data_1MSH
# 
_entry.id   1MSH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1MSH         
WWPDB D_1000175147 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1MSG 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   'representative structure' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1MSH 
_pdbx_database_status.recvd_initial_deposition_date   1995-01-25 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kim, K.-S.'      1 
'Clark-Lewis, I.' 2 
'Sykes, B.D.'     3 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of GRO/melanoma growth stimulatory activity determined by 1H NMR spectroscopy.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            269 
_citation.page_first                32909 
_citation.page_last                 32915 
_citation.year                      1994 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   7806518 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kim, K.S.'       1 
primary 'Clark-Lewis, I.' 2 
primary 'Sykes, B.D.'     3 
# 
_cell.entry_id           1MSH 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1MSH 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'HUMAN MELANOMA GROWTH STIMULATORY ACTIVITY' 
_entity.formula_weight             7763.112 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKS 
_entity_poly.pdbx_seq_one_letter_code_can   ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKS 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  SER n 
1 3  VAL n 
1 4  ALA n 
1 5  THR n 
1 6  GLU n 
1 7  LEU n 
1 8  ARG n 
1 9  CYS n 
1 10 GLN n 
1 11 CYS n 
1 12 LEU n 
1 13 GLN n 
1 14 THR n 
1 15 LEU n 
1 16 GLN n 
1 17 GLY n 
1 18 ILE n 
1 19 HIS n 
1 20 PRO n 
1 21 LYS n 
1 22 ASN n 
1 23 ILE n 
1 24 GLN n 
1 25 SER n 
1 26 VAL n 
1 27 ASN n 
1 28 VAL n 
1 29 LYS n 
1 30 SER n 
1 31 PRO n 
1 32 GLY n 
1 33 PRO n 
1 34 HIS n 
1 35 CYS n 
1 36 ALA n 
1 37 GLN n 
1 38 THR n 
1 39 GLU n 
1 40 VAL n 
1 41 ILE n 
1 42 ALA n 
1 43 THR n 
1 44 LEU n 
1 45 LYS n 
1 46 ASN n 
1 47 GLY n 
1 48 ARG n 
1 49 LYS n 
1 50 ALA n 
1 51 CYS n 
1 52 LEU n 
1 53 ASN n 
1 54 PRO n 
1 55 ALA n 
1 56 SER n 
1 57 PRO n 
1 58 ILE n 
1 59 VAL n 
1 60 LYS n 
1 61 LYS n 
1 62 ILE n 
1 63 ILE n 
1 64 GLU n 
1 65 LYS n 
1 66 MET n 
1 67 LEU n 
1 68 ASN n 
1 69 SER n 
1 70 ASP n 
1 71 LYS n 
1 72 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GROA_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P09341 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKN
GRKACLNPASPIVKKIIEKMLNSDKSN
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1MSH A 1 ? 72 ? P09341 35 ? 106 ? 1 72 
2 1 1MSH B 1 ? 72 ? P09341 35 ? 106 ? 1 72 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_ensemble.entry_id                             1MSH 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    30 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1MSH 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1MSH 
_struct.title                     
'SOLUTION STRUCTURE OF GRO(SLASH)MELANOMA GROWTH STIMULATORY ACTIVITY DETERMINED BY 1H NMR SPECTROSCOPY' 
_struct.pdbx_descriptor           
;HUMAN MELANOMA GROWTH STIMULATORY ACTIVITY (MGSA, GRO-ALPHA) MUTATION WITH THE LAST ASN TRUNCATED (TOTAL 72 AMINO ACIDS) (NMR, 30 STRUCTURES)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MSH 
_struct_keywords.pdbx_keywords   'CYTOKINE (CHEMOTACTIC)' 
_struct_keywords.text            'CYTOKINE (CHEMOTACTIC)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 57 ? LEU A 67 ? PRO A 57 LEU A 67 1 ? 11 
HELX_P HELX_P2 2 PRO B 57 ? LEU B 67 ? PRO B 57 LEU B 67 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 9  SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 9  A CYS 35 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 11 A CYS 51 1_555 ? ? ? ? ? ? ? 2.021 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 25 ? LYS A 29 ? SER A 25 LYS A 29 
A 2 SER B 25 ? LYS B 29 ? SER B 25 LYS B 29 
A 3 GLU B 39 ? LEU B 44 ? GLU B 39 LEU B 44 
A 4 ARG B 48 ? CYS B 51 ? ARG B 48 CYS B 51 
B 1 ILE A 41 ? THR A 43 ? ILE A 41 THR A 43 
B 2 LYS A 49 ? CYS A 51 ? LYS A 49 CYS A 51 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 26 ? O VAL A 26 N VAL B 28 ? N VAL B 28 
A 2 3 O ASN B 27 ? O ASN B 27 N ILE B 41 ? N ILE B 41 
A 3 4 O ALA B 42 ? O ALA B 42 N ALA B 50 ? N ALA B 50 
B 1 2 O ALA A 42 ? O ALA A 42 N ALA A 50 ? N ALA A 50 
# 
_database_PDB_matrix.entry_id          1MSH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1MSH 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ALA A 1 1  ? 12.927  10.129  -38.871 1.00 14.80 ? 1  ALA A N    1  
ATOM 2     C CA   . ALA A 1 1  ? 14.331  10.628  -38.789 1.00 14.12 ? 1  ALA A CA   1  
ATOM 3     C C    . ALA A 1 1  ? 14.517  11.422  -37.489 1.00 13.40 ? 1  ALA A C    1  
ATOM 4     O O    . ALA A 1 1  ? 14.201  12.595  -37.416 1.00 13.47 ? 1  ALA A O    1  
ATOM 5     C CB   . ALA A 1 1  ? 14.628  11.529  -39.993 1.00 14.17 ? 1  ALA A CB   1  
ATOM 6     H H1   . ALA A 1 1  ? 12.268  10.934  -38.860 1.00 15.11 ? 1  ALA A H1   1  
ATOM 7     H H2   . ALA A 1 1  ? 12.801  9.590   -39.752 1.00 14.91 ? 1  ALA A H2   1  
ATOM 8     H H3   . ALA A 1 1  ? 12.729  9.513   -38.058 1.00 15.01 ? 1  ALA A H3   1  
ATOM 9     H HA   . ALA A 1 1  ? 15.009  9.787   -38.795 1.00 14.26 ? 1  ALA A HA   1  
ATOM 10    H HB1  . ALA A 1 1  ? 13.800  12.206  -40.148 1.00 14.43 ? 1  ALA A HB1  1  
ATOM 11    H HB2  . ALA A 1 1  ? 15.526  12.098  -39.805 1.00 14.25 ? 1  ALA A HB2  1  
ATOM 12    H HB3  . ALA A 1 1  ? 14.764  10.920  -40.873 1.00 14.03 ? 1  ALA A HB3  1  
ATOM 13    N N    . SER A 1 2  ? 15.027  10.783  -36.463 1.00 12.87 ? 2  SER A N    1  
ATOM 14    C CA   . SER A 1 2  ? 15.239  11.486  -35.158 1.00 12.29 ? 2  SER A CA   1  
ATOM 15    C C    . SER A 1 2  ? 16.192  10.668  -34.275 1.00 11.44 ? 2  SER A C    1  
ATOM 16    O O    . SER A 1 2  ? 16.485  9.520   -34.558 1.00 11.39 ? 2  SER A O    1  
ATOM 17    C CB   . SER A 1 2  ? 13.896  11.652  -34.436 1.00 12.48 ? 2  SER A CB   1  
ATOM 18    O OG   . SER A 1 2  ? 13.207  10.406  -34.414 1.00 12.82 ? 2  SER A OG   1  
ATOM 19    H H    . SER A 1 2  ? 15.270  9.837   -36.550 1.00 12.96 ? 2  SER A H    1  
ATOM 20    H HA   . SER A 1 2  ? 15.669  12.459  -35.341 1.00 12.52 ? 2  SER A HA   1  
ATOM 21    H HB2  . SER A 1 2  ? 14.068  11.979  -33.424 1.00 12.65 ? 2  SER A HB2  1  
ATOM 22    H HB3  . SER A 1 2  ? 13.301  12.394  -34.953 1.00 12.40 ? 2  SER A HB3  1  
ATOM 23    H HG   . SER A 1 2  ? 13.501  9.918   -33.640 1.00 12.81 ? 2  SER A HG   1  
ATOM 24    N N    . VAL A 1 3  ? 16.677  11.255  -33.207 1.00 10.93 ? 3  VAL A N    1  
ATOM 25    C CA   . VAL A 1 3  ? 17.611  10.523  -32.295 1.00 10.23 ? 3  VAL A CA   1  
ATOM 26    C C    . VAL A 1 3  ? 16.854  10.089  -31.033 1.00 9.33  ? 3  VAL A C    1  
ATOM 27    O O    . VAL A 1 3  ? 15.975  10.784  -30.556 1.00 9.35  ? 3  VAL A O    1  
ATOM 28    C CB   . VAL A 1 3  ? 18.776  11.442  -31.900 1.00 10.49 ? 3  VAL A CB   1  
ATOM 29    C CG1  . VAL A 1 3  ? 19.814  10.646  -31.104 1.00 10.45 ? 3  VAL A CG1  1  
ATOM 30    C CG2  . VAL A 1 3  ? 19.435  12.009  -33.163 1.00 11.15 ? 3  VAL A CG2  1  
ATOM 31    H H    . VAL A 1 3  ? 16.424  12.180  -33.003 1.00 11.13 ? 3  VAL A H    1  
ATOM 32    H HA   . VAL A 1 3  ? 17.997  9.650   -32.800 1.00 10.38 ? 3  VAL A HA   1  
ATOM 33    H HB   . VAL A 1 3  ? 18.403  12.253  -31.292 1.00 10.48 ? 3  VAL A HB   1  
ATOM 34    H HG11 . VAL A 1 3  ? 20.039  9.726   -31.624 1.00 10.52 ? 3  VAL A HG11 1  
ATOM 35    H HG12 . VAL A 1 3  ? 20.716  11.231  -31.000 1.00 10.71 ? 3  VAL A HG12 1  
ATOM 36    H HG13 . VAL A 1 3  ? 19.419  10.417  -30.126 1.00 10.31 ? 3  VAL A HG13 1  
ATOM 37    H HG21 . VAL A 1 3  ? 19.462  11.248  -33.928 1.00 11.32 ? 3  VAL A HG21 1  
ATOM 38    H HG22 . VAL A 1 3  ? 18.864  12.855  -33.516 1.00 11.52 ? 3  VAL A HG22 1  
ATOM 39    H HG23 . VAL A 1 3  ? 20.442  12.325  -32.933 1.00 11.26 ? 3  VAL A HG23 1  
ATOM 40    N N    . ALA A 1 4  ? 17.193  8.945   -30.487 1.00 8.73  ? 4  ALA A N    1  
ATOM 41    C CA   . ALA A 1 4  ? 16.502  8.460   -29.253 1.00 7.94  ? 4  ALA A CA   1  
ATOM 42    C C    . ALA A 1 4  ? 17.415  8.668   -28.040 1.00 7.00  ? 4  ALA A C    1  
ATOM 43    O O    . ALA A 1 4  ? 18.605  8.416   -28.097 1.00 7.01  ? 4  ALA A O    1  
ATOM 44    C CB   . ALA A 1 4  ? 16.176  6.973   -29.400 1.00 8.20  ? 4  ALA A CB   1  
ATOM 45    H H    . ALA A 1 4  ? 17.907  8.405   -30.889 1.00 8.94  ? 4  ALA A H    1  
ATOM 46    H HA   . ALA A 1 4  ? 15.586  9.016   -29.113 1.00 8.12  ? 4  ALA A HA   1  
ATOM 47    H HB1  . ALA A 1 4  ? 17.085  6.419   -29.581 1.00 8.32  ? 4  ALA A HB1  1  
ATOM 48    H HB2  . ALA A 1 4  ? 15.712  6.615   -28.492 1.00 8.35  ? 4  ALA A HB2  1  
ATOM 49    H HB3  . ALA A 1 4  ? 15.498  6.832   -30.229 1.00 8.38  ? 4  ALA A HB3  1  
ATOM 50    N N    . THR A 1 5  ? 16.861  9.123   -26.942 1.00 6.46  ? 5  THR A N    1  
ATOM 51    C CA   . THR A 1 5  ? 17.686  9.349   -25.711 1.00 5.78  ? 5  THR A CA   1  
ATOM 52    C C    . THR A 1 5  ? 17.949  8.007   -25.011 1.00 4.91  ? 5  THR A C    1  
ATOM 53    O O    . THR A 1 5  ? 17.391  6.988   -25.378 1.00 4.67  ? 5  THR A O    1  
ATOM 54    C CB   . THR A 1 5  ? 16.945  10.292  -24.752 1.00 6.14  ? 5  THR A CB   1  
ATOM 55    O OG1  . THR A 1 5  ? 15.670  9.741   -24.426 1.00 6.54  ? 5  THR A OG1  1  
ATOM 56    C CG2  . THR A 1 5  ? 16.767  11.667  -25.405 1.00 6.80  ? 5  THR A CG2  1  
ATOM 57    H H    . THR A 1 5  ? 15.900  9.314   -26.925 1.00 6.71  ? 5  THR A H    1  
ATOM 58    H HA   . THR A 1 5  ? 18.629  9.796   -25.991 1.00 5.96  ? 5  THR A HA   1  
ATOM 59    H HB   . THR A 1 5  ? 17.523  10.404  -23.849 1.00 5.97  ? 5  THR A HB   1  
ATOM 60    H HG1  . THR A 1 5  ? 15.054  9.968   -25.127 1.00 6.80  ? 5  THR A HG1  1  
ATOM 61    H HG21 . THR A 1 5  ? 16.361  11.545  -26.399 1.00 6.85  ? 5  THR A HG21 1  
ATOM 62    H HG22 . THR A 1 5  ? 16.091  12.263  -24.812 1.00 7.20  ? 5  THR A HG22 1  
ATOM 63    H HG23 . THR A 1 5  ? 17.725  12.162  -25.467 1.00 7.12  ? 5  THR A HG23 1  
ATOM 64    N N    . GLU A 1 6  ? 18.795  7.997   -24.005 1.00 4.60  ? 6  GLU A N    1  
ATOM 65    C CA   . GLU A 1 6  ? 19.092  6.716   -23.288 1.00 3.81  ? 6  GLU A CA   1  
ATOM 66    C C    . GLU A 1 6  ? 18.275  6.620   -21.991 1.00 3.24  ? 6  GLU A C    1  
ATOM 67    O O    . GLU A 1 6  ? 18.712  6.051   -21.011 1.00 3.60  ? 6  GLU A O    1  
ATOM 68    C CB   . GLU A 1 6  ? 20.591  6.636   -22.976 1.00 4.36  ? 6  GLU A CB   1  
ATOM 69    C CG   . GLU A 1 6  ? 21.345  6.113   -24.203 1.00 5.18  ? 6  GLU A CG   1  
ATOM 70    C CD   . GLU A 1 6  ? 21.034  4.625   -24.403 1.00 5.79  ? 6  GLU A CD   1  
ATOM 71    O OE1  . GLU A 1 6  ? 21.651  3.815   -23.732 1.00 6.16  ? 6  GLU A OE1  1  
ATOM 72    O OE2  . GLU A 1 6  ? 20.182  4.324   -25.223 1.00 6.17  ? 6  GLU A OE2  1  
ATOM 73    H H    . GLU A 1 6  ? 19.235  8.828   -23.726 1.00 5.01  ? 6  GLU A H    1  
ATOM 74    H HA   . GLU A 1 6  ? 18.814  5.895   -23.924 1.00 3.44  ? 6  GLU A HA   1  
ATOM 75    H HB2  . GLU A 1 6  ? 20.959  7.620   -22.720 1.00 4.83  ? 6  GLU A HB2  1  
ATOM 76    H HB3  . GLU A 1 6  ? 20.753  5.964   -22.145 1.00 4.03  ? 6  GLU A HB3  1  
ATOM 77    H HG2  . GLU A 1 6  ? 21.036  6.667   -25.078 1.00 5.45  ? 6  GLU A HG2  1  
ATOM 78    H HG3  . GLU A 1 6  ? 22.407  6.239   -24.055 1.00 5.43  ? 6  GLU A HG3  1  
ATOM 79    N N    . LEU A 1 7  ? 17.080  7.151   -22.002 1.00 2.59  ? 7  LEU A N    1  
ATOM 80    C CA   . LEU A 1 7  ? 16.188  7.090   -20.817 1.00 2.31  ? 7  LEU A CA   1  
ATOM 81    C C    . LEU A 1 7  ? 14.828  6.623   -21.320 1.00 1.55  ? 7  LEU A C    1  
ATOM 82    O O    . LEU A 1 7  ? 14.359  5.549   -20.992 1.00 1.73  ? 7  LEU A O    1  
ATOM 83    C CB   . LEU A 1 7  ? 16.009  8.481   -20.181 1.00 2.51  ? 7  LEU A CB   1  
ATOM 84    C CG   . LEU A 1 7  ? 17.323  9.269   -20.109 1.00 3.14  ? 7  LEU A CG   1  
ATOM 85    C CD1  . LEU A 1 7  ? 18.439  8.406   -19.505 1.00 3.94  ? 7  LEU A CD1  1  
ATOM 86    C CD2  . LEU A 1 7  ? 17.707  9.726   -21.516 1.00 3.07  ? 7  LEU A CD2  1  
ATOM 87    H H    . LEU A 1 7  ? 16.754  7.579   -22.807 1.00 2.53  ? 7  LEU A H    1  
ATOM 88    H HA   . LEU A 1 7  ? 16.577  6.397   -20.091 1.00 2.80  ? 7  LEU A HA   1  
ATOM 89    H HB2  . LEU A 1 7  ? 15.295  9.046   -20.759 1.00 2.07  ? 7  LEU A HB2  1  
ATOM 90    H HB3  . LEU A 1 7  ? 15.626  8.349   -19.196 1.00 2.88  ? 7  LEU A HB3  1  
ATOM 91    H HG   . LEU A 1 7  ? 17.176  10.138  -19.484 1.00 3.32  ? 7  LEU A HG   1  
ATOM 92    H HD11 . LEU A 1 7  ? 18.036  7.447   -19.213 1.00 4.28  ? 7  LEU A HD11 1  
ATOM 93    H HD12 . LEU A 1 7  ? 19.220  8.262   -20.235 1.00 4.27  ? 7  LEU A HD12 1  
ATOM 94    H HD13 . LEU A 1 7  ? 18.845  8.904   -18.637 1.00 4.25  ? 7  LEU A HD13 1  
ATOM 95    H HD21 . LEU A 1 7  ? 16.893  9.512   -22.196 1.00 3.21  ? 7  LEU A HD21 1  
ATOM 96    H HD22 . LEU A 1 7  ? 17.899  10.786  -21.512 1.00 3.36  ? 7  LEU A HD22 1  
ATOM 97    H HD23 . LEU A 1 7  ? 18.591  9.198   -21.840 1.00 3.18  ? 7  LEU A HD23 1  
ATOM 98    N N    . ARG A 1 8  ? 14.224  7.446   -22.150 1.00 1.31  ? 8  ARG A N    1  
ATOM 99    C CA   . ARG A 1 8  ? 12.917  7.163   -22.765 1.00 1.48  ? 8  ARG A CA   1  
ATOM 100   C C    . ARG A 1 8  ? 11.821  7.174   -21.701 1.00 1.32  ? 8  ARG A C    1  
ATOM 101   O O    . ARG A 1 8  ? 11.002  8.072   -21.653 1.00 1.92  ? 8  ARG A O    1  
ATOM 102   C CB   . ARG A 1 8  ? 12.975  5.802   -23.437 1.00 2.16  ? 8  ARG A CB   1  
ATOM 103   C CG   . ARG A 1 8  ? 12.486  5.903   -24.886 1.00 2.68  ? 8  ARG A CG   1  
ATOM 104   C CD   . ARG A 1 8  ? 12.549  4.522   -25.545 1.00 2.99  ? 8  ARG A CD   1  
ATOM 105   N NE   . ARG A 1 8  ? 11.467  4.406   -26.565 1.00 3.47  ? 8  ARG A NE   1  
ATOM 106   C CZ   . ARG A 1 8  ? 11.763  4.423   -27.838 1.00 3.94  ? 8  ARG A CZ   1  
ATOM 107   N NH1  . ARG A 1 8  ? 12.029  3.304   -28.464 1.00 4.33  ? 8  ARG A NH1  1  
ATOM 108   N NH2  . ARG A 1 8  ? 11.790  5.560   -28.488 1.00 4.42  ? 8  ARG A NH2  1  
ATOM 109   H H    . ARG A 1 8  ? 14.656  8.259   -22.385 1.00 1.63  ? 8  ARG A H    1  
ATOM 110   H HA   . ARG A 1 8  ? 12.713  7.922   -23.503 1.00 1.84  ? 8  ARG A HA   1  
ATOM 111   H HB2  . ARG A 1 8  ? 13.991  5.439   -23.414 1.00 2.23  ? 8  ARG A HB2  1  
ATOM 112   H HB3  . ARG A 1 8  ? 12.354  5.131   -22.893 1.00 2.53  ? 8  ARG A HB3  1  
ATOM 113   H HG2  . ARG A 1 8  ? 11.467  6.261   -24.897 1.00 2.98  ? 8  ARG A HG2  1  
ATOM 114   H HG3  . ARG A 1 8  ? 13.117  6.588   -25.432 1.00 2.97  ? 8  ARG A HG3  1  
ATOM 115   H HD2  . ARG A 1 8  ? 13.509  4.395   -26.022 1.00 3.17  ? 8  ARG A HD2  1  
ATOM 116   H HD3  . ARG A 1 8  ? 12.418  3.758   -24.793 1.00 3.16  ? 8  ARG A HD3  1  
ATOM 117   H HE   . ARG A 1 8  ? 10.534  4.316   -26.280 1.00 3.66  ? 8  ARG A HE   1  
ATOM 118   H HH11 . ARG A 1 8  ? 12.008  2.435   -27.967 1.00 4.37  ? 8  ARG A HH11 1  
ATOM 119   H HH12 . ARG A 1 8  ? 12.256  3.315   -29.438 1.00 4.82  ? 8  ARG A HH12 1  
ATOM 120   H HH21 . ARG A 1 8  ? 11.586  6.414   -28.010 1.00 4.48  ? 8  ARG A HH21 1  
ATOM 121   H HH22 . ARG A 1 8  ? 12.016  5.575   -29.462 1.00 4.97  ? 8  ARG A HH22 1  
ATOM 122   N N    . CYS A 1 9  ? 11.834  6.177   -20.851 1.00 0.86  ? 9  CYS A N    1  
ATOM 123   C CA   . CYS A 1 9  ? 10.836  6.037   -19.751 1.00 0.66  ? 9  CYS A CA   1  
ATOM 124   C C    . CYS A 1 9  ? 9.439   6.525   -20.206 1.00 0.61  ? 9  CYS A C    1  
ATOM 125   O O    . CYS A 1 9  ? 9.081   6.387   -21.364 1.00 0.84  ? 9  CYS A O    1  
ATOM 126   C CB   . CYS A 1 9  ? 11.334  6.814   -18.532 1.00 0.66  ? 9  CYS A CB   1  
ATOM 127   S SG   . CYS A 1 9  ? 13.136  6.629   -18.372 1.00 0.94  ? 9  CYS A SG   1  
ATOM 128   H H    . CYS A 1 9  ? 12.537  5.510   -20.933 1.00 1.09  ? 9  CYS A H    1  
ATOM 129   H HA   . CYS A 1 9  ? 10.762  4.993   -19.486 1.00 0.74  ? 9  CYS A HA   1  
ATOM 130   H HB2  . CYS A 1 9  ? 11.084  7.856   -18.642 1.00 0.78  ? 9  CYS A HB2  1  
ATOM 131   H HB3  . CYS A 1 9  ? 10.862  6.419   -17.658 1.00 0.69  ? 9  CYS A HB3  1  
ATOM 132   N N    . GLN A 1 10 ? 8.632   7.053   -19.311 1.00 0.51  ? 10 GLN A N    1  
ATOM 133   C CA   . GLN A 1 10 ? 7.265   7.508   -19.711 1.00 0.47  ? 10 GLN A CA   1  
ATOM 134   C C    . GLN A 1 10 ? 6.728   8.621   -18.784 1.00 0.39  ? 10 GLN A C    1  
ATOM 135   O O    . GLN A 1 10 ? 5.894   9.405   -19.194 1.00 0.40  ? 10 GLN A O    1  
ATOM 136   C CB   . GLN A 1 10 ? 6.325   6.310   -19.647 1.00 0.53  ? 10 GLN A CB   1  
ATOM 137   C CG   . GLN A 1 10 ? 6.089   5.775   -21.057 1.00 0.64  ? 10 GLN A CG   1  
ATOM 138   C CD   . GLN A 1 10 ? 4.646   5.275   -21.188 1.00 1.20  ? 10 GLN A CD   1  
ATOM 139   O OE1  . GLN A 1 10 ? 3.804   5.952   -21.744 1.00 1.87  ? 10 GLN A OE1  1  
ATOM 140   N NE2  . GLN A 1 10 ? 4.322   4.109   -20.696 1.00 1.84  ? 10 GLN A NE2  1  
ATOM 141   H H    . GLN A 1 10 ? 8.910   7.123   -18.389 1.00 0.64  ? 10 GLN A H    1  
ATOM 142   H HA   . GLN A 1 10 ? 7.297   7.878   -20.722 1.00 0.52  ? 10 GLN A HA   1  
ATOM 143   H HB2  . GLN A 1 10 ? 6.769   5.536   -19.037 1.00 0.58  ? 10 GLN A HB2  1  
ATOM 144   H HB3  . GLN A 1 10 ? 5.392   6.615   -19.215 1.00 0.50  ? 10 GLN A HB3  1  
ATOM 145   H HG2  . GLN A 1 10 ? 6.267   6.566   -21.770 1.00 1.10  ? 10 GLN A HG2  1  
ATOM 146   H HG3  . GLN A 1 10 ? 6.772   4.962   -21.245 1.00 1.15  ? 10 GLN A HG3  1  
ATOM 147   H HE21 . GLN A 1 10 ? 4.999   3.559   -20.247 1.00 2.04  ? 10 GLN A HE21 1  
ATOM 148   H HE22 . GLN A 1 10 ? 3.401   3.782   -20.776 1.00 2.45  ? 10 GLN A HE22 1  
ATOM 149   N N    . CYS A 1 11 ? 7.172   8.691   -17.542 1.00 0.34  ? 11 CYS A N    1  
ATOM 150   C CA   . CYS A 1 11 ? 6.663   9.739   -16.596 1.00 0.31  ? 11 CYS A CA   1  
ATOM 151   C C    . CYS A 1 11 ? 6.662   11.125  -17.250 1.00 0.36  ? 11 CYS A C    1  
ATOM 152   O O    . CYS A 1 11 ? 7.592   11.494  -17.945 1.00 0.50  ? 11 CYS A O    1  
ATOM 153   C CB   . CYS A 1 11 ? 7.563   9.793   -15.364 1.00 0.30  ? 11 CYS A CB   1  
ATOM 154   S SG   . CYS A 1 11 ? 7.364   8.288   -14.386 1.00 0.30  ? 11 CYS A SG   1  
ATOM 155   H H    . CYS A 1 11 ? 7.831   8.044   -17.224 1.00 0.36  ? 11 CYS A H    1  
ATOM 156   H HA   . CYS A 1 11 ? 5.660   9.489   -16.283 1.00 0.31  ? 11 CYS A HA   1  
ATOM 157   H HB2  . CYS A 1 11 ? 8.590   9.883   -15.674 1.00 0.34  ? 11 CYS A HB2  1  
ATOM 158   H HB3  . CYS A 1 11 ? 7.296   10.645  -14.766 1.00 0.31  ? 11 CYS A HB3  1  
ATOM 159   N N    . LEU A 1 12 ? 5.639   11.908  -16.993 1.00 0.40  ? 12 LEU A N    1  
ATOM 160   C CA   . LEU A 1 12 ? 5.587   13.292  -17.556 1.00 0.44  ? 12 LEU A CA   1  
ATOM 161   C C    . LEU A 1 12 ? 6.618   14.121  -16.783 1.00 0.45  ? 12 LEU A C    1  
ATOM 162   O O    . LEU A 1 12 ? 7.640   14.521  -17.306 1.00 0.48  ? 12 LEU A O    1  
ATOM 163   C CB   . LEU A 1 12 ? 4.178   13.909  -17.363 1.00 0.49  ? 12 LEU A CB   1  
ATOM 164   C CG   . LEU A 1 12 ? 3.072   12.858  -17.527 1.00 0.82  ? 12 LEU A CG   1  
ATOM 165   C CD1  . LEU A 1 12 ? 1.713   13.529  -17.320 1.00 1.04  ? 12 LEU A CD1  1  
ATOM 166   C CD2  . LEU A 1 12 ? 3.122   12.252  -18.929 1.00 1.56  ? 12 LEU A CD2  1  
ATOM 167   H H    . LEU A 1 12 ? 4.925   11.596  -16.402 1.00 0.49  ? 12 LEU A H    1  
ATOM 168   H HA   . LEU A 1 12 ? 5.843   13.273  -18.605 1.00 0.48  ? 12 LEU A HA   1  
ATOM 169   H HB2  . LEU A 1 12 ? 4.107   14.331  -16.372 1.00 0.97  ? 12 LEU A HB2  1  
ATOM 170   H HB3  . LEU A 1 12 ? 4.029   14.692  -18.090 1.00 0.98  ? 12 LEU A HB3  1  
ATOM 171   H HG   . LEU A 1 12 ? 3.203   12.079  -16.789 1.00 1.56  ? 12 LEU A HG   1  
ATOM 172   H HD11 . LEU A 1 12 ? 1.692   14.469  -17.851 1.00 1.40  ? 12 LEU A HD11 1  
ATOM 173   H HD12 . LEU A 1 12 ? 0.932   12.886  -17.696 1.00 1.31  ? 12 LEU A HD12 1  
ATOM 174   H HD13 . LEU A 1 12 ? 1.557   13.707  -16.267 1.00 1.71  ? 12 LEU A HD13 1  
ATOM 175   H HD21 . LEU A 1 12 ? 3.031   13.037  -19.664 1.00 2.10  ? 12 LEU A HD21 1  
ATOM 176   H HD22 . LEU A 1 12 ? 4.060   11.737  -19.065 1.00 2.03  ? 12 LEU A HD22 1  
ATOM 177   H HD23 . LEU A 1 12 ? 2.307   11.553  -19.045 1.00 2.07  ? 12 LEU A HD23 1  
ATOM 178   N N    . GLN A 1 13 ? 6.342   14.336  -15.524 1.00 0.43  ? 13 GLN A N    1  
ATOM 179   C CA   . GLN A 1 13 ? 7.246   15.092  -14.613 1.00 0.45  ? 13 GLN A CA   1  
ATOM 180   C C    . GLN A 1 13 ? 6.697   14.904  -13.189 1.00 0.42  ? 13 GLN A C    1  
ATOM 181   O O    . GLN A 1 13 ? 6.570   15.844  -12.430 1.00 0.60  ? 13 GLN A O    1  
ATOM 182   C CB   . GLN A 1 13 ? 7.232   16.572  -14.996 1.00 0.52  ? 13 GLN A CB   1  
ATOM 183   C CG   . GLN A 1 13 ? 8.499   16.921  -15.786 1.00 1.11  ? 13 GLN A CG   1  
ATOM 184   C CD   . GLN A 1 13 ? 8.153   17.892  -16.921 1.00 1.40  ? 13 GLN A CD   1  
ATOM 185   O OE1  . GLN A 1 13 ? 8.610   19.018  -16.931 1.00 1.77  ? 13 GLN A OE1  1  
ATOM 186   N NE2  . GLN A 1 13 ? 7.360   17.504  -17.885 1.00 2.09  ? 13 GLN A NE2  1  
ATOM 187   H H    . GLN A 1 13 ? 5.517   13.974  -15.157 1.00 0.42  ? 13 GLN A H    1  
ATOM 188   H HA   . GLN A 1 13 ? 8.248   14.694  -14.676 1.00 0.46  ? 13 GLN A HA   1  
ATOM 189   H HB2  . GLN A 1 13 ? 6.362   16.775  -15.604 1.00 0.98  ? 13 GLN A HB2  1  
ATOM 190   H HB3  . GLN A 1 13 ? 7.187   17.162  -14.103 1.00 0.85  ? 13 GLN A HB3  1  
ATOM 191   H HG2  . GLN A 1 13 ? 9.218   17.384  -15.125 1.00 1.50  ? 13 GLN A HG2  1  
ATOM 192   H HG3  . GLN A 1 13 ? 8.926   16.021  -16.204 1.00 1.66  ? 13 GLN A HG3  1  
ATOM 193   H HE21 . GLN A 1 13 ? 6.990   16.596  -17.882 1.00 2.59  ? 13 GLN A HE21 1  
ATOM 194   H HE22 . GLN A 1 13 ? 7.136   18.121  -18.613 1.00 2.41  ? 13 GLN A HE22 1  
ATOM 195   N N    . THR A 1 14 ? 6.331   13.674  -12.877 1.00 0.36  ? 14 THR A N    1  
ATOM 196   C CA   . THR A 1 14 ? 5.713   13.296  -11.562 1.00 0.32  ? 14 THR A CA   1  
ATOM 197   C C    . THR A 1 14 ? 4.957   14.449  -10.906 1.00 0.35  ? 14 THR A C    1  
ATOM 198   O O    . THR A 1 14 ? 5.516   15.273  -10.203 1.00 0.39  ? 14 THR A O    1  
ATOM 199   C CB   . THR A 1 14 ? 6.714   12.735  -10.571 1.00 0.32  ? 14 THR A CB   1  
ATOM 200   O OG1  . THR A 1 14 ? 7.886   13.544  -10.529 1.00 0.38  ? 14 THR A OG1  1  
ATOM 201   C CG2  . THR A 1 14 ? 7.059   11.300  -10.971 1.00 0.31  ? 14 THR A CG2  1  
ATOM 202   H H    . THR A 1 14 ? 6.433   12.974  -13.556 1.00 0.51  ? 14 THR A H    1  
ATOM 203   H HA   . THR A 1 14 ? 5.005   12.520  -11.765 1.00 0.30  ? 14 THR A HA   1  
ATOM 204   H HB   . THR A 1 14 ? 6.234   12.720  -9.599  1.00 0.32  ? 14 THR A HB   1  
ATOM 205   H HG1  . THR A 1 14 ? 8.394   13.384  -11.331 1.00 0.69  ? 14 THR A HG1  1  
ATOM 206   H HG21 . THR A 1 14 ? 6.144   10.744  -11.127 1.00 1.05  ? 14 THR A HG21 1  
ATOM 207   H HG22 . THR A 1 14 ? 7.633   11.309  -11.885 1.00 1.08  ? 14 THR A HG22 1  
ATOM 208   H HG23 . THR A 1 14 ? 7.633   10.835  -10.186 1.00 1.01  ? 14 THR A HG23 1  
ATOM 209   N N    . LEU A 1 15 ? 3.673   14.468  -11.100 1.00 0.36  ? 15 LEU A N    1  
ATOM 210   C CA   . LEU A 1 15 ? 2.827   15.519  -10.472 1.00 0.41  ? 15 LEU A CA   1  
ATOM 211   C C    . LEU A 1 15 ? 2.636   15.172  -8.989  1.00 0.35  ? 15 LEU A C    1  
ATOM 212   O O    . LEU A 1 15 ? 2.944   14.077  -8.554  1.00 0.52  ? 15 LEU A O    1  
ATOM 213   C CB   . LEU A 1 15 ? 1.470   15.581  -11.180 1.00 0.57  ? 15 LEU A CB   1  
ATOM 214   C CG   . LEU A 1 15 ? 1.669   16.088  -12.613 1.00 0.64  ? 15 LEU A CG   1  
ATOM 215   C CD1  . LEU A 1 15 ? 0.613   15.471  -13.533 1.00 0.74  ? 15 LEU A CD1  1  
ATOM 216   C CD2  . LEU A 1 15 ? 1.541   17.614  -12.634 1.00 1.76  ? 15 LEU A CD2  1  
ATOM 217   H H    . LEU A 1 15 ? 3.259   13.757  -11.641 1.00 0.35  ? 15 LEU A H    1  
ATOM 218   H HA   . LEU A 1 15 ? 3.323   16.476  -10.554 1.00 0.51  ? 15 LEU A HA   1  
ATOM 219   H HB2  . LEU A 1 15 ? 1.030   14.593  -11.202 1.00 1.12  ? 15 LEU A HB2  1  
ATOM 220   H HB3  . LEU A 1 15 ? 0.816   16.256  -10.649 1.00 0.90  ? 15 LEU A HB3  1  
ATOM 221   H HG   . LEU A 1 15 ? 2.655   15.805  -12.959 1.00 1.32  ? 15 LEU A HG   1  
ATOM 222   H HD11 . LEU A 1 15 ? -0.313  15.354  -12.993 1.00 1.31  ? 15 LEU A HD11 1  
ATOM 223   H HD12 . LEU A 1 15 ? 0.455   16.118  -14.384 1.00 1.29  ? 15 LEU A HD12 1  
ATOM 224   H HD13 . LEU A 1 15 ? 0.955   14.505  -13.876 1.00 1.44  ? 15 LEU A HD13 1  
ATOM 225   H HD21 . LEU A 1 15 ? 0.788   17.921  -11.924 1.00 2.30  ? 15 LEU A HD21 1  
ATOM 226   H HD22 . LEU A 1 15 ? 2.490   18.058  -12.370 1.00 2.29  ? 15 LEU A HD22 1  
ATOM 227   H HD23 . LEU A 1 15 ? 1.256   17.938  -13.625 1.00 2.30  ? 15 LEU A HD23 1  
ATOM 228   N N    . GLN A 1 16 ? 2.150   16.096  -8.210  1.00 0.47  ? 16 GLN A N    1  
ATOM 229   C CA   . GLN A 1 16 ? 1.963   15.826  -6.756  1.00 0.41  ? 16 GLN A CA   1  
ATOM 230   C C    . GLN A 1 16 ? 0.501   15.500  -6.455  1.00 0.39  ? 16 GLN A C    1  
ATOM 231   O O    . GLN A 1 16 ? -0.202  16.256  -5.812  1.00 0.47  ? 16 GLN A O    1  
ATOM 232   C CB   . GLN A 1 16 ? 2.415   17.047  -5.944  1.00 0.48  ? 16 GLN A CB   1  
ATOM 233   C CG   . GLN A 1 16 ? 3.852   16.835  -5.462  1.00 0.60  ? 16 GLN A CG   1  
ATOM 234   C CD   . GLN A 1 16 ? 4.312   18.062  -4.670  1.00 0.77  ? 16 GLN A CD   1  
ATOM 235   O OE1  . GLN A 1 16 ? 4.955   18.941  -5.211  1.00 1.48  ? 16 GLN A OE1  1  
ATOM 236   N NE2  . GLN A 1 16 ? 4.010   18.161  -3.403  1.00 1.31  ? 16 GLN A NE2  1  
ATOM 237   H H    . GLN A 1 16 ? 1.923   16.966  -8.576  1.00 0.72  ? 16 GLN A H    1  
ATOM 238   H HA   . GLN A 1 16 ? 2.562   14.970  -6.480  1.00 0.43  ? 16 GLN A HA   1  
ATOM 239   H HB2  . GLN A 1 16 ? 2.369   17.929  -6.565  1.00 0.51  ? 16 GLN A HB2  1  
ATOM 240   H HB3  . GLN A 1 16 ? 1.767   17.173  -5.090  1.00 0.49  ? 16 GLN A HB3  1  
ATOM 241   H HG2  . GLN A 1 16 ? 3.893   15.960  -4.829  1.00 0.75  ? 16 GLN A HG2  1  
ATOM 242   H HG3  . GLN A 1 16 ? 4.500   16.694  -6.313  1.00 0.72  ? 16 GLN A HG3  1  
ATOM 243   H HE21 . GLN A 1 16 ? 3.492   17.454  -2.964  1.00 1.98  ? 16 GLN A HE21 1  
ATOM 244   H HE22 . GLN A 1 16 ? 4.304   18.943  -2.890  1.00 1.46  ? 16 GLN A HE22 1  
ATOM 245   N N    . GLY A 1 17 ? 0.060   14.354  -6.901  1.00 0.36  ? 17 GLY A N    1  
ATOM 246   C CA   . GLY A 1 17 ? -1.336  13.908  -6.628  1.00 0.45  ? 17 GLY A CA   1  
ATOM 247   C C    . GLY A 1 17 ? -2.347  14.884  -7.215  1.00 0.41  ? 17 GLY A C    1  
ATOM 248   O O    . GLY A 1 17 ? -2.840  15.764  -6.532  1.00 0.57  ? 17 GLY A O    1  
ATOM 249   H H    . GLY A 1 17 ? 0.664   13.770  -7.403  1.00 0.34  ? 17 GLY A H    1  
ATOM 250   H HA2  . GLY A 1 17 ? -1.487  12.933  -7.068  1.00 0.56  ? 17 GLY A HA2  1  
ATOM 251   H HA3  . GLY A 1 17 ? -1.485  13.843  -5.562  1.00 0.59  ? 17 GLY A HA3  1  
ATOM 252   N N    . ILE A 1 18 ? -2.691  14.711  -8.462  1.00 0.39  ? 18 ILE A N    1  
ATOM 253   C CA   . ILE A 1 18 ? -3.703  15.605  -9.083  1.00 0.49  ? 18 ILE A CA   1  
ATOM 254   C C    . ILE A 1 18 ? -5.092  15.089  -8.693  1.00 0.50  ? 18 ILE A C    1  
ATOM 255   O O    . ILE A 1 18 ? -5.220  14.206  -7.862  1.00 0.72  ? 18 ILE A O    1  
ATOM 256   C CB   . ILE A 1 18 ? -3.515  15.664  -10.617 1.00 0.67  ? 18 ILE A CB   1  
ATOM 257   C CG1  . ILE A 1 18 ? -4.280  14.536  -11.327 1.00 0.72  ? 18 ILE A CG1  1  
ATOM 258   C CG2  . ILE A 1 18 ? -2.025  15.569  -10.970 1.00 0.74  ? 18 ILE A CG2  1  
ATOM 259   C CD1  . ILE A 1 18 ? -3.909  13.189  -10.722 1.00 0.66  ? 18 ILE A CD1  1  
ATOM 260   H H    . ILE A 1 18 ? -2.305  13.979  -8.977  1.00 0.45  ? 18 ILE A H    1  
ATOM 261   H HA   . ILE A 1 18 ? -3.587  16.592  -8.683  1.00 0.54  ? 18 ILE A HA   1  
ATOM 262   H HB   . ILE A 1 18 ? -3.885  16.611  -10.965 1.00 0.79  ? 18 ILE A HB   1  
ATOM 263   H HG12 . ILE A 1 18 ? -5.342  14.698  -11.217 1.00 0.70  ? 18 ILE A HG12 1  
ATOM 264   H HG13 . ILE A 1 18 ? -4.026  14.538  -12.376 1.00 0.91  ? 18 ILE A HG13 1  
ATOM 265   H HG21 . ILE A 1 18 ? -1.444  16.078  -10.215 1.00 1.14  ? 18 ILE A HG21 1  
ATOM 266   H HG22 . ILE A 1 18 ? -1.728  14.532  -11.015 1.00 1.33  ? 18 ILE A HG22 1  
ATOM 267   H HG23 . ILE A 1 18 ? -1.854  16.034  -11.930 1.00 1.17  ? 18 ILE A HG23 1  
ATOM 268   H HD11 . ILE A 1 18 ? -2.834  13.092  -10.702 1.00 1.04  ? 18 ILE A HD11 1  
ATOM 269   H HD12 . ILE A 1 18 ? -4.295  13.131  -9.716  1.00 1.35  ? 18 ILE A HD12 1  
ATOM 270   H HD13 . ILE A 1 18 ? -4.334  12.401  -11.320 1.00 1.18  ? 18 ILE A HD13 1  
ATOM 271   N N    . HIS A 1 19 ? -6.130  15.627  -9.259  1.00 0.45  ? 19 HIS A N    1  
ATOM 272   C CA   . HIS A 1 19 ? -7.490  15.153  -8.886  1.00 0.47  ? 19 HIS A CA   1  
ATOM 273   C C    . HIS A 1 19 ? -7.908  14.027  -9.856  1.00 0.39  ? 19 HIS A C    1  
ATOM 274   O O    . HIS A 1 19 ? -7.548  14.061  -11.019 1.00 0.35  ? 19 HIS A O    1  
ATOM 275   C CB   . HIS A 1 19 ? -8.464  16.352  -8.901  1.00 0.54  ? 19 HIS A CB   1  
ATOM 276   C CG   . HIS A 1 19 ? -9.593  16.143  -9.871  1.00 0.60  ? 19 HIS A CG   1  
ATOM 277   N ND1  . HIS A 1 19 ? -10.911 16.049  -9.459  1.00 0.75  ? 19 HIS A ND1  1  
ATOM 278   C CD2  . HIS A 1 19 ? -9.614  16.033  -11.233 1.00 0.60  ? 19 HIS A CD2  1  
ATOM 279   C CE1  . HIS A 1 19 ? -11.665 15.889  -10.560 1.00 0.81  ? 19 HIS A CE1  1  
ATOM 280   N NE2  . HIS A 1 19 ? -10.923 15.876  -11.671 1.00 0.74  ? 19 HIS A NE2  1  
ATOM 281   H H    . HIS A 1 19 ? -6.014  16.336  -9.921  1.00 0.55  ? 19 HIS A H    1  
ATOM 282   H HA   . HIS A 1 19 ? -7.438  14.757  -7.885  1.00 0.50  ? 19 HIS A HA   1  
ATOM 283   H HB2  . HIS A 1 19 ? -8.872  16.484  -7.912  1.00 0.64  ? 19 HIS A HB2  1  
ATOM 284   H HB3  . HIS A 1 19 ? -7.919  17.244  -9.178  1.00 0.52  ? 19 HIS A HB3  1  
ATOM 285   H HD1  . HIS A 1 19 ? -11.236 16.090  -8.535  1.00 0.84  ? 19 HIS A HD1  1  
ATOM 286   H HD2  . HIS A 1 19 ? -8.739  16.037  -11.865 1.00 0.55  ? 19 HIS A HD2  1  
ATOM 287   H HE1  . HIS A 1 19 ? -12.736 15.766  -10.546 1.00 0.93  ? 19 HIS A HE1  1  
ATOM 288   N N    . PRO A 1 20 ? -8.628  13.044  -9.346  1.00 0.39  ? 20 PRO A N    1  
ATOM 289   C CA   . PRO A 1 20 ? -9.071  11.893  -10.153 1.00 0.35  ? 20 PRO A CA   1  
ATOM 290   C C    . PRO A 1 20 ? -10.238 12.285  -11.078 1.00 0.37  ? 20 PRO A C    1  
ATOM 291   O O    . PRO A 1 20 ? -10.089 13.188  -11.877 1.00 0.43  ? 20 PRO A O    1  
ATOM 292   C CB   . PRO A 1 20 ? -9.454  10.846  -9.098  1.00 0.40  ? 20 PRO A CB   1  
ATOM 293   C CG   . PRO A 1 20 ? -9.764  11.627  -7.805  1.00 0.47  ? 20 PRO A CG   1  
ATOM 294   C CD   . PRO A 1 20 ? -9.060  12.985  -7.933  1.00 0.46  ? 20 PRO A CD   1  
ATOM 295   H HA   . PRO A 1 20 ? -8.250  11.525  -10.747 1.00 0.32  ? 20 PRO A HA   1  
ATOM 296   H HB2  . PRO A 1 20 ? -10.315 10.284  -9.415  1.00 0.40  ? 20 PRO A HB2  1  
ATOM 297   H HB3  . PRO A 1 20 ? -8.624  10.182  -8.925  1.00 0.40  ? 20 PRO A HB3  1  
ATOM 298   H HG2  . PRO A 1 20 ? -10.830 11.770  -7.706  1.00 0.50  ? 20 PRO A HG2  1  
ATOM 299   H HG3  . PRO A 1 20 ? -9.377  11.098  -6.951  1.00 0.52  ? 20 PRO A HG3  1  
ATOM 300   H HD2  . PRO A 1 20 ? -9.751  13.783  -7.712  1.00 0.50  ? 20 PRO A HD2  1  
ATOM 301   H HD3  . PRO A 1 20 ? -8.206  13.021  -7.280  1.00 0.47  ? 20 PRO A HD3  1  
ATOM 302   N N    . LYS A 1 21 ? -11.373 11.596  -11.032 1.00 0.38  ? 21 LYS A N    1  
ATOM 303   C CA   . LYS A 1 21 ? -12.506 11.910  -11.967 1.00 0.40  ? 21 LYS A CA   1  
ATOM 304   C C    . LYS A 1 21 ? -12.136 11.360  -13.349 1.00 0.38  ? 21 LYS A C    1  
ATOM 305   O O    . LYS A 1 21 ? -12.877 10.604  -13.949 1.00 0.42  ? 21 LYS A O    1  
ATOM 306   C CB   . LYS A 1 21 ? -12.756 13.423  -12.036 1.00 0.42  ? 21 LYS A CB   1  
ATOM 307   C CG   . LYS A 1 21 ? -14.183 13.697  -12.524 1.00 0.51  ? 21 LYS A CG   1  
ATOM 308   C CD   . LYS A 1 21 ? -15.186 13.379  -11.409 1.00 0.98  ? 21 LYS A CD   1  
ATOM 309   C CE   . LYS A 1 21 ? -15.425 14.629  -10.554 1.00 1.47  ? 21 LYS A CE   1  
ATOM 310   N NZ   . LYS A 1 21 ? -16.778 14.557  -9.928  1.00 2.14  ? 21 LYS A NZ   1  
ATOM 311   H H    . LYS A 1 21 ? -11.465 10.847  -10.418 1.00 0.41  ? 21 LYS A H    1  
ATOM 312   H HA   . LYS A 1 21 ? -13.397 11.412  -11.618 1.00 0.43  ? 21 LYS A HA   1  
ATOM 313   H HB2  . LYS A 1 21 ? -12.626 13.849  -11.054 1.00 0.42  ? 21 LYS A HB2  1  
ATOM 314   H HB3  . LYS A 1 21 ? -12.053 13.873  -12.720 1.00 0.40  ? 21 LYS A HB3  1  
ATOM 315   H HG2  . LYS A 1 21 ? -14.271 14.738  -12.802 1.00 0.97  ? 21 LYS A HG2  1  
ATOM 316   H HG3  . LYS A 1 21 ? -14.394 13.078  -13.382 1.00 0.86  ? 21 LYS A HG3  1  
ATOM 317   H HD2  . LYS A 1 21 ? -16.119 13.060  -11.848 1.00 1.62  ? 21 LYS A HD2  1  
ATOM 318   H HD3  . LYS A 1 21 ? -14.794 12.589  -10.786 1.00 1.69  ? 21 LYS A HD3  1  
ATOM 319   H HE2  . LYS A 1 21 ? -14.675 14.684  -9.779  1.00 1.83  ? 21 LYS A HE2  1  
ATOM 320   H HE3  . LYS A 1 21 ? -15.364 15.509  -11.177 1.00 1.91  ? 21 LYS A HE3  1  
ATOM 321   H HZ1  . LYS A 1 21 ? -16.874 13.661  -9.408  1.00 2.32  ? 21 LYS A HZ1  1  
ATOM 322   H HZ2  . LYS A 1 21 ? -16.899 15.355  -9.272  1.00 2.71  ? 21 LYS A HZ2  1  
ATOM 323   H HZ3  . LYS A 1 21 ? -17.507 14.604  -10.669 1.00 2.51  ? 21 LYS A HZ3  1  
ATOM 324   N N    . ASN A 1 22 ? -10.962 11.696  -13.824 1.00 0.36  ? 22 ASN A N    1  
ATOM 325   C CA   . ASN A 1 22 ? -10.470 11.176  -15.116 1.00 0.36  ? 22 ASN A CA   1  
ATOM 326   C C    . ASN A 1 22 ? -9.586  9.980   -14.781 1.00 0.34  ? 22 ASN A C    1  
ATOM 327   O O    . ASN A 1 22 ? -9.765  8.889   -15.275 1.00 0.36  ? 22 ASN A O    1  
ATOM 328   C CB   . ASN A 1 22 ? -9.612  12.244  -15.805 1.00 0.36  ? 22 ASN A CB   1  
ATOM 329   C CG   . ASN A 1 22 ? -10.167 13.645  -15.528 1.00 0.38  ? 22 ASN A CG   1  
ATOM 330   O OD1  . ASN A 1 22 ? -11.151 14.052  -16.114 1.00 0.42  ? 22 ASN A OD1  1  
ATOM 331   N ND2  . ASN A 1 22 ? -9.567  14.404  -14.648 1.00 0.37  ? 22 ASN A ND2  1  
ATOM 332   H H    . ASN A 1 22 ? -10.372 12.269  -13.300 1.00 0.35  ? 22 ASN A H    1  
ATOM 333   H HA   . ASN A 1 22 ? -11.292 10.880  -15.748 1.00 0.39  ? 22 ASN A HA   1  
ATOM 334   H HB2  . ASN A 1 22 ? -8.601  12.185  -15.428 1.00 0.33  ? 22 ASN A HB2  1  
ATOM 335   H HB3  . ASN A 1 22 ? -9.605  12.064  -16.859 1.00 0.38  ? 22 ASN A HB3  1  
ATOM 336   H HD21 . ASN A 1 22 ? -8.772  14.074  -14.176 1.00 0.34  ? 22 ASN A HD21 1  
ATOM 337   H HD22 . ASN A 1 22 ? -9.910  15.301  -14.460 1.00 0.39  ? 22 ASN A HD22 1  
ATOM 338   N N    . ILE A 1 23 ? -8.647  10.204  -13.905 1.00 0.31  ? 23 ILE A N    1  
ATOM 339   C CA   . ILE A 1 23 ? -7.714  9.148   -13.449 1.00 0.30  ? 23 ILE A CA   1  
ATOM 340   C C    . ILE A 1 23 ? -8.493  7.845   -13.186 1.00 0.34  ? 23 ILE A C    1  
ATOM 341   O O    . ILE A 1 23 ? -9.240  7.736   -12.231 1.00 0.37  ? 23 ILE A O    1  
ATOM 342   C CB   . ILE A 1 23 ? -7.068  9.688   -12.170 1.00 0.29  ? 23 ILE A CB   1  
ATOM 343   C CG1  . ILE A 1 23 ? -5.823  10.500  -12.531 1.00 0.27  ? 23 ILE A CG1  1  
ATOM 344   C CG2  . ILE A 1 23 ? -6.688  8.558   -11.227 1.00 0.33  ? 23 ILE A CG2  1  
ATOM 345   C CD1  . ILE A 1 23 ? -6.247  11.809  -13.201 1.00 0.26  ? 23 ILE A CD1  1  
ATOM 346   H H    . ILE A 1 23 ? -8.565  11.097  -13.515 1.00 0.31  ? 23 ILE A H    1  
ATOM 347   H HA   . ILE A 1 23 ? -6.954  8.979   -14.202 1.00 0.29  ? 23 ILE A HA   1  
ATOM 348   H HB   . ILE A 1 23 ? -7.777  10.335  -11.677 1.00 0.31  ? 23 ILE A HB   1  
ATOM 349   H HG12 . ILE A 1 23 ? -5.265  10.718  -11.633 1.00 0.29  ? 23 ILE A HG12 1  
ATOM 350   H HG13 . ILE A 1 23 ? -5.207  9.932   -13.211 1.00 0.26  ? 23 ILE A HG13 1  
ATOM 351   H HG21 . ILE A 1 23 ? -6.362  7.706   -11.801 1.00 1.08  ? 23 ILE A HG21 1  
ATOM 352   H HG22 . ILE A 1 23 ? -5.894  8.889   -10.578 1.00 1.00  ? 23 ILE A HG22 1  
ATOM 353   H HG23 . ILE A 1 23 ? -7.550  8.289   -10.635 1.00 1.10  ? 23 ILE A HG23 1  
ATOM 354   H HD11 . ILE A 1 23 ? -7.040  12.265  -12.627 1.00 1.03  ? 23 ILE A HD11 1  
ATOM 355   H HD12 . ILE A 1 23 ? -5.405  12.480  -13.247 1.00 0.97  ? 23 ILE A HD12 1  
ATOM 356   H HD13 . ILE A 1 23 ? -6.601  11.603  -14.200 1.00 1.04  ? 23 ILE A HD13 1  
ATOM 357   N N    . GLN A 1 24 ? -8.337  6.877   -14.052 1.00 0.36  ? 24 GLN A N    1  
ATOM 358   C CA   . GLN A 1 24 ? -9.056  5.590   -13.912 1.00 0.42  ? 24 GLN A CA   1  
ATOM 359   C C    . GLN A 1 24 ? -8.113  4.492   -13.413 1.00 0.37  ? 24 GLN A C    1  
ATOM 360   O O    . GLN A 1 24 ? -8.559  3.476   -12.913 1.00 0.39  ? 24 GLN A O    1  
ATOM 361   C CB   . GLN A 1 24 ? -9.583  5.222   -15.291 1.00 0.48  ? 24 GLN A CB   1  
ATOM 362   C CG   . GLN A 1 24 ? -11.097 5.011   -15.237 1.00 0.57  ? 24 GLN A CG   1  
ATOM 363   C CD   . GLN A 1 24 ? -11.490 3.887   -16.199 1.00 1.16  ? 24 GLN A CD   1  
ATOM 364   O OE1  . GLN A 1 24 ? -11.882 2.819   -15.772 1.00 1.82  ? 24 GLN A OE1  1  
ATOM 365   N NE2  . GLN A 1 24 ? -11.398 4.081   -17.487 1.00 1.58  ? 24 GLN A NE2  1  
ATOM 366   H H    . GLN A 1 24 ? -7.749  6.996   -14.826 1.00 0.36  ? 24 GLN A H    1  
ATOM 367   H HA   . GLN A 1 24 ? -9.886  5.693   -13.226 1.00 0.46  ? 24 GLN A HA   1  
ATOM 368   H HB2  . GLN A 1 24 ? -9.361  6.028   -15.978 1.00 0.48  ? 24 GLN A HB2  1  
ATOM 369   H HB3  . GLN A 1 24 ? -9.093  4.334   -15.626 1.00 0.48  ? 24 GLN A HB3  1  
ATOM 370   H HG2  . GLN A 1 24 ? -11.389 4.746   -14.231 1.00 0.66  ? 24 GLN A HG2  1  
ATOM 371   H HG3  . GLN A 1 24 ? -11.599 5.922   -15.529 1.00 0.91  ? 24 GLN A HG3  1  
ATOM 372   H HE21 . GLN A 1 24 ? -11.080 4.943   -17.832 1.00 1.80  ? 24 GLN A HE21 1  
ATOM 373   H HE22 . GLN A 1 24 ? -11.645 3.366   -18.108 1.00 2.04  ? 24 GLN A HE22 1  
ATOM 374   N N    . SER A 1 25 ? -6.817  4.674   -13.544 1.00 0.33  ? 25 SER A N    1  
ATOM 375   C CA   . SER A 1 25 ? -5.875  3.619   -13.076 1.00 0.29  ? 25 SER A CA   1  
ATOM 376   C C    . SER A 1 25 ? -4.461  4.166   -12.947 1.00 0.27  ? 25 SER A C    1  
ATOM 377   O O    . SER A 1 25 ? -4.212  5.341   -13.136 1.00 0.29  ? 25 SER A O    1  
ATOM 378   C CB   . SER A 1 25 ? -5.849  2.476   -14.074 1.00 0.31  ? 25 SER A CB   1  
ATOM 379   O OG   . SER A 1 25 ? -5.216  2.902   -15.273 1.00 0.34  ? 25 SER A OG   1  
ATOM 380   H H    . SER A 1 25 ? -6.467  5.497   -13.951 1.00 0.33  ? 25 SER A H    1  
ATOM 381   H HA   . SER A 1 25 ? -6.201  3.241   -12.120 1.00 0.29  ? 25 SER A HA   1  
ATOM 382   H HB2  . SER A 1 25 ? -5.294  1.662   -13.651 1.00 0.31  ? 25 SER A HB2  1  
ATOM 383   H HB3  . SER A 1 25 ? -6.854  2.158   -14.277 1.00 0.30  ? 25 SER A HB3  1  
ATOM 384   H HG   . SER A 1 25 ? -4.385  2.430   -15.353 1.00 0.78  ? 25 SER A HG   1  
ATOM 385   N N    . VAL A 1 26 ? -3.535  3.302   -12.628 1.00 0.25  ? 26 VAL A N    1  
ATOM 386   C CA   . VAL A 1 26 ? -2.119  3.723   -12.492 1.00 0.24  ? 26 VAL A CA   1  
ATOM 387   C C    . VAL A 1 26 ? -1.206  2.505   -12.601 1.00 0.25  ? 26 VAL A C    1  
ATOM 388   O O    . VAL A 1 26 ? -1.599  1.382   -12.340 1.00 0.26  ? 26 VAL A O    1  
ATOM 389   C CB   . VAL A 1 26 ? -1.885  4.388   -11.134 1.00 0.23  ? 26 VAL A CB   1  
ATOM 390   C CG1  . VAL A 1 26 ? -2.610  3.606   -10.057 1.00 0.24  ? 26 VAL A CG1  1  
ATOM 391   C CG2  . VAL A 1 26 ? -0.381  4.415   -10.823 1.00 0.26  ? 26 VAL A CG2  1  
ATOM 392   H H    . VAL A 1 26 ? -3.777  2.364   -12.482 1.00 0.25  ? 26 VAL A H    1  
ATOM 393   H HA   . VAL A 1 26 ? -1.881  4.422   -13.277 1.00 0.24  ? 26 VAL A HA   1  
ATOM 394   H HB   . VAL A 1 26 ? -2.265  5.386   -11.154 1.00 0.25  ? 26 VAL A HB   1  
ATOM 395   H HG11 . VAL A 1 26 ? -3.616  3.399   -10.390 1.00 1.00  ? 26 VAL A HG11 1  
ATOM 396   H HG12 . VAL A 1 26 ? -2.088  2.682   -9.880  1.00 1.10  ? 26 VAL A HG12 1  
ATOM 397   H HG13 . VAL A 1 26 ? -2.639  4.190   -9.153  1.00 1.01  ? 26 VAL A HG13 1  
ATOM 398   H HG21 . VAL A 1 26 ? 0.148   4.873   -11.647 1.00 1.03  ? 26 VAL A HG21 1  
ATOM 399   H HG22 . VAL A 1 26 ? -0.205  4.978   -9.924  1.00 1.06  ? 26 VAL A HG22 1  
ATOM 400   H HG23 . VAL A 1 26 ? -0.025  3.402   -10.691 1.00 1.05  ? 26 VAL A HG23 1  
ATOM 401   N N    . ASN A 1 27 ? 0.020   2.743   -12.958 1.00 0.25  ? 27 ASN A N    1  
ATOM 402   C CA   . ASN A 1 27 ? 1.007   1.663   -13.071 1.00 0.27  ? 27 ASN A CA   1  
ATOM 403   C C    . ASN A 1 27 ? 2.201   1.999   -12.191 1.00 0.25  ? 27 ASN A C    1  
ATOM 404   O O    . ASN A 1 27 ? 2.586   3.147   -12.062 1.00 0.42  ? 27 ASN A O    1  
ATOM 405   C CB   . ASN A 1 27 ? 1.479   1.543   -14.503 1.00 0.30  ? 27 ASN A CB   1  
ATOM 406   C CG   . ASN A 1 27 ? 0.317   1.766   -15.482 1.00 0.57  ? 27 ASN A CG   1  
ATOM 407   O OD1  . ASN A 1 27 ? -0.715  1.130   -15.377 1.00 0.95  ? 27 ASN A OD1  1  
ATOM 408   N ND2  . ASN A 1 27 ? 0.444   2.646   -16.436 1.00 0.72  ? 27 ASN A ND2  1  
ATOM 409   H H    . ASN A 1 27 ? 0.298   3.656   -13.140 1.00 0.26  ? 27 ASN A H    1  
ATOM 410   H HA   . ASN A 1 27 ? 0.574   0.739   -12.753 1.00 0.30  ? 27 ASN A HA   1  
ATOM 411   H HB2  . ASN A 1 27 ? 2.256   2.265   -14.681 1.00 0.45  ? 27 ASN A HB2  1  
ATOM 412   H HB3  . ASN A 1 27 ? 1.869   0.570   -14.637 1.00 0.51  ? 27 ASN A HB3  1  
ATOM 413   H HD21 . ASN A 1 27 ? 1.276   3.157   -16.525 1.00 0.75  ? 27 ASN A HD21 1  
ATOM 414   H HD22 . ASN A 1 27 ? -0.293  2.799   -17.064 1.00 0.99  ? 27 ASN A HD22 1  
ATOM 415   N N    . VAL A 1 28 ? 2.795   1.012   -11.593 1.00 0.28  ? 28 VAL A N    1  
ATOM 416   C CA   . VAL A 1 28 ? 3.975   1.283   -10.723 1.00 0.28  ? 28 VAL A CA   1  
ATOM 417   C C    . VAL A 1 28 ? 5.083   0.263   -11.018 1.00 0.31  ? 28 VAL A C    1  
ATOM 418   O O    . VAL A 1 28 ? 4.954   -0.911  -10.727 1.00 0.33  ? 28 VAL A O    1  
ATOM 419   C CB   . VAL A 1 28 ? 3.552   1.223   -9.246  1.00 0.34  ? 28 VAL A CB   1  
ATOM 420   C CG1  . VAL A 1 28 ? 2.913   -0.130  -8.932  1.00 0.55  ? 28 VAL A CG1  1  
ATOM 421   C CG2  . VAL A 1 28 ? 4.774   1.436   -8.344  1.00 0.71  ? 28 VAL A CG2  1  
ATOM 422   H H    . VAL A 1 28 ? 2.465   0.094   -11.721 1.00 0.43  ? 28 VAL A H    1  
ATOM 423   H HA   . VAL A 1 28 ? 4.344   2.276   -10.944 1.00 0.28  ? 28 VAL A HA   1  
ATOM 424   H HB   . VAL A 1 28 ? 2.831   2.000   -9.059  1.00 0.31  ? 28 VAL A HB   1  
ATOM 425   H HG11 . VAL A 1 28 ? 2.472   -0.537  -9.829  1.00 1.11  ? 28 VAL A HG11 1  
ATOM 426   H HG12 . VAL A 1 28 ? 3.667   -0.806  -8.561  1.00 1.30  ? 28 VAL A HG12 1  
ATOM 427   H HG13 . VAL A 1 28 ? 2.147   0.003   -8.182  1.00 1.11  ? 28 VAL A HG13 1  
ATOM 428   H HG21 . VAL A 1 28 ? 5.236   2.382   -8.581  1.00 1.22  ? 28 VAL A HG21 1  
ATOM 429   H HG22 . VAL A 1 28 ? 4.461   1.438   -7.310  1.00 1.37  ? 28 VAL A HG22 1  
ATOM 430   H HG23 . VAL A 1 28 ? 5.484   0.638   -8.503  1.00 1.24  ? 28 VAL A HG23 1  
ATOM 431   N N    . LYS A 1 29 ? 6.173   0.717   -11.591 1.00 0.35  ? 29 LYS A N    1  
ATOM 432   C CA   . LYS A 1 29 ? 7.313   -0.200  -11.912 1.00 0.42  ? 29 LYS A CA   1  
ATOM 433   C C    . LYS A 1 29 ? 8.550   0.214   -11.118 1.00 0.37  ? 29 LYS A C    1  
ATOM 434   O O    . LYS A 1 29 ? 8.583   1.251   -10.475 1.00 0.35  ? 29 LYS A O    1  
ATOM 435   C CB   . LYS A 1 29 ? 7.675   -0.145  -13.409 1.00 0.52  ? 29 LYS A CB   1  
ATOM 436   C CG   . LYS A 1 29 ? 6.415   -0.225  -14.276 1.00 1.08  ? 29 LYS A CG   1  
ATOM 437   C CD   . LYS A 1 29 ? 6.627   -1.114  -15.523 1.00 0.83  ? 29 LYS A CD   1  
ATOM 438   C CE   . LYS A 1 29 ? 7.789   -2.104  -15.342 1.00 0.76  ? 29 LYS A CE   1  
ATOM 439   N NZ   . LYS A 1 29 ? 7.881   -2.985  -16.543 1.00 1.23  ? 29 LYS A NZ   1  
ATOM 440   H H    . LYS A 1 29 ? 6.242   1.665   -11.800 1.00 0.35  ? 29 LYS A H    1  
ATOM 441   H HA   . LYS A 1 29 ? 7.045   -1.211  -11.646 1.00 0.52  ? 29 LYS A HA   1  
ATOM 442   H HB2  . LYS A 1 29 ? 8.194   0.776   -13.619 1.00 1.12  ? 29 LYS A HB2  1  
ATOM 443   H HB3  . LYS A 1 29 ? 8.324   -0.972  -13.640 1.00 0.82  ? 29 LYS A HB3  1  
ATOM 444   H HG2  . LYS A 1 29 ? 5.604   -0.624  -13.691 1.00 1.70  ? 29 LYS A HG2  1  
ATOM 445   H HG3  . LYS A 1 29 ? 6.153   0.771   -14.600 1.00 2.02  ? 29 LYS A HG3  1  
ATOM 446   H HD2  . LYS A 1 29 ? 5.723   -1.671  -15.710 1.00 1.42  ? 29 LYS A HD2  1  
ATOM 447   H HD3  . LYS A 1 29 ? 6.833   -0.482  -16.371 1.00 1.54  ? 29 LYS A HD3  1  
ATOM 448   H HE2  . LYS A 1 29 ? 8.714   -1.558  -15.229 1.00 1.30  ? 29 LYS A HE2  1  
ATOM 449   H HE3  . LYS A 1 29 ? 7.619   -2.709  -14.464 1.00 1.09  ? 29 LYS A HE3  1  
ATOM 450   H HZ1  . LYS A 1 29 ? 7.910   -2.399  -17.401 1.00 1.71  ? 29 LYS A HZ1  1  
ATOM 451   H HZ2  . LYS A 1 29 ? 8.744   -3.560  -16.488 1.00 1.61  ? 29 LYS A HZ2  1  
ATOM 452   H HZ3  . LYS A 1 29 ? 7.049   -3.610  -16.577 1.00 1.74  ? 29 LYS A HZ3  1  
ATOM 453   N N    . SER A 1 30 ? 9.572   -0.597  -11.183 1.00 0.38  ? 30 SER A N    1  
ATOM 454   C CA   . SER A 1 30 ? 10.840  -0.300  -10.466 1.00 0.39  ? 30 SER A CA   1  
ATOM 455   C C    . SER A 1 30 ? 11.932  0.043   -11.502 1.00 0.34  ? 30 SER A C    1  
ATOM 456   O O    . SER A 1 30 ? 11.678  0.004   -12.693 1.00 0.35  ? 30 SER A O    1  
ATOM 457   C CB   . SER A 1 30 ? 11.236  -1.543  -9.661  1.00 0.52  ? 30 SER A CB   1  
ATOM 458   O OG   . SER A 1 30 ? 11.242  -1.224  -8.275  1.00 1.63  ? 30 SER A OG   1  
ATOM 459   H H    . SER A 1 30 ? 9.505   -1.414  -11.722 1.00 0.43  ? 30 SER A H    1  
ATOM 460   H HA   . SER A 1 30 ? 10.696  0.538   -9.798  1.00 0.41  ? 30 SER A HA   1  
ATOM 461   H HB2  . SER A 1 30 ? 10.519  -2.330  -9.839  1.00 0.91  ? 30 SER A HB2  1  
ATOM 462   H HB3  . SER A 1 30 ? 12.216  -1.879  -9.970  1.00 0.92  ? 30 SER A HB3  1  
ATOM 463   H HG   . SER A 1 30 ? 10.391  -1.475  -7.910  1.00 2.01  ? 30 SER A HG   1  
ATOM 464   N N    . PRO A 1 31 ? 13.116  0.364   -11.024 1.00 0.39  ? 31 PRO A N    1  
ATOM 465   C CA   . PRO A 1 31 ? 14.259  0.715   -11.899 1.00 0.44  ? 31 PRO A CA   1  
ATOM 466   C C    . PRO A 1 31 ? 14.839  -0.547  -12.558 1.00 0.52  ? 31 PRO A C    1  
ATOM 467   O O    . PRO A 1 31 ? 14.370  -1.646  -12.324 1.00 0.58  ? 31 PRO A O    1  
ATOM 468   C CB   . PRO A 1 31 ? 15.262  1.361   -10.938 1.00 0.52  ? 31 PRO A CB   1  
ATOM 469   C CG   . PRO A 1 31 ? 14.899  0.860   -9.522  1.00 0.56  ? 31 PRO A CG   1  
ATOM 470   C CD   . PRO A 1 31 ? 13.430  0.406   -9.578  1.00 0.49  ? 31 PRO A CD   1  
ATOM 471   H HA   . PRO A 1 31 ? 13.957  1.428   -12.650 1.00 0.44  ? 31 PRO A HA   1  
ATOM 472   H HB2  . PRO A 1 31 ? 16.268  1.060   -11.195 1.00 0.59  ? 31 PRO A HB2  1  
ATOM 473   H HB3  . PRO A 1 31 ? 15.173  2.435   -10.975 1.00 0.56  ? 31 PRO A HB3  1  
ATOM 474   H HG2  . PRO A 1 31 ? 15.535  0.028   -9.248  1.00 0.63  ? 31 PRO A HG2  1  
ATOM 475   H HG3  . PRO A 1 31 ? 15.005  1.659   -8.806  1.00 0.64  ? 31 PRO A HG3  1  
ATOM 476   H HD2  . PRO A 1 31 ? 13.324  -0.575  -9.136  1.00 0.54  ? 31 PRO A HD2  1  
ATOM 477   H HD3  . PRO A 1 31 ? 12.793  1.120   -9.078  1.00 0.52  ? 31 PRO A HD3  1  
ATOM 478   N N    . GLY A 1 32 ? 15.852  -0.402  -13.385 1.00 0.60  ? 32 GLY A N    1  
ATOM 479   C CA   . GLY A 1 32 ? 16.438  -1.608  -14.052 1.00 0.73  ? 32 GLY A CA   1  
ATOM 480   C C    . GLY A 1 32 ? 17.421  -1.186  -15.150 1.00 0.91  ? 32 GLY A C    1  
ATOM 481   O O    . GLY A 1 32 ? 18.619  -1.213  -14.940 1.00 1.05  ? 32 GLY A O    1  
ATOM 482   H H    . GLY A 1 32 ? 16.222  0.494   -13.568 1.00 0.61  ? 32 GLY A H    1  
ATOM 483   H HA2  . GLY A 1 32 ? 16.959  -2.204  -13.316 1.00 0.73  ? 32 GLY A HA2  1  
ATOM 484   H HA3  . GLY A 1 32 ? 15.646  -2.196  -14.490 1.00 0.79  ? 32 GLY A HA3  1  
ATOM 485   N N    . PRO A 1 33 ? 16.887  -0.814  -16.297 1.00 1.04  ? 33 PRO A N    1  
ATOM 486   C CA   . PRO A 1 33 ? 17.706  -0.388  -17.451 1.00 1.28  ? 33 PRO A CA   1  
ATOM 487   C C    . PRO A 1 33 ? 18.289  1.016   -17.219 1.00 1.12  ? 33 PRO A C    1  
ATOM 488   O O    . PRO A 1 33 ? 18.395  1.470   -16.094 1.00 1.13  ? 33 PRO A O    1  
ATOM 489   C CB   . PRO A 1 33 ? 16.715  -0.409  -18.623 1.00 1.58  ? 33 PRO A CB   1  
ATOM 490   C CG   . PRO A 1 33 ? 15.303  -0.301  -18.005 1.00 1.49  ? 33 PRO A CG   1  
ATOM 491   C CD   . PRO A 1 33 ? 15.426  -0.777  -16.547 1.00 1.14  ? 33 PRO A CD   1  
ATOM 492   H HA   . PRO A 1 33 ? 18.498  -1.097  -17.631 1.00 1.47  ? 33 PRO A HA   1  
ATOM 493   H HB2  . PRO A 1 33 ? 16.899  0.429   -19.282 1.00 1.67  ? 33 PRO A HB2  1  
ATOM 494   H HB3  . PRO A 1 33 ? 16.804  -1.336  -19.168 1.00 1.82  ? 33 PRO A HB3  1  
ATOM 495   H HG2  . PRO A 1 33 ? 14.963  0.725   -18.036 1.00 1.50  ? 33 PRO A HG2  1  
ATOM 496   H HG3  . PRO A 1 33 ? 14.615  -0.938  -18.539 1.00 1.73  ? 33 PRO A HG3  1  
ATOM 497   H HD2  . PRO A 1 33 ? 14.939  -0.076  -15.886 1.00 1.03  ? 33 PRO A HD2  1  
ATOM 498   H HD3  . PRO A 1 33 ? 15.004  -1.763  -16.434 1.00 1.20  ? 33 PRO A HD3  1  
ATOM 499   N N    . HIS A 1 34 ? 18.688  1.697   -18.269 1.00 1.15  ? 34 HIS A N    1  
ATOM 500   C CA   . HIS A 1 34 ? 19.284  3.065   -18.102 1.00 1.18  ? 34 HIS A CA   1  
ATOM 501   C C    . HIS A 1 34 ? 18.273  4.041   -17.484 1.00 1.17  ? 34 HIS A C    1  
ATOM 502   O O    . HIS A 1 34 ? 18.670  5.025   -16.887 1.00 1.26  ? 34 HIS A O    1  
ATOM 503   C CB   . HIS A 1 34 ? 19.795  3.613   -19.449 1.00 1.36  ? 34 HIS A CB   1  
ATOM 504   C CG   . HIS A 1 34 ? 18.847  3.275   -20.576 1.00 1.55  ? 34 HIS A CG   1  
ATOM 505   N ND1  . HIS A 1 34 ? 19.301  2.817   -21.803 1.00 2.08  ? 34 HIS A ND1  1  
ATOM 506   C CD2  . HIS A 1 34 ? 17.479  3.341   -20.686 1.00 2.02  ? 34 HIS A CD2  1  
ATOM 507   C CE1  . HIS A 1 34 ? 18.226  2.630   -22.589 1.00 2.65  ? 34 HIS A CE1  1  
ATOM 508   N NE2  . HIS A 1 34 ? 17.089  2.934   -21.957 1.00 2.66  ? 34 HIS A NE2  1  
ATOM 509   H H    . HIS A 1 34 ? 18.609  1.302   -19.163 1.00 1.28  ? 34 HIS A H    1  
ATOM 510   H HA   . HIS A 1 34 ? 20.119  2.985   -17.416 1.00 1.15  ? 34 HIS A HA   1  
ATOM 511   H HB2  . HIS A 1 34 ? 19.893  4.685   -19.379 1.00 1.71  ? 34 HIS A HB2  1  
ATOM 512   H HB3  . HIS A 1 34 ? 20.764  3.183   -19.659 1.00 1.68  ? 34 HIS A HB3  1  
ATOM 513   H HD1  . HIS A 1 34 ? 20.235  2.660   -22.052 1.00 2.32  ? 34 HIS A HD1  1  
ATOM 514   H HD2  . HIS A 1 34 ? 16.808  3.662   -19.905 1.00 2.22  ? 34 HIS A HD2  1  
ATOM 515   H HE1  . HIS A 1 34 ? 18.275  2.276   -23.609 1.00 3.26  ? 34 HIS A HE1  1  
ATOM 516   N N    . CYS A 1 35 ? 16.984  3.772   -17.563 1.00 1.17  ? 35 CYS A N    1  
ATOM 517   C CA   . CYS A 1 35 ? 16.009  4.691   -16.900 1.00 1.21  ? 35 CYS A CA   1  
ATOM 518   C C    . CYS A 1 35 ? 16.335  4.630   -15.403 1.00 1.02  ? 35 CYS A C    1  
ATOM 519   O O    . CYS A 1 35 ? 16.370  5.636   -14.720 1.00 1.08  ? 35 CYS A O    1  
ATOM 520   C CB   . CYS A 1 35 ? 14.568  4.226   -17.172 1.00 1.45  ? 35 CYS A CB   1  
ATOM 521   S SG   . CYS A 1 35 ? 13.390  5.525   -16.696 1.00 1.19  ? 35 CYS A SG   1  
ATOM 522   H H    . CYS A 1 35 ? 16.671  2.955   -18.003 1.00 1.22  ? 35 CYS A H    1  
ATOM 523   H HA   . CYS A 1 35 ? 16.152  5.699   -17.264 1.00 1.30  ? 35 CYS A HA   1  
ATOM 524   H HB2  . CYS A 1 35 ? 14.456  4.012   -18.225 1.00 2.02  ? 35 CYS A HB2  1  
ATOM 525   H HB3  . CYS A 1 35 ? 14.367  3.332   -16.601 1.00 2.07  ? 35 CYS A HB3  1  
ATOM 526   N N    . ALA A 1 36 ? 16.652  3.435   -14.929 1.00 0.94  ? 36 ALA A N    1  
ATOM 527   C CA   . ALA A 1 36 ? 17.075  3.211   -13.513 1.00 0.89  ? 36 ALA A CA   1  
ATOM 528   C C    . ALA A 1 36 ? 16.288  4.082   -12.531 1.00 0.85  ? 36 ALA A C    1  
ATOM 529   O O    . ALA A 1 36 ? 16.829  4.656   -11.602 1.00 1.18  ? 36 ALA A O    1  
ATOM 530   C CB   . ALA A 1 36 ? 18.560  3.515   -13.425 1.00 1.08  ? 36 ALA A CB   1  
ATOM 531   H H    . ALA A 1 36 ? 16.659  2.671   -15.542 1.00 1.02  ? 36 ALA A H    1  
ATOM 532   H HA   . ALA A 1 36 ? 16.919  2.175   -13.259 1.00 0.94  ? 36 ALA A HA   1  
ATOM 533   H HB1  . ALA A 1 36 ? 18.742  4.502   -13.821 1.00 1.40  ? 36 ALA A HB1  1  
ATOM 534   H HB2  . ALA A 1 36 ? 18.876  3.467   -12.399 1.00 1.48  ? 36 ALA A HB2  1  
ATOM 535   H HB3  . ALA A 1 36 ? 19.102  2.785   -14.010 1.00 1.69  ? 36 ALA A HB3  1  
ATOM 536   N N    . GLN A 1 37 ? 15.011  4.158   -12.734 1.00 0.93  ? 37 GLN A N    1  
ATOM 537   C CA   . GLN A 1 37 ? 14.131  4.958   -11.836 1.00 0.89  ? 37 GLN A CA   1  
ATOM 538   C C    . GLN A 1 37 ? 12.827  4.197   -11.633 1.00 0.71  ? 37 GLN A C    1  
ATOM 539   O O    . GLN A 1 37 ? 12.527  3.255   -12.345 1.00 0.74  ? 37 GLN A O    1  
ATOM 540   C CB   . GLN A 1 37 ? 13.850  6.321   -12.483 1.00 0.99  ? 37 GLN A CB   1  
ATOM 541   C CG   . GLN A 1 37 ? 12.968  7.203   -11.587 1.00 1.66  ? 37 GLN A CG   1  
ATOM 542   C CD   . GLN A 1 37 ? 13.707  7.549   -10.288 1.00 2.34  ? 37 GLN A CD   1  
ATOM 543   O OE1  . GLN A 1 37 ? 14.920  7.638   -10.266 1.00 2.82  ? 37 GLN A OE1  1  
ATOM 544   N NE2  . GLN A 1 37 ? 13.021  7.753   -9.196  1.00 3.07  ? 37 GLN A NE2  1  
ATOM 545   H H    . GLN A 1 37 ? 14.625  3.670   -13.484 1.00 1.27  ? 37 GLN A H    1  
ATOM 546   H HA   . GLN A 1 37 ? 14.619  5.102   -10.881 1.00 0.95  ? 37 GLN A HA   1  
ATOM 547   H HB2  . GLN A 1 37 ? 14.780  6.820   -12.643 1.00 1.38  ? 37 GLN A HB2  1  
ATOM 548   H HB3  . GLN A 1 37 ? 13.354  6.169   -13.429 1.00 1.44  ? 37 GLN A HB3  1  
ATOM 549   H HG2  . GLN A 1 37 ? 12.732  8.116   -12.115 1.00 2.22  ? 37 GLN A HG2  1  
ATOM 550   H HG3  . GLN A 1 37 ? 12.053  6.683   -11.355 1.00 2.02  ? 37 GLN A HG3  1  
ATOM 551   H HE21 . GLN A 1 37 ? 12.043  7.686   -9.210  1.00 3.26  ? 37 GLN A HE21 1  
ATOM 552   H HE22 . GLN A 1 37 ? 13.484  7.973   -8.361  1.00 3.72  ? 37 GLN A HE22 1  
ATOM 553   N N    . THR A 1 38 ? 12.052  4.598   -10.670 1.00 0.60  ? 38 THR A N    1  
ATOM 554   C CA   . THR A 1 38 ? 10.758  3.907   -10.410 1.00 0.44  ? 38 THR A CA   1  
ATOM 555   C C    . THR A 1 38 ? 9.780   4.188   -11.552 1.00 0.35  ? 38 THR A C    1  
ATOM 556   O O    . THR A 1 38 ? 10.151  4.641   -12.619 1.00 0.42  ? 38 THR A O    1  
ATOM 557   C CB   . THR A 1 38 ? 10.138  4.393   -9.087  1.00 0.44  ? 38 THR A CB   1  
ATOM 558   O OG1  . THR A 1 38 ? 11.051  5.237   -8.391  1.00 0.60  ? 38 THR A OG1  1  
ATOM 559   C CG2  . THR A 1 38 ? 9.819   3.173   -8.238  1.00 0.44  ? 38 THR A CG2  1  
ATOM 560   H H    . THR A 1 38 ? 12.324  5.359   -10.119 1.00 0.68  ? 38 THR A H    1  
ATOM 561   H HA   . THR A 1 38 ? 10.933  2.843   -10.349 1.00 0.44  ? 38 THR A HA   1  
ATOM 562   H HB   . THR A 1 38 ? 9.213   4.935   -9.284  1.00 0.40  ? 38 THR A HB   1  
ATOM 563   H HG1  . THR A 1 38 ? 10.666  6.116   -8.346  1.00 0.96  ? 38 THR A HG1  1  
ATOM 564   H HG21 . THR A 1 38 ? 10.604  2.441   -8.354  1.00 1.11  ? 38 THR A HG21 1  
ATOM 565   H HG22 . THR A 1 38 ? 9.742   3.465   -7.205  1.00 1.13  ? 38 THR A HG22 1  
ATOM 566   H HG23 . THR A 1 38 ? 8.881   2.749   -8.565  1.00 1.10  ? 38 THR A HG23 1  
ATOM 567   N N    . GLU A 1 39 ? 8.524   3.949   -11.312 1.00 0.25  ? 39 GLU A N    1  
ATOM 568   C CA   . GLU A 1 39 ? 7.493   4.217   -12.329 1.00 0.25  ? 39 GLU A CA   1  
ATOM 569   C C    . GLU A 1 39 ? 6.208   4.390   -11.584 1.00 0.21  ? 39 GLU A C    1  
ATOM 570   O O    . GLU A 1 39 ? 5.905   3.639   -10.676 1.00 0.35  ? 39 GLU A O    1  
ATOM 571   C CB   . GLU A 1 39 ? 7.311   3.057   -13.290 1.00 0.33  ? 39 GLU A CB   1  
ATOM 572   C CG   . GLU A 1 39 ? 7.654   3.489   -14.717 1.00 0.60  ? 39 GLU A CG   1  
ATOM 573   C CD   . GLU A 1 39 ? 6.495   4.301   -15.307 1.00 0.80  ? 39 GLU A CD   1  
ATOM 574   O OE1  . GLU A 1 39 ? 5.452   3.717   -15.559 1.00 1.40  ? 39 GLU A OE1  1  
ATOM 575   O OE2  . GLU A 1 39 ? 6.672   5.491   -15.500 1.00 1.47  ? 39 GLU A OE2  1  
ATOM 576   H H    . GLU A 1 39 ? 8.246   3.620   -10.430 1.00 0.25  ? 39 GLU A H    1  
ATOM 577   H HA   . GLU A 1 39 ? 7.737   5.117   -12.864 1.00 0.31  ? 39 GLU A HA   1  
ATOM 578   H HB2  . GLU A 1 39 ? 7.947   2.240   -12.991 1.00 0.30  ? 39 GLU A HB2  1  
ATOM 579   H HB3  . GLU A 1 39 ? 6.268   2.749   -13.246 1.00 0.41  ? 39 GLU A HB3  1  
ATOM 580   H HG2  . GLU A 1 39 ? 8.548   4.094   -14.705 1.00 0.88  ? 39 GLU A HG2  1  
ATOM 581   H HG3  . GLU A 1 39 ? 7.823   2.612   -15.326 1.00 0.85  ? 39 GLU A HG3  1  
ATOM 582   N N    . VAL A 1 40 ? 5.477   5.382   -11.913 1.00 0.15  ? 40 VAL A N    1  
ATOM 583   C CA   . VAL A 1 40 ? 4.244   5.629   -11.184 1.00 0.19  ? 40 VAL A CA   1  
ATOM 584   C C    . VAL A 1 40 ? 3.304   6.379   -12.122 1.00 0.19  ? 40 VAL A C    1  
ATOM 585   O O    . VAL A 1 40 ? 3.085   7.566   -11.986 1.00 0.21  ? 40 VAL A O    1  
ATOM 586   C CB   . VAL A 1 40 ? 4.639   6.461   -9.955  1.00 0.23  ? 40 VAL A CB   1  
ATOM 587   C CG1  . VAL A 1 40 ? 4.951   5.506   -8.809  1.00 0.28  ? 40 VAL A CG1  1  
ATOM 588   C CG2  . VAL A 1 40 ? 5.928   7.247   -10.251 1.00 0.24  ? 40 VAL A CG2  1  
ATOM 589   H H    . VAL A 1 40 ? 5.758   5.995   -12.608 1.00 0.22  ? 40 VAL A H    1  
ATOM 590   H HA   . VAL A 1 40 ? 3.818   4.676   -10.887 1.00 0.23  ? 40 VAL A HA   1  
ATOM 591   H HB   . VAL A 1 40 ? 3.847   7.145   -9.690  1.00 0.29  ? 40 VAL A HB   1  
ATOM 592   H HG11 . VAL A 1 40 ? 4.537   4.534   -9.030  1.00 1.04  ? 40 VAL A HG11 1  
ATOM 593   H HG12 . VAL A 1 40 ? 6.028   5.419   -8.707  1.00 1.00  ? 40 VAL A HG12 1  
ATOM 594   H HG13 . VAL A 1 40 ? 4.531   5.884   -7.896  1.00 1.08  ? 40 VAL A HG13 1  
ATOM 595   H HG21 . VAL A 1 40 ? 5.803   7.821   -11.154 1.00 1.01  ? 40 VAL A HG21 1  
ATOM 596   H HG22 . VAL A 1 40 ? 6.150   7.903   -9.428  1.00 1.04  ? 40 VAL A HG22 1  
ATOM 597   H HG23 . VAL A 1 40 ? 6.748   6.548   -10.381 1.00 1.03  ? 40 VAL A HG23 1  
ATOM 598   N N    . ILE A 1 41 ? 2.811   5.694   -13.126 1.00 0.23  ? 41 ILE A N    1  
ATOM 599   C CA   . ILE A 1 41 ? 1.964   6.353   -14.146 1.00 0.25  ? 41 ILE A CA   1  
ATOM 600   C C    . ILE A 1 41 ? 0.468   6.136   -13.899 1.00 0.23  ? 41 ILE A C    1  
ATOM 601   O O    . ILE A 1 41 ? -0.021  5.036   -13.966 1.00 0.25  ? 41 ILE A O    1  
ATOM 602   C CB   . ILE A 1 41 ? 2.360   5.778   -15.506 1.00 0.30  ? 41 ILE A CB   1  
ATOM 603   C CG1  . ILE A 1 41 ? 3.522   6.620   -16.054 1.00 0.50  ? 41 ILE A CG1  1  
ATOM 604   C CG2  . ILE A 1 41 ? 1.171   5.817   -16.467 1.00 0.67  ? 41 ILE A CG2  1  
ATOM 605   C CD1  . ILE A 1 41 ? 3.596   6.519   -17.577 1.00 0.54  ? 41 ILE A CD1  1  
ATOM 606   H H    . ILE A 1 41 ? 3.052   4.749   -13.239 1.00 0.27  ? 41 ILE A H    1  
ATOM 607   H HA   . ILE A 1 41 ? 2.178   7.401   -14.143 1.00 0.26  ? 41 ILE A HA   1  
ATOM 608   H HB   . ILE A 1 41 ? 2.681   4.749   -15.373 1.00 0.48  ? 41 ILE A HB   1  
ATOM 609   H HG12 . ILE A 1 41 ? 3.374   7.653   -15.774 1.00 0.70  ? 41 ILE A HG12 1  
ATOM 610   H HG13 . ILE A 1 41 ? 4.445   6.268   -15.626 1.00 0.69  ? 41 ILE A HG13 1  
ATOM 611   H HG21 . ILE A 1 41 ? 0.761   6.814   -16.488 1.00 1.20  ? 41 ILE A HG21 1  
ATOM 612   H HG22 . ILE A 1 41 ? 1.499   5.536   -17.455 1.00 1.18  ? 41 ILE A HG22 1  
ATOM 613   H HG23 . ILE A 1 41 ? 0.416   5.122   -16.129 1.00 1.38  ? 41 ILE A HG23 1  
ATOM 614   H HD11 . ILE A 1 41 ? 2.657   6.836   -18.005 1.00 1.22  ? 41 ILE A HD11 1  
ATOM 615   H HD12 . ILE A 1 41 ? 4.388   7.157   -17.938 1.00 1.02  ? 41 ILE A HD12 1  
ATOM 616   H HD13 . ILE A 1 41 ? 3.796   5.497   -17.862 1.00 1.14  ? 41 ILE A HD13 1  
ATOM 617   N N    . ALA A 1 42 ? -0.268  7.196   -13.678 1.00 0.22  ? 42 ALA A N    1  
ATOM 618   C CA   . ALA A 1 42 ? -1.739  7.065   -13.488 1.00 0.22  ? 42 ALA A CA   1  
ATOM 619   C C    . ALA A 1 42 ? -2.410  7.187   -14.849 1.00 0.24  ? 42 ALA A C    1  
ATOM 620   O O    . ALA A 1 42 ? -2.380  8.236   -15.467 1.00 0.25  ? 42 ALA A O    1  
ATOM 621   C CB   . ALA A 1 42 ? -2.225  8.170   -12.566 1.00 0.21  ? 42 ALA A CB   1  
ATOM 622   H H    . ALA A 1 42 ? 0.143   8.092   -13.676 1.00 0.23  ? 42 ALA A H    1  
ATOM 623   H HA   . ALA A 1 42 ? -1.975  6.112   -13.061 1.00 0.23  ? 42 ALA A HA   1  
ATOM 624   H HB1  . ALA A 1 42 ? -1.572  8.227   -11.708 1.00 1.00  ? 42 ALA A HB1  1  
ATOM 625   H HB2  . ALA A 1 42 ? -2.210  9.109   -13.097 1.00 1.00  ? 42 ALA A HB2  1  
ATOM 626   H HB3  . ALA A 1 42 ? -3.229  7.950   -12.244 1.00 0.95  ? 42 ALA A HB3  1  
ATOM 627   N N    . THR A 1 43 ? -3.006  6.123   -15.337 1.00 0.28  ? 43 THR A N    1  
ATOM 628   C CA   . THR A 1 43 ? -3.654  6.205   -16.670 1.00 0.32  ? 43 THR A CA   1  
ATOM 629   C C    . THR A 1 43 ? -4.932  7.021   -16.557 1.00 0.32  ? 43 THR A C    1  
ATOM 630   O O    . THR A 1 43 ? -5.804  6.742   -15.754 1.00 0.34  ? 43 THR A O    1  
ATOM 631   C CB   . THR A 1 43 ? -3.994  4.816   -17.223 1.00 0.35  ? 43 THR A CB   1  
ATOM 632   O OG1  . THR A 1 43 ? -2.990  3.885   -16.843 1.00 0.39  ? 43 THR A OG1  1  
ATOM 633   C CG2  . THR A 1 43 ? -4.077  4.892   -18.748 1.00 0.39  ? 43 THR A CG2  1  
ATOM 634   H H    . THR A 1 43 ? -3.019  5.284   -14.832 1.00 0.28  ? 43 THR A H    1  
ATOM 635   H HA   . THR A 1 43 ? -2.972  6.706   -17.346 1.00 0.32  ? 43 THR A HA   1  
ATOM 636   H HB   . THR A 1 43 ? -4.952  4.503   -16.842 1.00 0.35  ? 43 THR A HB   1  
ATOM 637   H HG1  . THR A 1 43 ? -3.303  3.004   -17.058 1.00 0.89  ? 43 THR A HG1  1  
ATOM 638   H HG21 . THR A 1 43 ? -4.805  5.639   -19.030 1.00 1.07  ? 43 THR A HG21 1  
ATOM 639   H HG22 . THR A 1 43 ? -3.112  5.162   -19.146 1.00 1.05  ? 43 THR A HG22 1  
ATOM 640   H HG23 . THR A 1 43 ? -4.376  3.932   -19.140 1.00 1.07  ? 43 THR A HG23 1  
ATOM 641   N N    . LEU A 1 44 ? -5.025  8.039   -17.353 1.00 0.32  ? 44 LEU A N    1  
ATOM 642   C CA   . LEU A 1 44 ? -6.204  8.924   -17.330 1.00 0.32  ? 44 LEU A CA   1  
ATOM 643   C C    . LEU A 1 44 ? -7.420  8.236   -17.961 1.00 0.37  ? 44 LEU A C    1  
ATOM 644   O O    . LEU A 1 44 ? -7.279  7.324   -18.759 1.00 0.40  ? 44 LEU A O    1  
ATOM 645   C CB   . LEU A 1 44 ? -5.854  10.154  -18.144 1.00 0.34  ? 44 LEU A CB   1  
ATOM 646   C CG   . LEU A 1 44 ? -5.361  11.265  -17.232 1.00 0.32  ? 44 LEU A CG   1  
ATOM 647   C CD1  . LEU A 1 44 ? -6.573  12.092  -16.826 1.00 0.35  ? 44 LEU A CD1  1  
ATOM 648   C CD2  . LEU A 1 44 ? -4.648  10.679  -15.985 1.00 0.28  ? 44 LEU A CD2  1  
ATOM 649   H H    . LEU A 1 44 ? -4.292  8.240   -17.969 1.00 0.33  ? 44 LEU A H    1  
ATOM 650   H HA   . LEU A 1 44 ? -6.415  9.209   -16.306 1.00 0.30  ? 44 LEU A HA   1  
ATOM 651   H HB2  . LEU A 1 44 ? -5.081  9.903   -18.848 1.00 0.37  ? 44 LEU A HB2  1  
ATOM 652   H HB3  . LEU A 1 44 ? -6.732  10.490  -18.676 1.00 0.37  ? 44 LEU A HB3  1  
ATOM 653   H HG   . LEU A 1 44 ? -4.671  11.883  -17.782 1.00 0.34  ? 44 LEU A HG   1  
ATOM 654   H HD11 . LEU A 1 44 ? -7.375  11.426  -16.535 1.00 1.03  ? 44 LEU A HD11 1  
ATOM 655   H HD12 . LEU A 1 44 ? -6.319  12.734  -16.003 1.00 1.05  ? 44 LEU A HD12 1  
ATOM 656   H HD13 . LEU A 1 44 ? -6.897  12.688  -17.670 1.00 1.07  ? 44 LEU A HD13 1  
ATOM 657   H HD21 . LEU A 1 44 ? -3.908  9.953   -16.298 1.00 1.04  ? 44 LEU A HD21 1  
ATOM 658   H HD22 . LEU A 1 44 ? -4.159  11.471  -15.439 1.00 1.08  ? 44 LEU A HD22 1  
ATOM 659   H HD23 . LEU A 1 44 ? -5.371  10.196  -15.343 1.00 1.03  ? 44 LEU A HD23 1  
ATOM 660   N N    . LYS A 1 45 ? -8.608  8.706   -17.626 1.00 0.38  ? 45 LYS A N    1  
ATOM 661   C CA   . LYS A 1 45 ? -9.872  8.146   -18.173 1.00 0.44  ? 45 LYS A CA   1  
ATOM 662   C C    . LYS A 1 45 ? -9.871  8.191   -19.690 1.00 0.49  ? 45 LYS A C    1  
ATOM 663   O O    . LYS A 1 45 ? -10.314 7.264   -20.344 1.00 0.54  ? 45 LYS A O    1  
ATOM 664   C CB   . LYS A 1 45 ? -11.020 8.999   -17.658 1.00 0.45  ? 45 LYS A CB   1  
ATOM 665   C CG   . LYS A 1 45 ? -12.043 8.124   -16.926 1.00 0.47  ? 45 LYS A CG   1  
ATOM 666   C CD   . LYS A 1 45 ? -13.457 8.584   -17.281 1.00 0.72  ? 45 LYS A CD   1  
ATOM 667   C CE   . LYS A 1 45 ? -14.453 7.981   -16.287 1.00 1.05  ? 45 LYS A CE   1  
ATOM 668   N NZ   . LYS A 1 45 ? -15.721 8.766   -16.309 1.00 1.42  ? 45 LYS A NZ   1  
ATOM 669   H H    . LYS A 1 45 ? -8.671  9.464   -17.017 1.00 0.37  ? 45 LYS A H    1  
ATOM 670   H HA   . LYS A 1 45 ? -10.000 7.133   -17.839 1.00 0.44  ? 45 LYS A HA   1  
ATOM 671   H HB2  . LYS A 1 45 ? -10.632 9.739   -16.975 1.00 0.42  ? 45 LYS A HB2  1  
ATOM 672   H HB3  . LYS A 1 45 ? -11.474 9.496   -18.480 1.00 0.49  ? 45 LYS A HB3  1  
ATOM 673   H HG2  . LYS A 1 45 ? -11.914 7.093   -17.225 1.00 0.52  ? 45 LYS A HG2  1  
ATOM 674   H HG3  . LYS A 1 45 ? -11.895 8.212   -15.860 1.00 0.54  ? 45 LYS A HG3  1  
ATOM 675   H HD2  . LYS A 1 45 ? -13.505 9.663   -17.233 1.00 0.99  ? 45 LYS A HD2  1  
ATOM 676   H HD3  . LYS A 1 45 ? -13.701 8.255   -18.278 1.00 0.94  ? 45 LYS A HD3  1  
ATOM 677   H HE2  . LYS A 1 45 ? -14.659 6.957   -16.561 1.00 1.46  ? 45 LYS A HE2  1  
ATOM 678   H HE3  . LYS A 1 45 ? -14.031 8.008   -15.293 1.00 1.42  ? 45 LYS A HE3  1  
ATOM 679   H HZ1  . LYS A 1 45 ? -16.041 8.886   -17.290 1.00 1.80  ? 45 LYS A HZ1  1  
ATOM 680   H HZ2  . LYS A 1 45 ? -16.450 8.259   -15.767 1.00 1.84  ? 45 LYS A HZ2  1  
ATOM 681   H HZ3  . LYS A 1 45 ? -15.559 9.701   -15.883 1.00 1.86  ? 45 LYS A HZ3  1  
ATOM 682   N N    . ASN A 1 46 ? -9.371  9.255   -20.259 1.00 0.49  ? 46 ASN A N    1  
ATOM 683   C CA   . ASN A 1 46 ? -9.335  9.347   -21.747 1.00 0.55  ? 46 ASN A CA   1  
ATOM 684   C C    . ASN A 1 46 ? -8.295  8.353   -22.314 1.00 0.57  ? 46 ASN A C    1  
ATOM 685   O O    . ASN A 1 46 ? -8.089  8.279   -23.512 1.00 0.75  ? 46 ASN A O    1  
ATOM 686   C CB   . ASN A 1 46 ? -8.982  10.782  -22.154 1.00 0.58  ? 46 ASN A CB   1  
ATOM 687   C CG   . ASN A 1 46 ? -7.540  11.106  -21.756 1.00 0.78  ? 46 ASN A CG   1  
ATOM 688   O OD1  . ASN A 1 46 ? -6.614  10.724  -22.440 1.00 1.66  ? 46 ASN A OD1  1  
ATOM 689   N ND2  . ASN A 1 46 ? -7.311  11.804  -20.676 1.00 0.81  ? 46 ASN A ND2  1  
ATOM 690   H H    . ASN A 1 46 ? -9.012  9.993   -19.705 1.00 0.47  ? 46 ASN A H    1  
ATOM 691   H HA   . ASN A 1 46 ? -10.310 9.097   -22.140 1.00 0.62  ? 46 ASN A HA   1  
ATOM 692   H HB2  . ASN A 1 46 ? -9.091  10.884  -23.218 1.00 0.73  ? 46 ASN A HB2  1  
ATOM 693   H HB3  . ASN A 1 46 ? -9.651  11.470  -21.658 1.00 0.74  ? 46 ASN A HB3  1  
ATOM 694   H HD21 . ASN A 1 46 ? -8.060  12.115  -20.124 1.00 1.39  ? 46 ASN A HD21 1  
ATOM 695   H HD22 . ASN A 1 46 ? -6.391  12.017  -20.417 1.00 0.88  ? 46 ASN A HD22 1  
ATOM 696   N N    . GLY A 1 47 ? -7.637  7.596   -21.458 1.00 0.50  ? 47 GLY A N    1  
ATOM 697   C CA   . GLY A 1 47 ? -6.612  6.619   -21.920 1.00 0.53  ? 47 GLY A CA   1  
ATOM 698   C C    . GLY A 1 47 ? -5.266  7.332   -22.008 1.00 0.51  ? 47 GLY A C    1  
ATOM 699   O O    . GLY A 1 47 ? -4.458  7.051   -22.872 1.00 0.60  ? 47 GLY A O    1  
ATOM 700   H H    . GLY A 1 47 ? -7.810  7.679   -20.502 1.00 0.52  ? 47 GLY A H    1  
ATOM 701   H HA2  . GLY A 1 47 ? -6.542  5.808   -21.203 1.00 0.52  ? 47 GLY A HA2  1  
ATOM 702   H HA3  . GLY A 1 47 ? -6.879  6.229   -22.885 1.00 0.59  ? 47 GLY A HA3  1  
ATOM 703   N N    . ARG A 1 48 ? -5.022  8.240   -21.097 1.00 0.47  ? 48 ARG A N    1  
ATOM 704   C CA   . ARG A 1 48 ? -3.721  8.974   -21.089 1.00 0.54  ? 48 ARG A CA   1  
ATOM 705   C C    . ARG A 1 48 ? -2.922  8.480   -19.894 1.00 0.42  ? 48 ARG A C    1  
ATOM 706   O O    . ARG A 1 48 ? -3.287  7.509   -19.269 1.00 0.37  ? 48 ARG A O    1  
ATOM 707   C CB   . ARG A 1 48 ? -3.970  10.481  -20.952 1.00 0.66  ? 48 ARG A CB   1  
ATOM 708   C CG   . ARG A 1 48 ? -3.780  11.160  -22.309 1.00 1.00  ? 48 ARG A CG   1  
ATOM 709   C CD   . ARG A 1 48 ? -4.203  12.629  -22.209 1.00 1.55  ? 48 ARG A CD   1  
ATOM 710   N NE   . ARG A 1 48 ? -3.789  13.359  -23.445 1.00 2.08  ? 48 ARG A NE   1  
ATOM 711   C CZ   . ARG A 1 48 ? -3.987  14.648  -23.544 1.00 2.34  ? 48 ARG A CZ   1  
ATOM 712   N NH1  . ARG A 1 48 ? -3.087  15.485  -23.093 1.00 2.89  ? 48 ARG A NH1  1  
ATOM 713   N NH2  . ARG A 1 48 ? -5.084  15.100  -24.097 1.00 2.67  ? 48 ARG A NH2  1  
ATOM 714   H H    . ARG A 1 48 ? -5.693  8.426   -20.397 1.00 0.43  ? 48 ARG A H    1  
ATOM 715   H HA   . ARG A 1 48 ? -3.174  8.773   -21.997 1.00 0.68  ? 48 ARG A HA   1  
ATOM 716   H HB2  . ARG A 1 48 ? -4.978  10.648  -20.603 1.00 1.19  ? 48 ARG A HB2  1  
ATOM 717   H HB3  . ARG A 1 48 ? -3.272  10.900  -20.243 1.00 1.23  ? 48 ARG A HB3  1  
ATOM 718   H HG2  . ARG A 1 48 ? -2.740  11.102  -22.596 1.00 1.43  ? 48 ARG A HG2  1  
ATOM 719   H HG3  . ARG A 1 48 ? -4.386  10.661  -23.049 1.00 1.63  ? 48 ARG A HG3  1  
ATOM 720   H HD2  . ARG A 1 48 ? -5.278  12.688  -22.099 1.00 1.84  ? 48 ARG A HD2  1  
ATOM 721   H HD3  . ARG A 1 48 ? -3.731  13.082  -21.348 1.00 1.84  ? 48 ARG A HD3  1  
ATOM 722   H HE   . ARG A 1 48 ? -3.367  12.871  -24.183 1.00 2.46  ? 48 ARG A HE   1  
ATOM 723   H HH11 . ARG A 1 48 ? -2.248  15.139  -22.672 1.00 3.28  ? 48 ARG A HH11 1  
ATOM 724   H HH12 . ARG A 1 48 ? -3.238  16.472  -23.169 1.00 3.23  ? 48 ARG A HH12 1  
ATOM 725   H HH21 . ARG A 1 48 ? -5.770  14.460  -24.444 1.00 2.92  ? 48 ARG A HH21 1  
ATOM 726   H HH22 . ARG A 1 48 ? -5.236  16.086  -24.175 1.00 3.04  ? 48 ARG A HH22 1  
ATOM 727   N N    . LYS A 1 49 ? -1.847  9.127   -19.559 1.00 0.45  ? 49 LYS A N    1  
ATOM 728   C CA   . LYS A 1 49 ? -1.061  8.672   -18.390 1.00 0.39  ? 49 LYS A CA   1  
ATOM 729   C C    . LYS A 1 49 ? -0.273  9.827   -17.786 1.00 0.38  ? 49 LYS A C    1  
ATOM 730   O O    . LYS A 1 49 ? 0.139   10.750  -18.465 1.00 0.54  ? 49 LYS A O    1  
ATOM 731   C CB   . LYS A 1 49 ? -0.091  7.560   -18.790 1.00 0.58  ? 49 LYS A CB   1  
ATOM 732   C CG   . LYS A 1 49 ? 0.266   7.628   -20.288 1.00 0.89  ? 49 LYS A CG   1  
ATOM 733   C CD   . LYS A 1 49 ? 1.095   8.881   -20.597 1.00 0.96  ? 49 LYS A CD   1  
ATOM 734   C CE   . LYS A 1 49 ? 2.409   8.854   -19.812 1.00 0.92  ? 49 LYS A CE   1  
ATOM 735   N NZ   . LYS A 1 49 ? 3.497   9.443   -20.644 1.00 1.06  ? 49 LYS A NZ   1  
ATOM 736   H H    . LYS A 1 49 ? -1.558  9.900   -20.068 1.00 0.55  ? 49 LYS A H    1  
ATOM 737   H HA   . LYS A 1 49 ? -1.744  8.290   -17.644 1.00 0.34  ? 49 LYS A HA   1  
ATOM 738   H HB2  . LYS A 1 49 ? 0.807   7.648   -18.198 1.00 0.59  ? 49 LYS A HB2  1  
ATOM 739   H HB3  . LYS A 1 49 ? -0.559  6.617   -18.587 1.00 0.69  ? 49 LYS A HB3  1  
ATOM 740   H HG2  . LYS A 1 49 ? 0.834   6.750   -20.557 1.00 1.06  ? 49 LYS A HG2  1  
ATOM 741   H HG3  . LYS A 1 49 ? -0.644  7.652   -20.868 1.00 1.14  ? 49 LYS A HG3  1  
ATOM 742   H HD2  . LYS A 1 49 ? 1.311   8.909   -21.655 1.00 0.98  ? 49 LYS A HD2  1  
ATOM 743   H HD3  . LYS A 1 49 ? 0.533   9.761   -20.326 1.00 1.23  ? 49 LYS A HD3  1  
ATOM 744   H HE2  . LYS A 1 49 ? 2.299   9.427   -18.903 1.00 0.97  ? 49 LYS A HE2  1  
ATOM 745   H HE3  . LYS A 1 49 ? 2.660   7.833   -19.564 1.00 0.87  ? 49 LYS A HE3  1  
ATOM 746   H HZ1  . LYS A 1 49 ? 3.199   10.377  -20.995 1.00 1.19  ? 49 LYS A HZ1  1  
ATOM 747   H HZ2  . LYS A 1 49 ? 4.355   9.548   -20.068 1.00 1.66  ? 49 LYS A HZ2  1  
ATOM 748   H HZ3  . LYS A 1 49 ? 3.697   8.817   -21.449 1.00 1.54  ? 49 LYS A HZ3  1  
ATOM 749   N N    . ALA A 1 50 ? -0.049  9.758   -16.508 1.00 0.27  ? 50 ALA A N    1  
ATOM 750   C CA   . ALA A 1 50 ? 0.740   10.820  -15.814 1.00 0.28  ? 50 ALA A CA   1  
ATOM 751   C C    . ALA A 1 50 ? 1.631   10.162  -14.792 1.00 0.24  ? 50 ALA A C    1  
ATOM 752   O O    . ALA A 1 50 ? 1.333   9.094   -14.327 1.00 0.21  ? 50 ALA A O    1  
ATOM 753   C CB   . ALA A 1 50 ? -0.177  11.774  -15.065 1.00 0.32  ? 50 ALA A CB   1  
ATOM 754   H H    . ALA A 1 50 ? -0.392  8.981   -15.997 1.00 0.29  ? 50 ALA A H    1  
ATOM 755   H HA   . ALA A 1 50 ? 1.337   11.363  -16.528 1.00 0.34  ? 50 ALA A HA   1  
ATOM 756   H HB1  . ALA A 1 50 ? -0.983  12.081  -15.707 1.00 1.04  ? 50 ALA A HB1  1  
ATOM 757   H HB2  . ALA A 1 50 ? -0.574  11.271  -14.194 1.00 1.10  ? 50 ALA A HB2  1  
ATOM 758   H HB3  . ALA A 1 50 ? 0.391   12.638  -14.749 1.00 1.06  ? 50 ALA A HB3  1  
ATOM 759   N N    . CYS A 1 51 ? 2.677   10.806  -14.378 1.00 0.25  ? 51 CYS A N    1  
ATOM 760   C CA   . CYS A 1 51 ? 3.515   10.197  -13.333 1.00 0.22  ? 51 CYS A CA   1  
ATOM 761   C C    . CYS A 1 51 ? 3.405   11.083  -12.115 1.00 0.22  ? 51 CYS A C    1  
ATOM 762   O O    . CYS A 1 51 ? 3.179   12.268  -12.235 1.00 0.24  ? 51 CYS A O    1  
ATOM 763   C CB   . CYS A 1 51 ? 4.972   10.084  -13.789 1.00 0.24  ? 51 CYS A CB   1  
ATOM 764   S SG   . CYS A 1 51 ? 5.446   8.335   -13.750 1.00 0.26  ? 51 CYS A SG   1  
ATOM 765   H H    . CYS A 1 51 ? 2.881   11.709  -14.708 1.00 0.28  ? 51 CYS A H    1  
ATOM 766   H HA   . CYS A 1 51 ? 3.134   9.216   -13.104 1.00 0.20  ? 51 CYS A HA   1  
ATOM 767   H HB2  . CYS A 1 51 ? 5.067   10.465  -14.794 1.00 0.28  ? 51 CYS A HB2  1  
ATOM 768   H HB3  . CYS A 1 51 ? 5.609   10.648  -13.125 1.00 0.27  ? 51 CYS A HB3  1  
ATOM 769   N N    . LEU A 1 52 ? 3.528   10.526  -10.948 1.00 0.21  ? 52 LEU A N    1  
ATOM 770   C CA   . LEU A 1 52 ? 3.433   11.349  -9.719  1.00 0.23  ? 52 LEU A CA   1  
ATOM 771   C C    . LEU A 1 52 ? 4.531   10.889  -8.764  1.00 0.25  ? 52 LEU A C    1  
ATOM 772   O O    . LEU A 1 52 ? 5.161   9.874   -8.987  1.00 0.25  ? 52 LEU A O    1  
ATOM 773   C CB   . LEU A 1 52 ? 2.031   11.265  -9.075  1.00 0.22  ? 52 LEU A CB   1  
ATOM 774   C CG   . LEU A 1 52 ? 1.301   9.987   -9.490  1.00 0.18  ? 52 LEU A CG   1  
ATOM 775   C CD1  . LEU A 1 52 ? 0.962   10.019  -10.992 1.00 0.17  ? 52 LEU A CD1  1  
ATOM 776   C CD2  . LEU A 1 52 ? 2.180   8.788   -9.134  1.00 0.19  ? 52 LEU A CD2  1  
ATOM 777   H H    . LEU A 1 52 ? 3.670   9.560   -10.876 1.00 0.20  ? 52 LEU A H    1  
ATOM 778   H HA   . LEU A 1 52 ? 3.628   12.362  -9.983  1.00 0.25  ? 52 LEU A HA   1  
ATOM 779   H HB2  . LEU A 1 52 ? 2.131   11.281  -8.003  1.00 0.25  ? 52 LEU A HB2  1  
ATOM 780   H HB3  . LEU A 1 52 ? 1.449   12.120  -9.386  1.00 0.24  ? 52 LEU A HB3  1  
ATOM 781   H HG   . LEU A 1 52 ? 0.390   9.918   -8.946  1.00 0.19  ? 52 LEU A HG   1  
ATOM 782   H HD11 . LEU A 1 52 ? 1.115   11.022  -11.374 1.00 1.01  ? 52 LEU A HD11 1  
ATOM 783   H HD12 . LEU A 1 52 ? 1.600   9.333   -11.527 1.00 0.98  ? 52 LEU A HD12 1  
ATOM 784   H HD13 . LEU A 1 52 ? -0.071  9.740   -11.138 1.00 0.98  ? 52 LEU A HD13 1  
ATOM 785   H HD21 . LEU A 1 52 ? 3.017   9.128   -8.536  1.00 0.98  ? 52 LEU A HD21 1  
ATOM 786   H HD22 . LEU A 1 52 ? 1.604   8.077   -8.567  1.00 1.03  ? 52 LEU A HD22 1  
ATOM 787   H HD23 . LEU A 1 52 ? 2.545   8.328   -10.034 1.00 1.00  ? 52 LEU A HD23 1  
ATOM 788   N N    . ASN A 1 53 ? 4.804   11.642  -7.738  1.00 0.29  ? 53 ASN A N    1  
ATOM 789   C CA   . ASN A 1 53 ? 5.906   11.255  -6.804  1.00 0.32  ? 53 ASN A CA   1  
ATOM 790   C C    . ASN A 1 53 ? 5.358   10.412  -5.644  1.00 0.34  ? 53 ASN A C    1  
ATOM 791   O O    . ASN A 1 53 ? 4.884   10.971  -4.687  1.00 0.37  ? 53 ASN A O    1  
ATOM 792   C CB   . ASN A 1 53 ? 6.547   12.526  -6.219  1.00 0.36  ? 53 ASN A CB   1  
ATOM 793   C CG   . ASN A 1 53 ? 7.907   12.789  -6.881  1.00 0.43  ? 53 ASN A CG   1  
ATOM 794   O OD1  . ASN A 1 53 ? 8.218   12.232  -7.915  1.00 1.07  ? 53 ASN A OD1  1  
ATOM 795   N ND2  . ASN A 1 53 ? 8.738   13.627  -6.320  1.00 0.93  ? 53 ASN A ND2  1  
ATOM 796   H H    . ASN A 1 53 ? 4.306   12.473  -7.600  1.00 0.30  ? 53 ASN A H    1  
ATOM 797   H HA   . ASN A 1 53 ? 6.650   10.706  -7.345  1.00 0.33  ? 53 ASN A HA   1  
ATOM 798   H HB2  . ASN A 1 53 ? 5.895   13.367  -6.386  1.00 0.40  ? 53 ASN A HB2  1  
ATOM 799   H HB3  . ASN A 1 53 ? 6.693   12.395  -5.156  1.00 0.40  ? 53 ASN A HB3  1  
ATOM 800   H HD21 . ASN A 1 53 ? 8.492   14.080  -5.485  1.00 1.59  ? 53 ASN A HD21 1  
ATOM 801   H HD22 . ASN A 1 53 ? 9.609   13.803  -6.732  1.00 0.93  ? 53 ASN A HD22 1  
ATOM 802   N N    . PRO A 1 54 ? 5.468   9.094   -5.706  1.00 0.34  ? 54 PRO A N    1  
ATOM 803   C CA   . PRO A 1 54 ? 4.988   8.246   -4.594  1.00 0.37  ? 54 PRO A CA   1  
ATOM 804   C C    . PRO A 1 54 ? 5.778   8.579   -3.325  1.00 0.43  ? 54 PRO A C    1  
ATOM 805   O O    . PRO A 1 54 ? 5.258   8.492   -2.228  1.00 0.46  ? 54 PRO A O    1  
ATOM 806   C CB   . PRO A 1 54 ? 5.204   6.816   -5.093  1.00 0.37  ? 54 PRO A CB   1  
ATOM 807   C CG   . PRO A 1 54 ? 6.242   6.921   -6.222  1.00 0.36  ? 54 PRO A CG   1  
ATOM 808   C CD   . PRO A 1 54 ? 6.082   8.330   -6.813  1.00 0.32  ? 54 PRO A CD   1  
ATOM 809   H HA   . PRO A 1 54 ? 3.937   8.419   -4.429  1.00 0.36  ? 54 PRO A HA   1  
ATOM 810   H HB2  . PRO A 1 54 ? 5.578   6.195   -4.291  1.00 0.41  ? 54 PRO A HB2  1  
ATOM 811   H HB3  . PRO A 1 54 ? 4.281   6.414   -5.482  1.00 0.35  ? 54 PRO A HB3  1  
ATOM 812   H HG2  . PRO A 1 54 ? 7.235   6.796   -5.822  1.00 0.40  ? 54 PRO A HG2  1  
ATOM 813   H HG3  . PRO A 1 54 ? 6.045   6.185   -6.978  1.00 0.36  ? 54 PRO A HG3  1  
ATOM 814   H HD2  . PRO A 1 54 ? 7.046   8.725   -7.083  1.00 0.34  ? 54 PRO A HD2  1  
ATOM 815   H HD3  . PRO A 1 54 ? 5.418   8.308   -7.666  1.00 0.28  ? 54 PRO A HD3  1  
ATOM 816   N N    . ALA A 1 55 ? 7.003   9.046   -3.471  1.00 0.45  ? 55 ALA A N    1  
ATOM 817   C CA   . ALA A 1 55 ? 7.783   9.481   -2.277  1.00 0.51  ? 55 ALA A CA   1  
ATOM 818   C C    . ALA A 1 55 ? 7.026   10.665  -1.659  1.00 0.52  ? 55 ALA A C    1  
ATOM 819   O O    . ALA A 1 55 ? 7.026   10.861  -0.458  1.00 0.56  ? 55 ALA A O    1  
ATOM 820   C CB   . ALA A 1 55 ? 9.186   9.925   -2.702  1.00 0.54  ? 55 ALA A CB   1  
ATOM 821   H H    . ALA A 1 55 ? 7.381   9.167   -4.368  1.00 0.43  ? 55 ALA A H    1  
ATOM 822   H HA   . ALA A 1 55 ? 7.847   8.672   -1.565  1.00 0.53  ? 55 ALA A HA   1  
ATOM 823   H HB1  . ALA A 1 55 ? 9.126   10.463  -3.638  1.00 1.06  ? 55 ALA A HB1  1  
ATOM 824   H HB2  . ALA A 1 55 ? 9.606   10.568  -1.943  1.00 1.13  ? 55 ALA A HB2  1  
ATOM 825   H HB3  . ALA A 1 55 ? 9.817   9.056   -2.827  1.00 1.19  ? 55 ALA A HB3  1  
ATOM 826   N N    . SER A 1 56 ? 6.342   11.433  -2.492  1.00 0.50  ? 56 SER A N    1  
ATOM 827   C CA   . SER A 1 56 ? 5.529   12.582  -2.000  1.00 0.51  ? 56 SER A CA   1  
ATOM 828   C C    . SER A 1 56 ? 4.422   12.030  -1.082  1.00 0.51  ? 56 SER A C    1  
ATOM 829   O O    . SER A 1 56 ? 3.968   10.919  -1.285  1.00 0.51  ? 56 SER A O    1  
ATOM 830   C CB   . SER A 1 56 ? 4.880   13.299  -3.191  1.00 0.50  ? 56 SER A CB   1  
ATOM 831   O OG   . SER A 1 56 ? 4.858   14.701  -2.945  1.00 0.56  ? 56 SER A OG   1  
ATOM 832   H H    . SER A 1 56 ? 6.344   11.226  -3.449  1.00 0.47  ? 56 SER A H    1  
ATOM 833   H HA   . SER A 1 56 ? 6.163   13.267  -1.470  1.00 0.54  ? 56 SER A HA   1  
ATOM 834   H HB2  . SER A 1 56 ? 5.446   13.105  -4.087  1.00 0.46  ? 56 SER A HB2  1  
ATOM 835   H HB3  . SER A 1 56 ? 3.870   12.931  -3.325  1.00 0.51  ? 56 SER A HB3  1  
ATOM 836   H HG   . SER A 1 56 ? 3.950   14.957  -2.760  1.00 1.08  ? 56 SER A HG   1  
ATOM 837   N N    . PRO A 1 57 ? 4.006   12.808  -0.108  1.00 0.53  ? 57 PRO A N    1  
ATOM 838   C CA   . PRO A 1 57 ? 2.941   12.388  0.832   1.00 0.53  ? 57 PRO A CA   1  
ATOM 839   C C    . PRO A 1 57 ? 1.576   12.429  0.129   1.00 0.51  ? 57 PRO A C    1  
ATOM 840   O O    . PRO A 1 57 ? 0.881   11.427  0.042   1.00 0.51  ? 57 PRO A O    1  
ATOM 841   C CB   . PRO A 1 57 ? 3.036   13.416  1.966   1.00 0.59  ? 57 PRO A CB   1  
ATOM 842   C CG   . PRO A 1 57 ? 3.747   14.656  1.373   1.00 0.62  ? 57 PRO A CG   1  
ATOM 843   C CD   . PRO A 1 57 ? 4.537   14.165  0.144   1.00 0.58  ? 57 PRO A CD   1  
ATOM 844   H HA   . PRO A 1 57 ? 3.142   11.398  1.212   1.00 0.54  ? 57 PRO A HA   1  
ATOM 845   H HB2  . PRO A 1 57 ? 2.044   13.680  2.308   1.00 0.60  ? 57 PRO A HB2  1  
ATOM 846   H HB3  . PRO A 1 57 ? 3.617   13.018  2.781   1.00 0.62  ? 57 PRO A HB3  1  
ATOM 847   H HG2  . PRO A 1 57 ? 3.015   15.396  1.078   1.00 0.63  ? 57 PRO A HG2  1  
ATOM 848   H HG3  . PRO A 1 57 ? 4.427   15.076  2.099   1.00 0.67  ? 57 PRO A HG3  1  
ATOM 849   H HD2  . PRO A 1 57 ? 4.350   14.811  -0.703  1.00 0.59  ? 57 PRO A HD2  1  
ATOM 850   H HD3  . PRO A 1 57 ? 5.591   14.119  0.364   1.00 0.59  ? 57 PRO A HD3  1  
ATOM 851   N N    . ILE A 1 58 ? 1.211   13.572  -0.402  1.00 0.52  ? 58 ILE A N    1  
ATOM 852   C CA   . ILE A 1 58 ? -0.082  13.702  -1.141  1.00 0.51  ? 58 ILE A CA   1  
ATOM 853   C C    . ILE A 1 58 ? -0.143  12.625  -2.210  1.00 0.45  ? 58 ILE A C    1  
ATOM 854   O O    . ILE A 1 58 ? -1.153  11.992  -2.425  1.00 0.44  ? 58 ILE A O    1  
ATOM 855   C CB   . ILE A 1 58 ? -0.118  15.082  -1.820  1.00 0.54  ? 58 ILE A CB   1  
ATOM 856   C CG1  . ILE A 1 58 ? -1.261  15.922  -1.240  1.00 0.62  ? 58 ILE A CG1  1  
ATOM 857   C CG2  . ILE A 1 58 ? -0.306  14.936  -3.341  1.00 0.49  ? 58 ILE A CG2  1  
ATOM 858   C CD1  . ILE A 1 58 ? -0.905  16.370  0.179   1.00 0.68  ? 58 ILE A CD1  1  
ATOM 859   H H    . ILE A 1 58 ? 1.806   14.348  -0.338  1.00 0.55  ? 58 ILE A H    1  
ATOM 860   H HA   . ILE A 1 58 ? -0.912  13.593  -0.462  1.00 0.55  ? 58 ILE A HA   1  
ATOM 861   H HB   . ILE A 1 58 ? 0.824   15.576  -1.640  1.00 0.56  ? 58 ILE A HB   1  
ATOM 862   H HG12 . ILE A 1 58 ? -1.419  16.791  -1.862  1.00 0.64  ? 58 ILE A HG12 1  
ATOM 863   H HG13 . ILE A 1 58 ? -2.165  15.331  -1.212  1.00 0.62  ? 58 ILE A HG13 1  
ATOM 864   H HG21 . ILE A 1 58 ? -1.068  14.196  -3.545  1.00 1.14  ? 58 ILE A HG21 1  
ATOM 865   H HG22 . ILE A 1 58 ? -0.599  15.880  -3.762  1.00 1.11  ? 58 ILE A HG22 1  
ATOM 866   H HG23 . ILE A 1 58 ? 0.628   14.616  -3.790  1.00 1.12  ? 58 ILE A HG23 1  
ATOM 867   H HD11 . ILE A 1 58 ? 0.167   16.473  0.267   1.00 1.15  ? 58 ILE A HD11 1  
ATOM 868   H HD12 . ILE A 1 58 ? -1.375  17.320  0.385   1.00 1.10  ? 58 ILE A HD12 1  
ATOM 869   H HD13 . ILE A 1 58 ? -1.255  15.635  0.889   1.00 1.28  ? 58 ILE A HD13 1  
ATOM 870   N N    . VAL A 1 59 ? 0.936   12.456  -2.905  1.00 0.43  ? 59 VAL A N    1  
ATOM 871   C CA   . VAL A 1 59 ? 0.979   11.464  -3.986  1.00 0.40  ? 59 VAL A CA   1  
ATOM 872   C C    . VAL A 1 59 ? 0.869   10.061  -3.404  1.00 0.37  ? 59 VAL A C    1  
ATOM 873   O O    . VAL A 1 59 ? 0.162   9.230   -3.937  1.00 0.33  ? 59 VAL A O    1  
ATOM 874   C CB   . VAL A 1 59 ? 2.297   11.623  -4.706  1.00 0.51  ? 59 VAL A CB   1  
ATOM 875   C CG1  . VAL A 1 59 ? 2.400   10.587  -5.789  1.00 0.31  ? 59 VAL A CG1  1  
ATOM 876   C CG2  . VAL A 1 59 ? 2.405   13.015  -5.319  1.00 0.88  ? 59 VAL A CG2  1  
ATOM 877   H H    . VAL A 1 59 ? 1.723   13.012  -2.731  1.00 0.46  ? 59 VAL A H    1  
ATOM 878   H HA   . VAL A 1 59 ? 0.151   11.637  -4.654  1.00 0.41  ? 59 VAL A HA   1  
ATOM 879   H HB   . VAL A 1 59 ? 3.095   11.478  -3.999  1.00 0.83  ? 59 VAL A HB   1  
ATOM 880   H HG11 . VAL A 1 59 ? 1.439   10.471  -6.257  1.00 1.01  ? 59 VAL A HG11 1  
ATOM 881   H HG12 . VAL A 1 59 ? 3.126   10.910  -6.514  1.00 1.11  ? 59 VAL A HG12 1  
ATOM 882   H HG13 . VAL A 1 59 ? 2.713   9.654   -5.349  1.00 1.09  ? 59 VAL A HG13 1  
ATOM 883   H HG21 . VAL A 1 59 ? 2.274   13.761  -4.551  1.00 1.24  ? 59 VAL A HG21 1  
ATOM 884   H HG22 . VAL A 1 59 ? 3.377   13.134  -5.775  1.00 1.47  ? 59 VAL A HG22 1  
ATOM 885   H HG23 . VAL A 1 59 ? 1.643   13.131  -6.069  1.00 1.52  ? 59 VAL A HG23 1  
ATOM 886   N N    . LYS A 1 60 ? 1.520   9.795   -2.296  1.00 0.43  ? 60 LYS A N    1  
ATOM 887   C CA   . LYS A 1 60 ? 1.379   8.448   -1.669  1.00 0.43  ? 60 LYS A CA   1  
ATOM 888   C C    . LYS A 1 60 ? -0.122  8.211   -1.418  1.00 0.43  ? 60 LYS A C    1  
ATOM 889   O O    . LYS A 1 60 ? -0.586  7.089   -1.317  1.00 0.42  ? 60 LYS A O    1  
ATOM 890   C CB   . LYS A 1 60 ? 2.123   8.417   -0.336  1.00 0.50  ? 60 LYS A CB   1  
ATOM 891   C CG   . LYS A 1 60 ? 2.919   7.115   -0.220  1.00 0.60  ? 60 LYS A CG   1  
ATOM 892   C CD   . LYS A 1 60 ? 3.371   6.921   1.229   1.00 0.91  ? 60 LYS A CD   1  
ATOM 893   C CE   . LYS A 1 60 ? 4.649   7.727   1.477   1.00 0.99  ? 60 LYS A CE   1  
ATOM 894   N NZ   . LYS A 1 60 ? 5.037   7.620   2.913   1.00 1.67  ? 60 LYS A NZ   1  
ATOM 895   H H    . LYS A 1 60 ? 2.060   10.488  -1.861  1.00 0.47  ? 60 LYS A H    1  
ATOM 896   H HA   . LYS A 1 60 ? 1.771   7.694   -2.343  1.00 0.40  ? 60 LYS A HA   1  
ATOM 897   H HB2  . LYS A 1 60 ? 2.794   9.260   -0.281  1.00 0.65  ? 60 LYS A HB2  1  
ATOM 898   H HB3  . LYS A 1 60 ? 1.409   8.474   0.472   1.00 0.59  ? 60 LYS A HB3  1  
ATOM 899   H HG2  . LYS A 1 60 ? 2.293   6.285   -0.517  1.00 1.10  ? 60 LYS A HG2  1  
ATOM 900   H HG3  . LYS A 1 60 ? 3.785   7.162   -0.863  1.00 0.87  ? 60 LYS A HG3  1  
ATOM 901   H HD2  . LYS A 1 60 ? 2.593   7.262   1.898   1.00 1.38  ? 60 LYS A HD2  1  
ATOM 902   H HD3  . LYS A 1 60 ? 3.568   5.876   1.408   1.00 1.48  ? 60 LYS A HD3  1  
ATOM 903   H HE2  . LYS A 1 60 ? 5.445   7.339   0.860   1.00 1.20  ? 60 LYS A HE2  1  
ATOM 904   H HE3  . LYS A 1 60 ? 4.475   8.764   1.229   1.00 1.40  ? 60 LYS A HE3  1  
ATOM 905   H HZ1  . LYS A 1 60 ? 5.012   6.621   3.207   1.00 2.08  ? 60 LYS A HZ1  1  
ATOM 906   H HZ2  . LYS A 1 60 ? 5.997   7.995   3.042   1.00 2.01  ? 60 LYS A HZ2  1  
ATOM 907   H HZ3  . LYS A 1 60 ? 4.372   8.169   3.494   1.00 2.22  ? 60 LYS A HZ3  1  
ATOM 908   N N    . LYS A 1 61 ? -0.879  9.289   -1.381  1.00 0.45  ? 61 LYS A N    1  
ATOM 909   C CA   . LYS A 1 61 ? -2.345  9.222   -1.216  1.00 0.46  ? 61 LYS A CA   1  
ATOM 910   C C    . LYS A 1 61 ? -2.892  8.729   -2.537  1.00 0.42  ? 61 LYS A C    1  
ATOM 911   O O    . LYS A 1 61 ? -3.623  7.776   -2.600  1.00 0.44  ? 61 LYS A O    1  
ATOM 912   C CB   . LYS A 1 61 ? -2.856  10.634  -0.962  1.00 0.51  ? 61 LYS A CB   1  
ATOM 913   C CG   . LYS A 1 61 ? -3.953  10.606  0.096   1.00 0.72  ? 61 LYS A CG   1  
ATOM 914   C CD   . LYS A 1 61 ? -5.032  11.623  -0.269  1.00 1.03  ? 61 LYS A CD   1  
ATOM 915   C CE   . LYS A 1 61 ? -6.266  11.397  0.610   1.00 1.30  ? 61 LYS A CE   1  
ATOM 916   N NZ   . LYS A 1 61 ? -6.985  12.689  0.807   1.00 1.87  ? 61 LYS A NZ   1  
ATOM 917   H H    . LYS A 1 61 ? -0.475  10.159  -1.523  1.00 0.46  ? 61 LYS A H    1  
ATOM 918   H HA   . LYS A 1 61 ? -2.616  8.560   -0.409  1.00 0.49  ? 61 LYS A HA   1  
ATOM 919   H HB2  . LYS A 1 61 ? -2.033  11.253  -0.624  1.00 0.58  ? 61 LYS A HB2  1  
ATOM 920   H HB3  . LYS A 1 61 ? -3.246  11.042  -1.888  1.00 0.66  ? 61 LYS A HB3  1  
ATOM 921   H HG2  . LYS A 1 61 ? -4.385  9.617   0.137   1.00 1.41  ? 61 LYS A HG2  1  
ATOM 922   H HG3  . LYS A 1 61 ? -3.531  10.857  1.056   1.00 1.05  ? 61 LYS A HG3  1  
ATOM 923   H HD2  . LYS A 1 61 ? -4.649  12.621  -0.110  1.00 1.37  ? 61 LYS A HD2  1  
ATOM 924   H HD3  . LYS A 1 61 ? -5.303  11.503  -1.307  1.00 1.76  ? 61 LYS A HD3  1  
ATOM 925   H HE2  . LYS A 1 61 ? -6.924  10.689  0.129   1.00 1.85  ? 61 LYS A HE2  1  
ATOM 926   H HE3  . LYS A 1 61 ? -5.957  11.007  1.569   1.00 1.55  ? 61 LYS A HE3  1  
ATOM 927   H HZ1  . LYS A 1 61 ? -6.340  13.385  1.233   1.00 2.27  ? 61 LYS A HZ1  1  
ATOM 928   H HZ2  . LYS A 1 61 ? -7.321  13.042  -0.112  1.00 2.42  ? 61 LYS A HZ2  1  
ATOM 929   H HZ3  . LYS A 1 61 ? -7.796  12.540  1.440   1.00 2.11  ? 61 LYS A HZ3  1  
ATOM 930   N N    . ILE A 1 62 ? -2.480  9.378   -3.596  1.00 0.37  ? 62 ILE A N    1  
ATOM 931   C CA   . ILE A 1 62 ? -2.880  8.988   -4.969  1.00 0.34  ? 62 ILE A CA   1  
ATOM 932   C C    . ILE A 1 62 ? -2.846  7.461   -5.104  1.00 0.33  ? 62 ILE A C    1  
ATOM 933   O O    . ILE A 1 62 ? -3.718  6.877   -5.713  1.00 0.34  ? 62 ILE A O    1  
ATOM 934   C CB   . ILE A 1 62 ? -1.879  9.663   -5.931  1.00 0.32  ? 62 ILE A CB   1  
ATOM 935   C CG1  . ILE A 1 62 ? -2.592  10.653  -6.850  1.00 0.34  ? 62 ILE A CG1  1  
ATOM 936   C CG2  . ILE A 1 62 ? -1.122  8.634   -6.768  1.00 0.30  ? 62 ILE A CG2  1  
ATOM 937   C CD1  . ILE A 1 62 ? -3.483  11.556  -6.005  1.00 0.36  ? 62 ILE A CD1  1  
ATOM 938   H H    . ILE A 1 62 ? -1.868  10.133  -3.484  1.00 0.37  ? 62 ILE A H    1  
ATOM 939   H HA   . ILE A 1 62 ? -3.875  9.335   -5.160  1.00 0.36  ? 62 ILE A HA   1  
ATOM 940   H HB   . ILE A 1 62 ? -1.166  10.207  -5.339  1.00 0.33  ? 62 ILE A HB   1  
ATOM 941   H HG12 . ILE A 1 62 ? -1.855  11.257  -7.368  1.00 0.35  ? 62 ILE A HG12 1  
ATOM 942   H HG13 . ILE A 1 62 ? -3.190  10.120  -7.567  1.00 0.35  ? 62 ILE A HG13 1  
ATOM 943   H HG21 . ILE A 1 62 ? -1.826  8.030   -7.318  1.00 1.06  ? 62 ILE A HG21 1  
ATOM 944   H HG22 . ILE A 1 62 ? -0.464  9.143   -7.454  1.00 1.07  ? 62 ILE A HG22 1  
ATOM 945   H HG23 . ILE A 1 62 ? -0.540  8.003   -6.112  1.00 1.02  ? 62 ILE A HG23 1  
ATOM 946   H HD11 . ILE A 1 62 ? -2.960  11.822  -5.098  1.00 1.08  ? 62 ILE A HD11 1  
ATOM 947   H HD12 . ILE A 1 62 ? -3.720  12.448  -6.560  1.00 1.05  ? 62 ILE A HD12 1  
ATOM 948   H HD13 . ILE A 1 62 ? -4.391  11.029  -5.755  1.00 1.01  ? 62 ILE A HD13 1  
ATOM 949   N N    . ILE A 1 63 ? -1.866  6.809   -4.519  1.00 0.31  ? 63 ILE A N    1  
ATOM 950   C CA   . ILE A 1 63 ? -1.819  5.319   -4.602  1.00 0.31  ? 63 ILE A CA   1  
