ? 129 ALA A O   1 
ATOM   1016 C  CB  . ALA A 1 129 ? 15.638  16.183 18.147 1.00 8.23  ? 129 ALA A CB  1 
ATOM   1017 N  N   . TRP A 1 130 ? 18.571  16.509 16.473 1.00 8.06  ? 130 TRP A N   1 
ATOM   1018 C  CA  . TRP A 1 130 ? 19.239  16.321 15.187 1.00 7.45  ? 130 TRP A CA  1 
ATOM   1019 C  C   . TRP A 1 130 ? 19.931  14.990 14.953 1.00 8.27  ? 130 TRP A C   1 
ATOM   1020 O  O   . TRP A 1 130 ? 20.305  14.286 15.887 1.00 7.06  ? 130 TRP A O   1 
ATOM   1021 C  CB  . TRP A 1 130 ? 20.338  17.370 14.966 1.00 6.20  ? 130 TRP A CB  1 
ATOM   1022 C  CG  . TRP A 1 130 ? 20.026  18.787 15.336 1.00 8.87  ? 130 TRP A CG  1 
ATOM   1023 C  CD1 . TRP A 1 130 ? 20.103  19.349 16.580 1.00 6.52  ? 130 TRP A CD1 1 
ATOM   1024 C  CD2 . TRP A 1 130 ? 19.626  19.835 14.445 1.00 7.66  ? 130 TRP A CD2 1 
ATOM   1025 N  NE1 . TRP A 1 130 ? 19.781  20.686 16.515 1.00 7.00  ? 130 TRP A NE1 1 
ATOM   1026 C  CE2 . TRP A 1 130 ? 19.484  21.011 15.218 1.00 7.55  ? 130 TRP A CE2 1 
ATOM   1027 C  CE3 . TRP A 1 130 ? 19.376  19.895 13.067 1.00 7.74  ? 130 TRP A CE3 1 
ATOM   1028 C  CZ2 . TRP A 1 130 ? 19.101  22.237 14.659 1.00 7.41  ? 130 TRP A CZ2 1 
ATOM   1029 C  CZ3 . TRP A 1 130 ? 18.994  21.115 12.509 1.00 9.60  ? 130 TRP A CZ3 1 
ATOM   1030 C  CH2 . TRP A 1 130 ? 18.860  22.270 13.309 1.00 6.77  ? 130 TRP A CH2 1 
ATOM   1031 N  N   . LEU A 1 131 ? 20.100  14.678 13.670 1.00 8.19  ? 131 LEU A N   1 
ATOM   1032 C  CA  . LEU A 1 131 ? 20.857  13.519 13.229 1.00 6.66  ? 131 LEU A CA  1 
ATOM   1033 C  C   . LEU A 1 131 ? 22.029  14.247 12.569 1.00 6.97  ? 131 LEU A C   1 
ATOM   1034 O  O   . LEU A 1 131 ? 21.842  14.959 11.581 1.00 6.47  ? 131 LEU A O   1 
ATOM   1035 C  CB  . LEU A 1 131 ? 20.110  12.691 12.177 1.00 7.47  ? 131 LEU A CB  1 
ATOM   1036 C  CG  . LEU A 1 131 ? 21.033  11.682 11.466 1.00 8.71  ? 131 LEU A CG  1 
ATOM   1037 C  CD1 . LEU A 1 131 ? 21.667  10.743 12.492 1.00 7.14  ? 131 LEU A CD1 1 
ATOM   1038 C  CD2 . LEU A 1 131 ? 20.258  10.893 10.422 1.00 9.38  ? 131 LEU A CD2 1 
ATOM   1039 N  N   . VAL A 1 132 ? 23.223  14.123 13.134 1.00 6.91  ? 132 VAL A N   1 
ATOM   1040 C  CA  . VAL A 1 132 ? 24.376  14.797 12.557 1.00 7.64  ? 132 VAL A CA  1 
ATOM   1041 C  C   . VAL A 1 132 ? 25.446  13.808 12.140 1.00 9.04  ? 132 VAL A C   1 
ATOM   1042 O  O   . VAL A 1 132 ? 25.406  12.634 12.504 1.00 8.18  ? 132 VAL A O   1 
ATOM   1043 C  CB  . VAL A 1 132 ? 25.030  15.802 13.553 1.00 8.41  ? 132 VAL A CB  1 
ATOM   1044 C  CG1 . VAL A 1 132 ? 24.023  16.872 13.980 1.00 5.49  ? 132 VAL A CG1 1 
ATOM   1045 C  CG2 . VAL A 1 132 ? 25.575  15.057 14.765 1.00 7.16  ? 132 VAL A CG2 1 
ATOM   1046 N  N   . LEU A 1 133 ? 26.398  14.298 11.357 1.00 11.06 ? 133 LEU A N   1 
ATOM   1047 C  CA  . LEU A 1 133 ? 27.515  13.488 10.914 1.00 12.22 ? 133 LEU A CA  1 
ATOM   1048 C  C   . LEU A 1 133 ? 28.769  14.131 11.495 1.00 13.65 ? 133 LEU A C   1 
ATOM   1049 O  O   . LEU A 1 133 ? 29.111  15.259 11.145 1.00 12.80 ? 133 LEU A O   1 
ATOM   1050 C  CB  . LEU A 1 133 ? 27.595  13.456 9.383  1.00 10.58 ? 133 LEU A CB  1 
ATOM   1051 C  CG  . LEU A 1 133 ? 28.803  12.744 8.753  1.00 11.27 ? 133 LEU A CG  1 
ATOM   1052 C  CD1 . LEU A 1 133 ? 28.908  11.315 9.256  1.00 6.29  ? 133 LEU A CD1 1 
ATOM   1053 C  CD2 . LEU A 1 133 ? 28.669  12.759 7.237  1.00 10.57 ? 133 LEU A CD2 1 
ATOM   1054 N  N   . LYS A 1 134 ? 29.419  13.421 12.413 1.00 14.02 ? 134 LYS A N   1 
ATOM   1055 C  CA  . LYS A 1 134 ? 30.650  13.887 13.042 1.00 16.42 ? 134 LYS A CA  1 
ATOM   1056 C  C   . LYS A 1 134 ? 31.814  13.146 12.390 1.00 16.42 ? 134 LYS A C   1 
ATOM   1057 O  O   . LYS A 1 134 ? 32.180  12.057 12.824 1.00 16.47 ? 134 LYS A O   1 
ATOM   1058 C  CB  . LYS A 1 134 ? 30.655  13.573 14.538 1.00 16.61 ? 134 LYS A CB  1 
ATOM   1059 C  CG  . LYS A 1 134 ? 29.625  14.302 15.370 1.00 21.51 ? 134 LYS A CG  1 
ATOM   1060 C  CD  . LYS A 1 134 ? 29.736  13.848 16.822 1.00 24.25 ? 134 LYS A CD  1 
ATOM   1061 C  CE  . LYS A 1 134 ? 28.808  14.618 17.732 1.00 26.69 ? 134 LYS A CE  1 
ATOM   1062 N  NZ  . LYS A 1 134 ? 29.160  16.061 17.734 1.00 31.84 ? 134 LYS A NZ  1 
ATOM   1063 N  N   . GLY A 1 135 ? 32.391  13.736 11.349 1.00 17.97 ? 135 GLY A N   1 
ATOM   1064 C  CA  . GLY A 1 135 ? 33.497  13.093 10.662 1.00 18.55 ? 135 GLY A CA  1 
ATOM   1065 C  C   . GLY A 1 135 ? 33.021  11.883 9.881  1.00 19.77 ? 135 GLY A C   1 
ATOM   1066 O  O   . GLY A 1 135 ? 32.513  12.018 8.766  1.00 20.32 ? 135 GLY A O   1 
ATOM   1067 N  N   . ASP A 1 136 ? 33.175  10.697 10.462 1.00 19.70 ? 136 ASP A N   1 
ATOM   1068 C  CA  . ASP A 1 136 ? 32.746  9.477  9.793  1.00 20.38 ? 136 ASP A CA  1 
ATOM   1069 C  C   . ASP A 1 136 ? 31.692  8.730  10.583 1.00 18.69 ? 136 ASP A C   1 
ATOM   1070 O  O   . ASP A 1 136 ? 31.397  7.577  10.282 1.00 17.78 ? 136 ASP A O   1 
ATOM   1071 C  CB  . ASP A 1 136 ? 33.930  8.543  9.548  1.00 23.96 ? 136 ASP A CB  1 
ATOM   1072 C  CG  . ASP A 1 136 ? 34.968  9.146  8.628  1.00 29.27 ? 136 ASP A CG  1 
ATOM   1073 O  OD1 . ASP A 1 136 ? 34.610  9.543  7.495  1.00 31.36 ? 136 ASP A OD1 1 
ATOM   1074 O  OD2 . ASP A 1 136 ? 36.146  9.214  9.038  1.00 33.86 ? 136 ASP A OD2 1 
ATOM   1075 N  N   . LYS A 1 137 ? 31.121  9.378  11.592 1.00 15.37 ? 137 LYS A N   1 
ATOM   1076 C  CA  . LYS A 1 137 ? 30.104  8.719  12.392 1.00 14.14 ? 137 LYS A CA  1 
ATOM   1077 C  C   . LYS A 1 137 ? 28.870  9.577  12.654 1.00 12.81 ? 137 LYS A C   1 
ATOM   1078 O  O   . LYS A 1 137 ? 28.975  10.747 13.019 1.00 12.84 ? 137 LYS A O   1 
ATOM   1079 C  CB  . LYS A 1 137 ? 30.699  8.262  13.722 1.00 15.39 ? 137 LYS A CB  1 
ATOM   1080 C  CG  . LYS A 1 137 ? 29.731  7.455  14.563 1.00 18.04 ? 137 LYS A CG  1 
ATOM   1081 C  CD  . LYS A 1 137 ? 30.381  6.963  15.841 1.00 22.59 ? 137 LYS A CD  1 
ATOM   1082 C  CE  . LYS A 1 137 ? 29.441  6.069  16.624 1.00 22.10 ? 137 LYS A CE  1 
ATOM   1083 N  NZ  . LYS A 1 137 ? 30.091  5.560  17.856 1.00 27.25 ? 137 LYS A NZ  1 
ATOM   1084 N  N   . LEU A 1 138 ? 27.703  8.969  12.463 1.00 10.68 ? 138 LEU A N   1 
ATOM   1085 C  CA  . LEU A 1 138 ? 26.420  9.620  12.682 1.00 9.32  ? 138 LEU A CA  1 
ATOM   1086 C  C   . LEU A 1 138 ? 26.077  9.603  14.165 1.00 11.05 ? 138 LEU A C   1 
ATOM   1087 O  O   . LEU A 1 138 ? 26.485  8.693  14.900 1.00 11.04 ? 138 LEU A O   1 
ATOM   1088 C  CB  . LEU A 1 138 ? 25.319  8.891  11.904 1.00 8.89  ? 138 LEU A CB  1 
ATOM   1089 C  CG  . LEU A 1 138 ? 25.419  8.953  10.379 1.00 8.77  ? 138 LEU A CG  1 
ATOM   1090 C  CD1 . LEU A 1 138 ? 24.395  8.035  9.743  1.00 7.00  ? 138 LEU A CD1 1 
ATOM   1091 C  CD2 . LEU A 1 138 ? 25.219  10.394 9.925  1.00 8.04  ? 138 LEU A CD2 1 
ATOM   1092 N  N   . ALA A 1 139 ? 25.319  10.605 14.598 1.00 10.02 ? 139 ALA A N   1 
ATOM   1093 C  CA  . ALA A 1 139 ? 24.912  10.705 15.992 1.00 10.15 ? 139 ALA A CA  1 
ATOM   1094 C  C   . ALA A 1 139 ? 23.651  11.553 16.169 1.00 9.89  ? 139 ALA A C   1 
ATOM   1095 O  O   . ALA A 1 139 ? 23.304  12.377 15.318 1.00 7.59  ? 139 ALA A O   1 
ATOM   1096 C  CB  . ALA A 1 139 ? 26.050  11.289 16.824 1.00 6.61  ? 139 ALA A CB  1 
ATOM   1097 N  N   . VAL A 1 140 ? 22.976  11.332 17.289 1.00 9.83  ? 140 VAL A N   1 
ATOM   1098 C  CA  . VAL A 1 140 ? 21.767  12.060 17.643 1.00 10.81 ? 140 VAL A CA  1 
ATOM   1099 C  C   . VAL A 1 140 ? 22.130  13.063 18.730 1.00 11.51 ? 140 VAL A C   1 
ATOM   1100 O  O   . VAL A 1 140 ? 22.684  12.691 19.761 1.00 12.04 ? 140 VAL A O   1 
ATOM   1101 C  CB  . VAL A 1 140 ? 20.673  11.097 18.177 1.00 10.47 ? 140 VAL A CB  1 
ATOM   1102 C  CG1 . VAL A 1 140 ? 19.520  11.885 18.782 1.00 10.06 ? 140 VAL A CG1 1 
ATOM   1103 C  CG2 . VAL A 1 140 ? 20.159  10.225 17.042 1.00 10.38 ? 140 VAL A CG2 1 
ATOM   1104 N  N   . VAL A 1 141 ? 21.840  14.337 18.486 1.00 11.55 ? 141 VAL A N   1 
ATOM   1105 C  CA  . VAL A 1 141 ? 22.133  15.388 19.452 1.00 11.34 ? 141 VAL A CA  1 
ATOM   1106 C  C   . VAL A 1 141 ? 20.986  16.393 19.456 1.00 12.00 ? 141 VAL A C   1 
ATOM   1107 O  O   . VAL A 1 141 ? 20.172  16.417 18.537 1.00 11.50 ? 141 VAL A O   1 
ATOM   1108 C  CB  . VAL A 1 141 ? 23.452  16.135 19.105 1.00 13.01 ? 141 VAL A CB  1 
ATOM   1109 C  CG1 . VAL A 1 141 ? 24.625  15.167 19.115 1.00 9.50  ? 141 VAL A CG1 1 
ATOM   1110 C  CG2 . VAL A 1 141 ? 23.331  16.817 17.745 1.00 10.61 ? 141 VAL A CG2 1 
ATOM   1111 N  N   . SER A 1 142 ? 20.906  17.211 20.497 1.00 11.44 ? 142 SER A N   1 
ATOM   1112 C  CA  . SER A 1 142 ? 19.853  18.211 20.569 1.00 10.56 ? 142 SER A CA  1 
ATOM   1113 C  C   . SER A 1 142 ? 20.456  19.542 20.985 1.00 9.83  ? 142 SER A C   1 
ATOM   1114 O  O   . SER A 1 142 ? 21.511  19.586 21.618 1.00 9.65  ? 142 SER A O   1 
ATOM   1115 C  CB  . SER A 1 142 ? 18.772  17.803 21.580 1.00 11.27 ? 142 SER A CB  1 
ATOM   1116 O  OG  . SER A 1 142 ? 19.281  17.799 22.904 1.00 11.57 ? 142 SER A OG  1 
ATOM   1117 N  N   . THR A 1 143 ? 19.783  20.624 20.615 1.00 9.34  ? 143 THR A N   1 
ATOM   1118 C  CA  . THR A 1 143 ? 20.239  21.960 20.963 1.00 8.33  ? 143 THR A CA  1 
ATOM   1119 C  C   . THR A 1 143 ? 19.092  22.763 21.561 1.00 7.66  ? 143 THR A C   1 
ATOM   1120 O  O   . THR A 1 143 ? 17.921  22.432 21.369 1.00 5.11  ? 143 THR A O   1 
ATOM   1121 C  CB  . THR A 1 143 ? 20.770  22.698 19.732 1.00 9.04  ? 143 THR A CB  1 
ATOM   1122 O  OG1 . THR A 1 143 ? 19.763  22.713 18.713 1.00 9.82  ? 143 THR A OG1 1 
ATOM   1123 C  CG2 . THR A 1 143 ? 22.019  22.019 19.205 1.00 10.85 ? 143 THR A CG2 1 
ATOM   1124 N  N   . ALA A 1 144 ? 19.433  23.820 22.289 1.00 7.72  ? 144 ALA A N   1 
ATOM   1125 C  CA  . ALA A 1 144 ? 18.424  24.669 22.911 1.00 7.14  ? 144 ALA A CA  1 
ATOM   1126 C  C   . ALA A 1 144 ? 18.011  25.798 21.981 1.00 7.56  ? 144 ALA A C   1 
ATOM   1127 O  O   . ALA A 1 144 ? 18.818  26.290 21.185 1.00 7.69  ? 144 ALA A O   1 
ATOM   1128 C  CB  . ALA A 1 144 ? 18.957  25.244 24.218 1.00 6.50  ? 144 ALA A CB  1 
ATOM   1129 N  N   . ASN A 1 145 ? 16.743  26.189 22.084 1.00 6.76  ? 145 ASN A N   1 
ATOM   1130 C  CA  . ASN A 1 145 ? 16.180  27.280 21.298 1.00 5.33  ? 145 ASN A CA  1 
ATOM   1131 C  C   . ASN A 1 145 ? 16.520  27.191 19.816 1.00 6.25  ? 145 ASN A C   1 
ATOM   1132 O  O   . ASN A 1 145 ? 16.108  26.249 19.141 1.00 7.41  ? 145 ASN A O   1 
ATOM   1133 C  CB  . ASN A 1 145 ? 16.654  28.606 21.887 1.00 6.24  ? 145 ASN A CB  1 
ATOM   1134 C  CG  . ASN A 1 145 ? 16.419  28.680 23.381 1.00 9.03  ? 145 ASN A CG  1 
ATOM   1135 O  OD1 . ASN A 1 145 ? 15.329  28.355 23.860 1.00 9.70  ? 145 ASN A OD1 1 
ATOM   1136 N  ND2 . ASN A 1 145 ? 17.434  29.111 24.128 1.00 5.40  ? 145 ASN A ND2 1 
ATOM   1137 N  N   . GLN A 1 146 ? 17.253  28.171 19.295 1.00 6.09  ? 146 GLN A N   1 
ATOM   1138 C  CA  . GLN A 1 146 ? 17.625  28.131 17.883 1.00 5.91  ? 146 GLN A CA  1 
ATOM   1139 C  C   . GLN A 1 146 ? 19.086  27.784 17.635 1.00 6.35  ? 146 GLN A C   1 
ATOM   1140 O  O   . GLN A 1 146 ? 19.611  28.060 16.553 1.00 7.29  ? 146 GLN A O   1 
ATOM   1141 C  CB  . GLN A 1 146 ? 17.303  29.452 17.178 1.00 3.57  ? 146 GLN A CB  1 
ATOM   1142 C  CG  . GLN A 1 146 ? 15.820  29.727 16.964 1.00 4.16  ? 146 GLN A CG  1 
ATOM   1143 C  CD  . GLN A 1 146 ? 15.090  28.560 16.327 1.00 5.77  ? 146 GLN A CD  1 
ATOM   1144 O  OE1 . GLN A 1 146 ? 15.657  27.817 15.526 1.00 5.53  ? 146 GLN A OE1 1 
ATOM   1145 N  NE2 . GLN A 1 146 ? 13.814  28.408 16.663 1.00 8.94  ? 146 GLN A NE2 1 
ATOM   1146 N  N   . ASP A 1 147 ? 19.750  27.178 18.620 1.00 5.23  ? 147 ASP A N   1 
ATOM   1147 C  CA  . ASP A 1 147 ? 21.146  26.812 18.426 1.00 5.03  ? 147 ASP A CA  1 
ATOM   1148 C  C   . ASP A 1 147 ? 21.249  25.672 17.421 1.00 5.10  ? 147 ASP A C   1 
ATOM   1149 O  O   . ASP A 1 147 ? 20.329  24.866 17.275 1.00 5.16  ? 147 ASP A O   1 
ATOM   1150 C  CB  . ASP A 1 147 ? 21.820  26.395 19.738 1.00 4.44  ? 147 ASP A CB  1 
ATOM   1151 C  CG  . ASP A 1 147 ? 21.867  27.516 20.765 1.00 3.47  ? 147 ASP A CG  1 
ATOM   1152 O  OD1 . ASP A 1 147 ? 21.719  28.698 20.395 1.00 3.13  ? 147 ASP A OD1 1 
ATOM   1153 O  OD2 . ASP A 1 147 ? 22.080  27.209 21.954 1.00 7.58  ? 147 ASP A OD2 1 
ATOM   1154 N  N   . SER A 1 148 ? 22.378  25.615 16.729 1.00 5.37  ? 148 SER A N   1 
ATOM   1155 C  CA  . SER A 1 148 ? 22.621  24.592 15.729 1.00 5.87  ? 148 SER A CA  1 
ATOM   1156 C  C   . SER A 1 148 ? 23.958  23.898 15.955 1.00 7.15  ? 148 SER A C   1 
ATOM   1157 O  O   . SER A 1 148 ? 24.912  24.506 16.439 1.00 7.25  ? 148 SER A O   1 
ATOM   1158 C  CB  . SER A 1 148 ? 22.623  25.223 14.334 1.00 5.99  ? 148 SER A CB  1 
ATOM   1159 O  OG  . SER A 1 148 ? 23.023  24.284 13.349 1.00 6.26  ? 148 SER A OG  1 
ATOM   1160 N  N   . PRO A 1 149 ? 24.038  22.601 15.636 1.00 7.52  ? 149 PRO A N   1 
ATOM   1161 C  CA  . PRO A 1 149 ? 25.323  21.927 15.834 1.00 8.53  ? 149 PRO A CA  1 
ATOM   1162 C  C   . PRO A 1 149 ? 26.419  22.616 14.997 1.00 8.40  ? 149 PRO A C   1 
ATOM   1163 O  O   . PRO A 1 149 ? 27.602  22.541 15.331 1.00 8.61  ? 149 PRO A O   1 
ATOM   1164 C  CB  . PRO A 1 149 ? 25.024  20.495 15.380 1.00 7.23  ? 149 PRO A CB  1 
ATOM   1165 C  CG  . PRO A 1 149 ? 23.900  20.703 14.348 1.00 8.74  ? 149 PRO A CG  1 
ATOM   1166 C  CD  . PRO A 1 149 ? 23.032  21.650 15.137 1.00 7.56  ? 149 PRO A CD  1 
ATOM   1167 N  N   . LEU A 1 150 ? 26.014  23.301 13.925 1.00 6.02  ? 150 LEU A N   1 
ATOM   1168 C  CA  . LEU A 1 150 ? 26.956  24.007 13.054 1.00 7.25  ? 150 LEU A CA  1 
ATOM   1169 C  C   . LEU A 1 150 ? 27.678  25.132 13.798 1.00 7.75  ? 150 LEU A C   1 
ATOM   1170 O  O   . LEU A 1 150 ? 28.702  25.635 13.339 1.00 6.03  ? 150 LEU A O   1 
ATOM   1171 C  CB  . LEU A 1 150 ? 26.235  24.599 11.835 1.00 7.23  ? 150 LEU A CB  1 
ATOM   1172 C  CG  . LEU A 1 150 ? 25.730  23.639 10.755 1.00 11.61 ? 150 LEU A CG  1 
ATOM   1173 C  CD1 . LEU A 1 150 ? 24.970  24.421 9.701  1.00 10.62 ? 150 LEU A CD1 1 
ATOM   1174 C  CD2 . LEU A 1 150 ? 26.912  22.904 10.120 1.00 10.56 ? 150 LEU A CD2 1 
ATOM   1175 N  N   . MET A 1 151 ? 27.131  25.533 14.940 1.00 9.04  ? 151 MET A N   1 
ATOM   1176 C  CA  . MET A 1 151 ? 27.734  26.583 15.752 1.00 9.23  ? 151 MET A CA  1 
ATOM   1177 C  C   . MET A 1 151 ? 28.894  26.017 16.566 1.00 10.68 ? 151 MET A C   1 
ATOM   1178 O  O   . MET A 1 151 ? 29.752  26.762 17.033 1.00 13.17 ? 151 MET A O   1 
ATOM   1179 C  CB  . MET A 1 151 ? 26.693  27.184 16.694 1.00 7.27  ? 151 MET A CB  1 
ATOM   1180 C  CG  . MET A 1 151 ? 25.526  27.844 15.980 1.00 7.98  ? 151 MET A CG  1 
ATOM   1181 S  SD  . MET A 1 151 ? 24.238  28.433 17.106 1.00 6.09  ? 151 MET A SD  1 
ATOM   1182 C  CE  . MET A 1 151 ? 23.084  29.150 15.926 1.00 3.22  ? 151 MET A CE  1 
ATOM   1183 N  N   . GLY A 1 152 ? 28.915  24.697 16.736 1.00 12.44 ? 152 GLY A N   1 
ATOM   1184 C  CA  . GLY A 1 152 ? 29.980  24.063 17.495 1.00 12.03 ? 152 GLY A CA  1 
ATOM   1185 C  C   . GLY A 1 152 ? 29.635  23.793 18.949 1.00 13.37 ? 152 GLY A C   1 
ATOM   1186 O  O   . GLY A 1 152 ? 28.636  24.291 19.469 1.00 12.93 ? 152 GLY A O   1 
ATOM   1187 N  N   . GLU A 1 153 ? 30.481  23.002 19.601 1.00 13.28 ? 153 GLU A N   1 
ATOM   1188 C  CA  . GLU A 1 153 ? 30.309  22.615 21.000 1.00 16.13 ? 153 GLU A CA  1 
ATOM   1189 C  C   . GLU A 1 153 ? 30.278  23.761 22.013 1.00 14.98 ? 153 GLU A C   1 
ATOM   1190 O  O   . GLU A 1 153 ? 29.413  23.806 22.889 1.00 12.91 ? 153 GLU A O   1 
ATOM   1191 C  CB  . GLU A 1 153 ? 31.429  21.654 21.407 1.00 19.02 ? 153 GLU A CB  1 
ATOM   1192 C  CG  . GLU A 1 153 ? 31.372  20.269 20.783 1.00 25.28 ? 153 GLU A CG  1 
ATOM   1193 C  CD  . GLU A 1 153 ? 30.190  19.453 21.277 1.00 27.44 ? 153 GLU A CD  1 
ATOM   1194 O  OE1 . GLU A 1 153 ? 29.938  19.456 22.502 1.00 29.39 ? 153 GLU A OE1 1 
ATOM   1195 O  OE2 . GLU A 1 153 ? 29.528  18.793 20.448 1.00 28.76 ? 153 GLU A OE2 1 
ATOM   1196 N  N   . ALA A 1 154 ? 31.237  24.670 21.898 1.00 14.14 ? 154 ALA A N   1 
ATOM   1197 C  CA  . ALA A 1 154 ? 31.347  25.791 22.821 1.00 15.10 ? 154 ALA A CA  1 
ATOM   1198 C  C   . ALA A 1 154 ? 30.054  26.592 22.979 1.00 14.87 ? 154 ALA A C   1 
ATOM   1199 O  O   . ALA A 1 154 ? 29.670  26.953 24.095 1.00 12.75 ? 154 ALA A O   1 
ATOM   1200 C  CB  . ALA A 1 154 ? 32.483  26.709 22.381 1.00 15.60 ? 154 ALA A CB  1 
ATOM   1201 N  N   . ILE A 1 155 ? 29.380  26.856 21.866 1.00 13.29 ? 155 ILE A N   1 
ATOM   1202 C  CA  . ILE A 1 155 ? 28.148  27.626 21.902 1.00 11.25 ? 155 ILE A CA  1 
ATOM   1203 C  C   . ILE A 1 155 ? 26.866  26.807 22.071 1.00 11.15 ? 155 ILE A C   1 
ATOM   1204 O  O   . ILE A 1 155 ? 26.073  27.079 22.978 1.00 8.93  ? 155 ILE A O   1 
ATOM   1205 C  CB  . ILE A 1 155 ? 28.001  28.491 20.630 1.00 13.89 ? 155 ILE A CB  1 
ATOM   1206 C  CG1 . ILE A 1 155 ? 29.182  29.462 20.523 1.00 12.95 ? 155 ILE A CG1 1 
ATOM   1207 C  CG2 . ILE A 1 155 ? 26.679  29.255 20.670 1.00 13.54 ? 155 ILE A CG2 1 
ATOM   1208 C  CD1 . ILE A 1 155 ? 29.115  30.390 19.329 1.00 12.55 ? 155 ILE A CD1 1 
ATOM   1209 N  N   . SER A 1 156 ? 26.668  25.802 21.220 1.00 8.96  ? 156 SER A N   1 
ATOM   1210 C  CA  . SER A 1 156 ? 25.441  25.001 21.262 1.00 9.47  ? 156 SER A CA  1 
ATOM   1211 C  C   . SER A 1 156 ? 25.458  23.745 22.121 1.00 8.35  ? 156 SER A C   1 
ATOM   1212 O  O   . SER A 1 156 ? 24.399  23.185 22.416 1.00 8.67  ? 156 SER A O   1 
ATOM   1213 C  CB  . SER A 1 156 ? 25.039  24.584 19.846 1.00 10.36 ? 156 SER A CB  1 
ATOM   1214 O  OG  . SER A 1 156 ? 25.922  23.589 19.357 1.00 9.92  ? 156 SER A OG  1 
ATOM   1215 N  N   . GLY A 1 157 ? 26.646  23.287 22.502 1.00 9.17  ? 157 GLY A N   1 
ATOM   1216 C  CA  . GLY A 1 157 ? 26.743  22.073 23.300 1.00 8.38  ? 157 GLY A CA  1 
ATOM   1217 C  C   . GLY A 1 157 ? 26.731  20.835 22.416 1.00 8.90  ? 157 GLY A C   1 
ATOM   1218 O  O   . GLY A 1 157 ? 26.779  19.699 22.902 1.00 8.97  ? 157 GLY A O   1 
ATOM   1219 N  N   . ALA A 1 158 ? 26.665  21.056 21.107 1.00 7.42  ? 158 ALA A N   1 
ATOM   1220 C  CA  . ALA A 1 158 ? 26.650  19.963 20.138 1.00 8.59  ? 158 ALA A CA  1 
ATOM   1221 C  C   . ALA A 1 158 ? 27.501  20.341 18.926 1.00 8.13  ? 158 ALA A C   1 
ATOM   1222 O  O   . ALA A 1 158 ? 27.964  21.474 18.815 1.00 6.89  ? 158 ALA A O   1 
ATOM   1223 C  CB  . ALA A 1 158 ? 25.211  19.671 19.703 1.00 7.74  ? 158 ALA A CB  1 
ATOM   1224 N  N   . SER A 1 159 ? 27.712  19.395 18.019 1.00 8.41  ? 159 SER A N   1 
ATOM   1225 C  CA  . SER A 1 159 ? 28.509  19.673 16.831 1.00 10.90 ? 159 SER A CA  1 
ATOM   1226 C  C   . SER A 1 159 ? 28.281  18.618 15.764 1.00 11.34 ? 159 SER A C   1 
ATOM   1227 O  O   . SER A 1 159 ? 27.735  17.552 16.037 1.00 11.71 ? 159 SER A O   1 
ATOM   1228 C  CB  . SER A 1 159 ? 29.998  19.737 17.181 1.00 11.82 ? 159 SER A CB  1 
ATOM   1229 O  OG  . SER A 1 159 ? 30.466  18.492 17.667 1.00 13.17 ? 159 SER A OG  1 
ATOM   1230 N  N   . GLY A 1 160 ? 28.707  18.925 14.545 1.00 11.54 ? 160 GLY A N   1 
ATOM   1231 C  CA  . GLY A 1 160 ? 28.530  17.997 13.446 1.00 11.46 ? 160 GLY A CA  1 
ATOM   1232 C  C   . GLY A 1 160 ? 27.667  18.586 12.347 1.00 10.47 ? 160 GLY A C   1 
ATOM   1233 O  O   . GLY A 1 160 ? 26.981  19.584 12.557 1.00 11.21 ? 160 GLY A O   1 
ATOM   1234 N  N   . PHE A 1 161 ? 27.708  17.965 11.173 1.00 11.00 ? 161 PHE A N   1 
ATOM   1235 C  CA  . PHE A 1 161 ? 26.926  18.408 10.024 1.00 9.61  ? 161 PHE A CA  1 
ATOM   1236 C  C   . PHE A 1 161 ? 25.523  17.823 10.131 1.00 9.13  ? 161 PHE A C   1 
ATOM   1237 O  O   . PHE A 1 161 ? 25.347  16.608 10.097 1.00 9.84  ? 161 PHE A O   1 
ATOM   1238 C  CB  . PHE A 1 161 ? 27.563  17.924 8.725  1.00 10.12 ? 161 PHE A CB  1 
ATOM   1239 C  CG  . PHE A 1 161 ? 26.816  18.349 7.495  1.00 9.49  ? 161 PHE A CG  1 
ATOM   1240 C  CD1 . PHE A 1 161 ? 26.833  19.676 7.081  1.00 9.93  ? 161 PHE A CD1 1 
ATOM   1241 C  CD2 . PHE A 1 161 ? 26.082  17.426 6.758  1.00 10.73 ? 161 PHE A CD2 1 
ATOM   1242 C  CE1 . PHE A 1 161 ? 26.128  20.081 5.946  1.00 10.89 ? 161 PHE A CE1 1 
ATOM   1243 C  CE2 . PHE A 1 161 ? 25.371  17.817 5.619  1.00 10.76 ? 161 PHE A CE2 1 
ATOM   1244 C  CZ  . PHE A 1 161 ? 25.395  19.147 5.213  1.00 11.38 ? 161 PHE A CZ  1 
ATOM   1245 N  N   . PRO A 1 162 ? 24.506  18.684 10.257 1.00 7.91  ? 162 PRO A N   1 
ATOM   1246 C  CA  . PRO A 1 162 ? 23.125  18.217 10.373 1.00 8.24  ? 162 PRO A CA  1 
ATOM   1247 C  C   . PRO A 1 162 ? 22.570  17.576 9.101  1.00 8.70  ? 162 PRO A C   1 
ATOM   1248 O  O   . PRO A 1 162 ? 22.383  18.244 8.083  1.00 10.02 ? 162 PRO A O   1 
ATOM   1249 C  CB  . PRO A 1 162 ? 22.381  19.491 10.771 1.00 7.18  ? 162 PRO A CB  1 
ATOM   1250 C  CG  . PRO A 1 162 ? 23.140  20.532 9.983  1.00 8.99  ? 162 PRO A CG  1 
ATOM   1251 C  CD  . PRO A 1 162 ? 24.559  20.152 10.351 1.00 5.51  ? 162 PRO A CD  1 
ATOM   1252 N  N   . ILE A 1 163 ? 22.315  16.273 9.172  1.00 7.95  ? 163 ILE A N   1 
ATOM   1253 C  CA  . ILE A 1 163 ? 21.760  15.522 8.050  1.00 7.33  ? 163 ILE A CA  1 
ATOM   1254 C  C   . ILE A 1 163 ? 20.269  15.845 7.986  1.00 7.84  ? 163 ILE A C   1 
ATOM   1255 O  O   . ILE A 1 163 ? 19.714  16.149 6.929  1.00 7.10  ? 163 ILE A O   1 
ATOM   1256 C  CB  . ILE A 1 163 ? 21.934  13.990 8.269  1.00 7.50  ? 163 ILE A CB  1 
ATOM   1257 C  CG1 . ILE A 1 163 ? 23.423  13.635 8.318  1.00 5.57  ? 163 ILE A CG1 1 
ATOM   1258 C  CG2 . ILE A 1 163 ? 21.241  13.208 7.157  1.00 8.08  ? 163 ILE A CG2 1 
ATOM   1259 C  CD1 . ILE A 1 163 ? 24.159  13.970 7.047  1.00 5.16  ? 163 ILE A CD1 1 
ATOM   1260 N  N   . MET A 1 164 ? 19.640  15.804 9.152  1.00 8.52  ? 164 MET A N   1 
ATOM   1261 C  CA  . MET A 1 164 ? 18.220  16.063 9.278  1.00 9.49  ? 164 MET A CA  1 
ATOM   1262 C  C   . MET A 1 164 ? 17.919  16.551 10.700 1.00 7.79  ? 164 MET A C   1 
ATOM   1263 O  O   . MET A 1 164 ? 18.746  16.393 11.592 1.00 7.47  ? 164 MET A O   1 
ATOM   1264 C  CB  . MET A 1 164 ? 17.466  14.774 8.915  1.00 9.54  ? 164 MET A CB  1 
ATOM   1265 C  CG  . MET A 1 164 ? 16.141  14.558 9.601  1.00 16.40 ? 164 MET A CG  1 
ATOM   1266 S  SD  . MET A 1 164 ? 16.347  13.859 11.247 1.00 12.84 ? 164 MET A SD  1 
ATOM   1267 C  CE  . MET A 1 164 ? 16.968  12.243 10.874 1.00 19.61 ? 164 MET A CE  1 
ATOM   1268 N  N   . GLY A 1 165 ? 16.753  17.162 10.901 1.00 8.83  ? 165 GLY A N   1 
ATOM   1269 C  CA  . GLY A 1 165 ? 16.393  17.661 12.222 1.00 7.92  ? 165 GLY A CA  1 
ATOM   1270 C  C   . GLY A 1 165 ? 14.902  17.909 12.453 1.00 8.05  ? 165 GLY A C   1 
ATOM   1271 O  O   . GLY A 1 165 ? 14.136  18.110 11.503 1.00 4.08  ? 165 GLY A O   1 
ATOM   1272 N  N   . LEU A 1 166 ? 14.496  17.886 13.724 1.00 6.36  ? 166 LEU A N   1 
ATOM   1273 C  CA  . LEU A 1 166 ? 13.108  18.114 14.113 1.00 6.42  ? 166 LEU A CA  1 
ATOM   1274 C  C   . LEU A 1 166 ? 12.970  19.298 15.069 1.00 6.34  ? 166 LEU A C   1 
ATOM   1275 O  O   . LEU A 1 166 ? 13.629  19.349 16.105 1.00 6.66  ? 166 LEU A O   1 
ATOM   1276 C  CB  . LEU A 1 166 ? 12.521  16.875 14.796 1.00 5.27  ? 166 LEU A CB  1 
ATOM   1277 C  CG  . LEU A 1 166 ? 11.076  17.069 15.278 1.00 6.09  ? 166 LEU A CG  1 
ATOM   1278 C  CD1 . LEU A 1 166 ? 10.198  17.393 14.087 1.00 4.37  ? 166 LEU A CD1 1 
ATOM   1279 C  CD2 . LEU A 1 166 ? 10.566  15.819 15.982 1.00 7.11  ? 166 LEU A CD2 1 
ATOM   1280 N  N   . ASP A 1 167 ? 12.097  20.236 14.712 1.00 4.91  ? 167 ASP A N   1 
ATOM   1281 C  CA  . ASP A 1 167 ? 11.834  21.421 15.520 1.00 4.99  ? 167 ASP A CA  1 
ATOM   1282 C  C   . ASP A 1 167 ? 10.883  21.037 16.658 1.00 5.11  ? 167 ASP A C   1 
ATOM   1283 O  O   . ASP A 1 167 ? 9.754   20.605 16.405 1.00 2.43  ? 167 ASP A O   1 
ATOM   1284 C  CB  . ASP A 1 167 ? 11.193  22.497 14.628 1.00 7.59  ? 167 ASP A CB  1 
ATOM   1285 C  CG  . ASP A 1 167 ? 10.967  23.818 15.349 1.00 10.23 ? 167 ASP A CG  1 
ATOM   1286 O  OD1 . ASP A 1 167 ? 11.377  23.951 16.519 1.00 9.75  ? 167 ASP A OD1 1 
ATOM   1287 O  OD2 . ASP A 1 167 ? 10.381  24.736 14.729 1.00 11.11 ? 167 ASP A OD2 1 
ATOM   1288 N  N   . VAL A 1 168 ? 11.332  21.162 17.907 1.00 4.95  ? 168 VAL A N   1 
ATOM   1289 C  CA  . VAL A 1 168 ? 10.444  20.828 19.016 1.00 4.82  ? 168 VAL A CA  1 
ATOM   1290 C  C   . VAL A 1 168 ? 9.959   22.023 19.837 1.00 6.83  ? 168 VAL A C   1 
ATOM   1291 O  O   . VAL A 1 168 ? 9.560   21.875 20.994 1.00 7.89  ? 168 VAL A O   1 
ATOM   1292 C  CB  . VAL A 1 168 ? 11.041  19.736 19.958 1.00 5.18  ? 168 VAL A CB  1 
ATOM   1293 C  CG1 . VAL A 1 168 ? 11.126  18.404 19.207 1.00 2.36  ? 168 VAL A CG1 1 
ATOM   1294 C  CG2 . VAL A 1 168 ? 12.404  20.151 20.482 1.00 2.60  ? 168 VAL A CG2 1 
ATOM   1295 N  N   . TRP A 1 169 ? 9.999   23.212 19.242 1.00 6.44  ? 169 TRP A N   1 
ATOM   1296 C  CA  . TRP A 1 169 ? 9.469   24.386 19.922 1.00 5.34  ? 169 TRP A CA  1 
ATOM   1297 C  C   . TRP A 1 169 ? 7.980   24.082 19.918 1.00 7.71  ? 169 TRP A C   1 
ATOM   1298 O  O   . TRP A 1 169 ? 7.482   23.427 18.992 1.00 4.78  ? 169 TRP A O   1 
ATOM   1299 C  CB  . TRP A 1 169 ? 9.715   25.663 19.119 1.00 5.22  ? 169 TRP A CB  1 
ATOM   1300 C  CG  . TRP A 1 169 ? 11.078  26.247 19.258 1.00 6.16  ? 169 TRP A CG  1 
ATOM   1301 C  CD1 . TRP A 1 169 ? 12.271  25.616 19.051 1.00 5.89  ? 169 TRP A CD1 1 
ATOM   1302 C  CD2 . TRP A 1 169 ? 11.393  27.610 19.571 1.00 5.79  ? 169 TRP A CD2 1 
ATOM   1303 N  NE1 . TRP A 1 169 ? 13.312  26.505 19.210 1.00 6.25  ? 169 TRP A NE1 1 
ATOM   1304 C  CE2 . TRP A 1 169 ? 12.801  27.735 19.529 1.00 7.07  ? 169 TRP A CE2 1 
ATOM   1305 C  CE3 . TRP A 1 169 ? 10.621  28.740 19.879 1.00 6.91  ? 169 TRP A CE3 1 
ATOM   1306 C  CZ2 . TRP A 1 169 ? 13.454  28.947 19.785 1.00 4.42  ? 169 TRP A CZ2 1 
ATOM   1307 C  CZ3 . TRP A 1 169 ? 11.270  29.945 20.131 1.00 3.16  ? 169 TRP A CZ3 1 
ATOM   1308 C  CH2 . TRP A 1 169 ? 12.673  30.037 20.083 1.00 6.20  ? 169 TRP A CH2 1 
ATOM   1309 N  N   . GLU A 1 170 ? 7.264   24.548 20.932 1.00 7.35  ? 170 GLU A N   1 
ATOM   1310 C  CA  . GLU A 1 170 ? 5.841   24.269 20.996 1.00 8.63  ? 170 GLU A CA  1 
ATOM   1311 C  C   . GLU A 1 170 ? 5.046   24.818 19.818 1.00 7.95  ? 170 GLU A C   1 
ATOM   1312 O  O   . GLU A 1 170 ? 4.039   24.223 19.435 1.00 10.30 ? 170 GLU A O   1 
ATOM   1313 C  CB  . GLU A 1 170 ? 5.265   24.760 22.332 1.00 6.49  ? 170 GLU A CB  1 
ATOM   1314 C  CG  . GLU A 1 170 ? 5.844   23.998 23.509 1.00 7.41  ? 170 GLU A CG  1 
ATOM   1315 C  CD  . GLU A 1 170 ? 5.317   24.467 24.852 1.00 7.34  ? 170 GLU A CD  1 
ATOM   1316 O  OE1 . GLU A 1 170 ? 5.362   25.685 25.112 1.00 3.57  ? 170 GLU A OE1 1 
ATOM   1317 O  OE2 . GLU A 1 170 ? 4.878   23.613 25.654 1.00 8.66  ? 170 GLU A OE2 1 
ATOM   1318 N  N   . HIS A 1 171 ? 5.502   25.918 19.220 1.00 7.13  ? 171 HIS A N   1 
ATOM   1319 C  CA  . HIS A 1 171 ? 4.785   26.498 18.081 1.00 7.49  ? 171 HIS A CA  1 
ATOM   1320 C  C   . HIS A 1 171 ? 4.743   25.577 16.865 1.00 7.23  ? 171 HIS A C   1 
ATOM   1321 O  O   . HIS A 1 171 ? 3.874   25.714 16.000 1.00 9.00  ? 171 HIS A O   1 
ATOM   1322 C  CB  . HIS A 1 171 ? 5.386   27.862 17.682 1.00 8.55  ? 171 HIS A CB  1 
ATOM   1323 C  CG  . HIS A 1 171 ? 6.789   27.798 17.156 1.00 8.97  ? 171 HIS A CG  1 
ATOM   1324 N  ND1 . HIS A 1 171 ? 7.798   28.603 17.640 1.00 9.35  ? 171 HIS A ND1 1 
ATOM   1325 C  CD2 . HIS A 1 171 ? 7.337   27.079 16.145 1.00 8.68  ? 171 HIS A CD2 1 
ATOM   1326 C  CE1 . HIS A 1 171 ? 8.906   28.384 16.952 1.00 7.45  ? 171 HIS A CE1 1 
ATOM   1327 N  NE2 . HIS A 1 171 ? 8.652   27.463 16.039 1.00 8.31  ? 171 HIS A NE2 1 
ATOM   1328 N  N   . ALA A 1 172 ? 5.672   24.630 16.803 1.00 6.26  ? 172 ALA A N   1 
ATOM   1329 C  CA  . ALA A 1 172 ? 5.729   23.697 15.687 1.00 6.76  ? 172 ALA A CA  1 
ATOM   1330 C  C   . ALA A 1 172 ? 4.703   22.574 15.812 1.00 8.83  ? 172 ALA A C   1 
ATOM   1331 O  O   . ALA A 1 172 ? 4.467   21.834 14.852 1.00 8.64  ? 172 ALA A O   1 
ATOM   1332 C  CB  . ALA A 1 172 ? 7.131   23.103 15.576 1.00 4.11  ? 172 ALA A CB  1 
ATOM   1333 N  N   . TYR A 1 173 ? 4.079   22.444 16.981 1.00 8.16  ? 173 TYR A N   1 
ATOM   1334 C  CA  . TYR A 1 173 ? 3.119   21.364 17.147 1.00 7.98  ? 173 TYR A CA  1 
ATOM   1335 C  C   . TYR A 1 173 ? 1.936   21.609 18.078 1.00 7.66  ? 173 TYR A C   1 
ATOM   1336 O  O   . TYR A 1 173 ? 1.098   20.723 18.235 1.00 6.75  ? 173 TYR A O   1 
ATOM   1337 C  CB  . TYR A 1 173 ? 3.867   20.109 17.611 1.00 6.92  ? 173 TYR A CB  1 
ATOM   1338 C  CG  . TYR A 1 173 ? 4.503   20.225 18.989 1.00 7.12  ? 173 TYR A CG  1 
ATOM   1339 C  CD1 . TYR A 1 173 ? 3.735   20.118 20.147 1.00 5.66  ? 173 TYR A CD1 1 
ATOM   1340 C  CD2 . TYR A 1 173 ? 5.869   20.457 19.129 1.00 8.06  ? 173 TYR A CD2 1 
ATOM   1341 C  CE1 . TYR A 1 173 ? 4.311   20.235 21.411 1.00 7.11  ? 173 TYR A CE1 1 
ATOM   1342 C  CE2 . TYR A 1 173 ? 6.457   20.578 20.392 1.00 8.31  ? 173 TYR A CE2 1 
ATOM   1343 C  CZ  . TYR A 1 173 ? 5.673   20.464 21.524 1.00 8.27  ? 173 TYR A CZ  1 
ATOM   1344 O  OH  . TYR A 1 173 ? 6.255   20.566 22.766 1.00 7.25  ? 173 TYR A OH  1 
ATOM   1345 N  N   . TYR A 1 174 ? 1.835   22.796 18.672 1.00 7.92  ? 174 TYR A N   1 
ATOM   1346 C  CA  . TYR A 1 174 ? 0.745   23.031 19.616 1.00 7.15  ? 174 TYR A CA  1 
ATOM   1347 C  C   . TYR A 1 174 ? -0.679  23.064 19.076 1.00 7.07  ? 174 TYR A C   1 
ATOM   1348 O  O   . TYR A 1 174 ? -1.582  22.510 19.696 1.00 7.21  ? 174 TYR A O   1 
ATOM   1349 C  CB  . TYR A 1 174 ? 0.988   24.298 20.437 1.00 4.65  ? 174 TYR A CB  1 
ATOM   1350 C  CG  . TYR A 1 174 ? 0.612   24.072 21.878 1.00 6.22  ? 174 TYR A CG  1 
ATOM   1351 C  CD1 . TYR A 1 174 ? 1.432   23.305 22.711 1.00 7.70  ? 174 TYR A CD1 1 
ATOM   1352 C  CD2 . TYR A 1 174 ? -0.618  24.501 22.380 1.00 5.72  ? 174 TYR A CD2 1 
ATOM   1353 C  CE1 . TYR A 1 174 ? 1.037   22.963 24.003 1.00 7.44  ? 174 TYR A CE1 1 
ATOM   1354 C  CE2 . TYR A 1 174 ? -1.025  24.163 23.674 1.00 6.81  ? 174 TYR A CE2 1 
ATOM   1355 C  CZ  . TYR A 1 174 ? -0.194  23.392 24.479 1.00 7.95  ? 174 TYR A CZ  1 
ATOM   1356 O  OH  . TYR A 1 174 ? -0.588  23.041 25.754 1.00 6.86  ? 174 TYR A OH  1 
ATOM   1357 N  N   . LEU A 1 175 ? -0.895  23.703 17.933 1.00 6.84  ? 175 LEU A N   1 
ATOM   1358 C  CA  . LEU A 1 175 ? -2.245  23.779 17.384 1.00 9.27  ? 175 LEU A CA  1 
ATOM   1359 C  C   . LEU A 1 175 ? -2.900  22.418 17.148 1.00 10.26 ? 175 LEU A C   1 
ATOM   1360 O  O   . LEU A 1 175 ? -4.104  22.259 17.351 1.00 11.41 ? 175 LEU A O   1 
ATOM   1361 C  CB  . LEU A 1 175 ? -2.252  24.583 16.079 1.00 5.19  ? 175 LEU A CB  1 
ATOM   1362 C  CG  . LEU A 1 175 ? -1.895  26.063 16.208 1.00 5.83  ? 175 LEU A CG  1 
ATOM   1363 C  CD1 . LEU A 1 175 ? -1.979  26.740 14.847 1.00 2.36  ? 175 LEU A CD1 1 
ATOM   1364 C  CD2 . LEU A 1 175 ? -2.851  26.726 17.186 1.00 5.09  ? 175 LEU A CD2 1 
