data_1MPU
# 
_entry.id   1MPU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1MPU         
RCSB  RCSB017080   
WWPDB D_1000017080 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1HYR 'human NKG2D in complex with MIC-A'     unspecified 
PDB 1KCG 'human NKG2D in complex with ULBP3'     unspecified 
PDB 1HQ8 'mouse NKG2D'                           unspecified 
PDB 1JSK 'mouse NKG2D in complex with Rae-1beta' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1MPU 
_pdbx_database_status.recvd_initial_deposition_date   2002-09-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'McFarland, B.J.' 1 
'Kortemme, T.'    2 
'Baker, D.'       3 
'Strong, R.K.'    4 
# 
_citation.id                        primary 
_citation.title                     
;Symmetry Recognizing Asymmetry: Analysis of the Interactions between the C-Type Lectin-like Immunoreceptor NKG2D and MHC 
Class I-like Ligands
;
_citation.journal_abbrev            Structure 
_citation.journal_volume            11 
_citation.page_first                411 
_citation.page_last                 422 
_citation.year                      2003 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12679019 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(03)00047-9' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'McFarland, B.J.' 1 
primary 'Kortemme, T.'    2 
primary 'Yu, S.F.'        3 
primary 'Baker, D.'       4 
primary 'Strong, R.K.'    5 
# 
_cell.entry_id           1MPU 
_cell.length_a           87.650 
_cell.length_b           87.650 
_cell.length_c           36.130 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
# 
_symmetry.entry_id                         1MPU 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                92 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'NKG2-D type II integral membrane protein' 15981.102 1   ? ? 'residues 80-216' ? 
2 non-polymer syn 'PHOSPHATE ION'                            94.971    1   ? ? ?                 ? 
3 water       nat water                                      18.015    105 ? ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'NKG2-D activating NK receptor, NK cell receptor D' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLV
HIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLV
HIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   SER n 
1 4   LEU n 
1 5   PHE n 
1 6   ASN n 
1 7   GLN n 
1 8   GLU n 
1 9   VAL n 
1 10  GLN n 
1 11  ILE n 
1 12  PRO n 
1 13  LEU n 
1 14  THR n 
1 15  GLU n 
1 16  SER n 
1 17  TYR n 
1 18  CYS n 
1 19  GLY n 
1 20  PRO n 
1 21  CYS n 
1 22  PRO n 
1 23  LYS n 
1 24  ASN n 
1 25  TRP n 
1 26  ILE n 
1 27  CYS n 
1 28  TYR n 
1 29  LYS n 
1 30  ASN n 
1 31  ASN n 
1 32  CYS n 
1 33  TYR n 
1 34  GLN n 
1 35  PHE n 
1 36  PHE n 
1 37  ASP n 
1 38  GLU n 
1 39  SER n 
1 40  LYS n 
1 41  ASN n 
1 42  TRP n 
1 43  TYR n 
1 44  GLU n 
1 45  SER n 
1 46  GLN n 
1 47  ALA n 
1 48  SER n 
1 49  CYS n 
1 50  MET n 
1 51  SER n 
1 52  GLN n 
1 53  ASN n 
1 54  ALA n 
1 55  SER n 
1 56  LEU n 
1 57  LEU n 
1 58  LYS n 
1 59  VAL n 
1 60  TYR n 
1 61  SER n 
1 62  LYS n 
1 63  GLU n 
1 64  ASP n 
1 65  GLN n 
1 66  ASP n 
1 67  LEU n 
1 68  LEU n 
1 69  LYS n 
1 70  LEU n 
1 71  VAL n 
1 72  LYS n 
1 73  SER n 
1 74  TYR n 
1 75  HIS n 
1 76  TRP n 
1 77  MET n 
1 78  GLY n 
1 79  LEU n 
1 80  VAL n 
1 81  HIS n 
1 82  ILE n 
1 83  PRO n 
1 84  THR n 
1 85  ASN n 
1 86  GLY n 
1 87  SER n 
1 88  TRP n 
1 89  GLN n 
1 90  TRP n 
1 91  GLU n 
1 92  ASP n 
1 93  GLY n 
1 94  SER n 
1 95  ILE n 
1 96  LEU n 
1 97  SER n 
1 98  PRO n 
1 99  ASN n 
1 100 LEU n 
1 101 LEU n 
1 102 THR n 
1 103 ILE n 
1 104 ILE n 
1 105 GLU n 
1 106 MET n 
1 107 GLN n 
1 108 LYS n 
1 109 GLY n 
1 110 ASP n 
1 111 CYS n 
1 112 ALA n 
1 113 LEU n 
1 114 TYR n 
1 115 ALA n 
1 116 SER n 
1 117 SER n 
1 118 PHE n 
1 119 LYS n 
1 120 GLY n 
1 121 TYR n 
1 122 ILE n 
1 123 GLU n 
1 124 ASN n 
1 125 CYS n 
1 126 SER n 
1 127 THR n 
1 128 PRO n 
1 129 ASN n 
1 130 THR n 
1 131 TYR n 
1 132 ILE n 
1 133 CYS n 
1 134 MET n 
1 135 GLN n 
1 136 ARG n 
1 137 THR n 
1 138 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21-DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b+ 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NKG2D_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVH
IPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
;
_struct_ref.pdbx_align_begin           80 
_struct_ref.pdbx_db_accession          P26718 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1MPU 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 138 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P26718 
_struct_ref_seq.db_align_beg                  80 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  216 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       80 
_struct_ref_seq.pdbx_auth_seq_align_end       216 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1MPU 
_struct_ref_seq_dif.mon_id                       MET 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P26718 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'INITIATING MET' 
_struct_ref_seq_dif.pdbx_auth_seq_num            79 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1MPU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   43.32 
_exptl_crystal.density_Matthews      2.17 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.pdbx_details    
'ammonium dihydrogen phosphate, bicine, ethylene glycol, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2001-12-05 
_diffrn_detector.details                'Osmics mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1MPU 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.5 
_reflns.d_resolution_low             20.0 
_reflns.number_all                   5240 
_reflns.number_obs                   5057 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.066 
_reflns.pdbx_netI_over_sigmaI        20.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              21.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   90.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.199 
_reflns_shell.meanI_over_sigI_obs    6.8 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      517 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1MPU 
_refine.ls_d_res_high                            2.5 
_refine.ls_d_res_low                             20.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     5057 
_refine.ls_number_reflns_obs                     4838 
_refine.ls_number_reflns_R_free                  498 
_refine.ls_percent_reflns_obs                    95.7 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.245 
_refine.ls_R_factor_R_free                       0.296 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1HYR (CHAIN A)' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             anisotropic 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            20.861 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            14.583 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            -35.444 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1MPU 
_refine_analyze.Luzzati_coordinate_error_obs    0.37 
_refine_analyze.Luzzati_sigma_a_obs             0.50 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1029 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             105 
_refine_hist.number_atoms_total               1139 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.9   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.4  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.5 
_refine_ls_shell.d_res_low                        2.59 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.3623 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.5083 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             38 
_refine_ls_shell.number_reflns_obs                421 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1MPU 
_struct.title                     'Crystal Structure of the free human NKG2D immunoreceptor' 
_struct.pdbx_descriptor           'NKG2-D type II integral membrane protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MPU 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'C-type lectin-like domain, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is a homodimer is generated by the two-fold axis: 1/2+x, 1/2-y, 3/4-z.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 41 ? GLN A 52 ? ASN A 119 GLN A 130 1 ? 12 
HELX_P HELX_P2 2 GLN A 65 ? VAL A 71 ? GLN A 143 VAL A 149 5 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 18  SG ? ? ? 1_555 A CYS 27  SG ? ? A CYS 96  A CYS 105 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf2 disulf ? ? A CYS 21  SG ? ? ? 1_555 A CYS 32  SG ? ? A CYS 99  A CYS 110 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf3 disulf ? ? A CYS 49  SG ? ? ? 1_555 A CYS 133 SG ? ? A CYS 127 A CYS 211 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf4 disulf ? ? A CYS 111 SG ? ? ? 1_555 A CYS 125 SG ? ? A CYS 189 A CYS 203 1_555 ? ? ? ? ? ? ? 2.031 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 26  ? CYS A 27  ? ILE A 104 CYS A 105 
A 2 CYS A 32  ? LYS A 40  ? CYS A 110 LYS A 118 
A 3 ASN A 129 ? GLN A 135 ? ASN A 207 GLN A 213 
A 4 SER A 55  ? LEU A 56  ? SER A 133 LEU A 134 
B 1 TRP A 88  ? TRP A 90  ? TRP A 166 TRP A 168 
B 2 TYR A 74  ? HIS A 81  ? TYR A 152 HIS A 159 
B 3 CYS A 111 ? ALA A 115 ? CYS A 189 ALA A 193 
B 4 LYS A 119 ? GLU A 123 ? LYS A 197 GLU A 201 
B 5 THR A 102 ? ILE A 104 ? THR A 180 ILE A 182 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 26  ? N ILE A 104 O TYR A 33  ? O TYR A 111 
A 2 3 N PHE A 36  ? N PHE A 114 O TYR A 131 ? O TYR A 209 
A 3 4 O MET A 134 ? O MET A 212 N SER A 55  ? N SER A 133 
B 1 2 O GLN A 89  ? O GLN A 167 N VAL A 80  ? N VAL A 158 
B 2 3 N HIS A 75  ? N HIS A 153 O TYR A 114 ? O TYR A 192 
B 3 4 N LEU A 113 ? N LEU A 191 O TYR A 121 ? O TYR A 199 
B 4 5 O GLY A 120 ? O GLY A 198 N ILE A 104 ? N ILE A 182 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE PO4 A 500' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 LYS A 58 ? LYS A 136 . ? 1_555 ? 
2 AC1 6 ILE A 95 ? ILE A 173 . ? 1_555 ? 
3 AC1 6 SER A 97 ? SER A 175 . ? 1_555 ? 
4 AC1 6 HOH C .  ? HOH A 303 . ? 1_555 ? 
5 AC1 6 HOH C .  ? HOH A 340 . ? 1_555 ? 
6 AC1 6 HOH C .  ? HOH A 365 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1MPU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1MPU 
_atom_sites.fract_transf_matrix[1][1]   0.011409 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011409 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.027678 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 10  ? 39.701 59.966 -19.603 1.00 74.55 ? 88  GLN A N   1 
ATOM   2    C CA  . GLN A 1 10  ? 38.984 59.670 -18.326 1.00 74.11 ? 88  GLN A CA  1 
ATOM   3    C C   . GLN A 1 10  ? 38.712 58.167 -18.253 1.00 72.65 ? 88  GLN A C   1 
ATOM   4    O O   . GLN A 1 10  ? 37.628 57.699 -17.892 1.00 71.80 ? 88  GLN A O   1 
ATOM   5    C CB  . GLN A 1 10  ? 37.701 60.493 -18.272 1.00 75.84 ? 88  GLN A CB  1 
ATOM   6    C CG  . GLN A 1 10  ? 37.981 61.994 -18.381 1.00 78.58 ? 88  GLN A CG  1 
ATOM   7    C CD  . GLN A 1 10  ? 36.754 62.849 -18.129 1.00 81.03 ? 88  GLN A CD  1 
ATOM   8    O OE1 . GLN A 1 10  ? 35.649 62.334 -17.961 1.00 82.83 ? 88  GLN A OE1 1 
ATOM   9    N NE2 . GLN A 1 10  ? 36.944 64.166 -18.104 1.00 82.10 ? 88  GLN A NE2 1 
ATOM   10   N N   . ILE A 1 11  ? 39.781 57.461 -18.602 1.00 71.00 ? 89  ILE A N   1 
ATOM   11   C CA  . ILE A 1 11  ? 39.972 56.014 -18.704 1.00 69.15 ? 89  ILE A CA  1 
ATOM   12   C C   . ILE A 1 11  ? 39.516 55.014 -17.617 1.00 67.36 ? 89  ILE A C   1 
ATOM   13   O O   . ILE A 1 11  ? 39.076 55.415 -16.535 1.00 67.43 ? 89  ILE A O   1 
ATOM   14   C CB  . ILE A 1 11  ? 41.458 55.812 -18.979 1.00 69.10 ? 89  ILE A CB  1 
ATOM   15   C CG1 . ILE A 1 11  ? 42.257 56.750 -18.067 1.00 68.59 ? 89  ILE A CG1 1 
ATOM   16   C CG2 . ILE A 1 11  ? 41.754 56.129 -20.442 1.00 69.60 ? 89  ILE A CG2 1 
ATOM   17   C CD1 . ILE A 1 11  ? 43.751 56.656 -18.211 1.00 67.83 ? 89  ILE A CD1 1 
ATOM   18   N N   . PRO A 1 12  ? 39.640 53.688 -17.899 1.00 65.42 ? 90  PRO A N   1 
ATOM   19   C CA  . PRO A 1 12  ? 39.264 52.575 -17.013 1.00 63.71 ? 90  PRO A CA  1 
ATOM   20   C C   . PRO A 1 12  ? 39.820 52.661 -15.590 1.00 62.08 ? 90  PRO A C   1 
ATOM   21   O O   . PRO A 1 12  ? 41.008 52.417 -15.366 1.00 62.06 ? 90  PRO A O   1 
ATOM   22   C CB  . PRO A 1 12  ? 39.801 51.350 -17.758 1.00 64.11 ? 90  PRO A CB  1 
ATOM   23   C CG  . PRO A 1 12  ? 40.981 51.900 -18.491 1.00 63.79 ? 90  PRO A CG  1 
ATOM   24   C CD  . PRO A 1 12  ? 40.360 53.145 -19.067 1.00 64.44 ? 90  PRO A CD  1 
ATOM   25   N N   . LEU A 1 13  ? 38.960 52.982 -14.627 1.00 59.34 ? 91  LEU A N   1 
ATOM   26   C CA  . LEU A 1 13  ? 39.417 53.099 -13.251 1.00 56.92 ? 91  LEU A CA  1 
ATOM   27   C C   . LEU A 1 13  ? 39.834 51.724 -12.762 1.00 54.55 ? 91  LEU A C   1 
ATOM   28   O O   . LEU A 1 13  ? 39.178 50.728 -13.068 1.00 54.24 ? 91  LEU A O   1 
ATOM   29   C CB  . LEU A 1 13  ? 38.310 53.645 -12.340 1.00 57.53 ? 91  LEU A CB  1 
ATOM   30   C CG  . LEU A 1 13  ? 37.395 54.771 -12.837 1.00 60.18 ? 91  LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 13  ? 36.341 55.029 -11.763 1.00 62.28 ? 91  LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 13  ? 38.174 56.053 -13.131 1.00 61.08 ? 91  LEU A CD2 1 
ATOM   33   N N   . THR A 1 14  ? 40.945 51.670 -12.034 1.00 51.02 ? 92  THR A N   1 
ATOM   34   C CA  . THR A 1 14  ? 41.437 50.418 -11.468 1.00 46.09 ? 92  THR A CA  1 
ATOM   35   C C   . THR A 1 14  ? 41.226 50.548 -9.977  1.00 42.73 ? 92  THR A C   1 
ATOM   36   O O   . THR A 1 14  ? 41.080 51.657 -9.471  1.00 42.52 ? 92  THR A O   1 
ATOM   37   C CB  . THR A 1 14  ? 42.950 50.200 -11.724 1.00 46.10 ? 92  THR A CB  1 
ATOM   38   O OG1 . THR A 1 14  ? 43.676 51.394 -11.407 1.00 47.31 ? 92  THR A OG1 1 
ATOM   39   C CG2 . THR A 1 14  ? 43.206 49.818 -13.162 1.00 46.85 ? 92  THR A CG2 1 
ATOM   40   N N   . GLU A 1 15  ? 41.201 49.421 -9.277  1.00 39.63 ? 93  GLU A N   1 
ATOM   41   C CA  . GLU A 1 15  ? 41.027 49.422 -7.825  1.00 37.52 ? 93  GLU A CA  1 
ATOM   42   C C   . GLU A 1 15  ? 41.359 48.026 -7.292  1.00 36.30 ? 93  GLU A C   1 
ATOM   43   O O   . GLU A 1 15  ? 40.567 47.088 -7.423  1.00 35.18 ? 93  GLU A O   1 
ATOM   44   C CB  . GLU A 1 15  ? 39.589 49.824 -7.465  1.00 36.58 ? 93  GLU A CB  1 
ATOM   45   C CG  . GLU A 1 15  ? 39.477 50.730 -6.241  1.00 34.22 ? 93  GLU A CG  1 
ATOM   46   C CD  . GLU A 1 15  ? 40.145 52.102 -6.421  1.00 32.99 ? 93  GLU A CD  1 
ATOM   47   O OE1 . GLU A 1 15  ? 39.524 53.028 -6.977  1.00 28.71 ? 93  GLU A OE1 1 
ATOM   48   O OE2 . GLU A 1 15  ? 41.308 52.255 -6.004  1.00 32.95 ? 93  GLU A OE2 1 
ATOM   49   N N   . SER A 1 16  ? 42.545 47.897 -6.704  1.00 36.21 ? 94  SER A N   1 
ATOM   50   C CA  . SER A 1 16  ? 43.012 46.616 -6.176  1.00 36.25 ? 94  SER A CA  1 
ATOM   51   C C   . SER A 1 16  ? 43.669 46.778 -4.813  1.00 35.99 ? 94  SER A C   1 
ATOM   52   O O   . SER A 1 16  ? 44.199 47.830 -4.485  1.00 33.99 ? 94  SER A O   1 
ATOM   53   C CB  . SER A 1 16  ? 44.031 45.995 -7.132  1.00 36.12 ? 94  SER A CB  1 
ATOM   54   O OG  . SER A 1 16  ? 43.624 46.125 -8.482  1.00 37.03 ? 94  SER A OG  1 