ATOM 951   C C    . ILE A 1 63 ? -2.931  4.747   -3.747  1.00 0.37  ? 63 ILE A C    1  
ATOM 952   O O    . ILE A 1 63 ? -3.712  3.921   -4.180  1.00 0.41  ? 63 ILE A O    1  
ATOM 953   C CB   . ILE A 1 63 ? -0.503  4.810   -4.028  1.00 0.32  ? 63 ILE A CB   1  
ATOM 954   C CG1  . ILE A 1 63 ? 0.641   5.280   -4.903  1.00 0.32  ? 63 ILE A CG1  1  
ATOM 955   C CG2  . ILE A 1 63 ? -0.520  3.281   -3.954  1.00 0.34  ? 63 ILE A CG2  1  
ATOM 956   C CD1  . ILE A 1 63 ? 1.060   6.660   -4.441  1.00 0.42  ? 63 ILE A CD1  1  
ATOM 957   H H    . ILE A 1 63 ? -1.171  7.301   -4.005  1.00 0.32  ? 63 ILE A H    1  
ATOM 958   H HA   . ILE A 1 63 ? -1.926  4.996   -5.625  1.00 0.30  ? 63 ILE A HA   1  
ATOM 959   H HB   . ILE A 1 63 ? -0.376  5.208   -3.030  1.00 0.35  ? 63 ILE A HB   1  
ATOM 960   H HG12 . ILE A 1 63 ? 1.462   4.609   -4.800  1.00 0.31  ? 63 ILE A HG12 1  
ATOM 961   H HG13 . ILE A 1 63 ? 0.326   5.322   -5.933  1.00 0.48  ? 63 ILE A HG13 1  
ATOM 962   H HG21 . ILE A 1 63 ? -1.223  2.893   -4.678  1.00 1.03  ? 63 ILE A HG21 1  
ATOM 963   H HG22 . ILE A 1 63 ? 0.465   2.898   -4.163  1.00 1.02  ? 63 ILE A HG22 1  
ATOM 964   H HG23 . ILE A 1 63 ? -0.822  2.975   -2.962  1.00 1.03  ? 63 ILE A HG23 1  
ATOM 965   H HD11 . ILE A 1 63 ? 0.621   6.855   -3.471  1.00 1.06  ? 63 ILE A HD11 1  
ATOM 966   H HD12 . ILE A 1 63 ? 2.131   6.705   -4.369  1.00 1.07  ? 63 ILE A HD12 1  
ATOM 967   H HD13 . ILE A 1 63 ? 0.706   7.392   -5.148  1.00 1.16  ? 63 ILE A HD13 1  
ATOM 968   N N    . GLU A 1 64 ? -2.971  5.171   -2.515  1.00 0.39  ? 64 GLU A N    1  
ATOM 969   C CA   . GLU A 1 64 ? -3.987  4.652   -1.569  1.00 0.46  ? 64 GLU A CA   1  
ATOM 970   C C    . GLU A 1 64 ? -5.405  5.003   -2.035  1.00 0.49  ? 64 GLU A C    1  
ATOM 971   O O    . GLU A 1 64 ? -6.291  4.173   -2.010  1.00 0.62  ? 64 GLU A O    1  
ATOM 972   C CB   . GLU A 1 64 ? -3.757  5.262   -0.192  1.00 0.49  ? 64 GLU A CB   1  
ATOM 973   C CG   . GLU A 1 64 ? -2.871  4.335   0.640   1.00 1.04  ? 64 GLU A CG   1  
ATOM 974   C CD   . GLU A 1 64 ? -2.871  4.798   2.098   1.00 1.41  ? 64 GLU A CD   1  
ATOM 975   O OE1  . GLU A 1 64 ? -2.069  5.658   2.427   1.00 1.81  ? 64 GLU A OE1  1  
ATOM 976   O OE2  . GLU A 1 64 ? -3.673  4.286   2.862   1.00 2.00  ? 64 GLU A OE2  1  
ATOM 977   H H    . GLU A 1 64 ? -2.302  5.826   -2.208  1.00 0.37  ? 64 GLU A H    1  
ATOM 978   H HA   . GLU A 1 64 ? -3.871  3.581   -1.510  1.00 0.49  ? 64 GLU A HA   1  
ATOM 979   H HB2  . GLU A 1 64 ? -3.277  6.223   -0.305  1.00 0.72  ? 64 GLU A HB2  1  
ATOM 980   H HB3  . GLU A 1 64 ? -4.707  5.390   0.301   1.00 0.75  ? 64 GLU A HB3  1  
ATOM 981   H HG2  . GLU A 1 64 ? -3.252  3.325   0.580   1.00 1.39  ? 64 GLU A HG2  1  
ATOM 982   H HG3  . GLU A 1 64 ? -1.862  4.362   0.255   1.00 1.44  ? 64 GLU A HG3  1  
ATOM 983   N N    . LYS A 1 65 ? -5.629  6.230   -2.451  1.00 0.48  ? 65 LYS A N    1  
ATOM 984   C CA   . LYS A 1 65 ? -6.989  6.633   -2.911  1.00 0.51  ? 65 LYS A CA   1  
ATOM 985   C C    . LYS A 1 65 ? -7.323  5.881   -4.189  1.00 0.51  ? 65 LYS A C    1  
ATOM 986   O O    . LYS A 1 65 ? -8.412  5.360   -4.338  1.00 0.56  ? 65 LYS A O    1  
ATOM 987   C CB   . LYS A 1 65 ? -7.035  8.144   -3.154  1.00 0.52  ? 65 LYS A CB   1  
ATOM 988   C CG   . LYS A 1 65 ? -8.353  8.519   -3.836  1.00 1.07  ? 65 LYS A CG   1  
ATOM 989   C CD   . LYS A 1 65 ? -8.683  9.983   -3.545  1.00 1.45  ? 65 LYS A CD   1  
ATOM 990   C CE   . LYS A 1 65 ? -9.536  10.072  -2.277  1.00 1.72  ? 65 LYS A CE   1  
ATOM 991   N NZ   . LYS A 1 65 ? -9.619  11.490  -1.825  1.00 2.15  ? 65 LYS A NZ   1  
ATOM 992   H H    . LYS A 1 65 ? -4.901  6.883   -2.459  1.00 0.54  ? 65 LYS A H    1  
ATOM 993   H HA   . LYS A 1 65 ? -7.700  6.364   -2.153  1.00 0.56  ? 65 LYS A HA   1  
ATOM 994   H HB2  . LYS A 1 65 ? -6.960  8.660   -2.208  1.00 0.92  ? 65 LYS A HB2  1  
ATOM 995   H HB3  . LYS A 1 65 ? -6.210  8.431   -3.788  1.00 1.10  ? 65 LYS A HB3  1  
ATOM 996   H HG2  . LYS A 1 65 ? -8.260  8.375   -4.903  1.00 1.56  ? 65 LYS A HG2  1  
ATOM 997   H HG3  . LYS A 1 65 ? -9.146  7.891   -3.456  1.00 1.65  ? 65 LYS A HG3  1  
ATOM 998   H HD2  . LYS A 1 65 ? -7.765  10.538  -3.406  1.00 1.79  ? 65 LYS A HD2  1  
ATOM 999   H HD3  . LYS A 1 65 ? -9.232  10.398  -4.377  1.00 1.92  ? 65 LYS A HD3  1  
ATOM 1000  H HE2  . LYS A 1 65 ? -10.529 9.703   -2.485  1.00 2.13  ? 65 LYS A HE2  1  
ATOM 1001  H HE3  . LYS A 1 65 ? -9.086  9.474   -1.498  1.00 2.04  ? 65 LYS A HE3  1  
ATOM 1002  H HZ1  . LYS A 1 65 ? -9.956  12.086  -2.609  1.00 2.64  ? 65 LYS A HZ1  1  
ATOM 1003  H HZ2  . LYS A 1 65 ? -10.283 11.561  -1.026  1.00 2.41  ? 65 LYS A HZ2  1  
ATOM 1004  H HZ3  . LYS A 1 65 ? -8.679  11.816  -1.524  1.00 2.47  ? 65 LYS A HZ3  1  
ATOM 1005  N N    . MET A 1 66 ? -6.382  5.778   -5.094  1.00 0.46  ? 66 MET A N    1  
ATOM 1006  C CA   . MET A 1 66 ? -6.636  5.003   -6.331  1.00 0.46  ? 66 MET A CA   1  
ATOM 1007  C C    . MET A 1 66 ? -6.987  3.573   -5.900  1.00 0.50  ? 66 MET A C    1  
ATOM 1008  O O    . MET A 1 66 ? -7.854  2.934   -6.466  1.00 0.54  ? 66 MET A O    1  
ATOM 1009  C CB   . MET A 1 66 ? -5.384  5.008   -7.203  1.00 0.42  ? 66 MET A CB   1  
ATOM 1010  C CG   . MET A 1 66 ? -5.396  6.256   -8.095  1.00 0.40  ? 66 MET A CG   1  
ATOM 1011  S SD   . MET A 1 66 ? -6.641  6.042   -9.393  1.00 1.14  ? 66 MET A SD   1  
ATOM 1012  C CE   . MET A 1 66 ? -5.756  4.798   -10.362 1.00 0.37  ? 66 MET A CE   1  
ATOM 1013  H H    . MET A 1 66 ? -5.504  6.178   -4.940  1.00 0.42  ? 66 MET A H    1  
ATOM 1014  H HA   . MET A 1 66 ? -7.461  5.441   -6.865  1.00 0.48  ? 66 MET A HA   1  
ATOM 1015  H HB2  . MET A 1 66 ? -4.508  5.017   -6.571  1.00 0.40  ? 66 MET A HB2  1  
ATOM 1016  H HB3  . MET A 1 66 ? -5.375  4.124   -7.819  1.00 0.46  ? 66 MET A HB3  1  
ATOM 1017  H HG2  . MET A 1 66 ? -5.642  7.128   -7.500  1.00 0.76  ? 66 MET A HG2  1  
ATOM 1018  H HG3  . MET A 1 66 ? -4.424  6.394   -8.543  1.00 0.67  ? 66 MET A HG3  1  
ATOM 1019  H HE1  . MET A 1 66 ? -4.741  4.710   -10.003 1.00 1.06  ? 66 MET A HE1  1  
ATOM 1020  H HE2  . MET A 1 66 ? -6.259  3.844   -10.274 1.00 1.05  ? 66 MET A HE2  1  
ATOM 1021  H HE3  . MET A 1 66 ? -5.740  5.098   -11.394 1.00 1.09  ? 66 MET A HE3  1  
ATOM 1022  N N    . LEU A 1 67 ? -6.340  3.103   -4.852  1.00 0.50  ? 67 LEU A N    1  
ATOM 1023  C CA   . LEU A 1 67 ? -6.633  1.757   -4.297  1.00 0.55  ? 67 LEU A CA   1  
ATOM 1024  C C    . LEU A 1 67 ? -8.067  1.759   -3.746  1.00 0.60  ? 67 LEU A C    1  
ATOM 1025  O O    . LEU A 1 67 ? -8.781  0.779   -3.844  1.00 0.64  ? 67 LEU A O    1  
ATOM 1026  C CB   . LEU A 1 67 ? -5.662  1.468   -3.150  1.00 0.56  ? 67 LEU A CB   1  
ATOM 1027  C CG   . LEU A 1 67 ? -4.537  0.554   -3.632  1.00 0.53  ? 67 LEU A CG   1  
ATOM 1028  C CD1  . LEU A 1 67 ? -3.195  1.192   -3.274  1.00 0.53  ? 67 LEU A CD1  1  
ATOM 1029  C CD2  . LEU A 1 67 ? -4.657  -0.810  -2.947  1.00 0.56  ? 67 LEU A CD2  1  
ATOM 1030  H H    . LEU A 1 67 ? -5.679  3.662   -4.406  1.00 0.49  ? 67 LEU A H    1  
ATOM 1031  H HA   . LEU A 1 67 ? -6.522  1.015   -5.064  1.00 0.55  ? 67 LEU A HA   1  
ATOM 1032  H HB2  . LEU A 1 67 ? -5.241  2.396   -2.802  1.00 0.57  ? 67 LEU A HB2  1  
ATOM 1033  H HB3  . LEU A 1 67 ? -6.189  0.992   -2.338  1.00 0.60  ? 67 LEU A HB3  1  
ATOM 1034  H HG   . LEU A 1 67 ? -4.605  0.432   -4.704  1.00 0.51  ? 67 LEU A HG   1  
ATOM 1035  H HD11 . LEU A 1 67 ? -3.347  1.935   -2.504  1.00 0.98  ? 67 LEU A HD11 1  
ATOM 1036  H HD12 . LEU A 1 67 ? -2.520  0.433   -2.914  1.00 1.24  ? 67 LEU A HD12 1  
ATOM 1037  H HD13 . LEU A 1 67 ? -2.778  1.662   -4.151  1.00 1.19  ? 67 LEU A HD13 1  
ATOM 1038  H HD21 . LEU A 1 67 ? -5.700  -1.060  -2.821  1.00 1.16  ? 67 LEU A HD21 1  
ATOM 1039  H HD22 . LEU A 1 67 ? -4.179  -1.562  -3.557  1.00 1.18  ? 67 LEU A HD22 1  
ATOM 1040  H HD23 . LEU A 1 67 ? -4.177  -0.771  -1.980  1.00 1.13  ? 67 LEU A HD23 1  
ATOM 1041  N N    . ASN A 1 68 ? -8.484  2.871   -3.168  1.00 0.63  ? 68 ASN A N    1  
ATOM 1042  C CA   . ASN A 1 68 ? -9.875  2.966   -2.604  1.00 0.70  ? 68 ASN A CA   1  
ATOM 1043  C C    . ASN A 1 68 ? -10.900 2.943   -3.751  1.00 0.76  ? 68 ASN A C    1  
ATOM 1044  O O    . ASN A 1 68 ? -10.536 2.887   -4.912  1.00 0.92  ? 68 ASN A O    1  
ATOM 1045  C CB   . ASN A 1 68 ? -10.034 4.268   -1.785  1.00 0.78  ? 68 ASN A CB   1  
ATOM 1046  C CG   . ASN A 1 68 ? -8.962  4.339   -0.688  1.00 1.48  ? 68 ASN A CG   1  
ATOM 1047  O OD1  . ASN A 1 68 ? -8.479  3.323   -0.222  1.00 2.21  ? 68 ASN A OD1  1  
ATOM 1048  N ND2  . ASN A 1 68 ? -8.574  5.505   -0.244  1.00 2.00  ? 68 ASN A ND2  1  
ATOM 1049  H H    . ASN A 1 68 ? -7.873  3.647   -3.109  1.00 0.62  ? 68 ASN A H    1  
ATOM 1050  H HA   . ASN A 1 68 ? -10.052 2.117   -1.958  1.00 0.72  ? 68 ASN A HA   1  
ATOM 1051  H HB2  . ASN A 1 68 ? -9.942  5.129   -2.437  1.00 1.16  ? 68 ASN A HB2  1  
ATOM 1052  H HB3  . ASN A 1 68 ? -11.007 4.283   -1.323  1.00 1.06  ? 68 ASN A HB3  1  
ATOM 1053  H HD21 . ASN A 1 68 ? -8.966  6.325   -0.611  1.00 2.14  ? 68 ASN A HD21 1  
ATOM 1054  H HD22 . ASN A 1 68 ? -7.889  5.559   0.455   1.00 2.63  ? 68 ASN A HD22 1  
ATOM 1055  N N    . SER A 1 69 ? -12.179 2.973   -3.424  1.00 0.87  ? 69 SER A N    1  
ATOM 1056  C CA   . SER A 1 69 ? -13.264 2.945   -4.463  1.00 0.99  ? 69 SER A CA   1  
ATOM 1057  C C    . SER A 1 69 ? -13.531 1.491   -4.880  1.00 1.13  ? 69 SER A C    1  
ATOM 1058  O O    . SER A 1 69 ? -13.237 1.078   -5.988  1.00 1.69  ? 69 SER A O    1  
ATOM 1059  C CB   . SER A 1 69 ? -12.871 3.790   -5.685  1.00 1.46  ? 69 SER A CB   1  
ATOM 1060  O OG   . SER A 1 69 ? -14.047 4.286   -6.311  1.00 2.02  ? 69 SER A OG   1  
ATOM 1061  H H    . SER A 1 69 ? -12.431 3.005   -2.478  1.00 1.01  ? 69 SER A H    1  
ATOM 1062  H HA   . SER A 1 69 ? -14.167 3.351   -4.030  1.00 1.09  ? 69 SER A HA   1  
ATOM 1063  H HB2  . SER A 1 69 ? -12.263 4.621   -5.370  1.00 1.86  ? 69 SER A HB2  1  
ATOM 1064  H HB3  . SER A 1 69 ? -12.310 3.180   -6.381  1.00 1.93  ? 69 SER A HB3  1  
ATOM 1065  H HG   . SER A 1 69 ? -14.335 3.638   -6.959  1.00 2.26  ? 69 SER A HG   1  
ATOM 1066  N N    . ASP A 1 70 ? -14.096 0.716   -3.985  1.00 1.22  ? 70 ASP A N    1  
ATOM 1067  C CA   . ASP A 1 70 ? -14.406 -0.716  -4.290  1.00 1.68  ? 70 ASP A CA   1  
ATOM 1068  C C    . ASP A 1 70 ? -15.532 -1.197  -3.359  1.00 1.89  ? 70 ASP A C    1  
ATOM 1069  O O    . ASP A 1 70 ? -16.094 -0.421  -2.607  1.00 2.34  ? 70 ASP A O    1  
ATOM 1070  C CB   . ASP A 1 70 ? -13.147 -1.568  -4.074  1.00 2.32  ? 70 ASP A CB   1  
ATOM 1071  C CG   . ASP A 1 70 ? -12.992 -2.560  -5.232  1.00 3.12  ? 70 ASP A CG   1  
ATOM 1072  O OD1  . ASP A 1 70 ? -12.474 -2.162  -6.263  1.00 3.64  ? 70 ASP A OD1  1  
ATOM 1073  O OD2  . ASP A 1 70 ? -13.393 -3.701  -5.068  1.00 3.72  ? 70 ASP A OD2  1  
ATOM 1074  H H    . ASP A 1 70 ? -14.323 1.082   -3.103  1.00 1.39  ? 70 ASP A H    1  
ATOM 1075  H HA   . ASP A 1 70 ? -14.729 -0.802  -5.318  1.00 2.07  ? 70 ASP A HA   1  
ATOM 1076  H HB2  . ASP A 1 70 ? -12.280 -0.925  -4.033  1.00 2.46  ? 70 ASP A HB2  1  
ATOM 1077  H HB3  . ASP A 1 70 ? -13.234 -2.113  -3.146  1.00 2.72  ? 70 ASP A HB3  1  
ATOM 1078  N N    . LYS A 1 71 ? -15.874 -2.469  -3.411  1.00 2.37  ? 71 LYS A N    1  
ATOM 1079  C CA   . LYS A 1 71 ? -16.968 -3.007  -2.538  1.00 3.07  ? 71 LYS A CA   1  
ATOM 1080  C C    . LYS A 1 71 ? -18.300 -2.349  -2.931  1.00 3.94  ? 71 LYS A C    1  
ATOM 1081  O O    . LYS A 1 71 ? -19.028 -1.838  -2.100  1.00 4.56  ? 71 LYS A O    1  
ATOM 1082  C CB   . LYS A 1 71 ? -16.645 -2.719  -1.062  1.00 3.59  ? 71 LYS A CB   1  
ATOM 1083  C CG   . LYS A 1 71 ? -17.475 -3.637  -0.156  1.00 3.79  ? 71 LYS A CG   1  
ATOM 1084  C CD   . LYS A 1 71 ? -18.062 -2.821  1.002   1.00 4.62  ? 71 LYS A CD   1  
ATOM 1085  C CE   . LYS A 1 71 ? -17.074 -2.807  2.173   1.00 5.22  ? 71 LYS A CE   1  
ATOM 1086  N NZ   . LYS A 1 71 ? -17.507 -1.797  3.181   1.00 5.99  ? 71 LYS A NZ   1  
ATOM 1087  H H    . LYS A 1 71 ? -15.413 -3.072  -4.032  1.00 2.66  ? 71 LYS A H    1  
ATOM 1088  H HA   . LYS A 1 71 ? -17.045 -4.076  -2.685  1.00 3.10  ? 71 LYS A HA   1  
ATOM 1089  H HB2  . LYS A 1 71 ? -15.594 -2.898  -0.885  1.00 3.70  ? 71 LYS A HB2  1  
ATOM 1090  H HB3  . LYS A 1 71 ? -16.877 -1.690  -0.837  1.00 4.21  ? 71 LYS A HB3  1  
ATOM 1091  H HG2  . LYS A 1 71 ? -18.279 -4.078  -0.728  1.00 3.86  ? 71 LYS A HG2  1  
ATOM 1092  H HG3  . LYS A 1 71 ? -16.844 -4.418  0.240   1.00 3.74  ? 71 LYS A HG3  1  
ATOM 1093  H HD2  . LYS A 1 71 ? -18.246 -1.809  0.673   1.00 4.84  ? 71 LYS A HD2  1  
ATOM 1094  H HD3  . LYS A 1 71 ? -18.990 -3.269  1.324   1.00 4.97  ? 71 LYS A HD3  1  
ATOM 1095  H HE2  . LYS A 1 71 ? -17.047 -3.784  2.632   1.00 5.27  ? 71 LYS A HE2  1  
ATOM 1096  H HE3  . LYS A 1 71 ? -16.089 -2.553  1.810   1.00 5.40  ? 71 LYS A HE3  1  
ATOM 1097  H HZ1  . LYS A 1 71 ? -17.618 -0.872  2.723   1.00 6.30  ? 71 LYS A HZ1  1  
ATOM 1098  H HZ2  . LYS A 1 71 ? -18.414 -2.090  3.598   1.00 6.39  ? 71 LYS A HZ2  1  
ATOM 1099  H HZ3  . LYS A 1 71 ? -16.789 -1.726  3.929   1.00 6.11  ? 71 LYS A HZ3  1  
ATOM 1100  N N    . SER A 1 72 ? -18.618 -2.359  -4.205  1.00 4.42  ? 72 SER A N    1  
ATOM 1101  C CA   . SER A 1 72 ? -19.895 -1.736  -4.674  1.00 5.58  ? 72 SER A CA   1  
ATOM 1102  C C    . SER A 1 72 ? -21.029 -2.769  -4.622  1.00 5.86  ? 72 SER A C    1  
ATOM 1103  O O    . SER A 1 72 ? -20.825 -3.879  -5.088  1.00 5.92  ? 72 SER A O    1  
ATOM 1104  C CB   . SER A 1 72 ? -19.722 -1.231  -6.111  1.00 6.45  ? 72 SER A CB   1  
ATOM 1105  O OG   . SER A 1 72 ? -18.615 -0.339  -6.168  1.00 6.62  ? 72 SER A OG   1  
ATOM 1106  O OXT  . SER A 1 72 ? -22.086 -2.429  -4.113  1.00 6.32  ? 72 SER A OXT  1  
ATOM 1107  H H    . SER A 1 72 ? -18.011 -2.776  -4.854  1.00 4.24  ? 72 SER A H    1  
ATOM 1108  H HA   . SER A 1 72 ? -20.142 -0.903  -4.032  1.00 5.92  ? 72 SER A HA   1  
ATOM 1109  H HB2  . SER A 1 72 ? -19.540 -2.065  -6.769  1.00 6.89  ? 72 SER A HB2  1  
ATOM 1110  H HB3  . SER A 1 72 ? -20.625 -0.721  -6.422  1.00 6.83  ? 72 SER A HB3  1  
ATOM 1111  H HG   . SER A 1 72 ? -18.939 0.547   -5.990  1.00 6.94  ? 72 SER A HG   1  
ATOM 1112  N N    . ALA B 1 1  ? -9.539  -14.834 -38.332 1.00 14.81 ? 1  ALA B N    1  
ATOM 1113  C CA   . ALA B 1 1  ? -10.941 -15.347 -38.366 1.00 14.13 ? 1  ALA B CA   1  
ATOM 1114  C C    . ALA B 1 1  ? -11.315 -15.907 -36.988 1.00 13.41 ? 1  ALA B C    1  
ATOM 1115  O O    . ALA B 1 1  ? -11.022 -17.045 -36.668 1.00 13.48 ? 1  ALA B O    1  
ATOM 1116  C CB   . ALA B 1 1  ? -11.059 -16.451 -39.422 1.00 14.18 ? 1  ALA B CB   1  
ATOM 1117  H H1   . ALA B 1 1  ? -8.902  -15.585 -37.998 1.00 14.87 ? 1  ALA B H1   1  
ATOM 1118  H H2   . ALA B 1 1  ? -9.255  -14.537 -39.287 1.00 15.26 ? 1  ALA B H2   1  
ATOM 1119  H H3   . ALA B 1 1  ? -9.483  -14.019 -37.688 1.00 14.93 ? 1  ALA B H3   1  
ATOM 1120  H HA   . ALA B 1 1  ? -11.611 -14.538 -38.617 1.00 14.27 ? 1  ALA B HA   1  
ATOM 1121  H HB1  . ALA B 1 1  ? -10.327 -17.219 -39.223 1.00 14.46 ? 1  ALA B HB1  1  
ATOM 1122  H HB2  . ALA B 1 1  ? -12.050 -16.880 -39.384 1.00 13.94 ? 1  ALA B HB2  1  
ATOM 1123  H HB3  . ALA B 1 1  ? -10.885 -16.032 -40.402 1.00 14.35 ? 1  ALA B HB3  1  
ATOM 1124  N N    . SER B 1 2  ? -11.959 -15.109 -36.169 1.00 12.88 ? 2  SER B N    1  
ATOM 1125  C CA   . SER B 1 2  ? -12.357 -15.581 -34.804 1.00 12.30 ? 2  SER B CA   1  
ATOM 1126  C C    . SER B 1 2  ? -13.420 -14.642 -34.219 1.00 11.45 ? 2  SER B C    1  
ATOM 1127  O O    . SER B 1 2  ? -13.663 -13.565 -34.734 1.00 11.40 ? 2  SER B O    1  
ATOM 1128  C CB   . SER B 1 2  ? -11.129 -15.598 -33.886 1.00 12.49 ? 2  SER B CB   1  
ATOM 1129  O OG   . SER B 1 2  ? -10.476 -14.336 -33.939 1.00 12.82 ? 2  SER B OG   1  
ATOM 1130  H H    . SER B 1 2  ? -12.179 -14.196 -36.451 1.00 12.97 ? 2  SER B H    1  
ATOM 1131  H HA   . SER B 1 2  ? -12.764 -16.579 -34.877 1.00 12.53 ? 2  SER B HA   1  
ATOM 1132  H HB2  . SER B 1 2  ? -11.439 -15.794 -32.873 1.00 12.66 ? 2  SER B HB2  1  
ATOM 1133  H HB3  . SER B 1 2  ? -10.453 -16.379 -34.209 1.00 12.41 ? 2  SER B HB3  1  
ATOM 1134  H HG   . SER B 1 2  ? -9.726  -14.365 -33.341 1.00 13.11 ? 2  SER B HG   1  
ATOM 1135  N N    . VAL B 1 3  ? -14.053 -15.044 -33.143 1.00 10.94 ? 3  VAL B N    1  
ATOM 1136  C CA   . VAL B 1 3  ? -15.103 -14.184 -32.511 1.00 10.24 ? 3  VAL B CA   1  
ATOM 1137  C C    . VAL B 1 3  ? -14.530 -13.523 -31.250 1.00 9.35  ? 3  VAL B C    1  
ATOM 1138  O O    . VAL B 1 3  ? -13.731 -14.109 -30.541 1.00 9.36  ? 3  VAL B O    1  
ATOM 1139  C CB   . VAL B 1 3  ? -16.317 -15.044 -32.131 1.00 10.50 ? 3  VAL B CB   1  
ATOM 1140  C CG1  . VAL B 1 3  ? -17.452 -14.142 -31.636 1.00 10.46 ? 3  VAL B CG1  1  
ATOM 1141  C CG2  . VAL B 1 3  ? -16.795 -15.833 -33.355 1.00 11.15 ? 3  VAL B CG2  1  
ATOM 1142  H H    . VAL B 1 3  ? -13.837 -15.916 -32.748 1.00 11.14 ? 3  VAL B H    1  
ATOM 1143  H HA   . VAL B 1 3  ? -15.409 -13.419 -33.210 1.00 10.39 ? 3  VAL B HA   1  
ATOM 1144  H HB   . VAL B 1 3  ? -16.037 -15.731 -31.344 1.00 10.49 ? 3  VAL B HB   1  
ATOM 1145  H HG11 . VAL B 1 3  ? -17.600 -13.332 -32.336 1.00 10.59 ? 3  VAL B HG11 1  
ATOM 1146  H HG12 . VAL B 1 3  ? -18.361 -14.719 -31.554 1.00 10.33 ? 3  VAL B HG12 1  
ATOM 1147  H HG13 . VAL B 1 3  ? -17.194 -13.739 -30.668 1.00 10.64 ? 3  VAL B HG13 1  
ATOM 1148  H HG21 . VAL B 1 3  ? -16.766 -15.198 -34.227 1.00 11.42 ? 3  VAL B HG21 1  
ATOM 1149  H HG22 . VAL B 1 3  ? -16.149 -16.685 -33.508 1.00 11.34 ? 3  VAL B HG22 1  
ATOM 1150  H HG23 . VAL B 1 3  ? -17.807 -16.174 -33.191 1.00 11.36 ? 3  VAL B HG23 1  
ATOM 1151  N N    . ALA B 1 4  ? -14.939 -12.309 -30.967 1.00 8.75  ? 4  ALA B N    1  
ATOM 1152  C CA   . ALA B 1 4  ? -14.428 -11.605 -29.751 1.00 7.96  ? 4  ALA B CA   1  
ATOM 1153  C C    . ALA B 1 4  ? -15.506 -11.617 -28.661 1.00 7.01  ? 4  ALA B C    1  
ATOM 1154  O O    . ALA B 1 4  ? -16.675 -11.403 -28.928 1.00 7.03  ? 4  ALA B O    1  
ATOM 1155  C CB   . ALA B 1 4  ? -14.078 -10.157 -30.105 1.00 8.21  ? 4  ALA B CB   1  
ATOM 1156  H H    . ALA B 1 4  ? -15.585 -11.862 -31.552 1.00 8.95  ? 4  ALA B H    1  
ATOM 1157  H HA   . ALA B 1 4  ? -13.544 -12.109 -29.388 1.00 8.13  ? 4  ALA B HA   1  
ATOM 1158  H HB1  . ALA B 1 4  ? -14.959 -9.655  -30.479 1.00 8.39  ? 4  ALA B HB1  1  
ATOM 1159  H HB2  . ALA B 1 4  ? -13.720 -9.647  -29.224 1.00 8.38  ? 4  ALA B HB2  1  
ATOM 1160  H HB3  . ALA B 1 4  ? -13.310 -10.148 -30.865 1.00 8.31  ? 4  ALA B HB3  1  
ATOM 1161  N N    . THR B 1 5  ? -15.117 -11.866 -27.433 1.00 6.47  ? 5  THR B N    1  
ATOM 1162  C CA   . THR B 1 5  ? -16.111 -11.893 -26.313 1.00 5.79  ? 5  THR B CA   1  
ATOM 1163  C C    . THR B 1 5  ? -16.462 -10.455 -25.898 1.00 4.92  ? 5  THR B C    1  
ATOM 1164  O O    . THR B 1 5  ? -15.858 -9.503  -26.360 1.00 4.69  ? 5  THR B O    1  
ATOM 1165  C CB   . THR B 1 5  ? -15.513 -12.643 -25.113 1.00 6.15  ? 5  THR B CB   1  
ATOM 1166  O OG1  . THR B 1 5  ? -14.231 -12.108 -24.803 1.00 6.56  ? 5  THR B OG1  1  
ATOM 1167  C CG2  . THR B 1 5  ? -15.375 -14.129 -25.451 1.00 6.81  ? 5  THR B CG2  1  
ATOM 1168  H H    . THR B 1 5  ? -14.168 -12.032 -27.247 1.00 6.72  ? 5  THR B H    1  
ATOM 1169  H HA   . THR B 1 5  ? -17.007 -12.399 -26.641 1.00 5.97  ? 5  THR B HA   1  
ATOM 1170  H HB   . THR B 1 5  ? -16.164 -12.533 -24.261 1.00 5.99  ? 5  THR B HB   1  
ATOM 1171  H HG1  . THR B 1 5  ? -14.357 -11.237 -24.425 1.00 6.97  ? 5  THR B HG1  1  
ATOM 1172  H HG21 . THR B 1 5  ? -16.331 -14.516 -25.771 1.00 7.08  ? 5  THR B HG21 1  
ATOM 1173  H HG22 . THR B 1 5  ? -14.652 -14.254 -26.243 1.00 7.02  ? 5  THR B HG22 1  
ATOM 1174  H HG23 . THR B 1 5  ? -15.045 -14.668 -24.574 1.00 7.11  ? 5  THR B HG23 1  
ATOM 1175  N N    . GLU B 1 6  ? -17.438 -10.288 -25.032 1.00 4.62  ? 6  GLU B N    1  
ATOM 1176  C CA   . GLU B 1 6  ? -17.825 -8.909  -24.595 1.00 3.82  ? 6  GLU B CA   1  
ATOM 1177  C C    . GLU B 1 6  ? -17.194 -8.572  -23.237 1.00 3.24  ? 6  GLU B C    1  
ATOM 1178  O O    . GLU B 1 6  ? -17.758 -7.846  -22.442 1.00 3.60  ? 6  GLU B O    1  
ATOM 1179  C CB   . GLU B 1 6  ? -19.353 -8.807  -24.509 1.00 4.37  ? 6  GLU B CB   1  
ATOM 1180  C CG   . GLU B 1 6  ? -19.928 -8.517  -25.900 1.00 5.20  ? 6  GLU B CG   1  
ATOM 1181  C CD   . GLU B 1 6  ? -19.582 -7.083  -26.313 1.00 5.80  ? 6  GLU B CD   1  
ATOM 1182  O OE1  . GLU B 1 6  ? -20.281 -6.178  -25.886 1.00 6.17  ? 6  GLU B OE1  1  
ATOM 1183  O OE2  . GLU B 1 6  ? -18.623 -6.913  -27.049 1.00 6.18  ? 6  GLU B OE2  1  
ATOM 1184  H H    . GLU B 1 6  ? -17.914 -11.066 -24.673 1.00 5.02  ? 6  GLU B H    1  
ATOM 1185  H HA   . GLU B 1 6  ? -17.461 -8.205  -25.322 1.00 3.46  ? 6  GLU B HA   1  
ATOM 1186  H HB2  . GLU B 1 6  ? -19.756 -9.739  -24.139 1.00 4.83  ? 6  GLU B HB2  1  
ATOM 1187  H HB3  . GLU B 1 6  ? -19.624 -8.006  -23.837 1.00 4.04  ? 6  GLU B HB3  1  
ATOM 1188  H HG2  . GLU B 1 6  ? -19.506 -9.211  -26.613 1.00 5.47  ? 6  GLU B HG2  1  
ATOM 1189  H HG3  . GLU B 1 6  ? -21.001 -8.634  -25.877 1.00 5.45  ? 6  GLU B HG3  1  
ATOM 1190  N N    . LEU B 1 7  ? -16.013 -9.073  -22.991 1.00 2.60  ? 7  LEU B N    1  
ATOM 1191  C CA   . LEU B 1 7  ? -15.288 -8.789  -21.726 1.00 2.31  ? 7  LEU B CA   1  
ATOM 1192  C C    . LEU B 1 7  ? -13.868 -8.395  -22.121 1.00 1.54  ? 7  LEU B C    1  
ATOM 1193  O O    . LEU B 1 7  ? -13.434 -7.275  -21.922 1.00 1.71  ? 7  LEU B O    1  
ATOM 1194  C CB   . LEU B 1 7  ? -15.208 -10.041 -20.837 1.00 2.52  ? 7  LEU B CB   1  
ATOM 1195  C CG   . LEU B 1 7  ? -16.525 -10.830 -20.807 1.00 3.16  ? 7  LEU B CG   1  
ATOM 1196  C CD1  . LEU B 1 7  ? -17.711 -9.901  -20.526 1.00 3.96  ? 7  LEU B CD1  1  
ATOM 1197  C CD2  . LEU B 1 7  ? -16.714 -11.537 -22.150 1.00 3.09  ? 7  LEU B CD2  1  
ATOM 1198  H H    . LEU B 1 7  ? -15.583 -9.629  -23.656 1.00 2.54  ? 7  LEU B H    1  
ATOM 1199  H HA   . LEU B 1 7  ? -15.768 -7.985  -21.194 1.00 2.79  ? 7  LEU B HA   1  
ATOM 1200  H HB2  . LEU B 1 7  ? -14.425 -10.686 -21.204 1.00 2.09  ? 7  LEU B HB2  1  
ATOM 1201  H HB3  . LEU B 1 7  ? -14.964 -9.733  -19.848 1.00 2.90  ? 7  LEU B HB3  1  
ATOM 1202  H HG   . LEU B 1 7  ? -16.470 -11.573 -20.024 1.00 3.35  ? 7  LEU B HG   1  
ATOM 1203  H HD11 . LEU B 1 7  ? -17.352 -8.897  -20.353 1.00 4.26  ? 7  LEU B HD11 1  
ATOM 1204  H HD12 . LEU B 1 7  ? -18.381 -9.902  -21.373 1.00 4.38  ? 7  LEU B HD12 1  
ATOM 1205  H HD13 . LEU B 1 7  ? -18.239 -10.249 -19.651 1.00 4.19  ? 7  LEU B HD13 1  
ATOM 1206  H HD21 . LEU B 1 7  ? -15.812 -11.432 -22.739 1.00 3.19  ? 7  LEU B HD21 1  
ATOM 1207  H HD22 . LEU B 1 7  ? -16.912 -12.583 -21.982 1.00 3.29  ? 7  LEU B HD22 1  
ATOM 1208  H HD23 . LEU B 1 7  ? -17.541 -11.090 -22.680 1.00 3.35  ? 7  LEU B HD23 1  
ATOM 1209  N N    . ARG B 1 8  ? -13.169 -9.340  -22.717 1.00 1.31  ? 8  ARG B N    1  
ATOM 1210  C CA   . ARG B 1 8  ? -11.792 -9.153  -23.203 1.00 1.49  ? 8  ARG B CA   1  
ATOM 1211  C C    . ARG B 1 8  ? -10.837 -8.980  -22.027 1.00 1.33  ? 8  ARG B C    1  
ATOM 1212  O O    . ARG B 1 8  ? -10.055 -9.857  -21.715 1.00 1.98  ? 8  ARG B O    1  
ATOM 1213  C CB   . ARG B 1 8  ? -11.751 -7.921  -24.090 1.00 2.16  ? 8  ARG B CB   1  
ATOM 1214  C CG   . ARG B 1 8  ? -11.052 -8.244  -25.414 1.00 2.69  ? 8  ARG B CG   1  
ATOM 1215  C CD   . ARG B 1 8  ? -10.998 -6.985  -26.282 1.00 3.00  ? 8  ARG B CD   1  
ATOM 1216  N NE   . ARG B 1 8  ? -9.788  -7.031  -27.152 1.00 3.47  ? 8  ARG B NE   1  
ATOM 1217  C CZ   . ARG B 1 8  ? -9.910  -7.283  -28.429 1.00 3.94  ? 8  ARG B CZ   1  
ATOM 1218  N NH1  . ARG B 1 8  ? -10.087 -6.299  -29.275 1.00 4.33  ? 8  ARG B NH1  1  
ATOM 1219  N NH2  . ARG B 1 8  ? -9.853  -8.518  -28.859 1.00 4.43  ? 8  ARG B NH2  1  
ATOM 1220  H H    . ARG B 1 8  ? -13.577 -10.184 -22.864 1.00 1.64  ? 8  ARG B H    1  
ATOM 1221  H HA   . ARG B 1 8  ? -11.507 -10.020 -23.777 1.00 1.85  ? 8  ARG B HA   1  
ATOM 1222  H HB2  . ARG B 1 8  ? -12.758 -7.588  -24.278 1.00 2.24  ? 8  ARG B HB2  1  
ATOM 1223  H HB3  . ARG B 1 8  ? -11.219 -7.155  -23.579 1.00 2.53  ? 8  ARG B HB3  1  
ATOM 1224  H HG2  . ARG B 1 8  ? -10.047 -8.589  -25.215 1.00 2.99  ? 8  ARG B HG2  1  
ATOM 1225  H HG3  . ARG B 1 8  ? -11.602 -9.013  -25.934 1.00 2.99  ? 8  ARG B HG3  1  
ATOM 1226  H HD2  . ARG B 1 8  ? -11.884 -6.934  -26.898 1.00 3.17  ? 8  ARG B HD2  1  
ATOM 1227  H HD3  . ARG B 1 8  ? -10.951 -6.112  -25.647 1.00 3.16  ? 8  ARG B HD3  1  
ATOM 1228  H HE   . ARG B 1 8  ? -8.902  -6.869  -26.767 1.00 3.66  ? 8  ARG B HE   1  
ATOM 1229  H HH11 . ARG B 1 8  ? -10.128 -5.356  -28.944 1.00 4.37  ? 8  ARG B HH11 1  
ATOM 1230  H HH12 . ARG B 1 8  ? -10.180 -6.489  -30.253 1.00 4.82  ? 8  ARG B HH12 1  
ATOM 1231  H HH21 . ARG B 1 8  ? -9.718  -9.269  -28.210 1.00 4.49  ? 8  ARG B HH21 1  
ATOM 1232  H HH22 . ARG B 1 8  ? -9.946  -8.715  -29.835 1.00 4.97  ? 8  ARG B HH22 1  
ATOM 1233  N N    . CYS B 1 9  ? -10.929 -7.849  -21.379 1.00 0.80  ? 9  CYS B N    1  
ATOM 1234  C CA   . CYS B 1 9  ? -10.073 -7.521  -20.204 1.00 0.67  ? 9  CYS B CA   1  
ATOM 1235  C C    . CYS B 1 9  ? -8.635  -8.052  -20.396 1.00 0.60  ? 9  CYS B C    1  
ATOM 1236  O O    . CYS B 1 9  ? -8.140  -8.148  -21.506 1.00 0.78  ? 9  CYS B O    1  
ATOM 1237  C CB   . CYS B 1 9  ? -10.705 -8.125  -18.953 1.00 0.79  ? 9  CYS B CB   1  
ATOM 1238  S SG   . CYS B 1 9  ? -12.511 -8.020  -19.045 1.00 1.22  ? 9  CYS B SG   1  
ATOM 1239  H H    . CYS B 1 9  ? -11.598 -7.205  -21.665 1.00 0.99  ? 9  CYS B H    1  
ATOM 1240  H HA   . CYS B 1 9  ? -10.035 -6.447  -20.091 1.00 0.83  ? 9  CYS B HA   1  
ATOM 1241  H HB2  . CYS B 1 9  ? -10.409 -9.155  -18.867 1.00 0.89  ? 9  CYS B HB2  1  
ATOM 1242  H HB3  . CYS B 1 9  ? -10.364 -7.578  -18.100 1.00 0.93  ? 9  CYS B HB3  1  
ATOM 1243  N N    . GLN B 1 10 ? -7.956  -8.372  -19.320 1.00 0.50  ? 10 GLN B N    1  
ATOM 1244  C CA   . GLN B 1 10 ? -6.556  -8.878  -19.420 1.00 0.47  ? 10 GLN B CA   1  
ATOM 1245  C C    . GLN B 1 10 ? -6.243  -9.837  -18.253 1.00 0.40  ? 10 GLN B C    1  
ATOM 1246  O O    . GLN B 1 10 ? -5.472  -10.765 -18.405 1.00 0.43  ? 10 GLN B O    1  
ATOM 1247  C CB   . GLN B 1 10 ? -5.608  -7.688  -19.374 1.00 0.53  ? 10 GLN B CB   1  
ATOM 1248  C CG   . GLN B 1 10 ? -5.188  -7.322  -20.796 1.00 0.64  ? 10 GLN B CG   1  
ATOM 1249  C CD   . GLN B 1 10 ? -3.747  -6.810  -20.795 1.00 1.21  ? 10 GLN B CD   1  
ATOM 1250  O OE1  . GLN B 1 10 ? -2.829  -7.545  -21.098 1.00 1.88  ? 10 GLN B OE1  1  
ATOM 1251  N NE2  . GLN B 1 10 ? -3.507  -5.569  -20.465 1.00 1.84  ? 10 GLN B NE2  1  
ATOM 1252  H H    . GLN B 1 10 ? -8.360  -8.260  -18.448 1.00 0.61  ? 10 GLN B H    1  
ATOM 1253  H HA   . GLN B 1 10 ? -6.429  -9.401  -20.355 1.00 0.53  ? 10 GLN B HA   1  
ATOM 1254  H HB2  . GLN B 1 10 ? -6.110  -6.848  -18.918 1.00 0.58  ? 10 GLN B HB2  1  
ATOM 1255  H HB3  . GLN B 1 10 ? -4.741  -7.946  -18.795 1.00 0.51  ? 10 GLN B HB3  1  
ATOM 1256  H HG2  . GLN B 1 10 ? -5.261  -8.196  -21.425 1.00 1.12  ? 10 GLN B HG2  1  
ATOM 1257  H HG3  . GLN B 1 10 ? -5.844  -6.552  -21.172 1.00 1.14  ? 10 GLN B HG3  1  
ATOM 1258  H HE21 . GLN B 1 10 ? -4.247  -4.974  -20.221 1.00 2.04  ? 10 GLN B HE21 1  
ATOM 1259  H HE22 . GLN B 1 10 ? -2.588  -5.231  -20.463 1.00 2.46  ? 10 GLN B HE22 1  
ATOM 1260  N N    . CYS B 1 11 ? -6.821  -9.596  -17.092 1.00 0.35  ? 11 CYS B N    1  
ATOM 1261  C CA   . CYS B 1 11 ? -6.578  -10.458 -15.877 1.00 0.32  ? 11 CYS B CA   1  
ATOM 1262  C C    . CYS B 1 11 ? -6.437  -11.941 -16.260 1.00 0.37  ? 11 CYS B C    1  
ATOM 1263  O O    . CYS B 1 11 ? -7.237  -12.473 -17.011 1.00 0.51  ? 11 CYS B O    1  
ATOM 1264  C CB   . CYS B 1 11 ? -7.761  -10.353 -14.888 1.00 0.33  ? 11 CYS B CB   1  
ATOM 1265  S SG   . CYS B 1 11 ? -9.073  -9.276  -15.534 1.00 0.49  ? 11 CYS B SG   1  
ATOM 1266  H H    . CYS B 1 11 ? -7.411  -8.825  -17.013 1.00 0.37  ? 11 CYS B H    1  
ATOM 1267  H HA   . CYS B 1 11 ? -5.677  -10.131 -15.381 1.00 0.33  ? 11 CYS B HA   1  
ATOM 1268  H HB2  . CYS B 1 11 ? -8.169  -11.336 -14.717 1.00 0.41  ? 11 CYS B HB2  1  
ATOM 1269  H HB3  . CYS B 1 11 ? -7.403  -9.955  -13.950 1.00 0.33  ? 11 CYS B HB3  1  
ATOM 1270  N N    . LEU B 1 12 ? -5.455  -12.625 -15.706 1.00 0.40  ? 12 LEU B N    1  
ATOM 1271  C CA   . LEU B 1 12 ? -5.300  -14.086 -15.995 1.00 0.45  ? 12 LEU B CA   1  
ATOM 1272  C C    . LEU B 1 12 ? -6.426  -14.802 -15.238 1.00 0.45  ? 12 LEU B C    1  
ATOM 1273  O O    . LEU B 1 12 ? -7.360  -15.318 -15.820 1.00 0.49  ? 12 LEU B O    1  
ATOM 1274  C CB   . LEU B 1 12 ? -3.932  -14.618 -15.491 1.00 0.49  ? 12 LEU B CB   1  
ATOM 1275  C CG   . LEU B 1 12 ? -2.815  -13.585 -15.679 1.00 0.83  ? 12 LEU B CG   1  
ATOM 1276  C CD1  . LEU B 1 12 ? -1.504  -14.177 -15.160 1.00 1.04  ? 12 LEU B CD1  1  
ATOM 1277  C CD2  . LEU B 1 12 ? -2.655  -13.237 -17.160 1.00 1.56  ? 12 LEU B CD2  1  
ATOM 1278  H H    . LEU B 1 12 ? -4.852  -12.185 -15.073 1.00 0.49  ? 12 LEU B H    1  
ATOM 1279  H HA   . LEU B 1 12 ? -5.400  -14.264 -17.055 1.00 0.48  ? 12 LEU B HA   1  
ATOM 1280  H HB2  . LEU B 1 12 ? -4.008  -14.853 -14.441 1.00 0.99  ? 12 LEU B HB2  1  
ATOM 1281  H HB3  . LEU B 1 12 ? -3.676  -15.514 -16.034 1.00 0.99  ? 12 LEU B HB3  1  
ATOM 1282  H HG   . LEU B 1 12 ? -3.051  -12.692 -15.118 1.00 1.56  ? 12 LEU B HG   1  
ATOM 1283  H HD11 . LEU B 1 12 ? -1.429  -15.210 -15.465 1.00 1.49  ? 12 LEU B HD11 1  
ATOM 1284  H HD12 . LEU B 1 12 ? -0.673  -13.620 -15.568 1.00 1.52  ? 12 LEU B HD12 1  
ATOM 1285  H HD13 . LEU B 1 12 ? -1.483  -14.116 -14.083 1.00 1.64  ? 12 LEU B HD13 1  
ATOM 1286  H HD21 . LEU B 1 12 ? -2.415  -14.130 -17.715 1.00 1.96  ? 12 LEU B HD21 1  
ATOM 1287  H HD22 . LEU B 1 12 ? -3.574  -12.813 -17.532 1.00 1.94  ? 12 LEU B HD22 1  
ATOM 1288  H HD23 . LEU B 1 12 ? -1.855  -12.518 -17.272 1.00 2.16  ? 12 LEU B HD23 1  
ATOM 1289  N N    . GLN B 1 13 ? -6.329  -14.787 -13.934 1.00 0.44  ? 13 GLN B N    1  
ATOM 1290  C CA   . GLN B 1 13 ? -7.347  -15.401 -13.036 1.00 0.46  ? 13 GLN B CA   1  
ATOM 1291  C C    . GLN B 1 13 ? -6.996  -14.965 -11.603 1.00 0.42  ? 13 GLN B C    1  
ATOM 1292  O O    . GLN B 1 13 ? -6.982  -15.759 -10.684 1.00 0.60  ? 13 GLN B O    1  
ATOM 1293  C CB   . GLN B 1 13 ? -7.280  -16.926 -13.157 1.00 0.53  ? 13 GLN B CB   1  
ATOM 1294  C CG   . GLN B 1 13 ? -8.428  -17.431 -14.040 1.00 1.12  ? 13 GLN B CG   1  
ATOM 1295  C CD   . GLN B 1 13 ? -7.934  -18.580 -14.927 1.00 1.40  ? 13 GLN B CD   1  
ATOM 1296  O OE1  . GLN B 1 13 ? -8.394  -19.697 -14.804 1.00 1.77  ? 13 GLN B OE1  1  
ATOM 1297  N NE2  . GLN B 1 13 ? -7.012  -18.351 -15.825 1.00 2.09  ? 13 GLN B NE2  1  
ATOM 1298  H H    . GLN B 1 13 ? -5.566  -14.341 -13.526 1.00 0.43  ? 13 GLN B H    1  
ATOM 1299  H HA   . GLN B 1 13 ? -8.332  -15.045 -13.297 1.00 0.47  ? 13 GLN B HA   1  
ATOM 1300  H HB2  . GLN B 1 13 ? -6.335  -17.208 -13.600 1.00 0.99  ? 13 GLN B HB2  1  
ATOM 1301  H HB3  . GLN B 1 13 ? -7.357  -17.357 -12.180 1.00 0.86  ? 13 GLN B HB3  1  
ATOM 1302  H HG2  . GLN B 1 13 ? -9.234  -17.785 -13.413 1.00 1.51  ? 13 GLN B HG2  1  
ATOM 1303  H HG3  . GLN B 1 13 ? -8.787  -16.627 -14.663 1.00 1.66  ? 13 GLN B HG3  1  
ATOM 1304  H HE21 . GLN B 1 13 ? -6.639  -17.451 -15.928 1.00 2.59  ? 13 GLN B HE21 1  
ATOM 1305  H HE22 . GLN B 1 13 ? -6.693  -19.081 -16.395 1.00 2.41  ? 13 GLN B HE22 1  
ATOM 1306  N N    . THR B 1 14 ? -6.667  -13.693 -11.457 1.00 0.37  ? 14 THR B N    1  
ATOM 1307  C CA   . THR B 1 14 ? -6.234  -13.087 -10.151 1.00 0.33  ? 14 THR B CA   1  
ATOM 1308  C C    . THR B 1 14 ? -5.589  -14.099 -9.208  1.00 0.35  ? 14 THR B C    1  
ATOM 1309  O O    . THR B 1 14 ? -6.251  -14.796 -8.458  1.00 0.39  ? 14 THR B O    1  
ATOM 1310  C CB   . THR B 1 14 ? -7.360  -12.386 -9.415  1.00 0.33  ? 14 THR B CB   1  
ATOM 1311  O OG1  . THR B 1 14 ? -8.531  -13.197 -9.402  1.00 0.39  ? 14 THR B OG1  1  
ATOM 1312  C CG2  . THR B 1 14 ? -7.641  -11.043 -10.086 1.00 0.32  ? 14 THR B CG2  1  
ATOM 1313  H H    . THR B 1 14 ? -6.672  -13.120 -12.252 1.00 0.51  ? 14 THR B H    1  
ATOM 1314  H HA   . THR B 1 14 ? -5.498  -12.345 -10.383 1.00 0.30  ? 14 THR B HA   1  
ATOM 1315  H HB   . THR B 1 14 ? -7.019  -12.203 -8.402  1.00 0.32  ? 14 THR B HB   1  
ATOM 1316  H HG1  . THR B 1 14 ? -8.909  -13.197 -10.286 1.00 0.95  ? 14 THR B HG1  1  
ATOM 1317  H HG21 . THR B 1 14 ? -6.706  -10.529 -10.261 1.00 1.03  ? 14 THR B HG21 1  
ATOM 1318  H HG22 . THR B 1 14 ? -8.141  -11.208 -11.027 1.00 1.06  ? 14 THR B HG22 1  
ATOM 1319  H HG23 . THR B 1 14 ? -8.266  -10.443 -9.443  1.00 1.06  ? 14 THR B HG23 1  
ATOM 1320  N N    . LEU B 1 15 ? -4.290  -14.135 -9.210  1.00 0.36  ? 15 LEU B N    1  
ATOM 1321  C CA   . LEU B 1 15 ? -3.557  -15.050 -8.292  1.00 0.42  ? 15 LEU B CA   1  
ATOM 1322  C C    . LEU B 1 15 ? -3.573  -14.444 -6.884  1.00 0.36  ? 15 LEU B C    1  
ATOM 1323  O O    . LEU B 1 15 ? -3.936  -13.295 -6.696  1.00 0.52  ? 15 LEU B O    1  
ATOM 1324  C CB   . LEU B 1 15 ? -2.113  -15.223 -8.775  1.00 0.57  ? 15 LEU B CB   1  
ATOM 1325  C CG   . LEU B 1 15 ? -2.112  -15.967 -10.115 1.00 0.65  ? 15 LEU B CG   1  
ATOM 1326  C CD1  . LEU B 1 15 ? -0.938  -15.487 -10.973 1.00 0.74  ? 15 LEU B CD1  1  
ATOM 1327  C CD2  . LEU B 1 15 ? -1.979  -17.471 -9.860  1.00 1.78  ? 15 LEU B CD2  1  
ATOM 1328  H H    . LEU B 1 15 ? -3.795  -13.521 -9.800  1.00 0.35  ? 15 LEU B H    1  
ATOM 1329  H HA   . LEU B 1 15 ? -4.051  -16.012 -8.274  1.00 0.51  ? 15 LEU B HA   1  
ATOM 1330  H HB2  . LEU B 1 15 ? -1.653  -14.253 -8.897  1.00 1.12  ? 15 LEU B HB2  1  
ATOM 1331  H HB3  . LEU B 1 15 ? -1.558  -15.798 -8.049  1.00 0.91  ? 15 LEU B HB3  1  
ATOM 1332  H HG   . LEU B 1 15 ? -3.039  -15.770 -10.635 1.00 1.32  ? 15 LEU B HG   1  
ATOM 1333  H HD11 . LEU B 1 15 ? -0.101  -15.243 -10.335 1.00 1.44  ? 15 LEU B HD11 1  
ATOM 1334  H HD12 . LEU B 1 15 ? -0.651  -16.268 -11.661 1.00 1.20  ? 15 LEU B HD12 1  
ATOM 1335  H HD13 . LEU B 1 15 ? -1.234  -14.609 -11.529 1.00 1.40  ? 15 LEU B HD13 1  
ATOM 1336  H HD21 . LEU B 1 15 ? -2.590  -17.747 -9.013  1.00 2.33  ? 15 LEU B HD21 1  
ATOM 1337  H HD22 . LEU B 1 15 ? -2.310  -18.015 -10.734 1.00 2.33  ? 15 LEU B HD22 1  
ATOM 1338  H HD23 . LEU B 1 15 ? -0.948  -17.712 -9.654  1.00 2.19  ? 15 LEU B HD23 1  
ATOM 1339  N N    . GLN B 1 16 ? -3.205  -15.206 -5.892  1.00 0.47  ? 16 GLN B N    1  
ATOM 1340  C CA   . GLN B 1 16 ? -3.223  -14.680 -4.499  1.00 0.42  ? 16 GLN B CA   1  
ATOM 1341  C C    . GLN B 1 16 ? -1.816  -14.277 -4.062  1.00 0.39  ? 16 GLN B C    1  
ATOM 1342  O O    . GLN B 1 16 ? -1.211  -14.896 -3.206  1.00 0.47  ? 16 GLN B O    1  
ATOM 1343  C CB   . GLN B 1 16 ? -3.790  -15.745 -3.552  1.00 0.49  ? 16 GLN B CB   1  
ATOM 1344  C CG   . GLN B 1 16 ? -5.283  -15.487 -3.327  1.00 0.60  ? 16 GLN B CG   1  
ATOM 1345  C CD   . GLN B 1 16 ? -5.859  -16.569 -2.410  1.00 0.78  ? 16 GLN B CD   1  
ATOM 1346  O OE1  . GLN B 1 16 ? -6.424  -17.538 -2.877  1.00 1.48  ? 16 GLN B OE1  1  
ATOM 1347  N NE2  . GLN B 1 16 ? -5.741  -16.445 -1.114  1.00 1.31  ? 16 GLN B NE2  1  
ATOM 1348  H H    . GLN B 1 16 ? -2.932  -16.122 -6.062  1.00 0.72  ? 16 GLN B H    1  
ATOM 1349  H HA   . GLN B 1 16 ? -3.850  -13.800 -4.465  1.00 0.43  ? 16 GLN B HA   1  
ATOM 1350  H HB2  . GLN B 1 16 ? -3.654  -16.724 -3.988  1.00 0.51  ? 16 GLN B HB2  1  
ATOM 1351  H HB3  . GLN B 1 16 ? -3.273  -15.699 -2.605  1.00 0.50  ? 16 GLN B HB3  1  
ATOM 1352  H HG2  . GLN B 1 16 ? -5.414  -14.517 -2.868  1.00 0.75  ? 16 GLN B HG2  1  
ATOM 1353  H HG3  . GLN B 1 16 ? -5.798  -15.509 -4.275  1.00 0.72  ? 16 GLN B HG3  1  
ATOM 1354  H HE21 . GLN B 1 16 ? -5.285  -15.664 -0.734  1.00 1.97  ? 16 GLN B HE21 1  
ATOM 1355  H HE22 . GLN B 1 16 ? -6.109  -17.133 -0.521  1.00 1.46  ? 16 GLN B HE22 1  
ATOM 1356  N N    . GLY B 1 17 ? -1.313  -13.216 -4.633  1.00 0.37  ? 17 GLY B N    1  
ATOM 1357  C CA   . GLY B 1 17 ? 0.031   -12.699 -4.254  1.00 0.45  ? 17 GLY B CA   1  
ATOM 1358  C C    . GLY B 1 17 ? 1.112   -13.741 -4.517  1.00 0.41  ? 17 GLY B C    1  
ATOM 1359  O O    . GLY B 1 17 ? 1.503   -14.479 -3.630  1.00 0.57  ? 17 GLY B O    1  
ATOM 1360  H H    . GLY B 1 17 ? -1.841  -12.740 -5.308  1.00 0.35  ? 17 GLY B H    1  
ATOM 1361  H HA2  . GLY B 1 17 ? 0.246   -11.813 -4.830  1.00 0.56  ? 17 GLY B HA2  1  
ATOM 1362  H HA3  . GLY B 1 17 ? 0.031   -12.449 -3.204  1.00 0.59  ? 17 GLY B HA3  1  
ATOM 1363  N N    . ILE B 1 18 ? 1.625   -13.779 -5.716  1.00 0.39  ? 18 ILE B N    1  
ATOM 1364  C CA   . ILE B 1 18 ? 2.711   -14.745 -6.028  1.00 0.49  ? 18 ILE B CA   1  
ATOM 1365  C C    . ILE B 1 18 ? 4.033   -14.143 -5.542  1.00 0.51  ? 18 ILE B C    1  
ATOM 1366  O O    . ILE B 1 18 ? 4.047   -13.126 -4.868  1.00 0.72  ? 18 ILE B O    1  
ATOM 1367  C CB   . ILE B 1 18 ? 2.739   -15.069 -7.540  1.00 0.67  ? 18 ILE B CB   1  
ATOM 1368  C CG1  . ILE B 1 18 ? 3.602   -14.065 -8.319  1.00 0.72  ? 18 ILE B CG1  1  
ATOM 1369  C CG2  . ILE B 1 18 ? 1.313   -15.065 -8.107  1.00 0.74  ? 18 ILE B CG2  1  
ATOM 1370  C CD1  . ILE B 1 18 ? 3.159   -12.640 -8.011  1.00 0.67  ? 18 ILE B CD1  1  
ATOM 1371  H H    . ILE B 1 18 ? 1.316   -13.156 -6.400  1.00 0.44  ? 18 ILE B H    1  
ATOM 1372  H HA   . ILE B 1 18 ? 2.535   -15.652 -5.484  1.00 0.54  ? 18 ILE B HA   1  
ATOM 1373  H HB   . ILE B 1 18 ? 3.150   -16.054 -7.664  1.00 0.79  ? 18 ILE B HB   1  
ATOM 1374  H HG12 . ILE B 1 18 ? 4.636   -14.187 -8.040  1.00 0.70  ? 18 ILE B HG12 1  
ATOM 1375  H HG13 . ILE B 1 18 ? 3.494   -14.249 -9.379  1.00 0.91  ? 18 ILE B HG13 1  
ATOM 1376  H HG21 . ILE B 1 18 ? 0.627   -15.437 -7.360  1.00 1.30  ? 18 ILE B HG21 1  
ATOM 1377  H HG22 . ILE B 1 18 ? 1.036   -14.058 -8.381  1.00 1.15  ? 18 ILE B HG22 1  
ATOM 1378  H HG23 . ILE B 1 18 ? 1.273   -15.699 -8.980  1.00 1.25  ? 18 ILE B HG23 1  
ATOM 1379  H HD11 . ILE B 1 18 ? 2.092   -12.560 -8.154  1.00 1.21  ? 18 ILE B HD11 1  
ATOM 1380  H HD12 . ILE B 1 18 ? 3.404   -12.405 -6.986  1.00 1.17  ? 18 ILE B HD12 1  
ATOM 1381  H HD13 . ILE B 1 18 ? 3.666   -11.959 -8.670  1.00 1.16  ? 18 ILE B HD13 1  
ATOM 1382  N N    . HIS B 1 19 ? 5.138   -14.749 -5.857  1.00 0.45  ? 19 HIS B N    1  
ATOM 1383  C CA   . HIS B 1 19 ? 6.433   -14.191 -5.386  1.00 0.46  ? 19 HIS B CA   1  
ATOM 1384  C C    . HIS B 1 19 ? 6.987   -13.241 -6.469  1.00 0.38  ? 19 HIS B C    1  
ATOM 1385  O O    . HIS B 1 19 ? 6.794   -13.484 -7.648  1.00 0.35  ? 19 HIS B O    1  
ATOM 1386  C CB   . HIS B 1 19 ? 7.394   -15.354 -5.058  1.00 0.54  ? 19 HIS B CB   1  
ATOM 1387  C CG   . HIS B 1 19 ? 8.650   -15.292 -5.881  1.00 0.60  ? 19 HIS B CG   1  
ATOM 1388  N ND1  . HIS B 1 19 ? 9.898   -15.100 -5.314  1.00 0.76  ? 19 HIS B ND1  1  
ATOM 1389  C CD2  . HIS B 1 19 ? 8.863   -15.419 -7.226  1.00 0.60  ? 19 HIS B CD2  1  
ATOM 1390  C CE1  . HIS B 1 19 ? 10.798  -15.117 -6.309  1.00 0.81  ? 19 HIS B CE1  1  
ATOM 1391  N NE2  . HIS B 1 19 ? 10.222  -15.311 -7.498  1.00 0.74  ? 19 HIS B NE2  1  
ATOM 1392  H H    . HIS B 1 19 ? 5.113   -15.564 -6.396  1.00 0.55  ? 19 HIS B H    1  
ATOM 1393  H HA   . HIS B 1 19 ? 6.244   -13.629 -4.486  1.00 0.50  ? 19 HIS B HA   1  
ATOM 1394  H HB2  . HIS B 1 19 ? 7.659   -15.307 -4.013  1.00 0.64  ? 19 HIS B HB2  1  
ATOM 1395  H HB3  . HIS B 1 19 ? 6.891   -16.291 -5.249  1.00 0.52  ? 19 HIS B HB3  1  
ATOM 1396  H HD1  . HIS B 1 19 ? 10.088  -14.974 -4.360  1.00 0.84  ? 19 HIS B HD1  1  
ATOM 1397  H HD2  . HIS B 1 19 ? 8.088   -15.550 -7.963  1.00 0.55  ? 19 HIS B HD2  1  
ATOM 1398  H HE1  . HIS B 1 19 ? 11.858  -14.970 -6.168  1.00 0.93  ? 19 HIS B HE1  1  
ATOM 1399  N N    . PRO B 1 20 ? 7.633   -12.170 -6.045  1.00 0.39  ? 20 PRO B N    1  
ATOM 1400  C CA   . PRO B 1 20 ? 8.189   -11.167 -6.970  1.00 0.35  ? 20 PRO B CA   1  
ATOM 1401  C C    . PRO B 1 20 ? 9.472   -11.688 -7.642  1.00 0.37  ? 20 PRO B C    1  
ATOM 1402  O O    . PRO B 1 20 ? 9.434   -12.719 -8.283  1.00 0.43  ? 20 PRO B O    1  
ATOM 1403  C CB   . PRO B 1 20 ? 8.423   -9.945  -6.072  1.00 0.39  ? 20 PRO B CB   1  
ATOM 1404  C CG   . PRO B 1 20 ? 8.545   -10.483 -4.632  1.00 0.47  ? 20 PRO B CG   1  
ATOM 1405  C CD   . PRO B 1 20 ? 7.863   -11.858 -4.618  1.00 0.46  ? 20 PRO B CD   1  
ATOM 1406  H HA   . PRO B 1 20 ? 7.460   -10.925 -7.727  1.00 0.32  ? 20 PRO B HA   1  
ATOM 1407  H HB2  . PRO B 1 20 ? 9.321   -9.428  -6.361  1.00 0.40  ? 20 PRO B HB2  1  
ATOM 1408  H HB3  . PRO B 1 20 ? 7.577   -9.280  -6.136  1.00 0.40  ? 20 PRO B HB3  1  
ATOM 1409  H HG2  . PRO B 1 20 ? 9.587   -10.583 -4.362  1.00 0.50  ? 20 PRO B HG2  1  
ATOM 1410  H HG3  . PRO B 1 20 ? 8.042   -9.822  -3.946  1.00 0.51  ? 20 PRO B HG3  1  
ATOM 1411  H HD2  . PRO B 1 20 ? 8.514   -12.589 -4.166  1.00 0.50  ? 20 PRO B HD2  1  
ATOM 1412  H HD3  . PRO B 1 20 ? 6.925   -11.800 -4.092  1.00 0.47  ? 20 PRO B HD3  1  
ATOM 1413  N N    . LYS B 1 21 ? 10.591  -10.978 -7.559  1.00 0.38  ? 21 LYS B N    1  
ATOM 1414  C CA   . LYS B 1 21 ? 11.845  -11.425 -8.257  1.00 0.40  ? 21 LYS B CA   1  
ATOM 1415  C C    . LYS B 1 21 ? 11.675  -11.133 -9.753  1.00 0.38  ? 21 LYS B C    1  
ATOM 1416  O O    . LYS B 1 21 ? 12.493  -10.473 -10.366 1.00 0.42  ? 21 LYS B O    1  
ATOM 1417  C CB   . LYS B 1 21 ? 12.098  -12.920 -8.024  1.00 0.42  ? 21 LYS B CB   1  
ATOM 1418  C CG   . LYS B 1 21 ? 13.579  -13.243 -8.252  1.00 0.52  ? 21 LYS B CG   1  
ATOM 1419  C CD   . LYS B 1 21 ? 14.411  -12.722 -7.075  1.00 0.95  ? 21 LYS B CD   1  
ATOM 1420  C CE   . LYS B 1 21 ? 14.544  -13.816 -6.010  1.00 1.49  ? 21 LYS B CE   1  
ATOM 1421  N NZ   . LYS B 1 21 ? 15.785  -13.589 -5.212  1.00 2.16  ? 21 LYS B NZ   1  
ATOM 1422  H H    . LYS B 1 21 ? 10.599  -10.132 -7.079  1.00 0.41  ? 21 LYS B H    1  
ATOM 1423  H HA   . LYS B 1 21 ? 12.679  -10.854 -7.881  1.00 0.43  ? 21 LYS B HA   1  
ATOM 1424  H HB2  . LYS B 1 21 ? 11.828  -13.172 -7.010  1.00 0.42  ? 21 LYS B HB2  1  
ATOM 1425  H HB3  . LYS B 1 21 ? 11.497  -13.500 -8.710  1.00 0.41  ? 21 LYS B HB3  1  
ATOM 1426  H HG2  . LYS B 1 21 ? 13.702  -14.313 -8.334  1.00 0.96  ? 21 LYS B HG2  1  
ATOM 1427  H HG3  . LYS B 1 21 ? 13.913  -12.771 -9.164  1.00 0.83  ? 21 LYS B HG3  1  
ATOM 1428  H HD2  . LYS B 1 21 ? 15.393  -12.443 -7.428  1.00 1.56  ? 21 LYS B HD2  1  
ATOM 1429  H HD3  . LYS B 1 21 ? 13.926  -11.859 -6.643  1.00 1.65  ? 21 LYS B HD3  1  
ATOM 1430  H HE2  . LYS B 1 21 ? 13.685  -13.786 -5.354  1.00 1.90  ? 21 LYS B HE2  1  
ATOM 1431  H HE3  . LYS B 1 21 ? 14.597  -14.782 -6.490  1.00 1.94  ? 21 LYS B HE3  1  
ATOM 1432  H HZ1  . LYS B 1 21 ? 16.608  -13.554 -5.849  1.00 2.59  ? 21 LYS B HZ1  1  
ATOM 1433  H HZ2  . LYS B 1 21 ? 15.708  -12.690 -4.695  1.00 2.41  ? 21 LYS B HZ2  1  
ATOM 1434  H HZ3  . LYS B 1 21 ? 15.907  -14.367 -4.533  1.00 2.61  ? 21 LYS B HZ3  1  
ATOM 1435  N N    . ASN B 1 22 ? 10.580  -11.575 -10.320 1.00 0.36  ? 22 ASN B N    1  
ATOM 1436  C CA   . ASN B 1 22 ? 10.276  -11.299 -11.739 1.00 0.36  ? 22 ASN B CA   1  
ATOM 1437  C C    . ASN B 1 22 ? 9.357   -10.082 -11.745 1.00 0.34  ? 22 ASN B C    1  
ATOM 1438  O O    . ASN B 1 22 ? 9.608   -9.089  -12.390 1.00 0.36  ? 22 ASN B O    1  
ATOM 1439  C CB   . ASN B 1 22 ? 9.521   -12.489 -12.343 1.00 0.36  ? 22 ASN B CB   1  
ATOM 1440  C CG   . ASN B 1 22 ? 10.028  -13.807 -11.749 1.00 0.38  ? 22 ASN B CG   1  
ATOM 1441  O OD1  . ASN B 1 22 ? 11.082  -14.289 -12.113 1.00 0.43  ? 22 ASN B OD1  1  
ATOM 1442  N ND2  . ASN B 1 22 ? 9.308   -14.413 -10.841 1.00 0.37  ? 22 ASN B ND2  1  
ATOM 1443  H H    . ASN B 1 22 ? 9.922   -12.063 -9.791  1.00 0.35  ? 22 ASN B H    1  
ATOM 1444  H HA   . ASN B 1 22 ? 11.179  -11.098 -12.293 1.00 0.39  ? 22 ASN B HA   1  
ATOM 1445  H HB2  . ASN B 1 22 ? 8.467   -12.388 -12.127 1.00 0.33  ? 22 ASN B HB2  1  
ATOM 1446  H HB3  . ASN B 1 22 ? 9.663   -12.495 -13.401 1.00 0.38  ? 22 ASN B HB3  1  
ATOM 1447  H HD21 . ASN B 1 22 ? 8.456   -14.024 -10.549 1.00 0.34  ? 22 ASN B HD21 1  
ATOM 1448  H HD22 . ASN B 1 22 ? 9.619   -15.256 -10.452 1.00 0.40  ? 22 ASN B HD22 1  
ATOM 1449  N N    . ILE B 1 23 ? 8.304   -10.172 -10.981 1.00 0.31  ? 23 ILE B N    1  
ATOM 1450  C CA   . ILE B 1 23 ? 7.321   -9.074  -10.848 1.00 0.30  ? 23 ILE B CA   1  
ATOM 1451  C C    . ILE B 1 23 ? 8.061   -7.732  -10.708 1.00 0.34  ? 23 ILE B C    1  
ATOM 1452  O O    . ILE B 1 23 ? 8.660   -7.441  -9.687  1.00 0.37  ? 23 ILE B O    1  
ATOM 1453  C CB   . ILE B 1 23 ? 6.499   -9.398  -9.598  1.00 0.29  ? 23 ILE B CB   1  
ATOM 1454  C CG1  . ILE B 1 23 ? 5.315   -10.288 -9.981  1.00 0.27  ? 23 ILE B CG1  1  
ATOM 1455  C CG2  . ILE B 1 23 ? 5.992   -8.130  -8.930  1.00 0.33  ? 23 ILE B CG2  1  
ATOM 1456  C CD1  . ILE B 1 23 ? 5.827   -11.681 -10.352 1.00 0.26  ? 23 ILE B CD1  1  
ATOM 1457  H H    . ILE B 1 23 ? 8.166   -10.986 -10.456 1.00 0.31  ? 23 ILE B H    1  
ATOM 1458  H HA   . ILE B 1 23 ? 6.676   -9.053  -11.718 1.00 0.29  ? 23 ILE B HA   1  
ATOM 1459  H HB   . ILE B 1 23 ? 7.130   -9.933  -8.905  1.00 0.31  ? 23 ILE B HB   1  
ATOM 1460  H HG12 . ILE B 1 23 ? 4.637   -10.363 -9.145  1.00 0.29  ? 23 ILE B HG12 1  
ATOM 1461  H HG13 . ILE B 1 23 ? 4.801   -9.859  -10.827 1.00 0.26  ? 23 ILE B HG13 1  
ATOM 1462  H HG21 . ILE B 1 23 ? 5.752   -7.399  -9.685  1.00 1.12  ? 23 ILE B HG21 1  
ATOM 1463  H HG22 . ILE B 1 23 ? 5.113   -8.360  -8.350  1.00 1.08  ? 23 ILE B HG22 1  
ATOM 1464  H HG23 . ILE B 1 23 ? 6.762   -7.743  -8.279  1.00 1.01  ? 23 ILE B HG23 1  
ATOM 1465  H HD11 . ILE B 1 23 ? 6.540   -12.010 -9.610  1.00 1.04  ? 23 ILE B HD11 1  
ATOM 1466  H HD12 . ILE B 1 23 ? 5.000   -12.372 -10.389 1.00 1.04  ? 23 ILE B HD12 1  
ATOM 1467  H HD13 . ILE B 1 23 ? 6.309   -11.640 -11.318 1.00 1.01  ? 23 ILE B HD13 1  
ATOM 1468  N N    . GLN B 1 24 ? 8.042   -6.932  -11.744 1.00 0.36  ? 24 GLN B N    1  
ATOM 1469  C CA   . GLN B 1 24 ? 8.742   -5.629  -11.726 1.00 0.42  ? 24 GLN B CA   1  
ATOM 1470  C C    . GLN B 1 24 ? 7.741   -4.482  -11.567 1.00 0.37  ? 24 GLN B C    1  
ATOM 1471  O O    . GLN B 1 24 ? 8.114   -3.383  -11.201 1.00 0.39  ? 24 GLN B O    1  
ATOM 1472  C CB   . GLN B 1 24 ? 9.462   -5.492  -13.059 1.00 0.48  ? 24 GLN B CB   1  
ATOM 1473  C CG   . GLN B 1 24 ? 10.954  -5.245  -12.831 1.00 0.57  ? 24 GLN B CG   1  
ATOM 1474  C CD   . GLN B 1 24 ? 11.482  -4.289  -13.904 1.00 1.16  ? 24 GLN B CD   1  
ATOM 1475  O OE1  . GLN B 1 24 ? 11.819  -3.158  -13.612 1.00 1.83  ? 24 GLN B OE1  1  
ATOM 1476  N NE2  . GLN B 1 24 ? 11.567  -4.696  -15.142 1.00 1.58  ? 24 GLN B NE2  1  
ATOM 1477  H H    . GLN B 1 24 ? 7.574   -7.197  -12.562 1.00 0.36  ? 24 GLN B H    1  
ATOM 1478  H HA   . GLN B 1 24 ? 9.463   -5.598  -10.920 1.00 0.46  ? 24 GLN B HA   1  
ATOM 1479  H HB2  . GLN B 1 24 ? 9.337   -6.407  -13.621 1.00 0.48  ? 24 GLN B HB2  1  
ATOM 1480  H HB3  . GLN B 1 24 ? 9.030   -4.684  -13.607 1.00 0.48  ? 24 GLN B HB3  1  
ATOM 1481  H HG2  . GLN B 1 24 ? 11.103  -4.809  -11.853 1.00 0.65  ? 24 GLN B HG2  1  
ATOM 1482  H HG3  . GLN B 1 24 ? 11.489  -6.181  -12.892 1.00 0.92  ? 24 GLN B HG3  1  
ATOM 1483  H HE21 . GLN B 1 24 ? 11.295  -5.607  -15.379 1.00 1.79  ? 24 GLN B HE21 1  
ATOM 1484  H HE22 . GLN B 1 24 ? 11.903  -4.090  -15.835 1.00 2.03  ? 24 GLN B HE22 1  
ATOM 1485  N N    . SER B 1 25 ? 6.477   -4.711  -11.848 1.00 0.33  ? 25 SER B N    1  
ATOM 1486  C CA   . SER B 1 25 ? 5.484   -3.610  -11.718 1.00 0.29  ? 25 SER B CA   1  
ATOM 1487  C C    . SER B 1 25 ? 4.060   -4.151  -11.682 1.00 0.27  ? 25 SER B C    1  
ATOM 1488  O O    . SER B 1 25 ? 3.832   -5.345  -11.694 1.00 0.29  ? 25 SER B O    1  
ATOM 1489  C CB   . SER B 1 25 ? 5.601   -2.685  -12.906 1.00 0.31  ? 25 SER B CB   1  
ATOM 1490  O OG   . SER B 1 25 ? 5.264   -3.384  -14.094 1.00 0.34  ? 25 SER B OG   1  
ATOM 1491  H H    . SER B 1 25 ? 6.186   -5.601  -12.149 1.00 0.33  ? 25 SER B H    1  
ATOM 1492  H HA   . SER B 1 25 ? 5.679   -3.049  -10.822 1.00 0.29  ? 25 SER B HA   1  
ATOM 1493  H HB2  . SER B 1 25 ? 4.920   -1.867  -12.768 1.00 0.31  ? 25 SER B HB2  1  
ATOM 1494  H HB3  . SER B 1 25 ? 6.609   -2.308  -12.970 1.00 0.30  ? 25 SER B HB3  1  
ATOM 1495  H HG   . SER B 1 25 ? 6.019   -3.923  -14.346 1.00 0.88  ? 25 SER B HG   1  
ATOM 1496  N N    . VAL B 1 26 ? 3.103   -3.261  -11.646 1.00 0.25  ? 26 VAL B N    1  
ATOM 1497  C CA   . VAL B 1 26 ? 1.677   -3.678  -11.627 1.00 0.24  ? 26 VAL B CA   1  
ATOM 1498  C C    . VAL B 1 26 ? 0.793   -2.512  -12.062 1.00 0.25  ? 26 VAL B C    1  
ATOM 1499  O O    . VAL B 1 26 ? 1.150   -1.356  -11.939 1.00 0.26  ? 26 VAL B O    1  
ATOM 1500  C CB   . VAL B 1 26 ? 1.257   -4.107  -10.219 1.00 0.23  ? 26 VAL B CB   1  
ATOM 1501  C CG1  . VAL B 1 26 ? 1.835   -3.143  -9.202  1.00 0.25  ? 26 VAL B CG1  1  
ATOM 1502  C CG2  . VAL B 1 26 ? -0.275  -4.106  -10.114 1.00 0.26  ? 26 VAL B CG2  1  
ATOM 1503  H H    . VAL B 1 26 ? 3.325   -2.309  -11.637 1.00 0.25  ? 26 VAL B H    1  
ATOM 1504  H HA   . VAL B 1 26 ? 1.542   -4.504  -12.307 1.00 0.24  ? 26 VAL B HA   1  
ATOM 1505  H HB   . VAL B 1 26 ? 1.630   -5.086  -10.018 1.00 0.25  ? 26 VAL B HB   1  
ATOM 1506  H HG11 . VAL B 1 26 ? 2.875   -2.964  -9.435  1.00 1.00  ? 26 VAL B HG11 1  
ATOM 1507  H HG12 . VAL B 1 26 ? 1.290   -2.216  -9.243  1.00 1.01  ? 26 VAL B HG12 1  
ATOM 1508  H HG13 . VAL B 1 26 ? 1.752   -3.573  -8.218  1.00 1.08  ? 26 VAL B HG13 1  
ATOM 1509  H HG21 . VAL B 1 26 ? -0.690  -4.708  -10.909 1.00 1.05  ? 26 VAL B HG21 1  
ATOM 1510  H HG22 . VAL B 1 26 ? -0.575  -4.509  -9.162  1.00 1.04  ? 26 VAL B HG22 1  
ATOM 1511  H HG23 . VAL B 1 26 ? -0.640  -3.091  -10.208 1.00 1.04  ? 26 VAL B HG23 1  
ATOM 1512  N N    . ASN B 1 27 ? -0.371  -2.830  -12.540 1.00 0.25  ? 27 ASN B N    1  
ATOM 1513  C CA   . ASN B 1 27 ? -1.327  -1.802  -12.961 1.00 0.27  ? 27 ASN B CA   1  
ATOM 1514  C C    . ASN B 1 27 ? -2.635  -2.011  -12.211 1.00 0.25  ? 27 ASN B C    1  
ATOM 1515  O O    . ASN B 1 27 ? -3.063  -3.129  -11.991 1.00 0.42  ? 27 ASN B O    1  
ATOM 1516  C CB   . ASN B 1 27 ? -1.597  -1.915  -14.444 1.00 0.30  ? 27 ASN B CB   1  
ATOM 1517  C CG   . ASN B 1 27 ? -0.319  -2.299  -15.204 1.00 0.57  ? 27 ASN B CG   1  
ATOM 1518  O OD1  . ASN B 1 27 ? 0.698   -1.642  -15.080 1.00 0.94  ? 27 ASN B OD1  1  
ATOM 1519  N ND2  . ASN B 1 27 ? -0.329  -3.337  -15.994 1.00 0.72  ? 27 ASN B ND2  1  
ATOM 1520  H H    . ASN B 1 27 ? -0.626  -3.766  -12.605 1.00 0.26  ? 27 ASN B H    1  
ATOM 1521  H HA   . ASN B 1 27 ? -0.936  -0.831  -12.739 1.00 0.30  ? 27 ASN B HA   1  
ATOM 1522  H HB2  . ASN B 1 27 ? -2.362  -2.653  -14.609 1.00 0.46  ? 27 ASN B HB2  1  
ATOM 1523  H HB3  . ASN B 1 27 ? -1.940  -0.976  -14.785 1.00 0.51  ? 27 ASN B HB3  1  
ATOM 1524  H HD21 . ASN B 1 27 ? -1.148  -3.865  -16.100 1.00 0.75  ? 27 ASN B HD21 1  
ATOM 1525  H HD22 . ASN B 1 27 ? 0.484   -3.590  -16.479 1.00 0.99  ? 27 ASN B HD22 1  
ATOM 1526  N N    . VAL B 1 28 ? -3.276  -0.950  -11.827 1.00 0.28  ? 28 VAL B N    1  
ATOM 1527  C CA   . VAL B 1 28 ? -4.569  -1.091  -11.098 1.00 0.29  ? 28 VAL B CA   1  
ATOM 1528  C C    . VAL B 1 28 ? -5.617  -0.187  -11.753 1.00 0.31  ? 28 VAL B C    1  
ATOM 1529  O O    . VAL B 1 28 ? -5.536  1.025   -11.697 1.00 0.33  ? 28 VAL B O    1  
ATOM 1530  C CB   . VAL B 1 28 ? -4.377  -0.732  -9.618  1.00 0.34  ? 28 VAL B CB   1  
ATOM 1531  C CG1  . VAL B 1 28 ? -3.779  0.666   -9.487  1.00 0.55  ? 28 VAL B CG1  1  
ATOM 1532  C CG2  . VAL B 1 28 ? -5.726  -0.786  -8.890  1.00 0.72  ? 28 VAL B CG2  1  
ATOM 1533  H H    . VAL B 1 28 ? -2.910  -0.060  -12.029 1.00 0.44  ? 28 VAL B H    1  
ATOM 1534  H HA   . VAL B 1 28 ? -4.895  -2.121  -11.174 1.00 0.28  ? 28 VAL B HA   1  
ATOM 1535  H HB   . VAL B 1 28 ? -3.703  -1.442  -9.172  1.00 0.31  ? 28 VAL B HB   1  
ATOM 1536  H HG11 . VAL B 1 28 ? -3.149  0.869   -10.340 1.00 1.09  ? 28 VAL B HG11 1  
ATOM 1537  H HG12 . VAL B 1 28 ? -4.573  1.395   -9.442  1.00 1.22  ? 28 VAL B HG12 1  
ATOM 1538  H HG13 . VAL B 1 28 ? -3.189  0.718   -8.584  1.00 1.25  ? 28 VAL B HG13 1  
ATOM 1539  H HG21 . VAL B 1 28 ? -6.311  -1.607  -9.276  1.00 1.29  ? 28 VAL B HG21 1  
ATOM 1540  H HG22 . VAL B 1 28 ? -5.556  -0.931  -7.833  1.00 1.29  ? 28 VAL B HG22 1  
ATOM 1541  H HG23 . VAL B 1 28 ? -6.258  0.141   -9.046  1.00 1.29  ? 28 VAL B HG23 1  
ATOM 1542  N N    . LYS B 1 29 ? -6.585  -0.791  -12.391 1.00 0.35  ? 29 LYS B N    1  
ATOM 1543  C CA   . LYS B 1 29 ? -7.653  -0.023  -13.098 1.00 0.42  ? 29 LYS B CA   1  
ATOM 1544  C C    . LYS B 1 29 ? -9.011  -0.265  -12.429 1.00 0.37  ? 29 LYS B C    1  
ATOM 1545  O O    . LYS B 1 29 ? -9.167  -1.156  -11.612 1.00 0.35  ? 29 LYS B O    1  
ATOM 1546  C CB   . LYS B 1 29 ? -7.712  -0.508  -14.552 1.00 0.52  ? 29 LYS B CB   1  
ATOM 1547  C CG   . LYS B 1 29 ? -8.096  0.634   -15.481 1.00 1.08  ? 29 LYS B CG   1  
ATOM 1548  C CD   . LYS B 1 29 ? -7.022  0.812   -16.553 1.00 0.83  ? 29 LYS B CD   1  
ATOM 1549  C CE   . LYS B 1 29 ? -7.266  2.133   -17.282 1.00 0.77  ? 29 LYS B CE   1  
ATOM 1550  N NZ   . LYS B 1 29 ? -7.629  1.865   -18.702 1.00 1.23  ? 29 LYS B NZ   1  
ATOM 1551  H H    . LYS B 1 29 ? -6.600  -1.765  -12.417 1.00 0.35  ? 29 LYS B H    1  
ATOM 1552  H HA   . LYS B 1 29 ? -7.421  1.029   -13.075 1.00 0.52  ? 29 LYS B HA   1  
ATOM 1553  H HB2  . LYS B 1 29 ? -6.748  -0.895  -14.841 1.00 1.13  ? 29 LYS B HB2  1  
ATOM 1554  H HB3  . LYS B 1 29 ? -8.451  -1.288  -14.638 1.00 0.82  ? 29 LYS B HB3  1  
ATOM 1555  H HG2  . LYS B 1 29 ? -9.040  0.404   -15.954 1.00 1.70  ? 29 LYS B HG2  1  
ATOM 1556  H HG3  . LYS B 1 29 ? -8.195  1.545   -14.914 1.00 2.02  ? 29 LYS B HG3  1  
ATOM 1557  H HD2  . LYS B 1 29 ? -6.046  0.826   -16.090 1.00 1.42  ? 29 LYS B HD2  1  
ATOM 1558  H HD3  . LYS B 1 29 ? -7.076  -0.004  -17.258 1.00 1.53  ? 29 LYS B HD3  1  
ATOM 1559  H HE2  . LYS B 1 29 ? -8.074  2.666   -16.800 1.00 1.30  ? 29 LYS B HE2  1  
ATOM 1560  H HE3  . LYS B 1 29 ? -6.370  2.734   -17.248 1.00 1.10  ? 29 LYS B HE3  1  
ATOM 1561  H HZ1  . LYS B 1 29 ? -8.427  1.198   -18.738 1.00 1.80  ? 29 LYS B HZ1  1  
ATOM 1562  H HZ2  . LYS B 1 29 ? -7.904  2.755   -19.164 1.00 1.54  ? 29 LYS B HZ2  1  
ATOM 1563  H HZ3  . LYS B 1 29 ? -6.811  1.455   -19.198 1.00 1.71  ? 29 LYS B HZ3  1  
ATOM 1564  N N    . SER B 1 30 ? -9.994  0.525   -12.786 1.00 0.39  ? 30 SER B N    1  
ATOM 1565  C CA   . SER B 1 30 ? -11.359 0.371   -12.203 1.00 0.39  ? 30 SER B CA   1  
ATOM 1566  C C    . SER B 1 30 ? -12.319 -0.159  -13.293 1.00 0.34  ? 30 SER B C    1  
ATOM 1567  O O    . SER B 1 30 ? -11.912 -0.332  -14.428 1.00 0.35  ? 30 SER B O    1  
ATOM 1568  C CB   . SER B 1 30 ? -11.823 1.743   -11.698 1.00 0.52  ? 30 SER B CB   1  
ATOM 1569  O OG   . SER B 1 30 ? -12.118 1.657   -10.308 1.00 1.63  ? 30 SER B OG   1  
ATOM 1570  H H    . SER B 1 30 ? -9.830  1.228   -13.451 1.00 0.43  ? 30 SER B H    1  
ATOM 1571  H HA   . SER B 1 30 ? -11.327 -0.328  -11.380 1.00 0.41  ? 30 SER B HA   1  
ATOM 1572  H HB2  . SER B 1 30 ? -11.036 2.466   -11.846 1.00 0.91  ? 30 SER B HB2  1  
ATOM 1573  H HB3  . SER B 1 30 ? -12.700 2.054   -12.246 1.00 0.92  ? 30 SER B HB3  1  
ATOM 1574  H HG   . SER B 1 30 ? -12.596 2.450   -10.058 1.00 2.13  ? 30 SER B HG   1  
ATOM 1575  N N    . PRO B 1 31 ? -13.563 -0.407  -12.924 1.00 0.39  ? 31 PRO B N    1  
ATOM 1576  C CA   . PRO B 1 31 ? -14.583 -0.922  -13.869 1.00 0.44  ? 31 PRO B CA   1  
ATOM 1577  C C    . PRO B 1 31 ? -15.064 0.195   -14.809 1.00 0.52  ? 31 PRO B C    1  
ATOM 1578  O O    . PRO B 1 31 ? -14.621 1.326   -14.712 1.00 0.59  ? 31 PRO B O    1  
ATOM 1579  C CB   . PRO B 1 31 ? -15.711 -1.406  -12.952 1.00 0.52  ? 31 PRO B CB   1  
ATOM 1580  C CG   . PRO B 1 31 ? -15.539 -0.659  -11.610 1.00 0.56  ? 31 PRO B CG   1  
ATOM 1581  C CD   . PRO B 1 31 ? -14.070 -0.195  -11.550 1.00 0.49  ? 31 PRO B CD   1  
ATOM 1582  H HA   . PRO B 1 31 ? -14.190 -1.749  -14.436 1.00 0.44  ? 31 PRO B HA   1  
ATOM 1583  H HB2  . PRO B 1 31 ? -16.672 -1.173  -13.389 1.00 0.58  ? 31 PRO B HB2  1  
ATOM 1584  H HB3  . PRO B 1 31 ? -15.626 -2.469  -12.788 1.00 0.55  ? 31 PRO B HB3  1  
ATOM 1585  H HG2  . PRO B 1 31 ? -16.201 0.194   -11.575 1.00 0.62  ? 31 PRO B HG2  1  
ATOM 1586  H HG3  . PRO B 1 31 ? -15.744 -1.324  -10.786 1.00 0.64  ? 31 PRO B HG3  1  
ATOM 1587  H HD2  . PRO B 1 31 ? -14.021 0.851   -11.282 1.00 0.54  ? 31 PRO B HD2  1  
ATOM 1588  H HD3  . PRO B 1 31 ? -13.511 -0.795  -10.848 1.00 0.52  ? 31 PRO B HD3  1  
ATOM 1589  N N    . GLY B 1 32 ? -15.959 -0.109  -15.724 1.00 0.59  ? 32 GLY B N    1  
ATOM 1590  C CA   . GLY B 1 32 ? -16.443 0.952   -16.663 1.00 0.72  ? 32 GLY B CA   1  
ATOM 1591  C C    . GLY B 1 32 ? -17.273 0.331   -17.793 1.00 0.91  ? 32 GLY B C    1  
ATOM 1592  O O    . GLY B 1 32 ? -18.487 0.369   -17.752 1.00 1.05  ? 32 GLY B O    1  
ATOM 1593  H H    . GLY B 1 32 ? -16.309 -1.029  -15.794 1.00 0.60  ? 32 GLY B H    1  
ATOM 1594  H HA2  . GLY B 1 32 ? -17.055 1.658   -16.118 1.00 0.72  ? 32 GLY B HA2  1  
ATOM 1595  H HA3  . GLY B 1 32 ? -15.596 1.468   -17.087 1.00 0.77  ? 32 GLY B HA3  1  
ATOM 1596  N N    . PRO B 1 33 ? -16.591 -0.221  -18.778 1.00 1.05  ? 33 PRO B N    1  
ATOM 1597  C CA   . PRO B 1 33 ? -17.249 -0.851  -19.942 1.00 1.30  ? 33 PRO B CA   1  
ATOM 1598  C C    . PRO B 1 33 ? -17.866 -2.207  -19.555 1.00 1.12  ? 33 PRO B C    1  
ATOM 1599  O O    . PRO B 1 33 ? -18.131 -2.464  -18.394 1.00 1.13  ? 33 PRO B O    1  
ATOM 1600  C CB   . PRO B 1 33 ? -16.111 -1.003  -20.960 1.00 1.62  ? 33 PRO B CB   1  
ATOM 1601  C CG   . PRO B 1 33 ? -14.792 -0.968  -20.155 1.00 1.55  ? 33 PRO B CG   1  
ATOM 1602  C CD   . PRO B 1 33 ? -15.110 -0.272  -18.820 1.00 1.17  ? 33 PRO B CD   1  
ATOM 1603  H HA   . PRO B 1 33 ? -18.007 -0.198  -20.340 1.00 1.48  ? 33 PRO B HA   1  
ATOM 1604  H HB2  . PRO B 1 33 ? -16.203 -1.945  -21.484 1.00 1.72  ? 33 PRO B HB2  1  
ATOM 1605  H HB3  . PRO B 1 33 ? -16.129 -0.185  -21.662 1.00 1.87  ? 33 PRO B HB3  1  
ATOM 1606  H HG2  . PRO B 1 33 ? -14.442 -1.975  -19.978 1.00 1.57  ? 33 PRO B HG2  1  
ATOM 1607  H HG3  . PRO B 1 33 ? -14.045 -0.404  -20.690 1.00 1.80  ? 33 PRO B HG3  1  
ATOM 1608  H HD2  . PRO B 1 33 ? -14.722 -0.852  -17.996 1.00 1.04  ? 33 PRO B HD2  1  
ATOM 1609  H HD3  . PRO B 1 33 ? -14.703 0.726   -18.808 1.00 1.24  ? 33 PRO B HD3  1  
ATOM 1610  N N    . HIS B 1 34 ? -18.122 -3.063  -20.518 1.00 1.15  ? 34 HIS B N    1  
ATOM 1611  C CA   . HIS B 1 34 ? -18.749 -4.390  -20.202 1.00 1.18  ? 34 HIS B CA   1  
ATOM 1612  C C    . HIS B 1 34 ? -17.856 -5.228  -19.280 1.00 1.19  ? 34 HIS B C    1  
ATOM 1613  O O    . HIS B 1 34 ? -18.350 -6.099  -18.587 1.00 1.29  ? 34 HIS B O    1  
ATOM 1614  C CB   . HIS B 1 34 ? -19.066 -5.176  -21.488 1.00 1.36  ? 34 HIS B CB   1  
ATOM 1615  C CG   . HIS B 1 34 ? -17.961 -5.031  -22.511 1.00 1.55  ? 34 HIS B CG   1  
ATOM 1616  N ND1  . HIS B 1 34 ? -18.229 -4.809  -23.852 1.00 2.08  ? 34 HIS B ND1  1  
ATOM 1617  C CD2  . HIS B 1 34 ? -16.592 -5.097  -22.410 1.00 2.02  ? 34 HIS B CD2  1  
ATOM 1618  C CE1  . HIS B 1 34 ? -17.051 -4.750  -24.498 1.00 2.64  ? 34 HIS B CE1  1  
ATOM 1619  N NE2  . HIS B 1 34 ? -16.020 -4.919  -23.666 1.00 2.66  ? 34 HIS B NE2  1  
ATOM 1620  H H    . HIS B 1 34 ? -17.921 -2.825  -21.447 1.00 1.28  ? 34 HIS B H    1  
ATOM 1621  H HA   . HIS B 1 34 ? -19.675 -4.205  -19.668 1.00 1.14  ? 34 HIS B HA   1  
ATOM 1622  H HB2  . HIS B 1 34 ? -19.185 -6.221  -21.245 1.00 1.72  ? 34 HIS B HB2  1  
ATOM 1623  H HB3  . HIS B 1 34 ? -19.989 -4.805  -21.910 1.00 1.68  ? 34 HIS B HB3  1  
ATOM 1624  H HD1  . HIS B 1 34 ? -19.116 -4.713  -24.258 1.00 2.31  ? 34 HIS B HD1  1  
ATOM 1625  H HD2  . HIS B 1 34 ? -16.043 -5.264  -21.496 1.00 2.23  ? 34 HIS B HD2  1  
ATOM 1626  H HE1  . HIS B 1 34 ? -16.951 -4.586  -25.561 1.00 3.25  ? 34 HIS B HE1  1  
ATOM 1627  N N    . CYS B 1 35 ? -16.568 -4.963  -19.209 1.00 1.22  ? 35 CYS B N    1  
ATOM 1628  C CA   . CYS B 1 35 ? -15.725 -5.744  -18.258 1.00 1.29  ? 35 CYS B CA   1  
ATOM 1629  C C    . CYS B 1 35 ? -16.256 -5.421  -16.857 1.00 1.07  ? 35 CYS B C    1  
ATOM 1630  O O    . CYS B 1 35 ? -16.402 -6.291  -16.019 1.00 1.13  ? 35 CYS B O    1  
ATOM 1631  C CB   . CYS B 1 35 ? -14.244 -5.357  -18.384 1.00 1.59  ? 35 CYS B CB   1  
ATOM 1632  S SG   . CYS B 1 35 ? -14.036 -3.574  -18.161 1.00 2.40  ? 35 CYS B SG   1  
ATOM 1633  H H    . CYS B 1 35 ? -16.178 -4.234  -19.735 1.00 1.28  ? 35 CYS B H    1  
ATOM 1634  H HA   . CYS B 1 35 ? -15.848 -6.802  -18.454 1.00 1.39  ? 35 CYS B HA   1  
ATOM 1635  H HB2  . CYS B 1 35 ? -13.674 -5.879  -17.631 1.00 1.86  ? 35 CYS B HB2  1  
ATOM 1636  H HB3  . CYS B 1 35 ? -13.885 -5.640  -19.362 1.00 1.86  ? 35 CYS B HB3  1  
ATOM 1637  N N    . ALA B 1 36 ? -16.614 -4.164  -16.651 1.00 0.96  ? 36 ALA B N    1  
ATOM 1638  C CA   . ALA B 1 36 ? -17.220 -3.701  -15.369 1.00 0.90  ? 36 ALA B CA   1  
ATOM 1639  C C    . ALA B 1 36 ? -16.579 -4.381  -14.156 1.00 0.86  ? 36 ALA B C    1  
ATOM 1640  O O    . ALA B 1 36 ? -17.243 -4.800  -13.226 1.00 1.18  ? 36 ALA B O    1  
ATOM 1641  C CB   . ALA B 1 36 ? -18.704 -4.005  -15.437 1.00 1.09  ? 36 ALA B CB   1  
ATOM 1642  H H    . ALA B 1 36 ? -16.524 -3.521  -17.383 1.00 1.03  ? 36 ALA B H    1  
ATOM 1643  H HA   . ALA B 1 36 ? -17.087 -2.634  -15.283 1.00 0.98  ? 36 ALA B HA   1  
ATOM 1644  H HB1  . ALA B 1 36 ? -18.842 -5.065  -15.575 1.00 1.51  ? 36 ALA B HB1  1  
ATOM 1645  H HB2  . ALA B 1 36 ? -19.178 -3.687  -14.526 1.00 1.38  ? 36 ALA B HB2  1  
ATOM 1646  H HB3  . ALA B 1 36 ? -19.133 -3.473  -16.275 1.00 1.61  ? 36 ALA B HB3  1  
ATOM 1647  N N    . GLN B 1 37 ? -15.285 -4.468  -14.171 1.00 0.93  ? 37 GLN B N    1  
ATOM 1648  C CA   . GLN B 1 37 ? -14.535 -5.093  -13.042 1.00 0.88  ? 37 GLN B CA   1  
ATOM 1649  C C    . GLN B 1 37 ? -13.266 -4.285  -12.795 1.00 0.71  ? 37 GLN B C    1  
ATOM 1650  O O    . GLN B 1 37 ? -12.867 -3.469  -13.607 1.00 0.74  ? 37 GLN B O    1  
ATOM 1651  C CB   . GLN B 1 37 ? -14.174 -6.539  -13.410 1.00 0.99  ? 37 GLN B CB   1  
ATOM 1652  C CG   . GLN B 1 37 ? -13.421 -7.242  -12.271 1.00 1.66  ? 37 GLN B CG   1  
ATOM 1653  C CD   . GLN B 1 37 ? -14.327 -7.378  -11.039 1.00 2.34  ? 37 GLN B CD   1  
ATOM 1654  O OE1  . GLN B 1 37 ? -15.532 -7.481  -11.160 1.00 2.83  ? 37 GLN B OE1  1  
ATOM 1655  N NE2  . GLN B 1 37 ? -13.791 -7.386  -9.847  1.00 3.07  ? 37 GLN B NE2  1  
ATOM 1656  H H    . GLN B 1 37 ? -14.798 -4.109  -14.936 1.00 1.26  ? 37 GLN B H    1  
ATOM 1657  H HA   . GLN B 1 37 ? -15.147 -5.087  -12.152 1.00 0.95  ? 37 GLN B HA   1  
ATOM 1658  H HB2  . GLN B 1 37 ? -15.076 -7.076  -13.604 1.00 1.38  ? 37 GLN B HB2  1  
ATOM 1659  H HB3  . GLN B 1 37 ? -13.557 -6.537  -14.295 1.00 1.44  ? 37 GLN B HB3  1  
ATOM 1660  H HG2  . GLN B 1 37 ? -13.121 -8.225  -12.601 1.00 2.21  ? 37 GLN B HG2  1  
ATOM 1661  H HG3  . GLN B 1 37 ? -12.542 -6.673  -12.012 1.00 2.02  ? 37 GLN B HG3  1  
ATOM 1662  H HE21 . GLN B 1 37 ? -12.819 -7.307  -9.744  1.00 3.26  ? 37 GLN B HE21 1  
ATOM 1663  H HE22 . GLN B 1 37 ? -14.361 -7.471  -9.054  1.00 3.72  ? 37 GLN B HE22 1  
ATOM 1664  N N    . THR B 1 38 ? -12.633 -4.507  -11.682 1.00 0.60  ? 38 THR B N    1  
ATOM 1665  C CA   . THR B 1 38 ? -11.382 -3.760  -11.365 1.00 0.44  ? 38 THR B CA   1  
ATOM 1666  C C    . THR B 1 38 ? -10.252 -4.218  -12.287 1.00 0.35  ? 38 THR B C    1  
ATOM 1667  O O    . THR B 1 38 ? -10.469 -4.845  -13.308 1.00 0.42  ? 38 THR B O    1  
ATOM 1668  C CB   . THR B 1 38 ? -10.962 -3.998  -9.902  1.00 0.44  ? 38 THR B CB   1  
ATOM 1669  O OG1  . THR B 1 38 ? -11.964 -4.739  -9.212  1.00 0.60  ? 38 THR B OG1  1  
ATOM 1670  C CG2  . THR B 1 38 ? -10.776 -2.645  -9.235  1.00 0.44  ? 38 THR B CG2  1  
ATOM 1671  H H    . THR B 1 38 ? -12.982 -5.170  -11.055 1.00 0.68  ? 38 THR B H    1  
ATOM 1672  H HA   . THR B 1 38 ? -11.555 -2.704  -11.515 1.00 0.44  ? 38 THR B HA   1  
ATOM 1673  H HB   . THR B 1 38 ? -10.015 -4.540  -9.868  1.00 0.40  ? 38 THR B HB   1  
ATOM 1674  H HG1  . THR B 1 38 ? -11.589 -5.589  -8.966  1.00 1.03  ? 38 THR B HG1  1  
ATOM 1675  H HG21 . THR B 1 38 ? -10.469 -1.922  -9.978  1.00 1.06  ? 38 THR B HG21 1  
ATOM 1676  H HG22 . THR B 1 38 ? -11.708 -2.333  -8.793  1.00 1.11  ? 38 THR B HG22 1  
ATOM 1677  H HG23 . THR B 1 38 ? -10.017 -2.723  -8.475  1.00 1.08  ? 38 THR B HG23 1  
ATOM 1678  N N    . GLU B 1 39 ? -9.042  -3.931  -11.908 1.00 0.25  ? 39 GLU B N    1  
ATOM 1679  C CA   . GLU B 1 39 ? -7.877  -4.353  -12.703 1.00 0.25  ? 39 GLU B CA   1  
ATOM 1680  C C    . GLU B 1 39 ? -6.710  -4.358  -11.769 1.00 0.21  ? 39 GLU B C    1  
ATOM 1681  O O    . GLU B 1 39 ? -6.540  -3.452  -10.973 1.00 0.35  ? 39 GLU B O    1  
ATOM 1682  C CB   . GLU B 1 39 ? -7.561  -3.382  -13.818 1.00 0.33  ? 39 GLU B CB   1  
ATOM 1683  C CG   . GLU B 1 39 ? -7.710  -4.068  -15.178 1.00 0.60  ? 39 GLU B CG   1  
ATOM 1684  C CD   . GLU B 1 39 ? -6.485  -4.951  -15.447 1.00 0.80  ? 39 GLU B CD   1  
ATOM 1685  O OE1  . GLU B 1 39 ? -5.420  -4.401  -15.679 1.00 1.40  ? 39 GLU B OE1  1  
ATOM 1686  O OE2  . GLU B 1 39 ? -6.637  -6.161  -15.416 1.00 1.47  ? 39 GLU B OE2  1  
ATOM 1687  H H    . GLU B 1 39 ? -8.892  -3.455  -11.062 1.00 0.25  ? 39 GLU B H    1  
ATOM 1688  H HA   . GLU B 1 39 ? -8.045  -5.339  -13.095 1.00 0.31  ? 39 GLU B HA   1  
ATOM 1689  H HB2  . GLU B 1 39 ? -8.231  -2.542  -13.756 1.00 0.30  ? 39 GLU B HB2  1  
ATOM 1690  H HB3  . GLU B 1 39 ? -6.534  -3.048  -13.691 1.00 0.41  ? 39 GLU B HB3  1  
ATOM 1691  H HG2  . GLU B 1 39 ? -8.601  -4.676  -15.177 1.00 0.87  ? 39 GLU B HG2  1  
ATOM 1692  H HG3  . GLU B 1 39 ? -7.787  -3.318  -15.952 1.00 0.84  ? 39 GLU B HG3  1  
ATOM 1693  N N    . VAL B 1 40 ? -5.937  -5.370  -11.817 1.00 0.15  ? 40 VAL B N    1  
ATOM 1694  C CA   . VAL B 1 40 ? -4.817  -5.454  -10.892 1.00 0.19  ? 40 VAL B CA   1  
ATOM 1695  C C    . VAL B 1 40 ? -3.756  -6.334  -11.547 1.00 0.19  ? 40 VAL B C    1  
ATOM 1696  O O    . VAL B 1 40 ? -3.561  -7.475  -11.178 1.00 0.22  ? 40 VAL B O    1  
ATOM 1697  C CB   . VAL B 1 40 ? -5.387  -6.068  -9.603  1.00 0.24  ? 40 VAL B CB   1  
ATOM 1698  C CG1  . VAL B 1 40 ? -5.856  -4.935  -8.699  1.00 0.28  ? 40 VAL B CG1  1  
ATOM 1699  C CG2  . VAL B 1 40 ? -6.624  -6.922  -9.931  1.00 0.24  ? 40 VAL B CG2  1  
ATOM 1700  H H    . VAL B 1 40 ? -6.116  -6.100  -12.427 1.00 0.22  ? 40 VAL B H    1  
ATOM 1701  H HA   . VAL B 1 40 ? -4.436  -4.453  -10.712 1.00 0.23  ? 40 VAL B HA   1  
ATOM 1702  H HB   . VAL B 1 40 ? -4.642  -6.677  -9.113  1.00 0.29  ? 40 VAL B HB   1  
ATOM 1703  H HG11 . VAL B 1 40 ? -5.415  -4.007  -9.030  1.00 0.98  ? 40 VAL B HG11 1  
ATOM 1704  H HG12 . VAL B 1 40 ? -6.937  -4.857  -8.764  1.00 1.04  ? 40 VAL B HG12 1  
ATOM 1705  H HG13 . VAL B 1 40 ? -5.569  -5.136  -7.684  1.00 1.02  ? 40 VAL B HG13 1  
ATOM 1706  H HG21 . VAL B 1 40 ? -6.376  -7.648  -10.688 1.00 1.08  ? 40 VAL B HG21 1  
ATOM 1707  H HG22 . VAL B 1 40 ? -6.966  -7.424  -9.042  1.00 0.98  ? 40 VAL B HG22 1  
ATOM 1708  H HG23 . VAL B 1 40 ? -7.414  -6.276  -10.302 1.00 1.00  ? 40 VAL B HG23 1  
ATOM 1709  N N    . ILE B 1 41 ? -3.126  -5.821  -12.578 1.00 0.22  ? 41 ILE B N    1  
ATOM 1710  C CA   . ILE B 1 41 ? -2.145  -6.627  -13.345 1.00 0.25  ? 41 ILE B CA   1  
ATOM 1711  C C    . ILE B 1 41 ? -0.695  -6.339  -12.941 1.00 0.23  ? 41 ILE B C    1  
ATOM 1712  O O    . ILE B 1 41 ? -0.197  -5.259  -13.137 1.00 0.25  ? 41 ILE B O    1  
ATOM 1713  C CB   . ILE B 1 41 ? -2.353  -6.303  -14.824 1.00 0.30  ? 41 ILE B CB   1  
ATOM 1714  C CG1  . ILE B 1 41 ? -3.435  -7.248  -15.368 1.00 0.50  ? 41 ILE B CG1  1  
ATOM 1715  C CG2  . ILE B 1 41 ? -1.045  -6.483  -15.599 1.00 0.67  ? 41 ILE B CG2  1  
ATOM 1716  C CD1  . ILE B 1 41 ? -3.295  -7.423  -16.881 1.00 0.54  ? 41 ILE B CD1  1  
ATOM 1717  H H    . ILE B 1 41 ? -3.348  -4.916  -12.885 1.00 0.27  ? 41 ILE B H    1  
ATOM 1718  H HA   . ILE B 1 41 ? -2.358  -7.664  -13.190 1.00 0.26  ? 41 ILE B HA   1  
ATOM 1719  H HB   . ILE B 1 41 ? -2.684  -5.273  -14.915 1.00 0.48  ? 41 ILE B HB   1  
ATOM 1720  H HG12 . ILE B 1 41 ? -3.336  -8.212  -14.890 1.00 0.70  ? 41 ILE B HG12 1  
ATOM 1721  H HG13 . ILE B 1 41 ? -4.405  -6.841  -15.143 1.00 0.68  ? 41 ILE B HG13 1  
ATOM 1722  H HG21 . ILE B 1 41 ? -0.639  -7.461  -15.394 1.00 1.24  ? 41 ILE B HG21 1  
ATOM 1723  H HG22 . ILE B 1 41 ? -1.238  -6.383  -16.656 1.00 1.41  ? 41 ILE B HG22 1  
ATOM 1724  H HG23 . ILE B 1 41 ? -0.341  -5.726  -15.290 1.00 1.13  ? 41 ILE B HG23 1  
ATOM 1725  H HD11 . ILE B 1 41 ? -2.322  -7.834  -17.105 1.00 1.15  ? 41 ILE B HD11 1  
ATOM 1726  H HD12 . ILE B 1 41 ? -4.059  -8.097  -17.233 1.00 1.12  ? 41 ILE B HD12 1  
ATOM 1727  H HD13 . ILE B 1 41 ? -3.404  -6.465  -17.366 1.00 1.11  ? 41 ILE B HD13 1  
ATOM 1728  N N    . ALA B 1 42 ? 0.001   -7.329  -12.438 1.00 0.22  ? 42 ALA B N    1  
ATOM 1729  C CA   . ALA B 1 42 ? 1.433   -7.140  -12.077 1.00 0.22  ? 42 ALA B CA   1  
ATOM 1730  C C    . ALA B 1 42 ? 2.282   -7.480  -13.294 1.00 0.24  ? 42 ALA B C    1  
ATOM 1731  O O    . ALA B 1 42 ? 2.332   -8.618  -13.720 1.00 0.25  ? 42 ALA B O    1  
ATOM 1732  C CB   . ALA B 1 42 ? 1.781   -8.065  -10.923 1.00 0.21  ? 42 ALA B CB   1  
ATOM 1733  H H    . ALA B 1 42 ? -0.411  -8.218  -12.333 1.00 0.23  ? 42 ALA B H    1  
ATOM 1734  H HA   . ALA B 1 42 ? 1.614   -6.125  -11.792 1.00 0.23  ? 42 ALA B HA   1  
ATOM 1735  H HB1  . ALA B 1 42 ? 1.021   -7.983  -10.161 1.00 1.07  ? 42 ALA B HB1  1  
ATOM 1736  H HB2  . ALA B 1 42 ? 1.827   -9.081  -11.281 1.00 1.01  ? 42 ALA B HB2  1  
ATOM 1737  H HB3  . ALA B 1 42 ? 2.737   -7.779  -10.513 1.00 1.02  ? 42 ALA B HB3  1  
ATOM 1738  N N    . THR B 1 43 ? 2.946   -6.506  -13.872 1.00 0.28  ? 43 THR B N    1  
ATOM 1739  C CA   . THR B 1 43 ? 3.771   -6.803  -15.070 1.00 0.32  ? 43 THR B CA   1  
ATOM 1740  C C    . THR B 1 43 ? 5.016   -7.563  -14.642 1.00 0.32  ? 43 THR B C    1  
ATOM 1741  O O    . THR B 1 43 ? 5.772   -7.131  -13.789 1.00 0.33  ? 43 THR B O    1  
ATOM 1742  C CB   . THR B 1 43 ? 4.193   -5.526  -15.804 1.00 0.35  ? 43 THR B CB   1  
ATOM 1743  O OG1  . THR B 1 43 ? 3.166   -4.547  -15.713 1.00 0.39  ? 43 THR B OG1  1  
ATOM 1744  C CG2  . THR B 1 43 ? 4.459   -5.857  -17.272 1.00 0.39  ? 43 THR B CG2  1  
ATOM 1745  H H    . THR B 1 43 ? 2.896   -5.591  -13.521 1.00 0.28  ? 43 THR B H    1  
ATOM 1746  H HA   . THR B 1 43 ? 3.186   -7.426  -15.734 1.00 0.33  ? 43 THR B HA   1  
ATOM 1747  H HB   . THR B 1 43 ? 5.102   -5.147  -15.370 1.00 0.35  ? 43 THR B HB   1  
ATOM 1748  H HG1  . THR B 1 43 ? 3.580   -3.698  -15.540 1.00 0.89  ? 43 THR B HG1  1  
ATOM 1749  H HG21 . THR B 1 43 ? 5.215   -6.627  -17.332 1.00 1.06  ? 43 THR B HG21 1  
ATOM 1750  H HG22 . THR B 1 43 ? 3.548   -6.210  -17.730 1.00 1.07  ? 43 THR B HG22 1  
ATOM 1751  H HG23 . THR B 1 43 ? 4.805   -4.974  -17.783 1.00 1.06  ? 43 THR B HG23 1  
ATOM 1752  N N    . LEU B 1 44 ? 5.213   -8.702  -15.227 1.00 0.32  ? 44 LEU B N    1  
ATOM 1753  C CA   . LEU B 1 44 ? 6.374   -9.544  -14.888 1.00 0.32  ? 44 LEU B CA   1  
ATOM 1754  C C    . LEU B 1 44 ? 7.669   -8.947  -15.452 1.00 0.37  ? 44 LEU B C    1  
ATOM 1755  O O    . LEU B 1 44 ? 7.644   -8.191  -16.410 1.00 0.40  ? 44 LEU B O    1  
ATOM 1756  C CB   . LEU B 1 44 ? 6.139   -10.903 -15.515 1.00 0.34  ? 44 LEU B CB   1  
ATOM 1757  C CG   . LEU B 1 44 ? 5.519   -11.850 -14.500 1.00 0.33  ? 44 LEU B CG   1  
ATOM 1758  C CD1  . LEU B 1 44 ? 6.661   -12.566 -13.791 1.00 0.35  ? 44 LEU B CD1  1  
ATOM 1759  C CD2  . LEU B 1 44 ? 4.640   -11.073 -13.486 1.00 0.29  ? 44 LEU B CD2  1  
ATOM 1760  H H    . LEU B 1 44 ? 4.572   -9.022  -15.893 1.00 0.33  ? 44 LEU B H    1  
ATOM 1761  H HA   . LEU B 1 44 ? 6.438   -9.642  -13.810 1.00 0.30  ? 44 LEU B HA   1  
ATOM 1762  H HB2  . LEU B 1 44 ? 5.472   -10.793 -16.353 1.00 0.37  ? 44 LEU B HB2  1  
ATOM 1763  H HB3  . LEU B 1 44 ? 7.081   -11.306 -15.855 1.00 0.37  ? 44 LEU B HB3  1  
ATOM 1764  H HG   . LEU B 1 44 ? 4.912   -12.570 -15.025 1.00 0.35  ? 44 LEU B HG   1  
ATOM 1765  H HD11 . LEU B 1 44 ? 7.416   -11.844 -13.516 1.00 1.02  ? 44 LEU B HD11 1  
ATOM 1766  H HD12 . LEU B 1 44 ? 6.291   -13.060 -12.911 1.00 1.19  ? 44 LEU B HD12 1  
ATOM 1767  H HD13 . LEU B 1 44 ? 7.096   -13.295 -14.464 1.00 1.02  ? 44 LEU B HD13 1  
ATOM 1768  H HD21 . LEU B 1 44 ? 3.964   -10.417 -14.019 1.00 1.02  ? 44 LEU B HD21 1  
ATOM 1769  H HD22 . LEU B 1 44 ? 4.064   -11.770 -12.895 1.00 1.04  ? 44 LEU B HD22 1  
ATOM 1770  H HD23 . LEU B 1 44 ? 5.266   -10.483 -12.834 1.00 1.02  ? 44 LEU B HD23 1  
ATOM 1771  N N    . LYS B 1 45 ? 8.796   -9.327  -14.878 1.00 0.38  ? 45 LYS B N    1  
ATOM 1772  C CA   . LYS B 1 45 ? 10.126  -8.843  -15.332 1.00 0.44  ? 45 LYS B CA   1  
ATOM 1773  C C    . LYS B 1 45 ? 10.340  -9.151  -16.804 1.00 0.49  ? 45 LYS B C    1  
ATOM 1774  O O    . LYS B 1 45 ? 10.874  -8.342  -17.540 1.00 0.54  ? 45 LYS B O    1  
ATOM 1775  C CB   . LYS B 1 45 ? 11.189  -9.567  -14.522 1.00 0.45  ? 45 LYS B CB   1  
ATOM 1776  C CG   . LYS B 1 45 ? 12.100  -8.555  -13.820 1.00 0.47  ? 45 LYS B CG   1  
ATOM 1777  C CD   . LYS B 1 45 ? 13.548  -9.036  -13.886 1.00 0.72  ? 45 LYS B CD   1  
ATOM 1778  C CE   . LYS B 1 45 ? 14.386  -8.279  -12.852 1.00 1.05  ? 45 LYS B CE   1  
ATOM 1779  N NZ   . LYS B 1 45 ? 15.658  -9.015  -12.597 1.00 1.42  ? 45 LYS B NZ   1  
ATOM 1780  H H    . LYS B 1 45 ? 8.771   -9.967  -14.145 1.00 0.37  ? 45 LYS B H    1  
ATOM 1781  H HA   . LYS B 1 45 ? 10.207  -7.782  -15.166 1.00 0.45  ? 45 LYS B HA   1  
ATOM 1782  H HB2  . LYS B 1 45 ? 10.706  -10.185 -13.781 1.00 0.41  ? 45 LYS B HB2  1  
ATOM 1783  H HB3  . LYS B 1 45 ? 11.752  -10.189 -15.172 1.00 0.49  ? 45 LYS B HB3  1  
ATOM 1784  H HG2  . LYS B 1 45 ? 12.017  -7.595  -14.309 1.00 0.52  ? 45 LYS B HG2  1  
ATOM 1785  H HG3  . LYS B 1 45 ? 11.802  -8.460  -12.786 1.00 0.54  ? 45 LYS B HG3  1  
ATOM 1786  H HD2  . LYS B 1 45 ? 13.585  -10.095 -13.674 1.00 0.99  ? 45 LYS B HD2  1  
ATOM 1787  H HD3  . LYS B 1 45 ? 13.944  -8.850  -14.873 1.00 0.93  ? 45 LYS B HD3  1  
ATOM 1788  H HE2  . LYS B 1 45 ? 14.612  -7.291  -13.227 1.00 1.47  ? 45 LYS B HE2  1  
ATOM 1789  H HE3  . LYS B 1 45 ? 13.829  -8.194  -11.929 1.00 1.41  ? 45 LYS B HE3  1  
ATOM 1790  H HZ1  . LYS B 1 45 ? 15.443  -9.988  -12.297 1.00 1.95  ? 45 LYS B HZ1  1  
ATOM 1791  H HZ2  . LYS B 1 45 ? 16.226  -9.041  -13.467 1.00 1.87  ? 45 LYS B HZ2  1  
ATOM 1792  H HZ3  . LYS B 1 45 ? 16.192  -8.531  -11.847 1.00 1.73  ? 45 LYS B HZ3  1  
ATOM 1793  N N    . ASN B 1 46 ? 9.922   -10.308 -17.241 1.00 0.49  ? 46 ASN B N    1  
ATOM 1794  C CA   . ASN B 1 46 ? 10.096  -10.659 -18.680 1.00 0.55  ? 46 ASN B CA   1  
ATOM 1795  C C    . ASN B 1 46 ? 9.153   -9.800  -19.553 1.00 0.58  ? 46 ASN B C    1  
ATOM 1796  O O    . ASN B 1 46 ? 9.118   -9.941  -20.761 1.00 0.75  ? 46 ASN B O    1  
ATOM 1797  C CB   . ASN B 1 46 ? 9.797   -12.150 -18.874 1.00 0.58  ? 46 ASN B CB   1  
ATOM 1798  C CG   . ASN B 1 46 ? 8.312   -12.428 -18.631 1.00 0.78  ? 46 ASN B CG   1  
ATOM 1799  O OD1  . ASN B 1 46 ? 7.493   -12.188 -19.493 1.00 1.67  ? 46 ASN B OD1  1  
ATOM 1800  N ND2  . ASN B 1 46 ? 7.929   -12.932 -17.488 1.00 0.81  ? 46 ASN B ND2  1  
ATOM 1801  H H    . ASN B 1 46 ? 9.486   -10.944 -16.622 1.00 0.47  ? 46 ASN B H    1  
ATOM 1802  H HA   . ASN B 1 46 ? 11.118  -10.462 -18.970 1.00 0.62  ? 46 ASN B HA   1  
ATOM 1803  H HB2  . ASN B 1 46 ? 10.054  -12.433 -19.878 1.00 0.73  ? 46 ASN B HB2  1  
ATOM 1804  H HB3  . ASN B 1 46 ? 10.387  -12.726 -18.177 1.00 0.75  ? 46 ASN B HB3  1  
ATOM 1805  H HD21 . ASN B 1 46 ? 8.590   -13.130 -16.792 1.00 1.39  ? 46 ASN B HD21 1  
ATOM 1806  H HD22 . ASN B 1 46 ? 6.981   -13.115 -17.327 1.00 0.88  ? 46 ASN B HD22 1  
ATOM 1807  N N    . GLY B 1 47 ? 8.383   -8.920  -18.944 1.00 0.50  ? 47 GLY B N    1  
ATOM 1808  C CA   . GLY B 1 47 ? 7.437   -8.060  -19.710 1.00 0.53  ? 47 GLY B CA   1  
ATOM 1809  C C    . GLY B 1 47 ? 6.114   -8.803  -19.858 1.00 0.52  ? 47 GLY B C    1  
ATOM 1810  O O    . GLY B 1 47 ? 5.436   -8.692  -20.863 1.00 0.60  ? 47 GLY B O    1  
ATOM 1811  H H    . GLY B 1 47 ? 8.417   -8.831  -17.973 1.00 0.52  ? 47 GLY B H    1  
ATOM 1812  H HA2  . GLY B 1 47 ? 7.272   -7.136  -19.166 1.00 0.53  ? 47 GLY B HA2  1  
ATOM 1813  H HA3  . GLY B 1 47 ? 7.841   -7.841  -20.683 1.00 0.59  ? 47 GLY B HA3  1  
ATOM 1814  N N    . ARG B 1 48 ? 5.738   -9.545  -18.846 1.00 0.47  ? 48 ARG B N    1  
ATOM 1815  C CA   . ARG B 1 48 ? 4.445   -10.291 -18.891 1.00 0.54  ? 48 ARG B CA   1  
ATOM 1816  C C    . ARG B 1 48 ? 3.490   -9.614  -17.920 1.00 0.43  ? 48 ARG B C    1  
ATOM 1817  O O    . ARG B 1 48 ? 3.771   -8.545  -17.426 1.00 0.37  ? 48 ARG B O    1  
ATOM 1818  C CB   . ARG B 1 48 ? 4.667   -11.747 -18.462 1.00 0.66  ? 48 ARG B CB   1  
ATOM 1819  C CG   . ARG B 1 48 ? 4.667   -12.655 -19.692 1.00 1.00  ? 48 ARG B CG   1  
ATOM 1820  C CD   . ARG B 1 48 ? 5.065   -14.076 -19.277 1.00 1.55  ? 48 ARG B CD   1  
ATOM 1821  N NE   . ARG B 1 48 ? 4.825   -15.018 -20.412 1.00 2.08  ? 48 ARG B NE   1  
ATOM 1822  C CZ   . ARG B 1 48 ? 5.030   -16.300 -20.255 1.00 2.34  ? 48 ARG B CZ   1  
ATOM 1823  N NH1  . ARG B 1 48 ? 4.073   -17.064 -19.793 1.00 2.89  ? 48 ARG B NH1  1  
ATOM 1824  N NH2  . ARG B 1 48 ? 6.191   -16.819 -20.563 1.00 2.67  ? 48 ARG B NH2  1  
ATOM 1825  H H    . ARG B 1 48 ? 6.305   -9.593  -18.038 1.00 0.43  ? 48 ARG B H    1  
ATOM 1826  H HA   . ARG B 1 48 ? 4.032   -10.260 -19.888 1.00 0.68  ? 48 ARG B HA   1  
ATOM 1827  H HB2  . ARG B 1 48 ? 5.614   -11.831 -17.952 1.00 1.19  ? 48 ARG B HB2  1  
ATOM 1828  H HB3  . ARG B 1 48 ? 3.873   -12.051 -17.795 1.00 1.23  ? 48 ARG B HB3  1  
ATOM 1829  H HG2  . ARG B 1 48 ? 3.677   -12.669 -20.127 1.00 1.43  ? 48 ARG B HG2  1  
ATOM 1830  H HG3  . ARG B 1 48 ? 5.373   -12.280 -20.416 1.00 1.63  ? 48 ARG B HG3  1  
ATOM 1831  H HD2  . ARG B 1 48 ? 6.113   -14.093 -19.012 1.00 1.85  ? 48 ARG B HD2  1  
ATOM 1832  H HD3  . ARG B 1 48 ? 4.476   -14.380 -18.425 1.00 1.85  ? 48 ARG B HD3  1  
ATOM 1833  H HE   . ARG B 1 48 ? 4.512   -14.675 -21.275 1.00 2.46  ? 48 ARG B HE   1  
ATOM 1834  H HH11 . ARG B 1 48 ? 3.184   -16.668 -19.561 1.00 3.28  ? 48 ARG B HH11 1  
ATOM 1835  H HH12 . ARG B 1 48 ? 4.228   -18.046 -19.673 1.00 3.24  ? 48 ARG B HH12 1  
ATOM 1836  H HH21 . ARG B 1 48 ? 6.922   -16.235 -20.918 1.00 2.93  ? 48 ARG B HH21 1  
ATOM 1837  H HH22 . ARG B 1 48 ? 6.350   -17.800 -20.444 1.00 3.04  ? 48 ARG B HH22 1  
ATOM 1838  N N    . LYS B 1 49 ? 2.373   -10.212 -17.632 1.00 0.45  ? 49 LYS B N    1  
ATOM 1839  C CA   . LYS B 1 49 ? 1.435   -9.577  -16.678 1.00 0.40  ? 49 LYS B CA   1  
ATOM 1840  C C    . LYS B 1 49 ? 0.572   -10.626 -15.990 1.00 0.38  ? 49 LYS B C    1  
ATOM 1841  O O    . LYS B 1 49 ? 0.255   -11.662 -16.544 1.00 0.54  ? 49 LYS B O    1  
ATOM 1842  C CB   . LYS B 1 49 ? 0.529   -8.574  -17.394 1.00 0.58  ? 49 LYS B CB   1  
ATOM 1843  C CG   . LYS B 1 49 ? 0.384   -8.906  -18.892 1.00 0.88  ? 49 LYS B CG   1  
ATOM 1844  C CD   . LYS B 1 49 ? -0.402  -10.209 -19.094 1.00 0.96  ? 49 LYS B CD   1  
ATOM 1845  C CE   . LYS B 1 49 ? -1.809  -10.074 -18.503 1.00 0.92  ? 49 LYS B CE   1  
ATOM 1846  N NZ   . LYS B 1 49 ? -2.783  -10.805 -19.365 1.00 1.06  ? 49 LYS B NZ   1  
ATOM 1847  H H    . LYS B 1 49 ? 2.152   -11.065 -18.037 1.00 0.55  ? 49 LYS B H    1  
ATOM 1848  H HA   . LYS B 1 49 ? 2.012   -9.054  -15.926 1.00 0.34  ? 49 LYS B HA   1  
ATOM 1849  H HB2  . LYS B 1 49 ? -0.443  -8.582  -16.923 1.00 0.59  ? 49 LYS B HB2  1  
ATOM 1850  H HB3  . LYS B 1 49 ? 0.962   -7.599  -17.294 1.00 0.69  ? 49 LYS B HB3  1  
ATOM 1851  H HG2  . LYS B 1 49 ? -0.136  -8.098  -19.386 1.00 1.06  ? 49 LYS B HG2  1  
ATOM 1852  H HG3  . LYS B 1 49 ? 1.366   -9.012  -19.328 1.00 1.13  ? 49 LYS B HG3  1  
ATOM 1853  H HD2  . LYS B 1 49 ? -0.478  -10.416 -20.151 1.00 0.98  ? 49 LYS B HD2  1  
ATOM 1854  H HD3  . LYS B 1 49 ? 0.115   -11.020 -18.607 1.00 1.23  ? 49 LYS B HD3  1  
ATOM 1855  H HE2  . LYS B 1 49 ? -1.824  -10.493 -17.508 1.00 0.97  ? 49 LYS B HE2  1  
ATOM 1856  H HE3  . LYS B 1 49 ? -2.083  -9.030  -18.458 1.00 0.86  ? 49 LYS B HE3  1  
ATOM 1857  H HZ1  . LYS B 1 49 ? -2.453  -11.778 -19.518 1.00 1.38  ? 49 LYS B HZ1  1  
ATOM 1858  H HZ2  . LYS B 1 49 ? -3.713  -10.823 -18.896 1.00 1.44  ? 49 LYS B HZ2  1  
ATOM 1859  H HZ3  . LYS B 1 49 ? -2.867  -10.322 -20.281 1.00 1.51  ? 49 LYS B HZ3  1  
ATOM 1860  N N    . ALA B 1 50 ? 0.173   -10.339 -14.785 1.00 0.27  ? 50 ALA B N    1  
ATOM 1861  C CA   . ALA B 1 50 ? -0.703  -11.281 -14.029 1.00 0.28  ? 50 ALA B CA   1  
ATOM 1862  C C    . ALA B 1 50 ? -1.717  -10.478 -13.259 1.00 0.24  ? 50 ALA B C    1  
ATOM 1863  O O    . ALA B 1 50 ? -1.482  -9.341  -12.950 1.00 0.21  ? 50 ALA B O    1  
ATOM 1864  C CB   . ALA B 1 50 ? 0.105   -12.081 -13.019 1.00 0.32  ? 50 ALA B CB   1  
ATOM 1865  H H    . ALA B 1 50 ? 0.441   -9.477  -14.379 1.00 0.29  ? 50 ALA B H    1  
ATOM 1866  H HA   . ALA B 1 50 ? -1.204  -11.947 -14.712 1.00 0.35  ? 50 ALA B HA   1  
ATOM 1867  H HB1  . ALA B 1 50 ? 0.916   -12.578 -13.516 1.00 1.08  ? 50 ALA B HB1  1  
ATOM 1868  H HB2  . ALA B 1 50 ? 0.492   -11.409 -12.264 1.00 1.03  ? 50 ALA B HB2  1  
ATOM 1869  H HB3  . ALA B 1 50 ? -0.541  -12.810 -12.548 1.00 1.05  ? 50 ALA B HB3  1  
ATOM 1870  N N    . CYS B 1 51 ? -2.810  -11.063 -12.883 1.00 0.25  ? 51 CYS B N    1  
ATOM 1871  C CA   . CYS B 1 51 ? -3.778  -10.307 -12.079 1.00 0.22  ? 51 CYS B CA   1  
ATOM 1872  C C    . CYS B 1 51 ? -3.842  -10.965 -10.724 1.00 0.22  ? 51 CYS B C    1  
ATOM 1873  O O    . CYS B 1 51 ? -3.597  -12.146 -10.602 1.00 0.25  ? 51 CYS B O    1  
ATOM 1874  C CB   . CYS B 1 51 ? -5.158  -10.318 -12.733 1.00 0.25  ? 51 CYS B CB   1  
ATOM 1875  S SG   . CYS B 1 51 ? -5.669  -8.612  -13.050 1.00 0.24  ? 51 CYS B SG   1  
ATOM 1876  H H    . CYS B 1 51 ? -2.972  -12.012 -13.079 1.00 0.28  ? 51 CYS B H    1  
ATOM 1877  H HA   . CYS B 1 51 ? -3.436  -9.290  -11.976 1.00 0.20  ? 51 CYS B HA   1  
ATOM 1878  H HB2  . CYS B 1 51 ? -5.113  -10.860 -13.663 1.00 0.28  ? 51 CYS B HB2  1  
ATOM 1879  H HB3  . CYS B 1 51 ? -5.871  -10.791 -12.073 1.00 0.27  ? 51 CYS B HB3  1  
ATOM 1880  N N    . LEU B 1 52 ? -4.139  -10.219 -9.708  1.00 0.21  ? 52 LEU B N    1  
ATOM 1881  C CA   . LEU B 1 52 ? -4.223  -10.810 -8.356  1.00 0.23  ? 52 LEU B CA   1  
ATOM 1882  C C    . LEU B 1 52 ? -5.449  -10.216 -7.667  1.00 0.25  ? 52 LEU B C    1  
ATOM 1883  O O    . LEU B 1 52 ? -6.036  -9.270  -8.154  1.00 0.25  ? 52 LEU B O    1  
ATOM 1884  C CB   . LEU B 1 52 ? -2.928  -10.579 -7.547  1.00 0.22  ? 52 LEU B CB   1  
ATOM 1885  C CG   . LEU B 1 52 ? -2.142  -9.378  -8.082  1.00 0.18  ? 52 LEU B CG   1  
ATOM 1886  C CD1  . LEU B 1 52 ? -1.587  -9.676  -9.489  1.00 0.17  ? 52 LEU B CD1  1  
ATOM 1887  C CD2  . LEU B 1 52 ? -3.062  -8.157  -8.082  1.00 0.18  ? 52 LEU B CD2  1  
ATOM 1888  H H    . LEU B 1 52 ? -4.299  -9.261  -9.830  1.00 0.20  ? 52 LEU B H    1  
ATOM 1889  H HA   . LEU B 1 52 ? -4.380  -11.858 -8.463  1.00 0.26  ? 52 LEU B HA   1  
ATOM 1890  H HB2  . LEU B 1 52 ? -3.181  -10.402 -6.515  1.00 0.25  ? 52 LEU B HB2  1  
ATOM 1891  H HB3  . LEU B 1 52 ? -2.310  -11.462 -7.612  1.00 0.24  ? 52 LEU B HB3  1  
ATOM 1892  H HG   . LEU B 1 52 ? -1.320  -9.189  -7.434  1.00 0.19  ? 52 LEU B HG   1  
ATOM 1893  H HD11 . LEU B 1 52 ? -1.649  -10.740 -9.684  1.00 0.98  ? 52 LEU B HD11 1  
ATOM 1894  H HD12 . LEU B 1 52 ? -2.163  -9.144  -10.230 1.00 0.95  ? 52 LEU B HD12 1  
ATOM 1895  H HD13 . LEU B 1 52 ? -0.555  -9.366  -9.546  1.00 1.00  ? 52 LEU B HD13 1  
ATOM 1896  H HD21 . LEU B 1 52 ? -3.979  -8.404  -7.561  1.00 0.96  ? 52 LEU B HD21 1  
ATOM 1897  H HD22 . LEU B 1 52 ? -2.574  -7.341  -7.576  1.00 0.97  ? 52 LEU B HD22 1  
ATOM 1898  H HD23 . LEU B 1 52 ? -3.289  -7.877  -9.094  1.00 1.01  ? 52 LEU B HD23 1  
ATOM 1899  N N    . ASN B 1 53 ? -5.871  -10.784 -6.577  1.00 0.29  ? 53 ASN B N    1  
ATOM 1900  C CA   . ASN B 1 53 ? -7.096  -10.266 -5.893  1.00 0.33  ? 53 ASN B CA   1  
ATOM 1901  C C    . ASN B 1 53 ? -6.723  -9.219  -4.835  1.00 0.34  ? 53 ASN B C    1  
ATOM 1902  O O    . ASN B 1 53 ? -6.391  -9.593  -3.737  1.00 0.37  ? 53 ASN B O    1  
ATOM 1903  C CB   . ASN B 1 53 ? -7.821  -11.428 -5.192  1.00 0.37  ? 53 ASN B CB   1  
ATOM 1904  C CG   . ASN B 1 53 ? -9.076  -11.827 -5.980  1.00 0.43  ? 53 ASN B CG   1  
ATOM 1905  O OD1  . ASN B 1 53 ? -9.236  -11.464 -7.128  1.00 1.07  ? 53 ASN B OD1  1  
ATOM 1906  N ND2  . ASN B 1 53 ? -9.983  -12.571 -5.403  1.00 0.93  ? 53 ASN B ND2  1  
ATOM 1907  H H    . ASN B 1 53 ? -5.400  -11.567 -6.224  1.00 0.31  ? 53 ASN B H    1  
ATOM 1908  H HA   . ASN B 1 53 ? -7.753  -9.838  -6.625  1.00 0.33  ? 53 ASN B HA   1  
ATOM 1909  H HB2  . ASN B 1 53 ? -7.155  -12.276 -5.118  1.00 0.41  ? 53 ASN B HB2  1  
ATOM 1910  H HB3  . ASN B 1 53 ? -8.112  -11.119 -4.198  1.00 0.41  ? 53 ASN B HB3  1  
ATOM 1911  H HD21 . ASN B 1 53 ? -9.858  -12.869 -4.477  1.00 1.59  ? 53 ASN B HD21 1  
ATOM 1912  H HD22 . ASN B 1 53 ? -10.788 -12.831 -5.897  1.00 0.93  ? 53 ASN B HD22 1  
ATOM 1913  N N    . PRO B 1 54 ? -6.817  -7.935  -5.142  1.00 0.34  ? 54 PRO B N    1  
ATOM 1914  C CA   . PRO B 1 54 ? -6.504  -6.896  -4.141  1.00 0.37  ? 54 PRO B CA   1  
ATOM 1915  C C    . PRO B 1 54 ? -7.464  -7.024  -2.955  1.00 0.43  ? 54 PRO B C    1  
ATOM 1916  O O    . PRO B 1 54 ? -7.103  -6.738  -1.829  1.00 0.46  ? 54 PRO B O    1  
ATOM 1917  C CB   . PRO B 1 54 ? -6.647  -5.580  -4.907  1.00 0.38  ? 54 PRO B CB   1  
ATOM 1918  C CG   . PRO B 1 54 ? -7.515  -5.906  -6.133  1.00 0.37  ? 54 PRO B CG   1  
ATOM 1919  C CD   . PRO B 1 54 ? -7.267  -7.390  -6.443  1.00 0.33  ? 54 PRO B CD   1  
ATOM 1920  H HA   . PRO B 1 54 ? -5.484  -7.010  -3.803  1.00 0.36  ? 54 PRO B HA   1  
ATOM 1921  H HB2  . PRO B 1 54 ? -7.132  -4.839  -4.286  1.00 0.42  ? 54 PRO B HB2  1  
ATOM 1922  H HB3  . PRO B 1 54 ? -5.679  -5.227  -5.228  1.00 0.36  ? 54 PRO B HB3  1  
ATOM 1923  H HG2  . PRO B 1 54 ? -8.556  -5.745  -5.902  1.00 0.41  ? 54 PRO B HG2  1  
ATOM 1924  H HG3  . PRO B 1 54 ? -7.217  -5.304  -6.970  1.00 0.36  ? 54 PRO B HG3  1  
ATOM 1925  H HD2  . PRO B 1 54 ? -8.179  -7.853  -6.777  1.00 0.35  ? 54 PRO B HD2  1  
ATOM 1926  H HD3  . PRO B 1 54 ? -6.484  -7.495  -7.182  1.00 0.28  ? 54 PRO B HD3  1  
ATOM 1927  N N    . ALA B 1 55 ? -8.658  -7.534  -3.188  1.00 0.45  ? 55 ALA B N    1  
ATOM 1928  C CA   . ALA B 1 55 ? -9.599  -7.773  -2.057  1.00 0.52  ? 55 ALA B CA   1  
ATOM 1929  C C    . ALA B 1 55 ? -8.941  -8.817  -1.141  1.00 0.53  ? 55 ALA B C    1  
ATOM 1930  O O    . ALA B 1 55 ? -9.113  -8.801  0.064   1.00 0.56  ? 55 ALA B O    1  
ATOM 1931  C CB   . ALA B 1 55 ? -10.931 -8.313  -2.587  1.00 0.55  ? 55 ALA B CB   1  
ATOM 1932  H H    . ALA B 1 55 ? -8.907  -7.814  -4.094  1.00 0.44  ? 55 ALA B H    1  
ATOM 1933  H HA   . ALA B 1 55 ? -9.760  -6.854  -1.511  1.00 0.53  ? 55 ALA B HA   1  
ATOM 1934  H HB1  . ALA B 1 55 ? -10.760 -8.847  -3.511  1.00 1.15  ? 55 ALA B HB1  1  
ATOM 1935  H HB2  . ALA B 1 55 ? -11.365 -8.983  -1.859  1.00 1.13  ? 55 ALA B HB2  1  
ATOM 1936  H HB3  . ALA B 1 55 ? -11.608 -7.491  -2.767  1.00 1.19  ? 55 ALA B HB3  1  
ATOM 1937  N N    . SER B 1 56 ? -8.148  -9.700  -1.725  1.00 0.50  ? 56 SER B N    1  
ATOM 1938  C CA   . SER B 1 56 ? -7.417  -10.730 -0.930  1.00 0.52  ? 56 SER B CA   1  
ATOM 1939  C C    . SER B 1 56 ? -6.448  -10.003 0.023   1.00 0.51  ? 56 SER B C    1  
ATOM 1940  O O    . SER B 1 56 ? -5.967  -8.935  -0.305  1.00 0.52  ? 56 SER B O    1  
ATOM 1941  C CB   . SER B 1 56 ? -6.608  -11.628 -1.876  1.00 0.50  ? 56 SER B CB   1  
ATOM 1942  O OG   . SER B 1 56 ? -6.592  -12.957 -1.367  1.00 0.56  ? 56 SER B OG   1  
ATOM 1943  H H    . SER B 1 56 ? -8.013  -9.662  -2.692  1.00 0.48  ? 56 SER B H    1  
ATOM 1944  H HA   . SER B 1 56 ? -8.121  -11.326 -0.383  1.00 0.55  ? 56 SER B HA   1  
ATOM 1945  H HB2  . SER B 1 56 ? -7.057  -11.625 -2.855  1.00 0.46  ? 56 SER B HB2  1  
ATOM 1946  H HB3  . SER B 1 56 ? -5.596  -11.248 -1.950  1.00 0.51  ? 56 SER B HB3  1  
ATOM 1947  H HG   . SER B 1 56 ? -7.155  -13.496 -1.929  1.00 1.02  ? 56 SER B HG   1  
ATOM 1948  N N    . PRO B 1 57 ? -6.174  -10.593 1.165   1.00 0.53  ? 57 PRO B N    1  
ATOM 1949  C CA   . PRO B 1 57 ? -5.251  -9.996  2.155   1.00 0.53  ? 57 PRO B CA   1  
ATOM 1950  C C    . PRO B 1 57 ? -3.802  -10.130 1.666   1.00 0.51  ? 57 PRO B C    1  