ATOM   1365 N  N   . LYS A 1 176 ? -2.112  21.437 16.729 1.00 10.60 ? 176 LYS A N   1 
ATOM   1366 C  CA  . LYS A 1 176 ? -2.650  20.116 16.458 1.00 10.74 ? 176 LYS A CA  1 
ATOM   1367 C  C   . LYS A 1 176 ? -2.463  19.105 17.582 1.00 10.78 ? 176 LYS A C   1 
ATOM   1368 O  O   . LYS A 1 176 ? -3.370  18.329 17.882 1.00 11.39 ? 176 LYS A O   1 
ATOM   1369 C  CB  . LYS A 1 176 ? -2.034  19.551 15.172 1.00 11.79 ? 176 LYS A CB  1 
ATOM   1370 C  CG  . LYS A 1 176 ? -2.505  18.135 14.838 1.00 11.72 ? 176 LYS A CG  1 
ATOM   1371 C  CD  . LYS A 1 176 ? -1.929  17.615 13.515 1.00 12.23 ? 176 LYS A CD  1 
ATOM   1372 C  CE  . LYS A 1 176 ? -2.382  16.170 13.265 1.00 12.03 ? 176 LYS A CE  1 
ATOM   1373 N  NZ  . LYS A 1 176 ? -1.915  15.604 11.964 1.00 11.54 ? 176 LYS A NZ  1 
ATOM   1374 N  N   . PHE A 1 177 ? -1.296  19.135 18.218 1.00 11.30 ? 177 PHE A N   1 
ATOM   1375 C  CA  . PHE A 1 177 ? -0.970  18.171 19.265 1.00 10.09 ? 177 PHE A CA  1 
ATOM   1376 C  C   . PHE A 1 177 ? -0.991  18.705 20.696 1.00 10.18 ? 177 PHE A C   1 
ATOM   1377 O  O   . PHE A 1 177 ? -0.984  17.924 21.646 1.00 8.23  ? 177 PHE A O   1 
ATOM   1378 C  CB  . PHE A 1 177 ? 0.414   17.592 18.966 1.00 9.60  ? 177 PHE A CB  1 
ATOM   1379 C  CG  . PHE A 1 177 ? 0.550   17.034 17.573 1.00 9.62  ? 177 PHE A CG  1 
ATOM   1380 C  CD1 . PHE A 1 177 ? 0.140   15.734 17.278 1.00 9.59  ? 177 PHE A CD1 1 
ATOM   1381 C  CD2 . PHE A 1 177 ? 1.057   17.826 16.543 1.00 9.51  ? 177 PHE A CD2 1 
ATOM   1382 C  CE1 . PHE A 1 177 ? 0.236   15.228 15.975 1.00 10.02 ? 177 PHE A CE1 1 
ATOM   1383 C  CE2 . PHE A 1 177 ? 1.156   17.331 15.236 1.00 10.92 ? 177 PHE A CE2 1 
ATOM   1384 C  CZ  . PHE A 1 177 ? 0.746   16.030 14.953 1.00 9.75  ? 177 PHE A CZ  1 
ATOM   1385 N  N   . GLN A 1 178 ? -1.033  20.024 20.852 1.00 10.38 ? 178 GLN A N   1 
ATOM   1386 C  CA  . GLN A 1 178 ? -0.991  20.633 22.180 1.00 10.63 ? 178 GLN A CA  1 
ATOM   1387 C  C   . GLN A 1 178 ? 0.194   20.037 22.951 1.00 10.41 ? 178 GLN A C   1 
ATOM   1388 O  O   . GLN A 1 178 ? 1.291   19.930 22.403 1.00 9.52  ? 178 GLN A O   1 
ATOM   1389 C  CB  . GLN A 1 178 ? -2.299  20.411 22.952 1.00 10.77 ? 178 GLN A CB  1 
ATOM   1390 C  CG  . GLN A 1 178 ? -3.512  21.153 22.392 1.00 11.09 ? 178 GLN A CG  1 
ATOM   1391 C  CD  . GLN A 1 178 ? -4.102  20.499 21.155 1.00 12.76 ? 178 GLN A CD  1 
ATOM   1392 O  OE1 . GLN A 1 178 ? -4.541  19.350 21.203 1.00 14.98 ? 178 GLN A OE1 1 
ATOM   1393 N  NE2 . GLN A 1 178 ? -4.125  21.230 20.044 1.00 13.17 ? 178 GLN A NE2 1 
ATOM   1394 N  N   . ASN A 1 179 ? -0.023  19.634 24.203 1.00 10.58 ? 179 ASN A N   1 
ATOM   1395 C  CA  . ASN A 1 179 ? 1.053   19.069 25.027 1.00 11.24 ? 179 ASN A CA  1 
ATOM   1396 C  C   . ASN A 1 179 ? 1.613   17.717 24.579 1.00 12.33 ? 179 ASN A C   1 
ATOM   1397 O  O   . ASN A 1 179 ? 2.701   17.325 25.007 1.00 12.63 ? 179 ASN A O   1 
ATOM   1398 C  CB  . ASN A 1 179 ? 0.595   18.924 26.485 1.00 11.41 ? 179 ASN A CB  1 
ATOM   1399 C  CG  . ASN A 1 179 ? -0.552  17.941 26.649 1.00 11.15 ? 179 ASN A CG  1 
ATOM   1400 O  OD1 . ASN A 1 179 ? -1.679  18.197 26.220 1.00 9.59  ? 179 ASN A OD1 1 
ATOM   1401 N  ND2 . ASN A 1 179 ? -0.266  16.802 27.267 1.00 10.77 ? 179 ASN A ND2 1 
ATOM   1402 N  N   . ARG A 1 180 ? 0.885   17.008 23.721 1.00 12.17 ? 180 ARG A N   1 
ATOM   1403 C  CA  . ARG A 1 180 ? 1.314   15.687 23.266 1.00 11.86 ? 180 ARG A CA  1 
ATOM   1404 C  C   . ARG A 1 180 ? 2.477   15.684 22.265 1.00 12.37 ? 180 ARG A C   1 
ATOM   1405 O  O   . ARG A 1 180 ? 2.318   15.247 21.122 1.00 13.16 ? 180 ARG A O   1 
ATOM   1406 C  CB  . ARG A 1 180 ? 0.115   14.941 22.669 1.00 12.41 ? 180 ARG A CB  1 
ATOM   1407 C  CG  . ARG A 1 180 ? -1.104  14.869 23.599 1.00 17.46 ? 180 ARG A CG  1 
ATOM   1408 C  CD  . ARG A 1 180 ? -2.270  14.101 22.970 1.00 19.27 ? 180 ARG A CD  1 
ATOM   1409 N  NE  . ARG A 1 180 ? -2.742  14.696 21.719 1.00 21.84 ? 180 ARG A NE  1 
ATOM   1410 C  CZ  . ARG A 1 180 ? -3.384  15.857 21.626 1.00 23.28 ? 180 ARG A CZ  1 
ATOM   1411 N  NH1 . ARG A 1 180 ? -3.643  16.569 22.714 1.00 25.60 ? 180 ARG A NH1 1 
ATOM   1412 N  NH2 . ARG A 1 180 ? -3.767  16.309 20.440 1.00 24.86 ? 180 ARG A NH2 1 
ATOM   1413 N  N   . ARG A 1 181 ? 3.651   16.145 22.695 1.00 11.05 ? 181 ARG A N   1 
ATOM   1414 C  CA  . ARG A 1 181 ? 4.813   16.176 21.807 1.00 11.06 ? 181 ARG A CA  1 
ATOM   1415 C  C   . ARG A 1 181 ? 5.185   14.797 21.245 1.00 9.75  ? 181 ARG A C   1 
ATOM   1416 O  O   . ARG A 1 181 ? 5.643   14.692 20.106 1.00 9.05  ? 181 ARG A O   1 
ATOM   1417 C  CB  . ARG A 1 181 ? 6.041   16.770 22.509 1.00 11.69 ? 181 ARG A CB  1 
ATOM   1418 C  CG  . ARG A 1 181 ? 7.246   16.883 21.569 1.00 8.88  ? 181 ARG A CG  1 
ATOM   1419 C  CD  . ARG A 1 181 ? 8.536   17.250 22.284 1.00 9.87  ? 181 ARG A CD  1 
ATOM   1420 N  NE  . ARG A 1 181 ? 8.488   18.562 22.919 1.00 9.36  ? 181 ARG A NE  1 
ATOM   1421 C  CZ  . ARG A 1 181 ? 9.509   19.107 23.573 1.00 9.27  ? 181 ARG A CZ  1 
ATOM   1422 N  NH1 . ARG A 1 181 ? 10.656  18.453 23.678 1.00 11.34 ? 181 ARG A NH1 1 
ATOM   1423 N  NH2 . ARG A 1 181 ? 9.389   20.310 24.113 1.00 10.26 ? 181 ARG A NH2 1 
ATOM   1424 N  N   . PRO A 1 182 ? 5.031   13.728 22.046 1.00 9.43  ? 182 PRO A N   1 
ATOM   1425 C  CA  . PRO A 1 182 ? 5.365   12.386 21.555 1.00 9.55  ? 182 PRO A CA  1 
ATOM   1426 C  C   . PRO A 1 182 ? 4.577   11.987 20.302 1.00 9.34  ? 182 PRO A C   1 
ATOM   1427 O  O   . PRO A 1 182 ? 5.096   11.272 19.445 1.00 8.32  ? 182 PRO A O   1 
ATOM   1428 C  CB  . PRO A 1 182 ? 5.046   11.501 22.763 1.00 8.80  ? 182 PRO A CB  1 
ATOM   1429 C  CG  . PRO A 1 182 ? 5.365   12.432 23.929 1.00 8.38  ? 182 PRO A CG  1 
ATOM   1430 C  CD  . PRO A 1 182 ? 4.594   13.643 23.450 1.00 8.74  ? 182 PRO A CD  1 
ATOM   1431 N  N   . ASP A 1 183 ? 3.326   12.435 20.196 1.00 9.19  ? 183 ASP A N   1 
ATOM   1432 C  CA  . ASP A 1 183 ? 2.527   12.107 19.018 1.00 9.56  ? 183 ASP A CA  1 
ATOM   1433 C  C   . ASP A 1 183 ? 3.039   12.917 17.828 1.00 9.84  ? 183 ASP A C   1 
ATOM   1434 O  O   . ASP A 1 183 ? 2.984   12.463 16.685 1.00 7.34  ? 183 ASP A O   1 
ATOM   1435 C  CB  . ASP A 1 183 ? 1.038   12.398 19.244 1.00 10.80 ? 183 ASP A CB  1 
ATOM   1436 C  CG  . ASP A 1 183 ? 0.441   11.572 20.373 1.00 12.28 ? 183 ASP A CG  1 
ATOM   1437 O  OD1 . ASP A 1 183 ? 0.834   10.398 20.524 1.00 16.83 ? 183 ASP A OD1 1 
ATOM   1438 O  OD2 . ASP A 1 183 ? -0.443  12.081 21.089 1.00 12.29 ? 183 ASP A OD2 1 
ATOM   1439 N  N   . TYR A 1 184 ? 3.529   14.123 18.108 1.00 7.40  ? 184 TYR A N   1 
ATOM   1440 C  CA  . TYR A 1 184 ? 4.085   14.989 17.074 1.00 8.67  ? 184 TYR A CA  1 
ATOM   1441 C  C   . TYR A 1 184 ? 5.355   14.346 16.531 1.00 8.74  ? 184 TYR A C   1 
ATOM   1442 O  O   . TYR A 1 184 ? 5.593   14.333 15.330 1.00 9.81  ? 184 TYR A O   1 
ATOM   1443 C  CB  . TYR A 1 184 ? 4.406   16.364 17.661 1.00 6.62  ? 184 TYR A CB  1 
ATOM   1444 C  CG  . TYR A 1 184 ? 5.284   17.234 16.795 1.00 5.79  ? 184 TYR A CG  1 
ATOM   1445 C  CD1 . TYR A 1 184 ? 4.902   17.588 15.500 1.00 7.12  ? 184 TYR A CD1 1 
ATOM   1446 C  CD2 . TYR A 1 184 ? 6.480   17.744 17.290 1.00 5.62  ? 184 TYR A CD2 1 
ATOM   1447 C  CE1 . TYR A 1 184 ? 5.692   18.433 14.725 1.00 5.96  ? 184 TYR A CE1 1 
ATOM   1448 C  CE2 . TYR A 1 184 ? 7.276   18.588 16.527 1.00 6.54  ? 184 TYR A CE2 1 
ATOM   1449 C  CZ  . TYR A 1 184 ? 6.878   18.931 15.250 1.00 6.64  ? 184 TYR A CZ  1 
ATOM   1450 O  OH  . TYR A 1 184 ? 7.661   19.785 14.508 1.00 11.18 ? 184 TYR A OH  1 
ATOM   1451 N  N   . ILE A 1 185 ? 6.165   13.806 17.433 1.00 9.76  ? 185 ILE A N   1 
ATOM   1452 C  CA  . ILE A 1 185 ? 7.409   13.153 17.056 1.00 10.04 ? 185 ILE A CA  1 
ATOM   1453 C  C   . ILE A 1 185 ? 7.124   11.900 16.222 1.00 11.36 ? 185 ILE A C   1 
ATOM   1454 O  O   . ILE A 1 185 ? 7.859   11.598 15.275 1.00 10.70 ? 185 ILE A O   1 
ATOM   1455 C  CB  . ILE A 1 185 ? 8.225   12.814 18.320 1.00 9.57  ? 185 ILE A CB  1 
ATOM   1456 C  CG1 . ILE A 1 185 ? 8.633   14.121 19.008 1.00 7.14  ? 185 ILE A CG1 1 
ATOM   1457 C  CG2 . ILE A 1 185 ? 9.452   11.985 17.962 1.00 12.10 ? 185 ILE A CG2 1 
ATOM   1458 C  CD1 . ILE A 1 185 ? 9.291   13.935 20.353 1.00 7.95  ? 185 ILE A CD1 1 
ATOM   1459 N  N   . LYS A 1 186 ? 6.052   11.184 16.559 1.00 10.70 ? 186 LYS A N   1 
ATOM   1460 C  CA  . LYS A 1 186 ? 5.677   9.987  15.807 1.00 11.86 ? 186 LYS A CA  1 
ATOM   1461 C  C   . LYS A 1 186 ? 5.321   10.369 14.371 1.00 11.50 ? 186 LYS A C   1 
ATOM   1462 O  O   . LYS A 1 186 ? 5.759   9.714  13.421 1.00 10.08 ? 186 LYS A O   1 
ATOM   1463 C  CB  . LYS A 1 186 ? 4.481   9.284  16.459 1.00 16.80 ? 186 LYS A CB  1 
ATOM   1464 C  CG  . LYS A 1 186 ? 4.771   8.671  17.828 1.00 21.99 ? 186 LYS A CG  1 
ATOM   1465 C  CD  . LYS A 1 186 ? 5.844   7.599  17.727 1.00 26.60 ? 186 LYS A CD  1 
ATOM   1466 C  CE  . LYS A 1 186 ? 6.146   6.973  19.077 1.00 29.23 ? 186 LYS A CE  1 
ATOM   1467 N  NZ  . LYS A 1 186 ? 7.206   5.928  18.966 1.00 31.39 ? 186 LYS A NZ  1 
ATOM   1468 N  N   . GLU A 1 187 ? 4.529   11.431 14.219 1.00 9.16  ? 187 GLU A N   1 
ATOM   1469 C  CA  . GLU A 1 187 ? 4.126   11.905 12.900 1.00 9.56  ? 187 GLU A CA  1 
ATOM   1470 C  C   . GLU A 1 187 ? 5.326   12.304 12.057 1.00 8.66  ? 187 GLU A C   1 
ATOM   1471 O  O   . GLU A 1 187 ? 5.318   12.149 10.837 1.00 7.53  ? 187 GLU A O   1 
ATOM   1472 C  CB  . GLU A 1 187 ? 3.178   13.103 13.013 1.00 9.39  ? 187 GLU A CB  1 
ATOM   1473 C  CG  . GLU A 1 187 ? 1.748   12.771 13.412 1.00 12.92 ? 187 GLU A CG  1 
ATOM   1474 C  CD  . GLU A 1 187 ? 1.070   11.823 12.437 1.00 13.46 ? 187 GLU A CD  1 
ATOM   1475 O  OE1 . GLU A 1 187 ? 1.278   11.967 11.219 1.00 14.83 ? 187 GLU A OE1 1 
ATOM   1476 O  OE2 . GLU A 1 187 ? 0.309   10.946 12.886 1.00 18.98 ? 187 GLU A OE2 1 
ATOM   1477 N  N   . PHE A 1 188 ? 6.355   12.822 12.714 1.00 8.70  ? 188 PHE A N   1 
ATOM   1478 C  CA  . PHE A 1 188 ? 7.562   13.243 12.019 1.00 9.00  ? 188 PHE A CA  1 
ATOM   1479 C  C   . PHE A 1 188 ? 8.122   12.126 11.137 1.00 8.75  ? 188 PHE A C   1 
ATOM   1480 O  O   . PHE A 1 188 ? 8.640   12.382 10.050 1.00 10.90 ? 188 PHE A O   1 
ATOM   1481 C  CB  . PHE A 1 188 ? 8.622   13.693 13.027 1.00 5.45  ? 188 PHE A CB  1 
ATOM   1482 C  CG  . PHE A 1 188 ? 9.900   14.140 12.390 1.00 5.98  ? 188 PHE A CG  1 
ATOM   1483 C  CD1 . PHE A 1 188 ? 9.901   15.168 11.450 1.00 6.62  ? 188 PHE A CD1 1 
ATOM   1484 C  CD2 . PHE A 1 188 ? 11.106  13.532 12.718 1.00 5.73  ? 188 PHE A CD2 1 
ATOM   1485 C  CE1 . PHE A 1 188 ? 11.086  15.582 10.843 1.00 5.54  ? 188 PHE A CE1 1 
ATOM   1486 C  CE2 . PHE A 1 188 ? 12.298  13.940 12.117 1.00 8.34  ? 188 PHE A CE2 1 
ATOM   1487 C  CZ  . PHE A 1 188 ? 12.285  14.967 11.178 1.00 6.35  ? 188 PHE A CZ  1 
ATOM   1488 N  N   . TRP A 1 189 ? 8.021   10.889 11.605 1.00 8.19  ? 189 TRP A N   1 
ATOM   1489 C  CA  . TRP A 1 189 ? 8.509   9.754  10.832 1.00 8.65  ? 189 TRP A CA  1 
ATOM   1490 C  C   . TRP A 1 189 ? 7.768   9.641  9.500  1.00 7.60  ? 189 TRP A C   1 
ATOM   1491 O  O   . TRP A 1 189 ? 8.300   9.098  8.537  1.00 5.66  ? 189 TRP A O   1 
ATOM   1492 C  CB  . TRP A 1 189 ? 8.351   8.459  11.641 1.00 9.03  ? 189 TRP A CB  1 
ATOM   1493 C  CG  . TRP A 1 189 ? 9.247   8.400  12.846 1.00 9.39  ? 189 TRP A CG  1 
ATOM   1494 C  CD1 . TRP A 1 189 ? 8.911   7.968  14.099 1.00 8.25  ? 189 TRP A CD1 1 
ATOM   1495 C  CD2 . TRP A 1 189 ? 10.632  8.778  12.910 1.00 8.67  ? 189 TRP A CD2 1 
ATOM   1496 N  NE1 . TRP A 1 189 ? 9.999   8.058  14.937 1.00 11.41 ? 189 TRP A NE1 1 
ATOM   1497 C  CE2 . TRP A 1 189 ? 11.067  8.551  14.232 1.00 7.91  ? 189 TRP A CE2 1 
ATOM   1498 C  CE3 . TRP A 1 189 ? 11.547  9.286  11.974 1.00 9.02  ? 189 TRP A CE3 1 
ATOM   1499 C  CZ2 . TRP A 1 189 ? 12.377  8.816  14.646 1.00 8.62  ? 189 TRP A CZ2 1 
ATOM   1500 C  CZ3 . TRP A 1 189 ? 12.848  9.549  12.382 1.00 8.63  ? 189 TRP A CZ3 1 
ATOM   1501 C  CH2 . TRP A 1 189 ? 13.251  9.314  13.710 1.00 10.36 ? 189 TRP A CH2 1 
ATOM   1502 N  N   . ASN A 1 190 ? 6.544   10.165 9.440  1.00 7.22  ? 190 ASN A N   1 
ATOM   1503 C  CA  . ASN A 1 190 ? 5.766   10.103 8.203  1.00 6.97  ? 190 ASN A CA  1 
ATOM   1504 C  C   . ASN A 1 190 ? 6.126   11.216 7.220  1.00 7.19  ? 190 ASN A C   1 
ATOM   1505 O  O   . ASN A 1 190 ? 5.770   11.146 6.041  1.00 7.43  ? 190 ASN A O   1 
ATOM   1506 C  CB  . ASN A 1 190 ? 4.260   10.165 8.500  1.00 6.96  ? 190 ASN A CB  1 
ATOM   1507 C  CG  . ASN A 1 190 ? 3.753   8.932  9.237  1.00 9.59  ? 190 ASN A CG  1 
ATOM   1508 O  OD1 . ASN A 1 190 ? 3.868   7.805  8.744  1.00 10.65 ? 190 ASN A OD1 1 
ATOM   1509 N  ND2 . ASN A 1 190 ? 3.187   9.140  10.417 1.00 4.50  ? 190 ASN A ND2 1 
ATOM   1510 N  N   . VAL A 1 191 ? 6.830   12.238 7.694  1.00 5.08  ? 191 VAL A N   1 
ATOM   1511 C  CA  . VAL A 1 191 ? 7.189   13.345 6.821  1.00 5.51  ? 191 VAL A CA  1 
ATOM   1512 C  C   . VAL A 1 191 ? 8.669   13.689 6.703  1.00 5.62  ? 191 VAL A C   1 
ATOM   1513 O  O   . VAL A 1 191 ? 9.027   14.611 5.973  1.00 7.17  ? 191 VAL A O   1 
ATOM   1514 C  CB  . VAL A 1 191 ? 6.413   14.631 7.208  1.00 4.83  ? 191 VAL A CB  1 
ATOM   1515 C  CG1 . VAL A 1 191 ? 4.917   14.437 6.932  1.00 2.57  ? 191 VAL A CG1 1 
ATOM   1516 C  CG2 . VAL A 1 191 ? 6.652   14.968 8.675  1.00 4.40  ? 191 VAL A CG2 1 
ATOM   1517 N  N   . VAL A 1 192 ? 9.539   12.974 7.407  1.00 6.27  ? 192 VAL A N   1 
ATOM   1518 C  CA  . VAL A 1 192 ? 10.957  13.277 7.277  1.00 6.24  ? 192 VAL A CA  1 
ATOM   1519 C  C   . VAL A 1 192 ? 11.365  12.890 5.842  1.00 6.85  ? 192 VAL A C   1 
ATOM   1520 O  O   . VAL A 1 192 ? 11.115  11.773 5.389  1.00 3.69  ? 192 VAL A O   1 
ATOM   1521 C  CB  . VAL A 1 192 ? 11.804  12.524 8.341  1.00 5.40  ? 192 VAL A CB  1 
ATOM   1522 C  CG1 . VAL A 1 192 ? 11.607  11.029 8.231  1.00 6.28  ? 192 VAL A CG1 1 
ATOM   1523 C  CG2 . VAL A 1 192 ? 13.272  12.887 8.183  1.00 6.57  ? 192 VAL A CG2 1 
ATOM   1524 N  N   . ASN A 1 193 ? 11.953  13.841 5.123  1.00 5.81  ? 193 ASN A N   1 
ATOM   1525 C  CA  . ASN A 1 193 ? 12.363  13.622 3.736  1.00 7.49  ? 193 ASN A CA  1 
ATOM   1526 C  C   . ASN A 1 193 ? 13.667  12.837 3.690  1.00 6.87  ? 193 ASN A C   1 
ATOM   1527 O  O   . ASN A 1 193 ? 14.741  13.431 3.751  1.00 6.06  ? 193 ASN A O   1 
ATOM   1528 C  CB  . ASN A 1 193 ? 12.578  14.967 3.037  1.00 6.83  ? 193 ASN A CB  1 
ATOM   1529 C  CG  . ASN A 1 193 ? 12.780  14.821 1.541  1.00 9.73  ? 193 ASN A CG  1 
ATOM   1530 O  OD1 . ASN A 1 193 ? 13.291  13.806 1.068  1.00 9.52  ? 193 ASN A OD1 1 
ATOM   1531 N  ND2 . ASN A 1 193 ? 12.403  15.854 0.787  1.00 11.61 ? 193 ASN A ND2 1 
ATOM   1532 N  N   . TRP A 1 194 ? 13.591  11.513 3.580  1.00 6.05  ? 194 TRP A N   1 
ATOM   1533 C  CA  . TRP A 1 194 ? 14.814  10.721 3.544  1.00 5.61  ? 194 TRP A CA  1 
ATOM   1534 C  C   . TRP A 1 194 ? 15.634  10.942 2.270  1.00 5.69  ? 194 TRP A C   1 
ATOM   1535 O  O   . TRP A 1 194 ? 16.834  10.672 2.253  1.00 5.13  ? 194 TRP A O   1 
ATOM   1536 C  CB  . TRP A 1 194 ? 14.505  9.228  3.722  1.00 5.80  ? 194 TRP A CB  1 
ATOM   1537 C  CG  . TRP A 1 194 ? 14.058  8.858  5.113  1.00 5.18  ? 194 TRP A CG  1 
ATOM   1538 C  CD1 . TRP A 1 194 ? 12.852  8.330  5.476  1.00 6.19  ? 194 TRP A CD1 1 
ATOM   1539 C  CD2 . TRP A 1 194 ? 14.810  9.006  6.327  1.00 5.52  ? 194 TRP A CD2 1 
ATOM   1540 N  NE1 . TRP A 1 194 ? 12.806  8.141  6.840  1.00 4.80  ? 194 TRP A NE1 1 
ATOM   1541 C  CE2 . TRP A 1 194 ? 13.994  8.548  7.385  1.00 4.26  ? 194 TRP A CE2 1 
ATOM   1542 C  CE3 . TRP A 1 194 ? 16.097  9.483  6.623  1.00 4.59  ? 194 TRP A CE3 1 
ATOM   1543 C  CZ2 . TRP A 1 194 ? 14.420  8.551  8.719  1.00 3.67  ? 194 TRP A CZ2 1 
ATOM   1544 C  CZ3 . TRP A 1 194 ? 16.521  9.487  7.949  1.00 3.74  ? 194 TRP A CZ3 1 
ATOM   1545 C  CH2 . TRP A 1 194 ? 15.682  9.023  8.980  1.00 4.64  ? 194 TRP A CH2 1 
ATOM   1546 N  N   . ASP A 1 195 ? 15.000  11.430 1.207  1.00 6.20  ? 195 ASP A N   1 
ATOM   1547 C  CA  . ASP A 1 195 ? 15.735  11.681 -0.033 1.00 7.29  ? 195 ASP A CA  1 
ATOM   1548 C  C   . ASP A 1 195 ? 16.679  12.869 0.157  1.00 8.45  ? 195 ASP A C   1 
ATOM   1549 O  O   . ASP A 1 195 ? 17.801  12.862 -0.347 1.00 8.84  ? 195 ASP A O   1 
ATOM   1550 C  CB  . ASP A 1 195 ? 14.795  11.982 -1.203 1.00 7.88  ? 195 ASP A CB  1 
ATOM   1551 C  CG  . ASP A 1 195 ? 13.799  10.869 -1.466 1.00 10.01 ? 195 ASP A CG  1 
ATOM   1552 O  OD1 . ASP A 1 195 ? 14.090  9.694  -1.139 1.00 9.31  ? 195 ASP A OD1 1 
ATOM   1553 O  OD2 . ASP A 1 195 ? 12.727  11.175 -2.033 1.00 11.61 ? 195 ASP A OD2 1 
ATOM   1554 N  N   . GLU A 1 196 ? 16.221  13.887 0.882  1.00 7.04  ? 196 GLU A N   1 
ATOM   1555 C  CA  . GLU A 1 196 ? 17.043  15.070 1.141  1.00 7.09  ? 196 GLU A CA  1 
ATOM   1556 C  C   . GLU A 1 196 ? 18.163  14.701 2.113  1.00 6.36  ? 196 GLU A C   1 
ATOM   1557 O  O   . GLU A 1 196 ? 19.305  15.139 1.958  1.00 5.19  ? 196 GLU A O   1 
ATOM   1558 C  CB  . GLU A 1 196 ? 16.190  16.192 1.739  1.00 8.57  ? 196 GLU A CB  1 
ATOM   1559 C  CG  . GLU A 1 196 ? 16.910  17.535 1.894  1.00 9.57  ? 196 GLU A CG  1 
ATOM   1560 C  CD  . GLU A 1 196 ? 17.410  18.089 0.565  1.00 13.52 ? 196 GLU A CD  1 
ATOM   1561 O  OE1 . GLU A 1 196 ? 16.640  18.059 -0.419 1.00 11.95 ? 196 GLU A OE1 1 
ATOM   1562 O  OE2 . GLU A 1 196 ? 18.563  18.573 0.510  1.00 12.97 ? 196 GLU A OE2 1 
ATOM   1563 N  N   . ALA A 1 197 ? 17.827  13.896 3.119  1.00 6.31  ? 197 ALA A N   1 
ATOM   1564 C  CA  . ALA A 1 197 ? 18.816  13.455 4.097  1.00 6.46  ? 197 ALA A CA  1 
ATOM   1565 C  C   . ALA A 1 197 ? 19.873  12.630 3.365  1.00 5.83  ? 197 ALA A C   1 
ATOM   1566 O  O   . ALA A 1 197 ? 21.069  12.768 3.618  1.00 5.80  ? 197 ALA A O   1 
ATOM   1567 C  CB  . ALA A 1 197 ? 18.150  12.617 5.190  1.00 6.28  ? 197 ALA A CB  1 
ATOM   1568 N  N   . ALA A 1 198 ? 19.425  11.781 2.446  1.00 5.40  ? 198 ALA A N   1 
ATOM   1569 C  CA  . ALA A 1 198 ? 20.343  10.952 1.669  1.00 5.62  ? 198 ALA A CA  1 
ATOM   1570 C  C   . ALA A 1 198 ? 21.241  11.854 0.824  1.00 6.32  ? 198 ALA A C   1 
ATOM   1571 O  O   . ALA A 1 198 ? 22.440  11.605 0.690  1.00 9.51  ? 198 ALA A O   1 
ATOM   1572 C  CB  . ALA A 1 198 ? 19.560  9.997  0.777  1.00 2.36  ? 198 ALA A CB  1 
ATOM   1573 N  N   . ALA A 1 199 ? 20.657  12.910 0.265  1.00 6.40  ? 199 ALA A N   1 
ATOM   1574 C  CA  . ALA A 1 199 ? 21.401  13.863 -0.554 1.00 7.37  ? 199 ALA A CA  1 
ATOM   1575 C  C   . ALA A 1 199 ? 22.487  14.571 0.262  1.00 7.90  ? 199 ALA A C   1 
ATOM   1576 O  O   . ALA A 1 199 ? 23.621  14.720 -0.197 1.00 8.75  ? 199 ALA A O   1 
ATOM   1577 C  CB  . ALA A 1 199 ? 20.444  14.893 -1.158 1.00 6.05  ? 199 ALA A CB  1 
ATOM   1578 N  N   . ARG A 1 200 ? 22.139  15.013 1.468  1.00 8.35  ? 200 ARG A N   1 
ATOM   1579 C  CA  . ARG A 1 200 ? 23.102  15.696 2.324  1.00 7.54  ? 200 ARG A CA  1 
ATOM   1580 C  C   . ARG A 1 200 ? 24.186  14.713 2.779  1.00 7.20  ? 200 ARG A C   1 
ATOM   1581 O  O   . ARG A 1 200 ? 25.359  15.074 2.885  1.00 3.73  ? 200 ARG A O   1 
ATOM   1582 C  CB  . ARG A 1 200 ? 22.386  16.335 3.529  1.00 7.45  ? 200 ARG A CB  1 
ATOM   1583 C  CG  . ARG A 1 200 ? 21.439  17.481 3.140  1.00 5.86  ? 200 ARG A CG  1 
ATOM   1584 C  CD  . ARG A 1 200 ? 20.605  18.001 4.319  1.00 3.96  ? 200 ARG A CD  1 
ATOM   1585 N  NE  . ARG A 1 200 ? 21.376  18.698 5.350  1.00 2.36  ? 200 ARG A NE  1 
ATOM   1586 C  CZ  . ARG A 1 200 ? 21.904  19.913 5.210  1.00 3.08  ? 200 ARG A CZ  1 
ATOM   1587 N  NH1 . ARG A 1 200 ? 21.753  20.587 4.078  1.00 2.99  ? 200 ARG A NH1 1 
ATOM   1588 N  NH2 . ARG A 1 200 ? 22.573  20.463 6.212  1.00 3.42  ? 200 ARG A NH2 1 
ATOM   1589 N  N   . PHE A 1 201 ? 23.794  13.463 3.015  1.00 8.24  ? 201 PHE A N   1 
ATOM   1590 C  CA  . PHE A 1 201 ? 24.740  12.436 3.438  1.00 6.69  ? 201 PHE A CA  1 
ATOM   1591 C  C   . PHE A 1 201 ? 25.744  12.098 2.329  1.00 8.44  ? 201 PHE A C   1 
ATOM   1592 O  O   . PHE A 1 201 ? 26.934  11.909 2.603  1.00 8.09  ? 201 PHE A O   1 
ATOM   1593 C  CB  . PHE A 1 201 ? 24.006  11.163 3.851  1.00 6.29  ? 201 PHE A CB  1 
ATOM   1594 C  CG  . PHE A 1 201 ? 24.907  10.116 4.436  1.00 7.81  ? 201 PHE A CG  1 
ATOM   1595 C  CD1 . PHE A 1 201 ? 25.528  10.325 5.670  1.00 7.15  ? 201 PHE A CD1 1 
ATOM   1596 C  CD2 . PHE A 1 201 ? 25.162  8.934  3.748  1.00 6.44  ? 201 PHE A CD2 1 
ATOM   1597 C  CE1 . PHE A 1 201 ? 26.391  9.369  6.208  1.00 7.09  ? 201 PHE A CE1 1 
ATOM   1598 C  CE2 . PHE A 1 201 ? 26.025  7.971  4.278  1.00 8.90  ? 201 PHE A CE2 1 
ATOM   1599 C  CZ  . PHE A 1 201 ? 26.641  8.189  5.509  1.00 7.27  ? 201 PHE A CZ  1 
ATOM   1600 N  N   . ALA A 1 202 ? 25.268  12.016 1.085  1.00 6.91  ? 202 ALA A N   1 
ATOM   1601 C  CA  . ALA A 1 202 ? 26.145  11.713 -0.049 1.00 7.65  ? 202 ALA A CA  1 
ATOM   1602 C  C   . ALA A 1 202 ? 27.170  12.827 -0.241 1.00 7.47  ? 202 ALA A C   1 
ATOM   1603 O  O   . ALA A 1 202 ? 28.320  12.575 -0.599 1.00 7.92  ? 202 ALA A O   1 
ATOM   1604 C  CB  . ALA A 1 202 ? 25.328  11.539 -1.330 1.00 5.94  ? 202 ALA A CB  1 
ATOM   1605 N  N   . ALA A 1 203 ? 26.742  14.061 0.000  1.00 7.58  ? 203 ALA A N   1 
ATOM   1606 C  CA  . ALA A 1 203 ? 27.610  15.228 -0.140 1.00 6.93  ? 203 ALA A CA  1 
ATOM   1607 C  C   . ALA A 1 203 ? 28.689  15.314 0.940  1.00 6.22  ? 203 ALA A C   1 
ATOM   1608 O  O   . ALA A 1 203 ? 29.783  15.818 0.686  1.00 6.01  ? 203 ALA A O   1 
ATOM   1609 C  CB  . ALA A 1 203 ? 26.767  16.499 -0.115 1.00 6.73  ? 203 ALA A CB  1 
ATOM   1610 N  N   . LYS A 1 204 ? 28.382  14.816 2.136  1.00 5.21  ? 204 LYS A N   1 
ATOM   1611 C  CA  . LYS A 1 204 ? 29.311  14.882 3.266  1.00 7.34  ? 204 LYS A CA  1 
ATOM   1612 C  C   . LYS A 1 204 ? 30.006  13.600 3.747  1.00 8.74  ? 204 LYS A C   1 
ATOM   1613 O  O   . LYS A 1 204 ? 31.036  13.677 4.419  1.00 6.75  ? 204 LYS A O   1 
ATOM   1614 C  CB  . LYS A 1 204 ? 28.597  15.517 4.466  1.00 8.71  ? 204 LYS A CB  1 
ATOM   1615 C  CG  . LYS A 1 204 ? 28.340  17.002 4.336  1.00 12.96 ? 204 LYS A CG  1 
ATOM   1616 C  CD  . LYS A 1 204 ? 29.653  17.754 4.356  1.00 16.71 ? 204 LYS A CD  1 
ATOM   1617 C  CE  . LYS A 1 204 ? 29.441  19.242 4.342  1.00 18.86 ? 204 LYS A CE  1 
ATOM   1618 N  NZ  . LYS A 1 204 ? 30.746  19.948 4.418  1.00 22.62 ? 204 LYS A NZ  1 
ATOM   1619 N  N   . LYS A 1 205 ? 29.453  12.432 3.428  1.00 10.42 ? 205 LYS A N   1 
ATOM   1620 C  CA  . LYS A 1 205 ? 30.048  11.177 3.881  1.00 11.15 ? 205 LYS A CA  1 
ATOM   1621 C  C   . LYS A 1 205 ? 31.496  11.020 3.428  1.00 13.25 ? 205 LYS A C   1 
ATOM   1622 O  O   . LYS A 1 205 ? 32.277  10.414 4.186  1.00 14.41 ? 205 LYS A O   1 
ATOM   1623 C  CB  . LYS A 1 205 ? 29.217  9.975  3.421  1.00 12.32 ? 205 LYS A CB  1 
ATOM   1624 C  CG  . LYS A 1 205 ? 29.290  9.635  1.941  1.00 11.64 ? 205 LYS A CG  1 
ATOM   1625 C  CD  . LYS A 1 205 ? 28.402  8.426  1.654  1.00 14.05 ? 205 LYS A CD  1 
ATOM   1626 C  CE  . LYS A 1 205 ? 28.523  7.938  0.215  1.00 15.79 ? 205 LYS A CE  1 
ATOM   1627 N  NZ  . LYS A 1 205 ? 29.897  7.441  -0.092 1.00 15.89 ? 205 LYS A NZ  1 
ATOM   1628 O  OXT . LYS A 1 205 ? 31.832  11.479 2.317  1.00 14.84 ? 205 LYS A OXT 1 
ATOM   1629 N  N   . SER B 1 1   ? 6.591   14.370 48.371 1.00 28.30 ? 1   SER B N   1 
ATOM   1630 C  CA  . SER B 1 1   ? 5.429   14.171 47.460 1.00 24.78 ? 1   SER B CA  1 
ATOM   1631 C  C   . SER B 1 1   ? 4.673   15.475 47.238 1.00 23.81 ? 1   SER B C   1 
ATOM   1632 O  O   . SER B 1 1   ? 4.232   16.117 48.194 1.00 23.89 ? 1   SER B O   1 
ATOM   1633 C  CB  . SER B 1 1   ? 4.471   13.128 48.043 1.00 26.11 ? 1   SER B CB  1 
ATOM   1634 O  OG  . SER B 1 1   ? 3.318   12.977 47.227 1.00 27.33 ? 1   SER B OG  1 
ATOM   1635 N  N   . TYR B 1 2   ? 4.534   15.866 45.974 1.00 19.74 ? 2   TYR B N   1 
ATOM   1636 C  CA  . TYR B 1 2   ? 3.812   17.082 45.631 1.00 17.12 ? 2   TYR B CA  1 
ATOM   1637 C  C   . TYR B 1 2   ? 2.479   16.677 45.020 1.00 16.49 ? 2   TYR B C   1 
ATOM   1638 O  O   . TYR B 1 2   ? 2.304   15.534 44.605 1.00 16.35 ? 2   TYR B O   1 
ATOM   1639 C  CB  . TYR B 1 2   ? 4.578   17.912 44.601 1.00 15.58 ? 2   TYR B CB  1 
ATOM   1640 C  CG  . TYR B 1 2   ? 6.001   18.269 44.970 1.00 15.24 ? 2   TYR B CG  1 
ATOM   1641 C  CD1 . TYR B 1 2   ? 6.316   18.778 46.231 1.00 15.83 ? 2   TYR B CD1 1 
ATOM   1642 C  CD2 . TYR B 1 2   ? 7.024   18.175 44.027 1.00 13.81 ? 2   TYR B CD2 1 
ATOM   1643 C  CE1 . TYR B 1 2   ? 7.617   19.188 46.536 1.00 13.66 ? 2   TYR B CE1 1 
ATOM   1644 C  CE2 . TYR B 1 2   ? 8.322   18.582 44.324 1.00 11.85 ? 2   TYR B CE2 1 
ATOM   1645 C  CZ  . TYR B 1 2   ? 8.609   19.089 45.573 1.00 11.92 ? 2   TYR B CZ  1 
ATOM   1646 O  OH  . TYR B 1 2   ? 9.885   19.525 45.845 1.00 13.11 ? 2   TYR B OH  1 
ATOM   1647 N  N   . THR B 1 3   ? 1.544   17.617 44.958 1.00 15.73 ? 3   THR B N   1 
ATOM   1648 C  CA  . THR B 1 3   ? 0.241   17.344 44.368 1.00 15.27 ? 3   THR B CA  1 
ATOM   1649 C  C   . THR B 1 3   ? -0.191  18.526 43.513 1.00 14.39 ? 3   THR B C   1 
ATOM   1650 O  O   . THR B 1 3   ? 0.188   19.662 43.783 1.00 12.69 ? 3   THR B O   1 
ATOM   1651 C  CB  . THR B 1 3   ? -0.840  17.103 45.452 1.00 17.06 ? 3   THR B CB  1 
ATOM   1652 O  OG1 . THR B 1 3   ? -0.967  18.276 46.266 1.00 17.26 ? 3   THR B OG1 1 
ATOM   1653 C  CG2 . THR B 1 3   ? -0.463  15.910 46.335 1.00 14.42 ? 3   THR B CG2 1 
ATOM   1654 N  N   . LEU B 1 4   ? -0.975  18.254 42.474 1.00 14.73 ? 4   LEU B N   1 
ATOM   1655 C  CA  . LEU B 1 4   ? -1.469  19.315 41.607 1.00 13.92 ? 4   LEU B CA  1 
ATOM   1656 C  C   . LEU B 1 4   ? -2.499  20.109 42.404 1.00 14.08 ? 4   LEU B C   1 
ATOM   1657 O  O   . LEU B 1 4   ? -3.556  19.587 42.758 1.00 14.88 ? 4   LEU B O   1 
ATOM   1658 C  CB  . LEU B 1 4   ? -2.141  18.734 40.359 1.00 12.00 ? 4   LEU B CB  1 
ATOM   1659 C  CG  . LEU B 1 4   ? -2.738  19.763 39.389 1.00 14.10 ? 4   LEU B CG  1 
ATOM   1660 C  CD1 . LEU B 1 4   ? -1.621  20.594 38.776 1.00 11.85 ? 4   LEU B CD1 1 
ATOM   1661 C  CD2 . LEU B 1 4   ? -3.524  19.054 38.288 1.00 12.26 ? 4   LEU B CD2 1 
ATOM   1662 N  N   . PRO B 1 5   ? -2.199  21.379 42.710 1.00 13.35 ? 5   PRO B N   1 
ATOM   1663 C  CA  . PRO B 1 5   ? -3.143  22.201 43.471 1.00 12.85 ? 5   PRO B CA  1 
ATOM   1664 C  C   . PRO B 1 5   ? -4.353  22.553 42.611 1.00 13.34 ? 5   PRO B C   1 
ATOM   1665 O  O   . PRO B 1 5   ? -4.239  22.676 41.389 1.00 12.33 ? 5   PRO B O   1 
ATOM   1666 C  CB  . PRO B 1 5   ? -2.311  23.431 43.804 1.00 13.07 ? 5   PRO B CB  1 
ATOM   1667 C  CG  . PRO B 1 5   ? -1.482  23.575 42.528 1.00 11.83 ? 5   PRO B CG  1 
ATOM   1668 C  CD  . PRO B 1 5   ? -0.979  22.150 42.411 1.00 11.68 ? 5   PRO B CD  1 
ATOM   1669 N  N   . SER B 1 6   ? -5.513  22.703 43.241 1.00 13.80 ? 6   SER B N   1 
ATOM   1670 C  CA  . SER B 1 6   ? -6.714  23.074 42.504 1.00 14.07 ? 6   SER B CA  1 
ATOM   1671 C  C   . SER B 1 6   ? -6.605  24.555 42.188 1.00 12.90 ? 6   SER B C   1 
ATOM   1672 O  O   . SER B 1 6   ? -5.934  25.303 42.904 1.00 12.23 ? 6   SER B O   1 
ATOM   1673 C  CB  . SER B 1 6   ? -7.975  22.825 43.339 1.00 15.46 ? 6   SER B CB  1 
ATOM   1674 O  OG  . SER B 1 6   ? -8.174  21.443 43.574 1.00 21.75 ? 6   SER B OG  1 
ATOM   1675 N  N   . LEU B 1 7   ? -7.255  24.972 41.109 1.00 11.80 ? 7   LEU B N   1 
ATOM   1676 C  CA  . LEU B 1 7   ? -7.243  26.368 40.720 1.00 12.84 ? 7   LEU B CA  1 
ATOM   1677 C  C   . LEU B 1 7   ? -8.178  27.113 41.655 1.00 13.09 ? 7   LEU B C   1 
ATOM   1678 O  O   . LEU B 1 7   ? -9.103  26.528 42.204 1.00 14.53 ? 7   LEU B O   1 
ATOM   1679 C  CB  . LEU B 1 7   ? -7.740  26.539 39.287 1.00 10.40 ? 7   LEU B CB  1 
ATOM   1680 C  CG  . LEU B 1 7   ? -6.925  25.939 38.148 1.00 12.15 ? 7   LEU B CG  1 
ATOM   1681 C  CD1 . LEU B 1 7   ? -7.661  26.212 36.842 1.00 11.89 ? 7   LEU B CD1 1 
ATOM   1682 C  CD2 . LEU B 1 7   ? -5.526  26.548 38.114 1.00 9.04  ? 7   LEU B CD2 1 
ATOM   1683 N  N   . PRO B 1 8   ? -7.931  28.414 41.864 1.00 14.25 ? 8   PRO B N   1 
ATOM   1684 C  CA  . PRO B 1 8   ? -8.745  29.270 42.734 1.00 14.39 ? 8   PRO B CA  1 
ATOM   1685 C  C   . PRO B 1 8   ? -10.049 29.648 42.028 1.00 15.40 ? 8   PRO B C   1 
ATOM   1686 O  O   . PRO B 1 8   ? -10.918 30.304 42.607 1.00 15.91 ? 8   PRO B O   1 
ATOM   1687 C  CB  . PRO B 1 8   ? -7.851  30.503 42.928 1.00 13.70 ? 8   PRO B CB  1 
ATOM   1688 C  CG  . PRO B 1 8   ? -6.439  29.997 42.537 1.00 13.01 ? 8   PRO B CG  1 
ATOM   1689 C  CD  . PRO B 1 8   ? -6.801  29.189 41.330 1.00 13.15 ? 8   PRO B CD  1 
ATOM   1690 N  N   . TYR B 1 9   ? -10.174 29.219 40.774 1.00 14.63 ? 9   TYR B N   1 
ATOM   1691 C  CA  . TYR B 1 9   ? -11.330 29.553 39.951 1.00 14.70 ? 9   TYR B CA  1 
ATOM   1692 C  C   . TYR B 1 9   ? -11.589 28.531 38.850 1.00 14.61 ? 9   TYR B C   1 
ATOM   1693 O  O   . TYR B 1 9   ? -10.816 27.597 38.664 1.00 16.06 ? 9   TYR B O   1 
ATOM   1694 C  CB  . TYR B 1 9   ? -11.084 30.925 39.321 1.00 14.11 ? 9   TYR B CB  1 
ATOM   1695 C  CG  . TYR B 1 9   ? -9.649  31.080 38.847 1.00 14.43 ? 9   TYR B CG  1 
ATOM   1696 C  CD1 . TYR B 1 9   ? -9.119  30.236 37.864 1.00 13.09 ? 9   TYR B CD1 1 
ATOM   1697 C  CD2 . TYR B 1 9   ? -8.796  32.007 39.446 1.00 14.29 ? 9   TYR B CD2 1 
ATOM   1698 C  CE1 . TYR B 1 9   ? -7.771  30.307 37.498 1.00 12.59 ? 9   TYR B CE1 1 
ATOM   1699 C  CE2 . TYR B 1 9   ? -7.446  32.088 39.088 1.00 14.24 ? 9   TYR B CE2 1 
ATOM   1700 C  CZ  . TYR B 1 9   ? -6.941  31.232 38.118 1.00 14.35 ? 9   TYR B CZ  1 
ATOM   1701 O  OH  . TYR B 1 9   ? -5.605  31.288 37.792 1.00 12.10 ? 9   TYR B OH  1 
ATOM   1702 N  N   . ALA B 1 10  ? -12.683 28.731 38.118 1.00 13.95 ? 10  ALA B N   1 
ATOM   1703 C  CA  . ALA B 1 10  ? -13.059 27.857 37.012 1.00 13.38 ? 10  ALA B CA  1 
ATOM   1704 C  C   . ALA B 1 10  ? -12.124 28.120 35.834 1.00 12.78 ? 10  ALA B C   1 
ATOM   1705 O  O   . ALA B 1 10  ? -11.465 29.157 35.777 1.00 12.64 ? 10  ALA B O   1 
ATOM   1706 C  CB  . ALA B 1 10  ? -14.506 28.127 36.606 1.00 12.28 ? 10  ALA B CB  1 
ATOM   1707 N  N   . TYR B 1 11  ? -12.077 27.191 34.887 1.00 13.09 ? 11  TYR B N   1 
ATOM   1708 C  CA  . TYR B 1 11  ? -11.203 27.347 33.735 1.00 13.94 ? 11  TYR B CA  1 
ATOM   1709 C  C   . TYR B 1 11  ? -11.514 28.570 32.876 1.00 14.39 ? 11  TYR B C   1 
ATOM   1710 O  O   . TYR B 1 11  ? -10.613 29.131 32.255 1.00 14.94 ? 11  TYR B O   1 
ATOM   1711 C  CB  . TYR B 1 11  ? -11.217 26.069 32.890 1.00 16.04 ? 11  TYR B CB  1 
ATOM   1712 C  CG  . TYR B 1 11  ? -10.577 24.894 33.601 1.00 18.09 ? 11  TYR B CG  1 
ATOM   1713 C  CD1 . TYR B 1 11  ? -9.258  24.966 34.045 1.00 18.37 ? 11  TYR B CD1 1 
ATOM   1714 C  CD2 . TYR B 1 11  ? -11.294 23.726 33.859 1.00 20.04 ? 11  TYR B CD2 1 