ATOM   55   N N   . TYR A 1 17  ? 43.631 45.729 -4.008  1.00 37.74 ? 95  TYR A N   1 
ATOM   56   C CA  . TYR A 1 17  ? 44.261 45.807 -2.705  1.00 39.33 ? 95  TYR A CA  1 
ATOM   57   C C   . TYR A 1 17  ? 45.755 45.646 -2.957  1.00 40.24 ? 95  TYR A C   1 
ATOM   58   O O   . TYR A 1 17  ? 46.169 45.396 -4.092  1.00 41.21 ? 95  TYR A O   1 
ATOM   59   C CB  . TYR A 1 17  ? 43.730 44.694 -1.793  1.00 39.84 ? 95  TYR A CB  1 
ATOM   60   C CG  . TYR A 1 17  ? 42.394 45.014 -1.149  1.00 38.98 ? 95  TYR A CG  1 
ATOM   61   C CD1 . TYR A 1 17  ? 42.296 45.984 -0.154  1.00 38.69 ? 95  TYR A CD1 1 
ATOM   62   C CD2 . TYR A 1 17  ? 41.227 44.354 -1.536  1.00 40.50 ? 95  TYR A CD2 1 
ATOM   63   C CE1 . TYR A 1 17  ? 41.067 46.296 0.445   1.00 38.14 ? 95  TYR A CE1 1 
ATOM   64   C CE2 . TYR A 1 17  ? 39.985 44.661 -0.940  1.00 39.45 ? 95  TYR A CE2 1 
ATOM   65   C CZ  . TYR A 1 17  ? 39.920 45.634 0.050   1.00 37.63 ? 95  TYR A CZ  1 
ATOM   66   O OH  . TYR A 1 17  ? 38.720 45.954 0.644   1.00 35.22 ? 95  TYR A OH  1 
ATOM   67   N N   . CYS A 1 18  ? 46.571 45.812 -1.921  1.00 39.10 ? 96  CYS A N   1 
ATOM   68   C CA  . CYS A 1 18  ? 48.012 45.654 -2.084  1.00 37.85 ? 96  CYS A CA  1 
ATOM   69   C C   . CYS A 1 18  ? 48.559 44.555 -1.132  1.00 38.67 ? 96  CYS A C   1 
ATOM   70   O O   . CYS A 1 18  ? 48.641 44.759 0.081   1.00 37.58 ? 96  CYS A O   1 
ATOM   71   C CB  . CYS A 1 18  ? 48.688 47.021 -1.876  1.00 37.28 ? 96  CYS A CB  1 
ATOM   72   S SG  . CYS A 1 18  ? 50.477 47.154 -2.213  1.00 34.77 ? 96  CYS A SG  1 
ATOM   73   N N   . GLY A 1 19  ? 48.892 43.396 -1.730  1.00 40.55 ? 97  GLY A N   1 
ATOM   74   C CA  . GLY A 1 19  ? 49.416 42.183 -1.069  1.00 40.30 ? 97  GLY A CA  1 
ATOM   75   C C   . GLY A 1 19  ? 49.698 42.242 0.420   1.00 41.00 ? 97  GLY A C   1 
ATOM   76   O O   . GLY A 1 19  ? 50.484 43.088 0.822   1.00 44.16 ? 97  GLY A O   1 
ATOM   77   N N   . PRO A 1 20  ? 49.198 41.304 1.249   1.00 40.02 ? 98  PRO A N   1 
ATOM   78   C CA  . PRO A 1 20  ? 49.548 41.549 2.656   1.00 38.43 ? 98  PRO A CA  1 
ATOM   79   C C   . PRO A 1 20  ? 50.902 42.147 3.035   1.00 36.03 ? 98  PRO A C   1 
ATOM   80   O O   . PRO A 1 20  ? 51.973 41.756 2.547   1.00 35.77 ? 98  PRO A O   1 
ATOM   81   C CB  . PRO A 1 20  ? 49.282 40.215 3.371   1.00 38.42 ? 98  PRO A CB  1 
ATOM   82   C CG  . PRO A 1 20  ? 49.049 39.214 2.326   1.00 40.37 ? 98  PRO A CG  1 
ATOM   83   C CD  . PRO A 1 20  ? 49.084 39.864 0.959   1.00 39.93 ? 98  PRO A CD  1 
ATOM   84   N N   . CYS A 1 21  ? 50.782 43.135 3.912   1.00 33.00 ? 99  CYS A N   1 
ATOM   85   C CA  . CYS A 1 21  ? 51.878 43.890 4.494   1.00 31.90 ? 99  CYS A CA  1 
ATOM   86   C C   . CYS A 1 21  ? 51.615 44.016 5.983   1.00 33.11 ? 99  CYS A C   1 
ATOM   87   O O   . CYS A 1 21  ? 50.489 43.825 6.455   1.00 32.24 ? 99  CYS A O   1 
ATOM   88   C CB  . CYS A 1 21  ? 51.932 45.296 3.922   1.00 29.06 ? 99  CYS A CB  1 
ATOM   89   S SG  . CYS A 1 21  ? 52.700 45.375 2.299   1.00 24.38 ? 99  CYS A SG  1 
ATOM   90   N N   . PRO A 1 22  ? 52.659 44.318 6.757   1.00 34.66 ? 100 PRO A N   1 
ATOM   91   C CA  . PRO A 1 22  ? 52.375 44.448 8.187   1.00 36.69 ? 100 PRO A CA  1 
ATOM   92   C C   . PRO A 1 22  ? 51.396 45.608 8.375   1.00 38.06 ? 100 PRO A C   1 
ATOM   93   O O   . PRO A 1 22  ? 51.096 46.327 7.421   1.00 39.99 ? 100 PRO A O   1 
ATOM   94   C CB  . PRO A 1 22  ? 53.749 44.739 8.778   1.00 36.31 ? 100 PRO A CB  1 
ATOM   95   C CG  . PRO A 1 22  ? 54.656 43.928 7.891   1.00 35.67 ? 100 PRO A CG  1 
ATOM   96   C CD  . PRO A 1 22  ? 54.108 44.226 6.507   1.00 34.68 ? 100 PRO A CD  1 
ATOM   97   N N   . LYS A 1 23  ? 50.908 45.800 9.594   1.00 38.70 ? 101 LYS A N   1 
ATOM   98   C CA  . LYS A 1 23  ? 49.950 46.876 9.875   1.00 39.15 ? 101 LYS A CA  1 
ATOM   99   C C   . LYS A 1 23  ? 50.546 48.293 9.757   1.00 38.44 ? 101 LYS A C   1 
ATOM   100  O O   . LYS A 1 23  ? 51.621 48.579 10.292  1.00 38.24 ? 101 LYS A O   1 
ATOM   101  C CB  . LYS A 1 23  ? 49.344 46.674 11.277  1.00 39.15 ? 101 LYS A CB  1 
ATOM   102  C CG  . LYS A 1 23  ? 48.333 47.738 11.710  1.00 39.48 ? 101 LYS A CG  1 
ATOM   103  C CD  . LYS A 1 23  ? 46.894 47.387 11.308  1.00 40.46 ? 101 LYS A CD  1 
ATOM   104  C CE  . LYS A 1 23  ? 45.918 48.515 11.668  1.00 40.37 ? 101 LYS A CE  1 
ATOM   105  N NZ  . LYS A 1 23  ? 44.487 48.120 11.489  1.00 42.21 ? 101 LYS A NZ  1 
ATOM   106  N N   . ASN A 1 24  ? 49.834 49.169 9.049   1.00 37.69 ? 102 ASN A N   1 
ATOM   107  C CA  . ASN A 1 24  ? 50.244 50.566 8.850   1.00 35.96 ? 102 ASN A CA  1 
ATOM   108  C C   . ASN A 1 24  ? 51.543 50.773 8.078   1.00 33.20 ? 102 ASN A C   1 
ATOM   109  O O   . ASN A 1 24  ? 52.123 51.854 8.124   1.00 33.56 ? 102 ASN A O   1 
ATOM   110  C CB  . ASN A 1 24  ? 50.362 51.299 10.191  1.00 37.19 ? 102 ASN A CB  1 
ATOM   111  C CG  . ASN A 1 24  ? 49.066 51.296 10.978  1.00 40.71 ? 102 ASN A CG  1 
ATOM   112  O OD1 . ASN A 1 24  ? 47.971 51.351 10.407  1.00 41.29 ? 102 ASN A OD1 1 
ATOM   113  N ND2 . ASN A 1 24  ? 49.184 51.250 12.305  1.00 41.75 ? 102 ASN A ND2 1 
ATOM   114  N N   . TRP A 1 25  ? 52.003 49.745 7.381   1.00 30.27 ? 103 TRP A N   1 
ATOM   115  C CA  . TRP A 1 25  ? 53.230 49.848 6.594   1.00 28.83 ? 103 TRP A CA  1 
ATOM   116  C C   . TRP A 1 25  ? 52.913 50.420 5.217   1.00 26.53 ? 103 TRP A C   1 
ATOM   117  O O   . TRP A 1 25  ? 51.752 50.532 4.834   1.00 24.78 ? 103 TRP A O   1 
ATOM   118  C CB  . TRP A 1 25  ? 53.873 48.466 6.424   1.00 29.87 ? 103 TRP A CB  1 
ATOM   119  C CG  . TRP A 1 25  ? 54.772 48.066 7.543   1.00 30.83 ? 103 TRP A CG  1 
ATOM   120  C CD1 . TRP A 1 25  ? 54.552 48.237 8.878   1.00 31.78 ? 103 TRP A CD1 1 
ATOM   121  C CD2 . TRP A 1 25  ? 56.035 47.408 7.427   1.00 31.85 ? 103 TRP A CD2 1 
ATOM   122  N NE1 . TRP A 1 25  ? 55.602 47.725 9.601   1.00 31.28 ? 103 TRP A NE1 1 
ATOM   123  C CE2 . TRP A 1 25  ? 56.530 47.207 8.731   1.00 30.16 ? 103 TRP A CE2 1 
ATOM   124  C CE3 . TRP A 1 25  ? 56.806 46.963 6.338   1.00 31.35 ? 103 TRP A CE3 1 
ATOM   125  C CZ2 . TRP A 1 25  ? 57.751 46.587 8.988   1.00 30.48 ? 103 TRP A CZ2 1 
ATOM   126  C CZ3 . TRP A 1 25  ? 58.025 46.346 6.593   1.00 29.51 ? 103 TRP A CZ3 1 
ATOM   127  C CH2 . TRP A 1 25  ? 58.484 46.164 7.906   1.00 29.91 ? 103 TRP A CH2 1 
ATOM   128  N N   . ILE A 1 26  ? 53.944 50.792 4.476   1.00 25.07 ? 104 ILE A N   1 
ATOM   129  C CA  . ILE A 1 26  ? 53.724 51.316 3.143   1.00 25.93 ? 104 ILE A CA  1 
ATOM   130  C C   . ILE A 1 26  ? 53.682 50.149 2.182   1.00 26.63 ? 104 ILE A C   1 
ATOM   131  O O   . ILE A 1 26  ? 54.534 49.267 2.244   1.00 28.60 ? 104 ILE A O   1 
ATOM   132  C CB  . ILE A 1 26  ? 54.849 52.230 2.683   1.00 24.47 ? 104 ILE A CB  1 
ATOM   133  C CG1 . ILE A 1 26  ? 54.827 53.531 3.480   1.00 22.57 ? 104 ILE A CG1 1 
ATOM   134  C CG2 . ILE A 1 26  ? 54.711 52.482 1.190   1.00 24.26 ? 104 ILE A CG2 1 
ATOM   135  C CD1 . ILE A 1 26  ? 55.834 54.555 2.981   1.00 24.54 ? 104 ILE A CD1 1 
ATOM   136  N N   . CYS A 1 27  ? 52.698 50.137 1.294   1.00 28.20 ? 105 CYS A N   1 
ATOM   137  C CA  . CYS A 1 27  ? 52.593 49.057 0.314   1.00 29.73 ? 105 CYS A CA  1 
ATOM   138  C C   . CYS A 1 27  ? 52.761 49.568 -1.129  1.00 29.98 ? 105 CYS A C   1 
ATOM   139  O O   . CYS A 1 27  ? 52.147 50.564 -1.516  1.00 27.93 ? 105 CYS A O   1 
ATOM   140  C CB  . CYS A 1 27  ? 51.249 48.357 0.457   1.00 29.09 ? 105 CYS A CB  1 
ATOM   141  S SG  . CYS A 1 27  ? 51.219 46.748 -0.375  1.00 31.97 ? 105 CYS A SG  1 
ATOM   142  N N   . TYR A 1 28  ? 53.590 48.890 -1.920  1.00 31.50 ? 106 TYR A N   1 
ATOM   143  C CA  . TYR A 1 28  ? 53.815 49.309 -3.306  1.00 34.32 ? 106 TYR A CA  1 
ATOM   144  C C   . TYR A 1 28  ? 54.269 48.152 -4.197  1.00 34.81 ? 106 TYR A C   1 
ATOM   145  O O   . TYR A 1 28  ? 55.205 47.434 -3.847  1.00 34.74 ? 106 TYR A O   1 
ATOM   146  C CB  . TYR A 1 28  ? 54.861 50.432 -3.339  1.00 34.83 ? 106 TYR A CB  1 
ATOM   147  C CG  . TYR A 1 28  ? 55.157 50.967 -4.721  1.00 35.53 ? 106 TYR A CG  1 
ATOM   148  C CD1 . TYR A 1 28  ? 54.228 51.752 -5.401  1.00 37.11 ? 106 TYR A CD1 1 
ATOM   149  C CD2 . TYR A 1 28  ? 56.356 50.669 -5.360  1.00 35.99 ? 106 TYR A CD2 1 
ATOM   150  C CE1 . TYR A 1 28  ? 54.490 52.225 -6.689  1.00 37.63 ? 106 TYR A CE1 1 
ATOM   151  C CE2 . TYR A 1 28  ? 56.625 51.132 -6.640  1.00 37.51 ? 106 TYR A CE2 1 
ATOM   152  C CZ  . TYR A 1 28  ? 55.692 51.908 -7.300  1.00 37.47 ? 106 TYR A CZ  1 
ATOM   153  O OH  . TYR A 1 28  ? 55.977 52.364 -8.565  1.00 38.02 ? 106 TYR A OH  1 
ATOM   154  N N   . LYS A 1 29  ? 53.621 47.995 -5.354  1.00 36.72 ? 107 LYS A N   1 
ATOM   155  C CA  . LYS A 1 29  ? 53.932 46.914 -6.305  1.00 39.37 ? 107 LYS A CA  1 
ATOM   156  C C   . LYS A 1 29  ? 54.319 45.632 -5.560  1.00 40.95 ? 107 LYS A C   1 
ATOM   157  O O   . LYS A 1 29  ? 55.288 44.945 -5.902  1.00 41.10 ? 107 LYS A O   1 
ATOM   158  C CB  . LYS A 1 29  ? 55.050 47.336 -7.272  1.00 38.03 ? 107 LYS A CB  1 
ATOM   159  C CG  . LYS A 1 29  ? 54.662 48.483 -8.201  1.00 39.09 ? 107 LYS A CG  1 
ATOM   160  C CD  . LYS A 1 29  ? 55.773 48.816 -9.179  1.00 41.07 ? 107 LYS A CD  1 
ATOM   161  C CE  . LYS A 1 29  ? 55.366 49.956 -10.101 1.00 41.18 ? 107 LYS A CE  1 
ATOM   162  N NZ  . LYS A 1 29  ? 56.345 50.195 -11.207 1.00 42.76 ? 107 LYS A NZ  1 
ATOM   163  N N   . ASN A 1 30  ? 53.529 45.340 -4.531  1.00 42.55 ? 108 ASN A N   1 
ATOM   164  C CA  . ASN A 1 30  ? 53.696 44.175 -3.669  1.00 44.05 ? 108 ASN A CA  1 
ATOM   165  C C   . ASN A 1 30  ? 55.068 44.080 -3.017  1.00 43.04 ? 108 ASN A C   1 
ATOM   166  O O   . ASN A 1 30  ? 55.870 43.225 -3.371  1.00 44.97 ? 108 ASN A O   1 
ATOM   167  C CB  . ASN A 1 30  ? 53.395 42.885 -4.434  1.00 46.43 ? 108 ASN A CB  1 
ATOM   168  C CG  . ASN A 1 30  ? 51.947 42.800 -4.883  1.00 48.35 ? 108 ASN A CG  1 
ATOM   169  O OD1 . ASN A 1 30  ? 51.022 43.140 -4.133  1.00 46.87 ? 108 ASN A OD1 1 
ATOM   170  N ND2 . ASN A 1 30  ? 51.743 42.335 -6.105  1.00 48.72 ? 108 ASN A ND2 1 
ATOM   171  N N   . ASN A 1 31  ? 55.304 44.979 -2.069  1.00 39.55 ? 109 ASN A N   1 
ATOM   172  C CA  . ASN A 1 31  ? 56.527 45.074 -1.289  1.00 35.50 ? 109 ASN A CA  1 
ATOM   173  C C   . ASN A 1 31  ? 56.085 45.993 -0.166  1.00 32.62 ? 109 ASN A C   1 
ATOM   174  O O   . ASN A 1 31  ? 55.310 46.924 -0.379  1.00 31.38 ? 109 ASN A O   1 
ATOM   175  C CB  . ASN A 1 31  ? 57.670 45.692 -2.106  1.00 34.96 ? 109 ASN A CB  1 
ATOM   176  C CG  . ASN A 1 31  ? 58.478 44.650 -2.860  1.00 34.15 ? 109 ASN A CG  1 
ATOM   177  O OD1 . ASN A 1 31  ? 59.006 44.919 -3.935  1.00 34.67 ? 109 ASN A OD1 1 
ATOM   178  N ND2 . ASN A 1 31  ? 58.585 43.454 -2.291  1.00 32.56 ? 109 ASN A ND2 1 
ATOM   179  N N   . CYS A 1 32  ? 56.554 45.713 1.035   1.00 30.41 ? 110 CYS A N   1 
ATOM   180  C CA  . CYS A 1 32  ? 56.152 46.494 2.183   1.00 28.64 ? 110 CYS A CA  1 
ATOM   181  C C   . CYS A 1 32  ? 57.308 47.267 2.792   1.00 28.37 ? 110 CYS A C   1 
ATOM   182  O O   . CYS A 1 32  ? 58.358 46.703 3.087   1.00 26.68 ? 110 CYS A O   1 
ATOM   183  C CB  . CYS A 1 32  ? 55.558 45.564 3.233   1.00 28.83 ? 110 CYS A CB  1 
ATOM   184  S SG  . CYS A 1 32  ? 54.398 44.315 2.600   1.00 25.90 ? 110 CYS A SG  1 
ATOM   185  N N   . TYR A 1 33  ? 57.099 48.559 3.001   1.00 28.23 ? 111 TYR A N   1 
ATOM   186  C CA  . TYR A 1 33  ? 58.130 49.399 3.572   1.00 27.97 ? 111 TYR A CA  1 
ATOM   187  C C   . TYR A 1 33  ? 57.691 50.101 4.842   1.00 29.07 ? 111 TYR A C   1 
ATOM   188  O O   . TYR A 1 33  ? 56.509 50.358 5.056   1.00 30.56 ? 111 TYR A O   1 
ATOM   189  C CB  . TYR A 1 33  ? 58.573 50.433 2.550   1.00 25.40 ? 111 TYR A CB  1 
ATOM   190  C CG  . TYR A 1 33  ? 58.929 49.840 1.209   1.00 25.45 ? 111 TYR A CG  1 
ATOM   191  C CD1 . TYR A 1 33  ? 57.955 49.626 0.244   1.00 24.40 ? 111 TYR A CD1 1 
ATOM   192  C CD2 . TYR A 1 33  ? 60.243 49.513 0.896   1.00 25.80 ? 111 TYR A CD2 1 
ATOM   193  C CE1 . TYR A 1 33  ? 58.271 49.116 -0.997  1.00 24.11 ? 111 TYR A CE1 1 
ATOM   194  C CE2 . TYR A 1 33  ? 60.572 48.987 -0.354  1.00 27.45 ? 111 TYR A CE2 1 
ATOM   195  C CZ  . TYR A 1 33  ? 59.577 48.796 -1.298  1.00 26.17 ? 111 TYR A CZ  1 
ATOM   196  O OH  . TYR A 1 33  ? 59.887 48.291 -2.546  1.00 26.90 ? 111 TYR A OH  1 
ATOM   197  N N   . GLN A 1 34  ? 58.665 50.371 5.696   1.00 29.84 ? 112 GLN A N   1 
ATOM   198  C CA  . GLN A 1 34  ? 58.437 51.083 6.937   1.00 30.93 ? 112 GLN A CA  1 
ATOM   199  C C   . GLN A 1 34  ? 59.701 51.880 7.279   1.00 30.97 ? 112 GLN A C   1 
ATOM   200  O O   . GLN A 1 34  ? 60.818 51.357 7.358   1.00 29.58 ? 112 GLN A O   1 
ATOM   201  C CB  . GLN A 1 34  ? 58.032 50.144 8.075   1.00 32.30 ? 112 GLN A CB  1 
ATOM   202  C CG  . GLN A 1 34  ? 57.488 50.882 9.320   1.00 36.83 ? 112 GLN A CG  1 
ATOM   203  C CD  . GLN A 1 34  ? 56.224 51.705 9.049   1.00 40.69 ? 112 GLN A CD  1 
ATOM   204  O OE1 . GLN A 1 34  ? 56.046 52.247 7.962   1.00 44.45 ? 112 GLN A OE1 1 
ATOM   205  N NE2 . GLN A 1 34  ? 55.356 51.813 10.051  1.00 41.79 ? 112 GLN A NE2 1 
ATOM   206  N N   A PHE A 1 35  ? 59.481 53.163 7.499   0.50 30.53 ? 113 PHE A N   1 
ATOM   207  N N   B PHE A 1 35  ? 59.475 53.173 7.473   0.50 30.64 ? 113 PHE A N   1 
ATOM   208  C CA  A PHE A 1 35  ? 60.484 54.168 7.792   0.50 30.73 ? 113 PHE A CA  1 
ATOM   209  C CA  B PHE A 1 35  ? 60.513 54.134 7.780   0.50 30.93 ? 113 PHE A CA  1 
ATOM   210  C C   A PHE A 1 35  ? 60.572 54.485 9.278   0.50 31.62 ? 113 PHE A C   1 
ATOM   211  C C   B PHE A 1 35  ? 60.577 54.482 9.267   0.50 31.73 ? 113 PHE A C   1 
ATOM   212  O O   A PHE A 1 35  ? 59.706 55.170 9.811   0.50 32.79 ? 113 PHE A O   1 
ATOM   213  O O   B PHE A 1 35  ? 59.705 55.175 9.786   0.50 32.87 ? 113 PHE A O   1 
ATOM   214  C CB  A PHE A 1 35  ? 60.084 55.420 7.017   0.50 31.47 ? 113 PHE A CB  1 
ATOM   215  C CB  B PHE A 1 35  ? 60.252 55.386 6.945   0.50 31.99 ? 113 PHE A CB  1 
ATOM   216  C CG  A PHE A 1 35  ? 58.578 55.622 6.941   0.50 31.91 ? 113 PHE A CG  1 
ATOM   217  C CG  B PHE A 1 35  ? 60.467 55.182 5.465   0.50 32.68 ? 113 PHE A CG  1 
ATOM   218  C CD1 A PHE A 1 35  ? 57.716 54.534 6.762   0.50 31.07 ? 113 PHE A CD1 1 
ATOM   219  C CD1 B PHE A 1 35  ? 61.660 55.580 4.884   0.50 33.09 ? 113 PHE A CD1 1 
ATOM   220  C CD2 A PHE A 1 35  ? 58.017 56.878 7.088   0.50 31.39 ? 113 PHE A CD2 1 
ATOM   221  C CD2 B PHE A 1 35  ? 59.488 54.603 4.654   0.50 32.01 ? 113 PHE A CD2 1 
ATOM   222  C CE1 A PHE A 1 35  ? 56.343 54.690 6.740   0.50 29.70 ? 113 PHE A CE1 1 
ATOM   223  C CE1 B PHE A 1 35  ? 61.888 55.403 3.530   0.50 33.86 ? 113 PHE A CE1 1 
ATOM   224  C CE2 A PHE A 1 35  ? 56.635 57.041 7.064   0.50 30.76 ? 113 PHE A CE2 1 
ATOM   225  C CE2 B PHE A 1 35  ? 59.714 54.416 3.282   0.50 32.93 ? 113 PHE A CE2 1 
ATOM   226  C CZ  A PHE A 1 35  ? 55.800 55.944 6.893   0.50 29.69 ? 113 PHE A CZ  1 
ATOM   227  C CZ  B PHE A 1 35  ? 60.917 54.823 2.722   0.50 33.85 ? 113 PHE A CZ  1 
ATOM   228  N N   . PHE A 1 36  ? 61.635 54.030 9.936   1.00 32.42 ? 114 PHE A N   1 
ATOM   229  C CA  . PHE A 1 36  ? 61.813 54.284 11.369  1.00 33.61 ? 114 PHE A CA  1 
ATOM   230  C C   . PHE A 1 36  ? 62.717 55.465 11.669  1.00 36.54 ? 114 PHE A C   1 
ATOM   231  O O   . PHE A 1 36  ? 63.870 55.509 11.233  1.00 38.67 ? 114 PHE A O   1 
ATOM   232  C CB  . PHE A 1 36  ? 62.363 53.039 12.062  1.00 32.99 ? 114 PHE A CB  1 
ATOM   233  C CG  . PHE A 1 36  ? 61.414 51.883 12.052  1.00 33.35 ? 114 PHE A CG  1 