ATOM 1951  O O    . PRO B 1 57 ? -3.096  -9.145  1.505   1.00 0.51  ? 57 PRO B O    1  
ATOM 1952  C CB   . PRO B 1 57 ? -5.506  -10.815 3.427   1.00 0.59  ? 57 PRO B CB   1  
ATOM 1953  C CG   . PRO B 1 57 ? -6.132  -12.153 2.967   1.00 0.62  ? 57 PRO B CG   1  
ATOM 1954  C CD   . PRO B 1 57 ? -6.738  -11.899 1.573   1.00 0.58  ? 57 PRO B CD   1  
ATOM 1955  H HA   . PRO B 1 57 ? -5.499  -8.961  2.327   1.00 0.54  ? 57 PRO B HA   1  
ATOM 1956  H HB2  . PRO B 1 57 ? -4.573  -10.996 3.944   1.00 0.60  ? 57 PRO B HB2  1  
ATOM 1957  H HB3  . PRO B 1 57 ? -6.194  -10.294 4.072   1.00 0.63  ? 57 PRO B HB3  1  
ATOM 1958  H HG2  . PRO B 1 57 ? -5.370  -12.917 2.911   1.00 0.64  ? 57 PRO B HG2  1  
ATOM 1959  H HG3  . PRO B 1 57 ? -6.910  -12.454 3.653   1.00 0.67  ? 57 PRO B HG3  1  
ATOM 1960  H HD2  . PRO B 1 57 ? -6.436  -12.677 0.885   1.00 0.59  ? 57 PRO B HD2  1  
ATOM 1961  H HD3  . PRO B 1 57 ? -7.814  -11.839 1.632   1.00 0.60  ? 57 PRO B HD3  1  
ATOM 1962  N N    . ILE B 1 58 ? -3.371  -11.341 1.398   1.00 0.52  ? 58 ILE B N    1  
ATOM 1963  C CA   . ILE B 1 58 ? -1.988  -11.570 0.879   1.00 0.51  ? 58 ILE B CA   1  
ATOM 1964  C C    . ILE B 1 58 ? -1.772  -10.692 -0.341  1.00 0.45  ? 58 ILE B C    1  
ATOM 1965  O O    . ILE B 1 58 ? -0.739  -10.086 -0.520  1.00 0.44  ? 58 ILE B O    1  
ATOM 1966  C CB   . ILE B 1 58 ? -1.864  -13.046 0.461   1.00 0.54  ? 58 ILE B CB   1  
ATOM 1967  C CG1  . ILE B 1 58 ? -0.818  -13.751 1.332   1.00 0.62  ? 58 ILE B CG1  1  
ATOM 1968  C CG2  . ILE B 1 58 ? -1.463  -13.159 -1.021  1.00 0.49  ? 58 ILE B CG2  1  
ATOM 1969  C CD1  . ILE B 1 58 ? -1.380  -13.969 2.740   1.00 0.68  ? 58 ILE B CD1  1  
ATOM 1970  H H    . ILE B 1 58 ? -3.972  -12.104 1.512   1.00 0.55  ? 58 ILE B H    1  
ATOM 1971  H HA   . ILE B 1 58 ? -1.260  -11.329 1.637   1.00 0.55  ? 58 ILE B HA   1  
ATOM 1972  H HB   . ILE B 1 58 ? -2.824  -13.519 0.591   1.00 0.56  ? 58 ILE B HB   1  
ATOM 1973  H HG12 . ILE B 1 58 ? -0.571  -14.706 0.892   1.00 0.64  ? 58 ILE B HG12 1  
ATOM 1974  H HG13 . ILE B 1 58 ? 0.073   -13.143 1.391   1.00 0.62  ? 58 ILE B HG13 1  
ATOM 1975  H HG21 . ILE B 1 58 ? -0.678  -12.449 -1.241  1.00 1.14  ? 58 ILE B HG21 1  
ATOM 1976  H HG22 . ILE B 1 58 ? -1.115  -14.156 -1.226  1.00 1.10  ? 58 ILE B HG22 1  
ATOM 1977  H HG23 . ILE B 1 58 ? -2.323  -12.943 -1.644  1.00 1.12  ? 58 ILE B HG23 1  
ATOM 1978  H HD11 . ILE B 1 58 ? -1.793  -13.043 3.110   1.00 1.24  ? 58 ILE B HD11 1  
ATOM 1979  H HD12 . ILE B 1 58 ? -2.153  -14.721 2.705   1.00 1.22  ? 58 ILE B HD12 1  
ATOM 1980  H HD13 . ILE B 1 58 ? -0.587  -14.298 3.396   1.00 1.22  ? 58 ILE B HD13 1  
ATOM 1981  N N    . VAL B 1 59 ? -2.741  -10.668 -1.199  1.00 0.43  ? 59 VAL B N    1  
ATOM 1982  C CA   . VAL B 1 59 ? -2.627  -9.879  -2.430  1.00 0.40  ? 59 VAL B CA   1  
ATOM 1983  C C    . VAL B 1 59 ? -2.594  -8.395  -2.094  1.00 0.37  ? 59 VAL B C    1  
ATOM 1984  O O    . VAL B 1 59 ? -1.815  -7.654  -2.658  1.00 0.32  ? 59 VAL B O    1  
ATOM 1985  C CB   . VAL B 1 59 ? -3.831  -10.187 -3.288  1.00 0.51  ? 59 VAL B CB   1  
ATOM 1986  C CG1  . VAL B 1 59 ? -3.781  -9.347  -4.533  1.00 0.31  ? 59 VAL B CG1  1  
ATOM 1987  C CG2  . VAL B 1 59 ? -3.850  -11.664 -3.669  1.00 0.88  ? 59 VAL B CG2  1  
ATOM 1988  H H    . VAL B 1 59 ? -3.547  -11.201 -1.042  1.00 0.46  ? 59 VAL B H    1  
ATOM 1989  H HA   . VAL B 1 59 ? -1.713  -10.148 -2.937  1.00 0.41  ? 59 VAL B HA   1  
ATOM 1990  H HB   . VAL B 1 59 ? -4.719  -9.946  -2.732  1.00 0.84  ? 59 VAL B HB   1  
ATOM 1991  H HG11 . VAL B 1 59 ? -2.763  -9.293  -4.878  1.00 1.08  ? 59 VAL B HG11 1  
ATOM 1992  H HG12 . VAL B 1 59 ? -4.402  -9.800  -5.284  1.00 1.03  ? 59 VAL B HG12 1  
ATOM 1993  H HG13 . VAL B 1 59 ? -4.147  -8.361  -4.302  1.00 1.00  ? 59 VAL B HG13 1  
ATOM 1994  H HG21 . VAL B 1 59 ? -3.839  -12.269 -2.775  1.00 1.53  ? 59 VAL B HG21 1  
ATOM 1995  H HG22 . VAL B 1 59 ? -4.742  -11.878 -4.238  1.00 1.47  ? 59 VAL B HG22 1  
ATOM 1996  H HG23 . VAL B 1 59 ? -2.983  -11.887 -4.265  1.00 1.25  ? 59 VAL B HG23 1  
ATOM 1997  N N    . LYS B 1 60 ? -3.393  -7.955  -1.149  1.00 0.43  ? 60 LYS B N    1  
ATOM 1998  C CA   . LYS B 1 60 ? -3.335  -6.518  -0.753  1.00 0.43  ? 60 LYS B CA   1  
ATOM 1999  C C    . LYS B 1 60 ? -1.884  -6.210  -0.341  1.00 0.43  ? 60 LYS B C    1  
ATOM 2000  O O    . LYS B 1 60 ? -1.433  -5.078  -0.374  1.00 0.42  ? 60 LYS B O    1  
ATOM 2001  C CB   . LYS B 1 60 ? -4.260  -6.270  0.437   1.00 0.50  ? 60 LYS B CB   1  
ATOM 2002  C CG   . LYS B 1 60 ? -5.060  -4.985  0.211   1.00 0.60  ? 60 LYS B CG   1  
ATOM 2003  C CD   . LYS B 1 60 ? -5.712  -4.553  1.525   1.00 0.91  ? 60 LYS B CD   1  
ATOM 2004  C CE   . LYS B 1 60 ? -7.009  -5.340  1.736   1.00 0.99  ? 60 LYS B CE   1  
ATOM 2005  N NZ   . LYS B 1 60 ? -7.599  -4.984  3.058   1.00 1.68  ? 60 LYS B NZ   1  
ATOM 2006  H H    . LYS B 1 60 ? -3.992  -8.573  -0.680  1.00 0.47  ? 60 LYS B H    1  
ATOM 2007  H HA   . LYS B 1 60 ? -3.625  -5.899  -1.597  1.00 0.40  ? 60 LYS B HA   1  
ATOM 2008  H HB2  . LYS B 1 60 ? -4.935  -7.105  0.545   1.00 0.65  ? 60 LYS B HB2  1  
ATOM 2009  H HB3  . LYS B 1 60 ? -3.666  -6.169  1.333   1.00 0.59  ? 60 LYS B HB3  1  
ATOM 2010  H HG2  . LYS B 1 60 ? -4.396  -4.206  -0.136  1.00 1.10  ? 60 LYS B HG2  1  
ATOM 2011  H HG3  . LYS B 1 60 ? -5.826  -5.162  -0.529  1.00 0.87  ? 60 LYS B HG3  1  
ATOM 2012  H HD2  . LYS B 1 60 ? -5.034  -4.746  2.345   1.00 1.39  ? 60 LYS B HD2  1  
ATOM 2013  H HD3  . LYS B 1 60 ? -5.937  -3.497  1.486   1.00 1.49  ? 60 LYS B HD3  1  
ATOM 2014  H HE2  . LYS B 1 60 ? -7.709  -5.094  0.952   1.00 1.20  ? 60 LYS B HE2  1  
ATOM 2015  H HE3  . LYS B 1 60 ? -6.797  -6.398  1.710   1.00 1.40  ? 60 LYS B HE3  1  
ATOM 2016  H HZ1  . LYS B 1 60 ? -7.705  -3.950  3.125   1.00 2.15  ? 60 LYS B HZ1  1  
ATOM 2017  H HZ2  . LYS B 1 60 ? -8.531  -5.435  3.155   1.00 2.27  ? 60 LYS B HZ2  1  
ATOM 2018  H HZ3  . LYS B 1 60 ? -6.974  -5.319  3.819   1.00 1.91  ? 60 LYS B HZ3  1  
ATOM 2019  N N    . LYS B 1 61 ? -1.144  -7.249  -0.013  1.00 0.44  ? 61 LYS B N    1  
ATOM 2020  C CA   . LYS B 1 61 ? 0.284   -7.126  0.341   1.00 0.46  ? 61 LYS B CA   1  
ATOM 2021  C C    . LYS B 1 61 ? 1.013   -6.856  -0.957  1.00 0.42  ? 61 LYS B C    1  
ATOM 2022  O O    . LYS B 1 61 ? 1.750   -5.914  -1.082  1.00 0.44  ? 61 LYS B O    1  
ATOM 2023  C CB   . LYS B 1 61 ? 0.749   -8.462  0.906   1.00 0.51  ? 61 LYS B CB   1  
ATOM 2024  C CG   . LYS B 1 61 ? 1.684   -8.228  2.085   1.00 0.71  ? 61 LYS B CG   1  
ATOM 2025  C CD   . LYS B 1 61 ? 2.802   -9.268  2.057   1.00 1.02  ? 61 LYS B CD   1  
ATOM 2026  C CE   . LYS B 1 61 ? 3.897   -8.869  3.049   1.00 1.29  ? 61 LYS B CE   1  
ATOM 2027  N NZ   . LYS B 1 61 ? 4.594   -10.090 3.545   1.00 1.88  ? 61 LYS B NZ   1  
ATOM 2028  H H    . LYS B 1 61 ? -1.529  -8.139  -0.056  1.00 0.45  ? 61 LYS B H    1  
ATOM 2029  H HA   . LYS B 1 61 ? 0.442   -6.328  1.049   1.00 0.49  ? 61 LYS B HA   1  
ATOM 2030  H HB2  . LYS B 1 61 ? -0.117  -9.029  1.227   1.00 0.58  ? 61 LYS B HB2  1  
ATOM 2031  H HB3  . LYS B 1 61 ? 1.265   -9.015  0.129   1.00 0.65  ? 61 LYS B HB3  1  
ATOM 2032  H HG2  . LYS B 1 61 ? 2.108   -7.237  2.016   1.00 1.41  ? 61 LYS B HG2  1  
ATOM 2033  H HG3  . LYS B 1 61 ? 1.130   -8.321  3.006   1.00 1.04  ? 61 LYS B HG3  1  
ATOM 2034  H HD2  . LYS B 1 61 ? 2.397   -10.233 2.327   1.00 1.35  ? 61 LYS B HD2  1  
ATOM 2035  H HD3  . LYS B 1 61 ? 3.219   -9.319  1.063   1.00 1.75  ? 61 LYS B HD3  1  
ATOM 2036  H HE2  . LYS B 1 61 ? 4.610   -8.223  2.558   1.00 1.83  ? 61 LYS B HE2  1  
ATOM 2037  H HE3  . LYS B 1 61 ? 3.452   -8.345  3.883   1.00 1.54  ? 61 LYS B HE3  1  
ATOM 2038  H HZ1  . LYS B 1 61 ? 3.895   -10.758 3.928   1.00 2.14  ? 61 LYS B HZ1  1  
ATOM 2039  H HZ2  . LYS B 1 61 ? 5.110   -10.538 2.762   1.00 2.45  ? 61 LYS B HZ2  1  
ATOM 2040  H HZ3  . LYS B 1 61 ? 5.266   -9.825  4.293   1.00 2.28  ? 61 LYS B HZ3  1  
ATOM 2041  N N    . ILE B 1 62 ? 0.752   -7.687  -1.934  1.00 0.37  ? 62 ILE B N    1  
ATOM 2042  C CA   . ILE B 1 62 ? 1.343   -7.532  -3.285  1.00 0.34  ? 62 ILE B CA   1  
ATOM 2043  C C    . ILE B 1 62 ? 1.334   -6.052  -3.687  1.00 0.32  ? 62 ILE B C    1  
ATOM 2044  O O    . ILE B 1 62 ? 2.287   -5.564  -4.259  1.00 0.34  ? 62 ILE B O    1  
ATOM 2045  C CB   . ILE B 1 62 ? 0.483   -8.384  -4.246  1.00 0.32  ? 62 ILE B CB   1  
ATOM 2046  C CG1  . ILE B 1 62 ? 1.315   -9.502  -4.870  1.00 0.34  ? 62 ILE B CG1  1  
ATOM 2047  C CG2  . ILE B 1 62 ? -0.142  -7.528  -5.345  1.00 0.29  ? 62 ILE B CG2  1  
ATOM 2048  C CD1  . ILE B 1 62 ? 2.074   -10.228 -3.764  1.00 0.36  ? 62 ILE B CD1  1  
ATOM 2049  H H    . ILE B 1 62 ? 0.127   -8.424  -1.779  1.00 0.37  ? 62 ILE B H    1  
ATOM 2050  H HA   . ILE B 1 62 ? 2.354   -7.887  -3.272  1.00 0.36  ? 62 ILE B HA   1  
ATOM 2051  H HB   . ILE B 1 62 ? -0.308  -8.830  -3.673  1.00 0.32  ? 62 ILE B HB   1  
ATOM 2052  H HG12 . ILE B 1 62 ? 0.654   -10.201 -5.371  1.00 0.35  ? 62 ILE B HG12 1  
ATOM 2053  H HG13 . ILE B 1 62 ? 2.009   -9.090  -5.578  1.00 0.35  ? 62 ILE B HG13 1  
ATOM 2054  H HG21 . ILE B 1 62 ? 0.636   -7.017  -5.889  1.00 0.98  ? 62 ILE B HG21 1  
ATOM 2055  H HG22 . ILE B 1 62 ? -0.701  -8.161  -6.016  1.00 1.02  ? 62 ILE B HG22 1  
ATOM 2056  H HG23 . ILE B 1 62 ? -0.805  -6.803  -4.897  1.00 1.11  ? 62 ILE B HG23 1  
ATOM 2057  H HD11 . ILE B 1 62 ? 1.430   -10.336 -2.903  1.00 1.02  ? 62 ILE B HD11 1  
ATOM 2058  H HD12 . ILE B 1 62 ? 2.375   -11.200 -4.114  1.00 1.02  ? 62 ILE B HD12 1  
ATOM 2059  H HD13 . ILE B 1 62 ? 2.945   -9.650  -3.493  1.00 0.97  ? 62 ILE B HD13 1  
ATOM 2060  N N    . ILE B 1 63 ? 0.285   -5.330  -3.366  1.00 0.31  ? 63 ILE B N    1  
ATOM 2061  C CA   . ILE B 1 63 ? 0.255   -3.877  -3.711  1.00 0.31  ? 63 ILE B CA   1  
ATOM 2062  C C    . ILE B 1 63 ? 1.240   -3.144  -2.824  1.00 0.37  ? 63 ILE B C    1  
ATOM 2063  O O    . ILE B 1 63 ? 2.078   -2.390  -3.281  1.00 0.41  ? 63 ILE B O    1  
ATOM 2064  C CB   . ILE B 1 63 ? -1.126  -3.304  -3.420  1.00 0.32  ? 63 ILE B CB   1  
ATOM 2065  C CG1  . ILE B 1 63 ? -2.138  -3.939  -4.351  1.00 0.32  ? 63 ILE B CG1  1  
ATOM 2066  C CG2  . ILE B 1 63 ? -1.114  -1.785  -3.610  1.00 0.33  ? 63 ILE B CG2  1  
ATOM 2067  C CD1  . ILE B 1 63 ? -2.621  -5.230  -3.724  1.00 0.42  ? 63 ILE B CD1  1  
ATOM 2068  H H    . ILE B 1 63 ? -0.477  -5.740  -2.877  1.00 0.31  ? 63 ILE B H    1  
ATOM 2069  H HA   . ILE B 1 63 ? 0.505   -3.732  -4.751  1.00 0.30  ? 63 ILE B HA   1  
ATOM 2070  H HB   . ILE B 1 63 ? -1.393  -3.528  -2.397  1.00 0.35  ? 63 ILE B HB   1  
ATOM 2071  H HG12 . ILE B 1 63 ? -2.964  -3.277  -4.477  1.00 0.31  ? 63 ILE B HG12 1  
ATOM 2072  H HG13 . ILE B 1 63 ? -1.683  -4.148  -5.306  1.00 0.48  ? 63 ILE B HG13 1  
ATOM 2073  H HG21 . ILE B 1 63 ? -0.631  -1.540  -4.544  1.00 1.02  ? 63 ILE B HG21 1  
ATOM 2074  H HG22 . ILE B 1 63 ? -2.126  -1.416  -3.617  1.00 1.03  ? 63 ILE B HG22 1  
ATOM 2075  H HG23 . ILE B 1 63 ? -0.570  -1.328  -2.793  1.00 0.99  ? 63 ILE B HG23 1  
ATOM 2076  H HD11 . ILE B 1 63 ? -2.323  -5.247  -2.684  1.00 1.10  ? 63 ILE B HD11 1  
ATOM 2077  H HD12 . ILE B 1 63 ? -3.692  -5.286  -3.794  1.00 1.18  ? 63 ILE B HD12 1  
ATOM 2078  H HD13 . ILE B 1 63 ? -2.173  -6.063  -4.239  1.00 1.07  ? 63 ILE B HD13 1  
ATOM 2079  N N    . GLU B 1 64 ? 1.105   -3.348  -1.544  1.00 0.38  ? 64 GLU B N    1  
ATOM 2080  C CA   . GLU B 1 64 ? 1.981   -2.652  -0.570  1.00 0.46  ? 64 GLU B CA   1  
ATOM 2081  C C    . GLU B 1 64 ? 3.449   -3.053  -0.767  1.00 0.48  ? 64 GLU B C    1  
ATOM 2082  O O    . GLU B 1 64 ? 4.326   -2.213  -0.764  1.00 0.62  ? 64 GLU B O    1  
ATOM 2083  C CB   . GLU B 1 64 ? 1.558   -3.021  0.847   1.00 0.48  ? 64 GLU B CB   1  
ATOM 2084  C CG   . GLU B 1 64 ? 0.565   -1.984  1.372   1.00 1.04  ? 64 GLU B CG   1  
ATOM 2085  C CD   . GLU B 1 64 ? 0.359   -2.187  2.875   1.00 1.40  ? 64 GLU B CD   1  
ATOM 2086  O OE1  . GLU B 1 64 ? -0.484  -2.993  3.234   1.00 1.81  ? 64 GLU B OE1  1  
ATOM 2087  O OE2  . GLU B 1 64 ? 1.048   -1.533  3.641   1.00 2.00  ? 64 GLU B OE2  1  
ATOM 2088  H H    . GLU B 1 64 ? 0.396   -3.952  -1.223  1.00 0.37  ? 64 GLU B H    1  
ATOM 2089  H HA   . GLU B 1 64 ? 1.862   -1.591  -0.714  1.00 0.48  ? 64 GLU B HA   1  
ATOM 2090  H HB2  . GLU B 1 64 ? 1.095   -3.997  0.838   1.00 0.72  ? 64 GLU B HB2  1  
ATOM 2091  H HB3  . GLU B 1 64 ? 2.428   -3.042  1.483   1.00 0.75  ? 64 GLU B HB3  1  
ATOM 2092  H HG2  . GLU B 1 64 ? 0.953   -0.991  1.191   1.00 1.39  ? 64 GLU B HG2  1  
ATOM 2093  H HG3  . GLU B 1 64 ? -0.380  -2.100  0.862   1.00 1.43  ? 64 GLU B HG3  1  
ATOM 2094  N N    . LYS B 1 65 ? 3.723   -4.326  -0.928  1.00 0.47  ? 65 LYS B N    1  
ATOM 2095  C CA   . LYS B 1 65 ? 5.132   -4.776  -1.116  1.00 0.51  ? 65 LYS B CA   1  
ATOM 2096  C C    . LYS B 1 65 ? 5.646   -4.249  -2.448  1.00 0.50  ? 65 LYS B C    1  
ATOM 2097  O O    . LYS B 1 65 ? 6.748   -3.739  -2.530  1.00 0.55  ? 65 LYS B O    1  
ATOM 2098  C CB   . LYS B 1 65 ? 5.206   -6.305  -1.085  1.00 0.52  ? 65 LYS B CB   1  
ATOM 2099  C CG   . LYS B 1 65 ? 6.607   -6.762  -1.502  1.00 1.07  ? 65 LYS B CG   1  
ATOM 2100  C CD   . LYS B 1 65 ? 6.888   -8.146  -0.918  1.00 1.44  ? 65 LYS B CD   1  
ATOM 2101  C CE   . LYS B 1 65 ? 7.523   -7.996  0.468   1.00 1.72  ? 65 LYS B CE   1  
ATOM 2102  N NZ   . LYS B 1 65 ? 7.552   -9.319  1.154   1.00 2.15  ? 65 LYS B NZ   1  
ATOM 2103  H H    . LYS B 1 65 ? 3.001   -4.986  -0.923  1.00 0.54  ? 65 LYS B H    1  
ATOM 2104  H HA   . LYS B 1 65 ? 5.731   -4.366  -0.326  1.00 0.56  ? 65 LYS B HA   1  
ATOM 2105  H HB2  . LYS B 1 65 ? 4.998   -6.651  -0.084  1.00 0.91  ? 65 LYS B HB2  1  
ATOM 2106  H HB3  . LYS B 1 65 ? 4.478   -6.713  -1.768  1.00 1.09  ? 65 LYS B HB3  1  
ATOM 2107  H HG2  . LYS B 1 65 ? 6.664   -6.808  -2.580  1.00 1.56  ? 65 LYS B HG2  1  
ATOM 2108  H HG3  . LYS B 1 65 ? 7.340   -6.062  -1.131  1.00 1.65  ? 65 LYS B HG3  1  
ATOM 2109  H HD2  . LYS B 1 65 ? 5.963   -8.699  -0.837  1.00 1.78  ? 65 LYS B HD2  1  
ATOM 2110  H HD3  . LYS B 1 65 ? 7.568   -8.677  -1.568  1.00 1.92  ? 65 LYS B HD3  1  
ATOM 2111  H HE2  . LYS B 1 65 ? 8.531   -7.624  0.363   1.00 2.13  ? 65 LYS B HE2  1  
ATOM 2112  H HE3  . LYS B 1 65 ? 6.943   -7.300  1.055   1.00 2.04  ? 65 LYS B HE3  1  
ATOM 2113  H HZ1  . LYS B 1 65 ? 6.587   -9.708  1.200   1.00 2.61  ? 65 LYS B HZ1  1  
ATOM 2114  H HZ2  . LYS B 1 65 ? 8.164   -9.972  0.624   1.00 2.61  ? 65 LYS B HZ2  1  
ATOM 2115  H HZ3  . LYS B 1 65 ? 7.925   -9.202  2.117   1.00 2.25  ? 65 LYS B HZ3  1  
ATOM 2116  N N    . MET B 1 66 ? 4.843   -4.323  -3.479  1.00 0.45  ? 66 MET B N    1  
ATOM 2117  C CA   . MET B 1 66 ? 5.273   -3.769  -4.784  1.00 0.46  ? 66 MET B CA   1  
ATOM 2118  C C    . MET B 1 66 ? 5.565   -2.278  -4.564  1.00 0.49  ? 66 MET B C    1  
ATOM 2119  O O    . MET B 1 66 ? 6.505   -1.729  -5.106  1.00 0.53  ? 66 MET B O    1  
ATOM 2120  C CB   . MET B 1 66 ? 4.158   -3.950  -5.810  1.00 0.42  ? 66 MET B CB   1  
ATOM 2121  C CG   . MET B 1 66 ? 4.291   -5.333  -6.460  1.00 0.40  ? 66 MET B CG   1  
ATOM 2122  S SD   . MET B 1 66 ? 5.711   -5.326  -7.582  1.00 1.14  ? 66 MET B SD   1  
ATOM 2123  C CE   . MET B 1 66 ? 4.985   -4.292  -8.876  1.00 0.37  ? 66 MET B CE   1  
ATOM 2124  H H    . MET B 1 66 ? 3.951   -4.710  -3.383  1.00 0.42  ? 66 MET B H    1  
ATOM 2125  H HA   . MET B 1 66 ? 6.164   -4.275  -5.113  1.00 0.47  ? 66 MET B HA   1  
ATOM 2126  H HB2  . MET B 1 66 ? 3.201   -3.868  -5.315  1.00 0.40  ? 66 MET B HB2  1  
ATOM 2127  H HB3  . MET B 1 66 ? 4.241   -3.188  -6.564  1.00 0.46  ? 66 MET B HB3  1  
ATOM 2128  H HG2  . MET B 1 66 ? 4.443   -6.085  -5.695  1.00 0.76  ? 66 MET B HG2  1  
ATOM 2129  H HG3  . MET B 1 66 ? 3.394   -5.565  -7.013  1.00 0.66  ? 66 MET B HG3  1  
ATOM 2130  H HE1  . MET B 1 66 ? 3.930   -4.169  -8.699  1.00 1.06  ? 66 MET B HE1  1  
ATOM 2131  H HE2  . MET B 1 66 ? 5.464   -3.321  -8.879  1.00 1.01  ? 66 MET B HE2  1  
ATOM 2132  H HE3  . MET B 1 66 ? 5.132   -4.769  -9.833  1.00 1.12  ? 66 MET B HE3  1  
ATOM 2133  N N    . LEU B 1 67 ? 4.779   -1.648  -3.714  1.00 0.50  ? 67 LEU B N    1  
ATOM 2134  C CA   . LEU B 1 67 ? 4.996   -0.220  -3.366  1.00 0.54  ? 67 LEU B CA   1  
ATOM 2135  C C    . LEU B 1 67 ? 6.337   -0.099  -2.630  1.00 0.60  ? 67 LEU B C    1  
ATOM 2136  O O    . LEU B 1 67 ? 7.064   0.863   -2.796  1.00 0.63  ? 67 LEU B O    1  
ATOM 2137  C CB   . LEU B 1 67 ? 3.875   0.243   -2.431  1.00 0.56  ? 67 LEU B CB   1  
ATOM 2138  C CG   . LEU B 1 67 ? 2.833   1.037   -3.216  1.00 0.53  ? 67 LEU B CG   1  
ATOM 2139  C CD1  . LEU B 1 67 ? 1.452   0.445   -2.941  1.00 0.53  ? 67 LEU B CD1  1  
ATOM 2140  C CD2  . LEU B 1 67 ? 2.862   2.502   -2.767  1.00 0.56  ? 67 LEU B CD2  1  
ATOM 2141  H H    . LEU B 1 67 ? 4.059   -2.135  -3.273  1.00 0.49  ? 67 LEU B H    1  
ATOM 2142  H HA   . LEU B 1 67 ? 4.997   0.374   -4.258  1.00 0.54  ? 67 LEU B HA   1  
ATOM 2143  H HB2  . LEU B 1 67 ? 3.406   -0.620  -1.991  1.00 0.57  ? 67 LEU B HB2  1  
ATOM 2144  H HB3  . LEU B 1 67 ? 4.286   0.861   -1.649  1.00 0.60  ? 67 LEU B HB3  1  
ATOM 2145  H HG   . LEU B 1 67 ? 3.050   0.975   -4.272  1.00 0.51  ? 67 LEU B HG   1  
ATOM 2146  H HD11 . LEU B 1 67 ? 1.487   -0.141  -2.034  1.00 1.15  ? 67 LEU B HD11 1  
ATOM 2147  H HD12 . LEU B 1 67 ? 0.733   1.241   -2.827  1.00 1.18  ? 67 LEU B HD12 1  
ATOM 2148  H HD13 . LEU B 1 67 ? 1.164   -0.188  -3.766  1.00 1.08  ? 67 LEU B HD13 1  
ATOM 2149  H HD21 . LEU B 1 67 ? 3.298   2.569   -1.780  1.00 1.09  ? 67 LEU B HD21 1  
ATOM 2150  H HD22 . LEU B 1 67 ? 3.455   3.079   -3.461  1.00 1.19  ? 67 LEU B HD22 1  
ATOM 2151  H HD23 . LEU B 1 67 ? 1.856   2.892   -2.743  1.00 1.20  ? 67 LEU B HD23 1  
ATOM 2152  N N    . ASN B 1 68 ? 6.664   -1.084  -1.813  1.00 0.63  ? 68 ASN B N    1  
ATOM 2153  C CA   . ASN B 1 68 ? 7.961   -1.051  -1.053  1.00 0.69  ? 68 ASN B CA   1  
ATOM 2154  C C    . ASN B 1 68 ? 9.138   -1.208  -2.033  1.00 0.75  ? 68 ASN B C    1  
ATOM 2155  O O    . ASN B 1 68 ? 8.941   -1.359  -3.226  1.00 0.92  ? 68 ASN B O    1  
ATOM 2156  C CB   . ASN B 1 68 ? 7.998   -2.191  -0.008  1.00 0.78  ? 68 ASN B CB   1  
ATOM 2157  C CG   . ASN B 1 68 ? 6.783   -2.092  0.926   1.00 1.48  ? 68 ASN B CG   1  
ATOM 2158  O OD1  . ASN B 1 68 ? 6.244   -1.021  1.137   1.00 2.21  ? 68 ASN B OD1  1  
ATOM 2159  N ND2  . ASN B 1 68 ? 6.330   -3.170  1.507   1.00 2.00  ? 68 ASN B ND2  1  
ATOM 2160  H H    . ASN B 1 68 ? 6.047   -1.850  -1.705  1.00 0.62  ? 68 ASN B H    1  
ATOM 2161  H HA   . ASN B 1 68 ? 8.049   -0.101  -0.546  1.00 0.72  ? 68 ASN B HA   1  
ATOM 2162  H HB2  . ASN B 1 68 ? 7.994   -3.151  -0.506  1.00 1.16  ? 68 ASN B HB2  1  
ATOM 2163  H HB3  . ASN B 1 68 ? 8.896   -2.105  0.581   1.00 1.06  ? 68 ASN B HB3  1  
ATOM 2164  H HD21 . ASN B 1 68 ? 6.766   -4.034  1.348   1.00 2.13  ? 68 ASN B HD21 1  
ATOM 2165  H HD22 . ASN B 1 68 ? 5.555   -3.117  2.103   1.00 2.63  ? 68 ASN B HD22 1  
ATOM 2166  N N    . SER B 1 69 ? 10.358  -1.155  -1.530  1.00 0.87  ? 69 SER B N    1  
ATOM 2167  C CA   . SER B 1 69 ? 11.578  -1.284  -2.397  1.00 0.99  ? 69 SER B CA   1  
ATOM 2168  C C    . SER B 1 69 ? 11.910  0.080   -3.019  1.00 1.13  ? 69 SER B C    1  
ATOM 2169  O O    . SER B 1 69 ? 11.776  0.290   -4.212  1.00 1.69  ? 69 SER B O    1  
ATOM 2170  C CB   . SER B 1 69 ? 11.357  -2.336  -3.496  1.00 1.46  ? 69 SER B CB   1  
ATOM 2171  O OG   . SER B 1 69 ? 12.606  -2.911  -3.855  1.00 2.03  ? 69 SER B OG   1  
ATOM 2172  H H    . SER B 1 69 ? 10.474  -1.018  -0.568  1.00 1.00  ? 69 SER B H    1  
ATOM 2173  H HA   . SER B 1 69 ? 12.409  -1.593  -1.779  1.00 1.09  ? 69 SER B HA   1  
ATOM 2174  H HB2  . SER B 1 69 ? 10.704  -3.110  -3.130  1.00 1.85  ? 69 SER B HB2  1  
ATOM 2175  H HB3  . SER B 1 69 ? 10.905  -1.866  -4.360  1.00 1.93  ? 69 SER B HB3  1  
ATOM 2176  H HG   . SER B 1 69 ? 12.983  -2.386  -4.565  1.00 2.38  ? 69 SER B HG   1  
ATOM 2177  N N    . ASP B 1 70 ? 12.345  1.009   -2.201  1.00 1.22  ? 70 ASP B N    1  
ATOM 2178  C CA   . ASP B 1 70 ? 12.702  2.372   -2.704  1.00 1.69  ? 70 ASP B CA   1  
ATOM 2179  C C    . ASP B 1 70 ? 13.688  3.031   -1.724  1.00 1.89  ? 70 ASP B C    1  
ATOM 2180  O O    . ASP B 1 70 ? 14.135  2.407   -0.778  1.00 2.34  ? 70 ASP B O    1  
ATOM 2181  C CB   . ASP B 1 70 ? 11.429  3.224   -2.818  1.00 2.32  ? 70 ASP B CB   1  
ATOM 2182  C CG   . ASP B 1 70 ? 11.445  4.000   -4.139  1.00 3.13  ? 70 ASP B CG   1  
ATOM 2183  O OD1  . ASP B 1 70 ? 11.088  3.416   -5.150  1.00 3.65  ? 70 ASP B OD1  1  
ATOM 2184  O OD2  . ASP B 1 70 ? 11.814  5.162   -4.117  1.00 3.72  ? 70 ASP B OD2  1  
ATOM 2185  H H    . ASP B 1 70 ? 12.443  0.806   -1.247  1.00 1.38  ? 70 ASP B H    1  
ATOM 2186  H HA   . ASP B 1 70 ? 13.167  2.286   -3.677  1.00 2.07  ? 70 ASP B HA   1  
ATOM 2187  H HB2  . ASP B 1 70 ? 10.562  2.581   -2.789  1.00 2.46  ? 70 ASP B HB2  1  
ATOM 2188  H HB3  . ASP B 1 70 ? 11.386  3.922   -1.994  1.00 2.72  ? 70 ASP B HB3  1  
ATOM 2189  N N    . LYS B 1 71 ? 14.037  4.282   -1.947  1.00 2.37  ? 71 LYS B N    1  
ATOM 2190  C CA   . LYS B 1 71 ? 15.000  4.985   -1.037  1.00 3.06  ? 71 LYS B CA   1  
ATOM 2191  C C    . LYS B 1 71 ? 16.372  4.295   -1.121  1.00 3.94  ? 71 LYS B C    1  
ATOM 2192  O O    . LYS B 1 71 ? 16.972  3.949   -0.120  1.00 4.55  ? 71 LYS B O    1  
ATOM 2193  C CB   . LYS B 1 71 ? 14.470  4.948   0.407   1.00 3.59  ? 71 LYS B CB   1  
ATOM 2194  C CG   . LYS B 1 71 ? 15.169  6.022   1.248   1.00 3.82  ? 71 LYS B CG   1  
ATOM 2195  C CD   . LYS B 1 71 ? 15.585  5.427   2.598   1.00 4.61  ? 71 LYS B CD   1  
ATOM 2196  C CE   . LYS B 1 71 ? 14.461  5.633   3.619   1.00 5.23  ? 71 LYS B CE   1  
ATOM 2197  N NZ   . LYS B 1 71 ? 14.719  4.793   4.824   1.00 5.99  ? 71 LYS B NZ   1  
ATOM 2198  H H    . LYS B 1 71 ? 13.671  4.758   -2.722  1.00 2.66  ? 71 LYS B H    1  
ATOM 2199  H HA   . LYS B 1 71 ? 15.100  6.012   -1.356  1.00 3.09  ? 71 LYS B HA   1  
ATOM 2200  H HB2  . LYS B 1 71 ? 13.406  5.133   0.401   1.00 3.68  ? 71 LYS B HB2  1  
ATOM 2201  H HB3  . LYS B 1 71 ? 14.662  3.976   0.835   1.00 4.21  ? 71 LYS B HB3  1  
ATOM 2202  H HG2  . LYS B 1 71 ? 16.046  6.376   0.725   1.00 3.92  ? 71 LYS B HG2  1  
ATOM 2203  H HG3  . LYS B 1 71 ? 14.492  6.846   1.413   1.00 3.79  ? 71 LYS B HG3  1  
ATOM 2204  H HD2  . LYS B 1 71 ? 15.777  4.370   2.482   1.00 4.80  ? 71 LYS B HD2  1  
ATOM 2205  H HD3  . LYS B 1 71 ? 16.479  5.919   2.948   1.00 4.94  ? 71 LYS B HD3  1  
ATOM 2206  H HE2  . LYS B 1 71 ? 14.423  6.673   3.907   1.00 5.31  ? 71 LYS B HE2  1  
ATOM 2207  H HE3  . LYS B 1 71 ? 13.517  5.347   3.177   1.00 5.41  ? 71 LYS B HE3  1  
ATOM 2208  H HZ1  . LYS B 1 71 ? 15.663  5.009   5.203   1.00 6.23  ? 71 LYS B HZ1  1  
ATOM 2209  H HZ2  . LYS B 1 71 ? 14.002  4.998   5.548   1.00 6.33  ? 71 LYS B HZ2  1  
ATOM 2210  H HZ3  . LYS B 1 71 ? 14.670  3.787   4.563   1.00 6.24  ? 71 LYS B HZ3  1  
ATOM 2211  N N    . SER B 1 72 ? 16.864  4.092   -2.320  1.00 4.42  ? 72 SER B N    1  
ATOM 2212  C CA   . SER B 1 72 ? 18.192  3.423   -2.492  1.00 5.58  ? 72 SER B CA   1  
ATOM 2213  C C    . SER B 1 72 ? 19.313  4.472   -2.461  1.00 5.86  ? 72 SER B C    1  
ATOM 2214  O O    . SER B 1 72 ? 19.182  5.481   -3.139  1.00 5.92  ? 72 SER B O    1  
ATOM 2215  C CB   . SER B 1 72 ? 18.221  2.676   -3.829  1.00 6.45  ? 72 SER B CB   1  
ATOM 2216  O OG   . SER B 1 72 ? 17.131  1.764   -3.883  1.00 6.62  ? 72 SER B OG   1  
ATOM 2217  O OXT  . SER B 1 72 ? 20.285  4.247   -1.760  1.00 6.32  ? 72 SER B OXT  1  
ATOM 2218  H H    . SER B 1 72 ? 16.358  4.379   -3.110  1.00 4.24  ? 72 SER B H    1  
ATOM 2219  H HA   . SER B 1 72 ? 18.343  2.718   -1.687  1.00 5.92  ? 72 SER B HA   1  
ATOM 2220  H HB2  . SER B 1 72 ? 18.135  3.380   -4.640  1.00 6.89  ? 72 SER B HB2  1  
ATOM 2221  H HB3  . SER B 1 72 ? 19.157  2.140   -3.921  1.00 6.83  ? 72 SER B HB3  1  
ATOM 2222  H HG   . SER B 1 72 ? 17.428  0.923   -3.527  1.00 7.10  ? 72 SER B HG   1  
ATOM 2223  N N    . ALA A 1 1  ? 21.714  2.199   -32.249 1.00 14.80 ? 1  ALA A N    2  
ATOM 2224  C CA   . ALA A 1 1  ? 23.169  2.489   -32.413 1.00 14.12 ? 1  ALA A CA   2  
ATOM 2225  C C    . ALA A 1 1  ? 23.661  3.350   -31.242 1.00 13.40 ? 1  ALA A C    2  
ATOM 2226  O O    . ALA A 1 1  ? 24.525  2.943   -30.489 1.00 13.47 ? 1  ALA A O    2  
ATOM 2227  C CB   . ALA A 1 1  ? 23.401  3.233   -33.732 1.00 14.17 ? 1  ALA A CB   2  
ATOM 2228  H H1   . ALA A 1 1  ? 21.555  1.722   -31.338 1.00 15.01 ? 1  ALA A H1   2  
ATOM 2229  H H2   . ALA A 1 1  ? 21.175  3.087   -32.270 1.00 15.11 ? 1  ALA A H2   2  
ATOM 2230  H H3   . ALA A 1 1  ? 21.394  1.580   -33.023 1.00 14.91 ? 1  ALA A H3   2  
ATOM 2231  H HA   . ALA A 1 1  ? 23.718  1.559   -32.426 1.00 14.26 ? 1  ALA A HA   2  
ATOM 2232  H HB1  . ALA A 1 1  ? 22.964  2.672   -34.544 1.00 14.03 ? 1  ALA A HB1  2  
ATOM 2233  H HB2  . ALA A 1 1  ? 22.941  4.209   -33.681 1.00 14.43 ? 1  ALA A HB2  2  
ATOM 2234  H HB3  . ALA A 1 1  ? 24.462  3.344   -33.901 1.00 14.25 ? 1  ALA A HB3  2  
ATOM 2235  N N    . SER A 1 2  ? 23.119  4.537   -31.086 1.00 12.87 ? 2  SER A N    2  
ATOM 2236  C CA   . SER A 1 2  ? 23.556  5.426   -29.966 1.00 12.29 ? 2  SER A CA   2  
ATOM 2237  C C    . SER A 1 2  ? 22.449  6.434   -29.640 1.00 11.44 ? 2  SER A C    2  
ATOM 2238  O O    . SER A 1 2  ? 21.913  7.087   -30.518 1.00 11.39 ? 2  SER A O    2  
ATOM 2239  C CB   . SER A 1 2  ? 24.830  6.179   -30.368 1.00 12.48 ? 2  SER A CB   2  
ATOM 2240  O OG   . SER A 1 2  ? 24.667  6.730   -31.671 1.00 12.82 ? 2  SER A OG   2  
ATOM 2241  H H    . SER A 1 2  ? 22.426  4.843   -31.707 1.00 12.96 ? 2  SER A H    2  
ATOM 2242  H HA   . SER A 1 2  ? 23.759  4.825   -29.091 1.00 12.52 ? 2  SER A HA   2  
ATOM 2243  H HB2  . SER A 1 2  ? 25.013  6.977   -29.667 1.00 12.65 ? 2  SER A HB2  2  
ATOM 2244  H HB3  . SER A 1 2  ? 25.669  5.496   -30.357 1.00 12.40 ? 2  SER A HB3  2  
ATOM 2245  H HG   . SER A 1 2  ? 25.457  6.530   -32.178 1.00 12.81 ? 2  SER A HG   2  
ATOM 2246  N N    . VAL A 1 3  ? 22.108  6.566   -28.381 1.00 10.93 ? 3  VAL A N    2  
ATOM 2247  C CA   . VAL A 1 3  ? 21.041  7.534   -27.978 1.00 10.23 ? 3  VAL A CA   2  
ATOM 2248  C C    . VAL A 1 3  ? 21.533  8.347   -26.773 1.00 9.33  ? 3  VAL A C    2  
ATOM 2249  O O    . VAL A 1 3  ? 22.333  7.878   -25.984 1.00 9.35  ? 3  VAL A O    2  
ATOM 2250  C CB   . VAL A 1 3  ? 19.761  6.770   -27.603 1.00 10.49 ? 3  VAL A CB   2  
ATOM 2251  C CG1  . VAL A 1 3  ? 18.609  7.760   -27.414 1.00 10.45 ? 3  VAL A CG1  2  
ATOM 2252  C CG2  . VAL A 1 3  ? 19.398  5.786   -28.721 1.00 11.15 ? 3  VAL A CG2  2  
ATOM 2253  H H    . VAL A 1 3  ? 22.560  6.029   -27.696 1.00 11.13 ? 3  VAL A H    2  
ATOM 2254  H HA   . VAL A 1 3  ? 20.833  8.202   -28.801 1.00 10.38 ? 3  VAL A HA   2  
ATOM 2255  H HB   . VAL A 1 3  ? 19.923  6.228   -26.683 1.00 10.48 ? 3  VAL A HB   2  
ATOM 2256  H HG11 . VAL A 1 3  ? 18.543  8.406   -28.278 1.00 10.52 ? 3  VAL A HG11 2  
ATOM 2257  H HG12 . VAL A 1 3  ? 17.683  7.218   -27.299 1.00 10.71 ? 3  VAL A HG12 2  
ATOM 2258  H HG13 . VAL A 1 3  ? 18.790  8.358   -26.533 1.00 10.31 ? 3  VAL A HG13 2  
ATOM 2259  H HG21 . VAL A 1 3  ? 19.450  6.289   -29.675 1.00 11.26 ? 3  VAL A HG21 2  
ATOM 2260  H HG22 . VAL A 1 3  ? 20.093  4.959   -28.712 1.00 11.32 ? 3  VAL A HG22 2  
ATOM 2261  H HG23 . VAL A 1 3  ? 18.396  5.415   -28.563 1.00 11.52 ? 3  VAL A HG23 2  
ATOM 2262  N N    . ALA A 1 4  ? 21.068  9.566   -26.631 1.00 8.73  ? 4  ALA A N    2  
ATOM 2263  C CA   . ALA A 1 4  ? 21.515  10.418  -25.486 1.00 7.94  ? 4  ALA A CA   2  
ATOM 2264  C C    . ALA A 1 4  ? 20.361  10.609  -24.489 1.00 7.00  ? 4  ALA A C    2  
ATOM 2265  O O    . ALA A 1 4  ? 19.857  11.703  -24.311 1.00 7.01  ? 4  ALA A O    2  
ATOM 2266  C CB   . ALA A 1 4  ? 21.974  11.779  -26.019 1.00 8.20  ? 4  ALA A CB   2  
ATOM 2267  H H    . ALA A 1 4  ? 20.429  9.924   -27.283 1.00 8.94  ? 4  ALA A H    2  
ATOM 2268  H HA   . ALA A 1 4  ? 22.342  9.936   -24.983 1.00 8.12  ? 4  ALA A HA   2  
ATOM 2269  H HB1  . ALA A 1 4  ? 22.641  11.631  -26.856 1.00 8.32  ? 4  ALA A HB1  2  
ATOM 2270  H HB2  . ALA A 1 4  ? 21.114  12.349  -26.340 1.00 8.35  ? 4  ALA A HB2  2  
ATOM 2271  H HB3  . ALA A 1 4  ? 22.491  12.317  -25.238 1.00 8.38  ? 4  ALA A HB3  2  
ATOM 2272  N N    . THR A 1 5  ? 19.949  9.551   -23.830 1.00 6.46  ? 5  THR A N    2  
ATOM 2273  C CA   . THR A 1 5  ? 18.837  9.663   -22.833 1.00 5.78  ? 5  THR A CA   2  
ATOM 2274  C C    . THR A 1 5  ? 19.022  8.603   -21.743 1.00 4.91  ? 5  THR A C    2  
ATOM 2275  O O    . THR A 1 5  ? 18.912  7.417   -21.996 1.00 4.67  ? 5  THR A O    2  
ATOM 2276  C CB   . THR A 1 5  ? 17.478  9.453   -23.521 1.00 6.14  ? 5  THR A CB   2  
ATOM 2277  O OG1  . THR A 1 5  ? 17.613  8.519   -24.585 1.00 6.54  ? 5  THR A OG1  2  
ATOM 2278  C CG2  . THR A 1 5  ? 16.963  10.786  -24.071 1.00 6.80  ? 5  THR A CG2  2  
ATOM 2279  H H    . THR A 1 5  ? 20.378  8.683   -23.986 1.00 6.71  ? 5  THR A H    2  
ATOM 2280  H HA   . THR A 1 5  ? 18.862  10.645  -22.382 1.00 5.96  ? 5  THR A HA   2  
ATOM 2281  H HB   . THR A 1 5  ? 16.769  9.072   -22.802 1.00 5.97  ? 5  THR A HB   2  
ATOM 2282  H HG1  . THR A 1 5  ? 16.774  8.064   -24.689 1.00 6.80  ? 5  THR A HG1  2  
ATOM 2283  H HG21 . THR A 1 5  ? 17.320  11.595  -23.451 1.00 6.85  ? 5  THR A HG21 2  
ATOM 2284  H HG22 . THR A 1 5  ? 17.320  10.922  -25.081 1.00 7.20  ? 5  THR A HG22 2  
ATOM 2285  H HG23 . THR A 1 5  ? 15.882  10.782  -24.069 1.00 7.12  ? 5  THR A HG23 2  
ATOM 2286  N N    . GLU A 1 6  ? 19.303  9.022   -20.533 1.00 4.60  ? 6  GLU A N    2  
ATOM 2287  C CA   . GLU A 1 6  ? 19.494  8.040   -19.423 1.00 3.81  ? 6  GLU A CA   2  
ATOM 2288  C C    . GLU A 1 6  ? 18.245  8.006   -18.532 1.00 3.24  ? 6  GLU A C    2  
ATOM 2289  O O    . GLU A 1 6  ? 18.331  7.909   -17.321 1.00 3.60  ? 6  GLU A O    2  
ATOM 2290  C CB   . GLU A 1 6  ? 20.723  8.439   -18.595 1.00 4.36  ? 6  GLU A CB   2  
ATOM 2291  C CG   . GLU A 1 6  ? 21.966  7.735   -19.148 1.00 5.18  ? 6  GLU A CG   2  
ATOM 2292  C CD   . GLU A 1 6  ? 22.337  8.332   -20.509 1.00 5.79  ? 6  GLU A CD   2  
ATOM 2293  O OE1  . GLU A 1 6  ? 22.907  9.411   -20.525 1.00 6.16  ? 6  GLU A OE1  2  
ATOM 2294  O OE2  . GLU A 1 6  ? 22.043  7.702   -21.512 1.00 6.17  ? 6  GLU A OE2  2  
ATOM 2295  H H    . GLU A 1 6  ? 19.388  9.982   -20.356 1.00 5.01  ? 6  GLU A H    2  
ATOM 2296  H HA   . GLU A 1 6  ? 19.648  7.062   -19.844 1.00 3.44  ? 6  GLU A HA   2  
ATOM 2297  H HB2  . GLU A 1 6  ? 20.861  9.509   -18.651 1.00 4.83  ? 6  GLU A HB2  2  
ATOM 2298  H HB3  . GLU A 1 6  ? 20.576  8.148   -17.565 1.00 4.03  ? 6  GLU A HB3  2  
ATOM 2299  H HG2  . GLU A 1 6  ? 22.789  7.868   -18.460 1.00 5.45  ? 6  GLU A HG2  2  
ATOM 2300  H HG3  . GLU A 1 6  ? 21.761  6.681   -19.263 1.00 5.43  ? 6  GLU A HG3  2  
ATOM 2301  N N    . LEU A 1 7  ? 17.084  8.056   -19.136 1.00 2.59  ? 7  LEU A N    2  
ATOM 2302  C CA   . LEU A 1 7  ? 15.814  8.004   -18.376 1.00 2.31  ? 7  LEU A CA   2  
ATOM 2303  C C    . LEU A 1 7  ? 14.974  6.910   -18.994 1.00 1.55  ? 7  LEU A C    2  
ATOM 2304  O O    . LEU A 1 7  ? 14.640  5.935   -18.352 1.00 1.73  ? 7  LEU A O    2  
ATOM 2305  C CB   . LEU A 1 7  ? 15.031  9.319   -18.501 1.00 2.51  ? 7  LEU A CB   2  
ATOM 2306  C CG   . LEU A 1 7  ? 15.942  10.540  -18.379 1.00 3.14  ? 7  LEU A CG   2  
ATOM 2307  C CD1  . LEU A 1 7  ? 16.902  10.363  -17.196 1.00 3.94  ? 7  LEU A CD1  2  
ATOM 2308  C CD2  . LEU A 1 7  ? 16.720  10.702  -19.685 1.00 3.07  ? 7  LEU A CD2  2  
ATOM 2309  H H    . LEU A 1 7  ? 17.043  8.104   -20.103 1.00 2.53  ? 7  LEU A H    2  
ATOM 2310  H HA   . LEU A 1 7  ? 16.009  7.785   -17.341 1.00 2.80  ? 7  LEU A HA   2  
ATOM 2311  H HB2  . LEU A 1 7  ? 14.536  9.347   -19.458 1.00 2.07  ? 7  LEU A HB2  2  
ATOM 2312  H HB3  . LEU A 1 7  ? 14.297  9.349   -17.730 1.00 2.88  ? 7  LEU A HB3  2  
ATOM 2313  H HG   . LEU A 1 7  ? 15.336  11.418  -18.212 1.00 3.32  ? 7  LEU A HG   2  
ATOM 2314  H HD11 . LEU A 1 7  ? 16.625  9.479   -16.636 1.00 4.28  ? 7  LEU A HD11 2  
ATOM 2315  H HD12 . LEU A 1 7  ? 17.911  10.252  -17.562 1.00 4.27  ? 7  LEU A HD12 2  
ATOM 2316  H HD13 . LEU A 1 7  ? 16.843  11.226  -16.553 1.00 4.25  ? 7  LEU A HD13 2  
ATOM 2317  H HD21 . LEU A 1 7  ? 16.336  10.002  -20.419 1.00 3.18  ? 7  LEU A HD21 2  
ATOM 2318  H HD22 . LEU A 1 7  ? 16.601  11.706  -20.054 1.00 3.21  ? 7  LEU A HD22 2  
ATOM 2319  H HD23 . LEU A 1 7  ? 17.763  10.499  -19.511 1.00 3.36  ? 7  LEU A HD23 2  
ATOM 2320  N N    . ARG A 1 8  ? 14.645  7.079   -20.260 1.00 1.31  ? 8  ARG A N    2  
ATOM 2321  C CA   . ARG A 1 8  ? 13.837  6.089   -21.001 1.00 1.48  ? 8  ARG A CA   2  
ATOM 2322  C C    . ARG A 1 8  ? 12.379  6.180   -20.553 1.00 1.32  ? 8  ARG A C    2  
ATOM 2323  O O    . ARG A 1 8  ? 11.478  6.299   -21.361 1.00 1.92  ? 8  ARG A O    2  
ATOM 2324  C CB   . ARG A 1 8  ? 14.385  4.717   -20.692 1.00 2.16  ? 8  ARG A CB   2  
ATOM 2325  C CG   . ARG A 1 8  ? 14.627  3.931   -21.982 1.00 2.68  ? 8  ARG A CG   2  
ATOM 2326  C CD   . ARG A 1 8  ? 13.356  3.165   -22.354 1.00 2.99  ? 8  ARG A CD   2  
ATOM 2327  N NE   . ARG A 1 8  ? 13.671  2.134   -23.384 1.00 3.47  ? 8  ARG A NE   2  
ATOM 2328  C CZ   . ARG A 1 8  ? 13.169  0.930   -23.281 1.00 3.94  ? 8  ARG A CZ   2  
ATOM 2329  N NH1  . ARG A 1 8  ? 11.897  0.733   -23.517 1.00 4.42  ? 8  ARG A NH1  2  
ATOM 2330  N NH2  . ARG A 1 8  ? 13.938  -0.072  -22.944 1.00 4.33  ? 8  ARG A NH2  2  
ATOM 2331  H H    . ARG A 1 8  ? 14.948  7.863   -20.725 1.00 1.63  ? 8  ARG A H    2  
ATOM 2332  H HA   . ARG A 1 8  ? 13.916  6.291   -22.053 1.00 1.84  ? 8  ARG A HA   2  
ATOM 2333  H HB2  . ARG A 1 8  ? 15.308  4.839   -20.148 1.00 2.23  ? 8  ARG A HB2  2  
ATOM 2334  H HB3  . ARG A 1 8  ? 13.684  4.205   -20.077 1.00 2.53  ? 8  ARG A HB3  2  
ATOM 2335  H HG2  . ARG A 1 8  ? 14.884  4.614   -22.780 1.00 2.98  ? 8  ARG A HG2  2  
ATOM 2336  H HG3  . ARG A 1 8  ? 15.437  3.231   -21.833 1.00 2.97  ? 8  ARG A HG3  2  
ATOM 2337  H HD2  . ARG A 1 8  ? 12.957  2.682   -21.473 1.00 3.17  ? 8  ARG A HD2  2  
ATOM 2338  H HD3  . ARG A 1 8  ? 12.624  3.853   -22.748 1.00 3.16  ? 8  ARG A HD3  2  
ATOM 2339  H HE   . ARG A 1 8  ? 14.254  2.357   -24.140 1.00 3.66  ? 8  ARG A HE   2  
ATOM 2340  H HH11 . ARG A 1 8  ? 11.310  1.501   -23.776 1.00 4.48  ? 8  ARG A HH11 2  
ATOM 2341  H HH12 . ARG A 1 8  ? 11.510  -0.187  -23.439 1.00 4.97  ? 8  ARG A HH12 2  
ATOM 2342  H HH21 . ARG A 1 8  ? 14.910  0.081   -22.764 1.00 4.37  ? 8  ARG A HH21 2  
ATOM 2343  H HH22 . ARG A 1 8  ? 13.555  -0.993  -22.865 1.00 4.82  ? 8  ARG A HH22 2  
ATOM 2344  N N    . CYS A 1 9  ? 12.167  6.112   -19.259 1.00 0.86  ? 9  CYS A N    2  
ATOM 2345  C CA   . CYS A 1 9  ? 10.794  6.187   -18.669 1.00 0.66  ? 9  CYS A CA   2  
ATOM 2346  C C    . CYS A 1 9  ? 9.980   7.332   -19.302 1.00 0.61  ? 9  CYS A C    2  
ATOM 2347  O O    . CYS A 1 9  ? 10.517  8.225   -19.932 1.00 0.84  ? 9  CYS A O    2  
ATOM 2348  C CB   . CYS A 1 9  ? 10.914  6.417   -17.157 1.00 0.66  ? 9  CYS A CB   2  
ATOM 2349  S SG   . CYS A 1 9  ? 11.942  5.111   -16.423 1.00 0.94  ? 9  CYS A SG   2  
ATOM 2350  H H    . CYS A 1 9  ? 12.936  5.996   -18.664 1.00 1.09  ? 9  CYS A H    2  
ATOM 2351  H HA   . CYS A 1 9  ? 10.283  5.251   -18.843 1.00 0.74  ? 9  CYS A HA   2  
ATOM 2352  H HB2  . CYS A 1 9  ? 11.357  7.381   -16.973 1.00 0.78  ? 9  CYS A HB2  2  
ATOM 2353  H HB3  . CYS A 1 9  ? 9.934   6.388   -16.716 1.00 0.69  ? 9  CYS A HB3  2  
ATOM 2354  N N    . GLN A 1 10 ? 8.681   7.291   -19.145 1.00 0.51  ? 10 GLN A N    2  
ATOM 2355  C CA   . GLN A 1 10 ? 7.799   8.342   -19.752 1.00 0.47  ? 10 GLN A CA   2  
ATOM 2356  C C    . GLN A 1 10 ? 7.317   9.369   -18.711 1.00 0.39  ? 10 GLN A C    2  
ATOM 2357  O O    . GLN A 1 10 ? 6.773   10.393  -19.082 1.00 0.40  ? 10 GLN A O    2  
ATOM 2358  C CB   . GLN A 1 10 ? 6.570   7.660   -20.359 1.00 0.53  ? 10 GLN A CB   2  
ATOM 2359  C CG   . GLN A 1 10 ? 6.613   7.758   -21.891 1.00 0.64  ? 10 GLN A CG   2  
ATOM 2360  C CD   . GLN A 1 10 ? 5.280   7.276   -22.483 1.00 1.20  ? 10 GLN A CD   2  
ATOM 2361  O OE1  . GLN A 1 10 ? 4.613   6.434   -21.910 1.00 1.87  ? 10 GLN A OE1  2  
ATOM 2362  N NE2  . GLN A 1 10 ? 4.859   7.775   -23.616 1.00 1.84  ? 10 GLN A NE2  2  
ATOM 2363  H H    . GLN A 1 10 ? 8.283   6.554   -18.638 1.00 0.64  ? 10 GLN A H    2  
ATOM 2364  H HA   . GLN A 1 10 ? 8.340   8.854   -20.532 1.00 0.52  ? 10 GLN A HA   2  
ATOM 2365  H HB2  . GLN A 1 10 ? 6.557   6.622   -20.064 1.00 0.58  ? 10 GLN A HB2  2  
ATOM 2366  H HB3  . GLN A 1 10 ? 5.682   8.146   -19.992 1.00 0.50  ? 10 GLN A HB3  2  
ATOM 2367  H HG2  . GLN A 1 10 ? 6.785   8.784   -22.181 1.00 1.10  ? 10 GLN A HG2  2  
ATOM 2368  H HG3  . GLN A 1 10 ? 7.414   7.139   -22.267 1.00 1.15  ? 10 GLN A HG3  2  
ATOM 2369  H HE21 . GLN A 1 10 ? 5.392   8.452   -24.082 1.00 2.04  ? 10 GLN A HE21 2  
ATOM 2370  H HE22 . GLN A 1 10 ? 4.009   7.471   -23.999 1.00 2.45  ? 10 GLN A HE22 2  
ATOM 2371  N N    . CYS A 1 11 ? 7.482   9.101   -17.427 1.00 0.34  ? 11 CYS A N    2  
ATOM 2372  C CA   . CYS A 1 11 ? 7.007   10.055  -16.360 1.00 0.31  ? 11 CYS A CA   2  
ATOM 2373  C C    . CYS A 1 11 ? 7.163   11.515  -16.810 1.00 0.36  ? 11 CYS A C    2  
ATOM 2374  O O    . CYS A 1 11 ? 8.214   11.926  -17.270 1.00 0.50  ? 11 CYS A O    2  
ATOM 2375  C CB   . CYS A 1 11 ? 7.817   9.852   -15.083 1.00 0.30  ? 11 CYS A CB   2  
ATOM 2376  S SG   . CYS A 1 11 ? 7.490   8.215   -14.396 1.00 0.30  ? 11 CYS A SG   2  
ATOM 2377  H H    . CYS A 1 11 ? 7.902   8.260   -17.163 1.00 0.36  ? 11 CYS A H    2  
ATOM 2378  H HA   . CYS A 1 11 ? 5.967   9.861   -16.144 1.00 0.31  ? 11 CYS A HA   2  
ATOM 2379  H HB2  . CYS A 1 11 ? 8.867   9.942   -15.306 1.00 0.34  ? 11 CYS A HB2  2  
ATOM 2380  H HB3  . CYS A 1 11 ? 7.541   10.602  -14.367 1.00 0.31  ? 11 CYS A HB3  2  
ATOM 2381  N N    . LEU A 1 12 ? 6.122   12.297  -16.662 1.00 0.40  ? 12 LEU A N    2  
ATOM 2382  C CA   . LEU A 1 12 ? 6.181   13.733  -17.058 1.00 0.44  ? 12 LEU A CA   2  
ATOM 2383  C C    . LEU A 1 12 ? 7.120   14.459  -16.096 1.00 0.45  ? 12 LEU A C    2  
ATOM 2384  O O    . LEU A 1 12 ? 8.195   14.899  -16.459 1.00 0.48  ? 12 LEU A O    2  
ATOM 2385  C CB   . LEU A 1 12 ? 4.774   14.324  -16.957 1.00 0.49  ? 12 LEU A CB   2  
ATOM 2386  C CG   . LEU A 1 12 ? 4.084   14.213  -18.312 1.00 0.82  ? 12 LEU A CG   2  
ATOM 2387  C CD1  . LEU A 1 12 ? 3.564   12.787  -18.517 1.00 1.04  ? 12 LEU A CD1  2  
ATOM 2388  C CD2  . LEU A 1 12 ? 2.915   15.186  -18.348 1.00 1.56  ? 12 LEU A CD2  2  
ATOM 2389  H H    . LEU A 1 12 ? 5.297   11.940  -16.273 1.00 0.49  ? 12 LEU A H    2  
ATOM 2390  H HA   . LEU A 1 12 ? 6.537   13.829  -18.071 1.00 0.48  ? 12 LEU A HA   2  
ATOM 2391  H HB2  . LEU A 1 12 ? 4.206   13.778  -16.215 1.00 0.97  ? 12 LEU A HB2  2  
ATOM 2392  H HB3  . LEU A 1 12 ? 4.837   15.362  -16.669 1.00 0.98  ? 12 LEU A HB3  2  
ATOM 2393  H HG   . LEU A 1 12 ? 4.784   14.459  -19.096 1.00 1.56  ? 12 LEU A HG   2  
ATOM 2394  H HD11 . LEU A 1 12 ? 4.392   12.094  -18.474 1.00 1.71  ? 12 LEU A HD11 2  
ATOM 2395  H HD12 . LEU A 1 12 ? 2.853   12.548  -17.741 1.00 1.40  ? 12 LEU A HD12 2  
ATOM 2396  H HD13 . LEU A 1 12 ? 3.084   12.715  -19.482 1.00 1.31  ? 12 LEU A HD13 2  
ATOM 2397  H HD21 . LEU A 1 12 ? 2.248   14.972  -17.527 1.00 2.03  ? 12 LEU A HD21 2  
ATOM 2398  H HD22 . LEU A 1 12 ? 3.289   16.195  -18.256 1.00 2.07  ? 12 LEU A HD22 2  
ATOM 2399  H HD23 . LEU A 1 12 ? 2.389   15.079  -19.282 1.00 2.10  ? 12 LEU A HD23 2  
ATOM 2400  N N    . GLN A 1 13 ? 6.702   14.562  -14.867 1.00 0.43  ? 13 GLN A N    2  
ATOM 2401  C CA   . GLN A 1 13 ? 7.506   15.225  -13.807 1.00 0.45  ? 13 GLN A CA   2  
ATOM 2402  C C    . GLN A 1 13 ? 6.845   14.898  -12.464 1.00 0.42  ? 13 GLN A C    2  
ATOM 2403  O O    . GLN A 1 13 ? 6.707   15.744  -11.603 1.00 0.60  ? 13 GLN A O    2  
ATOM 2404  C CB   . GLN A 1 13 ? 7.495   16.734  -14.043 1.00 0.52  ? 13 GLN A CB   2  
ATOM 2405  C CG   . GLN A 1 13 ? 8.813   17.174  -14.686 1.00 1.11  ? 13 GLN A CG   2  
ATOM 2406  C CD   . GLN A 1 13 ? 9.032   18.669  -14.441 1.00 1.40  ? 13 GLN A CD   2  
ATOM 2407  O OE1  . GLN A 1 13 ? 9.417   19.069  -13.360 1.00 1.77  ? 13 GLN A OE1  2  
ATOM 2408  N NE2  . GLN A 1 13 ? 8.804   19.520  -15.407 1.00 2.09  ? 13 GLN A NE2  2  
ATOM 2409  H H    . GLN A 1 13 ? 5.835   14.184  -14.632 1.00 0.42  ? 13 GLN A H    2  
ATOM 2410  H HA   . GLN A 1 13 ? 8.516   14.847  -13.820 1.00 0.46  ? 13 GLN A HA   2  
ATOM 2411  H HB2  . GLN A 1 13 ? 6.674   16.986  -14.700 1.00 0.98  ? 13 GLN A HB2  2  
ATOM 2412  H HB3  . GLN A 1 13 ? 7.364   17.234  -13.104 1.00 0.85  ? 13 GLN A HB3  2  
ATOM 2413  H HG2  . GLN A 1 13 ? 9.629   16.614  -14.253 1.00 1.50  ? 13 GLN A HG2  2  
ATOM 2414  H HG3  . GLN A 1 13 ? 8.774   16.988  -15.749 1.00 1.66  ? 13 GLN A HG3  2  
ATOM 2415  H HE21 . GLN A 1 13 ? 8.494   19.199  -16.281 1.00 2.59  ? 13 GLN A HE21 2  
ATOM 2416  H HE22 . GLN A 1 13 ? 8.944   20.478  -15.258 1.00 2.41  ? 13 GLN A HE22 2  
ATOM 2417  N N    . THR A 1 14 ? 6.407   13.664  -12.331 1.00 0.36  ? 14 THR A N    2  
ATOM 2418  C CA   . THR A 1 14 ? 5.686   13.176  -11.113 1.00 0.32  ? 14 THR A CA   2  
ATOM 2419  C C    . THR A 1 14 ? 4.862   14.274  -10.447 1.00 0.35  ? 14 THR A C    2  
ATOM 2420  O O    . THR A 1 14 ? 5.340   15.025  -9.614  1.00 0.39  ? 14 THR A O    2  
ATOM 2421  C CB   . THR A 1 14 ? 6.613   12.553  -10.095 1.00 0.32  ? 14 THR A CB   2  
ATOM 2422  O OG1  . THR A 1 14 ? 7.755   13.376  -9.890  1.00 0.38  ? 14 THR A OG1  2  
ATOM 2423  C CG2  . THR A 1 14 ? 7.031   11.172  -10.595 1.00 0.31  ? 14 THR A CG2  2  
ATOM 2424  H H    . THR A 1 14 ? 6.531   13.042  -13.078 1.00 0.51  ? 14 THR A H    2  
ATOM 2425  H HA   . THR A 1 14 ? 5.012   12.412  -11.437 1.00 0.30  ? 14 THR A HA   2  
ATOM 2426  H HB   . THR A 1 14 ? 6.056   12.440  -9.175  1.00 0.32  ? 14 THR A HB   2  
ATOM 2427  H HG1  . THR A 1 14 ? 7.521   14.055  -9.254  1.00 0.69  ? 14 THR A HG1  2  
ATOM 2428  H HG21 . THR A 1 14 ? 6.150   10.620  -10.892 1.00 1.05  ? 14 THR A HG21 2  
ATOM 2429  H HG22 . THR A 1 14 ? 7.689   11.282  -11.443 1.00 1.08  ? 14 THR A HG22 2  
ATOM 2430  H HG23 . THR A 1 14 ? 7.538   10.641  -9.806  1.00 1.01  ? 14 THR A HG23 2  
ATOM 2431  N N    . LEU A 1 15 ? 3.610   14.334  -10.789 1.00 0.36  ? 15 LEU A N    2  
ATOM 2432  C CA   . LEU A 1 15 ? 2.706   15.349  -10.175 1.00 0.41  ? 15 LEU A CA   2  
ATOM 2433  C C    . LEU A 1 15 ? 2.447   14.955  -8.716  1.00 0.35  ? 15 LEU A C    2  
ATOM 2434  O O    . LEU A 1 15 ? 2.648   13.818  -8.326  1.00 0.52  ? 15 LEU A O    2  
ATOM 2435  C CB   . LEU A 1 15 ? 1.380   15.411  -10.950 1.00 0.57  ? 15 LEU A CB   2  
ATOM 2436  C CG   . LEU A 1 15 ? 1.573   16.181  -12.267 1.00 0.64  ? 15 LEU A CG   2  
ATOM 2437  C CD1  . LEU A 1 15 ? 2.060   15.223  -13.358 1.00 0.74  ? 15 LEU A CD1  2  
ATOM 2438  C CD2  . LEU A 1 15 ? 0.241   16.800  -12.697 1.00 1.76  ? 15 LEU A CD2  2  
ATOM 2439  H H    . LEU A 1 15 ? 3.261   13.684  -11.440 1.00 0.35  ? 15 LEU A H    2  
ATOM 2440  H HA   . LEU A 1 15 ? 3.186   16.316  -10.198 1.00 0.51  ? 15 LEU A HA   2  
ATOM 2441  H HB2  . LEU A 1 15 ? 1.043   14.407  -11.166 1.00 1.12  ? 15 LEU A HB2  2  
ATOM 2442  H HB3  . LEU A 1 15 ? 0.638   15.915  -10.347 1.00 0.90  ? 15 LEU A HB3  2  
ATOM 2443  H HG   . LEU A 1 15 ? 2.304   16.964  -12.127 1.00 1.32  ? 15 LEU A HG   2  
ATOM 2444  H HD11 . LEU A 1 15 ? 1.636   14.243  -13.193 1.00 1.29  ? 15 LEU A HD11 2  
ATOM 2445  H HD12 . LEU A 1 15 ? 1.750   15.592  -14.325 1.00 1.44  ? 15 LEU A HD12 2  
ATOM 2446  H HD13 . LEU A 1 15 ? 3.138   15.160  -13.326 1.00 1.31  ? 15 LEU A HD13 2  
ATOM 2447  H HD21 . LEU A 1 15 ? -0.251  17.229  -11.837 1.00 2.30  ? 15 LEU A HD21 2  
ATOM 2448  H HD22 . LEU A 1 15 ? 0.422   17.571  -13.430 1.00 2.29  ? 15 LEU A HD22 2  
ATOM 2449  H HD23 . LEU A 1 15 ? -0.389  16.036  -13.127 1.00 2.30  ? 15 LEU A HD23 2  
ATOM 2450  N N    . GLN A 1 16 ? 2.027   15.887  -7.906  1.00 0.47  ? 16 GLN A N    2  
ATOM 2451  C CA   . GLN A 1 16 ? 1.782   15.583  -6.471  1.00 0.41  ? 16 GLN A CA   2  
ATOM 2452  C C    . GLN A 1 16 ? 0.312   15.253  -6.238  1.00 0.39  ? 16 GLN A C    2  
ATOM 2453  O O    . GLN A 1 16 ? -0.411  15.984  -5.586  1.00 0.47  ? 16 GLN A O    2  
ATOM 2454  C CB   . GLN A 1 16 ? 2.195   16.790  -5.624  1.00 0.48  ? 16 GLN A CB   2  
ATOM 2455  C CG   . GLN A 1 16 ? 3.717   16.804  -5.449  1.00 0.60  ? 16 GLN A CG   2  
ATOM 2456  C CD   . GLN A 1 16 ? 4.363   17.576  -6.604  1.00 0.77  ? 16 GLN A CD   2  
ATOM 2457  O OE1  . GLN A 1 16 ? 5.047   17.000  -7.427  1.00 1.48  ? 16 GLN A OE1  2  
ATOM 2458  N NE2  . GLN A 1 16 ? 4.176   18.865  -6.701  1.00 1.31  ? 16 GLN A NE2  2  
ATOM 2459  H H    . GLN A 1 16 ? 1.889   16.789  -8.236  1.00 0.72  ? 16 GLN A H    2  
ATOM 2460  H HA   . GLN A 1 16 ? 2.372   14.724  -6.187  1.00 0.43  ? 16 GLN A HA   2  
ATOM 2461  H HB2  . GLN A 1 16 ? 1.880   17.699  -6.118  1.00 0.51  ? 16 GLN A HB2  2  
ATOM 2462  H HB3  . GLN A 1 16 ? 1.724   16.726  -4.659  1.00 0.49  ? 16 GLN A HB3  2  
ATOM 2463  H HG2  . GLN A 1 16 ? 3.966   17.283  -4.512  1.00 0.75  ? 16 GLN A HG2  2  
ATOM 2464  H HG3  . GLN A 1 16 ? 4.089   15.790  -5.444  1.00 0.72  ? 16 GLN A HG3  2  
ATOM 2465  H HE21 . GLN A 1 16 ? 3.625   19.333  -6.038  1.00 1.98  ? 16 GLN A HE21 2  
ATOM 2466  H HE22 . GLN A 1 16 ? 4.585   19.365  -7.438  1.00 1.46  ? 16 GLN A HE22 2  
ATOM 2467  N N    . GLY A 1 17 ? -0.119  14.133  -6.749  1.00 0.36  ? 17 GLY A N    2  
ATOM 2468  C CA   . GLY A 1 17 ? -1.526  13.692  -6.551  1.00 0.45  ? 17 GLY A CA   2  
ATOM 2469  C C    . GLY A 1 17 ? -2.494  14.669  -7.203  1.00 0.41  ? 17 GLY A C    2  
ATOM 2470  O O    . GLY A 1 17 ? -3.006  15.569  -6.563  1.00 0.57  ? 17 GLY A O    2  
ATOM 2471  H H    . GLY A 1 17 ? 0.500   13.566  -7.255  1.00 0.34  ? 17 GLY A H    2  
ATOM 2472  H HA2  . GLY A 1 17 ? -1.657  12.715  -6.989  1.00 0.56  ? 17 GLY A HA2  2  
ATOM 2473  H HA3  . GLY A 1 17 ? -1.737  13.638  -5.493  1.00 0.59  ? 17 GLY A HA3  2  
ATOM 2474  N N    . ILE A 1 18 ? -2.775  14.477  -8.464  1.00 0.39  ? 18 ILE A N    2  
ATOM 2475  C CA   . ILE A 1 18 ? -3.743  15.372  -9.151  1.00 0.49  ? 18 ILE A CA   2  
ATOM 2476  C C    . ILE A 1 18 ? -5.152  14.875  -8.825  1.00 0.50  ? 18 ILE A C    2  
ATOM 2477  O O    . ILE A 1 18 ? -5.330  13.997  -7.997  1.00 0.72  ? 18 ILE A O    2  
ATOM 2478  C CB   . ILE A 1 18 ? -3.481  15.407  -10.677 1.00 0.67  ? 18 ILE A CB   2  
ATOM 2479  C CG1  . ILE A 1 18 ? -4.226  14.279  -11.405 1.00 0.72  ? 18 ILE A CG1  2  
ATOM 2480  C CG2  . ILE A 1 18 ? -1.980  15.287  -10.960 1.00 0.74  ? 18 ILE A CG2  2  
ATOM 2481  C CD1  . ILE A 1 18 ? -3.870  12.938  -10.781 1.00 0.66  ? 18 ILE A CD1  2  
ATOM 2482  H H    . ILE A 1 18 ? -2.375  13.730  -8.946  1.00 0.45  ? 18 ILE A H    2  
ATOM 2483  H HA   . ILE A 1 18 ? -3.639  16.363  -8.761  1.00 0.54  ? 18 ILE A HA   2  
ATOM 2484  H HB   . ILE A 1 18 ? -3.823  16.352  -11.054 1.00 0.79  ? 18 ILE A HB   2  
ATOM 2485  H HG12 . ILE A 1 18 ? -5.289  14.441  -11.328 1.00 0.70  ? 18 ILE A HG12 2  
ATOM 2486  H HG13 . ILE A 1 18 ? -3.939  14.275  -12.446 1.00 0.91  ? 18 ILE A HG13 2  
ATOM 2487  H HG21 . ILE A 1 18 ? -1.446  16.030  -10.384 1.00 1.33  ? 18 ILE A HG21 2  
ATOM 2488  H HG22 . ILE A 1 18 ? -1.636  14.302  -10.684 1.00 1.17  ? 18 ILE A HG22 2  
ATOM 2489  H HG23 . ILE A 1 18 ? -1.799  15.449  -12.012 1.00 1.14  ? 18 ILE A HG23 2  
ATOM 2490  H HD11 . ILE A 1 18 ? -2.797  12.851  -10.713 1.00 1.04  ? 18 ILE A HD11 2  
ATOM 2491  H HD12 . ILE A 1 18 ? -4.302  12.879  -9.794  1.00 1.35  ? 18 ILE A HD12 2  
ATOM 2492  H HD13 . ILE A 1 18 ? -4.261  12.144  -11.395 1.00 1.18  ? 18 ILE A HD13 2  
ATOM 2493  N N    . HIS A 1 19 ? -6.151  15.418  -9.449  1.00 0.45  ? 19 HIS A N    2  
ATOM 2494  C CA   . HIS A 1 19 ? -7.531  14.962  -9.149  1.00 0.47  ? 19 HIS A CA   2  
ATOM 2495  C C    . HIS A 1 19 ? -7.930  13.900  -10.199 1.00 0.39  ? 19 HIS A C    2  
ATOM 2496  O O    . HIS A 1 19 ? -7.552  14.014  -11.351 1.00 0.35  ? 19 HIS A O    2  
ATOM 2497  C CB   . HIS A 1 19 ? -8.470  16.187  -9.144  1.00 0.54  ? 19 HIS A CB   2  
ATOM 2498  C CG   . HIS A 1 19 ? -9.601  16.021  -10.114 1.00 0.60  ? 19 HIS A CG   2  
ATOM 2499  N ND1  . HIS A 1 19 ? -10.915 15.902  -9.701  1.00 0.75  ? 19 HIS A ND1  2  
ATOM 2500  C CD2  . HIS A 1 19 ? -9.627  15.970  -11.479 1.00 0.60  ? 19 HIS A CD2  2  
ATOM 2501  C CE1  . HIS A 1 19 ? -11.672 15.787  -10.802 1.00 0.81  ? 19 HIS A CE1  2  
ATOM 2502  N NE2  . HIS A 1 19 ? -10.937 15.824  -11.918 1.00 0.74  ? 19 HIS A NE2  2  
ATOM 2503  H H    . HIS A 1 19 ? -5.990  16.118  -10.113 1.00 0.55  ? 19 HIS A H    2  
ATOM 2504  H HA   . HIS A 1 19 ? -7.528  14.514  -8.170  1.00 0.50  ? 19 HIS A HA   2  
ATOM 2505  H HB2  . HIS A 1 19 ? -8.876  16.313  -8.152  1.00 0.64  ? 19 HIS A HB2  2  
ATOM 2506  H HB3  . HIS A 1 19 ? -7.902  17.067  -9.408  1.00 0.52  ? 19 HIS A HB3  2  
ATOM 2507  H HD1  . HIS A 1 19 ? -11.235 15.900  -8.774  1.00 0.84  ? 19 HIS A HD1  2  
ATOM 2508  H HD2  . HIS A 1 19 ? -8.753  16.010  -12.113 1.00 0.55  ? 19 HIS A HD2  2  
ATOM 2509  H HE1  . HIS A 1 19 ? -12.742 15.663  -10.786 1.00 0.93  ? 19 HIS A HE1  2  
ATOM 2510  N N    . PRO A 1 20 ? -8.652  12.879  -9.772  1.00 0.39  ? 20 PRO A N    2  
ATOM 2511  C CA   . PRO A 1 20 ? -9.069  11.783  -10.665 1.00 0.35  ? 20 PRO A CA   2  
ATOM 2512  C C    . PRO A 1 20 ? -10.206 12.229  -11.610 1.00 0.37  ? 20 PRO A C    2  
ATOM 2513  O O    . PRO A 1 20 ? -10.023 13.165  -12.365 1.00 0.43  ? 20 PRO A O    2  
ATOM 2514  C CB   . PRO A 1 20 ? -9.483  10.669  -9.693  1.00 0.40  ? 20 PRO A CB   2  
ATOM 2515  C CG   . PRO A 1 20 ? -9.831  11.363  -8.361  1.00 0.47  ? 20 PRO A CG   2  
ATOM 2516  C CD   . PRO A 1 20 ? -9.110  12.717  -8.373  1.00 0.46  ? 20 PRO A CD   2  
ATOM 2517  H HA   . PRO A 1 20 ? -8.228  11.453  -11.253 1.00 0.32  ? 20 PRO A HA   2  
ATOM 2518  H HB2  . PRO A 1 20 ? -10.331 10.127  -10.071 1.00 0.40  ? 20 PRO A HB2  2  
ATOM 2519  H HB3  . PRO A 1 20 ? -8.656  9.995   -9.540  1.00 0.40  ? 20 PRO A HB3  2  
ATOM 2520  H HG2  . PRO A 1 20 ? -10.899 11.510  -8.290  1.00 0.50  ? 20 PRO A HG2  2  
ATOM 2521  H HG3  . PRO A 1 20 ? -9.479  10.771  -7.532  1.00 0.52  ? 20 PRO A HG3  2  
ATOM 2522  H HD2  . PRO A 1 20 ? -9.796  13.503  -8.102  1.00 0.50  ? 20 PRO A HD2  2  
ATOM 2523  H HD3  . PRO A 1 20 ? -8.266  12.692  -7.705  1.00 0.47  ? 20 PRO A HD3  2  
ATOM 2524  N N    . LYS A 1 21 ? -11.340 11.542  -11.638 1.00 0.38  ? 21 LYS A N    2  
ATOM 2525  C CA   . LYS A 1 21 ? -12.443 11.891  -12.598 1.00 0.40  ? 21 LYS A CA   2  
ATOM 2526  C C    . LYS A 1 21 ? -12.026 11.388  -13.986 1.00 0.38  ? 21 LYS A C    2  
ATOM 2527  O O    . LYS A 1 21 ? -12.765 10.688  -14.652 1.00 0.42  ? 21 LYS A O    2  
ATOM 2528  C CB   . LYS A 1 21 ? -12.708 13.404  -12.635 1.00 0.42  ? 21 LYS A CB   2  
ATOM 2529  C CG   . LYS A 1 21 ? -14.105 13.652  -13.218 1.00 0.51  ? 21 LYS A CG   2  
ATOM 2530  C CD   . LYS A 1 21 ? -14.463 15.138  -13.115 1.00 0.98  ? 21 LYS A CD   2  
ATOM 2531  C CE   . LYS A 1 21 ? -14.012 15.868  -14.383 1.00 1.47  ? 21 LYS A CE   2  
ATOM 2532  N NZ   . LYS A 1 21 ? -15.041 15.697  -15.449 1.00 2.14  ? 21 LYS A NZ   2  
ATOM 2533  H H    . LYS A 1 21 ? -11.451 10.764  -11.064 1.00 0.41  ? 21 LYS A H    2  
ATOM 2534  H HA   . LYS A 1 21 ? -13.342 11.376  -12.298 1.00 0.43  ? 21 LYS A HA   2  
ATOM 2535  H HB2  . LYS A 1 21 ? -12.658 13.801  -11.633 1.00 0.42  ? 21 LYS A HB2  2  
ATOM 2536  H HB3  . LYS A 1 21 ? -11.970 13.888  -13.256 1.00 0.40  ? 21 LYS A HB3  2  
ATOM 2537  H HG2  . LYS A 1 21 ? -14.117 13.351  -14.255 1.00 0.97  ? 21 LYS A HG2  2  
ATOM 2538  H HG3  . LYS A 1 21 ? -14.830 13.071  -12.667 1.00 0.86  ? 21 LYS A HG3  2  
ATOM 2539  H HD2  . LYS A 1 21 ? -15.535 15.240  -13.006 1.00 1.62  ? 21 LYS A HD2  2  
ATOM 2540  H HD3  . LYS A 1 21 ? -13.973 15.572  -12.258 1.00 1.69  ? 21 LYS A HD3  2  
ATOM 2541  H HE2  . LYS A 1 21 ? -13.887 16.919  -14.169 1.00 1.83  ? 21 LYS A HE2  2  
ATOM 2542  H HE3  . LYS A 1 21 ? -13.072 15.455  -14.721 1.00 1.91  ? 21 LYS A HE3  2  
ATOM 2543  H HZ1  . LYS A 1 21 ? -15.958 16.049  -15.107 1.00 2.51  ? 21 LYS A HZ1  2  
ATOM 2544  H HZ2  . LYS A 1 21 ? -14.759 16.236  -16.292 1.00 2.32  ? 21 LYS A HZ2  2  
ATOM 2545  H HZ3  . LYS A 1 21 ? -15.124 14.689  -15.693 1.00 2.71  ? 21 LYS A HZ3  2  
ATOM 2546  N N    . ASN A 1 22 ? -10.819 11.702  -14.394 1.00 0.36  ? 22 ASN A N    2  
ATOM 2547  C CA   . ASN A 1 22 ? -10.286 11.226  -15.686 1.00 0.36  ? 22 ASN A CA   2  
ATOM 2548  C C    . ASN A 1 22 ? -9.404  10.023  -15.369 1.00 0.34  ? 22 ASN A C    2  
ATOM 2549  O O    . ASN A 1 22 ? -9.562  8.948   -15.904 1.00 0.36  ? 22 ASN A O    2  
ATOM 2550  C CB   . ASN A 1 22 ? -9.413  12.320  -16.314 1.00 0.36  ? 22 ASN A CB   2  
ATOM 2551  C CG   . ASN A 1 22 ? -9.995  13.708  -16.025 1.00 0.38  ? 22 ASN A CG   2  
ATOM 2552  O OD1  . ASN A 1 22 ? -10.966 14.115  -16.632 1.00 0.42  ? 22 ASN A OD1  2  
ATOM 2553  N ND2  . ASN A 1 22 ? -9.432  14.454  -15.111 1.00 0.37  ? 22 ASN A ND2  2  
ATOM 2554  H H    . ASN A 1 22 ? -10.235 12.231  -13.821 1.00 0.35  ? 22 ASN A H    2  
ATOM 2555  H HA   . ASN A 1 22 ? -11.087 10.948  -16.352 1.00 0.39  ? 22 ASN A HA   2  
ATOM 2556  H HB2  . ASN A 1 22 ? -8.419  12.261  -15.898 1.00 0.33  ? 22 ASN A HB2  2  
ATOM 2557  H HB3  . ASN A 1 22 ? -9.362  12.166  -17.370 1.00 0.38  ? 22 ASN A HB3  2  
ATOM 2558  H HD21 . ASN A 1 22 ? -8.647  14.123  -14.621 1.00 0.34  ? 22 ASN A HD21 2  
ATOM 2559  H HD22 . ASN A 1 22 ? -9.792  15.343  -14.915 1.00 0.39  ? 22 ASN A HD22 2  
ATOM 2560  N N    . ILE A 1 23 ? -8.490  10.222  -14.458 1.00 0.31  ? 23 ILE A N    2  
ATOM 2561  C CA   . ILE A 1 23 ? -7.564  9.154   -14.016 1.00 0.30  ? 23 ILE A CA   2  
ATOM 2562  C C    . ILE A 1 23 ? -8.350  7.855   -13.772 1.00 0.34  ? 23 ILE A C    2  
ATOM 2563  O O    . ILE A 1 23 ? -9.126  7.747   -12.841 1.00 0.37  ? 23 ILE A O    2  
ATOM 2564  C CB   . ILE A 1 23 ? -6.917  9.662   -12.725 1.00 0.29  ? 23 ILE A CB   2  
ATOM 2565  C CG1  . ILE A 1 23 ? -5.680  10.495  -13.068 1.00 0.27  ? 23 ILE A CG1  2  
ATOM 2566  C CG2  . ILE A 1 23 ? -6.522  8.503   -11.827 1.00 0.33  ? 23 ILE A CG2  2  
ATOM 2567  C CD1  . ILE A 1 23 ? -6.119  11.851  -13.627 1.00 0.26  ? 23 ILE A CD1  2  
ATOM 2568  H H    . ILE A 1 23 ? -8.422  11.101  -14.036 1.00 0.31  ? 23 ILE A H    2  
ATOM 2569  H HA   . ILE A 1 23 ? -6.802  8.988   -14.768 1.00 0.29  ? 23 ILE A HA   2  
ATOM 2570  H HB   . ILE A 1 23 ? -7.630  10.288  -12.207 1.00 0.31  ? 23 ILE A HB   2  
ATOM 2571  H HG12 . ILE A 1 23 ? -5.090  10.645  -12.176 1.00 0.29  ? 23 ILE A HG12 2  
ATOM 2572  H HG13 . ILE A 1 23 ? -5.090  9.977   -13.808 1.00 0.26  ? 23 ILE A HG13 2  
ATOM 2573  H HG21 . ILE A 1 23 ? -6.203  7.673   -12.436 1.00 1.08  ? 23 ILE A HG21 2  
ATOM 2574  H HG22 . ILE A 1 23 ? -5.719  8.811   -11.178 1.00 1.00  ? 23 ILE A HG22 2  
ATOM 2575  H HG23 . ILE A 1 23 ? -7.375  8.213   -11.234 1.00 1.10  ? 23 ILE A HG23 2  
ATOM 2576  H HD11 . ILE A 1 23 ? -6.915  12.250  -13.016 1.00 1.03  ? 23 ILE A HD11 2  
ATOM 2577  H HD12 . ILE A 1 23 ? -5.282  12.532  -13.620 1.00 0.97  ? 23 ILE A HD12 2  
ATOM 2578  H HD13 . ILE A 1 23 ? -6.472  11.724  -14.639 1.00 1.04  ? 23 ILE A HD13 2  
ATOM 2579  N N    . GLN A 1 24 ? -8.163  6.885   -14.629 1.00 0.36  ? 24 GLN A N    2  
ATOM 2580  C CA   . GLN A 1 24 ? -8.882  5.600   -14.506 1.00 0.42  ? 24 GLN A CA   2  
ATOM 2581  C C    . GLN A 1 24 ? -7.942  4.505   -13.994 1.00 0.37  ? 24 GLN A C    2  
ATOM 2582  O O    . GLN A 1 24 ? -8.390  3.524   -13.430 1.00 0.39  ? 24 GLN A O    2  
ATOM 2583  C CB   . GLN A 1 24 ? -9.378  5.239   -15.898 1.00 0.48  ? 24 GLN A CB   2  
ATOM 2584  C CG   . GLN A 1 24 ? -10.895 5.036   -15.888 1.00 0.57  ? 24 GLN A CG   2  
ATOM 2585  C CD   . GLN A 1 24 ? -11.358 4.551   -17.268 1.00 1.16  ? 24 GLN A CD   2  
ATOM 2586  O OE1  . GLN A 1 24 ? -10.725 3.709   -17.873 1.00 1.82  ? 24 GLN A OE1  2  
ATOM 2587  N NE2  . GLN A 1 24 ? -12.445 5.051   -17.794 1.00 1.58  ? 24 GLN A NE2  2  
ATOM 2588  H H    . GLN A 1 24 ? -7.549  7.004   -15.383 1.00 0.36  ? 24 GLN A H    2  
ATOM 2589  H HA   . GLN A 1 24 ? -9.723  5.700   -13.835 1.00 0.46  ? 24 GLN A HA   2  
ATOM 2590  H HB2  . GLN A 1 24 ? -9.133  6.043   -16.578 1.00 0.48  ? 24 GLN A HB2  2  
ATOM 2591  H HB3  . GLN A 1 24 ? -8.885  4.349   -16.223 1.00 0.48  ? 24 GLN A HB3  2  
ATOM 2592  H HG2  . GLN A 1 24 ? -11.156 4.298   -15.142 1.00 0.66  ? 24 GLN A HG2  2  
ATOM 2593  H HG3  . GLN A 1 24 ? -11.383 5.971   -15.658 1.00 0.91  ? 24 GLN A HG3  2  
ATOM 2594  H HE21 . GLN A 1 24 ? -12.959 5.730   -17.308 1.00 1.80  ? 24 GLN A HE21 2  
ATOM 2595  H HE22 . GLN A 1 24 ? -12.745 4.747   -18.676 1.00 2.04  ? 24 GLN A HE22 2  
ATOM 2596  N N    . SER A 1 25 ? -6.649  4.649   -14.186 1.00 0.33  ? 25 SER A N    2  
ATOM 2597  C CA   . SER A 1 25 ? -5.714  3.588   -13.709 1.00 0.29  ? 25 SER A CA   2  
ATOM 2598  C C    . SER A 1 25 ? -4.296  4.131   -13.559 1.00 0.27  ? 25 SER A C    2  
ATOM 2599  O O    . SER A 1 25 ? -4.029  5.288   -13.813 1.00 0.29  ? 25 SER A O    2  
ATOM 2600  C CB   . SER A 1 25 ? -5.681  2.443   -14.709 1.00 0.31  ? 25 SER A CB   2  
ATOM 2601  O OG   . SER A 1 25 ? -5.227  2.917   -15.971 1.00 0.34  ? 25 SER A OG   2  
ATOM 2602  H H    . SER A 1 25 ? -6.297  5.450   -14.642 1.00 0.33  ? 25 SER A H    2  
ATOM 2603  H HA   . SER A 1 25 ? -6.053  3.209   -12.760 1.00 0.29  ? 25 SER A HA   2  
ATOM 2604  H HB2  . SER A 1 25 ? -5.005  1.693   -14.346 1.00 0.31  ? 25 SER A HB2  2  
ATOM 2605  H HB3  . SER A 1 25 ? -6.668  2.019   -14.802 1.00 0.30  ? 25 SER A HB3  2  
ATOM 2606  H HG   . SER A 1 25 ? -5.950  3.391   -16.390 1.00 0.78  ? 25 SER A HG   2  
ATOM 2607  N N    . VAL A 1 26 ? -3.389  3.284   -13.147 1.00 0.25  ? 26 VAL A N    2  
ATOM 2608  C CA   . VAL A 1 26 ? -1.973  3.701   -12.980 1.00 0.24  ? 26 VAL A CA   2  
ATOM 2609  C C    . VAL A 1 26 ? -1.067  2.476   -13.120 1.00 0.25  ? 26 VAL A C    2  
ATOM 2610  O O    . VAL A 1 26 ? -1.476  1.351   -12.904 1.00 0.26  ? 26 VAL A O    2  
ATOM 2611  C CB   . VAL A 1 26 ? -1.747  4.329   -11.597 1.00 0.23  ? 26 VAL A CB   2  
ATOM 2612  C CG1  . VAL A 1 26 ? -2.586  3.612   -10.554 1.00 0.24  ? 26 VAL A CG1  2  
ATOM 2613  C CG2  . VAL A 1 26 ? -0.265  4.226   -11.215 1.00 0.26  ? 26 VAL A CG2  2  
ATOM 2614  H H    . VAL A 1 26 ? -3.644  2.361   -12.950 1.00 0.25  ? 26 VAL A H    2  
ATOM 2615  H HA   . VAL A 1 26 ? -1.726  4.422   -13.744 1.00 0.24  ? 26 VAL A HA   2  
ATOM 2616  H HB   . VAL A 1 26 ? -2.037  5.356   -11.623 1.00 0.25  ? 26 VAL A HB   2  
ATOM 2617  H HG11 . VAL A 1 26 ? -3.568  3.422   -10.957 1.00 1.10  ? 26 VAL A HG11 2  
ATOM 2618  H HG12 . VAL A 1 26 ? -2.111  2.681   -10.296 1.00 1.01  ? 26 VAL A HG12 2  
ATOM 2619  H HG13 . VAL A 1 26 ? -2.669  4.236   -9.678  1.00 1.00  ? 26 VAL A HG13 2  
ATOM 2620  H HG21 . VAL A 1 26 ? 0.338   4.676   -11.991 1.00 1.05  ? 26 VAL A HG21 2  
ATOM 2621  H HG22 . VAL A 1 26 ? -0.093  4.733   -10.283 1.00 1.03  ? 26 VAL A HG22 2  
ATOM 2622  H HG23 . VAL A 1 26 ? 0.008   3.183   -11.114 1.00 1.06  ? 26 VAL A HG23 2  
ATOM 2623  N N    . ASN A 1 27 ? 0.171   2.706   -13.458 1.00 0.25  ? 27 ASN A N    2  
ATOM 2624  C CA   . ASN A 1 27 ? 1.136   1.602   -13.594 1.00 0.27  ? 27 ASN A CA   2  
ATOM 2625  C C    . ASN A 1 27 ? 2.372   1.910   -12.757 1.00 0.25  ? 27 ASN A C    2  
ATOM 2626  O O    . ASN A 1 27 ? 2.936   2.986   -12.833 1.00 0.42  ? 27 ASN A O    2  
ATOM 2627  C CB   . ASN A 1 27 ? 1.542   1.409   -15.049 1.00 0.30  ? 27 ASN A CB   2  
ATOM 2628  C CG   . ASN A 1 27 ? 0.723   2.297   -16.000 1.00 0.57  ? 27 ASN A CG   2  
ATOM 2629  O OD1  . ASN A 1 27 ? -0.489  2.203   -16.049 1.00 0.95  ? 27 ASN A OD1  2  
ATOM 2630  N ND2  . ASN A 1 27 ? 1.339   3.147   -16.771 1.00 0.72  ? 27 ASN A ND2  2  
ATOM 2631  H H    . ASN A 1 27 ? 0.466   3.621   -13.610 1.00 0.26  ? 27 ASN A H    2  
ATOM 2632  H HA   . ASN A 1 27 ? 0.687   0.701   -13.232 1.00 0.30  ? 27 ASN A HA   2  
ATOM 2633  H HB2  . ASN A 1 27 ? 2.593   1.628   -15.158 1.00 0.45  ? 27 ASN A HB2  2  
ATOM 2634  H HB3  . ASN A 1 27 ? 1.367   0.394   -15.292 1.00 0.51  ? 27 ASN A HB3  2  
ATOM 2635  H HD21 . ASN A 1 27 ? 2.317   3.217   -16.744 1.00 0.75  ? 27 ASN A HD21 2  
ATOM 2636  H HD22 . ASN A 1 27 ? 0.825   3.715   -17.381 1.00 0.99  ? 27 ASN A HD22 2  
ATOM 2637  N N    . VAL A 1 28 ? 2.790   0.972   -11.954 1.00 0.28  ? 28 VAL A N    2  
ATOM 2638  C CA   . VAL A 1 28 ? 3.988   1.203   -11.093 1.00 0.28  ? 28 VAL A CA   2  
ATOM 2639  C C    . VAL A 1 28 ? 5.079   0.181   -11.429 1.00 0.31  ? 28 VAL A C    2  
ATOM 2640  O O    . VAL A 1 28 ? 4.876   -1.013  -11.334 1.00 0.33  ? 28 VAL A O    2  
ATOM 2641  C CB   . VAL A 1 28 ? 3.588   1.094   -9.613  1.00 0.34  ? 28 VAL A CB   2  
ATOM 2642  C CG1  . VAL A 1 28 ? 2.986   -0.282  -9.323  1.00 0.55  ? 28 VAL A CG1  2  
ATOM 2643  C CG2  . VAL A 1 28 ? 4.818   1.311   -8.724  1.00 0.71  ? 28 VAL A CG2  2  
ATOM 2644  H H    . VAL A 1 28 ? 2.312   0.116   -11.916 1.00 0.43  ? 28 VAL A H    2  
ATOM 2645  H HA   . VAL A 1 28 ? 4.363   2.198   -11.285 1.00 0.28  ? 28 VAL A HA   2  
ATOM 2646  H HB   . VAL A 1 28 ? 2.853   1.848   -9.394  1.00 0.31  ? 28 VAL A HB   2  
ATOM 2647  H HG11 . VAL A 1 28 ? 2.503   -0.659  -10.211 1.00 1.11  ? 28 VAL A HG11 2  
ATOM 2648  H HG12 . VAL A 1 28 ? 3.767   -0.962  -9.022  1.00 1.11  ? 28 VAL A HG12 2  
ATOM 2649  H HG13 . VAL A 1 28 ? 2.259   -0.194  -8.529  1.00 1.30  ? 28 VAL A HG13 2  
ATOM 2650  H HG21 . VAL A 1 28 ? 5.238   2.286   -8.923  1.00 1.37  ? 28 VAL A HG21 2  
ATOM 2651  H HG22 . VAL A 1 28 ? 4.527   1.250   -7.686  1.00 1.24  ? 28 VAL A HG22 2  
ATOM 2652  H HG23 . VAL A 1 28 ? 5.556   0.553   -8.938  1.00 1.22  ? 28 VAL A HG23 2  
ATOM 2653  N N    . LYS A 1 29 ? 6.231   0.658   -11.822 1.00 0.35  ? 29 LYS A N    2  
ATOM 2654  C CA   . LYS A 1 29 ? 7.360   -0.250  -12.183 1.00 0.42  ? 29 LYS A CA   2  
ATOM 2655  C C    . LYS A 1 29 ? 8.592   0.107   -11.334 1.00 0.37  ? 29 LYS A C    2  
ATOM 2656  O O    . LYS A 1 29 ? 8.730   1.219   -10.856 1.00 0.35  ? 29 LYS A O    2  
ATOM 2657  C CB   . LYS A 1 29 ? 7.654   -0.081  -13.687 1.00 0.52  ? 29 LYS A CB   2  
ATOM 2658  C CG   . LYS A 1 29 ? 9.018   -0.678  -14.065 1.00 1.08  ? 29 LYS A CG   2  
ATOM 2659  C CD   . LYS A 1 29 ? 8.875   -2.172  -14.382 1.00 0.83  ? 29 LYS A CD   2  
ATOM 2660  C CE   . LYS A 1 29 ? 8.069   -2.366  -15.672 1.00 0.76  ? 29 LYS A CE   2  
ATOM 2661  N NZ   . LYS A 1 29 ? 8.686   -1.584  -16.785 1.00 1.23  ? 29 LYS A NZ   2  
ATOM 2662  H H    . LYS A 1 29 ? 6.353   1.626   -11.885 1.00 0.35  ? 29 LYS A H    2  
ATOM 2663  H HA   . LYS A 1 29 ? 7.075   -1.273  -11.986 1.00 0.52  ? 29 LYS A HA   2  
ATOM 2664  H HB2  . LYS A 1 29 ? 6.882   -0.575  -14.255 1.00 1.12  ? 29 LYS A HB2  2  
ATOM 2665  H HB3  . LYS A 1 29 ? 7.648   0.968   -13.930 1.00 0.82  ? 29 LYS A HB3  2  
ATOM 2666  H HG2  . LYS A 1 29 ? 9.399   -0.166  -14.934 1.00 1.70  ? 29 LYS A HG2  2  
ATOM 2667  H HG3  . LYS A 1 29 ? 9.707   -0.551  -13.250 1.00 2.02  ? 29 LYS A HG3  2  
ATOM 2668  H HD2  . LYS A 1 29 ? 9.856   -2.605  -14.506 1.00 1.42  ? 29 LYS A HD2  2  
ATOM 2669  H HD3  . LYS A 1 29 ? 8.369   -2.662  -13.569 1.00 1.54  ? 29 LYS A HD3  2  
ATOM 2670  H HE2  . LYS A 1 29 ? 8.060   -3.414  -15.932 1.00 1.30  ? 29 LYS A HE2  2  
ATOM 2671  H HE3  . LYS A 1 29 ? 7.056   -2.029  -15.514 1.00 1.09  ? 29 LYS A HE3  2  
ATOM 2672  H HZ1  . LYS A 1 29 ? 9.723   -1.655  -16.728 1.00 1.74  ? 29 LYS A HZ1  2  
ATOM 2673  H HZ2  . LYS A 1 29 ? 8.362   -1.966  -17.696 1.00 1.71  ? 29 LYS A HZ2  2  
ATOM 2674  H HZ3  . LYS A 1 29 ? 8.401   -0.588  -16.709 1.00 1.61  ? 29 LYS A HZ3  2  
ATOM 2675  N N    . SER A 1 30 ? 9.476   -0.842  -11.136 1.00 0.38  ? 30 SER A N    2  
ATOM 2676  C CA   . SER A 1 30 ? 10.701  -0.599  -10.311 1.00 0.39  ? 30 SER A CA   2  
ATOM 2677  C C    . SER A 1 30 ? 11.862  -0.101  -11.209 1.00 0.34  ? 30 SER A C    2  
ATOM 2678  O O    . SER A 1 30 ? 11.687  0.053   -12.404 1.00 0.35  ? 30 SER A O    2  
ATOM 2679  C CB   . SER A 1 30 ? 11.074  -1.919  -9.627  1.00 0.52  ? 30 SER A CB   2  
ATOM 2680  O OG   . SER A 1 30 ? 11.004  -1.755  -8.216  1.00 1.63  ? 30 SER A OG   2  
ATOM 2681  H H    . SER A 1 30 ? 9.326   -1.729  -11.527 1.00 0.43  ? 30 SER A H    2  
ATOM 2682  H HA   . SER A 1 30 ? 10.485  0.146   -9.558  1.00 0.41  ? 30 SER A HA   2  
ATOM 2683  H HB2  . SER A 1 30 ? 10.378  -2.686  -9.926  1.00 0.91  ? 30 SER A HB2  2  
ATOM 2684  H HB3  . SER A 1 30 ? 12.072  -2.208  -9.920  1.00 0.92  ? 30 SER A HB3  2  
ATOM 2685  H HG   . SER A 1 30 ? 10.085  -1.841  -7.952  1.00 2.01  ? 30 SER A HG   2  
ATOM 2686  N N    . PRO A 1 31 ? 13.015  0.153   -10.604 1.00 0.39  ? 31 PRO A N    2  
ATOM 2687  C CA   . PRO A 1 31 ? 14.212  0.653   -11.330 1.00 0.44  ? 31 PRO A CA   2  
ATOM 2688  C C    . PRO A 1 31 ? 14.888  -0.465  -12.136 1.00 0.52  ? 31 PRO A C    2  
ATOM 2689  O O    . PRO A 1 31 ? 14.390  -1.573  -12.213 1.00 0.58  ? 31 PRO A O    2  
ATOM 2690  C CB   . PRO A 1 31 ? 15.127  1.157   -10.207 1.00 0.52  ? 31 PRO A CB   2  
ATOM 2691  C CG   . PRO A 1 31 ? 14.681  0.434   -8.917  1.00 0.56  ? 31 PRO A CG   2  
ATOM 2692  C CD   . PRO A 1 31 ? 13.233  -0.036  -9.152  1.00 0.49  ? 31 PRO A CD   2  
ATOM 2693  H HA   . PRO A 1 31 ? 13.946  1.471   -11.976 1.00 0.44  ? 31 PRO A HA   2  
ATOM 2694  H HB2  . PRO A 1 31 ? 16.157  0.917   -10.432 1.00 0.59  ? 31 PRO A HB2  2  
ATOM 2695  H HB3  . PRO A 1 31 ? 15.010  2.221   -10.084 1.00 0.56  ? 31 PRO A HB3  2  
ATOM 2696  H HG2  . PRO A 1 31 ? 15.325  -0.415  -8.728  1.00 0.63  ? 31 PRO A HG2  2  
ATOM 2697  H HG3  . PRO A 1 31 ? 14.712  1.117   -8.081  1.00 0.64  ? 31 PRO A HG3  2  
ATOM 2698  H HD2  . PRO A 1 31 ? 13.133  -1.078  -8.884  1.00 0.54  ? 31 PRO A HD2  2  
ATOM 2699  H HD3  . PRO A 1 31 ? 12.542  0.571   -8.588  1.00 0.52  ? 31 PRO A HD3  2  
ATOM 2700  N N    . GLY A 1 32 ? 16.022  -0.180  -12.747 1.00 0.60  ? 32 GLY A N    2  
ATOM 2701  C CA   . GLY A 1 32 ? 16.712  -1.237  -13.551 1.00 0.73  ? 32 GLY A CA   2  
ATOM 2702  C C    . GLY A 1 32 ? 17.733  -0.598  -14.501 1.00 0.91  ? 32 GLY A C    2  
ATOM 2703  O O    . GLY A 1 32 ? 18.922  -0.656  -14.246 1.00 1.05  ? 32 GLY A O    2  
ATOM 2704  H H    . GLY A 1 32 ? 16.415  0.727   -12.676 1.00 0.61  ? 32 GLY A H    2  
ATOM 2705  H HA2  . GLY A 1 32 ? 17.220  -1.918  -12.884 1.00 0.73  ? 32 GLY A HA2  2  
ATOM 2706  H HA3  . GLY A 1 32 ? 15.982  -1.782  -14.129 1.00 0.79  ? 32 GLY A HA3  2  
ATOM 2707  N N    . PRO A 1 33 ? 17.243  -0.014  -15.575 1.00 1.04  ? 33 PRO A N    2  
ATOM 2708  C CA   . PRO A 1 33 ? 18.103  0.640   -16.586 1.00 1.28  ? 33 PRO A CA   2  
ATOM 2709  C C    . PRO A 1 33 ? 18.635  1.984   -16.061 1.00 1.12  ? 33 PRO A C    2  
ATOM 2710  O O    . PRO A 1 33 ? 18.656  2.225   -14.868 1.00 1.13  ? 33 PRO A O    2  
ATOM 2711  C CB   . PRO A 1 33 ? 17.164  0.830   -17.786 1.00 1.58  ? 33 PRO A CB   2  
ATOM 2712  C CG   . PRO A 1 33 ? 15.724  0.798   -17.226 1.00 1.49  ? 33 PRO A CG   2  
ATOM 2713  C CD   . PRO A 1 33 ? 15.793  0.056   -15.880 1.00 1.14  ? 33 PRO A CD   2  
ATOM 2714  H HA   . PRO A 1 33 ? 18.920  -0.008  -16.860 1.00 1.47  ? 33 PRO A HA   2  
ATOM 2715  H HB2  . PRO A 1 33 ? 17.358  1.780   -18.264 1.00 1.67  ? 33 PRO A HB2  2  
ATOM 2716  H HB3  . PRO A 1 33 ? 17.296  0.025   -18.491 1.00 1.82  ? 33 PRO A HB3  2  
ATOM 2717  H HG2  . PRO A 1 33 ? 15.362  1.807   -17.077 1.00 1.50  ? 33 PRO A HG2  2  
ATOM 2718  H HG3  . PRO A 1 33 ? 15.073  0.266   -17.902 1.00 1.73  ? 33 PRO A HG3  2  
ATOM 2719  H HD2  . PRO A 1 33 ? 15.264  0.612   -15.121 1.00 1.03  ? 33 PRO A HD2  2  
ATOM 2720  H HD3  . PRO A 1 33 ? 15.385  -0.939  -15.977 1.00 1.20  ? 33 PRO A HD3  2  
ATOM 2721  N N    . HIS A 1 34 ? 19.073  2.857   -16.942 1.00 1.15  ? 34 HIS A N    2  
ATOM 2722  C CA   . HIS A 1 34 ? 19.611  4.186   -16.488 1.00 1.18  ? 34 HIS A CA   2  
ATOM 2723  C C    . HIS A 1 34 ? 18.528  4.980   -15.746 1.00 1.17  ? 34 HIS A C    2  
ATOM 2724  O O    . HIS A 1 34 ? 18.843  5.830   -14.934 1.00 1.26  ? 34 HIS A O    2  
ATOM 2725  C CB   . HIS A 1 34 ? 20.141  5.007   -17.679 1.00 1.36  ? 34 HIS A CB   2  
ATOM 2726  C CG   . HIS A 1 34 ? 19.265  4.829   -18.895 1.00 1.55  ? 34 HIS A CG   2  
ATOM 2727  N ND1  . HIS A 1 34 ? 19.793  4.530   -20.141 1.00 2.08  ? 34 HIS A ND1  2  
ATOM 2728  C CD2  . HIS A 1 34 ? 17.906  4.914   -19.075 1.00 2.02  ? 34 HIS A CD2  2  
ATOM 2729  C CE1  . HIS A 1 34 ? 18.766  4.446   -21.006 1.00 2.65  ? 34 HIS A CE1  2  
ATOM 2730  N NE2  . HIS A 1 34 ? 17.595  4.672   -20.409 1.00 2.66  ? 34 HIS A NE2  2  
ATOM 2731  H H    . HIS A 1 34 ? 19.057  2.636   -17.896 1.00 1.28  ? 34 HIS A H    2  
ATOM 2732  H HA   . HIS A 1 34 ? 20.422  4.006   -15.793 1.00 1.15  ? 34 HIS A HA   2  
ATOM 2733  H HB2  . HIS A 1 34 ? 20.162  6.051   -17.409 1.00 1.71  ? 34 HIS A HB2  2  
ATOM 2734  H HB3  . HIS A 1 34 ? 21.145  4.681   -17.914 1.00 1.68  ? 34 HIS A HB3  2  
ATOM 2735  H HD1  . HIS A 1 34 ? 20.741  4.402   -20.354 1.00 2.32  ? 34 HIS A HD1  2  
ATOM 2736  H HD2  . HIS A 1 34 ? 17.189  5.137   -18.300 1.00 2.22  ? 34 HIS A HD2  2  
ATOM 2737  H HE1  . HIS A 1 34 ? 18.878  4.225   -22.058 1.00 3.26  ? 34 HIS A HE1  2  
ATOM 2738  N N    . CYS A 1 35 ? 17.261  4.677   -15.962 1.00 1.17  ? 35 CYS A N    2  
ATOM 2739  C CA   . CYS A 1 35 ? 16.189  5.381   -15.195 1.00 1.21  ? 35 CYS A CA   2  
ATOM 2740  C C    . CYS A 1 35 ? 16.499  5.097   -13.721 1.00 1.02  ? 35 CYS A C    2  
ATOM 2741  O O    . CYS A 1 35 ? 16.521  5.986   -12.891 1.00 1.08  ? 35 CYS A O    2  
ATOM 2742  C CB   . CYS A 1 35 ? 14.824  4.795   -15.582 1.00 1.45  ? 35 CYS A CB   2  
ATOM 2743  S SG   . CYS A 1 35 ? 13.532  6.071   -15.618 1.00 1.19  ? 35 CYS A SG   2  
ATOM 2744  H H    . CYS A 1 35 ? 17.024  3.955   -16.580 1.00 1.22  ? 35 CYS A H    2  
ATOM 2745  H HA   . CYS A 1 35 ? 16.221  6.443   -15.390 1.00 1.30  ? 35 CYS A HA   2  
ATOM 2746  H HB2  . CYS A 1 35 ? 14.902  4.352   -16.562 1.00 2.02  ? 35 CYS A HB2  2  
ATOM 2747  H HB3  . CYS A 1 35 ? 14.553  4.034   -14.869 1.00 2.07  ? 35 CYS A HB3  2  
ATOM 2748  N N    . ALA A 1 36 ? 16.815  3.843   -13.438 1.00 0.94  ? 36 ALA A N    2  
ATOM 2749  C CA   . ALA A 1 36 ? 17.220  3.401   -12.070 1.00 0.89  ? 36 ALA A CA   2  
ATOM 2750  C C    . ALA A 1 36 ? 16.345  4.021   -10.976 1.00 0.85  ? 36 ALA A C    2  
ATOM 2751  O O    . ALA A 1 36 ? 16.767  4.205   -9.848  1.00 1.18  ? 36 ALA A O    2  
ATOM 2752  C CB   . ALA A 1 36 ? 18.673  3.788   -11.876 1.00 1.08  ? 36 ALA A CB   2  
ATOM 2753  H H    . ALA A 1 36 ? 16.834  3.187   -14.163 1.00 1.02  ? 36 ALA A H    2  
ATOM 2754  H HA   . ALA A 1 36 ? 17.140  2.327   -12.012 1.00 0.94  ? 36 ALA A HA   2  
ATOM 2755  H HB1  . ALA A 1 36 ? 18.819  4.795   -12.236 1.00 1.69  ? 36 ALA A HB1  2  
ATOM 2756  H HB2  . ALA A 1 36 ? 18.923  3.730   -10.833 1.00 1.40  ? 36 ALA A HB2  2  
ATOM 2757  H HB3  . ALA A 1 36 ? 19.295  3.109   -12.441 1.00 1.48  ? 36 ALA A HB3  2  
ATOM 2758  N N    . GLN A 1 37 ? 15.121  4.304   -11.303 1.00 0.93  ? 37 GLN A N    2  
ATOM 2759  C CA   . GLN A 1 37 ? 14.172  4.873   -10.310 1.00 0.89  ? 37 GLN A CA   2  
ATOM 2760  C C    . GLN A 1 37 ? 12.883  4.065   -10.390 1.00 0.71  ? 37 GLN A C    2  
ATOM 2761  O O    . GLN A 1 37 ? 12.813  3.063   -11.074 1.00 0.74  ? 37 GLN A O    2  
ATOM 2762  C CB   . GLN A 1 37 ? 13.870  6.343   -10.644 1.00 0.99  ? 37 GLN A CB   2  
ATOM 2763  C CG   . GLN A 1 37 ? 13.894  7.209   -9.376  1.00 1.66  ? 37 GLN A CG   2  
ATOM 2764  C CD   . GLN A 1 37 ? 15.198  6.978   -8.605  1.00 2.34  ? 37 GLN A CD   2  
ATOM 2765  O OE1  . GLN A 1 37 ? 15.187  6.435   -7.519  1.00 2.82  ? 37 GLN A OE1  2  
ATOM 2766  N NE2  . GLN A 1 37 ? 16.331  7.370   -9.125  1.00 3.07  ? 37 GLN A NE2  2  
ATOM 2767  H H    . GLN A 1 37 ? 14.815  4.116   -12.210 1.00 1.27  ? 37 GLN A H    2  
ATOM 2768  H HA   . GLN A 1 37 ? 14.594  4.792   -9.318  1.00 0.95  ? 37 GLN A HA   2  
ATOM 2769  H HB2  . GLN A 1 37 ? 14.604  6.705   -11.334 1.00 1.38  ? 37 GLN A HB2  2  
ATOM 2770  H HB3  . GLN A 1 37 ? 12.892  6.410   -11.100 1.00 1.44  ? 37 GLN A HB3  2  
ATOM 2771  H HG2  . GLN A 1 37 ? 13.825  8.251   -9.656  1.00 2.22  ? 37 GLN A HG2  2  
ATOM 2772  H HG3  . GLN A 1 37 ? 13.052  6.956   -8.745  1.00 2.02  ? 37 GLN A HG3  2  
ATOM 2773  H HE21 . GLN A 1 37 ? 16.344  7.808   -10.002 1.00 3.26  ? 37 GLN A HE21 2  
ATOM 2774  H HE22 . GLN A 1 37 ? 17.169  7.225   -8.638  1.00 3.72  ? 37 GLN A HE22 2  
ATOM 2775  N N    . THR A 1 38 ? 11.860  4.490   -9.718  1.00 0.60  ? 38 THR A N    2  
ATOM 2776  C CA   . THR A 1 38 ? 10.584  3.738   -9.781  1.00 0.44  ? 38 THR A CA   2  
ATOM 2777  C C    . THR A 1 38 ? 9.807   4.137   -11.035 1.00 0.35  ? 38 THR A C    2  
ATOM 2778  O O    . THR A 1 38 ? 10.346  4.696   -11.975 1.00 0.42  ? 38 THR A O    2  
ATOM 2779  C CB   . THR A 1 38 ? 9.735   4.023   -8.534  1.00 0.44  ? 38 THR A CB   2  
ATOM 2780  O OG1  . THR A 1 38 ? 10.489  4.758   -7.575  1.00 0.60  ? 38 THR A OG1  2  
ATOM 2781  C CG2  . THR A 1 38 ? 9.316   2.687   -7.944  1.00 0.44  ? 38 THR A CG2  2  
ATOM 2782  H H    . THR A 1 38 ? 11.927  5.301   -9.180  1.00 0.68  ? 38 THR A H    2  
ATOM 2783  H HA   . THR A 1 38 ? 10.803  2.681   -9.825  1.00 0.44  ? 38 THR A HA   2  
ATOM 2784  H HB   . THR A 1 38 ? 8.846   4.583   -8.809  1.00 0.40  ? 38 THR A HB   2  
ATOM 2785  H HG1  . THR A 1 38 ? 10.185  5.670   -7.596  1.00 0.96  ? 38 THR A HG1  2  
ATOM 2786  H HG21 . THR A 1 38 ? 10.162  2.016   -7.948  1.00 1.13  ? 38 THR A HG21 2  
ATOM 2787  H HG22 . THR A 1 38 ? 8.970   2.832   -6.935  1.00 1.10  ? 38 THR A HG22 2  
ATOM 2788  H HG23 . THR A 1 38 ? 8.523   2.267   -8.546  1.00 1.11  ? 38 THR A HG23 2  
ATOM 2789  N N    . GLU A 1 39 ? 8.534   3.874   -11.032 1.00 0.25  ? 39 GLU A N    2  
ATOM 2790  C CA   . GLU A 1 39 ? 7.666   4.234   -12.167 1.00 0.25  ? 39 GLU A CA   2  
ATOM 2791  C C    . GLU A 1 39 ? 6.287   4.337   -11.597 1.00 0.21  ? 39 GLU A C    2  
ATOM 2792  O O    . GLU A 1 39 ? 5.891   3.526   -10.783 1.00 0.35  ? 39 GLU A O    2  
ATOM 2793  C CB   . GLU A 1 39 ? 7.642   3.166   -13.243 1.00 0.33  ? 39 GLU A CB   2  
ATOM 2794  C CG   . GLU A 1 39 ? 8.185   3.736   -14.557 1.00 0.60  ? 39 GLU A CG   2  
ATOM 2795  C CD   . GLU A 1 39 ? 8.421   2.600   -15.555 1.00 0.80  ? 39 GLU A CD   2  
ATOM 2796  O OE1  . GLU A 1 39 ? 7.460   2.162   -16.164 1.00 1.40  ? 39 GLU A OE1  2  
ATOM 2797  O OE2  . GLU A 1 39 ? 9.561   2.187   -15.692 1.00 1.47  ? 39 GLU A OE2  2  
ATOM 2798  H H    . GLU A 1 39 ? 8.127   3.452   -10.247 1.00 0.25  ? 39 GLU A H    2  
ATOM 2799  H HA   . GLU A 1 39 ? 7.974   5.181   -12.574 1.00 0.31  ? 39 GLU A HA   2  
ATOM 2800  H HB2  . GLU A 1 39 ? 8.244   2.323   -12.933 1.00 0.30  ? 39 GLU A HB2  2  
ATOM 2801  H HB3  . GLU A 1 39 ? 6.609   2.854   -13.381 1.00 0.41  ? 39 GLU A HB3  2  
ATOM 2802  H HG2  . GLU A 1 39 ? 7.470   4.435   -14.969 1.00 0.88  ? 39 GLU A HG2  2  
ATOM 2803  H HG3  . GLU A 1 39 ? 9.118   4.246   -14.370 1.00 0.85  ? 39 GLU A HG3  2  
ATOM 2804  N N    . VAL A 1 40 ? 5.576   5.337   -11.950 1.00 0.15  ? 40 VAL A N    2  
ATOM 2805  C CA   . VAL A 1 40 ? 4.258   5.503   -11.353 1.00 0.19  ? 40 VAL A CA   2  
ATOM 2806  C C    . VAL A 1 40 ? 3.386   6.302   -12.316 1.00 0.19  ? 40 VAL A C    2  
ATOM 2807  O O    . VAL A 1 40 ? 3.158   7.478   -12.129 1.00 0.21  ? 40 VAL A O    2  
ATOM 2808  C CB   . VAL A 1 40 ? 4.487   6.245   -10.029 1.00 0.23  ? 40 VAL A CB   2  
ATOM 2809  C CG1  . VAL A 1 40 ? 4.646   5.215   -8.917  1.00 0.28  ? 40 VAL A CG1  2  
ATOM 2810  C CG2  . VAL A 1 40 ? 5.799   7.051   -10.110 1.00 0.24  ? 40 VAL A CG2  2  
ATOM 2811  H H    . VAL A 1 40 ? 5.925   6.009   -12.554 1.00 0.22  ? 40 VAL A H    2  
ATOM 2812  H HA   . VAL A 1 40 ? 3.836   4.524   -11.176 1.00 0.23  ? 40 VAL A HA   2  
ATOM 2813  H HB   . VAL A 1 40 ? 3.664   6.913   -9.825  1.00 0.29  ? 40 VAL A HB   2  
ATOM 2814  H HG11 . VAL A 1 40 ? 4.181   4.289   -9.215  1.00 1.04  ? 40 VAL A HG11 2  
ATOM 2815  H HG12 . VAL A 1 40 ? 5.704   5.042   -8.742  1.00 1.00  ? 40 VAL A HG12 2  
ATOM 2816  H HG13 . VAL A 1 40 ? 4.188   5.582   -8.016  1.00 1.08  ? 40 VAL A HG13 2  
ATOM 2817  H HG21 . VAL A 1 40 ? 5.786   7.677   -10.988 1.00 1.01  ? 40 VAL A HG21 2  
ATOM 2818  H HG22 . VAL A 1 40 ? 5.907   7.660   -9.230  1.00 1.04  ? 40 VAL A HG22 2  
ATOM 2819  H HG23 . VAL A 1 40 ? 6.636   6.364   -10.174 1.00 1.03  ? 40 VAL A HG23 2  
ATOM 2820  N N    . ILE A 1 41 ? 2.945   5.676   -13.377 1.00 0.23  ? 41 ILE A N    2  
ATOM 2821  C CA   . ILE A 1 41 ? 2.148   6.395   -14.395 1.00 0.25  ? 41 ILE A CA   2  
ATOM 2822  C C    . ILE A 1 41 ? 0.648   6.175   -14.204 1.00 0.23  ? 41 ILE A C    2  
ATOM 2823  O O    . ILE A 1 41 ? 0.165   5.075   -14.276 1.00 0.25  ? 41 ILE A O    2  
ATOM 2824  C CB   . ILE A 1 41 ? 2.571   5.874   -15.761 1.00 0.30  ? 41 ILE A CB   2  
ATOM 2825  C CG1  . ILE A 1 41 ? 3.826   6.616   -16.222 1.00 0.50  ? 41 ILE A CG1  2  
ATOM 2826  C CG2  . ILE A 1 41 ? 1.455   6.087   -16.779 1.00 0.67  ? 41 ILE A CG2  2  
ATOM 2827  C CD1  . ILE A 1 41 ? 3.542   8.117   -16.344 1.00 0.54  ? 41 ILE A CD1  2  
ATOM 2828  H H    . ILE A 1 41 ? 3.174   4.734   -13.526 1.00 0.27  ? 41 ILE A H    2  
ATOM 2829  H HA   . ILE A 1 41 ? 2.370   7.441   -14.338 1.00 0.26  ? 41 ILE A HA   2  
ATOM 2830  H HB   . ILE A 1 41 ? 2.785   4.814   -15.677 1.00 0.48  ? 41 ILE A HB   2  
ATOM 2831  H HG12 . ILE A 1 41 ? 4.623   6.454   -15.512 1.00 0.70  ? 41 ILE A HG12 2  
ATOM 2832  H HG13 . ILE A 1 41 ? 4.116   6.240   -17.177 1.00 0.69  ? 41 ILE A HG13 2  
ATOM 2833  H HG21 . ILE A 1 41 ? 1.146   7.119   -16.756 1.00 1.18  ? 41 ILE A HG21 2  
ATOM 2834  H HG22 . ILE A 1 41 ? 1.819   5.837   -17.763 1.00 1.38  ? 41 ILE A HG22 2  
ATOM 2835  H HG23 . ILE A 1 41 ? 0.618   5.452   -16.530 1.00 1.20  ? 41 ILE A HG23 2  
ATOM 2836  H HD11 . ILE A 1 41 ? 2.499   8.270   -16.577 1.00 1.14  ? 41 ILE A HD11 2  
ATOM 2837  H HD12 . ILE A 1 41 ? 3.777   8.606   -15.412 1.00 1.22  ? 41 ILE A HD12 2  
ATOM 2838  H HD13 . ILE A 1 41 ? 4.151   8.534   -17.132 1.00 1.02  ? 41 ILE A HD13 2  
ATOM 2839  N N    . ALA A 1 42 ? -0.092  7.232   -14.033 1.00 0.22  ? 42 ALA A N    2  
ATOM 2840  C CA   . ALA A 1 42 ? -1.569  7.105   -13.901 1.00 0.22  ? 42 ALA A CA   2  
ATOM 2841  C C    . ALA A 1 42 ? -2.181  7.289   -15.279 1.00 0.24  ? 42 ALA A C    2  
ATOM 2842  O O    . ALA A 1 42 ? -2.126  8.361   -15.850 1.00 0.25  ? 42 ALA A O    2  
ATOM 2843  C CB   . ALA A 1 42 ? -2.095  8.172   -12.956 1.00 0.21  ? 42 ALA A CB   2  
ATOM 2844  H H    . ALA A 1 42 ? 0.322   8.121   -14.037 1.00 0.23  ? 42 ALA A H    2  
ATOM 2845  H HA   . ALA A 1 42 ? -1.828  6.135   -13.527 1.00 0.23  ? 42 ALA A HA   2  
ATOM 2846  H HB1  . ALA A 1 42 ? -1.834  9.145   -13.337 1.00 1.00  ? 42 ALA A HB1  2  
ATOM 2847  H HB2  . ALA A 1 42 ? -3.167  8.083   -12.885 1.00 0.95  ? 42 ALA A HB2  2  
ATOM 2848  H HB3  . ALA A 1 42 ? -1.653  8.030   -11.981 1.00 1.00  ? 42 ALA A HB3  2  
ATOM 2849  N N    . THR A 1 43 ? -2.755  6.250   -15.829 1.00 0.28  ? 43 THR A N    2  
ATOM 2850  C CA   . THR A 1 43 ? -3.348  6.380   -17.178 1.00 0.32  ? 43 THR A CA   2  
ATOM 2851  C C    . THR A 1 43 ? -4.634  7.188   -17.082 1.00 0.32  ? 43 THR A C    2  
ATOM 2852  O O    . THR A 1 43 ? -5.537  6.870   -16.327 1.00 0.34  ? 43 THR A O    2  
ATOM 2853  C CB   . THR A 1 43 ? -3.662  5.010   -17.784 1.00 0.35  ? 43 THR A CB   2  
ATOM 2854  O OG1  . THR A 1 43 ? -2.650  4.074   -17.426 1.00 0.39  ? 43 THR A OG1  2  
ATOM 2855  C CG2  . THR A 1 43 ? -3.736  5.140   -19.305 1.00 0.39  ? 43 THR A CG2  2  
ATOM 2856  H H    . THR A 1 43 ? -2.787  5.390   -15.357 1.00 0.28  ? 43 THR A H    2  
ATOM 2857  H HA   . THR A 1 43 ? -2.641  6.906   -17.808 1.00 0.32  ? 43 THR A HA   2  
ATOM 2858  H HB   . THR A 1 43 ? -4.617  4.672   -17.419 1.00 0.35  ? 43 THR A HB   2  
ATOM 2859  H HG1  . THR A 1 43 ? -1.809  4.397   -17.760 1.00 0.89  ? 43 THR A HG1  2  
ATOM 2860  H HG21 . THR A 1 43 ? -4.424  5.934   -19.563 1.00 1.07  ? 43 THR A HG21 2  
ATOM 2861  H HG22 . THR A 1 43 ? -2.756  5.374   -19.694 1.00 1.07  ? 43 THR A HG22 2  
ATOM 2862  H HG23 . THR A 1 43 ? -4.082  4.211   -19.730 1.00 1.05  ? 43 THR A HG23 2  
ATOM 2863  N N    . LEU A 1 44 ? -4.700  8.242   -17.835 1.00 0.32  ? 44 LEU A N    2  
ATOM 2864  C CA   . LEU A 1 44 ? -5.882  9.124   -17.820 1.00 0.32  ? 44 LEU A CA   2  
ATOM 2865  C C    . LEU A 1 44 ? -7.073  8.464   -18.525 1.00 0.37  ? 44 LEU A C    2  
ATOM 2866  O O    . LEU A 1 44 ? -6.902  7.581   -19.348 1.00 0.40  ? 44 LEU A O    2  
ATOM 2867  C CB   . LEU A 1 44 ? -5.506  10.386  -18.570 1.00 0.34  ? 44 LEU A CB   2  
ATOM 2868  C CG   . LEU A 1 44 ? -5.070  11.464  -17.592 1.00 0.32  ? 44 LEU A CG   2  
ATOM 2869  C CD1  . LEU A 1 44 ? -6.318  12.239  -17.185 1.00 0.35  ? 44 LEU A CD1  2  
ATOM 2870  C CD2  . LEU A 1 44 ? -4.381  10.836  -16.354 1.00 0.28  ? 44 LEU A CD2  2  
ATOM 2871  H H    . LEU A 1 44 ? -3.942  8.475   -18.410 1.00 0.33  ? 44 LEU A H    2  
ATOM 2872  H HA   . LEU A 1 44 ? -6.134  9.366   -16.794 1.00 0.30  ? 44 LEU A HA   2  
ATOM 2873  H HB2  . LEU A 1 44 ? -4.694  10.168  -19.242 1.00 0.37  ? 44 LEU A HB2  2  
ATOM 2874  H HB3  . LEU A 1 44 ? -6.357  10.734  -19.134 1.00 0.37  ? 44 LEU A HB3  2  
ATOM 2875  H HG   . LEU A 1 44 ? -4.382  12.124  -18.090 1.00 0.34  ? 44 LEU A HG   2  
ATOM 2876  H HD11 . LEU A 1 44 ? -7.097  11.539  -16.914 1.00 1.07  ? 44 LEU A HD11 2  
ATOM 2877  H HD12 . LEU A 1 44 ? -6.095  12.877  -16.351 1.00 1.03  ? 44 LEU A HD12 2  
ATOM 2878  H HD13 . LEU A 1 44 ? -6.654  12.835  -18.024 1.00 1.05  ? 44 LEU A HD13 2  
ATOM 2879  H HD21 . LEU A 1 44 ? -3.652  10.103  -16.677 1.00 1.08  ? 44 LEU A HD21 2  
ATOM 2880  H HD22 . LEU A 1 44 ? -3.882  11.605  -15.784 1.00 1.03  ? 44 LEU A HD22 2  
ATOM 2881  H HD23 . LEU A 1 44 ? -5.119  10.350  -15.731 1.00 1.04  ? 44 LEU A HD23 2  
ATOM 2882  N N    . LYS A 1 45 ? -8.271  8.934   -18.226 1.00 0.38  ? 45 LYS A N    2  
ATOM 2883  C CA   . LYS A 1 45 ? -9.515  8.407   -18.847 1.00 0.44  ? 45 LYS A CA   2  
ATOM 2884  C C    . LYS A 1 45 ? -9.442  8.484   -20.362 1.00 0.49  ? 45 LYS A C    2  
ATOM 2885  O O    . LYS A 1 45 ? -9.863  7.576   -21.056 1.00 0.54  ? 45 LYS A O    2  
ATOM 2886  C CB   . LYS A 1 45 ? -10.675 9.267   -18.369 1.00 0.45  ? 45 LYS A CB   2  
ATOM 2887  C CG   . LYS A 1 45 ? -11.752 8.397   -17.709 1.00 0.47  ? 45 LYS A CG   2  
ATOM 2888  C CD   . LYS A 1 45 ? -13.100 8.629   -18.397 1.00 0.72  ? 45 LYS A CD   2  
ATOM 2889  C CE   . LYS A 1 45 ? -13.789 9.850   -17.781 1.00 1.05  ? 45 LYS A CE   2  
ATOM 2890  N NZ   . LYS A 1 45 ? -15.235 9.845   -18.144 1.00 1.42  ? 45 LYS A NZ   2  
ATOM 2891  H H    . LYS A 1 45 ? -8.356  9.672   -17.596 1.00 0.37  ? 45 LYS A H    2  
ATOM 2892  H HA   . LYS A 1 45 ? -9.673  7.387   -18.542 1.00 0.44  ? 45 LYS A HA   2  
ATOM 2893  H HB2  . LYS A 1 45 ? -10.309 9.984   -17.652 1.00 0.42  ? 45 LYS A HB2  2  
ATOM 2894  H HB3  . LYS A 1 45 ? -11.079 9.793   -19.200 1.00 0.49  ? 45 LYS A HB3  2  
ATOM 2895  H HG2  . LYS A 1 45 ? -11.477 7.357   -17.798 1.00 0.52  ? 45 LYS A HG2  2  
ATOM 2896  H HG3  . LYS A 1 45 ? -11.835 8.658   -16.665 1.00 0.54  ? 45 LYS A HG3  2  
ATOM 2897  H HD2  . LYS A 1 45 ? -12.942 8.798   -19.453 1.00 0.99  ? 45 LYS A HD2  2  
ATOM 2898  H HD3  . LYS A 1 45 ? -13.727 7.761   -18.263 1.00 0.94  ? 45 LYS A HD3  2  
ATOM 2899  H HE2  . LYS A 1 45 ? -13.689 9.817   -16.707 1.00 1.46  ? 45 LYS A HE2  2  
ATOM 2900  H HE3  . LYS A 1 45 ? -13.327 10.752  -18.157 1.00 1.42  ? 45 LYS A HE3  2  
ATOM 2901  H HZ1  . LYS A 1 45 ? -15.680 8.976   -17.783 1.00 1.84  ? 45 LYS A HZ1  2  
ATOM 2902  H HZ2  . LYS A 1 45 ? -15.701 10.673  -17.726 1.00 1.86  ? 45 LYS A HZ2  2  
ATOM 2903  H HZ3  . LYS A 1 45 ? -15.334 9.881   -19.180 1.00 1.80  ? 45 LYS A HZ3  2  
ATOM 2904  N N    . ASN A 1 46 ? -8.909  9.556   -20.884 1.00 0.49  ? 46 ASN A N    2  
ATOM 2905  C CA   . ASN A 1 46 ? -8.804  9.681   -22.367 1.00 0.55  ? 46 ASN A CA   2  
ATOM 2906  C C    . ASN A 1 46 ? -7.716  8.723   -22.905 1.00 0.57  ? 46 ASN A C    2  
ATOM 2907  O O    . ASN A 1 46 ? -7.426  8.709   -24.087 1.00 0.75  ? 46 ASN A O    2  
ATOM 2908  C CB   . ASN A 1 46 ? -8.465  11.131  -22.724 1.00 0.58  ? 46 ASN A CB   2  
ATOM 2909  C CG   . ASN A 1 46 ? -7.056  11.478  -22.236 1.00 0.78  ? 46 ASN A CG   2  
ATOM 2910  O OD1  . ASN A 1 46 ? -6.083  11.143  -22.879 1.00 1.66  ? 46 ASN A OD1  2  
ATOM 2911  N ND2  . ASN A 1 46 ? -6.906  12.141  -21.121 1.00 0.81  ? 46 ASN A ND2  2  
ATOM 2912  H H    . ASN A 1 46 ? -8.570  10.277  -20.296 1.00 0.47  ? 46 ASN A H    2  
ATOM 2913  H HA   . ASN A 1 46 ? -9.754  9.420   -22.810 1.00 0.62  ? 46 ASN A HA   2  
ATOM 2914  H HB2  . ASN A 1 46 ? -8.514  11.253  -23.791 1.00 0.73  ? 46 ASN A HB2  2  
ATOM 2915  H HB3  . ASN A 1 46 ? -9.178  11.792  -22.255 1.00 0.74  ? 46 ASN A HB3  2  
ATOM 2916  H HD21 . ASN A 1 46 ? -7.692  12.413  -20.602 1.00 1.39  ? 46 ASN A HD21 2  
ATOM 2917  H HD22 . ASN A 1 46 ? -6.008  12.367  -20.803 1.00 0.88  ? 46 ASN A HD22 2  
ATOM 2918  N N    . GLY A 1 47 ? -7.111  7.934   -22.042 1.00 0.50  ? 47 GLY A N    2  
ATOM 2919  C CA   . GLY A 1 47 ? -6.044  6.990   -22.477 1.00 0.53  ? 47 GLY A CA   2  
ATOM 2920  C C    . GLY A 1 47 ? -4.712  7.730   -22.478 1.00 0.51  ? 47 GLY A C    2  
ATOM 2921  O O    . GLY A 1 47 ? -3.857  7.493   -23.311 1.00 0.60  ? 47 GLY A O    2  
ATOM 2922  H H    . GLY A 1 47 ? -7.350  7.969   -21.096 1.00 0.52  ? 47 GLY A H    2  
ATOM 2923  H HA2  . GLY A 1 47 ? -5.994  6.160   -21.781 1.00 0.52  ? 47 GLY A HA2  2  
ATOM 2924  H HA3  . GLY A 1 47 ? -6.255  6.623   -23.467 1.00 0.59  ? 47 GLY A HA3  2  
ATOM 2925  N N    . ARG A 1 48 ? -4.530  8.616   -21.531 1.00 0.47  ? 48 ARG A N    2  
ATOM 2926  C CA   . ARG A 1 48 ? -3.247  9.375   -21.441 1.00 0.54  ? 48 ARG A CA   2  
ATOM 2927  C C    . ARG A 1 48 ? -2.476  8.840   -20.247 1.00 0.42  ? 48 ARG A C    2  
ATOM 2928  O O    . ARG A 1 48 ? -2.825  7.816   -19.700 1.00 0.37  ? 48 ARG A O    2  
ATOM 2929  C CB   . ARG A 1 48 ? -3.539  10.868  -21.244 1.00 0.66  ? 48 ARG A CB   2  
ATOM 2930  C CG   . ARG A 1 48 ? -3.270  11.617  -22.549 1.00 1.00  ? 48 ARG A CG   2  
ATOM 2931  C CD   . ARG A 1 48 ? -3.760  13.063  -22.424 1.00 1.55  ? 48 ARG A CD   2  
ATOM 2932  N NE   . ARG A 1 48 ? -3.146  13.895  -23.501 1.00 2.08  ? 48 ARG A NE   2  
ATOM 2933  C CZ   . ARG A 1 48 ? -3.169  15.201  -23.418 1.00 2.34  ? 48 ARG A CZ   2  
ATOM 2934  N NH1  . ARG A 1 48 ? -2.462  15.812  -22.502 1.00 2.89  ? 48 ARG A NH1  2  
ATOM 2935  N NH2  . ARG A 1 48 ? -3.895  15.897  -24.257 1.00 2.67  ? 48 ARG A NH2  2  
ATOM 2936  H H    . ARG A 1 48 ? -5.237  8.770   -20.860 1.00 0.43  ? 48 ARG A H    2  
ATOM 2937  H HA   . ARG A 1 48 ? -2.666  9.232   -22.340 1.00 0.68  ? 48 ARG A HA   2  
ATOM 2938  H HB2  . ARG A 1 48 ? -4.571  10.997  -20.959 1.00 1.19  ? 48 ARG A HB2  2  
ATOM 2939  H HB3  . ARG A 1 48 ? -2.900  11.261  -20.467 1.00 1.23  ? 48 ARG A HB3  2  
ATOM 2940  H HG2  . ARG A 1 48 ? -2.210  11.611  -22.752 1.00 1.43  ? 48 ARG A HG2  2  
ATOM 2941  H HG3  . ARG A 1 48 ? -3.795  11.129  -23.356 1.00 1.63  ? 48 ARG A HG3  2  
ATOM 2942  H HD2  . ARG A 1 48 ? -4.836  13.088  -22.520 1.00 1.84  ? 48 ARG A HD2  2  
ATOM 2943  H HD3  . ARG A 1 48 ? -3.477  13.457  -21.458 1.00 1.84  ? 48 ARG A HD3  2  
ATOM 2944  H HE   . ARG A 1 48 ? -2.722  13.462  -24.272 1.00 2.46  ? 48 ARG A HE   2  
ATOM 2945  H HH11 . ARG A 1 48 ? -1.904  15.281  -21.863 1.00 3.28  ? 48 ARG A HH11 2  
ATOM 2946  H HH12 . ARG A 1 48 ? -2.480  16.811  -22.439 1.00 3.23  ? 48 ARG A HH12 2  
ATOM 2947  H HH21 . ARG A 1 48 ? -4.432  15.431  -24.961 1.00 2.92  ? 48 ARG A HH21 2  
ATOM 2948  H HH22 . ARG A 1 48 ? -3.912  16.895  -24.195 1.00 3.04  ? 48 ARG A HH22 2  
ATOM 2949  N N    . LYS A 1 49 ? -1.438  9.503   -19.827 1.00 0.45  ? 49 LYS A N    2  
ATOM 2950  C CA   . LYS A 1 49 ? -0.687  8.995   -18.655 1.00 0.39  ? 49 LYS A CA   2  
ATOM 2951  C C    . LYS A 1 49 ? 0.063   10.119  -17.946 1.00 0.38  ? 49 LYS A C    2  