ATOM   1715 C  CE1 . TYR B 1 11  ? -8.668  23.913 34.732 1.00 19.82 ? 11  TYR B CE1 1 
ATOM   1716 C  CE2 . TYR B 1 11  ? -10.709 22.660 34.550 1.00 20.94 ? 11  TYR B CE2 1 
ATOM   1717 C  CZ  . TYR B 1 11  ? -9.395  22.765 34.984 1.00 20.31 ? 11  TYR B CZ  1 
ATOM   1718 O  OH  . TYR B 1 11  ? -8.809  21.737 35.689 1.00 21.53 ? 11  TYR B OH  1 
ATOM   1719 N  N   . ASP B 1 12  ? -12.774 28.997 32.851 1.00 13.19 ? 12  ASP B N   1 
ATOM   1720 C  CA  . ASP B 1 12  ? -13.156 30.166 32.059 1.00 12.81 ? 12  ASP B CA  1 
ATOM   1721 C  C   . ASP B 1 12  ? -13.228 31.465 32.859 1.00 11.70 ? 12  ASP B C   1 
ATOM   1722 O  O   . ASP B 1 12  ? -13.697 32.481 32.348 1.00 10.18 ? 12  ASP B O   1 
ATOM   1723 C  CB  . ASP B 1 12  ? -14.510 29.947 31.378 1.00 14.51 ? 12  ASP B CB  1 
ATOM   1724 C  CG  . ASP B 1 12  ? -15.605 29.558 32.358 1.00 15.62 ? 12  ASP B CG  1 
ATOM   1725 O  OD1 . ASP B 1 12  ? -15.618 30.080 33.492 1.00 13.23 ? 12  ASP B OD1 1 
ATOM   1726 O  OD2 . ASP B 1 12  ? -16.470 28.742 31.981 1.00 18.92 ? 12  ASP B OD2 1 
ATOM   1727 N  N   . ALA B 1 13  ? -12.762 31.443 34.104 1.00 10.73 ? 13  ALA B N   1 
ATOM   1728 C  CA  . ALA B 1 13  ? -12.812 32.641 34.943 1.00 10.88 ? 13  ALA B CA  1 
ATOM   1729 C  C   . ALA B 1 13  ? -11.920 33.782 34.456 1.00 10.49 ? 13  ALA B C   1 
ATOM   1730 O  O   . ALA B 1 13  ? -12.159 34.942 34.791 1.00 11.34 ? 13  ALA B O   1 
ATOM   1731 C  CB  . ALA B 1 13  ? -12.459 32.285 36.388 1.00 10.75 ? 13  ALA B CB  1 
ATOM   1732 N  N   . LEU B 1 14  ? -10.901 33.466 33.662 1.00 9.89  ? 14  LEU B N   1 
ATOM   1733 C  CA  . LEU B 1 14  ? -9.998  34.498 33.168 1.00 8.47  ? 14  LEU B CA  1 
ATOM   1734 C  C   . LEU B 1 14  ? -10.352 35.041 31.790 1.00 9.65  ? 14  LEU B C   1 
ATOM   1735 O  O   . LEU B 1 14  ? -9.682  35.935 31.281 1.00 7.06  ? 14  LEU B O   1 
ATOM   1736 C  CB  . LEU B 1 14  ? -8.559  33.989 33.170 1.00 8.97  ? 14  LEU B CB  1 
ATOM   1737 C  CG  . LEU B 1 14  ? -8.050  33.553 34.550 1.00 10.11 ? 14  LEU B CG  1 
ATOM   1738 C  CD1 . LEU B 1 14  ? -6.573  33.210 34.459 1.00 10.16 ? 14  LEU B CD1 1 
ATOM   1739 C  CD2 . LEU B 1 14  ? -8.264  34.670 35.561 1.00 6.95  ? 14  LEU B CD2 1 
ATOM   1740 N  N   . GLU B 1 15  ? -11.401 34.506 31.175 1.00 10.97 ? 15  GLU B N   1 
ATOM   1741 C  CA  . GLU B 1 15  ? -11.801 35.012 29.869 1.00 13.09 ? 15  GLU B CA  1 
ATOM   1742 C  C   . GLU B 1 15  ? -12.500 36.353 30.053 1.00 12.90 ? 15  GLU B C   1 
ATOM   1743 O  O   . GLU B 1 15  ? -12.958 36.669 31.149 1.00 14.47 ? 15  GLU B O   1 
ATOM   1744 C  CB  . GLU B 1 15  ? -12.724 34.017 29.163 1.00 15.03 ? 15  GLU B CB  1 
ATOM   1745 C  CG  . GLU B 1 15  ? -11.988 32.782 28.647 1.00 18.08 ? 15  GLU B CG  1 
ATOM   1746 C  CD  . GLU B 1 15  ? -12.873 31.877 27.818 1.00 18.76 ? 15  GLU B CD  1 
ATOM   1747 O  OE1 . GLU B 1 15  ? -13.572 32.391 26.924 1.00 22.44 ? 15  GLU B OE1 1 
ATOM   1748 O  OE2 . GLU B 1 15  ? -12.859 30.651 28.041 1.00 23.33 ? 15  GLU B OE2 1 
ATOM   1749 N  N   . PRO B 1 16  ? -12.597 37.161 28.986 1.00 11.54 ? 16  PRO B N   1 
ATOM   1750 C  CA  . PRO B 1 16  ? -12.123 36.966 27.609 1.00 11.50 ? 16  PRO B CA  1 
ATOM   1751 C  C   . PRO B 1 16  ? -10.638 37.300 27.420 1.00 11.57 ? 16  PRO B C   1 
ATOM   1752 O  O   . PRO B 1 16  ? -10.231 37.749 26.344 1.00 10.81 ? 16  PRO B O   1 
ATOM   1753 C  CB  . PRO B 1 16  ? -13.005 37.932 26.834 1.00 11.81 ? 16  PRO B CB  1 
ATOM   1754 C  CG  . PRO B 1 16  ? -12.975 39.125 27.772 1.00 11.18 ? 16  PRO B CG  1 
ATOM   1755 C  CD  . PRO B 1 16  ? -13.345 38.429 29.082 1.00 11.31 ? 16  PRO B CD  1 
ATOM   1756 N  N   . HIS B 1 17  ? -9.831  37.089 28.457 1.00 11.45 ? 17  HIS B N   1 
ATOM   1757 C  CA  . HIS B 1 17  ? -8.404  37.403 28.382 1.00 11.10 ? 17  HIS B CA  1 
ATOM   1758 C  C   . HIS B 1 17  ? -7.563  36.164 28.114 1.00 10.38 ? 17  HIS B C   1 
ATOM   1759 O  O   . HIS B 1 17  ? -6.869  36.098 27.104 1.00 9.82  ? 17  HIS B O   1 
ATOM   1760 C  CB  . HIS B 1 17  ? -7.971  38.094 29.675 1.00 10.75 ? 17  HIS B CB  1 
ATOM   1761 C  CG  . HIS B 1 17  ? -8.801  39.292 30.003 1.00 10.53 ? 17  HIS B CG  1 
ATOM   1762 N  ND1 . HIS B 1 17  ? -8.925  40.364 29.145 1.00 10.28 ? 17  HIS B ND1 1 
ATOM   1763 C  CD2 . HIS B 1 17  ? -9.602  39.561 31.061 1.00 10.03 ? 17  HIS B CD2 1 
ATOM   1764 C  CE1 . HIS B 1 17  ? -9.768  41.241 29.659 1.00 8.90  ? 17  HIS B CE1 1 
ATOM   1765 N  NE2 . HIS B 1 17  ? -10.193 40.778 30.821 1.00 10.31 ? 17  HIS B NE2 1 
ATOM   1766 N  N   . PHE B 1 18  ? -7.615  35.200 29.031 1.00 10.50 ? 18  PHE B N   1 
ATOM   1767 C  CA  . PHE B 1 18  ? -6.905  33.927 28.878 1.00 10.78 ? 18  PHE B CA  1 
ATOM   1768 C  C   . PHE B 1 18  ? -7.978  32.873 28.600 1.00 11.09 ? 18  PHE B C   1 
ATOM   1769 O  O   . PHE B 1 18  ? -8.919  32.732 29.377 1.00 11.90 ? 18  PHE B O   1 
ATOM   1770 C  CB  . PHE B 1 18  ? -6.138  33.569 30.158 1.00 8.72  ? 18  PHE B CB  1 
ATOM   1771 C  CG  . PHE B 1 18  ? -4.851  34.338 30.342 1.00 8.47  ? 18  PHE B CG  1 
ATOM   1772 C  CD1 . PHE B 1 18  ? -4.523  35.402 29.508 1.00 8.07  ? 18  PHE B CD1 1 
ATOM   1773 C  CD2 . PHE B 1 18  ? -3.966  33.992 31.364 1.00 6.75  ? 18  PHE B CD2 1 
ATOM   1774 C  CE1 . PHE B 1 18  ? -3.330  36.109 29.686 1.00 7.12  ? 18  PHE B CE1 1 
ATOM   1775 C  CE2 . PHE B 1 18  ? -2.779  34.689 31.550 1.00 6.58  ? 18  PHE B CE2 1 
ATOM   1776 C  CZ  . PHE B 1 18  ? -2.458  35.750 30.709 1.00 6.07  ? 18  PHE B CZ  1 
ATOM   1777 N  N   . ASP B 1 19  ? -7.838  32.140 27.498 1.00 10.94 ? 19  ASP B N   1 
ATOM   1778 C  CA  . ASP B 1 19  ? -8.826  31.130 27.118 1.00 10.95 ? 19  ASP B CA  1 
ATOM   1779 C  C   . ASP B 1 19  ? -8.923  29.941 28.065 1.00 12.85 ? 19  ASP B C   1 
ATOM   1780 O  O   . ASP B 1 19  ? -7.918  29.467 28.603 1.00 13.73 ? 19  ASP B O   1 
ATOM   1781 C  CB  . ASP B 1 19  ? -8.560  30.637 25.687 1.00 11.27 ? 19  ASP B CB  1 
ATOM   1782 C  CG  . ASP B 1 19  ? -7.204  29.973 25.536 1.00 12.15 ? 19  ASP B CG  1 
ATOM   1783 O  OD1 . ASP B 1 19  ? -6.176  30.626 25.825 1.00 11.91 ? 19  ASP B OD1 1 
ATOM   1784 O  OD2 . ASP B 1 19  ? -7.169  28.797 25.121 1.00 10.64 ? 19  ASP B OD2 1 
ATOM   1785 N  N   . LYS B 1 20  ? -10.147 29.452 28.250 1.00 13.69 ? 20  LYS B N   1 
ATOM   1786 C  CA  . LYS B 1 20  ? -10.410 28.326 29.139 1.00 13.24 ? 20  LYS B CA  1 
ATOM   1787 C  C   . LYS B 1 20  ? -9.742  27.024 28.707 1.00 13.47 ? 20  LYS B C   1 
ATOM   1788 O  O   . LYS B 1 20  ? -9.271  26.266 29.558 1.00 13.47 ? 20  LYS B O   1 
ATOM   1789 C  CB  . LYS B 1 20  ? -11.917 28.088 29.262 1.00 15.39 ? 20  LYS B CB  1 
ATOM   1790 C  CG  . LYS B 1 20  ? -12.565 27.636 27.963 1.00 16.76 ? 20  LYS B CG  1 
ATOM   1791 C  CD  . LYS B 1 20  ? -14.066 27.464 28.097 1.00 16.47 ? 20  LYS B CD  1 
ATOM   1792 C  CE  . LYS B 1 20  ? -14.667 27.028 26.769 1.00 15.36 ? 20  LYS B CE  1 
ATOM   1793 N  NZ  . LYS B 1 20  ? -16.140 26.931 26.834 1.00 14.48 ? 20  LYS B NZ  1 
ATOM   1794 N  N   . GLN B 1 21  ? -9.708  26.756 27.401 1.00 12.02 ? 21  GLN B N   1 
ATOM   1795 C  CA  . GLN B 1 21  ? -9.099  25.522 26.903 1.00 11.82 ? 21  GLN B CA  1 
ATOM   1796 C  C   . GLN B 1 21  ? -7.635  25.455 27.322 1.00 12.04 ? 21  GLN B C   1 
ATOM   1797 O  O   . GLN B 1 21  ? -7.156  24.410 27.764 1.00 13.54 ? 21  GLN B O   1 
ATOM   1798 C  CB  . GLN B 1 21  ? -9.208  25.430 25.376 1.00 11.75 ? 21  GLN B CB  1 
ATOM   1799 C  CG  . GLN B 1 21  ? -8.646  24.144 24.789 0.00 13.40 ? 21  GLN B CG  1 
ATOM   1800 C  CD  . GLN B 1 21  ? -8.812  24.065 23.283 0.00 13.97 ? 21  GLN B CD  1 
ATOM   1801 O  OE1 . GLN B 1 21  ? -8.410  23.085 22.654 0.00 14.44 ? 21  GLN B OE1 1 
ATOM   1802 N  NE2 . GLN B 1 21  ? -9.407  25.097 22.696 0.00 14.44 ? 21  GLN B NE2 1 
ATOM   1803 N  N   . THR B 1 22  ? -6.926  26.569 27.175 1.00 11.13 ? 22  THR B N   1 
ATOM   1804 C  CA  . THR B 1 22  ? -5.526  26.622 27.565 1.00 10.08 ? 22  THR B CA  1 
ATOM   1805 C  C   . THR B 1 22  ? -5.429  26.448 29.078 1.00 8.57  ? 22  THR B C   1 
ATOM   1806 O  O   . THR B 1 22  ? -4.590  25.695 29.568 1.00 8.35  ? 22  THR B O   1 
ATOM   1807 C  CB  . THR B 1 22  ? -4.874  27.965 27.148 1.00 9.71  ? 22  THR B CB  1 
ATOM   1808 O  OG1 . THR B 1 22  ? -4.834  28.050 25.718 1.00 10.22 ? 22  THR B OG1 1 
ATOM   1809 C  CG2 . THR B 1 22  ? -3.449  28.070 27.689 1.00 7.65  ? 22  THR B CG2 1 
ATOM   1810 N  N   . MET B 1 23  ? -6.303  27.126 29.816 1.00 9.15  ? 23  MET B N   1 
ATOM   1811 C  CA  . MET B 1 23  ? -6.296  27.032 31.274 1.00 9.59  ? 23  MET B CA  1 
ATOM   1812 C  C   . MET B 1 23  ? -6.386  25.591 31.772 1.00 10.73 ? 23  MET B C   1 
ATOM   1813 O  O   . MET B 1 23  ? -5.690  25.217 32.717 1.00 10.77 ? 23  MET B O   1 
ATOM   1814 C  CB  . MET B 1 23  ? -7.443  27.849 31.874 1.00 10.99 ? 23  MET B CB  1 
ATOM   1815 C  CG  . MET B 1 23  ? -7.312  29.353 31.694 1.00 9.69  ? 23  MET B CG  1 
ATOM   1816 S  SD  . MET B 1 23  ? -5.813  30.034 32.445 1.00 14.30 ? 23  MET B SD  1 
ATOM   1817 C  CE  . MET B 1 23  ? -6.048  29.548 34.151 1.00 11.56 ? 23  MET B CE  1 
ATOM   1818 N  N   . GLU B 1 24  ? -7.231  24.784 31.131 1.00 11.03 ? 24  GLU B N   1 
ATOM   1819 C  CA  . GLU B 1 24  ? -7.408  23.389 31.525 1.00 11.20 ? 24  GLU B CA  1 
ATOM   1820 C  C   . GLU B 1 24  ? -6.211  22.525 31.116 1.00 11.06 ? 24  GLU B C   1 
ATOM   1821 O  O   . GLU B 1 24  ? -5.668  21.779 31.931 1.00 10.86 ? 24  GLU B O   1 
ATOM   1822 C  CB  . GLU B 1 24  ? -8.683  22.819 30.893 1.00 12.44 ? 24  GLU B CB  1 
ATOM   1823 C  CG  . GLU B 1 24  ? -9.131  21.495 31.507 1.00 14.80 ? 24  GLU B CG  1 
ATOM   1824 C  CD  . GLU B 1 24  ? -10.329 20.875 30.796 1.00 17.51 ? 24  GLU B CD  1 
ATOM   1825 O  OE1 . GLU B 1 24  ? -11.318 21.592 30.530 1.00 17.93 ? 24  GLU B OE1 1 
ATOM   1826 O  OE2 . GLU B 1 24  ? -10.290 19.657 30.522 1.00 18.94 ? 24  GLU B OE2 1 
ATOM   1827 N  N   . ILE B 1 25  ? -5.810  22.623 29.850 1.00 9.22  ? 25  ILE B N   1 
ATOM   1828 C  CA  . ILE B 1 25  ? -4.678  21.850 29.341 1.00 9.60  ? 25  ILE B CA  1 
ATOM   1829 C  C   . ILE B 1 25  ? -3.410  22.194 30.121 1.00 9.75  ? 25  ILE B C   1 
ATOM   1830 O  O   . ILE B 1 25  ? -2.657  21.317 30.540 1.00 8.11  ? 25  ILE B O   1 
ATOM   1831 C  CB  . ILE B 1 25  ? -4.434  22.145 27.839 1.00 10.05 ? 25  ILE B CB  1 
ATOM   1832 C  CG1 . ILE B 1 25  ? -5.658  21.723 27.023 1.00 10.95 ? 25  ILE B CG1 1 
ATOM   1833 C  CG2 . ILE B 1 25  ? -3.192  21.411 27.355 1.00 9.78  ? 25  ILE B CG2 1 
ATOM   1834 C  CD1 . ILE B 1 25  ? -5.566  22.041 25.545 1.00 12.22 ? 25  ILE B CD1 1 
ATOM   1835 N  N   . HIS B 1 26  ? -3.197  23.488 30.317 1.00 9.38  ? 26  HIS B N   1 
ATOM   1836 C  CA  . HIS B 1 26  ? -2.032  23.995 31.027 1.00 9.89  ? 26  HIS B CA  1 
ATOM   1837 C  C   . HIS B 1 26  ? -1.976  23.447 32.458 1.00 10.58 ? 26  HIS B C   1 
ATOM   1838 O  O   . HIS B 1 26  ? -0.899  23.139 32.985 1.00 10.27 ? 26  HIS B O   1 
ATOM   1839 C  CB  . HIS B 1 26  ? -2.098  25.525 31.049 1.00 7.15  ? 26  HIS B CB  1 
ATOM   1840 C  CG  . HIS B 1 26  ? -0.787  26.189 31.329 1.00 6.90  ? 26  HIS B CG  1 
ATOM   1841 N  ND1 . HIS B 1 26  ? -0.642  27.558 31.354 1.00 5.20  ? 26  HIS B ND1 1 
ATOM   1842 C  CD2 . HIS B 1 26  ? 0.441   25.675 31.574 1.00 7.13  ? 26  HIS B CD2 1 
ATOM   1843 C  CE1 . HIS B 1 26  ? 0.620   27.860 31.603 1.00 6.37  ? 26  HIS B CE1 1 
ATOM   1844 N  NE2 . HIS B 1 26  ? 1.298   26.735 31.740 1.00 6.49  ? 26  HIS B NE2 1 
ATOM   1845 N  N   . HIS B 1 27  ? -3.148  23.307 33.071 1.00 10.53 ? 27  HIS B N   1 
ATOM   1846 C  CA  . HIS B 1 27  ? -3.248  22.826 34.440 1.00 9.97  ? 27  HIS B CA  1 
ATOM   1847 C  C   . HIS B 1 27  ? -3.251  21.304 34.584 1.00 9.63  ? 27  HIS B C   1 
ATOM   1848 O  O   . HIS B 1 27  ? -2.414  20.747 35.289 1.00 10.39 ? 27  HIS B O   1 
ATOM   1849 C  CB  . HIS B 1 27  ? -4.509  23.402 35.098 1.00 9.49  ? 27  HIS B CB  1 
ATOM   1850 C  CG  . HIS B 1 27  ? -4.629  23.085 36.557 1.00 9.39  ? 27  HIS B CG  1 
ATOM   1851 N  ND1 . HIS B 1 27  ? -5.698  22.394 37.084 1.00 10.18 ? 27  HIS B ND1 1 
ATOM   1852 C  CD2 . HIS B 1 27  ? -3.811  23.363 37.600 1.00 8.66  ? 27  HIS B CD2 1 
ATOM   1853 C  CE1 . HIS B 1 27  ? -5.534  22.258 38.387 1.00 6.80  ? 27  HIS B CE1 1 
ATOM   1854 N  NE2 . HIS B 1 27  ? -4.396  22.837 38.725 1.00 8.86  ? 27  HIS B NE2 1 
ATOM   1855 N  N   . THR B 1 28  ? -4.182  20.629 33.913 1.00 11.02 ? 28  THR B N   1 
ATOM   1856 C  CA  . THR B 1 28  ? -4.282  19.175 34.026 1.00 9.90  ? 28  THR B CA  1 
ATOM   1857 C  C   . THR B 1 28  ? -3.212  18.367 33.286 1.00 10.15 ? 28  THR B C   1 
ATOM   1858 O  O   . THR B 1 28  ? -3.030  17.182 33.568 1.00 10.76 ? 28  THR B O   1 
ATOM   1859 C  CB  . THR B 1 28  ? -5.675  18.681 33.565 1.00 10.16 ? 28  THR B CB  1 
ATOM   1860 O  OG1 . THR B 1 28  ? -5.853  18.962 32.170 1.00 10.65 ? 28  THR B OG1 1 
ATOM   1861 C  CG2 . THR B 1 28  ? -6.773  19.385 34.362 1.00 10.24 ? 28  THR B CG2 1 
ATOM   1862 N  N   . LYS B 1 29  ? -2.504  18.995 32.350 1.00 8.92  ? 29  LYS B N   1 
ATOM   1863 C  CA  . LYS B 1 29  ? -1.470  18.295 31.588 1.00 9.38  ? 29  LYS B CA  1 
ATOM   1864 C  C   . LYS B 1 29  ? -0.050  18.757 31.928 1.00 9.28  ? 29  LYS B C   1 
ATOM   1865 O  O   . LYS B 1 29  ? 0.751   17.991 32.472 1.00 9.46  ? 29  LYS B O   1 
ATOM   1866 C  CB  . LYS B 1 29  ? -1.711  18.473 30.084 1.00 8.54  ? 29  LYS B CB  1 
ATOM   1867 C  CG  . LYS B 1 29  ? -3.088  18.024 29.613 1.00 13.52 ? 29  LYS B CG  1 
ATOM   1868 C  CD  . LYS B 1 29  ? -3.342  16.550 29.929 1.00 16.14 ? 29  LYS B CD  1 
ATOM   1869 C  CE  . LYS B 1 29  ? -4.711  16.107 29.433 1.00 15.95 ? 29  LYS B CE  1 
ATOM   1870 N  NZ  . LYS B 1 29  ? -4.978  14.678 29.753 1.00 20.28 ? 29  LYS B NZ  1 
ATOM   1871 N  N   . HIS B 1 30  ? 0.260   20.006 31.599 1.00 7.70  ? 30  HIS B N   1 
ATOM   1872 C  CA  . HIS B 1 30  ? 1.584   20.557 31.862 1.00 8.92  ? 30  HIS B CA  1 
ATOM   1873 C  C   . HIS B 1 30  ? 1.953   20.540 33.347 1.00 8.37  ? 30  HIS B C   1 
ATOM   1874 O  O   . HIS B 1 30  ? 2.898   19.862 33.745 1.00 9.66  ? 30  HIS B O   1 
ATOM   1875 C  CB  . HIS B 1 30  ? 1.672   21.989 31.316 1.00 8.11  ? 30  HIS B CB  1 
ATOM   1876 C  CG  . HIS B 1 30  ? 1.646   22.069 29.822 1.00 9.54  ? 30  HIS B CG  1 
ATOM   1877 N  ND1 . HIS B 1 30  ? 2.767   21.867 29.045 1.00 10.98 ? 30  HIS B ND1 1 
ATOM   1878 C  CD2 . HIS B 1 30  ? 0.623   22.275 28.958 1.00 8.71  ? 30  HIS B CD2 1 
ATOM   1879 C  CE1 . HIS B 1 30  ? 2.436   21.947 27.768 1.00 8.75  ? 30  HIS B CE1 1 
ATOM   1880 N  NE2 . HIS B 1 30  ? 1.141   22.193 27.689 1.00 8.84  ? 30  HIS B NE2 1 
ATOM   1881 N  N   . HIS B 1 31  ? 1.213   21.274 34.169 1.00 7.83  ? 31  HIS B N   1 
ATOM   1882 C  CA  . HIS B 1 31  ? 1.533   21.315 35.593 1.00 8.56  ? 31  HIS B CA  1 
ATOM   1883 C  C   . HIS B 1 31  ? 1.472   19.921 36.207 1.00 8.79  ? 31  HIS B C   1 
ATOM   1884 O  O   . HIS B 1 31  ? 2.351   19.538 36.981 1.00 8.73  ? 31  HIS B O   1 
ATOM   1885 C  CB  . HIS B 1 31  ? 0.592   22.272 36.327 1.00 7.53  ? 31  HIS B CB  1 
ATOM   1886 C  CG  . HIS B 1 31  ? 1.012   22.571 37.734 1.00 9.35  ? 31  HIS B CG  1 
ATOM   1887 N  ND1 . HIS B 1 31  ? 0.413   23.552 38.497 1.00 7.49  ? 31  HIS B ND1 1 
ATOM   1888 C  CD2 . HIS B 1 31  ? 1.981   22.029 38.512 1.00 7.09  ? 31  HIS B CD2 1 
ATOM   1889 C  CE1 . HIS B 1 31  ? 0.997   23.602 39.681 1.00 9.40  ? 31  HIS B CE1 1 
ATOM   1890 N  NE2 . HIS B 1 31  ? 1.951   22.689 39.715 1.00 9.54  ? 31  HIS B NE2 1 
ATOM   1891 N  N   . GLN B 1 32  ? 0.446   19.153 35.856 1.00 9.42  ? 32  GLN B N   1 
ATOM   1892 C  CA  . GLN B 1 32  ? 0.322   17.794 36.376 1.00 9.25  ? 32  GLN B CA  1 
ATOM   1893 C  C   . GLN B 1 32  ? 1.586   16.984 36.090 1.00 10.36 ? 32  GLN B C   1 
ATOM   1894 O  O   . GLN B 1 32  ? 2.034   16.201 36.930 1.00 11.98 ? 32  GLN B O   1 
ATOM   1895 C  CB  . GLN B 1 32  ? -0.870  17.075 35.741 1.00 7.38  ? 32  GLN B CB  1 
ATOM   1896 C  CG  . GLN B 1 32  ? -1.061  15.665 36.270 1.00 7.16  ? 32  GLN B CG  1 
ATOM   1897 C  CD  . GLN B 1 32  ? -1.432  15.648 37.742 1.00 9.73  ? 32  GLN B CD  1 
ATOM   1898 O  OE1 . GLN B 1 32  ? -2.519  16.080 38.121 1.00 12.22 ? 32  GLN B OE1 1 
ATOM   1899 N  NE2 . GLN B 1 32  ? -0.525  15.165 38.578 1.00 8.23  ? 32  GLN B NE2 1 
ATOM   1900 N  N   . THR B 1 33  ? 2.152   17.167 34.899 1.00 10.83 ? 33  THR B N   1 
ATOM   1901 C  CA  . THR B 1 33  ? 3.359   16.439 34.514 1.00 11.50 ? 33  THR B CA  1 
ATOM   1902 C  C   . THR B 1 33  ? 4.581   16.845 35.327 1.00 11.14 ? 33  THR B C   1 
ATOM   1903 O  O   . THR B 1 33  ? 5.412   15.996 35.651 1.00 11.46 ? 33  THR B O   1 
ATOM   1904 C  CB  . THR B 1 33  ? 3.671   16.611 33.008 1.00 12.51 ? 33  THR B CB  1 
ATOM   1905 O  OG1 . THR B 1 33  ? 2.638   15.983 32.237 1.00 10.27 ? 33  THR B OG1 1 
ATOM   1906 C  CG2 . THR B 1 33  ? 5.017   15.975 32.657 1.00 11.50 ? 33  THR B CG2 1 
ATOM   1907 N  N   . TYR B 1 34  ? 4.705   18.130 35.653 1.00 10.03 ? 34  TYR B N   1 
ATOM   1908 C  CA  . TYR B 1 34  ? 5.846   18.569 36.452 1.00 10.21 ? 34  TYR B CA  1 
ATOM   1909 C  C   . TYR B 1 34  ? 5.744   17.877 37.809 1.00 9.46  ? 34  TYR B C   1 
ATOM   1910 O  O   . TYR B 1 34  ? 6.734   17.363 38.331 1.00 9.20  ? 34  TYR B O   1 
ATOM   1911 C  CB  . TYR B 1 34  ? 5.841   20.085 36.652 1.00 9.96  ? 34  TYR B CB  1 
ATOM   1912 C  CG  . TYR B 1 34  ? 5.859   20.896 35.374 1.00 10.39 ? 34  TYR B CG  1 
ATOM   1913 C  CD1 . TYR B 1 34  ? 6.783   20.630 34.361 1.00 11.87 ? 34  TYR B CD1 1 
ATOM   1914 C  CD2 . TYR B 1 34  ? 4.978   21.966 35.197 1.00 12.80 ? 34  TYR B CD2 1 
ATOM   1915 C  CE1 . TYR B 1 34  ? 6.829   21.413 33.201 1.00 12.73 ? 34  TYR B CE1 1 
ATOM   1916 C  CE2 . TYR B 1 34  ? 5.015   22.754 34.044 1.00 12.53 ? 34  TYR B CE2 1 
ATOM   1917 C  CZ  . TYR B 1 34  ? 5.941   22.473 33.054 1.00 12.28 ? 34  TYR B CZ  1 
ATOM   1918 O  OH  . TYR B 1 34  ? 5.969   23.249 31.920 1.00 13.69 ? 34  TYR B OH  1 
ATOM   1919 N  N   . VAL B 1 35  ? 4.537   17.871 38.369 1.00 8.44  ? 35  VAL B N   1 
ATOM   1920 C  CA  . VAL B 1 35  ? 4.273   17.228 39.652 1.00 9.57  ? 35  VAL B CA  1 
ATOM   1921 C  C   . VAL B 1 35  ? 4.661   15.753 39.634 1.00 9.32  ? 35  VAL B C   1 
ATOM   1922 O  O   . VAL B 1 35  ? 5.322   15.274 40.554 1.00 9.76  ? 35  VAL B O   1 
ATOM   1923 C  CB  . VAL B 1 35  ? 2.770   17.333 40.041 1.00 9.21  ? 35  VAL B CB  1 
ATOM   1924 C  CG1 . VAL B 1 35  ? 2.459   16.404 41.213 1.00 7.50  ? 35  VAL B CG1 1 
ATOM   1925 C  CG2 . VAL B 1 35  ? 2.432   18.765 40.421 1.00 6.49  ? 35  VAL B CG2 1 
ATOM   1926 N  N   . ASN B 1 36  ? 4.256   15.037 38.586 1.00 10.21 ? 36  ASN B N   1 
ATOM   1927 C  CA  . ASN B 1 36  ? 4.569   13.614 38.485 1.00 10.35 ? 36  ASN B CA  1 
ATOM   1928 C  C   . ASN B 1 36  ? 6.053   13.334 38.286 1.00 11.21 ? 36  ASN B C   1 
ATOM   1929 O  O   . ASN B 1 36  ? 6.615   12.476 38.966 1.00 10.23 ? 36  ASN B O   1 
ATOM   1930 C  CB  . ASN B 1 36  ? 3.767   12.957 37.357 1.00 11.87 ? 36  ASN B CB  1 
ATOM   1931 C  CG  . ASN B 1 36  ? 2.272   13.143 37.526 1.00 13.90 ? 36  ASN B CG  1 
ATOM   1932 O  OD1 . ASN B 1 36  ? 1.764   13.202 38.647 1.00 15.20 ? 36  ASN B OD1 1 
ATOM   1933 N  ND2 . ASN B 1 36  ? 1.557   13.207 36.413 1.00 15.15 ? 36  ASN B ND2 1 
ATOM   1934 N  N   . ASN B 1 37  ? 6.697   14.046 37.365 1.00 11.44 ? 37  ASN B N   1 
ATOM   1935 C  CA  . ASN B 1 37  ? 8.118   13.812 37.152 1.00 13.63 ? 37  ASN B CA  1 
ATOM   1936 C  C   . ASN B 1 37  ? 8.921   14.227 38.374 1.00 13.03 ? 37  ASN B C   1 
ATOM   1937 O  O   . ASN B 1 37  ? 9.962   13.640 38.666 1.00 14.15 ? 37  ASN B O   1 
ATOM   1938 C  CB  . ASN B 1 37  ? 8.631   14.556 35.915 1.00 14.18 ? 37  ASN B CB  1 
ATOM   1939 C  CG  . ASN B 1 37  ? 7.955   14.096 34.648 1.00 15.72 ? 37  ASN B CG  1 
ATOM   1940 O  OD1 . ASN B 1 37  ? 7.582   12.931 34.526 1.00 16.86 ? 37  ASN B OD1 1 
ATOM   1941 N  ND2 . ASN B 1 37  ? 7.817   14.999 33.683 1.00 16.56 ? 37  ASN B ND2 1 
ATOM   1942 N  N   . ALA B 1 38  ? 8.435   15.234 39.093 1.00 12.61 ? 38  ALA B N   1 
ATOM   1943 C  CA  . ALA B 1 38  ? 9.123   15.705 40.291 1.00 12.22 ? 38  ALA B CA  1 
ATOM   1944 C  C   . ALA B 1 38  ? 9.063   14.629 41.373 1.00 11.91 ? 38  ALA B C   1 
ATOM   1945 O  O   . ALA B 1 38  ? 10.073  14.329 42.000 1.00 12.31 ? 38  ALA B O   1 
ATOM   1946 C  CB  . ALA B 1 38  ? 8.489   17.000 40.798 1.00 11.72 ? 38  ALA B CB  1 
ATOM   1947 N  N   . ASN B 1 39  ? 7.884   14.051 41.587 1.00 11.74 ? 39  ASN B N   1 
ATOM   1948 C  CA  . ASN B 1 39  ? 7.732   12.999 42.591 1.00 12.11 ? 39  ASN B CA  1 
ATOM   1949 C  C   . ASN B 1 39  ? 8.541   11.750 42.235 1.00 12.94 ? 39  ASN B C   1 
ATOM   1950 O  O   . ASN B 1 39  ? 9.109   11.102 43.110 1.00 12.65 ? 39  ASN B O   1 
ATOM   1951 C  CB  . ASN B 1 39  ? 6.256   12.605 42.779 1.00 9.64  ? 39  ASN B CB  1 
ATOM   1952 C  CG  . ASN B 1 39  ? 5.431   13.701 43.440 1.00 10.74 ? 39  ASN B CG  1 
ATOM   1953 O  OD1 . ASN B 1 39  ? 5.915   14.415 44.324 1.00 9.14  ? 39  ASN B OD1 1 
ATOM   1954 N  ND2 . ASN B 1 39  ? 4.169   13.815 43.040 1.00 8.70  ? 39  ASN B ND2 1 
ATOM   1955 N  N   . ALA B 1 40  ? 8.594   11.410 40.952 1.00 14.31 ? 40  ALA B N   1 
ATOM   1956 C  CA  . ALA B 1 40  ? 9.348   10.237 40.530 1.00 14.65 ? 40  ALA B CA  1 
ATOM   1957 C  C   . ALA B 1 40  ? 10.821  10.436 40.890 1.00 15.57 ? 40  ALA B C   1 
ATOM   1958 O  O   . ALA B 1 40  ? 11.507  9.494  41.291 1.00 15.41 ? 40  ALA B O   1 
ATOM   1959 C  CB  . ALA B 1 40  ? 9.190   10.021 39.022 1.00 15.12 ? 40  ALA B CB  1 
ATOM   1960 N  N   . ALA B 1 41  ? 11.296  11.670 40.752 1.00 14.99 ? 41  ALA B N   1 
ATOM   1961 C  CA  . ALA B 1 41  ? 12.680  11.996 41.067 1.00 16.22 ? 41  ALA B CA  1 
ATOM   1962 C  C   . ALA B 1 41  ? 12.915  11.982 42.579 1.00 17.76 ? 41  ALA B C   1 
ATOM   1963 O  O   . ALA B 1 41  ? 13.933  11.474 43.054 1.00 16.75 ? 41  ALA B O   1 
ATOM   1964 C  CB  . ALA B 1 41  ? 13.036  13.365 40.490 1.00 15.34 ? 41  ALA B CB  1 
ATOM   1965 N  N   . LEU B 1 42  ? 11.966  12.542 43.326 1.00 19.53 ? 42  LEU B N   1 
ATOM   1966 C  CA  . LEU B 1 42  ? 12.050  12.605 44.785 1.00 21.30 ? 42  LEU B CA  1 
ATOM   1967 C  C   . LEU B 1 42  ? 11.758  11.252 45.426 1.00 22.00 ? 42  LEU B C   1 
ATOM   1968 O  O   . LEU B 1 42  ? 11.993  11.053 46.617 1.00 21.93 ? 42  LEU B O   1 
ATOM   1969 C  CB  . LEU B 1 42  ? 11.057  13.640 45.325 1.00 20.89 ? 42  LEU B CB  1 
ATOM   1970 C  CG  . LEU B 1 42  ? 11.279  15.112 44.964 1.00 21.32 ? 42  LEU B CG  1 
ATOM   1971 C  CD1 . LEU B 1 42  ? 10.094  15.940 45.440 1.00 20.37 ? 42  LEU B CD1 1 
ATOM   1972 C  CD2 . LEU B 1 42  ? 12.573  15.611 45.597 1.00 19.39 ? 42  LEU B CD2 1 
ATOM   1973 N  N   . GLU B 1 43  ? 11.249  10.320 44.632 1.00 23.74 ? 43  GLU B N   1 
ATOM   1974 C  CA  . GLU B 1 43  ? 10.911  8.999  45.136 1.00 26.41 ? 43  GLU B CA  1 
ATOM   1975 C  C   . GLU B 1 43  ? 12.130  8.268  45.691 1.00 26.45 ? 43  GLU B C   1 
ATOM   1976 O  O   . GLU B 1 43  ? 12.000  7.349  46.498 1.00 25.84 ? 43  GLU B O   1 
ATOM   1977 C  CB  . GLU B 1 43  ? 10.257  8.182  44.027 1.00 29.01 ? 43  GLU B CB  1 
ATOM   1978 C  CG  . GLU B 1 43  ? 9.666   6.871  44.487 1.00 34.28 ? 43  GLU B CG  1 
ATOM   1979 C  CD  . GLU B 1 43  ? 8.872   6.198  43.389 1.00 37.72 ? 43  GLU B CD  1 
ATOM   1980 O  OE1 . GLU B 1 43  ? 7.921   6.831  42.878 1.00 39.39 ? 43  GLU B OE1 1 
ATOM   1981 O  OE2 . GLU B 1 43  ? 9.195   5.042  43.040 1.00 39.89 ? 43  GLU B OE2 1 
ATOM   1982 N  N   . SER B 1 44  ? 13.316  8.682  45.262 1.00 26.69 ? 44  SER B N   1 
ATOM   1983 C  CA  . SER B 1 44  ? 14.550  8.071  45.739 1.00 25.88 ? 44  SER B CA  1 
ATOM   1984 C  C   . SER B 1 44  ? 15.395  9.127  46.447 1.00 26.79 ? 44  SER B C   1 
ATOM   1985 O  O   . SER B 1 44  ? 16.625  9.048  46.465 1.00 28.11 ? 44  SER B O   1 
ATOM   1986 C  CB  . SER B 1 44  ? 15.332  7.467  44.569 1.00 24.40 ? 44  SER B CB  1 
ATOM   1987 O  OG  . SER B 1 44  ? 15.679  8.456  43.620 1.00 22.54 ? 44  SER B OG  1 
ATOM   1988 N  N   . LEU B 1 45  ? 14.718  10.119 47.020 1.00 25.47 ? 45  LEU B N   1 
ATOM   1989 C  CA  . LEU B 1 45  ? 15.366  11.212 47.745 1.00 25.30 ? 45  LEU B CA  1 
ATOM   1990 C  C   . LEU B 1 45  ? 14.473  11.594 48.927 1.00 25.33 ? 45  LEU B C   1 
ATOM   1991 O  O   . LEU B 1 45  ? 13.951  12.705 48.987 1.00 24.84 ? 45  LEU B O   1 
ATOM   1992 C  CB  . LEU B 1 45  ? 15.551  12.432 46.827 1.00 24.14 ? 45  LEU B CB  1 
ATOM   1993 C  CG  . LEU B 1 45  ? 16.443  12.324 45.584 1.00 23.19 ? 45  LEU B CG  1 
ATOM   1994 C  CD1 . LEU B 1 45  ? 16.295  13.577 44.738 1.00 24.99 ? 45  LEU B CD1 1 
ATOM   1995 C  CD2 . LEU B 1 45  ? 17.893  12.130 45.995 1.00 23.22 ? 45  LEU B CD2 1 
ATOM   1996 N  N   . PRO B 1 46  ? 14.297  10.675 49.888 1.00 26.08 ? 46  PRO B N   1 
ATOM   1997 C  CA  . PRO B 1 46  ? 13.466  10.891 51.076 1.00 27.27 ? 46  PRO B CA  1 
ATOM   1998 C  C   . PRO B 1 46  ? 13.797  12.147 51.880 1.00 28.22 ? 46  PRO B C   1 
ATOM   1999 O  O   . PRO B 1 46  ? 12.895  12.841 52.352 1.00 29.75 ? 46  PRO B O   1 
ATOM   2000 C  CB  . PRO B 1 46  ? 13.690  9.606  51.876 1.00 26.57 ? 46  PRO B CB  1 
ATOM   2001 C  CG  . PRO B 1 46  ? 15.094  9.192  51.440 1.00 27.19 ? 46  PRO B CG  1 
ATOM   2002 C  CD  . PRO B 1 46  ? 14.911  9.340  49.954 1.00 26.02 ? 46  PRO B CD  1 
ATOM   2003 N  N   . GLU B 1 47  ? 15.085  12.439 52.029 1.00 27.85 ? 47  GLU B N   1 
ATOM   2004 C  CA  . GLU B 1 47  ? 15.508  13.608 52.788 1.00 29.14 ? 47  GLU B CA  1 
ATOM   2005 C  C   . GLU B 1 47  ? 15.062  14.917 52.138 1.00 29.55 ? 47  GLU B C   1 
ATOM   2006 O  O   . GLU B 1 47  ? 15.014  15.953 52.798 1.00 31.07 ? 47  GLU B O   1 
ATOM   2007 C  CB  . GLU B 1 47  ? 17.032  13.614 52.954 1.00 28.10 ? 47  GLU B CB  1 
ATOM   2008 C  CG  . GLU B 1 47  ? 17.809  13.743 51.656 0.00 28.35 ? 47  GLU B CG  1 
ATOM   2009 C  CD  . GLU B 1 47  ? 19.306  13.809 51.885 0.00 28.19 ? 47  GLU B CD  1 
ATOM   2010 O  OE1 . GLU B 1 47  ? 19.868  12.838 52.433 0.00 28.18 ? 47  GLU B OE1 1 
ATOM   2011 O  OE2 . GLU B 1 47  ? 19.921  14.834 51.522 0.00 28.18 ? 47  GLU B OE2 1 
ATOM   2012 N  N   . PHE B 1 48  ? 14.732  14.869 50.851 1.00 29.05 ? 48  PHE B N   1 
ATOM   2013 C  CA  . PHE B 1 48  ? 14.303  16.063 50.125 1.00 29.05 ? 48  PHE B CA  1 
ATOM   2014 C  C   . PHE B 1 48  ? 12.820  16.088 49.786 1.00 28.70 ? 48  PHE B C   1 
ATOM   2015 O  O   . PHE B 1 48  ? 12.240  17.155 49.602 1.00 28.35 ? 48  PHE B O   1 
ATOM   2016 C  CB  . PHE B 1 48  ? 15.097  16.198 48.826 1.00 29.49 ? 48  PHE B CB  1 
ATOM   2017 C  CG  . PHE B 1 48  ? 16.541  16.526 49.031 1.00 30.93 ? 48  PHE B CG  1 
ATOM   2018 C  CD1 . PHE B 1 48  ? 16.919  17.770 49.525 1.00 32.29 ? 48  PHE B CD1 1 
ATOM   2019 C  CD2 . PHE B 1 48  ? 17.528  15.591 48.735 1.00 31.87 ? 48  PHE B CD2 1 
ATOM   2020 C  CE1 . PHE B 1 48  ? 18.263  18.080 49.722 1.00 33.26 ? 48  PHE B CE1 1 
ATOM   2021 C  CE2 . PHE B 1 48  ? 18.873  15.890 48.928 1.00 32.92 ? 48  PHE B CE2 1 
ATOM   2022 C  CZ  . PHE B 1 48  ? 19.243  17.137 49.422 1.00 33.55 ? 48  PHE B CZ  1 
ATOM   2023 N  N   . ALA B 1 49  ? 12.214  14.911 49.702 1.00 29.95 ? 49  ALA B N   1 
ATOM   2024 C  CA  . ALA B 1 49  ? 10.805  14.793 49.349 1.00 30.81 ? 49  ALA B CA  1 
ATOM   2025 C  C   . ALA B 1 49  ? 9.825   15.416 50.341 1.00 30.69 ? 49  ALA B C   1 
ATOM   2026 O  O   . ALA B 1 49  ? 8.666   15.650 49.998 1.00 32.38 ? 49  ALA B O   1 
ATOM   2027 C  CB  . ALA B 1 49  ? 10.452  13.322 49.132 1.00 31.24 ? 49  ALA B CB  1 
ATOM   2028 N  N   . ASN B 1 50  ? 10.278  15.688 51.561 1.00 29.76 ? 50  ASN B N   1 
ATOM   2029 C  CA  . ASN B 1 50  ? 9.402   16.260 52.581 1.00 28.72 ? 50  ASN B CA  1 
ATOM   2030 C  C   . ASN B 1 50  ? 9.411   17.792 52.622 1.00 27.70 ? 50  ASN B C   1 
ATOM   2031 O  O   . ASN B 1 50  ? 8.587   18.411 53.299 1.00 26.09 ? 50  ASN B O   1 
ATOM   2032 C  CB  . ASN B 1 50  ? 9.781   15.704 53.958 1.00 29.48 ? 50  ASN B CB  1 
ATOM   2033 C  CG  . ASN B 1 50  ? 9.648   14.195 54.032 0.00 29.54 ? 50  ASN B CG  1 
ATOM   2034 O  OD1 . ASN B 1 50  ? 8.564   13.645 53.834 0.00 29.72 ? 50  ASN B OD1 1 
ATOM   2035 N  ND2 . ASN B 1 50  ? 10.753  13.517 54.318 0.00 29.72 ? 50  ASN B ND2 1 
ATOM   2036 N  N   . LEU B 1 51  ? 10.337  18.399 51.889 1.00 25.91 ? 51  LEU B N   1 
ATOM   2037 C  CA  . LEU B 1 51  ? 10.453  19.851 51.853 1.00 23.56 ? 51  LEU B CA  1 
ATOM   2038 C  C   . LEU B 1 51  ? 9.434   20.468 50.902 1.00 22.06 ? 51  LEU B C   1 
ATOM   2039 O  O   . LEU B 1 51  ? 9.020   19.833 49.932 1.00 22.09 ? 51  LEU B O   1 
ATOM   2040 C  CB  . LEU B 1 51  ? 11.853  20.252 51.384 1.00 25.01 ? 51  LEU B CB  1 
ATOM   2041 C  CG  . LEU B 1 51  ? 13.072  19.705 52.127 1.00 25.08 ? 51  LEU B CG  1 
ATOM   2042 C  CD1 . LEU B 1 51  ? 14.340  20.171 51.419 1.00 24.15 ? 51  LEU B CD1 1 
ATOM   2043 C  CD2 . LEU B 1 51  ? 13.051  20.173 53.568 1.00 24.69 ? 51  LEU B CD2 1 
ATOM   2044 N  N   . PRO B 1 52  ? 8.999   21.710 51.181 1.00 20.10 ? 52  PRO B N   1 
ATOM   2045 C  CA  . PRO B 1 52  ? 8.032   22.406 50.323 1.00 17.19 ? 52  PRO B CA  1 
ATOM   2046 C  C   . PRO B 1 52  ? 8.760   22.683 49.004 1.00 14.87 ? 52  PRO B C   1 
ATOM   2047 O  O   . PRO B 1 52  ? 9.958   22.969 49.013 1.00 13.81 ? 52  PRO B O   1 
ATOM   2048 C  CB  . PRO B 1 52  ? 7.754   23.691 51.104 1.00 17.87 ? 52  PRO B CB  1 
ATOM   2049 C  CG  . PRO B 1 52  ? 8.036   23.271 52.554 1.00 20.61 ? 52  PRO B CG  1 
ATOM   2050 C  CD  . PRO B 1 52  ? 9.344   22.559 52.332 1.00 20.43 ? 52  PRO B CD  1 
ATOM   2051 N  N   . VAL B 1 53  ? 8.052   22.608 47.882 1.00 12.77 ? 53  VAL B N   1 
ATOM   2052 C  CA  . VAL B 1 53  ? 8.678   22.826 46.582 1.00 9.60  ? 53  VAL B CA  1 
ATOM   2053 C  C   . VAL B 1 53  ? 9.479   24.126 46.517 1.00 10.61 ? 53  VAL B C   1 
ATOM   2054 O  O   . VAL B 1 53  ? 10.592  24.138 45.989 1.00 9.01  ? 53  VAL B O   1 
ATOM   2055 C  CB  . VAL B 1 53  ? 7.629   22.809 45.435 1.00 9.11  ? 53  VAL B CB  1 
ATOM   2056 C  CG1 . VAL B 1 53  ? 6.778   24.062 45.485 1.00 7.37  ? 53  VAL B CG1 1 
ATOM   2057 C  CG2 . VAL B 1 53  ? 8.327   22.658 44.081 1.00 3.70  ? 53  VAL B CG2 1 
ATOM   2058 N  N   . GLU B 1 54  ? 8.927   25.209 47.066 1.00 11.00 ? 54  GLU B N   1 
ATOM   2059 C  CA  . GLU B 1 54  ? 9.607   26.510 47.055 1.00 13.21 ? 54  GLU B CA  1 
ATOM   2060 C  C   . GLU B 1 54  ? 10.976  26.445 47.731 1.00 13.41 ? 54  GLU B C   1 
ATOM   2061 O  O   . GLU B 1 54  ? 11.904  27.161 47.350 1.00 11.88 ? 54  GLU B O   1 
ATOM   2062 C  CB  . GLU B 1 54  ? 8.781   27.584 47.782 1.00 14.96 ? 54  GLU B CB  1 
ATOM   2063 C  CG  . GLU B 1 54  ? 7.405   27.917 47.209 1.00 19.38 ? 54  GLU B CG  1 
ATOM   2064 C  CD  . GLU B 1 54  ? 6.410   26.775 47.331 1.00 19.80 ? 54  GLU B CD  1 