ATOM   234  C CD1 . PHE A 1 36  ? 61.210 51.140 10.893  1.00 32.00 ? 114 PHE A CD1 1 
ATOM   235  C CD2 . PHE A 1 36  ? 60.684 51.564 13.192  1.00 33.79 ? 114 PHE A CD2 1 
ATOM   236  C CE1 . PHE A 1 36  ? 60.288 50.105 10.865  1.00 32.42 ? 114 PHE A CE1 1 
ATOM   237  C CE2 . PHE A 1 36  ? 59.756 50.531 13.176  1.00 33.70 ? 114 PHE A CE2 1 
ATOM   238  C CZ  . PHE A 1 36  ? 59.559 49.798 12.011  1.00 34.89 ? 114 PHE A CZ  1 
ATOM   239  N N   . ASP A 1 37  ? 62.207 56.424 12.425  1.00 38.83 ? 115 ASP A N   1 
ATOM   240  C CA  . ASP A 1 37  ? 63.009 57.586 12.739  1.00 42.93 ? 115 ASP A CA  1 
ATOM   241  C C   . ASP A 1 37  ? 63.745 57.459 14.057  1.00 44.59 ? 115 ASP A C   1 
ATOM   242  O O   . ASP A 1 37  ? 64.406 58.399 14.477  1.00 46.83 ? 115 ASP A O   1 
ATOM   243  C CB  . ASP A 1 37  ? 62.156 58.866 12.739  1.00 45.08 ? 115 ASP A CB  1 
ATOM   244  C CG  . ASP A 1 37  ? 61.172 58.925 13.896  1.00 48.29 ? 115 ASP A CG  1 
ATOM   245  O OD1 . ASP A 1 37  ? 61.568 58.639 15.050  1.00 48.59 ? 115 ASP A OD1 1 
ATOM   246  O OD2 . ASP A 1 37  ? 59.997 59.282 13.651  1.00 50.79 ? 115 ASP A OD2 1 
ATOM   247  N N   . GLU A 1 38  ? 63.641 56.310 14.714  1.00 45.98 ? 116 GLU A N   1 
ATOM   248  C CA  . GLU A 1 38  ? 64.343 56.128 15.981  1.00 48.64 ? 116 GLU A CA  1 
ATOM   249  C C   . GLU A 1 38  ? 65.808 55.689 15.796  1.00 49.04 ? 116 GLU A C   1 
ATOM   250  O O   . GLU A 1 38  ? 66.161 54.547 16.084  1.00 50.21 ? 116 GLU A O   1 
ATOM   251  C CB  . GLU A 1 38  ? 63.601 55.117 16.863  1.00 51.28 ? 116 GLU A CB  1 
ATOM   252  C CG  . GLU A 1 38  ? 62.728 55.755 17.949  1.00 56.39 ? 116 GLU A CG  1 
ATOM   253  C CD  . GLU A 1 38  ? 61.317 56.090 17.484  1.00 58.77 ? 116 GLU A CD  1 
ATOM   254  O OE1 . GLU A 1 38  ? 60.731 57.049 18.034  1.00 60.22 ? 116 GLU A OE1 1 
ATOM   255  O OE2 . GLU A 1 38  ? 60.789 55.388 16.590  1.00 59.74 ? 116 GLU A OE2 1 
ATOM   256  N N   . SER A 1 39  ? 66.646 56.606 15.318  1.00 47.65 ? 117 SER A N   1 
ATOM   257  C CA  . SER A 1 39  ? 68.076 56.369 15.083  1.00 47.04 ? 117 SER A CA  1 
ATOM   258  C C   . SER A 1 39  ? 68.765 55.296 15.938  1.00 45.76 ? 117 SER A C   1 
ATOM   259  O O   . SER A 1 39  ? 68.749 55.355 17.169  1.00 46.18 ? 117 SER A O   1 
ATOM   260  C CB  . SER A 1 39  ? 68.832 57.686 15.247  1.00 47.58 ? 117 SER A CB  1 
ATOM   261  O OG  . SER A 1 39  ? 70.081 57.474 15.883  1.00 51.22 ? 117 SER A OG  1 
ATOM   262  N N   . LYS A 1 40  ? 69.393 54.337 15.266  1.00 44.24 ? 118 LYS A N   1 
ATOM   263  C CA  . LYS A 1 40  ? 70.102 53.240 15.919  1.00 43.43 ? 118 LYS A CA  1 
ATOM   264  C C   . LYS A 1 40  ? 71.248 52.822 15.007  1.00 42.67 ? 118 LYS A C   1 
ATOM   265  O O   . LYS A 1 40  ? 71.223 53.115 13.809  1.00 42.46 ? 118 LYS A O   1 
ATOM   266  C CB  . LYS A 1 40  ? 69.173 52.044 16.110  1.00 44.25 ? 118 LYS A CB  1 
ATOM   267  C CG  . LYS A 1 40  ? 67.872 52.361 16.804  1.00 47.42 ? 118 LYS A CG  1 
ATOM   268  C CD  . LYS A 1 40  ? 66.968 51.138 16.875  1.00 51.11 ? 118 LYS A CD  1 
ATOM   269  C CE  . LYS A 1 40  ? 65.579 51.518 17.371  1.00 53.94 ? 118 LYS A CE  1 
ATOM   270  N NZ  . LYS A 1 40  ? 64.670 50.337 17.459  1.00 58.10 ? 118 LYS A NZ  1 
ATOM   271  N N   . ASN A 1 41  ? 72.257 52.146 15.555  1.00 41.62 ? 119 ASN A N   1 
ATOM   272  C CA  . ASN A 1 41  ? 73.359 51.706 14.710  1.00 40.10 ? 119 ASN A CA  1 
ATOM   273  C C   . ASN A 1 41  ? 72.803 50.648 13.771  1.00 39.70 ? 119 ASN A C   1 
ATOM   274  O O   . ASN A 1 41  ? 71.652 50.227 13.911  1.00 39.08 ? 119 ASN A O   1 
ATOM   275  C CB  . ASN A 1 41  ? 74.526 51.150 15.534  1.00 38.84 ? 119 ASN A CB  1 
ATOM   276  C CG  . ASN A 1 41  ? 74.129 49.984 16.408  1.00 39.43 ? 119 ASN A CG  1 
ATOM   277  O OD1 . ASN A 1 41  ? 73.528 49.019 15.940  1.00 38.18 ? 119 ASN A OD1 1 
ATOM   278  N ND2 . ASN A 1 41  ? 74.482 50.057 17.689  1.00 38.35 ? 119 ASN A ND2 1 
ATOM   279  N N   . TRP A 1 42  ? 73.613 50.224 12.812  1.00 39.78 ? 120 TRP A N   1 
ATOM   280  C CA  . TRP A 1 42  ? 73.167 49.242 11.829  1.00 39.12 ? 120 TRP A CA  1 
ATOM   281  C C   . TRP A 1 42  ? 72.735 47.908 12.433  1.00 38.27 ? 120 TRP A C   1 
ATOM   282  O O   . TRP A 1 42  ? 71.797 47.283 11.947  1.00 37.80 ? 120 TRP A O   1 
ATOM   283  C CB  . TRP A 1 42  ? 74.266 49.006 10.790  1.00 37.35 ? 120 TRP A CB  1 
ATOM   284  C CG  . TRP A 1 42  ? 73.825 48.164 9.644   1.00 35.26 ? 120 TRP A CG  1 
ATOM   285  C CD1 . TRP A 1 42  ? 73.461 48.595 8.397   1.00 34.52 ? 120 TRP A CD1 1 
ATOM   286  C CD2 . TRP A 1 42  ? 73.684 46.737 9.635   1.00 35.53 ? 120 TRP A CD2 1 
ATOM   287  N NE1 . TRP A 1 42  ? 73.105 47.522 7.612   1.00 35.29 ? 120 TRP A NE1 1 
ATOM   288  C CE2 . TRP A 1 42  ? 73.232 46.371 8.346   1.00 35.29 ? 120 TRP A CE2 1 
ATOM   289  C CE3 . TRP A 1 42  ? 73.897 45.731 10.592  1.00 34.90 ? 120 TRP A CE3 1 
ATOM   290  C CZ2 . TRP A 1 42  ? 72.987 45.034 7.990   1.00 34.88 ? 120 TRP A CZ2 1 
ATOM   291  C CZ3 . TRP A 1 42  ? 73.654 44.406 10.235  1.00 33.38 ? 120 TRP A CZ3 1 
ATOM   292  C CH2 . TRP A 1 42  ? 73.203 44.071 8.945   1.00 33.39 ? 120 TRP A CH2 1 
ATOM   293  N N   . TYR A 1 43  ? 73.422 47.466 13.478  1.00 38.12 ? 121 TYR A N   1 
ATOM   294  C CA  . TYR A 1 43  ? 73.083 46.200 14.122  1.00 37.82 ? 121 TYR A CA  1 
ATOM   295  C C   . TYR A 1 43  ? 71.722 46.289 14.809  1.00 37.43 ? 121 TYR A C   1 
ATOM   296  O O   . TYR A 1 43  ? 70.825 45.492 14.524  1.00 36.29 ? 121 TYR A O   1 
ATOM   297  C CB  . TYR A 1 43  ? 74.156 45.822 15.144  1.00 38.43 ? 121 TYR A CB  1 
ATOM   298  C CG  . TYR A 1 43  ? 75.553 45.773 14.575  1.00 38.27 ? 121 TYR A CG  1 
ATOM   299  C CD1 . TYR A 1 43  ? 76.507 46.719 14.949  1.00 37.78 ? 121 TYR A CD1 1 
ATOM   300  C CD2 . TYR A 1 43  ? 75.921 44.783 13.656  1.00 38.85 ? 121 TYR A CD2 1 
ATOM   301  C CE1 . TYR A 1 43  ? 77.798 46.684 14.427  1.00 40.49 ? 121 TYR A CE1 1 
ATOM   302  C CE2 . TYR A 1 43  ? 77.210 44.736 13.124  1.00 40.18 ? 121 TYR A CE2 1 
ATOM   303  C CZ  . TYR A 1 43  ? 78.142 45.689 13.515  1.00 41.07 ? 121 TYR A CZ  1 
ATOM   304  O OH  . TYR A 1 43  ? 79.423 45.635 13.016  1.00 43.36 ? 121 TYR A OH  1 
ATOM   305  N N   . GLU A 1 44  ? 71.583 47.252 15.719  1.00 37.39 ? 122 GLU A N   1 
ATOM   306  C CA  . GLU A 1 44  ? 70.329 47.475 16.432  1.00 38.75 ? 122 GLU A CA  1 
ATOM   307  C C   . GLU A 1 44  ? 69.234 47.633 15.381  1.00 39.50 ? 122 GLU A C   1 
ATOM   308  O O   . GLU A 1 44  ? 68.088 47.211 15.568  1.00 39.15 ? 122 GLU A O   1 
ATOM   309  C CB  . GLU A 1 44  ? 70.395 48.768 17.252  1.00 39.36 ? 122 GLU A CB  1 
ATOM   310  C CG  . GLU A 1 44  ? 71.195 48.709 18.540  1.00 41.00 ? 122 GLU A CG  1 
ATOM   311  C CD  . GLU A 1 44  ? 71.304 50.076 19.217  1.00 42.78 ? 122 GLU A CD  1 
ATOM   312  O OE1 . GLU A 1 44  ? 71.992 50.968 18.660  1.00 41.97 ? 122 GLU A OE1 1 
ATOM   313  O OE2 . GLU A 1 44  ? 70.696 50.262 20.299  1.00 41.86 ? 122 GLU A OE2 1 
ATOM   314  N N   . SER A 1 45  ? 69.611 48.255 14.272  1.00 39.35 ? 123 SER A N   1 
ATOM   315  C CA  . SER A 1 45  ? 68.693 48.507 13.182  1.00 40.19 ? 123 SER A CA  1 
ATOM   316  C C   . SER A 1 45  ? 68.154 47.231 12.545  1.00 38.78 ? 123 SER A C   1 
ATOM   317  O O   . SER A 1 45  ? 66.946 47.083 12.375  1.00 40.55 ? 123 SER A O   1 
ATOM   318  C CB  . SER A 1 45  ? 69.386 49.374 12.132  1.00 43.22 ? 123 SER A CB  1 
ATOM   319  O OG  . SER A 1 45  ? 68.480 49.774 11.124  1.00 46.78 ? 123 SER A OG  1 
ATOM   320  N N   . GLN A 1 46  ? 69.041 46.310 12.196  1.00 37.79 ? 124 GLN A N   1 
ATOM   321  C CA  . GLN A 1 46  ? 68.617 45.062 11.576  1.00 37.52 ? 124 GLN A CA  1 
ATOM   322  C C   . GLN A 1 46  ? 67.771 44.227 12.527  1.00 36.98 ? 124 GLN A C   1 
ATOM   323  O O   . GLN A 1 46  ? 66.964 43.401 12.099  1.00 36.45 ? 124 GLN A O   1 
ATOM   324  C CB  . GLN A 1 46  ? 69.828 44.251 11.119  1.00 37.38 ? 124 GLN A CB  1 
ATOM   325  C CG  . GLN A 1 46  ? 69.474 42.904 10.511  1.00 40.06 ? 124 GLN A CG  1 
ATOM   326  C CD  . GLN A 1 46  ? 68.551 43.006 9.303   1.00 41.20 ? 124 GLN A CD  1 
ATOM   327  O OE1 . GLN A 1 46  ? 68.124 41.990 8.748   1.00 41.50 ? 124 GLN A OE1 1 
ATOM   328  N NE2 . GLN A 1 46  ? 68.240 44.226 8.890   1.00 42.46 ? 124 GLN A NE2 1 
ATOM   329  N N   . ALA A 1 47  ? 67.961 44.453 13.820  1.00 36.28 ? 125 ALA A N   1 
ATOM   330  C CA  . ALA A 1 47  ? 67.213 43.738 14.844  1.00 34.18 ? 125 ALA A CA  1 
ATOM   331  C C   . ALA A 1 47  ? 65.741 44.154 14.823  1.00 33.60 ? 125 ALA A C   1 
ATOM   332  O O   . ALA A 1 47  ? 64.840 43.307 14.841  1.00 34.59 ? 125 ALA A O   1 
ATOM   333  C CB  . ALA A 1 47  ? 67.822 44.015 16.213  1.00 34.57 ? 125 ALA A CB  1 
ATOM   334  N N   . SER A 1 48  ? 65.494 45.458 14.789  1.00 32.94 ? 126 SER A N   1 
ATOM   335  C CA  . SER A 1 48  ? 64.126 45.959 14.752  1.00 32.24 ? 126 SER A CA  1 
ATOM   336  C C   . SER A 1 48  ? 63.381 45.294 13.597  1.00 32.25 ? 126 SER A C   1 
ATOM   337  O O   . SER A 1 48  ? 62.357 44.637 13.799  1.00 32.47 ? 126 SER A O   1 
ATOM   338  C CB  . SER A 1 48  ? 64.122 47.479 14.572  1.00 33.64 ? 126 SER A CB  1 
ATOM   339  O OG  . SER A 1 48  ? 64.896 48.114 15.577  1.00 34.53 ? 126 SER A OG  1 
ATOM   340  N N   . CYS A 1 49  ? 63.904 45.448 12.385  1.00 31.34 ? 127 CYS A N   1 
ATOM   341  C CA  . CYS A 1 49  ? 63.267 44.848 11.215  1.00 32.10 ? 127 CYS A CA  1 
ATOM   342  C C   . CYS A 1 49  ? 62.899 43.375 11.410  1.00 34.08 ? 127 CYS A C   1 
ATOM   343  O O   . CYS A 1 49  ? 61.762 42.974 11.141  1.00 32.77 ? 127 CYS A O   1 
ATOM   344  C CB  . CYS A 1 49  ? 64.168 44.968 9.993   1.00 27.94 ? 127 CYS A CB  1 
ATOM   345  S SG  . CYS A 1 49  ? 64.579 46.662 9.526   1.00 24.44 ? 127 CYS A SG  1 
ATOM   346  N N   . MET A 1 50  ? 63.866 42.569 11.851  1.00 35.88 ? 128 MET A N   1 
ATOM   347  C CA  . MET A 1 50  ? 63.623 41.147 12.079  1.00 38.55 ? 128 MET A CA  1 
ATOM   348  C C   . MET A 1 50  ? 62.549 40.978 13.154  1.00 40.39 ? 128 MET A C   1 
ATOM   349  O O   . MET A 1 50  ? 61.689 40.103 13.057  1.00 40.39 ? 128 MET A O   1 
ATOM   350  C CB  . MET A 1 50  ? 64.906 40.449 12.532  1.00 38.89 ? 128 MET A CB  1 
ATOM   351  C CG  . MET A 1 50  ? 66.045 40.487 11.527  1.00 39.43 ? 128 MET A CG  1 
ATOM   352  S SD  . MET A 1 50  ? 67.554 39.727 12.181  1.00 39.23 ? 128 MET A SD  1 
ATOM   353  C CE  . MET A 1 50  ? 67.307 38.046 11.660  1.00 38.27 ? 128 MET A CE  1 
ATOM   354  N N   . SER A 1 51  ? 62.615 41.825 14.179  1.00 41.65 ? 129 SER A N   1 
ATOM   355  C CA  . SER A 1 51  ? 61.660 41.811 15.284  1.00 44.10 ? 129 SER A CA  1 
ATOM   356  C C   . SER A 1 51  ? 60.205 41.907 14.817  1.00 44.26 ? 129 SER A C   1 
ATOM   357  O O   . SER A 1 51  ? 59.275 41.496 15.515  1.00 44.16 ? 129 SER A O   1 
ATOM   358  C CB  . SER A 1 51  ? 61.969 42.972 16.227  1.00 45.58 ? 129 SER A CB  1 
ATOM   359  O OG  . SER A 1 51  ? 60.881 43.225 17.096  1.00 50.31 ? 129 SER A OG  1 
ATOM   360  N N   . GLN A 1 52  ? 60.125 42.496 13.627  1.00 44.51 ? 130 GLN A N   1 
ATOM   361  C CA  . GLN A 1 52  ? 58.752 42.590 13.176  1.00 44.01 ? 130 GLN A CA  1 
ATOM   362  C C   . GLN A 1 52  ? 58.658 41.692 11.952  1.00 42.94 ? 130 GLN A C   1 
ATOM   363  O O   . GLN A 1 52  ? 57.864 41.910 11.043  1.00 42.94 ? 130 GLN A O   1 
ATOM   364  C CB  . GLN A 1 52  ? 58.443 44.054 12.867  1.00 47.50 ? 130 GLN A CB  1 
ATOM   365  C CG  . GLN A 1 52  ? 58.703 44.936 14.098  1.00 51.66 ? 130 GLN A CG  1 
ATOM   366  C CD  . GLN A 1 52  ? 58.503 46.422 13.860  1.00 54.41 ? 130 GLN A CD  1 
ATOM   367  O OE1 . GLN A 1 52  ? 57.390 46.874 13.588  1.00 56.94 ? 130 GLN A OE1 1 
ATOM   368  N NE2 . GLN A 1 52  ? 59.580 47.190 13.969  1.00 56.48 ? 130 GLN A NE2 1 
ATOM   369  N N   . ASN A 1 53  ? 59.559 40.789 11.781  1.00 41.91 ? 131 ASN A N   1 
ATOM   370  C CA  . ASN A 1 53  ? 59.788 39.846 10.692  1.00 41.43 ? 131 ASN A CA  1 
ATOM   371  C C   . ASN A 1 53  ? 60.032 40.414 9.305   1.00 40.92 ? 131 ASN A C   1 
ATOM   372  O O   . ASN A 1 53  ? 59.183 40.333 8.422   1.00 40.42 ? 131 ASN A O   1 
ATOM   373  C CB  . ASN A 1 53  ? 58.658 38.829 10.620  1.00 42.64 ? 131 ASN A CB  1 
ATOM   374  C CG  . ASN A 1 53  ? 59.021 37.635 9.757   1.00 43.86 ? 131 ASN A CG  1 
ATOM   375  O OD1 . ASN A 1 53  ? 60.129 37.096 9.857   1.00 45.38 ? 131 ASN A OD1 1 
ATOM   376  N ND2 . ASN A 1 53  ? 58.092 37.208 8.914   1.00 43.47 ? 131 ASN A ND2 1 
ATOM   377  N N   . ALA A 1 54  ? 61.282 40.896 9.136   1.00 40.30 ? 132 ALA A N   1 
ATOM   378  C CA  . ALA A 1 54  ? 61.651 41.672 7.968   1.00 38.05 ? 132 ALA A CA  1 
ATOM   379  C C   . ALA A 1 54  ? 63.151 41.896 8.087   1.00 37.15 ? 132 ALA A C   1 
ATOM   380  O O   . ALA A 1 54  ? 63.826 41.211 8.859   1.00 38.23 ? 132 ALA A O   1 
ATOM   381  C CB  . ALA A 1 54  ? 60.915 43.009 7.976   1.00 38.58 ? 132 ALA A CB  1 
ATOM   382  N N   . SER A 1 55  ? 63.665 42.650 7.178   1.00 34.33 ? 133 SER A N   1 
ATOM   383  C CA  . SER A 1 55  ? 65.059 43.069 7.198   1.00 31.50 ? 133 SER A CA  1 
ATOM   384  C C   . SER A 1 55  ? 65.135 44.490 6.645   1.00 28.45 ? 133 SER A C   1 
ATOM   385  O O   . SER A 1 55  ? 64.114 45.092 6.298   1.00 25.58 ? 133 SER A O   1 
ATOM   386  C CB  . SER A 1 55  ? 65.938 42.120 6.364   1.00 32.38 ? 133 SER A CB  1 
ATOM   387  O OG  . SER A 1 55  ? 65.171 41.135 5.696   1.00 33.42 ? 133 SER A OG  1 
ATOM   388  N N   . LEU A 1 56  ? 66.343 45.010 6.613   1.00 25.76 ? 134 LEU A N   1 
ATOM   389  C CA  . LEU A 1 56  ? 66.565 46.364 6.153   1.00 25.37 ? 134 LEU A CA  1 
ATOM   390  C C   . LEU A 1 56  ? 66.364 46.375 4.644   1.00 25.25 ? 134 LEU A C   1 
ATOM   391  O O   . LEU A 1 56  ? 66.572 45.372 3.971   1.00 24.63 ? 134 LEU A O   1 
ATOM   392  C CB  . LEU A 1 56  ? 67.973 46.819 6.526   1.00 25.16 ? 134 LEU A CB  1 
ATOM   393  C CG  . LEU A 1 56  ? 68.206 47.015 8.032   1.00 23.59 ? 134 LEU A CG  1 
ATOM   394  C CD1 . LEU A 1 56  ? 69.670 46.827 8.360   1.00 21.94 ? 134 LEU A CD1 1 
ATOM   395  C CD2 . LEU A 1 56  ? 67.720 48.386 8.456   1.00 21.91 ? 134 LEU A CD2 1 
ATOM   396  N N   . LEU A 1 57  ? 65.860 47.427 4.043   1.00 24.82 ? 135 LEU A N   1 
ATOM   397  C CA  . LEU A 1 57  ? 65.493 47.681 2.661   1.00 24.55 ? 135 LEU A CA  1 
ATOM   398  C C   . LEU A 1 57  ? 66.459 47.123 1.605   1.00 25.02 ? 135 LEU A C   1 
ATOM   399  O O   . LEU A 1 57  ? 67.677 47.214 1.742   1.00 25.25 ? 135 LEU A O   1 
ATOM   400  C CB  . LEU A 1 57  ? 65.353 49.193 2.471   1.00 23.23 ? 135 LEU A CB  1 
ATOM   401  C CG  . LEU A 1 57  ? 65.826 49.784 1.146   1.00 23.29 ? 135 LEU A CG  1 
ATOM   402  C CD1 . LEU A 1 57  ? 64.865 49.380 0.043   1.00 23.80 ? 135 LEU A CD1 1 
ATOM   403  C CD2 . LEU A 1 57  ? 65.906 51.300 1.258   1.00 22.81 ? 135 LEU A CD2 1 
ATOM   404  N N   . LYS A 1 58  ? 66.062 46.268 0.719   1.00 25.60 ? 136 LYS A N   1 
ATOM   405  C CA  . LYS A 1 58  ? 66.953 45.669 -0.258  1.00 27.99 ? 136 LYS A CA  1 
ATOM   406  C C   . LYS A 1 58  ? 66.600 46.256 -1.623  1.00 28.06 ? 136 LYS A C   1 
ATOM   407  O O   . LYS A 1 58  ? 65.426 46.387 -1.960  1.00 26.94 ? 136 LYS A O   1 
ATOM   408  C CB  . LYS A 1 58  ? 66.808 44.148 -0.319  1.00 29.50 ? 136 LYS A CB  1 
ATOM   409  C CG  . LYS A 1 58  ? 67.639 43.554 -1.469  1.00 32.65 ? 136 LYS A CG  1 
ATOM   410  C CD  . LYS A 1 58  ? 67.369 42.072 -1.713  1.00 34.23 ? 136 LYS A CD  1 
ATOM   411  C CE  . LYS A 1 58  ? 68.067 41.601 -2.988  1.00 33.89 ? 136 LYS A CE  1 