ATOM 2952  O O    . LYS A 1 49 ? 0.486   11.092  -18.545 1.00 0.54  ? 49 LYS A O    2  
ATOM 2953  C CB   . LYS A 1 49 ? 0.312   7.915   -19.077 1.00 0.58  ? 49 LYS A CB   2  
ATOM 2954  C CG   . LYS A 1 49 ? 0.794   8.109   -20.527 1.00 0.89  ? 49 LYS A CG   2  
ATOM 2955  C CD   . LYS A 1 49 ? 1.760   9.295   -20.632 1.00 0.96  ? 49 LYS A CD   2  
ATOM 2956  C CE   . LYS A 1 49 ? 2.919   9.140   -19.643 1.00 0.92  ? 49 LYS A CE   2  
ATOM 2957  N NZ   . LYS A 1 49 ? 4.079   9.946   -20.121 1.00 1.06  ? 49 LYS A NZ   2  
ATOM 2958  H H    . LYS A 1 49 ? -1.160  10.319  -20.274 1.00 0.55  ? 49 LYS A H    2  
ATOM 2959  H HA   . LYS A 1 49 ? -1.394  8.559   -17.961 1.00 0.34  ? 49 LYS A HA   2  
ATOM 2960  H HB2  . LYS A 1 49 ? 1.159   7.940   -18.410 1.00 0.59  ? 49 LYS A HB2  2  
ATOM 2961  H HB3  . LYS A 1 49 ? -0.173  6.961   -18.996 1.00 0.69  ? 49 LYS A HB3  2  
ATOM 2962  H HG2  . LYS A 1 49 ? 1.297   7.213   -20.856 1.00 1.06  ? 49 LYS A HG2  2  
ATOM 2963  H HG3  . LYS A 1 49 ? -0.059  8.289   -21.166 1.00 1.14  ? 49 LYS A HG3  2  
ATOM 2964  H HD2  . LYS A 1 49 ? 2.154   9.342   -21.636 1.00 0.98  ? 49 LYS A HD2  2  
ATOM 2965  H HD3  . LYS A 1 49 ? 1.227   10.208  -20.417 1.00 1.23  ? 49 LYS A HD3  2  
ATOM 2966  H HE2  . LYS A 1 49 ? 2.613   9.493   -18.668 1.00 0.97  ? 49 LYS A HE2  2  
ATOM 2967  H HE3  . LYS A 1 49 ? 3.204   8.101   -19.577 1.00 0.87  ? 49 LYS A HE3  2  
ATOM 2968  H HZ1  . LYS A 1 49 ? 3.758   10.900  -20.381 1.00 1.66  ? 49 LYS A HZ1  2  
ATOM 2969  H HZ2  . LYS A 1 49 ? 4.787   10.016  -19.363 1.00 1.54  ? 49 LYS A HZ2  2  
ATOM 2970  H HZ3  . LYS A 1 49 ? 4.503   9.484   -20.951 1.00 1.19  ? 49 LYS A HZ3  2  
ATOM 2971  N N    . ALA A 1 50 ? 0.241   9.963   -16.666 1.00 0.27  ? 50 ALA A N    2  
ATOM 2972  C CA   . ALA A 1 50 ? 0.990   10.983  -15.862 1.00 0.28  ? 50 ALA A CA   2  
ATOM 2973  C C    . ALA A 1 50 ? 1.833   10.258  -14.840 1.00 0.24  ? 50 ALA A C    2  
ATOM 2974  O O    . ALA A 1 50 ? 1.492   9.182   -14.429 1.00 0.21  ? 50 ALA A O    2  
ATOM 2975  C CB   . ALA A 1 50 ? 0.022   11.876  -15.094 1.00 0.32  ? 50 ALA A CB   2  
ATOM 2976  H H    . ALA A 1 50 ? -0.110  9.147   -16.226 1.00 0.29  ? 50 ALA A H    2  
ATOM 2977  H HA   . ALA A 1 50 ? 1.617   11.580  -16.507 1.00 0.34  ? 50 ALA A HA   2  
ATOM 2978  H HB1  . ALA A 1 50 ? -0.688  12.312  -15.772 1.00 1.10  ? 50 ALA A HB1  2  
ATOM 2979  H HB2  . ALA A 1 50 ? -0.497  11.282  -14.353 1.00 1.06  ? 50 ALA A HB2  2  
ATOM 2980  H HB3  . ALA A 1 50 ? 0.578   12.658  -14.593 1.00 1.04  ? 50 ALA A HB3  2  
ATOM 2981  N N    . CYS A 1 51 ? 2.884   10.850  -14.358 1.00 0.25  ? 51 CYS A N    2  
ATOM 2982  C CA   . CYS A 1 51 ? 3.656   10.166  -13.306 1.00 0.22  ? 51 CYS A CA   2  
ATOM 2983  C C    . CYS A 1 51 ? 3.459   10.979  -12.049 1.00 0.22  ? 51 CYS A C    2  
ATOM 2984  O O    . CYS A 1 51 ? 3.267   12.174  -12.119 1.00 0.24  ? 51 CYS A O    2  
ATOM 2985  C CB   . CYS A 1 51 ? 5.147   10.056  -13.665 1.00 0.24  ? 51 CYS A CB   2  
ATOM 2986  S SG   . CYS A 1 51 ? 5.587   8.296   -13.710 1.00 0.26  ? 51 CYS A SG   2  
ATOM 2987  H H    . CYS A 1 51 ? 3.123   11.762  -14.633 1.00 0.28  ? 51 CYS A H    2  
ATOM 2988  H HA   . CYS A 1 51 ? 3.250   9.177   -13.161 1.00 0.20  ? 51 CYS A HA   2  
ATOM 2989  H HB2  . CYS A 1 51 ? 5.321   10.500  -14.627 1.00 0.28  ? 51 CYS A HB2  2  
ATOM 2990  H HB3  . CYS A 1 51 ? 5.742   10.560  -12.918 1.00 0.27  ? 51 CYS A HB3  2  
ATOM 2991  N N    . LEU A 1 52 ? 3.459   10.355  -10.911 1.00 0.21  ? 52 LEU A N    2  
ATOM 2992  C CA   . LEU A 1 52 ? 3.263   11.115  -9.654  1.00 0.23  ? 52 LEU A CA   2  
ATOM 2993  C C    . LEU A 1 52 ? 4.329   10.664  -8.661  1.00 0.25  ? 52 LEU A C    2  
ATOM 2994  O O    . LEU A 1 52 ? 5.034   9.707   -8.904  1.00 0.25  ? 52 LEU A O    2  
ATOM 2995  C CB   . LEU A 1 52 ? 1.834   10.942  -9.090  1.00 0.22  ? 52 LEU A CB   2  
ATOM 2996  C CG   . LEU A 1 52 ? 1.162   9.676   -9.625  1.00 0.18  ? 52 LEU A CG   2  
ATOM 2997  C CD1  . LEU A 1 52 ? 0.922   9.785   -11.143 1.00 0.17  ? 52 LEU A CD1  2  
ATOM 2998  C CD2  . LEU A 1 52 ? 2.042   8.479   -9.276  1.00 0.19  ? 52 LEU A CD2  2  
ATOM 2999  H H    . LEU A 1 52 ? 3.573   9.384   -10.881 1.00 0.20  ? 52 LEU A H    2  
ATOM 3000  H HA   . LEU A 1 52 ? 3.424   12.144  -9.864  1.00 0.25  ? 52 LEU A HA   2  
ATOM 3001  H HB2  . LEU A 1 52 ? 1.884   10.886  -8.017  1.00 0.25  ? 52 LEU A HB2  2  
ATOM 3002  H HB3  . LEU A 1 52 ? 1.240   11.802  -9.368  1.00 0.24  ? 52 LEU A HB3  2  
ATOM 3003  H HG   . LEU A 1 52 ? 0.216   9.559   -9.150  1.00 0.19  ? 52 LEU A HG   2  
ATOM 3004  H HD11 . LEU A 1 52 ? 1.073   10.810  -11.459 1.00 0.98  ? 52 LEU A HD11 2  
ATOM 3005  H HD12 . LEU A 1 52 ? 1.611   9.144   -11.670 1.00 1.01  ? 52 LEU A HD12 2  
ATOM 3006  H HD13 . LEU A 1 52 ? -0.091  9.491   -11.372 1.00 0.98  ? 52 LEU A HD13 2  
ATOM 3007  H HD21 . LEU A 1 52 ? 2.878   8.816   -8.677  1.00 1.00  ? 52 LEU A HD21 2  
ATOM 3008  H HD22 . LEU A 1 52 ? 1.467   7.764   -8.710  1.00 0.98  ? 52 LEU A HD22 2  
ATOM 3009  H HD23 . LEU A 1 52 ? 2.407   8.025   -10.178 1.00 1.03  ? 52 LEU A HD23 2  
ATOM 3010  N N    . ASN A 1 53 ? 4.487   11.363  -7.576  1.00 0.29  ? 53 ASN A N    2  
ATOM 3011  C CA   . ASN A 1 53 ? 5.548   10.987  -6.596  1.00 0.32  ? 53 ASN A CA   2  
ATOM 3012  C C    . ASN A 1 53 ? 4.971   10.077  -5.501  1.00 0.34  ? 53 ASN A C    2  
ATOM 3013  O O    . ASN A 1 53 ? 4.455   10.582  -4.534  1.00 0.37  ? 53 ASN A O    2  
ATOM 3014  C CB   . ASN A 1 53 ? 6.094   12.258  -5.929  1.00 0.36  ? 53 ASN A CB   2  
ATOM 3015  C CG   . ASN A 1 53 ? 7.274   12.808  -6.732  1.00 0.43  ? 53 ASN A CG   2  
ATOM 3016  O OD1  . ASN A 1 53 ? 7.198   13.892  -7.274  1.00 1.07  ? 53 ASN A OD1  2  
ATOM 3017  N ND2  . ASN A 1 53 ? 8.371   12.105  -6.823  1.00 0.93  ? 53 ASN A ND2  2  
ATOM 3018  H H    . ASN A 1 53 ? 3.928   12.152  -7.420  1.00 0.30  ? 53 ASN A H    2  
ATOM 3019  H HA   . ASN A 1 53 ? 6.350   10.490  -7.110  1.00 0.33  ? 53 ASN A HA   2  
ATOM 3020  H HB2  . ASN A 1 53 ? 5.313   13.000  -5.878  1.00 0.40  ? 53 ASN A HB2  2  
ATOM 3021  H HB3  . ASN A 1 53 ? 6.425   12.021  -4.928  1.00 0.40  ? 53 ASN A HB3  2  
ATOM 3022  H HD21 . ASN A 1 53 ? 8.433   11.234  -6.380  1.00 1.59  ? 53 ASN A HD21 2  
ATOM 3023  H HD22 . ASN A 1 53 ? 9.132   12.451  -7.334  1.00 0.93  ? 53 ASN A HD22 2  
ATOM 3024  N N    . PRO A 1 54 ? 5.097   8.766   -5.627  1.00 0.34  ? 54 PRO A N    2  
ATOM 3025  C CA   . PRO A 1 54 ? 4.591   7.858   -4.581  1.00 0.37  ? 54 PRO A CA   2  
ATOM 3026  C C    . PRO A 1 54 ? 5.353   8.122   -3.281  1.00 0.43  ? 54 PRO A C    2  
ATOM 3027  O O    . PRO A 1 54 ? 4.811   7.981   -2.203  1.00 0.46  ? 54 PRO A O    2  
ATOM 3028  C CB   . PRO A 1 54 ? 4.815   6.458   -5.155  1.00 0.37  ? 54 PRO A CB   2  
ATOM 3029  C CG   . PRO A 1 54 ? 5.884   6.622   -6.249  1.00 0.36  ? 54 PRO A CG   2  
ATOM 3030  C CD   . PRO A 1 54 ? 5.760   8.068   -6.752  1.00 0.32  ? 54 PRO A CD   2  
ATOM 3031  H HA   . PRO A 1 54 ? 3.535   8.024   -4.429  1.00 0.36  ? 54 PRO A HA   2  
ATOM 3032  H HB2  . PRO A 1 54 ? 5.168   5.790   -4.380  1.00 0.41  ? 54 PRO A HB2  2  
ATOM 3033  H HB3  . PRO A 1 54 ? 3.903   6.081   -5.589  1.00 0.35  ? 54 PRO A HB3  2  
ATOM 3034  H HG2  . PRO A 1 54 ? 6.865   6.457   -5.834  1.00 0.40  ? 54 PRO A HG2  2  
ATOM 3035  H HG3  . PRO A 1 54 ? 5.695   5.940   -7.057  1.00 0.36  ? 54 PRO A HG3  2  
ATOM 3036  H HD2  . PRO A 1 54 ? 6.738   8.473   -6.949  1.00 0.34  ? 54 PRO A HD2  2  
ATOM 3037  H HD3  . PRO A 1 54 ? 5.138   8.107   -7.633  1.00 0.28  ? 54 PRO A HD3  2  
ATOM 3038  N N    . ALA A 1 55 ? 6.582   8.593   -3.378  1.00 0.45  ? 55 ALA A N    2  
ATOM 3039  C CA   . ALA A 1 55 ? 7.339   8.965   -2.149  1.00 0.51  ? 55 ALA A CA   2  
ATOM 3040  C C    . ALA A 1 55 ? 6.556   10.102  -1.472  1.00 0.52  ? 55 ALA A C    2  
ATOM 3041  O O    . ALA A 1 55 ? 6.525   10.218  -0.261  1.00 0.56  ? 55 ALA A O    2  
ATOM 3042  C CB   . ALA A 1 55 ? 8.743   9.451   -2.526  1.00 0.54  ? 55 ALA A CB   2  
ATOM 3043  H H    . ALA A 1 55 ? 6.978   8.759   -4.260  1.00 0.43  ? 55 ALA A H    2  
ATOM 3044  H HA   . ALA A 1 55 ? 7.404   8.116   -1.484  1.00 0.53  ? 55 ALA A HA   2  
ATOM 3045  H HB1  . ALA A 1 55 ? 8.664   10.250  -3.250  1.00 1.19  ? 55 ALA A HB1  2  
ATOM 3046  H HB2  . ALA A 1 55 ? 9.249   9.814   -1.644  1.00 1.06  ? 55 ALA A HB2  2  
ATOM 3047  H HB3  . ALA A 1 55 ? 9.305   8.634   -2.953  1.00 1.13  ? 55 ALA A HB3  2  
ATOM 3048  N N    . SER A 1 56 ? 5.889   10.915  -2.272  1.00 0.50  ? 56 SER A N    2  
ATOM 3049  C CA   . SER A 1 56 ? 5.055   12.027  -1.732  1.00 0.51  ? 56 SER A CA   2  
ATOM 3050  C C    . SER A 1 56 ? 3.905   11.418  -0.907  1.00 0.51  ? 56 SER A C    2  
ATOM 3051  O O    . SER A 1 56 ? 3.460   10.325  -1.206  1.00 0.51  ? 56 SER A O    2  
ATOM 3052  C CB   . SER A 1 56 ? 4.464   12.830  -2.898  1.00 0.50  ? 56 SER A CB   2  
ATOM 3053  O OG   . SER A 1 56 ? 4.486   14.217  -2.579  1.00 0.56  ? 56 SER A OG   2  
ATOM 3054  H H    . SER A 1 56 ? 5.920   10.770  -3.240  1.00 0.47  ? 56 SER A H    2  
ATOM 3055  H HA   . SER A 1 56 ? 5.662   12.670  -1.125  1.00 0.54  ? 56 SER A HA   2  
ATOM 3056  H HB2  . SER A 1 56 ? 5.050   12.662  -3.787  1.00 0.46  ? 56 SER A HB2  2  
ATOM 3057  H HB3  . SER A 1 56 ? 3.447   12.506  -3.080  1.00 0.51  ? 56 SER A HB3  2  
ATOM 3058  H HG   . SER A 1 56 ? 3.582   14.503  -2.425  1.00 1.08  ? 56 SER A HG   2  
ATOM 3059  N N    . PRO A 1 57 ? 3.447   12.130  0.098   1.00 0.53  ? 57 PRO A N    2  
ATOM 3060  C CA   . PRO A 1 57 ? 2.341   11.655  0.960   1.00 0.53  ? 57 PRO A CA   2  
ATOM 3061  C C    . PRO A 1 57 ? 1.004   11.753  0.210   1.00 0.51  ? 57 PRO A C    2  
ATOM 3062  O O    . PRO A 1 57 ? 0.305   10.767  0.036   1.00 0.51  ? 57 PRO A O    2  
ATOM 3063  C CB   . PRO A 1 57 ? 2.392   12.601  2.165   1.00 0.59  ? 57 PRO A CB   2  
ATOM 3064  C CG   . PRO A 1 57 ? 3.133   13.873  1.692   1.00 0.62  ? 57 PRO A CG   2  
ATOM 3065  C CD   . PRO A 1 57 ? 3.970   13.464  0.464   1.00 0.58  ? 57 PRO A CD   2  
ATOM 3066  H HA   . PRO A 1 57 ? 2.522   10.642  1.279   1.00 0.54  ? 57 PRO A HA   2  
ATOM 3067  H HB2  . PRO A 1 57 ? 1.388   12.849  2.484   1.00 0.60  ? 57 PRO A HB2  2  
ATOM 3068  H HB3  . PRO A 1 57 ? 2.936   12.143  2.976   1.00 0.62  ? 57 PRO A HB3  2  
ATOM 3069  H HG2  . PRO A 1 57 ? 2.419   14.638  1.421   1.00 0.63  ? 57 PRO A HG2  2  
ATOM 3070  H HG3  . PRO A 1 57 ? 3.785   14.236  2.472   1.00 0.67  ? 57 PRO A HG3  2  
ATOM 3071  H HD2  . PRO A 1 57 ? 3.820   14.168  -0.343  1.00 0.59  ? 57 PRO A HD2  2  
ATOM 3072  H HD3  . PRO A 1 57 ? 5.015   13.397  0.722   1.00 0.59  ? 57 PRO A HD3  2  
ATOM 3073  N N    . ILE A 1 58 ? 0.665   12.932  -0.260  1.00 0.52  ? 58 ILE A N    2  
ATOM 3074  C CA   . ILE A 1 58 ? -0.602  13.120  -1.033  1.00 0.51  ? 58 ILE A CA   2  
ATOM 3075  C C    . ILE A 1 58 ? -0.635  12.116  -2.171  1.00 0.45  ? 58 ILE A C    2  
ATOM 3076  O O    . ILE A 1 58 ? -1.643  11.510  -2.463  1.00 0.44  ? 58 ILE A O    2  
ATOM 3077  C CB   . ILE A 1 58 ? -0.609  14.543  -1.619  1.00 0.54  ? 58 ILE A CB   2  
ATOM 3078  C CG1  . ILE A 1 58 ? -1.785  15.339  -1.040  1.00 0.62  ? 58 ILE A CG1  2  
ATOM 3079  C CG2  . ILE A 1 58 ? -0.717  14.503  -3.155  1.00 0.49  ? 58 ILE A CG2  2  
ATOM 3080  C CD1  . ILE A 1 58 ? -1.503  15.686  0.424   1.00 0.68  ? 58 ILE A CD1  2  
ATOM 3081  H H    . ILE A 1 58 ? 1.261   13.696  -0.122  1.00 0.55  ? 58 ILE A H    2  
ATOM 3082  H HA   . ILE A 1 58 ? -1.456  12.971  -0.391  1.00 0.55  ? 58 ILE A HA   2  
ATOM 3083  H HB   . ILE A 1 58 ? 0.319   15.022  -1.355  1.00 0.56  ? 58 ILE A HB   2  
ATOM 3084  H HG12 . ILE A 1 58 ? -1.915  16.249  -1.608  1.00 0.64  ? 58 ILE A HG12 2  
ATOM 3085  H HG13 . ILE A 1 58 ? -2.685  14.746  -1.101  1.00 0.62  ? 58 ILE A HG13 2  
ATOM 3086  H HG21 . ILE A 1 58 ? -1.474  13.791  -3.449  1.00 1.11  ? 58 ILE A HG21 2  
ATOM 3087  H HG22 . ILE A 1 58 ? -0.977  15.479  -3.526  1.00 1.12  ? 58 ILE A HG22 2  
ATOM 3088  H HG23 . ILE A 1 58 ? 0.237   14.202  -3.574  1.00 1.14  ? 58 ILE A HG23 2  
ATOM 3089  H HD11 . ILE A 1 58 ? -0.590  16.260  0.487   1.00 1.10  ? 58 ILE A HD11 2  
ATOM 3090  H HD12 . ILE A 1 58 ? -2.322  16.269  0.819   1.00 1.28  ? 58 ILE A HD12 2  
ATOM 3091  H HD13 . ILE A 1 58 ? -1.399  14.777  0.996   1.00 1.15  ? 58 ILE A HD13 2  
ATOM 3092  N N    . VAL A 1 59 ? 0.464   11.983  -2.838  1.00 0.43  ? 59 VAL A N    2  
ATOM 3093  C CA   . VAL A 1 59 ? 0.536   11.067  -3.980  1.00 0.40  ? 59 VAL A CA   2  
ATOM 3094  C C    . VAL A 1 59 ? 0.425   9.626   -3.498  1.00 0.37  ? 59 VAL A C    2  
ATOM 3095  O O    . VAL A 1 59 ? -0.259  8.827   -4.105  1.00 0.33  ? 59 VAL A O    2  
ATOM 3096  C CB   . VAL A 1 59 ? 1.866   11.293  -4.660  1.00 0.51  ? 59 VAL A CB   2  
ATOM 3097  C CG1  . VAL A 1 59 ? 2.040   10.292  -5.767  1.00 0.31  ? 59 VAL A CG1  2  
ATOM 3098  C CG2  . VAL A 1 59 ? 1.934   12.708  -5.229  1.00 0.88  ? 59 VAL A CG2  2  
ATOM 3099  H H    . VAL A 1 59 ? 1.249   12.521  -2.601  1.00 0.46  ? 59 VAL A H    2  
ATOM 3100  H HA   . VAL A 1 59 ? -0.279  11.279  -4.653  1.00 0.41  ? 59 VAL A HA   2  
ATOM 3101  H HB   . VAL A 1 59 ? 2.648   11.159  -3.935  1.00 0.83  ? 59 VAL A HB   2  
ATOM 3102  H HG11 . VAL A 1 59 ? 1.096   10.150  -6.262  1.00 1.09  ? 59 VAL A HG11 2  
ATOM 3103  H HG12 . VAL A 1 59 ? 2.770   10.665  -6.460  1.00 1.01  ? 59 VAL A HG12 2  
ATOM 3104  H HG13 . VAL A 1 59 ? 2.381   9.362   -5.342  1.00 1.11  ? 59 VAL A HG13 2  
ATOM 3105  H HG21 . VAL A 1 59 ? 1.060   13.261  -4.922  1.00 1.24  ? 59 VAL A HG21 2  
ATOM 3106  H HG22 . VAL A 1 59 ? 2.820   13.202  -4.859  1.00 1.47  ? 59 VAL A HG22 2  
ATOM 3107  H HG23 . VAL A 1 59 ? 1.973   12.663  -6.307  1.00 1.52  ? 59 VAL A HG23 2  
ATOM 3108  N N    . LYS A 1 60 ? 1.040   9.290   -2.388  1.00 0.43  ? 60 LYS A N    2  
ATOM 3109  C CA   . LYS A 1 60 ? 0.887   7.902   -1.857  1.00 0.43  ? 60 LYS A CA   2  
ATOM 3110  C C    . LYS A 1 60 ? -0.622  7.645   -1.676  1.00 0.43  ? 60 LYS A C    2  
ATOM 3111  O O    . LYS A 1 60 ? -1.087  6.521   -1.683  1.00 0.42  ? 60 LYS A O    2  
ATOM 3112  C CB   . LYS A 1 60 ? 1.581   7.790   -0.503  1.00 0.50  ? 60 LYS A CB   2  
ATOM 3113  C CG   . LYS A 1 60 ? 1.831   6.316   -0.169  1.00 0.60  ? 60 LYS A CG   2  
ATOM 3114  C CD   . LYS A 1 60 ? 3.273   5.942   -0.522  1.00 0.91  ? 60 LYS A CD   2  
ATOM 3115  C CE   . LYS A 1 60 ? 4.239   6.649   0.435   1.00 0.99  ? 60 LYS A CE   2  
ATOM 3116  N NZ   . LYS A 1 60 ? 4.430   5.819   1.660   1.00 1.67  ? 60 LYS A NZ   2  
ATOM 3117  H H    . LYS A 1 60 ? 1.557   9.955   -1.887  1.00 0.47  ? 60 LYS A H    2  
ATOM 3118  H HA   . LYS A 1 60 ? 1.309   7.194   -2.563  1.00 0.40  ? 60 LYS A HA   2  
ATOM 3119  H HB2  . LYS A 1 60 ? 2.518   8.322   -0.539  1.00 0.65  ? 60 LYS A HB2  2  
ATOM 3120  H HB3  . LYS A 1 60 ? 0.947   8.227   0.257   1.00 0.59  ? 60 LYS A HB3  2  
ATOM 3121  H HG2  . LYS A 1 60 ? 1.665   6.155   0.886   1.00 1.10  ? 60 LYS A HG2  2  
ATOM 3122  H HG3  . LYS A 1 60 ? 1.152   5.698   -0.737  1.00 0.87  ? 60 LYS A HG3  2  
ATOM 3123  H HD2  . LYS A 1 60 ? 3.397   4.872   -0.436  1.00 1.38  ? 60 LYS A HD2  2  
ATOM 3124  H HD3  . LYS A 1 60 ? 3.485   6.247   -1.535  1.00 1.48  ? 60 LYS A HD3  2  
ATOM 3125  H HE2  . LYS A 1 60 ? 5.190   6.789   -0.055  1.00 1.20  ? 60 LYS A HE2  2  
ATOM 3126  H HE3  . LYS A 1 60 ? 3.832   7.611   0.712   1.00 1.40  ? 60 LYS A HE3  2  
ATOM 3127  H HZ1  . LYS A 1 60 ? 3.505   5.599   2.079   1.00 2.22  ? 60 LYS A HZ1  2  
ATOM 3128  H HZ2  . LYS A 1 60 ? 4.918   4.936   1.406   1.00 2.08  ? 60 LYS A HZ2  2  
ATOM 3129  H HZ3  . LYS A 1 60 ? 5.003   6.347   2.349   1.00 2.01  ? 60 LYS A HZ3  2  
ATOM 3130  N N    . LYS A 1 61 ? -1.377  8.719   -1.579  1.00 0.45  ? 61 LYS A N    2  
ATOM 3131  C CA   . LYS A 1 61 ? -2.850  8.644   -1.468  1.00 0.46  ? 61 LYS A CA   2  
ATOM 3132  C C    . LYS A 1 61 ? -3.351  8.247   -2.840  1.00 0.42  ? 61 LYS A C    2  
ATOM 3133  O O    . LYS A 1 61 ? -4.081  7.305   -2.998  1.00 0.44  ? 61 LYS A O    2  
ATOM 3134  C CB   . LYS A 1 61 ? -3.373  10.035  -1.128  1.00 0.51  ? 61 LYS A CB   2  
ATOM 3135  C CG   . LYS A 1 61 ? -4.467  9.938   -0.067  1.00 0.72  ? 61 LYS A CG   2  
ATOM 3136  C CD   . LYS A 1 61 ? -5.461  11.085  -0.255  1.00 1.03  ? 61 LYS A CD   2  
ATOM 3137  C CE   . LYS A 1 61 ? -6.751  10.777  0.512   1.00 1.30  ? 61 LYS A CE   2  
ATOM 3138  N NZ   . LYS A 1 61 ? -7.220  12.004  1.220   1.00 1.87  ? 61 LYS A NZ   2  
ATOM 3139  H H    . LYS A 1 61 ? -0.965  9.595   -1.638  1.00 0.46  ? 61 LYS A H    2  
ATOM 3140  H HA   . LYS A 1 61 ? -3.146  7.924   -0.723  1.00 0.49  ? 61 LYS A HA   2  
ATOM 3141  H HB2  . LYS A 1 61 ? -2.554  10.639  -0.759  1.00 0.58  ? 61 LYS A HB2  2  
ATOM 3142  H HB3  . LYS A 1 61 ? -3.771  10.493  -2.026  1.00 0.66  ? 61 LYS A HB3  2  
ATOM 3143  H HG2  . LYS A 1 61 ? -4.979  8.993   -0.167  1.00 1.41  ? 61 LYS A HG2  2  
ATOM 3144  H HG3  . LYS A 1 61 ? -4.019  10.006  0.913   1.00 1.05  ? 61 LYS A HG3  2  
ATOM 3145  H HD2  . LYS A 1 61 ? -5.026  12.000  0.119   1.00 1.37  ? 61 LYS A HD2  2  
ATOM 3146  H HD3  . LYS A 1 61 ? -5.687  11.197  -1.305  1.00 1.76  ? 61 LYS A HD3  2  
ATOM 3147  H HE2  . LYS A 1 61 ? -7.512  10.449  -0.181  1.00 1.85  ? 61 LYS A HE2  2  
ATOM 3148  H HE3  . LYS A 1 61 ? -6.564  9.995   1.234   1.00 1.55  ? 61 LYS A HE3  2  
ATOM 3149  H HZ1  . LYS A 1 61 ? -6.431  12.421  1.753   1.00 2.11  ? 61 LYS A HZ1  2  
ATOM 3150  H HZ2  . LYS A 1 61 ? -7.570  12.693  0.525   1.00 2.27  ? 61 LYS A HZ2  2  
ATOM 3151  H HZ3  . LYS A 1 61 ? -7.987  11.752  1.876   1.00 2.42  ? 61 LYS A HZ3  2  
ATOM 3152  N N    . ILE A 1 62 ? -2.900  8.970   -3.835  1.00 0.37  ? 62 ILE A N    2  
ATOM 3153  C CA   . ILE A 1 62 ? -3.250  8.685   -5.248  1.00 0.34  ? 62 ILE A CA   2  
ATOM 3154  C C    . ILE A 1 62 ? -3.214  7.172   -5.497  1.00 0.33  ? 62 ILE A C    2  
ATOM 3155  O O    . ILE A 1 62 ? -4.057  6.641   -6.191  1.00 0.34  ? 62 ILE A O    2  
ATOM 3156  C CB   . ILE A 1 62 ? -2.209  9.427   -6.115  1.00 0.32  ? 62 ILE A CB   2  
ATOM 3157  C CG1  . ILE A 1 62 ? -2.876  10.494  -6.980  1.00 0.34  ? 62 ILE A CG1  2  
ATOM 3158  C CG2  . ILE A 1 62 ? -1.425  8.463   -7.000  1.00 0.30  ? 62 ILE A CG2  2  
ATOM 3159  C CD1  . ILE A 1 62 ? -3.818  11.318  -6.112  1.00 0.36  ? 62 ILE A CD1  2  
ATOM 3160  H H    . ILE A 1 62 ? -2.291  9.714   -3.646  1.00 0.37  ? 62 ILE A H    2  
ATOM 3161  H HA   . ILE A 1 62 ? -4.238  9.049   -5.451  1.00 0.36  ? 62 ILE A HA   2  
ATOM 3162  H HB   . ILE A 1 62 ? -1.520  9.915   -5.453  1.00 0.33  ? 62 ILE A HB   2  
ATOM 3163  H HG12 . ILE A 1 62 ? -2.113  11.141  -7.397  1.00 0.35  ? 62 ILE A HG12 2  
ATOM 3164  H HG13 . ILE A 1 62 ? -3.427  10.028  -7.775  1.00 0.35  ? 62 ILE A HG13 2  
ATOM 3165  H HG21 . ILE A 1 62 ? -2.105  7.921   -7.636  1.00 1.02  ? 62 ILE A HG21 2  
ATOM 3166  H HG22 . ILE A 1 62 ? -0.726  9.020   -7.604  1.00 1.06  ? 62 ILE A HG22 2  
ATOM 3167  H HG23 . ILE A 1 62 ? -0.884  7.768   -6.376  1.00 1.07  ? 62 ILE A HG23 2  
ATOM 3168  H HD11 . ILE A 1 62 ? -3.373  11.457  -5.135  1.00 1.01  ? 62 ILE A HD11 2  
ATOM 3169  H HD12 . ILE A 1 62 ? -3.983  12.278  -6.572  1.00 1.08  ? 62 ILE A HD12 2  
ATOM 3170  H HD13 . ILE A 1 62 ? -4.756  10.797  -6.008  1.00 1.05  ? 62 ILE A HD13 2  
ATOM 3171  N N    . ILE A 1 63 ? -2.265  6.473   -4.917  1.00 0.31  ? 63 ILE A N    2  
ATOM 3172  C CA   . ILE A 1 63 ? -2.214  4.993   -5.108  1.00 0.31  ? 63 ILE A CA   2  
ATOM 3173  C C    . ILE A 1 63 ? -3.361  4.365   -4.341  1.00 0.37  ? 63 ILE A C    2  
ATOM 3174  O O    . ILE A 1 63 ? -4.142  3.598   -4.868  1.00 0.41  ? 63 ILE A O    2  
ATOM 3175  C CB   . ILE A 1 63 ? -0.921  4.442   -4.520  1.00 0.32  ? 63 ILE A CB   2  
ATOM 3176  C CG1  . ILE A 1 63 ? 0.255   4.967   -5.318  1.00 0.32  ? 63 ILE A CG1  2  
ATOM 3177  C CG2  . ILE A 1 63 ? -0.937  2.912   -4.549  1.00 0.34  ? 63 ILE A CG2  2  
ATOM 3178  C CD1  . ILE A 1 63 ? 0.652   6.314   -4.751  1.00 0.42  ? 63 ILE A CD1  2  
ATOM 3179  H H    . ILE A 1 63 ? -1.596  6.921   -4.334  1.00 0.32  ? 63 ILE A H    2  
ATOM 3180  H HA   . ILE A 1 63 ? -2.281  4.747   -6.156  1.00 0.30  ? 63 ILE A HA   2  
ATOM 3181  H HB   . ILE A 1 63 ? -0.831  4.772   -3.495  1.00 0.35  ? 63 ILE A HB   2  
ATOM 3182  H HG12 . ILE A 1 63 ? 1.073   4.290   -5.226  1.00 0.31  ? 63 ILE A HG12 2  
ATOM 3183  H HG13 . ILE A 1 63 ? -0.019  5.076   -6.355  1.00 0.48  ? 63 ILE A HG13 2  
ATOM 3184  H HG21 . ILE A 1 63 ? -1.223  2.571   -5.532  1.00 1.02  ? 63 ILE A HG21 2  
ATOM 3185  H HG22 . ILE A 1 63 ? 0.044   2.539   -4.307  1.00 1.03  ? 63 ILE A HG22 2  
ATOM 3186  H HG23 . ILE A 1 63 ? -1.649  2.549   -3.820  1.00 1.03  ? 63 ILE A HG23 2  
ATOM 3187  H HD11 . ILE A 1 63 ? 0.170   6.447   -3.791  1.00 1.16  ? 63 ILE A HD11 2  
ATOM 3188  H HD12 . ILE A 1 63 ? 1.719   6.351   -4.629  1.00 1.06  ? 63 ILE A HD12 2  
ATOM 3189  H HD13 . ILE A 1 63 ? 0.331   7.090   -5.425  1.00 1.07  ? 63 ILE A HD13 2  
ATOM 3190  N N    . GLU A 1 64 ? -3.429  4.678   -3.079  1.00 0.39  ? 64 GLU A N    2  
ATOM 3191  C CA   . GLU A 1 64 ? -4.476  4.098   -2.205  1.00 0.46  ? 64 GLU A CA   2  
ATOM 3192  C C    . GLU A 1 64 ? -5.879  4.477   -2.701  1.00 0.49  ? 64 GLU A C    2  
ATOM 3193  O O    . GLU A 1 64 ? -6.766  3.650   -2.753  1.00 0.62  ? 64 GLU A O    2  
ATOM 3194  C CB   . GLU A 1 64 ? -4.296  4.634   -0.790  1.00 0.49  ? 64 GLU A CB   2  
ATOM 3195  C CG   . GLU A 1 64 ? -4.416  3.486   0.216   1.00 1.04  ? 64 GLU A CG   2  
ATOM 3196  C CD   . GLU A 1 64 ? -4.879  4.035   1.569   1.00 1.41  ? 64 GLU A CD   2  
ATOM 3197  O OE1  . GLU A 1 64 ? -4.034  4.495   2.321   1.00 1.81  ? 64 GLU A OE1  2  
ATOM 3198  O OE2  . GLU A 1 64 ? -6.070  3.990   1.828   1.00 2.00  ? 64 GLU A OE2  2  
ATOM 3199  H H    . GLU A 1 64 ? -2.758  5.290   -2.698  1.00 0.37  ? 64 GLU A H    2  
ATOM 3200  H HA   . GLU A 1 64 ? -4.359  3.027   -2.203  1.00 0.49  ? 64 GLU A HA   2  
ATOM 3201  H HB2  . GLU A 1 64 ? -3.324  5.094   -0.705  1.00 0.72  ? 64 GLU A HB2  2  
ATOM 3202  H HB3  . GLU A 1 64 ? -5.061  5.368   -0.590  1.00 0.75  ? 64 GLU A HB3  2  
ATOM 3203  H HG2  . GLU A 1 64 ? -5.135  2.765   -0.146  1.00 1.39  ? 64 GLU A HG2  2  
ATOM 3204  H HG3  . GLU A 1 64 ? -3.454  3.009   0.333   1.00 1.44  ? 64 GLU A HG3  2  
ATOM 3205  N N    . LYS A 1 65 ? -6.080  5.724   -3.051  1.00 0.48  ? 65 LYS A N    2  
ATOM 3206  C CA   . LYS A 1 65 ? -7.418  6.171   -3.533  1.00 0.51  ? 65 LYS A CA   2  
ATOM 3207  C C    . LYS A 1 65 ? -7.715  5.500   -4.866  1.00 0.51  ? 65 LYS A C    2  
ATOM 3208  O O    . LYS A 1 65 ? -8.792  4.971   -5.068  1.00 0.56  ? 65 LYS A O    2  
ATOM 3209  C CB   . LYS A 1 65 ? -7.422  7.697   -3.686  1.00 0.52  ? 65 LYS A CB   2  
ATOM 3210  C CG   . LYS A 1 65 ? -8.745  8.163   -4.300  1.00 1.07  ? 65 LYS A CG   2  
ATOM 3211  C CD   . LYS A 1 65 ? -8.950  9.650   -3.992  1.00 1.45  ? 65 LYS A CD   2  
ATOM 3212  C CE   . LYS A 1 65 ? -10.438 9.936   -3.776  1.00 1.72  ? 65 LYS A CE   2  
ATOM 3213  N NZ   . LYS A 1 65 ? -10.598 11.037  -2.783  1.00 2.15  ? 65 LYS A NZ   2  
ATOM 3214  H H    . LYS A 1 65 ? -5.347  6.371   -2.992  1.00 0.54  ? 65 LYS A H    2  
ATOM 3215  H HA   . LYS A 1 65 ? -8.162  5.869   -2.819  1.00 0.56  ? 65 LYS A HA   2  
ATOM 3216  H HB2  . LYS A 1 65 ? -7.298  8.152   -2.715  1.00 0.92  ? 65 LYS A HB2  2  
ATOM 3217  H HB3  . LYS A 1 65 ? -6.606  7.994   -4.329  1.00 1.10  ? 65 LYS A HB3  2  
ATOM 3218  H HG2  . LYS A 1 65 ? -8.716  8.017   -5.372  1.00 1.56  ? 65 LYS A HG2  2  
ATOM 3219  H HG3  . LYS A 1 65 ? -9.559  7.593   -3.880  1.00 1.65  ? 65 LYS A HG3  2  
ATOM 3220  H HD2  . LYS A 1 65 ? -8.401  9.910   -3.097  1.00 1.79  ? 65 LYS A HD2  2  
ATOM 3221  H HD3  . LYS A 1 65 ? -8.588  10.241  -4.819  1.00 1.92  ? 65 LYS A HD3  2  
ATOM 3222  H HE2  . LYS A 1 65 ? -10.887 10.231  -4.714  1.00 2.13  ? 65 LYS A HE2  2  
ATOM 3223  H HE3  . LYS A 1 65 ? -10.929 9.046   -3.409  1.00 2.04  ? 65 LYS A HE3  2  
ATOM 3224  H HZ1  . LYS A 1 65 ? -10.081 11.878  -3.109  1.00 2.47  ? 65 LYS A HZ1  2  
ATOM 3225  H HZ2  . LYS A 1 65 ? -11.605 11.270  -2.681  1.00 2.64  ? 65 LYS A HZ2  2  
ATOM 3226  H HZ3  . LYS A 1 65 ? -10.217 10.731  -1.863  1.00 2.41  ? 65 LYS A HZ3  2  
ATOM 3227  N N    . MET A 1 66 ? -6.759  5.479   -5.759  1.00 0.46  ? 66 MET A N    2  
ATOM 3228  C CA   . MET A 1 66 ? -6.972  4.790   -7.055  1.00 0.46  ? 66 MET A CA   2  
ATOM 3229  C C    . MET A 1 66 ? -7.308  3.325   -6.748  1.00 0.50  ? 66 MET A C    2  
ATOM 3230  O O    . MET A 1 66 ? -8.134  2.711   -7.397  1.00 0.54  ? 66 MET A O    2  
ATOM 3231  C CB   . MET A 1 66 ? -5.696  4.873   -7.886  1.00 0.42  ? 66 MET A CB   2  
ATOM 3232  C CG   . MET A 1 66 ? -5.703  6.175   -8.693  1.00 0.40  ? 66 MET A CG   2  
ATOM 3233  S SD   . MET A 1 66 ? -6.753  5.958   -10.149 1.00 1.14  ? 66 MET A SD   2  
ATOM 3234  C CE   . MET A 1 66 ? -5.678  4.816   -11.051 1.00 0.37  ? 66 MET A CE   2  
ATOM 3235  H H    . MET A 1 66 ? -5.893  5.888   -5.561  1.00 0.42  ? 66 MET A H    2  
ATOM 3236  H HA   . MET A 1 66 ? -7.787  5.255   -7.580  1.00 0.48  ? 66 MET A HA   2  
ATOM 3237  H HB2  . MET A 1 66 ? -4.839  4.854   -7.229  1.00 0.40  ? 66 MET A HB2  2  
ATOM 3238  H HB3  . MET A 1 66 ? -5.653  4.032   -8.558  1.00 0.46  ? 66 MET A HB3  2  
ATOM 3239  H HG2  . MET A 1 66 ? -6.092  6.981   -8.083  1.00 0.76  ? 66 MET A HG2  2  
ATOM 3240  H HG3  . MET A 1 66 ? -4.697  6.417   -9.004  1.00 0.67  ? 66 MET A HG3  2  
ATOM 3241  H HE1  . MET A 1 66 ? -4.728  4.732   -10.548 1.00 1.09  ? 66 MET A HE1  2  
ATOM 3242  H HE2  . MET A 1 66 ? -6.143  3.840   -11.102 1.00 1.06  ? 66 MET A HE2  2  
ATOM 3243  H HE3  . MET A 1 66 ? -5.518  5.194   -12.049 1.00 1.05  ? 66 MET A HE3  2  
ATOM 3244  N N    . LEU A 1 67 ? -6.686  2.788   -5.721  1.00 0.50  ? 67 LEU A N    2  
ATOM 3245  C CA   . LEU A 1 67 ? -6.953  1.392   -5.290  1.00 0.55  ? 67 LEU A CA   2  
ATOM 3246  C C    . LEU A 1 67 ? -8.380  1.299   -4.735  1.00 0.60  ? 67 LEU A C    2  
ATOM 3247  O O    . LEU A 1 67 ? -9.038  0.283   -4.864  1.00 0.64  ? 67 LEU A O    2  
ATOM 3248  C CB   . LEU A 1 67 ? -5.977  1.023   -4.170  1.00 0.56  ? 67 LEU A CB   2  
ATOM 3249  C CG   . LEU A 1 67 ? -4.817  0.206   -4.731  1.00 0.53  ? 67 LEU A CG   2  
ATOM 3250  C CD1  . LEU A 1 67 ? -3.505  0.884   -4.341  1.00 0.53  ? 67 LEU A CD1  2  
ATOM 3251  C CD2  . LEU A 1 67 ? -4.857  -1.210  -4.145  1.00 0.56  ? 67 LEU A CD2  2  
ATOM 3252  H H    . LEU A 1 67 ? -6.049  3.322   -5.212  1.00 0.49  ? 67 LEU A H    2  
ATOM 3253  H HA   . LEU A 1 67 ? -6.825  0.726   -6.120  1.00 0.55  ? 67 LEU A HA   2  
ATOM 3254  H HB2  . LEU A 1 67 ? -5.594  1.927   -3.726  1.00 0.57  ? 67 LEU A HB2  2  
ATOM 3255  H HB3  . LEU A 1 67 ? -6.492  0.449   -3.417  1.00 0.60  ? 67 LEU A HB3  2  
ATOM 3256  H HG   . LEU A 1 67 ? -4.894  0.157   -5.809  1.00 0.51  ? 67 LEU A HG   2  
ATOM 3257  H HD11 . LEU A 1 67 ? -3.677  1.534   -3.494  1.00 1.19  ? 67 LEU A HD11 2  
ATOM 3258  H HD12 . LEU A 1 67 ? -2.776  0.136   -4.078  1.00 0.98  ? 67 LEU A HD12 2  
ATOM 3259  H HD13 . LEU A 1 67 ? -3.144  1.469   -5.173  1.00 1.24  ? 67 LEU A HD13 2  
ATOM 3260  H HD21 . LEU A 1 67 ? -5.882  -1.493  -3.955  1.00 1.16  ? 67 LEU A HD21 2  
ATOM 3261  H HD22 . LEU A 1 67 ? -4.417  -1.903  -4.848  1.00 1.18  ? 67 LEU A HD22 2  
ATOM 3262  H HD23 . LEU A 1 67 ? -4.300  -1.234  -3.220  1.00 1.13  ? 67 LEU A HD23 2  
ATOM 3263  N N    . ASN A 1 68 ? -8.856  2.354   -4.101  1.00 0.63  ? 68 ASN A N    2  
ATOM 3264  C CA   . ASN A 1 68 ? -10.242 2.317   -3.518  1.00 0.70  ? 68 ASN A CA   2  
ATOM 3265  C C    . ASN A 1 68 ? -11.299 2.448   -4.626  1.00 0.76  ? 68 ASN A C    2  
ATOM 3266  O O    . ASN A 1 68 ? -12.418 1.999   -4.461  1.00 0.92  ? 68 ASN A O    2  
ATOM 3267  C CB   . ASN A 1 68 ? -10.439 3.448   -2.487  1.00 0.78  ? 68 ASN A CB   2  
ATOM 3268  C CG   . ASN A 1 68 ? -11.776 3.251   -1.768  1.00 1.48  ? 68 ASN A CG   2  
ATOM 3269  O OD1  . ASN A 1 68 ? -12.013 2.216   -1.175  1.00 2.21  ? 68 ASN A OD1  2  
ATOM 3270  N ND2  . ASN A 1 68 ? -12.666 4.205   -1.792  1.00 2.00  ? 68 ASN A ND2  2  
ATOM 3271  H H    . ASN A 1 68 ? -8.292  3.165   -4.008  1.00 0.62  ? 68 ASN A H    2  
ATOM 3272  H HA   . ASN A 1 68 ? -10.381 1.366   -3.020  1.00 0.72  ? 68 ASN A HA   2  
ATOM 3273  H HB2  . ASN A 1 68 ? -9.640  3.424   -1.758  1.00 1.16  ? 68 ASN A HB2  2  
ATOM 3274  H HB3  . ASN A 1 68 ? -10.445 4.405   -2.990  1.00 1.06  ? 68 ASN A HB3  2  
ATOM 3275  H HD21 . ASN A 1 68 ? -12.477 5.040   -2.270  1.00 2.14  ? 68 ASN A HD21 2  
ATOM 3276  H HD22 . ASN A 1 68 ? -13.524 4.086   -1.335  1.00 2.63  ? 68 ASN A HD22 2  
ATOM 3277  N N    . SER A 1 69 ? -10.961 3.061   -5.744  1.00 0.87  ? 69 SER A N    2  
ATOM 3278  C CA   . SER A 1 69 ? -11.942 3.231   -6.865  1.00 0.99  ? 69 SER A CA   2  
ATOM 3279  C C    . SER A 1 69 ? -13.013 4.245   -6.453  1.00 1.13  ? 69 SER A C    2  
ATOM 3280  O O    . SER A 1 69 ? -13.878 3.962   -5.643  1.00 1.69  ? 69 SER A O    2  
ATOM 3281  C CB   . SER A 1 69 ? -12.599 1.891   -7.220  1.00 1.46  ? 69 SER A CB   2  
ATOM 3282  O OG   . SER A 1 69 ? -11.588 0.926   -7.486  1.00 2.02  ? 69 SER A OG   2  
ATOM 3283  H H    . SER A 1 69 ? -10.056 3.421   -5.846  1.00 1.01  ? 69 SER A H    2  
ATOM 3284  H HA   . SER A 1 69 ? -11.420 3.609   -7.732  1.00 1.09  ? 69 SER A HA   2  
ATOM 3285  H HB2  . SER A 1 69 ? -13.206 1.552   -6.399  1.00 1.86  ? 69 SER A HB2  2  
ATOM 3286  H HB3  . SER A 1 69 ? -13.224 2.020   -8.095  1.00 1.93  ? 69 SER A HB3  2  
ATOM 3287  H HG   . SER A 1 69 ? -11.582 0.295   -6.763  1.00 2.26  ? 69 SER A HG   2  
ATOM 3288  N N    . ASP A 1 70 ? -12.944 5.432   -7.000  1.00 1.22  ? 70 ASP A N    2  
ATOM 3289  C CA   . ASP A 1 70 ? -13.937 6.499   -6.652  1.00 1.68  ? 70 ASP A CA   2  
ATOM 3290  C C    . ASP A 1 70 ? -15.356 6.044   -7.010  1.00 1.89  ? 70 ASP A C    2  
ATOM 3291  O O    . ASP A 1 70 ? -15.720 5.979   -8.171  1.00 2.34  ? 70 ASP A O    2  
ATOM 3292  C CB   . ASP A 1 70 ? -13.618 7.778   -7.434  1.00 2.32  ? 70 ASP A CB   2  
ATOM 3293  C CG   . ASP A 1 70 ? -12.177 8.230   -7.157  1.00 3.12  ? 70 ASP A CG   2  
ATOM 3294  O OD1  . ASP A 1 70 ? -11.772 8.208   -6.005  1.00 3.72  ? 70 ASP A OD1  2  
ATOM 3295  O OD2  . ASP A 1 70 ? -11.502 8.593   -8.106  1.00 3.64  ? 70 ASP A OD2  2  
ATOM 3296  H H    . ASP A 1 70 ? -12.225 5.626   -7.638  1.00 1.39  ? 70 ASP A H    2  
ATOM 3297  H HA   . ASP A 1 70 ? -13.884 6.705   -5.593  1.00 2.07  ? 70 ASP A HA   2  
ATOM 3298  H HB2  . ASP A 1 70 ? -13.739 7.583   -8.491  1.00 2.46  ? 70 ASP A HB2  2  
ATOM 3299  H HB3  . ASP A 1 70 ? -14.303 8.556   -7.135  1.00 2.72  ? 70 ASP A HB3  2  
ATOM 3300  N N    . LYS A 1 71 ? -16.161 5.743   -6.019  1.00 2.37  ? 71 LYS A N    2  
ATOM 3301  C CA   . LYS A 1 71 ? -17.567 5.304   -6.287  1.00 3.07  ? 71 LYS A CA   2  
ATOM 3302  C C    . LYS A 1 71 ? -18.303 5.076   -4.955  1.00 3.94  ? 71 LYS A C    2  
ATOM 3303  O O    . LYS A 1 71 ? -18.919 4.047   -4.738  1.00 4.56  ? 71 LYS A O    2  
ATOM 3304  C CB   . LYS A 1 71 ? -17.557 4.014   -7.124  1.00 3.59  ? 71 LYS A CB   2  
ATOM 3305  C CG   . LYS A 1 71 ? -16.788 2.907   -6.389  1.00 3.79  ? 71 LYS A CG   2  
ATOM 3306  C CD   . LYS A 1 71 ? -17.613 1.615   -6.398  1.00 4.62  ? 71 LYS A CD   2  
ATOM 3307  C CE   . LYS A 1 71 ? -17.343 0.842   -7.692  1.00 5.22  ? 71 LYS A CE   2  
ATOM 3308  N NZ   . LYS A 1 71 ? -17.574 -0.614  -7.464  1.00 5.99  ? 71 LYS A NZ   2  
ATOM 3309  H H    . LYS A 1 71 ? -15.842 5.813   -5.095  1.00 2.66  ? 71 LYS A H    2  
ATOM 3310  H HA   . LYS A 1 71 ? -18.076 6.080   -6.840  1.00 3.10  ? 71 LYS A HA   2  
ATOM 3311  H HB2  . LYS A 1 71 ? -18.572 3.695   -7.296  1.00 3.70  ? 71 LYS A HB2  2  
ATOM 3312  H HB3  . LYS A 1 71 ? -17.078 4.210   -8.072  1.00 4.21  ? 71 LYS A HB3  2  
ATOM 3313  H HG2  . LYS A 1 71 ? -15.845 2.736   -6.887  1.00 3.86  ? 71 LYS A HG2  2  
ATOM 3314  H HG3  . LYS A 1 71 ? -16.607 3.208   -5.368  1.00 3.74  ? 71 LYS A HG3  2  
ATOM 3315  H HD2  . LYS A 1 71 ? -17.335 1.006   -5.550  1.00 4.84  ? 71 LYS A HD2  2  
ATOM 3316  H HD3  . LYS A 1 71 ? -18.664 1.858   -6.338  1.00 4.97  ? 71 LYS A HD3  2  
ATOM 3317  H HE2  . LYS A 1 71 ? -18.009 1.193   -8.467  1.00 5.27  ? 71 LYS A HE2  2  
ATOM 3318  H HE3  . LYS A 1 71 ? -16.320 1.000   -8.000  1.00 5.40  ? 71 LYS A HE3  2  
ATOM 3319  H HZ1  . LYS A 1 71 ? -18.549 -0.763  -7.132  1.00 6.39  ? 71 LYS A HZ1  2  
ATOM 3320  H HZ2  . LYS A 1 71 ? -17.427 -1.132  -8.353  1.00 6.11  ? 71 LYS A HZ2  2  
ATOM 3321  H HZ3  . LYS A 1 71 ? -16.906 -0.965  -6.747  1.00 6.30  ? 71 LYS A HZ3  2  
ATOM 3322  N N    . SER A 1 72 ? -18.244 6.036   -4.063  1.00 4.42  ? 72 SER A N    2  
ATOM 3323  C CA   . SER A 1 72 ? -18.935 5.892   -2.746  1.00 5.58  ? 72 SER A CA   2  
ATOM 3324  C C    . SER A 1 72 ? -20.425 6.223   -2.903  1.00 5.86  ? 72 SER A C    2  
ATOM 3325  O O    . SER A 1 72 ? -21.236 5.427   -2.460  1.00 5.92  ? 72 SER A O    2  
ATOM 3326  C CB   . SER A 1 72 ? -18.301 6.844   -1.726  1.00 6.45  ? 72 SER A CB   2  
ATOM 3327  O OG   . SER A 1 72 ? -17.165 6.217   -1.144  1.00 6.62  ? 72 SER A OG   2  
ATOM 3328  O OXT  . SER A 1 72 ? -20.730 7.265   -3.464  1.00 6.32  ? 72 SER A OXT  2  
ATOM 3329  H H    . SER A 1 72 ? -17.745 6.857   -4.263  1.00 4.24  ? 72 SER A H    2  
ATOM 3330  H HA   . SER A 1 72 ? -18.830 4.874   -2.397  1.00 5.92  ? 72 SER A HA   2  
ATOM 3331  H HB2  . SER A 1 72 ? -17.990 7.750   -2.220  1.00 6.89  ? 72 SER A HB2  2  
ATOM 3332  H HB3  . SER A 1 72 ? -19.025 7.085   -0.960  1.00 6.83  ? 72 SER A HB3  2  
ATOM 3333  H HG   . SER A 1 72 ? -16.651 6.893   -0.695  1.00 6.94  ? 72 SER A HG   2  
ATOM 3334  N N    . ALA B 1 1  ? -19.081 -5.821  -34.465 1.00 14.81 ? 1  ALA B N    2  
ATOM 3335  C CA   . ALA B 1 1  ? -20.505 -6.146  -34.778 1.00 14.13 ? 1  ALA B CA   2  
ATOM 3336  C C    . ALA B 1 1  ? -21.167 -6.803  -33.561 1.00 13.41 ? 1  ALA B C    2  
ATOM 3337  O O    . ALA B 1 1  ? -22.121 -6.283  -33.013 1.00 13.48 ? 1  ALA B O    2  
ATOM 3338  C CB   . ALA B 1 1  ? -20.564 -7.103  -35.974 1.00 14.18 ? 1  ALA B CB   2  
ATOM 3339  H H1   . ALA B 1 1  ? -19.039 -5.237  -33.606 1.00 14.93 ? 1  ALA B H1   2  
ATOM 3340  H H2   . ALA B 1 1  ? -18.548 -6.702  -34.312 1.00 14.87 ? 1  ALA B H2   2  
ATOM 3341  H H3   . ALA B 1 1  ? -18.663 -5.296  -35.258 1.00 15.26 ? 1  ALA B H3   2  
ATOM 3342  H HA   . ALA B 1 1  ? -21.033 -5.236  -35.023 1.00 14.27 ? 1  ALA B HA   2  
ATOM 3343  H HB1  . ALA B 1 1  ? -19.983 -7.987  -35.759 1.00 14.35 ? 1  ALA B HB1  2  
ATOM 3344  H HB2  . ALA B 1 1  ? -21.591 -7.382  -36.160 1.00 14.46 ? 1  ALA B HB2  2  
ATOM 3345  H HB3  . ALA B 1 1  ? -20.162 -6.612  -36.848 1.00 13.94 ? 1  ALA B HB3  2  
ATOM 3346  N N    . SER B 1 2  ? -20.670 -7.943  -33.134 1.00 12.88 ? 2  SER B N    2  
ATOM 3347  C CA   . SER B 1 2  ? -21.271 -8.635  -31.953 1.00 12.30 ? 2  SER B CA   2  
ATOM 3348  C C    . SER B 1 2  ? -20.232 -9.560  -31.309 1.00 11.45 ? 2  SER B C    2  
ATOM 3349  O O    . SER B 1 2  ? -19.587 -10.347 -31.979 1.00 11.40 ? 2  SER B O    2  
ATOM 3350  C CB   . SER B 1 2  ? -22.483 -9.462  -32.399 1.00 12.49 ? 2  SER B CB   2  
ATOM 3351  O OG   . SER B 1 2  ? -22.144 -10.224 -33.552 1.00 12.82 ? 2  SER B OG   2  
ATOM 3352  H H    . SER B 1 2  ? -19.901 -8.342  -33.593 1.00 12.97 ? 2  SER B H    2  
ATOM 3353  H HA   . SER B 1 2  ? -21.588 -7.897  -31.230 1.00 12.53 ? 2  SER B HA   2  
ATOM 3354  H HB2  . SER B 1 2  ? -22.774 -10.131 -31.607 1.00 12.66 ? 2  SER B HB2  2  
ATOM 3355  H HB3  . SER B 1 2  ? -23.307 -8.796  -32.623 1.00 12.41 ? 2  SER B HB3  2  
ATOM 3356  H HG   . SER B 1 2  ? -22.870 -10.154 -34.177 1.00 13.11 ? 2  SER B HG   2  
ATOM 3357  N N    . VAL B 1 3  ? -20.075 -9.472  -30.010 1.00 10.94 ? 3  VAL B N    2  
ATOM 3358  C CA   . VAL B 1 3  ? -19.087 -10.343 -29.302 1.00 10.24 ? 3  VAL B CA   2  
ATOM 3359  C C    . VAL B 1 3  ? -19.755 -10.944 -28.057 1.00 9.35  ? 3  VAL B C    2  
ATOM 3360  O O    . VAL B 1 3  ? -20.651 -10.355 -27.479 1.00 9.36  ? 3  VAL B O    2  
ATOM 3361  C CB   . VAL B 1 3  ? -17.863 -9.514  -28.886 1.00 10.50 ? 3  VAL B CB   2  
ATOM 3362  C CG1  . VAL B 1 3  ? -16.764 -10.443 -28.370 1.00 10.46 ? 3  VAL B CG1  2  
ATOM 3363  C CG2  . VAL B 1 3  ? -17.334 -8.730  -30.093 1.00 11.15 ? 3  VAL B CG2  2  
ATOM 3364  H H    . VAL B 1 3  ? -20.613 -8.833  -29.498 1.00 11.14 ? 3  VAL B H    2  
ATOM 3365  H HA   . VAL B 1 3  ? -18.775 -11.142 -29.961 1.00 10.39 ? 3  VAL B HA   2  
ATOM 3366  H HB   . VAL B 1 3  ? -18.146 -8.824  -28.103 1.00 10.49 ? 3  VAL B HB   2  
ATOM 3367  H HG11 . VAL B 1 3  ? -16.583 -11.225 -29.094 1.00 10.33 ? 3  VAL B HG11 2  
ATOM 3368  H HG12 . VAL B 1 3  ? -15.856 -9.878  -28.218 1.00 10.64 ? 3  VAL B HG12 2  
ATOM 3369  H HG13 . VAL B 1 3  ? -17.074 -10.885 -27.435 1.00 10.59 ? 3  VAL B HG13 2  
ATOM 3370  H HG21 . VAL B 1 3  ? -17.246 -9.393  -30.942 1.00 11.34 ? 3  VAL B HG21 2  
ATOM 3371  H HG22 . VAL B 1 3  ? -18.018 -7.929  -30.331 1.00 11.36 ? 3  VAL B HG22 2  
ATOM 3372  H HG23 . VAL B 1 3  ? -16.365 -8.317  -29.856 1.00 11.42 ? 3  VAL B HG23 2  
ATOM 3373  N N    . ALA B 1 4  ? -19.331 -12.116 -27.645 1.00 8.75  ? 4  ALA B N    2  
ATOM 3374  C CA   . ALA B 1 4  ? -19.946 -12.764 -26.445 1.00 7.96  ? 4  ALA B CA   2  
ATOM 3375  C C    . ALA B 1 4  ? -18.943 -12.771 -25.281 1.00 7.01  ? 4  ALA B C    2  
ATOM 3376  O O    . ALA B 1 4  ? -18.474 -13.814 -24.858 1.00 7.03  ? 4  ALA B O    2  
ATOM 3377  C CB   . ALA B 1 4  ? -20.346 -14.201 -26.797 1.00 8.21  ? 4  ALA B CB   2  
ATOM 3378  H H    . ALA B 1 4  ? -18.613 -12.574 -28.131 1.00 8.95  ? 4  ALA B H    2  
ATOM 3379  H HA   . ALA B 1 4  ? -20.827 -12.210 -26.152 1.00 8.13  ? 4  ALA B HA   2  
ATOM 3380  H HB1  . ALA B 1 4  ? -19.500 -14.714 -27.229 1.00 8.39  ? 4  ALA B HB1  2  
ATOM 3381  H HB2  . ALA B 1 4  ? -20.661 -14.717 -25.902 1.00 8.38  ? 4  ALA B HB2  2  
ATOM 3382  H HB3  . ALA B 1 4  ? -21.159 -14.184 -27.508 1.00 8.31  ? 4  ALA B HB3  2  
ATOM 3383  N N    . THR B 1 5  ? -18.618 -11.614 -24.753 1.00 6.47  ? 5  THR B N    2  
ATOM 3384  C CA   . THR B 1 5  ? -17.655 -11.546 -23.608 1.00 5.79  ? 5  THR B CA   2  
ATOM 3385  C C    . THR B 1 5  ? -17.969 -10.319 -22.746 1.00 4.92  ? 5  THR B C    2  
ATOM 3386  O O    . THR B 1 5  ? -17.807 -9.191  -23.174 1.00 4.69  ? 5  THR B O    2  
ATOM 3387  C CB   . THR B 1 5  ? -16.210 -11.442 -24.129 1.00 6.15  ? 5  THR B CB   2  
ATOM 3388  O OG1  . THR B 1 5  ? -16.187 -10.704 -25.343 1.00 6.56  ? 5  THR B OG1  2  
ATOM 3389  C CG2  . THR B 1 5  ? -15.643 -12.843 -24.368 1.00 6.81  ? 5  THR B CG2  2  
ATOM 3390  H H    . THR B 1 5  ? -19.014 -10.789 -25.106 1.00 6.72  ? 5  THR B H    2  
ATOM 3391  H HA   . THR B 1 5  ? -17.753 -12.437 -23.005 1.00 5.97  ? 5  THR B HA   2  
ATOM 3392  H HB   . THR B 1 5  ? -15.603 -10.938 -23.393 1.00 5.99  ? 5  THR B HB   2  
ATOM 3393  H HG1  . THR B 1 5  ? -15.338 -10.257 -25.403 1.00 6.97  ? 5  THR B HG1  2  
ATOM 3394  H HG21 . THR B 1 5  ? -16.049 -13.528 -23.639 1.00 7.08  ? 5  THR B HG21 2  
ATOM 3395  H HG22 . THR B 1 5  ? -15.909 -13.175 -25.362 1.00 7.02  ? 5  THR B HG22 2  
ATOM 3396  H HG23 . THR B 1 5  ? -14.567 -12.815 -24.274 1.00 7.11  ? 5  THR B HG23 2  
ATOM 3397  N N    . GLU B 1 6  ? -18.415 -10.532 -21.532 1.00 4.62  ? 6  GLU B N    2  
ATOM 3398  C CA   . GLU B 1 6  ? -18.739 -9.381  -20.634 1.00 3.82  ? 6  GLU B CA   2  
ATOM 3399  C C    . GLU B 1 6  ? -17.620 -9.198  -19.597 1.00 3.24  ? 6  GLU B C    2  
ATOM 3400  O O    . GLU B 1 6  ? -17.867 -8.901  -18.441 1.00 3.60  ? 6  GLU B O    2  
ATOM 3401  C CB   . GLU B 1 6  ? -20.078 -9.643  -19.932 1.00 4.37  ? 6  GLU B CB   2  
ATOM 3402  C CG   . GLU B 1 6  ? -21.221 -9.051  -20.764 1.00 5.20  ? 6  GLU B CG   2  
ATOM 3403  C CD   . GLU B 1 6  ? -21.412 -9.875  -22.044 1.00 5.80  ? 6  GLU B CD   2  
ATOM 3404  O OE1  . GLU B 1 6  ? -21.991 -10.946 -21.955 1.00 6.17  ? 6  GLU B OE1  2  
ATOM 3405  O OE2  . GLU B 1 6  ? -20.977 -9.420  -23.089 1.00 6.18  ? 6  GLU B OE2  2  
ATOM 3406  H H    . GLU B 1 6  ? -18.538 -11.451 -21.211 1.00 5.02  ? 6  GLU B H    2  
ATOM 3407  H HA   . GLU B 1 6  ? -18.813 -8.486  -21.226 1.00 3.46  ? 6  GLU B HA   2  
ATOM 3408  H HB2  . GLU B 1 6  ? -20.225 -10.709 -19.825 1.00 4.83  ? 6  GLU B HB2  2  
ATOM 3409  H HB3  . GLU B 1 6  ? -20.071 -9.182  -18.956 1.00 4.04  ? 6  GLU B HB3  2  
ATOM 3410  H HG2  . GLU B 1 6  ? -22.132 -9.070  -20.185 1.00 5.47  ? 6  GLU B HG2  2  
ATOM 3411  H HG3  . GLU B 1 6  ? -20.984 -8.031  -21.027 1.00 5.45  ? 6  GLU B HG3  2  
ATOM 3412  N N    . LEU B 1 7  ? -16.388 -9.346  -20.020 1.00 2.60  ? 7  LEU B N    2  
ATOM 3413  C CA   . LEU B 1 7  ? -15.226 -9.165  -19.117 1.00 2.31  ? 7  LEU B CA   2  
ATOM 3414  C C    . LEU B 1 7  ? -14.293 -8.175  -19.796 1.00 1.54  ? 7  LEU B C    2  
ATOM 3415  O O    . LEU B 1 7  ? -14.015 -7.112  -19.277 1.00 1.71  ? 7  LEU B O    2  
ATOM 3416  C CB   . LEU B 1 7  ? -14.460 -10.483 -18.916 1.00 2.52  ? 7  LEU B CB   2  
ATOM 3417  C CG   . LEU B 1 7  ? -15.396 -11.694 -18.786 1.00 3.16  ? 7  LEU B CG   2  
ATOM 3418  C CD1  . LEU B 1 7  ? -16.535 -11.400 -17.802 1.00 3.96  ? 7  LEU B CD1  2  
ATOM 3419  C CD2  . LEU B 1 7  ? -15.964 -12.034 -20.164 1.00 3.09  ? 7  LEU B CD2  2  
ATOM 3420  H H    . LEU B 1 7  ? -16.220 -9.553  -20.952 1.00 2.54  ? 7  LEU B H    2  
ATOM 3421  H HA   . LEU B 1 7  ? -15.553 -8.778  -18.169 1.00 2.79  ? 7  LEU B HA   2  
ATOM 3422  H HB2  . LEU B 1 7  ? -13.803 -10.640 -19.758 1.00 2.09  ? 7  LEU B HB2  2  
ATOM 3423  H HB3  . LEU B 1 7  ? -13.873 -10.397 -18.032 1.00 2.90  ? 7  LEU B HB3  2  
ATOM 3424  H HG   . LEU B 1 7  ? -14.828 -12.538 -18.420 1.00 3.35  ? 7  LEU B HG   2  
ATOM 3425  H HD11 . LEU B 1 7  ? -16.356 -10.454 -17.313 1.00 4.26  ? 7  LEU B HD11 2  
ATOM 3426  H HD12 . LEU B 1 7  ? -17.472 -11.357 -18.338 1.00 4.38  ? 7  LEU B HD12 2  
ATOM 3427  H HD13 . LEU B 1 7  ? -16.581 -12.185 -17.062 1.00 4.19  ? 7  LEU B HD13 2  
ATOM 3428  H HD21 . LEU B 1 7  ? -15.462 -11.435 -20.914 1.00 3.19  ? 7  LEU B HD21 2  
ATOM 3429  H HD22 . LEU B 1 7  ? -15.804 -13.079 -20.372 1.00 3.29  ? 7  LEU B HD22 2  
ATOM 3430  H HD23 . LEU B 1 7  ? -17.018 -11.816 -20.179 1.00 3.35  ? 7  LEU B HD23 2  
ATOM 3431  N N    . ARG B 1 8  ? -13.840 -8.528  -20.985 1.00 1.31  ? 8  ARG B N    2  
ATOM 3432  C CA   . ARG B 1 8  ? -12.952 -7.656  -21.787 1.00 1.49  ? 8  ARG B CA   2  
ATOM 3433  C C    . ARG B 1 8  ? -11.539 -7.647  -21.214 1.00 1.33  ? 8  ARG B C    2  
ATOM 3434  O O    . ARG B 1 8  ? -10.578 -7.920  -21.907 1.00 1.98  ? 8  ARG B O    2  
ATOM 3435  C CB   . ARG B 1 8  ? -13.519 -6.257  -21.747 1.00 2.16  ? 8  ARG B CB   2  
ATOM 3436  C CG   . ARG B 1 8  ? -13.578 -5.664  -23.157 1.00 2.69  ? 8  ARG B CG   2  
ATOM 3437  C CD   . ARG B 1 8  ? -12.239 -4.999  -23.482 1.00 3.00  ? 8  ARG B CD   2  
ATOM 3438  N NE   . ARG B 1 8  ? -12.378 -4.159  -24.706 1.00 3.47  ? 8  ARG B NE   2  
ATOM 3439  C CZ   . ARG B 1 8  ? -11.874 -2.952  -24.730 1.00 3.94  ? 8  ARG B CZ   2  
ATOM 3440  N NH1  . ARG B 1 8  ? -10.578 -2.786  -24.809 1.00 4.43  ? 8  ARG B NH1  2  
ATOM 3441  N NH2  . ARG B 1 8  ? -12.667 -1.912  -24.675 1.00 4.33  ? 8  ARG B NH2  2  
ATOM 3442  H H    . ARG B 1 8  ? -14.114 -9.368  -21.359 1.00 1.64  ? 8  ARG B H    2  
ATOM 3443  H HA   . ARG B 1 8  ? -12.935 -8.011  -22.801 1.00 1.85  ? 8  ARG B HA   2  
ATOM 3444  H HB2  . ARG B 1 8  ? -14.504 -6.303  -21.315 1.00 2.24  ? 8  ARG B HB2  2  
ATOM 3445  H HB3  . ARG B 1 8  ? -12.894 -5.659  -21.126 1.00 2.53  ? 8  ARG B HB3  2  
ATOM 3446  H HG2  . ARG B 1 8  ? -13.775 -6.451  -23.872 1.00 2.99  ? 8  ARG B HG2  2  
ATOM 3447  H HG3  . ARG B 1 8  ? -14.366 -4.927  -23.205 1.00 2.99  ? 8  ARG B HG3  2  
ATOM 3448  H HD2  . ARG B 1 8  ? -11.936 -4.377  -22.652 1.00 3.17  ? 8  ARG B HD2  2  
ATOM 3449  H HD3  . ARG B 1 8  ? -11.492 -5.760  -23.652 1.00 3.16  ? 8  ARG B HD3  2  
ATOM 3450  H HE   . ARG B 1 8  ? -12.845 -4.510  -25.492 1.00 3.66  ? 8  ARG B HE   2  
ATOM 3451  H HH11 . ARG B 1 8  ? -9.973  -3.583  -24.851 1.00 4.49  ? 8  ARG B HH11 2  
ATOM 3452  H HH12 . ARG B 1 8  ? -10.190 -1.864  -24.827 1.00 4.97  ? 8  ARG B HH12 2  
ATOM 3453  H HH21 . ARG B 1 8  ? -13.657 -2.041  -24.614 1.00 4.37  ? 8  ARG B HH21 2  
ATOM 3454  H HH22 . ARG B 1 8  ? -12.284 -0.988  -24.693 1.00 4.82  ? 8  ARG B HH22 2  
ATOM 3455  N N    . CYS B 1 9  ? -11.420 -7.300  -19.963 1.00 0.80  ? 9  CYS B N    2  
ATOM 3456  C CA   . CYS B 1 9  ? -10.084 -7.226  -19.294 1.00 0.67  ? 9  CYS B CA   2  
ATOM 3457  C C    . CYS B 1 9  ? -9.264  -8.508  -19.530 1.00 0.60  ? 9  CYS B C    2  
ATOM 3458  O O    . CYS B 1 9  ? -9.762  -9.510  -20.014 1.00 0.78  ? 9  CYS B O    2  
ATOM 3459  C CB   . CYS B 1 9  ? -10.286 -7.012  -17.796 1.00 0.79  ? 9  CYS B CB   2  
ATOM 3460  S SG   . CYS B 1 9  ? -11.140 -5.440  -17.528 1.00 1.22  ? 9  CYS B SG   2  
ATOM 3461  H H    . CYS B 1 9  ? -12.230 -7.057  -19.461 1.00 0.99  ? 9  CYS B H    2  
ATOM 3462  H HA   . CYS B 1 9  ? -9.539  -6.386  -19.697 1.00 0.83  ? 9  CYS B HA   2  
ATOM 3463  H HB2  . CYS B 1 9  ? -10.876 -7.820  -17.392 1.00 0.89  ? 9  CYS B HB2  2  
ATOM 3464  H HB3  . CYS B 1 9  ? -9.330  -6.988  -17.307 1.00 0.93  ? 9  CYS B HB3  2  
ATOM 3465  N N    . GLN B 1 10 ? -7.995  -8.463  -19.204 1.00 0.50  ? 10 GLN B N    2  
ATOM 3466  C CA   . GLN B 1 10 ? -7.098  -9.645  -19.427 1.00 0.47  ? 10 GLN B CA   2  
ATOM 3467  C C    . GLN B 1 10 ? -6.911  -10.479 -18.146 1.00 0.40  ? 10 GLN B C    2  
ATOM 3468  O O    . GLN B 1 10 ? -6.393  -11.577 -18.208 1.00 0.43  ? 10 GLN B O    2  
ATOM 3469  C CB   . GLN B 1 10 ? -5.728  -9.146  -19.891 1.00 0.53  ? 10 GLN B CB   2  
ATOM 3470  C CG   . GLN B 1 10 ? -5.529  -9.487  -21.373 1.00 0.64  ? 10 GLN B CG   2  
ATOM 3471  C CD   . GLN B 1 10 ? -4.157  -8.990  -21.839 1.00 1.21  ? 10 GLN B CD   2  
ATOM 3472  O OE1  . GLN B 1 10 ? -3.639  -8.018  -21.322 1.00 1.88  ? 10 GLN B OE1  2  
ATOM 3473  N NE2  . GLN B 1 10 ? -3.542  -9.620  -22.804 1.00 1.84  ? 10 GLN B NE2  2  
ATOM 3474  H H    . GLN B 1 10 ? -7.628  -7.637  -18.826 1.00 0.61  ? 10 GLN B H    2  
ATOM 3475  H HA   . GLN B 1 10 ? -7.523  -10.273 -20.195 1.00 0.53  ? 10 GLN B HA   2  
ATOM 3476  H HB2  . GLN B 1 10 ? -5.668  -8.076  -19.756 1.00 0.58  ? 10 GLN B HB2  2  
ATOM 3477  H HB3  . GLN B 1 10 ? -4.961  -9.623  -19.305 1.00 0.51  ? 10 GLN B HB3  2  
ATOM 3478  H HG2  . GLN B 1 10 ? -5.585  -10.557 -21.505 1.00 1.12  ? 10 GLN B HG2  2  
ATOM 3479  H HG3  . GLN B 1 10 ? -6.299  -9.011  -21.960 1.00 1.14  ? 10 GLN B HG3  2  
ATOM 3480  H HE21 . GLN B 1 10 ? -3.956  -10.402 -23.224 1.00 2.04  ? 10 GLN B HE21 2  
ATOM 3481  H HE22 . GLN B 1 10 ? -2.663  -9.309  -23.108 1.00 2.46  ? 10 GLN B HE22 2  
ATOM 3482  N N    . CYS B 1 11 ? -7.297  -9.949  -17.001 1.00 0.35  ? 11 CYS B N    2  
ATOM 3483  C CA   . CYS B 1 11 ? -7.139  -10.673 -15.680 1.00 0.32  ? 11 CYS B CA   2  
ATOM 3484  C C    . CYS B 1 11 ? -7.128  -12.202 -15.872 1.00 0.37  ? 11 CYS B C    2  
ATOM 3485  O O    . CYS B 1 11 ? -8.052  -12.770 -16.426 1.00 0.51  ? 11 CYS B O    2  
ATOM 3486  C CB   . CYS B 1 11 ? -8.302  -10.326 -14.728 1.00 0.33  ? 11 CYS B CB   2  
ATOM 3487  S SG   . CYS B 1 11 ? -9.497  -9.220  -15.529 1.00 0.49  ? 11 CYS B SG   2  
ATOM 3488  H H    . CYS B 1 11 ? -7.676  -9.051  -17.006 1.00 0.37  ? 11 CYS B H    2  
ATOM 3489  H HA   . CYS B 1 11 ? -6.210  -10.369 -15.220 1.00 0.33  ? 11 CYS B HA   2  
ATOM 3490  H HB2  . CYS B 1 11 ? -8.802  -11.232 -14.437 1.00 0.41  ? 11 CYS B HB2  2  
ATOM 3491  H HB3  . CYS B 1 11 ? -7.906  -9.846  -13.846 1.00 0.33  ? 11 CYS B HB3  2  
ATOM 3492  N N    . LEU B 1 12 ? -6.101  -12.869 -15.393 1.00 0.40  ? 12 LEU B N    2  
ATOM 3493  C CA   . LEU B 1 12 ? -6.035  -14.357 -15.519 1.00 0.45  ? 12 LEU B CA   2  
ATOM 3494  C C    . LEU B 1 12 ? -7.085  -14.955 -14.582 1.00 0.45  ? 12 LEU B C    2  
ATOM 3495  O O    . LEU B 1 12 ? -8.091  -15.491 -15.007 1.00 0.49  ? 12 LEU B O    2  
ATOM 3496  C CB   . LEU B 1 12 ? -4.642  -14.830 -15.099 1.00 0.49  ? 12 LEU B CB   2  
ATOM 3497  C CG   . LEU B 1 12 ? -3.772  -15.013 -16.341 1.00 0.83  ? 12 LEU B CG   2  
ATOM 3498  C CD1  . LEU B 1 12 ? -3.182  -13.664 -16.761 1.00 1.04  ? 12 LEU B CD1  2  
ATOM 3499  C CD2  . LEU B 1 12 ? -2.640  -15.979 -16.015 1.00 1.56  ? 12 LEU B CD2  2  
ATOM 3500  H H    . LEU B 1 12 ? -5.382  -12.393 -14.928 1.00 0.49  ? 12 LEU B H    2  
ATOM 3501  H HA   . LEU B 1 12 ? -6.227  -14.657 -16.537 1.00 0.48  ? 12 LEU B HA   2  
ATOM 3502  H HB2  . LEU B 1 12 ? -4.192  -14.092 -14.449 1.00 0.99  ? 12 LEU B HB2  2  
ATOM 3503  H HB3  . LEU B 1 12 ? -4.721  -15.770 -14.576 1.00 0.99  ? 12 LEU B HB3  2  
ATOM 3504  H HG   . LEU B 1 12 ? -4.370  -15.413 -17.145 1.00 1.56  ? 12 LEU B HG   2  
ATOM 3505  H HD11 . LEU B 1 12 ? -3.979  -12.947 -16.888 1.00 1.52  ? 12 LEU B HD11 2  
ATOM 3506  H HD12 . LEU B 1 12 ? -2.502  -13.314 -15.999 1.00 1.64  ? 12 LEU B HD12 2  
ATOM 3507  H HD13 . LEU B 1 12 ? -2.650  -13.779 -17.694 1.00 1.49  ? 12 LEU B HD13 2  
ATOM 3508  H HD21 . LEU B 1 12 ? -2.235  -15.741 -15.042 1.00 1.96  ? 12 LEU B HD21 2  
ATOM 3509  H HD22 . LEU B 1 12 ? -3.024  -16.988 -16.009 1.00 1.94  ? 12 LEU B HD22 2  
ATOM 3510  H HD23 . LEU B 1 12 ? -1.866  -15.889 -16.760 1.00 2.16  ? 12 LEU B HD23 2  
ATOM 3511  N N    . GLN B 1 13 ? -6.842  -14.833 -13.309 1.00 0.44  ? 13 GLN B N    2  
ATOM 3512  C CA   . GLN B 1 13 ? -7.773  -15.341 -12.267 1.00 0.46  ? 13 GLN B CA   2  
ATOM 3513  C C    . GLN B 1 13 ? -7.291  -14.797 -10.917 1.00 0.42  ? 13 GLN B C    2  
ATOM 3514  O O    . GLN B 1 13 ? -7.278  -15.495 -9.923  1.00 0.60  ? 13 GLN B O    2  
ATOM 3515  C CB   . GLN B 1 13 ? -7.738  -16.869 -12.260 1.00 0.53  ? 13 GLN B CB   2  
ATOM 3516  C CG   . GLN B 1 13 ? -8.970  -17.426 -12.980 1.00 1.12  ? 13 GLN B CG   2  
ATOM 3517  C CD   . GLN B 1 13 ? -9.236  -18.860 -12.513 1.00 1.40  ? 13 GLN B CD   2  
ATOM 3518  O OE1  . GLN B 1 13 ? -9.772  -19.074 -11.444 1.00 1.77  ? 13 GLN B OE1  2  
ATOM 3519  N NE2  . GLN B 1 13 ? -8.883  -19.860 -13.276 1.00 2.09  ? 13 GLN B NE2  2  
ATOM 3520  H H    . GLN B 1 13 ? -6.024  -14.384 -13.028 1.00 0.43  ? 13 GLN B H    2  
ATOM 3521  H HA   . GLN B 1 13 ? -8.772  -14.987 -12.465 1.00 0.47  ? 13 GLN B HA   2  
ATOM 3522  H HB2  . GLN B 1 13 ? -6.845  -17.207 -12.767 1.00 0.99  ? 13 GLN B HB2  2  
ATOM 3523  H HB3  . GLN B 1 13 ? -7.721  -17.213 -11.247 1.00 0.86  ? 13 GLN B HB3  2  
ATOM 3524  H HG2  . GLN B 1 13 ? -9.828  -16.809 -12.755 1.00 1.51  ? 13 GLN B HG2  2  
ATOM 3525  H HG3  . GLN B 1 13 ? -8.797  -17.424 -14.045 1.00 1.66  ? 13 GLN B HG3  2  
ATOM 3526  H HE21 . GLN B 1 13 ? -8.450  -19.691 -14.139 1.00 2.59  ? 13 GLN B HE21 2  
ATOM 3527  H HE22 . GLN B 1 13 ? -9.051  -20.781 -12.985 1.00 2.41  ? 13 GLN B HE22 2  
ATOM 3528  N N    . THR B 1 14 ? -6.862  -13.552 -10.924 1.00 0.37  ? 14 THR B N    2  
ATOM 3529  C CA   . THR B 1 14 ? -6.305  -12.865 -9.714  1.00 0.33  ? 14 THR B CA   2  
ATOM 3530  C C    . THR B 1 14 ? -5.608  -13.835 -8.765  1.00 0.35  ? 14 THR B C    2  
ATOM 3531  O O    . THR B 1 14 ? -6.216  -14.440 -7.897  1.00 0.39  ? 14 THR B O    2  
ATOM 3532  C CB   . THR B 1 14 ? -7.354  -12.086 -8.949  1.00 0.33  ? 14 THR B CB   2  
ATOM 3533  O OG1  . THR B 1 14 ? -8.531  -12.868 -8.779  1.00 0.39  ? 14 THR B OG1  2  
ATOM 3534  C CG2  . THR B 1 14 ? -7.671  -10.805 -9.712  1.00 0.32  ? 14 THR B CG2  2  
ATOM 3535  H H    . THR B 1 14 ? -6.882  -13.056 -11.769 1.00 0.51  ? 14 THR B H    2  
ATOM 3536  H HA   . THR B 1 14 ? -5.573  -12.164 -10.059 1.00 0.30  ? 14 THR B HA   2  
ATOM 3537  H HB   . THR B 1 14 ? -6.930  -11.826 -7.988  1.00 0.32  ? 14 THR B HB   2  
ATOM 3538  H HG1  . THR B 1 14 ? -8.403  -13.433 -8.013  1.00 0.95  ? 14 THR B HG1  2  
ATOM 3539  H HG21 . THR B 1 14 ? -6.746  -10.320 -9.994  1.00 1.06  ? 14 THR B HG21 2  
ATOM 3540  H HG22 . THR B 1 14 ? -8.236  -11.046 -10.600 1.00 1.06  ? 14 THR B HG22 2  
ATOM 3541  H HG23 . THR B 1 14 ? -8.245  -10.143 -9.083  1.00 1.03  ? 14 THR B HG23 2  
ATOM 3542  N N    . LEU B 1 15 ? -4.322  -13.943 -8.905  1.00 0.36  ? 15 LEU B N    2  
ATOM 3543  C CA   . LEU B 1 15 ? -3.533  -14.832 -8.007  1.00 0.42  ? 15 LEU B CA   2  
ATOM 3544  C C    . LEU B 1 15 ? -3.476  -14.189 -6.617  1.00 0.36  ? 15 LEU B C    2  
ATOM 3545  O O    . LEU B 1 15 ? -3.713  -13.005 -6.460  1.00 0.52  ? 15 LEU B O    2  
ATOM 3546  C CB   . LEU B 1 15 ? -2.111  -15.013 -8.563  1.00 0.57  ? 15 LEU B CB   2  
ATOM 3547  C CG   . LEU B 1 15 ? -2.132  -15.985 -9.754  1.00 0.65  ? 15 LEU B CG   2  
ATOM 3548  C CD1  . LEU B 1 15 ? -2.453  -15.222 -11.042 1.00 0.74  ? 15 LEU B CD1  2  
ATOM 3549  C CD2  . LEU B 1 15 ? -0.761  -16.653 -9.890  1.00 1.78  ? 15 LEU B CD2  2  
ATOM 3550  H H    . LEU B 1 15 ? -3.871  -13.404 -9.592  1.00 0.35  ? 15 LEU B H    2  
ATOM 3551  H HA   . LEU B 1 15 ? -4.021  -15.793 -7.933  1.00 0.51  ? 15 LEU B HA   2  
ATOM 3552  H HB2  . LEU B 1 15 ? -1.728  -14.056 -8.886  1.00 1.12  ? 15 LEU B HB2  2  
ATOM 3553  H HB3  . LEU B 1 15 ? -1.473  -15.412 -7.788  1.00 0.91  ? 15 LEU B HB3  2  
ATOM 3554  H HG   . LEU B 1 15 ? -2.885  -16.744 -9.592  1.00 1.32  ? 15 LEU B HG   2  
ATOM 3555  H HD11 . LEU B 1 15 ? -2.032  -14.229 -10.988 1.00 1.20  ? 15 LEU B HD11 2  
ATOM 3556  H HD12 . LEU B 1 15 ? -2.030  -15.746 -11.887 1.00 1.40  ? 15 LEU B HD12 2  
ATOM 3557  H HD13 . LEU B 1 15 ? -3.524  -15.153 -11.162 1.00 1.44  ? 15 LEU B HD13 2  
ATOM 3558  H HD21 . LEU B 1 15 ? -0.396  -16.930 -8.913  1.00 2.33  ? 15 LEU B HD21 2  
ATOM 3559  H HD22 . LEU B 1 15 ? -0.850  -17.536 -10.506 1.00 2.19  ? 15 LEU B HD22 2  
ATOM 3560  H HD23 . LEU B 1 15 ? -0.069  -15.963 -10.350 1.00 2.33  ? 15 LEU B HD23 2  
ATOM 3561  N N    . GLN B 1 16 ? -3.191  -14.962 -5.605  1.00 0.47  ? 16 GLN B N    2  
ATOM 3562  C CA   . GLN B 1 16 ? -3.148  -14.410 -4.227  1.00 0.42  ? 16 GLN B CA   2  
ATOM 3563  C C    . GLN B 1 16 ? -1.721  -14.027 -3.849  1.00 0.39  ? 16 GLN B C    2  
ATOM 3564  O O    . GLN B 1 16 ? -1.106  -14.627 -2.988  1.00 0.47  ? 16 GLN B O    2  
ATOM 3565  C CB   . GLN B 1 16 ? -3.694  -15.454 -3.249  1.00 0.49  ? 16 GLN B CB   2  
ATOM 3566  C CG   . GLN B 1 16 ? -5.226  -15.457 -3.296  1.00 0.60  ? 16 GLN B CG   2  
ATOM 3567  C CD   . GLN B 1 16 ? -5.709  -16.416 -4.390  1.00 0.78  ? 16 GLN B CD   2  
ATOM 3568  O OE1  . GLN B 1 16 ? -6.260  -15.991 -5.386  1.00 1.48  ? 16 GLN B OE1  2  
ATOM 3569  N NE2  . GLN B 1 16 ? -5.525  -17.702 -4.246  1.00 1.31  ? 16 GLN B NE2  2  
ATOM 3570  H H    . GLN B 1 16 ? -3.021  -15.908 -5.749  1.00 0.72  ? 16 GLN B H    2  
ATOM 3571  H HA   . GLN B 1 16 ? -3.761  -13.521 -4.184  1.00 0.43  ? 16 GLN B HA   2  
ATOM 3572  H HB2  . GLN B 1 16 ? -3.324  -16.431 -3.526  1.00 0.51  ? 16 GLN B HB2  2  
ATOM 3573  H HB3  . GLN B 1 16 ? -3.367  -15.217 -2.253  1.00 0.50  ? 16 GLN B HB3  2  
ATOM 3574  H HG2  . GLN B 1 16 ? -5.614  -15.778 -2.340  1.00 0.75  ? 16 GLN B HG2  2  
ATOM 3575  H HG3  . GLN B 1 16 ? -5.583  -14.461 -3.511  1.00 0.72  ? 16 GLN B HG3  2  
ATOM 3576  H HE21 . GLN B 1 16 ? -5.082  -18.048 -3.443  1.00 1.97  ? 16 GLN B HE21 2  
ATOM 3577  H HE22 . GLN B 1 16 ? -5.832  -18.321 -4.942  1.00 1.46  ? 16 GLN B HE22 2  
ATOM 3578  N N    . GLY B 1 17 ? -1.210  -13.006 -4.480  1.00 0.37  ? 17 GLY B N    2  
ATOM 3579  C CA   . GLY B 1 17 ? 0.160   -12.519 -4.165  1.00 0.45  ? 17 GLY B CA   2  
ATOM 3580  C C    . GLY B 1 17 ? 1.198   -13.581 -4.503  1.00 0.41  ? 17 GLY B C    2  
ATOM 3581  O O    . GLY B 1 17 ? 1.605   -14.355 -3.656  1.00 0.57  ? 17 GLY B O    2  
ATOM 3582  H H    . GLY B 1 17 ? -1.745  -12.543 -5.157  1.00 0.35  ? 17 GLY B H    2  
ATOM 3583  H HA2  . GLY B 1 17 ? 0.362   -11.628 -4.740  1.00 0.56  ? 17 GLY B HA2  2  
ATOM 3584  H HA3  . GLY B 1 17 ? 0.223   -12.285 -3.113  1.00 0.59  ? 17 GLY B HA3  2  
ATOM 3585  N N    . ILE B 1 18 ? 1.655   -13.599 -5.726  1.00 0.39  ? 18 ILE B N    2  
ATOM 3586  C CA   . ILE B 1 18 ? 2.698   -14.585 -6.112  1.00 0.49  ? 18 ILE B CA   2  
ATOM 3587  C C    . ILE B 1 18 ? 4.054   -14.025 -5.678  1.00 0.51  ? 18 ILE B C    2  
ATOM 3588  O O    . ILE B 1 18 ? 4.125   -13.019 -4.993  1.00 0.72  ? 18 ILE B O    2  
ATOM 3589  C CB   . ILE B 1 18 ? 2.654   -14.873 -7.632  1.00 0.67  ? 18 ILE B CB   2  
ATOM 3590  C CG1  . ILE B 1 18 ? 3.508   -13.873 -8.425  1.00 0.72  ? 18 ILE B CG1  2  
ATOM 3591  C CG2  . ILE B 1 18 ? 1.209   -14.819 -8.140  1.00 0.74  ? 18 ILE B CG2  2  
ATOM 3592  C CD1  . ILE B 1 18 ? 3.103   -12.449 -8.070  1.00 0.67  ? 18 ILE B CD1  2  
ATOM 3593  H H    . ILE B 1 18 ? 1.334   -12.948 -6.377  1.00 0.44  ? 18 ILE B H    2  
ATOM 3594  H HA   . ILE B 1 18 ? 2.528   -15.501 -5.582  1.00 0.54  ? 18 ILE B HA   2  
ATOM 3595  H HB   . ILE B 1 18 ? 3.032   -15.865 -7.797  1.00 0.79  ? 18 ILE B HB   2  
ATOM 3596  H HG12 . ILE B 1 18 ? 4.550   -14.021 -8.185  1.00 0.70  ? 18 ILE B HG12 2  
ATOM 3597  H HG13 . ILE B 1 18 ? 3.359   -14.033 -9.482  1.00 0.91  ? 18 ILE B HG13 2  
ATOM 3598  H HG21 . ILE B 1 18 ? 0.588   -15.453 -7.525  1.00 1.25  ? 18 ILE B HG21 2  
ATOM 3599  H HG22 . ILE B 1 18 ? 0.845   -13.802 -8.091  1.00 1.30  ? 18 ILE B HG22 2  
ATOM 3600  H HG23 . ILE B 1 18 ? 1.174   -15.163 -9.162  1.00 1.15  ? 18 ILE B HG23 2  
ATOM 3601  H HD11 . ILE B 1 18 ? 2.034   -12.348 -8.172  1.00 1.21  ? 18 ILE B HD11 2  
ATOM 3602  H HD12 . ILE B 1 18 ? 3.391   -12.241 -7.051  1.00 1.17  ? 18 ILE B HD12 2  
ATOM 3603  H HD13 . ILE B 1 18 ? 3.598   -11.762 -8.734  1.00 1.16  ? 18 ILE B HD13 2  
ATOM 3604  N N    . HIS B 1 19 ? 5.123   -14.654 -6.054  1.00 0.45  ? 19 HIS B N    2  
ATOM 3605  C CA   . HIS B 1 19 ? 6.454   -14.139 -5.646  1.00 0.46  ? 19 HIS B CA   2  
ATOM 3606  C C    . HIS B 1 19 ? 7.009   -13.266 -6.794  1.00 0.38  ? 19 HIS B C    2  
ATOM 3607  O O    . HIS B 1 19 ? 6.796   -13.580 -7.951  1.00 0.35  ? 19 HIS B O    2  
ATOM 3608  C CB   . HIS B 1 19 ? 7.367   -15.334 -5.301  1.00 0.54  ? 19 HIS B CB   2  
ATOM 3609  C CG   . HIS B 1 19 ? 8.625   -15.323 -6.115  1.00 0.60  ? 19 HIS B CG   2  
ATOM 3610  N ND1  . HIS B 1 19 ? 9.870   -15.118 -5.549  1.00 0.76  ? 19 HIS B ND1  2  
ATOM 3611  C CD2  . HIS B 1 19 ? 8.843   -15.503 -7.452  1.00 0.60  ? 19 HIS B CD2  2  
ATOM 3612  C CE1  . HIS B 1 19 ? 10.776  -15.182 -6.536  1.00 0.81  ? 19 HIS B CE1  2  
ATOM 3613  N NE2  . HIS B 1 19 ? 10.204  -15.417 -7.721  1.00 0.74  ? 19 HIS B NE2  2  
ATOM 3614  H H    . HIS B 1 19 ? 5.050   -15.459 -6.606  1.00 0.55  ? 19 HIS B H    2  
ATOM 3615  H HA   . HIS B 1 19 ? 6.319   -13.531 -4.766  1.00 0.50  ? 19 HIS B HA   2  
ATOM 3616  H HB2  . HIS B 1 19 ? 7.628   -15.287 -4.255  1.00 0.64  ? 19 HIS B HB2  2  
ATOM 3617  H HB3  . HIS B 1 19 ? 6.831   -16.254 -5.489  1.00 0.52  ? 19 HIS B HB3  2  
ATOM 3618  H HD1  . HIS B 1 19 ? 10.056  -14.955 -4.599  1.00 0.84  ? 19 HIS B HD1  2  
ATOM 3619  H HD2  . HIS B 1 19 ? 8.067   -15.661 -8.186  1.00 0.55  ? 19 HIS B HD2  2  
ATOM 3620  H HE1  . HIS B 1 19 ? 11.833  -15.043 -6.390  1.00 0.93  ? 19 HIS B HE1  2  
ATOM 3621  N N    . PRO B 1 20 ? 7.675   -12.178 -6.449  1.00 0.39  ? 20 PRO B N    2  
ATOM 3622  C CA   . PRO B 1 20 ? 8.227   -11.245 -7.448  1.00 0.35  ? 20 PRO B CA   2  
ATOM 3623  C C    . PRO B 1 20 ? 9.481   -11.831 -8.135  1.00 0.37  ? 20 PRO B C    2  
ATOM 3624  O O    . PRO B 1 20 ? 9.395   -12.883 -8.737  1.00 0.43  ? 20 PRO B O    2  
ATOM 3625  C CB   . PRO B 1 20 ? 8.512   -9.976  -6.632  1.00 0.39  ? 20 PRO B CB   2  
ATOM 3626  C CG   . PRO B 1 20 ? 8.662   -10.429 -5.166  1.00 0.47  ? 20 PRO B CG   2  
ATOM 3627  C CD   . PRO B 1 20 ? 7.934   -11.774 -5.049  1.00 0.46  ? 20 PRO B CD   2  
ATOM 3628  H HA   . PRO B 1 20 ? 7.480   -11.030 -8.196  1.00 0.32  ? 20 PRO B HA   2  
ATOM 3629  H HB2  . PRO B 1 20 ? 9.413   -9.495  -6.973  1.00 0.40  ? 20 PRO B HB2  2  
ATOM 3630  H HB3  . PRO B 1 20 ? 7.680   -9.296  -6.714  1.00 0.40  ? 20 PRO B HB3  2  
ATOM 3631  H HG2  . PRO B 1 20 ? 9.707   -10.548 -4.921  1.00 0.50  ? 20 PRO B HG2  2  
ATOM 3632  H HG3  . PRO B 1 20 ? 8.203   -9.710  -4.507  1.00 0.51  ? 20 PRO B HG3  2  
ATOM 3633  H HD2  . PRO B 1 20 ? 8.565   -12.493 -4.554  1.00 0.50  ? 20 PRO B HD2  2  
ATOM 3634  H HD3  . PRO B 1 20 ? 7.005   -11.647 -4.520  1.00 0.47  ? 20 PRO B HD3  2  
ATOM 3635  N N    . LYS B 1 21 ? 10.615  -11.144 -8.117  1.00 0.38  ? 21 LYS B N    2  
ATOM 3636  C CA   . LYS B 1 21 ? 11.838  -11.639 -8.839  1.00 0.40  ? 21 LYS B CA   2  
ATOM 3637  C C    . LYS B 1 21 ? 11.628  -11.384 -10.337 1.00 0.38  ? 21 LYS B C    2  
ATOM 3638  O O    . LYS B 1 21 ? 12.463  -10.797 -11.001 1.00 0.42  ? 21 LYS B O    2  
ATOM 3639  C CB   . LYS B 1 21 ? 12.088  -13.133 -8.582  1.00 0.42  ? 21 LYS B CB   2  
ATOM 3640  C CG   . LYS B 1 21 ? 13.549  -13.460 -8.911  1.00 0.52  ? 21 LYS B CG   2  
ATOM 3641  C CD   . LYS B 1 21 ? 13.871  -14.903 -8.510  1.00 0.95  ? 21 LYS B CD   2  
ATOM 3642  C CE   . LYS B 1 21 ? 13.592  -15.841 -9.687  1.00 1.49  ? 21 LYS B CE   2  
ATOM 3643  N NZ   . LYS B 1 21 ? 14.765  -15.846 -10.609 1.00 2.16  ? 21 LYS B NZ   2  
ATOM 3644  H H    . LYS B 1 21 ? 10.654  -10.279 -7.674  1.00 0.41  ? 21 LYS B H    2  
ATOM 3645  H HA   . LYS B 1 21 ? 12.692  -11.070 -8.507  1.00 0.43  ? 21 LYS B HA   2  
ATOM 3646  H HB2  . LYS B 1 21 ? 11.892  -13.355 -7.543  1.00 0.42  ? 21 LYS B HB2  2  
ATOM 3647  H HB3  . LYS B 1 21 ? 11.439  -13.724 -9.208  1.00 0.41  ? 21 LYS B HB3  2  
ATOM 3648  H HG2  . LYS B 1 21 ? 13.712  -13.338 -9.972  1.00 0.96  ? 21 LYS B HG2  2  
ATOM 3649  H HG3  . LYS B 1 21 ? 14.195  -12.786 -8.370  1.00 0.83  ? 21 LYS B HG3  2  
ATOM 3650  H HD2  . LYS B 1 21 ? 14.915  -14.973 -8.235  1.00 1.56  ? 21 LYS B HD2  2  
ATOM 3651  H HD3  . LYS B 1 21 ? 13.260  -15.191 -7.669  1.00 1.65  ? 21 LYS B HD3  2  
ATOM 3652  H HE2  . LYS B 1 21 ? 13.421  -16.841 -9.317  1.00 1.90  ? 21 LYS B HE2  2  
ATOM 3653  H HE3  . LYS B 1 21 ? 12.716  -15.501 -10.220 1.00 1.94  ? 21 LYS B HE3  2  
ATOM 3654  H HZ1  . LYS B 1 21 ? 15.614  -16.147 -10.089 1.00 2.61  ? 21 LYS B HZ1  2  
ATOM 3655  H HZ2  . LYS B 1 21 ? 14.585  -16.506 -11.393 1.00 2.59  ? 21 LYS B HZ2  2  
ATOM 3656  H HZ3  . LYS B 1 21 ? 14.914  -14.889 -10.987 1.00 2.41  ? 21 LYS B HZ3  2  
ATOM 3657  N N    . ASN B 1 22 ? 10.488  -11.777 -10.852 1.00 0.36  ? 22 ASN B N    2  
ATOM 3658  C CA   . ASN B 1 22 ? 10.148  -11.532 -12.269 1.00 0.36  ? 22 ASN B CA   2  
ATOM 3659  C C    . ASN B 1 22 ? 9.247   -10.303 -12.287 1.00 0.34  ? 22 ASN B C    2  
ATOM 3660  O O    . ASN B 1 22 ? 9.491   -9.333  -12.971 1.00 0.36  ? 22 ASN B O    2  
ATOM 3661  C CB   . ASN B 1 22 ? 9.360   -12.728 -12.818 1.00 0.36  ? 22 ASN B CB   2  
ATOM 3662  C CG   . ASN B 1 22 ? 9.876   -14.039 -12.219 1.00 0.38  ? 22 ASN B CG   2  
ATOM 3663  O OD1  . ASN B 1 22 ? 10.919  -14.532 -12.604 1.00 0.43  ? 22 ASN B OD1  2  
ATOM 3664  N ND2  . ASN B 1 22 ? 9.180   -14.626 -11.281 1.00 0.37  ? 22 ASN B ND2  2  
ATOM 3665  H H    . ASN B 1 22 ? 9.823   -12.208 -10.287 1.00 0.35  ? 22 ASN B H    2  
ATOM 3666  H HA   . ASN B 1 22 ? 11.040  -11.363 -12.852 1.00 0.39  ? 22 ASN B HA   2  
ATOM 3667  H HB2  . ASN B 1 22 ? 8.317   -12.610 -12.564 1.00 0.33  ? 22 ASN B HB2  2  
ATOM 3668  H HB3  . ASN B 1 22 ? 9.460   -12.756 -13.882 1.00 0.38  ? 22 ASN B HB3  2  
ATOM 3669  H HD21 . ASN B 1 22 ? 8.338   -14.226 -10.970 1.00 0.34  ? 22 ASN B HD21 2  
ATOM 3670  H HD22 . ASN B 1 22 ? 9.496   -15.464 -10.888 1.00 0.40  ? 22 ASN B HD22 2  
ATOM 3671  N N    . ILE B 1 23 ? 8.211   -10.356 -11.494 1.00 0.31  ? 23 ILE B N    2  
ATOM 3672  C CA   . ILE B 1 23 ? 7.245   -9.238  -11.375 1.00 0.30  ? 23 ILE B CA   2  
ATOM 3673  C C    . ILE B 1 23 ? 8.004   -7.908  -11.247 1.00 0.34  ? 23 ILE B C    2  
ATOM 3674  O O    . ILE B 1 23 ? 8.642   -7.635  -10.246 1.00 0.37  ? 23 ILE B O    2  
ATOM 3675  C CB   . ILE B 1 23 ? 6.415   -9.528  -10.122 1.00 0.29  ? 23 ILE B CB   2  
ATOM 3676  C CG1  . ILE B 1 23 ? 5.229   -10.421 -10.491 1.00 0.27  ? 23 ILE B CG1  2  
ATOM 3677  C CG2  . ILE B 1 23 ? 5.912   -8.237  -9.499  1.00 0.33  ? 23 ILE B CG2  2  
ATOM 3678  C CD1  . ILE B 1 23 ? 5.724   -11.847 -10.743 1.00 0.26  ? 23 ILE B CD1  2  
ATOM 3679  H H    . ILE B 1 23 ? 8.073   -11.151 -10.943 1.00 0.31  ? 23 ILE B H    2  
ATOM 3680  H HA   . ILE B 1 23 ? 6.600   -9.211  -12.245 1.00 0.29  ? 23 ILE B HA   2  
ATOM 3681  H HB   . ILE B 1 23 ? 7.040   -10.048 -9.409  1.00 0.31  ? 23 ILE B HB   2  
ATOM 3682  H HG12 . ILE B 1 23 ? 4.516   -10.423 -9.680  1.00 0.29  ? 23 ILE B HG12 2  
ATOM 3683  H HG13 . ILE B 1 23 ? 4.757   -10.042 -11.384 1.00 0.26  ? 23 ILE B HG13 2  
ATOM 3684  H HG21 . ILE B 1 23 ? 5.694   -7.526  -10.279 1.00 1.08  ? 23 ILE B HG21 2  
ATOM 3685  H HG22 . ILE B 1 23 ? 5.021   -8.440  -8.927  1.00 1.01  ? 23 ILE B HG22 2  
ATOM 3686  H HG23 . ILE B 1 23 ? 6.677   -7.841  -8.848  1.00 1.12  ? 23 ILE B HG23 2  
ATOM 3687  H HD11 . ILE B 1 23 ? 6.424   -12.126 -9.969  1.00 1.04  ? 23 ILE B HD11 2  
ATOM 3688  H HD12 . ILE B 1 23 ? 4.886   -12.526 -10.735 1.00 1.04  ? 23 ILE B HD12 2  
ATOM 3689  H HD13 . ILE B 1 23 ? 6.215   -11.890 -11.703 1.00 1.01  ? 23 ILE B HD13 2  
ATOM 3690  N N    . GLN B 1 24 ? 7.954   -7.100  -12.273 1.00 0.36  ? 24 GLN B N    2  
ATOM 3691  C CA   . GLN B 1 24 ? 8.664   -5.805  -12.270 1.00 0.42  ? 24 GLN B CA   2  
ATOM 3692  C C    . GLN B 1 24 ? 7.675   -4.649  -12.090 1.00 0.37  ? 24 GLN B C    2  
ATOM 3693  O O    . GLN B 1 24 ? 8.050   -3.582  -11.641 1.00 0.39  ? 24 GLN B O    2  
ATOM 3694  C CB   . GLN B 1 24 ? 9.355   -5.680  -13.620 1.00 0.48  ? 24 GLN B CB   2  
ATOM 3695  C CG   . GLN B 1 24 ? 10.860  -5.462  -13.432 1.00 0.57  ? 24 GLN B CG   2  
ATOM 3696  C CD   . GLN B 1 24 ? 11.516  -5.213  -14.795 1.00 1.16  ? 24 GLN B CD   2  
ATOM 3697  O OE1  . GLN B 1 24 ? 10.985  -4.492  -15.617 1.00 1.83  ? 24 GLN B OE1  2  
ATOM 3698  N NE2  . GLN B 1 24 ? 12.659  -5.782  -15.071 1.00 1.58  ? 24 GLN B NE2  2  
ATOM 3699  H H    . GLN B 1 24 ? 7.452   -7.353  -13.075 1.00 0.36  ? 24 GLN B H    2  
ATOM 3700  H HA   . GLN B 1 24 ? 9.401   -5.779  -11.481 1.00 0.46  ? 24 GLN B HA   2  
ATOM 3701  H HB2  . GLN B 1 24 ? 9.197   -6.591  -14.180 1.00 0.48  ? 24 GLN B HB2  2  
ATOM 3702  H HB3  . GLN B 1 24 ? 8.925   -4.863  -14.156 1.00 0.48  ? 24 GLN B HB3  2  
ATOM 3703  H HG2  . GLN B 1 24 ? 11.023  -4.608  -12.792 1.00 0.65  ? 24 GLN B HG2  2  
ATOM 3704  H HG3  . GLN B 1 24 ? 11.296  -6.340  -12.981 1.00 0.92  ? 24 GLN B HG3  2  
ATOM 3705  H HE21 . GLN B 1 24 ? 13.092  -6.363  -14.410 1.00 1.79  ? 24 GLN B HE21 2  
ATOM 3706  H HE22 . GLN B 1 24 ? 13.084  -5.630  -15.942 1.00 2.03  ? 24 GLN B HE22 2  
ATOM 3707  N N    . SER B 1 25 ? 6.421   -4.839  -12.437 1.00 0.33  ? 25 SER B N    2  
ATOM 3708  C CA   . SER B 1 25 ? 5.440   -3.724  -12.282 1.00 0.29  ? 25 SER B CA   2  
ATOM 3709  C C    . SER B 1 25 ? 4.009   -4.250  -12.243 1.00 0.27  ? 25 SER B C    2  
ATOM 3710  O O    . SER B 1 25 ? 3.767   -5.436  -12.330 1.00 0.29  ? 25 SER B O    2  
ATOM 3711  C CB   . SER B 1 25 ? 5.563   -2.766  -13.456 1.00 0.31  ? 25 SER B CB   2  
ATOM 3712  O OG   . SER B 1 25 ? 5.292   -3.455  -14.672 1.00 0.34  ? 25 SER B OG   2  
ATOM 3713  H H    . SER B 1 25 ? 6.126   -5.710  -12.796 1.00 0.33  ? 25 SER B H    2  
ATOM 3714  H HA   . SER B 1 25 ? 5.648   -3.185  -11.373 1.00 0.29  ? 25 SER B HA   2  
ATOM 3715  H HB2  . SER B 1 25 ? 4.847   -1.975  -13.326 1.00 0.31  ? 25 SER B HB2  2  
ATOM 3716  H HB3  . SER B 1 25 ? 6.556   -2.347  -13.477 1.00 0.30  ? 25 SER B HB3  2  
ATOM 3717  H HG   . SER B 1 25 ? 4.421   -3.192  -14.975 1.00 0.88  ? 25 SER B HG   2  
ATOM 3718  N N    . VAL B 1 26 ? 3.063   -3.357  -12.115 1.00 0.25  ? 26 VAL B N    2  
ATOM 3719  C CA   . VAL B 1 26 ? 1.631   -3.756  -12.079 1.00 0.24  ? 26 VAL B CA   2  
ATOM 3720  C C    . VAL B 1 26 ? 0.769   -2.587  -12.553 1.00 0.25  ? 26 VAL B C    2  
ATOM 3721  O O    . VAL B 1 26 ? 1.156   -1.435  -12.476 1.00 0.26  ? 26 VAL B O    2  
ATOM 3722  C CB   . VAL B 1 26 ? 1.206   -4.142  -10.654 1.00 0.23  ? 26 VAL B CB   2  
ATOM 3723  C CG1  . VAL B 1 26 ? 1.899   -3.248  -9.641  1.00 0.25  ? 26 VAL B CG1  2  
ATOM 3724  C CG2  . VAL B 1 26 ? -0.314  -3.993  -10.508 1.00 0.26  ? 26 VAL B CG2  2  
ATOM 3725  H H    . VAL B 1 26 ? 3.298   -2.410  -12.044 1.00 0.25  ? 26 VAL B H    2  
ATOM 3726  H HA   . VAL B 1 26 ? 1.486   -4.601  -12.735 1.00 0.24  ? 26 VAL B HA   2  
ATOM 3727  H HB   . VAL B 1 26 ? 1.485   -5.156  -10.464 1.00 0.25  ? 26 VAL B HB   2  
ATOM 3728  H HG11 . VAL B 1 26 ? 2.930   -3.117  -9.930  1.00 1.08  ? 26 VAL B HG11 2  
ATOM 3729  H HG12 . VAL B 1 26 ? 1.404   -2.292  -9.615  1.00 1.00  ? 26 VAL B HG12 2  
ATOM 3730  H HG13 . VAL B 1 26 ? 1.852   -3.712  -8.670  1.00 1.01  ? 26 VAL B HG13 2  
ATOM 3731  H HG21 . VAL B 1 26 ? -0.808  -4.577  -11.271 1.00 1.05  ? 26 VAL B HG21 2  
ATOM 3732  H HG22 . VAL B 1 26 ? -0.620  -4.335  -9.537  1.00 1.04  ? 26 VAL B HG22 2  
ATOM 3733  H HG23 . VAL B 1 26 ? -0.584  -2.951  -10.626 1.00 1.04  ? 26 VAL B HG23 2  
ATOM 3734  N N    . ASN B 1 27 ? -0.411  -2.887  -13.017 1.00 0.25  ? 27 ASN B N    2  
ATOM 3735  C CA   . ASN B 1 27 ? -1.336  -1.835  -13.475 1.00 0.27  ? 27 ASN B CA   2  
ATOM 3736  C C    . ASN B 1 27 ? -2.681  -2.011  -12.781 1.00 0.25  ? 27 ASN B C    2  
ATOM 3737  O O    . ASN B 1 27 ? -3.243  -3.090  -12.756 1.00 0.42  ? 27 ASN B O    2  
ATOM 3738  C CB   . ASN B 1 27 ? -1.528  -1.894  -14.982 1.00 0.30  ? 27 ASN B CB   2  
ATOM 3739  C CG   . ASN B 1 27 ? -0.603  -2.930  -15.641 1.00 0.57  ? 27 ASN B CG   2  
ATOM 3740  O OD1  . ASN B 1 27 ? 0.607   -2.840  -15.538 1.00 0.94  ? 27 ASN B OD1  2  
ATOM 3741  N ND2  . ASN B 1 27 ? -1.123  -3.906  -16.332 1.00 0.72  ? 27 ASN B ND2  2  
ATOM 3742  H H    . ASN B 1 27 ? -0.694  -3.817  -13.049 1.00 0.26  ? 27 ASN B H    2  
ATOM 3743  H HA   . ASN B 1 27 ? -0.933  -0.880  -13.210 1.00 0.30  ? 27 ASN B HA   2  
ATOM 3744  H HB2  . ASN B 1 27 ? -2.558  -2.131  -15.203 1.00 0.46  ? 27 ASN B HB2  2  
ATOM 3745  H HB3  . ASN B 1 27 ? -1.297  -0.936  -15.368 1.00 0.51  ? 27 ASN B HB3  2  
ATOM 3746  H HD21 . ASN B 1 27 ? -2.095  -3.975  -16.428 1.00 0.75  ? 27 ASN B HD21 2  
ATOM 3747  H HD22 . ASN B 1 27 ? -0.541  -4.570  -16.754 1.00 0.99  ? 27 ASN B HD22 2  
ATOM 3748  N N    . VAL B 1 28 ? -3.197  -0.956  -12.214 1.00 0.28  ? 28 VAL B N    2  
ATOM 3749  C CA   . VAL B 1 28 ? -4.507  -1.051  -11.506 1.00 0.29  ? 28 VAL B CA   2  
ATOM 3750  C C    . VAL B 1 28 ? -5.524  -0.112  -12.162 1.00 0.31  ? 28 VAL B C    2  
ATOM 3751  O O    . VAL B 1 28 ? -5.319  1.081   -12.245 1.00 0.33  ? 28 VAL B O    2  
ATOM 3752  C CB   . VAL B 1 28 ? -4.319  -0.689  -10.025 1.00 0.34  ? 28 VAL B CB   2  
ATOM 3753  C CG1  . VAL B 1 28 ? -3.752  0.725   -9.889  1.00 0.55  ? 28 VAL B CG1  2  
ATOM 3754  C CG2  . VAL B 1 28 ? -5.665  -0.772  -9.293  1.00 0.72  ? 28 VAL B CG2  2  
ATOM 3755  H H    . VAL B 1 28 ? -2.717  -0.100  -12.254 1.00 0.44  ? 28 VAL B H    2  
ATOM 3756  H HA   . VAL B 1 28 ? -4.865  -2.068  -11.579 1.00 0.28  ? 28 VAL B HA   2  
ATOM 3757  H HB   . VAL B 1 28 ? -3.630  -1.384  -9.581  1.00 0.31  ? 28 VAL B HB   2  
ATOM 3758  H HG11 . VAL B 1 28 ? -3.127  0.946   -10.741 1.00 1.25  ? 28 VAL B HG11 2  
ATOM 3759  H HG12 . VAL B 1 28 ? -4.562  1.437   -9.841  1.00 1.09  ? 28 VAL B HG12 2  
ATOM 3760  H HG13 . VAL B 1 28 ? -3.162  0.787   -8.987  1.00 1.22  ? 28 VAL B HG13 2  
ATOM 3761  H HG21 . VAL B 1 28 ? -6.388  -0.145  -9.794  1.00 1.29  ? 28 VAL B HG21 2  
ATOM 3762  H HG22 . VAL B 1 28 ? -6.013  -1.794  -9.295  1.00 1.29  ? 28 VAL B HG22 2  
ATOM 3763  H HG23 . VAL B 1 28 ? -5.542  -0.436  -8.274  1.00 1.29  ? 28 VAL B HG23 2  
ATOM 3764  N N    . LYS B 1 29 ? -6.617  -0.661  -12.626 1.00 0.35  ? 29 LYS B N    2  
ATOM 3765  C CA   . LYS B 1 29 ? -7.671  0.162   -13.292 1.00 0.42  ? 29 LYS B CA   2  
ATOM 3766  C C    . LYS B 1 29 ? -9.015  -0.061  -12.578 1.00 0.37  ? 29 LYS B C    2  
ATOM 3767  O O    . LYS B 1 29 ? -9.238  -1.082  -11.955 1.00 0.35  ? 29 LYS B O    2  
ATOM 3768  C CB   . LYS B 1 29 ? -7.751  -0.262  -14.771 1.00 0.52  ? 29 LYS B CB   2  
ATOM 3769  C CG   . LYS B 1 29 ? -9.043  0.242   -15.432 1.00 1.08  ? 29 LYS B CG   2  
ATOM 3770  C CD   . LYS B 1 29 ? -8.843  1.660   -15.978 1.00 0.83  ? 29 LYS B CD   2  
ATOM 3771  C CE   . LYS B 1 29 ? -7.868  1.640   -17.161 1.00 0.77  ? 29 LYS B CE   2  
ATOM 3772  N NZ   . LYS B 1 29 ? -8.339  0.672   -18.197 1.00 1.23  ? 29 LYS B NZ   2  
ATOM 3773  H H    . LYS B 1 29 ? -6.745  -1.625  -12.539 1.00 0.35  ? 29 LYS B H    2  
ATOM 3774  H HA   . LYS B 1 29 ? -7.402  1.206   -13.231 1.00 0.52  ? 29 LYS B HA   2  
ATOM 3775  H HB2  . LYS B 1 29 ? -6.902  0.143   -15.301 1.00 1.13  ? 29 LYS B HB2  2  
ATOM 3776  H HB3  . LYS B 1 29 ? -7.720  -1.337  -14.831 1.00 0.82  ? 29 LYS B HB3  2  
ATOM 3777  H HG2  . LYS B 1 29 ? -9.305  -0.418  -16.244 1.00 1.70  ? 29 LYS B HG2  2  
ATOM 3778  H HG3  . LYS B 1 29 ? -9.840  0.247   -14.709 1.00 2.02  ? 29 LYS B HG3  2  
ATOM 3779  H HD2  . LYS B 1 29 ? -9.794  2.052   -16.306 1.00 1.42  ? 29 LYS B HD2  2  
ATOM 3780  H HD3  . LYS B 1 29 ? -8.447  2.290   -15.200 1.00 1.53  ? 29 LYS B HD3  2  
ATOM 3781  H HE2  . LYS B 1 29 ? -7.812  2.627   -17.593 1.00 1.30  ? 29 LYS B HE2  2  
ATOM 3782  H HE3  . LYS B 1 29 ? -6.890  1.345   -16.813 1.00 1.10  ? 29 LYS B HE3  2  
ATOM 3783  H HZ1  . LYS B 1 29 ? -9.372  0.742   -18.297 1.00 1.54  ? 29 LYS B HZ1  2  
ATOM 3784  H HZ2  . LYS B 1 29 ? -7.887  0.894   -19.107 1.00 1.71  ? 29 LYS B HZ2  2  
ATOM 3785  H HZ3  . LYS B 1 29 ? -8.084  -0.294  -17.912 1.00 1.80  ? 29 LYS B HZ3  2  
ATOM 3786  N N    . SER B 1 30 ? -9.899  0.905   -12.660 1.00 0.39  ? 30 SER B N    2  
ATOM 3787  C CA   . SER B 1 30 ? -11.232 0.792   -11.988 1.00 0.39  ? 30 SER B CA   2  
ATOM 3788  C C    . SER B 1 30 ? -12.260 0.136   -12.943 1.00 0.34  ? 30 SER B C    2  
ATOM 3789  O O    . SER B 1 30 ? -11.921 -0.218  -14.057 1.00 0.35  ? 30 SER B O    2  
ATOM 3790  C CB   . SER B 1 30 ? -11.682 2.204   -11.598 1.00 0.52  ? 30 SER B CB   2  
ATOM 3791  O OG   . SER B 1 30 ? -11.810 2.283   -10.185 1.00 1.63  ? 30 SER B OG   2  
ATOM 3792  H H    . SER B 1 30 ? -9.679  1.719   -13.161 1.00 0.43  ? 30 SER B H    2  
ATOM 3793  H HA   . SER B 1 30 ? -11.134 0.189   -11.098 1.00 0.41  ? 30 SER B HA   2  
ATOM 3794  H HB2  . SER B 1 30 ? -10.943 2.918   -11.924 1.00 0.91  ? 30 SER B HB2  2  
ATOM 3795  H HB3  . SER B 1 30 ? -12.626 2.425   -12.071 1.00 0.92  ? 30 SER B HB3  2  
ATOM 3796  H HG   . SER B 1 30 ? -11.433 3.119   -9.899  1.00 2.13  ? 30 SER B HG   2  
ATOM 3797  N N    . PRO B 1 31 ? -13.490 -0.021  -12.475 1.00 0.39  ? 31 PRO B N    2  
ATOM 3798  C CA   . PRO B 1 31 ? -14.581 -0.648  -13.266 1.00 0.44  ? 31 PRO B CA   2  
ATOM 3799  C C    . PRO B 1 31 ? -15.117 0.306   -14.342 1.00 0.52  ? 31 PRO B C    2  
ATOM 3800  O O    . PRO B 1 31 ? -14.584 1.382   -14.548 1.00 0.59  ? 31 PRO B O    2  
ATOM 3801  C CB   . PRO B 1 31 ? -15.653 -0.959  -12.216 1.00 0.52  ? 31 PRO B CB   2  
ATOM 3802  C CG   . PRO B 1 31 ? -15.384 -0.022  -11.019 1.00 0.56  ? 31 PRO B CG   2  
ATOM 3803  C CD   . PRO B 1 31 ? -13.910 0.412   -11.121 1.00 0.49  ? 31 PRO B CD   2  
ATOM 3804  H HA   . PRO B 1 31 ? -14.239 -1.564  -13.719 1.00 0.44  ? 31 PRO B HA   2  
ATOM 3805  H HB2  . PRO B 1 31 ? -16.637 -0.772  -12.625 1.00 0.58  ? 31 PRO B HB2  2  
ATOM 3806  H HB3  . PRO B 1 31 ? -15.573 -1.985  -11.897 1.00 0.55  ? 31 PRO B HB3  2  
ATOM 3807  H HG2  . PRO B 1 31 ? -16.033 0.842   -11.073 1.00 0.62  ? 31 PRO B HG2  2  
ATOM 3808  H HG3  . PRO B 1 31 ? -15.545 -0.549  -10.091 1.00 0.64  ? 31 PRO B HG3  2  
ATOM 3809  H HD2  . PRO B 1 31 ? -13.830 1.485   -11.023 1.00 0.54  ? 31 PRO B HD2  2  
ATOM 3810  H HD3  . PRO B 1 31 ? -13.316 -0.085  -10.370 1.00 0.52  ? 31 PRO B HD3  2  
ATOM 3811  N N    . GLY B 1 32 ? -16.167 -0.081  -15.038 1.00 0.59  ? 32 GLY B N    2  
ATOM 3812  C CA   . GLY B 1 32 ? -16.719 0.814   -16.102 1.00 0.72  ? 32 GLY B CA   2  
ATOM 3813  C C    . GLY B 1 32 ? -17.597 0.012   -17.072 1.00 0.91  ? 32 GLY B C    2  
ATOM 3814  O O    . GLY B 1 32 ? -18.809 0.100   -17.013 1.00 1.05  ? 32 GLY B O    2  
ATOM 3815  H H    . GLY B 1 32 ? -16.588 -0.959  -14.859 1.00 0.60  ? 32 GLY B H    2  
ATOM 3816  H HA2  . GLY B 1 32 ? -17.312 1.591   -15.642 1.00 0.72  ? 32 GLY B HA2  2  
ATOM 3817  H HA3  . GLY B 1 32 ? -15.905 1.264   -16.650 1.00 0.77  ? 32 GLY B HA3  2  
ATOM 3818  N N    . PRO B 1 33 ? -16.960 -0.745  -17.944 1.00 1.05  ? 33 PRO B N    2  
ATOM 3819  C CA   . PRO B 1 33 ? -17.669 -1.570  -18.944 1.00 1.30  ? 33 PRO B CA   2  
ATOM 3820  C C    . PRO B 1 33 ? -18.311 -2.800  -18.283 1.00 1.12  ? 33 PRO B C    2  
ATOM 3821  O O    . PRO B 1 33 ? -18.524 -2.826  -17.084 1.00 1.13  ? 33 PRO B O    2  
ATOM 3822  C CB   . PRO B 1 33 ? -16.563 -1.964  -19.934 1.00 1.62  ? 33 PRO B CB   2  
ATOM 3823  C CG   . PRO B 1 33 ? -15.226 -1.825  -19.176 1.00 1.55  ? 33 PRO B CG   2  
ATOM 3824  C CD   . PRO B 1 33 ? -15.482 -0.854  -18.010 1.00 1.17  ? 33 PRO B CD   2  
ATOM 3825  H HA   . PRO B 1 33 ? -18.418 -0.982  -19.450 1.00 1.48  ? 33 PRO B HA   2  
ATOM 3826  H HB2  . PRO B 1 33 ? -16.704 -2.985  -20.260 1.00 1.72  ? 33 PRO B HB2  2  
ATOM 3827  H HB3  . PRO B 1 33 ? -16.571 -1.298  -20.783 1.00 1.87  ? 33 PRO B HB3  2  
ATOM 3828  H HG2  . PRO B 1 33 ? -14.913 -2.788  -18.798 1.00 1.57  ? 33 PRO B HG2  2  
ATOM 3829  H HG3  . PRO B 1 33 ? -14.469 -1.417  -19.828 1.00 1.80  ? 33 PRO B HG3  2  
ATOM 3830  H HD2  . PRO B 1 33 ? -15.084 -1.261  -17.093 1.00 1.04  ? 33 PRO B HD2  2  
ATOM 3831  H HD3  . PRO B 1 33 ? -15.047 0.112   -18.219 1.00 1.24  ? 33 PRO B HD3  2  
ATOM 3832  N N    . HIS B 1 34 ? -18.639 -3.811  -19.056 1.00 1.15  ? 34 HIS B N    2  
ATOM 3833  C CA   . HIS B 1 34 ? -19.286 -5.035  -18.469 1.00 1.18  ? 34 HIS B CA   2  
ATOM 3834  C C    . HIS B 1 34 ? -18.374 -5.691  -17.428 1.00 1.19  ? 34 HIS B C    2  
ATOM 3835  O O    . HIS B 1 34 ? -18.856 -6.390  -16.556 1.00 1.29  ? 34 HIS B O    2  
ATOM 3836  C CB   . HIS B 1 34 ? -19.651 -6.053  -19.566 1.00 1.36  ? 34 HIS B CB   2  
ATOM 3837  C CG   . HIS B 1 34 ? -18.596 -6.096  -20.645 1.00 1.55  ? 34 HIS B CG   2  
ATOM 3838  N ND1  . HIS B 1 34 ? -18.921 -6.027  -21.990 1.00 2.08  ? 34 HIS B ND1  2  
ATOM 3839  C CD2  . HIS B 1 34 ? -17.228 -6.206  -20.597 1.00 2.02  ? 34 HIS B CD2  2  
ATOM 3840  C CE1  . HIS B 1 34 ? -17.775 -6.097  -22.689 1.00 2.64  ? 34 HIS B CE1  2  
ATOM 3841  N NE2  . HIS B 1 34 ? -16.713 -6.208  -21.889 1.00 2.66  ? 34 HIS B NE2  2  
ATOM 3842  H H    . HIS B 1 34 ? -18.474 -3.759  -20.020 1.00 1.28  ? 34 HIS B H    2  
ATOM 3843  H HA   . HIS B 1 34 ? -20.191 -4.727  -17.957 1.00 1.14  ? 34 HIS B HA   2  
ATOM 3844  H HB2  . HIS B 1 34 ? -19.742 -7.033  -19.124 1.00 1.72  ? 34 HIS B HB2  2  
ATOM 3845  H HB3  . HIS B 1 34 ? -20.597 -5.774  -20.006 1.00 1.68  ? 34 HIS B HB3  2  
ATOM 3846  H HD1  . HIS B 1 34 ? -19.824 -5.944  -22.364 1.00 2.31  ? 34 HIS B HD1  2  
ATOM 3847  H HD2  . HIS B 1 34 ? -16.641 -6.284  -19.694 1.00 2.23  ? 34 HIS B HD2  2  
ATOM 3848  H HE1  . HIS B 1 34 ? -17.721 -6.068  -23.768 1.00 3.25  ? 34 HIS B HE1  2  
ATOM 3849  N N    . CYS B 1 35 ? -17.081 -5.440  -17.457 1.00 1.22  ? 35 CYS B N    2  
ATOM 3850  C CA   . CYS B 1 35 ? -16.214 -6.024  -16.395 1.00 1.29  ? 35 CYS B CA   2  
ATOM 3851  C C    . CYS B 1 35 ? -16.741 -5.454  -15.084 1.00 1.07  ? 35 CYS B C    2  
ATOM 3852  O O    . CYS B 1 35 ? -16.987 -6.170  -14.130 1.00 1.13  ? 35 CYS B O    2  
ATOM 3853  C CB   . CYS B 1 35 ? -14.752 -5.610  -16.595 1.00 1.59  ? 35 CYS B CB   2  
ATOM 3854  S SG   . CYS B 1 35 ? -13.821 -5.913  -15.068 1.00 2.40  ? 35 CYS B SG   2  
ATOM 3855  H H    . CYS B 1 35 ? -16.702 -4.838  -18.130 1.00 1.28  ? 35 CYS B H    2  
ATOM 3856  H HA   . CYS B 1 35 ? -16.306 -7.100  -16.394 1.00 1.39  ? 35 CYS B HA   2  
ATOM 3857  H HB2  . CYS B 1 35 ? -14.322 -6.188  -17.397 1.00 1.86  ? 35 CYS B HB2  2  
ATOM 3858  H HB3  . CYS B 1 35 ? -14.705 -4.560  -16.842 1.00 1.86  ? 35 CYS B HB3  2  
ATOM 3859  N N    . ALA B 1 36 ? -16.973 -4.157  -15.079 1.00 0.96  ? 36 ALA B N    2  
ATOM 3860  C CA   . ALA B 1 36 ? -17.550 -3.467  -13.896 1.00 0.90  ? 36 ALA B CA   2  
ATOM 3861  C C    . ALA B 1 36 ? -16.838 -3.890  -12.604 1.00 0.86  ? 36 ALA B C    2  
ATOM 3862  O O    . ALA B 1 36 ? -17.406 -3.883  -11.528 1.00 1.18  ? 36 ALA B O    2  
ATOM 3863  C CB   . ALA B 1 36 ? -19.024 -3.813  -13.849 1.00 1.09  ? 36 ALA B CB   2  
ATOM 3864  H H    . ALA B 1 36 ? -16.804 -3.639  -15.889 1.00 1.03  ? 36 ALA B H    2  
ATOM 3865  H HA   . ALA B 1 36 ? -17.444 -2.400  -14.022 1.00 0.98  ? 36 ALA B HA   2  
ATOM 3866  H HB1  . ALA B 1 36 ? -19.425 -3.761  -14.854 1.00 1.38  ? 36 ALA B HB1  2  
ATOM 3867  H HB2  . ALA B 1 36 ? -19.141 -4.813  -13.468 1.00 1.61  ? 36 ALA B HB2  2  
ATOM 3868  H HB3  . ALA B 1 36 ? -19.536 -3.111  -13.217 1.00 1.51  ? 36 ALA B HB3  2  
ATOM 3869  N N    . GLN B 1 37 ? -15.585 -4.222  -12.721 1.00 0.93  ? 37 GLN B N    2  
ATOM 3870  C CA   . GLN B 1 37 ? -14.774 -4.619  -11.536 1.00 0.88  ? 37 GLN B CA   2  
ATOM 3871  C C    . GLN B 1 37 ? -13.469 -3.830  -11.580 1.00 0.71  ? 37 GLN B C    2  
ATOM 3872  O O    . GLN B 1 37 ? -13.291 -2.955  -12.404 1.00 0.74  ? 37 GLN B O    2  
ATOM 3873  C CB   . GLN B 1 37 ? -14.453 -6.122  -11.593 1.00 0.99  ? 37 GLN B CB   2  
ATOM 3874  C CG   . GLN B 1 37 ? -14.647 -6.776  -10.217 1.00 1.66  ? 37 GLN B CG   2  
ATOM 3875  C CD   . GLN B 1 37 ? -16.039 -6.441  -9.671  1.00 2.34  ? 37 GLN B CD   2  
ATOM 3876  O OE1  . GLN B 1 37 ? -16.165 -5.728  -8.696  1.00 2.83  ? 37 GLN B OE1  2  
ATOM 3877  N NE2  . GLN B 1 37 ? -17.098 -6.926  -10.264 1.00 3.07  ? 37 GLN B NE2  2  
ATOM 3878  H H    . GLN B 1 37 ? -15.166 -4.188  -13.600 1.00 1.26  ? 37 GLN B H    2  
ATOM 3879  H HA   . GLN B 1 37 ? -15.314 -4.385  -10.632 1.00 0.95  ? 37 GLN B HA   2  
ATOM 3880  H HB2  . GLN B 1 37 ? -15.100 -6.593  -12.303 1.00 1.38  ? 37 GLN B HB2  2  
ATOM 3881  H HB3  . GLN B 1 37 ? -13.428 -6.256  -11.906 1.00 1.44  ? 37 GLN B HB3  2  
ATOM 3882  H HG2  . GLN B 1 37 ? -14.552 -7.848  -10.317 1.00 2.21  ? 37 GLN B HG2  2  
ATOM 3883  H HG3  . GLN B 1 37 ? -13.893 -6.416  -9.532  1.00 2.02  ? 37 GLN B HG3  2  
ATOM 3884  H HE21 . GLN B 1 37 ? -16.999 -7.500  -11.053 1.00 3.26  ? 37 GLN B HE21 2  
ATOM 3885  H HE22 . GLN B 1 37 ? -17.991 -6.716  -9.920  1.00 3.72  ? 37 GLN B HE22 2  
ATOM 3886  N N    . THR B 1 38 ? -12.549 -4.134  -10.716 1.00 0.60  ? 38 THR B N    2  
ATOM 3887  C CA   . THR B 1 38 ? -11.262 -3.396  -10.729 1.00 0.44  ? 38 THR B CA   2  
ATOM 3888  C C    . THR B 1 38 ? -10.321 -3.997  -11.775 1.00 0.35  ? 38 THR B C    2  
ATOM 3889  O O    . THR B 1 38 ? -10.730 -4.710  -12.674 1.00 0.42  ? 38 THR B O    2  
ATOM 3890  C CB   . THR B 1 38 ? -10.599 -3.459  -9.345  1.00 0.44  ? 38 THR B CB   2  
ATOM 3891  O OG1  . THR B 1 38 ? -11.487 -4.034  -8.392  1.00 0.60  ? 38 THR B OG1  2  
ATOM 3892  C CG2  . THR B 1 38 ? -10.251 -2.039  -8.933  1.00 0.44  ? 38 THR B CG2  2  
ATOM 3893  H H    . THR B 1 38 ? -12.703 -4.845  -10.066 1.00 0.68  ? 38 THR B H    2  
ATOM 3894  H HA   . THR B 1 38 ? -11.453 -2.364  -10.981 1.00 0.44  ? 38 THR B HA   2  
ATOM 3895  H HB   . THR B 1 38 ? -9.686  -4.047  -9.396  1.00 0.40  ? 38 THR B HB   2  
ATOM 3896  H HG1  . THR B 1 38 ? -11.204 -4.938  -8.232  1.00 1.03  ? 38 THR B HG1  2  
ATOM 3897  H HG21 . THR B 1 38 ? -9.715  -1.559  -9.740  1.00 1.08  ? 38 THR B HG21 2  
ATOM 3898  H HG22 . THR B 1 38 ? -11.160 -1.494  -8.731  1.00 1.06  ? 38 THR B HG22 2  
ATOM 3899  H HG23 . THR B 1 38 ? -9.635  -2.062  -8.052  1.00 1.11  ? 38 THR B HG23 2  
ATOM 3900  N N    . GLU B 1 39 ? -9.057  -3.722  -11.637 1.00 0.25  ? 39 GLU B N    2  
ATOM 3901  C CA   . GLU B 1 39 ? -8.041  -4.261  -12.558 1.00 0.25  ? 39 GLU B CA   2  
ATOM 3902  C C    . GLU B 1 39 ? -6.758  -4.252  -11.790 1.00 0.21  ? 39 GLU B C    2  
ATOM 3903  O O    . GLU B 1 39 ? -6.468  -3.311  -11.076 1.00 0.35  ? 39 GLU B O    2  
ATOM 3904  C CB   . GLU B 1 39 ? -7.848  -3.388  -13.785 1.00 0.33  ? 39 GLU B CB   2  
ATOM 3905  C CG   . GLU B 1 39 ? -8.212  -4.174  -15.048 1.00 0.60  ? 39 GLU B CG   2  
ATOM 3906  C CD   . GLU B 1 39 ? -8.281  -3.222  -16.243 1.00 0.80  ? 39 GLU B CD   2  
ATOM 3907  O OE1  . GLU B 1 39 ? -7.235  -2.901  -16.783 1.00 1.40  ? 39 GLU B OE1  2  
ATOM 3908  O OE2  . GLU B 1 39 ? -9.380  -2.828  -16.598 1.00 1.47  ? 39 GLU B OE2  2  
ATOM 3909  H H    . GLU B 1 39 ? -8.759  -3.170  -10.884 1.00 0.25  ? 39 GLU B H    2  
ATOM 3910  H HA   . GLU B 1 39 ? -8.300  -5.265  -12.840 1.00 0.31  ? 39 GLU B HA   2  
ATOM 3911  H HB2  . GLU B 1 39 ? -8.473  -2.509  -13.707 1.00 0.30  ? 39 GLU B HB2  2  
ATOM 3912  H HB3  . GLU B 1 39 ? -6.801  -3.097  -13.826 1.00 0.41  ? 39 GLU B HB3  2  
ATOM 3913  H HG2  . GLU B 1 39 ? -7.460  -4.928  -15.231 1.00 0.87  ? 39 GLU B HG2  2  
ATOM 3914  H HG3  . GLU B 1 39 ? -9.172  -4.648  -14.912 1.00 0.84  ? 39 GLU B HG3  2  
ATOM 3915  N N    . VAL B 1 40 ? -6.019  -5.291  -11.865 1.00 0.15  ? 40 VAL B N    2  
ATOM 3916  C CA   . VAL B 1 40 ? -4.800  -5.341  -11.070 1.00 0.19  ? 40 VAL B CA   2  
ATOM 3917  C C    . VAL B 1 40 ? -3.815  -6.284  -11.751 1.00 0.19  ? 40 VAL B C    2  
ATOM 3918  O O    . VAL B 1 40 ? -3.651  -7.417  -11.349 1.00 0.22  ? 40 VAL B O    2  
ATOM 3919  C CB   . VAL B 1 40 ? -5.224  -5.852  -9.687  1.00 0.24  ? 40 VAL B CB   2  
ATOM 3920  C CG1  . VAL B 1 40 ? -5.529  -4.653  -8.795  1.00 0.28  ? 40 VAL B CG1  2  
ATOM 3921  C CG2  . VAL B 1 40 ? -6.518  -6.680  -9.819  1.00 0.24  ? 40 VAL B CG2  2  
ATOM 3922  H H    . VAL B 1 40 ? -6.289  -6.058  -12.391 1.00 0.22  ? 40 VAL B H    2  
ATOM 3923  H HA   . VAL B 1 40 ? -4.391  -4.342  -11.001 1.00 0.23  ? 40 VAL B HA   2  
ATOM 3924  H HB   . VAL B 1 40 ? -4.446  -6.464  -9.258  1.00 0.29  ? 40 VAL B HB   2  
ATOM 3925  H HG11 . VAL B 1 40 ? -5.020  -3.783  -9.178  1.00 1.04  ? 40 VAL B HG11 2  
ATOM 3926  H HG12 . VAL B 1 40 ? -6.599  -4.472  -8.801  1.00 1.02  ? 40 VAL B HG12 2  
ATOM 3927  H HG13 . VAL B 1 40 ? -5.204  -4.857  -7.792  1.00 0.98  ? 40 VAL B HG13 2  
ATOM 3928  H HG21 . VAL B 1 40 ? -6.386  -7.439  -10.573 1.00 1.08  ? 40 VAL B HG21 2  
ATOM 3929  H HG22 . VAL B 1 40 ? -6.754  -7.140  -8.877  1.00 0.98  ? 40 VAL B HG22 2  
ATOM 3930  H HG23 . VAL B 1 40 ? -7.331  -6.024  -10.112 1.00 1.00  ? 40 VAL B HG23 2  
ATOM 3931  N N    . ILE B 1 41 ? -3.200  -5.836  -12.816 1.00 0.22  ? 41 ILE B N    2  
ATOM 3932  C CA   . ILE B 1 41 ? -2.279  -6.711  -13.572 1.00 0.25  ? 41 ILE B CA   2  
ATOM 3933  C C    . ILE B 1 41 ? -0.818  -6.439  -13.219 1.00 0.23  ? 41 ILE B C    2  
ATOM 3934  O O    . ILE B 1 41 ? -0.319  -5.360  -13.414 1.00 0.25  ? 41 ILE B O    2  
ATOM 3935  C CB   . ILE B 1 41 ? -2.504  -6.442  -15.054 1.00 0.30  ? 41 ILE B CB   2  
ATOM 3936  C CG1  . ILE B 1 41 ? -3.692  -7.269  -15.547 1.00 0.50  ? 41 ILE B CG1  2  
ATOM 3937  C CG2  . ILE B 1 41 ? -1.261  -6.813  -15.857 1.00 0.67  ? 41 ILE B CG2  2  
ATOM 3938  C CD1  . ILE B 1 41 ? -3.427  -8.762  -15.330 1.00 0.54  ? 41 ILE B CD1  2  
ATOM 3939  H H    . ILE B 1 41 ? -3.378  -4.929  -13.144 1.00 0.27  ? 41 ILE B H    2  
ATOM 3940  H HA   . ILE B 1 41 ? -2.518  -7.735  -13.363 1.00 0.26  ? 41 ILE B HA   2  
ATOM 3941  H HB   . ILE B 1 41 ? -2.716  -5.387  -15.185 1.00 0.48  ? 41 ILE B HB   2  
ATOM 3942  H HG12 . ILE B 1 41 ? -4.583  -6.978  -15.012 1.00 0.70  ? 41 ILE B HG12 2  
ATOM 3943  H HG13 . ILE B 1 41 ? -3.826  -7.090  -16.590 1.00 0.68  ? 41 ILE B HG13 2  
ATOM 3944  H HG21 . ILE B 1 41 ? -0.975  -7.826  -15.622 1.00 1.41  ? 41 ILE B HG21 2  
ATOM 3945  H HG22 . ILE B 1 41 ? -1.480  -6.732  -16.911 1.00 1.13  ? 41 ILE B HG22 2  
ATOM 3946  H HG23 . ILE B 1 41 ? -0.456  -6.141  -15.602 1.00 1.24  ? 41 ILE B HG23 2  
ATOM 3947  H HD11 . ILE B 1 41 ? -2.380  -8.970  -15.495 1.00 1.11  ? 41 ILE B HD11 2  
ATOM 3948  H HD12 . ILE B 1 41 ? -3.692  -9.031  -14.319 1.00 1.15  ? 41 ILE B HD12 2  
ATOM 3949  H HD13 . ILE B 1 41 ? -4.022  -9.336  -16.023 1.00 1.12  ? 41 ILE B HD13 2  
ATOM 3950  N N    . ALA B 1 42 ? -0.118  -7.439  -12.766 1.00 0.22  ? 42 ALA B N    2  
ATOM 3951  C CA   . ALA B 1 42 ? 1.325   -7.271  -12.455 1.00 0.22  ? 42 ALA B CA   2  