ATOM   2065 O  OE1 . GLU B 1 54  ? 6.387   26.114 48.390 1.00 18.94 ? 54  GLU B OE1 1 
ATOM   2066 O  OE2 . GLU B 1 54  ? 5.632   26.558 46.377 1.00 21.59 ? 54  GLU B OE2 1 
ATOM   2067 N  N   . GLU B 1 55  ? 11.088  25.601 48.751 1.00 13.99 ? 55  GLU B N   1 
ATOM   2068 C  CA  . GLU B 1 55  ? 12.335  25.464 49.494 1.00 15.46 ? 55  GLU B CA  1 
ATOM   2069 C  C   . GLU B 1 55  ? 13.324  24.552 48.783 1.00 14.08 ? 55  GLU B C   1 
ATOM   2070 O  O   . GLU B 1 55  ? 14.532  24.806 48.789 1.00 12.42 ? 55  GLU B O   1 
ATOM   2071 C  CB  . GLU B 1 55  ? 12.039  24.936 50.901 1.00 19.10 ? 55  GLU B CB  1 
ATOM   2072 C  CG  . GLU B 1 55  ? 13.263  24.645 51.746 1.00 26.78 ? 55  GLU B CG  1 
ATOM   2073 C  CD  . GLU B 1 55  ? 12.899  24.196 53.153 1.00 32.03 ? 55  GLU B CD  1 
ATOM   2074 O  OE1 . GLU B 1 55  ? 12.145  23.210 53.292 1.00 34.93 ? 55  GLU B OE1 1 
ATOM   2075 O  OE2 . GLU B 1 55  ? 13.371  24.827 54.123 1.00 36.31 ? 55  GLU B OE2 1 
ATOM   2076 N  N   . LEU B 1 56  ? 12.810  23.496 48.163 1.00 12.43 ? 56  LEU B N   1 
ATOM   2077 C  CA  . LEU B 1 56  ? 13.661  22.553 47.453 1.00 12.81 ? 56  LEU B CA  1 
ATOM   2078 C  C   . LEU B 1 56  ? 14.486  23.249 46.371 1.00 12.21 ? 56  LEU B C   1 
ATOM   2079 O  O   . LEU B 1 56  ? 15.694  23.025 46.264 1.00 12.44 ? 56  LEU B O   1 
ATOM   2080 C  CB  . LEU B 1 56  ? 12.818  21.449 46.809 1.00 13.43 ? 56  LEU B CB  1 
ATOM   2081 C  CG  . LEU B 1 56  ? 13.619  20.393 46.042 1.00 16.36 ? 56  LEU B CG  1 
ATOM   2082 C  CD1 . LEU B 1 56  ? 14.443  19.584 47.025 1.00 15.88 ? 56  LEU B CD1 1 
ATOM   2083 C  CD2 . LEU B 1 56  ? 12.688  19.477 45.266 1.00 18.96 ? 56  LEU B CD2 1 
ATOM   2084 N  N   . ILE B 1 57  ? 13.835  24.101 45.582 1.00 11.02 ? 57  ILE B N   1 
ATOM   2085 C  CA  . ILE B 1 57  ? 14.509  24.799 44.485 1.00 10.88 ? 57  ILE B CA  1 
ATOM   2086 C  C   . ILE B 1 57  ? 15.608  25.777 44.897 1.00 11.76 ? 57  ILE B C   1 
ATOM   2087 O  O   . ILE B 1 57  ? 16.311  26.316 44.042 1.00 10.18 ? 57  ILE B O   1 
ATOM   2088 C  CB  . ILE B 1 57  ? 13.494  25.543 43.593 1.00 9.27  ? 57  ILE B CB  1 
ATOM   2089 C  CG1 . ILE B 1 57  ? 12.712  26.561 44.420 1.00 8.34  ? 57  ILE B CG1 1 
ATOM   2090 C  CG2 . ILE B 1 57  ? 12.544  24.538 42.957 1.00 10.16 ? 57  ILE B CG2 1 
ATOM   2091 C  CD1 . ILE B 1 57  ? 11.791  27.441 43.600 1.00 11.09 ? 57  ILE B CD1 1 
ATOM   2092 N  N   . THR B 1 58  ? 15.751  26.010 46.200 1.00 11.61 ? 58  THR B N   1 
ATOM   2093 C  CA  . THR B 1 58  ? 16.791  26.901 46.699 1.00 11.53 ? 58  THR B CA  1 
ATOM   2094 C  C   . THR B 1 58  ? 17.968  26.036 47.134 1.00 14.11 ? 58  THR B C   1 
ATOM   2095 O  O   . THR B 1 58  ? 19.022  26.550 47.504 1.00 13.68 ? 58  THR B O   1 
ATOM   2096 C  CB  . THR B 1 58  ? 16.331  27.705 47.939 1.00 13.53 ? 58  THR B CB  1 
ATOM   2097 O  OG1 . THR B 1 58  ? 16.043  26.801 49.015 1.00 13.11 ? 58  THR B OG1 1 
ATOM   2098 C  CG2 . THR B 1 58  ? 15.095  28.526 47.628 1.00 11.55 ? 58  THR B CG2 1 
ATOM   2099 N  N   . LYS B 1 59  ? 17.783  24.717 47.078 1.00 15.88 ? 59  LYS B N   1 
ATOM   2100 C  CA  . LYS B 1 59  ? 18.823  23.782 47.500 1.00 17.19 ? 59  LYS B CA  1 
ATOM   2101 C  C   . LYS B 1 59  ? 19.282  22.817 46.413 1.00 17.45 ? 59  LYS B C   1 
ATOM   2102 O  O   . LYS B 1 59  ? 19.887  21.783 46.704 1.00 16.73 ? 59  LYS B O   1 
ATOM   2103 C  CB  . LYS B 1 59  ? 18.326  22.991 48.715 1.00 17.22 ? 59  LYS B CB  1 
ATOM   2104 C  CG  . LYS B 1 59  ? 17.969  23.878 49.897 1.00 20.95 ? 59  LYS B CG  1 
ATOM   2105 C  CD  . LYS B 1 59  ? 17.482  23.073 51.093 1.00 24.33 ? 59  LYS B CD  1 
ATOM   2106 C  CE  . LYS B 1 59  ? 17.186  23.985 52.269 1.00 25.66 ? 59  LYS B CE  1 
ATOM   2107 N  NZ  . LYS B 1 59  ? 16.741  23.225 53.467 1.00 30.30 ? 59  LYS B NZ  1 
ATOM   2108 N  N   . LEU B 1 60  ? 19.004  23.159 45.161 1.00 17.26 ? 60  LEU B N   1 
ATOM   2109 C  CA  . LEU B 1 60  ? 19.379  22.311 44.037 1.00 17.75 ? 60  LEU B CA  1 
ATOM   2110 C  C   . LEU B 1 60  ? 20.870  21.976 44.008 1.00 19.07 ? 60  LEU B C   1 
ATOM   2111 O  O   . LEU B 1 60  ? 21.259  20.894 43.571 1.00 16.88 ? 60  LEU B O   1 
ATOM   2112 C  CB  . LEU B 1 60  ? 18.976  22.984 42.728 1.00 15.94 ? 60  LEU B CB  1 
ATOM   2113 C  CG  . LEU B 1 60  ? 17.484  23.289 42.605 1.00 14.31 ? 60  LEU B CG  1 
ATOM   2114 C  CD1 . LEU B 1 60  ? 17.222  24.071 41.332 1.00 14.58 ? 60  LEU B CD1 1 
ATOM   2115 C  CD2 . LEU B 1 60  ? 16.701  21.991 42.623 1.00 14.53 ? 60  LEU B CD2 1 
ATOM   2116 N  N   . ASP B 1 61  ? 21.699  22.899 44.486 1.00 20.43 ? 61  ASP B N   1 
ATOM   2117 C  CA  . ASP B 1 61  ? 23.141  22.686 44.492 1.00 22.83 ? 61  ASP B CA  1 
ATOM   2118 C  C   . ASP B 1 61  ? 23.549  21.513 45.387 1.00 23.41 ? 61  ASP B C   1 
ATOM   2119 O  O   . ASP B 1 61  ? 24.683  21.037 45.314 1.00 23.63 ? 61  ASP B O   1 
ATOM   2120 C  CB  . ASP B 1 61  ? 23.866  23.957 44.947 1.00 26.09 ? 61  ASP B CB  1 
ATOM   2121 C  CG  . ASP B 1 61  ? 23.667  24.250 46.426 1.00 30.00 ? 61  ASP B CG  1 
ATOM   2122 O  OD1 . ASP B 1 61  ? 22.510  24.416 46.868 1.00 32.02 ? 61  ASP B OD1 1 
ATOM   2123 O  OD2 . ASP B 1 61  ? 24.679  24.312 47.152 1.00 33.32 ? 61  ASP B OD2 1 
ATOM   2124 N  N   . GLN B 1 62  ? 22.628  21.048 46.229 1.00 23.03 ? 62  GLN B N   1 
ATOM   2125 C  CA  . GLN B 1 62  ? 22.912  19.928 47.126 1.00 23.49 ? 62  GLN B CA  1 
ATOM   2126 C  C   . GLN B 1 62  ? 22.527  18.592 46.487 1.00 24.25 ? 62  GLN B C   1 
ATOM   2127 O  O   . GLN B 1 62  ? 22.495  17.553 47.153 1.00 22.79 ? 62  GLN B O   1 
ATOM   2128 C  CB  . GLN B 1 62  ? 22.156  20.092 48.447 1.00 22.18 ? 62  GLN B CB  1 
ATOM   2129 C  CG  . GLN B 1 62  ? 22.462  21.384 49.182 1.00 24.28 ? 62  GLN B CG  1 
ATOM   2130 C  CD  . GLN B 1 62  ? 21.767  21.471 50.530 1.00 24.26 ? 62  GLN B CD  1 
ATOM   2131 O  OE1 . GLN B 1 62  ? 21.850  22.487 51.216 1.00 28.18 ? 62  GLN B OE1 1 
ATOM   2132 N  NE2 . GLN B 1 62  ? 21.088  20.403 50.917 1.00 22.13 ? 62  GLN B NE2 1 
ATOM   2133 N  N   . LEU B 1 63  ? 22.236  18.624 45.193 1.00 24.10 ? 63  LEU B N   1 
ATOM   2134 C  CA  . LEU B 1 63  ? 21.850  17.417 44.478 1.00 24.20 ? 63  LEU B CA  1 
ATOM   2135 C  C   . LEU B 1 63  ? 22.837  17.063 43.376 1.00 24.74 ? 63  LEU B C   1 
ATOM   2136 O  O   . LEU B 1 63  ? 23.502  17.939 42.816 1.00 24.21 ? 63  LEU B O   1 
ATOM   2137 C  CB  . LEU B 1 63  ? 20.464  17.599 43.851 1.00 21.94 ? 63  LEU B CB  1 
ATOM   2138 C  CG  . LEU B 1 63  ? 19.283  17.813 44.792 1.00 22.27 ? 63  LEU B CG  1 
ATOM   2139 C  CD1 . LEU B 1 63  ? 18.050  18.180 43.985 1.00 22.97 ? 63  LEU B CD1 1 
ATOM   2140 C  CD2 . LEU B 1 63  ? 19.047  16.560 45.608 1.00 22.38 ? 63  LEU B CD2 1 
ATOM   2141 N  N   . PRO B 1 64  ? 22.959  15.763 43.064 1.00 25.44 ? 64  PRO B N   1 
ATOM   2142 C  CA  . PRO B 1 64  ? 23.869  15.316 42.007 1.00 26.37 ? 64  PRO B CA  1 
ATOM   2143 C  C   . PRO B 1 64  ? 23.399  15.928 40.682 1.00 27.41 ? 64  PRO B C   1 
ATOM   2144 O  O   . PRO B 1 64  ? 22.215  16.236 40.521 1.00 27.77 ? 64  PRO B O   1 
ATOM   2145 C  CB  . PRO B 1 64  ? 23.704  13.798 42.050 1.00 25.79 ? 64  PRO B CB  1 
ATOM   2146 C  CG  . PRO B 1 64  ? 22.259  13.645 42.511 1.00 26.22 ? 64  PRO B CG  1 
ATOM   2147 C  CD  . PRO B 1 64  ? 22.297  14.600 43.678 1.00 25.68 ? 64  PRO B CD  1 
ATOM   2148 N  N   . ALA B 1 65  ? 24.320  16.102 39.740 1.00 26.79 ? 65  ALA B N   1 
ATOM   2149 C  CA  . ALA B 1 65  ? 23.993  16.697 38.448 1.00 27.04 ? 65  ALA B CA  1 
ATOM   2150 C  C   . ALA B 1 65  ? 22.730  16.141 37.789 1.00 26.85 ? 65  ALA B C   1 
ATOM   2151 O  O   . ALA B 1 65  ? 21.956  16.897 37.199 1.00 27.80 ? 65  ALA B O   1 
ATOM   2152 C  CB  . ALA B 1 65  ? 25.181  16.560 37.492 1.00 26.02 ? 65  ALA B CB  1 
ATOM   2153 N  N   . ASP B 1 66  ? 22.517  14.831 37.880 1.00 26.59 ? 66  ASP B N   1 
ATOM   2154 C  CA  . ASP B 1 66  ? 21.339  14.224 37.260 1.00 26.30 ? 66  ASP B CA  1 
ATOM   2155 C  C   . ASP B 1 66  ? 20.029  14.625 37.940 1.00 24.22 ? 66  ASP B C   1 
ATOM   2156 O  O   . ASP B 1 66  ? 19.094  15.073 37.272 1.00 20.06 ? 66  ASP B O   1 
ATOM   2157 C  CB  . ASP B 1 66  ? 21.480  12.692 37.222 1.00 29.18 ? 66  ASP B CB  1 
ATOM   2158 C  CG  . ASP B 1 66  ? 21.633  12.081 38.600 1.00 31.97 ? 66  ASP B CG  1 
ATOM   2159 O  OD1 . ASP B 1 66  ? 22.530  12.522 39.346 1.00 34.87 ? 66  ASP B OD1 1 
ATOM   2160 O  OD2 . ASP B 1 66  ? 20.867  11.151 38.935 1.00 34.61 ? 66  ASP B OD2 1 
ATOM   2161 N  N   . LYS B 1 67  ? 19.964  14.476 39.263 1.00 22.28 ? 67  LYS B N   1 
ATOM   2162 C  CA  . LYS B 1 67  ? 18.762  14.840 40.011 1.00 21.62 ? 67  LYS B CA  1 
ATOM   2163 C  C   . LYS B 1 67  ? 18.541  16.347 39.991 1.00 20.81 ? 67  LYS B C   1 
ATOM   2164 O  O   . LYS B 1 67  ? 17.404  16.825 39.986 1.00 21.21 ? 67  LYS B O   1 
ATOM   2165 C  CB  . LYS B 1 67  ? 18.869  14.363 41.464 1.00 23.63 ? 67  LYS B CB  1 
ATOM   2166 C  CG  . LYS B 1 67  ? 18.756  12.859 41.649 1.00 25.00 ? 67  LYS B CG  1 
ATOM   2167 C  CD  . LYS B 1 67  ? 17.372  12.363 41.246 1.00 27.54 ? 67  LYS B CD  1 
ATOM   2168 C  CE  . LYS B 1 67  ? 17.237  10.864 41.462 1.00 29.21 ? 67  LYS B CE  1 
ATOM   2169 N  NZ  . LYS B 1 67  ? 15.888  10.344 41.089 1.00 30.27 ? 67  LYS B NZ  1 
ATOM   2170 N  N   . LYS B 1 68  ? 19.637  17.093 39.983 1.00 18.90 ? 68  LYS B N   1 
ATOM   2171 C  CA  . LYS B 1 68  ? 19.569  18.544 39.967 1.00 18.68 ? 68  LYS B CA  1 
ATOM   2172 C  C   . LYS B 1 68  ? 18.814  19.024 38.729 1.00 17.56 ? 68  LYS B C   1 
ATOM   2173 O  O   . LYS B 1 68  ? 17.899  19.843 38.825 1.00 17.30 ? 68  LYS B O   1 
ATOM   2174 C  CB  . LYS B 1 68  ? 20.986  19.129 39.987 1.00 21.40 ? 68  LYS B CB  1 
ATOM   2175 C  CG  . LYS B 1 68  ? 21.042  20.647 40.043 1.00 24.17 ? 68  LYS B CG  1 
ATOM   2176 C  CD  . LYS B 1 68  ? 22.477  21.146 40.117 1.00 26.25 ? 68  LYS B CD  1 
ATOM   2177 C  CE  . LYS B 1 68  ? 22.532  22.665 40.200 1.00 27.58 ? 68  LYS B CE  1 
ATOM   2178 N  NZ  . LYS B 1 68  ? 23.926  23.161 40.370 1.00 27.50 ? 68  LYS B NZ  1 
ATOM   2179 N  N   . THR B 1 69  ? 19.190  18.503 37.568 1.00 15.02 ? 69  THR B N   1 
ATOM   2180 C  CA  . THR B 1 69  ? 18.543  18.899 36.325 1.00 14.61 ? 69  THR B CA  1 
ATOM   2181 C  C   . THR B 1 69  ? 17.050  18.572 36.313 1.00 14.44 ? 69  THR B C   1 
ATOM   2182 O  O   . THR B 1 69  ? 16.216  19.454 36.095 1.00 14.01 ? 69  THR B O   1 
ATOM   2183 C  CB  . THR B 1 69  ? 19.226  18.233 35.111 1.00 13.14 ? 69  THR B CB  1 
ATOM   2184 O  OG1 . THR B 1 69  ? 20.586  18.686 35.027 1.00 11.93 ? 69  THR B OG1 1 
ATOM   2185 C  CG2 . THR B 1 69  ? 18.497  18.589 33.818 1.00 14.31 ? 69  THR B CG2 1 
ATOM   2186 N  N   . VAL B 1 70  ? 16.707  17.314 36.562 1.00 13.20 ? 70  VAL B N   1 
ATOM   2187 C  CA  . VAL B 1 70  ? 15.306  16.913 36.547 1.00 13.37 ? 70  VAL B CA  1 
ATOM   2188 C  C   . VAL B 1 70  ? 14.448  17.668 37.579 1.00 11.88 ? 70  VAL B C   1 
ATOM   2189 O  O   . VAL B 1 70  ? 13.277  17.949 37.325 1.00 10.77 ? 70  VAL B O   1 
ATOM   2190 C  CB  . VAL B 1 70  ? 15.162  15.384 36.761 1.00 13.20 ? 70  VAL B CB  1 
ATOM   2191 C  CG1 . VAL B 1 70  ? 15.598  15.006 38.162 1.00 14.71 ? 70  VAL B CG1 1 
ATOM   2192 C  CG2 . VAL B 1 70  ? 13.728  14.952 36.495 1.00 14.39 ? 70  VAL B CG2 1 
ATOM   2193 N  N   . LEU B 1 71  ? 15.024  18.005 38.732 1.00 10.21 ? 71  LEU B N   1 
ATOM   2194 C  CA  . LEU B 1 71  ? 14.270  18.726 39.762 1.00 9.20  ? 71  LEU B CA  1 
ATOM   2195 C  C   . LEU B 1 71  ? 14.223  20.227 39.481 1.00 9.25  ? 71  LEU B C   1 
ATOM   2196 O  O   . LEU B 1 71  ? 13.248  20.902 39.810 1.00 8.61  ? 71  LEU B O   1 
ATOM   2197 C  CB  . LEU B 1 71  ? 14.856  18.441 41.153 1.00 8.80  ? 71  LEU B CB  1 
ATOM   2198 C  CG  . LEU B 1 71  ? 14.529  17.033 41.680 1.00 9.61  ? 71  LEU B CG  1 
ATOM   2199 C  CD1 . LEU B 1 71  ? 15.330  16.701 42.919 1.00 10.77 ? 71  LEU B CD1 1 
ATOM   2200 C  CD2 . LEU B 1 71  ? 13.048  16.954 41.976 1.00 9.27  ? 71  LEU B CD2 1 
ATOM   2201 N  N   . ARG B 1 72  ? 15.278  20.744 38.864 1.00 8.84  ? 72  ARG B N   1 
ATOM   2202 C  CA  . ARG B 1 72  ? 15.339  22.150 38.501 1.00 9.12  ? 72  ARG B CA  1 
ATOM   2203 C  C   . ARG B 1 72  ? 14.195  22.452 37.536 1.00 8.64  ? 72  ARG B C   1 
ATOM   2204 O  O   . ARG B 1 72  ? 13.509  23.470 37.658 1.00 7.96  ? 72  ARG B O   1 
ATOM   2205 C  CB  . ARG B 1 72  ? 16.679  22.449 37.828 1.00 9.09  ? 72  ARG B CB  1 
ATOM   2206 C  CG  . ARG B 1 72  ? 16.775  23.796 37.120 1.00 9.40  ? 72  ARG B CG  1 
ATOM   2207 C  CD  . ARG B 1 72  ? 18.149  23.928 36.463 1.00 10.58 ? 72  ARG B CD  1 
ATOM   2208 N  NE  . ARG B 1 72  ? 18.296  25.119 35.628 1.00 7.50  ? 72  ARG B NE  1 
ATOM   2209 C  CZ  . ARG B 1 72  ? 19.454  25.499 35.088 1.00 10.19 ? 72  ARG B CZ  1 
ATOM   2210 N  NH1 . ARG B 1 72  ? 20.549  24.775 35.305 1.00 7.28  ? 72  ARG B NH1 1 
ATOM   2211 N  NH2 . ARG B 1 72  ? 19.525  26.594 34.335 1.00 3.74  ? 72  ARG B NH2 1 
ATOM   2212 N  N   . ASN B 1 73  ? 13.986  21.545 36.590 1.00 8.39  ? 73  ASN B N   1 
ATOM   2213 C  CA  . ASN B 1 73  ? 12.941  21.703 35.584 1.00 8.82  ? 73  ASN B CA  1 
ATOM   2214 C  C   . ASN B 1 73  ? 11.527  21.412 36.081 1.00 9.82  ? 73  ASN B C   1 
ATOM   2215 O  O   . ASN B 1 73  ? 10.583  22.138 35.755 1.00 10.55 ? 73  ASN B O   1 
ATOM   2216 C  CB  . ASN B 1 73  ? 13.216  20.795 34.371 1.00 9.85  ? 73  ASN B CB  1 
ATOM   2217 C  CG  . ASN B 1 73  ? 14.536  21.104 33.685 1.00 9.36  ? 73  ASN B CG  1 
ATOM   2218 O  OD1 . ASN B 1 73  ? 14.916  22.262 33.529 1.00 10.77 ? 73  ASN B OD1 1 
ATOM   2219 N  ND2 . ASN B 1 73  ? 15.222  20.065 33.235 1.00 13.20 ? 73  ASN B ND2 1 
ATOM   2220 N  N   . ASN B 1 74  ? 11.378  20.358 36.873 1.00 8.30  ? 74  ASN B N   1 
ATOM   2221 C  CA  . ASN B 1 74  ? 10.060  19.963 37.345 1.00 10.22 ? 74  ASN B CA  1 
ATOM   2222 C  C   . ASN B 1 74  ? 9.631   20.511 38.696 1.00 10.70 ? 74  ASN B C   1 
ATOM   2223 O  O   . ASN B 1 74  ? 8.442   20.759 38.910 1.00 10.47 ? 74  ASN B O   1 
ATOM   2224 C  CB  . ASN B 1 74  ? 9.963   18.440 37.304 1.00 9.53  ? 74  ASN B CB  1 
ATOM   2225 C  CG  . ASN B 1 74  ? 10.111  17.902 35.896 1.00 10.30 ? 74  ASN B CG  1 
ATOM   2226 O  OD1 . ASN B 1 74  ? 9.233   18.084 35.056 1.00 12.33 ? 74  ASN B OD1 1 
ATOM   2227 N  ND2 . ASN B 1 74  ? 11.235  17.263 35.621 1.00 10.99 ? 74  ASN B ND2 1 
ATOM   2228 N  N   . ALA B 1 75  ? 10.574  20.695 39.612 1.00 9.87  ? 75  ALA B N   1 
ATOM   2229 C  CA  . ALA B 1 75  ? 10.219  21.271 40.899 1.00 11.15 ? 75  ALA B CA  1 
ATOM   2230 C  C   . ALA B 1 75  ? 10.012  22.742 40.561 1.00 9.43  ? 75  ALA B C   1 
ATOM   2231 O  O   . ALA B 1 75  ? 9.118   23.396 41.089 1.00 9.54  ? 75  ALA B O   1 
ATOM   2232 C  CB  . ALA B 1 75  ? 11.352  21.105 41.908 1.00 10.83 ? 75  ALA B CB  1 
ATOM   2233 N  N   . GLY B 1 76  ? 10.844  23.247 39.655 1.00 10.81 ? 76  GLY B N   1 
ATOM   2234 C  CA  . GLY B 1 76  ? 10.726  24.631 39.228 1.00 9.73  ? 76  GLY B CA  1 
ATOM   2235 C  C   . GLY B 1 76  ? 9.386   24.829 38.542 1.00 9.30  ? 76  GLY B C   1 
ATOM   2236 O  O   . GLY B 1 76  ? 8.666   25.784 38.828 1.00 9.77  ? 76  GLY B O   1 
ATOM   2237 N  N   . GLY B 1 77  ? 9.041   23.912 37.644 1.00 8.07  ? 77  GLY B N   1 
ATOM   2238 C  CA  . GLY B 1 77  ? 7.772   24.014 36.948 1.00 9.28  ? 77  GLY B CA  1 
ATOM   2239 C  C   . GLY B 1 77  ? 6.605   24.033 37.921 1.00 8.98  ? 77  GLY B C   1 
ATOM   2240 O  O   . GLY B 1 77  ? 5.679   24.832 37.785 1.00 6.53  ? 77  GLY B O   1 
ATOM   2241 N  N   . HIS B 1 78  ? 6.656   23.147 38.909 1.00 8.82  ? 78  HIS B N   1 
ATOM   2242 C  CA  . HIS B 1 78  ? 5.609   23.047 39.920 1.00 8.93  ? 78  HIS B CA  1 
ATOM   2243 C  C   . HIS B 1 78  ? 5.496   24.323 40.752 1.00 7.32  ? 78  HIS B C   1 
ATOM   2244 O  O   . HIS B 1 78  ? 4.396   24.805 41.007 1.00 5.14  ? 78  HIS B O   1 
ATOM   2245 C  CB  . HIS B 1 78  ? 5.881   21.838 40.823 1.00 10.32 ? 78  HIS B CB  1 
ATOM   2246 C  CG  . HIS B 1 78  ? 4.924   21.699 41.965 1.00 10.53 ? 78  HIS B CG  1 
ATOM   2247 N  ND1 . HIS B 1 78  ? 3.560   21.822 41.814 1.00 11.78 ? 78  HIS B ND1 1 
ATOM   2248 C  CD2 . HIS B 1 78  ? 5.131   21.389 43.267 1.00 10.00 ? 78  HIS B CD2 1 
ATOM   2249 C  CE1 . HIS B 1 78  ? 2.968   21.596 42.973 1.00 12.83 ? 78  HIS B CE1 1 
ATOM   2250 N  NE2 . HIS B 1 78  ? 3.899   21.330 43.872 1.00 11.88 ? 78  HIS B NE2 1 
ATOM   2251 N  N   . ALA B 1 79  ? 6.635   24.874 41.160 1.00 7.61  ? 79  ALA B N   1 
ATOM   2252 C  CA  . ALA B 1 79  ? 6.644   26.094 41.961 1.00 7.34  ? 79  ALA B CA  1 
ATOM   2253 C  C   . ALA B 1 79  ? 6.144   27.297 41.168 1.00 6.62  ? 79  ALA B C   1 
ATOM   2254 O  O   . ALA B 1 79  ? 5.301   28.056 41.649 1.00 6.27  ? 79  ALA B O   1 
ATOM   2255 C  CB  . ALA B 1 79  ? 8.046   26.367 42.481 1.00 8.41  ? 79  ALA B CB  1 
ATOM   2256 N  N   . ASN B 1 80  ? 6.658   27.469 39.952 1.00 6.17  ? 80  ASN B N   1 
ATOM   2257 C  CA  . ASN B 1 80  ? 6.259   28.599 39.130 1.00 6.78  ? 80  ASN B CA  1 
ATOM   2258 C  C   . ASN B 1 80  ? 4.767   28.611 38.815 1.00 7.39  ? 80  ASN B C   1 
ATOM   2259 O  O   . ASN B 1 80  ? 4.115   29.651 38.932 1.00 8.74  ? 80  ASN B O   1 
ATOM   2260 C  CB  . ASN B 1 80  ? 7.048   28.639 37.814 1.00 6.30  ? 80  ASN B CB  1 
ATOM   2261 C  CG  . ASN B 1 80  ? 8.556   28.666 38.027 1.00 6.61  ? 80  ASN B CG  1 
ATOM   2262 O  OD1 . ASN B 1 80  ? 9.052   29.266 38.979 1.00 4.59  ? 80  ASN B OD1 1 
ATOM   2263 N  ND2 . ASN B 1 80  ? 9.291   28.039 37.116 1.00 7.27  ? 80  ASN B ND2 1 
ATOM   2264 N  N   . HIS B 1 81  ? 4.217   27.466 38.423 1.00 6.75  ? 81  HIS B N   1 
ATOM   2265 C  CA  . HIS B 1 81  ? 2.798   27.424 38.086 1.00 8.11  ? 81  HIS B CA  1 
ATOM   2266 C  C   . HIS B 1 81  ? 1.873   27.532 39.295 1.00 6.99  ? 81  HIS B C   1 
ATOM   2267 O  O   . HIS B 1 81  ? 0.811   28.141 39.201 1.00 7.06  ? 81  HIS B O   1 
ATOM   2268 C  CB  . HIS B 1 81  ? 2.475   26.176 37.256 1.00 7.74  ? 81  HIS B CB  1 
ATOM   2269 C  CG  . HIS B 1 81  ? 3.140   26.168 35.913 1.00 10.77 ? 81  HIS B CG  1 
ATOM   2270 N  ND1 . HIS B 1 81  ? 4.501   26.003 35.757 1.00 9.64  ? 81  HIS B ND1 1 
ATOM   2271 C  CD2 . HIS B 1 81  ? 2.641   26.372 34.670 1.00 9.42  ? 81  HIS B CD2 1 
ATOM   2272 C  CE1 . HIS B 1 81  ? 4.810   26.106 34.476 1.00 10.56 ? 81  HIS B CE1 1 
ATOM   2273 N  NE2 . HIS B 1 81  ? 3.701   26.330 33.795 1.00 8.53  ? 81  HIS B NE2 1 
ATOM   2274 N  N   . SER B 1 82  ? 2.268   26.956 40.426 1.00 5.70  ? 82  SER B N   1 
ATOM   2275 C  CA  . SER B 1 82  ? 1.447   27.056 41.632 1.00 7.68  ? 82  SER B CA  1 
ATOM   2276 C  C   . SER B 1 82  ? 1.312   28.545 41.976 1.00 7.20  ? 82  SER B C   1 
ATOM   2277 O  O   . SER B 1 82  ? 0.262   29.000 42.422 1.00 6.01  ? 82  SER B O   1 
ATOM   2278 C  CB  . SER B 1 82  ? 2.104   26.307 42.800 1.00 5.81  ? 82  SER B CB  1 
ATOM   2279 O  OG  . SER B 1 82  ? 2.233   24.926 42.502 1.00 5.61  ? 82  SER B OG  1 
ATOM   2280 N  N   . LEU B 1 83  ? 2.391   29.292 41.756 1.00 6.68  ? 83  LEU B N   1 
ATOM   2281 C  CA  . LEU B 1 83  ? 2.413   30.728 42.014 1.00 7.61  ? 83  LEU B CA  1 
ATOM   2282 C  C   . LEU B 1 83  ? 1.575   31.444 40.949 1.00 8.46  ? 83  LEU B C   1 
ATOM   2283 O  O   . LEU B 1 83  ? 0.845   32.390 41.246 1.00 7.38  ? 83  LEU B O   1 
ATOM   2284 C  CB  . LEU B 1 83  ? 3.864   31.237 41.982 1.00 6.34  ? 83  LEU B CB  1 
ATOM   2285 C  CG  . LEU B 1 83  ? 4.186   32.721 42.200 1.00 8.69  ? 83  LEU B CG  1 
ATOM   2286 C  CD1 . LEU B 1 83  ? 5.689   32.898 42.344 1.00 7.63  ? 83  LEU B CD1 1 
ATOM   2287 C  CD2 . LEU B 1 83  ? 3.663   33.559 41.040 1.00 7.18  ? 83  LEU B CD2 1 
ATOM   2288 N  N   . PHE B 1 84  ? 1.684   30.971 39.711 1.00 7.82  ? 84  PHE B N   1 
ATOM   2289 C  CA  . PHE B 1 84  ? 0.965   31.552 38.580 1.00 8.83  ? 84  PHE B CA  1 
ATOM   2290 C  C   . PHE B 1 84  ? -0.554  31.526 38.761 1.00 8.28  ? 84  PHE B C   1 
ATOM   2291 O  O   . PHE B 1 84  ? -1.214  32.551 38.603 1.00 8.37  ? 84  PHE B O   1 
ATOM   2292 C  CB  . PHE B 1 84  ? 1.360   30.806 37.294 1.00 9.68  ? 84  PHE B CB  1 
ATOM   2293 C  CG  . PHE B 1 84  ? 0.904   31.473 36.021 1.00 9.79  ? 84  PHE B CG  1 
ATOM   2294 C  CD1 . PHE B 1 84  ? 1.191   32.814 35.778 1.00 10.37 ? 84  PHE B CD1 1 
ATOM   2295 C  CD2 . PHE B 1 84  ? 0.252   30.740 35.033 1.00 10.19 ? 84  PHE B CD2 1 
ATOM   2296 C  CE1 . PHE B 1 84  ? 0.838   33.416 34.565 1.00 11.06 ? 84  PHE B CE1 1 
ATOM   2297 C  CE2 . PHE B 1 84  ? -0.104  31.329 33.819 1.00 10.92 ? 84  PHE B CE2 1 
ATOM   2298 C  CZ  . PHE B 1 84  ? 0.189   32.670 33.584 1.00 11.14 ? 84  PHE B CZ  1 
ATOM   2299 N  N   . TRP B 1 85  ? -1.104  30.361 39.099 1.00 8.99  ? 85  TRP B N   1 
ATOM   2300 C  CA  . TRP B 1 85  ? -2.551  30.216 39.285 1.00 8.61  ? 85  TRP B CA  1 
ATOM   2301 C  C   . TRP B 1 85  ? -3.069  31.206 40.327 1.00 10.56 ? 85  TRP B C   1 
ATOM   2302 O  O   . TRP B 1 85  ? -4.058  31.910 40.096 1.00 9.65  ? 85  TRP B O   1 
ATOM   2303 C  CB  . TRP B 1 85  ? -2.887  28.784 39.714 1.00 7.72  ? 85  TRP B CB  1 
ATOM   2304 C  CG  . TRP B 1 85  ? -2.328  27.735 38.802 1.00 6.38  ? 85  TRP B CG  1 
ATOM   2305 C  CD1 . TRP B 1 85  ? -1.716  26.576 39.173 1.00 6.29  ? 85  TRP B CD1 1 
ATOM   2306 C  CD2 . TRP B 1 85  ? -2.306  27.758 37.366 1.00 7.18  ? 85  TRP B CD2 1 
ATOM   2307 N  NE1 . TRP B 1 85  ? -1.307  25.875 38.060 1.00 7.28  ? 85  TRP B NE1 1 
ATOM   2308 C  CE2 . TRP B 1 85  ? -1.657  26.579 36.939 1.00 6.49  ? 85  TRP B CE2 1 
ATOM   2309 C  CE3 . TRP B 1 85  ? -2.771  28.661 36.400 1.00 7.22  ? 85  TRP B CE3 1 
ATOM   2310 C  CZ2 . TRP B 1 85  ? -1.459  26.278 35.585 1.00 8.52  ? 85  TRP B CZ2 1 
ATOM   2311 C  CZ3 . TRP B 1 85  ? -2.573  28.362 35.053 1.00 8.34  ? 85  TRP B CZ3 1 
ATOM   2312 C  CH2 . TRP B 1 85  ? -1.920  27.180 34.660 1.00 6.84  ? 85  TRP B CH2 1 
ATOM   2313 N  N   . LYS B 1 86  ? -2.405  31.253 41.478 1.00 10.93 ? 86  LYS B N   1 
ATOM   2314 C  CA  . LYS B 1 86  ? -2.794  32.178 42.536 1.00 11.27 ? 86  LYS B CA  1 
ATOM   2315 C  C   . LYS B 1 86  ? -2.516  33.616 42.138 1.00 10.04 ? 86  LYS B C   1 
ATOM   2316 O  O   . LYS B 1 86  ? -3.124  34.542 42.667 1.00 10.43 ? 86  LYS B O   1 
ATOM   2317 C  CB  . LYS B 1 86  ? -2.045  31.859 43.833 1.00 13.82 ? 86  LYS B CB  1 
ATOM   2318 C  CG  . LYS B 1 86  ? -2.622  30.700 44.608 1.00 16.75 ? 86  LYS B CG  1 
ATOM   2319 C  CD  . LYS B 1 86  ? -1.820  30.435 45.865 1.00 21.30 ? 86  LYS B CD  1 
ATOM   2320 C  CE  . LYS B 1 86  ? -2.653  29.664 46.875 1.00 23.17 ? 86  LYS B CE  1 
ATOM   2321 N  NZ  . LYS B 1 86  ? -3.278  28.453 46.280 1.00 26.46 ? 86  LYS B NZ  1 
ATOM   2322 N  N   . GLY B 1 87  ? -1.595  33.794 41.198 1.00 10.16 ? 87  GLY B N   1 
ATOM   2323 C  CA  . GLY B 1 87  ? -1.235  35.127 40.749 1.00 9.80  ? 87  GLY B CA  1 
ATOM   2324 C  C   . GLY B 1 87  ? -2.105  35.688 39.641 1.00 8.83  ? 87  GLY B C   1 
ATOM   2325 O  O   . GLY B 1 87  ? -1.772  36.717 39.053 1.00 6.77  ? 87  GLY B O   1 
ATOM   2326 N  N   . LEU B 1 88  ? -3.216  35.014 39.353 1.00 8.92  ? 88  LEU B N   1 
ATOM   2327 C  CA  . LEU B 1 88  ? -4.136  35.459 38.314 1.00 8.80  ? 88  LEU B CA  1 
ATOM   2328 C  C   . LEU B 1 88  ? -5.527  35.650 38.897 1.00 10.27 ? 88  LEU B C   1 
ATOM   2329 O  O   . LEU B 1 88  ? -5.982  34.842 39.714 1.00 8.39  ? 88  LEU B O   1 
ATOM   2330 C  CB  . LEU B 1 88  ? -4.201  34.437 37.174 1.00 8.49  ? 88  LEU B CB  1 
ATOM   2331 C  CG  . LEU B 1 88  ? -2.936  34.203 36.346 1.00 8.77  ? 88  LEU B CG  1 
ATOM   2332 C  CD1 . LEU B 1 88  ? -3.136  32.996 35.430 1.00 6.46  ? 88  LEU B CD1 1 
ATOM   2333 C  CD2 . LEU B 1 88  ? -2.613  35.457 35.546 1.00 6.65  ? 88  LEU B CD2 1 
ATOM   2334 N  N   . LYS B 1 89  ? -6.196  36.718 38.469 1.00 10.10 ? 89  LYS B N   1 
ATOM   2335 C  CA  . LYS B 1 89  ? -7.542  37.021 38.937 1.00 12.39 ? 89  LYS B CA  1 
ATOM   2336 C  C   . LYS B 1 89  ? -8.074  38.278 38.256 1.00 12.21 ? 89  LYS B C   1 
ATOM   2337 O  O   . LYS B 1 89  ? -7.326  39.223 38.004 1.00 13.28 ? 89  LYS B O   1 
ATOM   2338 C  CB  . LYS B 1 89  ? -7.538  37.228 40.453 1.00 16.10 ? 89  LYS B CB  1 
ATOM   2339 C  CG  . LYS B 1 89  ? -8.916  37.450 41.049 1.00 17.90 ? 89  LYS B CG  1 
ATOM   2340 C  CD  . LYS B 1 89  ? -8.824  37.800 42.520 1.00 21.47 ? 89  LYS B CD  1 
ATOM   2341 C  CE  . LYS B 1 89  ? -10.203 38.008 43.123 1.00 23.91 ? 89  LYS B CE  1 
ATOM   2342 N  NZ  . LYS B 1 89  ? -10.108 38.473 44.533 1.00 27.57 ? 89  LYS B NZ  1 
ATOM   2343 N  N   . LYS B 1 90  ? -9.368  38.286 37.951 1.00 12.22 ? 90  LYS B N   1 
ATOM   2344 C  CA  . LYS B 1 90  ? -9.982  39.442 37.311 1.00 12.20 ? 90  LYS B CA  1 
ATOM   2345 C  C   . LYS B 1 90  ? -10.527 40.448 38.321 1.00 12.09 ? 90  LYS B C   1 
ATOM   2346 O  O   . LYS B 1 90  ? -10.808 40.108 39.475 1.00 12.47 ? 90  LYS B O   1 
ATOM   2347 C  CB  . LYS B 1 90  ? -11.122 39.003 36.385 1.00 12.65 ? 90  LYS B CB  1 
ATOM   2348 C  CG  . LYS B 1 90  ? -10.668 38.277 35.123 1.00 12.98 ? 90  LYS B CG  1 
ATOM   2349 C  CD  . LYS B 1 90  ? -11.859 37.839 34.272 1.00 13.73 ? 90  LYS B CD  1 
ATOM   2350 C  CE  . LYS B 1 90  ? -12.701 39.021 33.816 1.00 14.17 ? 90  LYS B CE  1 
ATOM   2351 N  NZ  . LYS B 1 90  ? -13.852 38.597 32.969 1.00 12.64 ? 90  LYS B NZ  1 
ATOM   2352 N  N   . GLY B 1 91  ? -10.650 41.693 37.874 1.00 10.16 ? 91  GLY B N   1 
ATOM   2353 C  CA  . GLY B 1 91  ? -11.205 42.742 38.709 1.00 11.04 ? 91  GLY B CA  1 
ATOM   2354 C  C   . GLY B 1 91  ? -10.407 43.289 39.877 1.00 11.40 ? 91  GLY B C   1 
ATOM   2355 O  O   . GLY B 1 91  ? -10.999 43.839 40.804 1.00 10.96 ? 91  GLY B O   1 
ATOM   2356 N  N   . THR B 1 92  ? -9.084  43.152 39.857 1.00 10.82 ? 92  THR B N   1 
ATOM   2357 C  CA  . THR B 1 92  ? -8.276  43.686 40.948 1.00 9.99  ? 92  THR B CA  1 
ATOM   2358 C  C   . THR B 1 92  ? -7.707  45.016 40.481 1.00 10.82 ? 92  THR B C   1 
ATOM   2359 O  O   . THR B 1 92  ? -7.710  45.318 39.288 1.00 11.36 ? 92  THR B O   1 
ATOM   2360 C  CB  . THR B 1 92  ? -7.099  42.753 41.328 1.00 9.77  ? 92  THR B CB  1 
ATOM   2361 O  OG1 . THR B 1 92  ? -6.128  42.746 40.275 1.00 7.92  ? 92  THR B OG1 1 
ATOM   2362 C  CG2 . THR B 1 92  ? -7.601  41.327 41.561 1.00 6.05  ? 92  THR B CG2 1 
ATOM   2363 N  N   . THR B 1 93  ? -7.213  45.810 41.420 1.00 11.24 ? 93  THR B N   1 
ATOM   2364 C  CA  . THR B 1 93  ? -6.652  47.106 41.080 1.00 10.82 ? 93  THR B CA  1 
ATOM   2365 C  C   . THR B 1 93  ? -5.308  47.284 41.762 1.00 10.09 ? 93  THR B C   1 
ATOM   2366 O  O   . THR B 1 93  ? -5.180  47.016 42.952 1.00 9.80  ? 93  THR B O   1 
ATOM   2367 C  CB  . THR B 1 93  ? -7.597  48.244 41.533 1.00 11.77 ? 93  THR B CB  1 
ATOM   2368 O  OG1 . THR B 1 93  ? -8.877  48.075 40.912 1.00 12.94 ? 93  THR B OG1 1 
ATOM   2369 C  CG2 . THR B 1 93  ? -7.031  49.599 41.149 1.00 10.42 ? 93  THR B CG2 1 
ATOM   2370 N  N   . LEU B 1 94  ? -4.303  47.713 41.004 1.00 9.99  ? 94  LEU B N   1 
ATOM   2371 C  CA  . LEU B 1 94  ? -2.978  47.953 41.571 1.00 9.81  ? 94  LEU B CA  1 
ATOM   2372 C  C   . LEU B 1 94  ? -3.107  49.194 42.454 1.00 9.93  ? 94  LEU B C   1 
ATOM   2373 O  O   . LEU B 1 94  ? -3.502  50.257 41.979 1.00 9.15  ? 94  LEU B O   1 
ATOM   2374 C  CB  . LEU B 1 94  ? -1.953  48.200 40.460 1.00 7.37  ? 94  LEU B CB  1 
ATOM   2375 C  CG  . LEU B 1 94  ? -0.530  48.559 40.906 1.00 7.94  ? 94  LEU B CG  1 
ATOM   2376 C  CD1 . LEU B 1 94  ? 0.020   47.476 41.832 1.00 7.87  ? 94  LEU B CD1 1 
ATOM   2377 C  CD2 . LEU B 1 94  ? 0.359   48.727 39.679 1.00 6.74  ? 94  LEU B CD2 1 
ATOM   2378 N  N   . GLN B 1 95  ? -2.769  49.065 43.733 1.00 9.93  ? 95  GLN B N   1 
ATOM   2379 C  CA  . GLN B 1 95  ? -2.907  50.189 44.651 1.00 11.10 ? 95  GLN B CA  1 
ATOM   2380 C  C   . GLN B 1 95  ? -2.046  50.057 45.903 1.00 10.97 ? 95  GLN B C   1 
ATOM   2381 O  O   . GLN B 1 95  ? -1.254  49.126 46.033 1.00 9.87  ? 95  GLN B O   1 
ATOM   2382 C  CB  . GLN B 1 95  ? -4.369  50.295 45.066 1.00 13.23 ? 95  GLN B CB  1 
ATOM   2383 C  CG  . GLN B 1 95  ? -4.891  48.993 45.678 1.00 15.66 ? 95  GLN B CG  1 
ATOM   2384 C  CD  . GLN B 1 95  ? -6.383  49.021 45.942 1.00 18.02 ? 95  GLN B CD  1 
ATOM   2385 O  OE1 . GLN B 1 95  ? -6.861  49.775 46.785 1.00 19.72 ? 95  GLN B OE1 1 
ATOM   2386 N  NE2 . GLN B 1 95  ? -7.130  48.204 45.209 1.00 16.60 ? 95  GLN B NE2 1 
ATOM   2387 N  N   . GLY B 1 96  ? -2.215  51.008 46.817 1.00 9.77  ? 96  GLY B N   1 
ATOM   2388 C  CA  . GLY B 1 96  ? -1.489  50.989 48.077 1.00 9.43  ? 96  GLY B CA  1 
ATOM   2389 C  C   . GLY B 1 96  ? 0.029   50.903 48.064 1.00 8.13  ? 96  GLY B C   1 
ATOM   2390 O  O   . GLY B 1 96  ? 0.701   51.480 47.205 1.00 7.37  ? 96  GLY B O   1 
ATOM   2391 N  N   . ASP B 1 97  ? 0.567   50.168 49.034 1.00 9.42  ? 97  ASP B N   1 
ATOM   2392 C  CA  . ASP B 1 97  ? 2.008   50.008 49.186 1.00 11.98 ? 97  ASP B CA  1 
ATOM   2393 C  C   . ASP B 1 97  ? 2.740   49.502 47.953 1.00 11.88 ? 97  ASP B C   1 
ATOM   2394 O  O   . ASP B 1 97  ? 3.799   50.027 47.600 1.00 13.18 ? 97  ASP B O   1 
ATOM   2395 C  CB  . ASP B 1 97  ? 2.322   49.090 50.369 1.00 11.80 ? 97  ASP B CB  1 
ATOM   2396 C  CG  . ASP B 1 97  ? 1.812   49.647 51.687 1.00 14.69 ? 97  ASP B CG  1 
ATOM   2397 O  OD1 . ASP B 1 97  ? 2.012   50.860 51.933 1.00 15.73 ? 97  ASP B OD1 1 
ATOM   2398 O  OD2 . ASP B 1 97  ? 1.229   48.876 52.479 1.00 12.82 ? 97  ASP B OD2 1 
ATOM   2399 N  N   . LEU B 1 98  ? 2.184   48.488 47.300 1.00 11.17 ? 98  LEU B N   1 
ATOM   2400 C  CA  . LEU B 1 98  ? 2.820   47.932 46.115 1.00 12.14 ? 98  LEU B CA  1 
ATOM   2401 C  C   . LEU B 1 98  ? 2.899   48.962 44.985 1.00 11.64 ? 98  LEU B C   1 
ATOM   2402 O  O   . LEU B 1 98  ? 3.937   49.104 44.337 1.00 13.74 ? 98  LEU B O   1 
ATOM   2403 C  CB  . LEU B 1 98  ? 2.060   46.685 45.641 1.00 11.27 ? 98  LEU B CB  1 
ATOM   2404 C  CG  . LEU B 1 98  ? 2.622   45.986 44.399 1.00 10.22 ? 98  LEU B CG  1 
ATOM   2405 C  CD1 . LEU B 1 98  ? 4.078   45.584 44.639 1.00 9.55  ? 98  LEU B CD1 1 
ATOM   2406 C  CD2 . LEU B 1 98  ? 1.773   44.771 44.071 1.00 8.51  ? 98  LEU B CD2 1 
ATOM   2407 N  N   . LYS B 1 99  ? 1.806   49.681 44.753 1.00 10.79 ? 99  LYS B N   1 
ATOM   2408 C  CA  . LYS B 1 99  ? 1.771   50.689 43.696 1.00 11.41 ? 99  LYS B CA  1 
ATOM   2409 C  C   . LYS B 1 99  ? 2.775   51.805 43.964 1.00 12.07 ? 99  LYS B C   1 
ATOM   2410 O  O   . LYS B 1 99  ? 3.429   52.290 43.042 1.00 11.91 ? 99  LYS B O   1 
ATOM   2411 C  CB  . LYS B 1 99  ? 0.361   51.274 43.566 1.00 11.00 ? 99  LYS B CB  1 
ATOM   2412 C  CG  . LYS B 1 99  ? 0.191   52.307 42.452 1.00 13.07 ? 99  LYS B CG  1 
ATOM   2413 C  CD  . LYS B 1 99  ? -1.273  52.710 42.325 1.00 13.95 ? 99  LYS B CD  1 