ATOM   412  N NZ  . LYS A 1 58  ? 67.748 40.186 -3.323  1.00 35.15 ? 136 LYS A NZ  1 
ATOM   413  N N   . VAL A 1 59  ? 67.534 46.606 -2.429  1.00 28.49 ? 137 VAL A N   1 
ATOM   414  C CA  . VAL A 1 59  ? 67.254 47.154 -3.755  1.00 29.91 ? 137 VAL A CA  1 
ATOM   415  C C   . VAL A 1 59  ? 67.495 46.096 -4.835  1.00 31.12 ? 137 VAL A C   1 
ATOM   416  O O   . VAL A 1 59  ? 68.613 45.599 -4.982  1.00 29.78 ? 137 VAL A O   1 
ATOM   417  C CB  . VAL A 1 59  ? 68.148 48.366 -4.056  1.00 27.96 ? 137 VAL A CB  1 
ATOM   418  C CG1 . VAL A 1 59  ? 67.892 48.854 -5.465  1.00 27.82 ? 137 VAL A CG1 1 
ATOM   419  C CG2 . VAL A 1 59  ? 67.878 49.463 -3.058  1.00 28.28 ? 137 VAL A CG2 1 
ATOM   420  N N   . TYR A 1 60  ? 66.440 45.743 -5.489  1.00 31.28 ? 138 TYR A N   1 
ATOM   421  C CA  . TYR A 1 60  ? 66.603 44.735 -6.517  1.00 32.79 ? 138 TYR A CA  1 
ATOM   422  C C   . TYR A 1 60  ? 66.159 45.128 -7.926  1.00 34.45 ? 138 TYR A C   1 
ATOM   423  O O   . TYR A 1 60  ? 66.537 44.466 -8.900  1.00 34.82 ? 138 TYR A O   1 
ATOM   424  C CB  . TYR A 1 60  ? 65.902 43.444 -6.086  1.00 34.26 ? 138 TYR A CB  1 
ATOM   425  C CG  . TYR A 1 60  ? 64.390 43.495 -6.066  1.00 36.46 ? 138 TYR A CG  1 
ATOM   426  C CD1 . TYR A 1 60  ? 63.644 43.064 -7.165  1.00 37.95 ? 138 TYR A CD1 1 
ATOM   427  C CD2 . TYR A 1 60  ? 63.700 43.966 -4.946  1.00 37.72 ? 138 TYR A CD2 1 
ATOM   428  C CE1 . TYR A 1 60  ? 62.241 43.102 -7.150  1.00 39.35 ? 138 TYR A CE1 1 
ATOM   429  C CE2 . TYR A 1 60  ? 62.301 44.005 -4.920  1.00 38.41 ? 138 TYR A CE2 1 
ATOM   430  C CZ  . TYR A 1 60  ? 61.582 43.572 -6.026  1.00 37.94 ? 138 TYR A CZ  1 
ATOM   431  O OH  . TYR A 1 60  ? 60.212 43.621 -6.026  1.00 39.60 ? 138 TYR A OH  1 
ATOM   432  N N   . SER A 1 61  ? 65.363 46.179 -8.062  1.00 33.35 ? 139 SER A N   1 
ATOM   433  C CA  . SER A 1 61  ? 64.981 46.526 -9.427  1.00 32.84 ? 139 SER A CA  1 
ATOM   434  C C   . SER A 1 61  ? 64.468 47.946 -9.577  1.00 34.93 ? 139 SER A C   1 
ATOM   435  O O   . SER A 1 61  ? 63.516 48.348 -8.895  1.00 35.90 ? 139 SER A O   1 
ATOM   436  C CB  . SER A 1 61  ? 63.907 45.574 -9.927  1.00 32.47 ? 139 SER A CB  1 
ATOM   437  O OG  . SER A 1 61  ? 62.801 46.321 -10.394 1.00 30.15 ? 139 SER A OG  1 
ATOM   438  N N   . LYS A 1 62  ? 64.891 48.862 -10.417 1.00 35.84 ? 140 LYS A N   1 
ATOM   439  C CA  . LYS A 1 62  ? 64.452 50.247 -10.521 1.00 36.34 ? 140 LYS A CA  1 
ATOM   440  C C   . LYS A 1 62  ? 63.057 50.378 -11.076 1.00 35.58 ? 140 LYS A C   1 
ATOM   441  O O   . LYS A 1 62  ? 62.533 51.488 -11.235 1.00 35.85 ? 140 LYS A O   1 
ATOM   442  C CB  . LYS A 1 62  ? 65.417 51.074 -11.361 1.00 39.55 ? 140 LYS A CB  1 
ATOM   443  C CG  . LYS A 1 62  ? 66.845 51.152 -10.837 1.00 42.19 ? 140 LYS A CG  1 
ATOM   444  C CD  . LYS A 1 62  ? 67.548 52.356 -11.494 1.00 46.49 ? 140 LYS A CD  1 
ATOM   445  C CE  . LYS A 1 62  ? 69.067 52.327 -11.374 1.00 47.72 ? 140 LYS A CE  1 
ATOM   446  N NZ  . LYS A 1 62  ? 69.703 53.112 -12.474 1.00 50.35 ? 140 LYS A NZ  1 
ATOM   447  N N   A GLU A 1 63  ? 62.441 49.245 -11.400 0.50 35.81 ? 141 GLU A N   1 
ATOM   448  N N   B GLU A 1 63  ? 62.441 49.245 -11.396 0.50 35.60 ? 141 GLU A N   1 
ATOM   449  C CA  A GLU A 1 63  ? 61.078 49.286 -11.904 0.50 36.27 ? 141 GLU A CA  1 
ATOM   450  C CA  B GLU A 1 63  ? 61.083 49.283 -11.906 0.50 35.91 ? 141 GLU A CA  1 
ATOM   451  C C   A GLU A 1 63  ? 60.042 49.041 -10.798 0.50 35.93 ? 141 GLU A C   1 
ATOM   452  C C   B GLU A 1 63  ? 60.046 49.040 -10.796 0.50 35.71 ? 141 GLU A C   1 
ATOM   453  O O   A GLU A 1 63  ? 58.975 49.667 -10.750 0.50 34.46 ? 141 GLU A O   1 
ATOM   454  O O   B GLU A 1 63  ? 58.984 49.662 -10.745 0.50 34.25 ? 141 GLU A O   1 
ATOM   455  C CB  A GLU A 1 63  ? 60.891 48.250 -13.011 0.50 37.45 ? 141 GLU A CB  1 
ATOM   456  C CB  B GLU A 1 63  ? 60.902 48.226 -12.991 0.50 36.65 ? 141 GLU A CB  1 
ATOM   457  C CG  A GLU A 1 63  ? 61.501 48.645 -14.350 0.50 39.31 ? 141 GLU A CG  1 
ATOM   458  C CG  B GLU A 1 63  ? 61.916 48.289 -14.119 0.50 37.86 ? 141 GLU A CG  1 
ATOM   459  C CD  A GLU A 1 63  ? 63.012 48.440 -14.417 0.50 41.08 ? 141 GLU A CD  1 
ATOM   460  C CD  B GLU A 1 63  ? 63.268 47.677 -13.749 0.50 38.83 ? 141 GLU A CD  1 
ATOM   461  O OE1 A GLU A 1 63  ? 63.612 48.734 -15.476 0.50 40.85 ? 141 GLU A OE1 1 
ATOM   462  O OE1 B GLU A 1 63  ? 64.294 48.391 -13.841 0.50 37.90 ? 141 GLU A OE1 1 
ATOM   463  O OE2 A GLU A 1 63  ? 63.604 47.976 -13.421 0.50 42.99 ? 141 GLU A OE2 1 
ATOM   464  O OE2 B GLU A 1 63  ? 63.303 46.480 -13.375 0.50 37.36 ? 141 GLU A OE2 1 
ATOM   465  N N   . ASP A 1 64  ? 60.360 48.101 -9.896  1.00 36.41 ? 142 ASP A N   1 
ATOM   466  C CA  . ASP A 1 64  ? 59.442 47.769 -8.825  1.00 39.26 ? 142 ASP A CA  1 
ATOM   467  C C   . ASP A 1 64  ? 59.756 48.526 -7.532  1.00 38.10 ? 142 ASP A C   1 
ATOM   468  O O   . ASP A 1 64  ? 59.134 48.277 -6.503  1.00 38.98 ? 142 ASP A O   1 
ATOM   469  C CB  . ASP A 1 64  ? 59.469 46.252 -8.579  1.00 43.68 ? 142 ASP A CB  1 
ATOM   470  C CG  . ASP A 1 64  ? 59.122 45.449 -9.818  1.00 49.30 ? 142 ASP A CG  1 
ATOM   471  O OD1 . ASP A 1 64  ? 58.297 45.930 -10.632 1.00 51.70 ? 142 ASP A OD1 1 
ATOM   472  O OD2 . ASP A 1 64  ? 59.660 44.327 -9.975  1.00 52.73 ? 142 ASP A OD2 1 
ATOM   473  N N   . GLN A 1 65  ? 60.695 49.455 -7.593  1.00 36.25 ? 143 GLN A N   1 
ATOM   474  C CA  . GLN A 1 65  ? 61.067 50.224 -6.399  1.00 34.19 ? 143 GLN A CA  1 
ATOM   475  C C   . GLN A 1 65  ? 61.339 51.678 -6.737  1.00 33.84 ? 143 GLN A C   1 
ATOM   476  O O   . GLN A 1 65  ? 62.007 52.387 -5.990  1.00 35.48 ? 143 GLN A O   1 
ATOM   477  C CB  . GLN A 1 65  ? 62.296 49.593 -5.724  1.00 32.90 ? 143 GLN A CB  1 
ATOM   478  C CG  . GLN A 1 65  ? 62.026 48.205 -5.141  1.00 32.05 ? 143 GLN A CG  1 
ATOM   479  C CD  . GLN A 1 65  ? 63.281 47.504 -4.635  1.00 31.89 ? 143 GLN A CD  1 
ATOM   480  O OE1 . GLN A 1 65  ? 64.238 47.295 -5.384  1.00 30.27 ? 143 GLN A OE1 1 
ATOM   481  N NE2 . GLN A 1 65  ? 63.276 47.127 -3.359  1.00 30.19 ? 143 GLN A NE2 1 
ATOM   482  N N   . ASP A 1 66  ? 60.803 52.130 -7.861  1.00 33.43 ? 144 ASP A N   1 
ATOM   483  C CA  . ASP A 1 66  ? 61.007 53.511 -8.289  1.00 33.26 ? 144 ASP A CA  1 
ATOM   484  C C   . ASP A 1 66  ? 60.512 54.524 -7.271  1.00 31.96 ? 144 ASP A C   1 
ATOM   485  O O   . ASP A 1 66  ? 60.879 55.691 -7.328  1.00 33.08 ? 144 ASP A O   1 
ATOM   486  C CB  . ASP A 1 66  ? 60.320 53.772 -9.627  1.00 33.13 ? 144 ASP A CB  1 
ATOM   487  C CG  . ASP A 1 66  ? 58.847 53.487 -9.577  1.00 34.34 ? 144 ASP A CG  1 
ATOM   488  O OD1 . ASP A 1 66  ? 58.239 53.656 -8.504  1.00 36.38 ? 144 ASP A OD1 1 
ATOM   489  O OD2 . ASP A 1 66  ? 58.286 53.103 -10.616 1.00 37.41 ? 144 ASP A OD2 1 
ATOM   490  N N   . LEU A 1 67  ? 59.655 54.099 -6.354  1.00 31.92 ? 145 LEU A N   1 
ATOM   491  C CA  . LEU A 1 67  ? 59.179 55.024 -5.338  1.00 31.70 ? 145 LEU A CA  1 
ATOM   492  C C   . LEU A 1 67  ? 60.412 55.489 -4.591  1.00 32.22 ? 145 LEU A C   1 
ATOM   493  O O   . LEU A 1 67  ? 60.501 56.639 -4.148  1.00 34.00 ? 145 LEU A O   1 
ATOM   494  C CB  . LEU A 1 67  ? 58.211 54.341 -4.367  1.00 32.46 ? 145 LEU A CB  1 
ATOM   495  C CG  . LEU A 1 67  ? 58.523 53.048 -3.590  1.00 34.52 ? 145 LEU A CG  1 
ATOM   496  C CD1 . LEU A 1 67  ? 59.922 52.531 -3.853  1.00 35.30 ? 145 LEU A CD1 1 
ATOM   497  C CD2 . LEU A 1 67  ? 58.332 53.324 -2.111  1.00 34.75 ? 145 LEU A CD2 1 
ATOM   498  N N   . LEU A 1 68  ? 61.381 54.585 -4.499  1.00 30.78 ? 146 LEU A N   1 
ATOM   499  C CA  . LEU A 1 68  ? 62.627 54.828 -3.792  1.00 30.94 ? 146 LEU A CA  1 
ATOM   500  C C   . LEU A 1 68  ? 63.333 56.122 -4.188  1.00 32.29 ? 146 LEU A C   1 
ATOM   501  O O   . LEU A 1 68  ? 64.126 56.663 -3.413  1.00 31.70 ? 146 LEU A O   1 
ATOM   502  C CB  . LEU A 1 68  ? 63.560 53.624 -3.981  1.00 30.10 ? 146 LEU A CB  1 
ATOM   503  C CG  . LEU A 1 68  ? 63.839 52.753 -2.753  1.00 27.84 ? 146 LEU A CG  1 
ATOM   504  C CD1 . LEU A 1 68  ? 62.867 53.088 -1.638  1.00 28.62 ? 146 LEU A CD1 1 
ATOM   505  C CD2 . LEU A 1 68  ? 63.740 51.298 -3.125  1.00 26.33 ? 146 LEU A CD2 1 
ATOM   506  N N   . LYS A 1 69  ? 63.034 56.624 -5.384  1.00 33.77 ? 147 LYS A N   1 
ATOM   507  C CA  . LYS A 1 69  ? 63.653 57.857 -5.865  1.00 34.97 ? 147 LYS A CA  1 
ATOM   508  C C   . LYS A 1 69  ? 63.232 59.080 -5.065  1.00 35.31 ? 147 LYS A C   1 
ATOM   509  O O   . LYS A 1 69  ? 63.909 60.094 -5.106  1.00 34.42 ? 147 LYS A O   1 
ATOM   510  C CB  . LYS A 1 69  ? 63.304 58.133 -7.330  1.00 35.75 ? 147 LYS A CB  1 
ATOM   511  C CG  . LYS A 1 69  ? 63.639 57.026 -8.311  1.00 39.31 ? 147 LYS A CG  1 
ATOM   512  C CD  . LYS A 1 69  ? 63.754 57.573 -9.742  1.00 41.22 ? 147 LYS A CD  1 
ATOM   513  C CE  . LYS A 1 69  ? 65.217 57.871 -10.094 1.00 42.54 ? 147 LYS A CE  1 
ATOM   514  N NZ  . LYS A 1 69  ? 65.406 59.132 -10.867 1.00 43.26 ? 147 LYS A NZ  1 
ATOM   515  N N   . LEU A 1 70  ? 62.121 58.990 -4.342  1.00 36.41 ? 148 LEU A N   1 
ATOM   516  C CA  . LEU A 1 70  ? 61.631 60.135 -3.580  1.00 37.64 ? 148 LEU A CA  1 
ATOM   517  C C   . LEU A 1 70  ? 62.026 60.210 -2.110  1.00 37.30 ? 148 LEU A C   1 
ATOM   518  O O   . LEU A 1 70  ? 61.659 61.158 -1.410  1.00 37.25 ? 148 LEU A O   1 
ATOM   519  C CB  . LEU A 1 70  ? 60.115 60.194 -3.677  1.00 39.46 ? 148 LEU A CB  1 
ATOM   520  C CG  . LEU A 1 70  ? 59.582 60.297 -5.098  1.00 41.05 ? 148 LEU A CG  1 
ATOM   521  C CD1 . LEU A 1 70  ? 58.125 60.005 -5.030  1.00 40.37 ? 148 LEU A CD1 1 
ATOM   522  C CD2 . LEU A 1 70  ? 59.862 61.675 -5.717  1.00 40.85 ? 148 LEU A CD2 1 
ATOM   523  N N   . VAL A 1 71  ? 62.767 59.221 -1.634  1.00 36.36 ? 149 VAL A N   1 
ATOM   524  C CA  . VAL A 1 71  ? 63.174 59.221 -0.239  1.00 34.62 ? 149 VAL A CA  1 
ATOM   525  C C   . VAL A 1 71  ? 64.145 60.362 0.019   1.00 34.01 ? 149 VAL A C   1 
ATOM   526  O O   . VAL A 1 71  ? 65.031 60.643 -0.791  1.00 31.44 ? 149 VAL A O   1 
ATOM   527  C CB  . VAL A 1 71  ? 63.846 57.892 0.147   1.00 33.98 ? 149 VAL A CB  1 
ATOM   528  C CG1 . VAL A 1 71  ? 64.000 57.810 1.653   1.00 32.64 ? 149 VAL A CG1 1 
ATOM   529  C CG2 . VAL A 1 71  ? 63.029 56.734 -0.379  1.00 33.96 ? 149 VAL A CG2 1 
ATOM   530  N N   . LYS A 1 72  ? 63.979 61.020 1.158   1.00 34.11 ? 150 LYS A N   1 
ATOM   531  C CA  . LYS A 1 72  ? 64.847 62.134 1.508   1.00 34.12 ? 150 LYS A CA  1 
ATOM   532  C C   . LYS A 1 72  ? 65.855 61.663 2.548   1.00 32.53 ? 150 LYS A C   1 
ATOM   533  O O   . LYS A 1 72  ? 65.616 60.663 3.215   1.00 32.88 ? 150 LYS A O   1 
ATOM   534  C CB  . LYS A 1 72  ? 64.003 63.276 2.079   1.00 36.27 ? 150 LYS A CB  1 
ATOM   535  C CG  . LYS A 1 72  ? 64.622 64.641 1.893   1.00 38.89 ? 150 LYS A CG  1 
ATOM   536  C CD  . LYS A 1 72  ? 64.047 65.675 2.854   1.00 41.87 ? 150 LYS A CD  1 
ATOM   537  C CE  . LYS A 1 72  ? 64.637 67.062 2.558   1.00 44.18 ? 150 LYS A CE  1 
ATOM   538  N NZ  . LYS A 1 72  ? 64.333 68.080 3.599   1.00 45.47 ? 150 LYS A NZ  1 
ATOM   539  N N   . SER A 1 73  ? 66.982 62.365 2.659   1.00 30.95 ? 151 SER A N   1 
ATOM   540  C CA  . SER A 1 73  ? 68.018 62.048 3.654   1.00 30.25 ? 151 SER A CA  1 
ATOM   541  C C   . SER A 1 73  ? 68.707 60.681 3.483   1.00 29.85 ? 151 SER A C   1 
ATOM   542  O O   . SER A 1 73  ? 68.669 60.086 2.406   1.00 28.77 ? 151 SER A O   1 
ATOM   543  C CB  . SER A 1 73  ? 67.412 62.150 5.065   1.00 28.65 ? 151 SER A CB  1 
ATOM   544  O OG  . SER A 1 73  ? 68.269 62.835 5.956   1.00 28.89 ? 151 SER A OG  1 
ATOM   545  N N   . TYR A 1 74  ? 69.347 60.201 4.551   1.00 29.46 ? 152 TYR A N   1 
ATOM   546  C CA  . TYR A 1 74  ? 70.040 58.912 4.526   1.00 30.19 ? 152 TYR A CA  1 
ATOM   547  C C   . TYR A 1 74  ? 69.355 57.919 5.449   1.00 29.99 ? 152 TYR A C   1 
ATOM   548  O O   . TYR A 1 74  ? 68.840 58.293 6.496   1.00 32.12 ? 152 TYR A O   1 
ATOM   549  C CB  . TYR A 1 74  ? 71.496 59.061 4.968   1.00 31.21 ? 152 TYR A CB  1 
ATOM   550  C CG  . TYR A 1 74  ? 72.301 60.064 4.173   1.00 31.49 ? 152 TYR A CG  1 
ATOM   551  C CD1 . TYR A 1 74  ? 72.312 61.413 4.522   1.00 31.70 ? 152 TYR A CD1 1 
ATOM   552  C CD2 . TYR A 1 74  ? 73.051 59.660 3.071   1.00 32.45 ? 152 TYR A CD2 1 
ATOM   553  C CE1 . TYR A 1 74  ? 73.055 62.337 3.795   1.00 34.34 ? 152 TYR A CE1 1 
ATOM   554  C CE2 . TYR A 1 74  ? 73.794 60.571 2.329   1.00 34.88 ? 152 TYR A CE2 1 
ATOM   555  C CZ  . TYR A 1 74  ? 73.796 61.908 2.693   1.00 37.08 ? 152 TYR A CZ  1 
ATOM   556  O OH  . TYR A 1 74  ? 74.528 62.809 1.945   1.00 38.74 ? 152 TYR A OH  1 
ATOM   557  N N   . HIS A 1 75  ? 69.356 56.651 5.068   1.00 29.36 ? 153 HIS A N   1 
ATOM   558  C CA  . HIS A 1 75  ? 68.715 55.625 5.881   1.00 28.66 ? 153 HIS A CA  1 
ATOM   559  C C   . HIS A 1 75  ? 69.453 54.315 5.710   1.00 27.79 ? 153 HIS A C   1 
ATOM   560  O O   . HIS A 1 75  ? 70.011 54.041 4.646   1.00 28.14 ? 153 HIS A O   1 
ATOM   561  C CB  . HIS A 1 75  ? 67.259 55.444 5.453   1.00 29.59 ? 153 HIS A CB  1 
ATOM   562  C CG  . HIS A 1 75  ? 66.495 56.727 5.379   1.00 31.09 ? 153 HIS A CG  1 
ATOM   563  N ND1 . HIS A 1 75  ? 66.134 57.440 6.500   1.00 31.07 ? 153 HIS A ND1 1 
ATOM   564  C CD2 . HIS A 1 75  ? 66.079 57.455 4.316   1.00 30.95 ? 153 HIS A CD2 1 
ATOM   565  C CE1 . HIS A 1 75  ? 65.529 58.556 6.132   1.00 30.86 ? 153 HIS A CE1 1 
ATOM   566  N NE2 . HIS A 1 75  ? 65.485 58.588 4.814   1.00 31.88 ? 153 HIS A NE2 1 
ATOM   567  N N   . TRP A 1 76  ? 69.451 53.512 6.764   1.00 25.90 ? 154 TRP A N   1 
ATOM   568  C CA  . TRP A 1 76  ? 70.113 52.219 6.745   1.00 24.99 ? 154 TRP A CA  1 
ATOM   569  C C   . TRP A 1 76  ? 69.404 51.248 5.817   1.00 24.12 ? 154 TRP A C   1 
ATOM   570  O O   . TRP A 1 76  ? 68.171 51.177 5.802   1.00 21.98 ? 154 TRP A O   1 
ATOM   571  C CB  . TRP A 1 76  ? 70.107 51.603 8.141   1.00 26.16 ? 154 TRP A CB  1 
ATOM   572  C CG  . TRP A 1 76  ? 71.180 52.067 9.072   1.00 27.87 ? 154 TRP A CG  1 
ATOM   573  C CD1 . TRP A 1 76  ? 71.035 52.358 10.403  1.00 27.28 ? 154 TRP A CD1 1 
ATOM   574  C CD2 . TRP A 1 76  ? 72.584 52.155 8.793   1.00 26.79 ? 154 TRP A CD2 1 
ATOM   575  N NE1 . TRP A 1 76  ? 72.257 52.609 10.969  1.00 26.95 ? 154 TRP A NE1 1 
ATOM   576  C CE2 . TRP A 1 76  ? 73.224 52.493 10.012  1.00 27.34 ? 154 TRP A CE2 1 
ATOM   577  C CE3 . TRP A 1 76  ? 73.358 51.972 7.640   1.00 25.80 ? 154 TRP A CE3 1 
ATOM   578  C CZ2 . TRP A 1 76  ? 74.616 52.652 10.107  1.00 27.40 ? 154 TRP A CZ2 1 
ATOM   579  C CZ3 . TRP A 1 76  ? 74.739 52.129 7.732   1.00 26.43 ? 154 TRP A CZ3 1 
ATOM   580  C CH2 . TRP A 1 76  ? 75.355 52.466 8.962   1.00 29.40 ? 154 TRP A CH2 1 
ATOM   581  N N   . MET A 1 77  ? 70.188 50.509 5.041   1.00 23.50 ? 155 MET A N   1 
ATOM   582  C CA  . MET A 1 77  ? 69.642 49.482 4.167   1.00 25.25 ? 155 MET A CA  1 
ATOM   583  C C   . MET A 1 77  ? 70.470 48.213 4.415   1.00 24.71 ? 155 MET A C   1 
ATOM   584  O O   . MET A 1 77  ? 71.490 48.250 5.100   1.00 23.65 ? 155 MET A O   1 
ATOM   585  C CB  . MET A 1 77  ? 69.676 49.915 2.686   1.00 24.62 ? 155 MET A CB  1 
ATOM   586  C CG  . MET A 1 77  ? 71.047 50.120 2.079   1.00 25.37 ? 155 MET A CG  1 
ATOM   587  S SD  . MET A 1 77  ? 70.934 50.407 0.292   1.00 26.80 ? 155 MET A SD  1 
ATOM   588  C CE  . MET A 1 77  ? 72.303 51.500 0.026   1.00 23.76 ? 155 MET A CE  1 
ATOM   589  N N   . GLY A 1 78  ? 70.033 47.090 3.873   1.00 25.14 ? 156 GLY A N   1 
ATOM   590  C CA  . GLY A 1 78  ? 70.765 45.862 4.104   1.00 25.26 ? 156 GLY A CA  1 