ATOM 3952  C C    . ALA B 1 42 ? 2.121   -7.678  -13.682 1.00 0.24  ? 42 ALA B C    2  
ATOM 3953  O O    . ALA B 1 42 ? 2.135   -8.833  -14.065 1.00 0.25  ? 42 ALA B O    2  
ATOM 3954  C CB   . ALA B 1 42 ? 1.702   -8.154  -11.279 1.00 0.21  ? 42 ALA B CB   2  
ATOM 3955  H H    . ALA B 1 42 ? -0.538  -8.320  -12.672 1.00 0.23  ? 42 ALA B H    2  
ATOM 3956  H HA   . ALA B 1 42 ? 1.540   -6.249  -12.219 1.00 0.23  ? 42 ALA B HA   2  
ATOM 3957  H HB1  . ALA B 1 42 ? 1.429   -9.174  -11.497 1.00 1.01  ? 42 ALA B HB1  2  
ATOM 3958  H HB2  . ALA B 1 42 ? 2.765   -8.089  -11.113 1.00 1.02  ? 42 ALA B HB2  2  
ATOM 3959  H HB3  . ALA B 1 42 ? 1.175   -7.818  -10.399 1.00 1.07  ? 42 ALA B HB3  2  
ATOM 3960  N N    . THR B 1 43 ? 2.778   -6.741  -14.317 1.00 0.28  ? 43 THR B N    2  
ATOM 3961  C CA   . THR B 1 43 ? 3.553   -7.091  -15.527 1.00 0.32  ? 43 THR B CA   2  
ATOM 3962  C C    . THR B 1 43 ? 4.802   -7.856  -15.115 1.00 0.32  ? 43 THR B C    2  
ATOM 3963  O O    . THR B 1 43 ? 5.592   -7.405  -14.303 1.00 0.33  ? 43 THR B O    2  
ATOM 3964  C CB   . THR B 1 43 ? 3.965   -5.839  -16.305 1.00 0.35  ? 43 THR B CB   2  
ATOM 3965  O OG1  . THR B 1 43 ? 2.925   -4.870  -16.258 1.00 0.39  ? 43 THR B OG1  2  
ATOM 3966  C CG2  . THR B 1 43 ? 4.253   -6.223  -17.756 1.00 0.39  ? 43 THR B CG2  2  
ATOM 3967  H H    . THR B 1 43 ? 2.754   -5.814  -13.998 1.00 0.28  ? 43 THR B H    2  
ATOM 3968  H HA   . THR B 1 43 ? 2.937   -7.724  -16.153 1.00 0.33  ? 43 THR B HA   2  
ATOM 3969  H HB   . THR B 1 43 ? 4.863   -5.431  -15.871 1.00 0.35  ? 43 THR B HB   2  
ATOM 3970  H HG1  . THR B 1 43 ? 2.127   -5.267  -16.617 1.00 0.89  ? 43 THR B HG1  2  
ATOM 3971  H HG21 . THR B 1 43 ? 4.952   -7.049  -17.776 1.00 1.07  ? 43 THR B HG21 2  
ATOM 3972  H HG22 . THR B 1 43 ? 3.335   -6.519  -18.239 1.00 1.06  ? 43 THR B HG22 2  
ATOM 3973  H HG23 . THR B 1 43 ? 4.680   -5.379  -18.275 1.00 1.06  ? 43 THR B HG23 2  
ATOM 3974  N N    . LEU B 1 44 ? 4.961   -9.021  -15.663 1.00 0.32  ? 44 LEU B N    2  
ATOM 3975  C CA   . LEU B 1 44 ? 6.119   -9.873  -15.330 1.00 0.32  ? 44 LEU B CA   2  
ATOM 3976  C C    . LEU B 1 44 ? 7.406   -9.328  -15.958 1.00 0.37  ? 44 LEU B C    2  
ATOM 3977  O O    . LEU B 1 44 ? 7.367   -8.594  -16.930 1.00 0.40  ? 44 LEU B O    2  
ATOM 3978  C CB   . LEU B 1 44 ? 5.836   -11.249 -15.900 1.00 0.34  ? 44 LEU B CB   2  
ATOM 3979  C CG   . LEU B 1 44 ? 5.255   -12.149 -14.823 1.00 0.33  ? 44 LEU B CG   2  
ATOM 3980  C CD1  . LEU B 1 44 ? 6.422   -12.825 -14.116 1.00 0.35  ? 44 LEU B CD1  2  
ATOM 3981  C CD2  . LEU B 1 44 ? 4.404   -11.328 -13.822 1.00 0.29  ? 44 LEU B CD2  2  
ATOM 3982  H H    . LEU B 1 44 ? 4.291   -9.356  -16.292 1.00 0.33  ? 44 LEU B H    2  
ATOM 3983  H HA   . LEU B 1 44 ? 6.218   -9.934  -14.253 1.00 0.30  ? 44 LEU B HA   2  
ATOM 3984  H HB2  . LEU B 1 44 ? 5.129   -11.157 -16.706 1.00 0.37  ? 44 LEU B HB2  2  
ATOM 3985  H HB3  . LEU B 1 44 ? 6.754   -11.677 -16.272 1.00 0.37  ? 44 LEU B HB3  2  
ATOM 3986  H HG   . LEU B 1 44 ? 4.636   -12.895 -15.295 1.00 0.35  ? 44 LEU B HG   2  
ATOM 3987  H HD11 . LEU B 1 44 ? 7.160   -12.079 -13.858 1.00 1.19  ? 44 LEU B HD11 2  
ATOM 3988  H HD12 . LEU B 1 44 ? 6.075   -13.317 -13.226 1.00 1.02  ? 44 LEU B HD12 2  
ATOM 3989  H HD13 . LEU B 1 44 ? 6.869   -13.551 -14.783 1.00 1.02  ? 44 LEU B HD13 2  
ATOM 3990  H HD21 . LEU B 1 44 ? 3.736   -10.673 -14.365 1.00 1.02  ? 44 LEU B HD21 2  
ATOM 3991  H HD22 . LEU B 1 44 ? 3.822   -11.996 -13.204 1.00 1.04  ? 44 LEU B HD22 2  
ATOM 3992  H HD23 . LEU B 1 44 ? 5.052   -10.733 -13.194 1.00 1.02  ? 44 LEU B HD23 2  
ATOM 3993  N N    . LYS B 1 45 ? 8.544   -9.732  -15.419 1.00 0.38  ? 45 LYS B N    2  
ATOM 3994  C CA   . LYS B 1 45 ? 9.871   -9.302  -15.937 1.00 0.44  ? 45 LYS B CA   2  
ATOM 3995  C C    . LYS B 1 45 ? 10.011  -9.634  -17.412 1.00 0.49  ? 45 LYS B C    2  
ATOM 3996  O O    . LYS B 1 45 ? 10.539  -8.852  -18.181 1.00 0.54  ? 45 LYS B O    2  
ATOM 3997  C CB   . LYS B 1 45 ? 10.941  -10.058 -15.162 1.00 0.45  ? 45 LYS B CB   2  
ATOM 3998  C CG   . LYS B 1 45 ? 11.923  -9.077  -14.512 1.00 0.47  ? 45 LYS B CG   2  
ATOM 3999  C CD   . LYS B 1 45 ? 13.352  -9.407  -14.954 1.00 0.72  ? 45 LYS B CD   2  
ATOM 4000  C CE   . LYS B 1 45 ? 13.937  -10.488 -14.040 1.00 1.05  ? 45 LYS B CE   2  
ATOM 4001  N NZ   . LYS B 1 45 ? 15.419  -10.533 -14.204 1.00 1.42  ? 45 LYS B NZ   2  
ATOM 4002  H H    . LYS B 1 45 ? 8.529   -10.355 -14.670 1.00 0.37  ? 45 LYS B H    2  
ATOM 4003  H HA   . LYS B 1 45 ? 9.996   -8.243  -15.788 1.00 0.45  ? 45 LYS B HA   2  
ATOM 4004  H HB2  . LYS B 1 45 ? 10.467  -10.646 -14.394 1.00 0.41  ? 45 LYS B HB2  2  
ATOM 4005  H HB3  . LYS B 1 45 ? 11.449  -10.711 -15.828 1.00 0.49  ? 45 LYS B HB3  2  
ATOM 4006  H HG2  . LYS B 1 45 ? 11.678  -8.069  -14.814 1.00 0.52  ? 45 LYS B HG2  2  
ATOM 4007  H HG3  . LYS B 1 45 ? 11.855  -9.157  -13.438 1.00 0.54  ? 45 LYS B HG3  2  
ATOM 4008  H HD2  . LYS B 1 45 ? 13.342  -9.764  -15.973 1.00 0.99  ? 45 LYS B HD2  2  
ATOM 4009  H HD3  . LYS B 1 45 ? 13.962  -8.518  -14.890 1.00 0.93  ? 45 LYS B HD3  2  
ATOM 4010  H HE2  . LYS B 1 45 ? 13.697  -10.259 -13.012 1.00 1.47  ? 45 LYS B HE2  2  
ATOM 4011  H HE3  . LYS B 1 45 ? 13.517  -11.448 -14.303 1.00 1.41  ? 45 LYS B HE3  2  
ATOM 4012  H HZ1  . LYS B 1 45 ? 15.812  -9.579  -14.080 1.00 1.87  ? 45 LYS B HZ1  2  
ATOM 4013  H HZ2  . LYS B 1 45 ? 15.826  -11.171 -13.489 1.00 1.73  ? 45 LYS B HZ2  2  
ATOM 4014  H HZ3  . LYS B 1 45 ? 15.652  -10.882 -15.155 1.00 1.95  ? 45 LYS B HZ3  2  
ATOM 4015  N N    . ASN B 1 46 ? 9.541   -10.783 -17.816 1.00 0.49  ? 46 ASN B N    2  
ATOM 4016  C CA   . ASN B 1 46 ? 9.647   -11.157 -19.256 1.00 0.55  ? 46 ASN B CA   2  
ATOM 4017  C C    . ASN B 1 46 ? 8.656   -10.319 -20.096 1.00 0.58  ? 46 ASN B C    2  
ATOM 4018  O O    . ASN B 1 46 ? 8.526   -10.516 -21.290 1.00 0.75  ? 46 ASN B O    2  
ATOM 4019  C CB   . ASN B 1 46 ? 9.347   -12.652 -19.411 1.00 0.58  ? 46 ASN B CB   2  
ATOM 4020  C CG   . ASN B 1 46 ? 7.880   -12.934 -19.073 1.00 0.78  ? 46 ASN B CG   2  
ATOM 4021  O OD1  . ASN B 1 46 ? 7.011   -12.735 -19.895 1.00 1.67  ? 46 ASN B OD1  2  
ATOM 4022  N ND2  . ASN B 1 46 ? 7.570   -13.397 -17.891 1.00 0.81  ? 46 ASN B ND2  2  
ATOM 4023  H H    . ASN B 1 46 ? 9.112   -11.398 -17.171 1.00 0.47  ? 46 ASN B H    2  
ATOM 4024  H HA   . ASN B 1 46 ? 10.652  -10.961 -19.599 1.00 0.62  ? 46 ASN B HA   2  
ATOM 4025  H HB2  . ASN B 1 46 ? 9.543   -12.947 -20.424 1.00 0.73  ? 46 ASN B HB2  2  
ATOM 4026  H HB3  . ASN B 1 46 ? 9.982   -13.215 -18.744 1.00 0.75  ? 46 ASN B HB3  2  
ATOM 4027  H HD21 . ASN B 1 46 ? 8.273   -13.559 -17.227 1.00 1.39  ? 46 ASN B HD21 2  
ATOM 4028  H HD22 . ASN B 1 46 ? 6.635   -13.583 -17.669 1.00 0.88  ? 46 ASN B HD22 2  
ATOM 4029  N N    . GLY B 1 47 ? 7.952   -9.395  -19.474 1.00 0.50  ? 47 GLY B N    2  
ATOM 4030  C CA   . GLY B 1 47 ? 6.966   -8.554  -20.206 1.00 0.53  ? 47 GLY B CA   2  
ATOM 4031  C C    . GLY B 1 47 ? 5.642   -9.306  -20.264 1.00 0.52  ? 47 GLY B C    2  
ATOM 4032  O O    . GLY B 1 47 ? 4.910   -9.225  -21.232 1.00 0.60  ? 47 GLY B O    2  
ATOM 4033  H H    . GLY B 1 47 ? 8.060   -9.263  -18.512 1.00 0.52  ? 47 GLY B H    2  
ATOM 4034  H HA2  . GLY B 1 47 ? 6.826   -7.619  -19.675 1.00 0.53  ? 47 GLY B HA2  2  
ATOM 4035  H HA3  . GLY B 1 47 ? 7.314   -8.357  -21.204 1.00 0.59  ? 47 GLY B HA3  2  
ATOM 4036  N N    . ARG B 1 48 ? 5.331   -10.029 -19.217 1.00 0.47  ? 48 ARG B N    2  
ATOM 4037  C CA   . ARG B 1 48 ? 4.050   -10.787 -19.175 1.00 0.54  ? 48 ARG B CA   2  
ATOM 4038  C C    . ARG B 1 48 ? 3.113   -10.065 -18.222 1.00 0.43  ? 48 ARG B C    2  
ATOM 4039  O O    . ARG B 1 48 ? 3.353   -8.933  -17.861 1.00 0.37  ? 48 ARG B O    2  
ATOM 4040  C CB   . ARG B 1 48 ? 4.310   -12.215 -18.681 1.00 0.66  ? 48 ARG B CB   2  
ATOM 4041  C CG   . ARG B 1 48 ? 4.163   -13.187 -19.851 1.00 1.00  ? 48 ARG B CG   2  
ATOM 4042  C CD   . ARG B 1 48 ? 4.619   -14.585 -19.426 1.00 1.55  ? 48 ARG B CD   2  
ATOM 4043  N NE   . ARG B 1 48 ? 4.154   -15.585 -20.432 1.00 2.08  ? 48 ARG B NE   2  
ATOM 4044  C CZ   . ARG B 1 48 ? 4.142   -16.859 -20.135 1.00 2.34  ? 48 ARG B CZ   2  
ATOM 4045  N NH1  . ARG B 1 48 ? 3.301   -17.315 -19.243 1.00 2.89  ? 48 ARG B NH1  2  
ATOM 4046  N NH2  . ARG B 1 48 ? 4.966   -17.678 -20.738 1.00 2.67  ? 48 ARG B NH2  2  
ATOM 4047  H H    . ARG B 1 48 ? 5.944   -10.058 -18.443 1.00 0.43  ? 48 ARG B H    2  
ATOM 4048  H HA   . ARG B 1 48 ? 3.605   -10.818 -20.158 1.00 0.68  ? 48 ARG B HA   2  
ATOM 4049  H HB2  . ARG B 1 48 ? 5.309   -12.280 -18.280 1.00 1.19  ? 48 ARG B HB2  2  
ATOM 4050  H HB3  . ARG B 1 48 ? 3.597   -12.469 -17.912 1.00 1.23  ? 48 ARG B HB3  2  
ATOM 4051  H HG2  . ARG B 1 48 ? 3.128   -13.221 -20.156 1.00 1.43  ? 48 ARG B HG2  2  
ATOM 4052  H HG3  . ARG B 1 48 ? 4.771   -12.846 -20.675 1.00 1.63  ? 48 ARG B HG3  2  
ATOM 4053  H HD2  . ARG B 1 48 ? 5.696   -14.610 -19.364 1.00 1.85  ? 48 ARG B HD2  2  
ATOM 4054  H HD3  . ARG B 1 48 ? 4.198   -14.823 -18.459 1.00 1.85  ? 48 ARG B HD3  2  
ATOM 4055  H HE   . ARG B 1 48 ? 3.857   -15.287 -21.317 1.00 2.46  ? 48 ARG B HE   2  
ATOM 4056  H HH11 . ARG B 1 48 ? 2.668   -16.689 -18.786 1.00 3.28  ? 48 ARG B HH11 2  
ATOM 4057  H HH12 . ARG B 1 48 ? 3.289   -18.289 -19.017 1.00 3.24  ? 48 ARG B HH12 2  
ATOM 4058  H HH21 . ARG B 1 48 ? 5.605   -17.330 -21.424 1.00 2.93  ? 48 ARG B HH21 2  
ATOM 4059  H HH22 . ARG B 1 48 ? 4.956   -18.653 -20.513 1.00 3.04  ? 48 ARG B HH22 2  
ATOM 4060  N N    . LYS B 1 49 ? 2.047   -10.686 -17.813 1.00 0.45  ? 49 LYS B N    2  
ATOM 4061  C CA   . LYS B 1 49 ? 1.120   -9.994  -16.884 1.00 0.40  ? 49 LYS B CA   2  
ATOM 4062  C C    . LYS B 1 49 ? 0.284   -10.991 -16.092 1.00 0.38  ? 49 LYS B C    2  
ATOM 4063  O O    . LYS B 1 49 ? -0.043  -12.070 -16.552 1.00 0.54  ? 49 LYS B O    2  
ATOM 4064  C CB   . LYS B 1 49 ? 0.180   -9.087  -17.670 1.00 0.58  ? 49 LYS B CB   2  
ATOM 4065  C CG   . LYS B 1 49 ? -0.167  -9.728  -19.022 1.00 0.88  ? 49 LYS B CG   2  
ATOM 4066  C CD   . LYS B 1 49 ? -1.660  -9.564  -19.313 1.00 0.96  ? 49 LYS B CD   2  
ATOM 4067  C CE   . LYS B 1 49 ? -2.487  -10.370 -18.304 1.00 0.92  ? 49 LYS B CE   2  
ATOM 4068  N NZ   . LYS B 1 49 ? -3.306  -11.389 -19.024 1.00 1.06  ? 49 LYS B NZ   2  
ATOM 4069  H H    . LYS B 1 49 ? 1.855   -11.591 -18.119 1.00 0.55  ? 49 LYS B H    2  
ATOM 4070  H HA   . LYS B 1 49 ? 1.698   -9.391  -16.197 1.00 0.34  ? 49 LYS B HA   2  
ATOM 4071  H HB2  . LYS B 1 49 ? -0.723  -8.932  -17.098 1.00 0.59  ? 49 LYS B HB2  2  
ATOM 4072  H HB3  . LYS B 1 49 ? 0.665   -8.146  -17.833 1.00 0.69  ? 49 LYS B HB3  2  
ATOM 4073  H HG2  . LYS B 1 49 ? 0.404   -9.246  -19.803 1.00 1.06  ? 49 LYS B HG2  2  
ATOM 4074  H HG3  . LYS B 1 49 ? 0.077   -10.780 -18.997 1.00 1.13  ? 49 LYS B HG3  2  
ATOM 4075  H HD2  . LYS B 1 49 ? -1.925  -8.520  -19.239 1.00 0.98  ? 49 LYS B HD2  2  
ATOM 4076  H HD3  . LYS B 1 49 ? -1.870  -9.918  -20.311 1.00 1.23  ? 49 LYS B HD3  2  
ATOM 4077  H HE2  . LYS B 1 49 ? -1.827  -10.866 -17.609 1.00 0.97  ? 49 LYS B HE2  2  
ATOM 4078  H HE3  . LYS B 1 49 ? -3.141  -9.703  -17.763 1.00 0.86  ? 49 LYS B HE3  2  
ATOM 4079  H HZ1  . LYS B 1 49 ? -3.606  -11.011 -19.945 1.00 1.38  ? 49 LYS B HZ1  2  
ATOM 4080  H HZ2  . LYS B 1 49 ? -2.738  -12.249 -19.170 1.00 1.44  ? 49 LYS B HZ2  2  
ATOM 4081  H HZ3  . LYS B 1 49 ? -4.147  -11.619 -18.458 1.00 1.51  ? 49 LYS B HZ3  2  
ATOM 4082  N N    . ALA B 1 50 ? -0.081  -10.600 -14.906 1.00 0.27  ? 50 ALA B N    2  
ATOM 4083  C CA   . ALA B 1 50 ? -0.933  -11.472 -14.038 1.00 0.28  ? 50 ALA B CA   2  
ATOM 4084  C C    . ALA B 1 50 ? -1.910  -10.597 -13.285 1.00 0.24  ? 50 ALA B C    2  
ATOM 4085  O O    . ALA B 1 50 ? -1.638  -9.452  -13.047 1.00 0.21  ? 50 ALA B O    2  
ATOM 4086  C CB   . ALA B 1 50 ? -0.079  -12.191 -12.999 1.00 0.32  ? 50 ALA B CB   2  
ATOM 4087  H H    . ALA B 1 50 ? 0.197   -9.701  -14.591 1.00 0.29  ? 50 ALA B H    2  
ATOM 4088  H HA   . ALA B 1 50 ? -1.467  -12.193 -14.639 1.00 0.35  ? 50 ALA B HA   2  
ATOM 4089  H HB1  . ALA B 1 50 ? 0.448   -11.458 -12.405 1.00 1.08  ? 50 ALA B HB1  2  
ATOM 4090  H HB2  . ALA B 1 50 ? -0.720  -12.778 -12.355 1.00 1.03  ? 50 ALA B HB2  2  
ATOM 4091  H HB3  . ALA B 1 50 ? 0.626   -12.835 -13.494 1.00 1.05  ? 50 ALA B HB3  2  
ATOM 4092  N N    . CYS B 1 51 ? -3.008  -11.127 -12.841 1.00 0.25  ? 51 CYS B N    2  
ATOM 4093  C CA   . CYS B 1 51 ? -3.929  -10.297 -12.045 1.00 0.22  ? 51 CYS B CA   2  
ATOM 4094  C C    . CYS B 1 51 ? -3.902  -10.856 -10.646 1.00 0.22  ? 51 CYS B C    2  
ATOM 4095  O O    . CYS B 1 51 ? -3.691  -12.037 -10.463 1.00 0.25  ? 51 CYS B O    2  
ATOM 4096  C CB   . CYS B 1 51 ? -5.354  -10.352 -12.600 1.00 0.25  ? 51 CYS B CB   2  
ATOM 4097  S SG   . CYS B 1 51 ? -5.893  -8.679  -13.027 1.00 0.24  ? 51 CYS B SG   2  
ATOM 4098  H H    . CYS B 1 51 ? -3.198  -12.081 -12.974 1.00 0.28  ? 51 CYS B H    2  
ATOM 4099  H HA   . CYS B 1 51 ? -3.580  -9.277  -12.042 1.00 0.20  ? 51 CYS B HA   2  
ATOM 4100  H HB2  . CYS B 1 51 ? -5.375  -10.967 -13.479 1.00 0.28  ? 51 CYS B HB2  2  
ATOM 4101  H HB3  . CYS B 1 51 ? -6.019  -10.764 -11.855 1.00 0.27  ? 51 CYS B HB3  2  
ATOM 4102  N N    . LEU B 1 52 ? -4.087  -10.039 -9.659  1.00 0.21  ? 52 LEU B N    2  
ATOM 4103  C CA   . LEU B 1 52 ? -4.077  -10.551 -8.273  1.00 0.23  ? 52 LEU B CA   2  
ATOM 4104  C C    . LEU B 1 52 ? -5.274  -9.951  -7.545  1.00 0.25  ? 52 LEU B C    2  
ATOM 4105  O O    . LEU B 1 52 ? -5.919  -9.054  -8.048  1.00 0.25  ? 52 LEU B O    2  
ATOM 4106  C CB   . LEU B 1 52 ? -2.742  -10.245 -7.555  1.00 0.22  ? 52 LEU B CB   2  
ATOM 4107  C CG   . LEU B 1 52 ? -1.999  -9.082  -8.216  1.00 0.18  ? 52 LEU B CG   2  
ATOM 4108  C CD1  . LEU B 1 52 ? -1.544  -9.462  -9.638  1.00 0.17  ? 52 LEU B CD1  2  
ATOM 4109  C CD2  . LEU B 1 52 ? -2.919  -7.863  -8.225  1.00 0.18  ? 52 LEU B CD2  2  
ATOM 4110  H H    . LEU B 1 52 ? -4.227  -9.085  -9.827  1.00 0.20  ? 52 LEU B H    2  
ATOM 4111  H HA   . LEU B 1 52 ? -4.211  -11.606 -8.311  1.00 0.26  ? 52 LEU B HA   2  
ATOM 4112  H HB2  . LEU B 1 52 ? -2.943  -9.996  -6.528  1.00 0.25  ? 52 LEU B HB2  2  
ATOM 4113  H HB3  . LEU B 1 52 ? -2.117  -11.126 -7.585  1.00 0.24  ? 52 LEU B HB3  2  
ATOM 4114  H HG   . LEU B 1 52 ? -1.133  -8.855  -7.644  1.00 0.19  ? 52 LEU B HG   2  
ATOM 4115  H HD11 . LEU B 1 52 ? -1.643  -10.532 -9.774  1.00 0.98  ? 52 LEU B HD11 2  
ATOM 4116  H HD12 . LEU B 1 52 ? -2.155  -8.953  -10.367 1.00 0.95  ? 52 LEU B HD12 2  
ATOM 4117  H HD13 . LEU B 1 52 ? -0.510  -9.182  -9.776  1.00 1.00  ? 52 LEU B HD13 2  
ATOM 4118  H HD21 . LEU B 1 52 ? -3.822  -8.097  -7.675  1.00 1.01  ? 52 LEU B HD21 2  
ATOM 4119  H HD22 . LEU B 1 52 ? -2.419  -7.035  -7.751  1.00 0.96  ? 52 LEU B HD22 2  
ATOM 4120  H HD23 . LEU B 1 52 ? -3.171  -7.610  -9.238  1.00 0.97  ? 52 LEU B HD23 2  
ATOM 4121  N N    . ASN B 1 53 ? -5.606  -10.461 -6.396  1.00 0.29  ? 53 ASN B N    2  
ATOM 4122  C CA   . ASN B 1 53 ? -6.796  -9.937  -5.664  1.00 0.33  ? 53 ASN B CA   2  
ATOM 4123  C C    . ASN B 1 53 ? -6.376  -8.843  -4.672  1.00 0.34  ? 53 ASN B C    2  
ATOM 4124  O O    . ASN B 1 53 ? -6.009  -9.167  -3.568  1.00 0.37  ? 53 ASN B O    2  
ATOM 4125  C CB   . ASN B 1 53 ? -7.450  -11.081 -4.874  1.00 0.37  ? 53 ASN B CB   2  
ATOM 4126  C CG   . ASN B 1 53 ? -8.511  -11.773 -5.731  1.00 0.43  ? 53 ASN B CG   2  
ATOM 4127  O OD1  . ASN B 1 53 ? -8.374  -12.933 -6.066  1.00 1.07  ? 53 ASN B OD1  2  
ATOM 4128  N ND2  . ASN B 1 53 ? -9.574  -11.109 -6.097  1.00 0.93  ? 53 ASN B ND2  2  
ATOM 4129  H H    . ASN B 1 53 ? -5.089  -11.206 -6.028  1.00 0.31  ? 53 ASN B H    2  
ATOM 4130  H HA   . ASN B 1 53 ? -7.508  -9.548  -6.369  1.00 0.33  ? 53 ASN B HA   2  
ATOM 4131  H HB2  . ASN B 1 53 ? -6.695  -11.797 -4.586  1.00 0.41  ? 53 ASN B HB2  2  
ATOM 4132  H HB3  . ASN B 1 53 ? -7.916  -10.680 -3.985  1.00 0.41  ? 53 ASN B HB3  2  
ATOM 4133  H HD21 . ASN B 1 53 ? -9.688  -10.175 -5.822  1.00 1.59  ? 53 ASN B HD21 2  
ATOM 4134  H HD22 . ASN B 1 53 ? -10.258 -11.544 -6.645  1.00 0.93  ? 53 ASN B HD22 2  
ATOM 4135  N N    . PRO B 1 54 ? -6.467  -7.575  -5.040  1.00 0.34  ? 54 PRO B N    2  
ATOM 4136  C CA   . PRO B 1 54 ? -6.108  -6.494  -4.103  1.00 0.37  ? 54 PRO B CA   2  
ATOM 4137  C C    . PRO B 1 54 ? -7.048  -6.546  -2.897  1.00 0.43  ? 54 PRO B C    2  
ATOM 4138  O O    . PRO B 1 54 ? -6.661  -6.218  -1.793  1.00 0.46  ? 54 PRO B O    2  
ATOM 4139  C CB   . PRO B 1 54 ? -6.237  -5.217  -4.933  1.00 0.38  ? 54 PRO B CB   2  
ATOM 4140  C CG   . PRO B 1 54 ? -7.141  -5.581  -6.122  1.00 0.37  ? 54 PRO B CG   2  
ATOM 4141  C CD   . PRO B 1 54 ? -6.957  -7.090  -6.350  1.00 0.33  ? 54 PRO B CD   2  
ATOM 4142  H HA   . PRO B 1 54 ? -5.085  -6.615  -3.779  1.00 0.36  ? 54 PRO B HA   2  
ATOM 4143  H HB2  . PRO B 1 54 ? -6.691  -4.432  -4.341  1.00 0.42  ? 54 PRO B HB2  2  
ATOM 4144  H HB3  . PRO B 1 54 ? -5.270  -4.903  -5.292  1.00 0.36  ? 54 PRO B HB3  2  
ATOM 4145  H HG2  . PRO B 1 54 ? -8.169  -5.365  -5.884  1.00 0.41  ? 54 PRO B HG2  2  
ATOM 4146  H HG3  . PRO B 1 54 ? -6.835  -5.043  -7.000  1.00 0.36  ? 54 PRO B HG3  2  
ATOM 4147  H HD2  . PRO B 1 54 ? -7.898  -7.539  -6.614  1.00 0.35  ? 54 PRO B HD2  2  
ATOM 4148  H HD3  . PRO B 1 54 ? -6.213  -7.266  -7.113  1.00 0.28  ? 54 PRO B HD3  2  
ATOM 4149  N N    . ALA B 1 55 ? -8.256  -7.042  -3.086  1.00 0.45  ? 55 ALA B N    2  
ATOM 4150  C CA   . ALA B 1 55 ? -9.182  -7.210  -1.929  1.00 0.52  ? 55 ALA B CA   2  
ATOM 4151  C C    . ALA B 1 55 ? -8.516  -8.207  -0.967  1.00 0.53  ? 55 ALA B C    2  
ATOM 4152  O O    . ALA B 1 55 ? -8.656  -8.115  0.238   1.00 0.56  ? 55 ALA B O    2  
ATOM 4153  C CB   . ALA B 1 55 ? -10.526 -7.770  -2.411  1.00 0.55  ? 55 ALA B CB   2  
ATOM 4154  H H    . ALA B 1 55 ? -8.525  -7.358  -3.973  1.00 0.44  ? 55 ALA B H    2  
ATOM 4155  H HA   . ALA B 1 55 ? -9.329  -6.261  -1.433  1.00 0.53  ? 55 ALA B HA   2  
ATOM 4156  H HB1  . ALA B 1 55 ? -10.375 -8.343  -3.314  1.00 1.13  ? 55 ALA B HB1  2  
ATOM 4157  H HB2  . ALA B 1 55 ? -10.947 -8.407  -1.646  1.00 1.19  ? 55 ALA B HB2  2  
ATOM 4158  H HB3  . ALA B 1 55 ? -11.204 -6.954  -2.613  1.00 1.15  ? 55 ALA B HB3  2  
ATOM 4159  N N    . SER B 1 56 ? -7.752  -9.135  -1.515  1.00 0.50  ? 56 SER B N    2  
ATOM 4160  C CA   . SER B 1 56 ? -7.016  -10.129 -0.681  1.00 0.52  ? 56 SER B CA   2  
ATOM 4161  C C    . SER B 1 56 ? -5.985  -9.374  0.180   1.00 0.51  ? 56 SER B C    2  
ATOM 4162  O O    . SER B 1 56 ? -5.489  -8.344  -0.235  1.00 0.52  ? 56 SER B O    2  
ATOM 4163  C CB   . SER B 1 56 ? -6.278  -11.112 -1.600  1.00 0.50  ? 56 SER B CB   2  
ATOM 4164  O OG   . SER B 1 56 ? -6.365  -12.425 -1.057  1.00 0.56  ? 56 SER B OG   2  
ATOM 4165  H H    . SER B 1 56 ? -7.645  -9.158  -2.487  1.00 0.48  ? 56 SER B H    2  
ATOM 4166  H HA   . SER B 1 56 ? -7.710  -10.666 -0.064  1.00 0.55  ? 56 SER B HA   2  
ATOM 4167  H HB2  . SER B 1 56 ? -6.731  -11.102 -2.578  1.00 0.46  ? 56 SER B HB2  2  
ATOM 4168  H HB3  . SER B 1 56 ? -5.242  -10.813 -1.688  1.00 0.51  ? 56 SER B HB3  2  
ATOM 4169  H HG   . SER B 1 56 ? -5.496  -12.671 -0.730  1.00 1.02  ? 56 SER B HG   2  
ATOM 4170  N N    . PRO B 1 57 ? -5.681  -9.900  1.346   1.00 0.53  ? 57 PRO B N    2  
ATOM 4171  C CA   . PRO B 1 57 ? -4.702  -9.272  2.262   1.00 0.53  ? 57 PRO B CA   2  
ATOM 4172  C C    . PRO B 1 57 ? -3.275  -9.482  1.735   1.00 0.51  ? 57 PRO B C    2  
ATOM 4173  O O    . PRO B 1 57 ? -2.547  -8.532  1.495   1.00 0.51  ? 57 PRO B O    2  
ATOM 4174  C CB   . PRO B 1 57 ? -4.934  -10.001 3.591   1.00 0.59  ? 57 PRO B CB   2  
ATOM 4175  C CG   . PRO B 1 57 ? -5.618  -11.344 3.241   1.00 0.62  ? 57 PRO B CG   2  
ATOM 4176  C CD   . PRO B 1 57 ? -6.268  -11.159 1.856   1.00 0.58  ? 57 PRO B CD   2  
ATOM 4177  H HA   . PRO B 1 57 ? -4.913  -8.222  2.376   1.00 0.54  ? 57 PRO B HA   2  
ATOM 4178  H HB2  . PRO B 1 57 ? -3.988  -10.179 4.085   1.00 0.60  ? 57 PRO B HB2  2  
ATOM 4179  H HB3  . PRO B 1 57 ? -5.581  -9.418  4.227   1.00 0.63  ? 57 PRO B HB3  2  
ATOM 4180  H HG2  . PRO B 1 57 ? -4.881  -12.135 3.206   1.00 0.64  ? 57 PRO B HG2  2  
ATOM 4181  H HG3  . PRO B 1 57 ? -6.377  -11.576 3.972   1.00 0.67  ? 57 PRO B HG3  2  
ATOM 4182  H HD2  . PRO B 1 57 ? -6.016  -11.987 1.209   1.00 0.59  ? 57 PRO B HD2  2  
ATOM 4183  H HD3  . PRO B 1 57 ? -7.338  -11.061 1.950   1.00 0.60  ? 57 PRO B HD3  2  
ATOM 4184  N N    . ILE B 1 58 ? -2.888  -10.719 1.526   1.00 0.52  ? 58 ILE B N    2  
ATOM 4185  C CA   . ILE B 1 58 ? -1.527  -11.021 0.982   1.00 0.51  ? 58 ILE B CA   2  
ATOM 4186  C C    . ILE B 1 58 ? -1.321  -10.226 -0.293  1.00 0.45  ? 58 ILE B C    2  
ATOM 4187  O O    . ILE B 1 58 ? -0.274  -9.668  -0.539  1.00 0.44  ? 58 ILE B O    2  
ATOM 4188  C CB   . ILE B 1 58 ? -1.458  -12.524 0.653   1.00 0.54  ? 58 ILE B CB   2  
ATOM 4189  C CG1  . ILE B 1 58 ? -0.386  -13.197 1.518   1.00 0.62  ? 58 ILE B CG1  2  
ATOM 4190  C CG2  . ILE B 1 58 ? -1.135  -12.744 -0.838  1.00 0.49  ? 58 ILE B CG2  2  
ATOM 4191  C CD1  . ILE B 1 58 ? -0.872  -13.285 2.968   1.00 0.68  ? 58 ILE B CD1  2  
ATOM 4192  H H    . ILE B 1 58 ? -3.507  -11.456 1.707   1.00 0.55  ? 58 ILE B H    2  
ATOM 4193  H HA   . ILE B 1 58 ? -0.770  -10.759 1.703   1.00 0.55  ? 58 ILE B HA   2  
ATOM 4194  H HB   . ILE B 1 58 ? -2.421  -12.960 0.860   1.00 0.56  ? 58 ILE B HB   2  
ATOM 4195  H HG12 . ILE B 1 58 ? -0.194  -14.191 1.142   1.00 0.64  ? 58 ILE B HG12 2  
ATOM 4196  H HG13 . ILE B 1 58 ? 0.524   -12.617 1.480   1.00 0.62  ? 58 ILE B HG13 2  
ATOM 4197  H HG21 . ILE B 1 58 ? -0.334  -12.081 -1.139  1.00 1.10  ? 58 ILE B HG21 2  
ATOM 4198  H HG22 . ILE B 1 58 ? -0.835  -13.765 -0.998  1.00 1.12  ? 58 ILE B HG22 2  
ATOM 4199  H HG23 . ILE B 1 58 ? -2.015  -12.531 -1.431  1.00 1.14  ? 58 ILE B HG23 2  
ATOM 4200  H HD11 . ILE B 1 58 ? -1.948  -13.375 2.983   1.00 1.22  ? 58 ILE B HD11 2  
ATOM 4201  H HD12 . ILE B 1 58 ? -0.431  -14.150 3.442   1.00 1.24  ? 58 ILE B HD12 2  
ATOM 4202  H HD13 . ILE B 1 58 ? -0.577  -12.394 3.501   1.00 1.22  ? 58 ILE B HD13 2  
ATOM 4203  N N    . VAL B 1 59 ? -2.313  -10.220 -1.122  1.00 0.43  ? 59 VAL B N    2  
ATOM 4204  C CA   . VAL B 1 59 ? -2.212  -9.513  -2.402  1.00 0.40  ? 59 VAL B CA   2  
ATOM 4205  C C    . VAL B 1 59 ? -2.151  -8.009  -2.161  1.00 0.37  ? 59 VAL B C    2  
ATOM 4206  O O    . VAL B 1 59 ? -1.378  -7.318  -2.793  1.00 0.32  ? 59 VAL B O    2  
ATOM 4207  C CB   . VAL B 1 59 ? -3.436  -9.866  -3.213  1.00 0.51  ? 59 VAL B CB   2  
ATOM 4208  C CG1  . VAL B 1 59 ? -3.443  -9.061  -4.481  1.00 0.31  ? 59 VAL B CG1  2  
ATOM 4209  C CG2  . VAL B 1 59 ? -3.437  -11.355 -3.546  1.00 0.88  ? 59 VAL B CG2  2  
ATOM 4210  H H    . VAL B 1 59 ? -3.130  -10.719 -0.909  1.00 0.46  ? 59 VAL B H    2  
ATOM 4211  H HA   . VAL B 1 59 ? -1.314  -9.828  -2.907  1.00 0.41  ? 59 VAL B HA   2  
ATOM 4212  H HB   . VAL B 1 59 ? -4.310  -9.625  -2.637  1.00 0.84  ? 59 VAL B HB   2  
ATOM 4213  H HG11 . VAL B 1 59 ? -2.438  -8.987  -4.856  1.00 1.03  ? 59 VAL B HG11 2  
ATOM 4214  H HG12 . VAL B 1 59 ? -4.070  -9.552  -5.201  1.00 1.00  ? 59 VAL B HG12 2  
ATOM 4215  H HG13 . VAL B 1 59 ? -3.833  -8.078  -4.265  1.00 1.08  ? 59 VAL B HG13 2  
ATOM 4216  H HG21 . VAL B 1 59 ? -2.625  -11.841 -3.028  1.00 1.53  ? 59 VAL B HG21 2  
ATOM 4217  H HG22 . VAL B 1 59 ? -4.374  -11.792 -3.237  1.00 1.47  ? 59 VAL B HG22 2  
ATOM 4218  H HG23 . VAL B 1 59 ? -3.314  -11.487 -4.612  1.00 1.25  ? 59 VAL B HG23 2  
ATOM 4219  N N    . LYS B 1 60 ? -2.913  -7.496  -1.223  1.00 0.43  ? 60 LYS B N    2  
ATOM 4220  C CA   . LYS B 1 60 ? -2.818  -6.037  -0.922  1.00 0.43  ? 60 LYS B CA   2  
ATOM 4221  C C    . LYS B 1 60 ? -1.347  -5.735  -0.575  1.00 0.43  ? 60 LYS B C    2  
ATOM 4222  O O    . LYS B 1 60 ? -0.871  -4.623  -0.709  1.00 0.42  ? 60 LYS B O    2  
ATOM 4223  C CB   . LYS B 1 60 ? -3.695  -5.703  0.282   1.00 0.50  ? 60 LYS B CB   2  
ATOM 4224  C CG   . LYS B 1 60 ? -3.970  -4.196  0.321   1.00 0.60  ? 60 LYS B CG   2  
ATOM 4225  C CD   . LYS B 1 60 ? -5.345  -3.904  -0.289  1.00 0.91  ? 60 LYS B CD   2  
ATOM 4226  C CE   . LYS B 1 60 ? -6.443  -4.451  0.630   1.00 0.99  ? 60 LYS B CE   2  
ATOM 4227  N NZ   . LYS B 1 60 ? -6.793  -3.429  1.658   1.00 1.68  ? 60 LYS B NZ   2  
ATOM 4228  H H    . LYS B 1 60 ? -3.505  -8.071  -0.696  1.00 0.47  ? 60 LYS B H    2  
ATOM 4229  H HA   . LYS B 1 60 ? -3.127  -5.464  -1.789  1.00 0.40  ? 60 LYS B HA   2  
ATOM 4230  H HB2  . LYS B 1 60 ? -4.624  -6.243  0.205   1.00 0.65  ? 60 LYS B HB2  2  
ATOM 4231  H HB3  . LYS B 1 60 ? -3.180  -5.997  1.187   1.00 0.59  ? 60 LYS B HB3  2  
ATOM 4232  H HG2  . LYS B 1 60 ? -3.952  -3.855  1.345   1.00 1.10  ? 60 LYS B HG2  2  
ATOM 4233  H HG3  . LYS B 1 60 ? -3.212  -3.677  -0.244  1.00 0.87  ? 60 LYS B HG3  2  
ATOM 4234  H HD2  . LYS B 1 60 ? -5.467  -2.837  -0.403  1.00 1.39  ? 60 LYS B HD2  2  
ATOM 4235  H HD3  . LYS B 1 60 ? -5.417  -4.380  -1.255  1.00 1.49  ? 60 LYS B HD3  2  
ATOM 4236  H HE2  . LYS B 1 60 ? -7.319  -4.683  0.043   1.00 1.20  ? 60 LYS B HE2  2  
ATOM 4237  H HE3  . LYS B 1 60 ? -6.091  -5.347  1.119   1.00 1.40  ? 60 LYS B HE3  2  
ATOM 4238  H HZ1  . LYS B 1 60 ? -5.936  -3.152  2.177   1.00 2.15  ? 60 LYS B HZ1  2  
ATOM 4239  H HZ2  . LYS B 1 60 ? -7.203  -2.595  1.191   1.00 2.27  ? 60 LYS B HZ2  2  
ATOM 4240  H HZ3  . LYS B 1 60 ? -7.487  -3.828  2.321   1.00 1.91  ? 60 LYS B HZ3  2  
ATOM 4241  N N    . LYS B 1 61 ? -0.627  -6.768  -0.191  1.00 0.44  ? 61 LYS B N    2  
ATOM 4242  C CA   . LYS B 1 61 ? 0.817   -6.658  0.113   1.00 0.46  ? 61 LYS B CA   2  
ATOM 4243  C C    . LYS B 1 61 ? 1.510   -6.496  -1.222  1.00 0.42  ? 61 LYS B C    2  
ATOM 4244  O O    . LYS B 1 61 ? 2.266   -5.585  -1.434  1.00 0.44  ? 61 LYS B O    2  
ATOM 4245  C CB   . LYS B 1 61 ? 1.269   -7.966  0.754   1.00 0.51  ? 61 LYS B CB   2  
ATOM 4246  C CG   . LYS B 1 61 ? 2.207   -7.677  1.924   1.00 0.71  ? 61 LYS B CG   2  
ATOM 4247  C CD   . LYS B 1 61 ? 3.191   -8.837  2.083   1.00 1.02  ? 61 LYS B CD   2  
ATOM 4248  C CE   . LYS B 1 61 ? 4.380   -8.389  2.940   1.00 1.29  ? 61 LYS B CE   2  
ATOM 4249  N NZ   . LYS B 1 61 ? 4.719   -9.457  3.925   1.00 1.88  ? 61 LYS B NZ   2  
ATOM 4250  H H    . LYS B 1 61 ? -1.037  -7.646  -0.155  1.00 0.45  ? 61 LYS B H    2  
ATOM 4251  H HA   . LYS B 1 61 ? 1.014   -5.819  0.759   1.00 0.49  ? 61 LYS B HA   2  
ATOM 4252  H HB2  . LYS B 1 61 ? 0.399   -8.506  1.105   1.00 0.58  ? 61 LYS B HB2  2  
ATOM 4253  H HB3  . LYS B 1 61 ? 1.781   -8.566  0.011   1.00 0.65  ? 61 LYS B HB3  2  
ATOM 4254  H HG2  . LYS B 1 61 ? 2.749   -6.764  1.733   1.00 1.41  ? 61 LYS B HG2  2  
ATOM 4255  H HG3  . LYS B 1 61 ? 1.627   -7.572  2.828   1.00 1.04  ? 61 LYS B HG3  2  
ATOM 4256  H HD2  . LYS B 1 61 ? 2.691   -9.666  2.561   1.00 1.35  ? 61 LYS B HD2  2  
ATOM 4257  H HD3  . LYS B 1 61 ? 3.546   -9.143  1.111   1.00 1.75  ? 61 LYS B HD3  2  
ATOM 4258  H HE2  . LYS B 1 61 ? 5.232   -8.203  2.304   1.00 1.83  ? 61 LYS B HE2  2  
ATOM 4259  H HE3  . LYS B 1 61 ? 4.121   -7.483  3.469   1.00 1.54  ? 61 LYS B HE3  2  
ATOM 4260  H HZ1  . LYS B 1 61 ? 4.946   -10.337 3.418   1.00 2.14  ? 61 LYS B HZ1  2  
ATOM 4261  H HZ2  . LYS B 1 61 ? 5.540   -9.160  4.488   1.00 2.45  ? 61 LYS B HZ2  2  
ATOM 4262  H HZ3  . LYS B 1 61 ? 3.909   -9.618  4.556   1.00 2.28  ? 61 LYS B HZ3  2  
ATOM 4263  N N    . ILE B 1 62 ? 1.195   -7.383  -2.133  1.00 0.37  ? 62 ILE B N    2  
ATOM 4264  C CA   . ILE B 1 62 ? 1.743   -7.337  -3.510  1.00 0.34  ? 62 ILE B CA   2  
ATOM 4265  C C    . ILE B 1 62 ? 1.762   -5.890  -4.016  1.00 0.32  ? 62 ILE B C    2  
ATOM 4266  O O    . ILE B 1 62 ? 2.701   -5.475  -4.665  1.00 0.34  ? 62 ILE B O    2  
ATOM 4267  C CB   . ILE B 1 62 ? 0.826   -8.230  -4.376  1.00 0.32  ? 62 ILE B CB   2  
ATOM 4268  C CG1  . ILE B 1 62 ? 1.594   -9.420  -4.943  1.00 0.34  ? 62 ILE B CG1  2  
ATOM 4269  C CG2  . ILE B 1 62 ? 0.186   -7.440  -5.514  1.00 0.29  ? 62 ILE B CG2  2  
ATOM 4270  C CD1  . ILE B 1 62 ? 2.396   -10.072 -3.823  1.00 0.36  ? 62 ILE B CD1  2  
ATOM 4271  H H    . ILE B 1 62 ? 0.557   -8.090  -1.907  1.00 0.37  ? 62 ILE B H    2  
ATOM 4272  H HA   . ILE B 1 62 ? 2.745   -7.719  -3.508  1.00 0.36  ? 62 ILE B HA   2  
ATOM 4273  H HB   . ILE B 1 62 ? 0.044   -8.605  -3.744  1.00 0.32  ? 62 ILE B HB   2  
ATOM 4274  H HG12 . ILE B 1 62 ? 0.889   -10.139 -5.346  1.00 0.35  ? 62 ILE B HG12 2  
ATOM 4275  H HG13 . ILE B 1 62 ? 2.257   -9.092  -5.721  1.00 0.35  ? 62 ILE B HG13 2  
ATOM 4276  H HG21 . ILE B 1 62 ? 0.956   -7.010  -6.133  1.00 1.11  ? 62 ILE B HG21 2  
ATOM 4277  H HG22 . ILE B 1 62 ? -0.429  -8.099  -6.105  1.00 0.98  ? 62 ILE B HG22 2  
ATOM 4278  H HG23 . ILE B 1 62 ? -0.426  -6.653  -5.101  1.00 1.02  ? 62 ILE B HG23 2  
ATOM 4279  H HD11 . ILE B 1 62 ? 1.812   -10.059 -2.913  1.00 1.02  ? 62 ILE B HD11 2  
ATOM 4280  H HD12 . ILE B 1 62 ? 2.625   -11.090 -4.090  1.00 1.02  ? 62 ILE B HD12 2  
ATOM 4281  H HD13 . ILE B 1 62 ? 3.310   -9.521  -3.670  1.00 0.97  ? 62 ILE B HD13 2  
ATOM 4282  N N    . ILE B 1 63 ? 0.750   -5.113  -3.703  1.00 0.31  ? 63 ILE B N    2  
ATOM 4283  C CA   . ILE B 1 63 ? 0.746   -3.688  -4.150  1.00 0.31  ? 63 ILE B CA   2  
ATOM 4284  C C    . ILE B 1 63 ? 1.780   -2.926  -3.346  1.00 0.37  ? 63 ILE B C    2  
ATOM 4285  O O    . ILE B 1 63 ? 2.638   -2.250  -3.880  1.00 0.41  ? 63 ILE B O    2  
ATOM 4286  C CB   . ILE B 1 63 ? -0.611  -3.060  -3.857  1.00 0.32  ? 63 ILE B CB   2  
ATOM 4287  C CG1  . ILE B 1 63 ? -1.668  -3.729  -4.710  1.00 0.32  ? 63 ILE B CG1  2  
ATOM 4288  C CG2  . ILE B 1 63 ? -0.569  -1.557  -4.147  1.00 0.33  ? 63 ILE B CG2  2  
ATOM 4289  C CD1  . ILE B 1 63 ? -2.159  -4.962  -3.982  1.00 0.42  ? 63 ILE B CD1  2  
ATOM 4290  H H    . ILE B 1 63 ? -0.001  -5.463  -3.153  1.00 0.31  ? 63 ILE B H    2  
ATOM 4291  H HA   . ILE B 1 63 ? 0.965   -3.625  -5.204  1.00 0.30  ? 63 ILE B HA   2  
ATOM 4292  H HB   . ILE B 1 63 ? -0.849  -3.207  -2.812  1.00 0.35  ? 63 ILE B HB   2  
ATOM 4293  H HG12 . ILE B 1 63 ? -2.482  -3.056  -4.854  1.00 0.31  ? 63 ILE B HG12 2  
ATOM 4294  H HG13 . ILE B 1 63 ? -1.250  -4.013  -5.663  1.00 0.48  ? 63 ILE B HG13 2  
ATOM 4295  H HG21 . ILE B 1 63 ? 0.133   -1.362  -4.943  1.00 0.99  ? 63 ILE B HG21 2  
ATOM 4296  H HG22 . ILE B 1 63 ? -1.550  -1.220  -4.440  1.00 1.02  ? 63 ILE B HG22 2  
ATOM 4297  H HG23 . ILE B 1 63 ? -0.258  -1.030  -3.256  1.00 1.03  ? 63 ILE B HG23 2  
ATOM 4298  H HD11 . ILE B 1 63 ? -1.819  -4.922  -2.955  1.00 1.07  ? 63 ILE B HD11 2  
ATOM 4299  H HD12 . ILE B 1 63 ? -3.234  -4.990  -4.006  1.00 1.10  ? 63 ILE B HD12 2  
ATOM 4300  H HD13 . ILE B 1 63 ? -1.758  -5.839  -4.459  1.00 1.18  ? 63 ILE B HD13 2  
ATOM 4301  N N    . GLU B 1 64 ? 1.665   -3.018  -2.052  1.00 0.38  ? 64 GLU B N    2  
ATOM 4302  C CA   . GLU B 1 64 ? 2.586   -2.287  -1.150  1.00 0.46  ? 64 GLU B CA   2  
ATOM 4303  C C    . GLU B 1 64 ? 4.039   -2.727  -1.372  1.00 0.48  ? 64 GLU B C    2  
ATOM 4304  O O    . GLU B 1 64 ? 4.936   -1.911  -1.437  1.00 0.62  ? 64 GLU B O    2  
ATOM 4305  C CB   . GLU B 1 64 ? 2.201   -2.576  0.296   1.00 0.48  ? 64 GLU B CB   2  
ATOM 4306  C CG   . GLU B 1 64 ? 2.192   -1.273  1.100   1.00 1.04  ? 64 GLU B CG   2  
ATOM 4307  C CD   . GLU B 1 64 ? 2.454   -1.580  2.577   1.00 1.40  ? 64 GLU B CD   2  
ATOM 4308  O OE1  . GLU B 1 64 ? 1.506   -1.915  3.270   1.00 1.81  ? 64 GLU B OE1  2  
ATOM 4309  O OE2  . GLU B 1 64 ? 3.597   -1.477  2.989   1.00 2.00  ? 64 GLU B OE2  2  
ATOM 4310  H H    . GLU B 1 64 ? 0.940   -3.565  -1.672  1.00 0.37  ? 64 GLU B H    2  
ATOM 4311  H HA   . GLU B 1 64 ? 2.482   -1.232  -1.347  1.00 0.48  ? 64 GLU B HA   2  
ATOM 4312  H HB2  . GLU B 1 64 ? 1.221   -3.025  0.319   1.00 0.72  ? 64 GLU B HB2  2  
ATOM 4313  H HB3  . GLU B 1 64 ? 2.921   -3.258  0.724   1.00 0.75  ? 64 GLU B HB3  2  
ATOM 4314  H HG2  . GLU B 1 64 ? 2.963   -0.616  0.725   1.00 1.39  ? 64 GLU B HG2  2  
ATOM 4315  H HG3  . GLU B 1 64 ? 1.230   -0.795  0.998   1.00 1.43  ? 64 GLU B HG3  2  
ATOM 4316  N N    . LYS B 1 65 ? 4.272   -4.013  -1.472  1.00 0.47  ? 65 LYS B N    2  
ATOM 4317  C CA   . LYS B 1 65 ? 5.659   -4.520  -1.677  1.00 0.51  ? 65 LYS B CA   2  
ATOM 4318  C C    . LYS B 1 65 ? 6.151   -4.083  -3.049  1.00 0.50  ? 65 LYS B C    2  
ATOM 4319  O O    . LYS B 1 65 ? 7.251   -3.583  -3.184  1.00 0.55  ? 65 LYS B O    2  
ATOM 4320  C CB   . LYS B 1 65 ? 5.666   -6.049  -1.567  1.00 0.52  ? 65 LYS B CB   2  
ATOM 4321  C CG   . LYS B 1 65 ? 7.056   -6.599  -1.898  1.00 1.07  ? 65 LYS B CG   2  
ATOM 4322  C CD   . LYS B 1 65 ? 7.194   -8.009  -1.316  1.00 1.44  ? 65 LYS B CD   2  
ATOM 4323  C CE   . LYS B 1 65 ? 8.637   -8.245  -0.861  1.00 1.72  ? 65 LYS B CE   2  
ATOM 4324  N NZ   . LYS B 1 65 ? 8.646   -9.148  0.327   1.00 2.15  ? 65 LYS B NZ   2  
ATOM 4325  H H    . LYS B 1 65 ? 3.530   -4.650  -1.408  1.00 0.54  ? 65 LYS B H    2  
ATOM 4326  H HA   . LYS B 1 65 ? 6.298   -4.093  -0.927  1.00 0.56  ? 65 LYS B HA   2  
ATOM 4327  H HB2  . LYS B 1 65 ? 5.397   -6.334  -0.560  1.00 0.91  ? 65 LYS B HB2  2  
ATOM 4328  H HB3  . LYS B 1 65 ? 4.946   -6.460  -2.259  1.00 1.09  ? 65 LYS B HB3  2  
ATOM 4329  H HG2  . LYS B 1 65 ? 7.181   -6.637  -2.972  1.00 1.56  ? 65 LYS B HG2  2  
ATOM 4330  H HG3  . LYS B 1 65 ? 7.809   -5.956  -1.468  1.00 1.65  ? 65 LYS B HG3  2  
ATOM 4331  H HD2  . LYS B 1 65 ? 6.529   -8.115  -0.470  1.00 1.78  ? 65 LYS B HD2  2  
ATOM 4332  H HD3  . LYS B 1 65 ? 6.934   -8.736  -2.069  1.00 1.92  ? 65 LYS B HD3  2  
ATOM 4333  H HE2  . LYS B 1 65 ? 9.196   -8.703  -1.663  1.00 2.13  ? 65 LYS B HE2  2  
ATOM 4334  H HE3  . LYS B 1 65 ? 9.092   -7.302  -0.598  1.00 2.04  ? 65 LYS B HE3  2  
ATOM 4335  H HZ1  . LYS B 1 65 ? 8.051   -9.980  0.135   1.00 2.61  ? 65 LYS B HZ1  2  
ATOM 4336  H HZ2  . LYS B 1 65 ? 9.618   -9.457  0.519   1.00 2.25  ? 65 LYS B HZ2  2  
ATOM 4337  H HZ3  . LYS B 1 65 ? 8.272   -8.637  1.153   1.00 2.61  ? 65 LYS B HZ3  2  
ATOM 4338  N N    . MET B 1 66 ? 5.331   -4.226  -4.059  1.00 0.45  ? 66 MET B N    2  
ATOM 4339  C CA   . MET B 1 66 ? 5.734   -3.764  -5.410  1.00 0.46  ? 66 MET B CA   2  
ATOM 4340  C C    . MET B 1 66 ? 6.041   -2.265  -5.311  1.00 0.49  ? 66 MET B C    2  
ATOM 4341  O O    . MET B 1 66 ? 6.958   -1.760  -5.932  1.00 0.53  ? 66 MET B O    2  
ATOM 4342  C CB   . MET B 1 66 ? 4.587   -4.001  -6.387  1.00 0.42  ? 66 MET B CB   2  
ATOM 4343  C CG   . MET B 1 66 ? 4.690   -5.422  -6.951  1.00 0.40  ? 66 MET B CG   2  
ATOM 4344  S SD   . MET B 1 66 ? 5.938   -5.443  -8.261  1.00 1.14  ? 66 MET B SD   2  
ATOM 4345  C CE   . MET B 1 66 ? 5.014   -4.482  -9.485  1.00 0.37  ? 66 MET B CE   2  
ATOM 4346  H H    . MET B 1 66 ? 4.440   -4.604  -3.920  1.00 0.42  ? 66 MET B H    2  
ATOM 4347  H HA   . MET B 1 66 ? 6.609   -4.302  -5.727  1.00 0.47  ? 66 MET B HA   2  
ATOM 4348  H HB2  . MET B 1 66 ? 3.646   -3.881  -5.870  1.00 0.40  ? 66 MET B HB2  2  
ATOM 4349  H HB3  . MET B 1 66 ? 4.651   -3.288  -7.192  1.00 0.46  ? 66 MET B HB3  2  
ATOM 4350  H HG2  . MET B 1 66 ? 4.980   -6.108  -6.163  1.00 0.76  ? 66 MET B HG2  2  
ATOM 4351  H HG3  . MET B 1 66 ? 3.735   -5.725  -7.354  1.00 0.66  ? 66 MET B HG3  2  
ATOM 4352  H HE1  . MET B 1 66 ? 4.005   -4.323  -9.142  1.00 1.06  ? 66 MET B HE1  2  
ATOM 4353  H HE2  . MET B 1 66 ? 5.496   -3.524  -9.636  1.00 1.01  ? 66 MET B HE2  2  
ATOM 4354  H HE3  . MET B 1 66 ? 4.992   -5.025  -10.417 1.00 1.12  ? 66 MET B HE3  2  
ATOM 4355  N N    . LEU B 1 67 ? 5.287   -1.568  -4.488  1.00 0.50  ? 67 LEU B N    2  
ATOM 4356  C CA   . LEU B 1 67 ? 5.509   -0.117  -4.267  1.00 0.54  ? 67 LEU B CA   2  
ATOM 4357  C C    . LEU B 1 67 ? 6.845   0.087   -3.540  1.00 0.60  ? 67 LEU B C    2  
ATOM 4358  O O    . LEU B 1 67 ? 7.526   1.074   -3.745  1.00 0.63  ? 67 LEU B O    2  
ATOM 4359  C CB   . LEU B 1 67 ? 4.390   0.426   -3.375  1.00 0.56  ? 67 LEU B CB   2  
ATOM 4360  C CG   . LEU B 1 67 ? 3.331   1.122   -4.224  1.00 0.53  ? 67 LEU B CG   2  
ATOM 4361  C CD1  . LEU B 1 67 ? 1.969   0.502   -3.914  1.00 0.53  ? 67 LEU B CD1  2  
ATOM 4362  C CD2  . LEU B 1 67 ? 3.304   2.616   -3.886  1.00 0.56  ? 67 LEU B CD2  2  
ATOM 4363  H H    . LEU B 1 67 ? 4.579   -2.016  -3.991  1.00 0.49  ? 67 LEU B H    2  
ATOM 4364  H HA   . LEU B 1 67 ? 5.506   0.398   -5.208  1.00 0.54  ? 67 LEU B HA   2  
ATOM 4365  H HB2  . LEU B 1 67 ? 3.937   -0.395  -2.842  1.00 0.57  ? 67 LEU B HB2  2  
ATOM 4366  H HB3  . LEU B 1 67 ? 4.801   1.126   -2.666  1.00 0.60  ? 67 LEU B HB3  2  
ATOM 4367  H HG   . LEU B 1 67 ? 3.559   0.988   -5.272  1.00 0.51  ? 67 LEU B HG   2  
ATOM 4368  H HD11 . LEU B 1 67 ? 2.008   0.017   -2.949  1.00 1.18  ? 67 LEU B HD11 2  
ATOM 4369  H HD12 . LEU B 1 67 ? 1.217   1.273   -3.900  1.00 1.08  ? 67 LEU B HD12 2  
ATOM 4370  H HD13 . LEU B 1 67 ? 1.728   -0.227  -4.672  1.00 1.15  ? 67 LEU B HD13 2  
ATOM 4371  H HD21 . LEU B 1 67 ? 4.306   2.955   -3.670  1.00 1.19  ? 67 LEU B HD21 2  
ATOM 4372  H HD22 . LEU B 1 67 ? 2.911   3.168   -4.727  1.00 1.20  ? 67 LEU B HD22 2  
ATOM 4373  H HD23 . LEU B 1 67 ? 2.676   2.779   -3.023  1.00 1.09  ? 67 LEU B HD23 2  
ATOM 4374  N N    . ASN B 1 68 ? 7.213   -0.840  -2.677  1.00 0.63  ? 68 ASN B N    2  
ATOM 4375  C CA   . ASN B 1 68 ? 8.504   -0.688  -1.918  1.00 0.69  ? 68 ASN B CA   2  
ATOM 4376  C C    . ASN B 1 68 ? 9.705   -0.994  -2.829  1.00 0.75  ? 68 ASN B C    2  
ATOM 4377  O O    . ASN B 1 68 ? 10.794  -0.510  -2.588  1.00 0.92  ? 68 ASN B O    2  
ATOM 4378  C CB   . ASN B 1 68 ? 8.540   -1.625  -0.694  1.00 0.78  ? 68 ASN B CB   2  
ATOM 4379  C CG   . ASN B 1 68 ? 9.765   -1.294  0.163   1.00 1.48  ? 68 ASN B CG   2  
ATOM 4380  O OD1  . ASN B 1 68 ? 9.929   -0.170  0.598   1.00 2.21  ? 68 ASN B OD1  2  
ATOM 4381  N ND2  . ASN B 1 68 ? 10.638  -2.228  0.425   1.00 2.00  ? 68 ASN B ND2  2  
ATOM 4382  H H    . ASN B 1 68 ? 6.632   -1.631  -2.527  1.00 0.62  ? 68 ASN B H    2  
ATOM 4383  H HA   . ASN B 1 68 ? 8.584   0.334   -1.576  1.00 0.72  ? 68 ASN B HA   2  
ATOM 4384  H HB2  . ASN B 1 68 ? 7.647   -1.486  -0.098  1.00 1.16  ? 68 ASN B HB2  2  
ATOM 4385  H HB3  . ASN B 1 68 ? 8.604   -2.654  -1.019  1.00 1.06  ? 68 ASN B HB3  2  
ATOM 4386  H HD21 . ASN B 1 68 ? 10.508  -3.134  0.074   1.00 2.13  ? 68 ASN B HD21 2  
ATOM 4387  H HD22 . ASN B 1 68 ? 11.425  -2.021  0.971   1.00 2.63  ? 68 ASN B HD22 2  
ATOM 4388  N N    . SER B 1 69 ? 9.518   -1.792  -3.863  1.00 0.87  ? 69 SER B N    2  
ATOM 4389  C CA   . SER B 1 69 ? 10.645  -2.139  -4.790  1.00 0.99  ? 69 SER B CA   2  
ATOM 4390  C C    . SER B 1 69 ? 11.635  -3.055  -4.066  1.00 1.13  ? 69 SER B C    2  
ATOM 4391  O O    . SER B 1 69 ? 12.380  -2.628  -3.203  1.00 1.69  ? 69 SER B O    2  
ATOM 4392  C CB   . SER B 1 69 ? 11.362  -0.870  -5.272  1.00 1.46  ? 69 SER B CB   2  
ATOM 4393  O OG   . SER B 1 69 ? 10.410  0.024   -5.837  1.00 2.03  ? 69 SER B OG   2  
ATOM 4394  H H    . SER B 1 69 ? 8.632   -2.174  -4.029  1.00 1.00  ? 69 SER B H    2  
ATOM 4395  H HA   . SER B 1 69 ? 10.245  -2.664  -5.645  1.00 1.09  ? 69 SER B HA   2  
ATOM 4396  H HB2  . SER B 1 69 ? 11.852  -0.390  -4.443  1.00 1.85  ? 69 SER B HB2  2  
ATOM 4397  H HB3  . SER B 1 69 ? 12.101  -1.139  -6.015  1.00 1.93  ? 69 SER B HB3  2  
ATOM 4398  H HG   . SER B 1 69 ? 10.318  0.773   -5.245  1.00 2.38  ? 69 SER B HG   2  
ATOM 4399  N N    . ASP B 1 70 ? 11.628  -4.318  -4.407  1.00 1.22  ? 70 ASP B N    2  
ATOM 4400  C CA   . ASP B 1 70 ? 12.548  -5.299  -3.746  1.00 1.69  ? 70 ASP B CA   2  
ATOM 4401  C C    . ASP B 1 70 ? 14.010  -4.895  -3.973  1.00 1.89  ? 70 ASP B C    2  
ATOM 4402  O O    . ASP B 1 70 ? 14.534  -5.024  -5.064  1.00 2.34  ? 70 ASP B O    2  
ATOM 4403  C CB   . ASP B 1 70 ? 12.327  -6.695  -4.336  1.00 2.32  ? 70 ASP B CB   2  
ATOM 4404  C CG   . ASP B 1 70 ? 10.855  -7.111  -4.193  1.00 3.13  ? 70 ASP B CG   2  
ATOM 4405  O OD1  . ASP B 1 70 ? 10.293  -6.897  -3.130  1.00 3.72  ? 70 ASP B OD1  2  
ATOM 4406  O OD2  . ASP B 1 70 ? 10.316  -7.638  -5.151  1.00 3.65  ? 70 ASP B OD2  2  
ATOM 4407  H H    . ASP B 1 70 ? 11.003  -4.627  -5.098  1.00 1.38  ? 70 ASP B H    2  
ATOM 4408  H HA   . ASP B 1 70 ? 12.343  -5.322  -2.687  1.00 2.07  ? 70 ASP B HA   2  
ATOM 4409  H HB2  . ASP B 1 70 ? 12.597  -6.683  -5.383  1.00 2.46  ? 70 ASP B HB2  2  
ATOM 4410  H HB3  . ASP B 1 70 ? 12.952  -7.404  -3.815  1.00 2.72  ? 70 ASP B HB3  2  
ATOM 4411  N N    . LYS B 1 71 ? 14.671  -4.421  -2.944  1.00 2.37  ? 71 LYS B N    2  
ATOM 4412  C CA   . LYS B 1 71 ? 16.105  -4.019  -3.081  1.00 3.06  ? 71 LYS B CA   2  
ATOM 4413  C C    . LYS B 1 71 ? 16.649  -3.559  -1.717  1.00 3.94  ? 71 LYS B C    2  
ATOM 4414  O O    . LYS B 1 71 ? 17.242  -2.501  -1.592  1.00 4.55  ? 71 LYS B O    2  
ATOM 4415  C CB   . LYS B 1 71 ? 16.231  -2.890  -4.118  1.00 3.59  ? 71 LYS B CB   2  
ATOM 4416  C CG   . LYS B 1 71 ? 15.383  -1.681  -3.698  1.00 3.82  ? 71 LYS B CG   2  
ATOM 4417  C CD   . LYS B 1 71 ? 16.217  -0.402  -3.812  1.00 4.61  ? 71 LYS B CD   2  
ATOM 4418  C CE   . LYS B 1 71 ? 16.133  0.141   -5.242  1.00 5.23  ? 71 LYS B CE   2  
ATOM 4419  N NZ   . LYS B 1 71 ? 16.354  1.617   -5.231  1.00 5.99  ? 71 LYS B NZ   2  
ATOM 4420  H H    . LYS B 1 71 ? 14.224  -4.338  -2.075  1.00 2.66  ? 71 LYS B H    2  
ATOM 4421  H HA   . LYS B 1 71 ? 16.678  -4.873  -3.417  1.00 3.09  ? 71 LYS B HA   2  
ATOM 4422  H HB2  . LYS B 1 71 ? 17.265  -2.594  -4.198  1.00 3.68  ? 71 LYS B HB2  2  
ATOM 4423  H HB3  . LYS B 1 71 ? 15.888  -3.249  -5.077  1.00 4.21  ? 71 LYS B HB3  2  
ATOM 4424  H HG2  . LYS B 1 71 ? 14.520  -1.608  -4.344  1.00 3.92  ? 71 LYS B HG2  2  
ATOM 4425  H HG3  . LYS B 1 71 ? 15.057  -1.806  -2.676  1.00 3.79  ? 71 LYS B HG3  2  
ATOM 4426  H HD2  . LYS B 1 71 ? 15.836  0.338   -3.123  1.00 4.80  ? 71 LYS B HD2  2  
ATOM 4427  H HD3  . LYS B 1 71 ? 17.246  -0.620  -3.571  1.00 4.94  ? 71 LYS B HD3  2  
ATOM 4428  H HE2  . LYS B 1 71 ? 16.891  -0.330  -5.850  1.00 5.31  ? 71 LYS B HE2  2  
ATOM 4429  H HE3  . LYS B 1 71 ? 15.158  -0.073  -5.653  1.00 5.41  ? 71 LYS B HE3  2  
ATOM 4430  H HZ1  . LYS B 1 71 ? 15.627  2.072   -4.642  1.00 6.24  ? 71 LYS B HZ1  2  
ATOM 4431  H HZ2  . LYS B 1 71 ? 17.297  1.825   -4.844  1.00 6.23  ? 71 LYS B HZ2  2  
ATOM 4432  H HZ3  . LYS B 1 71 ? 16.293  1.983   -6.202  1.00 6.33  ? 71 LYS B HZ3  2  
ATOM 4433  N N    . SER B 1 72 ? 16.453  -4.355  -0.693  1.00 4.42  ? 72 SER B N    2  
ATOM 4434  C CA   . SER B 1 72 ? 16.952  -3.982  0.666   1.00 5.58  ? 72 SER B CA   2  
ATOM 4435  C C    . SER B 1 72 ? 18.446  -4.316  0.778   1.00 5.86  ? 72 SER B C    2  
ATOM 4436  O O    . SER B 1 72 ? 19.195  -3.445  1.189   1.00 5.92  ? 72 SER B O    2  
ATOM 4437  C CB   . SER B 1 72 ? 16.169  -4.757  1.731   1.00 6.45  ? 72 SER B CB   2  
ATOM 4438  O OG   . SER B 1 72 ? 14.983  -4.043  2.056   1.00 6.62  ? 72 SER B OG   2  
ATOM 4439  O OXT  . SER B 1 72 ? 18.816  -5.433  0.451   1.00 6.32  ? 72 SER B OXT  2  
ATOM 4440  H H    . SER B 1 72 ? 15.977  -5.204  -0.820  1.00 4.24  ? 72 SER B H    2  
ATOM 4441  H HA   . SER B 1 72 ? 16.811  -2.921  0.820   1.00 5.92  ? 72 SER B HA   2  
ATOM 4442  H HB2  . SER B 1 72 ? 15.903  -5.730  1.348   1.00 6.89  ? 72 SER B HB2  2  
ATOM 4443  H HB3  . SER B 1 72 ? 16.783  -4.878  2.614   1.00 6.83  ? 72 SER B HB3  2  
ATOM 4444  H HG   . SER B 1 72 ? 14.982  -3.886  3.003   1.00 7.10  ? 72 SER B HG   2  
ATOM 4445  N N    . ALA A 1 1  ? 25.762  18.666  -20.295 1.00 14.80 ? 1  ALA A N    3  
ATOM 4446  C CA   . ALA A 1 1  ? 24.582  19.228  -19.573 1.00 14.12 ? 1  ALA A CA   3  
ATOM 4447  C C    . ALA A 1 1  ? 23.628  18.090  -19.189 1.00 13.40 ? 1  ALA A C    3  
ATOM 4448  O O    . ALA A 1 1  ? 22.818  17.649  -19.985 1.00 13.47 ? 1  ALA A O    3  
ATOM 4449  C CB   . ALA A 1 1  ? 23.857  20.232  -20.478 1.00 14.17 ? 1  ALA A CB   3  
ATOM 4450  H H1   . ALA A 1 1  ? 26.207  17.929  -19.709 1.00 14.91 ? 1  ALA A H1   3  
ATOM 4451  H H2   . ALA A 1 1  ? 25.454  18.254  -21.198 1.00 15.01 ? 1  ALA A H2   3  
ATOM 4452  H H3   . ALA A 1 1  ? 26.450  19.424  -20.478 1.00 15.11 ? 1  ALA A H3   3  
ATOM 4453  H HA   . ALA A 1 1  ? 24.918  19.732  -18.678 1.00 14.26 ? 1  ALA A HA   3  
ATOM 4454  H HB1  . ALA A 1 1  ? 24.561  20.970  -20.834 1.00 14.25 ? 1  ALA A HB1  3  
ATOM 4455  H HB2  . ALA A 1 1  ? 23.424  19.713  -21.320 1.00 14.03 ? 1  ALA A HB2  3  
ATOM 4456  H HB3  . ALA A 1 1  ? 23.075  20.722  -19.916 1.00 14.43 ? 1  ALA A HB3  3  
ATOM 4457  N N    . SER A 1 2  ? 23.724  17.610  -17.972 1.00 12.87 ? 2  SER A N    3  
ATOM 4458  C CA   . SER A 1 2  ? 22.831  16.496  -17.525 1.00 12.29 ? 2  SER A CA   3  
ATOM 4459  C C    . SER A 1 2  ? 21.674  17.072  -16.702 1.00 11.44 ? 2  SER A C    3  
ATOM 4460  O O    . SER A 1 2  ? 21.885  17.768  -15.724 1.00 11.39 ? 2  SER A O    3  
ATOM 4461  C CB   . SER A 1 2  ? 23.627  15.509  -16.664 1.00 12.48 ? 2  SER A CB   3  
ATOM 4462  O OG   . SER A 1 2  ? 24.845  15.180  -17.321 1.00 12.82 ? 2  SER A OG   3  
ATOM 4463  H H    . SER A 1 2  ? 24.388  17.980  -17.352 1.00 12.96 ? 2  SER A H    3  
ATOM 4464  H HA   . SER A 1 2  ? 22.436  15.982  -18.389 1.00 12.52 ? 2  SER A HA   3  
ATOM 4465  H HB2  . SER A 1 2  ? 23.847  15.957  -15.710 1.00 12.65 ? 2  SER A HB2  3  
ATOM 4466  H HB3  . SER A 1 2  ? 23.036  14.614  -16.510 1.00 12.40 ? 2  SER A HB3  3  
ATOM 4467  H HG   . SER A 1 2  ? 25.557  15.647  -16.876 1.00 12.81 ? 2  SER A HG   3  
ATOM 4468  N N    . VAL A 1 3  ? 20.455  16.785  -17.090 1.00 10.93 ? 3  VAL A N    3  
ATOM 4469  C CA   . VAL A 1 3  ? 19.277  17.310  -16.334 1.00 10.23 ? 3  VAL A CA   3  
ATOM 4470  C C    . VAL A 1 3  ? 18.495  16.132  -15.735 1.00 9.33  ? 3  VAL A C    3  
ATOM 4471  O O    . VAL A 1 3  ? 17.795  15.423  -16.436 1.00 9.35  ? 3  VAL A O    3  
ATOM 4472  C CB   . VAL A 1 3  ? 18.369  18.111  -17.282 1.00 10.49 ? 3  VAL A CB   3  
ATOM 4473  C CG1  . VAL A 1 3  ? 17.225  18.748  -16.485 1.00 10.45 ? 3  VAL A CG1  3  
ATOM 4474  C CG2  . VAL A 1 3  ? 19.184  19.215  -17.966 1.00 11.15 ? 3  VAL A CG2  3  
ATOM 4475  H H    . VAL A 1 3  ? 20.314  16.221  -17.881 1.00 11.13 ? 3  VAL A H    3  
ATOM 4476  H HA   . VAL A 1 3  ? 19.618  17.953  -15.536 1.00 10.38 ? 3  VAL A HA   3  
ATOM 4477  H HB   . VAL A 1 3  ? 17.958  17.449  -18.030 1.00 10.48 ? 3  VAL A HB   3  
ATOM 4478  H HG11 . VAL A 1 3  ? 17.608  19.135  -15.553 1.00 10.31 ? 3  VAL A HG11 3  
ATOM 4479  H HG12 . VAL A 1 3  ? 16.792  19.554  -17.059 1.00 10.52 ? 3  VAL A HG12 3  
ATOM 4480  H HG13 . VAL A 1 3  ? 16.469  18.004  -16.282 1.00 10.71 ? 3  VAL A HG13 3  
ATOM 4481  H HG21 . VAL A 1 3  ? 19.612  19.864  -17.217 1.00 11.26 ? 3  VAL A HG21 3  
ATOM 4482  H HG22 . VAL A 1 3  ? 19.975  18.769  -18.551 1.00 11.32 ? 3  VAL A HG22 3  
ATOM 4483  H HG23 . VAL A 1 3  ? 18.538  19.790  -18.613 1.00 11.52 ? 3  VAL A HG23 3  
ATOM 4484  N N    . ALA A 1 4  ? 18.621  15.922  -14.441 1.00 8.73  ? 4  ALA A N    3  
ATOM 4485  C CA   . ALA A 1 4  ? 17.901  14.792  -13.760 1.00 7.94  ? 4  ALA A CA   3  
ATOM 4486  C C    . ALA A 1 4  ? 18.403  13.441  -14.295 1.00 7.00  ? 4  ALA A C    3  
ATOM 4487  O O    . ALA A 1 4  ? 19.266  13.379  -15.153 1.00 7.01  ? 4  ALA A O    3  
ATOM 4488  C CB   . ALA A 1 4  ? 16.388  14.917  -13.996 1.00 8.20  ? 4  ALA A CB   3  
ATOM 4489  H H    . ALA A 1 4  ? 19.197  16.511  -13.910 1.00 8.94  ? 4  ALA A H    3  
ATOM 4490  H HA   . ALA A 1 4  ? 18.097  14.842  -12.699 1.00 8.12  ? 4  ALA A HA   3  
ATOM 4491  H HB1  . ALA A 1 4  ? 16.204  15.568  -14.836 1.00 8.32  ? 4  ALA A HB1  3  
ATOM 4492  H HB2  . ALA A 1 4  ? 15.972  13.941  -14.199 1.00 8.35  ? 4  ALA A HB2  3  
ATOM 4493  H HB3  . ALA A 1 4  ? 15.921  15.328  -13.113 1.00 8.38  ? 4  ALA A HB3  3  
ATOM 4494  N N    . THR A 1 5  ? 17.871  12.354  -13.785 1.00 6.46  ? 5  THR A N    3  
ATOM 4495  C CA   . THR A 1 5  ? 18.314  11.006  -14.253 1.00 5.78  ? 5  THR A CA   3  
ATOM 4496  C C    . THR A 1 5  ? 17.082  10.161  -14.605 1.00 4.91  ? 5  THR A C    3  
ATOM 4497  O O    . THR A 1 5  ? 16.774  9.184   -13.946 1.00 4.67  ? 5  THR A O    3  
ATOM 4498  C CB   . THR A 1 5  ? 19.129  10.315  -13.147 1.00 6.14  ? 5  THR A CB   3  
ATOM 4499  O OG1  . THR A 1 5  ? 19.931  11.275  -12.471 1.00 6.54  ? 5  THR A OG1  3  
ATOM 4500  C CG2  . THR A 1 5  ? 20.033  9.246   -13.766 1.00 6.80  ? 5  THR A CG2  3  
ATOM 4501  H H    . THR A 1 5  ? 17.182  12.426  -13.092 1.00 6.71  ? 5  THR A H    3  
ATOM 4502  H HA   . THR A 1 5  ? 18.930  11.118  -15.133 1.00 5.96  ? 5  THR A HA   3  
ATOM 4503  H HB   . THR A 1 5  ? 18.457  9.847   -12.442 1.00 5.97  ? 5  THR A HB   3  
ATOM 4504  H HG1  . THR A 1 5  ? 20.054  10.975  -11.567 1.00 6.80  ? 5  THR A HG1  3  
ATOM 4505  H HG21 . THR A 1 5  ? 19.635  8.948   -14.725 1.00 6.85  ? 5  THR A HG21 3  
ATOM 4506  H HG22 . THR A 1 5  ? 21.027  9.646   -13.897 1.00 7.20  ? 5  THR A HG22 3  
ATOM 4507  H HG23 . THR A 1 5  ? 20.074  8.387   -13.112 1.00 7.12  ? 5  THR A HG23 3  
ATOM 4508  N N    . GLU A 1 6  ? 16.376  10.535  -15.644 1.00 4.60  ? 6  GLU A N    3  
ATOM 4509  C CA   . GLU A 1 6  ? 15.162  9.765   -16.054 1.00 3.81  ? 6  GLU A CA   3  
ATOM 4510  C C    . GLU A 1 6  ? 14.762  10.155  -17.484 1.00 3.24  ? 6  GLU A C    3  
ATOM 4511  O O    . GLU A 1 6  ? 14.015  11.092  -17.700 1.00 3.60  ? 6  GLU A O    3  
ATOM 4512  C CB   . GLU A 1 6  ? 14.001  10.054  -15.088 1.00 4.36  ? 6  GLU A CB   3  
ATOM 4513  C CG   . GLU A 1 6  ? 13.856  11.566  -14.859 1.00 5.18  ? 6  GLU A CG   3  
ATOM 4514  C CD   . GLU A 1 6  ? 13.363  11.827  -13.434 1.00 5.79  ? 6  GLU A CD   3  
ATOM 4515  O OE1  . GLU A 1 6  ? 12.158  11.849  -13.239 1.00 6.16  ? 6  GLU A OE1  3  
ATOM 4516  O OE2  . GLU A 1 6  ? 14.198  12.004  -12.561 1.00 6.17  ? 6  GLU A OE2  3  
ATOM 4517  H H    . GLU A 1 6  ? 16.645  11.327  -16.155 1.00 5.01  ? 6  GLU A H    3  
ATOM 4518  H HA   . GLU A 1 6  ? 15.390  8.709   -16.028 1.00 3.44  ? 6  GLU A HA   3  
ATOM 4519  H HB2  . GLU A 1 6  ? 13.084  9.666   -15.509 1.00 4.83  ? 6  GLU A HB2  3  
ATOM 4520  H HB3  . GLU A 1 6  ? 14.193  9.566   -14.143 1.00 4.03  ? 6  GLU A HB3  3  
ATOM 4521  H HG2  . GLU A 1 6  ? 14.812  12.048  -15.002 1.00 5.45  ? 6  GLU A HG2  3  
ATOM 4522  H HG3  . GLU A 1 6  ? 13.143  11.970  -15.562 1.00 5.43  ? 6  GLU A HG3  3  
ATOM 4523  N N    . LEU A 1 7  ? 15.257  9.436   -18.466 1.00 2.59  ? 7  LEU A N    3  
ATOM 4524  C CA   . LEU A 1 7  ? 14.913  9.745   -19.881 1.00 2.31  ? 7  LEU A CA   3  
ATOM 4525  C C    . LEU A 1 7  ? 14.049  8.613   -20.400 1.00 1.55  ? 7  LEU A C    3  
ATOM 4526  O O    . LEU A 1 7  ? 12.955  8.814   -20.891 1.00 1.73  ? 7  LEU A O    3  
ATOM 4527  C CB   . LEU A 1 7  ? 16.169  9.832   -20.761 1.00 2.51  ? 7  LEU A CB   3  
ATOM 4528  C CG   . LEU A 1 7  ? 17.415  10.249  -19.970 1.00 3.14  ? 7  LEU A CG   3  
ATOM 4529  C CD1  . LEU A 1 7  ? 17.085  11.343  -18.953 1.00 3.94  ? 7  LEU A CD1  3  
ATOM 4530  C CD2  . LEU A 1 7  ? 17.951  9.029   -19.245 1.00 3.07  ? 7  LEU A CD2  3  
ATOM 4531  H H    . LEU A 1 7  ? 15.848  8.684   -18.272 1.00 2.53  ? 7  LEU A H    3  
ATOM 4532  H HA   . LEU A 1 7  ? 14.377  10.671  -19.926 1.00 2.80  ? 7  LEU A HA   3  
ATOM 4533  H HB2  . LEU A 1 7  ? 16.349  8.867   -21.212 1.00 2.07  ? 7  LEU A HB2  3  
ATOM 4534  H HB3  . LEU A 1 7  ? 15.989  10.540  -21.532 1.00 2.88  ? 7  LEU A HB3  3  
ATOM 4535  H HG   . LEU A 1 7  ? 18.165  10.614  -20.655 1.00 3.32  ? 7  LEU A HG   3  
ATOM 4536  H HD11 . LEU A 1 7  ? 16.096  11.729  -19.144 1.00 4.25  ? 7  LEU A HD11 3  
ATOM 4537  H HD12 . LEU A 1 7  ? 17.123  10.925  -17.957 1.00 4.28  ? 7  LEU A HD12 3  
ATOM 4538  H HD13 . LEU A 1 7  ? 17.808  12.138  -19.035 1.00 4.27  ? 7  LEU A HD13 3  
ATOM 4539  H HD21 . LEU A 1 7  ? 17.325  8.178   -19.479 1.00 3.18  ? 7  LEU A HD21 3  
ATOM 4540  H HD22 . LEU A 1 7  ? 18.959  8.836   -19.569 1.00 3.21  ? 7  LEU A HD22 3  
ATOM 4541  H HD23 . LEU A 1 7  ? 17.933  9.208   -18.182 1.00 3.36  ? 7  LEU A HD23 3  
ATOM 4542  N N    . ARG A 1 8  ? 14.561  7.416   -20.275 1.00 1.31  ? 8  ARG A N    3  
ATOM 4543  C CA   . ARG A 1 8  ? 13.833  6.197   -20.721 1.00 1.48  ? 8  ARG A CA   3  
ATOM 4544  C C    . ARG A 1 8  ? 12.390  6.245   -20.212 1.00 1.32  ? 8  ARG A C    3  
ATOM 4545  O O    . ARG A 1 8  ? 11.447  6.043   -20.956 1.00 1.92  ? 8  ARG A O    3  
ATOM 4546  C CB   . ARG A 1 8  ? 14.526  4.975   -20.119 1.00 2.16  ? 8  ARG A CB   3  
ATOM 4547  C CG   . ARG A 1 8  ? 15.260  4.197   -21.217 1.00 2.68  ? 8  ARG A CG   3  
ATOM 4548  C CD   . ARG A 1 8  ? 14.271  3.286   -21.952 1.00 2.99  ? 8  ARG A CD   3  
ATOM 4549  N NE   . ARG A 1 8  ? 13.902  2.132   -21.080 1.00 3.47  ? 8  ARG A NE   3  
ATOM 4550  C CZ   . ARG A 1 8  ? 12.966  1.297   -21.454 1.00 3.94  ? 8  ARG A CZ   3  
ATOM 4551  N NH1  . ARG A 1 8  ? 13.174  0.492   -22.465 1.00 4.42  ? 8  ARG A NH1  3  
ATOM 4552  N NH2  . ARG A 1 8  ? 11.826  1.264   -20.813 1.00 4.33  ? 8  ARG A NH2  3  
ATOM 4553  H H    . ARG A 1 8  ? 15.449  7.324   -19.872 1.00 1.63  ? 8  ARG A H    3  
ATOM 4554  H HA   . ARG A 1 8  ? 13.852  6.138   -21.793 1.00 1.84  ? 8  ARG A HA   3  
ATOM 4555  H HB2  . ARG A 1 8  ? 15.234  5.308   -19.370 1.00 2.23  ? 8  ARG A HB2  3  
ATOM 4556  H HB3  . ARG A 1 8  ? 13.788  4.339   -19.656 1.00 2.53  ? 8  ARG A HB3  3  
ATOM 4557  H HG2  . ARG A 1 8  ? 15.698  4.893   -21.918 1.00 2.98  ? 8  ARG A HG2  3  
ATOM 4558  H HG3  . ARG A 1 8  ? 16.038  3.595   -20.772 1.00 2.97  ? 8  ARG A HG3  3  
ATOM 4559  H HD2  . ARG A 1 8  ? 13.382  3.847   -22.200 1.00 3.17  ? 8  ARG A HD2  3  
ATOM 4560  H HD3  . ARG A 1 8  ? 14.727  2.919   -22.860 1.00 3.16  ? 8  ARG A HD3  3  
ATOM 4561  H HE   . ARG A 1 8  ? 14.358  1.998   -20.224 1.00 3.66  ? 8  ARG A HE   3  
ATOM 4562  H HH11 . ARG A 1 8  ? 14.048  0.515   -22.952 1.00 4.48  ? 8  ARG A HH11 3  
ATOM 4563  H HH12 . ARG A 1 8  ? 12.460  -0.147  -22.752 1.00 4.97  ? 8  ARG A HH12 3  
ATOM 4564  H HH21 . ARG A 1 8  ? 11.669  1.878   -20.038 1.00 4.37  ? 8  ARG A HH21 3  
ATOM 4565  H HH22 . ARG A 1 8  ? 11.109  0.626   -21.097 1.00 4.82  ? 8  ARG A HH22 3  
ATOM 4566  N N    . CYS A 1 9  ? 12.235  6.510   -18.936 1.00 0.86  ? 9  CYS A N    3  
ATOM 4567  C CA   . CYS A 1 9  ? 10.879  6.582   -18.311 1.00 0.66  ? 9  CYS A CA   3  
ATOM 4568  C C    . CYS A 1 9  ? 10.042  7.696   -18.971 1.00 0.61  ? 9  CYS A C    3  
ATOM 4569  O O    . CYS A 1 9  ? 10.558  8.553   -19.663 1.00 0.84  ? 9  CYS A O    3  
ATOM 4570  C CB   . CYS A 1 9  ? 11.041  6.859   -16.811 1.00 0.66  ? 9  CYS A CB   3  
ATOM 4571  S SG   . CYS A 1 9  ? 12.145  5.607   -16.083 1.00 0.94  ? 9  CYS A SG   3  
ATOM 4572  H H    . CYS A 1 9  ? 13.027  6.656   -18.380 1.00 1.09  ? 9  CYS A H    3  
ATOM 4573  H HA   . CYS A 1 9  ? 10.377  5.634   -18.445 1.00 0.74  ? 9  CYS A HA   3  
ATOM 4574  H HB2  . CYS A 1 9  ? 11.452  7.844   -16.669 1.00 0.78  ? 9  CYS A HB2  3  
ATOM 4575  H HB3  . CYS A 1 9  ? 10.078  6.804   -16.336 1.00 0.69  ? 9  CYS A HB3  3  
ATOM 4576  N N    . GLN A 1 10 ? 8.745   7.671   -18.770 1.00 0.51  ? 10 GLN A N    3  
ATOM 4577  C CA   . GLN A 1 10 ? 7.846   8.702   -19.394 1.00 0.47  ? 10 GLN A CA   3  
ATOM 4578  C C    . GLN A 1 10 ? 7.293   9.684   -18.342 1.00 0.39  ? 10 GLN A C    3  
ATOM 4579  O O    . GLN A 1 10 ? 6.689   10.678  -18.696 1.00 0.40  ? 10 GLN A O    3  
ATOM 4580  C CB   . GLN A 1 10 ? 6.665   7.991   -20.051 1.00 0.53  ? 10 GLN A CB   3  
ATOM 4581  C CG   . GLN A 1 10 ? 6.772   8.101   -21.576 1.00 0.64  ? 10 GLN A CG   3  
ATOM 4582  C CD   . GLN A 1 10 ? 5.405   7.834   -22.219 1.00 1.20  ? 10 GLN A CD   3  
ATOM 4583  O OE1  . GLN A 1 10 ? 4.810   6.796   -22.001 1.00 1.87  ? 10 GLN A OE1  3  
ATOM 4584  N NE2  . GLN A 1 10 ? 4.878   8.729   -23.013 1.00 1.84  ? 10 GLN A NE2  3  
ATOM 4585  H H    . GLN A 1 10 ? 8.358   6.961   -18.219 1.00 0.64  ? 10 GLN A H    3  
ATOM 4586  H HA   . GLN A 1 10 ? 8.394   9.250   -20.145 1.00 0.52  ? 10 GLN A HA   3  
ATOM 4587  H HB2  . GLN A 1 10 ? 6.671   6.951   -19.760 1.00 0.58  ? 10 GLN A HB2  3  
ATOM 4588  H HB3  . GLN A 1 10 ? 5.751   8.449   -19.717 1.00 0.50  ? 10 GLN A HB3  3  
ATOM 4589  H HG2  . GLN A 1 10 ? 7.107   9.094   -21.840 1.00 1.10  ? 10 GLN A HG2  3  
ATOM 4590  H HG3  . GLN A 1 10 ? 7.484   7.375   -21.937 1.00 1.15  ? 10 GLN A HG3  3  
ATOM 4591  H HE21 . GLN A 1 10 ? 5.356   9.566   -23.196 1.00 2.04  ? 10 GLN A HE21 3  
ATOM 4592  H HE22 . GLN A 1 10 ? 4.005   8.565   -23.426 1.00 2.45  ? 10 GLN A HE22 3  
ATOM 4593  N N    . CYS A 1 11 ? 7.477   9.399   -17.066 1.00 0.34  ? 11 CYS A N    3  
ATOM 4594  C CA   . CYS A 1 11 ? 6.953   10.293  -15.971 1.00 0.31  ? 11 CYS A CA   3  
ATOM 4595  C C    . CYS A 1 11 ? 7.035   11.774  -16.367 1.00 0.36  ? 11 CYS A C    3  
ATOM 4596  O O    . CYS A 1 11 ? 8.030   12.231  -16.903 1.00 0.50  ? 11 CYS A O    3  
ATOM 4597  C CB   . CYS A 1 11 ? 7.780   10.084  -14.706 1.00 0.30  ? 11 CYS A CB   3  
ATOM 4598  S SG   . CYS A 1 11 ? 7.502   8.420   -14.060 1.00 0.30  ? 11 CYS A SG   3  
ATOM 4599  H H    . CYS A 1 11 ? 7.950   8.580   -16.824 1.00 0.36  ? 11 CYS A H    3  
ATOM 4600  H HA   . CYS A 1 11 ? 5.926   10.038  -15.759 1.00 0.31  ? 11 CYS A HA   3  
ATOM 4601  H HB2  . CYS A 1 11 ? 8.826   10.211  -14.932 1.00 0.34  ? 11 CYS A HB2  3  
ATOM 4602  H HB3  . CYS A 1 11 ? 7.484   10.806  -13.968 1.00 0.31  ? 11 CYS A HB3  3  
ATOM 4603  N N    . LEU A 1 12 ? 5.998   12.526  -16.082 1.00 0.40  ? 12 LEU A N    3  
ATOM 4604  C CA   . LEU A 1 12 ? 6.003   13.985  -16.413 1.00 0.44  ? 12 LEU A CA   3  
ATOM 4605  C C    . LEU A 1 12 ? 6.950   14.681  -15.428 1.00 0.45  ? 12 LEU A C    3  
ATOM 4606  O O    . LEU A 1 12 ? 8.002   15.169  -15.790 1.00 0.48  ? 12 LEU A O    3  
ATOM 4607  C CB   . LEU A 1 12 ? 4.579   14.579  -16.269 1.00 0.49  ? 12 LEU A CB   3  
ATOM 4608  C CG   . LEU A 1 12 ? 3.499   13.568  -16.683 1.00 0.82  ? 12 LEU A CG   3  
ATOM 4609  C CD1  . LEU A 1 12 ? 2.124   14.228  -16.562 1.00 1.04  ? 12 LEU A CD1  3  
ATOM 4610  C CD2  . LEU A 1 12 ? 3.716   13.128  -18.132 1.00 1.56  ? 12 LEU A CD2  3  
ATOM 4611  H H    . LEU A 1 12 ? 5.225   12.134  -15.629 1.00 0.49  ? 12 LEU A H    3  
ATOM 4612  H HA   . LEU A 1 12 ? 6.359   14.128  -17.423 1.00 0.48  ? 12 LEU A HA   3  
ATOM 4613  H HB2  . LEU A 1 12 ? 4.412   14.858  -15.239 1.00 0.97  ? 12 LEU A HB2  3  
ATOM 4614  H HB3  . LEU A 1 12 ? 4.495   15.457  -16.890 1.00 0.98  ? 12 LEU A HB3  3  
ATOM 4615  H HG   . LEU A 1 12 ? 3.541   12.708  -16.033 1.00 1.56  ? 12 LEU A HG   3  
ATOM 4616  H HD11 . LEU A 1 12 ? 2.151   15.204  -17.023 1.00 1.31  ? 12 LEU A HD11 3  
ATOM 4617  H HD12 . LEU A 1 12 ? 1.385   13.616  -17.058 1.00 1.71  ? 12 LEU A HD12 3  
ATOM 4618  H HD13 . LEU A 1 12 ? 1.864   14.329  -15.518 1.00 1.40  ? 12 LEU A HD13 3  
ATOM 4619  H HD21 . LEU A 1 12 ? 3.699   13.994  -18.776 1.00 2.07  ? 12 LEU A HD21 3  
ATOM 4620  H HD22 . LEU A 1 12 ? 4.668   12.629  -18.218 1.00 2.10  ? 12 LEU A HD22 3  
ATOM 4621  H HD23 . LEU A 1 12 ? 2.925   12.450  -18.421 1.00 2.03  ? 12 LEU A HD23 3  
ATOM 4622  N N    . GLN A 1 13 ? 6.564   14.698  -14.181 1.00 0.43  ? 13 GLN A N    3  
ATOM 4623  C CA   . GLN A 1 13 ? 7.385   15.317  -13.101 1.00 0.45  ? 13 GLN A CA   3  
ATOM 4624  C C    . GLN A 1 13 ? 6.742   14.923  -11.765 1.00 0.42  ? 13 GLN A C    3  
ATOM 4625  O O    . GLN A 1 13 ? 6.572   15.738  -10.879 1.00 0.60  ? 13 GLN A O    3  
ATOM 4626  C CB   . GLN A 1 13 ? 7.377   16.844  -13.250 1.00 0.52  ? 13 GLN A CB   3  
ATOM 4627  C CG   . GLN A 1 13 ? 6.137   17.310  -14.025 1.00 1.11  ? 13 GLN A CG   3  
ATOM 4628  C CD   . GLN A 1 13 ? 5.801   18.750  -13.630 1.00 1.40  ? 13 GLN A CD   3  
ATOM 4629  O OE1  . GLN A 1 13 ? 6.054   19.671  -14.381 1.00 1.77  ? 13 GLN A OE1  3  
ATOM 4630  N NE2  . GLN A 1 13 ? 5.238   18.987  -12.475 1.00 2.09  ? 13 GLN A NE2  3  
ATOM 4631  H H    . GLN A 1 13 ? 5.720   14.286  -13.948 1.00 0.42  ? 13 GLN A H    3  
ATOM 4632  H HA   . GLN A 1 13 ? 8.396   14.940  -13.147 1.00 0.46  ? 13 GLN A HA   3  
ATOM 4633  H HB2  . GLN A 1 13 ? 7.392   17.304  -12.274 1.00 0.98  ? 13 GLN A HB2  3  
ATOM 4634  H HB3  . GLN A 1 13 ? 8.253   17.130  -13.794 1.00 0.85  ? 13 GLN A HB3  3  
ATOM 4635  H HG2  . GLN A 1 13 ? 6.336   17.263  -15.086 1.00 1.50  ? 13 GLN A HG2  3  
ATOM 4636  H HG3  . GLN A 1 13 ? 5.301   16.670  -13.787 1.00 1.66  ? 13 GLN A HG3  3  
ATOM 4637  H HE21 . GLN A 1 13 ? 5.034   18.245  -11.866 1.00 2.59  ? 13 GLN A HE21 3  
ATOM 4638  H HE22 . GLN A 1 13 ? 5.019   19.907  -12.216 1.00 2.41  ? 13 GLN A HE22 3  
ATOM 4639  N N    . THR A 1 14 ? 6.348   13.669  -11.668 1.00 0.36  ? 14 THR A N    3  
ATOM 4640  C CA   . THR A 1 14 ? 5.645   13.114  -10.464 1.00 0.32  ? 14 THR A CA   3  
ATOM 4641  C C    . THR A 1 14 ? 4.839   14.170  -9.710  1.00 0.35  ? 14 THR A C    3  
ATOM 4642  O O    . THR A 1 14 ? 5.339   14.876  -8.851  1.00 0.39  ? 14 THR A O    3  
ATOM 4643  C CB   . THR A 1 14 ? 6.585   12.415  -9.506  1.00 0.32  ? 14 THR A CB   3  
ATOM 4644  O OG1  . THR A 1 14 ? 7.706   13.241  -9.217  1.00 0.38  ? 14 THR A OG1  3  
ATOM 4645  C CG2  . THR A 1 14 ? 7.038   11.097  -10.133 1.00 0.31  ? 14 THR A CG2  3  
ATOM 4646  H H    . THR A 1 14 ? 6.491   13.076  -12.435 1.00 0.51  ? 14 THR A H    3  
ATOM 4647  H HA   . THR A 1 14 ? 4.958   12.377  -10.822 1.00 0.30  ? 14 THR A HA   3  
ATOM 4648  H HB   . THR A 1 14 ? 6.031   12.201  -8.602  1.00 0.32  ? 14 THR A HB   3  
ATOM 4649  H HG1  . THR A 1 14 ? 7.478   13.801  -8.470  1.00 0.69  ? 14 THR A HG1  3  
ATOM 4650  H HG21 . THR A 1 14 ? 6.169   10.543  -10.462 1.00 1.08  ? 14 THR A HG21 3  
ATOM 4651  H HG22 . THR A 1 14 ? 7.675   11.301  -10.979 1.00 1.01  ? 14 THR A HG22 3  
ATOM 4652  H HG23 . THR A 1 14 ? 7.578   10.518  -9.402  1.00 1.05  ? 14 THR A HG23 3  
ATOM 4653  N N    . LEU A 1 15 ? 3.579   14.246  -10.014 1.00 0.36  ? 15 LEU A N    3  
ATOM 4654  C CA   . LEU A 1 15 ? 2.688   15.225  -9.323  1.00 0.41  ? 15 LEU A CA   3  
ATOM 4655  C C    . LEU A 1 15 ? 2.356   14.700  -7.921  1.00 0.35  ? 15 LEU A C    3  
ATOM 4656  O O    . LEU A 1 15 ? 2.418   13.513  -7.663  1.00 0.52  ? 15 LEU A O    3  
ATOM 4657  C CB   . LEU A 1 15 ? 1.401   15.412  -10.131 1.00 0.57  ? 15 LEU A CB   3  
ATOM 4658  C CG   . LEU A 1 15 ? 1.739   16.083  -11.467 1.00 0.64  ? 15 LEU A CG   3  
ATOM 4659  C CD1  . LEU A 1 15 ? 0.669   15.739  -12.506 1.00 0.74  ? 15 LEU A CD1  3  
ATOM 4660  C CD2  . LEU A 1 15 ? 1.797   17.600  -11.273 1.00 1.76  ? 15 LEU A CD2  3  
ATOM 4661  H H    . LEU A 1 15 ? 3.213   13.634  -10.693 1.00 0.35  ? 15 LEU A H    3  
ATOM 4662  H HA   . LEU A 1 15 ? 3.199   16.175  -9.237  1.00 0.51  ? 15 LEU A HA   3  
ATOM 4663  H HB2  . LEU A 1 15 ? 0.946   14.448  -10.313 1.00 1.12  ? 15 LEU A HB2  3  
ATOM 4664  H HB3  . LEU A 1 15 ? 0.715   16.037  -9.579  1.00 0.90  ? 15 LEU A HB3  3  
ATOM 4665  H HG   . LEU A 1 15 ? 2.699   15.727  -11.812 1.00 1.32  ? 15 LEU A HG   3  
ATOM 4666  H HD11 . LEU A 1 15 ? 0.268   14.756  -12.300 1.00 1.31  ? 15 LEU A HD11 3  
ATOM 4667  H HD12 . LEU A 1 15 ? -0.126  16.469  -12.462 1.00 1.29  ? 15 LEU A HD12 3  
ATOM 4668  H HD13 . LEU A 1 15 ? 1.110   15.747  -13.492 1.00 1.44  ? 15 LEU A HD13 3  
ATOM 4669  H HD21 . LEU A 1 15 ? 2.434   17.829  -10.431 1.00 2.29  ? 15 LEU A HD21 3  
ATOM 4670  H HD22 . LEU A 1 15 ? 2.197   18.061  -12.163 1.00 2.30  ? 15 LEU A HD22 3  
ATOM 4671  H HD23 . LEU A 1 15 ? 0.803   17.978  -11.085 1.00 2.30  ? 15 LEU A HD23 3  
ATOM 4672  N N    . GLN A 1 16 ? 2.021   15.581  -7.014  1.00 0.47  ? 16 GLN A N    3  
ATOM 4673  C CA   . GLN A 1 16 ? 1.703   15.149  -5.622  1.00 0.41  ? 16 GLN A CA   3  
ATOM 4674  C C    . GLN A 1 16 ? 0.220   14.793  -5.501  1.00 0.39  ? 16 GLN A C    3  
ATOM 4675  O O    . GLN A 1 16 ? -0.530  15.414  -4.770  1.00 0.47  ? 16 GLN A O    3  
ATOM 4676  C CB   . GLN A 1 16 ? 2.054   16.275  -4.642  1.00 0.48  ? 16 GLN A CB   3  
ATOM 4677  C CG   . GLN A 1 16 ? 3.513   16.141  -4.193  1.00 0.60  ? 16 GLN A CG   3  
ATOM 4678  C CD   . GLN A 1 16 ? 4.422   16.939  -5.136  1.00 0.77  ? 16 GLN A CD   3  
ATOM 4679  O OE1  . GLN A 1 16 ? 4.166   18.094  -5.412  1.00 1.48  ? 16 GLN A OE1  3  
ATOM 4680  N NE2  . GLN A 1 16 ? 5.482   16.368  -5.641  1.00 1.31  ? 16 GLN A NE2  3  
ATOM 4681  H H    . GLN A 1 16 ? 1.990   16.526  -7.245  1.00 0.72  ? 16 GLN A H    3  
ATOM 4682  H HA   . GLN A 1 16 ? 2.285   14.268  -5.382  1.00 0.43  ? 16 GLN A HA   3  
ATOM 4683  H HB2  . GLN A 1 16 ? 1.913   17.230  -5.128  1.00 0.51  ? 16 GLN A HB2  3  
ATOM 4684  H HB3  . GLN A 1 16 ? 1.409   16.215  -3.779  1.00 0.49  ? 16 GLN A HB3  3  
ATOM 4685  H HG2  . GLN A 1 16 ? 3.615   16.522  -3.187  1.00 0.75  ? 16 GLN A HG2  3  
ATOM 4686  H HG3  . GLN A 1 16 ? 3.802   15.100  -4.214  1.00 0.72  ? 16 GLN A HG3  3  
ATOM 4687  H HE21 . GLN A 1 16 ? 5.693   15.437  -5.418  1.00 1.98  ? 16 GLN A HE21 3  
ATOM 4688  H HE22 . GLN A 1 16 ? 6.067   16.871  -6.245  1.00 1.46  ? 16 GLN A HE22 3  
ATOM 4689  N N    . GLY A 1 17 ? -0.190  13.770  -6.199  1.00 0.36  ? 17 GLY A N    3  
ATOM 4690  C CA   . GLY A 1 17 ? -1.601  13.308  -6.121  1.00 0.45  ? 17 GLY A CA   3  
ATOM 4691  C C    . GLY A 1 17 ? -2.547  14.324  -6.748  1.00 0.41  ? 17 GLY A C    3  
ATOM 4692  O O    . GLY A 1 17 ? -3.064  15.198  -6.077  1.00 0.57  ? 17 GLY A O    3  
ATOM 4693  H H    . GLY A 1 17 ? 0.447   13.288  -6.763  1.00 0.34  ? 17 GLY A H    3  
ATOM 4694  H HA2  . GLY A 1 17 ? -1.693  12.369  -6.643  1.00 0.56  ? 17 GLY A HA2  3  
ATOM 4695  H HA3  . GLY A 1 17 ? -1.871  13.166  -5.085  1.00 0.59  ? 17 GLY A HA3  3  
ATOM 4696  N N    . ILE A 1 18 ? -2.812  14.191  -8.021  1.00 0.39  ? 18 ILE A N    3  
ATOM 4697  C CA   . ILE A 1 18 ? -3.767  15.120  -8.681  1.00 0.49  ? 18 ILE A CA   3  
ATOM 4698  C C    . ILE A 1 18 ? -5.182  14.598  -8.414  1.00 0.50  ? 18 ILE A C    3  
ATOM 4699  O O    . ILE A 1 18 ? -5.370  13.670  -7.646  1.00 0.72  ? 18 ILE A O    3  
ATOM 4700  C CB   . ILE A 1 18 ? -3.469  15.238  -10.194 1.00 0.67  ? 18 ILE A CB   3  
ATOM 4701  C CG1  . ILE A 1 18 ? -4.198  14.152  -10.999 1.00 0.72  ? 18 ILE A CG1  3  
ATOM 4702  C CG2  . ILE A 1 18 ? -1.960  15.132  -10.448 1.00 0.74  ? 18 ILE A CG2  3  
ATOM 4703  C CD1  . ILE A 1 18 ? -3.870  12.777  -10.436 1.00 0.66  ? 18 ILE A CD1  3  
ATOM 4704  H H    . ILE A 1 18 ? -2.412  13.462  -8.532  1.00 0.45  ? 18 ILE A H    3  
ATOM 4705  H HA   . ILE A 1 18 ? -3.675  16.090  -8.233  1.00 0.54  ? 18 ILE A HA   3  
ATOM 4706  H HB   . ILE A 1 18 ? -3.801  16.203  -10.528 1.00 0.79  ? 18 ILE A HB   3  
ATOM 4707  H HG12 . ILE A 1 18 ? -5.263  14.318  -10.945 1.00 0.70  ? 18 ILE A HG12 3  
ATOM 4708  H HG13 . ILE A 1 18 ? -3.882  14.199  -12.030 1.00 0.91  ? 18 ILE A HG13 3  
ATOM 4709  H HG21 . ILE A 1 18 ? -1.426  15.637  -9.657  1.00 1.33  ? 18 ILE A HG21 3  
ATOM 4710  H HG22 . ILE A 1 18 ? -1.670  14.093  -10.472 1.00 1.17  ? 18 ILE A HG22 3  
ATOM 4711  H HG23 . ILE A 1 18 ? -1.723  15.595  -11.394 1.00 1.14  ? 18 ILE A HG23 3  
ATOM 4712  H HD11 . ILE A 1 18 ? -2.800  12.675  -10.345 1.00 1.04  ? 18 ILE A HD11 3  
ATOM 4713  H HD12 . ILE A 1 18 ? -4.327  12.672  -9.463  1.00 1.35  ? 18 ILE A HD12 3  
ATOM 4714  H HD13 . ILE A 1 18 ? -4.252  12.020  -11.097 1.00 1.18  ? 18 ILE A HD13 3  
ATOM 4715  N N    . HIS A 1 19 ? -6.175  15.172  -9.022  1.00 0.45  ? 19 HIS A N    3  
ATOM 4716  C CA   . HIS A 1 19 ? -7.559  14.685  -8.774  1.00 0.47  ? 19 HIS A CA   3  
ATOM 4717  C C    . HIS A 1 19 ? -7.931  13.675  -9.879  1.00 0.39  ? 19 HIS A C    3  
ATOM 4718  O O    . HIS A 1 19 ? -7.507  13.828  -11.011 1.00 0.35  ? 19 HIS A O    3  
ATOM 4719  C CB   . HIS A 1 19 ? -8.518  15.894  -8.721  1.00 0.54  ? 19 HIS A CB   3  
ATOM 4720  C CG   . HIS A 1 19 ? -9.606  15.785  -9.750  1.00 0.60  ? 19 HIS A CG   3  
ATOM 4721  N ND1  . HIS A 1 19 ? -10.938 15.643  -9.403  1.00 0.75  ? 19 HIS A ND1  3  
ATOM 4722  C CD2  . HIS A 1 19 ? -9.571  15.815  -11.116 1.00 0.60  ? 19 HIS A CD2  3  
ATOM 4723  C CE1  . HIS A 1 19 ? -11.647 15.598  -10.542 1.00 0.81  ? 19 HIS A CE1  3  
ATOM 4724  N NE2  . HIS A 1 19 ? -10.862 15.699  -11.619 1.00 0.74  ? 19 HIS A NE2  3  
ATOM 4725  H H    . HIS A 1 19 ? -6.011  15.913  -9.637  1.00 0.55  ? 19 HIS A H    3  
ATOM 4726  H HA   . HIS A 1 19 ? -7.569  14.187  -7.818  1.00 0.50  ? 19 HIS A HA   3  
ATOM 4727  H HB2  . HIS A 1 19 ? -8.966  15.944  -7.741  1.00 0.64  ? 19 HIS A HB2  3  
ATOM 4728  H HB3  . HIS A 1 19 ? -7.953  16.799  -8.897  1.00 0.52  ? 19 HIS A HB3  3  
ATOM 4729  H HD1  . HIS A 1 19 ? -11.300 15.587  -8.493  1.00 0.84  ? 19 HIS A HD1  3  
ATOM 4730  H HD2  . HIS A 1 19 ? -8.673  15.888  -11.708 1.00 0.55  ? 19 HIS A HD2  3  
ATOM 4731  H HE1  . HIS A 1 19 ? -12.719 15.480  -10.584 1.00 0.93  ? 19 HIS A HE1  3  
ATOM 4732  N N    . PRO A 1 20 ? -8.683  12.651  -9.519  1.00 0.39  ? 20 PRO A N    3  
ATOM 4733  C CA   . PRO A 1 20 ? -9.084  11.597  -10.468 1.00 0.35  ? 20 PRO A CA   3  
ATOM 4734  C C    . PRO A 1 20 ? -10.193 12.091  -11.418 1.00 0.37  ? 20 PRO A C    3  
ATOM 4735  O O    . PRO A 1 20 ? -9.987  13.059  -12.123 1.00 0.43  ? 20 PRO A O    3  
ATOM 4736  C CB   . PRO A 1 20 ? -9.528  10.447  -9.556  1.00 0.40  ? 20 PRO A CB   3  
ATOM 4737  C CG   . PRO A 1 20 ? -9.906  11.085  -8.203  1.00 0.47  ? 20 PRO A CG   3  
ATOM 4738  C CD   . PRO A 1 20 ? -9.194  12.445  -8.146  1.00 0.46  ? 20 PRO A CD   3  
ATOM 4739  H HA   . PRO A 1 20 ? -8.230  11.287  -11.047 1.00 0.32  ? 20 PRO A HA   3  
ATOM 4740  H HB2  . PRO A 1 20 ? -10.370 9.928   -9.979  1.00 0.40  ? 20 PRO A HB2  3  
ATOM 4741  H HB3  . PRO A 1 20 ? -8.709  9.760   -9.411  1.00 0.40  ? 20 PRO A HB3  3  
ATOM 4742  H HG2  . PRO A 1 20 ? -10.977 11.225  -8.147  1.00 0.50  ? 20 PRO A HG2  3  
ATOM 4743  H HG3  . PRO A 1 20 ? -9.567  10.464  -7.392  1.00 0.52  ? 20 PRO A HG3  3  
ATOM 4744  H HD2  . PRO A 1 20 ? -9.896  13.217  -7.879  1.00 0.50  ? 20 PRO A HD2  3  
ATOM 4745  H HD3  . PRO A 1 20 ? -8.378  12.405  -7.445  1.00 0.47  ? 20 PRO A HD3  3  
ATOM 4746  N N    . LYS A 1 21 ? -11.333 11.416  -11.503 1.00 0.38  ? 21 LYS A N    3  
ATOM 4747  C CA   . LYS A 1 21 ? -12.410 11.822  -12.472 1.00 0.40  ? 21 LYS A CA   3  
ATOM 4748  C C    . LYS A 1 21 ? -11.948 11.424  -13.881 1.00 0.38  ? 21 LYS A C    3  
ATOM 4749  O O    . LYS A 1 21 ? -12.651 10.749  -14.610 1.00 0.42  ? 21 LYS A O    3  
ATOM 4750  C CB   . LYS A 1 21 ? -12.688 13.330  -12.407 1.00 0.42  ? 21 LYS A CB   3  
ATOM 4751  C CG   . LYS A 1 21 ? -13.985 13.636  -13.163 1.00 0.51  ? 21 LYS A CG   3  
ATOM 4752  C CD   . LYS A 1 21 ? -14.545 14.990  -12.719 1.00 0.98  ? 21 LYS A CD   3  
ATOM 4753  C CE   . LYS A 1 21 ? -13.645 16.120  -13.229 1.00 1.47  ? 21 LYS A CE   3  
ATOM 4754  N NZ   . LYS A 1 21 ? -14.484 17.267  -13.680 1.00 2.14  ? 21 LYS A NZ   3  
ATOM 4755  H H    . LYS A 1 21 ? -11.466 10.615  -10.965 1.00 0.41  ? 21 LYS A H    3  
ATOM 4756  H HA   . LYS A 1 21 ? -13.313 11.280  -12.236 1.00 0.43  ? 21 LYS A HA   3  
ATOM 4757  H HB2  . LYS A 1 21 ? -12.789 13.633  -11.376 1.00 0.42  ? 21 LYS A HB2  3  
ATOM 4758  H HB3  . LYS A 1 21 ? -11.873 13.869  -12.865 1.00 0.40  ? 21 LYS A HB3  3  
ATOM 4759  H HG2  . LYS A 1 21 ? -13.784 13.663  -14.224 1.00 0.97  ? 21 LYS A HG2  3  
ATOM 4760  H HG3  . LYS A 1 21 ? -14.712 12.865  -12.955 1.00 0.86  ? 21 LYS A HG3  3  
ATOM 4761  H HD2  . LYS A 1 21 ? -15.540 15.114  -13.120 1.00 1.62  ? 21 LYS A HD2  3  
ATOM 4762  H HD3  . LYS A 1 21 ? -14.588 15.026  -11.640 1.00 1.69  ? 21 LYS A HD3  3  
ATOM 4763  H HE2  . LYS A 1 21 ? -12.993 16.445  -12.432 1.00 1.83  ? 21 LYS A HE2  3  
ATOM 4764  H HE3  . LYS A 1 21 ? -13.050 15.761  -14.055 1.00 1.91  ? 21 LYS A HE3  3  
ATOM 4765  H HZ1  . LYS A 1 21 ? -15.120 17.557  -12.910 1.00 2.32  ? 21 LYS A HZ1  3  
ATOM 4766  H HZ2  . LYS A 1 21 ? -13.867 18.065  -13.938 1.00 2.71  ? 21 LYS A HZ2  3  
ATOM 4767  H HZ3  . LYS A 1 21 ? -15.047 16.983  -14.506 1.00 2.51  ? 21 LYS A HZ3  3  
ATOM 4768  N N    . ASN A 1 22 ? -10.744 11.802  -14.239 1.00 0.36  ? 22 ASN A N    3  
ATOM 4769  C CA   . ASN A 1 22 ? -10.166 11.431  -15.547 1.00 0.36  ? 22 ASN A CA   3  
ATOM 4770  C C    . ASN A 1 22 ? -9.291  10.208  -15.297 1.00 0.34  ? 22 ASN A C    3  
ATOM 4771  O O    . ASN A 1 22 ? -9.421  9.182   -15.927 1.00 0.36  ? 22 ASN A O    3  
ATOM 4772  C CB   . ASN A 1 22 ? -9.275  12.573  -16.054 1.00 0.36  ? 22 ASN A CB   3  
ATOM 4773  C CG   . ASN A 1 22 ? -9.859  13.933  -15.656 1.00 0.38  ? 22 ASN A CG   3  
ATOM 4774  O OD1  . ASN A 1 22 ? -10.801 14.407  -16.262 1.00 0.42  ? 22 ASN A OD1  3  
ATOM 4775  N ND2  . ASN A 1 22 ? -9.331  14.584  -14.653 1.00 0.37  ? 22 ASN A ND2  3  
ATOM 4776  H H    . ASN A 1 22 ? -10.191 12.309  -13.618 1.00 0.35  ? 22 ASN A H    3  
ATOM 4777  H HA   . ASN A 1 22 ? -10.943 11.207  -16.261 1.00 0.39  ? 22 ASN A HA   3  
ATOM 4778  H HB2  . ASN A 1 22 ? -8.292  12.474  -15.618 1.00 0.33  ? 22 ASN A HB2  3  
ATOM 4779  H HB3  . ASN A 1 22 ? -9.194  12.514  -17.117 1.00 0.38  ? 22 ASN A HB3  3  
ATOM 4780  H HD21 . ASN A 1 22 ? -8.570  14.201  -14.165 1.00 0.34  ? 22 ASN A HD21 3  
ATOM 4781  H HD22 . ASN A 1 22 ? -9.693  15.454  -14.387 1.00 0.39  ? 22 ASN A HD22 3  
ATOM 4782  N N    . ILE A 1 23 ? -8.413  10.338  -14.340 1.00 0.31  ? 23 ILE A N    3  
ATOM 4783  C CA   . ILE A 1 23 ? -7.492  9.246   -13.950 1.00 0.30  ? 23 ILE A CA   3  
ATOM 4784  C C    . ILE A 1 23 ? -8.262  7.918   -13.870 1.00 0.34  ? 23 ILE A C    3  
ATOM 4785  O O    . ILE A 1 23 ? -9.062  7.699   -12.980 1.00 0.37  ? 23 ILE A O    3  
ATOM 4786  C CB   . ILE A 1 23 ? -6.924  9.642   -12.584 1.00 0.29  ? 23 ILE A CB   3  
ATOM 4787  C CG1  . ILE A 1 23 ? -5.669  10.494  -12.782 1.00 0.27  ? 23 ILE A CG1  3  
ATOM 4788  C CG2  . ILE A 1 23 ? -6.585  8.413   -11.755 1.00 0.33  ? 23 ILE A CG2  3  
ATOM 4789  C CD1  . ILE A 1 23 ? -6.068  11.871  -13.317 1.00 0.26  ? 23 ILE A CD1  3  
ATOM 4790  H H    . ILE A 1 23 ? -8.367  11.180  -13.848 1.00 0.31  ? 23 ILE A H    3  
ATOM 4791  H HA   . ILE A 1 23 ? -6.689  9.168   -14.674 1.00 0.29  ? 23 ILE A HA   3  
ATOM 4792  H HB   . ILE A 1 23 ? -7.667  10.226  -12.062 1.00 0.31  ? 23 ILE A HB   3  
ATOM 4793  H HG12 . ILE A 1 23 ? -5.161  10.609  -11.835 1.00 0.29  ? 23 ILE A HG12 3  
ATOM 4794  H HG13 . ILE A 1 23 ? -5.013  10.011  -13.488 1.00 0.26  ? 23 ILE A HG13 3  
ATOM 4795  H HG21 . ILE A 1 23 ? -6.199  7.641   -12.401 1.00 1.10  ? 23 ILE A HG21 3  
ATOM 4796  H HG22 . ILE A 1 23 ? -5.846  8.675   -11.016 1.00 1.08  ? 23 ILE A HG22 3  
ATOM 4797  H HG23 . ILE A 1 23 ? -7.481  8.061   -11.264 1.00 1.00  ? 23 ILE A HG23 3  
ATOM 4798  H HD11 . ILE A 1 23 ? -6.913  12.244  -12.757 1.00 0.97  ? 23 ILE A HD11 3  
ATOM 4799  H HD12 . ILE A 1 23 ? -5.239  12.552  -13.215 1.00 1.04  ? 23 ILE A HD12 3  
ATOM 4800  H HD13 . ILE A 1 23 ? -6.339  11.786  -14.360 1.00 1.03  ? 23 ILE A HD13 3  
ATOM 4801  N N    . GLN A 1 24 ? -8.033  7.047   -14.817 1.00 0.36  ? 24 GLN A N    3  
ATOM 4802  C CA   . GLN A 1 24 ? -8.731  5.743   -14.850 1.00 0.42  ? 24 GLN A CA   3  
ATOM 4803  C C    . GLN A 1 24 ? -7.783  4.615   -14.432 1.00 0.37  ? 24 GLN A C    3  
ATOM 4804  O O    . GLN A 1 24 ? -8.226  3.546   -14.055 1.00 0.39  ? 24 GLN A O    3  
ATOM 4805  C CB   . GLN A 1 24 ? -9.185  5.518   -16.285 1.00 0.48  ? 24 GLN A CB   3  
ATOM 4806  C CG   . GLN A 1 24 ? -10.692 5.265   -16.329 1.00 0.57  ? 24 GLN A CG   3  
ATOM 4807  C CD   . GLN A 1 24 ? -10.948 3.791   -16.653 1.00 1.16  ? 24 GLN A CD   3  
ATOM 4808  O OE1  . GLN A 1 24 ? -11.138 2.986   -15.763 1.00 1.82  ? 24 GLN A OE1  3  
ATOM 4809  N NE2  . GLN A 1 24 ? -10.955 3.400   -17.899 1.00 1.58  ? 24 GLN A NE2  3  
ATOM 4810  H H    . GLN A 1 24 ? -7.400  7.252   -15.535 1.00 0.36  ? 24 GLN A H    3  
ATOM 4811  H HA   . GLN A 1 24 ? -9.593  5.758   -14.194 1.00 0.46  ? 24 GLN A HA   3  
ATOM 4812  H HB2  . GLN A 1 24 ? -8.957  6.400   -16.868 1.00 0.48  ? 24 GLN A HB2  3  
ATOM 4813  H HB3  . GLN A 1 24 ? -8.654  4.685   -16.690 1.00 0.48  ? 24 GLN A HB3  3  
ATOM 4814  H HG2  . GLN A 1 24 ? -11.128 5.505   -15.369 1.00 0.66  ? 24 GLN A HG2  3  
ATOM 4815  H HG3  . GLN A 1 24 ? -11.138 5.882   -17.092 1.00 0.91  ? 24 GLN A HG3  3  
ATOM 4816  H HE21 . GLN A 1 24 ? -10.797 4.048   -18.617 1.00 1.80  ? 24 GLN A HE21 3  
ATOM 4817  H HE22 . GLN A 1 24 ? -11.117 2.458   -18.114 1.00 2.04  ? 24 GLN A HE22 3  
ATOM 4818  N N    . SER A 1 25 ? -6.486  4.828   -14.500 1.00 0.33  ? 25 SER A N    3  
ATOM 4819  C CA   . SER A 1 25 ? -5.545  3.741   -14.110 1.00 0.29  ? 25 SER A CA   3  
ATOM 4820  C C    . SER A 1 25 ? -4.144  4.286   -13.855 1.00 0.27  ? 25 SER A C    3  
ATOM 4821  O O    . SER A 1 25 ? -3.883  5.463   -13.999 1.00 0.29  ? 25 SER A O    3  
ATOM 4822  C CB   . SER A 1 25 ? -5.451  2.723   -15.227 1.00 0.31  ? 25 SER A CB   3  
ATOM 4823  O OG   . SER A 1 25 ? -4.968  3.349   -16.410 1.00 0.34  ? 25 SER A OG   3  
ATOM 4824  H H    . SER A 1 25 ? -6.136  5.693   -14.809 1.00 0.33  ? 25 SER A H    3  
ATOM 4825  H HA   . SER A 1 25 ? -5.907  3.248   -13.226 1.00 0.29  ? 25 SER A HA   3  
ATOM 4826  H HB2  . SER A 1 25 ? -4.764  1.957   -14.925 1.00 0.31  ? 25 SER A HB2  3  
ATOM 4827  H HB3  . SER A 1 25 ? -6.422  2.288   -15.401 1.00 0.30  ? 25 SER A HB3  3  
ATOM 4828  H HG   . SER A 1 25 ? -4.247  2.817   -16.753 1.00 0.78  ? 25 SER A HG   3  
ATOM 4829  N N    . VAL A 1 26 ? -3.243  3.412   -13.489 1.00 0.25  ? 26 VAL A N    3  
ATOM 4830  C CA   . VAL A 1 26 ? -1.835  3.816   -13.238 1.00 0.24  ? 26 VAL A CA   3  
ATOM 4831  C C    . VAL A 1 26 ? -0.926  2.608   -13.440 1.00 0.25  ? 26 VAL A C    3  
ATOM 4832  O O    . VAL A 1 26 ? -1.342  1.469   -13.314 1.00 0.26  ? 26 VAL A O    3  
ATOM 4833  C CB   . VAL A 1 26 ? -1.648  4.337   -11.806 1.00 0.23  ? 26 VAL A CB   3  
ATOM 4834  C CG1  . VAL A 1 26 ? -2.451  3.495   -10.831 1.00 0.24  ? 26 VAL A CG1  3  
ATOM 4835  C CG2  . VAL A 1 26 ? -0.165  4.268   -11.422 1.00 0.26  ? 26 VAL A CG2  3  
ATOM 4836  H H    . VAL A 1 26 ? -3.496  2.471   -13.390 1.00 0.25  ? 26 VAL A H    3  
ATOM 4837  H HA   . VAL A 1 26 ? -1.563  4.591   -13.937 1.00 0.24  ? 26 VAL A HA   3  
ATOM 4838  H HB   . VAL A 1 26 ? -1.985  5.347   -11.748 1.00 0.25  ? 26 VAL A HB   3  
ATOM 4839  H HG11 . VAL A 1 26 ? -3.236  2.984   -11.365 1.00 1.10  ? 26 VAL A HG11 3  
ATOM 4840  H HG12 . VAL A 1 26 ? -1.802  2.775   -10.365 1.00 1.01  ? 26 VAL A HG12 3  
ATOM 4841  H HG13 . VAL A 1 26 ? -2.882  4.139   -10.081 1.00 1.00  ? 26 VAL A HG13 3  
ATOM 4842  H HG21 . VAL A 1 26 ? 0.422   4.792   -12.162 1.00 1.03  ? 26 VAL A HG21 3  
ATOM 4843  H HG22 . VAL A 1 26 ? -0.019  4.721   -10.458 1.00 1.06  ? 26 VAL A HG22 3  
ATOM 4844  H HG23 . VAL A 1 26 ? 0.148   3.232   -11.387 1.00 1.05  ? 26 VAL A HG23 3  
ATOM 4845  N N    . ASN A 1 27 ? 0.319   2.859   -13.729 1.00 0.25  ? 27 ASN A N    3  
ATOM 4846  C CA   . ASN A 1 27 ? 1.276   1.757   -13.916 1.00 0.27  ? 27 ASN A CA   3  
ATOM 4847  C C    . ASN A 1 27 ? 2.507   1.985   -13.052 1.00 0.25  ? 27 ASN A C    3  
ATOM 4848  O O    . ASN A 1 27 ? 3.146   3.019   -13.110 1.00 0.42  ? 27 ASN A O    3  
ATOM 4849  C CB   . ASN A 1 27 ? 1.698   1.621   -15.370 1.00 0.30  ? 27 ASN A CB   3  
ATOM 4850  C CG   . ASN A 1 27 ? 0.990   2.636   -16.281 1.00 0.57  ? 27 ASN A CG   3  
ATOM 4851  O OD1  . ASN A 1 27 ? -0.224  2.668   -16.355 1.00 0.95  ? 27 ASN A OD1  3  
ATOM 4852  N ND2  . ASN A 1 27 ? 1.705   3.457   -16.998 1.00 0.72  ? 27 ASN A ND2  3  
ATOM 4853  H H    . ASN A 1 27 ? 0.621   3.781   -13.808 1.00 0.26  ? 27 ASN A H    3  
ATOM 4854  H HA   . ASN A 1 27 ? 0.811   0.846   -13.608 1.00 0.30  ? 27 ASN A HA   3  
ATOM 4855  H HB2  . ASN A 1 27 ? 2.766   1.748   -15.445 1.00 0.45  ? 27 ASN A HB2  3  
ATOM 4856  H HB3  . ASN A 1 27 ? 1.438   0.641   -15.680 1.00 0.51  ? 27 ASN A HB3  3  
ATOM 4857  H HD21 . ASN A 1 27 ? 2.683   3.427   -16.952 1.00 0.75  ? 27 ASN A HD21 3  
ATOM 4858  H HD22 . ASN A 1 27 ? 1.262   4.099   -17.590 1.00 0.99  ? 27 ASN A HD22 3  
ATOM 4859  N N    . VAL A 1 28 ? 2.842   1.009   -12.259 1.00 0.28  ? 28 VAL A N    3  
ATOM 4860  C CA   . VAL A 1 28 ? 4.035   1.132   -11.378 1.00 0.28  ? 28 VAL A CA   3  
ATOM 4861  C C    . VAL A 1 28 ? 5.080   0.094   -11.804 1.00 0.31  ? 28 VAL A C    3  
ATOM 4862  O O    . VAL A 1 28 ? 4.747   -1.023  -12.145 1.00 0.33  ? 28 VAL A O    3  
ATOM 4863  C CB   . VAL A 1 28 ? 3.620   0.911   -9.914  1.00 0.34  ? 28 VAL A CB   3  
ATOM 4864  C CG1  . VAL A 1 28 ? 3.144   -0.526  -9.710  1.00 0.55  ? 28 VAL A CG1  3  
ATOM 4865  C CG2  . VAL A 1 28 ? 4.807   1.184   -8.984  1.00 0.71  ? 28 VAL A CG2  3  
ATOM 4866  H H    . VAL A 1 28 ? 2.307   0.186   -12.254 1.00 0.43  ? 28 VAL A H    3  
ATOM 4867  H HA   . VAL A 1 28 ? 4.449   2.122   -11.490 1.00 0.28  ? 28 VAL A HA   3  
ATOM 4868  H HB   . VAL A 1 28 ? 2.814   1.585   -9.673  1.00 0.31  ? 28 VAL A HB   3  
ATOM 4869  H HG11 . VAL A 1 28 ? 2.455   -0.790  -10.497 1.00 1.11  ? 28 VAL A HG11 3  
ATOM 4870  H HG12 . VAL A 1 28 ? 3.993   -1.194  -9.733  1.00 1.30  ? 28 VAL A HG12 3  
ATOM 4871  H HG13 . VAL A 1 28 ? 2.647   -0.607  -8.755  1.00 1.11  ? 28 VAL A HG13 3  
ATOM 4872  H HG21 . VAL A 1 28 ? 5.714   0.811   -9.435  1.00 1.24  ? 28 VAL A HG21 3  
ATOM 4873  H HG22 . VAL A 1 28 ? 4.898   2.247   -8.820  1.00 1.22  ? 28 VAL A HG22 3  
ATOM 4874  H HG23 . VAL A 1 28 ? 4.645   0.688   -8.039  1.00 1.37  ? 28 VAL A HG23 3  
ATOM 4875  N N    . LYS A 1 29 ? 6.338   0.460   -11.787 1.00 0.35  ? 29 LYS A N    3  
ATOM 4876  C CA   . LYS A 1 29 ? 7.417   -0.494  -12.199 1.00 0.42  ? 29 LYS A CA   3  
ATOM 4877  C C    . LYS A 1 29 ? 8.690   -0.225  -11.390 1.00 0.37  ? 29 LYS A C    3  
ATOM 4878  O O    . LYS A 1 29 ? 8.758   0.700   -10.595 1.00 0.35  ? 29 LYS A O    3  
ATOM 4879  C CB   . LYS A 1 29 ? 7.748   -0.328  -13.693 1.00 0.52  ? 29 LYS A CB   3  
ATOM 4880  C CG   . LYS A 1 29 ? 6.461   -0.265  -14.523 1.00 1.08  ? 29 LYS A CG   3  
ATOM 4881  C CD   . LYS A 1 29 ? 6.754   -0.610  -15.988 1.00 0.83  ? 29 LYS A CD   3  
ATOM 4882  C CE   . LYS A 1 29 ? 7.470   -1.965  -16.099 1.00 0.76  ? 29 LYS A CE   3  
ATOM 4883  N NZ   . LYS A 1 29 ? 8.061   -2.107  -17.461 1.00 1.23  ? 29 LYS A NZ   3  
ATOM 4884  H H    . LYS A 1 29 ? 6.575   1.366   -11.503 1.00 0.35  ? 29 LYS A H    3  
ATOM 4885  H HA   . LYS A 1 29 ? 7.087   -1.506  -12.018 1.00 0.52  ? 29 LYS A HA   3  
ATOM 4886  H HB2  . LYS A 1 29 ? 8.312   0.579   -13.838 1.00 1.12  ? 29 LYS A HB2  3  
ATOM 4887  H HB3  . LYS A 1 29 ? 8.341   -1.166  -14.016 1.00 0.82  ? 29 LYS A HB3  3  
ATOM 4888  H HG2  . LYS A 1 29 ? 5.744   -0.961  -14.127 1.00 1.70  ? 29 LYS A HG2  3  
ATOM 4889  H HG3  . LYS A 1 29 ? 6.053   0.734   -14.470 1.00 2.02  ? 29 LYS A HG3  3  
ATOM 4890  H HD2  . LYS A 1 29 ? 5.823   -0.658  -16.530 1.00 1.42  ? 29 LYS A HD2  3  
ATOM 4891  H HD3  . LYS A 1 29 ? 7.378   0.158   -16.415 1.00 1.54  ? 29 LYS A HD3  3  
ATOM 4892  H HE2  . LYS A 1 29 ? 8.257   -2.025  -15.364 1.00 1.30  ? 29 LYS A HE2  3  
ATOM 4893  H HE3  . LYS A 1 29 ? 6.762   -2.761  -15.933 1.00 1.09  ? 29 LYS A HE3  3  
ATOM 4894  H HZ1  . LYS A 1 29 ? 7.335   -1.900  -18.178 1.00 1.74  ? 29 LYS A HZ1  3  
ATOM 4895  H HZ2  . LYS A 1 29 ? 8.854   -1.443  -17.567 1.00 1.71  ? 29 LYS A HZ2  3  
ATOM 4896  H HZ3  . LYS A 1 29 ? 8.407   -3.079  -17.589 1.00 1.61  ? 29 LYS A HZ3  3  
ATOM 4897  N N    . SER A 1 30 ? 9.696   -1.039  -11.604 1.00 0.38  ? 30 SER A N    3  
ATOM 4898  C CA   . SER A 1 30 ? 10.989  -0.883  -10.877 1.00 0.39  ? 30 SER A CA   3  
ATOM 4899  C C    . SER A 1 30 ? 12.003  -0.127  -11.773 1.00 0.34  ? 30 SER A C    3  
ATOM 4900  O O    . SER A 1 30 ? 11.709  0.163   -12.919 1.00 0.35  ? 30 SER A O    3  
ATOM 4901  C CB   . SER A 1 30 ? 11.502  -2.296  -10.529 1.00 0.52  ? 30 SER A CB   3  
ATOM 4902  O OG   . SER A 1 30 ? 12.622  -2.631  -11.342 1.00 1.63  ? 30 SER A OG   3  
ATOM 4903  H H    . SER A 1 30 ? 9.597   -1.765  -12.255 1.00 0.43  ? 30 SER A H    3  
ATOM 4904  H HA   . SER A 1 30 ? 10.823  -0.322  -9.966  1.00 0.41  ? 30 SER A HA   3  
ATOM 4905  H HB2  . SER A 1 30 ? 11.793  -2.334  -9.495  1.00 0.91  ? 30 SER A HB2  3  
ATOM 4906  H HB3  . SER A 1 30 ? 10.704  -3.013  -10.696 1.00 0.92  ? 30 SER A HB3  3  
ATOM 4907  H HG   . SER A 1 30 ? 13.224  -3.162  -10.815 1.00 2.01  ? 30 SER A HG   3  
ATOM 4908  N N    . PRO A 1 31 ? 13.173  0.164   -11.227 1.00 0.39  ? 31 PRO A N    3  
ATOM 4909  C CA   . PRO A 1 31 ? 14.248  0.876   -11.963 1.00 0.44  ? 31 PRO A CA   3  
ATOM 4910  C C    . PRO A 1 31 ? 14.936  -0.068  -12.964 1.00 0.52  ? 31 PRO A C    3  
ATOM 4911  O O    . PRO A 1 31 ? 14.548  -1.215  -13.103 1.00 0.58  ? 31 PRO A O    3  
ATOM 4912  C CB   . PRO A 1 31 ? 15.211  1.315   -10.855 1.00 0.52  ? 31 PRO A CB   3  
ATOM 4913  C CG   . PRO A 1 31 ? 14.953  0.379   -9.652  1.00 0.56  ? 31 PRO A CG   3  
ATOM 4914  C CD   . PRO A 1 31 ? 13.533  -0.189  -9.834  1.00 0.49  ? 31 PRO A CD   3  
ATOM 4915  H HA   . PRO A 1 31 ? 13.852  1.741   -12.471 1.00 0.44  ? 31 PRO A HA   3  
ATOM 4916  H HB2  . PRO A 1 31 ? 16.234  1.217   -11.192 1.00 0.59  ? 31 PRO A HB2  3  
ATOM 4917  H HB3  . PRO A 1 31 ? 15.009  2.335   -10.570 1.00 0.56  ? 31 PRO A HB3  3  
ATOM 4918  H HG2  . PRO A 1 31 ? 15.678  -0.423  -9.644  1.00 0.63  ? 31 PRO A HG2  3  
ATOM 4919  H HG3  . PRO A 1 31 ? 15.006  0.938   -8.730  1.00 0.64  ? 31 PRO A HG3  3  
ATOM 4920  H HD2  . PRO A 1 31 ? 13.540  -1.262  -9.700  1.00 0.54  ? 31 PRO A HD2  3  
ATOM 4921  H HD3  . PRO A 1 31 ? 12.850  0.276   -9.142  1.00 0.52  ? 31 PRO A HD3  3  
ATOM 4922  N N    . GLY A 1 32 ? 15.950  0.395   -13.668 1.00 0.60  ? 32 GLY A N    3  
ATOM 4923  C CA   . GLY A 1 32 ? 16.630  -0.506  -14.652 1.00 0.73  ? 32 GLY A CA   3  
ATOM 4924  C C    . GLY A 1 32 ? 17.791  0.218   -15.345 1.00 0.91  ? 32 GLY A C    3  
ATOM 4925  O O    . GLY A 1 32 ? 18.927  0.087   -14.932 1.00 1.05  ? 32 GLY A O    3  
ATOM 4926  H H    . GLY A 1 32 ? 16.257  1.326   -13.551 1.00 0.61  ? 32 GLY A H    3  
ATOM 4927  H HA2  . GLY A 1 32 ? 17.011  -1.374  -14.134 1.00 0.73  ? 32 GLY A HA2  3  
ATOM 4928  H HA3  . GLY A 1 32 ? 15.915  -0.823  -15.397 1.00 0.79  ? 32 GLY A HA3  3  
ATOM 4929  N N    . PRO A 1 33 ? 17.474  0.949   -16.394 1.00 1.04  ? 33 PRO A N    3  
ATOM 4930  C CA   . PRO A 1 33 ? 18.480  1.694   -17.182 1.00 1.28  ? 33 PRO A CA   3  
ATOM 4931  C C    . PRO A 1 33 ? 18.955  2.945   -16.426 1.00 1.12  ? 33 PRO A C    3  
ATOM 4932  O O    . PRO A 1 33 ? 18.821  3.037   -15.221 1.00 1.13  ? 33 PRO A O    3  
ATOM 4933  C CB   . PRO A 1 33 ? 17.726  2.064   -18.467 1.00 1.58  ? 33 PRO A CB   3  
ATOM 4934  C CG   . PRO A 1 33 ? 16.222  2.014   -18.122 1.00 1.49  ? 33 PRO A CG   3  
ATOM 4935  C CD   . PRO A 1 33 ? 16.085  1.110   -16.886 1.00 1.14  ? 33 PRO A CD   3  
ATOM 4936  H HA   . PRO A 1 33 ? 19.318  1.058   -17.421 1.00 1.47  ? 33 PRO A HA   3  
ATOM 4937  H HB2  . PRO A 1 33 ? 18.002  3.060   -18.787 1.00 1.67  ? 33 PRO A HB2  3  
ATOM 4938  H HB3  . PRO A 1 33 ? 17.944  1.350   -19.245 1.00 1.82  ? 33 PRO A HB3  3  
ATOM 4939  H HG2  . PRO A 1 33 ? 15.859  3.008   -17.899 1.00 1.50  ? 33 PRO A HG2  3  
ATOM 4940  H HG3  . PRO A 1 33 ? 15.667  1.591   -18.944 1.00 1.73  ? 33 PRO A HG3  3  
ATOM 4941  H HD2  . PRO A 1 33 ? 15.465  1.588   -16.142 1.00 1.03  ? 33 PRO A HD2  3  
ATOM 4942  H HD3  . PRO A 1 33 ? 15.675  0.150   -17.162 1.00 1.20  ? 33 PRO A HD3  3  
ATOM 4943  N N    . HIS A 1 34 ? 19.518  3.904   -17.128 1.00 1.15  ? 34 HIS A N    3  
ATOM 4944  C CA   . HIS A 1 34 ? 20.008  5.153   -16.452 1.00 1.18  ? 34 HIS A CA   3  
ATOM 4945  C C    . HIS A 1 34 ? 18.851  5.876   -15.750 1.00 1.17  ? 34 HIS A C    3  
ATOM 4946  O O    . HIS A 1 34 ? 19.075  6.603   -14.799 1.00 1.26  ? 34 HIS A O    3  
ATOM 4947  C CB   . HIS A 1 34 ? 20.675  6.103   -17.465 1.00 1.36  ? 34 HIS A CB   3  
ATOM 4948  C CG   . HIS A 1 34 ? 19.950  6.084   -18.789 1.00 1.55  ? 34 HIS A CG   3  
ATOM 4949  N ND1  . HIS A 1 34 ? 20.628  6.055   -19.997 1.00 2.08  ? 34 HIS A ND1  3  
ATOM 4950  C CD2  . HIS A 1 34 ? 18.612  6.086   -19.113 1.00 2.02  ? 34 HIS A CD2  3  
ATOM 4951  C CE1  . HIS A 1 34 ? 19.709  6.039   -20.980 1.00 2.65  ? 34 HIS A CE1  3  
ATOM 4952  N NE2  . HIS A 1 34 ? 18.465  6.057   -20.495 1.00 2.66  ? 34 HIS A NE2  3  