ATOM   2414 C  CE  . LYS B 1 99  ? -1.520  53.666 41.174 1.00 14.34 ? 99  LYS B CE  1 
ATOM   2415 N  NZ  . LYS B 1 99  ? -0.864  54.984 41.380 1.00 19.49 ? 99  LYS B NZ  1 
ATOM   2416 N  N   . ALA B 1 100 ? 2.897   52.208 45.228 1.00 12.00 ? 100 ALA B N   1 
ATOM   2417 C  CA  . ALA B 1 100 ? 3.834   53.258 45.596 1.00 12.16 ? 100 ALA B CA  1 
ATOM   2418 C  C   . ALA B 1 100 ? 5.270   52.759 45.438 1.00 12.40 ? 100 ALA B C   1 
ATOM   2419 O  O   . ALA B 1 100 ? 6.152   53.514 45.025 1.00 12.56 ? 100 ALA B O   1 
ATOM   2420 C  CB  . ALA B 1 100 ? 3.585   53.714 47.036 1.00 11.82 ? 100 ALA B CB  1 
ATOM   2421 N  N   . ALA B 1 101 ? 5.502   51.488 45.765 1.00 11.36 ? 101 ALA B N   1 
ATOM   2422 C  CA  . ALA B 1 101 ? 6.838   50.900 45.642 1.00 11.04 ? 101 ALA B CA  1 
ATOM   2423 C  C   . ALA B 1 101 ? 7.252   50.808 44.173 1.00 11.56 ? 101 ALA B C   1 
ATOM   2424 O  O   . ALA B 1 101 ? 8.416   51.015 43.831 1.00 12.39 ? 101 ALA B O   1 
ATOM   2425 C  CB  . ALA B 1 101 ? 6.867   49.512 46.281 1.00 10.76 ? 101 ALA B CB  1 
ATOM   2426 N  N   . ILE B 1 102 ? 6.297   50.487 43.309 1.00 10.67 ? 102 ILE B N   1 
ATOM   2427 C  CA  . ILE B 1 102 ? 6.567   50.389 41.879 1.00 10.86 ? 102 ILE B CA  1 
ATOM   2428 C  C   . ILE B 1 102 ? 6.935   51.760 41.294 1.00 11.99 ? 102 ILE B C   1 
ATOM   2429 O  O   . ILE B 1 102 ? 7.953   51.908 40.613 1.00 12.68 ? 102 ILE B O   1 
ATOM   2430 C  CB  . ILE B 1 102 ? 5.339   49.819 41.128 1.00 10.17 ? 102 ILE B CB  1 
ATOM   2431 C  CG1 . ILE B 1 102 ? 5.138   48.351 41.518 1.00 11.22 ? 102 ILE B CG1 1 
ATOM   2432 C  CG2 . ILE B 1 102 ? 5.517   49.972 39.620 1.00 9.20  ? 102 ILE B CG2 1 
ATOM   2433 C  CD1 . ILE B 1 102 ? 3.954   47.680 40.857 1.00 6.64  ? 102 ILE B CD1 1 
ATOM   2434 N  N   . GLU B 1 103 ? 6.110   52.763 41.573 1.00 11.63 ? 103 GLU B N   1 
ATOM   2435 C  CA  . GLU B 1 103 ? 6.348   54.108 41.067 1.00 13.72 ? 103 GLU B CA  1 
ATOM   2436 C  C   . GLU B 1 103 ? 7.697   54.603 41.570 1.00 14.83 ? 103 GLU B C   1 
ATOM   2437 O  O   . GLU B 1 103 ? 8.387   55.374 40.905 1.00 13.50 ? 103 GLU B O   1 
ATOM   2438 C  CB  . GLU B 1 103 ? 5.222   55.039 41.534 1.00 12.88 ? 103 GLU B CB  1 
ATOM   2439 C  CG  . GLU B 1 103 ? 3.842   54.500 41.179 1.00 14.67 ? 103 GLU B CG  1 
ATOM   2440 C  CD  . GLU B 1 103 ? 2.706   55.333 41.727 1.00 14.47 ? 103 GLU B CD  1 
ATOM   2441 O  OE1 . GLU B 1 103 ? 2.725   55.646 42.932 1.00 15.28 ? 103 GLU B OE1 1 
ATOM   2442 O  OE2 . GLU B 1 103 ? 1.777   55.654 40.955 1.00 16.60 ? 103 GLU B OE2 1 
ATOM   2443 N  N   . ARG B 1 104 ? 8.075   54.125 42.746 1.00 16.42 ? 104 ARG B N   1 
ATOM   2444 C  CA  . ARG B 1 104 ? 9.330   54.509 43.368 1.00 18.82 ? 104 ARG B CA  1 
ATOM   2445 C  C   . ARG B 1 104 ? 10.555  53.859 42.712 1.00 18.01 ? 104 ARG B C   1 
ATOM   2446 O  O   . ARG B 1 104 ? 11.562  54.526 42.475 1.00 18.38 ? 104 ARG B O   1 
ATOM   2447 C  CB  . ARG B 1 104 ? 9.248   54.169 44.856 1.00 20.00 ? 104 ARG B CB  1 
ATOM   2448 C  CG  . ARG B 1 104 ? 10.405  54.607 45.722 1.00 23.31 ? 104 ARG B CG  1 
ATOM   2449 C  CD  . ARG B 1 104 ? 9.896   54.716 47.159 1.00 24.62 ? 104 ARG B CD  1 
ATOM   2450 N  NE  . ARG B 1 104 ? 9.218   53.494 47.589 1.00 25.76 ? 104 ARG B NE  1 
ATOM   2451 C  CZ  . ARG B 1 104 ? 8.120   53.475 48.341 1.00 26.86 ? 104 ARG B CZ  1 
ATOM   2452 N  NH1 . ARG B 1 104 ? 7.568   54.613 48.748 1.00 26.90 ? 104 ARG B NH1 1 
ATOM   2453 N  NH2 . ARG B 1 104 ? 7.569   52.318 48.686 1.00 25.19 ? 104 ARG B NH2 1 
ATOM   2454 N  N   . ASP B 1 105 ? 10.477  52.569 42.403 1.00 17.49 ? 105 ASP B N   1 
ATOM   2455 C  CA  . ASP B 1 105 ? 11.622  51.910 41.785 1.00 18.01 ? 105 ASP B CA  1 
ATOM   2456 C  C   . ASP B 1 105 ? 11.620  51.989 40.267 1.00 16.37 ? 105 ASP B C   1 
ATOM   2457 O  O   . ASP B 1 105 ? 12.666  51.830 39.644 1.00 17.37 ? 105 ASP B O   1 
ATOM   2458 C  CB  . ASP B 1 105 ? 11.712  50.437 42.212 1.00 20.61 ? 105 ASP B CB  1 
ATOM   2459 C  CG  . ASP B 1 105 ? 11.872  50.270 43.715 1.00 23.33 ? 105 ASP B CG  1 
ATOM   2460 O  OD1 . ASP B 1 105 ? 12.637  51.053 44.323 1.00 25.54 ? 105 ASP B OD1 1 
ATOM   2461 O  OD2 . ASP B 1 105 ? 11.253  49.344 44.285 1.00 22.21 ? 105 ASP B OD2 1 
ATOM   2462 N  N   . PHE B 1 106 ? 10.456  52.248 39.676 1.00 14.97 ? 106 PHE B N   1 
ATOM   2463 C  CA  . PHE B 1 106 ? 10.334  52.320 38.221 1.00 14.81 ? 106 PHE B CA  1 
ATOM   2464 C  C   . PHE B 1 106 ? 9.947   53.701 37.687 1.00 15.48 ? 106 PHE B C   1 
ATOM   2465 O  O   . PHE B 1 106 ? 10.016  53.950 36.482 1.00 16.63 ? 106 PHE B O   1 
ATOM   2466 C  CB  . PHE B 1 106 ? 9.314   51.284 37.746 1.00 13.01 ? 106 PHE B CB  1 
ATOM   2467 C  CG  . PHE B 1 106 ? 9.745   49.860 37.971 1.00 13.47 ? 106 PHE B CG  1 
ATOM   2468 C  CD1 . PHE B 1 106 ? 10.657  49.252 37.114 1.00 12.53 ? 106 PHE B CD1 1 
ATOM   2469 C  CD2 . PHE B 1 106 ? 9.254   49.135 39.053 1.00 12.35 ? 106 PHE B CD2 1 
ATOM   2470 C  CE1 . PHE B 1 106 ? 11.072  47.940 37.330 1.00 11.64 ? 106 PHE B CE1 1 
ATOM   2471 C  CE2 . PHE B 1 106 ? 9.664   47.821 39.279 1.00 10.09 ? 106 PHE B CE2 1 
ATOM   2472 C  CZ  . PHE B 1 106 ? 10.573  47.225 38.417 1.00 11.50 ? 106 PHE B CZ  1 
ATOM   2473 N  N   . GLY B 1 107 ? 9.537   54.593 38.581 1.00 15.36 ? 107 GLY B N   1 
ATOM   2474 C  CA  . GLY B 1 107 ? 9.145   55.924 38.156 1.00 15.80 ? 107 GLY B CA  1 
ATOM   2475 C  C   . GLY B 1 107 ? 7.637   56.056 38.076 1.00 16.36 ? 107 GLY B C   1 
ATOM   2476 O  O   . GLY B 1 107 ? 7.072   57.063 38.508 1.00 17.97 ? 107 GLY B O   1 
ATOM   2477 N  N   . SER B 1 108 ? 6.985   55.041 37.516 1.00 14.55 ? 108 SER B N   1 
ATOM   2478 C  CA  . SER B 1 108 ? 5.533   55.033 37.386 1.00 13.46 ? 108 SER B CA  1 
ATOM   2479 C  C   . SER B 1 108 ? 5.090   53.634 36.991 1.00 13.54 ? 108 SER B C   1 
ATOM   2480 O  O   . SER B 1 108 ? 5.918   52.797 36.615 1.00 13.52 ? 108 SER B O   1 
ATOM   2481 C  CB  . SER B 1 108 ? 5.072   56.016 36.309 1.00 14.08 ? 108 SER B CB  1 
ATOM   2482 O  OG  . SER B 1 108 ? 5.407   55.543 35.020 1.00 9.99  ? 108 SER B OG  1 
ATOM   2483 N  N   . VAL B 1 109 ? 3.785   53.385 37.067 1.00 11.73 ? 109 VAL B N   1 
ATOM   2484 C  CA  . VAL B 1 109 ? 3.244   52.082 36.716 1.00 12.60 ? 109 VAL B CA  1 
ATOM   2485 C  C   . VAL B 1 109 ? 3.422   51.793 35.230 1.00 14.03 ? 109 VAL B C   1 
ATOM   2486 O  O   . VAL B 1 109 ? 3.708   50.654 34.853 1.00 14.54 ? 109 VAL B O   1 
ATOM   2487 C  CB  . VAL B 1 109 ? 1.747   51.968 37.111 1.00 11.97 ? 109 VAL B CB  1 
ATOM   2488 C  CG1 . VAL B 1 109 ? 1.180   50.620 36.681 1.00 10.27 ? 109 VAL B CG1 1 
ATOM   2489 C  CG2 . VAL B 1 109 ? 1.612   52.110 38.618 1.00 12.50 ? 109 VAL B CG2 1 
ATOM   2490 N  N   . ASP B 1 110 ? 3.265   52.811 34.385 1.00 13.28 ? 110 ASP B N   1 
ATOM   2491 C  CA  . ASP B 1 110 ? 3.440   52.601 32.952 1.00 15.62 ? 110 ASP B CA  1 
ATOM   2492 C  C   . ASP B 1 110 ? 4.882   52.221 32.623 1.00 15.91 ? 110 ASP B C   1 
ATOM   2493 O  O   . ASP B 1 110 ? 5.119   51.340 31.795 1.00 16.17 ? 110 ASP B O   1 
ATOM   2494 C  CB  . ASP B 1 110 ? 3.042   53.840 32.138 1.00 14.89 ? 110 ASP B CB  1 
ATOM   2495 C  CG  . ASP B 1 110 ? 1.542   54.074 32.114 1.00 16.40 ? 110 ASP B CG  1 
ATOM   2496 O  OD1 . ASP B 1 110 ? 0.782   53.088 32.035 1.00 17.06 ? 110 ASP B OD1 1 
ATOM   2497 O  OD2 . ASP B 1 110 ? 1.118   55.247 32.142 1.00 18.61 ? 110 ASP B OD2 1 
ATOM   2498 N  N   . ASN B 1 111 ? 5.841   52.886 33.263 1.00 15.86 ? 111 ASN B N   1 
ATOM   2499 C  CA  . ASN B 1 111 ? 7.245   52.576 33.023 1.00 18.32 ? 111 ASN B CA  1 
ATOM   2500 C  C   . ASN B 1 111 ? 7.504   51.142 33.456 1.00 17.08 ? 111 ASN B C   1 
ATOM   2501 O  O   . ASN B 1 111 ? 8.275   50.429 32.823 1.00 16.47 ? 111 ASN B O   1 
ATOM   2502 C  CB  . ASN B 1 111 ? 8.168   53.523 33.798 1.00 20.95 ? 111 ASN B CB  1 
ATOM   2503 C  CG  . ASN B 1 111 ? 8.040   54.963 33.344 1.00 23.96 ? 111 ASN B CG  1 
ATOM   2504 O  OD1 . ASN B 1 111 ? 8.140   55.264 32.153 1.00 25.34 ? 111 ASN B OD1 1 
ATOM   2505 N  ND2 . ASN B 1 111 ? 7.833   55.865 34.294 1.00 27.00 ? 111 ASN B ND2 1 
ATOM   2506 N  N   . PHE B 1 112 ? 6.861   50.729 34.544 1.00 16.08 ? 112 PHE B N   1 
ATOM   2507 C  CA  . PHE B 1 112 ? 7.008   49.366 35.027 1.00 14.75 ? 112 PHE B CA  1 
ATOM   2508 C  C   . PHE B 1 112 ? 6.447   48.405 33.991 1.00 13.88 ? 112 PHE B C   1 
ATOM   2509 O  O   . PHE B 1 112 ? 7.110   47.449 33.605 1.00 13.81 ? 112 PHE B O   1 
ATOM   2510 C  CB  . PHE B 1 112 ? 6.253   49.155 36.338 1.00 13.94 ? 112 PHE B CB  1 
ATOM   2511 C  CG  . PHE B 1 112 ? 5.873   47.720 36.575 1.00 12.84 ? 112 PHE B CG  1 
ATOM   2512 C  CD1 . PHE B 1 112 ? 6.850   46.746 36.754 1.00 12.04 ? 112 PHE B CD1 1 
ATOM   2513 C  CD2 . PHE B 1 112 ? 4.537   47.330 36.530 1.00 14.14 ? 112 PHE B CD2 1 
ATOM   2514 C  CE1 . PHE B 1 112 ? 6.506   45.406 36.878 1.00 13.51 ? 112 PHE B CE1 1 
ATOM   2515 C  CE2 . PHE B 1 112 ? 4.179   45.987 36.652 1.00 13.69 ? 112 PHE B CE2 1 
ATOM   2516 C  CZ  . PHE B 1 112 ? 5.166   45.023 36.825 1.00 14.37 ? 112 PHE B CZ  1 
ATOM   2517 N  N   . LYS B 1 113 ? 5.214   48.655 33.558 1.00 13.56 ? 113 LYS B N   1 
ATOM   2518 C  CA  . LYS B 1 113 ? 4.572   47.801 32.566 1.00 13.71 ? 113 LYS B CA  1 
ATOM   2519 C  C   . LYS B 1 113 ? 5.375   47.697 31.279 1.00 14.42 ? 113 LYS B C   1 
ATOM   2520 O  O   . LYS B 1 113 ? 5.487   46.618 30.702 1.00 14.13 ? 113 LYS B O   1 
ATOM   2521 C  CB  . LYS B 1 113 ? 3.161   48.305 32.247 1.00 13.76 ? 113 LYS B CB  1 
ATOM   2522 C  CG  . LYS B 1 113 ? 2.183   48.153 33.403 1.00 15.65 ? 113 LYS B CG  1 
ATOM   2523 C  CD  . LYS B 1 113 ? 0.783   48.591 33.013 1.00 18.83 ? 113 LYS B CD  1 
ATOM   2524 C  CE  . LYS B 1 113 ? -0.196  48.393 34.162 1.00 20.84 ? 113 LYS B CE  1 
ATOM   2525 N  NZ  . LYS B 1 113 ? -1.588  48.737 33.752 1.00 23.40 ? 113 LYS B NZ  1 
ATOM   2526 N  N   . ALA B 1 114 ? 5.937   48.813 30.826 1.00 13.95 ? 114 ALA B N   1 
ATOM   2527 C  CA  . ALA B 1 114 ? 6.724   48.800 29.600 1.00 13.14 ? 114 ALA B CA  1 
ATOM   2528 C  C   . ALA B 1 114 ? 7.976   47.942 29.756 1.00 13.16 ? 114 ALA B C   1 
ATOM   2529 O  O   . ALA B 1 114 ? 8.356   47.221 28.831 1.00 11.77 ? 114 ALA B O   1 
ATOM   2530 C  CB  . ALA B 1 114 ? 7.109   50.227 29.201 1.00 12.42 ? 114 ALA B CB  1 
ATOM   2531 N  N   . GLU B 1 115 ? 8.613   48.013 30.923 1.00 12.56 ? 115 GLU B N   1 
ATOM   2532 C  CA  . GLU B 1 115 ? 9.825   47.232 31.160 1.00 13.47 ? 115 GLU B CA  1 
ATOM   2533 C  C   . GLU B 1 115 ? 9.492   45.741 31.307 1.00 13.52 ? 115 GLU B C   1 
ATOM   2534 O  O   . GLU B 1 115 ? 10.277  44.875 30.912 1.00 13.44 ? 115 GLU B O   1 
ATOM   2535 C  CB  . GLU B 1 115 ? 10.555  47.718 32.420 1.00 14.69 ? 115 GLU B CB  1 
ATOM   2536 C  CG  . GLU B 1 115 ? 11.985  47.181 32.524 1.00 17.84 ? 115 GLU B CG  1 
ATOM   2537 C  CD  . GLU B 1 115 ? 12.671  47.500 33.845 1.00 20.38 ? 115 GLU B CD  1 
ATOM   2538 O  OE1 . GLU B 1 115 ? 12.686  48.681 34.260 1.00 17.62 ? 115 GLU B OE1 1 
ATOM   2539 O  OE2 . GLU B 1 115 ? 13.213  46.559 34.464 1.00 22.15 ? 115 GLU B OE2 1 
ATOM   2540 N  N   . PHE B 1 116 ? 8.330   45.444 31.880 1.00 12.23 ? 116 PHE B N   1 
ATOM   2541 C  CA  . PHE B 1 116 ? 7.916   44.057 32.065 1.00 12.00 ? 116 PHE B CA  1 
ATOM   2542 C  C   . PHE B 1 116 ? 7.590   43.446 30.702 1.00 11.61 ? 116 PHE B C   1 
ATOM   2543 O  O   . PHE B 1 116 ? 7.958   42.305 30.418 1.00 12.31 ? 116 PHE B O   1 
ATOM   2544 C  CB  . PHE B 1 116 ? 6.675   43.980 32.961 1.00 11.29 ? 116 PHE B CB  1 
ATOM   2545 C  CG  . PHE B 1 116 ? 6.314   42.576 33.388 1.00 12.11 ? 116 PHE B CG  1 
ATOM   2546 C  CD1 . PHE B 1 116 ? 6.976   41.964 34.449 1.00 11.87 ? 116 PHE B CD1 1 
ATOM   2547 C  CD2 . PHE B 1 116 ? 5.322   41.864 32.722 1.00 11.58 ? 116 PHE B CD2 1 
ATOM   2548 C  CE1 . PHE B 1 116 ? 6.651   40.664 34.845 1.00 13.55 ? 116 PHE B CE1 1 
ATOM   2549 C  CE2 . PHE B 1 116 ? 4.989   40.564 33.105 1.00 11.44 ? 116 PHE B CE2 1 
ATOM   2550 C  CZ  . PHE B 1 116 ? 5.653   39.963 34.169 1.00 12.77 ? 116 PHE B CZ  1 
ATOM   2551 N  N   . GLU B 1 117 ? 6.901   44.213 29.862 1.00 11.74 ? 117 GLU B N   1 
ATOM   2552 C  CA  . GLU B 1 117 ? 6.518   43.752 28.529 1.00 13.08 ? 117 GLU B CA  1 
ATOM   2553 C  C   . GLU B 1 117 ? 7.735   43.480 27.656 1.00 13.11 ? 117 GLU B C   1 
ATOM   2554 O  O   . GLU B 1 117 ? 7.745   42.532 26.871 1.00 11.58 ? 117 GLU B O   1 
ATOM   2555 C  CB  . GLU B 1 117 ? 5.627   44.787 27.853 1.00 13.40 ? 117 GLU B CB  1 
ATOM   2556 C  CG  . GLU B 1 117 ? 4.407   45.137 28.674 1.00 18.61 ? 117 GLU B CG  1 
ATOM   2557 C  CD  . GLU B 1 117 ? 3.591   46.240 28.049 1.00 21.54 ? 117 GLU B CD  1 
ATOM   2558 O  OE1 . GLU B 1 117 ? 4.198   47.230 27.593 1.00 22.44 ? 117 GLU B OE1 1 
ATOM   2559 O  OE2 . GLU B 1 117 ? 2.347   46.128 28.035 1.00 23.87 ? 117 GLU B OE2 1 
ATOM   2560 N  N   . LYS B 1 118 ? 8.756   44.320 27.792 1.00 12.87 ? 118 LYS B N   1 
ATOM   2561 C  CA  . LYS B 1 118 ? 9.982   44.157 27.026 1.00 14.45 ? 118 LYS B CA  1 
ATOM   2562 C  C   . LYS B 1 118 ? 10.693  42.885 27.474 1.00 13.33 ? 118 LYS B C   1 
ATOM   2563 O  O   . LYS B 1 118 ? 11.170  42.107 26.652 1.00 13.95 ? 118 LYS B O   1 
ATOM   2564 C  CB  . LYS B 1 118 ? 10.902  45.360 27.233 1.00 17.88 ? 118 LYS B CB  1 
ATOM   2565 C  CG  . LYS B 1 118 ? 12.244  45.257 26.517 1.00 22.50 ? 118 LYS B CG  1 
ATOM   2566 C  CD  . LYS B 1 118 ? 13.114  46.477 26.821 1.00 26.61 ? 118 LYS B CD  1 
ATOM   2567 C  CE  . LYS B 1 118 ? 14.467  46.398 26.128 1.00 28.80 ? 118 LYS B CE  1 
ATOM   2568 N  NZ  . LYS B 1 118 ? 15.298  47.608 26.398 1.00 29.59 ? 118 LYS B NZ  1 
ATOM   2569 N  N   . ALA B 1 119 ? 10.761  42.678 28.784 1.00 11.77 ? 119 ALA B N   1 
ATOM   2570 C  CA  . ALA B 1 119 ? 11.409  41.493 29.325 1.00 9.29  ? 119 ALA B CA  1 
ATOM   2571 C  C   . ALA B 1 119 ? 10.686  40.220 28.885 1.00 7.68  ? 119 ALA B C   1 
ATOM   2572 O  O   . ALA B 1 119 ? 11.318  39.226 28.529 1.00 7.81  ? 119 ALA B O   1 
ATOM   2573 C  CB  . ALA B 1 119 ? 11.451  41.573 30.853 1.00 7.86  ? 119 ALA B CB  1 
ATOM   2574 N  N   . ALA B 1 120 ? 9.359   40.254 28.912 1.00 6.88  ? 120 ALA B N   1 
ATOM   2575 C  CA  . ALA B 1 120 ? 8.559   39.096 28.527 1.00 7.05  ? 120 ALA B CA  1 
ATOM   2576 C  C   . ALA B 1 120 ? 8.679   38.796 27.033 1.00 9.37  ? 120 ALA B C   1 
ATOM   2577 O  O   . ALA B 1 120 ? 8.777   37.638 26.621 1.00 7.70  ? 120 ALA B O   1 
ATOM   2578 C  CB  . ALA B 1 120 ? 7.100   39.328 28.903 1.00 5.48  ? 120 ALA B CB  1 
ATOM   2579 N  N   . ALA B 1 121 ? 8.669   39.847 26.221 1.00 9.69  ? 121 ALA B N   1 
ATOM   2580 C  CA  . ALA B 1 121 ? 8.783   39.686 24.782 1.00 9.68  ? 121 ALA B CA  1 
ATOM   2581 C  C   . ALA B 1 121 ? 10.178  39.221 24.354 1.00 11.46 ? 121 ALA B C   1 
ATOM   2582 O  O   . ALA B 1 121 ? 10.307  38.362 23.481 1.00 9.63  ? 121 ALA B O   1 
ATOM   2583 C  CB  . ALA B 1 121 ? 8.442   40.999 24.087 1.00 8.08  ? 121 ALA B CB  1 
ATOM   2584 N  N   . SER B 1 122 ? 11.214  39.778 24.978 1.00 10.71 ? 122 SER B N   1 
ATOM   2585 C  CA  . SER B 1 122 ? 12.597  39.452 24.625 1.00 12.54 ? 122 SER B CA  1 
ATOM   2586 C  C   . SER B 1 122 ? 13.120  38.101 25.111 1.00 10.44 ? 122 SER B C   1 
ATOM   2587 O  O   . SER B 1 122 ? 14.216  37.698 24.740 1.00 9.77  ? 122 SER B O   1 
ATOM   2588 C  CB  . SER B 1 122 ? 13.536  40.567 25.106 1.00 11.94 ? 122 SER B CB  1 
ATOM   2589 O  OG  . SER B 1 122 ? 13.456  40.719 26.515 1.00 16.17 ? 122 SER B OG  1 
ATOM   2590 N  N   . ARG B 1 123 ? 12.353  37.411 25.947 1.00 11.02 ? 123 ARG B N   1 
ATOM   2591 C  CA  . ARG B 1 123 ? 12.755  36.094 26.439 1.00 8.69  ? 123 ARG B CA  1 
ATOM   2592 C  C   . ARG B 1 123 ? 12.670  35.106 25.267 1.00 10.12 ? 123 ARG B C   1 
ATOM   2593 O  O   . ARG B 1 123 ? 11.601  34.585 24.951 1.00 10.11 ? 123 ARG B O   1 
ATOM   2594 C  CB  . ARG B 1 123 ? 11.837  35.672 27.597 1.00 6.84  ? 123 ARG B CB  1 
ATOM   2595 C  CG  . ARG B 1 123 ? 11.884  34.187 27.983 1.00 7.26  ? 123 ARG B CG  1 
ATOM   2596 C  CD  . ARG B 1 123 ? 13.299  33.646 28.146 1.00 5.77  ? 123 ARG B CD  1 
ATOM   2597 N  NE  . ARG B 1 123 ? 14.093  34.372 29.126 1.00 4.83  ? 123 ARG B NE  1 
ATOM   2598 C  CZ  . ARG B 1 123 ? 15.347  34.061 29.438 1.00 6.22  ? 123 ARG B CZ  1 
ATOM   2599 N  NH1 . ARG B 1 123 ? 15.947  33.036 28.844 1.00 5.77  ? 123 ARG B NH1 1 
ATOM   2600 N  NH2 . ARG B 1 123 ? 16.001  34.766 30.349 1.00 6.72  ? 123 ARG B NH2 1 
ATOM   2601 N  N   . PHE B 1 124 ? 13.807  34.868 24.619 1.00 10.94 ? 124 PHE B N   1 
ATOM   2602 C  CA  . PHE B 1 124 ? 13.874  33.978 23.465 1.00 10.16 ? 124 PHE B CA  1 
ATOM   2603 C  C   . PHE B 1 124 ? 13.780  32.528 23.911 1.00 10.44 ? 124 PHE B C   1 
ATOM   2604 O  O   . PHE B 1 124 ? 14.542  32.078 24.772 1.00 10.42 ? 124 PHE B O   1 
ATOM   2605 C  CB  . PHE B 1 124 ? 15.186  34.199 22.709 1.00 9.99  ? 124 PHE B CB  1 
ATOM   2606 C  CG  . PHE B 1 124 ? 15.183  33.643 21.312 1.00 9.22  ? 124 PHE B CG  1 
ATOM   2607 C  CD1 . PHE B 1 124 ? 14.429  34.256 20.305 1.00 10.03 ? 124 PHE B CD1 1 
ATOM   2608 C  CD2 . PHE B 1 124 ? 15.937  32.520 20.994 1.00 7.97  ? 124 PHE B CD2 1 
ATOM   2609 C  CE1 . PHE B 1 124 ? 14.432  33.751 18.989 1.00 9.95  ? 124 PHE B CE1 1 
ATOM   2610 C  CE2 . PHE B 1 124 ? 15.947  32.004 19.679 1.00 10.49 ? 124 PHE B CE2 1 
ATOM   2611 C  CZ  . PHE B 1 124 ? 15.195  32.623 18.681 1.00 6.31  ? 124 PHE B CZ  1 
ATOM   2612 N  N   . GLY B 1 125 ? 12.853  31.793 23.305 1.00 9.54  ? 125 GLY B N   1 
ATOM   2613 C  CA  . GLY B 1 125 ? 12.662  30.408 23.678 1.00 7.25  ? 125 GLY B CA  1 
ATOM   2614 C  C   . GLY B 1 125 ? 11.611  30.353 24.770 1.00 8.29  ? 125 GLY B C   1 
ATOM   2615 O  O   . GLY B 1 125 ? 10.730  31.216 24.821 1.00 6.80  ? 125 GLY B O   1 
ATOM   2616 N  N   . SER B 1 126 ? 11.709  29.354 25.647 1.00 7.32  ? 126 SER B N   1 
ATOM   2617 C  CA  . SER B 1 126 ? 10.763  29.180 26.746 1.00 6.47  ? 126 SER B CA  1 
ATOM   2618 C  C   . SER B 1 126 ? 11.276  29.882 27.996 1.00 7.52  ? 126 SER B C   1 
ATOM   2619 O  O   . SER B 1 126 ? 12.486  30.004 28.195 1.00 7.47  ? 126 SER B O   1 
ATOM   2620 C  CB  . SER B 1 126 ? 10.583  27.693 27.048 1.00 8.20  ? 126 SER B CB  1 
ATOM   2621 O  OG  . SER B 1 126 ? 10.173  26.979 25.897 1.00 5.56  ? 126 SER B OG  1 
ATOM   2622 N  N   . GLY B 1 127 ? 10.359  30.337 28.844 1.00 7.61  ? 127 GLY B N   1 
ATOM   2623 C  CA  . GLY B 1 127 ? 10.774  31.024 30.056 1.00 7.52  ? 127 GLY B CA  1 
ATOM   2624 C  C   . GLY B 1 127 ? 9.692   31.839 30.740 1.00 9.88  ? 127 GLY B C   1 
ATOM   2625 O  O   . GLY B 1 127 ? 8.520   31.792 30.355 1.00 8.17  ? 127 GLY B O   1 
ATOM   2626 N  N   . TRP B 1 128 ? 10.092  32.588 31.765 1.00 10.10 ? 128 TRP B N   1 
ATOM   2627 C  CA  . TRP B 1 128 ? 9.172   33.418 32.537 1.00 9.08  ? 128 TRP B CA  1 
ATOM   2628 C  C   . TRP B 1 128 ? 9.650   34.853 32.668 1.00 9.80  ? 128 TRP B C   1 
ATOM   2629 O  O   . TRP B 1 128 ? 10.843  35.127 32.570 1.00 11.52 ? 128 TRP B O   1 
ATOM   2630 C  CB  . TRP B 1 128 ? 9.005   32.871 33.957 1.00 7.65  ? 128 TRP B CB  1 
ATOM   2631 C  CG  . TRP B 1 128 ? 8.280   31.577 34.067 1.00 8.13  ? 128 TRP B CG  1 
ATOM   2632 C  CD1 . TRP B 1 128 ? 8.720   30.344 33.674 1.00 6.69  ? 128 TRP B CD1 1 
ATOM   2633 C  CD2 . TRP B 1 128 ? 6.961   31.387 34.590 1.00 8.71  ? 128 TRP B CD2 1 
ATOM   2634 N  NE1 . TRP B 1 128 ? 7.751   29.396 33.921 1.00 7.80  ? 128 TRP B NE1 1 
ATOM   2635 C  CE2 . TRP B 1 128 ? 6.661   30.010 34.481 1.00 6.88  ? 128 TRP B CE2 1 
ATOM   2636 C  CE3 . TRP B 1 128 ? 6.000   32.249 35.139 1.00 8.27  ? 128 TRP B CE3 1 
ATOM   2637 C  CZ2 . TRP B 1 128 ? 5.439   29.473 34.902 1.00 7.13  ? 128 TRP B CZ2 1 
ATOM   2638 C  CZ3 . TRP B 1 128 ? 4.781   31.712 35.559 1.00 7.77  ? 128 TRP B CZ3 1 
ATOM   2639 C  CH2 . TRP B 1 128 ? 4.515   30.337 35.436 1.00 5.94  ? 128 TRP B CH2 1 
ATOM   2640 N  N   . ALA B 1 129 ? 8.705   35.761 32.900 1.00 8.93  ? 129 ALA B N   1 
ATOM   2641 C  CA  . ALA B 1 129 ? 9.011   37.176 33.111 1.00 9.26  ? 129 ALA B CA  1 
ATOM   2642 C  C   . ALA B 1 129 ? 8.574   37.430 34.551 1.00 8.31  ? 129 ALA B C   1 
ATOM   2643 O  O   . ALA B 1 129 ? 7.452   37.085 34.925 1.00 9.34  ? 129 ALA B O   1 
ATOM   2644 C  CB  . ALA B 1 129 ? 8.215   38.053 32.152 1.00 8.13  ? 129 ALA B CB  1 
ATOM   2645 N  N   . TRP B 1 130 ? 9.445   38.020 35.361 1.00 7.86  ? 130 TRP B N   1 
ATOM   2646 C  CA  . TRP B 1 130 ? 9.100   38.251 36.758 1.00 8.05  ? 130 TRP B CA  1 
ATOM   2647 C  C   . TRP B 1 130 ? 9.251   39.673 37.284 1.00 9.14  ? 130 TRP B C   1 
ATOM   2648 O  O   . TRP B 1 130 ? 9.970   40.504 36.731 1.00 9.68  ? 130 TRP B O   1 
ATOM   2649 C  CB  . TRP B 1 130 ? 9.951   37.374 37.686 1.00 7.92  ? 130 TRP B CB  1 
ATOM   2650 C  CG  . TRP B 1 130 ? 10.118  35.945 37.299 1.00 8.64  ? 130 TRP B CG  1 
ATOM   2651 C  CD1 . TRP B 1 130 ? 11.040  35.429 36.426 1.00 9.10  ? 130 TRP B CD1 1 
ATOM   2652 C  CD2 . TRP B 1 130 ? 9.359   34.833 37.786 1.00 8.01  ? 130 TRP B CD2 1 
ATOM   2653 N  NE1 . TRP B 1 130 ? 10.902  34.062 36.346 1.00 8.45  ? 130 TRP B NE1 1 
ATOM   2654 C  CE2 . TRP B 1 130 ? 9.877   33.670 37.170 1.00 9.14  ? 130 TRP B CE2 1 
ATOM   2655 C  CE3 . TRP B 1 130 ? 8.290   34.705 38.684 1.00 8.18  ? 130 TRP B CE3 1 
ATOM   2656 C  CZ2 . TRP B 1 130 ? 9.360   32.393 37.423 1.00 9.92  ? 130 TRP B CZ2 1 
ATOM   2657 C  CZ3 . TRP B 1 130 ? 7.775   33.438 38.938 1.00 9.06  ? 130 TRP B CZ3 1 
ATOM   2658 C  CH2 . TRP B 1 130 ? 8.312   32.296 38.308 1.00 9.05  ? 130 TRP B CH2 1 
ATOM   2659 N  N   . LEU B 1 131 ? 8.543   39.925 38.376 1.00 10.52 ? 131 LEU B N   1 
ATOM   2660 C  CA  . LEU B 1 131 ? 8.626   41.174 39.112 1.00 9.68  ? 131 LEU B CA  1 
ATOM   2661 C  C   . LEU B 1 131 ? 9.150   40.601 40.421 1.00 10.33 ? 131 LEU B C   1 
ATOM   2662 O  O   . LEU B 1 131 ? 8.452   39.832 41.085 1.00 10.18 ? 131 LEU B O   1 
ATOM   2663 C  CB  . LEU B 1 131 ? 7.248   41.806 39.332 1.00 9.42  ? 131 LEU B CB  1 
ATOM   2664 C  CG  . LEU B 1 131 ? 7.231   42.969 40.344 1.00 10.79 ? 131 LEU B CG  1 
ATOM   2665 C  CD1 . LEU B 1 131 ? 8.209   44.064 39.933 1.00 10.66 ? 131 LEU B CD1 1 
ATOM   2666 C  CD2 . LEU B 1 131 ? 5.829   43.528 40.446 1.00 10.67 ? 131 LEU B CD2 1 
ATOM   2667 N  N   . VAL B 1 132 ? 10.389  40.929 40.764 1.00 10.66 ? 132 VAL B N   1 
ATOM   2668 C  CA  . VAL B 1 132 ? 10.994  40.413 41.987 1.00 10.97 ? 132 VAL B CA  1 
ATOM   2669 C  C   . VAL B 1 132 ? 11.371  41.510 42.969 1.00 12.41 ? 132 VAL B C   1 
ATOM   2670 O  O   . VAL B 1 132 ? 11.505  42.678 42.602 1.00 10.51 ? 132 VAL B O   1 
ATOM   2671 C  CB  . VAL B 1 132 ? 12.285  39.607 41.685 1.00 11.47 ? 132 VAL B CB  1 
ATOM   2672 C  CG1 . VAL B 1 132 ? 11.968  38.395 40.827 1.00 10.35 ? 132 VAL B CG1 1 
ATOM   2673 C  CG2 . VAL B 1 132 ? 13.296  40.503 40.980 1.00 10.87 ? 132 VAL B CG2 1 
ATOM   2674 N  N   . LEU B 1 133 ? 11.548  41.120 44.224 1.00 12.27 ? 133 LEU B N   1 
ATOM   2675 C  CA  . LEU B 1 133 ? 11.947  42.057 45.252 1.00 14.70 ? 133 LEU B CA  1 
ATOM   2676 C  C   . LEU B 1 133 ? 13.345  41.664 45.709 1.00 16.71 ? 133 LEU B C   1 
ATOM   2677 O  O   . LEU B 1 133 ? 13.535  40.616 46.325 1.00 17.42 ? 133 LEU B O   1 
ATOM   2678 C  CB  . LEU B 1 133 ? 10.985  42.008 46.441 1.00 12.98 ? 133 LEU B CB  1 
ATOM   2679 C  CG  . LEU B 1 133 ? 11.391  42.898 47.621 1.00 13.15 ? 133 LEU B CG  1 
ATOM   2680 C  CD1 . LEU B 1 133 ? 11.421  44.366 47.188 1.00 9.71  ? 133 LEU B CD1 1 
ATOM   2681 C  CD2 . LEU B 1 133 ? 10.415  42.687 48.769 1.00 11.29 ? 133 LEU B CD2 1 
ATOM   2682 N  N   . LYS B 1 134 ? 14.323  42.494 45.372 1.00 20.20 ? 134 LYS B N   1 
ATOM   2683 C  CA  . LYS B 1 134 ? 15.707  42.255 45.764 1.00 23.39 ? 134 LYS B CA  1 
ATOM   2684 C  C   . LYS B 1 134 ? 15.987  43.132 46.971 1.00 24.97 ? 134 LYS B C   1 
ATOM   2685 O  O   . LYS B 1 134 ? 16.232  44.330 46.834 1.00 24.84 ? 134 LYS B O   1 
ATOM   2686 C  CB  . LYS B 1 134 ? 16.665  42.633 44.635 1.00 25.11 ? 134 LYS B CB  1 
ATOM   2687 C  CG  . LYS B 1 134 ? 16.593  41.746 43.411 1.00 27.26 ? 134 LYS B CG  1 
ATOM   2688 C  CD  . LYS B 1 134 ? 17.543  42.262 42.345 1.00 30.97 ? 134 LYS B CD  1 
ATOM   2689 C  CE  . LYS B 1 134 ? 17.667  41.284 41.203 1.00 32.70 ? 134 LYS B CE  1 
ATOM   2690 N  NZ  . LYS B 1 134 ? 18.213  39.991 41.701 1.00 35.82 ? 134 LYS B NZ  1 
ATOM   2691 N  N   . GLY B 1 135 ? 15.943  42.537 48.155 1.00 26.06 ? 135 GLY B N   1 
ATOM   2692 C  CA  . GLY B 1 135 ? 16.186  43.309 49.354 1.00 28.52 ? 135 GLY B CA  1 
ATOM   2693 C  C   . GLY B 1 135 ? 15.050  44.286 49.581 1.00 29.12 ? 135 GLY B C   1 
ATOM   2694 O  O   . GLY B 1 135 ? 14.004  43.921 50.116 1.00 30.16 ? 135 GLY B O   1 
ATOM   2695 N  N   . ASP B 1 136 ? 15.236  45.528 49.155 1.00 29.40 ? 136 ASP B N   1 
ATOM   2696 C  CA  . ASP B 1 136 ? 14.199  46.526 49.348 1.00 29.18 ? 136 ASP B CA  1 
ATOM   2697 C  C   . ASP B 1 136 ? 13.844  47.219 48.034 1.00 26.96 ? 136 ASP B C   1 
ATOM   2698 O  O   . ASP B 1 136 ? 13.164  48.246 48.027 1.00 27.33 ? 136 ASP B O   1 
ATOM   2699 C  CB  . ASP B 1 136 ? 14.673  47.545 50.386 1.00 33.83 ? 136 ASP B CB  1 
ATOM   2700 C  CG  . ASP B 1 136 ? 13.526  48.250 51.076 1.00 37.86 ? 136 ASP B CG  1 
ATOM   2701 O  OD1 . ASP B 1 136 ? 12.778  48.990 50.402 1.00 40.95 ? 136 ASP B OD1 1 
ATOM   2702 O  OD2 . ASP B 1 136 ? 13.369  48.050 52.302 1.00 40.38 ? 136 ASP B OD2 1 
ATOM   2703 N  N   . LYS B 1 137 ? 14.296  46.647 46.921 1.00 22.88 ? 137 LYS B N   1 
ATOM   2704 C  CA  . LYS B 1 137 ? 14.021  47.220 45.610 1.00 18.95 ? 137 LYS B CA  1 
ATOM   2705 C  C   . LYS B 1 137 ? 13.337  46.240 44.657 1.00 17.03 ? 137 LYS B C   1 
ATOM   2706 O  O   . LYS B 1 137 ? 13.685  45.058 44.595 1.00 15.75 ? 137 LYS B O   1 
ATOM   2707 C  CB  . LYS B 1 137 ? 15.319  47.727 44.978 1.00 20.03 ? 137 LYS B CB  1 
ATOM   2708 C  CG  . LYS B 1 137 ? 16.012  48.813 45.785 0.00 19.71 ? 137 LYS B CG  1 
ATOM   2709 C  CD  . LYS B 1 137 ? 17.283  49.287 45.102 0.00 19.85 ? 137 LYS B CD  1 
ATOM   2710 C  CE  . LYS B 1 137 ? 17.967  50.379 45.910 0.00 19.81 ? 137 LYS B CE  1 
ATOM   2711 N  NZ  . LYS B 1 137 ? 19.213  50.861 45.254 0.00 19.81 ? 137 LYS B NZ  1 
ATOM   2712 N  N   . LEU B 1 138 ? 12.352  46.744 43.922 1.00 14.70 ? 138 LEU B N   1 
ATOM   2713 C  CA  . LEU B 1 138 ? 11.618  45.937 42.956 1.00 12.25 ? 138 LEU B CA  1 
ATOM   2714 C  C   . LEU B 1 138 ? 12.371  45.943 41.635 1.00 12.43 ? 138 LEU B C   1 
ATOM   2715 O  O   . LEU B 1 138 ? 12.997  46.939 41.274 1.00 12.95 ? 138 LEU B O   1 
ATOM   2716 C  CB  . LEU B 1 138 ? 10.206  46.502 42.763 1.00 10.94 ? 138 LEU B CB  1 
ATOM   2717 C  CG  . LEU B 1 138 ? 9.278   46.323 43.970 1.00 11.61 ? 138 LEU B CG  1 
ATOM   2718 C  CD1 . LEU B 1 138 ? 8.003   47.141 43.806 1.00 9.81  ? 138 LEU B CD1 1 
ATOM   2719 C  CD2 . LEU B 1 138 ? 8.963   44.835 44.120 1.00 6.71  ? 138 LEU B CD2 1 
ATOM   2720 N  N   . ALA B 1 139 ? 12.317  44.826 40.918 1.00 12.23 ? 139 ALA B N   1 
ATOM   2721 C  CA  . ALA B 1 139 ? 13.006  44.716 39.638 1.00 10.79 ? 139 ALA B CA  1 
ATOM   2722 C  C   . ALA B 1 139 ? 12.293  43.764 38.693 1.00 10.99 ? 139 ALA B C   1 
ATOM   2723 O  O   . ALA B 1 139 ? 11.474  42.944 39.108 1.00 9.41  ? 139 ALA B O   1 
ATOM   2724 C  CB  . ALA B 1 139 ? 14.445  44.240 39.860 1.00 9.02  ? 139 ALA B CB  1 
ATOM   2725 N  N   . VAL B 1 140 ? 12.618  43.886 37.413 1.00 11.59 ? 140 VAL B N   1 
ATOM   2726 C  CA  . VAL B 1 140 ? 12.050  43.032 36.382 1.00 11.78 ? 140 VAL B CA  1 
ATOM   2727 C  C   . VAL B 1 140 ? 13.167  42.149 35.848 1.00 13.51 ? 140 VAL B C   1 
ATOM   2728 O  O   . VAL B 1 140 ? 14.247  42.635 35.506 1.00 14.25 ? 140 VAL B O   1 
ATOM   2729 C  CB  . VAL B 1 140 ? 11.448  43.868 35.222 1.00 11.51 ? 140 VAL B CB  1 
ATOM   2730 C  CG1 . VAL B 1 140 ? 11.149  42.973 34.023 1.00 10.48 ? 140 VAL B CG1 1 
ATOM   2731 C  CG2 . VAL B 1 140 ? 10.168  44.541 35.689 1.00 8.57  ? 140 VAL B CG2 1 
ATOM   2732 N  N   . VAL B 1 141 ? 12.908  40.847 35.798 1.00 13.23 ? 141 VAL B N   1 
ATOM   2733 C  CA  . VAL B 1 141 ? 13.882  39.885 35.303 1.00 11.95 ? 141 VAL B CA  1 
ATOM   2734 C  C   . VAL B 1 141 ? 13.131  38.772 34.592 1.00 12.74 ? 141 VAL B C   1 
ATOM   2735 O  O   . VAL B 1 141 ? 11.907  38.689 34.683 1.00 13.00 ? 141 VAL B O   1 
ATOM   2736 C  CB  . VAL B 1 141 ? 14.704  39.261 36.462 1.00 12.34 ? 141 VAL B CB  1 
ATOM   2737 C  CG1 . VAL B 1 141 ? 15.429  40.353 37.242 1.00 11.62 ? 141 VAL B CG1 1 
ATOM   2738 C  CG2 . VAL B 1 141 ? 13.789  38.471 37.392 1.00 8.72  ? 141 VAL B CG2 1 
ATOM   2739 N  N   . SER B 1 142 ? 13.858  37.933 33.862 1.00 12.80 ? 142 SER B N   1 
ATOM   2740 C  CA  . SER B 1 142 ? 13.235  36.807 33.180 1.00 11.52 ? 142 SER B CA  1 
ATOM   2741 C  C   . SER B 1 142 ? 14.182  35.632 33.337 1.00 10.26 ? 142 SER B C   1 
ATOM   2742 O  O   . SER B 1 142 ? 15.383  35.812 33.525 1.00 10.33 ? 142 SER B O   1 
ATOM   2743 C  CB  . SER B 1 142 ? 12.992  37.093 31.688 1.00 11.50 ? 142 SER B CB  1 
ATOM   2744 O  OG  . SER B 1 142 ? 14.184  37.021 30.925 1.00 12.19 ? 142 SER B OG  1 
ATOM   2745 N  N   . THR B 1 143 ? 13.632  34.430 33.282 1.00 9.92  ? 143 THR B N   1 
ATOM   2746 C  CA  . THR B 1 143 ? 14.425  33.221 33.417 1.00 9.48  ? 143 THR B CA  1 
ATOM   2747 C  C   . THR B 1 143 ? 14.073  32.272 32.286 1.00 9.62  ? 143 THR B C   1 
ATOM   2748 O  O   . THR B 1 143 ? 13.011  32.394 31.670 1.00 8.66  ? 143 THR B O   1 
ATOM   2749 C  CB  . THR B 1 143 ? 14.144  32.516 34.760 1.00 9.55  ? 143 THR B CB  1 
ATOM   2750 O  OG1 . THR B 1 143 ? 12.737  32.274 34.888 1.00 8.87  ? 143 THR B OG1 1 
ATOM   2751 C  CG2 . THR B 1 143 ? 14.624  33.370 35.920 1.00 7.37  ? 143 THR B CG2 1 
ATOM   2752 N  N   . ALA B 1 144 ? 14.977  31.342 32.010 1.00 8.68  ? 144 ALA B N   1 
ATOM   2753 C  CA  . ALA B 1 144 ? 14.772  30.354 30.964 1.00 7.76  ? 144 ALA B CA  1 
ATOM   2754 C  C   . ALA B 1 144 ? 14.012  29.142 31.499 1.00 8.41  ? 144 ALA B C   1 
ATOM   2755 O  O   . ALA B 1 144 ? 14.140  28.777 32.679 1.00 7.27  ? 144 ALA B O   1 
ATOM   2756 C  CB  . ALA B 1 144 ? 16.122  29.909 30.401 1.00 7.59  ? 144 ALA B CB  1 
ATOM   2757 N  N   . ASN B 1 145 ? 13.233  28.528 30.610 1.00 7.39  ? 145 ASN B N   1 
ATOM   2758 C  CA  . ASN B 1 145 ? 12.440  27.336 30.901 1.00 5.76  ? 145 ASN B CA  1 
ATOM   2759 C  C   . ASN B 1 145 ? 11.671  27.430 32.217 1.00 6.00  ? 145 ASN B C   1 
ATOM   2760 O  O   . ASN B 1 145 ? 10.853  28.332 32.382 1.00 6.76  ? 145 ASN B O   1 
ATOM   2761 C  CB  . ASN B 1 145 ? 13.357  26.111 30.876 1.00 6.59  ? 145 ASN B CB  1 
ATOM   2762 C  CG  . ASN B 1 145 ? 14.220  26.066 29.622 1.00 9.08  ? 145 ASN B CG  1 
ATOM   2763 O  OD1 . ASN B 1 145 ? 13.719  26.233 28.510 1.00 7.36  ? 145 ASN B OD1 1 