ATOM   591  C C   . GLY A 1 78  ? 72.021 45.611 3.294   1.00 24.32 ? 156 GLY A C   1 
ATOM   592  O O   . GLY A 1 78  ? 72.338 44.460 3.011   1.00 24.50 ? 156 GLY A O   1 
ATOM   593  N N   . LEU A 1 79  ? 72.746 46.653 2.904   1.00 23.35 ? 157 LEU A N   1 
ATOM   594  C CA  . LEU A 1 79  ? 73.968 46.415 2.141   1.00 22.98 ? 157 LEU A CA  1 
ATOM   595  C C   . LEU A 1 79  ? 75.166 46.438 3.080   1.00 22.12 ? 157 LEU A C   1 
ATOM   596  O O   . LEU A 1 79  ? 75.386 47.397 3.808   1.00 21.58 ? 157 LEU A O   1 
ATOM   597  C CB  . LEU A 1 79  ? 74.145 47.461 1.038   1.00 22.64 ? 157 LEU A CB  1 
ATOM   598  C CG  . LEU A 1 79  ? 75.164 47.088 -0.050  1.00 21.97 ? 157 LEU A CG  1 
ATOM   599  C CD1 . LEU A 1 79  ? 74.595 45.977 -0.908  1.00 21.85 ? 157 LEU A CD1 1 
ATOM   600  C CD2 . LEU A 1 79  ? 75.479 48.309 -0.917  1.00 20.69 ? 157 LEU A CD2 1 
ATOM   601  N N   . VAL A 1 80  ? 75.939 45.369 3.057   1.00 23.77 ? 158 VAL A N   1 
ATOM   602  C CA  . VAL A 1 80  ? 77.101 45.261 3.918   1.00 26.12 ? 158 VAL A CA  1 
ATOM   603  C C   . VAL A 1 80  ? 78.261 44.581 3.219   1.00 28.52 ? 158 VAL A C   1 
ATOM   604  O O   . VAL A 1 80  ? 78.071 43.810 2.289   1.00 28.31 ? 158 VAL A O   1 
ATOM   605  C CB  . VAL A 1 80  ? 76.764 44.438 5.164   1.00 26.48 ? 158 VAL A CB  1 
ATOM   606  C CG1 . VAL A 1 80  ? 75.710 45.159 5.993   1.00 25.90 ? 158 VAL A CG1 1 
ATOM   607  C CG2 . VAL A 1 80  ? 76.260 43.056 4.746   1.00 23.45 ? 158 VAL A CG2 1 
ATOM   608  N N   . HIS A 1 81  ? 79.470 44.886 3.665   1.00 33.72 ? 159 HIS A N   1 
ATOM   609  C CA  . HIS A 1 81  ? 80.669 44.262 3.111   1.00 37.88 ? 159 HIS A CA  1 
ATOM   610  C C   . HIS A 1 81  ? 81.261 43.345 4.187   1.00 38.77 ? 159 HIS A C   1 
ATOM   611  O O   . HIS A 1 81  ? 81.613 43.790 5.285   1.00 37.48 ? 159 HIS A O   1 
ATOM   612  C CB  . HIS A 1 81  ? 81.715 45.311 2.707   1.00 39.65 ? 159 HIS A CB  1 
ATOM   613  C CG  . HIS A 1 81  ? 83.054 44.722 2.357   1.00 42.55 ? 159 HIS A CG  1 
ATOM   614  N ND1 . HIS A 1 81  ? 84.220 45.453 2.402   1.00 43.74 ? 159 HIS A ND1 1 
ATOM   615  C CD2 . HIS A 1 81  ? 83.406 43.470 1.982   1.00 43.65 ? 159 HIS A CD2 1 
ATOM   616  C CE1 . HIS A 1 81  ? 85.238 44.672 2.072   1.00 45.64 ? 159 HIS A CE1 1 
ATOM   617  N NE2 . HIS A 1 81  ? 84.771 43.465 1.814   1.00 44.59 ? 159 HIS A NE2 1 
ATOM   618  N N   . ILE A 1 82  ? 81.354 42.062 3.872   1.00 39.78 ? 160 ILE A N   1 
ATOM   619  C CA  . ILE A 1 82  ? 81.920 41.111 4.807   1.00 43.07 ? 160 ILE A CA  1 
ATOM   620  C C   . ILE A 1 82  ? 83.340 40.883 4.303   1.00 46.72 ? 160 ILE A C   1 
ATOM   621  O O   . ILE A 1 82  ? 83.536 40.419 3.179   1.00 46.62 ? 160 ILE A O   1 
ATOM   622  C CB  . ILE A 1 82  ? 81.091 39.827 4.816   1.00 40.60 ? 160 ILE A CB  1 
ATOM   623  C CG1 . ILE A 1 82  ? 79.638 40.192 5.130   1.00 38.79 ? 160 ILE A CG1 1 
ATOM   624  C CG2 . ILE A 1 82  ? 81.608 38.872 5.871   1.00 40.47 ? 160 ILE A CG2 1 
ATOM   625  C CD1 . ILE A 1 82  ? 78.687 39.037 5.073   1.00 38.95 ? 160 ILE A CD1 1 
ATOM   626  N N   . PRO A 1 83  ? 84.350 41.225 5.130   1.00 50.27 ? 161 PRO A N   1 
ATOM   627  C CA  . PRO A 1 83  ? 85.782 41.105 4.827   1.00 53.12 ? 161 PRO A CA  1 
ATOM   628  C C   . PRO A 1 83  ? 86.310 39.791 4.269   1.00 56.21 ? 161 PRO A C   1 
ATOM   629  O O   . PRO A 1 83  ? 87.515 39.573 4.267   1.00 58.78 ? 161 PRO A O   1 
ATOM   630  C CB  . PRO A 1 83  ? 86.448 41.478 6.153   1.00 52.21 ? 161 PRO A CB  1 
ATOM   631  C CG  . PRO A 1 83  ? 85.469 41.018 7.158   1.00 51.36 ? 161 PRO A CG  1 
ATOM   632  C CD  . PRO A 1 83  ? 84.162 41.500 6.566   1.00 50.70 ? 161 PRO A CD  1 
ATOM   633  N N   . THR A 1 84  ? 85.425 38.932 3.775   1.00 58.22 ? 162 THR A N   1 
ATOM   634  C CA  . THR A 1 84  ? 85.821 37.638 3.213   1.00 59.36 ? 162 THR A CA  1 
ATOM   635  C C   . THR A 1 84  ? 86.658 37.838 1.946   1.00 60.80 ? 162 THR A C   1 
ATOM   636  O O   . THR A 1 84  ? 86.830 36.906 1.149   1.00 60.57 ? 162 THR A O   1 
ATOM   637  C CB  . THR A 1 84  ? 84.578 36.808 2.809   1.00 59.25 ? 162 THR A CB  1 
ATOM   638  O OG1 . THR A 1 84  ? 84.151 37.197 1.496   1.00 59.78 ? 162 THR A OG1 1 
ATOM   639  C CG2 . THR A 1 84  ? 83.428 37.052 3.774   1.00 59.55 ? 162 THR A CG2 1 
ATOM   640  N N   . ASN A 1 85  ? 87.200 39.044 1.788   1.00 62.02 ? 163 ASN A N   1 
ATOM   641  C CA  . ASN A 1 85  ? 87.936 39.409 0.589   1.00 62.80 ? 163 ASN A CA  1 
ATOM   642  C C   . ASN A 1 85  ? 86.797 39.405 -0.436  1.00 62.75 ? 163 ASN A C   1 
ATOM   643  O O   . ASN A 1 85  ? 86.990 39.157 -1.623  1.00 62.93 ? 163 ASN A O   1 
ATOM   644  C CB  . ASN A 1 85  ? 89.036 38.376 0.262   1.00 63.55 ? 163 ASN A CB  1 
ATOM   645  C CG  . ASN A 1 85  ? 90.282 38.564 1.128   1.00 64.86 ? 163 ASN A CG  1 
ATOM   646  O OD1 . ASN A 1 85  ? 90.495 39.645 1.676   1.00 65.36 ? 163 ASN A OD1 1 
ATOM   647  N ND2 . ASN A 1 85  ? 91.112 37.526 1.242   1.00 65.82 ? 163 ASN A ND2 1 
ATOM   648  N N   . GLY A 1 86  ? 85.591 39.695 0.057   1.00 61.68 ? 164 GLY A N   1 
ATOM   649  C CA  . GLY A 1 86  ? 84.425 39.701 -0.803  1.00 58.10 ? 164 GLY A CA  1 
ATOM   650  C C   . GLY A 1 86  ? 83.999 41.061 -1.314  1.00 56.28 ? 164 GLY A C   1 
ATOM   651  O O   . GLY A 1 86  ? 84.691 42.067 -1.147  1.00 56.05 ? 164 GLY A O   1 
ATOM   652  N N   . SER A 1 87  ? 82.832 41.067 -1.950  1.00 55.00 ? 165 SER A N   1 
ATOM   653  C CA  . SER A 1 87  ? 82.233 42.265 -2.521  1.00 52.48 ? 165 SER A CA  1 
ATOM   654  C C   . SER A 1 87  ? 81.134 42.690 -1.569  1.00 49.66 ? 165 SER A C   1 
ATOM   655  O O   . SER A 1 87  ? 80.982 42.125 -0.483  1.00 49.81 ? 165 SER A O   1 
ATOM   656  C CB  . SER A 1 87  ? 81.587 41.954 -3.877  1.00 52.89 ? 165 SER A CB  1 
ATOM   657  O OG  . SER A 1 87  ? 82.374 41.072 -4.657  1.00 56.53 ? 165 SER A OG  1 
ATOM   658  N N   . TRP A 1 88  ? 80.358 43.682 -1.985  1.00 45.91 ? 166 TRP A N   1 
ATOM   659  C CA  . TRP A 1 88  ? 79.257 44.136 -1.167  1.00 41.37 ? 166 TRP A CA  1 
ATOM   660  C C   . TRP A 1 88  ? 78.062 43.233 -1.444  1.00 39.78 ? 166 TRP A C   1 
ATOM   661  O O   . TRP A 1 88  ? 77.833 42.798 -2.572  1.00 39.14 ? 166 TRP A O   1 
ATOM   662  C CB  . TRP A 1 88  ? 78.943 45.600 -1.464  1.00 40.25 ? 166 TRP A CB  1 
ATOM   663  C CG  . TRP A 1 88  ? 79.947 46.544 -0.858  1.00 37.82 ? 166 TRP A CG  1 
ATOM   664  C CD1 . TRP A 1 88  ? 81.196 46.836 -1.327  1.00 37.20 ? 166 TRP A CD1 1 
ATOM   665  C CD2 . TRP A 1 88  ? 79.803 47.269 0.373   1.00 37.05 ? 166 TRP A CD2 1 
ATOM   666  N NE1 . TRP A 1 88  ? 81.839 47.697 -0.464  1.00 35.09 ? 166 TRP A NE1 1 
ATOM   667  C CE2 . TRP A 1 88  ? 81.009 47.976 0.586   1.00 35.14 ? 166 TRP A CE2 1 
ATOM   668  C CE3 . TRP A 1 88  ? 78.774 47.385 1.317   1.00 35.75 ? 166 TRP A CE3 1 
ATOM   669  C CZ2 . TRP A 1 88  ? 81.211 48.787 1.707   1.00 34.57 ? 166 TRP A CZ2 1 
ATOM   670  C CZ3 . TRP A 1 88  ? 78.977 48.193 2.430   1.00 34.21 ? 166 TRP A CZ3 1 
ATOM   671  C CH2 . TRP A 1 88  ? 80.187 48.882 2.615   1.00 34.67 ? 166 TRP A CH2 1 
ATOM   672  N N   . GLN A 1 89  ? 77.301 42.947 -0.401  1.00 38.42 ? 167 GLN A N   1 
ATOM   673  C CA  . GLN A 1 89  ? 76.165 42.053 -0.526  1.00 36.08 ? 167 GLN A CA  1 
ATOM   674  C C   . GLN A 1 89  ? 75.089 42.446 0.459   1.00 33.12 ? 167 GLN A C   1 
ATOM   675  O O   . GLN A 1 89  ? 75.291 43.316 1.297   1.00 32.63 ? 167 GLN A O   1 
ATOM   676  C CB  . GLN A 1 89  ? 76.616 40.627 -0.198  1.00 38.50 ? 167 GLN A CB  1 
ATOM   677  C CG  . GLN A 1 89  ? 76.940 40.425 1.302   1.00 39.11 ? 167 GLN A CG  1 
ATOM   678  C CD  . GLN A 1 89  ? 77.506 39.051 1.621   1.00 39.94 ? 167 GLN A CD  1 
ATOM   679  O OE1 . GLN A 1 89  ? 78.715 38.834 1.567   1.00 41.51 ? 167 GLN A OE1 1 
ATOM   680  N NE2 . GLN A 1 89  ? 76.631 38.117 1.944   1.00 40.31 ? 167 GLN A NE2 1 
ATOM   681  N N   . TRP A 1 90  ? 73.950 41.775 0.376   1.00 31.47 ? 168 TRP A N   1 
ATOM   682  C CA  . TRP A 1 90  ? 72.871 42.037 1.309   1.00 31.05 ? 168 TRP A CA  1 
ATOM   683  C C   . TRP A 1 90  ? 73.053 41.141 2.526   1.00 32.70 ? 168 TRP A C   1 
ATOM   684  O O   . TRP A 1 90  ? 73.615 40.049 2.428   1.00 32.96 ? 168 TRP A O   1 
ATOM   685  C CB  . TRP A 1 90  ? 71.520 41.774 0.656   1.00 28.69 ? 168 TRP A CB  1 
ATOM   686  C CG  . TRP A 1 90  ? 71.307 42.625 -0.558  1.00 28.53 ? 168 TRP A CG  1 
ATOM   687  C CD1 . TRP A 1 90  ? 71.386 42.229 -1.865  1.00 26.48 ? 168 TRP A CD1 1 
ATOM   688  C CD2 . TRP A 1 90  ? 71.040 44.034 -0.582  1.00 26.34 ? 168 TRP A CD2 1 
ATOM   689  N NE1 . TRP A 1 90  ? 71.189 43.301 -2.700  1.00 25.39 ? 168 TRP A NE1 1 
ATOM   690  C CE2 . TRP A 1 90  ? 70.973 44.421 -1.943  1.00 25.74 ? 168 TRP A CE2 1 
ATOM   691  C CE3 . TRP A 1 90  ? 70.853 45.004 0.409   1.00 25.68 ? 168 TRP A CE3 1 
ATOM   692  C CZ2 . TRP A 1 90  ? 70.725 45.736 -2.336  1.00 25.21 ? 168 TRP A CZ2 1 
ATOM   693  C CZ3 . TRP A 1 90  ? 70.607 46.318 0.019   1.00 26.76 ? 168 TRP A CZ3 1 
ATOM   694  C CH2 . TRP A 1 90  ? 70.546 46.670 -1.348  1.00 26.87 ? 168 TRP A CH2 1 
ATOM   695  N N   . GLU A 1 91  ? 72.577 41.605 3.673   1.00 34.61 ? 169 GLU A N   1 
ATOM   696  C CA  . GLU A 1 91  ? 72.703 40.850 4.910   1.00 36.79 ? 169 GLU A CA  1 
ATOM   697  C C   . GLU A 1 91  ? 72.267 39.392 4.804   1.00 36.93 ? 169 GLU A C   1 
ATOM   698  O O   . GLU A 1 91  ? 72.628 38.579 5.656   1.00 38.13 ? 169 GLU A O   1 
ATOM   699  C CB  . GLU A 1 91  ? 71.917 41.547 6.025   1.00 39.39 ? 169 GLU A CB  1 
ATOM   700  C CG  . GLU A 1 91  ? 71.036 42.679 5.537   1.00 41.52 ? 169 GLU A CG  1 
ATOM   701  C CD  . GLU A 1 91  ? 69.638 42.229 5.207   1.00 44.57 ? 169 GLU A CD  1 
ATOM   702  O OE1 . GLU A 1 91  ? 68.948 42.948 4.456   1.00 47.64 ? 169 GLU A OE1 1 
ATOM   703  O OE2 . GLU A 1 91  ? 69.220 41.166 5.713   1.00 47.97 ? 169 GLU A OE2 1 
ATOM   704  N N   . ASP A 1 92  ? 71.506 39.048 3.771   1.00 35.56 ? 170 ASP A N   1 
ATOM   705  C CA  . ASP A 1 92  ? 71.048 37.671 3.646   1.00 35.00 ? 170 ASP A CA  1 
ATOM   706  C C   . ASP A 1 92  ? 71.858 36.787 2.711   1.00 34.97 ? 170 ASP A C   1 
ATOM   707  O O   . ASP A 1 92  ? 71.382 35.724 2.328   1.00 36.32 ? 170 ASP A O   1 
ATOM   708  C CB  . ASP A 1 92  ? 69.566 37.624 3.227   1.00 34.36 ? 170 ASP A CB  1 
ATOM   709  C CG  . ASP A 1 92  ? 69.331 38.110 1.799   1.00 33.73 ? 170 ASP A CG  1 
ATOM   710  O OD1 . ASP A 1 92  ? 70.306 38.269 1.045   1.00 31.64 ? 170 ASP A OD1 1 
ATOM   711  O OD2 . ASP A 1 92  ? 68.162 38.321 1.420   1.00 36.73 ? 170 ASP A OD2 1 
ATOM   712  N N   . GLY A 1 93  ? 73.072 37.204 2.355   1.00 34.75 ? 171 GLY A N   1 
ATOM   713  C CA  . GLY A 1 93  ? 73.891 36.410 1.450   1.00 34.28 ? 171 GLY A CA  1 
ATOM   714  C C   . GLY A 1 93  ? 73.510 36.636 -0.004  1.00 34.29 ? 171 GLY A C   1 
ATOM   715  O O   . GLY A 1 93  ? 74.172 36.140 -0.919  1.00 33.02 ? 171 GLY A O   1 
ATOM   716  N N   . SER A 1 94  ? 72.437 37.389 -0.223  1.00 35.43 ? 172 SER A N   1 
ATOM   717  C CA  . SER A 1 94  ? 72.006 37.650 -1.581  1.00 38.39 ? 172 SER A CA  1 
ATOM   718  C C   . SER A 1 94  ? 72.884 38.711 -2.226  1.00 39.28 ? 172 SER A C   1 
ATOM   719  O O   . SER A 1 94  ? 73.280 39.717 -1.623  1.00 39.73 ? 172 SER A O   1 
ATOM   720  C CB  . SER A 1 94  ? 70.511 38.025 -1.658  1.00 38.58 ? 172 SER A CB  1 
ATOM   721  O OG  . SER A 1 94  ? 70.253 39.364 -1.290  1.00 43.83 ? 172 SER A OG  1 
ATOM   722  N N   . ILE A 1 95  ? 73.183 38.431 -3.479  1.00 39.89 ? 173 ILE A N   1 
ATOM   723  C CA  . ILE A 1 95  ? 74.042 39.233 -4.313  1.00 41.90 ? 173 ILE A CA  1 
ATOM   724  C C   . ILE A 1 95  ? 73.503 40.565 -4.831  1.00 42.18 ? 173 ILE A C   1 
ATOM   725  O O   . ILE A 1 95  ? 72.353 40.675 -5.255  1.00 42.15 ? 173 ILE A O   1 
ATOM   726  C CB  . ILE A 1 95  ? 74.488 38.366 -5.490  1.00 43.50 ? 173 ILE A CB  1 
ATOM   727  C CG1 . ILE A 1 95  ? 74.280 39.094 -6.812  1.00 44.62 ? 173 ILE A CG1 1 
ATOM   728  C CG2 . ILE A 1 95  ? 73.668 37.079 -5.501  1.00 46.62 ? 173 ILE A CG2 1 
ATOM   729  C CD1 . ILE A 1 95  ? 75.332 38.765 -7.820  1.00 46.15 ? 173 ILE A CD1 1 
ATOM   730  N N   . LEU A 1 96  ? 74.354 41.582 -4.783  1.00 41.91 ? 174 LEU A N   1 
ATOM   731  C CA  . LEU A 1 96  ? 73.978 42.874 -5.306  1.00 42.31 ? 174 LEU A CA  1 
ATOM   732  C C   . LEU A 1 96  ? 74.056 42.688 -6.813  1.00 43.65 ? 174 LEU A C   1 
ATOM   733  O O   . LEU A 1 96  ? 74.958 42.020 -7.320  1.00 44.23 ? 174 LEU A O   1 
ATOM   734  C CB  . LEU A 1 96  ? 74.970 43.947 -4.870  1.00 40.55 ? 174 LEU A CB  1 
ATOM   735  C CG  . LEU A 1 96  ? 74.783 45.271 -5.618  1.00 40.24 ? 174 LEU A CG  1 
ATOM   736  C CD1 . LEU A 1 96  ? 73.368 45.833 -5.405  1.00 38.01 ? 174 LEU A CD1 1 
ATOM   737  C CD2 . LEU A 1 96  ? 75.836 46.246 -5.151  1.00 36.76 ? 174 LEU A CD2 1 
ATOM   738  N N   . SER A 1 97  ? 73.109 43.267 -7.533  1.00 44.58 ? 175 SER A N   1 
ATOM   739  C CA  . SER A 1 97  ? 73.098 43.136 -8.977  1.00 45.86 ? 175 SER A CA  1 
ATOM   740  C C   . SER A 1 97  ? 73.643 44.369 -9.679  1.00 47.13 ? 175 SER A C   1 
ATOM   741  O O   . SER A 1 97  ? 73.605 45.480 -9.140  1.00 46.88 ? 175 SER A O   1 
ATOM   742  C CB  . SER A 1 97  ? 71.682 42.839 -9.474  1.00 45.77 ? 175 SER A CB  1 
ATOM   743  O OG  . SER A 1 97  ? 71.453 41.442 -9.553  1.00 44.63 ? 175 SER A OG  1 
ATOM   744  N N   . PRO A 1 98  ? 74.161 44.179 -10.905 1.00 47.90 ? 176 PRO A N   1 
ATOM   745  C CA  . PRO A 1 98  ? 74.736 45.230 -11.747 1.00 47.23 ? 176 PRO A CA  1 
ATOM   746  C C   . PRO A 1 98  ? 73.693 46.222 -12.242 1.00 47.16 ? 176 PRO A C   1 
ATOM   747  O O   . PRO A 1 98  ? 72.513 45.890 -12.376 1.00 46.25 ? 176 PRO A O   1 
ATOM   748  C CB  . PRO A 1 98  ? 75.370 44.442 -12.887 1.00 46.07 ? 176 PRO A CB  1 
ATOM   749  C CG  . PRO A 1 98  ? 74.440 43.285 -13.031 1.00 46.05 ? 176 PRO A CG  1 
ATOM   750  C CD  . PRO A 1 98  ? 74.211 42.878 -11.596 1.00 46.82 ? 176 PRO A CD  1 
ATOM   751  N N   . ASN A 1 99  ? 74.146 47.444 -12.488 1.00 47.59 ? 177 ASN A N   1 
ATOM   752  C CA  . ASN A 1 99  ? 73.305 48.518 -12.990 1.00 48.22 ? 177 ASN A CA  1 
ATOM   753  C C   . ASN A 1 99  ? 72.173 48.958 -12.052 1.00 48.97 ? 177 ASN A C   1 
ATOM   754  O O   . ASN A 1 99  ? 71.094 49.324 -12.525 1.00 49.46 ? 177 ASN A O   1 
ATOM   755  C CB  . ASN A 1 99  ? 72.712 48.119 -14.354 1.00 49.05 ? 177 ASN A CB  1 
ATOM   756  C CG  . ASN A 1 99  ? 73.770 47.610 -15.338 1.00 50.78 ? 177 ASN A CG  1 
ATOM   757  O OD1 . ASN A 1 99  ? 74.832 48.220 -15.511 1.00 51.52 ? 177 ASN A OD1 1 
ATOM   758  N ND2 . ASN A 1 99  ? 73.471 46.496 -15.999 1.00 50.21 ? 177 ASN A ND2 1 
ATOM   759  N N   . LEU A 1 100 ? 72.400 48.928 -10.736 1.00 48.48 ? 178 LEU A N   1 
ATOM   760  C CA  . LEU A 1 100 ? 71.362 49.356 -9.789  1.00 46.61 ? 178 LEU A CA  1 
ATOM   761  C C   . LEU A 1 100 ? 71.848 50.557 -9.014  1.00 45.49 ? 178 LEU A C   1 
ATOM   762  O O   . LEU A 1 100 ? 71.448 51.692 -9.269  1.00 46.96 ? 178 LEU A O   1 
ATOM   763  C CB  . LEU A 1 100 ? 71.027 48.272 -8.769  1.00 46.35 ? 178 LEU A CB  1 
ATOM   764  C CG  . LEU A 1 100 ? 70.545 46.903 -9.211  1.00 48.49 ? 178 LEU A CG  1 
ATOM   765  C CD1 . LEU A 1 100 ? 70.000 46.174 -7.994  1.00 50.58 ? 178 LEU A CD1 1 
ATOM   766  C CD2 . LEU A 1 100 ? 69.472 47.047 -10.270 1.00 48.73 ? 178 LEU A CD2 1 
ATOM   767  N N   . LEU A 1 101 ? 72.737 50.287 -8.067  1.00 43.84 ? 179 LEU A N   1 
ATOM   768  C CA  . LEU A 1 101 ? 73.291 51.310 -7.198  1.00 41.66 ? 179 LEU A CA  1 