ATOM 4953  H H    . HIS A 1 34 ? 19.622  3.799   -18.095 1.00 1.28  ? 34 HIS A H    3  
ATOM 4954  H HA   . HIS A 1 34 ? 20.734  4.872   -15.699 1.00 1.15  ? 34 HIS A HA   3  
ATOM 4955  H HB2  . HIS A 1 34 ? 20.662  7.108   -17.070 1.00 1.71  ? 34 HIS A HB2  3  
ATOM 4956  H HB3  . HIS A 1 34 ? 21.700  5.797   -17.617 1.00 1.68  ? 34 HIS A HB3  3  
ATOM 4957  H HD1  . HIS A 1 34 ? 21.601  6.046   -20.115 1.00 2.32  ? 34 HIS A HD1  3  
ATOM 4958  H HD2  . HIS A 1 34 ? 17.800  6.109   -18.402 1.00 2.22  ? 34 HIS A HD2  3  
ATOM 4959  H HE1  . HIS A 1 34 ? 19.949  6.016   -22.032 1.00 3.26  ? 34 HIS A HE1  3  
ATOM 4960  N N    . CYS A 1 35 ? 17.618  5.649   -16.160 1.00 1.17  ? 35 CYS A N    3  
ATOM 4961  C CA   . CYS A 1 35 ? 16.473  6.291   -15.449 1.00 1.21  ? 35 CYS A CA   3  
ATOM 4962  C C    . CYS A 1 35 ? 16.539  5.762   -14.008 1.00 1.02  ? 35 CYS A C    3  
ATOM 4963  O O    . CYS A 1 35 ? 16.366  6.499   -13.056 1.00 1.08  ? 35 CYS A O    3  
ATOM 4964  C CB   . CYS A 1 35 ? 15.158  5.907   -16.157 1.00 1.45  ? 35 CYS A CB   3  
ATOM 4965  S SG   . CYS A 1 35 ? 13.713  6.645   -15.334 1.00 1.19  ? 35 CYS A SG   3  
ATOM 4966  H H    . CYS A 1 35 ? 17.447  5.023   -16.893 1.00 1.22  ? 35 CYS A H    3  
ATOM 4967  H HA   . CYS A 1 35 ? 16.600  7.364   -15.450 1.00 1.30  ? 35 CYS A HA   3  
ATOM 4968  H HB2  . CYS A 1 35 ? 15.196  6.266   -17.177 1.00 2.02  ? 35 CYS A HB2  3  
ATOM 4969  H HB3  . CYS A 1 35 ? 15.059  4.835   -16.165 1.00 2.07  ? 35 CYS A HB3  3  
ATOM 4970  N N    . ALA A 1 36 ? 16.889  4.488   -13.875 1.00 0.94  ? 36 ALA A N    3  
ATOM 4971  C CA   . ALA A 1 36 ? 17.094  3.825   -12.543 1.00 0.89  ? 36 ALA A CA   3  
ATOM 4972  C C    . ALA A 1 36 ? 16.153  4.373   -11.470 1.00 0.85  ? 36 ALA A C    3  
ATOM 4973  O O    . ALA A 1 36 ? 16.526  4.563   -10.324 1.00 1.18  ? 36 ALA A O    3  
ATOM 4974  C CB   . ALA A 1 36 ? 18.540  4.046   -12.136 1.00 1.08  ? 36 ALA A CB   3  
ATOM 4975  H H    . ALA A 1 36 ? 17.077  3.966   -14.684 1.00 1.02  ? 36 ALA A H    3  
ATOM 4976  H HA   . ALA A 1 36 ? 16.922  2.767   -12.648 1.00 0.94  ? 36 ALA A HA   3  
ATOM 4977  H HB1  . ALA A 1 36 ? 18.810  5.072   -12.331 1.00 1.40  ? 36 ALA A HB1  3  
ATOM 4978  H HB2  . ALA A 1 36 ? 18.654  3.832   -11.086 1.00 1.48  ? 36 ALA A HB2  3  
ATOM 4979  H HB3  . ALA A 1 36 ? 19.173  3.389   -12.714 1.00 1.69  ? 36 ALA A HB3  3  
ATOM 4980  N N    . GLN A 1 37 ? 14.939  4.603   -11.840 1.00 0.93  ? 37 GLN A N    3  
ATOM 4981  C CA   . GLN A 1 37 ? 13.927  5.118   -10.881 1.00 0.89  ? 37 GLN A CA   3  
ATOM 4982  C C    . GLN A 1 37 ? 12.709  4.211   -10.951 1.00 0.71  ? 37 GLN A C    3  
ATOM 4983  O O    . GLN A 1 37 ? 12.569  3.409   -11.857 1.00 0.74  ? 37 GLN A O    3  
ATOM 4984  C CB   . GLN A 1 37 ? 13.543  6.551   -11.274 1.00 0.99  ? 37 GLN A CB   3  
ATOM 4985  C CG   . GLN A 1 37 ? 12.487  7.139   -10.323 1.00 1.66  ? 37 GLN A CG   3  
ATOM 4986  C CD   . GLN A 1 37 ? 13.068  7.288   -8.910  1.00 2.34  ? 37 GLN A CD   3  
ATOM 4987  O OE1  . GLN A 1 37 ? 14.254  7.495   -8.742  1.00 2.82  ? 37 GLN A OE1  3  
ATOM 4988  N NE2  . GLN A 1 37 ? 12.273  7.196   -7.879  1.00 3.07  ? 37 GLN A NE2  3  
ATOM 4989  H H    . GLN A 1 37 ? 14.684  4.422   -12.765 1.00 1.27  ? 37 GLN A H    3  
ATOM 4990  H HA   . GLN A 1 37 ? 14.333  5.108   -9.879  1.00 0.95  ? 37 GLN A HA   3  
ATOM 4991  H HB2  . GLN A 1 37 ? 14.419  7.162   -11.230 1.00 1.38  ? 37 GLN A HB2  3  
ATOM 4992  H HB3  . GLN A 1 37 ? 13.153  6.551   -12.279 1.00 1.44  ? 37 GLN A HB3  3  
ATOM 4993  H HG2  . GLN A 1 37 ? 12.186  8.110   -10.688 1.00 2.22  ? 37 GLN A HG2  3  
ATOM 4994  H HG3  . GLN A 1 37 ? 11.628  6.490   -10.293 1.00 2.02  ? 37 GLN A HG3  3  
ATOM 4995  H HE21 . GLN A 1 37 ? 11.314  7.033   -8.009  1.00 3.26  ? 37 GLN A HE21 3  
ATOM 4996  H HE22 . GLN A 1 37 ? 12.634  7.290   -6.972  1.00 3.72  ? 37 GLN A HE22 3  
ATOM 4997  N N    . THR A 1 38 ? 11.831  4.333   -10.006 1.00 0.60  ? 38 THR A N    3  
ATOM 4998  C CA   . THR A 1 38 ? 10.608  3.489   -10.005 1.00 0.44  ? 38 THR A CA   3  
ATOM 4999  C C    . THR A 1 38 ? 9.729   3.857   -11.205 1.00 0.35  ? 38 THR A C    3  
ATOM 5000  O O    . THR A 1 38 ? 10.171  4.476   -12.157 1.00 0.42  ? 38 THR A O    3  
ATOM 5001  C CB   . THR A 1 38 ? 9.809   3.719   -8.712  1.00 0.44  ? 38 THR A CB   3  
ATOM 5002  O OG1  . THR A 1 38 ? 10.580  4.468   -7.779  1.00 0.60  ? 38 THR A OG1  3  
ATOM 5003  C CG2  . THR A 1 38 ? 9.453   2.369   -8.113  1.00 0.44  ? 38 THR A CG2  3  
ATOM 5004  H H    . THR A 1 38 ? 11.976  4.988   -9.296  1.00 0.68  ? 38 THR A H    3  
ATOM 5005  H HA   . THR A 1 38 ? 10.890  2.449   -10.072 1.00 0.44  ? 38 THR A HA   3  
ATOM 5006  H HB   . THR A 1 38 ? 8.894   4.252   -8.938  1.00 0.40  ? 38 THR A HB   3  
ATOM 5007  H HG1  . THR A 1 38 ? 10.038  5.196   -7.463  1.00 0.96  ? 38 THR A HG1  3  
ATOM 5008  H HG21 . THR A 1 38 ? 10.179  1.637   -8.433  1.00 1.13  ? 38 THR A HG21 3  
ATOM 5009  H HG22 . THR A 1 38 ? 9.458   2.442   -7.038  1.00 1.10  ? 38 THR A HG22 3  
ATOM 5010  H HG23 . THR A 1 38 ? 8.472   2.078   -8.454  1.00 1.11  ? 38 THR A HG23 3  
ATOM 5011  N N    . GLU A 1 39 ? 8.477   3.516   -11.144 1.00 0.25  ? 39 GLU A N    3  
ATOM 5012  C CA   . GLU A 1 39 ? 7.545   3.864   -12.230 1.00 0.25  ? 39 GLU A CA   3  
ATOM 5013  C C    . GLU A 1 39 ? 6.217   4.081   -11.579 1.00 0.21  ? 39 GLU A C    3  
ATOM 5014  O O    . GLU A 1 39 ? 5.836   3.343   -10.693 1.00 0.35  ? 39 GLU A O    3  
ATOM 5015  C CB   . GLU A 1 39 ? 7.386   2.737   -13.232 1.00 0.33  ? 39 GLU A CB   3  
ATOM 5016  C CG   . GLU A 1 39 ? 7.810   3.203   -14.627 1.00 0.60  ? 39 GLU A CG   3  
ATOM 5017  C CD   . GLU A 1 39 ? 6.666   3.985   -15.277 1.00 0.80  ? 39 GLU A CD   3  
ATOM 5018  O OE1  . GLU A 1 39 ? 5.766   3.353   -15.807 1.00 1.40  ? 39 GLU A OE1  3  
ATOM 5019  O OE2  . GLU A 1 39 ? 6.708   5.204   -15.232 1.00 1.47  ? 39 GLU A OE2  3  
ATOM 5020  H H    . GLU A 1 39 ? 8.131   3.057   -10.348 1.00 0.25  ? 39 GLU A H    3  
ATOM 5021  H HA   . GLU A 1 39 ? 7.873   4.763   -12.721 1.00 0.31  ? 39 GLU A HA   3  
ATOM 5022  H HB2  . GLU A 1 39 ? 7.993   1.898   -12.927 1.00 0.30  ? 39 GLU A HB2  3  
ATOM 5023  H HB3  . GLU A 1 39 ? 6.336   2.448   -13.248 1.00 0.41  ? 39 GLU A HB3  3  
ATOM 5024  H HG2  . GLU A 1 39 ? 8.681   3.837   -14.545 1.00 0.88  ? 39 GLU A HG2  3  
ATOM 5025  H HG3  . GLU A 1 39 ? 8.047   2.344   -15.236 1.00 0.85  ? 39 GLU A HG3  3  
ATOM 5026  N N    . VAL A 1 40 ? 5.531   5.095   -11.952 1.00 0.15  ? 40 VAL A N    3  
ATOM 5027  C CA   . VAL A 1 40 ? 4.258   5.371   -11.300 1.00 0.19  ? 40 VAL A CA   3  
ATOM 5028  C C    . VAL A 1 40 ? 3.442   6.274   -12.220 1.00 0.19  ? 40 VAL A C    3  
ATOM 5029  O O    . VAL A 1 40 ? 3.260   7.445   -11.956 1.00 0.21  ? 40 VAL A O    3  
ATOM 5030  C CB   . VAL A 1 40 ? 4.594   6.060   -9.974  1.00 0.23  ? 40 VAL A CB   3  
ATOM 5031  C CG1  . VAL A 1 40 ? 4.740   4.994   -8.896  1.00 0.28  ? 40 VAL A CG1  3  
ATOM 5032  C CG2  . VAL A 1 40 ? 5.945   6.788   -10.097 1.00 0.24  ? 40 VAL A CG2  3  
ATOM 5033  H H    . VAL A 1 40 ? 5.870   5.703   -12.624 1.00 0.22  ? 40 VAL A H    3  
ATOM 5034  H HA   . VAL A 1 40 ? 3.746   4.433   -11.128 1.00 0.23  ? 40 VAL A HA   3  
ATOM 5035  H HB   . VAL A 1 40 ? 3.823   6.767   -9.716  1.00 0.29  ? 40 VAL A HB   3  
ATOM 5036  H HG11 . VAL A 1 40 ? 4.188   4.114   -9.187  1.00 1.00  ? 40 VAL A HG11 3  
ATOM 5037  H HG12 . VAL A 1 40 ? 5.789   4.740   -8.793  1.00 1.08  ? 40 VAL A HG12 3  
ATOM 5038  H HG13 . VAL A 1 40 ? 4.366   5.370   -7.962  1.00 1.04  ? 40 VAL A HG13 3  
ATOM 5039  H HG21 . VAL A 1 40 ? 5.957   7.378   -11.000 1.00 1.01  ? 40 VAL A HG21 3  
ATOM 5040  H HG22 . VAL A 1 40 ? 6.096   7.424   -9.243  1.00 1.04  ? 40 VAL A HG22 3  
ATOM 5041  H HG23 . VAL A 1 40 ? 6.743   6.053   -10.141 1.00 1.03  ? 40 VAL A HG23 3  
ATOM 5042  N N    . ILE A 1 41 ? 3.004   5.741   -13.330 1.00 0.23  ? 41 ILE A N    3  
ATOM 5043  C CA   . ILE A 1 41 ? 2.266   6.563   -14.315 1.00 0.25  ? 41 ILE A CA   3  
ATOM 5044  C C    . ILE A 1 41 ? 0.758   6.341   -14.226 1.00 0.23  ? 41 ILE A C    3  
ATOM 5045  O O    . ILE A 1 41 ? 0.273   5.262   -14.460 1.00 0.25  ? 41 ILE A O    3  
ATOM 5046  C CB   . ILE A 1 41 ? 2.767   6.178   -15.703 1.00 0.30  ? 41 ILE A CB   3  
ATOM 5047  C CG1  . ILE A 1 41 ? 3.997   7.038   -16.027 1.00 0.50  ? 41 ILE A CG1  3  
ATOM 5048  C CG2  . ILE A 1 41 ? 1.668   6.414   -16.739 1.00 0.67  ? 41 ILE A CG2  3  
ATOM 5049  C CD1  . ILE A 1 41 ? 4.134   7.233   -17.539 1.00 0.54  ? 41 ILE A CD1  3  
ATOM 5050  H H    . ILE A 1 41 ? 3.201   4.803   -13.538 1.00 0.27  ? 41 ILE A H    3  
ATOM 5051  H HA   . ILE A 1 41 ? 2.489   7.595   -14.142 1.00 0.26  ? 41 ILE A HA   3  
ATOM 5052  H HB   . ILE A 1 41 ? 3.040   5.128   -15.698 1.00 0.48  ? 41 ILE A HB   3  
ATOM 5053  H HG12 . ILE A 1 41 ? 3.890   8.004   -15.554 1.00 0.70  ? 41 ILE A HG12 3  
ATOM 5054  H HG13 . ILE A 1 41 ? 4.877   6.554   -15.646 1.00 0.69  ? 41 ILE A HG13 3  
ATOM 5055  H HG21 . ILE A 1 41 ? 1.352   7.444   -16.694 1.00 1.18  ? 41 ILE A HG21 3  
ATOM 5056  H HG22 . ILE A 1 41 ? 2.050   6.192   -17.721 1.00 1.38  ? 41 ILE A HG22 3  
ATOM 5057  H HG23 . ILE A 1 41 ? 0.829   5.770   -16.523 1.00 1.20  ? 41 ILE A HG23 3  
ATOM 5058  H HD11 . ILE A 1 41 ? 4.123   6.273   -18.032 1.00 1.22  ? 41 ILE A HD11 3  
ATOM 5059  H HD12 . ILE A 1 41 ? 3.308   7.830   -17.899 1.00 1.02  ? 41 ILE A HD12 3  
ATOM 5060  H HD13 . ILE A 1 41 ? 5.063   7.740   -17.756 1.00 1.14  ? 41 ILE A HD13 3  
ATOM 5061  N N    . ALA A 1 42 ? 0.012   7.375   -13.940 1.00 0.22  ? 42 ALA A N    3  
ATOM 5062  C CA   . ALA A 1 42 ? -1.466  7.245   -13.883 1.00 0.22  ? 42 ALA A CA   3  
ATOM 5063  C C    . ALA A 1 42 ? -2.036  7.539   -15.264 1.00 0.24  ? 42 ALA A C    3  
ATOM 5064  O O    . ALA A 1 42 ? -1.976  8.658   -15.740 1.00 0.25  ? 42 ALA A O    3  
ATOM 5065  C CB   . ALA A 1 42 ? -2.015  8.239   -12.875 1.00 0.21  ? 42 ALA A CB   3  
ATOM 5066  H H    . ALA A 1 42 ? 0.426   8.256   -13.795 1.00 0.23  ? 42 ALA A H    3  
ATOM 5067  H HA   . ALA A 1 42 ? -1.741  6.251   -13.591 1.00 0.23  ? 42 ALA A HA   3  
ATOM 5068  H HB1  . ALA A 1 42 ? -1.542  9.197   -13.029 1.00 0.95  ? 42 ALA A HB1  3  
ATOM 5069  H HB2  . ALA A 1 42 ? -3.080  8.332   -13.010 1.00 1.00  ? 42 ALA A HB2  3  
ATOM 5070  H HB3  . ALA A 1 42 ? -1.802  7.886   -11.878 1.00 1.00  ? 42 ALA A HB3  3  
ATOM 5071  N N    . THR A 1 43 ? -2.589  6.546   -15.917 1.00 0.28  ? 43 THR A N    3  
ATOM 5072  C CA   . THR A 1 43 ? -3.155  6.788   -17.267 1.00 0.32  ? 43 THR A CA   3  
ATOM 5073  C C    . THR A 1 43 ? -4.450  7.572   -17.122 1.00 0.32  ? 43 THR A C    3  
ATOM 5074  O O    . THR A 1 43 ? -5.340  7.211   -16.370 1.00 0.34  ? 43 THR A O    3  
ATOM 5075  C CB   . THR A 1 43 ? -3.441  5.475   -18.001 1.00 0.35  ? 43 THR A CB   3  
ATOM 5076  O OG1  . THR A 1 43 ? -2.444  4.513   -17.677 1.00 0.39  ? 43 THR A OG1  3  
ATOM 5077  C CG2  . THR A 1 43 ? -3.443  5.731   -19.507 1.00 0.39  ? 43 THR A CG2  3  
ATOM 5078  H H    . THR A 1 43 ? -2.635  5.653   -15.516 1.00 0.28  ? 43 THR A H    3  
ATOM 5079  H HA   . THR A 1 43 ? -2.443  7.374   -17.833 1.00 0.32  ? 43 THR A HA   3  
ATOM 5080  H HB   . THR A 1 43 ? -4.412  5.108   -17.712 1.00 0.35  ? 43 THR A HB   3  
ATOM 5081  H HG1  . THR A 1 43 ? -2.743  3.657   -17.988 1.00 0.89  ? 43 THR A HG1  3  
ATOM 5082  H HG21 . THR A 1 43 ? -4.153  6.512   -19.736 1.00 1.05  ? 43 THR A HG21 3  
ATOM 5083  H HG22 . THR A 1 43 ? -2.456  6.038   -19.821 1.00 1.07  ? 43 THR A HG22 3  
ATOM 5084  H HG23 . THR A 1 43 ? -3.723  4.827   -20.026 1.00 1.07  ? 43 THR A HG23 3  
ATOM 5085  N N    . LEU A 1 44 ? -4.539  8.657   -17.825 1.00 0.32  ? 44 LEU A N    3  
ATOM 5086  C CA   . LEU A 1 44 ? -5.732  9.522   -17.756 1.00 0.32  ? 44 LEU A CA   3  
ATOM 5087  C C    . LEU A 1 44 ? -6.900  8.918   -18.543 1.00 0.37  ? 44 LEU A C    3  
ATOM 5088  O O    . LEU A 1 44 ? -6.700  8.122   -19.447 1.00 0.40  ? 44 LEU A O    3  
ATOM 5089  C CB   . LEU A 1 44 ? -5.352  10.846  -18.384 1.00 0.34  ? 44 LEU A CB   3  
ATOM 5090  C CG   . LEU A 1 44 ? -4.905  11.833  -17.316 1.00 0.32  ? 44 LEU A CG   3  
ATOM 5091  C CD1  . LEU A 1 44 ? -6.135  12.611  -16.869 1.00 0.35  ? 44 LEU A CD1  3  
ATOM 5092  C CD2  . LEU A 1 44 ? -4.252  11.093  -16.120 1.00 0.28  ? 44 LEU A CD2  3  
ATOM 5093  H H    . LEU A 1 44 ? -3.793  8.924   -18.398 1.00 0.33  ? 44 LEU A H    3  
ATOM 5094  H HA   . LEU A 1 44 ? -6.006  9.671   -16.717 1.00 0.30  ? 44 LEU A HA   3  
ATOM 5095  H HB2  . LEU A 1 44 ? -4.544  10.686  -19.076 1.00 0.37  ? 44 LEU A HB2  3  
ATOM 5096  H HB3  . LEU A 1 44 ? -6.204  11.248  -18.913 1.00 0.37  ? 44 LEU A HB3  3  
ATOM 5097  H HG   . LEU A 1 44 ? -4.191  12.511  -17.751 1.00 0.34  ? 44 LEU A HG   3  
ATOM 5098  H HD11 . LEU A 1 44 ? -6.961  11.926  -16.742 1.00 1.03  ? 44 LEU A HD11 3  
ATOM 5099  H HD12 . LEU A 1 44 ? -5.931  13.111  -15.939 1.00 1.05  ? 44 LEU A HD12 3  
ATOM 5100  H HD13 . LEU A 1 44 ? -6.390  13.339  -17.627 1.00 1.07  ? 44 LEU A HD13 3  
ATOM 5101  H HD21 . LEU A 1 44 ? -3.477  10.430  -16.483 1.00 1.03  ? 44 LEU A HD21 3  
ATOM 5102  H HD22 . LEU A 1 44 ? -3.815  11.812  -15.441 1.00 1.04  ? 44 LEU A HD22 3  
ATOM 5103  H HD23 . LEU A 1 44 ? -4.997  10.514  -15.595 1.00 1.08  ? 44 LEU A HD23 3  
ATOM 5104  N N    . LYS A 1 45 ? -8.112  9.341   -18.226 1.00 0.38  ? 45 LYS A N    3  
ATOM 5105  C CA   . LYS A 1 45 ? -9.335  8.863   -18.928 1.00 0.44  ? 45 LYS A CA   3  
ATOM 5106  C C    . LYS A 1 45 ? -9.229  9.125   -20.421 1.00 0.49  ? 45 LYS A C    3  
ATOM 5107  O O    . LYS A 1 45 ? -9.623  8.308   -21.233 1.00 0.54  ? 45 LYS A O    3  
ATOM 5108  C CB   . LYS A 1 45 ? -10.519 9.642   -18.379 1.00 0.45  ? 45 LYS A CB   3  
ATOM 5109  C CG   . LYS A 1 45 ? -11.587 8.682   -17.848 1.00 0.47  ? 45 LYS A CG   3  
ATOM 5110  C CD   . LYS A 1 45 ? -12.969 9.135   -18.325 1.00 0.72  ? 45 LYS A CD   3  
ATOM 5111  C CE   . LYS A 1 45 ? -14.047 8.334   -17.589 1.00 1.05  ? 45 LYS A CE   3  
ATOM 5112  N NZ   . LYS A 1 45 ? -15.348 8.463   -18.309 1.00 1.42  ? 45 LYS A NZ   3  
ATOM 5113  H H    . LYS A 1 45 ? -8.221  10.016  -17.532 1.00 0.37  ? 45 LYS A H    3  
ATOM 5114  H HA   . LYS A 1 45 ? -9.476  7.811   -18.748 1.00 0.44  ? 45 LYS A HA   3  
ATOM 5115  H HB2  . LYS A 1 45 ? -10.180 10.275  -17.575 1.00 0.42  ? 45 LYS A HB2  3  
ATOM 5116  H HB3  . LYS A 1 45 ? -10.916 10.253  -19.153 1.00 0.49  ? 45 LYS A HB3  3  
ATOM 5117  H HG2  . LYS A 1 45 ? -11.390 7.685   -18.213 1.00 0.52  ? 45 LYS A HG2  3  
ATOM 5118  H HG3  . LYS A 1 45 ? -11.565 8.682   -16.769 1.00 0.54  ? 45 LYS A HG3  3  
ATOM 5119  H HD2  . LYS A 1 45 ? -13.094 10.188  -18.115 1.00 0.99  ? 45 LYS A HD2  3  
ATOM 5120  H HD3  . LYS A 1 45 ? -13.057 8.965   -19.387 1.00 0.94  ? 45 LYS A HD3  3  
ATOM 5121  H HE2  . LYS A 1 45 ? -13.760 7.294   -17.553 1.00 1.46  ? 45 LYS A HE2  3  
ATOM 5122  H HE3  . LYS A 1 45 ? -14.153 8.714   -16.583 1.00 1.42  ? 45 LYS A HE3  3  
ATOM 5123  H HZ1  . LYS A 1 45 ? -15.616 9.466   -18.367 1.00 1.86  ? 45 LYS A HZ1  3  
ATOM 5124  H HZ2  . LYS A 1 45 ? -15.255 8.074   -19.268 1.00 1.80  ? 45 LYS A HZ2  3  
ATOM 5125  H HZ3  . LYS A 1 45 ? -16.082 7.938   -17.791 1.00 1.84  ? 45 LYS A HZ3  3  
ATOM 5126  N N    . ASN A 1 46 ? -8.682  10.254  -20.787 1.00 0.49  ? 46 ASN A N    3  
ATOM 5127  C CA   . ASN A 1 46 ? -8.528  10.566  -22.245 1.00 0.55  ? 46 ASN A CA   3  
ATOM 5128  C C    . ASN A 1 46 ? -7.413  9.685   -22.851 1.00 0.57  ? 46 ASN A C    3  
ATOM 5129  O O    . ASN A 1 46 ? -7.056  9.834   -24.005 1.00 0.75  ? 46 ASN A O    3  
ATOM 5130  C CB   . ASN A 1 46 ? -8.196  12.058  -22.455 1.00 0.58  ? 46 ASN A CB   3  
ATOM 5131  C CG   . ASN A 1 46 ? -7.479  12.642  -21.232 1.00 0.78  ? 46 ASN A CG   3  
ATOM 5132  O OD1  . ASN A 1 46 ? -8.108  12.984  -20.250 1.00 1.66  ? 46 ASN A OD1  3  
ATOM 5133  N ND2  . ASN A 1 46 ? -6.185  12.771  -21.251 1.00 0.81  ? 46 ASN A ND2  3  
ATOM 5134  H H    . ASN A 1 46 ? -8.361  10.886  -20.100 1.00 0.47  ? 46 ASN A H    3  
ATOM 5135  H HA   . ASN A 1 46 ? -9.458  10.340  -22.747 1.00 0.62  ? 46 ASN A HA   3  
ATOM 5136  H HB2  . ASN A 1 46 ? -7.558  12.160  -23.318 1.00 0.73  ? 46 ASN A HB2  3  
ATOM 5137  H HB3  . ASN A 1 46 ? -9.111  12.605  -22.626 1.00 0.74  ? 46 ASN A HB3  3  
ATOM 5138  H HD21 . ASN A 1 46 ? -5.676  12.497  -22.043 1.00 1.39  ? 46 ASN A HD21 3  
ATOM 5139  H HD22 . ASN A 1 46 ? -5.719  13.143  -20.474 1.00 0.88  ? 46 ASN A HD22 3  
ATOM 5140  N N    . GLY A 1 47 ? -6.862  8.768   -22.076 1.00 0.50  ? 47 GLY A N    3  
ATOM 5141  C CA   . GLY A 1 47 ? -5.779  7.878   -22.582 1.00 0.53  ? 47 GLY A CA   3  
ATOM 5142  C C    . GLY A 1 47 ? -4.451  8.619   -22.494 1.00 0.51  ? 47 GLY A C    3  
ATOM 5143  O O    . GLY A 1 47 ? -3.595  8.485   -23.348 1.00 0.60  ? 47 GLY A O    3  
ATOM 5144  H H    . GLY A 1 47 ? -7.156  8.670   -21.153 1.00 0.52  ? 47 GLY A H    3  
ATOM 5145  H HA2  . GLY A 1 47 ? -5.733  6.986   -21.965 1.00 0.52  ? 47 GLY A HA2  3  
ATOM 5146  H HA3  . GLY A 1 47 ? -5.973  7.603   -23.603 1.00 0.59  ? 47 GLY A HA3  3  
ATOM 5147  N N    . ARG A 1 48 ? -4.273  9.385   -21.447 1.00 0.47  ? 48 ARG A N    3  
ATOM 5148  C CA   . ARG A 1 48 ? -2.990  10.133  -21.265 1.00 0.54  ? 48 ARG A CA   3  
ATOM 5149  C C    . ARG A 1 48 ? -2.244  9.491   -20.104 1.00 0.42  ? 48 ARG A C    3  
ATOM 5150  O O    . ARG A 1 48 ? -2.618  8.435   -19.643 1.00 0.37  ? 48 ARG A O    3  
ATOM 5151  C CB   . ARG A 1 48 ? -3.285  11.601  -20.937 1.00 0.66  ? 48 ARG A CB   3  
ATOM 5152  C CG   . ARG A 1 48 ? -3.030  12.470  -22.170 1.00 1.00  ? 48 ARG A CG   3  
ATOM 5153  C CD   . ARG A 1 48 ? -3.260  13.944  -21.813 1.00 1.55  ? 48 ARG A CD   3  
ATOM 5154  N NE   . ARG A 1 48 ? -2.240  14.795  -22.499 1.00 2.08  ? 48 ARG A NE   3  
ATOM 5155  C CZ   . ARG A 1 48 ? -2.266  16.096  -22.357 1.00 2.34  ? 48 ARG A CZ   3  
ATOM 5156  N NH1  . ARG A 1 48 ? -2.079  16.630  -21.176 1.00 2.67  ? 48 ARG A NH1  3  
ATOM 5157  N NH2  . ARG A 1 48 ? -2.474  16.865  -23.396 1.00 2.89  ? 48 ARG A NH2  3  
ATOM 5158  H H    . ARG A 1 48 ? -4.983  9.452   -20.763 1.00 0.43  ? 48 ARG A H    3  
ATOM 5159  H HA   . ARG A 1 48 ? -2.391  10.069  -22.160 1.00 0.68  ? 48 ARG A HA   3  
ATOM 5160  H HB2  . ARG A 1 48 ? -4.314  11.700  -20.632 1.00 1.19  ? 48 ARG A HB2  3  
ATOM 5161  H HB3  . ARG A 1 48 ? -2.640  11.927  -20.133 1.00 1.23  ? 48 ARG A HB3  3  
ATOM 5162  H HG2  . ARG A 1 48 ? -2.013  12.332  -22.503 1.00 1.43  ? 48 ARG A HG2  3  
ATOM 5163  H HG3  . ARG A 1 48 ? -3.710  12.183  -22.959 1.00 1.63  ? 48 ARG A HG3  3  
ATOM 5164  H HD2  . ARG A 1 48 ? -4.249  14.241  -22.129 1.00 1.84  ? 48 ARG A HD2  3  
ATOM 5165  H HD3  . ARG A 1 48 ? -3.173  14.071  -20.742 1.00 1.84  ? 48 ARG A HD3  3  
ATOM 5166  H HE   . ARG A 1 48 ? -1.547  14.379  -23.055 1.00 2.46  ? 48 ARG A HE   3  
ATOM 5167  H HH11 . ARG A 1 48 ? -1.915  16.044  -20.383 1.00 2.92  ? 48 ARG A HH11 3  
ATOM 5168  H HH12 . ARG A 1 48 ? -2.098  17.625  -21.066 1.00 3.04  ? 48 ARG A HH12 3  
ATOM 5169  H HH21 . ARG A 1 48 ? -2.613  16.459  -24.300 1.00 3.28  ? 48 ARG A HH21 3  
ATOM 5170  H HH22 . ARG A 1 48 ? -2.493  17.860  -23.289 1.00 3.23  ? 48 ARG A HH22 3  
ATOM 5171  N N    . LYS A 1 49 ? -1.204  10.101  -19.619 1.00 0.45  ? 49 LYS A N    3  
ATOM 5172  C CA   . LYS A 1 49 ? -0.478  9.493   -18.478 1.00 0.39  ? 49 LYS A CA   3  
ATOM 5173  C C    . LYS A 1 49 ? 0.252   10.554  -17.668 1.00 0.38  ? 49 LYS A C    3  
ATOM 5174  O O    . LYS A 1 49 ? 0.713   11.556  -18.184 1.00 0.54  ? 49 LYS A O    3  
ATOM 5175  C CB   . LYS A 1 49 ? 0.534   8.469   -18.977 1.00 0.58  ? 49 LYS A CB   3  
ATOM 5176  C CG   . LYS A 1 49 ? 1.130   8.910   -20.319 1.00 0.89  ? 49 LYS A CG   3  
ATOM 5177  C CD   . LYS A 1 49 ? 2.625   8.589   -20.343 1.00 0.96  ? 49 LYS A CD   3  
ATOM 5178  C CE   . LYS A 1 49 ? 3.384   9.622   -19.504 1.00 0.92  ? 49 LYS A CE   3  
ATOM 5179  N NZ   . LYS A 1 49 ? 3.851   10.736  -20.378 1.00 1.06  ? 49 LYS A NZ   3  
ATOM 5180  H H    . LYS A 1 49 ? -0.904  10.946  -19.996 1.00 0.55  ? 49 LYS A H    3  
ATOM 5181  H HA   . LYS A 1 49 ? -1.195  8.994   -17.839 1.00 0.34  ? 49 LYS A HA   3  
ATOM 5182  H HB2  . LYS A 1 49 ? 1.322   8.370   -18.245 1.00 0.59  ? 49 LYS A HB2  3  
ATOM 5183  H HB3  . LYS A 1 49 ? 0.039   7.526   -19.097 1.00 0.69  ? 49 LYS A HB3  3  
ATOM 5184  H HG2  . LYS A 1 49 ? 0.635   8.384   -21.123 1.00 1.06  ? 49 LYS A HG2  3  
ATOM 5185  H HG3  . LYS A 1 49 ? 0.992   9.973   -20.445 1.00 1.14  ? 49 LYS A HG3  3  
ATOM 5186  H HD2  . LYS A 1 49 ? 2.787   7.600   -19.935 1.00 0.98  ? 49 LYS A HD2  3  
ATOM 5187  H HD3  . LYS A 1 49 ? 2.982   8.620   -21.361 1.00 1.23  ? 49 LYS A HD3  3  
ATOM 5188  H HE2  . LYS A 1 49 ? 2.729   10.016  -18.739 1.00 0.97  ? 49 LYS A HE2  3  
ATOM 5189  H HE3  . LYS A 1 49 ? 4.234   9.151   -19.039 1.00 0.87  ? 49 LYS A HE3  3  
ATOM 5190  H HZ1  . LYS A 1 49 ? 4.105   10.364  -21.315 1.00 1.54  ? 49 LYS A HZ1  3  
ATOM 5191  H HZ2  . LYS A 1 49 ? 3.090   11.439  -20.478 1.00 1.19  ? 49 LYS A HZ2  3  
ATOM 5192  H HZ3  . LYS A 1 49 ? 4.684   11.185  -19.950 1.00 1.66  ? 49 LYS A HZ3  3  
ATOM 5193  N N    . ALA A 1 50 ? 0.375   10.305  -16.398 1.00 0.27  ? 50 ALA A N    3  
ATOM 5194  C CA   . ALA A 1 50 ? 1.099   11.254  -15.496 1.00 0.28  ? 50 ALA A CA   3  
ATOM 5195  C C    . ALA A 1 50 ? 1.920   10.451  -14.514 1.00 0.24  ? 50 ALA A C    3  
ATOM 5196  O O    . ALA A 1 50 ? 1.628   9.308   -14.277 1.00 0.21  ? 50 ALA A O    3  
ATOM 5197  C CB   . ALA A 1 50 ? 0.106   12.082  -14.689 1.00 0.32  ? 50 ALA A CB   3  
ATOM 5198  H H    . ALA A 1 50 ? -0.002  9.464   -16.036 1.00 0.29  ? 50 ALA A H    3  
ATOM 5199  H HA   . ALA A 1 50 ? 1.740   11.900  -16.073 1.00 0.34  ? 50 ALA A HA   3  
ATOM 5200  H HB1  . ALA A 1 50 ? -0.698  12.402  -15.324 1.00 1.06  ? 50 ALA A HB1  3  
ATOM 5201  H HB2  . ALA A 1 50 ? -0.284  11.477  -13.882 1.00 1.04  ? 50 ALA A HB2  3  
ATOM 5202  H HB3  . ALA A 1 50 ? 0.614   12.942  -14.276 1.00 1.10  ? 50 ALA A HB3  3  
ATOM 5203  N N    . CYS A 1 51 ? 2.895   11.035  -13.884 1.00 0.25  ? 51 CYS A N    3  
ATOM 5204  C CA   . CYS A 1 51 ? 3.648   10.264  -12.878 1.00 0.22  ? 51 CYS A CA   3  
ATOM 5205  C C    . CYS A 1 51 ? 3.444   10.959  -11.551 1.00 0.22  ? 51 CYS A C    3  
ATOM 5206  O O    . CYS A 1 51 ? 3.213   12.151  -11.508 1.00 0.24  ? 51 CYS A O    3  
ATOM 5207  C CB   . CYS A 1 51 ? 5.143   10.179  -13.228 1.00 0.24  ? 51 CYS A CB   3  
ATOM 5208  S SG   . CYS A 1 51 ? 5.590   8.428   -13.403 1.00 0.26  ? 51 CYS A SG   3  
ATOM 5209  H H    . CYS A 1 51 ? 3.094   11.991  -14.023 1.00 0.28  ? 51 CYS A H    3  
ATOM 5210  H HA   . CYS A 1 51 ? 3.241   9.268   -12.822 1.00 0.20  ? 51 CYS A HA   3  
ATOM 5211  H HB2  . CYS A 1 51 ? 5.328   10.695  -14.154 1.00 0.28  ? 51 CYS A HB2  3  
ATOM 5212  H HB3  . CYS A 1 51 ? 5.730   10.626  -12.440 1.00 0.27  ? 51 CYS A HB3  3  
ATOM 5213  N N    . LEU A 1 52 ? 3.483   10.232  -10.477 1.00 0.21  ? 52 LEU A N    3  
ATOM 5214  C CA   . LEU A 1 52 ? 3.285   10.856  -9.147  1.00 0.23  ? 52 LEU A CA   3  
ATOM 5215  C C    . LEU A 1 52 ? 4.352   10.294  -8.212  1.00 0.25  ? 52 LEU A C    3  
ATOM 5216  O O    . LEU A 1 52 ? 5.052   9.363   -8.559  1.00 0.25  ? 52 LEU A O    3  
ATOM 5217  C CB   . LEU A 1 52 ? 1.857   10.612  -8.605  1.00 0.22  ? 52 LEU A CB   3  
ATOM 5218  C CG   . LEU A 1 52 ? 1.194   9.413   -9.286  1.00 0.18  ? 52 LEU A CG   3  
ATOM 5219  C CD1  . LEU A 1 52 ? 0.941   9.707   -10.780 1.00 0.17  ? 52 LEU A CD1  3  
ATOM 5220  C CD2  . LEU A 1 52 ? 2.092   8.193   -9.091  1.00 0.19  ? 52 LEU A CD2  3  
ATOM 5221  H H    . LEU A 1 52 ? 3.630   9.267   -10.544 1.00 0.20  ? 52 LEU A H    3  
ATOM 5222  H HA   . LEU A 1 52 ? 3.441   11.906  -9.242  1.00 0.25  ? 52 LEU A HA   3  
ATOM 5223  H HB2  . LEU A 1 52 ? 1.908   10.428  -7.544  1.00 0.25  ? 52 LEU A HB2  3  
ATOM 5224  H HB3  . LEU A 1 52 ? 1.258   11.494  -8.780  1.00 0.24  ? 52 LEU A HB3  3  
ATOM 5225  H HG   . LEU A 1 52 ? 0.254   9.228   -8.819  1.00 0.19  ? 52 LEU A HG   3  
ATOM 5226  H HD11 . LEU A 1 52 ? 1.097   10.761  -10.974 1.00 0.98  ? 52 LEU A HD11 3  
ATOM 5227  H HD12 . LEU A 1 52 ? 1.619   9.128   -11.388 1.00 0.98  ? 52 LEU A HD12 3  
ATOM 5228  H HD13 . LEU A 1 52 ? -0.077  9.450   -11.033 1.00 1.01  ? 52 LEU A HD13 3  
ATOM 5229  H HD21 . LEU A 1 52 ? 2.944   8.473   -8.483  1.00 1.00  ? 52 LEU A HD21 3  
ATOM 5230  H HD22 . LEU A 1 52 ? 1.538   7.418   -8.587  1.00 0.98  ? 52 LEU A HD22 3  
ATOM 5231  H HD23 . LEU A 1 52 ? 2.433   7.839   -10.045 1.00 1.03  ? 52 LEU A HD23 3  
ATOM 5232  N N    . ASN A 1 53 ? 4.522   10.873  -7.060  1.00 0.29  ? 53 ASN A N    3  
ATOM 5233  C CA   . ASN A 1 53 ? 5.590   10.384  -6.136  1.00 0.32  ? 53 ASN A CA   3  
ATOM 5234  C C    . ASN A 1 53 ? 5.030   9.337   -5.161  1.00 0.34  ? 53 ASN A C    3  
ATOM 5235  O O    . ASN A 1 53 ? 4.471   9.708   -4.151  1.00 0.37  ? 53 ASN A O    3  
ATOM 5236  C CB   . ASN A 1 53 ? 6.143   11.565  -5.323  1.00 0.36  ? 53 ASN A CB   3  
ATOM 5237  C CG   . ASN A 1 53 ? 7.530   11.970  -5.843  1.00 0.43  ? 53 ASN A CG   3  
ATOM 5238  O OD1  . ASN A 1 53 ? 7.973   11.504  -6.874  1.00 1.07  ? 53 ASN A OD1  3  
ATOM 5239  N ND2  . ASN A 1 53 ? 8.241   12.828  -5.162  1.00 0.93  ? 53 ASN A ND2  3  
ATOM 5240  H H    . ASN A 1 53 ? 3.970   11.644  -6.816  1.00 0.30  ? 53 ASN A H    3  
ATOM 5241  H HA   . ASN A 1 53 ? 6.386   9.961   -6.716  1.00 0.33  ? 53 ASN A HA   3  
ATOM 5242  H HB2  . ASN A 1 53 ? 5.468   12.404  -5.400  1.00 0.40  ? 53 ASN A HB2  3  
ATOM 5243  H HB3  . ASN A 1 53 ? 6.228   11.274  -4.286  1.00 0.40  ? 53 ASN A HB3  3  
ATOM 5244  H HD21 . ASN A 1 53 ? 7.889   13.208  -4.329  1.00 1.59  ? 53 ASN A HD21 3  
ATOM 5245  H HD22 . ASN A 1 53 ? 9.129   13.090  -5.481  1.00 0.93  ? 53 ASN A HD22 3  
ATOM 5246  N N    . PRO A 1 54 ? 5.221   8.054   -5.433  1.00 0.34  ? 54 PRO A N    3  
ATOM 5247  C CA   . PRO A 1 54 ? 4.743   7.005   -4.509  1.00 0.37  ? 54 PRO A CA   3  
ATOM 5248  C C    . PRO A 1 54 ? 5.464   7.156   -3.169  1.00 0.43  ? 54 PRO A C    3  
ATOM 5249  O O    . PRO A 1 54 ? 4.896   6.904   -2.122  1.00 0.46  ? 54 PRO A O    3  
ATOM 5250  C CB   . PRO A 1 54 ? 5.070   5.696   -5.229  1.00 0.37  ? 54 PRO A CB   3  
ATOM 5251  C CG   . PRO A 1 54 ? 6.157   6.045   -6.257  1.00 0.36  ? 54 PRO A CG   3  
ATOM 5252  C CD   . PRO A 1 54 ? 5.931   7.521   -6.619  1.00 0.32  ? 54 PRO A CD   3  
ATOM 5253  H HA   . PRO A 1 54 ? 3.676   7.090   -4.370  1.00 0.36  ? 54 PRO A HA   3  
ATOM 5254  H HB2  . PRO A 1 54 ? 5.440   4.965   -4.522  1.00 0.41  ? 54 PRO A HB2  3  
ATOM 5255  H HB3  . PRO A 1 54 ? 4.196   5.319   -5.736  1.00 0.35  ? 54 PRO A HB3  3  
ATOM 5256  H HG2  . PRO A 1 54 ? 7.135   5.916   -5.818  1.00 0.40  ? 54 PRO A HG2  3  
ATOM 5257  H HG3  . PRO A 1 54 ? 6.054   5.435   -7.134  1.00 0.36  ? 54 PRO A HG3  3  
ATOM 5258  H HD2  . PRO A 1 54 ? 6.875   8.009   -6.772  1.00 0.34  ? 54 PRO A HD2  3  
ATOM 5259  H HD3  . PRO A 1 54 ? 5.303   7.601   -7.496  1.00 0.28  ? 54 PRO A HD3  3  
ATOM 5260  N N    . ALA A 1 55 ? 6.688   7.648   -3.192  1.00 0.45  ? 55 ALA A N    3  
ATOM 5261  C CA   . ALA A 1 55 ? 7.413   7.914   -1.917  1.00 0.51  ? 55 ALA A CA   3  
ATOM 5262  C C    . ALA A 1 55 ? 6.602   8.969   -1.151  1.00 0.52  ? 55 ALA A C    3  
ATOM 5263  O O    . ALA A 1 55 ? 6.563   8.982   0.065   1.00 0.56  ? 55 ALA A O    3  
ATOM 5264  C CB   . ALA A 1 55 ? 8.813   8.457   -2.219  1.00 0.54  ? 55 ALA A CB   3  
ATOM 5265  H H    . ALA A 1 55 ? 7.100   7.899   -4.045  1.00 0.43  ? 55 ALA A H    3  
ATOM 5266  H HA   . ALA A 1 55 ? 7.481   7.006   -1.334  1.00 0.53  ? 55 ALA A HA   3  
ATOM 5267  H HB1  . ALA A 1 55 ? 9.256   7.885   -3.021  1.00 1.19  ? 55 ALA A HB1  3  
ATOM 5268  H HB2  . ALA A 1 55 ? 8.740   9.494   -2.514  1.00 1.06  ? 55 ALA A HB2  3  
ATOM 5269  H HB3  . ALA A 1 55 ? 9.430   8.376   -1.337  1.00 1.13  ? 55 ALA A HB3  3  
ATOM 5270  N N    . SER A 1 56 ? 5.918   9.834   -1.881  1.00 0.50  ? 56 SER A N    3  
ATOM 5271  C CA   . SER A 1 56 ? 5.063   10.872  -1.247  1.00 0.51  ? 56 SER A CA   3  
ATOM 5272  C C    . SER A 1 56 ? 3.875   10.170  -0.567  1.00 0.51  ? 56 SER A C    3  
ATOM 5273  O O    . SER A 1 56 ? 3.365   9.200   -1.096  1.00 0.51  ? 56 SER A O    3  
ATOM 5274  C CB   . SER A 1 56 ? 4.526   11.825  -2.320  1.00 0.50  ? 56 SER A CB   3  
ATOM 5275  O OG   . SER A 1 56 ? 4.490   13.148  -1.802  1.00 0.56  ? 56 SER A OG   3  
ATOM 5276  H H    . SER A 1 56 ? 5.951   9.777   -2.857  1.00 0.47  ? 56 SER A H    3  
ATOM 5277  H HA   . SER A 1 56 ? 5.639   11.427  -0.534  1.00 0.54  ? 56 SER A HA   3  
ATOM 5278  H HB2  . SER A 1 56 ? 5.168   11.799  -3.182  1.00 0.46  ? 56 SER A HB2  3  
ATOM 5279  H HB3  . SER A 1 56 ? 3.531   11.514  -2.612  1.00 0.51  ? 56 SER A HB3  3  
ATOM 5280  H HG   . SER A 1 56 ? 3.583   13.347  -1.555  1.00 1.08  ? 56 SER A HG   3  
ATOM 5281  N N    . PRO A 1 57 ? 3.456   10.675  0.571   1.00 0.53  ? 57 PRO A N    3  
ATOM 5282  C CA   . PRO A 1 57 ? 2.314   10.099  1.314   1.00 0.53  ? 57 PRO A CA   3  
ATOM 5283  C C    . PRO A 1 57 ? 1.002   10.435  0.590   1.00 0.51  ? 57 PRO A C    3  
ATOM 5284  O O    . PRO A 1 57 ? 0.180   9.569   0.336   1.00 0.51  ? 57 PRO A O    3  
ATOM 5285  C CB   . PRO A 1 57 ? 2.404   10.768  2.692   1.00 0.59  ? 57 PRO A CB   3  
ATOM 5286  C CG   . PRO A 1 57 ? 3.228   12.062  2.495   1.00 0.62  ? 57 PRO A CG   3  
ATOM 5287  C CD   . PRO A 1 57 ? 4.059   11.863  1.213   1.00 0.58  ? 57 PRO A CD   3  
ATOM 5288  H HA   . PRO A 1 57 ? 2.429   9.030   1.413   1.00 0.54  ? 57 PRO A HA   3  
ATOM 5289  H HB2  . PRO A 1 57 ? 1.413   11.007  3.053   1.00 0.60  ? 57 PRO A HB2  3  
ATOM 5290  H HB3  . PRO A 1 57 ? 2.908   10.119  3.390   1.00 0.62  ? 57 PRO A HB3  3  
ATOM 5291  H HG2  . PRO A 1 57 ? 2.564   12.909  2.383   1.00 0.63  ? 57 PRO A HG2  3  
ATOM 5292  H HG3  . PRO A 1 57 ? 3.887   12.214  3.336   1.00 0.67  ? 57 PRO A HG3  3  
ATOM 5293  H HD2  . PRO A 1 57 ? 3.974   12.729  0.570   1.00 0.59  ? 57 PRO A HD2  3  
ATOM 5294  H HD3  . PRO A 1 57 ? 5.092   11.670  1.457   1.00 0.59  ? 57 PRO A HD3  3  
ATOM 5295  N N    . ILE A 1 58 ? 0.828   11.684  0.225   1.00 0.52  ? 58 ILE A N    3  
ATOM 5296  C CA   . ILE A 1 58 ? -0.396  12.106  -0.523  1.00 0.51  ? 58 ILE A CA   3  
ATOM 5297  C C    . ILE A 1 58 ? -0.528  11.244  -1.765  1.00 0.45  ? 58 ILE A C    3  
ATOM 5298  O O    . ILE A 1 58 ? -1.581  10.735  -2.089  1.00 0.44  ? 58 ILE A O    3  
ATOM 5299  C CB   . ILE A 1 58 ? -0.226  13.577  -0.948  1.00 0.54  ? 58 ILE A CB   3  
ATOM 5300  C CG1  . ILE A 1 58 ? -1.366  14.422  -0.369  1.00 0.62  ? 58 ILE A CG1  3  
ATOM 5301  C CG2  . ILE A 1 58 ? -0.213  13.708  -2.483  1.00 0.49  ? 58 ILE A CG2  3  
ATOM 5302  C CD1  . ILE A 1 58 ? -1.138  14.641  1.129   1.00 0.68  ? 58 ILE A CD1  3  
ATOM 5303  H H    . ILE A 1 58 ? 1.523   12.346  0.421   1.00 0.55  ? 58 ILE A H    3  
ATOM 5304  H HA   . ILE A 1 58 ? -1.270  11.990  0.096   1.00 0.55  ? 58 ILE A HA   3  
ATOM 5305  H HB   . ILE A 1 58 ? 0.718   13.933  -0.570  1.00 0.56  ? 58 ILE A HB   3  
ATOM 5306  H HG12 . ILE A 1 58 ? -1.396  15.377  -0.871  1.00 0.64  ? 58 ILE A HG12 3  
ATOM 5307  H HG13 . ILE A 1 58 ? -2.306  13.910  -0.517  1.00 0.62  ? 58 ILE A HG13 3  
ATOM 5308  H HG21 . ILE A 1 58 ? -1.041  13.155  -2.904  1.00 1.12  ? 58 ILE A HG21 3  
ATOM 5309  H HG22 . ILE A 1 58 ? -0.293  14.744  -2.759  1.00 1.14  ? 58 ILE A HG22 3  
ATOM 5310  H HG23 . ILE A 1 58 ? 0.717   13.307  -2.872  1.00 1.11  ? 58 ILE A HG23 3  
ATOM 5311  H HD11 . ILE A 1 58 ? -0.079  14.709  1.326   1.00 1.28  ? 58 ILE A HD11 3  
ATOM 5312  H HD12 . ILE A 1 58 ? -1.622  15.557  1.436   1.00 1.15  ? 58 ILE A HD12 3  
ATOM 5313  H HD13 . ILE A 1 58 ? -1.555  13.811  1.682   1.00 1.10  ? 58 ILE A HD13 3  
ATOM 5314  N N    . VAL A 1 59 ? 0.547   11.112  -2.476  1.00 0.43  ? 59 VAL A N    3  
ATOM 5315  C CA   . VAL A 1 59 ? 0.529   10.323  -3.711  1.00 0.40  ? 59 VAL A CA   3  
ATOM 5316  C C    . VAL A 1 59 ? 0.356   8.848   -3.359  1.00 0.37  ? 59 VAL A C    3  
ATOM 5317  O O    . VAL A 1 59 ? -0.328  8.128   -4.055  1.00 0.33  ? 59 VAL A O    3  
ATOM 5318  C CB   . VAL A 1 59 ? 1.840   10.571  -4.436  1.00 0.51  ? 59 VAL A CB   3  
ATOM 5319  C CG1  . VAL A 1 59 ? 2.127   9.436   -5.379  1.00 0.31  ? 59 VAL A CG1  3  
ATOM 5320  C CG2  . VAL A 1 59 ? 1.766   11.879  -5.214  1.00 0.88  ? 59 VAL A CG2  3  
ATOM 5321  H H    . VAL A 1 59 ? 1.373   11.563  -2.199  1.00 0.46  ? 59 VAL A H    3  
ATOM 5322  H HA   . VAL A 1 59 ? -0.307  10.639  -4.317  1.00 0.41  ? 59 VAL A HA   3  
ATOM 5323  H HB   . VAL A 1 59 ? 2.631   10.631  -3.712  1.00 0.83  ? 59 VAL A HB   3  
ATOM 5324  H HG11 . VAL A 1 59 ? 1.221   9.160   -5.884  1.00 1.11  ? 59 VAL A HG11 3  
ATOM 5325  H HG12 . VAL A 1 59 ? 2.868   9.754   -6.093  1.00 1.09  ? 59 VAL A HG12 3  
ATOM 5326  H HG13 . VAL A 1 59 ? 2.503   8.600   -4.810  1.00 1.01  ? 59 VAL A HG13 3  
ATOM 5327  H HG21 . VAL A 1 59 ? 1.180   12.595  -4.658  1.00 1.24  ? 59 VAL A HG21 3  
ATOM 5328  H HG22 . VAL A 1 59 ? 2.762   12.267  -5.361  1.00 1.47  ? 59 VAL A HG22 3  
ATOM 5329  H HG23 . VAL A 1 59 ? 1.303   11.701  -6.173  1.00 1.52  ? 59 VAL A HG23 3  
ATOM 5330  N N    . LYS A 1 60 ? 0.912   8.403   -2.254  1.00 0.43  ? 60 LYS A N    3  
ATOM 5331  C CA   . LYS A 1 60 ? 0.691   6.987   -1.840  1.00 0.43  ? 60 LYS A CA   3  
ATOM 5332  C C    . LYS A 1 60 ? -0.832  6.780   -1.714  1.00 0.43  ? 60 LYS A C    3  
ATOM 5333  O O    . LYS A 1 60 ? -1.341  5.676   -1.818  1.00 0.42  ? 60 LYS A O    3  
ATOM 5334  C CB   . LYS A 1 60 ? 1.347   6.738   -0.483  1.00 0.50  ? 60 LYS A CB   3  
ATOM 5335  C CG   . LYS A 1 60 ? 2.048   5.378   -0.488  1.00 0.60  ? 60 LYS A CG   3  
ATOM 5336  C CD   . LYS A 1 60 ? 2.478   5.024   0.938   1.00 0.91  ? 60 LYS A CD   3  
ATOM 5337  C CE   . LYS A 1 60 ? 3.768   4.203   0.900   1.00 0.99  ? 60 LYS A CE   3  
ATOM 5338  N NZ   . LYS A 1 60 ? 4.156   3.820   2.289   1.00 1.67  ? 60 LYS A NZ   3  
ATOM 5339  H H    . LYS A 1 60 ? 1.423   9.011   -1.678  1.00 0.47  ? 60 LYS A H    3  
ATOM 5340  H HA   . LYS A 1 60 ? 1.103   6.321   -2.590  1.00 0.40  ? 60 LYS A HA   3  
ATOM 5341  H HB2  . LYS A 1 60 ? 2.067   7.517   -0.284  1.00 0.65  ? 60 LYS A HB2  3  
ATOM 5342  H HB3  . LYS A 1 60 ? 0.589   6.746   0.286   1.00 0.59  ? 60 LYS A HB3  3  
ATOM 5343  H HG2  . LYS A 1 60 ? 1.366   4.625   -0.859  1.00 1.10  ? 60 LYS A HG2  3  
ATOM 5344  H HG3  . LYS A 1 60 ? 2.918   5.423   -1.126  1.00 0.87  ? 60 LYS A HG3  3  
ATOM 5345  H HD2  . LYS A 1 60 ? 2.646   5.933   1.498   1.00 1.38  ? 60 LYS A HD2  3  
ATOM 5346  H HD3  . LYS A 1 60 ? 1.700   4.447   1.416   1.00 1.48  ? 60 LYS A HD3  3  
ATOM 5347  H HE2  . LYS A 1 60 ? 3.609   3.311   0.313   1.00 1.20  ? 60 LYS A HE2  3  
ATOM 5348  H HE3  . LYS A 1 60 ? 4.557   4.791   0.456   1.00 1.40  ? 60 LYS A HE3  3  
ATOM 5349  H HZ1  . LYS A 1 60 ? 4.136   4.661   2.901   1.00 2.22  ? 60 LYS A HZ1  3  
ATOM 5350  H HZ2  . LYS A 1 60 ? 3.487   3.109   2.652   1.00 2.08  ? 60 LYS A HZ2  3  
ATOM 5351  H HZ3  . LYS A 1 60 ? 5.116   3.422   2.284   1.00 2.01  ? 60 LYS A HZ3  3  
ATOM 5352  N N    . LYS A 1 61 ? -1.555  7.872   -1.549  1.00 0.45  ? 61 LYS A N    3  
ATOM 5353  C CA   . LYS A 1 61 ? -3.030  7.843   -1.474  1.00 0.46  ? 61 LYS A CA   3  
ATOM 5354  C C    . LYS A 1 61 ? -3.514  7.591   -2.885  1.00 0.42  ? 61 LYS A C    3  
ATOM 5355  O O    . LYS A 1 61 ? -4.288  6.704   -3.139  1.00 0.44  ? 61 LYS A O    3  
ATOM 5356  C CB   . LYS A 1 61 ? -3.516  9.215   -1.021  1.00 0.51  ? 61 LYS A CB   3  
ATOM 5357  C CG   . LYS A 1 61 ? -4.669  9.057   -0.036  1.00 0.72  ? 61 LYS A CG   3  
ATOM 5358  C CD   . LYS A 1 61 ? -5.667  10.196  -0.240  1.00 1.03  ? 61 LYS A CD   3  
ATOM 5359  C CE   . LYS A 1 61 ? -6.974  9.877   0.494   1.00 1.30  ? 61 LYS A CE   3  
ATOM 5360  N NZ   . LYS A 1 61 ? -6.796  10.106  1.958   1.00 1.87  ? 61 LYS A NZ   3  
ATOM 5361  H H    . LYS A 1 61 ? -1.112  8.736   -1.528  1.00 0.46  ? 61 LYS A H    3  
ATOM 5362  H HA   . LYS A 1 61 ? -3.370  7.070   -0.803  1.00 0.49  ? 61 LYS A HA   3  
ATOM 5363  H HB2  . LYS A 1 61 ? -2.697  9.741   -0.548  1.00 0.58  ? 61 LYS A HB2  3  
ATOM 5364  H HB3  . LYS A 1 61 ? -3.846  9.779   -1.886  1.00 0.66  ? 61 LYS A HB3  3  
ATOM 5365  H HG2  . LYS A 1 61 ? -5.158  8.109   -0.206  1.00 1.41  ? 61 LYS A HG2  3  
ATOM 5366  H HG3  . LYS A 1 61 ? -4.285  9.091   0.972   1.00 1.05  ? 61 LYS A HG3  3  
ATOM 5367  H HD2  . LYS A 1 61 ? -5.246  11.111  0.147   1.00 1.37  ? 61 LYS A HD2  3  
ATOM 5368  H HD3  . LYS A 1 61 ? -5.868  10.311  -1.295  1.00 1.76  ? 61 LYS A HD3  3  
ATOM 5369  H HE2  . LYS A 1 61 ? -7.760  10.520  0.124   1.00 1.85  ? 61 LYS A HE2  3  
ATOM 5370  H HE3  . LYS A 1 61 ? -7.243  8.846   0.321   1.00 1.55  ? 61 LYS A HE3  3  
ATOM 5371  H HZ1  . LYS A 1 61 ? -6.301  11.007  2.113   1.00 2.11  ? 61 LYS A HZ1  3  
ATOM 5372  H HZ2  . LYS A 1 61 ? -7.727  10.141  2.418   1.00 2.27  ? 61 LYS A HZ2  3  
ATOM 5373  H HZ3  . LYS A 1 61 ? -6.237  9.327   2.365   1.00 2.42  ? 61 LYS A HZ3  3  
ATOM 5374  N N    . ILE A 1 62 ? -3.003  8.374   -3.801  1.00 0.37  ? 62 ILE A N    3  
ATOM 5375  C CA   . ILE A 1 62 ? -3.329  8.223   -5.237  1.00 0.34  ? 62 ILE A CA   3  
ATOM 5376  C C    . ILE A 1 62 ? -3.335  6.735   -5.610  1.00 0.33  ? 62 ILE A C    3  
ATOM 5377  O O    . ILE A 1 62 ? -4.186  6.287   -6.348  1.00 0.34  ? 62 ILE A O    3  
ATOM 5378  C CB   . ILE A 1 62 ? -2.252  9.001   -6.022  1.00 0.32  ? 62 ILE A CB   3  
ATOM 5379  C CG1  . ILE A 1 62 ? -2.878  10.159  -6.794  1.00 0.34  ? 62 ILE A CG1  3  
ATOM 5380  C CG2  . ILE A 1 62 ? -1.494  8.087   -6.981  1.00 0.30  ? 62 ILE A CG2  3  
ATOM 5381  C CD1  . ILE A 1 62 ? -3.846  10.899  -5.875  1.00 0.36  ? 62 ILE A CD1  3  
ATOM 5382  H H    . ILE A 1 62 ? -2.363  9.068   -3.535  1.00 0.37  ? 62 ILE A H    3  
ATOM 5383  H HA   . ILE A 1 62 ? -4.300  8.639   -5.426  1.00 0.36  ? 62 ILE A HA   3  
ATOM 5384  H HB   . ILE A 1 62 ? -1.553  9.404   -5.313  1.00 0.33  ? 62 ILE A HB   3  
ATOM 5385  H HG12 . ILE A 1 62 ? -2.096  10.838  -7.116  1.00 0.35  ? 62 ILE A HG12 3  
ATOM 5386  H HG13 . ILE A 1 62 ? -3.406  9.785   -7.652  1.00 0.35  ? 62 ILE A HG13 3  
ATOM 5387  H HG21 . ILE A 1 62 ? -2.188  7.639   -7.673  1.00 1.07  ? 62 ILE A HG21 3  
ATOM 5388  H HG22 . ILE A 1 62 ? -0.762  8.667   -7.520  1.00 1.02  ? 62 ILE A HG22 3  
ATOM 5389  H HG23 . ILE A 1 62 ? -0.995  7.314   -6.416  1.00 1.06  ? 62 ILE A HG23 3  
ATOM 5390  H HD11 . ILE A 1 62 ? -3.421  10.955  -4.883  1.00 1.05  ? 62 ILE A HD11 3  
ATOM 5391  H HD12 . ILE A 1 62 ? -4.013  11.893  -6.254  1.00 1.01  ? 62 ILE A HD12 3  
ATOM 5392  H HD13 . ILE A 1 62 ? -4.781  10.361  -5.836  1.00 1.08  ? 62 ILE A HD13 3  
ATOM 5393  N N    . ILE A 1 63 ? -2.413  5.959   -5.083  1.00 0.31  ? 63 ILE A N    3  
ATOM 5394  C CA   . ILE A 1 63 ? -2.409  4.498   -5.397  1.00 0.31  ? 63 ILE A CA   3  
ATOM 5395  C C    . ILE A 1 63 ? -3.609  3.855   -4.733  1.00 0.37  ? 63 ILE A C    3  
ATOM 5396  O O    . ILE A 1 63 ? -4.384  3.155   -5.354  1.00 0.41  ? 63 ILE A O    3  
ATOM 5397  C CB   . ILE A 1 63 ? -1.164  3.843   -4.809  1.00 0.32  ? 63 ILE A CB   3  
ATOM 5398  C CG1  . ILE A 1 63 ? 0.064   4.371   -5.521  1.00 0.32  ? 63 ILE A CG1  3  
ATOM 5399  C CG2  . ILE A 1 63 ? -1.248  2.322   -4.965  1.00 0.34  ? 63 ILE A CG2  3  
ATOM 5400  C CD1  . ILE A 1 63 ? 0.478   5.664   -4.855  1.00 0.42  ? 63 ILE A CD1  3  
ATOM 5401  H H    . ILE A 1 63 ? -1.737  6.333   -4.459  1.00 0.32  ? 63 ILE A H    3  
ATOM 5402  H HA   . ILE A 1 63 ? -2.441  4.344   -6.464  1.00 0.30  ? 63 ILE A HA   3  
ATOM 5403  H HB   . ILE A 1 63 ? -1.100  4.085   -3.758  1.00 0.35  ? 63 ILE A HB   3  
ATOM 5404  H HG12 . ILE A 1 63 ? 0.853   3.660   -5.435  1.00 0.31  ? 63 ILE A HG12 3  
ATOM 5405  H HG13 . ILE A 1 63 ? -0.158  4.552   -6.561  1.00 0.48  ? 63 ILE A HG13 3  
ATOM 5406  H HG21 . ILE A 1 63 ? -1.603  2.079   -5.956  1.00 1.03  ? 63 ILE A HG21 3  
ATOM 5407  H HG22 . ILE A 1 63 ? -0.273  1.889   -4.812  1.00 1.03  ? 63 ILE A HG22 3  
ATOM 5408  H HG23 . ILE A 1 63 ? -1.937  1.926   -4.230  1.00 1.02  ? 63 ILE A HG23 3  
ATOM 5409  H HD11 . ILE A 1 63 ? 0.001   5.728   -3.886  1.00 1.07  ? 63 ILE A HD11 3  
ATOM 5410  H HD12 . ILE A 1 63 ? 1.546   5.681   -4.735  1.00 1.16  ? 63 ILE A HD12 3  
ATOM 5411  H HD13 . ILE A 1 63 ? 0.162   6.493   -5.465  1.00 1.06  ? 63 ILE A HD13 3  
ATOM 5412  N N    . GLU A 1 64 ? -3.733  4.079   -3.455  1.00 0.39  ? 64 GLU A N    3  
ATOM 5413  C CA   . GLU A 1 64 ? -4.846  3.470   -2.685  1.00 0.46  ? 64 GLU A CA   3  
ATOM 5414  C C    . GLU A 1 64 ? -6.205  3.939   -3.223  1.00 0.49  ? 64 GLU A C    3  
ATOM 5415  O O    . GLU A 1 64 ? -7.114  3.150   -3.396  1.00 0.62  ? 64 GLU A O    3  
ATOM 5416  C CB   . GLU A 1 64 ? -4.730  3.875   -1.219  1.00 0.49  ? 64 GLU A CB   3  
ATOM 5417  C CG   . GLU A 1 64 ? -3.976  2.793   -0.441  1.00 1.04  ? 64 GLU A CG   3  
ATOM 5418  C CD   . GLU A 1 64 ? -4.230  2.970   1.059   1.00 1.41  ? 64 GLU A CD   3  
ATOM 5419  O OE1  . GLU A 1 64 ? -3.521  3.753   1.672   1.00 2.00  ? 64 GLU A OE1  3  
ATOM 5420  O OE2  . GLU A 1 64 ? -5.128  2.320   1.570   1.00 1.81  ? 64 GLU A OE2  3  
ATOM 5421  H H    . GLU A 1 64 ? -3.067  4.641   -2.995  1.00 0.37  ? 64 GLU A H    3  
ATOM 5422  H HA   . GLU A 1 64 ? -4.766  2.398   -2.771  1.00 0.49  ? 64 GLU A HA   3  
ATOM 5423  H HB2  . GLU A 1 64 ? -4.195  4.811   -1.150  1.00 0.72  ? 64 GLU A HB2  3  
ATOM 5424  H HB3  . GLU A 1 64 ? -5.718  3.994   -0.803  1.00 0.75  ? 64 GLU A HB3  3  
ATOM 5425  H HG2  . GLU A 1 64 ? -4.324  1.818   -0.753  1.00 1.39  ? 64 GLU A HG2  3  
ATOM 5426  H HG3  . GLU A 1 64 ? -2.919  2.879   -0.638  1.00 1.44  ? 64 GLU A HG3  3  
ATOM 5427  N N    . LYS A 1 65 ? -6.355  5.219   -3.478  1.00 0.48  ? 65 LYS A N    3  
ATOM 5428  C CA   . LYS A 1 65 ? -7.654  5.736   -3.993  1.00 0.51  ? 65 LYS A CA   3  
ATOM 5429  C C    . LYS A 1 65 ? -7.878  5.218   -5.409  1.00 0.51  ? 65 LYS A C    3  
ATOM 5430  O O    . LYS A 1 65 ? -8.954  4.756   -5.734  1.00 0.56  ? 65 LYS A O    3  
ATOM 5431  C CB   . LYS A 1 65 ? -7.652  7.267   -3.981  1.00 0.52  ? 65 LYS A CB   3  
ATOM 5432  C CG   . LYS A 1 65 ? -9.015  7.786   -4.450  1.00 1.07  ? 65 LYS A CG   3  
ATOM 5433  C CD   . LYS A 1 65 ? -9.291  9.153   -3.819  1.00 1.45  ? 65 LYS A CD   3  
ATOM 5434  C CE   . LYS A 1 65 ? -9.870  8.958   -2.415  1.00 1.72  ? 65 LYS A CE   3  
ATOM 5435  N NZ   . LYS A 1 65 ? -10.228 10.283  -1.830  1.00 2.15  ? 65 LYS A NZ   3  
ATOM 5436  H H    . LYS A 1 65 ? -5.611  5.837   -3.324  1.00 0.54  ? 65 LYS A H    3  
ATOM 5437  H HA   . LYS A 1 65 ? -8.443  5.369   -3.363  1.00 0.56  ? 65 LYS A HA   3  
ATOM 5438  H HB2  . LYS A 1 65 ? -7.458  7.615   -2.978  1.00 0.92  ? 65 LYS A HB2  3  
ATOM 5439  H HB3  . LYS A 1 65 ? -6.883  7.631   -4.643  1.00 1.10  ? 65 LYS A HB3  3  
ATOM 5440  H HG2  . LYS A 1 65 ? -9.013  7.879   -5.526  1.00 1.56  ? 65 LYS A HG2  3  
ATOM 5441  H HG3  . LYS A 1 65 ? -9.787  7.093   -4.150  1.00 1.65  ? 65 LYS A HG3  3  
ATOM 5442  H HD2  . LYS A 1 65 ? -8.369  9.715   -3.758  1.00 1.79  ? 65 LYS A HD2  3  
ATOM 5443  H HD3  . LYS A 1 65 ? -10.002 9.692   -4.428  1.00 1.92  ? 65 LYS A HD3  3  
ATOM 5444  H HE2  . LYS A 1 65 ? -10.753 8.340   -2.472  1.00 2.13  ? 65 LYS A HE2  3  
ATOM 5445  H HE3  . LYS A 1 65 ? -9.134  8.477   -1.787  1.00 2.04  ? 65 LYS A HE3  3  
ATOM 5446  H HZ1  . LYS A 1 65 ? -9.439  10.949  -1.966  1.00 2.41  ? 65 LYS A HZ1  3  
ATOM 5447  H HZ2  . LYS A 1 65 ? -11.079 10.651  -2.301  1.00 2.47  ? 65 LYS A HZ2  3  
ATOM 5448  H HZ3  . LYS A 1 65 ? -10.417 10.173  -0.814  1.00 2.64  ? 65 LYS A HZ3  3  
ATOM 5449  N N    . MET A 1 66 ? -6.865  5.245   -6.240  1.00 0.46  ? 66 MET A N    3  
ATOM 5450  C CA   . MET A 1 66 ? -7.023  4.694   -7.610  1.00 0.46  ? 66 MET A CA   3  
ATOM 5451  C C    . MET A 1 66 ? -7.432  3.224   -7.456  1.00 0.50  ? 66 MET A C    3  
ATOM 5452  O O    . MET A 1 66 ? -8.246  2.708   -8.199  1.00 0.54  ? 66 MET A O    3  
ATOM 5453  C CB   . MET A 1 66 ? -5.692  4.788   -8.358  1.00 0.42  ? 66 MET A CB   3  
ATOM 5454  C CG   . MET A 1 66 ? -5.531  6.182   -8.991  1.00 0.40  ? 66 MET A CG   3  
ATOM 5455  S SD   . MET A 1 66 ? -4.372  6.084   -10.380 1.00 1.14  ? 66 MET A SD   3  
ATOM 5456  C CE   . MET A 1 66 ? -5.230  4.806   -11.343 1.00 0.37  ? 66 MET A CE   3  
ATOM 5457  H H    . MET A 1 66 ? -6.000  5.593   -5.953  1.00 0.42  ? 66 MET A H    3  
ATOM 5458  H HA   . MET A 1 66 ? -7.789  5.239   -8.132  1.00 0.48  ? 66 MET A HA   3  
ATOM 5459  H HB2  . MET A 1 66 ? -4.883  4.612   -7.664  1.00 0.40  ? 66 MET A HB2  3  
ATOM 5460  H HB3  . MET A 1 66 ? -5.669  4.037   -9.128  1.00 0.46  ? 66 MET A HB3  3  
ATOM 5461  H HG2  . MET A 1 66 ? -6.484  6.541   -9.345  1.00 0.76  ? 66 MET A HG2  3  
ATOM 5462  H HG3  . MET A 1 66 ? -5.142  6.873   -8.253  1.00 0.67  ? 66 MET A HG3  3  
ATOM 5463  H HE1  . MET A 1 66 ? -6.042  4.394   -10.772 1.00 1.09  ? 66 MET A HE1  3  
ATOM 5464  H HE2  . MET A 1 66 ? -5.617  5.243   -12.254 1.00 1.06  ? 66 MET A HE2  3  
ATOM 5465  H HE3  . MET A 1 66 ? -4.534  4.016   -11.592 1.00 1.05  ? 66 MET A HE3  3  
ATOM 5466  N N    . LEU A 1 67 ? -6.891  2.572   -6.448  1.00 0.50  ? 67 LEU A N    3  
ATOM 5467  C CA   . LEU A 1 67 ? -7.240  1.159   -6.153  1.00 0.55  ? 67 LEU A CA   3  
ATOM 5468  C C    . LEU A 1 67 ? -8.715  1.087   -5.737  1.00 0.60  ? 67 LEU A C    3  
ATOM 5469  O O    . LEU A 1 67 ? -9.404  0.125   -6.024  1.00 0.64  ? 67 LEU A O    3  
ATOM 5470  C CB   . LEU A 1 67 ? -6.381  0.670   -4.987  1.00 0.56  ? 67 LEU A CB   3  
ATOM 5471  C CG   . LEU A 1 67 ? -5.207  -0.152  -5.514  1.00 0.53  ? 67 LEU A CG   3  
ATOM 5472  C CD1  . LEU A 1 67 ? -3.920  0.363   -4.880  1.00 0.53  ? 67 LEU A CD1  3  
ATOM 5473  C CD2  . LEU A 1 67 ? -5.405  -1.621  -5.145  1.00 0.56  ? 67 LEU A CD2  3  
ATOM 5474  H H    . LEU A 1 67 ? -6.264  3.033   -5.860  1.00 0.49  ? 67 LEU A H    3  
ATOM 5475  H HA   . LEU A 1 67 ? -7.058  0.553   -7.018  1.00 0.55  ? 67 LEU A HA   3  
ATOM 5476  H HB2  . LEU A 1 67 ? -6.004  1.521   -4.444  1.00 0.57  ? 67 LEU A HB2  3  
ATOM 5477  H HB3  . LEU A 1 67 ? -6.976  0.062   -4.326  1.00 0.60  ? 67 LEU A HB3  3  
ATOM 5478  H HG   . LEU A 1 67 ? -5.146  -0.051  -6.588  1.00 0.51  ? 67 LEU A HG   3  
ATOM 5479  H HD11 . LEU A 1 67 ? -4.163  0.953   -4.007  1.00 1.24  ? 67 LEU A HD11 3  
ATOM 5480  H HD12 . LEU A 1 67 ? -3.301  -0.470  -4.591  1.00 1.19  ? 67 LEU A HD12 3  
ATOM 5481  H HD13 . LEU A 1 67 ? -3.392  0.978   -5.593  1.00 0.98  ? 67 LEU A HD13 3  
ATOM 5482  H HD21 . LEU A 1 67 ? -6.416  -1.919  -5.384  1.00 1.13  ? 67 LEU A HD21 3  
ATOM 5483  H HD22 . LEU A 1 67 ? -4.709  -2.230  -5.702  1.00 1.16  ? 67 LEU A HD22 3  
ATOM 5484  H HD23 . LEU A 1 67 ? -5.233  -1.754  -4.087  1.00 1.18  ? 67 LEU A HD23 3  
ATOM 5485  N N    . ASN A 1 68 ? -9.199  2.106   -5.053  1.00 0.63  ? 68 ASN A N    3  
ATOM 5486  C CA   . ASN A 1 68 ? -10.630 2.106   -4.602  1.00 0.70  ? 68 ASN A CA   3  
ATOM 5487  C C    . ASN A 1 68 ? -11.496 2.867   -5.616  1.00 0.76  ? 68 ASN A C    3  
ATOM 5488  O O    . ASN A 1 68 ? -11.659 4.072   -5.528  1.00 0.92  ? 68 ASN A O    3  
ATOM 5489  C CB   . ASN A 1 68 ? -10.754 2.771   -3.218  1.00 0.78  ? 68 ASN A CB   3  
ATOM 5490  C CG   . ASN A 1 68 ? -12.134 2.464   -2.624  1.00 1.48  ? 68 ASN A CG   3  
ATOM 5491  O OD1  . ASN A 1 68 ? -12.613 1.348   -2.706  1.00 2.21  ? 68 ASN A OD1  3  
ATOM 5492  N ND2  . ASN A 1 68 ? -12.799 3.413   -2.022  1.00 2.00  ? 68 ASN A ND2  3  
ATOM 5493  H H    . ASN A 1 68 ? -8.611  2.874   -4.835  1.00 0.62  ? 68 ASN A H    3  
ATOM 5494  H HA   . ASN A 1 68 ? -10.979 1.085   -4.537  1.00 0.72  ? 68 ASN A HA   3  
ATOM 5495  H HB2  . ASN A 1 68 ? -9.987  2.385   -2.560  1.00 1.16  ? 68 ASN A HB2  3  
ATOM 5496  H HB3  . ASN A 1 68 ? -10.640 3.842   -3.316  1.00 1.06  ? 68 ASN A HB3  3  
ATOM 5497  H HD21 . ASN A 1 68 ? -12.416 4.313   -1.953  1.00 2.14  ? 68 ASN A HD21 3  
ATOM 5498  H HD22 . ASN A 1 68 ? -13.681 3.226   -1.638  1.00 2.63  ? 68 ASN A HD22 3  
ATOM 5499  N N    . SER A 1 69 ? -12.057 2.171   -6.575  1.00 0.87  ? 69 SER A N    3  
ATOM 5500  C CA   . SER A 1 69 ? -12.916 2.835   -7.592  1.00 0.99  ? 69 SER A CA   3  
ATOM 5501  C C    . SER A 1 69 ? -14.399 2.607   -7.248  1.00 1.13  ? 69 SER A C    3  
ATOM 5502  O O    . SER A 1 69 ? -15.181 2.176   -8.078  1.00 1.69  ? 69 SER A O    3  
ATOM 5503  C CB   . SER A 1 69 ? -12.600 2.263   -8.981  1.00 1.46  ? 69 SER A CB   3  
ATOM 5504  O OG   . SER A 1 69 ? -12.708 0.845   -8.947  1.00 2.02  ? 69 SER A OG   3  
ATOM 5505  H H    . SER A 1 69 ? -11.916 1.212   -6.624  1.00 1.01  ? 69 SER A H    3  
ATOM 5506  H HA   . SER A 1 69 ? -12.707 3.884   -7.585  1.00 1.09  ? 69 SER A HA   3  
ATOM 5507  H HB2  . SER A 1 69 ? -13.300 2.654   -9.701  1.00 1.86  ? 69 SER A HB2  3  
ATOM 5508  H HB3  . SER A 1 69 ? -11.597 2.552   -9.267  1.00 1.93  ? 69 SER A HB3  3  
ATOM 5509  H HG   . SER A 1 69 ? -11.820 0.483   -8.927  1.00 2.26  ? 69 SER A HG   3  
ATOM 5510  N N    . ASP A 1 70 ? -14.790 2.898   -6.029  1.00 1.22  ? 70 ASP A N    3  
ATOM 5511  C CA   . ASP A 1 70 ? -16.216 2.705   -5.622  1.00 1.68  ? 70 ASP A CA   3  
ATOM 5512  C C    . ASP A 1 70 ? -16.673 3.916   -4.804  1.00 1.89  ? 70 ASP A C    3  
ATOM 5513  O O    . ASP A 1 70 ? -16.282 4.085   -3.663  1.00 2.34  ? 70 ASP A O    3  
ATOM 5514  C CB   . ASP A 1 70 ? -16.342 1.436   -4.773  1.00 2.32  ? 70 ASP A CB   3  
ATOM 5515  C CG   . ASP A 1 70 ? -16.184 0.201   -5.665  1.00 3.12  ? 70 ASP A CG   3  
ATOM 5516  O OD1  . ASP A 1 70 ? -17.152 -0.168  -6.311  1.00 3.64  ? 70 ASP A OD1  3  
ATOM 5517  O OD2  . ASP A 1 70 ? -15.098 -0.356  -5.686  1.00 3.72  ? 70 ASP A OD2  3  
ATOM 5518  H H    . ASP A 1 70 ? -14.142 3.246   -5.380  1.00 1.39  ? 70 ASP A H    3  
ATOM 5519  H HA   . ASP A 1 70 ? -16.834 2.613   -6.503  1.00 2.07  ? 70 ASP A HA   3  
ATOM 5520  H HB2  . ASP A 1 70 ? -15.573 1.434   -4.014  1.00 2.46  ? 70 ASP A HB2  3  
ATOM 5521  H HB3  . ASP A 1 70 ? -17.313 1.414   -4.301  1.00 2.72  ? 70 ASP A HB3  3  
ATOM 5522  N N    . LYS A 1 71 ? -17.486 4.770   -5.391  1.00 2.37  ? 71 LYS A N    3  
ATOM 5523  C CA   . LYS A 1 71 ? -17.969 5.993   -4.671  1.00 3.07  ? 71 LYS A CA   3  
ATOM 5524  C C    . LYS A 1 71 ? -16.758 6.825   -4.208  1.00 3.94  ? 71 LYS A C    3  
ATOM 5525  O O    . LYS A 1 71 ? -16.768 7.413   -3.143  1.00 4.56  ? 71 LYS A O    3  
ATOM 5526  C CB   . LYS A 1 71 ? -18.828 5.582   -3.462  1.00 3.59  ? 71 LYS A CB   3  
ATOM 5527  C CG   . LYS A 1 71 ? -20.303 5.519   -3.873  1.00 3.79  ? 71 LYS A CG   3  
ATOM 5528  C CD   . LYS A 1 71 ? -21.191 5.623   -2.628  1.00 4.62  ? 71 LYS A CD   3  
ATOM 5529  C CE   . LYS A 1 71 ? -21.500 4.221   -2.094  1.00 5.22  ? 71 LYS A CE   3  
ATOM 5530  N NZ   . LYS A 1 71 ? -22.847 4.214   -1.453  1.00 5.99  ? 71 LYS A NZ   3  
ATOM 5531  H H    . LYS A 1 71 ? -17.770 4.612   -6.314  1.00 2.66  ? 71 LYS A H    3  
ATOM 5532  H HA   . LYS A 1 71 ? -18.566 6.588   -5.347  1.00 3.10  ? 71 LYS A HA   3  
ATOM 5533  H HB2  . LYS A 1 71 ? -18.512 4.611   -3.109  1.00 3.70  ? 71 LYS A HB2  3  
ATOM 5534  H HB3  . LYS A 1 71 ? -18.709 6.308   -2.672  1.00 4.21  ? 71 LYS A HB3  3  
ATOM 5535  H HG2  . LYS A 1 71 ? -20.525 6.338   -4.543  1.00 3.86  ? 71 LYS A HG2  3  
ATOM 5536  H HG3  . LYS A 1 71 ? -20.498 4.582   -4.374  1.00 3.74  ? 71 LYS A HG3  3  
ATOM 5537  H HD2  . LYS A 1 71 ? -20.677 6.194   -1.869  1.00 4.84  ? 71 LYS A HD2  3  
ATOM 5538  H HD3  . LYS A 1 71 ? -22.114 6.119   -2.887  1.00 4.97  ? 71 LYS A HD3  3  
ATOM 5539  H HE2  . LYS A 1 71 ? -21.486 3.514   -2.909  1.00 5.27  ? 71 LYS A HE2  3  
ATOM 5540  H HE3  . LYS A 1 71 ? -20.754 3.943   -1.364  1.00 5.40  ? 71 LYS A HE3  3  
ATOM 5541  H HZ1  . LYS A 1 71 ? -22.912 4.993   -0.767  1.00 6.11  ? 71 LYS A HZ1  3  
ATOM 5542  H HZ2  . LYS A 1 71 ? -23.579 4.334   -2.181  1.00 6.30  ? 71 LYS A HZ2  3  
ATOM 5543  H HZ3  . LYS A 1 71 ? -22.992 3.307   -0.962  1.00 6.39  ? 71 LYS A HZ3  3  
ATOM 5544  N N    . SER A 1 72 ? -15.715 6.867   -5.017  1.00 4.42  ? 72 SER A N    3  
ATOM 5545  C CA   . SER A 1 72 ? -14.478 7.640   -4.666  1.00 5.58  ? 72 SER A CA   3  
ATOM 5546  C C    . SER A 1 72 ? -13.840 7.056   -3.391  1.00 5.86  ? 72 SER A C    3  
ATOM 5547  O O    . SER A 1 72 ? -14.027 7.622   -2.322  1.00 5.92  ? 72 SER A O    3  
ATOM 5548  C CB   . SER A 1 72 ? -14.825 9.124   -4.476  1.00 6.45  ? 72 SER A CB   3  
ATOM 5549  O OG   . SER A 1 72 ? -13.623 9.886   -4.432  1.00 6.62  ? 72 SER A OG   3  
ATOM 5550  O OXT  . SER A 1 72 ? -13.170 6.043   -3.508  1.00 6.32  ? 72 SER A OXT  3  
ATOM 5551  H H    . SER A 1 72 ? -15.746 6.377   -5.865  1.00 4.24  ? 72 SER A H    3  
ATOM 5552  H HA   . SER A 1 72 ? -13.771 7.546   -5.479  1.00 5.92  ? 72 SER A HA   3  
ATOM 5553  H HB2  . SER A 1 72 ? -15.427 9.463   -5.302  1.00 6.89  ? 72 SER A HB2  3  
ATOM 5554  H HB3  . SER A 1 72 ? -15.377 9.251   -3.555  1.00 6.83  ? 72 SER A HB3  3  
ATOM 5555  H HG   . SER A 1 72 ? -13.847 10.780  -4.163  1.00 6.94  ? 72 SER A HG   3  
ATOM 5556  N N    . ALA B 1 1  ? -25.007 -20.022 -20.572 1.00 14.81 ? 1  ALA B N    3  
ATOM 5557  C CA   . ALA B 1 1  ? -23.934 -20.444 -19.624 1.00 14.13 ? 1  ALA B CA   3  
ATOM 5558  C C    . ALA B 1 1  ? -23.032 -19.244 -19.307 1.00 13.41 ? 1  ALA B C    3  
ATOM 5559  O O    . ALA B 1 1  ? -22.114 -18.934 -20.045 1.00 13.48 ? 1  ALA B O    3  
ATOM 5560  C CB   . ALA B 1 1  ? -23.103 -21.567 -20.254 1.00 14.18 ? 1  ALA B CB   3  
ATOM 5561  H H1   . ALA B 1 1  ? -24.574 -19.643 -21.440 1.00 14.87 ? 1  ALA B H1   3  
ATOM 5562  H H2   . ALA B 1 1  ? -25.603 -20.841 -20.810 1.00 15.26 ? 1  ALA B H2   3  
ATOM 5563  H H3   . ALA B 1 1  ? -25.594 -19.288 -20.128 1.00 14.93 ? 1  ALA B H3   3  
ATOM 5564  H HA   . ALA B 1 1  ? -24.386 -20.802 -18.710 1.00 14.27 ? 1  ALA B HA   3  
ATOM 5565  H HB1  . ALA B 1 1  ? -23.050 -21.421 -21.323 1.00 14.35 ? 1  ALA B HB1  3  
ATOM 5566  H HB2  . ALA B 1 1  ? -22.106 -21.555 -19.838 1.00 14.46 ? 1  ALA B HB2  3  
ATOM 5567  H HB3  . ALA B 1 1  ? -23.568 -22.520 -20.045 1.00 13.94 ? 1  ALA B HB3  3  
ATOM 5568  N N    . SER B 1 2  ? -23.292 -18.566 -18.215 1.00 12.88 ? 2  SER B N    3  
ATOM 5569  C CA   . SER B 1 2  ? -22.459 -17.382 -17.841 1.00 12.30 ? 2  SER B CA   3  
ATOM 5570  C C    . SER B 1 2  ? -21.439 -17.797 -16.775 1.00 11.45 ? 2  SER B C    3  
ATOM 5571  O O    . SER B 1 2  ? -21.797 -18.318 -15.733 1.00 11.40 ? 2  SER B O    3  
ATOM 5572  C CB   . SER B 1 2  ? -23.356 -16.272 -17.285 1.00 12.49 ? 2  SER B CB   3  
ATOM 5573  O OG   . SER B 1 2  ? -24.470 -16.082 -18.149 1.00 12.82 ? 2  SER B OG   3  
ATOM 5574  H H    . SER B 1 2  ? -24.040 -18.835 -17.640 1.00 12.97 ? 2  SER B H    3  
ATOM 5575  H HA   . SER B 1 2  ? -21.937 -17.019 -18.714 1.00 12.53 ? 2  SER B HA   3  
ATOM 5576  H HB2  . SER B 1 2  ? -23.711 -16.548 -16.306 1.00 12.66 ? 2  SER B HB2  3  
ATOM 5577  H HB3  . SER B 1 2  ? -22.785 -15.355 -17.211 1.00 12.41 ? 2  SER B HB3  3  
ATOM 5578  H HG   . SER B 1 2  ? -24.220 -15.445 -18.822 1.00 13.11 ? 2  SER B HG   3  
ATOM 5579  N N    . VAL B 1 3  ? -20.173 -17.570 -17.028 1.00 10.94 ? 3  VAL B N    3  
ATOM 5580  C CA   . VAL B 1 3  ? -19.122 -17.950 -16.034 1.00 10.24 ? 3  VAL B CA   3  
ATOM 5581  C C    . VAL B 1 3  ? -18.413 -16.683 -15.537 1.00 9.35  ? 3  VAL B C    3  
ATOM 5582  O O    . VAL B 1 3  ? -17.596 -16.107 -16.234 1.00 9.36  ? 3  VAL B O    3  
ATOM 5583  C CB   . VAL B 1 3  ? -18.102 -18.892 -16.695 1.00 10.50 ? 3  VAL B CB   3  
ATOM 5584  C CG1  . VAL B 1 3  ? -17.101 -19.386 -15.646 1.00 10.46 ? 3  VAL B CG1  3  
ATOM 5585  C CG2  . VAL B 1 3  ? -18.830 -20.097 -17.303 1.00 11.15 ? 3  VAL B CG2  3  
ATOM 5586  H H    . VAL B 1 3  ? -19.911 -17.151 -17.876 1.00 11.14 ? 3  VAL B H    3  
ATOM 5587  H HA   . VAL B 1 3  ? -19.584 -18.453 -15.197 1.00 10.39 ? 3  VAL B HA   3  
ATOM 5588  H HB   . VAL B 1 3  ? -17.573 -18.360 -17.473 1.00 10.49 ? 3  VAL B HB   3  
ATOM 5589  H HG11 . VAL B 1 3  ? -17.631 -19.889 -14.850 1.00 10.59 ? 3  VAL B HG11 3  
ATOM 5590  H HG12 . VAL B 1 3  ? -16.405 -20.073 -16.105 1.00 10.33 ? 3  VAL B HG12 3  
ATOM 5591  H HG13 . VAL B 1 3  ? -16.560 -18.544 -15.240 1.00 10.64 ? 3  VAL B HG13 3  
ATOM 5592  H HG21 . VAL B 1 3  ? -19.452 -20.560 -16.551 1.00 11.34 ? 3  VAL B HG21 3  
ATOM 5593  H HG22 . VAL B 1 3  ? -19.446 -19.767 -18.127 1.00 11.36 ? 3  VAL B HG22 3  
ATOM 5594  H HG23 . VAL B 1 3  ? -18.105 -20.813 -17.660 1.00 11.42 ? 3  VAL B HG23 3  
ATOM 5595  N N    . ALA B 1 4  ? -18.729 -16.248 -14.334 1.00 8.75  ? 4  ALA B N    3  
ATOM 5596  C CA   . ALA B 1 4  ? -18.092 -15.016 -13.759 1.00 7.96  ? 4  ALA B CA   3  
ATOM 5597  C C    . ALA B 1 4  ? -18.489 -13.778 -14.579 1.00 7.01  ? 4  ALA B C    3  
ATOM 5598  O O    . ALA B 1 4  ? -19.222 -13.868 -15.549 1.00 7.03  ? 4  ALA B O    3  
ATOM 5599  C CB   . ALA B 1 4  ? -16.565 -15.169 -13.760 1.00 8.21  ? 4  ALA B CB   3  
ATOM 5600  H H    . ALA B 1 4  ? -19.393 -16.737 -13.804 1.00 8.95  ? 4  ALA B H    3  
ATOM 5601  H HA   . ALA B 1 4  ? -18.432 -14.887 -12.743 1.00 8.13  ? 4  ALA B HA   3  
ATOM 5602  H HB1  . ALA B 1 4  ? -16.304 -16.178 -13.477 1.00 8.38  ? 4  ALA B HB1  3  
ATOM 5603  H HB2  . ALA B 1 4  ? -16.181 -14.962 -14.748 1.00 8.31  ? 4  ALA B HB2  3  
ATOM 5604  H HB3  . ALA B 1 4  ? -16.134 -14.475 -13.054 1.00 8.39  ? 4  ALA B HB3  3  
ATOM 5605  N N    . THR B 1 5  ? -18.011 -12.619 -14.190 1.00 6.47  ? 5  THR B N    3  
ATOM 5606  C CA   . THR B 1 5  ? -18.355 -11.372 -14.935 1.00 5.79  ? 5  THR B CA   3  
ATOM 5607  C C    . THR B 1 5  ? -17.067 -10.592 -15.235 1.00 4.92  ? 5  THR B C    3  
ATOM 5608  O O    . THR B 1 5  ? -16.826 -9.531  -14.689 1.00 4.69  ? 5  THR B O    3  
ATOM 5609  C CB   . THR B 1 5  ? -19.310 -10.509 -14.094 1.00 6.15  ? 5  THR B CB   3  
ATOM 5610  O OG1  . THR B 1 5  ? -20.215 -11.347 -13.385 1.00 6.56  ? 5  THR B OG1  3  
ATOM 5611  C CG2  . THR B 1 5  ? -20.099 -9.574  -15.011 1.00 6.81  ? 5  THR B CG2  3  
ATOM 5612  H H    . THR B 1 5  ? -17.426 -12.572 -13.404 1.00 6.72  ? 5  THR B H    3  
ATOM 5613  H HA   . THR B 1 5  ? -18.836 -11.633 -15.867 1.00 5.97  ? 5  THR B HA   3  
ATOM 5614  H HB   . THR B 1 5  ? -18.740 -9.920  -13.392 1.00 5.99  ? 5  THR B HB   3  
ATOM 5615  H HG1  . THR B 1 5  ? -20.474 -10.889 -12.581 1.00 6.97  ? 5  THR B HG1  3  
ATOM 5616  H HG21 . THR B 1 5  ? -19.548 -9.417  -15.927 1.00 7.08  ? 5  THR B HG21 3  
ATOM 5617  H HG22 . THR B 1 5  ? -21.057 -10.017 -15.240 1.00 7.02  ? 5  THR B HG22 3  
ATOM 5618  H HG23 . THR B 1 5  ? -20.251 -8.626  -14.515 1.00 7.11  ? 5  THR B HG23 3  
ATOM 5619  N N    . GLU B 1 6  ? -16.236 -11.119 -16.102 1.00 4.62  ? 6  GLU B N    3  
ATOM 5620  C CA   . GLU B 1 6  ? -14.959 -10.424 -16.452 1.00 3.82  ? 6  GLU B CA   3  
ATOM 5621  C C    . GLU B 1 6  ? -14.366 -11.046 -17.724 1.00 3.24  ? 6  GLU B C    3  
ATOM 5622  O O    . GLU B 1 6  ? -13.626 -12.011 -17.670 1.00 3.60  ? 6  GLU B O    3  
ATOM 5623  C CB   . GLU B 1 6  ? -13.955 -10.545 -15.293 1.00 4.37  ? 6  GLU B CB   3  
ATOM 5624  C CG   . GLU B 1 6  ? -13.880 -11.997 -14.795 1.00 5.20  ? 6  GLU B CG   3  
ATOM 5625  C CD   . GLU B 1 6  ? -13.593 -12.009 -13.292 1.00 5.80  ? 6  GLU B CD   3  
ATOM 5626  O OE1  . GLU B 1 6  ? -12.428 -11.986 -12.931 1.00 6.17  ? 6  GLU B OE1  3  
ATOM 5627  O OE2  . GLU B 1 6  ? -14.544 -12.041 -12.528 1.00 6.18  ? 6  GLU B OE2  3  
ATOM 5628  H H    . GLU B 1 6  ? -16.454 -11.976 -16.525 1.00 5.02  ? 6  GLU B H    3  
ATOM 5629  H HA   . GLU B 1 6  ? -15.165 -9.379  -16.634 1.00 3.46  ? 6  GLU B HA   3  
ATOM 5630  H HB2  . GLU B 1 6  ? -12.978 -10.235 -15.636 1.00 4.83  ? 6  GLU B HB2  3  
ATOM 5631  H HB3  . GLU B 1 6  ? -14.268 -9.905  -14.483 1.00 4.04  ? 6  GLU B HB3  3  
ATOM 5632  H HG2  . GLU B 1 6  ? -14.818 -12.496 -14.987 1.00 5.47  ? 6  GLU B HG2  3  
ATOM 5633  H HG3  . GLU B 1 6  ? -13.086 -12.515 -15.313 1.00 5.45  ? 6  GLU B HG3  3  
ATOM 5634  N N    . LEU B 1 7  ? -14.688 -10.495 -18.870 1.00 2.60  ? 7  LEU B N    3  
ATOM 5635  C CA   . LEU B 1 7  ? -14.151 -11.035 -20.147 1.00 2.31  ? 7  LEU B CA   3  
ATOM 5636  C C    . LEU B 1 7  ? -13.215 -9.997  -20.747 1.00 1.54  ? 7  LEU B C    3  
ATOM 5637  O O    . LEU B 1 7  ? -12.086 -10.277 -21.096 1.00 1.71  ? 7  LEU B O    3  
ATOM 5638  C CB   . LEU B 1 7  ? -15.273 -11.290 -21.166 1.00 2.52  ? 7  LEU B CB   3  
ATOM 5639  C CG   . LEU B 1 7  ? -16.612 -11.633 -20.501 1.00 3.16  ? 7  LEU B CG   3  
ATOM 5640  C CD1  . LEU B 1 7  ? -16.417 -12.592 -19.327 1.00 3.96  ? 7  LEU B CD1  3  
ATOM 5641  C CD2  . LEU B 1 7  ? -17.251 -10.346 -20.009 1.00 3.09  ? 7  LEU B CD2  3  
ATOM 5642  H H    . LEU B 1 7  ? -15.278 -9.719  -18.892 1.00 2.54  ? 7  LEU B H    3  
ATOM 5643  H HA   . LEU B 1 7  ? -13.622 -11.947 -19.960 1.00 2.79  ? 7  LEU B HA   3  
ATOM 5644  H HB2  . LEU B 1 7  ? -15.404 -10.407 -21.772 1.00 2.09  ? 7  LEU B HB2  3  
ATOM 5645  H HB3  . LEU B 1 7  ? -14.979 -12.094 -21.795 1.00 2.90  ? 7  LEU B HB3  3  
ATOM 5646  H HG   . LEU B 1 7  ? -17.262 -12.095 -21.231 1.00 3.35  ? 7  LEU B HG   3  
ATOM 5647  H HD11 . LEU B 1 7  ? -15.411 -12.981 -19.341 1.00 4.38  ? 7  LEU B HD11 3  
ATOM 5648  H HD12 . LEU B 1 7  ? -16.587 -12.062 -18.402 1.00 4.19  ? 7  LEU B HD12 3  
ATOM 5649  H HD13 . LEU B 1 7  ? -17.120 -13.406 -19.409 1.00 4.26  ? 7  LEU B HD13 3  
ATOM 5650  H HD21 . LEU B 1 7  ? -16.628 -9.511  -20.298 1.00 3.19  ? 7  LEU B HD21 3  
ATOM 5651  H HD22 . LEU B 1 7  ? -18.226 -10.240 -20.451 1.00 3.29  ? 7  LEU B HD22 3  
ATOM 5652  H HD23 . LEU B 1 7  ? -17.335 -10.377 -18.935 1.00 3.35  ? 7  LEU B HD23 3  
ATOM 5653  N N    . ARG B 1 8  ? -13.724 -8.801  -20.881 1.00 1.31  ? 8  ARG B N    3  
ATOM 5654  C CA   . ARG B 1 8  ? -12.956 -7.668  -21.470 1.00 1.49  ? 8  ARG B CA   3  
ATOM 5655  C C    . ARG B 1 8  ? -11.522 -7.615  -20.930 1.00 1.33  ? 8  ARG B C    3  
ATOM 5656  O O    . ARG B 1 8  ? -10.571 -7.614  -21.688 1.00 1.98  ? 8  ARG B O    3  
ATOM 5657  C CB   . ARG B 1 8  ? -13.664 -6.362  -21.116 1.00 2.16  ? 8  ARG B CB   3  
ATOM 5658  C CG   . ARG B 1 8  ? -14.319 -5.776  -22.371 1.00 2.69  ? 8  ARG B CG   3  
ATOM 5659  C CD   . ARG B 1 8  ? -13.274 -4.993  -23.175 1.00 3.00  ? 8  ARG B CD   3  
ATOM 5660  N NE   . ARG B 1 8  ? -12.932 -3.728  -22.457 1.00 3.47  ? 8  ARG B NE   3  
ATOM 5661  C CZ   . ARG B 1 8  ? -11.926 -2.994  -22.858 1.00 3.94  ? 8  ARG B CZ   3  
ATOM 5662  N NH1  . ARG B 1 8  ? -11.978 -2.390  -24.018 1.00 4.43  ? 8  ARG B NH1  3  
ATOM 5663  N NH2  . ARG B 1 8  ? -10.872 -2.861  -22.095 1.00 4.33  ? 8  ARG B NH2  3  
ATOM 5664  H H    . ARG B 1 8  ? -14.651 -8.652  -20.601 1.00 1.64  ? 8  ARG B H    3  
ATOM 5665  H HA   . ARG B 1 8  ? -12.936 -7.780  -22.536 1.00 1.85  ? 8  ARG B HA   3  
ATOM 5666  H HB2  . ARG B 1 8  ? -14.417 -6.561  -20.366 1.00 2.24  ? 8  ARG B HB2  3  
ATOM 5667  H HB3  . ARG B 1 8  ? -12.944 -5.658  -20.725 1.00 2.53  ? 8  ARG B HB3  3  
ATOM 5668  H HG2  . ARG B 1 8  ? -14.713 -6.578  -22.978 1.00 2.99  ? 8  ARG B HG2  3  
ATOM 5669  H HG3  . ARG B 1 8  ? -15.121 -5.113  -22.084 1.00 2.99  ? 8  ARG B HG3  3  
ATOM 5670  H HD2  . ARG B 1 8  ? -12.384 -5.593  -23.288 1.00 3.17  ? 8  ARG B HD2  3  
ATOM 5671  H HD3  . ARG B 1 8  ? -13.674 -4.757  -24.150 1.00 3.16  ? 8  ARG B HD3  3  
ATOM 5672  H HE   . ARG B 1 8  ? -13.460 -3.447  -21.684 1.00 3.66  ? 8  ARG B HE   3  
ATOM 5673  H HH11 . ARG B 1 8  ? -12.786 -2.489  -24.598 1.00 4.49  ? 8  ARG B HH11 3  
ATOM 5674  H HH12 . ARG B 1 8  ? -11.208 -1.826  -24.323 1.00 4.97  ? 8  ARG B HH12 3  
ATOM 5675  H HH21 . ARG B 1 8  ? -10.836 -3.321  -21.207 1.00 4.37  ? 8  ARG B HH21 3  
ATOM 5676  H HH22 . ARG B 1 8  ? -10.102 -2.298  -22.398 1.00 4.82  ? 8  ARG B HH22 3  
ATOM 5677  N N    . CYS B 1 9  ? -11.364 -7.541  -19.633 1.00 0.80  ? 9  CYS B N    3  
ATOM 5678  C CA   . CYS B 1 9  ? -9.989  -7.457  -19.045 1.00 0.67  ? 9  CYS B CA   3  
ATOM 5679  C C    . CYS B 1 9  ? -9.202  -8.750  -19.296 1.00 0.60  ? 9  CYS B C    3  
ATOM 5680  O O    . CYS B 1 9  ? -9.677  -9.677  -19.925 1.00 0.78  ? 9  CYS B O    3  
ATOM 5681  C CB   . CYS B 1 9  ? -10.080 -7.197  -17.543 1.00 0.79  ? 9  CYS B CB   3  
ATOM 5682  S SG   . CYS B 1 9  ? -10.293 -5.422  -17.262 1.00 1.22  ? 9  CYS B SG   3  
ATOM 5683  H H    . CYS B 1 9  ? -12.149 -7.520  -19.048 1.00 0.99  ? 9  CYS B H    3  
ATOM 5684  H HA   . CYS B 1 9  ? -9.465  -6.635  -19.509 1.00 0.83  ? 9  CYS B HA   3  
ATOM 5685  H HB2  . CYS B 1 9  ? -10.916 -7.738  -17.128 1.00 0.89  ? 9  CYS B HB2  3  
ATOM 5686  H HB3  . CYS B 1 9  ? -9.173  -7.528  -17.068 1.00 0.93  ? 9  CYS B HB3  3  
ATOM 5687  N N    . GLN B 1 10 ? -7.984  -8.794  -18.820 1.00 0.50  ? 10 GLN B N    3  
ATOM 5688  C CA   . GLN B 1 10 ? -7.119  -9.995  -19.034 1.00 0.47  ? 10 GLN B CA   3  
ATOM 5689  C C    . GLN B 1 10 ? -6.892  -10.771 -17.724 1.00 0.40  ? 10 GLN B C    3  
ATOM 5690  O O    . GLN B 1 10 ? -6.332  -11.849 -17.742 1.00 0.43  ? 10 GLN B O    3  
ATOM 5691  C CB   . GLN B 1 10 ? -5.770  -9.523  -19.558 1.00 0.53  ? 10 GLN B CB   3  
ATOM 5692  C CG   . GLN B 1 10 ? -5.683  -9.776  -21.066 1.00 0.64  ? 10 GLN B CG   3  
ATOM 5693  C CD   . GLN B 1 10 ? -4.257  -9.520  -21.549 1.00 1.21  ? 10 GLN B CD   3  
ATOM 5694  O OE1  . GLN B 1 10 ? -3.748  -8.422  -21.426 1.00 1.88  ? 10 GLN B OE1  3  
ATOM 5695  N NE2  . GLN B 1 10 ? -3.584  -10.493 -22.102 1.00 1.84  ? 10 GLN B NE2  3  
ATOM 5696  H H    . GLN B 1 10 ? -7.628  -8.023  -18.331 1.00 0.61  ? 10 GLN B H    3  
ATOM 5697  H HA   . GLN B 1 10 ? -7.578  -10.644 -19.765 1.00 0.53  ? 10 GLN B HA   3  
ATOM 5698  H HB2  . GLN B 1 10 ? -5.656  -8.467  -19.361 1.00 0.58  ? 10 GLN B HB2  3  
ATOM 5699  H HB3  . GLN B 1 10 ? -4.994  -10.067 -19.052 1.00 0.51  ? 10 GLN B HB3  3  
ATOM 5700  H HG2  . GLN B 1 10 ? -5.955  -10.801 -21.275 1.00 1.12  ? 10 GLN B HG2  3  
ATOM 5701  H HG3  . GLN B 1 10 ? -6.360  -9.112  -21.582 1.00 1.14  ? 10 GLN B HG3  3  
ATOM 5702  H HE21 . GLN B 1 10 ? -3.993  -11.378 -22.202 1.00 2.04  ? 10 GLN B HE21 3  
ATOM 5703  H HE22 . GLN B 1 10 ? -2.669  -10.339 -22.418 1.00 2.46  ? 10 GLN B HE22 3  
ATOM 5704  N N    . CYS B 1 11 ? -7.299  -10.210 -16.604 1.00 0.35  ? 11 CYS B N    3  
ATOM 5705  C CA   . CYS B 1 11 ? -7.115  -10.866 -15.250 1.00 0.32  ? 11 CYS B CA   3  
ATOM 5706  C C    . CYS B 1 11 ? -7.059  -12.401 -15.362 1.00 0.37  ? 11 CYS B C    3  
ATOM 5707  O O    . CYS B 1 11 ? -7.937  -13.018 -15.942 1.00 0.51  ? 11 CYS B O    3  
ATOM 5708  C CB   . CYS B 1 11 ? -8.292  -10.507 -14.324 1.00 0.33  ? 11 CYS B CB   3  
ATOM 5709  S SG   . CYS B 1 11 ? -9.510  -9.470  -15.182 1.00 0.49  ? 11 CYS B SG   3  
ATOM 5710  H H    . CYS B 1 11 ? -7.716  -9.329  -16.650 1.00 0.37  ? 11 CYS B H    3  
ATOM 5711  H HA   . CYS B 1 11 ? -6.199  -10.507 -14.803 1.00 0.33  ? 11 CYS B HA   3  
ATOM 5712  H HB2  . CYS B 1 11 ? -8.773  -11.416 -14.000 1.00 0.41  ? 11 CYS B HB2  3  
ATOM 5713  H HB3  . CYS B 1 11 ? -7.918  -9.978  -13.460 1.00 0.33  ? 11 CYS B HB3  3  
ATOM 5714  N N    . LEU B 1 12 ? -6.052  -13.026 -14.779 1.00 0.40  ? 12 LEU B N    3  
ATOM 5715  C CA   . LEU B 1 12 ? -5.970  -14.523 -14.824 1.00 0.45  ? 12 LEU B CA   3  
ATOM 5716  C C    . LEU B 1 12 ? -7.037  -15.066 -13.867 1.00 0.45  ? 12 LEU B C    3  
ATOM 5717  O O    . LEU B 1 12 ? -8.028  -15.643 -14.272 1.00 0.49  ? 12 LEU B O    3  
ATOM 5718  C CB   . LEU B 1 12 ? -4.576  -15.025 -14.360 1.00 0.49  ? 12 LEU B CB   3  
ATOM 5719  C CG   . LEU B 1 12 ? -3.450  -14.073 -14.783 1.00 0.83  ? 12 LEU B CG   3  
ATOM 5720  C CD1  . LEU B 1 12 ? -2.110  -14.665 -14.341 1.00 1.04  ? 12 LEU B CD1  3  
ATOM 5721  C CD2  . LEU B 1 12 ? -3.438  -13.902 -16.302 1.00 1.56  ? 12 LEU B CD2  3  
ATOM 5722  H H    . LEU B 1 12 ? -5.376  -12.515 -14.292 1.00 0.49  ? 12 LEU B H    3  
ATOM 5723  H HA   . LEU B 1 12 ? -6.170  -14.870 -15.827 1.00 0.48  ? 12 LEU B HA   3  
ATOM 5724  H HB2  . LEU B 1 12 ? -4.569  -15.107 -13.284 1.00 0.99  ? 12 LEU B HB2  3  
ATOM 5725  H HB3  . LEU B 1 12 ? -4.389  -15.999 -14.787 1.00 0.99  ? 12 LEU B HB3  3  
ATOM 5726  H HG   . LEU B 1 12 ? -3.589  -13.112 -14.309 1.00 1.56  ? 12 LEU B HG   3  
ATOM 5727  H HD11 . LEU B 1 12 ? -2.109  -15.730 -14.527 1.00 1.64  ? 12 LEU B HD11 3  
ATOM 5728  H HD12 . LEU B 1 12 ? -1.309  -14.202 -14.896 1.00 1.49  ? 12 LEU B HD12 3  
ATOM 5729  H HD13 . LEU B 1 12 ? -1.969  -14.484 -13.285 1.00 1.52  ? 12 LEU B HD13 3  
ATOM 5730  H HD21 . LEU B 1 12 ? -3.334  -14.868 -16.772 1.00 2.16  ? 12 LEU B HD21 3  
ATOM 5731  H HD22 . LEU B 1 12 ? -4.360  -13.441 -16.619 1.00 1.96  ? 12 LEU B HD22 3  
ATOM 5732  H HD23 . LEU B 1 12 ? -2.606  -13.273 -16.584 1.00 1.94  ? 12 LEU B HD23 3  
ATOM 5733  N N    . GLN B 1 13 ? -6.826  -14.849 -12.594 1.00 0.44  ? 13 GLN B N    3  
ATOM 5734  C CA   . GLN B 1 13 ? -7.781  -15.293 -11.540 1.00 0.46  ? 13 GLN B CA   3  
ATOM 5735  C C    . GLN B 1 13 ? -7.309  -14.684 -10.211 1.00 0.42  ? 13 GLN B C    3  
ATOM 5736  O O    . GLN B 1 13 ? -7.280  -15.343 -9.190  1.00 0.60  ? 13 GLN B O    3  
ATOM 5737  C CB   . GLN B 1 13 ? -7.773  -16.824 -11.436 1.00 0.53  ? 13 GLN B CB   3  
ATOM 5738  C CG   . GLN B 1 13 ? -6.444  -17.400 -11.950 1.00 1.12  ? 13 GLN B CG   3  
ATOM 5739  C CD   . GLN B 1 13 ? -6.178  -18.749 -11.278 1.00 1.40  ? 13 GLN B CD   3  
ATOM 5740  O OE1  . GLN B 1 13 ? -6.331  -19.786 -11.891 1.00 1.77  ? 13 GLN B OE1  3  
ATOM 5741  N NE2  . GLN B 1 13 ? -5.785  -18.781 -10.032 1.00 2.09  ? 13 GLN B NE2  3  
ATOM 5742  H H    . GLN B 1 13 ? -6.025  -14.375 -12.330 1.00 0.43  ? 13 GLN B H    3  
ATOM 5743  H HA   . GLN B 1 13 ? -8.774  -14.938 -11.771 1.00 0.47  ? 13 GLN B HA   3  
ATOM 5744  H HB2  . GLN B 1 13 ? -7.926  -17.121 -10.411 1.00 0.99  ? 13 GLN B HB2  3  
ATOM 5745  H HB3  . GLN B 1 13 ? -8.570  -17.202 -12.042 1.00 0.86  ? 13 GLN B HB3  3  
ATOM 5746  H HG2  . GLN B 1 13 ? -6.500  -17.534 -13.021 1.00 1.51  ? 13 GLN B HG2  3  
ATOM 5747  H HG3  . GLN B 1 13 ? -5.639  -16.718 -11.715 1.00 1.66  ? 13 GLN B HG3  3  
ATOM 5748  H HE21 . GLN B 1 13 ? -5.662  -17.946 -9.535  1.00 2.59  ? 13 GLN B HE21 3  
ATOM 5749  H HE22 . GLN B 1 13 ? -5.611  -19.641 -9.596  1.00 2.41  ? 13 GLN B HE22 3  
ATOM 5750  N N    . THR B 1 14 ? -6.905  -13.430 -10.265 1.00 0.37  ? 14 THR B N    3  
ATOM 5751  C CA   . THR B 1 14 ? -6.360  -12.683 -9.081  1.00 0.33  ? 14 THR B CA   3  
ATOM 5752  C C    . THR B 1 14 ? -5.697  -13.602 -8.056  1.00 0.35  ? 14 THR B C    3  
ATOM 5753  O O    . THR B 1 14 ? -6.334  -14.160 -7.179  1.00 0.39  ? 14 THR B O    3  
ATOM 5754  C CB   . THR B 1 14 ? -7.409  -11.836 -8.390  1.00 0.33  ? 14 THR B CB   3  
ATOM 5755  O OG1  . THR B 1 14 ? -8.582  -12.600 -8.140  1.00 0.39  ? 14 THR B OG1  3  
ATOM 5756  C CG2  . THR B 1 14 ? -7.734  -10.632 -9.270  1.00 0.32  ? 14 THR B CG2  3  
ATOM 5757  H H    . THR B 1 14 ? -6.934  -12.970 -11.129 1.00 0.51  ? 14 THR B H    3  
ATOM 5758  H HA   . THR B 1 14 ? -5.607  -12.018 -9.453  1.00 0.30  ? 14 THR B HA   3  
ATOM 5759  H HB   . THR B 1 14 ? -6.985  -11.483 -7.459  1.00 0.32  ? 14 THR B HB   3  
ATOM 5760  H HG1  . THR B 1 14 ? -8.475  -13.039 -7.293  1.00 0.95  ? 14 THR B HG1  3  
ATOM 5761  H HG21 . THR B 1 14 ? -6.813  -10.158 -9.579  1.00 1.06  ? 14 THR B HG21 3  
ATOM 5762  H HG22 . THR B 1 14 ? -8.279  -10.960 -10.142 1.00 1.03  ? 14 THR B HG22 3  
ATOM 5763  H HG23 . THR B 1 14 ? -8.331  -9.929  -8.711  1.00 1.06  ? 14 THR B HG23 3  
ATOM 5764  N N    . LEU B 1 15 ? -4.406  -13.719 -8.148  1.00 0.36  ? 15 LEU B N    3  
ATOM 5765  C CA   . LEU B 1 15 ? -3.649  -14.564 -7.180  1.00 0.42  ? 15 LEU B CA   3  
ATOM 5766  C C    . LEU B 1 15 ? -3.510  -13.804 -5.858  1.00 0.36  ? 15 LEU B C    3  
ATOM 5767  O O    . LEU B 1 15 ? -3.587  -12.589 -5.821  1.00 0.52  ? 15 LEU B O    3  
ATOM 5768  C CB   . LEU B 1 15 ? -2.263  -14.886 -7.748  1.00 0.57  ? 15 LEU B CB   3  
ATOM 5769  C CG   . LEU B 1 15 ? -2.419  -15.767 -8.992  1.00 0.65  ? 15 LEU B CG   3  
ATOM 5770  C CD1  . LEU B 1 15 ? -1.207  -15.587 -9.907  1.00 0.74  ? 15 LEU B CD1  3  
ATOM 5771  C CD2  . LEU B 1 15 ? -2.527  -17.235 -8.568  1.00 1.78  ? 15 LEU B CD2  3  
ATOM 5772  H H    . LEU B 1 15 ? -3.931  -13.221 -8.851  1.00 0.35  ? 15 LEU B H    3  
ATOM 5773  H HA   . LEU B 1 15 ? -4.190  -15.485 -7.008  1.00 0.51  ? 15 LEU B HA   3  
ATOM 5774  H HB2  . LEU B 1 15 ? -1.760  -13.967 -8.014  1.00 1.12  ? 15 LEU B HB2  3  
ATOM 5775  H HB3  . LEU B 1 15 ? -1.682  -15.414 -7.006  1.00 0.91  ? 15 LEU B HB3  3  
ATOM 5776  H HG   . LEU B 1 15 ? -3.314  -15.480 -9.524  1.00 1.32  ? 15 LEU B HG   3  
ATOM 5777  H HD11 . LEU B 1 15 ? -0.826  -14.580 -9.809  1.00 1.40  ? 15 LEU B HD11 3  
ATOM 5778  H HD12 . LEU B 1 15 ? -0.436  -16.292 -9.629  1.00 1.44  ? 15 LEU B HD12 3  
ATOM 5779  H HD13 . LEU B 1 15 ? -1.501  -15.761 -10.931 1.00 1.20  ? 15 LEU B HD13 3  
ATOM 5780  H HD21 . LEU B 1 15 ? -3.374  -17.357 -7.909  1.00 2.19  ? 15 LEU B HD21 3  
ATOM 5781  H HD22 . LEU B 1 15 ? -2.658  -17.853 -9.443  1.00 2.33  ? 15 LEU B HD22 3  
ATOM 5782  H HD23 . LEU B 1 15 ? -1.625  -17.527 -8.051  1.00 2.33  ? 15 LEU B HD23 3  
ATOM 5783  N N    . GLN B 1 16 ? -3.321  -14.508 -4.773  1.00 0.47  ? 16 GLN B N    3  
ATOM 5784  C CA   . GLN B 1 16 ? -3.196  -13.835 -3.448  1.00 0.42  ? 16 GLN B CA   3  
ATOM 5785  C C    . GLN B 1 16 ? -1.740  -13.449 -3.186  1.00 0.39  ? 16 GLN B C    3  
ATOM 5786  O O    . GLN B 1 16 ? -1.106  -13.929 -2.264  1.00 0.47  ? 16 GLN B O    3  
ATOM 5787  C CB   . GLN B 1 16 ? -3.699  -14.776 -2.345  1.00 0.49  ? 16 GLN B CB   3  
ATOM 5788  C CG   . GLN B 1 16 ? -5.207  -14.584 -2.145  1.00 0.60  ? 16 GLN B CG   3  
ATOM 5789  C CD   . GLN B 1 16 ? -5.978  -15.534 -3.069  1.00 0.78  ? 16 GLN B CD   3  
ATOM 5790  O OE1  . GLN B 1 16 ? -5.700  -16.717 -3.115  1.00 1.48  ? 16 GLN B OE1  3  
ATOM 5791  N NE2  . GLN B 1 16 ? -6.944  -15.064 -3.812  1.00 1.31  ? 16 GLN B NE2  3  
ATOM 5792  H H    . GLN B 1 16 ? -3.273  -15.479 -4.828  1.00 0.72  ? 16 GLN B H    3  
ATOM 5793  H HA   . GLN B 1 16 ? -3.793  -12.932 -3.452  1.00 0.43  ? 16 GLN B HA   3  
ATOM 5794  H HB2  . GLN B 1 16 ? -3.500  -15.799 -2.627  1.00 0.51  ? 16 GLN B HB2  3  
ATOM 5795  H HB3  . GLN B 1 16 ? -3.186  -14.554 -1.423  1.00 0.50  ? 16 GLN B HB3  3  
ATOM 5796  H HG2  . GLN B 1 16 ? -5.462  -14.798 -1.117  1.00 0.75  ? 16 GLN B HG2  3  
ATOM 5797  H HG3  . GLN B 1 16 ? -5.475  -13.563 -2.377  1.00 0.72  ? 16 GLN B HG3  3  
ATOM 5798  H HE21 . GLN B 1 16 ? -7.173  -14.111 -3.775  1.00 1.97  ? 16 GLN B HE21 3  
ATOM 5799  H HE22 . GLN B 1 16 ? -7.442  -15.664 -4.405  1.00 1.46  ? 16 GLN B HE22 3  
ATOM 5800  N N    . GLY B 1 17 ? -1.225  -12.555 -3.984  1.00 0.37  ? 17 GLY B N    3  
ATOM 5801  C CA   . GLY B 1 17 ? 0.168   -12.072 -3.793  1.00 0.45  ? 17 GLY B CA   3  
ATOM 5802  C C    . GLY B 1 17 ? 1.178   -13.169 -4.103  1.00 0.41  ? 17 GLY B C    3  
ATOM 5803  O O    . GLY B 1 17 ? 1.588   -13.911 -3.230  1.00 0.57  ? 17 GLY B O    3  
ATOM 5804  H H    . GLY B 1 17 ? -1.771  -12.183 -4.705  1.00 0.35  ? 17 GLY B H    3  
ATOM 5805  H HA2  . GLY B 1 17 ? 0.343   -11.234 -4.449  1.00 0.56  ? 17 GLY B HA2  3  
ATOM 5806  H HA3  . GLY B 1 17 ? 0.296   -11.752 -2.769  1.00 0.59  ? 17 GLY B HA3  3  
ATOM 5807  N N    . ILE B 1 18 ? 1.619   -13.248 -5.332  1.00 0.39  ? 18 ILE B N    3  
ATOM 5808  C CA   . ILE B 1 18 ? 2.642   -14.267 -5.687  1.00 0.49  ? 18 ILE B CA   3  
ATOM 5809  C C    . ILE B 1 18 ? 4.014   -13.694 -5.315  1.00 0.51  ? 18 ILE B C    3  
ATOM 5810  O O    . ILE B 1 18 ? 4.106   -12.650 -4.691  1.00 0.72  ? 18 ILE B O    3  
ATOM 5811  C CB   . ILE B 1 18 ? 2.559   -14.636 -7.188  1.00 0.67  ? 18 ILE B CB   3  
ATOM 5812  C CG1  . ILE B 1 18 ? 3.411   -13.694 -8.051  1.00 0.72  ? 18 ILE B CG1  3  
ATOM 5813  C CG2  . ILE B 1 18 ? 1.104   -14.587 -7.666  1.00 0.74  ? 18 ILE B CG2  3  
ATOM 5814  C CD1  . ILE B 1 18 ? 3.034   -12.245 -7.771  1.00 0.67  ? 18 ILE B CD1  3  
ATOM 5815  H H    . ILE B 1 18 ? 1.302   -12.619 -6.008  1.00 0.44  ? 18 ILE B H    3  
ATOM 5816  H HA   . ILE B 1 18 ? 2.476   -15.149 -5.103  1.00 0.54  ? 18 ILE B HA   3  
ATOM 5817  H HB   . ILE B 1 18 ? 2.921   -15.641 -7.306  1.00 0.79  ? 18 ILE B HB   3  
ATOM 5818  H HG12 . ILE B 1 18 ? 4.455   -13.843 -7.823  1.00 0.70  ? 18 ILE B HG12 3  
ATOM 5819  H HG13 . ILE B 1 18 ? 3.239   -13.912 -9.095  1.00 0.91  ? 18 ILE B HG13 3  
ATOM 5820  H HG21 . ILE B 1 18 ? 0.466   -15.057 -6.931  1.00 1.15  ? 18 ILE B HG21 3  
ATOM 5821  H HG22 . ILE B 1 18 ? 0.800   -13.559 -7.801  1.00 1.25  ? 18 ILE B HG22 3  
ATOM 5822  H HG23 . ILE B 1 18 ? 1.018   -15.114 -8.605  1.00 1.30  ? 18 ILE B HG23 3  
ATOM 5823  H HD11 . ILE B 1 18 ? 1.963   -12.135 -7.849  1.00 1.16  ? 18 ILE B HD11 3  
ATOM 5824  H HD12 . ILE B 1 18 ? 3.352   -11.980 -6.775  1.00 1.21  ? 18 ILE B HD12 3  
ATOM 5825  H HD13 . ILE B 1 18 ? 3.519   -11.607 -8.488  1.00 1.17  ? 18 ILE B HD13 3  
ATOM 5826  N N    . HIS B 1 19 ? 5.073   -14.351 -5.674  1.00 0.45  ? 19 HIS B N    3  
ATOM 5827  C CA   . HIS B 1 19 ? 6.415   -13.818 -5.317  1.00 0.46  ? 19 HIS B CA   3  
ATOM 5828  C C    . HIS B 1 19 ? 6.958   -13.010 -6.514  1.00 0.38  ? 19 HIS B C    3  
ATOM 5829  O O    . HIS B 1 19 ? 6.699   -13.361 -7.652  1.00 0.35  ? 19 HIS B O    3  
ATOM 5830  C CB   . HIS B 1 19 ? 7.334   -14.993 -4.920  1.00 0.54  ? 19 HIS B CB   3  
ATOM 5831  C CG   . HIS B 1 19 ? 8.562   -15.056 -5.782  1.00 0.60  ? 19 HIS B CG   3  
ATOM 5832  N ND1  . HIS B 1 19 ? 9.832   -14.857 -5.271  1.00 0.76  ? 19 HIS B ND1  3  
ATOM 5833  C CD2  . HIS B 1 19 ? 8.727   -15.317 -7.114  1.00 0.60  ? 19 HIS B CD2  3  
ATOM 5834  C CE1  . HIS B 1 19 ? 10.699  -15.004 -6.285  1.00 0.81  ? 19 HIS B CE1  3  
ATOM 5835  N NE2  . HIS B 1 19 ? 10.078  -15.288 -7.433  1.00 0.74  ? 19 HIS B NE2  3  
ATOM 5836  H H    . HIS B 1 19 ? 4.987   -15.185 -6.175  1.00 0.55  ? 19 HIS B H    3  
ATOM 5837  H HA   . HIS B 1 19 ? 6.297   -13.162 -4.469  1.00 0.50  ? 19 HIS B HA   3  
ATOM 5838  H HB2  . HIS B 1 19 ? 7.634   -14.872 -3.891  1.00 0.64  ? 19 HIS B HB2  3  
ATOM 5839  H HB3  . HIS B 1 19 ? 6.784   -15.918 -5.018  1.00 0.52  ? 19 HIS B HB3  3  
ATOM 5840  H HD1  . HIS B 1 19 ? 10.057  -14.646 -4.341  1.00 0.84  ? 19 HIS B HD1  3  
ATOM 5841  H HD2  . HIS B 1 19 ? 7.923   -15.490 -7.813  1.00 0.55  ? 19 HIS B HD2  3  
ATOM 5842  H HE1  . HIS B 1 19 ? 11.768  -14.889 -6.187  1.00 0.93  ? 19 HIS B HE1  3  
ATOM 5843  N N    . PRO B 1 20 ? 7.667   -11.932 -6.230  1.00 0.39  ? 20 PRO B N    3  
ATOM 5844  C CA   . PRO B 1 20 ? 8.216   -11.054 -7.278  1.00 0.35  ? 20 PRO B CA   3  
ATOM 5845  C C    . PRO B 1 20 ? 9.442   -11.695 -7.961  1.00 0.37  ? 20 PRO B C    3  
ATOM 5846  O O    . PRO B 1 20 ? 9.329   -12.780 -8.497  1.00 0.43  ? 20 PRO B O    3  
ATOM 5847  C CB   . PRO B 1 20 ? 8.544   -9.760  -6.522  1.00 0.39  ? 20 PRO B CB   3  
ATOM 5848  C CG   . PRO B 1 20 ? 8.714   -10.153 -5.041  1.00 0.47  ? 20 PRO B CG   3  
ATOM 5849  C CD   . PRO B 1 20 ? 7.979   -11.487 -4.854  1.00 0.46  ? 20 PRO B CD   3  
ATOM 5850  H HA   . PRO B 1 20 ? 7.459   -10.856 -8.019  1.00 0.32  ? 20 PRO B HA   3  
ATOM 5851  H HB2  . PRO B 1 20 ? 9.447   -9.316  -6.902  1.00 0.40  ? 20 PRO B HB2  3  
ATOM 5852  H HB3  . PRO B 1 20 ? 7.725   -9.066  -6.618  1.00 0.40  ? 20 PRO B HB3  3  
ATOM 5853  H HG2  . PRO B 1 20 ? 9.762   -10.271 -4.807  1.00 0.50  ? 20 PRO B HG2  3  
ATOM 5854  H HG3  . PRO B 1 20 ? 8.271   -9.404  -4.405  1.00 0.51  ? 20 PRO B HG3  3  
ATOM 5855  H HD2  . PRO B 1 20 ? 8.623   -12.198 -4.359  1.00 0.50  ? 20 PRO B HD2  3  
ATOM 5856  H HD3  . PRO B 1 20 ? 7.072   -11.335 -4.295  1.00 0.47  ? 20 PRO B HD3  3  
ATOM 5857  N N    . LYS B 1 21 ? 10.586  -11.026 -8.009  1.00 0.38  ? 21 LYS B N    3  
ATOM 5858  C CA   . LYS B 1 21 ? 11.784  -11.583 -8.725  1.00 0.40  ? 21 LYS B CA   3  
ATOM 5859  C C    . LYS B 1 21 ? 11.536  -11.432 -10.233 1.00 0.38  ? 21 LYS B C    3  
ATOM 5860  O O    . LYS B 1 21 ? 12.348  -10.886 -10.957 1.00 0.42  ? 21 LYS B O    3  
ATOM 5861  C CB   . LYS B 1 21 ? 12.008  -13.063 -8.370  1.00 0.42  ? 21 LYS B CB   3  
ATOM 5862  C CG   . LYS B 1 21 ? 13.510  -13.387 -8.378  1.00 0.52  ? 21 LYS B CG   3  
ATOM 5863  C CD   . LYS B 1 21 ? 13.753  -14.735 -9.064  1.00 0.95  ? 21 LYS B CD   3  
ATOM 5864  C CE   . LYS B 1 21 ? 13.184  -15.871 -8.212  1.00 1.49  ? 21 LYS B CE   3  
ATOM 5865  N NZ   . LYS B 1 21 ? 13.851  -17.153 -8.579  1.00 2.16  ? 21 LYS B NZ   3  
ATOM 5866  H H    . LYS B 1 21 ? 10.648  -10.138 -7.614  1.00 0.41  ? 21 LYS B H    3  
ATOM 5867  H HA   . LYS B 1 21 ? 12.650  -11.004 -8.450  1.00 0.43  ? 21 LYS B HA   3  
ATOM 5868  H HB2  . LYS B 1 21 ? 11.608  -13.254 -7.388  1.00 0.42  ? 21 LYS B HB2  3  
ATOM 5869  H HB3  . LYS B 1 21 ? 11.502  -13.687 -9.091  1.00 0.41  ? 21 LYS B HB3  3  
ATOM 5870  H HG2  . LYS B 1 21 ? 14.047  -12.618 -8.913  1.00 0.96  ? 21 LYS B HG2  3  
ATOM 5871  H HG3  . LYS B 1 21 ? 13.869  -13.436 -7.362  1.00 0.83  ? 21 LYS B HG3  3  
ATOM 5872  H HD2  . LYS B 1 21 ? 13.272  -14.737 -10.031 1.00 1.56  ? 21 LYS B HD2  3  
ATOM 5873  H HD3  . LYS B 1 21 ? 14.815  -14.884 -9.193  1.00 1.65  ? 21 LYS B HD3  3  
ATOM 5874  H HE2  . LYS B 1 21 ? 13.361  -15.661 -7.167  1.00 1.90  ? 21 LYS B HE2  3  
ATOM 5875  H HE3  . LYS B 1 21 ? 12.122  -15.955 -8.387  1.00 1.94  ? 21 LYS B HE3  3  
ATOM 5876  H HZ1  . LYS B 1 21 ? 14.880  -17.058 -8.458  1.00 2.59  ? 21 LYS B HZ1  3  
ATOM 5877  H HZ2  . LYS B 1 21 ? 13.498  -17.914 -7.964  1.00 2.41  ? 21 LYS B HZ2  3  
ATOM 5878  H HZ3  . LYS B 1 21 ? 13.636  -17.386 -9.570  1.00 2.61  ? 21 LYS B HZ3  3  
ATOM 5879  N N    . ASN B 1 22 ? 10.386  -11.871 -10.688 1.00 0.36  ? 22 ASN B N    3  
ATOM 5880  C CA   . ASN B 1 22 ? 10.004  -11.732 -12.107 1.00 0.36  ? 22 ASN B CA   3  
ATOM 5881  C C    . ASN B 1 22 ? 9.120   -10.492 -12.193 1.00 0.34  ? 22 ASN B C    3  
ATOM 5882  O O    . ASN B 1 22 ? 9.354   -9.585  -12.962 1.00 0.36  ? 22 ASN B O    3  
ATOM 5883  C CB   . ASN B 1 22 ? 9.177   -12.951 -12.534 1.00 0.36  ? 22 ASN B CB   3  
ATOM 5884  C CG   . ASN B 1 22 ? 9.679   -14.218 -11.834 1.00 0.38  ? 22 ASN B CG   3  
ATOM 5885  O OD1  . ASN B 1 22 ? 10.689  -14.778 -12.209 1.00 0.43  ? 22 ASN B OD1  3  
ATOM 5886  N ND2  . ASN B 1 22 ? 9.003   -14.697 -10.822 1.00 0.37  ? 22 ASN B ND2  3  
ATOM 5887  H H    . ASN B 1 22 ? 9.741   -12.267 -10.074 1.00 0.35  ? 22 ASN B H    3  
ATOM 5888  H HA   . ASN B 1 22 ? 10.877  -11.624 -12.733 1.00 0.39  ? 22 ASN B HA   3  
ATOM 5889  H HB2  . ASN B 1 22 ? 8.143   -12.788 -12.266 1.00 0.33  ? 22 ASN B HB2  3  
ATOM 5890  H HB3  . ASN B 1 22 ? 9.248   -13.073 -13.593 1.00 0.38  ? 22 ASN B HB3  3  
ATOM 5891  H HD21 . ASN B 1 22 ? 8.185   -14.245 -10.520 1.00 0.34  ? 22 ASN B HD21 3  
ATOM 5892  H HD22 . ASN B 1 22 ? 9.310   -15.505 -10.365 1.00 0.40  ? 22 ASN B HD22 3  
ATOM 5893  N N    . ILE B 1 23 ? 8.113   -10.468 -11.363 1.00 0.31  ? 23 ILE B N    3  
ATOM 5894  C CA   . ILE B 1 23 ? 7.163   -9.334  -11.297 1.00 0.30  ? 23 ILE B CA   3  
ATOM 5895  C C    . ILE B 1 23 ? 7.934   -8.005  -11.336 1.00 0.34  ? 23 ILE B C    3  
ATOM 5896  O O    . ILE B 1 23 ? 8.604   -7.631  -10.391 1.00 0.37  ? 23 ILE B O    3  
ATOM 5897  C CB   . ILE B 1 23 ? 6.402   -9.498  -9.979  1.00 0.29  ? 23 ILE B CB   3  
ATOM 5898  C CG1  . ILE B 1 23 ? 5.174   -10.383 -10.205 1.00 0.27  ? 23 ILE B CG1  3  
ATOM 5899  C CG2  . ILE B 1 23 ? 5.968   -8.148  -9.427  1.00 0.33  ? 23 ILE B CG2  3  
ATOM 5900  C CD1  . ILE B 1 23 ? 5.623   -11.826 -10.439 1.00 0.26  ? 23 ILE B CD1  3  
ATOM 5901  H H    . ILE B 1 23 ? 7.986   -11.216 -10.748 1.00 0.31  ? 23 ILE B H    3  
ATOM 5902  H HA   . ILE B 1 23 ? 6.471   -9.388  -12.131 1.00 0.29  ? 23 ILE B HA   3  
ATOM 5903  H HB   . ILE B 1 23 ? 7.055   -9.978  -9.265  1.00 0.31  ? 23 ILE B HB   3  
ATOM 5904  H HG12 . ILE B 1 23 ? 4.537   -10.340 -9.333  1.00 0.29  ? 23 ILE B HG12 3  
ATOM 5905  H HG13 . ILE B 1 23 ? 4.631   -10.032 -11.067 1.00 0.26  ? 23 ILE B HG13 3  
ATOM 5906  H HG21 . ILE B 1 23 ? 5.700   -7.498  -10.243 1.00 1.08  ? 23 ILE B HG21 3  
ATOM 5907  H HG22 . ILE B 1 23 ? 5.121   -8.286  -8.776  1.00 1.01  ? 23 ILE B HG22 3  
ATOM 5908  H HG23 . ILE B 1 23 ? 6.786   -7.716  -8.869  1.00 1.12  ? 23 ILE B HG23 3  
ATOM 5909  H HD11 . ILE B 1 23 ? 6.372   -12.094 -9.707  1.00 1.01  ? 23 ILE B HD11 3  
ATOM 5910  H HD12 . ILE B 1 23 ? 4.776   -12.488 -10.346 1.00 1.04  ? 23 ILE B HD12 3  
ATOM 5911  H HD13 . ILE B 1 23 ? 6.043   -11.914 -11.430 1.00 1.04  ? 23 ILE B HD13 3  
ATOM 5912  N N    . GLN B 1 24 ? 7.852   -7.307  -12.437 1.00 0.36  ? 24 GLN B N    3  
ATOM 5913  C CA   . GLN B 1 24 ? 8.565   -6.022  -12.592 1.00 0.42  ? 24 GLN B CA   3  
ATOM 5914  C C    . GLN B 1 24 ? 7.584   -4.848  -12.513 1.00 0.37  ? 24 GLN B C    3  
ATOM 5915  O O    . GLN B 1 24 ? 7.985   -3.725  -12.269 1.00 0.39  ? 24 GLN B O    3  
ATOM 5916  C CB   . GLN B 1 24 ? 9.224   -6.041  -13.964 1.00 0.48  ? 24 GLN B CB   3  
ATOM 5917  C CG   . GLN B 1 24 ? 10.725  -5.783  -13.835 1.00 0.57  ? 24 GLN B CG   3  
ATOM 5918  C CD   . GLN B 1 24 ? 11.045  -4.384  -14.366 1.00 1.16  ? 24 GLN B CD   3  
ATOM 5919  O OE1  . GLN B 1 24 ? 11.122  -3.437  -13.608 1.00 1.83  ? 24 GLN B OE1  3  
ATOM 5920  N NE2  . GLN B 1 24 ? 11.229  -4.210  -15.647 1.00 1.58  ? 24 GLN B NE2  3  
ATOM 5921  H H    . GLN B 1 24 ? 7.322   -7.637  -13.192 1.00 0.36  ? 24 GLN B H    3  
ATOM 5922  H HA   . GLN B 1 24 ? 9.325   -5.914  -11.826 1.00 0.46  ? 24 GLN B HA   3  
ATOM 5923  H HB2  . GLN B 1 24 ? 9.068   -7.012  -14.414 1.00 0.48  ? 24 GLN B HB2  3  
ATOM 5924  H HB3  . GLN B 1 24 ? 8.768   -5.294  -14.578 1.00 0.48  ? 24 GLN B HB3  3  
ATOM 5925  H HG2  . GLN B 1 24 ? 11.015  -5.852  -12.796 1.00 0.65  ? 24 GLN B HG2  3  
ATOM 5926  H HG3  . GLN B 1 24 ? 11.266  -6.518  -14.410 1.00 0.92  ? 24 GLN B HG3  3  
ATOM 5927  H HE21 . GLN B 1 24 ? 11.162  -4.973  -16.260 1.00 1.79  ? 24 GLN B HE21 3  
ATOM 5928  H HE22 . GLN B 1 24 ? 11.434  -3.318  -15.995 1.00 2.03  ? 24 GLN B HE22 3  
ATOM 5929  N N    . SER B 1 25 ? 6.307   -5.084  -12.727 1.00 0.33  ? 25 SER B N    3  
ATOM 5930  C CA   . SER B 1 25 ? 5.336   -3.955  -12.672 1.00 0.29  ? 25 SER B CA   3  
ATOM 5931  C C    . SER B 1 25 ? 3.905   -4.463  -12.523 1.00 0.27  ? 25 SER B C    3  
ATOM 5932  O O    . SER B 1 25 ? 3.651   -5.649  -12.495 1.00 0.29  ? 25 SER B O    3  
ATOM 5933  C CB   . SER B 1 25 ? 5.412   -3.153  -13.953 1.00 0.31  ? 25 SER B CB   3  
ATOM 5934  O OG   . SER B 1 25 ? 5.102   -3.985  -15.065 1.00 0.34  ? 25 SER B OG   3  
ATOM 5935  H H    . SER B 1 25 ? 5.992   -5.993  -12.929 1.00 0.33  ? 25 SER B H    3  
ATOM 5936  H HA   . SER B 1 25 ? 5.577   -3.309  -11.846 1.00 0.29  ? 25 SER B HA   3  
ATOM 5937  H HB2  . SER B 1 25 ? 4.695   -2.358  -13.892 1.00 0.31  ? 25 SER B HB2  3  
ATOM 5938  H HB3  . SER B 1 25 ? 6.402   -2.737  -14.060 1.00 0.30  ? 25 SER B HB3  3  
ATOM 5939  H HG   . SER B 1 25 ? 5.900   -4.456  -15.318 1.00 0.88  ? 25 SER B HG   3  
ATOM 5940  N N    . VAL B 1 26 ? 2.973   -3.549  -12.444 1.00 0.25  ? 26 VAL B N    3  
ATOM 5941  C CA   . VAL B 1 26 ? 1.538   -3.920  -12.325 1.00 0.24  ? 26 VAL B CA   3  
ATOM 5942  C C    . VAL B 1 26 ? 0.682   -2.774  -12.855 1.00 0.25  ? 26 VAL B C    3  
ATOM 5943  O O    . VAL B 1 26 ? 1.092   -1.625  -12.869 1.00 0.26  ? 26 VAL B O    3  
ATOM 5944  C CB   . VAL B 1 26 ? 1.147   -4.188  -10.865 1.00 0.23  ? 26 VAL B CB   3  
ATOM 5945  C CG1  . VAL B 1 26 ? 1.816   -3.182  -9.948  1.00 0.25  ? 26 VAL B CG1  3  
ATOM 5946  C CG2  . VAL B 1 26 ? -0.374  -4.073  -10.711 1.00 0.26  ? 26 VAL B CG2  3  
ATOM 5947  H H    . VAL B 1 26 ? 3.221   -2.604  -12.475 1.00 0.25  ? 26 VAL B H    3  
ATOM 5948  H HA   . VAL B 1 26 ? 1.356   -4.805  -12.912 1.00 0.24  ? 26 VAL B HA   3  
ATOM 5949  H HB   . VAL B 1 26 ? 1.460   -5.169  -10.589 1.00 0.25  ? 26 VAL B HB   3  
ATOM 5950  H HG11 . VAL B 1 26 ? 2.680   -2.771  -10.442 1.00 1.01  ? 26 VAL B HG11 3  
ATOM 5951  H HG12 . VAL B 1 26 ? 1.120   -2.394  -9.716  1.00 1.08  ? 26 VAL B HG12 3  
ATOM 5952  H HG13 . VAL B 1 26 ? 2.120   -3.679  -9.039  1.00 1.00  ? 26 VAL B HG13 3  