ATOM   2764 N  ND2 . ASN B 1 145 ? 15.521  25.831 29.796 1.00 7.87  ? 145 ASN B ND2 1 
ATOM   2765 N  N   . GLN B 1 146 ? 11.899  26.505 33.147 1.00 5.41  ? 146 GLN B N   1 
ATOM   2766 C  CA  . GLN B 1 146 ? 11.191  26.577 34.423 1.00 6.74  ? 146 GLN B CA  1 
ATOM   2767 C  C   . GLN B 1 146 ? 12.082  27.070 35.546 1.00 7.45  ? 146 GLN B C   1 
ATOM   2768 O  O   . GLN B 1 146 ? 11.811  26.794 36.716 1.00 8.94  ? 146 GLN B O   1 
ATOM   2769 C  CB  . GLN B 1 146 ? 10.598  25.224 34.838 1.00 7.02  ? 146 GLN B CB  1 
ATOM   2770 C  CG  . GLN B 1 146 ? 9.446   24.709 33.991 1.00 6.34  ? 146 GLN B CG  1 
ATOM   2771 C  CD  . GLN B 1 146 ? 8.356   25.742 33.768 1.00 8.72  ? 146 GLN B CD  1 
ATOM   2772 O  OE1 . GLN B 1 146 ? 8.057   26.556 34.647 1.00 10.29 ? 146 GLN B OE1 1 
ATOM   2773 N  NE2 . GLN B 1 146 ? 7.735   25.694 32.596 1.00 6.22  ? 146 GLN B NE2 1 
ATOM   2774 N  N   . ASP B 1 147 ? 13.156  27.775 35.198 1.00 5.63  ? 147 ASP B N   1 
ATOM   2775 C  CA  . ASP B 1 147 ? 14.044  28.308 36.221 1.00 6.76  ? 147 ASP B CA  1 
ATOM   2776 C  C   . ASP B 1 147 ? 13.284  29.376 37.005 1.00 7.27  ? 147 ASP B C   1 
ATOM   2777 O  O   . ASP B 1 147 ? 12.370  30.012 36.476 1.00 5.71  ? 147 ASP B O   1 
ATOM   2778 C  CB  . ASP B 1 147 ? 15.299  28.942 35.602 1.00 7.67  ? 147 ASP B CB  1 
ATOM   2779 C  CG  . ASP B 1 147 ? 16.227  27.921 34.961 1.00 8.57  ? 147 ASP B CG  1 
ATOM   2780 O  OD1 . ASP B 1 147 ? 15.972  26.707 35.083 1.00 6.75  ? 147 ASP B OD1 1 
ATOM   2781 O  OD2 . ASP B 1 147 ? 17.227  28.345 34.339 1.00 11.53 ? 147 ASP B OD2 1 
ATOM   2782 N  N   . SER B 1 148 ? 13.670  29.566 38.263 1.00 7.15  ? 148 SER B N   1 
ATOM   2783 C  CA  . SER B 1 148 ? 13.045  30.560 39.132 1.00 8.56  ? 148 SER B CA  1 
ATOM   2784 C  C   . SER B 1 148 ? 14.103  31.417 39.823 1.00 9.07  ? 148 SER B C   1 
ATOM   2785 O  O   . SER B 1 148 ? 15.201  30.943 40.122 1.00 9.98  ? 148 SER B O   1 
ATOM   2786 C  CB  . SER B 1 148 ? 12.193  29.870 40.203 1.00 8.26  ? 148 SER B CB  1 
ATOM   2787 O  OG  . SER B 1 148 ? 11.722  30.804 41.163 1.00 7.00  ? 148 SER B OG  1 
ATOM   2788 N  N   . PRO B 1 149 ? 13.791  32.697 40.075 1.00 8.87  ? 149 PRO B N   1 
ATOM   2789 C  CA  . PRO B 1 149 ? 14.745  33.586 40.742 1.00 9.14  ? 149 PRO B CA  1 
ATOM   2790 C  C   . PRO B 1 149 ? 15.099  33.035 42.125 1.00 8.59  ? 149 PRO B C   1 
ATOM   2791 O  O   . PRO B 1 149 ? 16.122  33.396 42.709 1.00 7.67  ? 149 PRO B O   1 
ATOM   2792 C  CB  . PRO B 1 149 ? 13.978  34.904 40.814 1.00 8.52  ? 149 PRO B CB  1 
ATOM   2793 C  CG  . PRO B 1 149 ? 13.101  34.831 39.569 1.00 10.59 ? 149 PRO B CG  1 
ATOM   2794 C  CD  . PRO B 1 149 ? 12.558  33.435 39.758 1.00 9.29  ? 149 PRO B CD  1 
ATOM   2795 N  N   . LEU B 1 150 ? 14.241  32.160 42.640 1.00 7.71  ? 150 LEU B N   1 
ATOM   2796 C  CA  . LEU B 1 150 ? 14.460  31.550 43.947 1.00 10.01 ? 150 LEU B CA  1 
ATOM   2797 C  C   . LEU B 1 150 ? 15.632  30.574 43.912 1.00 10.51 ? 150 LEU B C   1 
ATOM   2798 O  O   . LEU B 1 150 ? 16.156  30.188 44.958 1.00 11.44 ? 150 LEU B O   1 
ATOM   2799 C  CB  . LEU B 1 150 ? 13.196  30.825 44.421 1.00 8.43  ? 150 LEU B CB  1 
ATOM   2800 C  CG  . LEU B 1 150 ? 12.007  31.697 44.829 1.00 10.59 ? 150 LEU B CG  1 
ATOM   2801 C  CD1 . LEU B 1 150 ? 10.812  30.823 45.176 1.00 9.52  ? 150 LEU B CD1 1 
ATOM   2802 C  CD2 . LEU B 1 150 ? 12.402  32.561 46.036 1.00 10.81 ? 150 LEU B CD2 1 
ATOM   2803 N  N   . MET B 1 151 ? 16.043  30.181 42.709 1.00 10.08 ? 151 MET B N   1 
ATOM   2804 C  CA  . MET B 1 151 ? 17.157  29.256 42.554 1.00 9.97  ? 151 MET B CA  1 
ATOM   2805 C  C   . MET B 1 151 ? 18.501  29.958 42.701 1.00 11.94 ? 151 MET B C   1 
ATOM   2806 O  O   . MET B 1 151 ? 19.532  29.307 42.865 1.00 12.08 ? 151 MET B O   1 
ATOM   2807 C  CB  . MET B 1 151 ? 17.081  28.569 41.193 1.00 9.99  ? 151 MET B CB  1 
ATOM   2808 C  CG  . MET B 1 151 ? 15.856  27.681 41.023 1.00 7.89  ? 151 MET B CG  1 
ATOM   2809 S  SD  . MET B 1 151 ? 15.710  27.053 39.340 1.00 8.75  ? 151 MET B SD  1 
ATOM   2810 C  CE  . MET B 1 151 ? 14.194  26.058 39.494 1.00 5.16  ? 151 MET B CE  1 
ATOM   2811 N  N   . GLY B 1 152 ? 18.492  31.286 42.641 1.00 13.02 ? 152 GLY B N   1 
ATOM   2812 C  CA  . GLY B 1 152 ? 19.730  32.032 42.777 1.00 14.68 ? 152 GLY B CA  1 
ATOM   2813 C  C   . GLY B 1 152 ? 20.326  32.439 41.444 1.00 15.63 ? 152 GLY B C   1 
ATOM   2814 O  O   . GLY B 1 152 ? 19.942  31.921 40.393 1.00 15.70 ? 152 GLY B O   1 
ATOM   2815 N  N   . GLU B 1 153 ? 21.276  33.365 41.492 1.00 15.18 ? 153 GLU B N   1 
ATOM   2816 C  CA  . GLU B 1 153 ? 21.939  33.873 40.294 1.00 16.98 ? 153 GLU B CA  1 
ATOM   2817 C  C   . GLU B 1 153 ? 22.674  32.812 39.478 1.00 16.04 ? 153 GLU B C   1 
ATOM   2818 O  O   . GLU B 1 153 ? 22.507  32.729 38.264 1.00 14.99 ? 153 GLU B O   1 
ATOM   2819 C  CB  . GLU B 1 153 ? 22.947  34.964 40.672 1.00 19.89 ? 153 GLU B CB  1 
ATOM   2820 C  CG  . GLU B 1 153 ? 22.369  36.282 41.162 1.00 25.13 ? 153 GLU B CG  1 
ATOM   2821 C  CD  . GLU B 1 153 ? 21.770  37.116 40.044 1.00 29.71 ? 153 GLU B CD  1 
ATOM   2822 O  OE1 . GLU B 1 153 ? 22.442  37.280 39.001 1.00 32.73 ? 153 GLU B OE1 1 
ATOM   2823 O  OE2 . GLU B 1 153 ? 20.643  37.629 40.212 1.00 32.40 ? 153 GLU B OE2 1 
ATOM   2824 N  N   . ALA B 1 154 ? 23.497  32.012 40.149 1.00 15.02 ? 154 ALA B N   1 
ATOM   2825 C  CA  . ALA B 1 154 ? 24.288  30.988 39.477 1.00 15.29 ? 154 ALA B CA  1 
ATOM   2826 C  C   . ALA B 1 154 ? 23.479  30.036 38.596 1.00 14.95 ? 154 ALA B C   1 
ATOM   2827 O  O   . ALA B 1 154 ? 23.870  29.750 37.464 1.00 15.61 ? 154 ALA B O   1 
ATOM   2828 C  CB  . ALA B 1 154 ? 25.092  30.197 40.508 1.00 15.72 ? 154 ALA B CB  1 
ATOM   2829 N  N   . ILE B 1 155 ? 22.354  29.552 39.105 1.00 12.84 ? 155 ILE B N   1 
ATOM   2830 C  CA  . ILE B 1 155 ? 21.525  28.629 38.344 1.00 11.50 ? 155 ILE B CA  1 
ATOM   2831 C  C   . ILE B 1 155 ? 20.565  29.296 37.358 1.00 12.37 ? 155 ILE B C   1 
ATOM   2832 O  O   . ILE B 1 155 ? 20.581  28.964 36.174 1.00 11.75 ? 155 ILE B O   1 
ATOM   2833 C  CB  . ILE B 1 155 ? 20.727  27.701 39.292 1.00 12.18 ? 155 ILE B CB  1 
ATOM   2834 C  CG1 . ILE B 1 155 ? 21.698  26.755 40.008 1.00 11.63 ? 155 ILE B CG1 1 
ATOM   2835 C  CG2 . ILE B 1 155 ? 19.668  26.920 38.510 1.00 11.00 ? 155 ILE B CG2 1 
ATOM   2836 C  CD1 . ILE B 1 155 ? 21.051  25.858 41.049 1.00 12.21 ? 155 ILE B CD1 1 
ATOM   2837 N  N   . SER B 1 156 ? 19.749  30.239 37.833 1.00 11.39 ? 156 SER B N   1 
ATOM   2838 C  CA  . SER B 1 156 ? 18.769  30.907 36.971 1.00 11.44 ? 156 SER B CA  1 
ATOM   2839 C  C   . SER B 1 156 ? 19.259  32.174 36.273 1.00 11.47 ? 156 SER B C   1 
ATOM   2840 O  O   . SER B 1 156 ? 18.675  32.598 35.278 1.00 10.83 ? 156 SER B O   1 
ATOM   2841 C  CB  . SER B 1 156 ? 17.515  31.265 37.771 1.00 11.47 ? 156 SER B CB  1 
ATOM   2842 O  OG  . SER B 1 156 ? 17.773  32.349 38.648 1.00 9.00  ? 156 SER B OG  1 
ATOM   2843 N  N   . GLY B 1 157 ? 20.313  32.788 36.800 1.00 12.04 ? 157 GLY B N   1 
ATOM   2844 C  CA  . GLY B 1 157 ? 20.819  34.008 36.200 1.00 11.29 ? 157 GLY B CA  1 
ATOM   2845 C  C   . GLY B 1 157 ? 20.044  35.203 36.722 1.00 12.97 ? 157 GLY B C   1 
ATOM   2846 O  O   . GLY B 1 157 ? 20.115  36.303 36.172 1.00 14.18 ? 157 GLY B O   1 
ATOM   2847 N  N   . ALA B 1 158 ? 19.294  34.977 37.793 1.00 11.11 ? 158 ALA B N   1 
ATOM   2848 C  CA  . ALA B 1 158 ? 18.497  36.026 38.416 1.00 11.46 ? 158 ALA B CA  1 
ATOM   2849 C  C   . ALA B 1 158 ? 18.325  35.673 39.884 1.00 11.58 ? 158 ALA B C   1 
ATOM   2850 O  O   . ALA B 1 158 ? 18.691  34.578 40.312 1.00 10.61 ? 158 ALA B O   1 
ATOM   2851 C  CB  . ALA B 1 158 ? 17.132  36.121 37.741 1.00 10.91 ? 158 ALA B CB  1 
ATOM   2852 N  N   . SER B 1 159 ? 17.777  36.601 40.660 1.00 11.94 ? 159 SER B N   1 
ATOM   2853 C  CA  . SER B 1 159 ? 17.550  36.343 42.075 1.00 13.65 ? 159 SER B CA  1 
ATOM   2854 C  C   . SER B 1 159 ? 16.493  37.283 42.632 1.00 13.59 ? 159 SER B C   1 
ATOM   2855 O  O   . SER B 1 159 ? 16.026  38.189 41.943 1.00 15.81 ? 159 SER B O   1 
ATOM   2856 C  CB  . SER B 1 159 ? 18.859  36.471 42.869 1.00 12.51 ? 159 SER B CB  1 
ATOM   2857 O  OG  . SER B 1 159 ? 19.450  37.745 42.693 1.00 15.79 ? 159 SER B OG  1 
ATOM   2858 N  N   . GLY B 1 160 ? 16.111  37.054 43.880 1.00 13.84 ? 160 GLY B N   1 
ATOM   2859 C  CA  . GLY B 1 160 ? 15.098  37.881 44.499 1.00 13.84 ? 160 GLY B CA  1 
ATOM   2860 C  C   . GLY B 1 160 ? 13.838  37.077 44.726 1.00 14.76 ? 160 GLY B C   1 
ATOM   2861 O  O   . GLY B 1 160 ? 13.677  35.982 44.174 1.00 15.61 ? 160 GLY B O   1 
ATOM   2862 N  N   . PHE B 1 161 ? 12.947  37.617 45.550 1.00 13.85 ? 161 PHE B N   1 
ATOM   2863 C  CA  . PHE B 1 161 ? 11.685  36.962 45.867 1.00 12.34 ? 161 PHE B CA  1 
ATOM   2864 C  C   . PHE B 1 161 ? 10.621  37.351 44.838 1.00 11.48 ? 161 PHE B C   1 
ATOM   2865 O  O   . PHE B 1 161 ? 10.360  38.534 44.629 1.00 11.56 ? 161 PHE B O   1 
ATOM   2866 C  CB  . PHE B 1 161 ? 11.225  37.388 47.262 1.00 12.61 ? 161 PHE B CB  1 
ATOM   2867 C  CG  . PHE B 1 161 ? 9.921   36.777 47.687 1.00 10.30 ? 161 PHE B CG  1 
ATOM   2868 C  CD1 . PHE B 1 161 ? 9.818   35.413 47.918 1.00 10.91 ? 161 PHE B CD1 1 
ATOM   2869 C  CD2 . PHE B 1 161 ? 8.792   37.572 47.854 1.00 13.08 ? 161 PHE B CD2 1 
ATOM   2870 C  CE1 . PHE B 1 161 ? 8.610   34.846 48.310 1.00 10.25 ? 161 PHE B CE1 1 
ATOM   2871 C  CE2 . PHE B 1 161 ? 7.577   37.014 48.246 1.00 11.38 ? 161 PHE B CE2 1 
ATOM   2872 C  CZ  . PHE B 1 161 ? 7.487   35.650 48.474 1.00 10.55 ? 161 PHE B CZ  1 
ATOM   2873 N  N   . PRO B 1 162 ? 10.005  36.359 44.176 1.00 9.78  ? 162 PRO B N   1 
ATOM   2874 C  CA  . PRO B 1 162 ? 8.966   36.602 43.169 1.00 9.39  ? 162 PRO B CA  1 
ATOM   2875 C  C   . PRO B 1 162 ? 7.706   37.259 43.744 1.00 9.09  ? 162 PRO B C   1 
ATOM   2876 O  O   . PRO B 1 162 ? 7.130   36.783 44.725 1.00 8.13  ? 162 PRO B O   1 
ATOM   2877 C  CB  . PRO B 1 162 ? 8.687   35.197 42.629 1.00 9.05  ? 162 PRO B CB  1 
ATOM   2878 C  CG  . PRO B 1 162 ? 10.018  34.476 42.866 1.00 9.25  ? 162 PRO B CG  1 
ATOM   2879 C  CD  . PRO B 1 162 ? 10.260  34.914 44.286 1.00 9.23  ? 162 PRO B CD  1 
ATOM   2880 N  N   . ILE B 1 163 ? 7.282   38.355 43.123 1.00 8.60  ? 163 ILE B N   1 
ATOM   2881 C  CA  . ILE B 1 163 ? 6.087   39.072 43.550 1.00 6.60  ? 163 ILE B CA  1 
ATOM   2882 C  C   . ILE B 1 163 ? 4.938   38.645 42.647 1.00 7.55  ? 163 ILE B C   1 
ATOM   2883 O  O   . ILE B 1 163 ? 3.821   38.381 43.096 1.00 6.18  ? 163 ILE B O   1 
ATOM   2884 C  CB  . ILE B 1 163 ? 6.298   40.599 43.431 1.00 8.47  ? 163 ILE B CB  1 
ATOM   2885 C  CG1 . ILE B 1 163 ? 7.423   41.040 44.375 1.00 8.06  ? 163 ILE B CG1 1 
ATOM   2886 C  CG2 . ILE B 1 163 ? 4.996   41.347 43.724 1.00 7.09  ? 163 ILE B CG2 1 
ATOM   2887 C  CD1 . ILE B 1 163 ? 7.183   40.686 45.839 1.00 7.55  ? 163 ILE B CD1 1 
ATOM   2888 N  N   . MET B 1 164 ? 5.245   38.563 41.360 1.00 8.99  ? 164 MET B N   1 
ATOM   2889 C  CA  . MET B 1 164 ? 4.284   38.182 40.341 1.00 8.43  ? 164 MET B CA  1 
ATOM   2890 C  C   . MET B 1 164 ? 5.060   37.693 39.125 1.00 6.52  ? 164 MET B C   1 
ATOM   2891 O  O   . MET B 1 164 ? 6.235   38.010 38.981 1.00 3.93  ? 164 MET B O   1 
ATOM   2892 C  CB  . MET B 1 164 ? 3.402   39.397 40.013 1.00 11.26 ? 164 MET B CB  1 
ATOM   2893 C  CG  . MET B 1 164 ? 2.841   39.431 38.617 1.00 16.02 ? 164 MET B CG  1 
ATOM   2894 S  SD  . MET B 1 164 ? 4.030   40.113 37.453 1.00 13.27 ? 164 MET B SD  1 
ATOM   2895 C  CE  . MET B 1 164 ? 4.058   41.810 37.935 1.00 19.56 ? 164 MET B CE  1 
ATOM   2896 N  N   . GLY B 1 165 ? 4.415   36.912 38.262 1.00 7.12  ? 165 GLY B N   1 
ATOM   2897 C  CA  . GLY B 1 165 ? 5.105   36.403 37.091 1.00 4.33  ? 165 GLY B CA  1 
ATOM   2898 C  C   . GLY B 1 165 ? 4.207   35.994 35.940 1.00 4.83  ? 165 GLY B C   1 
ATOM   2899 O  O   . GLY B 1 165 ? 3.038   35.667 36.134 1.00 3.02  ? 165 GLY B O   1 
ATOM   2900 N  N   . LEU B 1 166 ? 4.766   36.027 34.731 1.00 5.97  ? 166 LEU B N   1 
ATOM   2901 C  CA  . LEU B 1 166 ? 4.046   35.643 33.521 1.00 5.59  ? 166 LEU B CA  1 
ATOM   2902 C  C   . LEU B 1 166 ? 4.777   34.518 32.796 1.00 6.97  ? 166 LEU B C   1 
ATOM   2903 O  O   . LEU B 1 166 ? 5.969   34.620 32.497 1.00 7.55  ? 166 LEU B O   1 
ATOM   2904 C  CB  . LEU B 1 166 ? 3.906   36.828 32.564 1.00 5.82  ? 166 LEU B CB  1 
ATOM   2905 C  CG  . LEU B 1 166 ? 3.310   36.493 31.182 1.00 6.26  ? 166 LEU B CG  1 
ATOM   2906 C  CD1 . LEU B 1 166 ? 1.864   36.027 31.332 1.00 2.66  ? 166 LEU B CD1 1 
ATOM   2907 C  CD2 . LEU B 1 166 ? 3.382   37.721 30.279 1.00 4.88  ? 166 LEU B CD2 1 
ATOM   2908 N  N   . ASP B 1 167 ? 4.044   33.450 32.509 1.00 6.60  ? 167 ASP B N   1 
ATOM   2909 C  CA  . ASP B 1 167 ? 4.579   32.296 31.805 1.00 7.08  ? 167 ASP B CA  1 
ATOM   2910 C  C   . ASP B 1 167 ? 4.564   32.602 30.305 1.00 7.53  ? 167 ASP B C   1 
ATOM   2911 O  O   . ASP B 1 167 ? 3.503   32.861 29.732 1.00 6.83  ? 167 ASP B O   1 
ATOM   2912 C  CB  . ASP B 1 167 ? 3.711   31.073 32.137 1.00 7.32  ? 167 ASP B CB  1 
ATOM   2913 C  CG  . ASP B 1 167 ? 4.184   29.798 31.460 1.00 8.71  ? 167 ASP B CG  1 
ATOM   2914 O  OD1 . ASP B 1 167 ? 5.370   29.711 31.070 1.00 11.27 ? 167 ASP B OD1 1 
ATOM   2915 O  OD2 . ASP B 1 167 ? 3.366   28.861 31.352 1.00 7.00  ? 167 ASP B OD2 1 
ATOM   2916 N  N   . VAL B 1 168 ? 5.736   32.605 29.675 1.00 7.06  ? 168 VAL B N   1 
ATOM   2917 C  CA  . VAL B 1 168 ? 5.791   32.884 28.250 1.00 8.00  ? 168 VAL B CA  1 
ATOM   2918 C  C   . VAL B 1 168 ? 6.204   31.689 27.396 1.00 8.19  ? 168 VAL B C   1 
ATOM   2919 O  O   . VAL B 1 168 ? 6.732   31.849 26.295 1.00 7.11  ? 168 VAL B O   1 
ATOM   2920 C  CB  . VAL B 1 168 ? 6.687   34.110 27.920 1.00 6.64  ? 168 VAL B CB  1 
ATOM   2921 C  CG1 . VAL B 1 168 ? 6.089   35.361 28.551 1.00 6.49  ? 168 VAL B CG1 1 
ATOM   2922 C  CG2 . VAL B 1 168 ? 8.104   33.884 28.404 1.00 4.22  ? 168 VAL B CG2 1 
ATOM   2923 N  N   . TRP B 1 169 ? 5.990   30.487 27.921 1.00 8.28  ? 169 TRP B N   1 
ATOM   2924 C  CA  . TRP B 1 169 ? 6.249   29.291 27.130 1.00 7.46  ? 169 TRP B CA  1 
ATOM   2925 C  C   . TRP B 1 169 ? 5.108   29.403 26.122 1.00 7.55  ? 169 TRP B C   1 
ATOM   2926 O  O   . TRP B 1 169 ? 4.038   29.915 26.459 1.00 6.95  ? 169 TRP B O   1 
ATOM   2927 C  CB  . TRP B 1 169 ? 6.059   28.022 27.955 1.00 6.48  ? 169 TRP B CB  1 
ATOM   2928 C  CG  . TRP B 1 169 ? 7.232   27.610 28.774 1.00 8.19  ? 169 TRP B CG  1 
ATOM   2929 C  CD1 . TRP B 1 169 ? 7.896   28.358 29.698 1.00 7.64  ? 169 TRP B CD1 1 
ATOM   2930 C  CD2 . TRP B 1 169 ? 7.841   26.310 28.794 1.00 8.16  ? 169 TRP B CD2 1 
ATOM   2931 N  NE1 . TRP B 1 169 ? 8.880   27.605 30.300 1.00 8.35  ? 169 TRP B NE1 1 
ATOM   2932 C  CE2 . TRP B 1 169 ? 8.868   26.344 29.763 1.00 7.98  ? 169 TRP B CE2 1 
ATOM   2933 C  CE3 . TRP B 1 169 ? 7.615   25.119 28.088 1.00 7.38  ? 169 TRP B CE3 1 
ATOM   2934 C  CZ2 . TRP B 1 169 ? 9.672   25.231 30.046 1.00 6.03  ? 169 TRP B CZ2 1 
ATOM   2935 C  CZ3 . TRP B 1 169 ? 8.411   24.011 28.371 1.00 7.68  ? 169 TRP B CZ3 1 
ATOM   2936 C  CH2 . TRP B 1 169 ? 9.429   24.078 29.344 1.00 6.14  ? 169 TRP B CH2 1 
ATOM   2937 N  N   . GLU B 1 170 ? 5.316   28.927 24.902 1.00 8.04  ? 170 GLU B N   1 
ATOM   2938 C  CA  . GLU B 1 170 ? 4.282   29.029 23.878 1.00 6.78  ? 170 GLU B CA  1 
ATOM   2939 C  C   . GLU B 1 170 ? 2.998   28.266 24.185 1.00 7.37  ? 170 GLU B C   1 
ATOM   2940 O  O   . GLU B 1 170 ? 1.924   28.639 23.710 1.00 6.55  ? 170 GLU B O   1 
ATOM   2941 C  CB  . GLU B 1 170 ? 4.857   28.602 22.529 1.00 6.23  ? 170 GLU B CB  1 
ATOM   2942 C  CG  . GLU B 1 170 ? 5.975   29.523 22.072 1.00 6.79  ? 170 GLU B CG  1 
ATOM   2943 C  CD  . GLU B 1 170 ? 6.631   29.078 20.784 1.00 5.53  ? 170 GLU B CD  1 
ATOM   2944 O  OE1 . GLU B 1 170 ? 7.055   27.910 20.711 1.00 6.85  ? 170 GLU B OE1 1 
ATOM   2945 O  OE2 . GLU B 1 170 ? 6.743   29.899 19.857 1.00 4.14  ? 170 GLU B OE2 1 
ATOM   2946 N  N   . HIS B 1 171 ? 3.093   27.213 24.992 1.00 7.52  ? 171 HIS B N   1 
ATOM   2947 C  CA  . HIS B 1 171 ? 1.908   26.442 25.339 1.00 6.22  ? 171 HIS B CA  1 
ATOM   2948 C  C   . HIS B 1 171 ? 0.918   27.297 26.133 1.00 7.23  ? 171 HIS B C   1 
ATOM   2949 O  O   . HIS B 1 171 ? -0.274  26.991 26.194 1.00 7.55  ? 171 HIS B O   1 
ATOM   2950 C  CB  . HIS B 1 171 ? 2.304   25.184 26.134 1.00 7.81  ? 171 HIS B CB  1 
ATOM   2951 C  CG  . HIS B 1 171 ? 2.944   25.465 27.459 1.00 7.07  ? 171 HIS B CG  1 
ATOM   2952 N  ND1 . HIS B 1 171 ? 4.084   24.817 27.881 1.00 5.79  ? 171 HIS B ND1 1 
ATOM   2953 C  CD2 . HIS B 1 171 ? 2.573   26.274 28.481 1.00 8.70  ? 171 HIS B CD2 1 
ATOM   2954 C  CE1 . HIS B 1 171 ? 4.389   25.215 29.103 1.00 7.85  ? 171 HIS B CE1 1 
ATOM   2955 N  NE2 . HIS B 1 171 ? 3.488   26.099 29.490 1.00 8.25  ? 171 HIS B NE2 1 
ATOM   2956 N  N   . ALA B 1 172 ? 1.410   28.386 26.716 1.00 6.26  ? 172 ALA B N   1 
ATOM   2957 C  CA  . ALA B 1 172 ? 0.561   29.269 27.511 1.00 6.81  ? 172 ALA B CA  1 
ATOM   2958 C  C   . ALA B 1 172 ? -0.270  30.244 26.689 1.00 5.96  ? 172 ALA B C   1 
ATOM   2959 O  O   . ALA B 1 172 ? -1.245  30.793 27.189 1.00 5.06  ? 172 ALA B O   1 
ATOM   2960 C  CB  . ALA B 1 172 ? 1.409   30.052 28.510 1.00 5.44  ? 172 ALA B CB  1 
ATOM   2961 N  N   . TYR B 1 173 ? 0.095   30.448 25.429 1.00 6.20  ? 173 TYR B N   1 
ATOM   2962 C  CA  . TYR B 1 173 ? -0.626  31.408 24.608 1.00 7.12  ? 173 TYR B CA  1 
ATOM   2963 C  C   . TYR B 1 173 ? -0.826  31.035 23.148 1.00 6.87  ? 173 TYR B C   1 
ATOM   2964 O  O   . TYR B 1 173 ? -1.474  31.776 22.414 1.00 7.65  ? 173 TYR B O   1 
ATOM   2965 C  CB  . TYR B 1 173 ? 0.097   32.756 24.679 1.00 6.61  ? 173 TYR B CB  1 
ATOM   2966 C  CG  . TYR B 1 173 ? 1.504   32.758 24.100 1.00 6.60  ? 173 TYR B CG  1 
ATOM   2967 C  CD1 . TYR B 1 173 ? 1.724   32.829 22.719 1.00 6.45  ? 173 TYR B CD1 1 
ATOM   2968 C  CD2 . TYR B 1 173 ? 2.619   32.698 24.937 1.00 8.25  ? 173 TYR B CD2 1 
ATOM   2969 C  CE1 . TYR B 1 173 ? 3.024   32.845 22.190 1.00 4.96  ? 173 TYR B CE1 1 
ATOM   2970 C  CE2 . TYR B 1 173 ? 3.922   32.713 24.422 1.00 6.90  ? 173 TYR B CE2 1 
ATOM   2971 C  CZ  . TYR B 1 173 ? 4.117   32.788 23.052 1.00 8.64  ? 173 TYR B CZ  1 
ATOM   2972 O  OH  . TYR B 1 173 ? 5.405   32.819 22.561 1.00 7.74  ? 173 TYR B OH  1 
ATOM   2973 N  N   . TYR B 1 174 ? -0.304  29.893 22.719 1.00 6.99  ? 174 TYR B N   1 
ATOM   2974 C  CA  . TYR B 1 174 ? -0.427  29.547 21.311 1.00 7.46  ? 174 TYR B CA  1 
ATOM   2975 C  C   . TYR B 1 174 ? -1.822  29.235 20.775 1.00 7.58  ? 174 TYR B C   1 
ATOM   2976 O  O   . TYR B 1 174 ? -2.142  29.631 19.661 1.00 8.01  ? 174 TYR B O   1 
ATOM   2977 C  CB  . TYR B 1 174 ? 0.517   28.401 20.943 1.00 4.44  ? 174 TYR B CB  1 
ATOM   2978 C  CG  . TYR B 1 174 ? 1.164   28.649 19.603 1.00 6.67  ? 174 TYR B CG  1 
ATOM   2979 C  CD1 . TYR B 1 174 ? 2.139   29.637 19.461 1.00 5.21  ? 174 TYR B CD1 1 
ATOM   2980 C  CD2 . TYR B 1 174 ? 0.733   27.977 18.455 1.00 7.85  ? 174 TYR B CD2 1 
ATOM   2981 C  CE1 . TYR B 1 174 ? 2.663   29.956 18.215 1.00 8.84  ? 174 TYR B CE1 1 
ATOM   2982 C  CE2 . TYR B 1 174 ? 1.253   28.292 17.194 1.00 6.61  ? 174 TYR B CE2 1 
ATOM   2983 C  CZ  . TYR B 1 174 ? 2.214   29.284 17.084 1.00 8.79  ? 174 TYR B CZ  1 
ATOM   2984 O  OH  . TYR B 1 174 ? 2.718   29.631 15.851 1.00 9.90  ? 174 TYR B OH  1 
ATOM   2985 N  N   . LEU B 1 175 ? -2.650  28.534 21.545 1.00 7.41  ? 175 LEU B N   1 
ATOM   2986 C  CA  . LEU B 1 175 ? -3.991  28.196 21.068 1.00 8.79  ? 175 LEU B CA  1 
ATOM   2987 C  C   . LEU B 1 175 ? -4.844  29.407 20.700 1.00 9.25  ? 175 LEU B C   1 
ATOM   2988 O  O   . LEU B 1 175 ? -5.591  29.371 19.725 1.00 10.68 ? 175 LEU B O   1 
ATOM   2989 C  CB  . LEU B 1 175 ? -4.735  27.335 22.100 1.00 5.94  ? 175 LEU B CB  1 
ATOM   2990 C  CG  . LEU B 1 175 ? -4.191  25.922 22.334 1.00 5.54  ? 175 LEU B CG  1 
ATOM   2991 C  CD1 . LEU B 1 175 ? -5.060  25.187 23.352 1.00 3.55  ? 175 LEU B CD1 1 
ATOM   2992 C  CD2 . LEU B 1 175 ? -4.169  25.165 21.013 1.00 3.12  ? 175 LEU B CD2 1 
ATOM   2993 N  N   . LYS B 1 176 ? -4.733  30.480 21.475 1.00 9.95  ? 176 LYS B N   1 
ATOM   2994 C  CA  . LYS B 1 176 ? -5.507  31.687 21.208 1.00 10.13 ? 176 LYS B CA  1 
ATOM   2995 C  C   . LYS B 1 176 ? -4.737  32.790 20.484 1.00 10.50 ? 176 LYS B C   1 
ATOM   2996 O  O   . LYS B 1 176 ? -5.295  33.476 19.624 1.00 9.27  ? 176 LYS B O   1 
ATOM   2997 C  CB  . LYS B 1 176 ? -6.056  32.259 22.514 1.00 11.82 ? 176 LYS B CB  1 
ATOM   2998 C  CG  . LYS B 1 176 ? -6.762  33.598 22.348 1.00 11.20 ? 176 LYS B CG  1 
ATOM   2999 C  CD  . LYS B 1 176 ? -7.150  34.184 23.696 1.00 13.64 ? 176 LYS B CD  1 
ATOM   3000 C  CE  . LYS B 1 176 ? -7.826  35.538 23.531 1.00 12.77 ? 176 LYS B CE  1 
ATOM   3001 N  NZ  . LYS B 1 176 ? -8.206  36.121 24.848 1.00 13.20 ? 176 LYS B NZ  1 
ATOM   3002 N  N   . PHE B 1 177 ? -3.461  32.952 20.822 1.00 9.60  ? 177 PHE B N   1 
ATOM   3003 C  CA  . PHE B 1 177 ? -2.637  34.014 20.236 1.00 10.92 ? 177 PHE B CA  1 
ATOM   3004 C  C   . PHE B 1 177 ? -1.622  33.580 19.172 1.00 10.54 ? 177 PHE B C   1 
ATOM   3005 O  O   . PHE B 1 177 ? -1.078  34.422 18.460 1.00 9.80  ? 177 PHE B O   1 
ATOM   3006 C  CB  . PHE B 1 177 ? -1.870  34.727 21.357 1.00 10.00 ? 177 PHE B CB  1 
ATOM   3007 C  CG  . PHE B 1 177 ? -2.752  35.298 22.439 1.00 8.50  ? 177 PHE B CG  1 
ATOM   3008 C  CD1 . PHE B 1 177 ? -3.365  36.537 22.281 1.00 8.96  ? 177 PHE B CD1 1 
ATOM   3009 C  CD2 . PHE B 1 177 ? -2.990  34.579 23.606 1.00 7.29  ? 177 PHE B CD2 1 
ATOM   3010 C  CE1 . PHE B 1 177 ? -4.203  37.052 23.271 1.00 7.01  ? 177 PHE B CE1 1 
ATOM   3011 C  CE2 . PHE B 1 177 ? -3.825  35.080 24.602 1.00 7.63  ? 177 PHE B CE2 1 
ATOM   3012 C  CZ  . PHE B 1 177 ? -4.433  36.319 24.436 1.00 7.47  ? 177 PHE B CZ  1 
ATOM   3013 N  N   . GLN B 1 178 ? -1.369  32.280 19.059 1.00 11.38 ? 178 GLN B N   1 
ATOM   3014 C  CA  . GLN B 1 178 ? -0.361  31.783 18.123 1.00 10.73 ? 178 GLN B CA  1 
ATOM   3015 C  C   . GLN B 1 178 ? 0.953   32.542 18.366 1.00 10.40 ? 178 GLN B C   1 
ATOM   3016 O  O   . GLN B 1 178 ? 1.400   32.662 19.505 1.00 8.15  ? 178 GLN B O   1 
ATOM   3017 C  CB  . GLN B 1 178 ? -0.801  31.944 16.660 1.00 11.16 ? 178 GLN B CB  1 
ATOM   3018 C  CG  . GLN B 1 178 ? -1.949  31.032 16.230 1.00 13.47 ? 178 GLN B CG  1 
ATOM   3019 C  CD  . GLN B 1 178 ? -3.299  31.494 16.740 1.00 14.38 ? 178 GLN B CD  1 
ATOM   3020 O  OE1 . GLN B 1 178 ? -3.771  32.572 16.381 1.00 14.23 ? 178 GLN B OE1 1 
ATOM   3021 N  NE2 . GLN B 1 178 ? -3.930  30.681 17.580 1.00 16.92 ? 178 GLN B NE2 1 
ATOM   3022 N  N   . ASN B 1 179 ? 1.555   33.067 17.302 1.00 10.64 ? 179 ASN B N   1 
ATOM   3023 C  CA  . ASN B 1 179 ? 2.826   33.785 17.401 1.00 11.97 ? 179 ASN B CA  1 
ATOM   3024 C  C   . ASN B 1 179 ? 2.763   35.145 18.088 1.00 12.66 ? 179 ASN B C   1 
ATOM   3025 O  O   . ASN B 1 179 ? 3.790   35.673 18.514 1.00 13.40 ? 179 ASN B O   1 
ATOM   3026 C  CB  . ASN B 1 179 ? 3.416   33.998 16.009 1.00 11.12 ? 179 ASN B CB  1 
ATOM   3027 C  CG  . ASN B 1 179 ? 2.506   34.822 15.121 1.00 10.50 ? 179 ASN B CG  1 
ATOM   3028 O  OD1 . ASN B 1 179 ? 1.419   34.377 14.748 1.00 11.72 ? 179 ASN B OD1 1 
ATOM   3029 N  ND2 . ASN B 1 179 ? 2.936   36.036 14.793 1.00 8.98  ? 179 ASN B ND2 1 
ATOM   3030 N  N   . ARG B 1 180 ? 1.566   35.711 18.190 1.00 13.27 ? 180 ARG B N   1 
ATOM   3031 C  CA  . ARG B 1 180 ? 1.389   37.034 18.787 1.00 12.99 ? 180 ARG B CA  1 
ATOM   3032 C  C   . ARG B 1 180 ? 1.563   37.115 20.306 1.00 12.00 ? 180 ARG B C   1 
ATOM   3033 O  O   . ARG B 1 180 ? 0.624   37.475 21.024 1.00 10.92 ? 180 ARG B O   1 
ATOM   3034 C  CB  . ARG B 1 180 ? 0.012   37.589 18.397 1.00 13.88 ? 180 ARG B CB  1 
ATOM   3035 C  CG  . ARG B 1 180 ? -0.221  37.645 16.888 1.00 16.28 ? 180 ARG B CG  1 
ATOM   3036 C  CD  . ARG B 1 180 ? -1.559  38.299 16.546 1.00 21.38 ? 180 ARG B CD  1 
ATOM   3037 N  NE  . ARG B 1 180 ? -2.704  37.619 17.155 1.00 24.31 ? 180 ARG B NE  1 
ATOM   3038 C  CZ  . ARG B 1 180 ? -3.090  36.382 16.861 1.00 25.89 ? 180 ARG B CZ  1 
ATOM   3039 N  NH1 . ARG B 1 180 ? -2.422  35.673 15.959 1.00 28.31 ? 180 ARG B NH1 1 
ATOM   3040 N  NH2 . ARG B 1 180 ? -4.148  35.852 17.464 1.00 25.42 ? 180 ARG B NH2 1 
ATOM   3041 N  N   . ARG B 1 181 ? 2.765   36.807 20.791 1.00 11.20 ? 181 ARG B N   1 
ATOM   3042 C  CA  . ARG B 1 181 ? 3.046   36.857 22.229 1.00 11.06 ? 181 ARG B CA  1 
ATOM   3043 C  C   . ARG B 1 181 ? 2.739   38.237 22.820 1.00 9.96  ? 181 ARG B C   1 
ATOM   3044 O  O   . ARG B 1 181 ? 2.238   38.335 23.937 1.00 10.12 ? 181 ARG B O   1 
ATOM   3045 C  CB  . ARG B 1 181 ? 4.510   36.491 22.525 1.00 11.56 ? 181 ARG B CB  1 
ATOM   3046 C  CG  . ARG B 1 181 ? 4.833   36.475 24.024 1.00 11.98 ? 181 ARG B CG  1 
ATOM   3047 C  CD  . ARG B 1 181 ? 6.328   36.338 24.332 1.00 11.36 ? 181 ARG B CD  1 
ATOM   3048 N  NE  . ARG B 1 181 ? 6.885   35.056 23.912 1.00 10.50 ? 181 ARG B NE  1 
ATOM   3049 C  CZ  . ARG B 1 181 ? 8.132   34.667 24.162 1.00 11.48 ? 181 ARG B CZ  1 
ATOM   3050 N  NH1 . ARG B 1 181 ? 8.954   35.460 24.833 1.00 10.92 ? 181 ARG B NH1 1 
ATOM   3051 N  NH2 . ARG B 1 181 ? 8.561   33.485 23.739 1.00 12.03 ? 181 ARG B NH2 1 
ATOM   3052 N  N   . PRO B 1 182 ? 3.043   39.324 22.083 1.00 10.70 ? 182 PRO B N   1 
ATOM   3053 C  CA  . PRO B 1 182 ? 2.767   40.671 22.597 1.00 11.32 ? 182 PRO B CA  1 
ATOM   3054 C  C   . PRO B 1 182 ? 1.294   40.913 22.960 1.00 10.68 ? 182 PRO B C   1 
ATOM   3055 O  O   . PRO B 1 182 ? 1.006   41.625 23.918 1.00 10.71 ? 182 PRO B O   1 
ATOM   3056 C  CB  . PRO B 1 182 ? 3.249   41.569 21.457 1.00 11.87 ? 182 PRO B CB  1 
ATOM   3057 C  CG  . PRO B 1 182 ? 4.393   40.743 20.870 1.00 11.80 ? 182 PRO B CG  1 
ATOM   3058 C  CD  . PRO B 1 182 ? 3.669   39.423 20.754 1.00 10.11 ? 182 PRO B CD  1 
ATOM   3059 N  N   . ASP B 1 183 ? 0.364   40.339 22.197 1.00 11.07 ? 183 ASP B N   1 
ATOM   3060 C  CA  . ASP B 1 183 ? -1.059  40.510 22.502 1.00 11.77 ? 183 ASP B CA  1 
ATOM   3061 C  C   . ASP B 1 183 ? -1.389  39.755 23.786 1.00 11.93 ? 183 ASP B C   1 
ATOM   3062 O  O   . ASP B 1 183 ? -2.248  40.166 24.566 1.00 11.90 ? 183 ASP B O   1 
ATOM   3063 C  CB  . ASP B 1 183 ? -1.951  39.989 21.365 1.00 12.99 ? 183 ASP B CB  1 
ATOM   3064 C  CG  . ASP B 1 183 ? -1.780  40.773 20.081 1.00 14.14 ? 183 ASP B CG  1 
ATOM   3065 O  OD1 . ASP B 1 183 ? -1.628  42.001 20.161 1.00 15.68 ? 183 ASP B OD1 1 
ATOM   3066 O  OD2 . ASP B 1 183 ? -1.825  40.169 18.991 1.00 18.14 ? 183 ASP B OD2 1 
ATOM   3067 N  N   . TYR B 1 184 ? -0.701  38.637 23.984 1.00 9.96  ? 184 TYR B N   1 
ATOM   3068 C  CA  . TYR B 1 184 ? -0.871  37.810 25.169 1.00 9.29  ? 184 TYR B CA  1 
ATOM   3069 C  C   . TYR B 1 184 ? -0.373  38.576 26.396 1.00 9.32  ? 184 TYR B C   1 
ATOM   3070 O  O   . TYR B 1 184 ? -1.005  38.571 27.455 1.00 8.72  ? 184 TYR B O   1 
ATOM   3071 C  CB  . TYR B 1 184 ? -0.071  36.522 24.983 1.00 9.23  ? 184 TYR B CB  1 
ATOM   3072 C  CG  . TYR B 1 184 ? 0.118   35.692 26.225 1.00 7.72  ? 184 TYR B CG  1 
ATOM   3073 C  CD1 . TYR B 1 184 ? -0.966  35.090 26.863 1.00 6.89  ? 184 TYR B CD1 1 
ATOM   3074 C  CD2 . TYR B 1 184 ? 1.394   35.484 26.748 1.00 7.09  ? 184 TYR B CD2 1 
ATOM   3075 C  CE1 . TYR B 1 184 ? -0.780  34.293 27.995 1.00 7.50  ? 184 TYR B CE1 1 
ATOM   3076 C  CE2 . TYR B 1 184 ? 1.591   34.690 27.879 1.00 9.45  ? 184 TYR B CE2 1 
ATOM   3077 C  CZ  . TYR B 1 184 ? 0.499   34.095 28.496 1.00 7.19  ? 184 TYR B CZ  1 
ATOM   3078 O  OH  . TYR B 1 184 ? 0.693   33.291 29.598 1.00 8.34  ? 184 TYR B OH  1 
ATOM   3079 N  N   . ILE B 1 185 ? 0.766   39.238 26.236 1.00 9.80  ? 185 ILE B N   1 
ATOM   3080 C  CA  . ILE B 1 185 ? 1.366   40.011 27.309 1.00 10.25 ? 185 ILE B CA  1 
ATOM   3081 C  C   . ILE B 1 185 ? 0.449   41.163 27.701 1.00 11.32 ? 185 ILE B C   1 
ATOM   3082 O  O   . ILE B 1 185 ? 0.295   41.460 28.886 1.00 11.35 ? 185 ILE B O   1 
ATOM   3083 C  CB  . ILE B 1 185 ? 2.757   40.540 26.884 1.00 9.35  ? 185 ILE B CB  1 
ATOM   3084 C  CG1 . ILE B 1 185 ? 3.664   39.350 26.540 1.00 9.58  ? 185 ILE B CG1 1 
ATOM   3085 C  CG2 . ILE B 1 185 ? 3.385   41.339 28.014 1.00 9.32  ? 185 ILE B CG2 1 
ATOM   3086 C  CD1 . ILE B 1 185 ? 5.052   39.726 26.057 1.00 6.75  ? 185 ILE B CD1 1 
ATOM   3087 N  N   . LYS B 1 186 ? -0.166  41.800 26.707 1.00 9.81  ? 186 LYS B N   1 
ATOM   3088 C  CA  . LYS B 1 186 ? -1.088  42.900 26.960 1.00 10.68 ? 186 LYS B CA  1 
ATOM   3089 C  C   . LYS B 1 186 ? -2.321  42.424 27.726 1.00 10.98 ? 186 LYS B C   1 
ATOM   3090 O  O   . LYS B 1 186 ? -2.827  43.133 28.598 1.00 11.83 ? 186 LYS B O   1 
ATOM   3091 C  CB  . LYS B 1 186 ? -1.524  43.551 25.646 1.00 10.33 ? 186 LYS B CB  1 
ATOM   3092 C  CG  . LYS B 1 186 ? -0.450  44.359 24.961 1.00 13.90 ? 186 LYS B CG  1 
ATOM   3093 C  CD  . LYS B 1 186 ? -0.039  45.553 25.810 1.00 16.02 ? 186 LYS B CD  1 
ATOM   3094 C  CE  . LYS B 1 186 ? 0.946   46.444 25.069 1.00 18.01 ? 186 LYS B CE  1 
ATOM   3095 N  NZ  . LYS B 1 186 ? 1.314   47.649 25.861 1.00 18.60 ? 186 LYS B NZ  1 
ATOM   3096 N  N   . GLU B 1 187 ? -2.810  41.231 27.395 1.00 11.09 ? 187 GLU B N   1 
ATOM   3097 C  CA  . GLU B 1 187 ? -3.974  40.677 28.080 1.00 11.86 ? 187 GLU B CA  1 
ATOM   3098 C  C   . GLU B 1 187 ? -3.643  40.370 29.539 1.00 12.02 ? 187 GLU B C   1 
ATOM   3099 O  O   . GLU B 1 187 ? -4.515  40.411 30.406 1.00 12.29 ? 187 GLU B O   1 
ATOM   3100 C  CB  . GLU B 1 187 ? -4.451  39.384 27.407 1.00 11.85 ? 187 GLU B CB  1 
ATOM   3101 C  CG  . GLU B 1 187 ? -5.129  39.550 26.057 1.00 16.25 ? 187 GLU B CG  1 
ATOM   3102 C  CD  . GLU B 1 187 ? -6.356  40.441 26.120 1.00 18.74 ? 187 GLU B CD  1 
ATOM   3103 O  OE1 . GLU B 1 187 ? -7.206  40.235 27.015 1.00 19.61 ? 187 GLU B OE1 1 
ATOM   3104 O  OE2 . GLU B 1 187 ? -6.477  41.341 25.262 1.00 22.36 ? 187 GLU B OE2 1 
ATOM   3105 N  N   . PHE B 1 188 ? -2.380  40.055 29.802 1.00 10.17 ? 188 PHE B N   1 
ATOM   3106 C  CA  . PHE B 1 188 ? -1.945  39.719 31.151 1.00 9.97  ? 188 PHE B CA  1 
ATOM   3107 C  C   . PHE B 1 188 ? -2.308  40.805 32.164 1.00 9.44  ? 188 PHE B C   1 
ATOM   3108 O  O   . PHE B 1 188 ? -2.675  40.506 33.294 1.00 10.40 ? 188 PHE B O   1 
ATOM   3109 C  CB  . PHE B 1 188 ? -0.431  39.471 31.162 1.00 8.84  ? 188 PHE B CB  1 
ATOM   3110 C  CG  . PHE B 1 188 ? 0.130   39.190 32.526 1.00 9.86  ? 188 PHE B CG  1 
ATOM   3111 C  CD1 . PHE B 1 188 ? -0.293  38.084 33.256 1.00 8.36  ? 188 PHE B CD1 1 
ATOM   3112 C  CD2 . PHE B 1 188 ? 1.087   40.035 33.083 1.00 11.41 ? 188 PHE B CD2 1 
ATOM   3113 C  CE1 . PHE B 1 188 ? 0.228   37.821 34.522 1.00 9.21  ? 188 PHE B CE1 1 