ATOM   769  C C   . LEU A 1 101 ? 74.655 51.880 -7.584  1.00 40.39 ? 179 LEU A C   1 
ATOM   770  O O   . LEU A 1 101 ? 75.528 51.186 -8.105  1.00 40.45 ? 179 LEU A O   1 
ATOM   771  C CB  . LEU A 1 101 ? 73.383 50.761 -5.773  1.00 39.31 ? 179 LEU A CB  1 
ATOM   772  C CG  . LEU A 1 101 ? 72.086 50.354 -5.085  1.00 38.72 ? 179 LEU A CG  1 
ATOM   773  C CD1 . LEU A 1 101 ? 72.402 49.561 -3.835  1.00 36.60 ? 179 LEU A CD1 1 
ATOM   774  C CD2 . LEU A 1 101 ? 71.271 51.596 -4.753  1.00 39.26 ? 179 LEU A CD2 1 
ATOM   775  N N   . THR A 1 102 ? 74.810 53.169 -7.317  1.00 38.96 ? 180 THR A N   1 
ATOM   776  C CA  . THR A 1 102 ? 76.056 53.878 -7.538  1.00 38.56 ? 180 THR A CA  1 
ATOM   777  C C   . THR A 1 102 ? 76.520 54.071 -6.096  1.00 38.17 ? 180 THR A C   1 
ATOM   778  O O   . THR A 1 102 ? 75.812 54.690 -5.305  1.00 37.92 ? 180 THR A O   1 
ATOM   779  C CB  . THR A 1 102 ? 75.819 55.261 -8.171  1.00 39.05 ? 180 THR A CB  1 
ATOM   780  O OG1 . THR A 1 102 ? 75.195 55.108 -9.450  1.00 42.48 ? 180 THR A OG1 1 
ATOM   781  C CG2 . THR A 1 102 ? 77.129 55.994 -8.340  1.00 39.55 ? 180 THR A CG2 1 
ATOM   782  N N   . ILE A 1 103 ? 77.686 53.535 -5.742  1.00 37.13 ? 181 ILE A N   1 
ATOM   783  C CA  . ILE A 1 103 ? 78.165 53.661 -4.374  1.00 35.67 ? 181 ILE A CA  1 
ATOM   784  C C   . ILE A 1 103 ? 79.075 54.850 -4.146  1.00 36.40 ? 181 ILE A C   1 
ATOM   785  O O   . ILE A 1 103 ? 79.861 55.219 -5.015  1.00 36.47 ? 181 ILE A O   1 
ATOM   786  C CB  . ILE A 1 103 ? 78.870 52.384 -3.932  1.00 35.39 ? 181 ILE A CB  1 
ATOM   787  C CG1 . ILE A 1 103 ? 77.896 51.214 -4.060  1.00 36.57 ? 181 ILE A CG1 1 
ATOM   788  C CG2 . ILE A 1 103 ? 79.307 52.494 -2.480  1.00 35.51 ? 181 ILE A CG2 1 
ATOM   789  C CD1 . ILE A 1 103 ? 78.483 49.908 -3.652  1.00 36.80 ? 181 ILE A CD1 1 
ATOM   790  N N   . ILE A 1 104 ? 78.944 55.451 -2.965  1.00 36.45 ? 182 ILE A N   1 
ATOM   791  C CA  . ILE A 1 104 ? 79.726 56.619 -2.578  1.00 37.13 ? 182 ILE A CA  1 
ATOM   792  C C   . ILE A 1 104 ? 80.546 56.278 -1.350  1.00 37.81 ? 182 ILE A C   1 
ATOM   793  O O   . ILE A 1 104 ? 80.079 55.560 -0.473  1.00 37.73 ? 182 ILE A O   1 
ATOM   794  C CB  . ILE A 1 104 ? 78.816 57.809 -2.198  1.00 37.90 ? 182 ILE A CB  1 
ATOM   795  C CG1 . ILE A 1 104 ? 77.645 57.927 -3.185  1.00 37.79 ? 182 ILE A CG1 1 
ATOM   796  C CG2 . ILE A 1 104 ? 79.641 59.085 -2.120  1.00 36.23 ? 182 ILE A CG2 1 
ATOM   797  C CD1 . ILE A 1 104 ? 78.030 57.887 -4.644  1.00 38.15 ? 182 ILE A CD1 1 
ATOM   798  N N   . GLU A 1 105 ? 81.760 56.808 -1.277  1.00 39.32 ? 183 GLU A N   1 
ATOM   799  C CA  . GLU A 1 105 ? 82.622 56.539 -0.138  1.00 42.51 ? 183 GLU A CA  1 
ATOM   800  C C   . GLU A 1 105 ? 83.296 57.803 0.365   1.00 44.37 ? 183 GLU A C   1 
ATOM   801  O O   . GLU A 1 105 ? 84.116 58.392 -0.331  1.00 46.06 ? 183 GLU A O   1 
ATOM   802  C CB  . GLU A 1 105 ? 83.697 55.519 -0.508  1.00 43.18 ? 183 GLU A CB  1 
ATOM   803  C CG  . GLU A 1 105 ? 84.380 54.909 0.708   1.00 43.50 ? 183 GLU A CG  1 
ATOM   804  C CD  . GLU A 1 105 ? 85.544 54.028 0.341   1.00 43.71 ? 183 GLU A CD  1 
ATOM   805  O OE1 . GLU A 1 105 ? 85.874 53.139 1.145   1.00 45.58 ? 183 GLU A OE1 1 
ATOM   806  O OE2 . GLU A 1 105 ? 86.139 54.229 -0.741  1.00 44.56 ? 183 GLU A OE2 1 
ATOM   807  N N   . MET A 1 106 ? 82.959 58.209 1.584   1.00 45.91 ? 184 MET A N   1 
ATOM   808  C CA  . MET A 1 106 ? 83.531 59.412 2.180   1.00 48.28 ? 184 MET A CA  1 
ATOM   809  C C   . MET A 1 106 ? 83.895 59.078 3.620   1.00 48.58 ? 184 MET A C   1 
ATOM   810  O O   . MET A 1 106 ? 84.440 59.905 4.358   1.00 48.05 ? 184 MET A O   1 
ATOM   811  C CB  . MET A 1 106 ? 82.489 60.534 2.211   1.00 49.65 ? 184 MET A CB  1 
ATOM   812  C CG  . MET A 1 106 ? 81.620 60.663 0.975   1.00 51.21 ? 184 MET A CG  1 
ATOM   813  S SD  . MET A 1 106 ? 82.022 62.150 0.045   1.00 54.20 ? 184 MET A SD  1 
ATOM   814  C CE  . MET A 1 106 ? 81.207 61.819 -1.529  1.00 54.00 ? 184 MET A CE  1 
ATOM   815  N N   . GLN A 1 107 ? 83.607 57.841 3.993   1.00 48.96 ? 185 GLN A N   1 
ATOM   816  C CA  . GLN A 1 107 ? 83.785 57.379 5.358   1.00 48.57 ? 185 GLN A CA  1 
ATOM   817  C C   . GLN A 1 107 ? 84.260 55.929 5.339   1.00 47.45 ? 185 GLN A C   1 
ATOM   818  O O   . GLN A 1 107 ? 84.165 55.257 4.313   1.00 48.75 ? 185 GLN A O   1 
ATOM   819  C CB  . GLN A 1 107 ? 82.407 57.474 6.001   1.00 50.06 ? 185 GLN A CB  1 
ATOM   820  C CG  . GLN A 1 107 ? 82.292 57.647 7.479   1.00 51.66 ? 185 GLN A CG  1 
ATOM   821  C CD  . GLN A 1 107 ? 80.896 58.110 7.835   1.00 52.56 ? 185 GLN A CD  1 
ATOM   822  O OE1 . GLN A 1 107 ? 80.552 59.279 7.648   1.00 53.28 ? 185 GLN A OE1 1 
ATOM   823  N NE2 . GLN A 1 107 ? 80.070 57.187 8.312   1.00 53.67 ? 185 GLN A NE2 1 
ATOM   824  N N   . LYS A 1 108 ? 84.776 55.435 6.457   1.00 45.69 ? 186 LYS A N   1 
ATOM   825  C CA  . LYS A 1 108 ? 85.196 54.041 6.489   1.00 43.48 ? 186 LYS A CA  1 
ATOM   826  C C   . LYS A 1 108 ? 84.026 53.242 7.040   1.00 41.60 ? 186 LYS A C   1 
ATOM   827  O O   . LYS A 1 108 ? 83.455 53.609 8.060   1.00 42.56 ? 186 LYS A O   1 
ATOM   828  C CB  . LYS A 1 108 ? 86.421 53.845 7.381   1.00 43.50 ? 186 LYS A CB  1 
ATOM   829  C CG  . LYS A 1 108 ? 87.080 52.494 7.183   1.00 43.56 ? 186 LYS A CG  1 
ATOM   830  C CD  . LYS A 1 108 ? 88.387 52.373 7.948   1.00 45.73 ? 186 LYS A CD  1 
ATOM   831  C CE  . LYS A 1 108 ? 89.140 51.107 7.543   1.00 47.39 ? 186 LYS A CE  1 
ATOM   832  N NZ  . LYS A 1 108 ? 90.364 50.847 8.363   1.00 48.50 ? 186 LYS A NZ  1 
ATOM   833  N N   . GLY A 1 109 ? 83.654 52.163 6.360   1.00 40.68 ? 187 GLY A N   1 
ATOM   834  C CA  . GLY A 1 109 ? 82.538 51.363 6.836   1.00 37.22 ? 187 GLY A CA  1 
ATOM   835  C C   . GLY A 1 109 ? 82.276 50.074 6.080   1.00 35.66 ? 187 GLY A C   1 
ATOM   836  O O   . GLY A 1 109 ? 82.709 49.891 4.935   1.00 34.90 ? 187 GLY A O   1 
ATOM   837  N N   . ASP A 1 110 ? 81.556 49.176 6.742   1.00 32.93 ? 188 ASP A N   1 
ATOM   838  C CA  . ASP A 1 110 ? 81.194 47.895 6.170   1.00 30.02 ? 188 ASP A CA  1 
ATOM   839  C C   . ASP A 1 110 ? 79.677 47.772 6.095   1.00 27.79 ? 188 ASP A C   1 
ATOM   840  O O   . ASP A 1 110 ? 79.138 46.685 5.973   1.00 27.63 ? 188 ASP A O   1 
ATOM   841  C CB  . ASP A 1 110 ? 81.792 46.772 7.011   1.00 31.54 ? 188 ASP A CB  1 
ATOM   842  C CG  . ASP A 1 110 ? 83.314 46.725 6.925   1.00 34.05 ? 188 ASP A CG  1 
ATOM   843  O OD1 . ASP A 1 110 ? 83.848 46.508 5.808   1.00 31.36 ? 188 ASP A OD1 1 
ATOM   844  O OD2 . ASP A 1 110 ? 83.973 46.905 7.974   1.00 33.51 ? 188 ASP A OD2 1 
ATOM   845  N N   . CYS A 1 111 ? 79.009 48.916 6.176   1.00 26.72 ? 189 CYS A N   1 
ATOM   846  C CA  . CYS A 1 111 ? 77.556 49.022 6.089   1.00 26.72 ? 189 CYS A CA  1 
ATOM   847  C C   . CYS A 1 111 ? 77.284 50.173 5.129   1.00 27.12 ? 189 CYS A C   1 
ATOM   848  O O   . CYS A 1 111 ? 78.210 50.907 4.772   1.00 27.95 ? 189 CYS A O   1 
ATOM   849  C CB  . CYS A 1 111 ? 76.968 49.343 7.462   1.00 26.81 ? 189 CYS A CB  1 
ATOM   850  S SG  . CYS A 1 111 ? 77.080 47.909 8.559   1.00 31.40 ? 189 CYS A SG  1 
ATOM   851  N N   . ALA A 1 112 ? 76.032 50.345 4.717   1.00 25.90 ? 190 ALA A N   1 
ATOM   852  C CA  . ALA A 1 112 ? 75.692 51.428 3.807   1.00 24.87 ? 190 ALA A CA  1 
ATOM   853  C C   . ALA A 1 112 ? 74.304 52.013 4.021   1.00 24.11 ? 190 ALA A C   1 
ATOM   854  O O   . ALA A 1 112 ? 73.355 51.295 4.315   1.00 24.58 ? 190 ALA A O   1 
ATOM   855  C CB  . ALA A 1 112 ? 75.831 50.955 2.359   1.00 24.97 ? 190 ALA A CB  1 
ATOM   856  N N   . LEU A 1 113 ? 74.212 53.331 3.865   1.00 23.70 ? 191 LEU A N   1 
ATOM   857  C CA  . LEU A 1 113 ? 72.960 54.068 3.989   1.00 24.08 ? 191 LEU A CA  1 
ATOM   858  C C   . LEU A 1 113 ? 72.420 54.255 2.565   1.00 25.68 ? 191 LEU A C   1 
ATOM   859  O O   . LEU A 1 113 ? 73.195 54.463 1.619   1.00 25.21 ? 191 LEU A O   1 
ATOM   860  C CB  . LEU A 1 113 ? 73.210 55.453 4.608   1.00 22.71 ? 191 LEU A CB  1 
ATOM   861  C CG  . LEU A 1 113 ? 73.799 55.551 6.021   1.00 24.81 ? 191 LEU A CG  1 
ATOM   862  C CD1 . LEU A 1 113 ? 74.465 56.908 6.207   1.00 23.82 ? 191 LEU A CD1 1 
ATOM   863  C CD2 . LEU A 1 113 ? 72.712 55.332 7.065   1.00 25.25 ? 191 LEU A CD2 1 
ATOM   864  N N   . TYR A 1 114 ? 71.100 54.171 2.404   1.00 26.08 ? 192 TYR A N   1 
ATOM   865  C CA  . TYR A 1 114 ? 70.499 54.367 1.093   1.00 24.86 ? 192 TYR A CA  1 
ATOM   866  C C   . TYR A 1 114 ? 70.237 55.847 0.914   1.00 24.99 ? 192 TYR A C   1 
ATOM   867  O O   . TYR A 1 114 ? 69.794 56.520 1.840   1.00 23.76 ? 192 TYR A O   1 
ATOM   868  C CB  . TYR A 1 114 ? 69.173 53.606 0.951   1.00 23.95 ? 192 TYR A CB  1 
ATOM   869  C CG  . TYR A 1 114 ? 68.398 54.036 -0.279  1.00 25.32 ? 192 TYR A CG  1 
ATOM   870  C CD1 . TYR A 1 114 ? 67.463 55.072 -0.216  1.00 24.76 ? 192 TYR A CD1 1 
ATOM   871  C CD2 . TYR A 1 114 ? 68.704 53.513 -1.534  1.00 27.07 ? 192 TYR A CD2 1 
ATOM   872  C CE1 . TYR A 1 114 ? 66.875 55.582 -1.359  1.00 23.27 ? 192 TYR A CE1 1 
ATOM   873  C CE2 . TYR A 1 114 ? 68.115 54.023 -2.691  1.00 26.60 ? 192 TYR A CE2 1 
ATOM   874  C CZ  . TYR A 1 114 ? 67.207 55.057 -2.592  1.00 25.79 ? 192 TYR A CZ  1 
ATOM   875  O OH  . TYR A 1 114 ? 66.653 55.579 -3.736  1.00 27.55 ? 192 TYR A OH  1 
ATOM   876  N N   . ALA A 1 115 ? 70.516 56.353 -0.281  1.00 26.08 ? 193 ALA A N   1 
ATOM   877  C CA  . ALA A 1 115 ? 70.281 57.758 -0.579  1.00 27.64 ? 193 ALA A CA  1 
ATOM   878  C C   . ALA A 1 115 ? 69.426 57.841 -1.815  1.00 28.51 ? 193 ALA A C   1 
ATOM   879  O O   . ALA A 1 115 ? 69.504 56.975 -2.683  1.00 29.47 ? 193 ALA A O   1 
ATOM   880  C CB  . ALA A 1 115 ? 71.553 58.449 -0.819  1.00 27.42 ? 193 ALA A CB  1 
ATOM   881  N N   . SER A 1 116 ? 68.640 58.899 -1.925  1.00 29.66 ? 194 SER A N   1 
ATOM   882  C CA  . SER A 1 116 ? 67.756 58.990 -3.066  1.00 31.86 ? 194 SER A CA  1 
ATOM   883  C C   . SER A 1 116 ? 68.370 59.057 -4.455  1.00 32.70 ? 194 SER A C   1 
ATOM   884  O O   . SER A 1 116 ? 69.216 59.894 -4.789  1.00 30.46 ? 194 SER A O   1 
ATOM   885  C CB  . SER A 1 116 ? 66.749 60.117 -2.901  1.00 31.99 ? 194 SER A CB  1 
ATOM   886  O OG  . SER A 1 116 ? 66.003 60.233 -4.095  1.00 32.07 ? 194 SER A OG  1 
ATOM   887  N N   . SER A 1 117 ? 67.863 58.115 -5.238  1.00 34.68 ? 195 SER A N   1 
ATOM   888  C CA  . SER A 1 117 ? 68.164 57.816 -6.623  1.00 34.48 ? 195 SER A CA  1 
ATOM   889  C C   . SER A 1 117 ? 69.200 56.732 -6.722  1.00 33.54 ? 195 SER A C   1 
ATOM   890  O O   . SER A 1 117 ? 70.253 56.886 -7.334  1.00 33.07 ? 195 SER A O   1 
ATOM   891  C CB  . SER A 1 117 ? 68.570 59.038 -7.421  1.00 36.39 ? 195 SER A CB  1 
ATOM   892  O OG  . SER A 1 117 ? 67.877 58.965 -8.658  1.00 40.69 ? 195 SER A OG  1 
ATOM   893  N N   . PHE A 1 118 ? 68.861 55.622 -6.086  1.00 32.78 ? 196 PHE A N   1 
ATOM   894  C CA  . PHE A 1 118 ? 69.681 54.433 -6.078  1.00 33.66 ? 196 PHE A CA  1 
ATOM   895  C C   . PHE A 1 118 ? 71.160 54.711 -5.926  1.00 33.01 ? 196 PHE A C   1 
ATOM   896  O O   . PHE A 1 118 ? 71.900 54.774 -6.902  1.00 32.85 ? 196 PHE A O   1 
ATOM   897  C CB  . PHE A 1 118 ? 69.399 53.636 -7.351  1.00 36.18 ? 196 PHE A CB  1 
ATOM   898  C CG  . PHE A 1 118 ? 67.950 53.258 -7.502  1.00 37.52 ? 196 PHE A CG  1 
ATOM   899  C CD1 . PHE A 1 118 ? 67.089 54.033 -8.270  1.00 37.53 ? 196 PHE A CD1 1 
ATOM   900  C CD2 . PHE A 1 118 ? 67.429 52.167 -6.811  1.00 37.74 ? 196 PHE A CD2 1 
ATOM   901  C CE1 . PHE A 1 118 ? 65.735 53.731 -8.343  1.00 37.37 ? 196 PHE A CE1 1 
ATOM   902  C CE2 . PHE A 1 118 ? 66.075 51.859 -6.879  1.00 37.77 ? 196 PHE A CE2 1 
ATOM   903  C CZ  . PHE A 1 118 ? 65.227 52.644 -7.644  1.00 38.14 ? 196 PHE A CZ  1 
ATOM   904  N N   . LYS A 1 119 ? 71.574 54.861 -4.675  1.00 32.68 ? 197 LYS A N   1 
ATOM   905  C CA  . LYS A 1 119 ? 72.954 55.146 -4.326  1.00 31.69 ? 197 LYS A CA  1 
ATOM   906  C C   . LYS A 1 119 ? 73.217 54.660 -2.915  1.00 30.68 ? 197 LYS A C   1 
ATOM   907  O O   . LYS A 1 119 ? 72.338 54.718 -2.059  1.00 30.49 ? 197 LYS A O   1 
ATOM   908  C CB  . LYS A 1 119 ? 73.216 56.646 -4.394  1.00 33.55 ? 197 LYS A CB  1 
ATOM   909  C CG  . LYS A 1 119 ? 73.638 57.173 -5.767  1.00 37.35 ? 197 LYS A CG  1 
ATOM   910  C CD  . LYS A 1 119 ? 72.998 58.530 -6.111  1.00 39.45 ? 197 LYS A CD  1 
ATOM   911  C CE  . LYS A 1 119 ? 72.586 59.328 -4.874  1.00 41.71 ? 197 LYS A CE  1 
ATOM   912  N NZ  . LYS A 1 119 ? 73.708 59.555 -3.926  1.00 43.77 ? 197 LYS A NZ  1 
ATOM   913  N N   . GLY A 1 120 ? 74.438 54.181 -2.696  1.00 30.30 ? 198 GLY A N   1 
ATOM   914  C CA  . GLY A 1 120 ? 74.837 53.675 -1.411  1.00 28.87 ? 198 GLY A CA  1 
ATOM   915  C C   . GLY A 1 120 ? 75.984 54.512 -0.890  1.00 28.86 ? 198 GLY A C   1 
ATOM   916  O O   . GLY A 1 120 ? 76.938 54.866 -1.613  1.00 28.53 ? 198 GLY A O   1 
ATOM   917  N N   A TYR A 1 121 ? 75.920 54.850 0.397   0.50 27.87 ? 199 TYR A N   1 
ATOM   918  N N   B TYR A 1 121 ? 75.846 54.857 0.375   0.50 28.73 ? 199 TYR A N   1 
ATOM   919  C CA  A TYR A 1 121 ? 76.951 55.660 1.032   0.50 27.31 ? 199 TYR A CA  1 
ATOM   920  C CA  B TYR A 1 121 ? 76.838 55.664 1.023   0.50 28.87 ? 199 TYR A CA  1 
ATOM   921  C C   A TYR A 1 121 ? 77.538 54.768 2.084   0.50 27.86 ? 199 TYR A C   1 
ATOM   922  C C   B TYR A 1 121 ? 77.551 54.866 2.132   0.50 28.90 ? 199 TYR A C   1 
ATOM   923  O O   A TYR A 1 121 ? 76.827 54.248 2.960   0.50 28.83 ? 199 TYR A O   1 
ATOM   924  O O   B TYR A 1 121 ? 76.957 54.574 3.158   0.50 30.10 ? 199 TYR A O   1 
ATOM   925  C CB  A TYR A 1 121 ? 76.382 56.926 1.715   0.50 26.49 ? 199 TYR A CB  1 
ATOM   926  C CB  B TYR A 1 121 ? 76.121 56.895 1.564   0.50 29.68 ? 199 TYR A CB  1 
ATOM   927  C CG  A TYR A 1 121 ? 75.970 58.068 0.788   0.50 25.06 ? 199 TYR A CG  1 
ATOM   928  C CG  B TYR A 1 121 ? 76.949 57.874 2.365   0.50 30.74 ? 199 TYR A CG  1 
ATOM   929  C CD1 A TYR A 1 121 ? 74.697 58.114 0.239   0.50 25.23 ? 199 TYR A CD1 1 
ATOM   930  C CD1 B TYR A 1 121 ? 77.660 58.909 1.746   0.50 30.82 ? 199 TYR A CD1 1 
ATOM   931  C CD2 A TYR A 1 121 ? 76.861 59.094 0.455   0.50 24.10 ? 199 TYR A CD2 1 
ATOM   932  C CD2 B TYR A 1 121 ? 76.950 57.816 3.756   0.50 30.94 ? 199 TYR A CD2 1 
ATOM   933  C CE1 A TYR A 1 121 ? 74.321 59.136 -0.610  0.50 24.95 ? 199 TYR A CE1 1 
ATOM   934  C CE1 B TYR A 1 121 ? 78.332 59.853 2.499   0.50 31.52 ? 199 TYR A CE1 1 
ATOM   935  C CE2 A TYR A 1 121 ? 76.484 60.123 -0.402  0.50 23.83 ? 199 TYR A CE2 1 
ATOM   936  C CE2 B TYR A 1 121 ? 77.617 58.751 4.508   0.50 30.80 ? 199 TYR A CE2 1 
ATOM   937  C CZ  A TYR A 1 121 ? 75.214 60.134 -0.928  0.50 24.31 ? 199 TYR A CZ  1 
ATOM   938  C CZ  B TYR A 1 121 ? 78.302 59.760 3.877   0.50 31.36 ? 199 TYR A CZ  1 
ATOM   939  O OH  A TYR A 1 121 ? 74.834 61.154 -1.764  0.50 24.73 ? 199 TYR A OH  1 
ATOM   940  O OH  B TYR A 1 121 ? 78.978 60.675 4.632   0.50 32.46 ? 199 TYR A OH  1 
ATOM   941  N N   . ILE A 1 122 ? 78.833 54.558 1.967   1.00 27.49 ? 200 ILE A N   1 
ATOM   942  C CA  . ILE A 1 122 ? 79.530 53.776 2.955   1.00 27.67 ? 200 ILE A CA  1 
ATOM   943  C C   . ILE A 1 122 ? 79.547 54.509 4.315   1.00 28.48 ? 200 ILE A C   1 
ATOM   944  O O   . ILE A 1 122 ? 79.973 55.663 4.429   1.00 30.35 ? 200 ILE A O   1 
ATOM   945  C CB  . ILE A 1 122 ? 80.953 53.429 2.444   1.00 27.84 ? 200 ILE A CB  1 
ATOM   946  C CG1 . ILE A 1 122 ? 80.806 52.614 1.156   1.00 25.72 ? 200 ILE A CG1 1 
ATOM   947  C CG2 . ILE A 1 122 ? 81.744 52.621 3.509   1.00 26.51 ? 200 ILE A CG2 1 