ATOM 5953  H HG21 . VAL B 1 26 ? -0.859  -4.722  -11.425 1.00 1.05  ? 26 VAL B HG21 3  
ATOM 5954  H HG22 . VAL B 1 26 ? -0.659  -4.357  -9.712  1.00 1.04  ? 26 VAL B HG22 3  
ATOM 5955  H HG23 . VAL B 1 26 ? -0.676  -3.050  -10.895 1.00 1.04  ? 26 VAL B HG23 3  
ATOM 5956  N N    . ASN B 1 27 ? -0.513  -3.083  -13.267 1.00 0.25  ? 27 ASN B N    3  
ATOM 5957  C CA   . ASN B 1 27 ? -1.421  -2.040  -13.773 1.00 0.27  ? 27 ASN B CA   3  
ATOM 5958  C C    . ASN B 1 27 ? -2.764  -2.132  -13.065 1.00 0.25  ? 27 ASN B C    3  
ATOM 5959  O O    . ASN B 1 27 ? -3.403  -3.168  -13.037 1.00 0.42  ? 27 ASN B O    3  
ATOM 5960  C CB   . ASN B 1 27 ? -1.631  -2.159  -15.273 1.00 0.30  ? 27 ASN B CB   3  
ATOM 5961  C CG   . ASN B 1 27 ? -0.817  -3.308  -15.887 1.00 0.57  ? 27 ASN B CG   3  
ATOM 5962  O OD1  . ASN B 1 27 ? 0.396   -3.336  -15.787 1.00 0.94  ? 27 ASN B OD1  3  
ATOM 5963  N ND2  . ASN B 1 27 ? -1.434  -4.250  -16.541 1.00 0.72  ? 27 ASN B ND2  3  
ATOM 5964  H H    . ASN B 1 27 ? -0.813  -4.009  -13.229 1.00 0.26  ? 27 ASN B H    3  
ATOM 5965  H HA   . ASN B 1 27 ? -0.993  -1.085  -13.561 1.00 0.30  ? 27 ASN B HA   3  
ATOM 5966  H HB2  . ASN B 1 27 ? -2.680  -2.309  -15.476 1.00 0.46  ? 27 ASN B HB2  3  
ATOM 5967  H HB3  . ASN B 1 27 ? -1.316  -1.244  -15.705 1.00 0.51  ? 27 ASN B HB3  3  
ATOM 5968  H HD21 . ASN B 1 27 ? -2.411  -4.226  -16.635 1.00 0.75  ? 27 ASN B HD21 3  
ATOM 5969  H HD22 . ASN B 1 27 ? -0.922  -4.979  -16.946 1.00 0.99  ? 27 ASN B HD22 3  
ATOM 5970  N N    . VAL B 1 28 ? -3.192  -1.040  -12.502 1.00 0.28  ? 28 VAL B N    3  
ATOM 5971  C CA   . VAL B 1 28 ? -4.499  -1.022  -11.789 1.00 0.29  ? 28 VAL B CA   3  
ATOM 5972  C C    . VAL B 1 28 ? -5.458  -0.082  -12.527 1.00 0.31  ? 28 VAL B C    3  
ATOM 5973  O O    . VAL B 1 28 ? -5.065  0.968   -12.996 1.00 0.33  ? 28 VAL B O    3  
ATOM 5974  C CB   . VAL B 1 28 ? -4.289  -0.554  -10.339 1.00 0.34  ? 28 VAL B CB   3  
ATOM 5975  C CG1  . VAL B 1 28 ? -3.820  0.899   -10.315 1.00 0.55  ? 28 VAL B CG1  3  
ATOM 5976  C CG2  . VAL B 1 28 ? -5.599  -0.675  -9.554  1.00 0.72  ? 28 VAL B CG2  3  
ATOM 5977  H H    . VAL B 1 28 ? -2.651  -0.223  -12.560 1.00 0.44  ? 28 VAL B H    3  
ATOM 5978  H HA   . VAL B 1 28 ? -4.908  -2.021  -11.790 1.00 0.28  ? 28 VAL B HA   3  
ATOM 5979  H HB   . VAL B 1 28 ? -3.536  -1.171  -9.878  1.00 0.31  ? 28 VAL B HB   3  
ATOM 5980  H HG11 . VAL B 1 28 ? -3.011  1.026   -11.019 1.00 1.22  ? 28 VAL B HG11 3  
ATOM 5981  H HG12 . VAL B 1 28 ? -4.640  1.547   -10.587 1.00 1.25  ? 28 VAL B HG12 3  
ATOM 5982  H HG13 . VAL B 1 28 ? -3.477  1.148   -9.323  1.00 1.09  ? 28 VAL B HG13 3  
ATOM 5983  H HG21 . VAL B 1 28 ? -6.428  -0.395  -10.187 1.00 1.29  ? 28 VAL B HG21 3  
ATOM 5984  H HG22 . VAL B 1 28 ? -5.727  -1.694  -9.223  1.00 1.29  ? 28 VAL B HG22 3  
ATOM 5985  H HG23 . VAL B 1 28 ? -5.565  -0.020  -8.695  1.00 1.29  ? 28 VAL B HG23 3  
ATOM 5986  N N    . LYS B 1 29 ? -6.710  -0.455  -12.632 1.00 0.35  ? 29 LYS B N    3  
ATOM 5987  C CA   . LYS B 1 29 ? -7.706  0.404   -13.346 1.00 0.42  ? 29 LYS B CA   3  
ATOM 5988  C C    . LYS B 1 29 ? -9.083  0.263   -12.692 1.00 0.37  ? 29 LYS B C    3  
ATOM 5989  O O    . LYS B 1 29 ? -9.278  -0.524  -11.779 1.00 0.35  ? 29 LYS B O    3  
ATOM 5990  C CB   . LYS B 1 29 ? -7.826  -0.015  -14.823 1.00 0.52  ? 29 LYS B CB   3  
ATOM 5991  C CG   . LYS B 1 29 ? -6.436  -0.215  -15.439 1.00 1.08  ? 29 LYS B CG   3  
ATOM 5992  C CD   . LYS B 1 29 ? -6.512  -0.119  -16.968 1.00 0.83  ? 29 LYS B CD   3  
ATOM 5993  C CE   . LYS B 1 29 ? -7.181  1.195   -17.403 1.00 0.77  ? 29 LYS B CE   3  
ATOM 5994  N NZ   . LYS B 1 29 ? -7.578  1.101   -18.837 1.00 1.23  ? 29 LYS B NZ   3  
ATOM 5995  H H    . LYS B 1 29 ? -6.996  -1.305  -12.238 1.00 0.35  ? 29 LYS B H    3  
ATOM 5996  H HA   . LYS B 1 29 ? -7.391  1.437   -13.294 1.00 0.52  ? 29 LYS B HA   3  
ATOM 5997  H HB2  . LYS B 1 29 ? -8.383  -0.936  -14.890 1.00 1.13  ? 29 LYS B HB2  3  
ATOM 5998  H HB3  . LYS B 1 29 ? -8.350  0.754   -15.363 1.00 0.82  ? 29 LYS B HB3  3  
ATOM 5999  H HG2  . LYS B 1 29 ? -5.765  0.537   -15.064 1.00 1.70  ? 29 LYS B HG2  3  
ATOM 6000  H HG3  . LYS B 1 29 ? -6.064  -1.191  -15.165 1.00 2.02  ? 29 LYS B HG3  3  
ATOM 6001  H HD2  . LYS B 1 29 ? -5.511  -0.154  -17.371 1.00 1.42  ? 29 LYS B HD2  3  
ATOM 6002  H HD3  . LYS B 1 29 ? -7.080  -0.951  -17.347 1.00 1.53  ? 29 LYS B HD3  3  
ATOM 6003  H HE2  . LYS B 1 29 ? -8.060  1.373   -16.804 1.00 1.30  ? 29 LYS B HE2  3  
ATOM 6004  H HE3  . LYS B 1 29 ? -6.489  2.011   -17.277 1.00 1.10  ? 29 LYS B HE3  3  
ATOM 6005  H HZ1  . LYS B 1 29 ? -6.749  0.852   -19.412 1.00 1.54  ? 29 LYS B HZ1  3  
ATOM 6006  H HZ2  . LYS B 1 29 ? -8.310  0.369   -18.947 1.00 1.71  ? 29 LYS B HZ2  3  
ATOM 6007  H HZ3  . LYS B 1 29 ? -7.953  2.017   -19.152 1.00 1.80  ? 29 LYS B HZ3  3  
ATOM 6008  N N    . SER B 1 30 ? -10.035 1.028   -13.172 1.00 0.39  ? 30 SER B N    3  
ATOM 6009  C CA   . SER B 1 30 ? -11.421 0.982   -12.619 1.00 0.39  ? 30 SER B CA   3  
ATOM 6010  C C    . SER B 1 30 ? -12.308 0.079   -13.512 1.00 0.34  ? 30 SER B C    3  
ATOM 6011  O O    . SER B 1 30 ? -11.858 -0.397  -14.538 1.00 0.35  ? 30 SER B O    3  
ATOM 6012  C CB   . SER B 1 30 ? -11.958 2.429   -12.585 1.00 0.52  ? 30 SER B CB   3  
ATOM 6013  O OG   . SER B 1 30 ? -12.929 2.620   -13.610 1.00 1.63  ? 30 SER B OG   3  
ATOM 6014  H H    . SER B 1 30 ? -9.834  1.643   -13.909 1.00 0.43  ? 30 SER B H    3  
ATOM 6015  H HA   . SER B 1 30 ? -11.393 0.582   -11.614 1.00 0.41  ? 30 SER B HA   3  
ATOM 6016  H HB2  . SER B 1 30 ? -12.411 2.626   -11.631 1.00 0.91  ? 30 SER B HB2  3  
ATOM 6017  H HB3  . SER B 1 30 ? -11.132 3.117   -12.733 1.00 0.92  ? 30 SER B HB3  3  
ATOM 6018  H HG   . SER B 1 30 ? -12.509 3.093   -14.332 1.00 2.13  ? 30 SER B HG   3  
ATOM 6019  N N    . PRO B 1 31 ? -13.548 -0.124  -13.097 1.00 0.39  ? 31 PRO B N    3  
ATOM 6020  C CA   . PRO B 1 31 ? -14.520 -0.959  -13.849 1.00 0.44  ? 31 PRO B CA   3  
ATOM 6021  C C    . PRO B 1 31 ? -15.042 -0.205  -15.084 1.00 0.52  ? 31 PRO B C    3  
ATOM 6022  O O    . PRO B 1 31 ? -14.602 0.893   -15.375 1.00 0.59  ? 31 PRO B O    3  
ATOM 6023  C CB   . PRO B 1 31 ? -15.640 -1.207  -12.832 1.00 0.52  ? 31 PRO B CB   3  
ATOM 6024  C CG   . PRO B 1 31 ? -15.538 -0.079  -11.781 1.00 0.56  ? 31 PRO B CG   3  
ATOM 6025  C CD   . PRO B 1 31 ? -14.096 0.456   -11.851 1.00 0.49  ? 31 PRO B CD   3  
ATOM 6026  H HA   . PRO B 1 31 ? -14.072 -1.895  -14.139 1.00 0.44  ? 31 PRO B HA   3  
ATOM 6027  H HB2  . PRO B 1 31 ? -16.602 -1.174  -13.325 1.00 0.58  ? 31 PRO B HB2  3  
ATOM 6028  H HB3  . PRO B 1 31 ? -15.500 -2.162  -12.352 1.00 0.55  ? 31 PRO B HB3  3  
ATOM 6029  H HG2  . PRO B 1 31 ? -16.241 0.710   -12.015 1.00 0.62  ? 31 PRO B HG2  3  
ATOM 6030  H HG3  . PRO B 1 31 ? -15.734 -0.471  -10.796 1.00 0.64  ? 31 PRO B HG3  3  
ATOM 6031  H HD2  . PRO B 1 31 ? -14.100 1.536   -11.901 1.00 0.54  ? 31 PRO B HD2  3  
ATOM 6032  H HD3  . PRO B 1 31 ? -13.528 0.118   -10.999 1.00 0.52  ? 31 PRO B HD3  3  
ATOM 6033  N N    . GLY B 1 32 ? -15.971 -0.779  -15.822 1.00 0.59  ? 32 GLY B N    3  
ATOM 6034  C CA   . GLY B 1 32 ? -16.488 -0.065  -17.033 1.00 0.72  ? 32 GLY B CA   3  
ATOM 6035  C C    . GLY B 1 32 ? -17.537 -0.912  -17.764 1.00 0.91  ? 32 GLY B C    3  
ATOM 6036  O O    . GLY B 1 32 ? -18.722 -0.721  -17.565 1.00 1.05  ? 32 GLY B O    3  
ATOM 6037  H H    . GLY B 1 32 ? -16.324 -1.670  -15.582 1.00 0.60  ? 32 GLY B H    3  
ATOM 6038  H HA2  . GLY B 1 32 ? -16.936 0.870   -16.729 1.00 0.72  ? 32 GLY B HA2  3  
ATOM 6039  H HA3  . GLY B 1 32 ? -15.666 0.138   -17.704 1.00 0.77  ? 32 GLY B HA3  3  
ATOM 6040  N N    . PRO B 1 33 ? -17.071 -1.814  -18.603 1.00 1.05  ? 33 PRO B N    3  
ATOM 6041  C CA   . PRO B 1 33 ? -17.956 -2.692  -19.399 1.00 1.30  ? 33 PRO B CA   3  
ATOM 6042  C C    . PRO B 1 33 ? -18.594 -3.781  -18.522 1.00 1.12  ? 33 PRO B C    3  
ATOM 6043  O O    . PRO B 1 33 ? -18.655 -3.657  -17.313 1.00 1.13  ? 33 PRO B O    3  
ATOM 6044  C CB   . PRO B 1 33 ? -17.014 -3.291  -20.452 1.00 1.62  ? 33 PRO B CB   3  
ATOM 6045  C CG   . PRO B 1 33 ? -15.584 -3.169  -19.883 1.00 1.55  ? 33 PRO B CG   3  
ATOM 6046  C CD   . PRO B 1 33 ? -15.625 -2.046  -18.833 1.00 1.17  ? 33 PRO B CD   3  
ATOM 6047  H HA   . PRO B 1 33 ? -18.721 -2.110  -19.885 1.00 1.48  ? 33 PRO B HA   3  
ATOM 6048  H HB2  . PRO B 1 33 ? -17.260 -4.330  -20.624 1.00 1.72  ? 33 PRO B HB2  3  
ATOM 6049  H HB3  . PRO B 1 33 ? -17.087 -2.734  -21.373 1.00 1.87  ? 33 PRO B HB3  3  
ATOM 6050  H HG2  . PRO B 1 33 ? -15.289 -4.102  -19.421 1.00 1.57  ? 33 PRO B HG2  3  
ATOM 6051  H HG3  . PRO B 1 33 ? -14.895 -2.906  -20.667 1.00 1.80  ? 33 PRO B HG3  3  
ATOM 6052  H HD2  . PRO B 1 33 ? -15.138 -2.368  -17.924 1.00 1.04  ? 33 PRO B HD2  3  
ATOM 6053  H HD3  . PRO B 1 33 ? -15.160 -1.152  -19.217 1.00 1.24  ? 33 PRO B HD3  3  
ATOM 6054  N N    . HIS B 1 34 ? -19.087 -4.837  -19.128 1.00 1.15  ? 34 HIS B N    3  
ATOM 6055  C CA   . HIS B 1 34 ? -19.744 -5.932  -18.338 1.00 1.18  ? 34 HIS B CA   3  
ATOM 6056  C C    . HIS B 1 34 ? -18.778 -6.532  -17.315 1.00 1.19  ? 34 HIS B C    3  
ATOM 6057  O O    . HIS B 1 34 ? -19.216 -7.067  -16.314 1.00 1.29  ? 34 HIS B O    3  
ATOM 6058  C CB   . HIS B 1 34 ? -20.270 -7.046  -19.266 1.00 1.36  ? 34 HIS B CB   3  
ATOM 6059  C CG   . HIS B 1 34 ? -19.327 -7.282  -20.423 1.00 1.55  ? 34 HIS B CG   3  
ATOM 6060  N ND1  . HIS B 1 34 ? -19.788 -7.433  -21.721 1.00 2.08  ? 34 HIS B ND1  3  
ATOM 6061  C CD2  . HIS B 1 34 ? -17.958 -7.393  -20.497 1.00 2.02  ? 34 HIS B CD2  3  
ATOM 6062  C CE1  . HIS B 1 34 ? -18.717 -7.624  -22.513 1.00 2.64  ? 34 HIS B CE1  3  
ATOM 6063  N NE2  . HIS B 1 34 ? -17.577 -7.607  -21.819 1.00 2.66  ? 34 HIS B NE2  3  
ATOM 6064  H H    . HIS B 1 34 ? -19.041 -4.900  -20.105 1.00 1.28  ? 34 HIS B H    3  
ATOM 6065  H HA   . HIS B 1 34 ? -20.576 -5.505  -17.790 1.00 1.14  ? 34 HIS B HA   3  
ATOM 6066  H HB2  . HIS B 1 34 ? -20.370 -7.960  -18.700 1.00 1.72  ? 34 HIS B HB2  3  
ATOM 6067  H HB3  . HIS B 1 34 ? -21.238 -6.759  -19.648 1.00 1.68  ? 34 HIS B HB3  3  
ATOM 6068  H HD1  . HIS B 1 34 ? -20.724 -7.408  -22.010 1.00 2.31  ? 34 HIS B HD1  3  
ATOM 6069  H HD2  . HIS B 1 34 ? -17.281 -7.332  -19.658 1.00 2.23  ? 34 HIS B HD2  3  
ATOM 6070  H HE1  . HIS B 1 34 ? -18.773 -7.770  -23.581 1.00 3.25  ? 34 HIS B HE1  3  
ATOM 6071  N N    . CYS B 1 35 ? -17.483 -6.414  -17.504 1.00 1.22  ? 35 CYS B N    3  
ATOM 6072  C CA   . CYS B 1 35 ? -16.567 -6.949  -16.462 1.00 1.29  ? 35 CYS B CA   3  
ATOM 6073  C C    . CYS B 1 35 ? -16.863 -6.141  -15.203 1.00 1.07  ? 35 CYS B C    3  
ATOM 6074  O O    . CYS B 1 35 ? -17.018 -6.682  -14.123 1.00 1.13  ? 35 CYS B O    3  
ATOM 6075  C CB   . CYS B 1 35 ? -15.103 -6.779  -16.878 1.00 1.59  ? 35 CYS B CB   3  
ATOM 6076  S SG   . CYS B 1 35 ? -14.041 -7.065  -15.437 1.00 2.40  ? 35 CYS B SG   3  
ATOM 6077  H H    . CYS B 1 35 ? -17.127 -5.942  -18.284 1.00 1.28  ? 35 CYS B H    3  
ATOM 6078  H HA   . CYS B 1 35 ? -16.786 -7.991  -16.286 1.00 1.39  ? 35 CYS B HA   3  
ATOM 6079  H HB2  . CYS B 1 35 ? -14.863 -7.496  -17.650 1.00 1.86  ? 35 CYS B HB2  3  
ATOM 6080  H HB3  . CYS B 1 35 ? -14.944 -5.780  -17.251 1.00 1.86  ? 35 CYS B HB3  3  
ATOM 6081  N N    . ALA B 1 36 ? -17.014 -4.841  -15.376 1.00 0.96  ? 36 ALA B N    3  
ATOM 6082  C CA   . ALA B 1 36 ? -17.380 -3.933  -14.254 1.00 0.90  ? 36 ALA B CA   3  
ATOM 6083  C C    . ALA B 1 36 ? -16.594 -4.274  -12.986 1.00 0.86  ? 36 ALA B C    3  
ATOM 6084  O O    . ALA B 1 36 ? -17.102 -4.225  -11.881 1.00 1.18  ? 36 ALA B O    3  
ATOM 6085  C CB   . ALA B 1 36 ? -18.874 -4.076  -14.030 1.00 1.09  ? 36 ALA B CB   3  
ATOM 6086  H H    . ALA B 1 36 ? -16.931 -4.466  -16.275 1.00 1.03  ? 36 ALA B H    3  
ATOM 6087  H HA   . ALA B 1 36 ? -17.164 -2.915  -14.539 1.00 0.98  ? 36 ALA B HA   3  
ATOM 6088  H HB1  . ALA B 1 36 ? -19.164 -5.097  -14.232 1.00 1.38  ? 36 ALA B HB1  3  
ATOM 6089  H HB2  . ALA B 1 36 ? -19.113 -3.822  -13.015 1.00 1.61  ? 36 ALA B HB2  3  
ATOM 6090  H HB3  . ALA B 1 36 ? -19.395 -3.414  -14.708 1.00 1.51  ? 36 ALA B HB3  3  
ATOM 6091  N N    . GLN B 1 37 ? -15.350 -4.600  -13.159 1.00 0.93  ? 37 GLN B N    3  
ATOM 6092  C CA   . GLN B 1 37 ? -14.469 -4.938  -12.006 1.00 0.88  ? 37 GLN B CA   3  
ATOM 6093  C C    . GLN B 1 37 ? -13.232 -4.051  -12.073 1.00 0.71  ? 37 GLN B C    3  
ATOM 6094  O O    . GLN B 1 37 ? -12.960 -3.420  -13.079 1.00 0.74  ? 37 GLN B O    3  
ATOM 6095  C CB   . GLN B 1 37 ? -14.061 -6.416  -12.094 1.00 0.99  ? 37 GLN B CB   3  
ATOM 6096  C CG   . GLN B 1 37 ? -13.137 -6.823  -10.936 1.00 1.66  ? 37 GLN B CG   3  
ATOM 6097  C CD   . GLN B 1 37 ? -13.890 -6.733  -9.602  1.00 2.34  ? 37 GLN B CD   3  
ATOM 6098  O OE1  . GLN B 1 37 ? -15.085 -6.948  -9.545  1.00 2.83  ? 37 GLN B OE1  3  
ATOM 6099  N NE2  . GLN B 1 37 ? -13.233 -6.427  -8.514  1.00 3.07  ? 37 GLN B NE2  3  
ATOM 6100  H H    . GLN B 1 37 ? -14.988 -4.614  -14.064 1.00 1.26  ? 37 GLN B H    3  
ATOM 6101  H HA   . GLN B 1 37 ? -14.994 -4.759  -11.079 1.00 0.95  ? 37 GLN B HA   3  
ATOM 6102  H HB2  . GLN B 1 37 ? -14.944 -7.016  -12.054 1.00 1.38  ? 37 GLN B HB2  3  
ATOM 6103  H HB3  . GLN B 1 37 ? -13.552 -6.586  -13.028 1.00 1.44  ? 37 GLN B HB3  3  
ATOM 6104  H HG2  . GLN B 1 37 ? -12.805 -7.839  -11.089 1.00 2.21  ? 37 GLN B HG2  3  
ATOM 6105  H HG3  . GLN B 1 37 ? -12.280 -6.170  -10.910 1.00 2.02  ? 37 GLN B HG3  3  
ATOM 6106  H HE21 . GLN B 1 37 ? -12.268 -6.257  -8.555  1.00 3.26  ? 37 GLN B HE21 3  
ATOM 6107  H HE22 . GLN B 1 37 ? -13.705 -6.366  -7.658  1.00 3.72  ? 37 GLN B HE22 3  
ATOM 6108  N N    . THR B 1 38 ? -12.487 -4.004  -11.014 1.00 0.60  ? 38 THR B N    3  
ATOM 6109  C CA   . THR B 1 38 ? -11.256 -3.168  -10.990 1.00 0.44  ? 38 THR B CA   3  
ATOM 6110  C C    . THR B 1 38 ? -10.224 -3.728  -11.978 1.00 0.35  ? 38 THR B C    3  
ATOM 6111  O O    . THR B 1 38 ? -10.541 -4.490  -12.874 1.00 0.42  ? 38 THR B O    3  
ATOM 6112  C CB   . THR B 1 38 ? -10.648 -3.169  -9.577  1.00 0.44  ? 38 THR B CB   3  
ATOM 6113  O OG1  . THR B 1 38 ? -11.566 -3.726  -8.644  1.00 0.60  ? 38 THR B OG1  3  
ATOM 6114  C CG2  . THR B 1 38 ? -10.326 -1.739  -9.183  1.00 0.44  ? 38 THR B CG2  3  
ATOM 6115  H H    . THR B 1 38 ? -12.738 -4.526  -10.227 1.00 0.68  ? 38 THR B H    3  
ATOM 6116  H HA   . THR B 1 38 ? -11.506 -2.155  -11.270 1.00 0.44  ? 38 THR B HA   3  
ATOM 6117  H HB   . THR B 1 38 ? -9.732  -3.747  -9.575  1.00 0.40  ? 38 THR B HB   3  
ATOM 6118  H HG1  . THR B 1 38 ? -11.064 -4.214  -7.987  1.00 1.03  ? 38 THR B HG1  3  
ATOM 6119  H HG21 . THR B 1 38 ? -10.958 -1.065  -9.740  1.00 1.11  ? 38 THR B HG21 3  
ATOM 6120  H HG22 . THR B 1 38 ? -10.500 -1.611  -8.127  1.00 1.08  ? 38 THR B HG22 3  
ATOM 6121  H HG23 . THR B 1 38 ? -9.291  -1.532  -9.409  1.00 1.06  ? 38 THR B HG23 3  
ATOM 6122  N N    . GLU B 1 39 ? -8.983  -3.383  -11.788 1.00 0.25  ? 39 GLU B N    3  
ATOM 6123  C CA   . GLU B 1 39 ? -7.908  -3.900  -12.657 1.00 0.25  ? 39 GLU B CA   3  
ATOM 6124  C C    . GLU B 1 39 ? -6.689  -3.988  -11.793 1.00 0.21  ? 39 GLU B C    3  
ATOM 6125  O O    . GLU B 1 39 ? -6.425  -3.104  -11.004 1.00 0.35  ? 39 GLU B O    3  
ATOM 6126  C CB   . GLU B 1 39 ? -7.590  -2.956  -13.799 1.00 0.33  ? 39 GLU B CB   3  
ATOM 6127  C CG   . GLU B 1 39 ? -7.816  -3.655  -15.142 1.00 0.60  ? 39 GLU B CG   3  
ATOM 6128  C CD   . GLU B 1 39 ? -6.600  -4.520  -15.483 1.00 0.80  ? 39 GLU B CD   3  
ATOM 6129  O OE1  . GLU B 1 39 ? -5.626  -3.975  -15.976 1.00 1.40  ? 39 GLU B OE1  3  
ATOM 6130  O OE2  . GLU B 1 39 ? -6.665  -5.715  -15.244 1.00 1.47  ? 39 GLU B OE2  3  
ATOM 6131  H H    . GLU B 1 39 ? -8.744  -2.803  -11.035 1.00 0.25  ? 39 GLU B H    3  
ATOM 6132  H HA   . GLU B 1 39 ? -8.174  -4.873  -13.031 1.00 0.31  ? 39 GLU B HA   3  
ATOM 6133  H HB2  . GLU B 1 39 ? -8.221  -2.084  -13.730 1.00 0.30  ? 39 GLU B HB2  3  
ATOM 6134  H HB3  . GLU B 1 39 ? -6.544  -2.664  -13.712 1.00 0.41  ? 39 GLU B HB3  3  
ATOM 6135  H HG2  . GLU B 1 39 ? -8.698  -4.276  -15.079 1.00 0.87  ? 39 GLU B HG2  3  
ATOM 6136  H HG3  . GLU B 1 39 ? -7.954  -2.912  -15.914 1.00 0.84  ? 39 GLU B HG3  3  
ATOM 6137  N N    . VAL B 1 40 ? -5.975  -5.046  -11.886 1.00 0.15  ? 40 VAL B N    3  
ATOM 6138  C CA   . VAL B 1 40 ? -4.811  -5.195  -11.022 1.00 0.19  ? 40 VAL B CA   3  
ATOM 6139  C C    . VAL B 1 40 ? -3.889  -6.233  -11.655 1.00 0.19  ? 40 VAL B C    3  
ATOM 6140  O O    . VAL B 1 40 ? -3.786  -7.351  -11.191 1.00 0.22  ? 40 VAL B O    3  
ATOM 6141  C CB   . VAL B 1 40 ? -5.341  -5.664  -9.664  1.00 0.24  ? 40 VAL B CB   3  
ATOM 6142  C CG1  . VAL B 1 40 ? -5.641  -4.441  -8.808  1.00 0.28  ? 40 VAL B CG1  3  
ATOM 6143  C CG2  . VAL B 1 40 ? -6.660  -6.434  -9.865  1.00 0.24  ? 40 VAL B CG2  3  
ATOM 6144  H H    . VAL B 1 40 ? -6.225  -5.762  -12.484 1.00 0.22  ? 40 VAL B H    3  
ATOM 6145  H HA   . VAL B 1 40 ? -4.316  -4.237  -10.934 1.00 0.23  ? 40 VAL B HA   3  
ATOM 6146  H HB   . VAL B 1 40 ? -4.618  -6.301  -9.183  1.00 0.29  ? 40 VAL B HB   3  
ATOM 6147  H HG11 . VAL B 1 40 ? -5.053  -3.606  -9.158  1.00 1.04  ? 40 VAL B HG11 3  
ATOM 6148  H HG12 . VAL B 1 40 ? -6.693  -4.197  -8.901  1.00 1.02  ? 40 VAL B HG12 3  
ATOM 6149  H HG13 . VAL B 1 40 ? -5.407  -4.650  -7.782  1.00 0.98  ? 40 VAL B HG13 3  
ATOM 6150  H HG21 . VAL B 1 40 ? -6.534  -7.166  -10.647 1.00 1.00  ? 40 VAL B HG21 3  
ATOM 6151  H HG22 . VAL B 1 40 ? -6.939  -6.923  -8.949  1.00 1.08  ? 40 VAL B HG22 3  
ATOM 6152  H HG23 . VAL B 1 40 ? -7.439  -5.737  -10.150 1.00 0.98  ? 40 VAL B HG23 3  
ATOM 6153  N N    . ILE B 1 41 ? -3.270  -5.881  -12.751 1.00 0.22  ? 41 ILE B N    3  
ATOM 6154  C CA   . ILE B 1 41 ? -2.416  -6.854  -13.466 1.00 0.25  ? 41 ILE B CA   3  
ATOM 6155  C C    . ILE B 1 41 ? -0.932  -6.606  -13.209 1.00 0.23  ? 41 ILE B C    3  
ATOM 6156  O O    . ILE B 1 41 ? -0.407  -5.576  -13.549 1.00 0.25  ? 41 ILE B O    3  
ATOM 6157  C CB   . ILE B 1 41 ? -2.717  -6.724  -14.954 1.00 0.30  ? 41 ILE B CB   3  
ATOM 6158  C CG1  . ILE B 1 41 ? -3.898  -7.646  -15.291 1.00 0.50  ? 41 ILE B CG1  3  
ATOM 6159  C CG2  . ILE B 1 41 ? -1.487  -7.119  -15.771 1.00 0.67  ? 41 ILE B CG2  3  
ATOM 6160  C CD1  . ILE B 1 41 ? -3.827  -8.100  -16.752 1.00 0.54  ? 41 ILE B CD1  3  
ATOM 6161  H H    . ILE B 1 41 ? -3.404  -4.988  -13.130 1.00 0.27  ? 41 ILE B H    3  
ATOM 6162  H HA   . ILE B 1 41 ? -2.676  -7.842  -13.148 1.00 0.26  ? 41 ILE B HA   3  
ATOM 6163  H HB   . ILE B 1 41 ? -2.978  -5.693  -15.170 1.00 0.48  ? 41 ILE B HB   3  
ATOM 6164  H HG12 . ILE B 1 41 ? -3.864  -8.514  -14.647 1.00 0.70  ? 41 ILE B HG12 3  
ATOM 6165  H HG13 . ILE B 1 41 ? -4.817  -7.117  -15.122 1.00 0.68  ? 41 ILE B HG13 3  
ATOM 6166  H HG21 . ILE B 1 41 ? -1.193  -8.123  -15.508 1.00 1.41  ? 41 ILE B HG21 3  
ATOM 6167  H HG22 . ILE B 1 41 ? -1.725  -7.072  -16.821 1.00 1.13  ? 41 ILE B HG22 3  
ATOM 6168  H HG23 . ILE B 1 41 ? -0.680  -6.436  -15.553 1.00 1.24  ? 41 ILE B HG23 3  
ATOM 6169  H HD11 . ILE B 1 41 ? -3.734  -7.240  -17.394 1.00 1.15  ? 41 ILE B HD11 3  
ATOM 6170  H HD12 . ILE B 1 41 ? -2.967  -8.743  -16.883 1.00 1.12  ? 41 ILE B HD12 3  
ATOM 6171  H HD13 . ILE B 1 41 ? -4.723  -8.646  -17.003 1.00 1.11  ? 41 ILE B HD13 3  
ATOM 6172  N N    . ALA B 1 42 ? -0.245  -7.570  -12.657 1.00 0.22  ? 42 ALA B N    3  
ATOM 6173  C CA   . ALA B 1 42 ? 1.214   -7.414  -12.420 1.00 0.22  ? 42 ALA B CA   3  
ATOM 6174  C C    . ALA B 1 42 ? 1.968   -7.930  -13.638 1.00 0.24  ? 42 ALA B C    3  
ATOM 6175  O O    . ALA B 1 42 ? 1.957   -9.113  -13.925 1.00 0.25  ? 42 ALA B O    3  
ATOM 6176  C CB   . ALA B 1 42 ? 1.606   -8.214  -11.191 1.00 0.21  ? 42 ALA B CB   3  
ATOM 6177  H H    . ALA B 1 42 ? -0.686  -8.420  -12.426 1.00 0.23  ? 42 ALA B H    3  
ATOM 6178  H HA   . ALA B 1 42 ? 1.456   -6.381  -12.266 1.00 0.23  ? 42 ALA B HA   3  
ATOM 6179  H HB1  . ALA B 1 42 ? 1.035   -7.864  -10.345 1.00 1.01  ? 42 ALA B HB1  3  
ATOM 6180  H HB2  . ALA B 1 42 ? 1.396   -9.257  -11.365 1.00 1.02  ? 42 ALA B HB2  3  
ATOM 6181  H HB3  . ALA B 1 42 ? 2.658   -8.079  -11.000 1.00 1.07  ? 42 ALA B HB3  3  
ATOM 6182  N N    . THR B 1 43 ? 2.624   -7.057  -14.363 1.00 0.28  ? 43 THR B N    3  
ATOM 6183  C CA   . THR B 1 43 ? 3.372   -7.517  -15.559 1.00 0.32  ? 43 THR B CA   3  
ATOM 6184  C C    . THR B 1 43 ? 4.622   -8.256  -15.102 1.00 0.32  ? 43 THR B C    3  
ATOM 6185  O O    . THR B 1 43 ? 5.400   -7.767  -14.302 1.00 0.33  ? 43 THR B O    3  
ATOM 6186  C CB   . THR B 1 43 ? 3.784   -6.344  -16.454 1.00 0.35  ? 43 THR B CB   3  
ATOM 6187  O OG1  . THR B 1 43 ? 2.780   -5.338  -16.432 1.00 0.39  ? 43 THR B OG1  3  
ATOM 6188  C CG2  . THR B 1 43 ? 3.977   -6.848  -17.883 1.00 0.39  ? 43 THR B CG2  3  
ATOM 6189  H H    . THR B 1 43 ? 2.628   -6.108  -14.114 1.00 0.28  ? 43 THR B H    3  
ATOM 6190  H HA   . THR B 1 43 ? 2.739   -8.196  -16.116 1.00 0.33  ? 43 THR B HA   3  
ATOM 6191  H HB   . THR B 1 43 ? 4.719   -5.939  -16.104 1.00 0.35  ? 43 THR B HB   3  
ATOM 6192  H HG1  . THR B 1 43 ? 3.215   -4.483  -16.452 1.00 0.89  ? 43 THR B HG1  3  
ATOM 6193  H HG21 . THR B 1 43 ? 4.692   -7.660  -17.883 1.00 1.07  ? 43 THR B HG21 3  
ATOM 6194  H HG22 . THR B 1 43 ? 3.034   -7.201  -18.272 1.00 1.06  ? 43 THR B HG22 3  
ATOM 6195  H HG23 . THR B 1 43 ? 4.347   -6.044  -18.502 1.00 1.06  ? 43 THR B HG23 3  
ATOM 6196  N N    . LEU B 1 44 ? 4.794   -9.441  -15.595 1.00 0.32  ? 44 LEU B N    3  
ATOM 6197  C CA   . LEU B 1 44 ? 5.951   -10.271 -15.211 1.00 0.32  ? 44 LEU B CA   3  
ATOM 6198  C C    . LEU B 1 44 ? 7.228   -9.798  -15.918 1.00 0.37  ? 44 LEU B C    3  
ATOM 6199  O O    . LEU B 1 44 ? 7.169   -9.170  -16.962 1.00 0.40  ? 44 LEU B O    3  
ATOM 6200  C CB   . LEU B 1 44 ? 5.643   -11.687 -15.653 1.00 0.34  ? 44 LEU B CB   3  
ATOM 6201  C CG   . LEU B 1 44 ? 5.038   -12.481 -14.506 1.00 0.33  ? 44 LEU B CG   3  
ATOM 6202  C CD1  . LEU B 1 44 ? 6.182   -13.161 -13.765 1.00 0.35  ? 44 LEU B CD1  3  
ATOM 6203  C CD2  . LEU B 1 44 ? 4.236   -11.557 -13.556 1.00 0.29  ? 44 LEU B CD2  3  
ATOM 6204  H H    . LEU B 1 44 ? 4.132   -9.806  -16.216 1.00 0.33  ? 44 LEU B H    3  
ATOM 6205  H HA   . LEU B 1 44 ? 6.074   -10.237 -14.134 1.00 0.30  ? 44 LEU B HA   3  
ATOM 6206  H HB2  . LEU B 1 44 ? 4.943   -11.654 -16.468 1.00 0.37  ? 44 LEU B HB2  3  
ATOM 6207  H HB3  . LEU B 1 44 ? 6.556   -12.164 -15.982 1.00 0.37  ? 44 LEU B HB3  3  
ATOM 6208  H HG   . LEU B 1 44 ? 4.383   -13.231 -14.916 1.00 0.35  ? 44 LEU B HG   3  
ATOM 6209  H HD11 . LEU B 1 44 ? 6.995   -12.458 -13.647 1.00 1.02  ? 44 LEU B HD11 3  
ATOM 6210  H HD12 . LEU B 1 44 ? 5.845   -13.494 -12.800 1.00 1.19  ? 44 LEU B HD12 3  
ATOM 6211  H HD13 . LEU B 1 44 ? 6.527   -14.008 -14.344 1.00 1.02  ? 44 LEU B HD13 3  
ATOM 6212  H HD21 . LEU B 1 44 ? 3.527   -10.973 -14.131 1.00 1.02  ? 44 LEU B HD21 3  
ATOM 6213  H HD22 . LEU B 1 44 ? 3.698   -12.153 -12.834 1.00 1.02  ? 44 LEU B HD22 3  
ATOM 6214  H HD23 . LEU B 1 44 ? 4.908   -10.889 -13.037 1.00 1.04  ? 44 LEU B HD23 3  
ATOM 6215  N N    . LYS B 1 45 ? 8.376   -10.150 -15.365 1.00 0.38  ? 45 LYS B N    3  
ATOM 6216  C CA   . LYS B 1 45 ? 9.692   -9.786  -15.958 1.00 0.44  ? 45 LYS B CA   3  
ATOM 6217  C C    . LYS B 1 45 ? 9.795   -10.300 -17.384 1.00 0.49  ? 45 LYS B C    3  
ATOM 6218  O O    . LYS B 1 45 ? 10.312  -9.630  -18.259 1.00 0.54  ? 45 LYS B O    3  
ATOM 6219  C CB   . LYS B 1 45 ? 10.776  -10.448 -15.122 1.00 0.45  ? 45 LYS B CB   3  
ATOM 6220  C CG   . LYS B 1 45 ? 11.772  -9.401  -14.616 1.00 0.47  ? 45 LYS B CG   3  
ATOM 6221  C CD   . LYS B 1 45 ? 13.199  -9.918  -14.803 1.00 0.72  ? 45 LYS B CD   3  
ATOM 6222  C CE   . LYS B 1 45 ? 14.175  -8.980  -14.086 1.00 1.05  ? 45 LYS B CE   3  
ATOM 6223  N NZ   . LYS B 1 45 ? 15.564  -9.232  -14.572 1.00 1.42  ? 45 LYS B NZ   3  
ATOM 6224  H H    . LYS B 1 45 ? 8.376   -10.696 -14.558 1.00 0.37  ? 45 LYS B H    3  
ATOM 6225  H HA   . LYS B 1 45 ? 9.823   -8.718  -15.941 1.00 0.45  ? 45 LYS B HA   3  
ATOM 6226  H HB2  . LYS B 1 45 ? 10.318  -10.940 -14.279 1.00 0.41  ? 45 LYS B HB2  3  
ATOM 6227  H HB3  . LYS B 1 45 ? 11.269  -11.179 -15.716 1.00 0.49  ? 45 LYS B HB3  3  
ATOM 6228  H HG2  . LYS B 1 45 ? 11.644  -8.484  -15.173 1.00 0.52  ? 45 LYS B HG2  3  
ATOM 6229  H HG3  . LYS B 1 45 ? 11.594  -9.213  -13.568 1.00 0.54  ? 45 LYS B HG3  3  
ATOM 6230  H HD2  . LYS B 1 45 ? 13.280  -10.912 -14.385 1.00 0.99  ? 45 LYS B HD2  3  
ATOM 6231  H HD3  . LYS B 1 45 ? 13.438  -9.947  -15.855 1.00 0.93  ? 45 LYS B HD3  3  
ATOM 6232  H HE2  . LYS B 1 45 ? 13.905  -7.956  -14.293 1.00 1.47  ? 45 LYS B HE2  3  
ATOM 6233  H HE3  . LYS B 1 45 ? 14.129  -9.158  -13.023 1.00 1.41  ? 45 LYS B HE3  3  
ATOM 6234  H HZ1  . LYS B 1 45 ? 15.597  -9.118  -15.605 1.00 1.87  ? 45 LYS B HZ1  3  
ATOM 6235  H HZ2  . LYS B 1 45 ? 16.213  -8.552  -14.127 1.00 1.73  ? 45 LYS B HZ2  3  
ATOM 6236  H HZ3  . LYS B 1 45 ? 15.850  -10.200 -14.322 1.00 1.95  ? 45 LYS B HZ3  3  
ATOM 6237  N N    . ASN B 1 46 ? 9.289   -11.481 -17.627 1.00 0.49  ? 46 ASN B N    3  
ATOM 6238  C CA   . ASN B 1 46 ? 9.339   -12.038 -19.017 1.00 0.55  ? 46 ASN B CA   3  
ATOM 6239  C C    . ASN B 1 46 ? 8.334   -11.282 -19.917 1.00 0.58  ? 46 ASN B C    3  
ATOM 6240  O O    . ASN B 1 46 ? 8.143   -11.630 -21.067 1.00 0.75  ? 46 ASN B O    3  
ATOM 6241  C CB   . ASN B 1 46 ? 9.014   -13.547 -19.016 1.00 0.58  ? 46 ASN B CB   3  
ATOM 6242  C CG   . ASN B 1 46 ? 8.124   -13.919 -17.825 1.00 0.78  ? 46 ASN B CG   3  
ATOM 6243  O OD1  . ASN B 1 46 ? 8.603   -14.085 -16.720 1.00 1.67  ? 46 ASN B OD1  3  
ATOM 6244  N ND2  . ASN B 1 46 ? 6.843   -14.061 -18.005 1.00 0.81  ? 46 ASN B ND2  3  
ATOM 6245  H H    . ASN B 1 46 ? 8.865   -11.990 -16.894 1.00 0.47  ? 46 ASN B H    3  
ATOM 6246  H HA   . ASN B 1 46 ? 10.333  -11.894 -19.413 1.00 0.62  ? 46 ASN B HA   3  
ATOM 6247  H HB2  . ASN B 1 46 ? 8.504   -13.799 -19.930 1.00 0.73  ? 46 ASN B HB2  3  
ATOM 6248  H HB3  . ASN B 1 46 ? 9.937   -14.107 -18.959 1.00 0.75  ? 46 ASN B HB3  3  
ATOM 6249  H HD21 . ASN B 1 46 ? 6.456   -13.930 -18.895 1.00 1.39  ? 46 ASN B HD21 3  
ATOM 6250  H HD22 . ASN B 1 46 ? 6.267   -14.299 -17.250 1.00 0.88  ? 46 ASN B HD22 3  
ATOM 6251  N N    . GLY B 1 47 ? 7.694   -10.253 -19.396 1.00 0.50  ? 47 GLY B N    3  
ATOM 6252  C CA   . GLY B 1 47 ? 6.708   -9.471  -20.195 1.00 0.53  ? 47 GLY B CA   3  
ATOM 6253  C C    . GLY B 1 47 ? 5.369   -10.196 -20.172 1.00 0.52  ? 47 GLY B C    3  
ATOM 6254  O O    . GLY B 1 47 ? 4.642   -10.213 -21.147 1.00 0.60  ? 47 GLY B O    3  
ATOM 6255  H H    . GLY B 1 47 ? 7.856   -9.996  -18.470 1.00 0.52  ? 47 GLY B H    3  
ATOM 6256  H HA2  . GLY B 1 47 ? 6.591   -8.487  -19.753 1.00 0.53  ? 47 GLY B HA2  3  
ATOM 6257  H HA3  . GLY B 1 47 ? 7.050   -9.373  -21.210 1.00 0.59  ? 47 GLY B HA3  3  
ATOM 6258  N N    . ARG B 1 48 ? 5.036   -10.779 -19.048 1.00 0.47  ? 48 ARG B N    3  
ATOM 6259  C CA   . ARG B 1 48 ? 3.730   -11.495 -18.925 1.00 0.54  ? 48 ARG B CA   3  
ATOM 6260  C C    . ARG B 1 48 ? 2.839   -10.673 -18.006 1.00 0.43  ? 48 ARG B C    3  
ATOM 6261  O O    . ARG B 1 48 ? 3.161   -9.552  -17.679 1.00 0.37  ? 48 ARG B O    3  
ATOM 6262  C CB   . ARG B 1 48 ? 3.953   -12.883 -18.313 1.00 0.66  ? 48 ARG B CB   3  
ATOM 6263  C CG   . ARG B 1 48 ? 3.855   -13.954 -19.402 1.00 1.00  ? 48 ARG B CG   3  
ATOM 6264  C CD   . ARG B 1 48 ? 4.009   -15.341 -18.768 1.00 1.55  ? 48 ARG B CD   3  
ATOM 6265  N NE   . ARG B 1 48 ? 3.084   -16.307 -19.437 1.00 2.08  ? 48 ARG B NE   3  
ATOM 6266  C CZ   . ARG B 1 48 ? 3.073   -17.565 -19.073 1.00 2.34  ? 48 ARG B CZ   3  
ATOM 6267  N NH1  . ARG B 1 48 ? 2.713   -17.891 -17.858 1.00 2.67  ? 48 ARG B NH1  3  
ATOM 6268  N NH2  . ARG B 1 48 ? 3.416   -18.495 -19.927 1.00 2.89  ? 48 ARG B NH2  3  
ATOM 6269  H H    . ARG B 1 48 ? 5.643   -10.725 -18.270 1.00 0.43  ? 48 ARG B H    3  
ATOM 6270  H HA   . ARG B 1 48 ? 3.263   -11.590 -19.894 1.00 0.68  ? 48 ARG B HA   3  
ATOM 6271  H HB2  . ARG B 1 48 ? 4.927   -12.920 -17.857 1.00 1.19  ? 48 ARG B HB2  3  
ATOM 6272  H HB3  . ARG B 1 48 ? 3.198   -13.070 -17.563 1.00 1.23  ? 48 ARG B HB3  3  
ATOM 6273  H HG2  . ARG B 1 48 ? 2.896   -13.882 -19.891 1.00 1.43  ? 48 ARG B HG2  3  
ATOM 6274  H HG3  . ARG B 1 48 ? 4.642   -13.802 -20.126 1.00 1.63  ? 48 ARG B HG3  3  
ATOM 6275  H HD2  . ARG B 1 48 ? 5.028   -15.679 -18.883 1.00 1.85  ? 48 ARG B HD2  3  
ATOM 6276  H HD3  . ARG B 1 48 ? 3.768   -15.284 -17.715 1.00 1.85  ? 48 ARG B HD3  3  
ATOM 6277  H HE   . ARG B 1 48 ? 2.484   -15.998 -20.146 1.00 2.46  ? 48 ARG B HE   3  
ATOM 6278  H HH11 . ARG B 1 48 ? 2.447   -17.181 -17.206 1.00 2.93  ? 48 ARG B HH11 3  
ATOM 6279  H HH12 . ARG B 1 48 ? 2.703   -18.852 -17.579 1.00 3.04  ? 48 ARG B HH12 3  
ATOM 6280  H HH21 . ARG B 1 48 ? 3.687   -18.246 -20.858 1.00 3.28  ? 48 ARG B HH21 3  
ATOM 6281  H HH22 . ARG B 1 48 ? 3.406   -19.457 -19.652 1.00 3.24  ? 48 ARG B HH22 3  
ATOM 6282  N N    . LYS B 1 49 ? 1.729   -11.200 -17.578 1.00 0.45  ? 49 LYS B N    3  
ATOM 6283  C CA   . LYS B 1 49 ? 0.862   -10.415 -16.668 1.00 0.40  ? 49 LYS B CA   3  
ATOM 6284  C C    . LYS B 1 49 ? 0.011   -11.330 -15.801 1.00 0.38  ? 49 LYS B C    3  
ATOM 6285  O O    . LYS B 1 49 ? -0.398  -12.404 -16.203 1.00 0.54  ? 49 LYS B O    3  
ATOM 6286  C CB   . LYS B 1 49 ? -0.054  -9.497  -17.465 1.00 0.58  ? 49 LYS B CB   3  
ATOM 6287  C CG   . LYS B 1 49 ? -0.464  -10.158 -18.787 1.00 0.88  ? 49 LYS B CG   3  
ATOM 6288  C CD   . LYS B 1 49 ? -1.939  -9.872  -19.064 1.00 0.96  ? 49 LYS B CD   3  
ATOM 6289  C CE   . LYS B 1 49 ? -2.810  -10.770 -18.180 1.00 0.92  ? 49 LYS B CE   3  
ATOM 6290  N NZ   . LYS B 1 49 ? -3.201  -11.996 -18.935 1.00 1.06  ? 49 LYS B NZ   3  
ATOM 6291  H H    . LYS B 1 49 ? 1.472   -12.099 -17.846 1.00 0.55  ? 49 LYS B H    3  
ATOM 6292  H HA   . LYS B 1 49 ? 1.490   -9.810  -16.027 1.00 0.34  ? 49 LYS B HA   3  
ATOM 6293  H HB2  . LYS B 1 49 ? -0.935  -9.286  -16.878 1.00 0.59  ? 49 LYS B HB2  3  
ATOM 6294  H HB3  . LYS B 1 49 ? 0.467   -8.584  -17.668 1.00 0.69  ? 49 LYS B HB3  3  
ATOM 6295  H HG2  . LYS B 1 49 ? 0.139   -9.759  -19.591 1.00 1.06  ? 49 LYS B HG2  3  
ATOM 6296  H HG3  . LYS B 1 49 ? -0.314  -11.225 -18.719 1.00 1.13  ? 49 LYS B HG3  3  
ATOM 6297  H HD2  . LYS B 1 49 ? -2.151  -8.834  -18.846 1.00 0.98  ? 49 LYS B HD2  3  
ATOM 6298  H HD3  . LYS B 1 49 ? -2.155  -10.071 -20.103 1.00 1.23  ? 49 LYS B HD3  3  
ATOM 6299  H HE2  . LYS B 1 49 ? -2.255  -11.053 -17.298 1.00 0.97  ? 49 LYS B HE2  3  
ATOM 6300  H HE3  . LYS B 1 49 ? -3.697  -10.232 -17.886 1.00 0.86  ? 49 LYS B HE3  3  
ATOM 6301  H HZ1  . LYS B 1 49 ? -3.328  -11.763 -19.940 1.00 1.38  ? 49 LYS B HZ1  3  
ATOM 6302  H HZ2  . LYS B 1 49 ? -2.454  -12.715 -18.837 1.00 1.44  ? 49 LYS B HZ2  3  
ATOM 6303  H HZ3  . LYS B 1 49 ? -4.094  -12.367 -18.554 1.00 1.51  ? 49 LYS B HZ3  3  
ATOM 6304  N N    . ALA B 1 50 ? -0.273  -10.876 -14.615 1.00 0.27  ? 50 ALA B N    3  
ATOM 6305  C CA   . ALA B 1 50 ? -1.125  -11.664 -13.673 1.00 0.28  ? 50 ALA B CA   3  
ATOM 6306  C C    . ALA B 1 50 ? -2.065  -10.717 -12.963 1.00 0.24  ? 50 ALA B C    3  
ATOM 6307  O O    . ALA B 1 50 ? -1.822  -9.542  -12.920 1.00 0.21  ? 50 ALA B O    3  
ATOM 6308  C CB   . ALA B 1 50 ? -0.265  -12.330 -12.606 1.00 0.32  ? 50 ALA B CB   3  
ATOM 6309  H H    . ALA B 1 50 ? 0.069   -9.986  -14.351 1.00 0.29  ? 50 ALA B H    3  
ATOM 6310  H HA   . ALA B 1 50 ? -1.687  -12.407 -14.213 1.00 0.35  ? 50 ALA B HA   3  
ATOM 6311  H HB1  . ALA B 1 50 ? 0.639   -12.706 -13.050 1.00 1.05  ? 50 ALA B HB1  3  
ATOM 6312  H HB2  . ALA B 1 50 ? -0.021  -11.602 -11.842 1.00 1.08  ? 50 ALA B HB2  3  
ATOM 6313  H HB3  . ALA B 1 50 ? -0.819  -13.143 -12.158 1.00 1.03  ? 50 ALA B HB3  3  
ATOM 6314  N N    . CYS B 1 51 ? -3.104  -11.211 -12.353 1.00 0.25  ? 51 CYS B N    3  
ATOM 6315  C CA   . CYS B 1 51 ? -3.994  -10.305 -11.607 1.00 0.22  ? 51 CYS B CA   3  
ATOM 6316  C C    . CYS B 1 51 ? -3.966  -10.742 -10.160 1.00 0.22  ? 51 CYS B C    3  
ATOM 6317  O O    . CYS B 1 51 ? -3.737  -11.898 -9.865  1.00 0.25  ? 51 CYS B O    3  
ATOM 6318  C CB   . CYS B 1 51 ? -5.422  -10.376 -12.148 1.00 0.25  ? 51 CYS B CB   3  
ATOM 6319  S SG   . CYS B 1 51 ? -5.929  -8.733  -12.710 1.00 0.24  ? 51 CYS B SG   3  
ATOM 6320  H H    . CYS B 1 51 ? -3.275  -12.181 -12.338 1.00 0.28  ? 51 CYS B H    3  
ATOM 6321  H HA   . CYS B 1 51 ? -3.626  -9.295  -11.689 1.00 0.20  ? 51 CYS B HA   3  
ATOM 6322  H HB2  . CYS B 1 51 ? -5.460  -11.064 -12.974 1.00 0.28  ? 51 CYS B HB2  3  
ATOM 6323  H HB3  . CYS B 1 51 ? -6.089  -10.712 -11.369 1.00 0.27  ? 51 CYS B HB3  3  
ATOM 6324  N N    . LEU B 1 52 ? -4.173  -9.837  -9.257  1.00 0.21  ? 52 LEU B N    3  
ATOM 6325  C CA   . LEU B 1 52 ? -4.168  -10.203 -7.824  1.00 0.23  ? 52 LEU B CA   3  
ATOM 6326  C C    . LEU B 1 52 ? -5.357  -9.504  -7.170  1.00 0.25  ? 52 LEU B C    3  
ATOM 6327  O O    . LEU B 1 52 ? -5.979  -8.648  -7.767  1.00 0.25  ? 52 LEU B O    3  
ATOM 6328  C CB   . LEU B 1 52 ? -2.833  -9.833  -7.140  1.00 0.22  ? 52 LEU B CB   3  
ATOM 6329  C CG   . LEU B 1 52 ? -2.076  -8.764  -7.933  1.00 0.18  ? 52 LEU B CG   3  
ATOM 6330  C CD1  . LEU B 1 52 ? -1.613  -9.320  -9.296  1.00 0.17  ? 52 LEU B CD1  3  
ATOM 6331  C CD2  . LEU B 1 52 ? -2.991  -7.550  -8.094  1.00 0.18  ? 52 LEU B CD2  3  
ATOM 6332  H H    . LEU B 1 52 ? -4.326  -8.906  -9.521  1.00 0.20  ? 52 LEU B H    3  
ATOM 6333  H HA   . LEU B 1 52 ? -4.315  -11.257 -7.747  1.00 0.26  ? 52 LEU B HA   3  
ATOM 6334  H HB2  . LEU B 1 52 ? -3.034  -9.458  -6.150  1.00 0.25  ? 52 LEU B HB2  3  
ATOM 6335  H HB3  . LEU B 1 52 ? -2.218  -10.717 -7.064  1.00 0.24  ? 52 LEU B HB3  3  
ATOM 6336  H HG   . LEU B 1 52 ? -1.213  -8.472  -7.381  1.00 0.19  ? 52 LEU B HG   3  
ATOM 6337  H HD11 . LEU B 1 52 ? -1.707  -10.399 -9.298  1.00 0.95  ? 52 LEU B HD11 3  
ATOM 6338  H HD12 . LEU B 1 52 ? -2.222  -8.908  -10.086 1.00 1.00  ? 52 LEU B HD12 3  
ATOM 6339  H HD13 . LEU B 1 52 ? -0.580  -9.056  -9.464  1.00 0.98  ? 52 LEU B HD13 3  
ATOM 6340  H HD21 . LEU B 1 52 ? -3.909  -7.723  -7.547  1.00 0.96  ? 52 LEU B HD21 3  
ATOM 6341  H HD22 . LEU B 1 52 ? -2.501  -6.677  -7.697  1.00 0.97  ? 52 LEU B HD22 3  
ATOM 6342  H HD23 . LEU B 1 52 ? -3.215  -7.403  -9.135  1.00 1.01  ? 52 LEU B HD23 3  
ATOM 6343  N N    . ASN B 1 53 ? -5.710  -9.887  -5.978  1.00 0.29  ? 53 ASN B N    3  
ATOM 6344  C CA   . ASN B 1 53 ? -6.897  -9.262  -5.319  1.00 0.33  ? 53 ASN B CA   3  
ATOM 6345  C C    . ASN B 1 53 ? -6.473  -8.055  -4.468  1.00 0.34  ? 53 ASN B C    3  
ATOM 6346  O O    . ASN B 1 53 ? -6.068  -8.240  -3.341  1.00 0.37  ? 53 ASN B O    3  
ATOM 6347  C CB   . ASN B 1 53 ? -7.580  -10.292 -4.404  1.00 0.37  ? 53 ASN B CB   3  
ATOM 6348  C CG   . ASN B 1 53 ? -8.884  -10.791 -5.042  1.00 0.43  ? 53 ASN B CG   3  
ATOM 6349  O OD1  . ASN B 1 53 ? -9.169  -10.509 -6.189  1.00 1.07  ? 53 ASN B OD1  3  
ATOM 6350  N ND2  . ASN B 1 53 ? -9.699  -11.529 -4.336  1.00 0.93  ? 53 ASN B ND2  3  
ATOM 6351  H H    . ASN B 1 53 ? -5.214  -10.602 -5.531  1.00 0.31  ? 53 ASN B H    3  
ATOM 6352  H HA   . ASN B 1 53 ? -7.594  -8.954  -6.074  1.00 0.33  ? 53 ASN B HA   3  
ATOM 6353  H HB2  . ASN B 1 53 ? -6.915  -11.125 -4.238  1.00 0.41  ? 53 ASN B HB2  3  
ATOM 6354  H HB3  . ASN B 1 53 ? -7.808  -9.828  -3.455  1.00 0.41  ? 53 ASN B HB3  3  
ATOM 6355  H HD21 . ASN B 1 53 ? -9.475  -11.761 -3.409  1.00 1.59  ? 53 ASN B HD21 3  
ATOM 6356  H HD22 . ASN B 1 53 ? -10.536 -11.850 -4.731  1.00 0.93  ? 53 ASN B HD22 3  
ATOM 6357  N N    . PRO B 1 54 ? -6.608  -6.840  -4.980  1.00 0.34  ? 54 PRO B N    3  
ATOM 6358  C CA   . PRO B 1 54 ? -6.255  -5.642  -4.192  1.00 0.37  ? 54 PRO B CA   3  
ATOM 6359  C C    . PRO B 1 54 ? -7.158  -5.574  -2.959  1.00 0.43  ? 54 PRO B C    3  
ATOM 6360  O O    . PRO B 1 54 ? -6.739  -5.143  -1.900  1.00 0.46  ? 54 PRO B O    3  
ATOM 6361  C CB   . PRO B 1 54 ? -6.467  -4.480  -5.161  1.00 0.38  ? 54 PRO B CB   3  
ATOM 6362  C CG   . PRO B 1 54 ? -7.404  -5.015  -6.254  1.00 0.37  ? 54 PRO B CG   3  
ATOM 6363  C CD   . PRO B 1 54 ? -7.136  -6.525  -6.328  1.00 0.33  ? 54 PRO B CD   3  
ATOM 6364  H HA   . PRO B 1 54 ? -5.219  -5.685  -3.892  1.00 0.36  ? 54 PRO B HA   3  
ATOM 6365  H HB2  . PRO B 1 54 ? -6.924  -3.645  -4.647  1.00 0.42  ? 54 PRO B HB2  3  
ATOM 6366  H HB3  . PRO B 1 54 ? -5.527  -4.182  -5.599  1.00 0.36  ? 54 PRO B HB3  3  
ATOM 6367  H HG2  . PRO B 1 54 ? -8.431  -4.832  -5.980  1.00 0.41  ? 54 PRO B HG2  3  
ATOM 6368  H HG3  . PRO B 1 54 ? -7.178  -4.558  -7.199  1.00 0.36  ? 54 PRO B HG3  3  
ATOM 6369  H HD2  . PRO B 1 54 ? -8.052  -7.049  -6.531  1.00 0.35  ? 54 PRO B HD2  3  
ATOM 6370  H HD3  . PRO B 1 54 ? -6.390  -6.739  -7.081  1.00 0.28  ? 54 PRO B HD3  3  
ATOM 6371  N N    . ALA B 1 55 ? -8.373  -6.075  -3.072  1.00 0.45  ? 55 ALA B N    3  
ATOM 6372  C CA   . ALA B 1 55 ? -9.273  -6.128  -1.885  1.00 0.52  ? 55 ALA B CA   3  
ATOM 6373  C C    . ALA B 1 55 ? -8.593  -7.031  -0.846  1.00 0.53  ? 55 ALA B C    3  
ATOM 6374  O O    . ALA B 1 55 ? -8.728  -6.837  0.348   1.00 0.56  ? 55 ALA B O    3  
ATOM 6375  C CB   . ALA B 1 55 ? -10.625 -6.729  -2.286  1.00 0.55  ? 55 ALA B CB   3  
ATOM 6376  H H    . ALA B 1 55 ? -8.665  -6.468  -3.921  1.00 0.44  ? 55 ALA B H    3  
ATOM 6377  H HA   . ALA B 1 55 ? -9.411  -5.136  -1.480  1.00 0.53  ? 55 ALA B HA   3  
ATOM 6378  H HB1  . ALA B 1 55 ? -10.485 -7.408  -3.115  1.00 1.13  ? 55 ALA B HB1  3  
ATOM 6379  H HB2  . ALA B 1 55 ? -11.043 -7.267  -1.448  1.00 1.19  ? 55 ALA B HB2  3  
ATOM 6380  H HB3  . ALA B 1 55 ? -11.299 -5.938  -2.579  1.00 1.15  ? 55 ALA B HB3  3  
ATOM 6381  N N    . SER B 1 56 ? -7.824  -7.999  -1.314  1.00 0.50  ? 56 SER B N    3  
ATOM 6382  C CA   . SER B 1 56 ? -7.081  -8.906  -0.397  1.00 0.52  ? 56 SER B CA   3  
ATOM 6383  C C    . SER B 1 56 ? -5.991  -8.085  0.312   1.00 0.51  ? 56 SER B C    3  
ATOM 6384  O O    . SER B 1 56 ? -5.399  -7.214  -0.297  1.00 0.52  ? 56 SER B O    3  
ATOM 6385  C CB   . SER B 1 56 ? -6.413  -10.022 -1.207  1.00 0.50  ? 56 SER B CB   3  
ATOM 6386  O OG   . SER B 1 56 ? -6.503  -11.246 -0.486  1.00 0.56  ? 56 SER B OG   3  
ATOM 6387  H H    . SER B 1 56 ? -7.717  -8.108  -2.281  1.00 0.48  ? 56 SER B H    3  
ATOM 6388  H HA   . SER B 1 56 ? -7.761  -9.335  0.310   1.00 0.55  ? 56 SER B HA   3  
ATOM 6389  H HB2  . SER B 1 56 ? -6.910  -10.131 -2.154  1.00 0.46  ? 56 SER B HB2  3  
ATOM 6390  H HB3  . SER B 1 56 ? -5.376  -9.768  -1.379  1.00 0.51  ? 56 SER B HB3  3  
ATOM 6391  H HG   . SER B 1 56 ? -7.184  -11.784 -0.897  1.00 1.02  ? 56 SER B HG   3  
ATOM 6392  N N    . PRO B 1 57 ? -5.741  -8.386  1.566   1.00 0.53  ? 57 PRO B N    3  
ATOM 6393  C CA   . PRO B 1 57 ? -4.707  -7.681  2.354   1.00 0.53  ? 57 PRO B CA   3  
ATOM 6394  C C    . PRO B 1 57 ? -3.312  -8.122  1.890   1.00 0.51  ? 57 PRO B C    3  
ATOM 6395  O O    . PRO B 1 57 ? -2.450  -7.303  1.609   1.00 0.51  ? 57 PRO B O    3  
ATOM 6396  C CB   . PRO B 1 57 ? -4.998  -8.108  3.799   1.00 0.59  ? 57 PRO B CB   3  
ATOM 6397  C CG   . PRO B 1 57 ? -5.805  -9.426  3.710   1.00 0.62  ? 57 PRO B CG   3  
ATOM 6398  C CD   . PRO B 1 57 ? -6.445  -9.455  2.308   1.00 0.58  ? 57 PRO B CD   3  
ATOM 6399  H HA   . PRO B 1 57 ? -4.821  -6.612  2.255   1.00 0.54  ? 57 PRO B HA   3  
ATOM 6400  H HB2  . PRO B 1 57 ? -4.071  -8.272  4.330   1.00 0.60  ? 57 PRO B HB2  3  
ATOM 6401  H HB3  . PRO B 1 57 ? -5.586  -7.356  4.299   1.00 0.63  ? 57 PRO B HB3  3  
ATOM 6402  H HG2  . PRO B 1 57 ? -5.144  -10.272 3.838   1.00 0.64  ? 57 PRO B HG2  3  
ATOM 6403  H HG3  . PRO B 1 57 ? -6.576  -9.440  4.463   1.00 0.67  ? 57 PRO B HG3  3  
ATOM 6404  H HD2  . PRO B 1 57 ? -6.282  -10.415 1.840   1.00 0.59  ? 57 PRO B HD2  3  
ATOM 6405  H HD3  . PRO B 1 57 ? -7.500  -9.234  2.369   1.00 0.60  ? 57 PRO B HD3  3  
ATOM 6406  N N    . ILE B 1 58 ? -3.104  -9.413  1.770   1.00 0.52  ? 58 ILE B N    3  
ATOM 6407  C CA   . ILE B 1 58 ? -1.793  -9.943  1.285   1.00 0.51  ? 58 ILE B CA   3  
ATOM 6408  C C    . ILE B 1 58 ? -1.476  -9.303  -0.055  1.00 0.45  ? 58 ILE B C    3  
ATOM 6409  O O    . ILE B 1 58 ? -0.381  -8.849  -0.308  1.00 0.44  ? 58 ILE B O    3  
ATOM 6410  C CB   . ILE B 1 58 ? -1.925  -11.467 1.096   1.00 0.54  ? 58 ILE B CB   3  
ATOM 6411  C CG1  . ILE B 1 58 ? -0.889  -12.191 1.962   1.00 0.62  ? 58 ILE B CG1  3  
ATOM 6412  C CG2  . ILE B 1 58 ? -1.726  -11.857 -0.382  1.00 0.49  ? 58 ILE B CG2  3  
ATOM 6413  C CD1  . ILE B 1 58 ? -1.329  -12.156 3.428   1.00 0.68  ? 58 ILE B CD1  3  
ATOM 6414  H H    . ILE B 1 58 ? -3.829  -10.039 1.977   1.00 0.55  ? 58 ILE B H    3  
ATOM 6415  H HA   . ILE B 1 58 ? -1.014  -9.716  1.992   1.00 0.55  ? 58 ILE B HA   3  
ATOM 6416  H HB   . ILE B 1 58 ? -2.917  -11.763 1.392   1.00 0.56  ? 58 ILE B HB   3  
ATOM 6417  H HG12 . ILE B 1 58 ? -0.803  -13.217 1.638   1.00 0.64  ? 58 ILE B HG12 3  
ATOM 6418  H HG13 . ILE B 1 58 ? 0.069   -11.702 1.865   1.00 0.62  ? 58 ILE B HG13 3  
ATOM 6419  H HG21 . ILE B 1 58 ? -0.838  -11.377 -0.770  1.00 1.10  ? 58 ILE B HG21 3  
ATOM 6420  H HG22 . ILE B 1 58 ? -1.623  -12.924 -0.464  1.00 1.12  ? 58 ILE B HG22 3  
ATOM 6421  H HG23 . ILE B 1 58 ? -2.585  -11.535 -0.958  1.00 1.14  ? 58 ILE B HG23 3  
ATOM 6422  H HD11 . ILE B 1 58 ? -2.408  -12.179 3.482   1.00 1.22  ? 58 ILE B HD11 3  
ATOM 6423  H HD12 . ILE B 1 58 ? -0.925  -13.014 3.946   1.00 1.22  ? 58 ILE B HD12 3  
ATOM 6424  H HD13 . ILE B 1 58 ? -0.964  -11.252 3.893   1.00 1.24  ? 58 ILE B HD13 3  
ATOM 6425  N N    . VAL B 1 59 ? -2.439  -9.305  -0.922  1.00 0.43  ? 59 VAL B N    3  
ATOM 6426  C CA   . VAL B 1 59 ? -2.236  -8.736  -2.258  1.00 0.40  ? 59 VAL B CA   3  
ATOM 6427  C C    . VAL B 1 59 ? -2.093  -7.222  -2.141  1.00 0.37  ? 59 VAL B C    3  
ATOM 6428  O O    . VAL B 1 59 ? -1.307  -6.623  -2.844  1.00 0.32  ? 59 VAL B O    3  
ATOM 6429  C CB   . VAL B 1 59 ? -3.436  -9.116  -3.106  1.00 0.51  ? 59 VAL B CB   3  
ATOM 6430  C CG1  . VAL B 1 59 ? -3.573  -8.157  -4.256  1.00 0.31  ? 59 VAL B CG1  3  
ATOM 6431  C CG2  . VAL B 1 59 ? -3.270  -10.535 -3.637  1.00 0.88  ? 59 VAL B CG2  3  
ATOM 6432  H H    . VAL B 1 59 ? -3.303  -9.710  -0.691  1.00 0.46  ? 59 VAL B H    3  
ATOM 6433  H HA   . VAL B 1 59 ? -1.327  -9.143  -2.677  1.00 0.41  ? 59 VAL B HA   3  
ATOM 6434  H HB   . VAL B 1 59 ? -4.321  -9.063  -2.501  1.00 0.84  ? 59 VAL B HB   3  
ATOM 6435  H HG11 . VAL B 1 59 ? -2.601  -7.965  -4.672  1.00 1.08  ? 59 VAL B HG11 3  
ATOM 6436  H HG12 . VAL B 1 59 ? -4.216  -8.593  -5.000  1.00 1.03  ? 59 VAL B HG12 3  
ATOM 6437  H HG13 . VAL B 1 59 ? -4.009  -7.240  -3.893  1.00 1.00  ? 59 VAL B HG13 3  
ATOM 6438  H HG21 . VAL B 1 59 ? -2.770  -11.140 -2.896  1.00 1.47  ? 59 VAL B HG21 3  
ATOM 6439  H HG22 . VAL B 1 59 ? -4.242  -10.956 -3.849  1.00 1.25  ? 59 VAL B HG22 3  
ATOM 6440  H HG23 . VAL B 1 59 ? -2.681  -10.514 -4.542  1.00 1.53  ? 59 VAL B HG23 3  
ATOM 6441  N N    . LYS B 1 60 ? -2.793  -6.601  -1.217  1.00 0.43  ? 60 LYS B N    3  
ATOM 6442  C CA   . LYS B 1 60 ? -2.612  -5.134  -1.023  1.00 0.43  ? 60 LYS B CA   3  
ATOM 6443  C C    . LYS B 1 60 ? -1.120  -4.892  -0.720  1.00 0.43  ? 60 LYS B C    3  
ATOM 6444  O O    . LYS B 1 60 ? -0.586  -3.818  -0.937  1.00 0.42  ? 60 LYS B O    3  
ATOM 6445  C CB   . LYS B 1 60 ? -3.451  -4.663  0.166   1.00 0.50  ? 60 LYS B CB   3  
ATOM 6446  C CG   . LYS B 1 60 ? -4.124  -3.331  -0.170  1.00 0.60  ? 60 LYS B CG   3  
ATOM 6447  C CD   . LYS B 1 60 ? -4.745  -2.744  1.101   1.00 0.91  ? 60 LYS B CD   3  
ATOM 6448  C CE   . LYS B 1 60 ? -6.008  -1.959  0.744   1.00 0.99  ? 60 LYS B CE   3  
ATOM 6449  N NZ   . LYS B 1 60 ? -6.579  -1.346  1.978   1.00 1.68  ? 60 LYS B NZ   3  
ATOM 6450  H H    . LYS B 1 60 ? -3.389  -7.106  -0.625  1.00 0.47  ? 60 LYS B H    3  
ATOM 6451  H HA   . LYS B 1 60 ? -2.905  -4.609  -1.927  1.00 0.40  ? 60 LYS B HA   3  
ATOM 6452  H HB2  . LYS B 1 60 ? -4.201  -5.404  0.390   1.00 0.65  ? 60 LYS B HB2  3  
ATOM 6453  H HB3  . LYS B 1 60 ? -2.808  -4.532  1.024   1.00 0.59  ? 60 LYS B HB3  3  
ATOM 6454  H HG2  . LYS B 1 60 ? -3.388  -2.646  -0.565  1.00 1.10  ? 60 LYS B HG2  3  
ATOM 6455  H HG3  . LYS B 1 60 ? -4.898  -3.493  -0.906  1.00 0.87  ? 60 LYS B HG3  3  
ATOM 6456  H HD2  . LYS B 1 60 ? -4.998  -3.545  1.779   1.00 1.39  ? 60 LYS B HD2  3  
ATOM 6457  H HD3  . LYS B 1 60 ? -4.034  -2.082  1.575   1.00 1.49  ? 60 LYS B HD3  3  
ATOM 6458  H HE2  . LYS B 1 60 ? -5.760  -1.179  0.037   1.00 1.20  ? 60 LYS B HE2  3  
ATOM 6459  H HE3  . LYS B 1 60 ? -6.736  -2.626  0.303   1.00 1.40  ? 60 LYS B HE3  3  
ATOM 6460  H HZ1  . LYS B 1 60 ? -6.646  -2.067  2.725   1.00 2.15  ? 60 LYS B HZ1  3  
ATOM 6461  H HZ2  . LYS B 1 60 ? -5.965  -0.570  2.298   1.00 2.27  ? 60 LYS B HZ2  3  
ATOM 6462  H HZ3  . LYS B 1 60 ? -7.527  -0.970  1.773   1.00 1.91  ? 60 LYS B HZ3  3  
ATOM 6463  N N    . LYS B 1 61 ? -0.444  -5.933  -0.271  1.00 0.44  ? 61 LYS B N    3  
ATOM 6464  C CA   . LYS B 1 61 ? 1.008   -5.878  0.006   1.00 0.46  ? 61 LYS B CA   3  
ATOM 6465  C C    . LYS B 1 61 ? 1.688   -5.865  -1.344  1.00 0.42  ? 61 LYS B C    3  
ATOM 6466  O O    . LYS B 1 61 ? 2.503   -5.025  -1.634  1.00 0.44  ? 61 LYS B O    3  
ATOM 6467  C CB   . LYS B 1 61 ? 1.404   -7.149  0.749   1.00 0.51  ? 61 LYS B CB   3  
ATOM 6468  C CG   . LYS B 1 61 ? 2.409   -6.815  1.845   1.00 0.71  ? 61 LYS B CG   3  
ATOM 6469  C CD   . LYS B 1 61 ? 3.409   -7.962  1.981   1.00 1.02  ? 61 LYS B CD   3  
ATOM 6470  C CE   . LYS B 1 61 ? 4.602   -7.513  2.829   1.00 1.29  ? 61 LYS B CE   3  
ATOM 6471  N NZ   . LYS B 1 61 ? 4.215   -7.489  4.270   1.00 1.88  ? 61 LYS B NZ   3  
ATOM 6472  H H    . LYS B 1 61 ? -0.897  -6.786  -0.167  1.00 0.45  ? 61 LYS B H    3  
ATOM 6473  H HA   . LYS B 1 61 ? 1.261   -4.999  0.577   1.00 0.49  ? 61 LYS B HA   3  
ATOM 6474  H HB2  . LYS B 1 61 ? 0.518   -7.594  1.184   1.00 0.58  ? 61 LYS B HB2  3  
ATOM 6475  H HB3  . LYS B 1 61 ? 1.844   -7.848  0.047   1.00 0.65  ? 61 LYS B HB3  3  
ATOM 6476  H HG2  . LYS B 1 61 ? 2.932   -5.906  1.588   1.00 1.41  ? 61 LYS B HG2  3  
ATOM 6477  H HG3  . LYS B 1 61 ? 1.886   -6.680  2.780   1.00 1.04  ? 61 LYS B HG3  3  
ATOM 6478  H HD2  . LYS B 1 61 ? 2.922   -8.803  2.455   1.00 1.35  ? 61 LYS B HD2  3  
ATOM 6479  H HD3  . LYS B 1 61 ? 3.754   -8.254  1.001   1.00 1.75  ? 61 LYS B HD3  3  
ATOM 6480  H HE2  . LYS B 1 61 ? 5.422   -8.202  2.689   1.00 1.83  ? 61 LYS B HE2  3  
ATOM 6481  H HE3  . LYS B 1 61 ? 4.909   -6.523  2.524   1.00 1.54  ? 61 LYS B HE3  3  
ATOM 6482  H HZ1  . LYS B 1 61 ? 3.696   -8.359  4.506   1.00 2.45  ? 61 LYS B HZ1  3  
ATOM 6483  H HZ2  . LYS B 1 61 ? 5.071   -7.430  4.858   1.00 2.28  ? 61 LYS B HZ2  3  
ATOM 6484  H HZ3  . LYS B 1 61 ? 3.610   -6.663  4.454   1.00 2.14  ? 61 LYS B HZ3  3  
ATOM 6485  N N    . ILE B 1 62 ? 1.300   -6.797  -2.177  1.00 0.37  ? 62 ILE B N    3  
ATOM 6486  C CA   . ILE B 1 62 ? 1.828   -6.890  -3.557  1.00 0.34  ? 62 ILE B CA   3  
ATOM 6487  C C    . ILE B 1 62 ? 1.908   -5.486  -4.173  1.00 0.32  ? 62 ILE B C    3  
ATOM 6488  O O    . ILE B 1 62 ? 2.863   -5.162  -4.849  1.00 0.34  ? 62 ILE B O    3  
ATOM 6489  C CB   . ILE B 1 62 ? 0.861   -7.798  -4.342  1.00 0.32  ? 62 ILE B CB   3  
ATOM 6490  C CG1  . ILE B 1 62 ? 1.571   -9.067  -4.811  1.00 0.34  ? 62 ILE B CG1  3  
ATOM 6491  C CG2  . ILE B 1 62 ? 0.259   -7.069  -5.540  1.00 0.29  ? 62 ILE B CG2  3  
ATOM 6492  C CD1  . ILE B 1 62 ? 2.393   -9.628  -3.655  1.00 0.36  ? 62 ILE B CD1  3  
ATOM 6493  H H    . ILE B 1 62 ? 0.620   -7.443  -1.890  1.00 0.37  ? 62 ILE B H    3  
ATOM 6494  H HA   . ILE B 1 62 ? 2.810   -7.323  -3.535  1.00 0.36  ? 62 ILE B HA   3  
ATOM 6495  H HB   . ILE B 1 62 ? 0.063   -8.082  -3.682  1.00 0.32  ? 62 ILE B HB   3  
ATOM 6496  H HG12 . ILE B 1 62 ? 0.831   -9.798  -5.116  1.00 0.35  ? 62 ILE B HG12 3  
ATOM 6497  H HG13 . ILE B 1 62 ? 2.217   -8.840  -5.640  1.00 0.35  ? 62 ILE B HG13 3  
ATOM 6498  H HG21 . ILE B 1 62 ? 1.049   -6.747  -6.198  1.00 0.98  ? 62 ILE B HG21 3  
ATOM 6499  H HG22 . ILE B 1 62 ? -0.407  -7.734  -6.065  1.00 1.02  ? 62 ILE B HG22 3  
ATOM 6500  H HG23 . ILE B 1 62 ? -0.295  -6.210  -5.191  1.00 1.11  ? 62 ILE B HG23 3  
ATOM 6501  H HD11 . ILE B 1 62 ? 1.834   -9.517  -2.735  1.00 0.97  ? 62 ILE B HD11 3  
ATOM 6502  H HD12 . ILE B 1 62 ? 2.597   -10.669 -3.831  1.00 1.02  ? 62 ILE B HD12 3  
ATOM 6503  H HD13 . ILE B 1 62 ? 3.320   -9.081  -3.580  1.00 1.02  ? 62 ILE B HD13 3  
ATOM 6504  N N    . ILE B 1 63 ? 0.933   -4.641  -3.921  1.00 0.31  ? 63 ILE B N    3  
ATOM 6505  C CA   . ILE B 1 63 ? 0.994   -3.255  -4.476  1.00 0.31  ? 63 ILE B CA   3  
ATOM 6506  C C    . ILE B 1 63 ? 2.098   -2.497  -3.768  1.00 0.37  ? 63 ILE B C    3  
ATOM 6507  O O    . ILE B 1 63 ? 2.963   -1.904  -4.382  1.00 0.41  ? 63 ILE B O    3  
ATOM 6508  C CB   . ILE B 1 63 ? -0.312  -2.522  -4.191  1.00 0.32  ? 63 ILE B CB   3  
ATOM 6509  C CG1  . ILE B 1 63 ? -1.435  -3.176  -4.970  1.00 0.32  ? 63 ILE B CG1  3  
ATOM 6510  C CG2  . ILE B 1 63 ? -0.183  -1.050  -4.590  1.00 0.33  ? 63 ILE B CG2  3  
ATOM 6511  C CD1  . ILE B 1 63 ? -1.958  -4.340  -4.160  1.00 0.42  ? 63 ILE B CD1  3  
ATOM 6512  H H    . ILE B 1 63 ? 0.170   -4.910  -3.346  1.00 0.31  ? 63 ILE B H    3  
ATOM 6513  H HA   . ILE B 1 63 ? 1.179   -3.284  -5.538  1.00 0.30  ? 63 ILE B HA   3  
ATOM 6514  H HB   . ILE B 1 63 ? -0.527  -2.582  -3.134  1.00 0.35  ? 63 ILE B HB   3  
ATOM 6515  H HG12 . ILE B 1 63 ? -2.217  -2.468  -5.119  1.00 0.31  ? 63 ILE B HG12 3  
ATOM 6516  H HG13 . ILE B 1 63 ? -1.069  -3.529  -5.921  1.00 0.48  ? 63 ILE B HG13 3  
ATOM 6517  H HG21 . ILE B 1 63 ? 0.363   -0.972  -5.518  1.00 1.02  ? 63 ILE B HG21 3  
ATOM 6518  H HG22 . ILE B 1 63 ? -1.166  -0.621  -4.709  1.00 1.03  ? 63 ILE B HG22 3  
ATOM 6519  H HG23 . ILE B 1 63 ? 0.349   -0.515  -3.815  1.00 0.99  ? 63 ILE B HG23 3  
ATOM 6520  H HD11 . ILE B 1 63 ? -1.622  -4.232  -3.136  1.00 1.07  ? 63 ILE B HD11 3  
ATOM 6521  H HD12 . ILE B 1 63 ? -3.031  -4.346  -4.190  1.00 1.10  ? 63 ILE B HD12 3  
ATOM 6522  H HD13 . ILE B 1 63 ? -1.571  -5.259  -4.569  1.00 1.18  ? 63 ILE B HD13 3  
ATOM 6523  N N    . GLU B 1 64 ? 2.037   -2.498  -2.466  1.00 0.38  ? 64 GLU B N    3  
ATOM 6524  C CA   . GLU B 1 64 ? 3.038   -1.757  -1.661  1.00 0.46  ? 64 GLU B CA   3  
ATOM 6525  C C    . GLU B 1 64 ? 4.453   -2.298  -1.914  1.00 0.48  ? 64 GLU B C    3  
ATOM 6526  O O    . GLU B 1 64 ? 5.387   -1.540  -2.088  1.00 0.62  ? 64 GLU B O    3  
ATOM 6527  C CB   . GLU B 1 64 ? 2.711   -1.909  -0.177  1.00 0.48  ? 64 GLU B CB   3  
ATOM 6528  C CG   . GLU B 1 64 ? 1.870   -0.719  0.291   1.00 1.04  ? 64 GLU B CG   3  
ATOM 6529  C CD   . GLU B 1 64 ? 1.908   -0.637  1.819   1.00 1.40  ? 64 GLU B CD   3  
ATOM 6530  O OE1  . GLU B 1 64 ? 1.109   -1.311  2.450   1.00 2.00  ? 64 GLU B OE1  3  
ATOM 6531  O OE2  . GLU B 1 64 ? 2.735   0.099   2.334   1.00 1.81  ? 64 GLU B OE2  3  
ATOM 6532  H H    . GLU B 1 64 ? 1.304   -2.982  -2.017  1.00 0.37  ? 64 GLU B H    3  
ATOM 6533  H HA   . GLU B 1 64 ? 2.986   -0.716  -1.937  1.00 0.48  ? 64 GLU B HA   3  
ATOM 6534  H HB2  . GLU B 1 64 ? 2.159   -2.825  -0.028  1.00 0.72  ? 64 GLU B HB2  3  
ATOM 6535  H HB3  . GLU B 1 64 ? 3.630   -1.945  0.387   1.00 0.75  ? 64 GLU B HB3  3  
ATOM 6536  H HG2  . GLU B 1 64 ? 2.271   0.192   -0.130  1.00 1.39  ? 64 GLU B HG2  3  
ATOM 6537  H HG3  . GLU B 1 64 ? 0.850   -0.849  -0.035  1.00 1.43  ? 64 GLU B HG3  3  
ATOM 6538  N N    . LYS B 1 65 ? 4.617   -3.600  -1.926  1.00 0.47  ? 65 LYS B N    3  
ATOM 6539  C CA   . LYS B 1 65 ? 5.969   -4.186  -2.158  1.00 0.51  ? 65 LYS B CA   3  
ATOM 6540  C C    . LYS B 1 65 ? 6.397   -3.913  -3.595  1.00 0.50  ? 65 LYS B C    3  
ATOM 6541  O O    . LYS B 1 65 ? 7.515   -3.502  -3.837  1.00 0.55  ? 65 LYS B O    3  
ATOM 6542  C CB   . LYS B 1 65 ? 5.940   -5.692  -1.888  1.00 0.52  ? 65 LYS B CB   3  
ATOM 6543  C CG   . LYS B 1 65 ? 7.346   -6.273  -2.061  1.00 1.07  ? 65 LYS B CG   3  
ATOM 6544  C CD   . LYS B 1 65 ? 7.507   -7.508  -1.173  1.00 1.44  ? 65 LYS B CD   3  
ATOM 6545  C CE   . LYS B 1 65 ? 7.940   -7.073  0.230   1.00 1.72  ? 65 LYS B CE   3  
ATOM 6546  N NZ   . LYS B 1 65 ? 8.148   -8.276  1.087   1.00 2.15  ? 65 LYS B NZ   3  
ATOM 6547  H H    . LYS B 1 65 ? 3.851   -4.190  -1.777  1.00 0.54  ? 65 LYS B H    3  
ATOM 6548  H HA   . LYS B 1 65 ? 6.667   -3.711  -1.494  1.00 0.56  ? 65 LYS B HA   3  
ATOM 6549  H HB2  . LYS B 1 65 ? 5.598   -5.867  -0.878  1.00 0.91  ? 65 LYS B HB2  3  
ATOM 6550  H HB3  . LYS B 1 65 ? 5.267   -6.169  -2.584  1.00 1.09  ? 65 LYS B HB3  3  
ATOM 6551  H HG2  . LYS B 1 65 ? 7.497   -6.550  -3.094  1.00 1.56  ? 65 LYS B HG2  3  
ATOM 6552  H HG3  . LYS B 1 65 ? 8.079   -5.531  -1.777  1.00 1.65  ? 65 LYS B HG3  3  
ATOM 6553  H HD2  . LYS B 1 65 ? 6.566   -8.036  -1.115  1.00 1.78  ? 65 LYS B HD2  3  
ATOM 6554  H HD3  . LYS B 1 65 ? 8.258   -8.158  -1.595  1.00 1.92  ? 65 LYS B HD3  3  
ATOM 6555  H HE2  . LYS B 1 65 ? 8.862   -6.514  0.166   1.00 2.13  ? 65 LYS B HE2  3  
ATOM 6556  H HE3  . LYS B 1 65 ? 7.172   -6.451  0.666   1.00 2.04  ? 65 LYS B HE3  3  
ATOM 6557  H HZ1  . LYS B 1 65 ? 8.849   -8.903  0.643   1.00 2.61  ? 65 LYS B HZ1  3  
ATOM 6558  H HZ2  . LYS B 1 65 ? 8.495   -7.980  2.021   1.00 2.25  ? 65 LYS B HZ2  3  
ATOM 6559  H HZ3  . LYS B 1 65 ? 7.246   -8.785  1.196   1.00 2.61  ? 65 LYS B HZ3  3  
ATOM 6560  N N    . MET B 1 66 ? 5.512   -4.092  -4.545  1.00 0.45  ? 66 MET B N    3  
ATOM 6561  C CA   . MET B 1 66 ? 5.869   -3.779  -5.951  1.00 0.46  ? 66 MET B CA   3  
ATOM 6562  C C    . MET B 1 66 ? 6.274   -2.299  -5.992  1.00 0.49  ? 66 MET B C    3  
ATOM 6563  O O    . MET B 1 66 ? 7.193   -1.909  -6.688  1.00 0.53  ? 66 MET B O    3  
ATOM 6564  C CB   . MET B 1 66 ? 4.656   -4.010  -6.854  1.00 0.42  ? 66 MET B CB   3  
ATOM 6565  C CG   . MET B 1 66 ? 4.566   -5.492  -7.261  1.00 0.40  ? 66 MET B CG   3  
ATOM 6566  S SD   . MET B 1 66 ? 3.615   -5.641  -8.795  1.00 1.14  ? 66 MET B SD   3  
ATOM 6567  C CE   . MET B 1 66 ? 4.617   -4.538  -9.831  1.00 0.37  ? 66 MET B CE   3  
ATOM 6568  H H    . MET B 1 66 ? 4.610   -4.393  -4.329  1.00 0.42  ? 66 MET B H    3  
ATOM 6569  H HA   . MET B 1 66 ? 6.695   -4.396  -6.260  1.00 0.47  ? 66 MET B HA   3  
ATOM 6570  H HB2  . MET B 1 66 ? 3.760   -3.728  -6.320  1.00 0.40  ? 66 MET B HB2  3  
ATOM 6571  H HB3  . MET B 1 66 ? 4.752   -3.400  -7.734  1.00 0.46  ? 66 MET B HB3  3  
ATOM 6572  H HG2  . MET B 1 66 ? 5.556   -5.895  -7.412  1.00 0.76  ? 66 MET B HG2  3  
ATOM 6573  H HG3  . MET B 1 66 ? 4.070   -6.053  -6.478  1.00 0.66  ? 66 MET B HG3  3  
ATOM 6574  H HE1  . MET B 1 66 ? 5.345   -4.022  -9.224  1.00 1.01  ? 66 MET B HE1  3  
ATOM 6575  H HE2  . MET B 1 66 ? 5.121   -5.120  -10.591 1.00 1.12  ? 66 MET B HE2  3  
ATOM 6576  H HE3  . MET B 1 66 ? 3.979   -3.812  -10.310 1.00 1.06  ? 66 MET B HE3  3  
ATOM 6577  N N    . LEU B 1 67 ? 5.605   -1.491  -5.196  1.00 0.50  ? 67 LEU B N    3  
ATOM 6578  C CA   . LEU B 1 67 ? 5.930   -0.046  -5.097  1.00 0.54  ? 67 LEU B CA   3  
ATOM 6579  C C    . LEU B 1 67 ? 7.334   0.110   -4.496  1.00 0.60  ? 67 LEU B C    3  
ATOM 6580  O O    . LEU B 1 67 ? 8.069   1.016   -4.841  1.00 0.63  ? 67 LEU B O    3  
ATOM 6581  C CB   . LEU B 1 67 ? 4.922   0.626   -4.164  1.00 0.56  ? 67 LEU B CB   3  
ATOM 6582  C CG   . LEU B 1 67 ? 3.846   1.333   -4.984  1.00 0.53  ? 67 LEU B CG   3  
ATOM 6583  C CD1  . LEU B 1 67 ? 2.476   0.926   -4.451  1.00 0.53  ? 67 LEU B CD1  3  
ATOM 6584  C CD2  . LEU B 1 67 ? 4.016   2.848   -4.854  1.00 0.56  ? 67 LEU B CD2  3  
ATOM 6585  H H    . LEU B 1 67 ? 4.896   -1.852  -4.633  1.00 0.49  ? 67 LEU B H    3  
ATOM 6586  H HA   . LEU B 1 67 ? 5.880   0.404   -6.069  1.00 0.54  ? 67 LEU B HA   3  
ATOM 6587  H HB2  . LEU B 1 67 ? 4.462   -0.124  -3.543  1.00 0.57  ? 67 LEU B HB2  3  
ATOM 6588  H HB3  . LEU B 1 67 ? 5.428   1.344   -3.539  1.00 0.60  ? 67 LEU B HB3  3  
ATOM 6589  H HG   . LEU B 1 67 ? 3.931   1.044   -6.021  1.00 0.51  ? 67 LEU B HG   3  
ATOM 6590  H HD11 . LEU B 1 67 ? 2.587   0.501   -3.464  1.00 1.08  ? 67 LEU B HD11 3  
ATOM 6591  H HD12 . LEU B 1 67 ? 1.837   1.793   -4.401  1.00 1.15  ? 67 LEU B HD12 3  
ATOM 6592  H HD13 . LEU B 1 67 ? 2.040   0.192   -5.112  1.00 1.18  ? 67 LEU B HD13 3  
ATOM 6593  H HD21 . LEU B 1 67 ? 4.352   3.089   -3.857  1.00 1.19  ? 67 LEU B HD21 3  
ATOM 6594  H HD22 . LEU B 1 67 ? 4.748   3.189   -5.572  1.00 1.20  ? 67 LEU B HD22 3  
ATOM 6595  H HD23 . LEU B 1 67 ? 3.071   3.334   -5.044  1.00 1.09  ? 67 LEU B HD23 3  
ATOM 6596  N N    . ASN B 1 68 ? 7.701   -0.773  -3.587  1.00 0.63  ? 68 ASN B N    3  
ATOM 6597  C CA   . ASN B 1 68 ? 9.054   -0.684  -2.946  1.00 0.69  ? 68 ASN B CA   3  
ATOM 6598  C C    . ASN B 1 68 ? 10.044  -1.597  -3.684  1.00 0.75  ? 68 ASN B C    3  
ATOM 6599  O O    . ASN B 1 68 ? 10.177  -2.767  -3.371  1.00 0.92  ? 68 ASN B O    3  
ATOM 6600  C CB   . ASN B 1 68 ? 8.972   -1.103  -1.466  1.00 0.78  ? 68 ASN B CB   3  
ATOM 6601  C CG   . ASN B 1 68 ? 10.258  -0.685  -0.743  1.00 1.48  ? 68 ASN B CG   3  
ATOM 6602  O OD1  . ASN B 1 68 ? 10.759  0.405   -0.944  1.00 2.21  ? 68 ASN B OD1  3  
ATOM 6603  N ND2  . ASN B 1 68 ? 10.818  -1.513  0.099   1.00 2.00  ? 68 ASN B ND2  3  
ATOM 6604  H H    . ASN B 1 68 ? 7.078   -1.499  -3.329  1.00 0.62  ? 68 ASN B H    3  
ATOM 6605  H HA   . ASN B 1 68 ? 9.405   0.337   -3.004  1.00 0.72  ? 68 ASN B HA   3  
ATOM 6606  H HB2  . ASN B 1 68 ? 8.126   -0.621  -0.997  1.00 1.16  ? 68 ASN B HB2  3  
ATOM 6607  H HB3  . ASN B 1 68 ? 8.858   -2.178  -1.398  1.00 1.06  ? 68 ASN B HB3  3  
ATOM 6608  H HD21 . ASN B 1 68 ? 10.418  -2.392  0.264   1.00 2.13  ? 68 ASN B HD21 3  
ATOM 6609  H HD22 . ASN B 1 68 ? 11.640  -1.253  0.566   1.00 2.63  ? 68 ASN B HD22 3  
ATOM 6610  N N    . SER B 1 69 ? 10.744  -1.065  -4.659  1.00 0.87  ? 69 SER B N    3  
ATOM 6611  C CA   . SER B 1 69 ? 11.728  -1.883  -5.418  1.00 0.99  ? 69 SER B CA   3  
ATOM 6612  C C    . SER B 1 69 ? 13.152  -1.587  -4.911  1.00 1.13  ? 69 SER B C    3  
ATOM 6613  O O    . SER B 1 69 ? 14.049  -1.293  -5.680  1.00 1.69  ? 69 SER B O    3  
ATOM 6614  C CB   . SER B 1 69 ? 11.620  -1.558  -6.914  1.00 1.46  ? 69 SER B CB   3  
ATOM 6615  O OG   . SER B 1 69 ? 11.730  -0.153  -7.104  1.00 2.03  ? 69 SER B OG   3  
ATOM 6616  H H    . SER B 1 69 ? 10.624  -0.131  -4.888  1.00 1.00  ? 69 SER B H    3  
ATOM 6617  H HA   . SER B 1 69 ? 11.505  -2.918  -5.263  1.00 1.09  ? 69 SER B HA   3  
ATOM 6618  H HB2  . SER B 1 69 ? 12.414  -2.052  -7.450  1.00 1.85  ? 69 SER B HB2  3  
ATOM 6619  H HB3  . SER B 1 69 ? 10.666  -1.909  -7.287  1.00 1.93  ? 69 SER B HB3  3  
ATOM 6620  H HG   . SER B 1 69 ? 10.865  0.180   -7.349  1.00 2.38  ? 69 SER B HG   3  
ATOM 6621  N N    . ASP B 1 70 ? 13.361  -1.665  -3.617  1.00 1.22  ? 70 ASP B N    3  
ATOM 6622  C CA   . ASP B 1 70 ? 14.718  -1.393  -3.050  1.00 1.69  ? 70 ASP B CA   3  
ATOM 6623  C C    . ASP B 1 70 ? 15.036  -2.444  -1.982  1.00 1.89  ? 70 ASP B C    3  
ATOM 6624  O O    . ASP B 1 70 ? 14.483  -2.419  -0.896  1.00 2.34  ? 70 ASP B O    3  
ATOM 6625  C CB   . ASP B 1 70 ? 14.742  0.004   -2.419  1.00 2.32  ? 70 ASP B CB   3  
ATOM 6626  C CG   . ASP B 1 70 ? 14.729  1.069   -3.520  1.00 3.13  ? 70 ASP B CG   3  
ATOM 6627  O OD1  . ASP B 1 70 ? 15.783  1.330   -4.077  1.00 3.65  ? 70 ASP B OD1  3  
ATOM 6628  O OD2  . ASP B 1 70 ? 13.665  1.603   -3.789  1.00 3.72  ? 70 ASP B OD2  3  
ATOM 6629  H H    . ASP B 1 70 ? 12.624  -1.906  -3.017  1.00 1.38  ? 70 ASP B H    3  
ATOM 6630  H HA   . ASP B 1 70 ? 15.456  -1.446  -3.836  1.00 2.07  ? 70 ASP B HA   3  
ATOM 6631  H HB2  . ASP B 1 70 ? 13.873  0.127   -1.787  1.00 2.46  ? 70 ASP B HB2  3  
ATOM 6632  H HB3  . ASP B 1 70 ? 15.637  0.114   -1.824  1.00 2.72  ? 70 ASP B HB3  3  
ATOM 6633  N N    . LYS B 1 71 ? 15.911  -3.376  -2.294  1.00 2.37  ? 71 LYS B N    3  
ATOM 6634  C CA   . LYS B 1 71 ? 16.269  -4.455  -1.315  1.00 3.06  ? 71 LYS B CA   3  
ATOM 6635  C C    . LYS B 1 71 ? 14.991  -5.209  -0.897  1.00 3.94  ? 71 LYS B C    3  
ATOM 6636  O O    . LYS B 1 71 ? 14.843  -5.612  0.243   1.00 4.55  ? 71 LYS B O    3  
ATOM 6637  C CB   . LYS B 1 71 ? 16.951  -3.836  -0.083  1.00 3.59  ? 71 LYS B CB   3  
ATOM 6638  C CG   . LYS B 1 71 ? 18.472  -3.844  -0.279  1.00 3.82  ? 71 LYS B CG   3  
ATOM 6639  C CD   . LYS B 1 71 ? 19.166  -3.704  1.081   1.00 4.61  ? 71 LYS B CD   3  
ATOM 6640  C CE   . LYS B 1 71 ? 19.457  -2.226  1.363   1.00 5.23  ? 71 LYS B CE   3  
ATOM 6641  N NZ   . LYS B 1 71 ? 20.675  -2.109  2.217   1.00 5.99  ? 71 LYS B NZ   3  
ATOM 6642  H H    . LYS B 1 71 ? 16.325  -3.374  -3.181  1.00 2.66  ? 71 LYS B H    3  
ATOM 6643  H HA   . LYS B 1 71 ? 16.948  -5.151  -1.788  1.00 3.09  ? 71 LYS B HA   3  
ATOM 6644  H HB2  . LYS B 1 71 ? 16.611  -2.820  0.045   1.00 3.68  ? 71 LYS B HB2  3  
ATOM 6645  H HB3  . LYS B 1 71 ? 16.703  -4.412  0.795   1.00 4.21  ? 71 LYS B HB3  3  
ATOM 6646  H HG2  . LYS B 1 71 ? 18.771  -4.773  -0.742  1.00 3.92  ? 71 LYS B HG2  3  
ATOM 6647  H HG3  . LYS B 1 71 ? 18.758  -3.017  -0.914  1.00 3.79  ? 71 LYS B HG3  3  
ATOM 6648  H HD2  . LYS B 1 71 ? 18.523  -4.099  1.854   1.00 4.80  ? 71 LYS B HD2  3  
ATOM 6649  H HD3  . LYS B 1 71 ? 20.094  -4.256  1.068   1.00 4.94  ? 71 LYS B HD3  3  
ATOM 6650  H HE2  . LYS B 1 71 ? 19.622  -1.706  0.430   1.00 5.31  ? 71 LYS B HE2  3  
ATOM 6651  H HE3  . LYS B 1 71 ? 18.615  -1.786  1.876   1.00 5.41  ? 71 LYS B HE3  3  
ATOM 6652  H HZ1  . LYS B 1 71 ? 21.468  -2.606  1.762   1.00 6.24  ? 71 LYS B HZ1  3  
ATOM 6653  H HZ2  . LYS B 1 71 ? 20.918  -1.105  2.337   1.00 6.23  ? 71 LYS B HZ2  3  
ATOM 6654  H HZ3  . LYS B 1 71 ? 20.488  -2.531  3.148   1.00 6.33  ? 71 LYS B HZ3  3  
ATOM 6655  N N    . SER B 1 72 ? 14.072  -5.393  -1.826  1.00 4.42  ? 72 SER B N    3  
ATOM 6656  C CA   . SER B 1 72 ? 12.788  -6.108  -1.529  1.00 5.58  ? 72 SER B CA   3  
ATOM 6657  C C    . SER B 1 72 ? 11.986  -5.325  -0.471  1.00 5.86  ? 72 SER B C    3  
ATOM 6658  O O    . SER B 1 72 ? 12.014  -5.705  0.692   1.00 5.92  ? 72 SER B O    3  
ATOM 6659  C CB   . SER B 1 72 ? 13.083  -7.538  -1.049  1.00 6.45  ? 72 SER B CB   3  
ATOM 6660  O OG   . SER B 1 72 ? 11.875  -8.289  -1.040  1.00 6.62  ? 72 SER B OG   3  
ATOM 6661  O OXT  . SER B 1 72 ? 11.354  -4.352  -0.848  1.00 6.32  ? 72 SER B OXT  3  
ATOM 6662  H H    . SER B 1 72 ? 14.229  -5.051  -2.731  1.00 4.24  ? 72 SER B H    3  
ATOM 6663  H HA   . SER B 1 72 ? 12.202  -6.157  -2.437  1.00 5.92  ? 72 SER B HA   3  
ATOM 6664  H HB2  . SER B 1 72 ? 13.785  -8.005  -1.721  1.00 6.89  ? 72 SER B HB2  3  
ATOM 6665  H HB3  . SER B 1 72 ? 13.508  -7.505  -0.055  1.00 6.83  ? 72 SER B HB3  3  
ATOM 6666  H HG   . SER B 1 72 ? 11.729  -8.631  -1.926  1.00 7.10  ? 72 SER B HG   3  
ATOM 6667  N N    . ALA A 1 1  ? 20.119  23.936  -20.475 1.00 14.80 ? 1  ALA A N    4  
ATOM 6668  C CA   . ALA A 1 1  ? 19.250  22.732  -20.316 1.00 14.12 ? 1  ALA A CA   4  
ATOM 6669  C C    . ALA A 1 1  ? 20.115  21.506  -19.997 1.00 13.40 ? 1  ALA A C    4  
ATOM 6670  O O    . ALA A 1 1  ? 21.210  21.357  -20.510 1.00 13.47 ? 1  ALA A O    4  
ATOM 6671  C CB   . ALA A 1 1  ? 18.473  22.484  -21.612 1.00 14.17 ? 1  ALA A CB   4  
ATOM 6672  H H1   . ALA A 1 1  ? 20.680  24.075  -19.610 1.00 14.91 ? 1  ALA A H1   4  
ATOM 6673  H H2   . ALA A 1 1  ? 20.757  23.800  -21.285 1.00 15.01 ? 1  ALA A H2   4  
ATOM 6674  H H3   . ALA A 1 1  ? 19.525  24.773  -20.641 1.00 15.11 ? 1  ALA A H3   4  
ATOM 6675  H HA   . ALA A 1 1  ? 18.553  22.899  -19.508 1.00 14.26 ? 1  ALA A HA   4  
ATOM 6676  H HB1  . ALA A 1 1  ? 19.133  22.608  -22.458 1.00 14.25 ? 1  ALA A HB1  4  
ATOM 6677  H HB2  . ALA A 1 1  ? 18.076  21.479  -21.608 1.00 14.03 ? 1  ALA A HB2  4  
ATOM 6678  H HB3  . ALA A 1 1  ? 17.660  23.191  -21.685 1.00 14.43 ? 1  ALA A HB3  4  
ATOM 6679  N N    . SER A 1 2  ? 19.627  20.630  -19.152 1.00 12.87 ? 2  SER A N    4  
ATOM 6680  C CA   . SER A 1 2  ? 20.407  19.407  -18.790 1.00 12.29 ? 2  SER A CA   4  
ATOM 6681  C C    . SER A 1 2  ? 19.502  18.175  -18.904 1.00 11.44 ? 2  SER A C    4  
ATOM 6682  O O    . SER A 1 2  ? 18.449  18.111  -18.295 1.00 11.39 ? 2  SER A O    4  
ATOM 6683  C CB   . SER A 1 2  ? 20.922  19.533  -17.354 1.00 12.48 ? 2  SER A CB   4  
ATOM 6684  O OG   . SER A 1 2  ? 21.931  20.534  -17.302 1.00 12.82 ? 2  SER A OG   4  
ATOM 6685  H H    . SER A 1 2  ? 18.743  20.776  -18.755 1.00 12.96 ? 2  SER A H    4  
ATOM 6686  H HA   . SER A 1 2  ? 21.245  19.300  -19.464 1.00 12.52 ? 2  SER A HA   4  
ATOM 6687  H HB2  . SER A 1 2  ? 20.111  19.813  -16.702 1.00 12.65 ? 2  SER A HB2  4  
ATOM 6688  H HB3  . SER A 1 2  ? 21.326  18.582  -17.032 1.00 12.40 ? 2  SER A HB3  4  
ATOM 6689  H HG   . SER A 1 2  ? 21.989  20.850  -16.398 1.00 12.81 ? 2  SER A HG   4  
ATOM 6690  N N    . VAL A 1 3  ? 19.905  17.199  -19.682 1.00 10.93 ? 3  VAL A N    4  
ATOM 6691  C CA   . VAL A 1 3  ? 19.069  15.967  -19.845 1.00 10.23 ? 3  VAL A CA   4  
ATOM 6692  C C    . VAL A 1 3  ? 19.148  15.112  -18.570 1.00 9.33  ? 3  VAL A C    4  
ATOM 6693  O O    . VAL A 1 3  ? 20.201  14.956  -17.978 1.00 9.35  ? 3  VAL A O    4  
ATOM 6694  C CB   . VAL A 1 3  ? 19.568  15.157  -21.055 1.00 10.49 ? 3  VAL A CB   4  
ATOM 6695  C CG1  . VAL A 1 3  ? 21.003  14.669  -20.816 1.00 10.45 ? 3  VAL A CG1  4  
ATOM 6696  C CG2  . VAL A 1 3  ? 18.650  13.950  -21.275 1.00 11.15 ? 3  VAL A CG2  4  
ATOM 6697  H H    . VAL A 1 3  ? 20.756  17.279  -20.163 1.00 11.13 ? 3  VAL A H    4  
ATOM 6698  H HA   . VAL A 1 3  ? 18.042  16.257  -20.013 1.00 10.38 ? 3  VAL A HA   4  
ATOM 6699  H HB   . VAL A 1 3  ? 19.549  15.786  -21.935 1.00 10.48 ? 3  VAL A HB   4  
ATOM 6700  H HG11 . VAL A 1 3  ? 21.538  15.398  -20.225 1.00 10.52 ? 3  VAL A HG11 4  
ATOM 6701  H HG12 . VAL A 1 3  ? 20.979  13.727  -20.290 1.00 10.71 ? 3  VAL A HG12 4  
ATOM 6702  H HG13 . VAL A 1 3  ? 21.501  14.540  -21.765 1.00 10.31 ? 3  VAL A HG13 4  
ATOM 6703  H HG21 . VAL A 1 3  ? 17.634  14.221  -21.034 1.00 11.32 ? 3  VAL A HG21 4  
ATOM 6704  H HG22 . VAL A 1 3  ? 18.705  13.639  -22.309 1.00 11.52 ? 3  VAL A HG22 4  
ATOM 6705  H HG23 . VAL A 1 3  ? 18.966  13.136  -20.638 1.00 11.26 ? 3  VAL A HG23 4  
ATOM 6706  N N    . ALA A 1 4  ? 18.036  14.558  -18.150 1.00 8.73  ? 4  ALA A N    4  
ATOM 6707  C CA   . ALA A 1 4  ? 18.028  13.709  -16.919 1.00 7.94  ? 4  ALA A CA   4  
ATOM 6708  C C    . ALA A 1 4  ? 18.107  12.229  -17.314 1.00 7.00  ? 4  ALA A C    4  
ATOM 6709  O O    . ALA A 1 4  ? 17.811  11.860  -18.436 1.00 7.01  ? 4  ALA A O    4  
ATOM 6710  C CB   . ALA A 1 4  ? 16.738  13.960  -16.133 1.00 8.20  ? 4  ALA A CB   4  
ATOM 6711  H H    . ALA A 1 4  ? 17.202  14.699  -18.648 1.00 8.94  ? 4  ALA A H    4  
ATOM 6712  H HA   . ALA A 1 4  ? 18.879  13.963  -16.303 1.00 8.12  ? 4  ALA A HA   4  
ATOM 6713  H HB1  . ALA A 1 4  ? 16.435  14.989  -16.256 1.00 8.35  ? 4  ALA A HB1  4  
ATOM 6714  H HB2  . ALA A 1 4  ? 15.959  13.308  -16.501 1.00 8.38  ? 4  ALA A HB2  4  
ATOM 6715  H HB3  . ALA A 1 4  ? 16.910  13.759  -15.086 1.00 8.32  ? 4  ALA A HB3  4  
ATOM 6716  N N    . THR A 1 5  ? 18.505  11.382  -16.396 1.00 6.46  ? 5  THR A N    4  
ATOM 6717  C CA   . THR A 1 5  ? 18.605  9.923   -16.706 1.00 5.78  ? 5  THR A CA   4  
ATOM 6718  C C    . THR A 1 5  ? 17.202  9.305   -16.704 1.00 4.91  ? 5  THR A C    4  
ATOM 6719  O O    . THR A 1 5  ? 16.620  9.073   -15.661 1.00 4.67  ? 5  THR A O    4  
ATOM 6720  C CB   . THR A 1 5  ? 19.479  9.229   -15.653 1.00 6.14  ? 5  THR A CB   4  
ATOM 6721  O OG1  . THR A 1 5  ? 19.033  9.579   -14.349 1.00 6.54  ? 5  THR A OG1  4  
ATOM 6722  C CG2  . THR A 1 5  ? 20.936  9.662   -15.830 1.00 6.80  ? 5  THR A CG2  4  
ATOM 6723  H H    . THR A 1 5  ? 18.736  11.707  -15.500 1.00 6.71  ? 5  THR A H    4  
ATOM 6724  H HA   . THR A 1 5  ? 19.050  9.796   -17.682 1.00 5.96  ? 5  THR A HA   4  
ATOM 6725  H HB   . THR A 1 5  ? 19.410  8.159   -15.780 1.00 5.97  ? 5  THR A HB   4  
ATOM 6726  H HG1  . THR A 1 5  ? 18.497  8.857   -14.014 1.00 6.80  ? 5  THR A HG1  4  
ATOM 6727  H HG21 . THR A 1 5  ? 20.983  10.736  -15.935 1.00 6.85  ? 5  THR A HG21 4  
ATOM 6728  H HG22 . THR A 1 5  ? 21.509  9.360   -14.966 1.00 7.20  ? 5  THR A HG22 4  
ATOM 6729  H HG23 . THR A 1 5  ? 21.345  9.197   -16.715 1.00 7.12  ? 5  THR A HG23 4  
ATOM 6730  N N    . GLU A 1 6  ? 16.656  9.043   -17.869 1.00 4.60  ? 6  GLU A N    4  
ATOM 6731  C CA   . GLU A 1 6  ? 15.288  8.446   -17.953 1.00 3.81  ? 6  GLU A CA   4  
ATOM 6732  C C    . GLU A 1 6  ? 14.894  8.260   -19.423 1.00 3.24  ? 6  GLU A C    4  
ATOM 6733  O O    . GLU A 1 6  ? 14.509  9.198   -20.098 1.00 3.60  ? 6  GLU A O    4  
ATOM 6734  C CB   . GLU A 1 6  ? 14.263  9.365   -17.262 1.00 4.36  ? 6  GLU A CB   4  
ATOM 6735  C CG   . GLU A 1 6  ? 14.513  10.830  -17.650 1.00 5.18  ? 6  GLU A CG   4  
ATOM 6736  C CD   . GLU A 1 6  ? 13.181  11.506  -17.986 1.00 5.79  ? 6  GLU A CD   4  
ATOM 6737  O OE1  . GLU A 1 6  ? 12.761  11.414  -19.129 1.00 6.16  ? 6  GLU A OE1  4  
ATOM 6738  O OE2  . GLU A 1 6  ? 12.604  12.108  -17.095 1.00 6.17  ? 6  GLU A OE2  4  
ATOM 6739  H H    . GLU A 1 6  ? 17.147  9.243   -18.693 1.00 5.01  ? 6  GLU A H    4  
ATOM 6740  H HA   . GLU A 1 6  ? 15.290  7.484   -17.460 1.00 3.44  ? 6  GLU A HA   4  
ATOM 6741  H HB2  . GLU A 1 6  ? 13.267  9.079   -17.563 1.00 4.83  ? 6  GLU A HB2  4  
ATOM 6742  H HB3  . GLU A 1 6  ? 14.355  9.261   -16.191 1.00 4.03  ? 6  GLU A HB3  4  
ATOM 6743  H HG2  . GLU A 1 6  ? 14.981  11.345  -16.825 1.00 5.45  ? 6  GLU A HG2  4  
ATOM 6744  H HG3  . GLU A 1 6  ? 15.161  10.870  -18.513 1.00 5.43  ? 6  GLU A HG3  4  
ATOM 6745  N N    . LEU A 1 7  ? 14.967  7.048   -19.919 1.00 2.59  ? 7  LEU A N    4  
ATOM 6746  C CA   . LEU A 1 7  ? 14.577  6.778   -21.329 1.00 2.31  ? 7  LEU A CA   4  
ATOM 6747  C C    . LEU A 1 7  ? 13.358  5.876   -21.275 1.00 1.55  ? 7  LEU A C    4  
ATOM 6748  O O    . LEU A 1 7  ? 12.286  6.208   -21.744 1.00 1.73  ? 7  LEU A O    4  
ATOM 6749  C CB   . LEU A 1 7  ? 15.683  6.045   -22.114 1.00 2.51  ? 7  LEU A CB   4  
ATOM 6750  C CG   . LEU A 1 7  ? 17.075  6.234   -21.500 1.00 3.14  ? 7  LEU A CG   4  
ATOM 6751  C CD1  . LEU A 1 7  ? 17.340  7.714   -21.201 1.00 3.94  ? 7  LEU A CD1  4  
ATOM 6752  C CD2  . LEU A 1 7  ? 17.167  5.407   -20.221 1.00 3.07  ? 7  LEU A CD2  4  
ATOM 6753  H H    . LEU A 1 7  ? 15.256  6.307   -19.357 1.00 2.53  ? 7  LEU A H    4  
ATOM 6754  H HA   . LEU A 1 7  ? 14.335  7.700   -21.816 1.00 2.80  ? 7  LEU A HA   4  
ATOM 6755  H HB2  . LEU A 1 7  ? 15.457  4.991   -22.142 1.00 2.07  ? 7  LEU A HB2  4  
ATOM 6756  H HB3  . LEU A 1 7  ? 15.689  6.420   -23.109 1.00 2.88  ? 7  LEU A HB3  4  
ATOM 6757  H HG   . LEU A 1 7  ? 17.818  5.882   -22.202 1.00 3.32  ? 7  LEU A HG   4  
ATOM 6758  H HD11 . LEU A 1 7  ? 16.591  8.322   -21.687 1.00 4.28  ? 7  LEU A HD11 4  
ATOM 6759  H HD12 . LEU A 1 7  ? 17.300  7.878   -20.134 1.00 4.27  ? 7  LEU A HD12 4  
ATOM 6760  H HD13 . LEU A 1 7  ? 18.318  7.985   -21.569 1.00 4.25  ? 7  LEU A HD13 4  
ATOM 6761  H HD21 . LEU A 1 7  ? 16.317  4.741   -20.168 1.00 3.36  ? 7  LEU A HD21 4  
ATOM 6762  H HD22 . LEU A 1 7  ? 18.076  4.833   -20.231 1.00 3.18  ? 7  LEU A HD22 4  
ATOM 6763  H HD23 . LEU A 1 7  ? 17.159  6.068   -19.368 1.00 3.21  ? 7  LEU A HD23 4  
ATOM 6764  N N    . ARG A 1 8  ? 13.542  4.736   -20.668 1.00 1.31  ? 8  ARG A N    4  
ATOM 6765  C CA   . ARG A 1 8  ? 12.445  3.751   -20.504 1.00 1.48  ? 8  ARG A CA   4  
ATOM 6766  C C    . ARG A 1 8  ? 11.285  4.412   -19.754 1.00 1.32  ? 8  ARG A C    4  
ATOM 6767  O O    . ARG A 1 8  ? 10.145  4.365   -20.180 1.00 1.92  ? 8  ARG A O    4  
ATOM 6768  C CB   . ARG A 1 8  ? 12.981  2.587   -19.673 1.00 2.16  ? 8  ARG A CB   4  
ATOM 6769  C CG   . ARG A 1 8  ? 13.261  1.382   -20.579 1.00 2.68  ? 8  ARG A CG   4  
ATOM 6770  C CD   . ARG A 1 8  ? 11.942  0.790   -21.081 1.00 2.99  ? 8  ARG A CD   4  
ATOM 6771  N NE   . ARG A 1 8  ? 11.273  0.041   -19.978 1.00 3.47  ? 8  ARG A NE   4  
ATOM 6772  C CZ   . ARG A 1 8  ? 9.969   -0.012  -19.920 1.00 3.94  ? 8  ARG A CZ   4  
ATOM 6773  N NH1  . ARG A 1 8  ? 9.319   -0.896  -20.634 1.00 4.33  ? 8  ARG A NH1  4  
ATOM 6774  N NH2  . ARG A 1 8  ? 9.315   0.821   -19.152 1.00 4.42  ? 8  ARG A NH2  4  
ATOM 6775  H H    . ARG A 1 8  ? 14.426  4.533   -20.300 1.00 1.63  ? 8  ARG A H    4  
ATOM 6776  H HA   . ARG A 1 8  ? 12.120  3.400   -21.464 1.00 1.84  ? 8  ARG A HA   4  
ATOM 6777  H HB2  . ARG A 1 8  ? 13.900  2.899   -19.189 1.00 2.23  ? 8  ARG A HB2  4  
ATOM 6778  H HB3  . ARG A 1 8  ? 12.254  2.318   -18.922 1.00 2.53  ? 8  ARG A HB3  4  
ATOM 6779  H HG2  . ARG A 1 8  ? 13.857  1.701   -21.423 1.00 2.98  ? 8  ARG A HG2  4  
ATOM 6780  H HG3  . ARG A 1 8  ? 13.802  0.631   -20.022 1.00 2.97  ? 8  ARG A HG3  4  
ATOM 6781  H HD2  . ARG A 1 8  ? 11.295  1.586   -21.419 1.00 3.17  ? 8  ARG A HD2  4  
ATOM 6782  H HD3  . ARG A 1 8  ? 12.141  0.118   -21.904 1.00 3.16  ? 8  ARG A HD3  4  
ATOM 6783  H HE   . ARG A 1 8  ? 11.812  -0.413  -19.297 1.00 3.66  ? 8  ARG A HE   4  
ATOM 6784  H HH11 . ARG A 1 8  ? 9.821   -1.531  -21.222 1.00 4.37  ? 8  ARG A HH11 4  
ATOM 6785  H HH12 . ARG A 1 8  ? 8.321   -0.938  -20.592 1.00 4.82  ? 8  ARG A HH12 4  
ATOM 6786  H HH21 . ARG A 1 8  ? 9.813   1.496   -18.607 1.00 4.48  ? 8  ARG A HH21 4  
ATOM 6787  H HH22 . ARG A 1 8  ? 8.316   0.782   -19.106 1.00 4.97  ? 8  ARG A HH22 4  
ATOM 6788  N N    . CYS A 1 9  ? 11.590  5.033   -18.638 1.00 0.86  ? 9  CYS A N    4  
ATOM 6789  C CA   . CYS A 1 9  ? 10.542  5.722   -17.822 1.00 0.66  ? 9  CYS A CA   4  
ATOM 6790  C C    . CYS A 1 9  ? 9.961   6.894   -18.626 1.00 0.61  ? 9  CYS A C    4  
ATOM 6791  O O    . CYS A 1 9  ? 10.644  7.526   -19.411 1.00 0.84  ? 9  CYS A O    4  
ATOM 6792  C CB   . CYS A 1 9  ? 11.151  6.245   -16.507 1.00 0.66  ? 9  CYS A CB   4  
ATOM 6793  S SG   . CYS A 1 9  ? 12.482  5.125   -15.958 1.00 0.94  ? 9  CYS A SG   4  
ATOM 6794  H H    . CYS A 1 9  ? 12.519  5.043   -18.338 1.00 1.09  ? 9  CYS A H    4  
ATOM 6795  H HA   . CYS A 1 9  ? 9.752   5.019   -17.595 1.00 0.74  ? 9  CYS A HA   4  
ATOM 6796  H HB2  . CYS A 1 9  ? 11.531  7.240   -16.660 1.00 0.78  ? 9  CYS A HB2  4  
ATOM 6797  H HB3  . CYS A 1 9  ? 10.382  6.275   -15.753 1.00 0.69  ? 9  CYS A HB3  4  
ATOM 6798  N N    . GLN A 1 10 ? 8.696   7.168   -18.440 1.00 0.51  ? 10 GLN A N    4  
ATOM 6799  C CA   . GLN A 1 10 ? 8.026   8.280   -19.192 1.00 0.47  ? 10 GLN A CA   4  
ATOM 6800  C C    . GLN A 1 10 ? 7.492   9.358   -18.232 1.00 0.39  ? 10 GLN A C    4  
ATOM 6801  O O    . GLN A 1 10 ? 6.967   10.366  -18.668 1.00 0.40  ? 10 GLN A O    4  
ATOM 6802  C CB   . GLN A 1 10 ? 6.837   7.696   -19.943 1.00 0.53  ? 10 GLN A CB   4  
ATOM 6803  C CG   . GLN A 1 10 ? 7.139   7.624   -21.446 1.00 0.64  ? 10 GLN A CG   4  
ATOM 6804  C CD   . GLN A 1 10 ? 6.701   8.921   -22.135 1.00 1.20  ? 10 GLN A CD   4  
ATOM 6805  O OE1  . GLN A 1 10 ? 7.265   9.970   -21.897 1.00 1.87  ? 10 GLN A OE1  4  
ATOM 6806  N NE2  . GLN A 1 10 ? 5.715   8.894   -22.994 1.00 1.84  ? 10 GLN A NE2  4  
ATOM 6807  H H    . GLN A 1 10 ? 8.178   6.630   -17.810 1.00 0.64  ? 10 GLN A H    4  
ATOM 6808  H HA   . GLN A 1 10 ? 8.717   8.722   -19.894 1.00 0.52  ? 10 GLN A HA   4  
ATOM 6809  H HB2  . GLN A 1 10 ? 6.637   6.703   -19.565 1.00 0.58  ? 10 GLN A HB2  4  
ATOM 6810  H HB3  . GLN A 1 10 ? 5.977   8.320   -19.771 1.00 0.50  ? 10 GLN A HB3  4  
ATOM 6811  H HG2  . GLN A 1 10 ? 8.200   7.480   -21.590 1.00 1.10  ? 10 GLN A HG2  4  
ATOM 6812  H HG3  . GLN A 1 10 ? 6.603   6.791   -21.877 1.00 1.15  ? 10 GLN A HG3  4  
ATOM 6813  H HE21 . GLN A 1 10 ? 5.259   8.049   -23.193 1.00 2.04  ? 10 GLN A HE21 4  
ATOM 6814  H HE22 . GLN A 1 10 ? 5.429   9.720   -23.439 1.00 2.45  ? 10 GLN A HE22 4  
ATOM 6815  N N    . CYS A 1 11 ? 7.593   9.132   -16.940 1.00 0.34  ? 11 CYS A N    4  
ATOM 6816  C CA   . CYS A 1 11 ? 7.069   10.105  -15.916 1.00 0.31  ? 11 CYS A CA   4  
ATOM 6817  C C    . CYS A 1 11 ? 7.244   11.562  -16.360 1.00 0.36  ? 11 CYS A C    4  
ATOM 6818  O O    . CYS A 1 11 ? 8.281   11.955  -16.863 1.00 0.50  ? 11 CYS A O    4  
ATOM 6819  C CB   . CYS A 1 11 ? 7.813   9.910   -14.600 1.00 0.30  ? 11 CYS A CB   4  
ATOM 6820  S SG   . CYS A 1 11 ? 7.446   8.278   -13.923 1.00 0.30  ? 11 CYS A SG   4  
ATOM 6821  H H    . CYS A 1 11 ? 7.998   8.297   -16.637 1.00 0.36  ? 11 CYS A H    4  
ATOM 6822  H HA   . CYS A 1 11 ? 6.020   9.911   -15.746 1.00 0.31  ? 11 CYS A HA   4  
ATOM 6823  H HB2  . CYS A 1 11 ? 8.873   9.997   -14.770 1.00 0.34  ? 11 CYS A HB2  4  
ATOM 6824  H HB3  . CYS A 1 11 ? 7.501   10.664  -13.903 1.00 0.31  ? 11 CYS A HB3  4  
ATOM 6825  N N    . LEU A 1 12 ? 6.233   12.366  -16.139 1.00 0.40  ? 12 LEU A N    4  
ATOM 6826  C CA   . LEU A 1 12 ? 6.303   13.809  -16.502 1.00 0.44  ? 12 LEU A CA   4  
ATOM 6827  C C    . LEU A 1 12 ? 7.205   14.511  -15.482 1.00 0.45  ? 12 LEU A C    4  
ATOM 6828  O O    . LEU A 1 12 ? 8.302   14.940  -15.786 1.00 0.48  ? 12 LEU A O    4  
ATOM 6829  C CB   . LEU A 1 12 ? 4.891   14.395  -16.438 1.00 0.49  ? 12 LEU A CB   4  
ATOM 6830  C CG   . LEU A 1 12 ? 4.241   14.307  -17.817 1.00 0.82  ? 12 LEU A CG   4  
ATOM 6831  C CD1  . LEU A 1 12 ? 3.687   12.899  -18.042 1.00 1.04  ? 12 LEU A CD1  4  
ATOM 6832  C CD2  . LEU A 1 12 ? 3.105   15.316  -17.889 1.00 1.56  ? 12 LEU A CD2  4  
ATOM 6833  H H    . LEU A 1 12 ? 5.425   12.019  -15.707 1.00 0.49  ? 12 LEU A H    4  
ATOM 6834  H HA   . LEU A 1 12 ? 6.697   13.928  -17.498 1.00 0.48  ? 12 LEU A HA   4  
ATOM 6835  H HB2  . LEU A 1 12 ? 4.300   13.836  -15.725 1.00 0.97  ? 12 LEU A HB2  4  
ATOM 6836  H HB3  . LEU A 1 12 ? 4.942   15.429  -16.131 1.00 0.98  ? 12 LEU A HB3  4  
ATOM 6837  H HG   . LEU A 1 12 ? 4.975   14.533  -18.578 1.00 1.56  ? 12 LEU A HG   4  
ATOM 6838  H HD11 . LEU A 1 12 ? 4.480   12.176  -17.926 1.00 1.40  ? 12 LEU A HD11 4  
ATOM 6839  H HD12 . LEU A 1 12 ? 2.909   12.699  -17.320 1.00 1.31  ? 12 LEU A HD12 4  
ATOM 6840  H HD13 . LEU A 1 12 ? 3.277   12.828  -19.038 1.00 1.71  ? 12 LEU A HD13 4  
ATOM 6841  H HD21 . LEU A 1 12 ? 2.519   15.258  -16.984 1.00 2.03  ? 12 LEU A HD21 4  
ATOM 6842  H HD22 . LEU A 1 12 ? 3.514   16.309  -17.990 1.00 2.07  ? 12 LEU A HD22 4  
ATOM 6843  H HD23 . LEU A 1 12 ? 2.480   15.091  -18.739 1.00 2.10  ? 12 LEU A HD23 4  
ATOM 6844  N N    . GLN A 1 13 ? 6.732   14.599  -14.268 1.00 0.43  ? 13 GLN A N    4  
ATOM 6845  C CA   . GLN A 1 13 ? 7.502   15.235  -13.161 1.00 0.45  ? 13 GLN A CA   4  
ATOM 6846  C C    . GLN A 1 13 ? 6.793   14.877  -11.848 1.00 0.42  ? 13 GLN A C    4  
ATOM 6847  O O    . GLN A 1 13 ? 6.592   15.711  -10.988 1.00 0.60  ? 13 GLN A O    4  
ATOM 6848  C CB   . GLN A 1 13 ? 7.521   16.758  -13.346 1.00 0.52  ? 13 GLN A CB   4  
ATOM 6849  C CG   . GLN A 1 13 ? 6.334   17.219  -14.205 1.00 1.11  ? 13 GLN A CG   4  
ATOM 6850  C CD   . GLN A 1 13 ? 6.011   18.680  -13.882 1.00 1.40  ? 13 GLN A CD   4  
ATOM 6851  O OE1  . GLN A 1 13 ? 6.402   19.573  -14.607 1.00 1.77  ? 13 GLN A OE1  4  
ATOM 6852  N NE2  . GLN A 1 13 ? 5.309   18.963  -12.818 1.00 2.09  ? 13 GLN A NE2  4  
ATOM 6853  H H    . GLN A 1 13 ? 5.855   14.233  -14.078 1.00 0.42  ? 13 GLN A H    4  
ATOM 6854  H HA   . GLN A 1 13 ? 8.510   14.848  -13.148 1.00 0.46  ? 13 GLN A HA   4  
ATOM 6855  H HB2  . GLN A 1 13 ? 7.484   17.243  -12.384 1.00 0.98  ? 13 GLN A HB2  4  
ATOM 6856  H HB3  . GLN A 1 13 ? 8.430   17.022  -13.847 1.00 0.85  ? 13 GLN A HB3  4  
ATOM 6857  H HG2  . GLN A 1 13 ? 6.589   17.127  -15.251 1.00 1.50  ? 13 GLN A HG2  4  
ATOM 6858  H HG3  . GLN A 1 13 ? 5.472   16.606  -13.989 1.00 1.66  ? 13 GLN A HG3  4  
ATOM 6859  H HE21 . GLN A 1 13 ? 4.992   18.244  -12.232 1.00 2.59  ? 13 GLN A HE21 4  
ATOM 6860  H HE22 . GLN A 1 13 ? 5.099   19.897  -12.604 1.00 2.41  ? 13 GLN A HE22 4  
ATOM 6861  N N    . THR A 1 14 ? 6.387   13.627  -11.740 1.00 0.36  ? 14 THR A N    4  
ATOM 6862  C CA   . THR A 1 14 ? 5.631   13.096  -10.557 1.00 0.32  ? 14 THR A CA   4  
ATOM 6863  C C    . THR A 1 14 ? 4.815   14.165  -9.831  1.00 0.35  ? 14 THR A C    4  
ATOM 6864  O O    . THR A 1 14 ? 5.308   14.894  -8.987  1.00 0.39  ? 14 THR A O    4  
ATOM 6865  C CB   . THR A 1 14 ? 6.524   12.392  -9.556  1.00 0.32  ? 14 THR A CB   4  
ATOM 6866  O OG1  . THR A 1 14 ? 7.688   13.171  -9.287  1.00 0.38  ? 14 THR A OG1  4  
ATOM 6867  C CG2  . THR A 1 14 ? 6.907   11.021  -10.116 1.00 0.31  ? 14 THR A CG2  4  
ATOM 6868  H H    . THR A 1 14 ? 6.563   13.017  -12.487 1.00 0.51  ? 14 THR A H    4  
ATOM 6869  H HA   . THR A 1 14 ? 4.945   12.366  -10.931 1.00 0.30  ? 14 THR A HA   4  
ATOM 6870  H HB   . THR A 1 14 ? 5.950   12.251  -8.648  1.00 0.32  ? 14 THR A HB   4  
ATOM 6871  H HG1  . THR A 1 14 ? 8.281   13.097  -10.039 1.00 0.69  ? 14 THR A HG1  4  
ATOM 6872  H HG21 . THR A 1 14 ? 6.017   10.523  -10.476 1.00 1.05  ? 14 THR A HG21 4  
ATOM 6873  H HG22 . THR A 1 14 ? 7.602   11.146  -10.931 1.00 1.08  ? 14 THR A HG22 4  
ATOM 6874  H HG23 . THR A 1 14 ? 7.362   10.429  -9.338  1.00 1.01  ? 14 THR A HG23 4  
ATOM 6875  N N    . LEU A 1 15 ? 3.552   14.217  -10.132 1.00 0.36  ? 15 LEU A N    4  
ATOM 6876  C CA   . LEU A 1 15 ? 2.648   15.190  -9.454  1.00 0.41  ? 15 LEU A CA   4  
ATOM 6877  C C    . LEU A 1 15 ? 2.349   14.679  -8.037  1.00 0.35  ? 15 LEU A C    4  
ATOM 6878  O O    . LEU A 1 15 ? 2.606   13.534  -7.717  1.00 0.52  ? 15 LEU A O    4  
ATOM 6879  C CB   . LEU A 1 15 ? 1.350   15.324  -10.255 1.00 0.57  ? 15 LEU A CB   4  
ATOM 6880  C CG   . LEU A 1 15 ? 1.659   15.985  -11.604 1.00 0.64  ? 15 LEU A CG   4  
ATOM 6881  C CD1  . LEU A 1 15 ? 0.610   15.567  -12.637 1.00 0.74  ? 15 LEU A CD1  4  
ATOM 6882  C CD2  . LEU A 1 15 ? 1.641   17.507  -11.441 1.00 1.76  ? 15 LEU A CD2  4  
ATOM 6883  H H    . LEU A 1 15 ? 3.189   13.580  -10.789 1.00 0.35  ? 15 LEU A H    4  
ATOM 6884  H HA   . LEU A 1 15 ? 3.138   16.152  -9.392  1.00 0.51  ? 15 LEU A HA   4  
ATOM 6885  H HB2  . LEU A 1 15 ? 0.924   14.344  -10.418 1.00 1.12  ? 15 LEU A HB2  4  
ATOM 6886  H HB3  . LEU A 1 15 ? 0.649   15.937  -9.708  1.00 0.90  ? 15 LEU A HB3  4  
ATOM 6887  H HG   . LEU A 1 15 ? 2.637   15.670  -11.940 1.00 1.32  ? 15 LEU A HG   4  
ATOM 6888  H HD11 . LEU A 1 15 ? 0.206   14.601  -12.372 1.00 1.31  ? 15 LEU A HD11 4  
ATOM 6889  H HD12 . LEU A 1 15 ? -0.186  16.296  -12.659 1.00 1.29  ? 15 LEU A HD12 4  
ATOM 6890  H HD13 . LEU A 1 15 ? 1.070   15.508  -13.612 1.00 1.44  ? 15 LEU A HD13 4  
ATOM 6891  H HD21 . LEU A 1 15 ? 2.137   17.775  -10.519 1.00 2.29  ? 15 LEU A HD21 4  
ATOM 6892  H HD22 . LEU A 1 15 ? 2.156   17.964  -12.272 1.00 2.30  ? 15 LEU A HD22 4  
ATOM 6893  H HD23 . LEU A 1 15 ? 0.619   17.854  -11.413 1.00 2.30  ? 15 LEU A HD23 4  
ATOM 6894  N N    . GLN A 1 16 ? 1.834   15.521  -7.182  1.00 0.47  ? 16 GLN A N    4  
ATOM 6895  C CA   . GLN A 1 16 ? 1.551   15.085  -5.784  1.00 0.41  ? 16 GLN A CA   4  
ATOM 6896  C C    . GLN A 1 16 ? 0.061   14.811  -5.590  1.00 0.39  ? 16 GLN A C    4  
ATOM 6897  O O    . GLN A 1 16 ? -0.635  15.521  -4.885  1.00 0.47  ? 16 GLN A O    4  
ATOM 6898  C CB   . GLN A 1 16 ? 2.028   16.160  -4.801  1.00 0.48  ? 16 GLN A CB   4  
ATOM 6899  C CG   . GLN A 1 16 ? 3.391   15.759  -4.231  1.00 0.60  ? 16 GLN A CG   4  
ATOM 6900  C CD   . GLN A 1 16 ? 3.675   16.565  -2.960  1.00 0.77  ? 16 GLN A CD   4  
ATOM 6901  O OE1  . GLN A 1 16 ? 3.043   16.359  -1.942  1.00 1.48  ? 16 GLN A OE1  4  
ATOM 6902  N NE2  . GLN A 1 16 ? 4.607   17.480  -2.975  1.00 1.31  ? 16 GLN A NE2  4  
ATOM 6903  H H    . GLN A 1 16 ? 1.651   16.436  -7.452  1.00 0.72  ? 16 GLN A H    4  
ATOM 6904  H HA   . GLN A 1 16 ? 2.088   14.168  -5.593  1.00 0.43  ? 16 GLN A HA   4  
ATOM 6905  H HB2  . GLN A 1 16 ? 2.117   17.106  -5.316  1.00 0.51  ? 16 GLN A HB2  4  
ATOM 6906  H HB3  . GLN A 1 16 ? 1.317   16.255  -3.994  1.00 0.49  ? 16 GLN A HB3  4  
ATOM 6907  H HG2  . GLN A 1 16 ? 3.384   14.704  -3.994  1.00 0.75  ? 16 GLN A HG2  4  
ATOM 6908  H HG3  . GLN A 1 16 ? 4.159   15.959  -4.961  1.00 0.72  ? 16 GLN A HG3  4  
ATOM 6909  H HE21 . GLN A 1 16 ? 5.118   17.647  -3.794  1.00 1.98  ? 16 GLN A HE21 4  
ATOM 6910  H HE22 . GLN A 1 16 ? 4.795   18.000  -2.165  1.00 1.46  ? 16 GLN A HE22 4  
ATOM 6911  N N    . GLY A 1 17 ? -0.418  13.756  -6.191  1.00 0.36  ? 17 GLY A N    4  
ATOM 6912  C CA   . GLY A 1 17 ? -1.846  13.364  -6.033  1.00 0.45  ? 17 GLY A CA   4  
ATOM 6913  C C    . GLY A 1 17 ? -2.762  14.384  -6.693  1.00 0.41  ? 17 GLY A C    4  
ATOM 6914  O O    . GLY A 1 17 ? -3.323  15.243  -6.037  1.00 0.57  ? 17 GLY A O    4  
ATOM 6915  H H    . GLY A 1 17 ? 0.178   13.201  -6.735  1.00 0.34  ? 17 GLY A H    4  
ATOM 6916  H HA2  . GLY A 1 17 ? -2.001  12.399  -6.490  1.00 0.56  ? 17 GLY A HA2  4  
ATOM 6917  H HA3  . GLY A 1 17 ? -2.085  13.303  -4.983  1.00 0.59  ? 17 GLY A HA3  4  
ATOM 6918  N N    . ILE A 1 18 ? -2.944  14.276  -7.981  1.00 0.39  ? 18 ILE A N    4  
ATOM 6919  C CA   . ILE A 1 18 ? -3.856  15.216  -8.682  1.00 0.49  ? 18 ILE A CA   4  
ATOM 6920  C C    . ILE A 1 18 ? -5.289  14.700  -8.517  1.00 0.50  ? 18 ILE A C    4  
ATOM 6921  O O    . ILE A 1 18 ? -5.534  13.761  -7.776  1.00 0.72  ? 18 ILE A O    4  
ATOM 6922  C CB   . ILE A 1 18 ? -3.460  15.356  -10.171 1.00 0.67  ? 18 ILE A CB   4  
ATOM 6923  C CG1  . ILE A 1 18 ? -4.145  14.292  -11.042 1.00 0.72  ? 18 ILE A CG1  4  
ATOM 6924  C CG2  . ILE A 1 18 ? -1.940  15.238  -10.327 1.00 0.74  ? 18 ILE A CG2  4  
ATOM 6925  C CD1  . ILE A 1 18 ? -3.876  12.903  -10.479 1.00 0.66  ? 18 ILE A CD1  4  
ATOM 6926  H H    . ILE A 1 18 ? -2.504  13.561  -8.478  1.00 0.45  ? 18 ILE A H    4  
ATOM 6927  H HA   . ILE A 1 18 ? -3.790  16.179  -8.214  1.00 0.54  ? 18 ILE A HA   4  
ATOM 6928  H HB   . ILE A 1 18 ? -3.760  16.331  -10.508 1.00 0.79  ? 18 ILE A HB   4  
ATOM 6929  H HG12 . ILE A 1 18 ? -5.209  14.473  -11.059 1.00 0.70  ? 18 ILE A HG12 4  
ATOM 6930  H HG13 . ILE A 1 18 ? -3.757  14.350  -12.048 1.00 0.91  ? 18 ILE A HG13 4  
ATOM 6931  H HG21 . ILE A 1 18 ? -1.453  15.667  -9.463  1.00 1.14  ? 18 ILE A HG21 4  
ATOM 6932  H HG22 . ILE A 1 18 ? -1.663  14.197  -10.414 1.00 1.33  ? 18 ILE A HG22 4  
ATOM 6933  H HG23 . ILE A 1 18 ? -1.627  15.769  -11.214 1.00 1.17  ? 18 ILE A HG23 4  
ATOM 6934  H HD11 . ILE A 1 18 ? -2.815  12.779  -10.327 1.00 1.04  ? 18 ILE A HD11 4  
ATOM 6935  H HD12 . ILE A 1 18 ? -4.390  12.794  -9.537  1.00 1.35  ? 18 ILE A HD12 4  
ATOM 6936  H HD13 . ILE A 1 18 ? -4.233  12.162  -11.173 1.00 1.18  ? 18 ILE A HD13 4  
ATOM 6937  N N    . HIS A 1 19 ? -6.235  15.292  -9.180  1.00 0.45  ? 19 HIS A N    4  
ATOM 6938  C CA   . HIS A 1 19 ? -7.636  14.819  -9.035  1.00 0.47  ? 19 HIS A CA   4  
ATOM 6939  C C    . HIS A 1 19 ? -7.949  13.845  -10.191 1.00 0.39  ? 19 HIS A C    4  
ATOM 6940  O O    . HIS A 1 19 ? -7.451  14.024  -11.289 1.00 0.35  ? 19 HIS A O    4  
ATOM 6941  C CB   . HIS A 1 19 ? -8.579  16.041  -9.006  1.00 0.54  ? 19 HIS A CB   4  
ATOM 6942  C CG   . HIS A 1 19 ? -9.604  15.983  -10.102 1.00 0.60  ? 19 HIS A CG   4  
ATOM 6943  N ND1  . HIS A 1 19 ? -10.957 15.866  -9.840  1.00 0.75  ? 19 HIS A ND1  4  
ATOM 6944  C CD2  . HIS A 1 19 ? -9.487  16.045  -11.463 1.00 0.60  ? 19 HIS A CD2  4  
ATOM 6945  C CE1  . HIS A 1 19 ? -11.596 15.864  -11.021 1.00 0.81  ? 19 HIS A CE1  4  
ATOM 6946  N NE2  . HIS A 1 19 ? -10.746 15.973  -12.045 1.00 0.74  ? 19 HIS A NE2  4  
ATOM 6947  H H    . HIS A 1 19 ? -6.023  16.042  -9.771  1.00 0.55  ? 19 HIS A H    4  
ATOM 6948  H HA   . HIS A 1 19 ? -7.713  14.293  -8.097  1.00 0.50  ? 19 HIS A HA   4  
ATOM 6949  H HB2  . HIS A 1 19 ? -9.085  16.070  -8.054  1.00 0.64  ? 19 HIS A HB2  4  
ATOM 6950  H HB3  . HIS A 1 19 ? -7.991  16.942  -9.117  1.00 0.52  ? 19 HIS A HB3  4  
ATOM 6951  H HD1  . HIS A 1 19 ? -11.374 15.800  -8.955  1.00 0.84  ? 19 HIS A HD1  4  
ATOM 6952  H HD2  . HIS A 1 19 ? -8.552  16.112  -12.000 1.00 0.55  ? 19 HIS A HD2  4  
ATOM 6953  H HE1  . HIS A 1 19 ? -12.665 15.764  -11.128 1.00 0.93  ? 19 HIS A HE1  4  