ATOM   3114 C  CE2 . PHE B 1 188 ? 1.615   39.783 34.348 1.00 10.68 ? 188 PHE B CE2 1 
ATOM   3115 C  CZ  . PHE B 1 188 ? 1.183   38.669 35.069 1.00 9.96  ? 188 PHE B CZ  1 
ATOM   3116 N  N   . TRP B 1 189 ? -2.199  42.061 31.751 1.00 9.79  ? 189 TRP B N   1 
ATOM   3117 C  CA  . TRP B 1 189 ? -2.511  43.192 32.620 1.00 9.34  ? 189 TRP B CA  1 
ATOM   3118 C  C   . TRP B 1 189 ? -3.955  43.160 33.121 1.00 9.54  ? 189 TRP B C   1 
ATOM   3119 O  O   . TRP B 1 189 ? -4.282  43.779 34.138 1.00 8.81  ? 189 TRP B O   1 
ATOM   3120 C  CB  . TRP B 1 189 ? -2.251  44.503 31.867 1.00 9.14  ? 189 TRP B CB  1 
ATOM   3121 C  CG  . TRP B 1 189 ? -0.802  44.731 31.524 1.00 10.23 ? 189 TRP B CG  1 
ATOM   3122 C  CD1 . TRP B 1 189 ? -0.308  45.225 30.350 1.00 10.76 ? 189 TRP B CD1 1 
ATOM   3123 C  CD2 . TRP B 1 189 ? 0.333   44.523 32.377 1.00 8.18  ? 189 TRP B CD2 1 
ATOM   3124 N  NE1 . TRP B 1 189 ? 1.059   45.336 30.417 1.00 10.25 ? 189 TRP B NE1 1 
ATOM   3125 C  CE2 . TRP B 1 189 ? 1.480   44.913 31.649 1.00 9.37  ? 189 TRP B CE2 1 
ATOM   3126 C  CE3 . TRP B 1 189 ? 0.492   44.048 33.683 1.00 6.56  ? 189 TRP B CE3 1 
ATOM   3127 C  CZ2 . TRP B 1 189 ? 2.773   44.840 32.185 1.00 8.98  ? 189 TRP B CZ2 1 
ATOM   3128 C  CZ3 . TRP B 1 189 ? 1.779   43.976 34.218 1.00 8.40  ? 189 TRP B CZ3 1 
ATOM   3129 C  CH2 . TRP B 1 189 ? 2.900   44.370 33.468 1.00 9.14  ? 189 TRP B CH2 1 
ATOM   3130 N  N   . ASN B 1 190 ? -4.814  42.438 32.404 1.00 8.72  ? 190 ASN B N   1 
ATOM   3131 C  CA  . ASN B 1 190 ? -6.222  42.330 32.772 1.00 8.99  ? 190 ASN B CA  1 
ATOM   3132 C  C   . ASN B 1 190 ? -6.500  41.190 33.748 1.00 10.50 ? 190 ASN B C   1 
ATOM   3133 O  O   . ASN B 1 190 ? -7.574  41.141 34.359 1.00 8.12  ? 190 ASN B O   1 
ATOM   3134 C  CB  . ASN B 1 190 ? -7.088  42.124 31.526 1.00 9.16  ? 190 ASN B CB  1 
ATOM   3135 C  CG  . ASN B 1 190 ? -7.069  43.318 30.600 1.00 11.75 ? 190 ASN B CG  1 
ATOM   3136 O  OD1 . ASN B 1 190 ? -7.346  44.442 31.019 1.00 13.52 ? 190 ASN B OD1 1 
ATOM   3137 N  ND2 . ASN B 1 190 ? -6.757  43.083 29.330 1.00 10.13 ? 190 ASN B ND2 1 
ATOM   3138 N  N   . VAL B 1 191 ? -5.541  40.277 33.896 1.00 9.39  ? 191 VAL B N   1 
ATOM   3139 C  CA  . VAL B 1 191 ? -5.728  39.137 34.784 1.00 8.70  ? 191 VAL B CA  1 
ATOM   3140 C  C   . VAL B 1 191 ? -4.705  38.965 35.905 1.00 9.48  ? 191 VAL B C   1 
ATOM   3141 O  O   . VAL B 1 191 ? -4.868  38.089 36.758 1.00 8.56  ? 191 VAL B O   1 
ATOM   3142 C  CB  . VAL B 1 191 ? -5.826  37.821 33.972 1.00 8.99  ? 191 VAL B CB  1 
ATOM   3143 C  CG1 . VAL B 1 191 ? -7.144  37.786 33.206 1.00 8.01  ? 191 VAL B CG1 1 
ATOM   3144 C  CG2 . VAL B 1 191 ? -4.663  37.719 32.986 1.00 6.82  ? 191 VAL B CG2 1 
ATOM   3145 N  N   . VAL B 1 192 ? -3.661  39.792 35.925 1.00 9.12  ? 192 VAL B N   1 
ATOM   3146 C  CA  . VAL B 1 192 ? -2.669  39.683 36.987 1.00 8.43  ? 192 VAL B CA  1 
ATOM   3147 C  C   . VAL B 1 192 ? -3.336  40.066 38.312 1.00 9.70  ? 192 VAL B C   1 
ATOM   3148 O  O   . VAL B 1 192 ? -3.878  41.164 38.454 1.00 10.70 ? 192 VAL B O   1 
ATOM   3149 C  CB  . VAL B 1 192 ? -1.437  40.592 36.724 1.00 8.23  ? 192 VAL B CB  1 
ATOM   3150 C  CG1 . VAL B 1 192 ? -1.858  42.042 36.601 1.00 9.68  ? 192 VAL B CG1 1 
ATOM   3151 C  CG2 . VAL B 1 192 ? -0.430  40.426 37.846 1.00 9.03  ? 192 VAL B CG2 1 
ATOM   3152 N  N   . ASN B 1 193 ? -3.313  39.140 39.268 1.00 8.10  ? 193 ASN B N   1 
ATOM   3153 C  CA  . ASN B 1 193 ? -3.922  39.353 40.578 1.00 8.27  ? 193 ASN B CA  1 
ATOM   3154 C  C   . ASN B 1 193 ? -3.059  40.278 41.440 1.00 8.72  ? 193 ASN B C   1 
ATOM   3155 O  O   . ASN B 1 193 ? -2.134  39.817 42.118 1.00 9.11  ? 193 ASN B O   1 
ATOM   3156 C  CB  . ASN B 1 193 ? -4.091  38.010 41.299 1.00 8.94  ? 193 ASN B CB  1 
ATOM   3157 C  CG  . ASN B 1 193 ? -4.917  38.126 42.566 1.00 8.33  ? 193 ASN B CG  1 
ATOM   3158 O  OD1 . ASN B 1 193 ? -5.014  39.196 43.164 1.00 7.62  ? 193 ASN B OD1 1 
ATOM   3159 N  ND2 . ASN B 1 193 ? -5.495  37.012 42.995 1.00 8.19  ? 193 ASN B ND2 1 
ATOM   3160 N  N   . TRP B 1 194 ? -3.355  41.576 41.419 1.00 7.57  ? 194 TRP B N   1 
ATOM   3161 C  CA  . TRP B 1 194 ? -2.588  42.525 42.214 1.00 7.19  ? 194 TRP B CA  1 
ATOM   3162 C  C   . TRP B 1 194 ? -2.821  42.363 43.716 1.00 8.31  ? 194 TRP B C   1 
ATOM   3163 O  O   . TRP B 1 194 ? -1.991  42.798 44.515 1.00 8.69  ? 194 TRP B O   1 
ATOM   3164 C  CB  . TRP B 1 194 ? -2.902  43.974 41.813 1.00 6.00  ? 194 TRP B CB  1 
ATOM   3165 C  CG  . TRP B 1 194 ? -2.447  44.351 40.429 1.00 5.94  ? 194 TRP B CG  1 
ATOM   3166 C  CD1 . TRP B 1 194 ? -3.240  44.693 39.369 1.00 6.96  ? 194 TRP B CD1 1 
ATOM   3167 C  CD2 . TRP B 1 194 ? -1.095  44.439 39.962 1.00 5.60  ? 194 TRP B CD2 1 
ATOM   3168 N  NE1 . TRP B 1 194 ? -2.464  44.991 38.271 1.00 8.92  ? 194 TRP B NE1 1 
ATOM   3169 C  CE2 . TRP B 1 194 ? -1.144  44.843 38.607 1.00 7.34  ? 194 TRP B CE2 1 
ATOM   3170 C  CE3 . TRP B 1 194 ? 0.154   44.216 40.556 1.00 7.76  ? 194 TRP B CE3 1 
ATOM   3171 C  CZ2 . TRP B 1 194 ? 0.010   45.030 37.836 1.00 7.10  ? 194 TRP B CZ2 1 
ATOM   3172 C  CZ3 . TRP B 1 194 ? 1.309   44.404 39.785 1.00 8.01  ? 194 TRP B CZ3 1 
ATOM   3173 C  CH2 . TRP B 1 194 ? 1.224   44.806 38.442 1.00 7.00  ? 194 TRP B CH2 1 
ATOM   3174 N  N   . ASP B 1 195 ? -3.941  41.757 44.111 1.00 7.96  ? 195 ASP B N   1 
ATOM   3175 C  CA  . ASP B 1 195 ? -4.202  41.575 45.541 1.00 9.91  ? 195 ASP B CA  1 
ATOM   3176 C  C   . ASP B 1 195 ? -3.195  40.587 46.119 1.00 10.25 ? 195 ASP B C   1 
ATOM   3177 O  O   . ASP B 1 195 ? -2.628  40.814 47.191 1.00 12.68 ? 195 ASP B O   1 
ATOM   3178 C  CB  . ASP B 1 195 ? -5.625  41.057 45.800 1.00 10.23 ? 195 ASP B CB  1 
ATOM   3179 C  CG  . ASP B 1 195 ? -6.703  42.054 45.399 1.00 9.75  ? 195 ASP B CG  1 
ATOM   3180 O  OD1 . ASP B 1 195 ? -6.378  43.241 45.170 1.00 10.20 ? 195 ASP B OD1 1 
ATOM   3181 O  OD2 . ASP B 1 195 ? -7.884  41.652 45.335 1.00 8.17  ? 195 ASP B OD2 1 
ATOM   3182 N  N   . GLU B 1 196 ? -2.981  39.492 45.396 1.00 8.98  ? 196 GLU B N   1 
ATOM   3183 C  CA  . GLU B 1 196 ? -2.040  38.455 45.808 1.00 9.18  ? 196 GLU B CA  1 
ATOM   3184 C  C   . GLU B 1 196 ? -0.603  38.968 45.659 1.00 8.10  ? 196 GLU B C   1 
ATOM   3185 O  O   . GLU B 1 196 ? 0.277   38.611 46.440 1.00 9.38  ? 196 GLU B O   1 
ATOM   3186 C  CB  . GLU B 1 196 ? -2.262  37.203 44.951 1.00 10.24 ? 196 GLU B CB  1 
ATOM   3187 C  CG  . GLU B 1 196 ? -1.395  36.004 45.288 1.00 10.34 ? 196 GLU B CG  1 
ATOM   3188 C  CD  . GLU B 1 196 ? -1.519  35.579 46.739 1.00 14.33 ? 196 GLU B CD  1 
ATOM   3189 O  OE1 . GLU B 1 196 ? -2.649  35.585 47.276 1.00 16.53 ? 196 GLU B OE1 1 
ATOM   3190 O  OE2 . GLU B 1 196 ? -0.488  35.213 47.337 1.00 14.21 ? 196 GLU B OE2 1 
ATOM   3191 N  N   . ALA B 1 197 ? -0.374  39.809 44.654 1.00 7.09  ? 197 ALA B N   1 
ATOM   3192 C  CA  . ALA B 1 197 ? 0.948   40.384 44.423 1.00 6.71  ? 197 ALA B CA  1 
ATOM   3193 C  C   . ALA B 1 197 ? 1.261   41.330 45.579 1.00 6.32  ? 197 ALA B C   1 
ATOM   3194 O  O   . ALA B 1 197 ? 2.402   41.420 46.032 1.00 5.17  ? 197 ALA B O   1 
ATOM   3195 C  CB  . ALA B 1 197 ? 0.969   41.141 43.105 1.00 5.91  ? 197 ALA B CB  1 
ATOM   3196 N  N   . ALA B 1 198 ? 0.235   42.035 46.047 1.00 5.83  ? 198 ALA B N   1 
ATOM   3197 C  CA  . ALA B 1 198 ? 0.387   42.960 47.166 1.00 4.73  ? 198 ALA B CA  1 
ATOM   3198 C  C   . ALA B 1 198 ? 0.643   42.178 48.444 1.00 3.58  ? 198 ALA B C   1 
ATOM   3199 O  O   . ALA B 1 198 ? 1.426   42.607 49.286 1.00 5.50  ? 198 ALA B O   1 
ATOM   3200 C  CB  . ALA B 1 198 ? -0.868  43.823 47.319 1.00 2.36  ? 198 ALA B CB  1 
ATOM   3201 N  N   . ALA B 1 199 ? -0.017  41.030 48.590 1.00 4.32  ? 199 ALA B N   1 
ATOM   3202 C  CA  . ALA B 1 199 ? 0.163   40.191 49.778 1.00 4.91  ? 199 ALA B CA  1 
ATOM   3203 C  C   . ALA B 1 199 ? 1.601   39.686 49.853 1.00 6.52  ? 199 ALA B C   1 
ATOM   3204 O  O   . ALA B 1 199 ? 2.234   39.735 50.913 1.00 6.81  ? 199 ALA B O   1 
ATOM   3205 C  CB  . ALA B 1 199 ? -0.802  39.006 49.748 1.00 4.75  ? 199 ALA B CB  1 
ATOM   3206 N  N   . ARG B 1 200 ? 2.114   39.194 48.728 1.00 7.43  ? 200 ARG B N   1 
ATOM   3207 C  CA  . ARG B 1 200 ? 3.488   38.697 48.681 1.00 8.02  ? 200 ARG B CA  1 
ATOM   3208 C  C   . ARG B 1 200 ? 4.465   39.846 48.964 1.00 8.29  ? 200 ARG B C   1 
ATOM   3209 O  O   . ARG B 1 200 ? 5.479   39.659 49.643 1.00 7.64  ? 200 ARG B O   1 
ATOM   3210 C  CB  . ARG B 1 200 ? 3.793   38.059 47.309 1.00 7.59  ? 200 ARG B CB  1 
ATOM   3211 C  CG  . ARG B 1 200 ? 2.986   36.786 46.991 1.00 6.10  ? 200 ARG B CG  1 
ATOM   3212 C  CD  . ARG B 1 200 ? 3.275   36.261 45.573 1.00 7.75  ? 200 ARG B CD  1 
ATOM   3213 N  NE  . ARG B 1 200 ? 4.630   35.731 45.401 1.00 5.31  ? 200 ARG B NE  1 
ATOM   3214 C  CZ  . ARG B 1 200 ? 5.024   34.528 45.813 1.00 7.44  ? 200 ARG B CZ  1 
ATOM   3215 N  NH1 . ARG B 1 200 ? 4.164   33.722 46.421 1.00 6.44  ? 200 ARG B NH1 1 
ATOM   3216 N  NH2 . ARG B 1 200 ? 6.281   34.131 45.630 1.00 4.99  ? 200 ARG B NH2 1 
ATOM   3217 N  N   . PHE B 1 201 ? 4.156   41.040 48.461 1.00 7.86  ? 201 PHE B N   1 
ATOM   3218 C  CA  . PHE B 1 201 ? 5.031   42.188 48.692 1.00 9.57  ? 201 PHE B CA  1 
ATOM   3219 C  C   . PHE B 1 201 ? 5.070   42.558 50.176 1.00 8.73  ? 201 PHE B C   1 
ATOM   3220 O  O   . PHE B 1 201 ? 6.111   42.956 50.688 1.00 10.07 ? 201 PHE B O   1 
ATOM   3221 C  CB  . PHE B 1 201 ? 4.579   43.402 47.871 1.00 8.28  ? 201 PHE B CB  1 
ATOM   3222 C  CG  . PHE B 1 201 ? 5.469   44.608 48.036 1.00 8.82  ? 201 PHE B CG  1 
ATOM   3223 C  CD1 . PHE B 1 201 ? 6.808   44.558 47.658 1.00 9.53  ? 201 PHE B CD1 1 
ATOM   3224 C  CD2 . PHE B 1 201 ? 4.977   45.786 48.594 1.00 7.24  ? 201 PHE B CD2 1 
ATOM   3225 C  CE1 . PHE B 1 201 ? 7.646   45.665 47.837 1.00 9.22  ? 201 PHE B CE1 1 
ATOM   3226 C  CE2 . PHE B 1 201 ? 5.804   46.891 48.775 1.00 7.21  ? 201 PHE B CE2 1 
ATOM   3227 C  CZ  . PHE B 1 201 ? 7.140   46.832 48.397 1.00 6.46  ? 201 PHE B CZ  1 
ATOM   3228 N  N   . ALA B 1 202 ? 3.938   42.413 50.861 1.00 8.03  ? 202 ALA B N   1 
ATOM   3229 C  CA  . ALA B 1 202 ? 3.853   42.737 52.284 1.00 8.46  ? 202 ALA B CA  1 
ATOM   3230 C  C   . ALA B 1 202 ? 4.605   41.720 53.136 1.00 10.07 ? 202 ALA B C   1 
ATOM   3231 O  O   . ALA B 1 202 ? 5.332   42.088 54.062 1.00 9.79  ? 202 ALA B O   1 
ATOM   3232 C  CB  . ALA B 1 202 ? 2.394   42.805 52.722 1.00 5.04  ? 202 ALA B CB  1 
ATOM   3233 N  N   . ALA B 1 203 ? 4.428   40.442 52.813 1.00 12.41 ? 203 ALA B N   1 
ATOM   3234 C  CA  . ALA B 1 203 ? 5.085   39.362 53.540 1.00 15.28 ? 203 ALA B CA  1 
ATOM   3235 C  C   . ALA B 1 203 ? 6.588   39.372 53.294 1.00 17.47 ? 203 ALA B C   1 
ATOM   3236 O  O   . ALA B 1 203 ? 7.375   39.049 54.187 1.00 18.60 ? 203 ALA B O   1 
ATOM   3237 C  CB  . ALA B 1 203 ? 4.497   38.011 53.115 1.00 13.12 ? 203 ALA B CB  1 
ATOM   3238 N  N   . LYS B 1 204 ? 6.972   39.739 52.075 1.00 20.49 ? 204 LYS B N   1 
ATOM   3239 C  CA  . LYS B 1 204 ? 8.372   39.791 51.674 1.00 23.22 ? 204 LYS B CA  1 
ATOM   3240 C  C   . LYS B 1 204 ? 9.064   38.438 51.812 1.00 26.08 ? 204 LYS B C   1 
ATOM   3241 O  O   . LYS B 1 204 ? 10.265  38.315 51.561 1.00 26.36 ? 204 LYS B O   1 
ATOM   3242 C  CB  . LYS B 1 204 ? 9.106   40.866 52.480 1.00 26.12 ? 204 LYS B CB  1 
ATOM   3243 C  CG  . LYS B 1 204 ? 8.685   42.275 52.089 1.00 29.34 ? 204 LYS B CG  1 
ATOM   3244 C  CD  . LYS B 1 204 ? 9.378   43.346 52.903 1.00 31.45 ? 204 LYS B CD  1 
ATOM   3245 C  CE  . LYS B 1 204 ? 9.095   44.728 52.313 1.00 34.38 ? 204 LYS B CE  1 
ATOM   3246 N  NZ  . LYS B 1 204 ? 7.637   45.021 52.164 1.00 33.08 ? 204 LYS B NZ  1 
ATOM   3247 N  N   . LYS B 1 205 ? 8.294   37.424 52.199 1.00 27.27 ? 205 LYS B N   1 
ATOM   3248 C  CA  . LYS B 1 205 ? 8.811   36.070 52.358 1.00 29.21 ? 205 LYS B CA  1 
ATOM   3249 C  C   . LYS B 1 205 ? 7.766   35.067 51.887 1.00 29.91 ? 205 LYS B C   1 
ATOM   3250 O  O   . LYS B 1 205 ? 6.597   35.473 51.709 1.00 31.16 ? 205 LYS B O   1 
ATOM   3251 C  CB  . LYS B 1 205 ? 9.141   35.784 53.824 0.00 28.43 ? 205 LYS B CB  1 
ATOM   3252 C  CG  . LYS B 1 205 ? 10.226  36.656 54.424 0.00 27.98 ? 205 LYS B CG  1 
ATOM   3253 C  CD  . LYS B 1 205 ? 10.497  36.241 55.861 0.00 27.44 ? 205 LYS B CD  1 
ATOM   3254 C  CE  . LYS B 1 205 ? 11.603  37.070 56.487 0.00 27.12 ? 205 LYS B CE  1 
ATOM   3255 N  NZ  . LYS B 1 205 ? 11.880  36.640 57.885 0.00 26.83 ? 205 LYS B NZ  1 
ATOM   3256 O  OXT . LYS B 1 205 ? 8.123   33.880 51.731 1.00 32.44 ? 205 LYS B OXT 1 
HETATM 3257 O  O   . OH  C 2 .   ? 11.688  26.943 16.280 1.00 6.59  ? 207 OH  A O   1 
HETATM 3258 FE FE  . FE  D 3 .   ? 10.265  26.810 14.582 1.00 12.30 ? 206 FE  A FE  1 
HETATM 3259 O  O   . OH  E 2 .   ? 5.732   26.916 31.628 1.00 5.09  ? 207 OH  B O   1 
HETATM 3260 O  O   . OH  F 2 .   ? 3.604   24.883 31.931 1.00 19.41 ? 208 OH  B O   1 
HETATM 3261 FE FE  . FE  G 3 .   ? 3.507   26.859 31.679 1.00 13.93 ? 206 FE  B FE  1 
HETATM 3262 O  O   . HOH H 4 .   ? 6.066   23.276 10.793 1.00 3.67  ? 208 HOH A O   1 
HETATM 3263 O  O   . HOH H 4 .   ? 0.228   21.904 15.299 1.00 9.62  ? 209 HOH A O   1 
HETATM 3264 O  O   . HOH H 4 .   ? 19.410  30.129 19.926 1.00 8.16  ? 210 HOH A O   1 
HETATM 3265 O  O   . HOH H 4 .   ? 15.335  15.106 5.669  1.00 7.26  ? 211 HOH A O   1 
HETATM 3266 O  O   . HOH H 4 .   ? 15.542  8.119  0.411  1.00 2.36  ? 212 HOH A O   1 
HETATM 3267 O  O   . HOH H 4 .   ? 23.504  23.491 6.670  1.00 11.30 ? 213 HOH A O   1 
HETATM 3268 O  O   . HOH H 4 .   ? 8.447   10.515 3.670  1.00 5.51  ? 214 HOH A O   1 
HETATM 3269 O  O   . HOH H 4 .   ? 9.237   9.505  6.064  1.00 5.54  ? 215 HOH A O   1 
HETATM 3270 O  O   . HOH H 4 .   ? 4.609   20.953 24.951 1.00 2.36  ? 216 HOH A O   1 
HETATM 3271 O  O   . HOH H 4 .   ? 23.068  8.964  0.412  1.00 7.45  ? 217 HOH A O   1 
HETATM 3272 O  O   . HOH H 4 .   ? 10.441  7.276  8.544  1.00 10.24 ? 218 HOH A O   1 
HETATM 3273 O  O   . HOH H 4 .   ? 14.057  16.960 8.743  1.00 9.52  ? 219 HOH A O   1 
HETATM 3274 O  O   . HOH H 4 .   ? 21.644  24.538 11.392 1.00 5.51  ? 220 HOH A O   1 
HETATM 3275 O  O   . HOH H 4 .   ? 12.248  38.090 3.062  1.00 2.36  ? 221 HOH A O   1 
HETATM 3276 O  O   . HOH H 4 .   ? 0.780   20.241 5.478  1.00 10.77 ? 222 HOH A O   1 
HETATM 3277 O  O   . HOH H 4 .   ? 8.987   23.227 23.299 1.00 6.19  ? 223 HOH A O   1 
HETATM 3278 O  O   . HOH H 4 .   ? 5.138   9.454  3.903  1.00 9.88  ? 224 HOH A O   1 
HETATM 3279 O  O   . HOH H 4 .   ? 20.307  25.827 6.721  1.00 13.40 ? 225 HOH A O   1 
HETATM 3280 O  O   . HOH H 4 .   ? -3.312  17.387 10.347 1.00 8.63  ? 226 HOH A O   1 
HETATM 3281 O  O   . HOH H 4 .   ? 20.939  -1.639 4.621  1.00 6.99  ? 227 HOH A O   1 
HETATM 3282 O  O   . HOH H 4 .   ? 17.650  7.028  2.124  1.00 2.36  ? 228 HOH A O   1 
HETATM 3283 O  O   . HOH H 4 .   ? 12.412  7.601  -1.222 1.00 2.36  ? 229 HOH A O   1 
HETATM 3284 O  O   . HOH H 4 .   ? 11.678  5.061  5.568  1.00 2.36  ? 230 HOH A O   1 
HETATM 3285 O  O   . HOH H 4 .   ? 15.834  24.016 25.871 1.00 5.41  ? 231 HOH A O   1 
HETATM 3286 O  O   . HOH H 4 .   ? 14.283  26.311 3.003  1.00 11.36 ? 232 HOH A O   1 
HETATM 3287 O  O   . HOH H 4 .   ? 1.309   24.492 15.903 1.00 5.97  ? 233 HOH A O   1 
HETATM 3288 O  O   . HOH H 4 .   ? -4.584  23.191 9.745  1.00 8.11  ? 234 HOH A O   1 
HETATM 3289 O  O   . HOH H 4 .   ? 6.007   21.550 12.718 1.00 12.31 ? 235 HOH A O   1 
HETATM 3290 O  O   . HOH H 4 .   ? 31.143  27.202 19.057 1.00 6.97  ? 236 HOH A O   1 
HETATM 3291 O  O   . HOH H 4 .   ? 16.957  28.993 27.035 1.00 2.36  ? 237 HOH A O   1 
HETATM 3292 O  O   . HOH H 4 .   ? 21.691  32.838 3.225  1.00 2.59  ? 238 HOH A O   1 
HETATM 3293 O  O   . HOH H 4 .   ? 21.962  24.627 22.660 1.00 8.36  ? 239 HOH A O   1 
HETATM 3294 O  O   . HOH H 4 .   ? 9.487   6.959  5.367  1.00 4.85  ? 240 HOH A O   1 
HETATM 3295 O  O   . HOH H 4 .   ? 21.239  7.103  0.985  1.00 10.68 ? 241 HOH A O   1 
HETATM 3296 O  O   . HOH H 4 .   ? 10.584  18.542 0.236  1.00 10.89 ? 242 HOH A O   1 
HETATM 3297 O  O   . HOH H 4 .   ? 23.182  20.896 23.376 1.00 15.11 ? 243 HOH A O   1 
HETATM 3298 O  O   . HOH H 4 .   ? 25.468  36.313 6.907  1.00 19.98 ? 244 HOH A O   1 
HETATM 3299 O  O   . HOH H 4 .   ? 29.593  29.628 16.031 1.00 16.33 ? 245 HOH A O   1 
HETATM 3300 O  O   . HOH H 4 .   ? 12.647  25.368 0.786  1.00 10.16 ? 246 HOH A O   1 
HETATM 3301 O  O   . HOH H 4 .   ? 17.211  16.977 5.663  1.00 9.83  ? 247 HOH A O   1 
HETATM 3302 O  O   . HOH H 4 .   ? 8.708   26.762 22.475 1.00 9.26  ? 248 HOH A O   1 
HETATM 3303 O  O   . HOH H 4 .   ? 19.083  34.040 2.781  1.00 2.36  ? 249 HOH A O   1 
HETATM 3304 O  O   . HOH H 4 .   ? 21.830  24.804 8.672  1.00 9.70  ? 250 HOH A O   1 
HETATM 3305 O  O   . HOH H 4 .   ? 32.986  22.354 18.188 1.00 5.65  ? 251 HOH A O   1 
HETATM 3306 O  O   . HOH H 4 .   ? 2.173   20.161 13.034 1.00 9.29  ? 252 HOH A O   1 
HETATM 3307 O  O   . HOH H 4 .   ? 12.460  4.460  8.173  1.00 12.85 ? 253 HOH A O   1 
HETATM 3308 O  O   . HOH H 4 .   ? 17.014  19.729 4.512  1.00 11.35 ? 254 HOH A O   1 
HETATM 3309 O  O   . HOH H 4 .   ? 20.135  29.229 23.326 1.00 12.12 ? 255 HOH A O   1 
HETATM 3310 O  O   . HOH H 4 .   ? 4.850   15.632 0.398  1.00 2.36  ? 256 HOH A O   1 
HETATM 3311 O  O   . HOH H 4 .   ? 16.185  27.512 1.775  1.00 5.50  ? 257 HOH A O   1 
HETATM 3312 O  O   . HOH H 4 .   ? 25.070  34.213 23.097 1.00 12.24 ? 258 HOH A O   1 
HETATM 3313 O  O   . HOH H 4 .   ? 33.449  24.889 19.773 1.00 21.05 ? 259 HOH A O   1 
HETATM 3314 O  O   . HOH H 4 .   ? 9.796   20.873 27.279 1.00 6.10  ? 260 HOH A O   1 
HETATM 3315 O  O   . HOH H 4 .   ? 24.342  9.211  19.017 1.00 8.80  ? 261 HOH A O   1 
HETATM 3316 O  O   . HOH H 4 .   ? 13.735  41.444 6.388  1.00 16.60 ? 262 HOH A O   1 
HETATM 3317 O  O   . HOH H 4 .   ? 26.349  7.835  17.433 1.00 29.27 ? 263 HOH A O   1 
HETATM 3318 O  O   . HOH H 4 .   ? 17.219  29.900 3.165  1.00 12.65 ? 264 HOH A O   1 
HETATM 3319 O  O   . HOH H 4 .   ? 16.506  32.096 1.778  1.00 11.81 ? 265 HOH A O   1 
HETATM 3320 O  O   . HOH H 4 .   ? 7.874   21.887 25.714 1.00 9.13  ? 266 HOH A O   1 
HETATM 3321 O  O   . HOH H 4 .   ? 10.242  34.144 15.455 1.00 10.06 ? 267 HOH A O   1 
HETATM 3322 O  O   . HOH H 4 .   ? 2.627   20.979 -2.998 1.00 8.94  ? 268 HOH A O   1 
HETATM 3323 O  O   . HOH H 4 .   ? 17.396  16.201 24.228 1.00 21.85 ? 269 HOH A O   1 
HETATM 3324 O  O   . HOH H 4 .   ? 17.728  -1.786 10.787 1.00 14.71 ? 270 HOH A O   1 
HETATM 3325 O  O   . HOH H 4 .   ? -5.177  20.797 9.129  1.00 13.01 ? 271 HOH A O   1 
HETATM 3326 O  O   . HOH H 4 .   ? 29.298  24.077 25.693 1.00 14.11 ? 272 HOH A O   1 
HETATM 3327 O  O   . HOH H 4 .   ? 6.015   36.775 5.565  1.00 9.53  ? 273 HOH A O   1 
HETATM 3328 O  O   . HOH H 4 .   ? -2.204  27.177 5.649  1.00 15.58 ? 274 HOH A O   1 
HETATM 3329 O  O   . HOH H 4 .   ? 2.244   15.673 -0.379 1.00 3.67  ? 275 HOH A O   1 
HETATM 3330 O  O   . HOH H 4 .   ? -3.710  16.246 25.729 1.00 19.58 ? 276 HOH A O   1 
HETATM 3331 O  O   . HOH H 4 .   ? 10.672  18.325 26.862 1.00 31.00 ? 277 HOH A O   1 
HETATM 3332 O  O   . HOH H 4 .   ? 23.143  16.309 22.522 1.00 12.16 ? 278 HOH A O   1 
HETATM 3333 O  O   . HOH H 4 .   ? 0.486   26.752 0.237  1.00 2.36  ? 279 HOH A O   1 
HETATM 3334 O  O   . HOH H 4 .   ? 13.670  19.226 -0.300 1.00 19.79 ? 280 HOH A O   1 
HETATM 3335 O  O   . HOH H 4 .   ? 6.584   7.301  2.821  1.00 22.02 ? 281 HOH A O   1 
HETATM 3336 O  O   . HOH H 4 .   ? 26.149  16.905 22.644 1.00 23.16 ? 282 HOH A O   1 
HETATM 3337 O  O   . HOH H 4 .   ? 22.415  23.509 4.185  1.00 20.69 ? 283 HOH A O   1 
HETATM 3338 O  O   . HOH H 4 .   ? 3.721   18.177 29.247 1.00 18.48 ? 284 HOH A O   1 
HETATM 3339 O  O   . HOH H 4 .   ? 15.969  38.863 18.544 1.00 28.88 ? 285 HOH A O   1 
HETATM 3340 O  O   . HOH H 4 .   ? 21.726  29.809 2.082  1.00 23.73 ? 286 HOH A O   1 
HETATM 3341 O  O   . HOH H 4 .   ? 26.660  3.640  4.112  1.00 22.02 ? 287 HOH A O   1 
HETATM 3342 O  O   . HOH H 4 .   ? 20.061  -4.211 11.913 1.00 26.89 ? 288 HOH A O   1 
HETATM 3343 O  O   . HOH H 4 .   ? 11.587  35.361 17.500 1.00 14.63 ? 289 HOH A O   1 
HETATM 3344 O  O   . HOH H 4 .   ? 2.136   16.021 28.597 1.00 16.14 ? 290 HOH A O   1 
HETATM 3345 O  O   . HOH H 4 .   ? 7.861   20.279 28.771 1.00 20.00 ? 291 HOH A O   1 
HETATM 3346 O  O   . HOH H 4 .   ? 27.793  16.539 20.002 1.00 16.49 ? 292 HOH A O   1 
HETATM 3347 O  O   . HOH H 4 .   ? 13.844  24.249 -1.578 1.00 13.74 ? 293 HOH A O   1 
HETATM 3348 O  O   . HOH H 4 .   ? 13.537  36.868 17.020 1.00 23.13 ? 294 HOH A O   1 
HETATM 3349 O  O   . HOH H 4 .   ? 31.217  33.301 2.257  1.00 13.12 ? 295 HOH A O   1 
HETATM 3350 O  O   . HOH H 4 .   ? 14.071  27.391 25.879 1.00 2.36  ? 296 HOH A O   1 
HETATM 3351 O  O   . HOH H 4 .   ? 31.722  9.492  6.681  1.00 22.59 ? 297 HOH A O   1 
HETATM 3352 O  O   . HOH H 4 .   ? -4.087  23.376 12.396 1.00 15.06 ? 298 HOH A O   1 
HETATM 3353 O  O   . HOH H 4 .   ? 15.611  -1.812 12.932 1.00 12.39 ? 299 HOH A O   1 
HETATM 3354 O  O   . HOH H 4 .   ? 18.181  11.913 -2.694 1.00 17.07 ? 300 HOH A O   1 
HETATM 3355 O  O   . HOH H 4 .   ? 36.725  46.473 7.686  1.00 23.76 ? 301 HOH A O   1 
HETATM 3356 O  O   . HOH H 4 .   ? 15.357  3.575  -5.110 1.00 10.52 ? 302 HOH A O   1 
HETATM 3357 O  O   . HOH H 4 .   ? 19.800  6.557  -1.516 1.00 3.67  ? 303 HOH A O   1 
HETATM 3358 O  O   . HOH H 4 .   ? 22.821  5.332  -1.797 1.00 16.79 ? 304 HOH A O   1 
HETATM 3359 O  O   . HOH H 4 .   ? -2.256  13.983 27.201 1.00 11.31 ? 305 HOH A O   1 
HETATM 3360 O  O   . HOH H 4 .   ? 21.200  -0.035 2.658  1.00 8.13  ? 306 HOH A O   1 
HETATM 3361 O  O   . HOH H 4 .   ? 22.102  24.210 25.847 1.00 14.56 ? 307 HOH A O   1 
HETATM 3362 O  O   . HOH H 4 .   ? 16.995  7.849  -1.940 1.00 23.41 ? 308 HOH A O   1 
HETATM 3363 O  O   . HOH H 4 .   ? 13.087  5.452  -3.838 1.00 11.84 ? 309 HOH A O   1 
HETATM 3364 O  O   . HOH H 4 .   ? 8.330   18.372 -2.058 1.00 13.22 ? 310 HOH A O   1 
HETATM 3365 O  O   . HOH H 4 .   ? 30.976  12.318 0.107  1.00 7.32  ? 311 HOH A O   1 
HETATM 3366 O  O   . HOH H 4 .   ? 23.089  46.665 12.642 1.00 16.25 ? 312 HOH A O   1 
HETATM 3367 O  O   . HOH H 4 .   ? 25.603  34.831 0.209  1.00 24.11 ? 313 HOH A O   1 
HETATM 3368 O  O   . HOH H 4 .   ? 17.398  18.495 -3.159 1.00 15.80 ? 314 HOH A O   1 
HETATM 3369 O  O   . HOH H 4 .   ? 25.323  8.214  -0.784 1.00 17.75 ? 315 HOH A O   1 
HETATM 3370 O  O   . HOH H 4 .   ? 9.098   33.926 1.039  1.00 11.52 ? 316 HOH A O   1 
HETATM 3371 O  O   . HOH H 4 .   ? -5.301  23.628 1.497  1.00 16.26 ? 317 HOH A O   1 
HETATM 3372 O  O   . HOH H 4 .   ? -8.571  23.090 1.460  1.00 11.72 ? 318 HOH A O   1 
HETATM 3373 O  O   . HOH H 4 .   ? -4.986  20.820 13.569 1.00 16.69 ? 319 HOH A O   1 
HETATM 3374 O  O   . HOH H 4 .   ? -4.942  19.188 11.389 1.00 17.87 ? 320 HOH A O   1 
HETATM 3375 O  O   . HOH H 4 .   ? 3.616   14.419 26.915 1.00 16.54 ? 321 HOH A O   1 
HETATM 3376 O  O   . HOH H 4 .   ? 29.126  29.071 2.446  1.00 27.27 ? 322 HOH A O   1 
HETATM 3377 O  O   . HOH H 4 .   ? 10.400  10.246 -3.058 1.00 11.80 ? 323 HOH A O   1 
HETATM 3378 O  O   . HOH H 4 .   ? 25.151  39.757 22.234 1.00 20.73 ? 324 HOH A O   1 
HETATM 3379 O  O   . HOH H 4 .   ? 22.974  40.516 20.556 1.00 20.97 ? 325 HOH A O   1 
HETATM 3380 O  O   . HOH H 4 .   ? 28.104  25.461 7.641  1.00 12.03 ? 326 HOH A O   1 
HETATM 3381 O  O   . HOH H 4 .   ? 20.479  31.783 22.924 1.00 23.38 ? 327 HOH A O   1 
HETATM 3382 O  O   . HOH H 4 .   ? 0.411   13.691 -0.146 1.00 24.59 ? 328 HOH A O   1 
HETATM 3383 O  O   . HOH H 4 .   ? -1.062  16.185 1.321  1.00 16.25 ? 329 HOH A O   1 
HETATM 3384 O  O   . HOH H 4 .   ? 2.231   9.390  4.482  1.00 18.09 ? 330 HOH A O   1 
HETATM 3385 O  O   . HOH H 4 .   ? 24.700  36.014 -1.969 1.00 19.96 ? 331 HOH A O   1 
HETATM 3386 O  O   . HOH H 4 .   ? 11.544  1.922  11.319 1.00 28.11 ? 332 HOH A O   1 
HETATM 3387 O  O   . HOH H 4 .   ? 32.629  12.448 6.288  1.00 17.88 ? 333 HOH A O   1 
HETATM 3388 O  O   . HOH H 4 .   ? 29.831  7.618  7.061  1.00 19.41 ? 334 HOH A O   1 
HETATM 3389 O  O   . HOH H 4 .   ? 29.330  10.615 -1.883 1.00 25.63 ? 335 HOH A O   1 
HETATM 3390 O  O   . HOH H 4 .   ? 28.866  22.107 5.326  1.00 22.77 ? 336 HOH A O   1 
HETATM 3391 O  O   . HOH H 4 .   ? -5.761  16.569 7.301  1.00 17.55 ? 337 HOH A O   1 
HETATM 3392 O  O   . HOH H 4 .   ? 24.905  27.584 2.712  1.00 13.73 ? 338 HOH A O   1 
HETATM 3393 O  O   . HOH H 4 .   ? 2.961   21.557 10.718 1.00 35.80 ? 339 HOH A O   1 
HETATM 3394 O  O   . HOH H 4 .   ? 0.166   33.825 6.600  1.00 16.59 ? 340 HOH A O   1 
HETATM 3395 O  O   . HOH H 4 .   ? 9.558   41.312 11.977 1.00 22.09 ? 341 HOH A O   1 
HETATM 3396 O  O   . HOH H 4 .   ? 22.312  26.953 1.280  1.00 18.06 ? 342 HOH A O   1 
HETATM 3397 O  O   . HOH H 4 .   ? -0.211  20.077 -1.767 1.00 32.08 ? 343 HOH A O   1 
HETATM 3398 O  O   . HOH H 4 .   ? 20.335  20.655 1.689  1.00 23.29 ? 344 HOH A O   1 
HETATM 3399 O  O   . HOH H 4 .   ? 26.620  23.806 6.026  1.00 18.55 ? 345 HOH A O   1 
HETATM 3400 O  O   . HOH H 4 .   ? 15.870  41.829 17.522 1.00 17.46 ? 346 HOH A O   1 
HETATM 3401 O  O   . HOH H 4 .   ? 17.469  42.496 15.527 1.00 22.23 ? 347 HOH A O   1 
HETATM 3402 O  O   . HOH H 4 .   ? 12.978  15.752 -2.161 1.00 15.62 ? 348 HOH A O   1 
HETATM 3403 O  O   . HOH H 4 .   ? 10.257  2.702  5.277  1.00 13.30 ? 349 HOH A O   1 
HETATM 3404 O  O   . HOH H 4 .   ? 10.030  1.835  8.050  1.00 20.51 ? 350 HOH A O   1 
HETATM 3405 O  O   . HOH H 4 .   ? 7.399   5.712  6.573  1.00 16.64 ? 351 HOH A O   1 
HETATM 3406 O  O   . HOH H 4 .   ? 9.111   4.819  8.643  1.00 33.50 ? 352 HOH A O   1 
HETATM 3407 O  O   . HOH H 4 .   ? 19.395  -3.606 3.780  1.00 27.53 ? 353 HOH A O   1 
HETATM 3408 O  O   . HOH H 4 .   ? 29.297  5.797  4.855  1.00 22.48 ? 354 HOH A O   1 
HETATM 3409 O  O   . HOH H 4 .   ? 26.745  29.126 25.038 1.00 17.57 ? 355 HOH A O   1 
HETATM 3410 O  O   . HOH H 4 .   ? 20.905  18.840 -0.777 1.00 14.16 ? 356 HOH A O   1 
HETATM 3411 O  O   . HOH H 4 .   ? 19.952  18.877 -3.149 1.00 21.45 ? 357 HOH A O   1 
HETATM 3412 O  O   . HOH H 4 .   ? -4.605  30.525 4.578  1.00 22.41 ? 358 HOH A O   1 
HETATM 3413 O  O   . HOH H 4 .   ? 16.930  9.728  -3.599 1.00 22.99 ? 359 HOH A O   1 
HETATM 3414 O  O   . HOH H 4 .   ? -2.322  33.152 2.984  1.00 20.06 ? 360 HOH A O   1 
HETATM 3415 O  O   . HOH H 4 .   ? 4.097   18.598 -2.799 1.00 19.06 ? 361 HOH A O   1 
HETATM 3416 O  O   . HOH H 4 .   ? 8.795   3.312  3.268  1.00 20.70 ? 362 HOH A O   1 
HETATM 3417 O  O   . HOH H 4 .   ? 6.558   4.940  4.050  1.00 22.59 ? 363 HOH A O   1 
HETATM 3418 O  O   . HOH H 4 .   ? 23.545  -2.688 7.099  1.00 22.66 ? 364 HOH A O   1 
HETATM 3419 O  O   . HOH H 4 .   ? 8.027   15.772 25.184 1.00 20.11 ? 365 HOH A O   1 
HETATM 3420 O  O   . HOH H 4 .   ? 16.906  19.707 27.787 1.00 6.17  ? 366 HOH A O   1 
HETATM 3421 O  O   . HOH H 4 .   ? 17.430  37.722 20.289 1.00 9.58  ? 367 HOH A O   1 
HETATM 3422 O  O   . HOH H 4 .   ? 16.437  22.422 28.747 1.00 18.09 ? 368 HOH A O   1 
HETATM 3423 O  O   . HOH H 4 .   ? 7.668   26.963 24.908 1.00 10.85 ? 369 HOH A O   1 
HETATM 3424 O  O   . HOH H 4 .   ? 9.700   32.065 16.856 1.00 15.26 ? 370 HOH A O   1 
HETATM 3425 O  O   . HOH H 4 .   ? 4.393   18.851 26.782 1.00 10.92 ? 371 HOH A O   1 
HETATM 3426 O  O   . HOH H 4 .   ? 7.685   35.259 15.715 1.00 19.32 ? 372 HOH A O   1 
HETATM 3427 O  O   . HOH H 4 .   ? 10.590  33.544 18.885 1.00 16.37 ? 373 HOH A O   1 
HETATM 3428 O  O   . HOH I 4 .   ? 16.362  35.449 26.389 1.00 8.02  ? 209 HOH B O   1 
HETATM 3429 O  O   . HOH I 4 .   ? 14.380  17.410 32.796 1.00 6.37  ? 210 HOH B O   1 
HETATM 3430 O  O   . HOH I 4 .   ? 3.678   27.769 13.976 1.00 5.85  ? 211 HOH B O   1 
HETATM 3431 O  O   . HOH I 4 .   ? 17.216  32.770 25.513 1.00 18.39 ? 212 HOH B O   1 
HETATM 3432 O  O   . HOH I 4 .   ? 5.479   21.531 29.797 1.00 10.86 ? 213 HOH B O   1 
HETATM 3433 O  O   . HOH I 4 .   ? 6.621   34.531 18.528 1.00 20.98 ? 214 HOH B O   1 
HETATM 3434 O  O   . HOH I 4 .   ? -2.735  29.545 31.317 1.00 12.07 ? 215 HOH B O   1 
HETATM 3435 O  O   . HOH I 4 .   ? -3.824  30.536 24.348 1.00 6.01  ? 216 HOH B O   1 
HETATM 3436 O  O   . HOH I 4 .   ? 14.032  24.908 33.927 1.00 5.38  ? 217 HOH B O   1 
HETATM 3437 O  O   . HOH I 4 .   ? -0.188  38.316 41.054 1.00 4.14  ? 218 HOH B O   1 
HETATM 3438 O  O   . HOH I 4 .   ? -4.485  45.116 44.701 1.00 12.56 ? 219 HOH B O   1 
HETATM 3439 O  O   . HOH I 4 .   ? 7.547   31.415 46.624 1.00 2.44  ? 220 HOH B O   1 
HETATM 3440 O  O   . HOH I 4 .   ? -7.251  41.994 38.011 1.00 18.39 ? 221 HOH B O   1 
HETATM 3441 O  O   . HOH I 4 .   ? -5.152  42.844 36.660 1.00 6.03  ? 222 HOH B O   1 
HETATM 3442 O  O   . HOH I 4 .   ? 5.667   32.485 19.948 1.00 2.96  ? 223 HOH B O   1 
HETATM 3443 O  O   . HOH I 4 .   ? 1.676   45.118 50.063 1.00 8.62  ? 224 HOH B O   1 
HETATM 3444 O  O   . HOH I 4 .   ? -2.856  45.708 35.384 1.00 6.23  ? 225 HOH B O   1 
HETATM 3445 O  O   . HOH I 4 .   ? 1.297   36.200 38.368 1.00 26.76 ? 226 HOH B O   1 
HETATM 3446 O  O   . HOH I 4 .   ? 9.098   30.365 41.557 1.00 11.16 ? 227 HOH B O   1 
HETATM 3447 O  O   . HOH I 4 .   ? -1.300  15.490 41.867 1.00 7.77  ? 228 HOH B O   1 
HETATM 3448 O  O   . HOH I 4 .   ? -10.111 31.618 31.522 1.00 9.49  ? 229 HOH B O   1 
HETATM 3449 O  O   . HOH I 4 .   ? 8.010   30.480 24.174 1.00 10.20 ? 230 HOH B O   1 
HETATM 3450 O  O   . HOH I 4 .   ? -9.464  42.905 35.256 1.00 12.44 ? 231 HOH B O   1 
HETATM 3451 O  O   . HOH I 4 .   ? 5.383   28.684 44.283 1.00 9.01  ? 232 HOH B O   1 
HETATM 3452 O  O   . HOH I 4 .   ? -10.422 34.160 25.745 1.00 5.18  ? 233 HOH B O   1 
HETATM 3453 O  O   . HOH I 4 .   ? 0.990   55.537 44.839 1.00 18.80 ? 234 HOH B O   1 
HETATM 3454 O  O   . HOH I 4 .   ? -1.895  46.518 44.585 1.00 15.84 ? 235 HOH B O   1 
HETATM 3455 O  O   . HOH I 4 .   ? -8.047  45.027 44.067 1.00 11.90 ? 236 HOH B O   1 
HETATM 3456 O  O   . HOH I 4 .   ? -4.586  47.955 38.114 1.00 6.72  ? 237 HOH B O   1 
HETATM 3457 O  O   . HOH I 4 .   ? 14.829  30.734 27.225 1.00 10.05 ? 238 HOH B O   1 
HETATM 3458 O  O   . HOH I 4 .   ? -1.451  27.201 42.971 1.00 3.33  ? 239 HOH B O   1 
HETATM 3459 O  O   . HOH I 4 .   ? -2.302  27.711 24.206 1.00 7.24  ? 240 HOH B O   1 
HETATM 3460 O  O   . HOH I 4 .   ? -10.954 27.873 24.923 1.00 12.00 ? 241 HOH B O   1 
HETATM 3461 O  O   . HOH I 4 .   ? -1.549  31.382 29.779 1.00 9.38  ? 242 HOH B O   1 
HETATM 3462 O  O   . HOH I 4 .   ? 22.027  29.795 41.978 1.00 17.94 ? 243 HOH B O   1 