ATOM   948  C CD1 . ILE A 1 122 ? 82.096 52.354 0.400   1.00 28.13 ? 200 ILE A CD1 1 
ATOM   949  N N   . GLU A 1 123 ? 79.093 53.816 5.354   1.00 27.87 ? 201 GLU A N   1 
ATOM   950  C CA  . GLU A 1 123 ? 79.039 54.389 6.695   1.00 28.10 ? 201 GLU A CA  1 
ATOM   951  C C   . GLU A 1 123 ? 79.439 53.384 7.761   1.00 27.24 ? 201 GLU A C   1 
ATOM   952  O O   . GLU A 1 123 ? 79.252 52.180 7.599   1.00 28.21 ? 201 GLU A O   1 
ATOM   953  C CB  . GLU A 1 123 ? 77.618 54.861 6.979   1.00 31.01 ? 201 GLU A CB  1 
ATOM   954  C CG  . GLU A 1 123 ? 77.376 55.429 8.369   1.00 33.87 ? 201 GLU A CG  1 
ATOM   955  C CD  . GLU A 1 123 ? 77.305 56.942 8.371   1.00 34.84 ? 201 GLU A CD  1 
ATOM   956  O OE1 . GLU A 1 123 ? 76.928 57.522 9.408   1.00 35.60 ? 201 GLU A OE1 1 
ATOM   957  O OE2 . GLU A 1 123 ? 77.634 57.550 7.332   1.00 36.75 ? 201 GLU A OE2 1 
ATOM   958  N N   . ASN A 1 124 ? 79.983 53.895 8.855   1.00 26.66 ? 202 ASN A N   1 
ATOM   959  C CA  . ASN A 1 124 ? 80.388 53.069 9.980   1.00 26.62 ? 202 ASN A CA  1 
ATOM   960  C C   . ASN A 1 124 ? 79.124 52.354 10.478  1.00 26.61 ? 202 ASN A C   1 
ATOM   961  O O   . ASN A 1 124 ? 78.068 52.968 10.626  1.00 26.35 ? 202 ASN A O   1 
ATOM   962  C CB  . ASN A 1 124 ? 80.960 53.969 11.074  1.00 27.39 ? 202 ASN A CB  1 
ATOM   963  C CG  . ASN A 1 124 ? 81.699 53.201 12.142  1.00 27.79 ? 202 ASN A CG  1 
ATOM   964  O OD1 . ASN A 1 124 ? 81.189 52.241 12.710  1.00 27.90 ? 202 ASN A OD1 1 
ATOM   965  N ND2 . ASN A 1 124 ? 82.915 53.634 12.429  1.00 31.77 ? 202 ASN A ND2 1 
ATOM   966  N N   . CYS A 1 125 ? 79.224 51.057 10.725  1.00 27.46 ? 203 CYS A N   1 
ATOM   967  C CA  . CYS A 1 125 ? 78.069 50.295 11.181  1.00 29.82 ? 203 CYS A CA  1 
ATOM   968  C C   . CYS A 1 125 ? 77.636 50.651 12.595  1.00 32.19 ? 203 CYS A C   1 
ATOM   969  O O   . CYS A 1 125 ? 76.521 50.311 13.014  1.00 31.72 ? 203 CYS A O   1 
ATOM   970  C CB  . CYS A 1 125 ? 78.368 48.806 11.152  1.00 28.77 ? 203 CYS A CB  1 
ATOM   971  S SG  . CYS A 1 125 ? 78.841 48.112 9.551   1.00 29.36 ? 203 CYS A SG  1 
ATOM   972  N N   . SER A 1 126 ? 78.524 51.310 13.337  1.00 32.12 ? 204 SER A N   1 
ATOM   973  C CA  . SER A 1 126 ? 78.222 51.682 14.709  1.00 34.10 ? 204 SER A CA  1 
ATOM   974  C C   . SER A 1 126 ? 77.549 53.040 14.809  1.00 34.99 ? 204 SER A C   1 
ATOM   975  O O   . SER A 1 126 ? 76.981 53.378 15.850  1.00 36.29 ? 204 SER A O   1 
ATOM   976  C CB  . SER A 1 126 ? 79.499 51.676 15.555  1.00 34.46 ? 204 SER A CB  1 
ATOM   977  O OG  . SER A 1 126 ? 80.038 50.366 15.651  1.00 35.29 ? 204 SER A OG  1 
ATOM   978  N N   . THR A 1 127 ? 77.609 53.818 13.734  1.00 33.30 ? 205 THR A N   1 
ATOM   979  C CA  . THR A 1 127 ? 76.994 55.139 13.742  1.00 33.38 ? 205 THR A CA  1 
ATOM   980  C C   . THR A 1 127 ? 75.482 55.075 13.626  1.00 33.25 ? 205 THR A C   1 
ATOM   981  O O   . THR A 1 127 ? 74.947 54.566 12.648  1.00 36.58 ? 205 THR A O   1 
ATOM   982  C CB  . THR A 1 127 ? 77.508 56.006 12.601  1.00 33.08 ? 205 THR A CB  1 
ATOM   983  O OG1 . THR A 1 127 ? 78.906 56.247 12.781  1.00 33.75 ? 205 THR A OG1 1 
ATOM   984  C CG2 . THR A 1 127 ? 76.770 57.326 12.578  1.00 30.28 ? 205 THR A CG2 1 
ATOM   985  N N   . PRO A 1 128 ? 74.770 55.595 14.628  1.00 32.24 ? 206 PRO A N   1 
ATOM   986  C CA  . PRO A 1 128 ? 73.308 55.565 14.574  1.00 31.84 ? 206 PRO A CA  1 
ATOM   987  C C   . PRO A 1 128 ? 72.767 56.338 13.373  1.00 31.07 ? 206 PRO A C   1 
ATOM   988  O O   . PRO A 1 128 ? 73.400 57.276 12.896  1.00 30.80 ? 206 PRO A O   1 
ATOM   989  C CB  . PRO A 1 128 ? 72.898 56.190 15.911  1.00 31.70 ? 206 PRO A CB  1 
ATOM   990  C CG  . PRO A 1 128 ? 74.050 57.097 16.233  1.00 31.86 ? 206 PRO A CG  1 
ATOM   991  C CD  . PRO A 1 128 ? 75.246 56.273 15.847  1.00 31.23 ? 206 PRO A CD  1 
ATOM   992  N N   . ASN A 1 129 ? 71.602 55.921 12.886  1.00 30.33 ? 207 ASN A N   1 
ATOM   993  C CA  . ASN A 1 129 ? 70.939 56.556 11.747  1.00 28.98 ? 207 ASN A CA  1 
ATOM   994  C C   . ASN A 1 129 ? 69.505 56.042 11.711  1.00 29.10 ? 207 ASN A C   1 
ATOM   995  O O   . ASN A 1 129 ? 69.171 55.070 12.390  1.00 27.47 ? 207 ASN A O   1 
ATOM   996  C CB  . ASN A 1 129 ? 71.631 56.172 10.433  1.00 28.50 ? 207 ASN A CB  1 
ATOM   997  C CG  . ASN A 1 129 ? 72.844 57.030 10.122  1.00 27.86 ? 207 ASN A CG  1 
ATOM   998  O OD1 . ASN A 1 129 ? 72.707 58.188 9.745   1.00 29.16 ? 207 ASN A OD1 1 
ATOM   999  N ND2 . ASN A 1 129 ? 74.038 56.463 10.273  1.00 25.10 ? 207 ASN A ND2 1 
ATOM   1000 N N   . THR A 1 130 ? 68.656 56.697 10.931  1.00 28.50 ? 208 THR A N   1 
ATOM   1001 C CA  . THR A 1 130 ? 67.285 56.236 10.798  1.00 29.44 ? 208 THR A CA  1 
ATOM   1002 C C   . THR A 1 130 ? 67.349 55.060 9.831   1.00 31.22 ? 208 THR A C   1 
ATOM   1003 O O   . THR A 1 130 ? 68.372 54.862 9.159   1.00 31.51 ? 208 THR A O   1 
ATOM   1004 C CB  . THR A 1 130 ? 66.376 57.326 10.234  1.00 29.08 ? 208 THR A CB  1 
ATOM   1005 O OG1 . THR A 1 130 ? 66.921 57.833 9.011   1.00 27.38 ? 208 THR A OG1 1 
ATOM   1006 C CG2 . THR A 1 130 ? 66.251 58.453 11.234  1.00 30.91 ? 208 THR A CG2 1 
ATOM   1007 N N   . TYR A 1 131 ? 66.276 54.278 9.747   1.00 31.25 ? 209 TYR A N   1 
ATOM   1008 C CA  . TYR A 1 131 ? 66.300 53.120 8.867   1.00 31.81 ? 209 TYR A CA  1 
ATOM   1009 C C   . TYR A 1 131 ? 64.986 52.742 8.208   1.00 32.12 ? 209 TYR A C   1 
ATOM   1010 O O   . TYR A 1 131 ? 63.918 53.182 8.625   1.00 33.36 ? 209 TYR A O   1 
ATOM   1011 C CB  . TYR A 1 131 ? 66.845 51.922 9.647   1.00 32.36 ? 209 TYR A CB  1 
ATOM   1012 C CG  . TYR A 1 131 ? 66.068 51.579 10.900  1.00 31.96 ? 209 TYR A CG  1 
ATOM   1013 C CD1 . TYR A 1 131 ? 65.098 50.582 10.886  1.00 32.78 ? 209 TYR A CD1 1 
ATOM   1014 C CD2 . TYR A 1 131 ? 66.322 52.233 12.107  1.00 32.90 ? 209 TYR A CD2 1 
ATOM   1015 C CE1 . TYR A 1 131 ? 64.405 50.236 12.040  1.00 33.40 ? 209 TYR A CE1 1 
ATOM   1016 C CE2 . TYR A 1 131 ? 65.631 51.896 13.274  1.00 32.35 ? 209 TYR A CE2 1 
ATOM   1017 C CZ  . TYR A 1 131 ? 64.677 50.896 13.231  1.00 34.44 ? 209 TYR A CZ  1 
ATOM   1018 O OH  . TYR A 1 131 ? 64.010 50.532 14.381  1.00 35.66 ? 209 TYR A OH  1 
ATOM   1019 N N   . ILE A 1 132 ? 65.076 51.908 7.176   1.00 32.66 ? 210 ILE A N   1 
ATOM   1020 C CA  . ILE A 1 132 ? 63.897 51.443 6.455   1.00 31.87 ? 210 ILE A CA  1 
ATOM   1021 C C   . ILE A 1 132 ? 63.847 49.927 6.386   1.00 30.20 ? 210 ILE A C   1 
ATOM   1022 O O   . ILE A 1 132 ? 64.779 49.297 5.887   1.00 31.36 ? 210 ILE A O   1 
ATOM   1023 C CB  . ILE A 1 132 ? 63.883 51.957 5.023   1.00 32.76 ? 210 ILE A CB  1 
ATOM   1024 C CG1 . ILE A 1 132 ? 64.043 53.467 5.023   1.00 34.89 ? 210 ILE A CG1 1 
ATOM   1025 C CG2 . ILE A 1 132 ? 62.571 51.563 4.341   1.00 31.01 ? 210 ILE A CG2 1 
ATOM   1026 C CD1 . ILE A 1 132 ? 64.404 54.006 3.670   1.00 37.28 ? 210 ILE A CD1 1 
ATOM   1027 N N   . CYS A 1 133 ? 62.760 49.343 6.879   1.00 27.93 ? 211 CYS A N   1 
ATOM   1028 C CA  . CYS A 1 133 ? 62.606 47.896 6.843   1.00 27.22 ? 211 CYS A CA  1 
ATOM   1029 C C   . CYS A 1 133 ? 61.753 47.531 5.640   1.00 27.29 ? 211 CYS A C   1 
ATOM   1030 O O   . CYS A 1 133 ? 60.954 48.341 5.187   1.00 26.65 ? 211 CYS A O   1 
ATOM   1031 C CB  . CYS A 1 133 ? 61.936 47.382 8.114   1.00 27.25 ? 211 CYS A CB  1 
ATOM   1032 S SG  . CYS A 1 133 ? 62.822 47.671 9.683   1.00 27.68 ? 211 CYS A SG  1 
ATOM   1033 N N   . MET A 1 134 ? 61.923 46.317 5.126   1.00 27.66 ? 212 MET A N   1 
ATOM   1034 C CA  . MET A 1 134 ? 61.173 45.863 3.964   1.00 27.42 ? 212 MET A CA  1 
ATOM   1035 C C   . MET A 1 134 ? 60.761 44.407 4.094   1.00 29.18 ? 212 MET A C   1 
ATOM   1036 O O   . MET A 1 134 ? 61.518 43.586 4.610   1.00 30.87 ? 212 MET A O   1 
ATOM   1037 C CB  . MET A 1 134 ? 62.020 46.035 2.694   1.00 26.72 ? 212 MET A CB  1 
ATOM   1038 C CG  . MET A 1 134 ? 61.331 45.563 1.419   1.00 29.35 ? 212 MET A CG  1 
ATOM   1039 S SD  . MET A 1 134 ? 62.329 45.832 -0.062  1.00 30.20 ? 212 MET A SD  1 
ATOM   1040 C CE  . MET A 1 134 ? 63.507 44.508 0.077   1.00 31.60 ? 212 MET A CE  1 
ATOM   1041 N N   . GLN A 1 135 ? 59.561 44.095 3.621   1.00 30.06 ? 213 GLN A N   1 
ATOM   1042 C CA  . GLN A 1 135 ? 59.020 42.742 3.638   1.00 31.12 ? 213 GLN A CA  1 
ATOM   1043 C C   . GLN A 1 135 ? 58.358 42.502 2.281   1.00 33.35 ? 213 GLN A C   1 
ATOM   1044 O O   . GLN A 1 135 ? 57.452 43.239 1.888   1.00 34.05 ? 213 GLN A O   1 
ATOM   1045 C CB  . GLN A 1 135 ? 57.980 42.590 4.756   1.00 31.56 ? 213 GLN A CB  1 
ATOM   1046 C CG  . GLN A 1 135 ? 57.462 41.160 4.950   1.00 31.56 ? 213 GLN A CG  1 
ATOM   1047 C CD  . GLN A 1 135 ? 56.428 41.052 6.056   1.00 33.04 ? 213 GLN A CD  1 
ATOM   1048 O OE1 . GLN A 1 135 ? 55.226 41.200 5.827   1.00 32.04 ? 213 GLN A OE1 1 
ATOM   1049 N NE2 . GLN A 1 135 ? 56.896 40.803 7.270   1.00 34.28 ? 213 GLN A NE2 1 
ATOM   1050 N N   . ARG A 1 136 ? 58.814 41.488 1.558   1.00 35.46 ? 214 ARG A N   1 
ATOM   1051 C CA  . ARG A 1 136 ? 58.235 41.177 0.257   1.00 39.04 ? 214 ARG A CA  1 
ATOM   1052 C C   . ARG A 1 136 ? 56.950 40.397 0.492   1.00 41.71 ? 214 ARG A C   1 
ATOM   1053 O O   . ARG A 1 136 ? 56.507 40.260 1.638   1.00 42.04 ? 214 ARG A O   1 
ATOM   1054 C CB  . ARG A 1 136 ? 59.203 40.348 -0.558  1.00 40.01 ? 214 ARG A CB  1 
ATOM   1055 N N   . THR A 1 137 ? 56.339 39.900 -0.582  1.00 43.25 ? 215 THR A N   1 
ATOM   1056 C CA  . THR A 1 137 ? 55.120 39.105 -0.438  1.00 45.21 ? 215 THR A CA  1 
ATOM   1057 C C   . THR A 1 137 ? 55.135 37.877 -1.346  1.00 46.31 ? 215 THR A C   1 
ATOM   1058 O O   . THR A 1 137 ? 54.036 37.376 -1.672  1.00 47.30 ? 215 THR A O   1 
ATOM   1059 C CB  . THR A 1 137 ? 53.836 39.942 -0.730  1.00 44.86 ? 215 THR A CB  1 
ATOM   1060 O OG1 . THR A 1 137 ? 53.952 40.597 -1.996  1.00 45.43 ? 215 THR A OG1 1 
ATOM   1061 C CG2 . THR A 1 137 ? 53.627 40.977 0.341   1.00 43.85 ? 215 THR A CG2 1 
HETATM 1062 P P   . PO4 B 2 .   ? 69.402 39.967 -6.233  1.00 92.05 ? 500 PO4 A P   1 
HETATM 1063 O O1  . PO4 B 2 .   ? 68.013 40.004 -6.759  1.00 92.69 ? 500 PO4 A O1  1 
HETATM 1064 O O2  . PO4 B 2 .   ? 70.334 39.600 -7.326  1.00 92.04 ? 500 PO4 A O2  1 
HETATM 1065 O O3  . PO4 B 2 .   ? 69.765 41.306 -5.708  1.00 92.71 ? 500 PO4 A O3  1 
HETATM 1066 O O4  . PO4 B 2 .   ? 69.493 38.962 -5.142  1.00 91.98 ? 500 PO4 A O4  1 
HETATM 1067 O O   . HOH C 3 .   ? 76.283 52.510 18.413  1.00 30.43 ? 300 HOH A O   1 
HETATM 1068 O O   . HOH C 3 .   ? 67.830 60.425 -11.270 1.00 35.59 ? 301 HOH A O   1 
HETATM 1069 O O   . HOH C 3 .   ? 88.683 43.469 0.480   1.00 51.94 ? 302 HOH A O   1 
HETATM 1070 O O   . HOH C 3 .   ? 71.140 43.491 -5.835  1.00 39.93 ? 303 HOH A O   1 
HETATM 1071 O O   . HOH C 3 .   ? 77.327 48.207 -13.136 1.00 62.87 ? 304 HOH A O   1 
HETATM 1072 O O   . HOH C 3 .   ? 77.259 51.028 -13.578 1.00 61.93 ? 305 HOH A O   1 
HETATM 1073 O O   . HOH C 3 .   ? 72.580 53.661 -10.625 1.00 31.47 ? 306 HOH A O   1 
HETATM 1074 O O   . HOH C 3 .   ? 81.995 49.696 9.636   1.00 23.58 ? 307 HOH A O   1 
HETATM 1075 O O   . HOH C 3 .   ? 82.430 47.476 11.044  1.00 34.23 ? 308 HOH A O   1 
HETATM 1076 O O   . HOH C 3 .   ? 67.690 60.923 -0.355  1.00 26.44 ? 309 HOH A O   1 
HETATM 1077 O O   . HOH C 3 .   ? 80.622 57.168 10.921  1.00 47.06 ? 310 HOH A O   1 
HETATM 1078 O O   . HOH C 3 .   ? 77.942 60.160 9.830   1.00 26.05 ? 311 HOH A O   1 
HETATM 1079 O O   . HOH C 3 .   ? 77.513 61.488 7.343   1.00 58.86 ? 312 HOH A O   1 
HETATM 1080 O O   . HOH C 3 .   ? 41.291 54.842 -10.266 1.00 42.52 ? 313 HOH A O   1 
HETATM 1081 O O   . HOH C 3 .   ? 53.019 55.542 12.595  1.00 34.31 ? 314 HOH A O   1 
HETATM 1082 O O   . HOH C 3 .   ? 70.060 65.040 6.247   1.00 26.85 ? 315 HOH A O   1 
HETATM 1083 O O   . HOH C 3 .   ? 70.247 65.186 3.328   1.00 32.95 ? 316 HOH A O   1 
HETATM 1084 O O   . HOH C 3 .   ? 72.258 66.990 3.343   1.00 58.31 ? 317 HOH A O   1 
HETATM 1085 O O   . HOH C 3 .   ? 74.953 65.166 4.938   1.00 38.39 ? 318 HOH A O   1 
HETATM 1086 O O   . HOH C 3 .   ? 65.573 62.172 -10.114 1.00 63.30 ? 319 HOH A O   1 
HETATM 1087 O O   . HOH C 3 .   ? 51.155 53.297 13.479  1.00 41.80 ? 320 HOH A O   1 
HETATM 1088 O O   . HOH C 3 .   ? 52.159 37.588 3.587   1.00 36.86 ? 321 HOH A O   1 
HETATM 1089 O O   . HOH C 3 .   ? 56.606 43.654 -11.392 1.00 42.19 ? 322 HOH A O   1 
HETATM 1090 O O   . HOH C 3 .   ? 57.076 47.693 23.900  1.00 34.92 ? 323 HOH A O   1 
HETATM 1091 O O   . HOH C 3 .   ? 96.156 41.029 2.408   1.00 50.33 ? 324 HOH A O   1 
HETATM 1092 O O   . HOH C 3 .   ? 69.835 63.083 -0.937  1.00 38.73 ? 325 HOH A O   1 
HETATM 1093 O O   . HOH C 3 .   ? 65.885 67.665 -0.798  1.00 35.78 ? 326 HOH A O   1 
HETATM 1094 O O   . HOH C 3 .   ? 92.493 39.297 -0.690  1.00 75.54 ? 327 HOH A O   1 
HETATM 1095 O O   . HOH C 3 .   ? 78.864 35.843 1.168   1.00 28.96 ? 328 HOH A O   1 
HETATM 1096 O O   . HOH C 3 .   ? 76.875 40.432 -3.818  1.00 30.72 ? 329 HOH A O   1 
HETATM 1097 O O   . HOH C 3 .   ? 36.777 58.414 -21.225 1.00 43.69 ? 330 HOH A O   1 
HETATM 1098 O O   . HOH C 3 .   ? 64.952 43.815 -12.540 1.00 41.49 ? 331 HOH A O   1 
HETATM 1099 O O   . HOH C 3 .   ? 38.943 64.717 -16.170 1.00 36.05 ? 332 HOH A O   1 
HETATM 1100 O O   . HOH C 3 .   ? 52.507 47.376 12.355  1.00 39.15 ? 333 HOH A O   1 
HETATM 1101 O O   . HOH C 3 .   ? 57.335 53.911 12.319  1.00 34.46 ? 334 HOH A O   1 
HETATM 1102 O O   . HOH C 3 .   ? 63.817 59.969 17.769  1.00 37.45 ? 335 HOH A O   1 
HETATM 1103 O O   . HOH C 3 .   ? 59.849 56.703 20.599  1.00 57.05 ? 336 HOH A O   1 
HETATM 1104 O O   . HOH C 3 .   ? 66.132 46.060 18.076  1.00 56.00 ? 337 HOH A O   1 
HETATM 1105 O O   . HOH C 3 .   ? 59.748 47.051 16.699  1.00 44.80 ? 338 HOH A O   1 
HETATM 1106 O O   . HOH C 3 .   ? 64.247 38.555 9.328   1.00 50.98 ? 339 HOH A O   1 
HETATM 1107 O O   . HOH C 3 .   ? 65.354 39.624 -6.462  1.00 30.65 ? 340 HOH A O   1 
HETATM 1108 O O   . HOH C 3 .   ? 93.554 38.693 3.190   1.00 33.87 ? 341 HOH A O   1 
HETATM 1109 O O   . HOH C 3 .   ? 92.452 41.023 3.514   1.00 54.42 ? 342 HOH A O   1 
HETATM 1110 O O   . HOH C 3 .   ? 74.450 51.427 -14.241 1.00 48.55 ? 343 HOH A O   1 
HETATM 1111 O O   . HOH C 3 .   ? 80.186 57.310 2.182   1.00 24.35 ? 344 HOH A O   1 
HETATM 1112 O O   . HOH C 3 .   ? 66.422 56.250 19.391  1.00 55.85 ? 345 HOH A O   1 
HETATM 1113 O O   . HOH C 3 .   ? 75.052 53.942 20.237  1.00 40.68 ? 346 HOH A O   1 
HETATM 1114 O O   . HOH C 3 .   ? 87.687 41.976 2.171   1.00 44.64 ? 347 HOH A O   1 
HETATM 1115 O O   . HOH C 3 .   ? 93.690 36.831 0.153   1.00 41.28 ? 348 HOH A O   1 
HETATM 1116 O O   . HOH C 3 .   ? 37.749 60.719 -22.605 1.00 68.28 ? 349 HOH A O   1 
HETATM 1117 O O   . HOH C 3 .   ? 80.666 42.495 7.797   1.00 44.77 ? 350 HOH A O   1 
HETATM 1118 O O   . HOH C 3 .   ? 77.257 64.231 0.911   1.00 35.96 ? 351 HOH A O   1 
HETATM 1119 O O   . HOH C 3 .   ? 34.373 58.406 -20.043 1.00 62.86 ? 352 HOH A O   1 
HETATM 1120 O O   . HOH C 3 .   ? 79.940 38.619 -1.625  1.00 44.80 ? 353 HOH A O   1 
HETATM 1121 O O   . HOH C 3 .   ? 59.193 35.592 -2.740  1.00 50.12 ? 354 HOH A O   1 
HETATM 1122 O O   . HOH C 3 .   ? 52.290 35.093 3.519   1.00 49.15 ? 355 HOH A O   1 
HETATM 1123 O O   . HOH C 3 .   ? 42.063 43.366 -5.591  1.00 43.92 ? 356 HOH A O   1 
HETATM 1124 O O   . HOH C 3 .   ? 45.187 42.604 -10.190 1.00 48.44 ? 357 HOH A O   1 
HETATM 1125 O O   . HOH C 3 .   ? 53.558 43.116 -1.136  1.00 36.33 ? 358 HOH A O   1 