HETATM 3463 O  O   . HOH I 4 .   ? 17.002  26.257 26.978 1.00 11.01 ? 244 HOH B O   1 
HETATM 3464 O  O   . HOH I 4 .   ? 5.396   21.941 47.980 1.00 19.17 ? 245 HOH B O   1 
HETATM 3465 O  O   . HOH I 4 .   ? 17.137  30.962 33.567 1.00 11.25 ? 246 HOH B O   1 
HETATM 3466 O  O   . HOH I 4 .   ? -5.569  45.553 36.927 1.00 12.54 ? 247 HOH B O   1 
HETATM 3467 O  O   . HOH I 4 .   ? -1.492  25.085 27.855 1.00 11.39 ? 248 HOH B O   1 
HETATM 3468 O  O   . HOH I 4 .   ? -0.518  47.136 47.795 1.00 10.30 ? 249 HOH B O   1 
HETATM 3469 O  O   . HOH I 4 .   ? -6.860  34.219 42.124 1.00 17.60 ? 250 HOH B O   1 
HETATM 3470 O  O   . HOH I 4 .   ? 17.923  34.852 33.805 1.00 17.23 ? 251 HOH B O   1 
HETATM 3471 O  O   . HOH I 4 .   ? 10.429  18.703 48.144 1.00 18.06 ? 252 HOH B O   1 
HETATM 3472 O  O   . HOH I 4 .   ? 18.845  26.447 44.102 1.00 9.39  ? 253 HOH B O   1 
HETATM 3473 O  O   . HOH I 4 .   ? -4.279  27.418 42.892 1.00 17.62 ? 254 HOH B O   1 
HETATM 3474 O  O   . HOH I 4 .   ? 1.369   36.727 42.506 1.00 8.22  ? 255 HOH B O   1 
HETATM 3475 O  O   . HOH I 4 .   ? 2.864   20.248 46.628 1.00 2.36  ? 256 HOH B O   1 
HETATM 3476 O  O   . HOH I 4 .   ? 7.541   30.011 43.787 1.00 18.24 ? 257 HOH B O   1 
HETATM 3477 O  O   . HOH I 4 .   ? 21.661  34.232 44.135 1.00 13.07 ? 258 HOH B O   1 
HETATM 3478 O  O   . HOH I 4 .   ? -4.097  32.498 27.199 1.00 10.45 ? 259 HOH B O   1 
HETATM 3479 O  O   . HOH I 4 .   ? -2.371  49.019 36.588 1.00 10.60 ? 260 HOH B O   1 
HETATM 3480 O  O   . HOH I 4 .   ? 0.740   34.250 43.404 1.00 10.42 ? 261 HOH B O   1 
HETATM 3481 O  O   . HOH I 4 .   ? 17.028  25.921 32.143 1.00 10.04 ? 262 HOH B O   1 
HETATM 3482 O  O   . HOH I 4 .   ? -10.925 35.764 38.255 1.00 16.01 ? 263 HOH B O   1 
HETATM 3483 O  O   . HOH I 4 .   ? -0.574  26.192 45.412 1.00 9.94  ? 264 HOH B O   1 
HETATM 3484 O  O   . HOH I 4 .   ? 21.199  22.006 36.484 1.00 9.15  ? 265 HOH B O   1 
HETATM 3485 O  O   . HOH I 4 .   ? 23.589  32.045 42.996 1.00 27.00 ? 266 HOH B O   1 
HETATM 3486 O  O   . HOH I 4 .   ? 11.092  33.221 21.599 1.00 5.97  ? 267 HOH B O   1 
HETATM 3487 O  O   . HOH I 4 .   ? 14.443  46.135 36.722 1.00 14.88 ? 268 HOH B O   1 
HETATM 3488 O  O   . HOH I 4 .   ? 2.482   12.606 41.220 1.00 13.39 ? 269 HOH B O   1 
HETATM 3489 O  O   . HOH I 4 .   ? 14.984  47.893 39.057 1.00 22.70 ? 270 HOH B O   1 
HETATM 3490 O  O   . HOH I 4 .   ? 1.164   24.005 45.029 1.00 12.15 ? 271 HOH B O   1 
HETATM 3491 O  O   . HOH I 4 .   ? 0.162   21.669 45.765 1.00 15.64 ? 272 HOH B O   1 
HETATM 3492 O  O   . HOH I 4 .   ? 8.472   31.891 21.395 1.00 17.35 ? 273 HOH B O   1 
HETATM 3493 O  O   . HOH I 4 .   ? 4.604   19.493 31.555 1.00 6.95  ? 274 HOH B O   1 
HETATM 3494 O  O   . HOH I 4 .   ? -14.545 30.789 39.070 1.00 22.77 ? 275 HOH B O   1 
HETATM 3495 O  O   . HOH I 4 .   ? 13.994  38.777 28.903 1.00 10.14 ? 276 HOH B O   1 
HETATM 3496 O  O   . HOH I 4 .   ? 1.580   55.116 38.468 1.00 26.80 ? 277 HOH B O   1 
HETATM 3497 O  O   . HOH I 4 .   ? -12.667 30.248 24.782 1.00 22.66 ? 278 HOH B O   1 
HETATM 3498 O  O   . HOH I 4 .   ? 24.302  33.046 35.807 1.00 23.03 ? 279 HOH B O   1 
HETATM 3499 O  O   . HOH I 4 .   ? -4.269  16.414 36.367 1.00 26.40 ? 280 HOH B O   1 
HETATM 3500 O  O   . HOH I 4 .   ? -11.302 23.942 29.726 1.00 19.81 ? 281 HOH B O   1 
HETATM 3501 O  O   . HOH I 4 .   ? -13.871 35.635 36.753 1.00 26.71 ? 282 HOH B O   1 
HETATM 3502 O  O   . HOH I 4 .   ? -0.997  34.959 13.905 1.00 23.38 ? 283 HOH B O   1 
HETATM 3503 O  O   . HOH I 4 .   ? 11.207  36.105 21.963 1.00 26.28 ? 284 HOH B O   1 
HETATM 3504 O  O   . HOH I 4 .   ? 16.655  39.304 33.099 1.00 19.64 ? 285 HOH B O   1 
HETATM 3505 O  O   . HOH I 4 .   ? -13.983 24.694 35.729 1.00 21.54 ? 286 HOH B O   1 
HETATM 3506 O  O   . HOH I 4 .   ? -5.055  34.000 44.324 1.00 30.77 ? 287 HOH B O   1 
HETATM 3507 O  O   . HOH I 4 .   ? -9.230  44.748 37.098 1.00 22.76 ? 288 HOH B O   1 
HETATM 3508 O  O   . HOH I 4 .   ? 19.294  38.995 35.872 1.00 25.21 ? 289 HOH B O   1 
HETATM 3509 O  O   . HOH I 4 .   ? 5.321   30.738 47.422 1.00 18.63 ? 290 HOH B O   1 
HETATM 3510 O  O   . HOH I 4 .   ? 11.915  15.656 33.023 1.00 17.09 ? 291 HOH B O   1 
HETATM 3511 O  O   . HOH I 4 .   ? 4.114   24.369 48.863 1.00 24.28 ? 292 HOH B O   1 
HETATM 3512 O  O   . HOH I 4 .   ? 5.436   50.948 49.534 1.00 10.61 ? 293 HOH B O   1 
HETATM 3513 O  O   . HOH I 4 .   ? 4.829   58.579 38.321 1.00 30.93 ? 294 HOH B O   1 
HETATM 3514 O  O   . HOH I 4 .   ? 7.077   18.567 31.001 1.00 23.59 ? 295 HOH B O   1 
HETATM 3515 O  O   . HOH I 4 .   ? 5.694   37.107 15.202 1.00 17.11 ? 296 HOH B O   1 
HETATM 3516 O  O   . HOH I 4 .   ? 18.425  39.467 39.114 1.00 20.06 ? 297 HOH B O   1 
HETATM 3517 O  O   . HOH I 4 .   ? -5.805  28.254 45.508 1.00 22.25 ? 298 HOH B O   1 
HETATM 3518 O  O   . HOH I 4 .   ? 8.948   17.249 32.642 1.00 24.45 ? 299 HOH B O   1 
HETATM 3519 O  O   . HOH I 4 .   ? 1.540   33.404 45.927 1.00 5.81  ? 300 HOH B O   1 
HETATM 3520 O  O   . HOH I 4 .   ? 2.929   43.552 25.109 1.00 13.78 ? 301 HOH B O   1 
HETATM 3521 O  O   . HOH I 4 .   ? 16.895  34.649 45.198 1.00 15.29 ? 302 HOH B O   1 
HETATM 3522 O  O   . HOH I 4 .   ? 5.416   42.853 24.524 1.00 21.81 ? 303 HOH B O   1 
HETATM 3523 O  O   . HOH I 4 .   ? 19.573  9.099  45.278 1.00 23.64 ? 304 HOH B O   1 
HETATM 3524 O  O   . HOH I 4 .   ? -8.636  39.286 46.560 1.00 22.52 ? 305 HOH B O   1 
HETATM 3525 O  O   . HOH I 4 .   ? -6.588  27.610 18.296 1.00 11.46 ? 306 HOH B O   1 
HETATM 3526 O  O   . HOH I 4 .   ? 14.638  35.119 47.317 1.00 35.03 ? 307 HOH B O   1 
HETATM 3527 O  O   . HOH I 4 .   ? -8.862  23.207 39.634 1.00 16.07 ? 308 HOH B O   1 
HETATM 3528 O  O   . HOH I 4 .   ? 22.915  19.910 36.770 1.00 17.63 ? 309 HOH B O   1 
HETATM 3529 O  O   . HOH I 4 .   ? -10.470 46.338 41.912 1.00 26.29 ? 310 HOH B O   1 
HETATM 3530 O  O   . HOH I 4 .   ? 10.252  48.673 46.573 1.00 28.00 ? 311 HOH B O   1 
HETATM 3531 O  O   . HOH I 4 .   ? 12.025  52.368 48.393 1.00 32.81 ? 312 HOH B O   1 
HETATM 3532 O  O   . HOH I 4 .   ? 25.150  13.120 37.720 1.00 21.29 ? 313 HOH B O   1 
HETATM 3533 O  O   . HOH I 4 .   ? 16.119  37.581 27.754 1.00 21.83 ? 314 HOH B O   1 
HETATM 3534 O  O   . HOH I 4 .   ? 0.962   41.866 18.431 1.00 31.93 ? 315 HOH B O   1 
HETATM 3535 O  O   . HOH I 4 .   ? 0.479   13.620 43.400 1.00 25.79 ? 316 HOH B O   1 
HETATM 3536 O  O   . HOH I 4 .   ? -4.431  15.622 40.020 1.00 25.44 ? 317 HOH B O   1 
HETATM 3537 O  O   . HOH I 4 .   ? 18.442  8.779  42.947 1.00 31.31 ? 318 HOH B O   1 
HETATM 3538 O  O   . HOH I 4 .   ? -3.497  25.570 46.656 1.00 28.89 ? 319 HOH B O   1 
HETATM 3539 O  O   . HOH I 4 .   ? -15.434 26.160 33.006 1.00 25.09 ? 320 HOH B O   1 
HETATM 3540 O  O   . HOH I 4 .   ? -8.105  38.873 23.764 1.00 31.56 ? 321 HOH B O   1 
HETATM 3541 O  O   . HOH I 4 .   ? 15.517  40.762 30.103 1.00 25.23 ? 322 HOH B O   1 
HETATM 3542 O  O   . HOH I 4 .   ? 14.224  43.039 28.545 1.00 23.55 ? 323 HOH B O   1 
HETATM 3543 O  O   . HOH I 4 .   ? -3.677  45.734 28.684 1.00 23.84 ? 324 HOH B O   1 
HETATM 3544 O  O   . HOH I 4 .   ? -5.494  46.166 30.542 1.00 28.08 ? 325 HOH B O   1 
HETATM 3545 O  O   . HOH I 4 .   ? 17.474  37.360 31.100 1.00 23.24 ? 326 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   1   SER SER A . n 
A 1 2   TYR 2   2   2   TYR TYR A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   TYR 9   9   9   TYR TYR A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  TYR 11  11  11  TYR TYR A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  MET 23  23  23  MET MET A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLN 62  62  62  GLN GLN A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  HIS 78  78  78  HIS HIS A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  HIS 81  81  81  HIS HIS A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  TRP 85  85  85  TRP TRP A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 TRP 128 128 128 TRP TRP A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 TRP 130 130 130 TRP TRP A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 MET 151 151 151 MET MET A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 MET 164 164 164 MET MET A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 TRP 169 169 169 TRP TRP A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 HIS 171 171 171 HIS HIS A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 TYR 174 174 174 TYR TYR A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 PHE 177 177 177 PHE PHE A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 ASN 179 179 179 ASN ASN A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 TYR 184 184 184 TYR TYR A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 TRP 189 189 189 TRP TRP A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 ASN 193 193 193 ASN ASN A . n 
A 1 194 TRP 194 194 194 TRP TRP A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 ARG 200 200 200 ARG ARG A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 LYS 205 205 205 LYS LYS A . n 
B 1 1   SER 1   1   1   SER SER B . n 
B 1 2   TYR 2   2   2   TYR TYR B . n 
B 1 3   THR 3   3   3   THR THR B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   SER 6   6   6   SER SER B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   TYR 9   9   9   TYR TYR B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  TYR 11  11  11  TYR TYR B . n 
B 1 12  ASP 12  12  12  ASP ASP B . n 
B 1 13  ALA 13  13  13  ALA ALA B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  PRO 16  16  16  PRO PRO B . n 
B 1 17  HIS 17  17  17  HIS HIS B . n 
B 1 18  PHE 18  18  18  PHE PHE B . n 
B 1 19  ASP 19  19  19  ASP ASP B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  GLN 21  21  21  GLN GLN B . n 
B 1 22  THR 22  22  22  THR THR B . n 
B 1 23  MET 23  23  23  MET MET B . n 
B 1 24  GLU 24  24  24  GLU GLU B . n 
B 1 25  ILE 25  25  25  ILE ILE B . n 
B 1 26  HIS 26  26  26  HIS HIS B . n 
B 1 27  HIS 27  27  27  HIS HIS B . n 
B 1 28  THR 28  28  28  THR THR B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  HIS 30  30  30  HIS HIS B . n 
B 1 31  HIS 31  31  31  HIS HIS B . n 
B 1 32  GLN 32  32  32  GLN GLN B . n 
B 1 33  THR 33  33  33  THR THR B . n 
B 1 34  TYR 34  34  34  TYR TYR B . n 
B 1 35  VAL 35  35  35  VAL VAL B . n 
B 1 36  ASN 36  36  36  ASN ASN B . n 
B 1 37  ASN 37  37  37  ASN ASN B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  ALA 40  40  40  ALA ALA B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  LEU 42  42  42  LEU LEU B . n 
B 1 43  GLU 43  43  43  GLU GLU B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  PRO 46  46  46  PRO PRO B . n 
B 1 47  GLU 47  47  47  GLU GLU B . n 
B 1 48  PHE 48  48  48  PHE PHE B . n 
B 1 49  ALA 49  49  49  ALA ALA B . n 
B 1 50  ASN 50  50  50  ASN ASN B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  VAL 53  53  53  VAL VAL B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  GLU 55  55  55  GLU GLU B . n 
B 1 56  LEU 56  56  56  LEU LEU B . n 
B 1 57  ILE 57  57  57  ILE ILE B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  LYS 59  59  59  LYS LYS B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  GLN 62  62  62  GLN GLN B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  PRO 64  64  64  PRO PRO B . n 
B 1 65  ALA 65  65  65  ALA ALA B . n 
B 1 66  ASP 66  66  66  ASP ASP B . n 
B 1 67  LYS 67  67  67  LYS LYS B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  THR 69  69  69  THR THR B . n 
B 1 70  VAL 70  70  70  VAL VAL B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  ARG 72  72  72  ARG ARG B . n 
B 1 73  ASN 73  73  73  ASN ASN B . n 
B 1 74  ASN 74  74  74  ASN ASN B . n 
B 1 75  ALA 75  75  75  ALA ALA B . n 
B 1 76  GLY 76  76  76  GLY GLY B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  HIS 78  78  78  HIS HIS B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  HIS 81  81  81  HIS HIS B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  PHE 84  84  84  PHE PHE B . n 
B 1 85  TRP 85  85  85  TRP TRP B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  LYS 90  90  90  LYS LYS B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  THR 92  92  92  THR THR B . n 
B 1 93  THR 93  93  93  THR THR B . n 
B 1 94  LEU 94  94  94  LEU LEU B . n 
B 1 95  GLN 95  95  95  GLN GLN B . n 
B 1 96  GLY 96  96  96  GLY GLY B . n 
B 1 97  ASP 97  97  97  ASP ASP B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  LYS 99  99  99  LYS LYS B . n 
B 1 100 ALA 100 100 100 ALA ALA B . n 
B 1 101 ALA 101 101 101 ALA ALA B . n 
B 1 102 ILE 102 102 102 ILE ILE B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 ARG 104 104 104 ARG ARG B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 PHE 106 106 106 PHE PHE B . n 
B 1 107 GLY 107 107 107 GLY GLY B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 VAL 109 109 109 VAL VAL B . n 
B 1 110 ASP 110 110 110 ASP ASP B . n 
B 1 111 ASN 111 111 111 ASN ASN B . n 
B 1 112 PHE 112 112 112 PHE PHE B . n 
B 1 113 LYS 113 113 113 LYS LYS B . n 
B 1 114 ALA 114 114 114 ALA ALA B . n 
B 1 115 GLU 115 115 115 GLU GLU B . n 
B 1 116 PHE 116 116 116 PHE PHE B . n 
B 1 117 GLU 117 117 117 GLU GLU B . n 
B 1 118 LYS 118 118 118 LYS LYS B . n 
B 1 119 ALA 119 119 119 ALA ALA B . n 
B 1 120 ALA 120 120 120 ALA ALA B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 ARG 123 123 123 ARG ARG B . n 
B 1 124 PHE 124 124 124 PHE PHE B . n 
B 1 125 GLY 125 125 125 GLY GLY B . n 
B 1 126 SER 126 126 126 SER SER B . n 
B 1 127 GLY 127 127 127 GLY GLY B . n 
B 1 128 TRP 128 128 128 TRP TRP B . n 
B 1 129 ALA 129 129 129 ALA ALA B . n 
B 1 130 TRP 130 130 130 TRP TRP B . n 
B 1 131 LEU 131 131 131 LEU LEU B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 LYS 134 134 134 LYS LYS B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ASP 136 136 136 ASP ASP B . n 
B 1 137 LYS 137 137 137 LYS LYS B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 VAL 140 140 140 VAL VAL B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 SER 142 142 142 SER SER B . n 
B 1 143 THR 143 143 143 THR THR B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 ASN 145 145 145 ASN ASN B . n 
B 1 146 GLN 146 146 146 GLN GLN B . n 
B 1 147 ASP 147 147 147 ASP ASP B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 LEU 150 150 150 LEU LEU B . n 
B 1 151 MET 151 151 151 MET MET B . n 
B 1 152 GLY 152 152 152 GLY GLY B . n 
B 1 153 GLU 153 153 153 GLU GLU B . n 
B 1 154 ALA 154 154 154 ALA ALA B . n 
B 1 155 ILE 155 155 155 ILE ILE B . n 
B 1 156 SER 156 156 156 SER SER B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 ALA 158 158 158 ALA ALA B . n 
B 1 159 SER 159 159 159 SER SER B . n 
B 1 160 GLY 160 160 160 GLY GLY B . n 
B 1 161 PHE 161 161 161 PHE PHE B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 ILE 163 163 163 ILE ILE B . n 
B 1 164 MET 164 164 164 MET MET B . n 
B 1 165 GLY 165 165 165 GLY GLY B . n 
B 1 166 LEU 166 166 166 LEU LEU B . n 
B 1 167 ASP 167 167 167 ASP ASP B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 TRP 169 169 169 TRP TRP B . n 
B 1 170 GLU 170 170 170 GLU GLU B . n 
B 1 171 HIS 171 171 171 HIS HIS B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 TYR 173 173 173 TYR TYR B . n 
B 1 174 TYR 174 174 174 TYR TYR B . n 
B 1 175 LEU 175 175 175 LEU LEU B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 PHE 177 177 177 PHE PHE B . n 
B 1 178 GLN 178 178 178 GLN GLN B . n 
B 1 179 ASN 179 179 179 ASN ASN B . n 
B 1 180 ARG 180 180 180 ARG ARG B . n 
B 1 181 ARG 181 181 181 ARG ARG B . n 
B 1 182 PRO 182 182 182 PRO PRO B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 TYR 184 184 184 TYR TYR B . n 
B 1 185 ILE 185 185 185 ILE ILE B . n 
B 1 186 LYS 186 186 186 LYS LYS B . n 
B 1 187 GLU 187 187 187 GLU GLU B . n 
B 1 188 PHE 188 188 188 PHE PHE B . n 
B 1 189 TRP 189 189 189 TRP TRP B . n 
B 1 190 ASN 190 190 190 ASN ASN B . n 
B 1 191 VAL 191 191 191 VAL VAL B . n 
B 1 192 VAL 192 192 192 VAL VAL B . n 
B 1 193 ASN 193 193 193 ASN ASN B . n 
B 1 194 TRP 194 194 194 TRP TRP B . n 
B 1 195 ASP 195 195 195 ASP ASP B . n 
B 1 196 GLU 196 196 196 GLU GLU B . n 
B 1 197 ALA 197 197 197 ALA ALA B . n 
B 1 198 ALA 198 198 198 ALA ALA B . n 
B 1 199 ALA 199 199 199 ALA ALA B . n 
B 1 200 ARG 200 200 200 ARG ARG B . n 
B 1 201 PHE 201 201 201 PHE PHE B . n 
B 1 202 ALA 202 202 202 ALA ALA B . n 
B 1 203 ALA 203 203 203 ALA ALA B . n 
B 1 204 LYS 204 204 204 LYS LYS B . n 
B 1 205 LYS 205 205 205 LYS LYS B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 FE ? D FE . ? A FE 206 ? 1_555 NE2 ? A HIS 81  ? A HIS 81  ? 1_555 88.5  ? 
2  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 FE ? D FE . ? A FE 206 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 85.3  ? 
3  NE2 ? A HIS 81  ? A HIS 81  ? 1_555 FE ? D FE . ? A FE 206 ? 1_555 OD2 ? A ASP 167 ? A ASP 167 ? 1_555 106.7 ? 
4  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 FE ? D FE . ? A FE 206 ? 1_555 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 90.0  ? 
5  NE2 ? A HIS 81  ? A HIS 81  ? 1_555 FE ? D FE . ? A FE 206 ? 1_555 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 146.7 ? 
6  OD2 ? A ASP 167 ? A ASP 167 ? 1_555 FE ? D FE . ? A FE 206 ? 1_555 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 106.3 ? 
7  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 FE ? D FE . ? A FE 206 ? 1_555 O   ? C OH  .   ? A OH  207 ? 1_555 171.8 ? 
8  NE2 ? A HIS 81  ? A HIS 81  ? 1_555 FE ? D FE . ? A FE 206 ? 1_555 O   ? C OH  .   ? A OH  207 ? 1_555 98.2  ? 
9  OD2 ? A ASP 167 ? A ASP 167 ? 1_555 FE ? D FE . ? A FE 206 ? 1_555 O   ? C OH  .   ? A OH  207 ? 1_555 88.3  ? 
10 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 FE ? D FE . ? A FE 206 ? 1_555 O   ? C OH  .   ? A OH  207 ? 1_555 87.0  ? 
11 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 92.8  ? 
12 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 89.4  ? 
13 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 113.5 ? 
14 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 90.0  ? 
15 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 146.5 ? 
16 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 99.8  ? 
17 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 O   ? E OH  .   ? B OH  207 ? 1_555 178.2 ? 
18 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 O   ? E OH  .   ? B OH  207 ? 1_555 86.5  ? 
19 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 O   ? E OH  .   ? B OH  207 ? 1_555 92.3  ? 
20 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 O   ? E OH  .   ? B OH  207 ? 1_555 89.7  ? 
21 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 O   ? F OH  .   ? B OH  208 ? 1_555 89.4  ? 
22 NE2 ? B HIS 81  ? B HIS 81  ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 O   ? F OH  .   ? B OH  208 ? 1_555 68.5  ? 
23 OD2 ? B ASP 167 ? B ASP 167 ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 O   ? F OH  .   ? B OH  208 ? 1_555 177.7 ? 
24 NE2 ? B HIS 171 ? B HIS 171 ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 O   ? F OH  .   ? B OH  208 ? 1_555 78.2  ? 
25 O   ? E OH  .   ? B OH  207 ? 1_555 FE ? G FE . ? B FE 206 ? 1_555 O   ? F OH  .   ? B OH  208 ? 1_555 88.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-09-02 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .    ? 1 
CNS       refinement       0.3C ? 2 
DENZO     'data reduction' .    ? 3 
SCALEPACK 'data scaling'   .    ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 16  ? ? -93.96  30.05   
2  1 LYS A 29  ? ? -107.96 -64.54  
3  1 LYS A 89  ? ? -178.42 142.09  
4  1 ASN A 145 ? ? 47.43   -116.82 
5  1 GLN A 178 ? ? 50.50   -133.25 
6  1 PRO B 16  ? ? -82.07  31.48   
7  1 HIS B 17  ? ? -99.71  -61.53  
8  1 LYS B 89  ? ? -178.58 143.12  
9  1 ASN B 145 ? ? 45.81   -121.78 
10 1 TYR B 173 ? ? -142.48 -1.84   
11 1 GLN B 178 ? ? 51.94   -130.14 
12 1 LYS B 204 ? ? 59.00   3.32    
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 B GLN 21  ? CG  ? B GLN 21  CG  
2  1 Y 0 B GLN 21  ? CD  ? B GLN 21  CD  
3  1 Y 0 B GLN 21  ? OE1 ? B GLN 21  OE1 
4  1 Y 0 B GLN 21  ? NE2 ? B GLN 21  NE2 
5  1 Y 0 B GLU 47  ? CG  ? B GLU 47  CG  
6  1 Y 0 B GLU 47  ? CD  ? B GLU 47  CD  
7  1 Y 0 B GLU 47  ? OE1 ? B GLU 47  OE1 
8  1 Y 0 B GLU 47  ? OE2 ? B GLU 47  OE2 
9  1 Y 0 B ASN 50  ? CG  ? B ASN 50  CG  
10 1 Y 0 B ASN 50  ? OD1 ? B ASN 50  OD1 
11 1 Y 0 B ASN 50  ? ND2 ? B ASN 50  ND2 
12 1 Y 0 B LYS 137 ? CG  ? B LYS 137 CG  
13 1 Y 0 B LYS 137 ? CD  ? B LYS 137 CD  
14 1 Y 0 B LYS 137 ? CE  ? B LYS 137 CE  
15 1 Y 0 B LYS 137 ? NZ  ? B LYS 137 NZ  
16 1 Y 0 B LYS 205 ? CB  ? B LYS 205 CB  
17 1 Y 0 B LYS 205 ? CG  ? B LYS 205 CG  
18 1 Y 0 B LYS 205 ? CD  ? B LYS 205 CD  
19 1 Y 0 B LYS 205 ? CE  ? B LYS 205 CE  
20 1 Y 0 B LYS 205 ? NZ  ? B LYS 205 NZ  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'HYDROXIDE ION' OH  
3 'FE (III) ION'  FE  
4 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 OH  1   207 207 OH  OH  A . 
D 3 FE  1   206 206 FE  FE  A . 
E 2 OH  1   207 207 OH  OH  B . 
F 2 OH  1   208 208 OH  OH  B . 
G 3 FE  1   206 206 FE  FE  B . 
H 4 HOH 1   208 1   HOH HOH A . 
H 4 HOH 2   209 2   HOH HOH A . 
H 4 HOH 3   210 3   HOH HOH A . 
H 4 HOH 4   211 4   HOH HOH A . 
H 4 HOH 5   212 5   HOH HOH A . 
H 4 HOH 6   213 6   HOH HOH A . 
H 4 HOH 7   214 7   HOH HOH A . 
H 4 HOH 8   215 8   HOH HOH A . 
H 4 HOH 9   216 9   HOH HOH A . 
H 4 HOH 10  217 10  HOH HOH A . 
H 4 HOH 11  218 11  HOH HOH A . 
H 4 HOH 12  219 12  HOH HOH A . 
H 4 HOH 13  220 13  HOH HOH A . 
H 4 HOH 14  221 14  HOH HOH A . 
H 4 HOH 15  222 16  HOH HOH A . 
H 4 HOH 16  223 17  HOH HOH A . 
H 4 HOH 17  224 18  HOH HOH A . 
H 4 HOH 18  225 19  HOH HOH A . 
H 4 HOH 19  226 20  HOH HOH A . 
H 4 HOH 20  227 21  HOH HOH A . 
H 4 HOH 21  228 22  HOH HOH A . 
H 4 HOH 22  229 23  HOH HOH A . 
H 4 HOH 23  230 24  HOH HOH A . 
H 4 HOH 24  231 25  HOH HOH A . 
H 4 HOH 25  232 26  HOH HOH A . 
H 4 HOH 26  233 27  HOH HOH A . 
H 4 HOH 27  234 28  HOH HOH A . 
H 4 HOH 28  235 29  HOH HOH A . 
H 4 HOH 29  236 30  HOH HOH A . 
H 4 HOH 30  237 31  HOH HOH A . 
H 4 HOH 31  238 32  HOH HOH A . 
H 4 HOH 32  239 34  HOH HOH A . 
H 4 HOH 33  240 35  HOH HOH A . 
H 4 HOH 34  241 37  HOH HOH A . 
H 4 HOH 35  242 38  HOH HOH A . 
H 4 HOH 36  243 39  HOH HOH A . 
H 4 HOH 37  244 40  HOH HOH A . 
H 4 HOH 38  245 41  HOH HOH A . 
H 4 HOH 39  246 42  HOH HOH A . 
H 4 HOH 40  247 43  HOH HOH A . 
H 4 HOH 41  248 45  HOH HOH A . 
H 4 HOH 42  249 46  HOH HOH A . 
H 4 HOH 43  250 47  HOH HOH A . 
H 4 HOH 44  251 48  HOH HOH A . 
H 4 HOH 45  252 49  HOH HOH A . 
H 4 HOH 46  253 50  HOH HOH A . 
H 4 HOH 47  254 51  HOH HOH A . 
H 4 HOH 48  255 52  HOH HOH A . 
H 4 HOH 49  256 53  HOH HOH A . 
H 4 HOH 50  257 54  HOH HOH A . 
H 4 HOH 51  258 55  HOH HOH A . 
H 4 HOH 52  259 56  HOH HOH A . 
H 4 HOH 53  260 57  HOH HOH A . 
H 4 HOH 54  261 58  HOH HOH A . 
H 4 HOH 55  262 59  HOH HOH A . 
H 4 HOH 56  263 60  HOH HOH A . 
H 4 HOH 57  264 61  HOH HOH A . 
H 4 HOH 58  265 62  HOH HOH A . 
H 4 HOH 59  266 63  HOH HOH A . 
H 4 HOH 60  267 64  HOH HOH A . 
H 4 HOH 61  268 65  HOH HOH A . 
H 4 HOH 62  269 66  HOH HOH A . 
H 4 HOH 63  270 67  HOH HOH A . 
H 4 HOH 64  271 69  HOH HOH A . 
H 4 HOH 65  272 70  HOH HOH A . 
H 4 HOH 66  273 71  HOH HOH A . 
H 4 HOH 67  274 72  HOH HOH A . 
H 4 HOH 68  275 73  HOH HOH A . 
H 4 HOH 69  276 74  HOH HOH A . 
H 4 HOH 70  277 75  HOH HOH A . 
H 4 HOH 71  278 76  HOH HOH A . 
H 4 HOH 72  279 77  HOH HOH A . 
H 4 HOH 73  280 79  HOH HOH A . 
H 4 HOH 74  281 80  HOH HOH A . 
H 4 HOH 75  282 81  HOH HOH A . 
H 4 HOH 76  283 82  HOH HOH A . 
H 4 HOH 77  284 83  HOH HOH A . 
H 4 HOH 78  285 84  HOH HOH A . 
H 4 HOH 79  286 85  HOH HOH A . 
H 4 HOH 80  287 86  HOH HOH A . 
H 4 HOH 81  288 87  HOH HOH A . 
H 4 HOH 82  289 88  HOH HOH A . 
H 4 HOH 83  290 89  HOH HOH A . 
H 4 HOH 84  291 90  HOH HOH A . 
H 4 HOH 85  292 91  HOH HOH A . 
H 4 HOH 86  293 92  HOH HOH A . 
H 4 HOH 87  294 93  HOH HOH A . 
H 4 HOH 88  295 94  HOH HOH A . 
H 4 HOH 89  296 95  HOH HOH A . 
H 4 HOH 90  297 96  HOH HOH A . 
H 4 HOH 91  298 97  HOH HOH A . 
H 4 HOH 92  299 98  HOH HOH A . 
H 4 HOH 93  300 99  HOH HOH A . 
H 4 HOH 94  301 100 HOH HOH A . 
H 4 HOH 95  302 101 HOH HOH A . 
H 4 HOH 96  303 102 HOH HOH A . 
H 4 HOH 97  304 103 HOH HOH A . 
H 4 HOH 98  305 104 HOH HOH A . 
H 4 HOH 99  306 105 HOH HOH A . 
H 4 HOH 100 307 106 HOH HOH A . 
H 4 HOH 101 308 107 HOH HOH A . 
H 4 HOH 102 309 108 HOH HOH A . 
H 4 HOH 103 310 109 HOH HOH A . 
H 4 HOH 104 311 110 HOH HOH A . 
H 4 HOH 105 312 111 HOH HOH A . 
H 4 HOH 106 313 112 HOH HOH A . 
H 4 HOH 107 314 113 HOH HOH A . 
H 4 HOH 108 315 114 HOH HOH A . 
H 4 HOH 109 316 115 HOH HOH A . 
H 4 HOH 110 317 116 HOH HOH A . 
H 4 HOH 111 318 117 HOH HOH A . 
H 4 HOH 112 319 118 HOH HOH A . 
H 4 HOH 113 320 119 HOH HOH A . 
H 4 HOH 114 321 120 HOH HOH A . 
H 4 HOH 115 322 121 HOH HOH A . 
H 4 HOH 116 323 122 HOH HOH A . 
H 4 HOH 117 324 123 HOH HOH A . 
H 4 HOH 118 325 124 HOH HOH A . 
H 4 HOH 119 326 125 HOH HOH A . 
H 4 HOH 120 327 126 HOH HOH A . 
H 4 HOH 121 328 127 HOH HOH A . 
H 4 HOH 122 329 128 HOH HOH A . 
H 4 HOH 123 330 129 HOH HOH A . 
H 4 HOH 124 331 130 HOH HOH A . 
H 4 HOH 125 332 131 HOH HOH A . 
H 4 HOH 126 333 132 HOH HOH A . 
H 4 HOH 127 334 133 HOH HOH A . 
H 4 HOH 128 335 134 HOH HOH A . 
H 4 HOH 129 336 135 HOH HOH A . 
H 4 HOH 130 337 136 HOH HOH A . 
H 4 HOH 131 338 137 HOH HOH A . 
H 4 HOH 132 339 138 HOH HOH A . 
H 4 HOH 133 340 139 HOH HOH A . 
H 4 HOH 134 341 140 HOH HOH A . 
H 4 HOH 135 342 141 HOH HOH A . 
H 4 HOH 136 343 142 HOH HOH A . 
H 4 HOH 137 344 143 HOH HOH A . 
H 4 HOH 138 345 144 HOH HOH A . 
H 4 HOH 139 346 145 HOH HOH A . 
H 4 HOH 140 347 146 HOH HOH A . 
H 4 HOH 141 348 147 HOH HOH A . 
H 4 HOH 142 349 148 HOH HOH A . 
H 4 HOH 143 350 149 HOH HOH A . 
H 4 HOH 144 351 150 HOH HOH A . 
H 4 HOH 145 352 151 HOH HOH A . 
H 4 HOH 146 353 152 HOH HOH A . 
H 4 HOH 147 354 153 HOH HOH A . 
H 4 HOH 148 355 154 HOH HOH A . 
H 4 HOH 149 356 155 HOH HOH A . 
H 4 HOH 150 357 156 HOH HOH A . 
H 4 HOH 151 358 157 HOH HOH A . 
H 4 HOH 152 359 158 HOH HOH A . 
H 4 HOH 153 360 159 HOH HOH A . 
H 4 HOH 154 361 160 HOH HOH A . 
H 4 HOH 155 362 161 HOH HOH A . 
H 4 HOH 156 363 162 HOH HOH A . 
H 4 HOH 157 364 163 HOH HOH A . 
H 4 HOH 158 365 164 HOH HOH A . 
H 4 HOH 159 366 15  HOH HOH A . 
H 4 HOH 160 367 33  HOH HOH A . 
H 4 HOH 161 368 44  HOH HOH A . 
H 4 HOH 162 369 45  HOH HOH A . 
H 4 HOH 163 370 68  HOH HOH A . 
H 4 HOH 164 371 78  HOH HOH A . 
H 4 HOH 165 372 83  HOH HOH A . 
H 4 HOH 166 373 90  HOH HOH A . 
I 4 HOH 1   209 15  HOH HOH B . 
I 4 HOH 2   210 33  HOH HOH B . 
I 4 HOH 3   211 36  HOH HOH B . 
I 4 HOH 4   212 44  HOH HOH B . 
I 4 HOH 5   213 68  HOH HOH B . 
I 4 HOH 6   214 78  HOH HOH B . 
I 4 HOH 7   215 1   HOH HOH B . 
I 4 HOH 8   216 2   HOH HOH B . 
I 4 HOH 9   217 3   HOH HOH B . 
I 4 HOH 10  218 4   HOH HOH B . 
I 4 HOH 11  219 5   HOH HOH B . 
I 4 HOH 12  220 6   HOH HOH B . 
I 4 HOH 13  221 7   HOH HOH B . 
I 4 HOH 14  222 8   HOH HOH B . 
I 4 HOH 15  223 9   HOH HOH B . 
I 4 HOH 16  224 10  HOH HOH B . 
I 4 HOH 17  225 11  HOH HOH B . 
I 4 HOH 18  226 12  HOH HOH B . 
I 4 HOH 19  227 13  HOH HOH B . 
I 4 HOH 20  228 14  HOH HOH B . 
I 4 HOH 21  229 16  HOH HOH B . 
I 4 HOH 22  230 17  HOH HOH B . 
I 4 HOH 23  231 18  HOH HOH B . 
I 4 HOH 24  232 19  HOH HOH B . 
I 4 HOH 25  233 20  HOH HOH B . 
I 4 HOH 26  234 21  HOH HOH B . 
I 4 HOH 27  235 22  HOH HOH B . 
I 4 HOH 28  236 23  HOH HOH B . 
I 4 HOH 29  237 24  HOH HOH B . 
I 4 HOH 30  238 25  HOH HOH B . 
I 4 HOH 31  239 26  HOH HOH B . 
I 4 HOH 32  240 27  HOH HOH B . 
I 4 HOH 33  241 28  HOH HOH B . 
I 4 HOH 34  242 29  HOH HOH B . 
I 4 HOH 35  243 30  HOH HOH B . 
I 4 HOH 36  244 31  HOH HOH B . 
I 4 HOH 37  245 32  HOH HOH B . 
I 4 HOH 38  246 34  HOH HOH B . 
I 4 HOH 39  247 35  HOH HOH B . 
I 4 HOH 40  248 36  HOH HOH B . 
I 4 HOH 41  249 37  HOH HOH B . 
I 4 HOH 42  250 38  HOH HOH B . 
I 4 HOH 43  251 39  HOH HOH B . 
I 4 HOH 44  252 40  HOH HOH B . 
I 4 HOH 45  253 41  HOH HOH B . 
I 4 HOH 46  254 42  HOH HOH B . 
I 4 HOH 47  255 43  HOH HOH B . 
I 4 HOH 48  256 46  HOH HOH B . 
I 4 HOH 49  257 47  HOH HOH B . 
I 4 HOH 50  258 48  HOH HOH B . 
I 4 HOH 51  259 49  HOH HOH B . 
I 4 HOH 52  260 50  HOH HOH B . 
I 4 HOH 53  261 51  HOH HOH B . 
I 4 HOH 54  262 52  HOH HOH B . 
I 4 HOH 55  263 53  HOH HOH B . 
I 4 HOH 56  264 54  HOH HOH B . 
I 4 HOH 57  265 55  HOH HOH B . 
I 4 HOH 58  266 56  HOH HOH B . 
I 4 HOH 59  267 57  HOH HOH B . 
I 4 HOH 60  268 58  HOH HOH B . 
I 4 HOH 61  269 59  HOH HOH B . 
I 4 HOH 62  270 60  HOH HOH B . 
I 4 HOH 63  271 61  HOH HOH B . 
I 4 HOH 64  272 62  HOH HOH B . 
I 4 HOH 65  273 63  HOH HOH B . 
I 4 HOH 66  274 64  HOH HOH B . 
I 4 HOH 67  275 65  HOH HOH B . 
I 4 HOH 68  276 66  HOH HOH B . 
I 4 HOH 69  277 67  HOH HOH B . 
I 4 HOH 70  278 69  HOH HOH B . 
I 4 HOH 71  279 70  HOH HOH B . 
I 4 HOH 72  280 71  HOH HOH B . 
I 4 HOH 73  281 72  HOH HOH B . 
I 4 HOH 74  282 73  HOH HOH B . 
I 4 HOH 75  283 74  HOH HOH B . 
I 4 HOH 76  284 75  HOH HOH B . 
I 4 HOH 77  285 76  HOH HOH B . 
I 4 HOH 78  286 77  HOH HOH B . 
I 4 HOH 79  287 79  HOH HOH B . 
I 4 HOH 80  288 80  HOH HOH B . 
I 4 HOH 81  289 81  HOH HOH B . 
I 4 HOH 82  290 82  HOH HOH B . 
I 4 HOH 83  291 84  HOH HOH B . 
I 4 HOH 84  292 85  HOH HOH B . 
I 4 HOH 85  293 86  HOH HOH B . 
I 4 HOH 86  294 87  HOH HOH B . 
I 4 HOH 87  295 88  HOH HOH B . 
I 4 HOH 88  296 89  HOH HOH B . 
I 4 HOH 89  297 91  HOH HOH B . 
I 4 HOH 90  298 92  HOH HOH B . 
I 4 HOH 91  299 93  HOH HOH B . 
I 4 HOH 92  300 165 HOH HOH B . 
I 4 HOH 93  301 166 HOH HOH B . 
I 4 HOH 94  302 167 HOH HOH B . 
I 4 HOH 95  303 168 HOH HOH B . 
I 4 HOH 96  304 169 HOH HOH B . 
I 4 HOH 97  305 170 HOH HOH B . 
I 4 HOH 98  306 171 HOH HOH B . 
I 4 HOH 99  307 172 HOH HOH B . 
I 4 HOH 100 308 173 HOH HOH B . 
I 4 HOH 101 309 174 HOH HOH B . 
I 4 HOH 102 310 175 HOH HOH B . 
I 4 HOH 103 311 176 HOH HOH B . 
I 4 HOH 104 312 177 HOH HOH B . 
I 4 HOH 105 313 178 HOH HOH B . 
I 4 HOH 106 314 179 HOH HOH B . 
I 4 HOH 107 315 180 HOH HOH B . 
I 4 HOH 108 316 181 HOH HOH B . 
I 4 HOH 109 317 182 HOH HOH B . 
I 4 HOH 110 318 183 HOH HOH B . 
I 4 HOH 111 319 184 HOH HOH B . 
I 4 HOH 112 320 185 HOH HOH B . 
I 4 HOH 113 321 186 HOH HOH B . 
I 4 HOH 114 322 187 HOH HOH B . 
I 4 HOH 115 323 188 HOH HOH B . 
I 4 HOH 116 324 189 HOH HOH B . 
I 4 HOH 117 325 190 HOH HOH B . 
I 4 HOH 118 326 191 HOH HOH B . 
#