HETATM 1126 O O   . HOH C 3 .   ? 66.395 59.426 17.360  1.00 50.84 ? 359 HOH A O   1 
HETATM 1127 O O   . HOH C 3 .   ? 77.900 44.128 -10.355 1.00 54.05 ? 360 HOH A O   1 
HETATM 1128 O O   . HOH C 3 .   ? 75.009 47.707 -9.047  1.00 42.09 ? 361 HOH A O   1 
HETATM 1129 O O   . HOH C 3 .   ? 38.211 54.158 -20.899 1.00 51.00 ? 362 HOH A O   1 
HETATM 1130 O O   . HOH C 3 .   ? 47.145 49.071 6.021   1.00 42.49 ? 363 HOH A O   1 
HETATM 1131 O O   . HOH C 3 .   ? 90.206 34.917 2.570   1.00 57.50 ? 364 HOH A O   1 
HETATM 1132 O O   . HOH C 3 .   ? 66.700 41.253 -9.024  1.00 37.60 ? 365 HOH A O   1 
HETATM 1133 O O   . HOH C 3 .   ? 62.888 41.734 -11.008 1.00 56.40 ? 366 HOH A O   1 
HETATM 1134 O O   . HOH C 3 .   ? 66.049 55.613 -13.001 1.00 48.47 ? 367 HOH A O   1 
HETATM 1135 O O   . HOH C 3 .   ? 51.037 40.093 -4.719  1.00 43.67 ? 368 HOH A O   1 
HETATM 1136 O O   . HOH C 3 .   ? 81.788 38.489 0.885   1.00 65.68 ? 369 HOH A O   1 
HETATM 1137 O O   . HOH C 3 .   ? 86.611 57.688 8.644   1.00 39.14 ? 370 HOH A O   1 
HETATM 1138 O O   . HOH C 3 .   ? 90.713 55.093 9.194   1.00 38.30 ? 371 HOH A O   1 
HETATM 1139 O O   . HOH C 3 .   ? 88.421 55.675 9.959   1.00 44.72 ? 372 HOH A O   1 
HETATM 1140 O O   . HOH C 3 .   ? 51.604 36.952 -1.390  1.00 32.18 ? 373 HOH A O   1 
HETATM 1141 O O   . HOH C 3 .   ? 61.976 58.159 9.132   1.00 47.06 ? 374 HOH A O   1 
HETATM 1142 O O   . HOH C 3 .   ? 68.046 52.191 20.391  1.00 90.93 ? 375 HOH A O   1 
HETATM 1143 O O   . HOH C 3 .   ? 60.660 41.052 -2.973  1.00 47.27 ? 376 HOH A O   1 
HETATM 1144 O O   . HOH C 3 .   ? 59.031 57.601 -9.260  1.00 49.67 ? 377 HOH A O   1 
HETATM 1145 O O   . HOH C 3 .   ? 67.811 42.132 2.483   1.00 44.63 ? 378 HOH A O   1 
HETATM 1146 O O   . HOH C 3 .   ? 63.642 54.103 -11.739 1.00 39.75 ? 379 HOH A O   1 
HETATM 1147 O O   . HOH C 3 .   ? 54.318 44.082 -9.374  1.00 45.55 ? 380 HOH A O   1 
HETATM 1148 O O   . HOH C 3 .   ? 51.495 43.278 -9.635  1.00 39.73 ? 381 HOH A O   1 
HETATM 1149 O O   . HOH C 3 .   ? 52.888 36.421 1.357   1.00 55.88 ? 382 HOH A O   1 
HETATM 1150 O O   . HOH C 3 .   ? 48.992 51.017 5.635   1.00 43.67 ? 383 HOH A O   1 
HETATM 1151 O O   . HOH C 3 .   ? 55.441 49.005 12.311  1.00 36.29 ? 384 HOH A O   1 
HETATM 1152 O O   . HOH C 3 .   ? 49.088 39.178 -3.236  1.00 55.71 ? 385 HOH A O   1 
HETATM 1153 O O   . HOH C 3 .   ? 58.203 54.985 19.729  1.00 35.84 ? 386 HOH A O   1 
HETATM 1154 O O   . HOH C 3 .   ? 62.795 40.179 -5.835  1.00 44.50 ? 387 HOH A O   1 
HETATM 1155 O O   . HOH C 3 .   ? 61.047 44.948 -13.549 1.00 46.28 ? 388 HOH A O   1 
HETATM 1156 O O   . HOH C 3 .   ? 60.456 40.508 -10.174 1.00 60.20 ? 389 HOH A O   1 
HETATM 1157 O O   . HOH C 3 .   ? 63.396 52.785 -14.615 1.00 52.90 ? 390 HOH A O   1 
HETATM 1158 O O   . HOH C 3 .   ? 60.394 53.810 -15.020 1.00 63.75 ? 391 HOH A O   1 
HETATM 1159 O O   . HOH C 3 .   ? 56.097 39.080 -4.093  1.00 54.76 ? 392 HOH A O   1 
HETATM 1160 O O   . HOH C 3 .   ? 53.900 39.648 2.775   1.00 50.63 ? 393 HOH A O   1 
HETATM 1161 O O   . HOH C 3 .   ? 72.999 39.834 -11.888 1.00 62.03 ? 394 HOH A O   1 
HETATM 1162 O O   . HOH C 3 .   ? 68.819 55.933 -11.819 1.00 46.20 ? 395 HOH A O   1 
HETATM 1163 O O   . HOH C 3 .   ? 86.392 45.312 6.194   1.00 60.69 ? 396 HOH A O   1 
HETATM 1164 O O   . HOH C 3 .   ? 96.672 39.311 0.218   1.00 54.27 ? 397 HOH A O   1 
HETATM 1165 O O   . HOH C 3 .   ? 60.166 50.074 16.887  1.00 57.75 ? 398 HOH A O   1 
HETATM 1166 O O   . HOH C 3 .   ? 65.792 46.752 -12.538 1.00 52.68 ? 399 HOH A O   1 
HETATM 1167 O O   . HOH C 3 .   ? 77.825 63.019 3.280   1.00 50.95 ? 400 HOH A O   1 
HETATM 1168 O O   . HOH C 3 .   ? 80.902 59.029 4.914   1.00 69.31 ? 401 HOH A O   1 
HETATM 1169 O O   . HOH C 3 .   ? 69.044 60.695 17.760  1.00 41.75 ? 402 HOH A O   1 
HETATM 1170 O O   . HOH C 3 .   ? 71.997 63.805 7.569   1.00 50.33 ? 403 HOH A O   1 
HETATM 1171 O O   . HOH C 3 .   ? 59.755 38.460 5.997   1.00 59.34 ? 404 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   79  ?   ?   ?   A . n 
A 1 2   ASN 2   80  ?   ?   ?   A . n 
A 1 3   SER 3   81  ?   ?   ?   A . n 
A 1 4   LEU 4   82  ?   ?   ?   A . n 
A 1 5   PHE 5   83  ?   ?   ?   A . n 
A 1 6   ASN 6   84  ?   ?   ?   A . n 
A 1 7   GLN 7   85  ?   ?   ?   A . n 
A 1 8   GLU 8   86  ?   ?   ?   A . n 
A 1 9   VAL 9   87  ?   ?   ?   A . n 
A 1 10  GLN 10  88  88  GLN GLN A . n 
A 1 11  ILE 11  89  89  ILE ILE A . n 
A 1 12  PRO 12  90  90  PRO PRO A . n 
A 1 13  LEU 13  91  91  LEU LEU A . n 
A 1 14  THR 14  92  92  THR THR A . n 
A 1 15  GLU 15  93  93  GLU GLU A . n 
A 1 16  SER 16  94  94  SER SER A . n 
A 1 17  TYR 17  95  95  TYR TYR A . n 
A 1 18  CYS 18  96  96  CYS CYS A . n 
A 1 19  GLY 19  97  97  GLY GLY A . n 
A 1 20  PRO 20  98  98  PRO PRO A . n 
A 1 21  CYS 21  99  99  CYS CYS A . n 
A 1 22  PRO 22  100 100 PRO PRO A . n 
A 1 23  LYS 23  101 101 LYS LYS A . n 
A 1 24  ASN 24  102 102 ASN ASN A . n 
A 1 25  TRP 25  103 103 TRP TRP A . n 
A 1 26  ILE 26  104 104 ILE ILE A . n 
A 1 27  CYS 27  105 105 CYS CYS A . n 
A 1 28  TYR 28  106 106 TYR TYR A . n 
A 1 29  LYS 29  107 107 LYS LYS A . n 
A 1 30  ASN 30  108 108 ASN ASN A . n 
A 1 31  ASN 31  109 109 ASN ASN A . n 
A 1 32  CYS 32  110 110 CYS CYS A . n 
A 1 33  TYR 33  111 111 TYR TYR A . n 
A 1 34  GLN 34  112 112 GLN GLN A . n 
A 1 35  PHE 35  113 113 PHE PHE A . n 
A 1 36  PHE 36  114 114 PHE PHE A . n 
A 1 37  ASP 37  115 115 ASP ASP A . n 
A 1 38  GLU 38  116 116 GLU GLU A . n 
A 1 39  SER 39  117 117 SER SER A . n 
A 1 40  LYS 40  118 118 LYS LYS A . n 
A 1 41  ASN 41  119 119 ASN ASN A . n 
A 1 42  TRP 42  120 120 TRP TRP A . n 
A 1 43  TYR 43  121 121 TYR TYR A . n 
A 1 44  GLU 44  122 122 GLU GLU A . n 
A 1 45  SER 45  123 123 SER SER A . n 
A 1 46  GLN 46  124 124 GLN GLN A . n 
A 1 47  ALA 47  125 125 ALA ALA A . n 
A 1 48  SER 48  126 126 SER SER A . n 
A 1 49  CYS 49  127 127 CYS CYS A . n 
A 1 50  MET 50  128 128 MET MET A . n 
A 1 51  SER 51  129 129 SER SER A . n 
A 1 52  GLN 52  130 130 GLN GLN A . n 
A 1 53  ASN 53  131 131 ASN ASN A . n 
A 1 54  ALA 54  132 132 ALA ALA A . n 
A 1 55  SER 55  133 133 SER SER A . n 
A 1 56  LEU 56  134 134 LEU LEU A . n 
A 1 57  LEU 57  135 135 LEU LEU A . n 
A 1 58  LYS 58  136 136 LYS LYS A . n 
A 1 59  VAL 59  137 137 VAL VAL A . n 
A 1 60  TYR 60  138 138 TYR TYR A . n 
A 1 61  SER 61  139 139 SER SER A . n 
A 1 62  LYS 62  140 140 LYS LYS A . n 
A 1 63  GLU 63  141 141 GLU GLU A . n 
A 1 64  ASP 64  142 142 ASP ASP A . n 
A 1 65  GLN 65  143 143 GLN GLN A . n 
A 1 66  ASP 66  144 144 ASP ASP A . n 
A 1 67  LEU 67  145 145 LEU LEU A . n 
A 1 68  LEU 68  146 146 LEU LEU A . n 
A 1 69  LYS 69  147 147 LYS LYS A . n 
A 1 70  LEU 70  148 148 LEU LEU A . n 
A 1 71  VAL 71  149 149 VAL VAL A . n 
A 1 72  LYS 72  150 150 LYS LYS A . n 
A 1 73  SER 73  151 151 SER SER A . n 
A 1 74  TYR 74  152 152 TYR TYR A . n 
A 1 75  HIS 75  153 153 HIS HIS A . n 
A 1 76  TRP 76  154 154 TRP TRP A . n 
A 1 77  MET 77  155 155 MET MET A . n 
A 1 78  GLY 78  156 156 GLY GLY A . n 
A 1 79  LEU 79  157 157 LEU LEU A . n 
A 1 80  VAL 80  158 158 VAL VAL A . n 
A 1 81  HIS 81  159 159 HIS HIS A . n 
A 1 82  ILE 82  160 160 ILE ILE A . n 
A 1 83  PRO 83  161 161 PRO PRO A . n 
A 1 84  THR 84  162 162 THR THR A . n 
A 1 85  ASN 85  163 163 ASN ASN A . n 
A 1 86  GLY 86  164 164 GLY GLY A . n 
A 1 87  SER 87  165 165 SER SER A . n 
A 1 88  TRP 88  166 166 TRP TRP A . n 
A 1 89  GLN 89  167 167 GLN GLN A . n 
A 1 90  TRP 90  168 168 TRP TRP A . n 
A 1 91  GLU 91  169 169 GLU GLU A . n 
A 1 92  ASP 92  170 170 ASP ASP A . n 
A 1 93  GLY 93  171 171 GLY GLY A . n 
A 1 94  SER 94  172 172 SER SER A . n 
A 1 95  ILE 95  173 173 ILE ILE A . n 
A 1 96  LEU 96  174 174 LEU LEU A . n 
A 1 97  SER 97  175 175 SER SER A . n 
A 1 98  PRO 98  176 176 PRO PRO A . n 
A 1 99  ASN 99  177 177 ASN ASN A . n 
A 1 100 LEU 100 178 178 LEU LEU A . n 
A 1 101 LEU 101 179 179 LEU LEU A . n 
A 1 102 THR 102 180 180 THR THR A . n 
A 1 103 ILE 103 181 181 ILE ILE A . n 
A 1 104 ILE 104 182 182 ILE ILE A . n 
A 1 105 GLU 105 183 183 GLU GLU A . n 
A 1 106 MET 106 184 184 MET MET A . n 
A 1 107 GLN 107 185 185 GLN GLN A . n 
A 1 108 LYS 108 186 186 LYS LYS A . n 
A 1 109 GLY 109 187 187 GLY GLY A . n 
A 1 110 ASP 110 188 188 ASP ASP A . n 
A 1 111 CYS 111 189 189 CYS CYS A . n 
A 1 112 ALA 112 190 190 ALA ALA A . n 
A 1 113 LEU 113 191 191 LEU LEU A . n 
A 1 114 TYR 114 192 192 TYR TYR A . n 
A 1 115 ALA 115 193 193 ALA ALA A . n 
A 1 116 SER 116 194 194 SER SER A . n 
A 1 117 SER 117 195 195 SER SER A . n 
A 1 118 PHE 118 196 196 PHE PHE A . n 
A 1 119 LYS 119 197 197 LYS LYS A . n 
A 1 120 GLY 120 198 198 GLY GLY A . n 
A 1 121 TYR 121 199 199 TYR TYR A . n 
A 1 122 ILE 122 200 200 ILE ILE A . n 
A 1 123 GLU 123 201 201 GLU GLU A . n 
A 1 124 ASN 124 202 202 ASN ASN A . n 
A 1 125 CYS 125 203 203 CYS CYS A . n 
A 1 126 SER 126 204 204 SER SER A . n 
A 1 127 THR 127 205 205 THR THR A . n 
A 1 128 PRO 128 206 206 PRO PRO A . n 
A 1 129 ASN 129 207 207 ASN ASN A . n 
A 1 130 THR 130 208 208 THR THR A . n 
A 1 131 TYR 131 209 209 TYR TYR A . n 
A 1 132 ILE 132 210 210 ILE ILE A . n 
A 1 133 CYS 133 211 211 CYS CYS A . n 
A 1 134 MET 134 212 212 MET MET A . n 
A 1 135 GLN 135 213 213 GLN GLN A . n 
A 1 136 ARG 136 214 214 ARG ALA A . n 
A 1 137 THR 137 215 215 THR THR A . n 
A 1 138 VAL 138 216 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PO4 1   500 500 PO4 PO4 A . 
C 3 HOH 1   300 300 HOH HOH A . 
C 3 HOH 2   301 301 HOH HOH A . 
C 3 HOH 3   302 302 HOH HOH A . 
C 3 HOH 4   303 303 HOH HOH A . 
C 3 HOH 5   304 304 HOH HOH A . 
C 3 HOH 6   305 305 HOH HOH A . 
C 3 HOH 7   306 306 HOH HOH A . 
C 3 HOH 8   307 307 HOH HOH A . 
C 3 HOH 9   308 308 HOH HOH A . 
C 3 HOH 10  309 309 HOH HOH A . 
C 3 HOH 11  310 310 HOH HOH A . 
C 3 HOH 12  311 311 HOH HOH A . 
C 3 HOH 13  312 312 HOH HOH A . 
C 3 HOH 14  313 313 HOH HOH A . 
C 3 HOH 15  314 314 HOH HOH A . 
C 3 HOH 16  315 315 HOH HOH A . 
C 3 HOH 17  316 316 HOH HOH A . 
C 3 HOH 18  317 317 HOH HOH A . 
C 3 HOH 19  318 318 HOH HOH A . 
C 3 HOH 20  319 319 HOH HOH A . 
C 3 HOH 21  320 320 HOH HOH A . 
C 3 HOH 22  321 321 HOH HOH A . 
C 3 HOH 23  322 322 HOH HOH A . 
C 3 HOH 24  323 323 HOH HOH A . 
C 3 HOH 25  324 324 HOH HOH A . 
C 3 HOH 26  325 325 HOH HOH A . 
C 3 HOH 27  326 326 HOH HOH A . 
C 3 HOH 28  327 327 HOH HOH A . 
C 3 HOH 29  328 328 HOH HOH A . 
C 3 HOH 30  329 329 HOH HOH A . 
C 3 HOH 31  330 330 HOH HOH A . 
C 3 HOH 32  331 331 HOH HOH A . 
C 3 HOH 33  332 332 HOH HOH A . 
C 3 HOH 34  333 333 HOH HOH A . 
C 3 HOH 35  334 334 HOH HOH A . 
C 3 HOH 36  335 335 HOH HOH A . 
C 3 HOH 37  336 336 HOH HOH A . 
C 3 HOH 38  337 337 HOH HOH A . 
C 3 HOH 39  338 338 HOH HOH A . 
C 3 HOH 40  339 339 HOH HOH A . 
C 3 HOH 41  340 340 HOH HOH A . 
C 3 HOH 42  341 341 HOH HOH A . 
C 3 HOH 43  342 342 HOH HOH A . 
C 3 HOH 44  343 343 HOH HOH A . 
C 3 HOH 45  344 344 HOH HOH A . 
C 3 HOH 46  345 345 HOH HOH A . 
C 3 HOH 47  346 346 HOH HOH A . 
C 3 HOH 48  347 347 HOH HOH A . 
C 3 HOH 49  348 348 HOH HOH A . 
C 3 HOH 50  349 349 HOH HOH A . 
C 3 HOH 51  350 350 HOH HOH A . 
C 3 HOH 52  351 351 HOH HOH A . 
C 3 HOH 53  352 352 HOH HOH A . 
C 3 HOH 54  353 353 HOH HOH A . 
C 3 HOH 55  354 354 HOH HOH A . 
C 3 HOH 56  355 355 HOH HOH A . 
C 3 HOH 57  356 356 HOH HOH A . 
C 3 HOH 58  357 357 HOH HOH A . 
C 3 HOH 59  358 358 HOH HOH A . 
C 3 HOH 60  359 359 HOH HOH A . 
C 3 HOH 61  360 360 HOH HOH A . 
C 3 HOH 62  361 361 HOH HOH A . 
C 3 HOH 63  362 362 HOH HOH A . 
C 3 HOH 64  363 363 HOH HOH A . 
C 3 HOH 65  364 364 HOH HOH A . 
C 3 HOH 66  365 365 HOH HOH A . 
C 3 HOH 67  366 366 HOH HOH A . 
C 3 HOH 68  367 367 HOH HOH A . 
C 3 HOH 69  368 368 HOH HOH A . 
C 3 HOH 70  369 369 HOH HOH A . 
C 3 HOH 71  370 370 HOH HOH A . 
C 3 HOH 72  371 371 HOH HOH A . 
C 3 HOH 73  372 372 HOH HOH A . 
C 3 HOH 74  373 373 HOH HOH A . 
C 3 HOH 75  374 374 HOH HOH A . 
C 3 HOH 76  375 375 HOH HOH A . 
C 3 HOH 77  376 376 HOH HOH A . 
C 3 HOH 78  377 377 HOH HOH A . 
C 3 HOH 79  378 378 HOH HOH A . 
C 3 HOH 80  379 379 HOH HOH A . 
C 3 HOH 81  380 380 HOH HOH A . 
C 3 HOH 82  381 381 HOH HOH A . 
C 3 HOH 83  382 382 HOH HOH A . 
C 3 HOH 84  383 383 HOH HOH A . 
C 3 HOH 85  384 384 HOH HOH A . 
C 3 HOH 86  385 385 HOH HOH A . 
C 3 HOH 87  386 386 HOH HOH A . 
C 3 HOH 88  387 387 HOH HOH A . 
C 3 HOH 89  388 388 HOH HOH A . 
C 3 HOH 90  389 389 HOH HOH A . 
C 3 HOH 91  390 390 HOH HOH A . 
C 3 HOH 92  391 391 HOH HOH A . 
C 3 HOH 93  392 392 HOH HOH A . 
C 3 HOH 94  393 393 HOH HOH A . 
C 3 HOH 95  394 394 HOH HOH A . 
C 3 HOH 96  395 395 HOH HOH A . 
C 3 HOH 97  396 396 HOH HOH A . 
C 3 HOH 98  397 397 HOH HOH A . 
C 3 HOH 99  398 398 HOH HOH A . 
C 3 HOH 100 399 399 HOH HOH A . 
C 3 HOH 101 400 400 HOH HOH A . 
C 3 HOH 102 401 401 HOH HOH A . 
C 3 HOH 103 402 402 HOH HOH A . 
C 3 HOH 104 403 403 HOH HOH A . 
C 3 HOH 105 404 404 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3210  ? 
1 MORE         -35   ? 
1 'SSA (A^2)'  13030 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-04-15 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
EPMR      phasing          . ? 3 
CNS       refinement       . ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             O 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             SER 
_pdbx_validate_rmsd_angle.auth_seq_id_1              139 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             C 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             SER 
_pdbx_validate_rmsd_angle.auth_seq_id_2              139 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             N 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LYS 
_pdbx_validate_rmsd_angle.auth_seq_id_3              140 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                111.94 
_pdbx_validate_rmsd_angle.angle_target_value         122.70 
_pdbx_validate_rmsd_angle.angle_deviation            -10.76 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.60 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ILE A 89  ? ? -46.44  173.82  
2  1 PRO A 90  ? ? -50.62  106.30  
3  1 GLU A 93  ? ? -167.25 103.12  
4  1 PRO A 98  ? ? -35.40  133.00  
5  1 LYS A 107 ? ? 35.75   44.49   
6  1 ASN A 108 ? ? 56.19   70.91   
7  1 SER A 117 ? ? -26.80  124.90  
8  1 ASN A 131 ? ? 59.45   77.45   
9  1 ALA A 132 ? ? -174.34 -175.62 
10 1 GLN A 143 ? ? -141.23 21.46   
11 1 SER A 151 ? ? 64.22   -161.18 
12 1 PRO A 161 ? ? -49.04  16.20   
13 1 THR A 162 ? ? -65.59  18.63   
14 1 GLU A 169 ? ? -49.18  -17.70  
15 1 LEU A 178 ? ? -117.30 -75.54  
16 1 SER A 195 ? ? 95.02   55.95   
17 1 PHE A 196 ? ? 40.97   84.41   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ARG 214 ? CG  ? A ARG 136 CG  
2 1 Y 1 A ARG 214 ? CD  ? A ARG 136 CD  
3 1 Y 1 A ARG 214 ? NE  ? A ARG 136 NE  
4 1 Y 1 A ARG 214 ? CZ  ? A ARG 136 CZ  
5 1 Y 1 A ARG 214 ? NH1 ? A ARG 136 NH1 
6 1 Y 1 A ARG 214 ? NH2 ? A ARG 136 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 79  ? A MET 1   
2  1 Y 1 A ASN 80  ? A ASN 2   
3  1 Y 1 A SER 81  ? A SER 3   
4  1 Y 1 A LEU 82  ? A LEU 4   
5  1 Y 1 A PHE 83  ? A PHE 5   
6  1 Y 1 A ASN 84  ? A ASN 6   
7  1 Y 1 A GLN 85  ? A GLN 7   
8  1 Y 1 A GLU 86  ? A GLU 8   
9  1 Y 1 A VAL 87  ? A VAL 9   
10 1 Y 1 A VAL 216 ? A VAL 138 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION' PO4 
3 water           HOH 
#