ATOM 6954  N N    . PRO A 1 20 ? -8.732  12.821  -9.909  1.00 0.39  ? 20 PRO A N    4  
ATOM 6955  C CA   . PRO A 1 20 ? -9.084  11.798  -10.909 1.00 0.35  ? 20 PRO A CA   4  
ATOM 6956  C C    . PRO A 1 20 ? -10.125 12.327  -11.914 1.00 0.37  ? 20 PRO A C    4  
ATOM 6957  O O    . PRO A 1 20 ? -9.840  13.270  -12.627 1.00 0.43  ? 20 PRO A O    4  
ATOM 6958  C CB   . PRO A 1 20 ? -9.595  10.628  -10.061 1.00 0.40  ? 20 PRO A CB   4  
ATOM 6959  C CG   . PRO A 1 20 ? -10.053 11.234  -8.718  1.00 0.47  ? 20 PRO A CG   4  
ATOM 6960  C CD   . PRO A 1 20 ? -9.333  12.583  -8.579  1.00 0.46  ? 20 PRO A CD   4  
ATOM 6961  H HA   . PRO A 1 20 ? -8.197  11.493  -11.441 1.00 0.32  ? 20 PRO A HA   4  
ATOM 6962  H HB2  . PRO A 1 20 ? -10.414 10.132  -10.552 1.00 0.40  ? 20 PRO A HB2  4  
ATOM 6963  H HB3  . PRO A 1 20 ? -8.794  9.928   -9.884  1.00 0.40  ? 20 PRO A HB3  4  
ATOM 6964  H HG2  . PRO A 1 20 ? -11.124 11.383  -8.727  1.00 0.50  ? 20 PRO A HG2  4  
ATOM 6965  H HG3  . PRO A 1 20 ? -9.772  10.587  -7.904  1.00 0.52  ? 20 PRO A HG3  4  
ATOM 6966  H HD2  . PRO A 1 20 ? -10.042 13.359  -8.338  1.00 0.50  ? 20 PRO A HD2  4  
ATOM 6967  H HD3  . PRO A 1 20 ? -8.564  12.518  -7.829  1.00 0.47  ? 20 PRO A HD3  4  
ATOM 6968  N N    . LYS A 1 21 ? -11.297 11.711  -12.031 1.00 0.38  ? 21 LYS A N    4  
ATOM 6969  C CA   . LYS A 1 21 ? -12.309 12.156  -13.050 1.00 0.40  ? 21 LYS A CA   4  
ATOM 6970  C C    . LYS A 1 21 ? -11.817 11.694  -14.428 1.00 0.38  ? 21 LYS A C    4  
ATOM 6971  O O    . LYS A 1 21 ? -12.523 11.028  -15.162 1.00 0.42  ? 21 LYS A O    4  
ATOM 6972  C CB   . LYS A 1 21 ? -12.483 13.679  -13.027 1.00 0.42  ? 21 LYS A CB   4  
ATOM 6973  C CG   . LYS A 1 21 ? -13.828 14.058  -13.655 1.00 0.51  ? 21 LYS A CG   4  
ATOM 6974  C CD   . LYS A 1 21 ? -13.832 15.552  -13.999 1.00 0.98  ? 21 LYS A CD   4  
ATOM 6975  C CE   . LYS A 1 21 ? -14.609 16.326  -12.928 1.00 1.47  ? 21 LYS A CE   4  
ATOM 6976  N NZ   . LYS A 1 21 ? -15.353 17.451  -13.566 1.00 2.14  ? 21 LYS A NZ   4  
ATOM 6977  H H    . LYS A 1 21 ? -11.494 10.931  -11.481 1.00 0.41  ? 21 LYS A H    4  
ATOM 6978  H HA   . LYS A 1 21 ? -13.255 11.681  -12.838 1.00 0.43  ? 21 LYS A HA   4  
ATOM 6979  H HB2  . LYS A 1 21 ? -12.456 14.023  -12.005 1.00 0.42  ? 21 LYS A HB2  4  
ATOM 6980  H HB3  . LYS A 1 21 ? -11.684 14.142  -13.585 1.00 0.40  ? 21 LYS A HB3  4  
ATOM 6981  H HG2  . LYS A 1 21 ? -13.978 13.481  -14.556 1.00 0.97  ? 21 LYS A HG2  4  
ATOM 6982  H HG3  . LYS A 1 21 ? -14.622 13.848  -12.956 1.00 0.86  ? 21 LYS A HG3  4  
ATOM 6983  H HD2  . LYS A 1 21 ? -12.816 15.916  -14.040 1.00 1.62  ? 21 LYS A HD2  4  
ATOM 6984  H HD3  . LYS A 1 21 ? -14.305 15.697  -14.958 1.00 1.69  ? 21 LYS A HD3  4  
ATOM 6985  H HE2  . LYS A 1 21 ? -15.309 15.664  -12.440 1.00 1.83  ? 21 LYS A HE2  4  
ATOM 6986  H HE3  . LYS A 1 21 ? -13.919 16.721  -12.198 1.00 1.91  ? 21 LYS A HE3  4  
ATOM 6987  H HZ1  . LYS A 1 21 ? -16.019 17.074  -14.269 1.00 2.51  ? 21 LYS A HZ1  4  
ATOM 6988  H HZ2  . LYS A 1 21 ? -15.881 17.974  -12.839 1.00 2.32  ? 21 LYS A HZ2  4  
ATOM 6989  H HZ3  . LYS A 1 21 ? -14.679 18.092  -14.033 1.00 2.71  ? 21 LYS A HZ3  4  
ATOM 6990  N N    . ASN A 1 22 ? -10.588 12.010  -14.750 1.00 0.36  ? 22 ASN A N    4  
ATOM 6991  C CA   . ASN A 1 22 ? -9.980  11.575  -16.025 1.00 0.36  ? 22 ASN A CA   4  
ATOM 6992  C C    . ASN A 1 22 ? -9.143  10.341  -15.709 1.00 0.34  ? 22 ASN A C    4  
ATOM 6993  O O    . ASN A 1 22 ? -9.257  9.306   -16.328 1.00 0.36  ? 22 ASN A O    4  
ATOM 6994  C CB   . ASN A 1 22 ? -9.045  12.673  -16.544 1.00 0.36  ? 22 ASN A CB   4  
ATOM 6995  C CG   . ASN A 1 22 ? -9.632  14.061  -16.266 1.00 0.38  ? 22 ASN A CG   4  
ATOM 6996  O OD1  . ASN A 1 22 ? -10.527 14.509  -16.955 1.00 0.42  ? 22 ASN A OD1  4  
ATOM 6997  N ND2  . ASN A 1 22 ? -9.153  14.766  -15.273 1.00 0.37  ? 22 ASN A ND2  4  
ATOM 6998  H H    . ASN A 1 22 ? -10.035 12.512  -14.123 1.00 0.35  ? 22 ASN A H    4  
ATOM 6999  H HA   . ASN A 1 22 ? -10.741 11.345  -16.754 1.00 0.39  ? 22 ASN A HA   4  
ATOM 7000  H HB2  . ASN A 1 22 ? -8.091  12.590  -16.046 1.00 0.33  ? 22 ASN A HB2  4  
ATOM 7001  H HB3  . ASN A 1 22 ? -8.903  12.549  -17.595 1.00 0.38  ? 22 ASN A HB3  4  
ATOM 7002  H HD21 . ASN A 1 22 ? -8.429  14.403  -14.718 1.00 0.34  ? 22 ASN A HD21 4  
ATOM 7003  H HD22 . ASN A 1 22 ? -9.515  15.655  -15.085 1.00 0.39  ? 22 ASN A HD22 4  
ATOM 7004  N N    . ILE A 1 23 ? -8.309  10.471  -14.715 1.00 0.31  ? 23 ILE A N    4  
ATOM 7005  C CA   . ILE A 1 23 ? -7.427  9.370   -14.269 1.00 0.30  ? 23 ILE A CA   4  
ATOM 7006  C C    . ILE A 1 23 ? -8.246  8.081   -14.071 1.00 0.34  ? 23 ILE A C    4  
ATOM 7007  O O    . ILE A 1 23 ? -9.021  7.962   -13.140 1.00 0.37  ? 23 ILE A O    4  
ATOM 7008  C CB   . ILE A 1 23 ? -6.811  9.833   -12.947 1.00 0.29  ? 23 ILE A CB   4  
ATOM 7009  C CG1  . ILE A 1 23 ? -5.558  10.666  -13.225 1.00 0.27  ? 23 ILE A CG1  4  
ATOM 7010  C CG2  . ILE A 1 23 ? -6.451  8.642   -12.073 1.00 0.33  ? 23 ILE A CG2  4  
ATOM 7011  C CD1  . ILE A 1 23 ? -5.972  12.064  -13.686 1.00 0.26  ? 23 ILE A CD1  4  
ATOM 7012  H H    . ILE A 1 23 ? -8.268  11.322  -14.237 1.00 0.31  ? 23 ILE A H    4  
ATOM 7013  H HA   . ILE A 1 23 ? -6.644  9.205   -15.000 1.00 0.29  ? 23 ILE A HA   4  
ATOM 7014  H HB   . ILE A 1 23 ? -7.534  10.448  -12.431 1.00 0.31  ? 23 ILE A HB   4  
ATOM 7015  H HG12 . ILE A 1 23 ? -4.969  10.743  -12.323 1.00 0.29  ? 23 ILE A HG12 4  
ATOM 7016  H HG13 . ILE A 1 23 ? -4.973  10.191  -13.998 1.00 0.26  ? 23 ILE A HG13 4  
ATOM 7017  H HG21 . ILE A 1 23 ? -6.102  7.835   -12.696 1.00 1.10  ? 23 ILE A HG21 4  
ATOM 7018  H HG22 . ILE A 1 23 ? -5.678  8.929   -11.379 1.00 1.08  ? 23 ILE A HG22 4  
ATOM 7019  H HG23 . ILE A 1 23 ? -7.329  8.327   -11.529 1.00 1.00  ? 23 ILE A HG23 4  
ATOM 7020  H HD11 . ILE A 1 23 ? -6.796  12.413  -13.081 1.00 1.03  ? 23 ILE A HD11 4  
ATOM 7021  H HD12 . ILE A 1 23 ? -5.137  12.740  -13.585 1.00 0.97  ? 23 ILE A HD12 4  
ATOM 7022  H HD13 . ILE A 1 23 ? -6.280  12.025  -14.721 1.00 1.04  ? 23 ILE A HD13 4  
ATOM 7023  N N    . GLN A 1 24 ? -8.079  7.126   -14.950 1.00 0.36  ? 24 GLN A N    4  
ATOM 7024  C CA   . GLN A 1 24 ? -8.821  5.850   -14.849 1.00 0.42  ? 24 GLN A CA   4  
ATOM 7025  C C    . GLN A 1 24 ? -7.887  4.715   -14.416 1.00 0.37  ? 24 GLN A C    4  
ATOM 7026  O O    . GLN A 1 24 ? -8.343  3.696   -13.931 1.00 0.39  ? 24 GLN A O    4  
ATOM 7027  C CB   . GLN A 1 24 ? -9.397  5.544   -16.225 1.00 0.48  ? 24 GLN A CB   4  
ATOM 7028  C CG   . GLN A 1 24 ? -10.912 5.308   -16.132 1.00 0.57  ? 24 GLN A CG   4  
ATOM 7029  C CD   . GLN A 1 24 ? -11.646 6.603   -15.751 1.00 1.16  ? 24 GLN A CD   4  
ATOM 7030  O OE1  . GLN A 1 24 ? -11.038 7.578   -15.355 1.00 1.82  ? 24 GLN A OE1  4  
ATOM 7031  N NE2  . GLN A 1 24 ? -12.947 6.652   -15.854 1.00 1.58  ? 24 GLN A NE2  4  
ATOM 7032  H H    . GLN A 1 24 ? -7.458  7.245   -15.697 1.00 0.36  ? 24 GLN A H    4  
ATOM 7033  H HA   . GLN A 1 24 ? -9.629  5.943   -14.133 1.00 0.46  ? 24 GLN A HA   4  
ATOM 7034  H HB2  . GLN A 1 24 ? -9.209  6.385   -16.880 1.00 0.48  ? 24 GLN A HB2  4  
ATOM 7035  H HB3  . GLN A 1 24 ? -8.909  4.679   -16.620 1.00 0.48  ? 24 GLN A HB3  4  
ATOM 7036  H HG2  . GLN A 1 24 ? -11.276 4.962   -17.087 1.00 0.66  ? 24 GLN A HG2  4  
ATOM 7037  H HG3  . GLN A 1 24 ? -11.108 4.556   -15.382 1.00 0.91  ? 24 GLN A HG3  4  
ATOM 7038  H HE21 . GLN A 1 24 ? -13.444 5.869   -16.168 1.00 1.80  ? 24 GLN A HE21 4  
ATOM 7039  H HE22 . GLN A 1 24 ? -13.426 7.473   -15.616 1.00 2.04  ? 24 GLN A HE22 4  
ATOM 7040  N N    . SER A 1 25 ? -6.590  4.869   -14.579 1.00 0.33  ? 25 SER A N    4  
ATOM 7041  C CA   . SER A 1 25 ? -5.668  3.769   -14.167 1.00 0.29  ? 25 SER A CA   4  
ATOM 7042  C C    . SER A 1 25 ? -4.258  4.298   -13.901 1.00 0.27  ? 25 SER A C    4  
ATOM 7043  O O    . SER A 1 25 ? -3.989  5.474   -14.025 1.00 0.29  ? 25 SER A O    4  
ATOM 7044  C CB   . SER A 1 25 ? -5.588  2.729   -15.267 1.00 0.31  ? 25 SER A CB   4  
ATOM 7045  O OG   . SER A 1 25 ? -5.227  3.349   -16.495 1.00 0.34  ? 25 SER A OG   4  
ATOM 7046  H H    . SER A 1 25 ? -6.226  5.698   -14.969 1.00 0.33  ? 25 SER A H    4  
ATOM 7047  H HA   . SER A 1 25 ? -6.052  3.301   -13.277 1.00 0.29  ? 25 SER A HA   4  
ATOM 7048  H HB2  . SER A 1 25 ? -4.840  2.009   -14.997 1.00 0.31  ? 25 SER A HB2  4  
ATOM 7049  H HB3  . SER A 1 25 ? -6.541  2.236   -15.362 1.00 0.30  ? 25 SER A HB3  4  
ATOM 7050  H HG   . SER A 1 25 ? -4.586  2.786   -16.934 1.00 0.78  ? 25 SER A HG   4  
ATOM 7051  N N    . VAL A 1 26 ? -3.359  3.416   -13.535 1.00 0.25  ? 26 VAL A N    4  
ATOM 7052  C CA   . VAL A 1 26 ? -1.952  3.819   -13.264 1.00 0.24  ? 26 VAL A CA   4  
ATOM 7053  C C    . VAL A 1 26 ? -1.034  2.612   -13.452 1.00 0.25  ? 26 VAL A C    4  
ATOM 7054  O O    . VAL A 1 26 ? -1.450  1.472   -13.347 1.00 0.26  ? 26 VAL A O    4  
ATOM 7055  C CB   . VAL A 1 26 ? -1.801  4.342   -11.830 1.00 0.23  ? 26 VAL A CB   4  
ATOM 7056  C CG1  . VAL A 1 26 ? -2.664  3.527   -10.886 1.00 0.24  ? 26 VAL A CG1  4  
ATOM 7057  C CG2  . VAL A 1 26 ? -0.333  4.239   -11.394 1.00 0.26  ? 26 VAL A CG2  4  
ATOM 7058  H H    . VAL A 1 26 ? -3.613  2.478   -13.441 1.00 0.25  ? 26 VAL A H    4  
ATOM 7059  H HA   . VAL A 1 26 ? -1.668  4.593   -13.958 1.00 0.24  ? 26 VAL A HA   4  
ATOM 7060  H HB   . VAL A 1 26 ? -2.114  5.360   -11.787 1.00 0.25  ? 26 VAL A HB   4  
ATOM 7061  H HG11 . VAL A 1 26 ? -3.637  3.384   -11.329 1.00 1.01  ? 26 VAL A HG11 4  
ATOM 7062  H HG12 . VAL A 1 26 ? -2.198  2.570   -10.716 1.00 1.00  ? 26 VAL A HG12 4  
ATOM 7063  H HG13 . VAL A 1 26 ? -2.767  4.055   -9.952  1.00 1.10  ? 26 VAL A HG13 4  
ATOM 7064  H HG21 . VAL A 1 26 ? 0.292   4.749   -12.114 1.00 1.03  ? 26 VAL A HG21 4  
ATOM 7065  H HG22 . VAL A 1 26 ? -0.210  4.690   -10.425 1.00 1.06  ? 26 VAL A HG22 4  
ATOM 7066  H HG23 . VAL A 1 26 ? -0.045  3.197   -11.347 1.00 1.05  ? 26 VAL A HG23 4  
ATOM 7067  N N    . ASN A 1 27 ? 0.219   2.866   -13.714 1.00 0.25  ? 27 ASN A N    4  
ATOM 7068  C CA   . ASN A 1 27 ? 1.184   1.767   -13.896 1.00 0.27  ? 27 ASN A CA   4  
ATOM 7069  C C    . ASN A 1 27 ? 2.435   2.019   -13.066 1.00 0.25  ? 27 ASN A C    4  
ATOM 7070  O O    . ASN A 1 27 ? 3.040   3.072   -13.130 1.00 0.42  ? 27 ASN A O    4  
ATOM 7071  C CB   . ASN A 1 27 ? 1.580   1.623   -15.360 1.00 0.30  ? 27 ASN A CB   4  
ATOM 7072  C CG   . ASN A 1 27 ? 0.815   2.601   -16.266 1.00 0.57  ? 27 ASN A CG   4  
ATOM 7073  O OD1  . ASN A 1 27 ? -0.399  2.560   -16.340 1.00 0.95  ? 27 ASN A OD1  4  
ATOM 7074  N ND2  . ASN A 1 27 ? 1.479   3.466   -16.980 1.00 0.72  ? 27 ASN A ND2  4  
ATOM 7075  H H    . ASN A 1 27 ? 0.520   3.789   -13.785 1.00 0.26  ? 27 ASN A H    4  
ATOM 7076  H HA   . ASN A 1 27 ? 0.734   0.855   -13.571 1.00 0.30  ? 27 ASN A HA   4  
ATOM 7077  H HB2  . ASN A 1 27 ? 2.641   1.788   -15.462 1.00 0.45  ? 27 ASN A HB2  4  
ATOM 7078  H HB3  . ASN A 1 27 ? 1.348   0.633   -15.651 1.00 0.51  ? 27 ASN A HB3  4  
ATOM 7079  H HD21 . ASN A 1 27 ? 2.458   3.493   -16.935 1.00 0.75  ? 27 ASN A HD21 4  
ATOM 7080  H HD22 . ASN A 1 27 ? 0.998   4.086   -17.565 1.00 0.99  ? 27 ASN A HD22 4  
ATOM 7081  N N    . VAL A 1 28 ? 2.836   1.040   -12.299 1.00 0.28  ? 28 VAL A N    4  
ATOM 7082  C CA   . VAL A 1 28 ? 4.063   1.196   -11.469 1.00 0.28  ? 28 VAL A CA   4  
ATOM 7083  C C    . VAL A 1 28 ? 5.144   0.252   -12.005 1.00 0.31  ? 28 VAL A C    4  
ATOM 7084  O O    . VAL A 1 28 ? 4.877   -0.886  -12.336 1.00 0.33  ? 28 VAL A O    4  
ATOM 7085  C CB   . VAL A 1 28 ? 3.745   0.886   -9.996  1.00 0.34  ? 28 VAL A CB   4  
ATOM 7086  C CG1  . VAL A 1 28 ? 3.346   -0.579  -9.840  1.00 0.55  ? 28 VAL A CG1  4  
ATOM 7087  C CG2  . VAL A 1 28 ? 4.975   1.171   -9.127  1.00 0.71  ? 28 VAL A CG2  4  
ATOM 7088  H H    . VAL A 1 28 ? 2.335   0.196   -12.286 1.00 0.43  ? 28 VAL A H    4  
ATOM 7089  H HA   . VAL A 1 28 ? 4.411   2.212   -11.552 1.00 0.28  ? 28 VAL A HA   4  
ATOM 7090  H HB   . VAL A 1 28 ? 2.926   1.511   -9.672  1.00 0.31  ? 28 VAL A HB   4  
ATOM 7091  H HG11 . VAL A 1 28 ? 2.839   -0.910  -10.733 1.00 1.11  ? 28 VAL A HG11 4  
ATOM 7092  H HG12 . VAL A 1 28 ? 4.231   -1.177  -9.684  1.00 1.11  ? 28 VAL A HG12 4  
ATOM 7093  H HG13 . VAL A 1 28 ? 2.687   -0.680  -8.991  1.00 1.30  ? 28 VAL A HG13 4  
ATOM 7094  H HG21 . VAL A 1 28 ? 5.861   0.803   -9.623  1.00 1.24  ? 28 VAL A HG21 4  
ATOM 7095  H HG22 . VAL A 1 28 ? 5.066   2.236   -8.971  1.00 1.22  ? 28 VAL A HG22 4  
ATOM 7096  H HG23 . VAL A 1 28 ? 4.864   0.676   -8.173  1.00 1.37  ? 28 VAL A HG23 4  
ATOM 7097  N N    . LYS A 1 29 ? 6.356   0.730   -12.104 1.00 0.35  ? 29 LYS A N    4  
ATOM 7098  C CA   . LYS A 1 29 ? 7.470   -0.113  -12.636 1.00 0.42  ? 29 LYS A CA   4  
ATOM 7099  C C    . LYS A 1 29 ? 8.708   0.048   -11.745 1.00 0.37  ? 29 LYS A C    4  
ATOM 7100  O O    . LYS A 1 29 ? 8.836   1.010   -11.005 1.00 0.35  ? 29 LYS A O    4  
ATOM 7101  C CB   . LYS A 1 29 ? 7.811   0.345   -14.062 1.00 0.52  ? 29 LYS A CB   4  
ATOM 7102  C CG   . LYS A 1 29 ? 7.519   -0.764  -15.080 1.00 1.08  ? 29 LYS A CG   4  
ATOM 7103  C CD   . LYS A 1 29 ? 8.463   -1.956  -14.864 1.00 0.83  ? 29 LYS A CD   4  
ATOM 7104  C CE   . LYS A 1 29 ? 9.922   -1.496  -14.933 1.00 0.76  ? 29 LYS A CE   4  
ATOM 7105  N NZ   . LYS A 1 29 ? 10.273  -1.123  -16.335 1.00 1.23  ? 29 LYS A NZ   4  
ATOM 7106  H H    . LYS A 1 29 ? 6.536   1.654   -11.835 1.00 0.35  ? 29 LYS A H    4  
ATOM 7107  H HA   . LYS A 1 29 ? 7.167   -1.149  -12.650 1.00 0.52  ? 29 LYS A HA   4  
ATOM 7108  H HB2  . LYS A 1 29 ? 7.215   1.211   -14.306 1.00 1.12  ? 29 LYS A HB2  4  
ATOM 7109  H HB3  . LYS A 1 29 ? 8.857   0.609   -14.112 1.00 0.82  ? 29 LYS A HB3  4  
ATOM 7110  H HG2  . LYS A 1 29 ? 6.496   -1.091  -14.969 1.00 1.70  ? 29 LYS A HG2  4  
ATOM 7111  H HG3  . LYS A 1 29 ? 7.660   -0.376  -16.078 1.00 2.02  ? 29 LYS A HG3  4  
ATOM 7112  H HD2  . LYS A 1 29 ? 8.271   -2.391  -13.895 1.00 1.42  ? 29 LYS A HD2  4  
ATOM 7113  H HD3  . LYS A 1 29 ? 8.285   -2.695  -15.630 1.00 1.54  ? 29 LYS A HD3  4  
ATOM 7114  H HE2  . LYS A 1 29 ? 10.059  -0.641  -14.289 1.00 1.30  ? 29 LYS A HE2  4  
ATOM 7115  H HE3  . LYS A 1 29 ? 10.562  -2.299  -14.602 1.00 1.09  ? 29 LYS A HE3  4  
ATOM 7116  H HZ1  . LYS A 1 29 ? 9.894   -1.835  -16.991 1.00 1.61  ? 29 LYS A HZ1  4  
ATOM 7117  H HZ2  . LYS A 1 29 ? 9.865   -0.192  -16.558 1.00 1.74  ? 29 LYS A HZ2  4  
ATOM 7118  H HZ3  . LYS A 1 29 ? 11.306  -1.081  -16.433 1.00 1.71  ? 29 LYS A HZ3  4  
ATOM 7119  N N    . SER A 1 30 ? 9.612   -0.896  -11.820 1.00 0.38  ? 30 SER A N    4  
ATOM 7120  C CA   . SER A 1 30 ? 10.859  -0.846  -10.997 1.00 0.39  ? 30 SER A CA   4  
ATOM 7121  C C    . SER A 1 30 ? 11.972  -0.096  -11.774 1.00 0.34  ? 30 SER A C    4  
ATOM 7122  O O    . SER A 1 30 ? 11.747  0.352   -12.884 1.00 0.35  ? 30 SER A O    4  
ATOM 7123  C CB   . SER A 1 30 ? 11.277  -2.298  -10.696 1.00 0.52  ? 30 SER A CB   4  
ATOM 7124  O OG   . SER A 1 30 ? 12.211  -2.748  -11.673 1.00 1.63  ? 30 SER A OG   4  
ATOM 7125  H H    . SER A 1 30 ? 9.469   -1.652  -12.425 1.00 0.43  ? 30 SER A H    4  
ATOM 7126  H HA   . SER A 1 30 ? 10.655  -0.325  -10.068 1.00 0.41  ? 30 SER A HA   4  
ATOM 7127  H HB2  . SER A 1 30 ? 11.730  -2.354  -9.721  1.00 0.91  ? 30 SER A HB2  4  
ATOM 7128  H HB3  . SER A 1 30 ? 10.398  -2.931  -10.714 1.00 0.92  ? 30 SER A HB3  4  
ATOM 7129  H HG   . SER A 1 30 ? 12.360  -3.686  -11.532 1.00 2.01  ? 30 SER A HG   4  
ATOM 7130  N N    . PRO A 1 31 ? 13.142  0.024   -11.166 1.00 0.39  ? 31 PRO A N    4  
ATOM 7131  C CA   . PRO A 1 31 ? 14.302  0.720   -11.780 1.00 0.44  ? 31 PRO A CA   4  
ATOM 7132  C C    . PRO A 1 31 ? 14.972  -0.152  -12.857 1.00 0.52  ? 31 PRO A C    4  
ATOM 7133  O O    . PRO A 1 31 ? 14.500  -1.230  -13.169 1.00 0.58  ? 31 PRO A O    4  
ATOM 7134  C CB   . PRO A 1 31 ? 15.241  0.962   -10.593 1.00 0.52  ? 31 PRO A CB   4  
ATOM 7135  C CG   . PRO A 1 31 ? 14.855  -0.067  -9.506  1.00 0.56  ? 31 PRO A CG   4  
ATOM 7136  C CD   . PRO A 1 31 ? 13.417  -0.520  -9.816  1.00 0.49  ? 31 PRO A CD   4  
ATOM 7137  H HA   . PRO A 1 31 ? 13.996  1.663   -12.201 1.00 0.44  ? 31 PRO A HA   4  
ATOM 7138  H HB2  . PRO A 1 31 ? 16.269  0.819   -10.896 1.00 0.59  ? 31 PRO A HB2  4  
ATOM 7139  H HB3  . PRO A 1 31 ? 15.102  1.960   -10.210 1.00 0.56  ? 31 PRO A HB3  4  
ATOM 7140  H HG2  . PRO A 1 31 ? 15.529  -0.912  -9.542  1.00 0.63  ? 31 PRO A HG2  4  
ATOM 7141  H HG3  . PRO A 1 31 ? 14.889  0.394   -8.532  1.00 0.64  ? 31 PRO A HG3  4  
ATOM 7142  H HD2  . PRO A 1 31 ? 13.361  -1.599  -9.821  1.00 0.54  ? 31 PRO A HD2  4  
ATOM 7143  H HD3  . PRO A 1 31 ? 12.727  -0.106  -9.098  1.00 0.52  ? 31 PRO A HD3  4  
ATOM 7144  N N    . GLY A 1 32 ? 16.066  0.309   -13.436 1.00 0.60  ? 32 GLY A N    4  
ATOM 7145  C CA   . GLY A 1 32 ? 16.742  -0.507  -14.497 1.00 0.73  ? 32 GLY A CA   4  
ATOM 7146  C C    . GLY A 1 32 ? 17.974  0.231   -15.050 1.00 0.91  ? 32 GLY A C    4  
ATOM 7147  O O    . GLY A 1 32 ? 19.078  0.002   -14.595 1.00 1.05  ? 32 GLY A O    4  
ATOM 7148  H H    . GLY A 1 32 ? 16.435  1.186   -13.176 1.00 0.61  ? 32 GLY A H    4  
ATOM 7149  H HA2  . GLY A 1 32 ? 17.053  -1.452  -14.077 1.00 0.73  ? 32 GLY A HA2  4  
ATOM 7150  H HA3  . GLY A 1 32 ? 16.047  -0.689  -15.304 1.00 0.79  ? 32 GLY A HA3  4  
ATOM 7151  N N    . PRO A 1 33 ? 17.747  1.092   -16.024 1.00 1.04  ? 33 PRO A N    4  
ATOM 7152  C CA   . PRO A 1 33 ? 18.827  1.875   -16.673 1.00 1.28  ? 33 PRO A CA   4  
ATOM 7153  C C    . PRO A 1 33 ? 19.280  3.016   -15.750 1.00 1.12  ? 33 PRO A C    4  
ATOM 7154  O O    . PRO A 1 33 ? 19.065  2.964   -14.552 1.00 1.13  ? 33 PRO A O    4  
ATOM 7155  C CB   . PRO A 1 33 ? 18.157  2.414   -17.945 1.00 1.58  ? 33 PRO A CB   4  
ATOM 7156  C CG   . PRO A 1 33 ? 16.633  2.396   -17.681 1.00 1.49  ? 33 PRO A CG   4  
ATOM 7157  C CD   . PRO A 1 33 ? 16.395  1.368   -16.563 1.00 1.14  ? 33 PRO A CD   4  
ATOM 7158  H HA   . PRO A 1 33 ? 19.658  1.240   -16.931 1.00 1.47  ? 33 PRO A HA   4  
ATOM 7159  H HB2  . PRO A 1 33 ? 18.490  3.424   -18.142 1.00 1.67  ? 33 PRO A HB2  4  
ATOM 7160  H HB3  . PRO A 1 33 ? 18.388  1.778   -18.785 1.00 1.82  ? 33 PRO A HB3  4  
ATOM 7161  H HG2  . PRO A 1 33 ? 16.301  3.375   -17.365 1.00 1.50  ? 33 PRO A HG2  4  
ATOM 7162  H HG3  . PRO A 1 33 ? 16.106  2.094   -18.572 1.00 1.73  ? 33 PRO A HG3  4  
ATOM 7163  H HD2  . PRO A 1 33 ? 15.756  1.787   -15.797 1.00 1.03  ? 33 PRO A HD2  4  
ATOM 7164  H HD3  . PRO A 1 33 ? 15.962  0.464   -16.966 1.00 1.20  ? 33 PRO A HD3  4  
ATOM 7165  N N    . HIS A 1 34 ? 19.893  4.058   -16.283 1.00 1.15  ? 34 HIS A N    4  
ATOM 7166  C CA   . HIS A 1 34 ? 20.318  5.189   -15.393 1.00 1.18  ? 34 HIS A CA   4  
ATOM 7167  C C    . HIS A 1 34 ? 19.073  5.786   -14.718 1.00 1.17  ? 34 HIS A C    4  
ATOM 7168  O O    . HIS A 1 34 ? 19.172  6.380   -13.660 1.00 1.26  ? 34 HIS A O    4  
ATOM 7169  C CB   . HIS A 1 34 ? 21.102  6.278   -16.153 1.00 1.36  ? 34 HIS A CB   4  
ATOM 7170  C CG   . HIS A 1 34 ? 20.619  6.435   -17.571 1.00 1.55  ? 34 HIS A CG   4  
ATOM 7171  N ND1  . HIS A 1 34 ? 21.450  6.196   -18.656 1.00 2.08  ? 34 HIS A ND1  4  
ATOM 7172  C CD2  . HIS A 1 34 ? 19.420  6.841   -18.099 1.00 2.02  ? 34 HIS A CD2  4  
ATOM 7173  C CE1  . HIS A 1 34 ? 20.748  6.463   -19.769 1.00 2.65  ? 34 HIS A CE1  4  
ATOM 7174  N NE2  . HIS A 1 34 ? 19.506  6.861   -19.486 1.00 2.66  ? 34 HIS A NE2  4  
ATOM 7175  H H    . HIS A 1 34 ? 20.056  4.096   -17.248 1.00 1.28  ? 34 HIS A H    4  
ATOM 7176  H HA   . HIS A 1 34 ? 20.954  4.783   -14.615 1.00 1.15  ? 34 HIS A HA   4  
ATOM 7177  H HB2  . HIS A 1 34 ? 20.985  7.219   -15.638 1.00 1.71  ? 34 HIS A HB2  4  
ATOM 7178  H HB3  . HIS A 1 34 ? 22.149  6.014   -16.162 1.00 1.68  ? 34 HIS A HB3  4  
ATOM 7179  H HD1  . HIS A 1 34 ? 22.379  5.888   -18.617 1.00 2.32  ? 34 HIS A HD1  4  
ATOM 7180  H HD2  . HIS A 1 34 ? 18.541  7.102   -17.527 1.00 2.22  ? 34 HIS A HD2  4  
ATOM 7181  H HE1  . HIS A 1 34 ? 21.141  6.370   -20.770 1.00 3.26  ? 34 HIS A HE1  4  
ATOM 7182  N N    . CYS A 1 35 ? 17.893  5.563   -15.287 1.00 1.17  ? 35 CYS A N    4  
ATOM 7183  C CA   . CYS A 1 35 ? 16.626  6.029   -14.636 1.00 1.21  ? 35 CYS A CA   4  
ATOM 7184  C C    . CYS A 1 35 ? 16.683  5.492   -13.200 1.00 1.02  ? 35 CYS A C    4  
ATOM 7185  O O    . CYS A 1 35 ? 16.515  6.220   -12.239 1.00 1.08  ? 35 CYS A O    4  
ATOM 7186  C CB   . CYS A 1 35 ? 15.435  5.412   -15.399 1.00 1.45  ? 35 CYS A CB   4  
ATOM 7187  S SG   . CYS A 1 35 ? 13.880  6.306   -15.093 1.00 1.19  ? 35 CYS A SG   4  
ATOM 7188  H H    . CYS A 1 35 ? 17.840  5.034   -16.109 1.00 1.22  ? 35 CYS A H    4  
ATOM 7189  H HA   . CYS A 1 35 ? 16.570  7.106   -14.638 1.00 1.30  ? 35 CYS A HA   4  
ATOM 7190  H HB2  . CYS A 1 35 ? 15.647  5.439   -16.458 1.00 2.02  ? 35 CYS A HB2  4  
ATOM 7191  H HB3  . CYS A 1 35 ? 15.318  4.383   -15.093 1.00 2.07  ? 35 CYS A HB3  4  
ATOM 7192  N N    . ALA A 1 36 ? 17.008  4.214   -13.087 1.00 0.94  ? 36 ALA A N    4  
ATOM 7193  C CA   . ALA A 1 36 ? 17.192  3.522   -11.769 1.00 0.89  ? 36 ALA A CA   4  
ATOM 7194  C C    . ALA A 1 36 ? 16.215  4.009   -10.698 1.00 0.85  ? 36 ALA A C    4  
ATOM 7195  O O    . ALA A 1 36 ? 16.527  4.034   -9.520  1.00 1.18  ? 36 ALA A O    4  
ATOM 7196  C CB   . ALA A 1 36 ? 18.616  3.760   -11.309 1.00 1.08  ? 36 ALA A CB   4  
ATOM 7197  H H    . ALA A 1 36 ? 17.185  3.705   -13.903 1.00 1.02  ? 36 ALA A H    4  
ATOM 7198  H HA   . ALA A 1 36 ? 17.051  2.463   -11.911 1.00 0.94  ? 36 ALA A HA   4  
ATOM 7199  H HB1  . ALA A 1 36 ? 18.786  4.821   -11.218 1.00 1.40  ? 36 ALA A HB1  4  
ATOM 7200  H HB2  . ALA A 1 36 ? 18.765  3.284   -10.355 1.00 1.48  ? 36 ALA A HB2  4  
ATOM 7201  H HB3  . ALA A 1 36 ? 19.296  3.344   -12.036 1.00 1.69  ? 36 ALA A HB3  4  
ATOM 7202  N N    . GLN A 1 37 ? 15.036  4.360   -11.094 1.00 0.93  ? 37 GLN A N    4  
ATOM 7203  C CA   . GLN A 1 37 ? 14.015  4.813   -10.114 1.00 0.89  ? 37 GLN A CA   4  
ATOM 7204  C C    . GLN A 1 37 ? 12.765  3.969   -10.307 1.00 0.71  ? 37 GLN A C    4  
ATOM 7205  O O    . GLN A 1 37 ? 12.736  3.054   -11.108 1.00 0.74  ? 37 GLN A O    4  
ATOM 7206  C CB   . GLN A 1 37 ? 13.669  6.291   -10.353 1.00 0.99  ? 37 GLN A CB   4  
ATOM 7207  C CG   . GLN A 1 37 ? 13.626  7.063   -9.024  1.00 1.66  ? 37 GLN A CG   4  
ATOM 7208  C CD   . GLN A 1 37 ? 14.902  6.794   -8.217  1.00 2.34  ? 37 GLN A CD   4  
ATOM 7209  O OE1  . GLN A 1 37 ? 14.856  6.158   -7.183  1.00 2.82  ? 37 GLN A OE1  4  
ATOM 7210  N NE2  . GLN A 1 37 ? 16.047  7.253   -8.648  1.00 3.07  ? 37 GLN A NE2  4  
ATOM 7211  H H    . GLN A 1 37 ? 14.812  4.306   -12.042 1.00 1.27  ? 37 GLN A H    4  
ATOM 7212  H HA   . GLN A 1 37 ? 14.392  4.676   -9.111  1.00 0.95  ? 37 GLN A HA   4  
ATOM 7213  H HB2  . GLN A 1 37 ? 14.409  6.726   -10.990 1.00 1.38  ? 37 GLN A HB2  4  
ATOM 7214  H HB3  . GLN A 1 37 ? 12.704  6.358   -10.832 1.00 1.44  ? 37 GLN A HB3  4  
ATOM 7215  H HG2  . GLN A 1 37 ? 13.553  8.122   -9.233  1.00 2.22  ? 37 GLN A HG2  4  
ATOM 7216  H HG3  . GLN A 1 37 ? 12.764  6.754   -8.451  1.00 2.02  ? 37 GLN A HG3  4  
ATOM 7217  H HE21 . GLN A 1 37 ? 16.089  7.765   -9.483  1.00 3.26  ? 37 GLN A HE21 4  
ATOM 7218  H HE22 . GLN A 1 37 ? 16.867  7.084   -8.137  1.00 3.72  ? 37 GLN A HE22 4  
ATOM 7219  N N    . THR A 1 38 ? 11.729  4.278   -9.597  1.00 0.60  ? 38 THR A N    4  
ATOM 7220  C CA   . THR A 1 38 ? 10.475  3.505   -9.749  1.00 0.44  ? 38 THR A CA   4  
ATOM 7221  C C    . THR A 1 38 ? 9.716   4.015   -10.972 1.00 0.35  ? 38 THR A C    4  
ATOM 7222  O O    . THR A 1 38 ? 10.260  4.691   -11.827 1.00 0.42  ? 38 THR A O    4  
ATOM 7223  C CB   . THR A 1 38 ? 9.594   3.676   -8.503  1.00 0.44  ? 38 THR A CB   4  
ATOM 7224  O OG1  . THR A 1 38 ? 10.297  4.388   -7.489  1.00 0.60  ? 38 THR A OG1  4  
ATOM 7225  C CG2  . THR A 1 38 ? 9.216   2.301   -7.990  1.00 0.44  ? 38 THR A CG2  4  
ATOM 7226  H H    . THR A 1 38 ? 11.772  5.026   -8.969  1.00 0.68  ? 38 THR A H    4  
ATOM 7227  H HA   . THR A 1 38 ? 10.711  2.460   -9.883  1.00 0.44  ? 38 THR A HA   4  
ATOM 7228  H HB   . THR A 1 38 ? 8.690   4.213   -8.766  1.00 0.40  ? 38 THR A HB   4  
ATOM 7229  H HG1  . THR A 1 38 ? 9.868   5.239   -7.372  1.00 0.96  ? 38 THR A HG1  4  
ATOM 7230  H HG21 . THR A 1 38 ? 8.900   1.689   -8.821  1.00 1.11  ? 38 THR A HG21 4  
ATOM 7231  H HG22 . THR A 1 38 ? 10.072  1.850   -7.515  1.00 1.13  ? 38 THR A HG22 4  
ATOM 7232  H HG23 . THR A 1 38 ? 8.409   2.394   -7.282  1.00 1.10  ? 38 THR A HG23 4  
ATOM 7233  N N    . GLU A 1 39 ? 8.452   3.728   -11.028 1.00 0.25  ? 39 GLU A N    4  
ATOM 7234  C CA   . GLU A 1 39 ? 7.608   4.209   -12.131 1.00 0.25  ? 39 GLU A CA   4  
ATOM 7235  C C    . GLU A 1 39 ? 6.228   4.285   -11.565 1.00 0.21  ? 39 GLU A C    4  
ATOM 7236  O O    . GLU A 1 39 ? 5.831   3.446   -10.781 1.00 0.35  ? 39 GLU A O    4  
ATOM 7237  C CB   . GLU A 1 39 ? 7.580   3.254   -13.309 1.00 0.33  ? 39 GLU A CB   4  
ATOM 7238  C CG   . GLU A 1 39 ? 8.078   3.971   -14.570 1.00 0.60  ? 39 GLU A CG   4  
ATOM 7239  C CD   . GLU A 1 39 ? 8.268   2.961   -15.706 1.00 0.80  ? 39 GLU A CD   4  
ATOM 7240  O OE1  . GLU A 1 39 ? 7.286   2.634   -16.352 1.00 1.47  ? 39 GLU A OE1  4  
ATOM 7241  O OE2  . GLU A 1 39 ? 9.393   2.536   -15.912 1.00 1.40  ? 39 GLU A OE2  4  
ATOM 7242  H H    . GLU A 1 39 ? 8.033   3.220   -10.301 1.00 0.25  ? 39 GLU A H    4  
ATOM 7243  H HA   . GLU A 1 39 ? 7.937   5.184   -12.438 1.00 0.31  ? 39 GLU A HA   4  
ATOM 7244  H HB2  . GLU A 1 39 ? 8.207   2.400   -13.099 1.00 0.30  ? 39 GLU A HB2  4  
ATOM 7245  H HB3  . GLU A 1 39 ? 6.550   2.934   -13.456 1.00 0.41  ? 39 GLU A HB3  4  
ATOM 7246  H HG2  . GLU A 1 39 ? 7.353   4.715   -14.869 1.00 0.88  ? 39 GLU A HG2  4  
ATOM 7247  H HG3  . GLU A 1 39 ? 9.021   4.452   -14.360 1.00 0.85  ? 39 GLU A HG3  4  
ATOM 7248  N N    . VAL A 1 40 ? 5.513   5.294   -11.886 1.00 0.15  ? 40 VAL A N    4  
ATOM 7249  C CA   . VAL A 1 40 ? 4.189   5.435   -11.296 1.00 0.19  ? 40 VAL A CA   4  
ATOM 7250  C C    . VAL A 1 40 ? 3.354   6.310   -12.220 1.00 0.19  ? 40 VAL A C    4  
ATOM 7251  O O    . VAL A 1 40 ? 3.132   7.475   -11.958 1.00 0.21  ? 40 VAL A O    4  
ATOM 7252  C CB   . VAL A 1 40 ? 4.409   6.087   -9.925  1.00 0.23  ? 40 VAL A CB   4  
ATOM 7253  C CG1  . VAL A 1 40 ? 4.523   4.981   -8.883  1.00 0.28  ? 40 VAL A CG1  4  
ATOM 7254  C CG2  . VAL A 1 40 ? 5.739   6.865   -9.929  1.00 0.24  ? 40 VAL A CG2  4  
ATOM 7255  H H    . VAL A 1 40 ? 5.863   5.985   -12.465 1.00 0.22  ? 40 VAL A H    4  
ATOM 7256  H HA   . VAL A 1 40 ? 3.750   4.453   -11.191 1.00 0.23  ? 40 VAL A HA   4  
ATOM 7257  H HB   . VAL A 1 40 ? 3.595   6.759   -9.692  1.00 0.29  ? 40 VAL A HB   4  
ATOM 7258  H HG11 . VAL A 1 40 ? 4.078   4.077   -9.269  1.00 1.04  ? 40 VAL A HG11 4  
ATOM 7259  H HG12 . VAL A 1 40 ? 5.573   4.799   -8.677  1.00 1.00  ? 40 VAL A HG12 4  
ATOM 7260  H HG13 . VAL A 1 40 ? 4.025   5.280   -7.980  1.00 1.08  ? 40 VAL A HG13 4  
ATOM 7261  H HG21 . VAL A 1 40 ? 5.758   7.542   -10.768 1.00 1.03  ? 40 VAL A HG21 4  
ATOM 7262  H HG22 . VAL A 1 40 ? 5.840   7.418   -9.012  1.00 1.01  ? 40 VAL A HG22 4  
ATOM 7263  H HG23 . VAL A 1 40 ? 6.561   6.164   -10.017 1.00 1.04  ? 40 VAL A HG23 4  
ATOM 7264  N N    . ILE A 1 41 ? 2.950   5.763   -13.336 1.00 0.23  ? 41 ILE A N    4  
ATOM 7265  C CA   . ILE A 1 41 ? 2.210   6.556   -14.333 1.00 0.25  ? 41 ILE A CA   4  
ATOM 7266  C C    . ILE A 1 41 ? 0.700   6.326   -14.261 1.00 0.23  ? 41 ILE A C    4  
ATOM 7267  O O    . ILE A 1 41 ? 0.218   5.252   -14.533 1.00 0.25  ? 41 ILE A O    4  
ATOM 7268  C CB   . ILE A 1 41 ? 2.743   6.155   -15.701 1.00 0.30  ? 41 ILE A CB   4  
ATOM 7269  C CG1  . ILE A 1 41 ? 4.008   6.982   -15.978 1.00 0.50  ? 41 ILE A CG1  4  
ATOM 7270  C CG2  . ILE A 1 41 ? 1.688   6.420   -16.769 1.00 0.67  ? 41 ILE A CG2  4  
ATOM 7271  C CD1  . ILE A 1 41 ? 4.298   7.040   -17.478 1.00 0.54  ? 41 ILE A CD1  4  
ATOM 7272  H H    . ILE A 1 41 ? 3.185   4.835   -13.546 1.00 0.27  ? 41 ILE A H    4  
ATOM 7273  H HA   . ILE A 1 41 ? 2.422   7.593   -14.174 1.00 0.26  ? 41 ILE A HA   4  
ATOM 7274  H HB   . ILE A 1 41 ? 2.987   5.098   -15.687 1.00 0.48  ? 41 ILE A HB   4  
ATOM 7275  H HG12 . ILE A 1 41 ? 3.864   7.986   -15.607 1.00 0.70  ? 41 ILE A HG12 4  
ATOM 7276  H HG13 . ILE A 1 41 ? 4.843   6.532   -15.468 1.00 0.69  ? 41 ILE A HG13 4  
ATOM 7277  H HG21 . ILE A 1 41 ? 1.397   7.457   -16.732 1.00 1.18  ? 41 ILE A HG21 4  
ATOM 7278  H HG22 . ILE A 1 41 ? 2.095   6.189   -17.739 1.00 1.38  ? 41 ILE A HG22 4  
ATOM 7279  H HG23 . ILE A 1 41 ? 0.826   5.797   -16.582 1.00 1.20  ? 41 ILE A HG23 4  
ATOM 7280  H HD11 . ILE A 1 41 ? 4.356   6.038   -17.873 1.00 1.14  ? 41 ILE A HD11 4  
ATOM 7281  H HD12 . ILE A 1 41 ? 3.505   7.579   -17.975 1.00 1.22  ? 41 ILE A HD12 4  
ATOM 7282  H HD13 . ILE A 1 41 ? 5.236   7.549   -17.643 1.00 1.02  ? 41 ILE A HD13 4  
ATOM 7283  N N    . ALA A 1 42 ? -0.049  7.353   -13.956 1.00 0.22  ? 42 ALA A N    4  
ATOM 7284  C CA   . ALA A 1 42 ? -1.530  7.229   -13.923 1.00 0.22  ? 42 ALA A CA   4  
ATOM 7285  C C    . ALA A 1 42 ? -2.063  7.486   -15.324 1.00 0.24  ? 42 ALA A C    4  
ATOM 7286  O O    . ALA A 1 42 ? -1.958  8.584   -15.838 1.00 0.25  ? 42 ALA A O    4  
ATOM 7287  C CB   . ALA A 1 42 ? -2.100  8.251   -12.955 1.00 0.21  ? 42 ALA A CB   4  
ATOM 7288  H H    . ALA A 1 42 ? 0.365   8.230   -13.786 1.00 0.23  ? 42 ALA A H    4  
ATOM 7289  H HA   . ALA A 1 42 ? -1.813  6.245   -13.613 1.00 0.23  ? 42 ALA A HA   4  
ATOM 7290  H HB1  . ALA A 1 42 ? -1.785  9.239   -13.256 1.00 0.95  ? 42 ALA A HB1  4  
ATOM 7291  H HB2  . ALA A 1 42 ? -3.176  8.191   -12.968 1.00 1.00  ? 42 ALA A HB2  4  
ATOM 7292  H HB3  . ALA A 1 42 ? -1.735  8.040   -11.962 1.00 1.00  ? 42 ALA A HB3  4  
ATOM 7293  N N    . THR A 1 43 ? -2.627  6.486   -15.955 1.00 0.28  ? 43 THR A N    4  
ATOM 7294  C CA   . THR A 1 43 ? -3.148  6.696   -17.326 1.00 0.32  ? 43 THR A CA   4  
ATOM 7295  C C    . THR A 1 43 ? -4.409  7.541   -17.254 1.00 0.32  ? 43 THR A C    4  
ATOM 7296  O O    . THR A 1 43 ? -5.352  7.230   -16.542 1.00 0.34  ? 43 THR A O    4  
ATOM 7297  C CB   . THR A 1 43 ? -3.476  5.371   -18.020 1.00 0.35  ? 43 THR A CB   4  
ATOM 7298  O OG1  . THR A 1 43 ? -2.572  4.356   -17.595 1.00 0.39  ? 43 THR A OG1  4  
ATOM 7299  C CG2  . THR A 1 43 ? -3.369  5.563   -19.534 1.00 0.39  ? 43 THR A CG2  4  
ATOM 7300  H H    . THR A 1 43 ? -2.703  5.607   -15.528 1.00 0.28  ? 43 THR A H    4  
ATOM 7301  H HA   . THR A 1 43 ? -2.396  7.228   -17.894 1.00 0.32  ? 43 THR A HA   4  
ATOM 7302  H HB   . THR A 1 43 ? -4.486  5.084   -17.779 1.00 0.35  ? 43 THR A HB   4  
ATOM 7303  H HG1  . THR A 1 43 ? -1.681  4.626   -17.837 1.00 0.89  ? 43 THR A HG1  4  
ATOM 7304  H HG21 . THR A 1 43 ? -4.028  6.365   -19.838 1.00 1.07  ? 43 THR A HG21 4  
ATOM 7305  H HG22 . THR A 1 43 ? -2.352  5.815   -19.793 1.00 1.05  ? 43 THR A HG22 4  
ATOM 7306  H HG23 . THR A 1 43 ? -3.657  4.652   -20.034 1.00 1.07  ? 43 THR A HG23 4  
ATOM 7307  N N    . LEU A 1 44 ? -4.412  8.613   -17.980 1.00 0.32  ? 44 LEU A N    4  
ATOM 7308  C CA   . LEU A 1 44 ? -5.566  9.531   -17.989 1.00 0.32  ? 44 LEU A CA   4  
ATOM 7309  C C    . LEU A 1 44 ? -6.720  8.944   -18.811 1.00 0.37  ? 44 LEU A C    4  
ATOM 7310  O O    . LEU A 1 44 ? -6.509  8.113   -19.679 1.00 0.40  ? 44 LEU A O    4  
ATOM 7311  C CB   . LEU A 1 44 ? -5.106  10.822  -18.638 1.00 0.34  ? 44 LEU A CB   4  
ATOM 7312  C CG   . LEU A 1 44 ? -4.666  11.824  -17.583 1.00 0.32  ? 44 LEU A CG   4  
ATOM 7313  C CD1  . LEU A 1 44 ? -5.875  12.686  -17.244 1.00 0.35  ? 44 LEU A CD1  4  
ATOM 7314  C CD2  . LEU A 1 44 ? -4.130  11.103  -16.321 1.00 0.28  ? 44 LEU A CD2  4  
ATOM 7315  H H    . LEU A 1 44 ? -3.625  8.834   -18.522 1.00 0.33  ? 44 LEU A H    4  
ATOM 7316  H HA   . LEU A 1 44 ? -5.879  9.721   -16.969 1.00 0.30  ? 44 LEU A HA   4  
ATOM 7317  H HB2  . LEU A 1 44 ? -4.279  10.611  -19.294 1.00 0.37  ? 44 LEU A HB2  4  
ATOM 7318  H HB3  . LEU A 1 44 ? -5.921  11.239  -19.211 1.00 0.37  ? 44 LEU A HB3  4  
ATOM 7319  H HG   . LEU A 1 44 ? -3.888  12.445  -17.999 1.00 0.34  ? 44 LEU A HG   4  
ATOM 7320  H HD11 . LEU A 1 44 ? -6.735  12.048  -17.098 1.00 1.07  ? 44 LEU A HD11 4  
ATOM 7321  H HD12 . LEU A 1 44 ? -5.683  13.249  -16.349 1.00 1.03  ? 44 LEU A HD12 4  
ATOM 7322  H HD13 . LEU A 1 44 ? -6.070  13.363  -18.065 1.00 1.05  ? 44 LEU A HD13 4  
ATOM 7323  H HD21 . LEU A 1 44 ? -3.400  10.356  -16.613 1.00 1.03  ? 44 LEU A HD21 4  
ATOM 7324  H HD22 . LEU A 1 44 ? -3.661  11.818  -15.663 1.00 1.04  ? 44 LEU A HD22 4  
ATOM 7325  H HD23 . LEU A 1 44 ? -4.943  10.618  -15.802 1.00 1.08  ? 44 LEU A HD23 4  
ATOM 7326  N N    . LYS A 1 45 ? -7.928  9.417   -18.561 1.00 0.38  ? 45 LYS A N    4  
ATOM 7327  C CA   . LYS A 1 45 ? -9.136  8.956   -19.299 1.00 0.44  ? 45 LYS A CA   4  
ATOM 7328  C C    . LYS A 1 45 ? -8.960  9.168   -20.793 1.00 0.49  ? 45 LYS A C    4  
ATOM 7329  O O    . LYS A 1 45 ? -9.340  8.334   -21.594 1.00 0.54  ? 45 LYS A O    4  
ATOM 7330  C CB   . LYS A 1 45 ? -10.316 9.789   -18.821 1.00 0.45  ? 45 LYS A CB   4  
ATOM 7331  C CG   . LYS A 1 45 ? -11.439 8.884   -18.305 1.00 0.47  ? 45 LYS A CG   4  
ATOM 7332  C CD   . LYS A 1 45 ? -12.489 8.692   -19.402 1.00 0.72  ? 45 LYS A CD   4  
ATOM 7333  C CE   . LYS A 1 45 ? -13.677 7.903   -18.841 1.00 1.05  ? 45 LYS A CE   4  
ATOM 7334  N NZ   . LYS A 1 45 ? -14.837 8.016   -19.773 1.00 1.42  ? 45 LYS A NZ   4  
ATOM 7335  H H    . LYS A 1 45 ? -8.043  10.114  -17.891 1.00 0.37  ? 45 LYS A H    4  
ATOM 7336  H HA   . LYS A 1 45 ? -9.318  7.915   -19.094 1.00 0.44  ? 45 LYS A HA   4  
ATOM 7337  H HB2  . LYS A 1 45 ? -9.987  10.435  -18.023 1.00 0.42  ? 45 LYS A HB2  4  
ATOM 7338  H HB3  . LYS A 1 45 ? -10.661 10.389  -19.627 1.00 0.49  ? 45 LYS A HB3  4  
ATOM 7339  H HG2  . LYS A 1 45 ? -11.030 7.923   -18.025 1.00 0.52  ? 45 LYS A HG2  4  
ATOM 7340  H HG3  . LYS A 1 45 ? -11.902 9.342   -17.444 1.00 0.54  ? 45 LYS A HG3  4  
ATOM 7341  H HD2  . LYS A 1 45 ? -12.828 9.658   -19.747 1.00 0.99  ? 45 LYS A HD2  4  
ATOM 7342  H HD3  . LYS A 1 45 ? -12.054 8.147   -20.225 1.00 0.94  ? 45 LYS A HD3  4  
ATOM 7343  H HE2  . LYS A 1 45 ? -13.400 6.866   -18.735 1.00 1.46  ? 45 LYS A HE2  4  
ATOM 7344  H HE3  . LYS A 1 45 ? -13.950 8.303   -17.877 1.00 1.42  ? 45 LYS A HE3  4  
ATOM 7345  H HZ1  . LYS A 1 45 ? -14.554 7.689   -20.720 1.00 1.84  ? 45 LYS A HZ1  4  
ATOM 7346  H HZ2  . LYS A 1 45 ? -15.619 7.427   -19.423 1.00 1.86  ? 45 LYS A HZ2  4  
ATOM 7347  H HZ3  . LYS A 1 45 ? -15.147 9.006   -19.824 1.00 1.80  ? 45 LYS A HZ3  4  
ATOM 7348  N N    . ASN A 1 46 ? -8.370  10.270  -21.172 1.00 0.49  ? 46 ASN A N    4  
ATOM 7349  C CA   . ASN A 1 46 ? -8.144  10.532  -22.627 1.00 0.55  ? 46 ASN A CA   4  
ATOM 7350  C C    . ASN A 1 46 ? -7.107  9.532   -23.184 1.00 0.57  ? 46 ASN A C    4  
ATOM 7351  O O    . ASN A 1 46 ? -6.771  9.567   -24.354 1.00 0.75  ? 46 ASN A O    4  
ATOM 7352  C CB   . ASN A 1 46 ? -7.642  11.972  -22.824 1.00 0.58  ? 46 ASN A CB   4  
ATOM 7353  C CG   . ASN A 1 46 ? -6.606  12.328  -21.750 1.00 0.78  ? 46 ASN A CG   4  
ATOM 7354  O OD1  . ASN A 1 46 ? -5.753  11.529  -21.428 1.00 1.66  ? 46 ASN A OD1  4  
ATOM 7355  N ND2  . ASN A 1 46 ? -6.650  13.502  -21.178 1.00 0.81  ? 46 ASN A ND2  4  
ATOM 7356  H H    . ASN A 1 46 ? -8.061  10.921  -20.494 1.00 0.47  ? 46 ASN A H    4  
ATOM 7357  H HA   . ASN A 1 46 ? -9.077  10.405  -23.157 1.00 0.62  ? 46 ASN A HA   4  
ATOM 7358  H HB2  . ASN A 1 46 ? -7.192  12.058  -23.796 1.00 0.73  ? 46 ASN A HB2  4  
ATOM 7359  H HB3  . ASN A 1 46 ? -8.476  12.653  -22.753 1.00 0.74  ? 46 ASN A HB3  4  
ATOM 7360  H HD21 . ASN A 1 46 ? -7.341  14.148  -21.434 1.00 1.39  ? 46 ASN A HD21 4  
ATOM 7361  H HD22 . ASN A 1 46 ? -5.991  13.735  -20.491 1.00 0.88  ? 46 ASN A HD22 4  
ATOM 7362  N N    . GLY A 1 47 ? -6.590  8.650   -22.350 1.00 0.50  ? 47 GLY A N    4  
ATOM 7363  C CA   . GLY A 1 47 ? -5.575  7.660   -22.804 1.00 0.53  ? 47 GLY A CA   4  
ATOM 7364  C C    . GLY A 1 47 ? -4.202  8.315   -22.734 1.00 0.51  ? 47 GLY A C    4  
ATOM 7365  O O    . GLY A 1 47 ? -3.357  8.107   -23.586 1.00 0.60  ? 47 GLY A O    4  
ATOM 7366  H H    . GLY A 1 47 ? -6.860  8.648   -21.413 1.00 0.52  ? 47 GLY A H    4  
ATOM 7367  H HA2  . GLY A 1 47 ? -5.596  6.796   -22.147 1.00 0.52  ? 47 GLY A HA2  4  
ATOM 7368  H HA3  . GLY A 1 47 ? -5.780  7.355   -23.814 1.00 0.59  ? 47 GLY A HA3  4  
ATOM 7369  N N    . ARG A 1 48 ? -3.976  9.098   -21.709 1.00 0.47  ? 48 ARG A N    4  
ATOM 7370  C CA   . ARG A 1 48 ? -2.651  9.772   -21.550 1.00 0.54  ? 48 ARG A CA   4  
ATOM 7371  C C    . ARG A 1 48 ? -2.008  9.232   -20.283 1.00 0.42  ? 48 ARG A C    4  
ATOM 7372  O O    . ARG A 1 48 ? -2.456  8.248   -19.738 1.00 0.37  ? 48 ARG A O    4  
ATOM 7373  C CB   . ARG A 1 48 ? -2.841  11.289  -21.438 1.00 0.66  ? 48 ARG A CB   4  
ATOM 7374  C CG   . ARG A 1 48 ? -3.172  11.869  -22.817 1.00 1.00  ? 48 ARG A CG   4  
ATOM 7375  C CD   . ARG A 1 48 ? -3.705  13.295  -22.656 1.00 1.55  ? 48 ARG A CD   4  
ATOM 7376  N NE   . ARG A 1 48 ? -2.800  14.251  -23.358 1.00 2.08  ? 48 ARG A NE   4  
ATOM 7377  C CZ   . ARG A 1 48 ? -2.322  15.291  -22.723 1.00 2.34  ? 48 ARG A CZ   4  
ATOM 7378  N NH1  . ARG A 1 48 ? -3.134  16.223  -22.293 1.00 2.89  ? 48 ARG A NH1  4  
ATOM 7379  N NH2  . ARG A 1 48 ? -1.034  15.398  -22.521 1.00 2.67  ? 48 ARG A NH2  4  
ATOM 7380  H H    . ARG A 1 48 ? -4.682  9.229   -21.027 1.00 0.43  ? 48 ARG A H    4  
ATOM 7381  H HA   . ARG A 1 48 ? -2.019  9.545   -22.395 1.00 0.68  ? 48 ARG A HA   4  
ATOM 7382  H HB2  . ARG A 1 48 ? -3.647  11.503  -20.753 1.00 1.19  ? 48 ARG A HB2  4  
ATOM 7383  H HB3  . ARG A 1 48 ? -1.931  11.740  -21.073 1.00 1.23  ? 48 ARG A HB3  4  
ATOM 7384  H HG2  . ARG A 1 48 ? -2.279  11.883  -23.426 1.00 1.43  ? 48 ARG A HG2  4  
ATOM 7385  H HG3  . ARG A 1 48 ? -3.923  11.257  -23.293 1.00 1.63  ? 48 ARG A HG3  4  
ATOM 7386  H HD2  . ARG A 1 48 ? -4.696  13.358  -23.083 1.00 1.84  ? 48 ARG A HD2  4  
ATOM 7387  H HD3  . ARG A 1 48 ? -3.752  13.547  -21.606 1.00 1.84  ? 48 ARG A HD3  4  
ATOM 7388  H HE   . ARG A 1 48 ? -2.564  14.101  -24.298 1.00 2.46  ? 48 ARG A HE   4  
ATOM 7389  H HH11 . ARG A 1 48 ? -4.119  16.142  -22.448 1.00 3.28  ? 48 ARG A HH11 4  
ATOM 7390  H HH12 . ARG A 1 48 ? -2.770  17.019  -21.807 1.00 3.23  ? 48 ARG A HH12 4  
ATOM 7391  H HH21 . ARG A 1 48 ? -0.414  14.685  -22.851 1.00 2.92  ? 48 ARG A HH21 4  
ATOM 7392  H HH22 . ARG A 1 48 ? -0.666  16.193  -22.036 1.00 3.04  ? 48 ARG A HH22 4  
ATOM 7393  N N    . LYS A 1 49 ? -0.959  9.839   -19.809 1.00 0.45  ? 49 LYS A N    4  
ATOM 7394  C CA   . LYS A 1 49 ? -0.321  9.314   -18.582 1.00 0.39  ? 49 LYS A CA   4  
ATOM 7395  C C    . LYS A 1 49 ? 0.335   10.427  -17.768 1.00 0.38  ? 49 LYS A C    4  
ATOM 7396  O O    . LYS A 1 49 ? 0.804   11.420  -18.293 1.00 0.54  ? 49 LYS A O    4  
ATOM 7397  C CB   . LYS A 1 49 ? 0.747   8.282   -18.948 1.00 0.58  ? 49 LYS A CB   4  
ATOM 7398  C CG   . LYS A 1 49 ? 1.277   8.497   -20.378 1.00 0.89  ? 49 LYS A CG   4  
ATOM 7399  C CD   . LYS A 1 49 ? 2.088   9.796   -20.467 1.00 0.96  ? 49 LYS A CD   4  
ATOM 7400  C CE   . LYS A 1 49 ? 3.266   9.749   -19.489 1.00 0.92  ? 49 LYS A CE   4  
ATOM 7401  N NZ   . LYS A 1 49 ? 4.411   10.519  -20.054 1.00 1.06  ? 49 LYS A NZ   4  
ATOM 7402  H H    . LYS A 1 49 ? -0.587  10.613  -20.261 1.00 0.55  ? 49 LYS A H    4  
ATOM 7403  H HA   . LYS A 1 49 ? -1.078  8.832   -17.974 1.00 0.34  ? 49 LYS A HA   4  
ATOM 7404  H HB2  . LYS A 1 49 ? 1.564   8.364   -18.247 1.00 0.59  ? 49 LYS A HB2  4  
ATOM 7405  H HB3  . LYS A 1 49 ? 0.315   7.302   -18.878 1.00 0.69  ? 49 LYS A HB3  4  
ATOM 7406  H HG2  . LYS A 1 49 ? 1.908   7.664   -20.653 1.00 1.06  ? 49 LYS A HG2  4  
ATOM 7407  H HG3  . LYS A 1 49 ? 0.443   8.551   -21.062 1.00 1.14  ? 49 LYS A HG3  4  
ATOM 7408  H HD2  . LYS A 1 49 ? 2.462   9.913   -21.473 1.00 0.98  ? 49 LYS A HD2  4  
ATOM 7409  H HD3  . LYS A 1 49 ? 1.454   10.635  -20.223 1.00 1.23  ? 49 LYS A HD3  4  
ATOM 7410  H HE2  . LYS A 1 49 ? 2.971   10.184  -18.546 1.00 0.97  ? 49 LYS A HE2  4  
ATOM 7411  H HE3  . LYS A 1 49 ? 3.565   8.724   -19.336 1.00 0.87  ? 49 LYS A HE3  4  
ATOM 7412  H HZ1  . LYS A 1 49 ? 4.097   11.478  -20.304 1.00 1.66  ? 49 LYS A HZ1  4  
ATOM 7413  H HZ2  . LYS A 1 49 ? 5.172   10.576  -19.349 1.00 1.54  ? 49 LYS A HZ2  4  
ATOM 7414  H HZ3  . LYS A 1 49 ? 4.764   10.039  -20.905 1.00 1.19  ? 49 LYS A HZ3  4  
ATOM 7415  N N    . ALA A 1 50 ? 0.399   10.224  -16.483 1.00 0.27  ? 50 ALA A N    4  
ATOM 7416  C CA   . ALA A 1 50 ? 1.063   11.210  -15.572 1.00 0.28  ? 50 ALA A CA   4  
ATOM 7417  C C    . ALA A 1 50 ? 1.873   10.424  -14.567 1.00 0.24  ? 50 ALA A C    4  
ATOM 7418  O O    . ALA A 1 50 ? 1.557   9.298   -14.293 1.00 0.21  ? 50 ALA A O    4  
ATOM 7419  C CB   . ALA A 1 50 ? 0.030   12.014  -14.792 1.00 0.32  ? 50 ALA A CB   4  
ATOM 7420  H H    . ALA A 1 50 ? 0.026   9.386   -16.110 1.00 0.29  ? 50 ALA A H    4  
ATOM 7421  H HA   . ALA A 1 50 ? 1.705   11.869  -16.136 1.00 0.34  ? 50 ALA A HA   4  
ATOM 7422  H HB1  . ALA A 1 50 ? -0.579  11.338  -14.210 1.00 1.10  ? 50 ALA A HB1  4  
ATOM 7423  H HB2  . ALA A 1 50 ? 0.543   12.695  -14.125 1.00 1.06  ? 50 ALA A HB2  4  
ATOM 7424  H HB3  . ALA A 1 50 ? -0.588  12.569  -15.473 1.00 1.04  ? 50 ALA A HB3  4  
ATOM 7425  N N    . CYS A 1 51 ? 2.859   11.007  -13.957 1.00 0.25  ? 51 CYS A N    4  
ATOM 7426  C CA   . CYS A 1 51 ? 3.595   10.250  -12.925 1.00 0.22  ? 51 CYS A CA   4  
ATOM 7427  C C    . CYS A 1 51 ? 3.388   10.982  -11.618 1.00 0.22  ? 51 CYS A C    4  
ATOM 7428  O O    . CYS A 1 51 ? 3.186   12.178  -11.612 1.00 0.24  ? 51 CYS A O    4  
ATOM 7429  C CB   . CYS A 1 51 ? 5.093   10.130  -13.257 1.00 0.24  ? 51 CYS A CB   4  
ATOM 7430  S SG   . CYS A 1 51 ? 5.503   8.364   -13.364 1.00 0.26  ? 51 CYS A SG   4  
ATOM 7431  H H    . CYS A 1 51 ? 3.076   11.949  -14.126 1.00 0.28  ? 51 CYS A H    4  
ATOM 7432  H HA   . CYS A 1 51 ? 3.171   9.264   -12.851 1.00 0.20  ? 51 CYS A HA   4  
ATOM 7433  H HB2  . CYS A 1 51 ? 5.296   10.608  -14.197 1.00 0.28  ? 51 CYS A HB2  4  
ATOM 7434  H HB3  . CYS A 1 51 ? 5.680   10.592  -12.478 1.00 0.27  ? 51 CYS A HB3  4  
ATOM 7435  N N    . LEU A 1 52 ? 3.393   10.284  -10.523 1.00 0.21  ? 52 LEU A N    4  
ATOM 7436  C CA   . LEU A 1 52 ? 3.188   10.953  -9.216  1.00 0.23  ? 52 LEU A CA   4  
ATOM 7437  C C    . LEU A 1 52 ? 4.213   10.390  -8.234  1.00 0.25  ? 52 LEU A C    4  
ATOM 7438  O O    . LEU A 1 52 ? 4.882   9.420   -8.528  1.00 0.25  ? 52 LEU A O    4  
ATOM 7439  C CB   . LEU A 1 52 ? 1.742   10.782  -8.699  1.00 0.22  ? 52 LEU A CB   4  
ATOM 7440  C CG   . LEU A 1 52 ? 1.056   9.570   -9.333  1.00 0.18  ? 52 LEU A CG   4  
ATOM 7441  C CD1  . LEU A 1 52 ? 0.840   9.796   -10.842 1.00 0.17  ? 52 LEU A CD1  4  
ATOM 7442  C CD2  . LEU A 1 52 ? 1.910   8.332   -9.063  1.00 0.19  ? 52 LEU A CD2  4  
ATOM 7443  H H    . LEU A 1 52 ? 3.513   9.313   -10.559 1.00 0.20  ? 52 LEU A H    4  
ATOM 7444  H HA   . LEU A 1 52 ? 3.387   11.989  -9.341  1.00 0.25  ? 52 LEU A HA   4  
ATOM 7445  H HB2  . LEU A 1 52 ? 1.761   10.656  -7.629  1.00 0.25  ? 52 LEU A HB2  4  
ATOM 7446  H HB3  . LEU A 1 52 ? 1.176   11.672  -8.936  1.00 0.24  ? 52 LEU A HB3  4  
ATOM 7447  H HG   . LEU A 1 52 ? 0.104   9.437   -8.877  1.00 0.19  ? 52 LEU A HG   4  
ATOM 7448  H HD11 . LEU A 1 52 ? 1.005   10.841  -11.077 1.00 0.98  ? 52 LEU A HD11 4  
ATOM 7449  H HD12 . LEU A 1 52 ? 1.532   9.190   -11.405 1.00 0.98  ? 52 LEU A HD12 4  
ATOM 7450  H HD13 . LEU A 1 52 ? -0.172  9.530   -11.107 1.00 1.01  ? 52 LEU A HD13 4  
ATOM 7451  H HD21 . LEU A 1 52 ? 2.718   8.597   -8.393  1.00 1.00  ? 52 LEU A HD21 4  
ATOM 7452  H HD22 . LEU A 1 52 ? 1.302   7.571   -8.603  1.00 0.98  ? 52 LEU A HD22 4  
ATOM 7453  H HD23 . LEU A 1 52 ? 2.317   7.966   -9.988  1.00 1.03  ? 52 LEU A HD23 4  
ATOM 7454  N N    . ASN A 1 53 ? 4.379   11.007  -7.099  1.00 0.29  ? 53 ASN A N    4  
ATOM 7455  C CA   . ASN A 1 53 ? 5.404   10.513  -6.126  1.00 0.32  ? 53 ASN A CA   4  
ATOM 7456  C C    . ASN A 1 53 ? 4.769   9.536   -5.130  1.00 0.34  ? 53 ASN A C    4  
ATOM 7457  O O    . ASN A 1 53 ? 4.221   9.974   -4.148  1.00 0.37  ? 53 ASN A O    4  
ATOM 7458  C CB   . ASN A 1 53 ? 5.985   11.697  -5.335  1.00 0.36  ? 53 ASN A CB   4  
ATOM 7459  C CG   . ASN A 1 53 ? 7.375   12.064  -5.868  1.00 0.43  ? 53 ASN A CG   4  
ATOM 7460  O OD1  . ASN A 1 53 ? 7.785   11.606  -6.916  1.00 1.07  ? 53 ASN A OD1  4  
ATOM 7461  N ND2  . ASN A 1 53 ? 8.127   12.881  -5.177  1.00 0.93  ? 53 ASN A ND2  4  
ATOM 7462  H H    . ASN A 1 53 ? 3.850   11.807  -6.897  1.00 0.30  ? 53 ASN A H    4  
ATOM 7463  H HA   . ASN A 1 53 ? 6.197   10.031  -6.665  1.00 0.33  ? 53 ASN A HA   4  
ATOM 7464  H HB2  . ASN A 1 53 ? 5.326   12.547  -5.421  1.00 0.40  ? 53 ASN A HB2  4  
ATOM 7465  H HB3  . ASN A 1 53 ? 6.070   11.418  -4.292  1.00 0.40  ? 53 ASN A HB3  4  
ATOM 7466  H HD21 . ASN A 1 53 ? 7.801   13.253  -4.331  1.00 1.59  ? 53 ASN A HD21 4  
ATOM 7467  H HD22 . ASN A 1 53 ? 9.019   13.116  -5.504  1.00 0.93  ? 53 ASN A HD22 4  
ATOM 7468  N N    . PRO A 1 54 ? 4.886   8.239   -5.349  1.00 0.34  ? 54 PRO A N    4  
ATOM 7469  C CA   . PRO A 1 54 ? 4.325   7.261   -4.398  1.00 0.37  ? 54 PRO A CA   4  
ATOM 7470  C C    . PRO A 1 54 ? 5.027   7.416   -3.046  1.00 0.43  ? 54 PRO A C    4  
ATOM 7471  O O    . PRO A 1 54 ? 4.430   7.204   -2.008  1.00 0.46  ? 54 PRO A O    4  
ATOM 7472  C CB   . PRO A 1 54 ? 4.568   5.908   -5.063  1.00 0.37  ? 54 PRO A CB   4  
ATOM 7473  C CG   . PRO A 1 54 ? 5.685   6.142   -6.093  1.00 0.36  ? 54 PRO A CG   4  
ATOM 7474  C CD   . PRO A 1 54 ? 5.585   7.620   -6.497  1.00 0.32  ? 54 PRO A CD   4  
ATOM 7475  H HA   . PRO A 1 54 ? 3.265   7.426   -4.284  1.00 0.36  ? 54 PRO A HA   4  
ATOM 7476  H HB2  . PRO A 1 54 ? 4.881   5.183   -4.325  1.00 0.41  ? 54 PRO A HB2  4  
ATOM 7477  H HB3  . PRO A 1 54 ? 3.674   5.574   -5.564  1.00 0.35  ? 54 PRO A HB3  4  
ATOM 7478  H HG2  . PRO A 1 54 ? 6.646   5.944   -5.646  1.00 0.40  ? 54 PRO A HG2  4  
ATOM 7479  H HG3  . PRO A 1 54 ? 5.534   5.519   -6.953  1.00 0.36  ? 54 PRO A HG3  4  
ATOM 7480  H HD2  . PRO A 1 54 ? 6.570   8.030   -6.630  1.00 0.34  ? 54 PRO A HD2  4  
ATOM 7481  H HD3  . PRO A 1 54 ? 4.994   7.724   -7.395  1.00 0.28  ? 54 PRO A HD3  4  
ATOM 7482  N N    . ALA A 1 55 ? 6.264   7.871   -3.049  1.00 0.45  ? 55 ALA A N    4  
ATOM 7483  C CA   . ALA A 1 55 ? 6.963   8.138   -1.760  1.00 0.51  ? 55 ALA A CA   4  
ATOM 7484  C C    . ALA A 1 55 ? 6.160   9.231   -1.039  1.00 0.52  ? 55 ALA A C    4  
ATOM 7485  O O    . ALA A 1 55 ? 6.074   9.259   0.175   1.00 0.56  ? 55 ALA A O    4  
ATOM 7486  C CB   . ALA A 1 55 ? 8.386   8.635   -2.033  1.00 0.54  ? 55 ALA A CB   4  
ATOM 7487  H H    . ALA A 1 55 ? 6.705   8.095   -3.896  1.00 0.43  ? 55 ALA A H    4  
ATOM 7488  H HA   . ALA A 1 55 ? 6.989   7.240   -1.160  1.00 0.53  ? 55 ALA A HA   4  
ATOM 7489  H HB1  . ALA A 1 55 ? 8.780   8.141   -2.910  1.00 1.13  ? 55 ALA A HB1  4  
ATOM 7490  H HB2  . ALA A 1 55 ? 8.370   9.703   -2.200  1.00 1.19  ? 55 ALA A HB2  4  
ATOM 7491  H HB3  . ALA A 1 55 ? 9.015   8.414   -1.184  1.00 1.06  ? 55 ALA A HB3  4  
ATOM 7492  N N    . SER A 1 56 ? 5.534   10.107  -1.806  1.00 0.50  ? 56 SER A N    4  
ATOM 7493  C CA   . SER A 1 56 ? 4.685   11.183  -1.222  1.00 0.51  ? 56 SER A CA   4  
ATOM 7494  C C    . SER A 1 56 ? 3.514   10.518  -0.472  1.00 0.51  ? 56 SER A C    4  
ATOM 7495  O O    . SER A 1 56 ? 3.076   9.450   -0.860  1.00 0.51  ? 56 SER A O    4  
ATOM 7496  C CB   . SER A 1 56 ? 4.122   12.061  -2.348  1.00 0.50  ? 56 SER A CB   4  
ATOM 7497  O OG   . SER A 1 56 ? 4.056   13.412  -1.907  1.00 0.56  ? 56 SER A OG   4  
ATOM 7498  H H    . SER A 1 56 ? 5.606   10.033  -2.779  1.00 0.47  ? 56 SER A H    4  
ATOM 7499  H HA   . SER A 1 56 ? 5.274   11.785  -0.559  1.00 0.54  ? 56 SER A HA   4  
ATOM 7500  H HB2  . SER A 1 56 ? 4.765   12.001  -3.210  1.00 0.46  ? 56 SER A HB2  4  
ATOM 7501  H HB3  . SER A 1 56 ? 3.135   11.710  -2.618  1.00 0.51  ? 56 SER A HB3  4  
ATOM 7502  H HG   . SER A 1 56 ? 3.132   13.638  -1.775  1.00 1.08  ? 56 SER A HG   4  
ATOM 7503  N N    . PRO A 1 57 ? 3.029   11.155  0.570   1.00 0.53  ? 57 PRO A N    4  
ATOM 7504  C CA   . PRO A 1 57 ? 1.902   10.618  1.364   1.00 0.53  ? 57 PRO A CA   4  
ATOM 7505  C C    . PRO A 1 57 ? 0.591   10.770  0.580   1.00 0.51  ? 57 PRO A C    4  
ATOM 7506  O O    . PRO A 1 57 ? -0.096  9.798   0.304   1.00 0.51  ? 57 PRO A O    4  
ATOM 7507  C CB   . PRO A 1 57 ? 1.916   11.477  2.634   1.00 0.59  ? 57 PRO A CB   4  
ATOM 7508  C CG   . PRO A 1 57 ? 2.666   12.781  2.274   1.00 0.62  ? 57 PRO A CG   4  
ATOM 7509  C CD   . PRO A 1 57 ? 3.540   12.459  1.046   1.00 0.58  ? 57 PRO A CD   4  
ATOM 7510  H HA   . PRO A 1 57 ? 2.076   9.584   1.615   1.00 0.54  ? 57 PRO A HA   4  
ATOM 7511  H HB2  . PRO A 1 57 ? 0.902   11.700  2.941   1.00 0.60  ? 57 PRO A HB2  4  
ATOM 7512  H HB3  . PRO A 1 57 ? 2.439   10.963  3.425   1.00 0.62  ? 57 PRO A HB3  4  
ATOM 7513  H HG2  . PRO A 1 57 ? 1.956   13.561  2.034   1.00 0.63  ? 57 PRO A HG2  4  
ATOM 7514  H HG3  . PRO A 1 57 ? 3.292   13.089  3.096   1.00 0.67  ? 57 PRO A HG3  4  
ATOM 7515  H HD2  . PRO A 1 57 ? 3.413   13.218  0.286   1.00 0.59  ? 57 PRO A HD2  4  
ATOM 7516  H HD3  . PRO A 1 57 ? 4.577   12.372  1.331   1.00 0.59  ? 57 PRO A HD3  4  
ATOM 7517  N N    . ILE A 1 58 ? 0.265   11.981  0.189   1.00 0.52  ? 58 ILE A N    4  
ATOM 7518  C CA   . ILE A 1 58 ? -0.973  12.226  -0.613  1.00 0.51  ? 58 ILE A CA   4  
ATOM 7519  C C    . ILE A 1 58 ? -0.961  11.310  -1.823  1.00 0.45  ? 58 ILE A C    4  
ATOM 7520  O O    . ILE A 1 58 ? -1.956  10.726  -2.195  1.00 0.44  ? 58 ILE A O    4  
ATOM 7521  C CB   . ILE A 1 58 ? -0.957  13.689  -1.092  1.00 0.54  ? 58 ILE A CB   4  
ATOM 7522  C CG1  . ILE A 1 58 ? -2.143  14.449  -0.486  1.00 0.62  ? 58 ILE A CG1  4  
ATOM 7523  C CG2  . ILE A 1 58 ? -1.027  13.762  -2.629  1.00 0.49  ? 58 ILE A CG2  4  
ATOM 7524  C CD1  . ILE A 1 58 ? -1.900  14.682  1.007   1.00 0.68  ? 58 ILE A CD1  4  
ATOM 7525  H H    . ILE A 1 58 ? 0.854   12.733  0.404   1.00 0.55  ? 58 ILE A H    4  
ATOM 7526  H HA   . ILE A 1 58 ? -1.850  12.034  -0.016  1.00 0.55  ? 58 ILE A HA   4  
ATOM 7527  H HB   . ILE A 1 58 ? -0.033  14.142  -0.771  1.00 0.56  ? 58 ILE A HB   4  
ATOM 7528  H HG12 . ILE A 1 58 ? -2.252  15.400  -0.986  1.00 0.64  ? 58 ILE A HG12 4  
ATOM 7529  H HG13 . ILE A 1 58 ? -3.046  13.871  -0.616  1.00 0.62  ? 58 ILE A HG13 4  
ATOM 7530  H HG21 . ILE A 1 58 ? -1.782  13.080  -2.993  1.00 1.11  ? 58 ILE A HG21 4  
ATOM 7531  H HG22 . ILE A 1 58 ? -1.270  14.764  -2.933  1.00 1.12  ? 58 ILE A HG22 4  
ATOM 7532  H HG23 . ILE A 1 58 ? -0.065  13.484  -3.046  1.00 1.14  ? 58 ILE A HG23 4  
ATOM 7533  H HD11 . ILE A 1 58 ? -0.917  15.108  1.149   1.00 1.10  ? 58 ILE A HD11 4  
ATOM 7534  H HD12 . ILE A 1 58 ? -2.646  15.363  1.391   1.00 1.28  ? 58 ILE A HD12 4  
ATOM 7535  H HD13 . ILE A 1 58 ? -1.964  13.742  1.534   1.00 1.15  ? 58 ILE A HD13 4  
ATOM 7536  N N    . VAL A 1 59 ? 0.164   11.225  -2.458  1.00 0.43  ? 59 VAL A N    4  
ATOM 7537  C CA   . VAL A 1 59 ? 0.280   10.395  -3.661  1.00 0.40  ? 59 VAL A CA   4  
ATOM 7538  C C    . VAL A 1 59 ? 0.137   8.924   -3.294  1.00 0.37  ? 59 VAL A C    4  
ATOM 7539  O O    . VAL A 1 59 ? -0.528  8.183   -3.987  1.00 0.33  ? 59 VAL A O    4  
ATOM 7540  C CB   . VAL A 1 59 ? 1.640   10.651  -4.268  1.00 0.51  ? 59 VAL A CB   4  
ATOM 7541  C CG1  . VAL A 1 59 ? 1.827   9.763   -5.466  1.00 0.31  ? 59 VAL A CG1  4  
ATOM 7542  C CG2  . VAL A 1 59 ? 1.765   12.111  -4.692  1.00 0.88  ? 59 VAL A CG2  4  
ATOM 7543  H H    . VAL A 1 59 ? 0.937   11.743  -2.153  1.00 0.46  ? 59 VAL A H    4  
ATOM 7544  H HA   . VAL A 1 59 ? -0.504  10.665  -4.351  1.00 0.41  ? 59 VAL A HA   4  
ATOM 7545  H HB   . VAL A 1 59 ? 2.392   10.422  -3.535  1.00 0.83  ? 59 VAL A HB   4  
ATOM 7546  H HG11 . VAL A 1 59 ? 0.902   9.713   -6.013  1.00 1.09  ? 59 VAL A HG11 4  
ATOM 7547  H HG12 . VAL A 1 59 ? 2.602   10.176  -6.088  1.00 1.01  ? 59 VAL A HG12 4  
ATOM 7548  H HG13 . VAL A 1 59 ? 2.114   8.782   -5.130  1.00 1.11  ? 59 VAL A HG13 4  
ATOM 7549  H HG21 . VAL A 1 59 ? 1.634   12.749  -3.832  1.00 1.47  ? 59 VAL A HG21 4  
ATOM 7550  H HG22 . VAL A 1 59 ? 2.741   12.280  -5.121  1.00 1.52  ? 59 VAL A HG22 4  
ATOM 7551  H HG23 . VAL A 1 59 ? 1.009   12.334  -5.423  1.00 1.24  ? 59 VAL A HG23 4  
ATOM 7552  N N    . LYS A 1 60 ? 0.709   8.497   -2.192  1.00 0.43  ? 60 LYS A N    4  
ATOM 7553  C CA   . LYS A 1 60 ? 0.526   7.074   -1.778  1.00 0.43  ? 60 LYS A CA   4  
ATOM 7554  C C    . LYS A 1 60 ? -0.991  6.815   -1.678  1.00 0.43  ? 60 LYS A C    4  
ATOM 7555  O O    . LYS A 1 60 ? -1.461  5.696   -1.792  1.00 0.42  ? 60 LYS A O    4  
ATOM 7556  C CB   . LYS A 1 60 ? 1.171   6.842   -0.412  1.00 0.50  ? 60 LYS A CB   4  
ATOM 7557  C CG   . LYS A 1 60 ? 2.107   5.634   -0.482  1.00 0.60  ? 60 LYS A CG   4  
ATOM 7558  C CD   . LYS A 1 60 ? 2.814   5.458   0.864   1.00 0.91  ? 60 LYS A CD   4  
ATOM 7559  C CE   . LYS A 1 60 ? 4.247   4.967   0.634   1.00 0.99  ? 60 LYS A CE   4  
ATOM 7560  N NZ   . LYS A 1 60 ? 5.182   6.128   0.639   1.00 1.67  ? 60 LYS A NZ   4  
ATOM 7561  H H    . LYS A 1 60 ? 1.214   9.115   -1.624  1.00 0.47  ? 60 LYS A H    4  
ATOM 7562  H HA   . LYS A 1 60 ? 0.969   6.421   -2.523  1.00 0.40  ? 60 LYS A HA   4  
ATOM 7563  H HB2  . LYS A 1 60 ? 1.730   7.720   -0.126  1.00 0.65  ? 60 LYS A HB2  4  
ATOM 7564  H HB3  . LYS A 1 60 ? 0.398   6.656   0.320   1.00 0.59  ? 60 LYS A HB3  4  
ATOM 7565  H HG2  . LYS A 1 60 ? 1.532   4.747   -0.707  1.00 1.10  ? 60 LYS A HG2  4  
ATOM 7566  H HG3  . LYS A 1 60 ? 2.842   5.792   -1.257  1.00 0.87  ? 60 LYS A HG3  4  
ATOM 7567  H HD2  . LYS A 1 60 ? 2.838   6.405   1.384   1.00 1.38  ? 60 LYS A HD2  4  
ATOM 7568  H HD3  . LYS A 1 60 ? 2.279   4.735   1.462   1.00 1.48  ? 60 LYS A HD3  4  
ATOM 7569  H HE2  . LYS A 1 60 ? 4.522   4.280   1.421   1.00 1.20  ? 60 LYS A HE2  4  
ATOM 7570  H HE3  . LYS A 1 60 ? 4.305   4.461   -0.319  1.00 1.40  ? 60 LYS A HE3  4  
ATOM 7571  H HZ1  . LYS A 1 60 ? 4.817   6.872   0.010   1.00 2.08  ? 60 LYS A HZ1  4  
ATOM 7572  H HZ2  . LYS A 1 60 ? 5.268   6.500   1.605   1.00 2.01  ? 60 LYS A HZ2  4  
ATOM 7573  H HZ3  . LYS A 1 60 ? 6.119   5.820   0.304   1.00 2.22  ? 60 LYS A HZ3  4  
ATOM 7574  N N    . LYS A 1 61 ? -1.750  7.883   -1.529  1.00 0.45  ? 61 LYS A N    4  
ATOM 7575  C CA   . LYS A 1 61 ? -3.225  7.806   -1.486  1.00 0.46  ? 61 LYS A CA   4  
ATOM 7576  C C    . LYS A 1 61 ? -3.670  7.520   -2.903  1.00 0.42  ? 61 LYS A C    4  
ATOM 7577  O O    . LYS A 1 61 ? -4.394  6.593   -3.163  1.00 0.44  ? 61 LYS A O    4  
ATOM 7578  C CB   . LYS A 1 61 ? -3.761  9.168   -1.065  1.00 0.51  ? 61 LYS A CB   4  
ATOM 7579  C CG   . LYS A 1 61 ? -4.919  8.992   -0.089  1.00 0.72  ? 61 LYS A CG   4  
ATOM 7580  C CD   . LYS A 1 61 ? -5.937  10.113  -0.301  1.00 1.03  ? 61 LYS A CD   4  
ATOM 7581  C CE   . LYS A 1 61 ? -7.249  9.759   0.404   1.00 1.30  ? 61 LYS A CE   4  
ATOM 7582  N NZ   . LYS A 1 61 ? -7.113  9.996   1.870   1.00 1.87  ? 61 LYS A NZ   4  
ATOM 7583  H H    . LYS A 1 61 ? -1.337  8.760   -1.504  1.00 0.46  ? 61 LYS A H    4  
ATOM 7584  H HA   . LYS A 1 61 ? -3.556  7.032   -0.810  1.00 0.49  ? 61 LYS A HA   4  
ATOM 7585  H HB2  . LYS A 1 61 ? -2.963  9.731   -0.595  1.00 0.58  ? 61 LYS A HB2  4  
ATOM 7586  H HB3  . LYS A 1 61 ? -4.099  9.704   -1.945  1.00 0.66  ? 61 LYS A HB3  4  
ATOM 7587  H HG2  . LYS A 1 61 ? -5.390  8.035   -0.260  1.00 1.41  ? 61 LYS A HG2  4  
ATOM 7588  H HG3  . LYS A 1 61 ? -4.543  9.035   0.922   1.00 1.05  ? 61 LYS A HG3  4  
ATOM 7589  H HD2  . LYS A 1 61 ? -5.543  11.033  0.106   1.00 1.37  ? 61 LYS A HD2  4  
ATOM 7590  H HD3  . LYS A 1 61 ? -6.119  10.236  -1.358  1.00 1.76  ? 61 LYS A HD3  4  
ATOM 7591  H HE2  . LYS A 1 61 ? -8.044  10.377  0.013   1.00 1.85  ? 61 LYS A HE2  4  
ATOM 7592  H HE3  . LYS A 1 61 ? -7.484  8.719   0.227   1.00 1.55  ? 61 LYS A HE3  4  
ATOM 7593  H HZ1  . LYS A 1 61 ? -6.697  10.936  2.032   1.00 2.42  ? 61 LYS A HZ1  4  
ATOM 7594  H HZ2  . LYS A 1 61 ? -8.051  9.950   2.316   1.00 2.11  ? 61 LYS A HZ2  4  
ATOM 7595  H HZ3  . LYS A 1 61 ? -6.499  9.268   2.285   1.00 2.27  ? 61 LYS A HZ3  4  
ATOM 7596  N N    . ILE A 1 62 ? -3.183  8.323   -3.817  1.00 0.37  ? 62 ILE A N    4  
ATOM 7597  C CA   . ILE A 1 62 ? -3.475  8.154   -5.259  1.00 0.34  ? 62 ILE A CA   4  
ATOM 7598  C C    . ILE A 1 62 ? -3.425  6.668   -5.628  1.00 0.33  ? 62 ILE A C    4  
ATOM 7599  O O    . ILE A 1 62 ? -4.243  6.194   -6.385  1.00 0.34  ? 62 ILE A O    4  
ATOM 7600  C CB   . ILE A 1 62 ? -2.410  8.967   -6.029  1.00 0.32  ? 62 ILE A CB   4  
ATOM 7601  C CG1  . ILE A 1 62 ? -3.062  10.085  -6.839  1.00 0.34  ? 62 ILE A CG1  4  
ATOM 7602  C CG2  . ILE A 1 62 ? -1.584  8.074   -6.952  1.00 0.30  ? 62 ILE A CG2  4  
ATOM 7603  C CD1  . ILE A 1 62 ? -3.980  10.885  -5.923  1.00 0.36  ? 62 ILE A CD1  4  
ATOM 7604  H H    . ILE A 1 62 ? -2.584  9.048   -3.542  1.00 0.37  ? 62 ILE A H    4  
ATOM 7605  H HA   . ILE A 1 62 ? -4.455  8.534   -5.469  1.00 0.36  ? 62 ILE A HA   4  
ATOM 7606  H HB   . ILE A 1 62 ? -1.749  9.413   -5.308  1.00 0.33  ? 62 ILE A HB   4  
ATOM 7607  H HG12 . ILE A 1 62 ? -2.293  10.736  -7.237  1.00 0.35  ? 62 ILE A HG12 4  
ATOM 7608  H HG13 . ILE A 1 62 ? -3.634  9.665   -7.648  1.00 0.35  ? 62 ILE A HG13 4  
ATOM 7609  H HG21 . ILE A 1 62 ? -2.238  7.570   -7.645  1.00 1.02  ? 62 ILE A HG21 4  
ATOM 7610  H HG22 . ILE A 1 62 ? -0.874  8.679   -7.494  1.00 1.06  ? 62 ILE A HG22 4  
ATOM 7611  H HG23 . ILE A 1 62 ? -1.054  7.343   -6.359  1.00 1.07  ? 62 ILE A HG23 4  
ATOM 7612  H HD11 . ILE A 1 62 ? -3.567  10.892  -4.924  1.00 1.08  ? 62 ILE A HD11 4  
ATOM 7613  H HD12 . ILE A 1 62 ? -4.060  11.896  -6.288  1.00 1.05  ? 62 ILE A HD12 4  
ATOM 7614  H HD13 . ILE A 1 62 ? -4.956  10.427  -5.905  1.00 1.01  ? 62 ILE A HD13 4  
ATOM 7615  N N    . ILE A 1 63 ? -2.492  5.923   -5.078  1.00 0.31  ? 63 ILE A N    4  
ATOM 7616  C CA   . ILE A 1 63 ? -2.435  4.463   -5.389  1.00 0.31  ? 63 ILE A CA   4  
ATOM 7617  C C    . ILE A 1 63 ? -3.617  3.777   -4.733  1.00 0.37  ? 63 ILE A C    4  
ATOM 7618  O O    . ILE A 1 63 ? -4.363  3.051   -5.358  1.00 0.41  ? 63 ILE A O    4  
ATOM 7619  C CB   . ILE A 1 63 ? -1.173  3.853   -4.792  1.00 0.32  ? 63 ILE A CB   4  
ATOM 7620  C CG1  . ILE A 1 63 ? 0.042   4.433   -5.488  1.00 0.32  ? 63 ILE A CG1  4  
ATOM 7621  C CG2  . ILE A 1 63 ? -1.198  2.332   -4.955  1.00 0.34  ? 63 ILE A CG2  4  
ATOM 7622  C CD1  . ILE A 1 63 ? 0.419   5.724   -4.794  1.00 0.42  ? 63 ILE A CD1  4  
ATOM 7623  H H    . ILE A 1 63 ? -1.841  6.319   -4.440  1.00 0.32  ? 63 ILE A H    4  
ATOM 7624  H HA   . ILE A 1 63 ? -2.454  4.306   -6.456  1.00 0.30  ? 63 ILE A HA   4  
ATOM 7625  H HB   . ILE A 1 63 ? -1.130  4.093   -3.739  1.00 0.35  ? 63 ILE A HB   4  
ATOM 7626  H HG12 . ILE A 1 63 ? 0.850   3.743   -5.415  1.00 0.31  ? 63 ILE A HG12 4  
ATOM 7627  H HG13 . ILE A 1 63 ? -0.184  4.629   -6.523  1.00 0.48  ? 63 ILE A HG13 4  
ATOM 7628  H HG21 . ILE A 1 63 ? -1.713  2.075   -5.868  1.00 1.03  ? 63 ILE A HG21 4  
ATOM 7629  H HG22 . ILE A 1 63 ? -0.187  1.957   -4.993  1.00 1.02  ? 63 ILE A HG22 4  
ATOM 7630  H HG23 . ILE A 1 63 ? -1.714  1.891   -4.114  1.00 1.03  ? 63 ILE A HG23 4  
ATOM 7631  H HD11 . ILE A 1 63 ? -0.094  5.773   -3.842  1.00 1.16  ? 63 ILE A HD11 4  
ATOM 7632  H HD12 . ILE A 1 63 ? 1.481   5.750   -4.636  1.00 1.06  ? 63 ILE A HD12 4  
ATOM 7633  H HD13 . ILE A 1 63 ? 0.118   6.556   -5.408  1.00 1.07  ? 63 ILE A HD13 4  
ATOM 7634  N N    . GLU A 1 64 ? -3.754  3.994   -3.456  1.00 0.39  ? 64 GLU A N    4  
ATOM 7635  C CA   . GLU A 1 64 ? -4.843  3.344   -2.690  1.00 0.46  ? 64 GLU A CA   4  
ATOM 7636  C C    . GLU A 1 64 ? -6.219  3.767   -3.219  1.00 0.49  ? 64 GLU A C    4  
ATOM 7637  O O    . GLU A 1 64 ? -7.097  2.943   -3.392  1.00 0.62  ? 64 GLU A O    4  
ATOM 7638  C CB   . GLU A 1 64 ? -4.734  3.745   -1.224  1.00 0.49  ? 64 GLU A CB   4  
ATOM 7639  C CG   . GLU A 1 64 ? -3.831  2.757   -0.483  1.00 1.04  ? 64 GLU A CG   4  
ATOM 7640  C CD   . GLU A 1 64 ? -3.292  3.413   0.790   1.00 1.41  ? 64 GLU A CD   4  
ATOM 7641  O OE1  . GLU A 1 64 ? -2.326  4.153   0.689   1.00 2.00  ? 64 GLU A OE1  4  
ATOM 7642  O OE2  . GLU A 1 64 ? -3.854  3.166   1.845   1.00 1.81  ? 64 GLU A OE2  4  
ATOM 7643  H H    . GLU A 1 64 ? -3.109  4.577   -2.993  1.00 0.37  ? 64 GLU A H    4  
ATOM 7644  H HA   . GLU A 1 64 ? -4.728  2.275   -2.781  1.00 0.49  ? 64 GLU A HA   4  
ATOM 7645  H HB2  . GLU A 1 64 ? -4.315  4.740   -1.159  1.00 0.72  ? 64 GLU A HB2  4  
ATOM 7646  H HB3  . GLU A 1 64 ? -5.715  3.740   -0.779  1.00 0.75  ? 64 GLU A HB3  4  
ATOM 7647  H HG2  . GLU A 1 64 ? -4.400  1.876   -0.224  1.00 1.39  ? 64 GLU A HG2  4  
ATOM 7648  H HG3  . GLU A 1 64 ? -3.005  2.479   -1.120  1.00 1.44  ? 64 GLU A HG3  4  
ATOM 7649  N N    . LYS A 1 65 ? -6.422  5.041   -3.462  1.00 0.48  ? 65 LYS A N    4  
ATOM 7650  C CA   . LYS A 1 65 ? -7.750  5.496   -3.966  1.00 0.51  ? 65 LYS A CA   4  
ATOM 7651  C C    . LYS A 1 65 ? -7.937  5.008   -5.397  1.00 0.51  ? 65 LYS A C    4  
ATOM 7652  O O    . LYS A 1 65 ? -9.002  4.549   -5.753  1.00 0.56  ? 65 LYS A O    4  
ATOM 7653  C CB   . LYS A 1 65 ? -7.873  7.026   -3.882  1.00 0.52  ? 65 LYS A CB   4  
ATOM 7654  C CG   . LYS A 1 65 ? -6.886  7.703   -4.837  1.00 1.07  ? 65 LYS A CG   4  
ATOM 7655  C CD   . LYS A 1 65 ? -6.797  9.194   -4.502  1.00 1.45  ? 65 LYS A CD   4  
ATOM 7656  C CE   . LYS A 1 65 ? -7.651  9.991   -5.491  1.00 1.72  ? 65 LYS A CE   4  
ATOM 7657  N NZ   . LYS A 1 65 ? -7.664  11.430  -5.097  1.00 2.15  ? 65 LYS A NZ   4  
ATOM 7658  H H    . LYS A 1 65 ? -5.705  5.691   -3.309  1.00 0.54  ? 65 LYS A H    4  
ATOM 7659  H HA   . LYS A 1 65 ? -8.510  5.040   -3.356  1.00 0.56  ? 65 LYS A HA   4  
ATOM 7660  H HB2  . LYS A 1 65 ? -8.880  7.315   -4.146  1.00 0.92  ? 65 LYS A HB2  4  
ATOM 7661  H HB3  . LYS A 1 65 ? -7.665  7.344   -2.871  1.00 1.10  ? 65 LYS A HB3  4  
ATOM 7662  H HG2  . LYS A 1 65 ? -5.912  7.249   -4.730  1.00 1.56  ? 65 LYS A HG2  4  
ATOM 7663  H HG3  . LYS A 1 65 ? -7.228  7.584   -5.855  1.00 1.65  ? 65 LYS A HG3  4  
ATOM 7664  H HD2  . LYS A 1 65 ? -7.160  9.358   -3.497  1.00 1.79  ? 65 LYS A HD2  4  
ATOM 7665  H HD3  . LYS A 1 65 ? -5.771  9.518   -4.570  1.00 1.92  ? 65 LYS A HD3  4  
ATOM 7666  H HE2  . LYS A 1 65 ? -7.236  9.895   -6.483  1.00 2.13  ? 65 LYS A HE2  4  
ATOM 7667  H HE3  . LYS A 1 65 ? -8.661  9.608   -5.484  1.00 2.04  ? 65 LYS A HE3  4  
ATOM 7668  H HZ1  . LYS A 1 65 ? -6.688  11.783  -5.032  1.00 2.64  ? 65 LYS A HZ1  4  
ATOM 7669  H HZ2  . LYS A 1 65 ? -8.184  11.979  -5.811  1.00 2.41  ? 65 LYS A HZ2  4  
ATOM 7670  H HZ3  . LYS A 1 65 ? -8.130  11.533  -4.173  1.00 2.47  ? 65 LYS A HZ3  4  
ATOM 7671  N N    . MET A 1 66 ? -6.905  5.044   -6.204  1.00 0.46  ? 66 MET A N    4  
ATOM 7672  C CA   . MET A 1 66 ? -7.032  4.510   -7.584  1.00 0.46  ? 66 MET A CA   4  
ATOM 7673  C C    . MET A 1 66 ? -7.401  3.029   -7.462  1.00 0.50  ? 66 MET A C    4  
ATOM 7674  O O    . MET A 1 66 ? -8.178  2.497   -8.231  1.00 0.54  ? 66 MET A O    4  
ATOM 7675  C CB   . MET A 1 66 ? -5.699  4.643   -8.314  1.00 0.42  ? 66 MET A CB   4  
ATOM 7676  C CG   . MET A 1 66 ? -5.616  6.016   -8.985  1.00 0.40  ? 66 MET A CG   4  
ATOM 7677  S SD   . MET A 1 66 ? -6.684  6.027   -10.446 1.00 1.14  ? 66 MET A SD   4  
ATOM 7678  C CE   . MET A 1 66 ? -5.695  4.915   -11.477 1.00 0.37  ? 66 MET A CE   4  
ATOM 7679  H H    . MET A 1 66 ? -6.044  5.381   -5.891  1.00 0.42  ? 66 MET A H    4  
ATOM 7680  H HA   . MET A 1 66 ? -7.802  5.046   -8.110  1.00 0.48  ? 66 MET A HA   4  
ATOM 7681  H HB2  . MET A 1 66 ? -4.892  4.532   -7.605  1.00 0.40  ? 66 MET A HB2  4  
ATOM 7682  H HB3  . MET A 1 66 ? -5.626  3.872   -9.062  1.00 0.46  ? 66 MET A HB3  4  
ATOM 7683  H HG2  . MET A 1 66 ? -5.945  6.779   -8.291  1.00 0.76  ? 66 MET A HG2  4  
ATOM 7684  H HG3  . MET A 1 66 ? -4.595  6.218   -9.279  1.00 0.67  ? 66 MET A HG3  4  
ATOM 7685  H HE1  . MET A 1 66 ? -4.691  4.845   -11.082 1.00 1.05  ? 66 MET A HE1  4  
ATOM 7686  H HE2  . MET A 1 66 ? -6.141  3.932   -11.490 1.00 1.09  ? 66 MET A HE2  4  
ATOM 7687  H HE3  . MET A 1 66 ? -5.661  5.303   -12.484 1.00 1.06  ? 66 MET A HE3  4  
ATOM 7688  N N    . LEU A 1 67 ? -6.850  2.379   -6.458  1.00 0.50  ? 67 LEU A N    4  
ATOM 7689  C CA   . LEU A 1 67 ? -7.140  0.948   -6.197  1.00 0.55  ? 67 LEU A CA   4  
ATOM 7690  C C    . LEU A 1 67 ? -8.620  0.776   -5.833  1.00 0.60  ? 67 LEU A C    4  
ATOM 7691  O O    . LEU A 1 67 ? -9.224  -0.234  -6.142  1.00 0.64  ? 67 LEU A O    4  
ATOM 7692  C CB   . LEU A 1 67 ? -6.283  0.484   -5.016  1.00 0.56  ? 67 LEU A CB   4  
ATOM 7693  C CG   . LEU A 1 67 ? -5.067  -0.284  -5.528  1.00 0.53  ? 67 LEU A CG   4  
ATOM 7694  C CD1  . LEU A 1 67 ? -3.810  0.317   -4.908  1.00 0.53  ? 67 LEU A CD1  4  
ATOM 7695  C CD2  . LEU A 1 67 ? -5.182  -1.752  -5.124  1.00 0.56  ? 67 LEU A CD2  4  
ATOM 7696  H H    . LEU A 1 67 ? -6.246  2.852   -5.857  1.00 0.49  ? 67 LEU A H    4  
ATOM 7697  H HA   . LEU A 1 67 ? -6.897  0.369   -7.067  1.00 0.55  ? 67 LEU A HA   4  
ATOM 7698  H HB2  . LEU A 1 67 ? -5.950  1.347   -4.460  1.00 0.57  ? 67 LEU A HB2  4  
ATOM 7699  H HB3  . LEU A 1 67 ? -6.864  -0.152  -4.370  1.00 0.60  ? 67 LEU A HB3  4  
ATOM 7700  H HG   . LEU A 1 67 ? -5.013  -0.204  -6.605  1.00 0.51  ? 67 LEU A HG   4  
ATOM 7701  H HD11 . LEU A 1 67 ? -4.085  0.915   -4.051  1.00 1.24  ? 67 LEU A HD11 4  
ATOM 7702  H HD12 . LEU A 1 67 ? -3.148  -0.475  -4.597  1.00 1.19  ? 67 LEU A HD12 4  
ATOM 7703  H HD13 . LEU A 1 67 ? -3.314  0.940   -5.636  1.00 0.98  ? 67 LEU A HD13 4  
ATOM 7704  H HD21 . LEU A 1 67 ? -6.108  -2.159  -5.505  1.00 1.16  ? 67 LEU A HD21 4  
ATOM 7705  H HD22 . LEU A 1 67 ? -4.350  -2.307  -5.534  1.00 1.18  ? 67 LEU A HD22 4  
ATOM 7706  H HD23 . LEU A 1 67 ? -5.171  -1.831  -4.046  1.00 1.13  ? 67 LEU A HD23 4  
ATOM 7707  N N    . ASN A 1 68 ? -9.204  1.750   -5.165  1.00 0.63  ? 68 ASN A N    4  
ATOM 7708  C CA   . ASN A 1 68 ? -10.649 1.622   -4.772  1.00 0.70  ? 68 ASN A CA   4  
ATOM 7709  C C    . ASN A 1 68 ? -11.548 2.378   -5.764  1.00 0.76  ? 68 ASN A C    4  
ATOM 7710  O O    . ASN A 1 68 ? -11.110 3.276   -6.457  1.00 0.92  ? 68 ASN A O    4  
ATOM 7711  C CB   . ASN A 1 68 ? -10.860 2.179   -3.354  1.00 0.78  ? 68 ASN A CB   4  
ATOM 7712  C CG   . ASN A 1 68 ? -12.195 1.674   -2.796  1.00 1.48  ? 68 ASN A CG   4  
ATOM 7713  O OD1  . ASN A 1 68 ? -12.406 0.481   -2.683  1.00 2.21  ? 68 ASN A OD1  4  
ATOM 7714  N ND2  . ASN A 1 68 ? -13.111 2.533   -2.439  1.00 2.00  ? 68 ASN A ND2  4  
ATOM 7715  H H    . ASN A 1 68 ? -8.687  2.561   -4.919  1.00 0.62  ? 68 ASN A H    4  
ATOM 7716  H HA   . ASN A 1 68 ? -10.923 0.576   -4.781  1.00 0.72  ? 68 ASN A HA   4  
ATOM 7717  H HB2  . ASN A 1 68 ? -10.058 1.847   -2.708  1.00 1.16  ? 68 ASN A HB2  4  
ATOM 7718  H HB3  . ASN A 1 68 ? -10.874 3.259   -3.387  1.00 1.06  ? 68 ASN A HB3  4  
ATOM 7719  H HD21 . ASN A 1 68 ? -12.946 3.494   -2.527  1.00 2.14  ? 68 ASN A HD21 4  
ATOM 7720  H HD22 . ASN A 1 68 ? -13.968 2.215   -2.082  1.00 2.63  ? 68 ASN A HD22 4  
ATOM 7721  N N    . SER A 1 69 ? -12.810 2.018   -5.826  1.00 0.87  ? 69 SER A N    4  
ATOM 7722  C CA   . SER A 1 69 ? -13.756 2.700   -6.753  1.00 0.99  ? 69 SER A CA   4  
ATOM 7723  C C    . SER A 1 69 ? -15.187 2.235   -6.448  1.00 1.13  ? 69 SER A C    4  
ATOM 7724  O O    . SER A 1 69 ? -15.615 1.179   -6.881  1.00 1.69  ? 69 SER A O    4  
ATOM 7725  C CB   . SER A 1 69 ? -13.400 2.364   -8.207  1.00 1.46  ? 69 SER A CB   4  
ATOM 7726  O OG   . SER A 1 69 ? -14.264 3.081   -9.081  1.00 2.02  ? 69 SER A OG   4  
ATOM 7727  H H    . SER A 1 69 ? -13.137 1.300   -5.255  1.00 1.01  ? 69 SER A H    4  
ATOM 7728  H HA   . SER A 1 69 ? -13.688 3.761   -6.600  1.00 1.09  ? 69 SER A HA   4  
ATOM 7729  H HB2  . SER A 1 69 ? -12.380 2.649   -8.405  1.00 1.86  ? 69 SER A HB2  4  
ATOM 7730  H HB3  . SER A 1 69 ? -13.510 1.300   -8.368  1.00 1.93  ? 69 SER A HB3  4  
ATOM 7731  H HG   . SER A 1 69 ? -13.753 3.349   -9.850  1.00 2.26  ? 69 SER A HG   4  
ATOM 7732  N N    . ASP A 1 70 ? -15.926 3.016   -5.695  1.00 1.22  ? 70 ASP A N    4  
ATOM 7733  C CA   . ASP A 1 70 ? -17.330 2.630   -5.349  1.00 1.68  ? 70 ASP A CA   4  
ATOM 7734  C C    . ASP A 1 70 ? -18.113 3.873   -4.911  1.00 1.89  ? 70 ASP A C    4  
ATOM 7735  O O    . ASP A 1 70 ? -17.604 4.713   -4.190  1.00 2.34  ? 70 ASP A O    4  
ATOM 7736  C CB   . ASP A 1 70 ? -17.313 1.608   -4.207  1.00 2.32  ? 70 ASP A CB   4  
ATOM 7737  C CG   . ASP A 1 70 ? -18.426 0.579   -4.420  1.00 3.12  ? 70 ASP A CG   4  
ATOM 7738  O OD1  . ASP A 1 70 ? -19.535 0.832   -3.976  1.00 3.64  ? 70 ASP A OD1  4  
ATOM 7739  O OD2  . ASP A 1 70 ? -18.151 -0.444  -5.024  1.00 3.72  ? 70 ASP A OD2  4  
ATOM 7740  H H    . ASP A 1 70 ? -15.555 3.857   -5.355  1.00 1.39  ? 70 ASP A H    4  
ATOM 7741  H HA   . ASP A 1 70 ? -17.807 2.194   -6.215  1.00 2.07  ? 70 ASP A HA   4  
ATOM 7742  H HB2  . ASP A 1 70 ? -16.357 1.106   -4.189  1.00 2.46  ? 70 ASP A HB2  4  
ATOM 7743  H HB3  . ASP A 1 70 ? -17.470 2.115   -3.266  1.00 2.72  ? 70 ASP A HB3  4  
ATOM 7744  N N    . LYS A 1 71 ? -19.348 3.996   -5.349  1.00 2.37  ? 71 LYS A N    4  
ATOM 7745  C CA   . LYS A 1 71 ? -20.186 5.180   -4.976  1.00 3.07  ? 71 LYS A CA   4  
ATOM 7746  C C    . LYS A 1 71 ? -19.510 6.467   -5.477  1.00 3.94  ? 71 LYS A C    4  
ATOM 7747  O O    . LYS A 1 71 ? -19.455 7.467   -4.782  1.00 4.56  ? 71 LYS A O    4  
ATOM 7748  C CB   . LYS A 1 71 ? -20.361 5.231   -3.450  1.00 3.59  ? 71 LYS A CB   4  
ATOM 7749  C CG   . LYS A 1 71 ? -21.639 6.003   -3.103  1.00 3.79  ? 71 LYS A CG   4  
ATOM 7750  C CD   . LYS A 1 71 ? -21.506 6.613   -1.705  1.00 4.62  ? 71 LYS A CD   4  
ATOM 7751  C CE   . LYS A 1 71 ? -22.818 7.303   -1.317  1.00 5.22  ? 71 LYS A CE   4  
ATOM 7752  N NZ   . LYS A 1 71 ? -22.564 8.279   -0.219  1.00 5.99  ? 71 LYS A NZ   4  
ATOM 7753  H H    . LYS A 1 71 ? -19.725 3.304   -5.932  1.00 2.66  ? 71 LYS A H    4  
ATOM 7754  H HA   . LYS A 1 71 ? -21.156 5.087   -5.442  1.00 3.10  ? 71 LYS A HA   4  
ATOM 7755  H HB2  . LYS A 1 71 ? -20.433 4.226   -3.063  1.00 3.70  ? 71 LYS A HB2  4  
ATOM 7756  H HB3  . LYS A 1 71 ? -19.512 5.728   -3.006  1.00 4.21  ? 71 LYS A HB3  4  
ATOM 7757  H HG2  . LYS A 1 71 ? -21.792 6.792   -3.826  1.00 3.86  ? 71 LYS A HG2  4  
ATOM 7758  H HG3  . LYS A 1 71 ? -22.483 5.330   -3.122  1.00 3.74  ? 71 LYS A HG3  4  
ATOM 7759  H HD2  . LYS A 1 71 ? -21.286 5.831   -0.991  1.00 4.84  ? 71 LYS A HD2  4  
ATOM 7760  H HD3  . LYS A 1 71 ? -20.707 7.338   -1.702  1.00 4.97  ? 71 LYS A HD3  4  
ATOM 7761  H HE2  . LYS A 1 71 ? -23.218 7.824   -2.175  1.00 5.27  ? 71 LYS A HE2  4  
ATOM 7762  H HE3  . LYS A 1 71 ? -23.528 6.562   -0.983  1.00 5.40  ? 71 LYS A HE3  4  
ATOM 7763  H HZ1  . LYS A 1 71 ? -21.812 8.938   -0.505  1.00 6.30  ? 71 LYS A HZ1  4  
ATOM 7764  H HZ2  . LYS A 1 71 ? -23.436 8.812   -0.021  1.00 6.39  ? 71 LYS A HZ2  4  
ATOM 7765  H HZ3  . LYS A 1 71 ? -22.268 7.769   0.637   1.00 6.11  ? 71 LYS A HZ3  4  
ATOM 7766  N N    . SER A 1 72 ? -18.995 6.443   -6.684  1.00 4.42  ? 72 SER A N    4  
ATOM 7767  C CA   . SER A 1 72 ? -18.318 7.650   -7.246  1.00 5.58  ? 72 SER A CA   4  
ATOM 7768  C C    . SER A 1 72 ? -18.762 7.863   -8.699  1.00 5.86  ? 72 SER A C    4  
ATOM 7769  O O    . SER A 1 72 ? -18.659 6.926   -9.479  1.00 5.92  ? 72 SER A O    4  
ATOM 7770  C CB   . SER A 1 72 ? -16.800 7.453   -7.193  1.00 6.45  ? 72 SER A CB   4  
ATOM 7771  O OG   . SER A 1 72 ? -16.163 8.721   -7.110  1.00 6.62  ? 72 SER A OG   4  
ATOM 7772  O OXT  . SER A 1 72 ? -19.198 8.959   -9.008  1.00 6.32  ? 72 SER A OXT  4  
ATOM 7773  H H    . SER A 1 72 ? -19.053 5.623   -7.221  1.00 4.24  ? 72 SER A H    4  
ATOM 7774  H HA   . SER A 1 72 ? -18.588 8.517   -6.660  1.00 5.92  ? 72 SER A HA   4  
ATOM 7775  H HB2  . SER A 1 72 ? -16.541 6.869   -6.325  1.00 6.89  ? 72 SER A HB2  4  
ATOM 7776  H HB3  . SER A 1 72 ? -16.475 6.932   -8.084  1.00 6.83  ? 72 SER A HB3  4  
ATOM 7777  H HG   . SER A 1 72 ? -15.971 9.016   -8.003  1.00 6.94  ? 72 SER A HG   4  
ATOM 7778  N N    . ALA B 1 1  ? -19.426 -25.225 -19.099 1.00 14.81 ? 1  ALA B N    4  
ATOM 7779  C CA   . ALA B 1 1  ? -18.572 -24.003 -19.019 1.00 14.13 ? 1  ALA B CA   4  
ATOM 7780  C C    . ALA B 1 1  ? -19.458 -22.750 -19.040 1.00 13.41 ? 1  ALA B C    4  
ATOM 7781  O O    . ALA B 1 1  ? -20.463 -22.700 -19.725 1.00 13.48 ? 1  ALA B O    4  
ATOM 7782  C CB   . ALA B 1 1  ? -17.612 -23.968 -20.211 1.00 14.18 ? 1  ALA B CB   4  
ATOM 7783  H H1   . ALA B 1 1  ? -20.116 -25.218 -18.322 1.00 14.93 ? 1  ALA B H1   4  
ATOM 7784  H H2   . ALA B 1 1  ? -19.928 -25.239 -20.010 1.00 14.87 ? 1  ALA B H2   4  
ATOM 7785  H H3   . ALA B 1 1  ? -18.828 -26.072 -19.019 1.00 15.26 ? 1  ALA B H3   4  
ATOM 7786  H HA   . ALA B 1 1  ? -18.004 -24.023 -18.101 1.00 14.27 ? 1  ALA B HA   4  
ATOM 7787  H HB1  . ALA B 1 1  ? -17.084 -24.908 -20.276 1.00 13.94 ? 1  ALA B HB1  4  
ATOM 7788  H HB2  . ALA B 1 1  ? -18.172 -23.806 -21.121 1.00 14.35 ? 1  ALA B HB2  4  
ATOM 7789  H HB3  . ALA B 1 1  ? -16.902 -23.165 -20.078 1.00 14.46 ? 1  ALA B HB3  4  
ATOM 7790  N N    . SER B 1 2  ? -19.085 -21.738 -18.294 1.00 12.88 ? 2  SER B N    4  
ATOM 7791  C CA   . SER B 1 2  ? -19.891 -20.479 -18.261 1.00 12.30 ? 2  SER B CA   4  
ATOM 7792  C C    . SER B 1 2  ? -18.962 -19.277 -18.452 1.00 11.45 ? 2  SER B C    4  
ATOM 7793  O O    . SER B 1 2  ? -18.000 -19.106 -17.727 1.00 11.40 ? 2  SER B O    4  
ATOM 7794  C CB   . SER B 1 2  ? -20.606 -20.364 -16.912 1.00 12.49 ? 2  SER B CB   4  
ATOM 7795  O OG   . SER B 1 2  ? -21.616 -21.361 -16.826 1.00 12.82 ? 2  SER B OG   4  
ATOM 7796  H H    . SER B 1 2  ? -18.269 -21.806 -17.755 1.00 12.97 ? 2  SER B H    4  
ATOM 7797  H HA   . SER B 1 2  ? -20.623 -20.498 -19.056 1.00 12.53 ? 2  SER B HA   4  
ATOM 7798  H HB2  . SER B 1 2  ? -19.897 -20.506 -16.113 1.00 12.66 ? 2  SER B HB2  4  
ATOM 7799  H HB3  . SER B 1 2  ? -21.049 -19.380 -16.824 1.00 12.41 ? 2  SER B HB3  4  
ATOM 7800  H HG   . SER B 1 2  ? -21.369 -21.975 -16.130 1.00 13.11 ? 2  SER B HG   4  
ATOM 7801  N N    . VAL B 1 3  ? -19.240 -18.445 -19.428 1.00 10.94 ? 3  VAL B N    4  
ATOM 7802  C CA   . VAL B 1 3  ? -18.372 -17.252 -19.674 1.00 10.24 ? 3  VAL B CA   4  
ATOM 7803  C C    . VAL B 1 3  ? -18.617 -16.196 -18.583 1.00 9.35  ? 3  VAL B C    4  
ATOM 7804  O O    . VAL B 1 3  ? -19.736 -15.972 -18.159 1.00 9.36  ? 3  VAL B O    4  
ATOM 7805  C CB   . VAL B 1 3  ? -18.676 -16.664 -21.065 1.00 10.50 ? 3  VAL B CB   4  
ATOM 7806  C CG1  . VAL B 1 3  ? -20.142 -16.218 -21.153 1.00 10.46 ? 3  VAL B CG1  4  
ATOM 7807  C CG2  . VAL B 1 3  ? -17.761 -15.463 -21.328 1.00 11.15 ? 3  VAL B CG2  4  
ATOM 7808  H H    . VAL B 1 3  ? -20.020 -18.608 -20.000 1.00 11.14 ? 3  VAL B H    4  
ATOM 7809  H HA   . VAL B 1 3  ? -17.336 -17.558 -19.640 1.00 10.39 ? 3  VAL B HA   4  
ATOM 7810  H HB   . VAL B 1 3  ? -18.493 -17.421 -21.815 1.00 10.49 ? 3  VAL B HB   4  
ATOM 7811  H HG11 . VAL B 1 3  ? -20.533 -16.055 -20.162 1.00 10.33 ? 3  VAL B HG11 4  
ATOM 7812  H HG12 . VAL B 1 3  ? -20.205 -15.299 -21.719 1.00 10.64 ? 3  VAL B HG12 4  
ATOM 7813  H HG13 . VAL B 1 3  ? -20.722 -16.983 -21.647 1.00 10.59 ? 3  VAL B HG13 4  
ATOM 7814  H HG21 . VAL B 1 3  ? -16.729 -15.772 -21.247 1.00 11.34 ? 3  VAL B HG21 4  
ATOM 7815  H HG22 . VAL B 1 3  ? -17.945 -15.080 -22.320 1.00 11.36 ? 3  VAL B HG22 4  
ATOM 7816  H HG23 . VAL B 1 3  ? -17.963 -14.691 -20.601 1.00 11.42 ? 3  VAL B HG23 4  
ATOM 7817  N N    . ALA B 1 4  ? -17.570 -15.551 -18.127 1.00 8.75  ? 4  ALA B N    4  
ATOM 7818  C CA   . ALA B 1 4  ? -17.724 -14.511 -17.066 1.00 7.96  ? 4  ALA B CA   4  
ATOM 7819  C C    . ALA B 1 4  ? -17.728 -13.118 -17.708 1.00 7.01  ? 4  ALA B C    4  
ATOM 7820  O O    . ALA B 1 4  ? -17.262 -12.935 -18.819 1.00 7.03  ? 4  ALA B O    4  
ATOM 7821  C CB   . ALA B 1 4  ? -16.560 -14.614 -16.077 1.00 8.21  ? 4  ALA B CB   4  
ATOM 7822  H H    . ALA B 1 4  ? -16.679 -15.753 -18.486 1.00 8.95  ? 4  ALA B H    4  
ATOM 7823  H HA   . ALA B 1 4  ? -18.655 -14.666 -16.542 1.00 8.13  ? 4  ALA B HA   4  
ATOM 7824  H HB1  . ALA B 1 4  ? -15.637 -14.760 -16.619 1.00 8.38  ? 4  ALA B HB1  4  
ATOM 7825  H HB2  . ALA B 1 4  ? -16.496 -13.705 -15.498 1.00 8.31  ? 4  ALA B HB2  4  
ATOM 7826  H HB3  . ALA B 1 4  ? -16.724 -15.451 -15.414 1.00 8.39  ? 4  ALA B HB3  4  
ATOM 7827  N N    . THR B 1 5  ? -18.248 -12.135 -17.013 1.00 6.47  ? 5  THR B N    4  
ATOM 7828  C CA   . THR B 1 5  ? -18.283 -10.750 -17.573 1.00 5.79  ? 5  THR B CA   4  
ATOM 7829  C C    . THR B 1 5  ? -16.887 -10.126 -17.473 1.00 4.92  ? 5  THR B C    4  
ATOM 7830  O O    . THR B 1 5  ? -16.455 -9.721  -16.410 1.00 4.69  ? 5  THR B O    4  
ATOM 7831  C CB   . THR B 1 5  ? -19.291 -9.897  -16.788 1.00 6.15  ? 5  THR B CB   4  
ATOM 7832  O OG1  . THR B 1 5  ? -19.054 -10.034 -15.392 1.00 6.56  ? 5  THR B OG1  4  
ATOM 7833  C CG2  . THR B 1 5  ? -20.714 -10.357 -17.112 1.00 6.81  ? 5  THR B CG2  4  
ATOM 7834  H H    . THR B 1 5  ? -18.614 -12.309 -16.121 1.00 6.72  ? 5  THR B H    4  
ATOM 7835  H HA   . THR B 1 5  ? -18.583 -10.792 -18.611 1.00 5.97  ? 5  THR B HA   4  
ATOM 7836  H HB   . THR B 1 5  ? -19.181 -8.862  -17.070 1.00 5.99  ? 5  THR B HB   4  
ATOM 7837  H HG1  . THR B 1 5  ? -19.054 -9.157  -15.003 1.00 6.97  ? 5  THR B HG1  4  
ATOM 7838  H HG21 . THR B 1 5  ? -20.864 -10.337 -18.181 1.00 7.02  ? 5  THR B HG21 4  
ATOM 7839  H HG22 . THR B 1 5  ? -20.858 -11.363 -16.747 1.00 7.11  ? 5  THR B HG22 4  
ATOM 7840  H HG23 . THR B 1 5  ? -21.423 -9.696  -16.636 1.00 7.08  ? 5  THR B HG23 4  
ATOM 7841  N N    . GLU B 1 6  ? -16.178 -10.053 -18.576 1.00 4.62  ? 6  GLU B N    4  
ATOM 7842  C CA   . GLU B 1 6  ? -14.804 -9.465  -18.562 1.00 3.82  ? 6  GLU B CA   4  
ATOM 7843  C C    . GLU B 1 6  ? -14.208 -9.524  -19.973 1.00 3.24  ? 6  GLU B C    4  
ATOM 7844  O O    . GLU B 1 6  ? -13.762 -10.564 -20.424 1.00 3.60  ? 6  GLU B O    4  
ATOM 7845  C CB   . GLU B 1 6  ? -13.898 -10.242 -17.591 1.00 4.37  ? 6  GLU B CB   4  
ATOM 7846  C CG   . GLU B 1 6  ? -14.110 -11.755 -17.756 1.00 5.20  ? 6  GLU B CG   4  
ATOM 7847  C CD   . GLU B 1 6  ? -12.755 -12.466 -17.785 1.00 5.80  ? 6  GLU B CD   4  
ATOM 7848  O OE1  . GLU B 1 6  ? -12.181 -12.565 -18.858 1.00 6.17  ? 6  GLU B OE1  4  
ATOM 7849  O OE2  . GLU B 1 6  ? -12.314 -12.901 -16.733 1.00 6.18  ? 6  GLU B OE2  4  
ATOM 7850  H H    . GLU B 1 6  ? -16.551 -10.390 -19.417 1.00 5.02  ? 6  GLU B H    4  
ATOM 7851  H HA   . GLU B 1 6  ? -14.864 -8.433  -18.246 1.00 3.46  ? 6  GLU B HA   4  
ATOM 7852  H HB2  . GLU B 1 6  ? -12.866 -10.001 -17.798 1.00 4.83  ? 6  GLU B HB2  4  
ATOM 7853  H HB3  . GLU B 1 6  ? -14.134 -9.957  -16.577 1.00 4.04  ? 6  GLU B HB3  4  
ATOM 7854  H HG2  . GLU B 1 6  ? -14.695 -12.127 -16.927 1.00 5.47  ? 6  GLU B HG2  4  
ATOM 7855  H HG3  . GLU B 1 6  ? -14.636 -11.948 -18.681 1.00 5.45  ? 6  GLU B HG3  4  
ATOM 7856  N N    . LEU B 1 7  ? -14.185 -8.413  -20.668 1.00 2.60  ? 7  LEU B N    4  
ATOM 7857  C CA   . LEU B 1 7  ? -13.603 -8.390  -22.034 1.00 2.31  ? 7  LEU B CA   4  
ATOM 7858  C C    . LEU B 1 7  ? -12.392 -7.472  -21.999 1.00 1.54  ? 7  LEU B C    4  
ATOM 7859  O O    . LEU B 1 7  ? -11.275 -7.863  -22.280 1.00 1.71  ? 7  LEU B O    4  
ATOM 7860  C CB   . LEU B 1 7  ? -14.587 -7.831  -23.082 1.00 2.52  ? 7  LEU B CB   4  
ATOM 7861  C CG   . LEU B 1 7  ? -16.053 -7.941  -22.649 1.00 3.16  ? 7  LEU B CG   4  
ATOM 7862  C CD1  . LEU B 1 7  ? -16.368 -9.359  -22.162 1.00 3.96  ? 7  LEU B CD1  4  
ATOM 7863  C CD2  . LEU B 1 7  ? -16.320 -6.924  -21.544 1.00 3.09  ? 7  LEU B CD2  4  
ATOM 7864  H H    . LEU B 1 7  ? -14.531 -7.587  -20.285 1.00 2.54  ? 7  LEU B H    4  
ATOM 7865  H HA   . LEU B 1 7  ? -13.311 -9.381  -22.309 1.00 2.79  ? 7  LEU B HA   4  
ATOM 7866  H HB2  . LEU B 1 7  ? -14.357 -6.793  -23.263 1.00 2.09  ? 7  LEU B HB2  4  
ATOM 7867  H HB3  . LEU B 1 7  ? -14.453 -8.374  -23.987 1.00 2.90  ? 7  LEU B HB3  4  
ATOM 7868  H HG   . LEU B 1 7  ? -16.685 -7.714  -23.496 1.00 3.35  ? 7  LEU B HG   4  
ATOM 7869  H HD11 . LEU B 1 7  ? -15.558 -10.021 -22.428 1.00 4.19  ? 7  LEU B HD11 4  
ATOM 7870  H HD12 . LEU B 1 7  ? -16.492 -9.353  -21.091 1.00 4.26  ? 7  LEU B HD12 4  
ATOM 7871  H HD13 . LEU B 1 7  ? -17.280 -9.703  -22.627 1.00 4.38  ? 7  LEU B HD13 4  
ATOM 7872  H HD21 . LEU B 1 7  ? -15.485 -6.239  -21.482 1.00 3.29  ? 7  LEU B HD21 4  
ATOM 7873  H HD22 . LEU B 1 7  ? -17.219 -6.378  -21.768 1.00 3.35  ? 7  LEU B HD22 4  
ATOM 7874  H HD23 . LEU B 1 7  ? -16.430 -7.440  -20.602 1.00 3.19  ? 7  LEU B HD23 4  
ATOM 7875  N N    . ARG B 1 8  ? -12.643 -6.241  -21.642 1.00 1.31  ? 8  ARG B N    4  
ATOM 7876  C CA   . ARG B 1 8  ? -11.575 -5.210  -21.550 1.00 1.49  ? 8  ARG B CA   4  
ATOM 7877  C C    . ARG B 1 8  ? -10.453 -5.688  -20.628 1.00 1.33  ? 8  ARG B C    4  
ATOM 7878  O O    . ARG B 1 8  ? -9.292  -5.682  -20.990 1.00 1.98  ? 8  ARG B O    4  
ATOM 7879  C CB   . ARG B 1 8  ? -12.193 -3.943  -20.965 1.00 2.16  ? 8  ARG B CB   4  
ATOM 7880  C CG   . ARG B 1 8  ? -12.375 -2.899  -22.069 1.00 2.69  ? 8  ARG B CG   4  
ATOM 7881  C CD   . ARG B 1 8  ? -11.008 -2.344  -22.484 1.00 3.00  ? 8  ARG B CD   4  
ATOM 7882  N NE   . ARG B 1 8  ? -10.469 -1.472  -21.398 1.00 3.47  ? 8  ARG B NE   4  
ATOM 7883  C CZ   . ARG B 1 8  ? -9.182  -1.421  -21.180 1.00 3.94  ? 8  ARG B CZ   4  
ATOM 7884  N NH1  . ARG B 1 8  ? -8.421  -0.668  -21.934 1.00 4.33  ? 8  ARG B NH1  4  
ATOM 7885  N NH2  . ARG B 1 8  ? -8.656  -2.119  -20.207 1.00 4.43  ? 8  ARG B NH2  4  
ATOM 7886  H H    . ARG B 1 8  ? -13.565 -5.990  -21.432 1.00 1.64  ? 8  ARG B H    4  
ATOM 7887  H HA   . ARG B 1 8  ? -11.187 -5.005  -22.529 1.00 1.85  ? 8  ARG B HA   4  
ATOM 7888  H HB2  . ARG B 1 8  ? -13.157 -4.191  -20.532 1.00 2.24  ? 8  ARG B HB2  4  
ATOM 7889  H HB3  . ARG B 1 8  ? -11.545 -3.548  -20.197 1.00 2.53  ? 8  ARG B HB3  4  
ATOM 7890  H HG2  . ARG B 1 8  ? -12.850 -3.359  -22.924 1.00 2.99  ? 8  ARG B HG2  4  
ATOM 7891  H HG3  . ARG B 1 8  ? -12.994 -2.093  -21.705 1.00 2.99  ? 8  ARG B HG3  4  
ATOM 7892  H HD2  . ARG B 1 8  ? -10.326 -3.163  -22.661 1.00 3.17  ? 8  ARG B HD2  4  
ATOM 7893  H HD3  . ARG B 1 8  ? -11.115 -1.765  -23.389 1.00 3.16  ? 8  ARG B HD3  4  
ATOM 7894  H HE   . ARG B 1 8  ? -11.081 -0.939  -20.849 1.00 3.66  ? 8  ARG B HE   4  
ATOM 7895  H HH11 . ARG B 1 8  ? -8.826  -0.135  -22.677 1.00 4.37  ? 8  ARG B HH11 4  
ATOM 7896  H HH12 . ARG B 1 8  ? -7.436  -0.626  -21.767 1.00 4.82  ? 8  ARG B HH12 4  
ATOM 7897  H HH21 . ARG B 1 8  ? -9.238  -2.695  -19.631 1.00 4.49  ? 8  ARG B HH21 4  
ATOM 7898  H HH22 . ARG B 1 8  ? -7.670  -2.080  -20.037 1.00 4.97  ? 8  ARG B HH22 4  
ATOM 7899  N N    . CYS B 1 9  ? -10.800 -6.087  -19.434 1.00 0.80  ? 9  CYS B N    4  
ATOM 7900  C CA   . CYS B 1 9  ? -9.771  -6.555  -18.462 1.00 0.67  ? 9  CYS B CA   4  
ATOM 7901  C C    . CYS B 1 9  ? -9.180  -7.892  -18.926 1.00 0.60  ? 9  CYS B C    4  
ATOM 7902  O O    . CYS B 1 9  ? -9.806  -8.650  -19.647 1.00 0.78  ? 9  CYS B O    4  
ATOM 7903  C CB   . CYS B 1 9  ? -10.408 -6.726  -17.083 1.00 0.79  ? 9  CYS B CB   4  
ATOM 7904  S SG   . CYS B 1 9  ? -11.599 -5.391  -16.787 1.00 1.22  ? 9  CYS B SG   4  
ATOM 7905  H H    . CYS B 1 9  ? -11.740 -6.067  -19.172 1.00 0.99  ? 9  CYS B H    4  
ATOM 7906  H HA   . CYS B 1 9  ? -8.981  -5.820  -18.399 1.00 0.83  ? 9  CYS B HA   4  
ATOM 7907  H HB2  . CYS B 1 9  ? -10.912 -7.678  -17.036 1.00 0.89  ? 9  CYS B HB2  4  
ATOM 7908  H HB3  . CYS B 1 9  ? -9.640  -6.691  -16.330 1.00 0.93  ? 9  CYS B HB3  4  
ATOM 7909  N N    . GLN B 1 10 ? -7.970  -8.170  -18.520 1.00 0.50  ? 10 GLN B N    4  
ATOM 7910  C CA   . GLN B 1 10 ? -7.293  -9.441  -18.925 1.00 0.47  ? 10 GLN B CA   4  
ATOM 7911  C C    . GLN B 1 10 ? -7.087  -10.365 -17.707 1.00 0.40  ? 10 GLN B C    4  
ATOM 7912  O O    . GLN B 1 10 ? -6.669  -11.496 -17.855 1.00 0.43  ? 10 GLN B O    4  
ATOM 7913  C CB   . GLN B 1 10 ? -5.932  -9.088  -19.511 1.00 0.53  ? 10 GLN B CB   4  
ATOM 7914  C CG   . GLN B 1 10 ? -5.976  -9.204  -21.038 1.00 0.64  ? 10 GLN B CG   4  
ATOM 7915  C CD   . GLN B 1 10 ? -5.616  -10.630 -21.463 1.00 1.21  ? 10 GLN B CD   4  
ATOM 7916  O OE1  . GLN B 1 10 ? -6.310  -11.572 -21.131 1.00 1.88  ? 10 GLN B OE1  4  
ATOM 7917  N NE2  . GLN B 1 10 ? -4.547  -10.830 -22.187 1.00 1.84  ? 10 GLN B NE2  4  
ATOM 7918  H H    . GLN B 1 10 ? -7.496  -7.531  -17.948 1.00 0.61  ? 10 GLN B H    4  
ATOM 7919  H HA   . GLN B 1 10 ? -7.885  -9.950  -19.670 1.00 0.53  ? 10 GLN B HA   4  
ATOM 7920  H HB2  . GLN B 1 10 ? -5.676  -8.075  -19.235 1.00 0.58  ? 10 GLN B HB2  4  
ATOM 7921  H HB3  . GLN B 1 10 ? -5.195  -9.763  -19.114 1.00 0.51  ? 10 GLN B HB3  4  
ATOM 7922  H HG2  . GLN B 1 10 ? -6.969  -8.962  -21.390 1.00 1.12  ? 10 GLN B HG2  4  
ATOM 7923  H HG3  . GLN B 1 10 ? -5.265  -8.515  -21.468 1.00 1.14  ? 10 GLN B HG3  4  
ATOM 7924  H HE21 . GLN B 1 10 ? -3.985  -10.072 -22.452 1.00 2.04  ? 10 GLN B HE21 4  
ATOM 7925  H HE22 . GLN B 1 10 ? -4.305  -11.739 -22.467 1.00 2.46  ? 10 GLN B HE22 4  
ATOM 7926  N N    . CYS B 1 11 ? -7.357  -9.861  -16.522 1.00 0.35  ? 11 CYS B N    4  
ATOM 7927  C CA   . CYS B 1 11 ? -7.190  -10.628 -15.232 1.00 0.32  ? 11 CYS B CA   4  
ATOM 7928  C C    . CYS B 1 11 ? -7.218  -12.156 -15.438 1.00 0.37  ? 11 CYS B C    4  
ATOM 7929  O O    . CYS B 1 11 ? -8.126  -12.699 -16.042 1.00 0.51  ? 11 CYS B O    4  
ATOM 7930  C CB   . CYS B 1 11 ? -8.334  -10.273 -14.264 1.00 0.33  ? 11 CYS B CB   4  
ATOM 7931  S SG   . CYS B 1 11 ? -9.509  -9.124  -15.038 1.00 0.49  ? 11 CYS B SG   4  
ATOM 7932  H H    . CYS B 1 11 ? -7.657  -8.937  -16.474 1.00 0.37  ? 11 CYS B H    4  
ATOM 7933  H HA   . CYS B 1 11 ? -6.252  -10.351 -14.776 1.00 0.33  ? 11 CYS B HA   4  
ATOM 7934  H HB2  . CYS B 1 11 ? -8.853  -11.172 -13.986 1.00 0.41  ? 11 CYS B HB2  4  
ATOM 7935  H HB3  . CYS B 1 11 ? -7.919  -9.816  -13.379 1.00 0.33  ? 11 CYS B HB3  4  
ATOM 7936  N N    . LEU B 1 12 ? -6.246  -12.851 -14.889 1.00 0.40  ? 12 LEU B N    4  
ATOM 7937  C CA   . LEU B 1 12 ? -6.214  -14.342 -14.990 1.00 0.45  ? 12 LEU B CA   4  
ATOM 7938  C C    . LEU B 1 12 ? -7.242  -14.899 -13.998 1.00 0.45  ? 12 LEU B C    4  
ATOM 7939  O O    . LEU B 1 12 ? -8.284  -15.403 -14.371 1.00 0.49  ? 12 LEU B O    4  
ATOM 7940  C CB   . LEU B 1 12 ? -4.813  -14.835 -14.614 1.00 0.49  ? 12 LEU B CB   4  
ATOM 7941  C CG   . LEU B 1 12 ? -3.982  -15.026 -15.880 1.00 0.83  ? 12 LEU B CG   4  
ATOM 7942  C CD1  . LEU B 1 12 ? -3.362  -13.692 -16.296 1.00 1.04  ? 12 LEU B CD1  4  
ATOM 7943  C CD2  . LEU B 1 12 ? -2.872  -16.028 -15.597 1.00 1.56  ? 12 LEU B CD2  4  
ATOM 7944  H H    . LEU B 1 12 ? -5.550  -12.390 -14.375 1.00 0.49  ? 12 LEU B H    4  
ATOM 7945  H HA   . LEU B 1 12 ? -6.451  -14.657 -15.993 1.00 0.48  ? 12 LEU B HA   4  
ATOM 7946  H HB2  . LEU B 1 12 ? -4.334  -14.105 -13.975 1.00 0.99  ? 12 LEU B HB2  4  
ATOM 7947  H HB3  . LEU B 1 12 ? -4.889  -15.774 -14.090 1.00 0.99  ? 12 LEU B HB3  4  
ATOM 7948  H HG   . LEU B 1 12 ? -4.613  -15.397 -16.675 1.00 1.56  ? 12 LEU B HG   4  
ATOM 7949  H HD11 . LEU B 1 12 ? -2.868  -13.243 -15.448 1.00 1.64  ? 12 LEU B HD11 4  
ATOM 7950  H HD12 . LEU B 1 12 ? -2.640  -13.861 -17.084 1.00 1.49  ? 12 LEU B HD12 4  
ATOM 7951  H HD13 . LEU B 1 12 ? -4.136  -13.030 -16.654 1.00 1.52  ? 12 LEU B HD13 4  
ATOM 7952  H HD21 . LEU B 1 12 ? -3.300  -16.927 -15.179 1.00 2.16  ? 12 LEU B HD21 4  
ATOM 7953  H HD22 . LEU B 1 12 ? -2.360  -16.263 -16.516 1.00 1.96  ? 12 LEU B HD22 4  
ATOM 7954  H HD23 . LEU B 1 12 ? -2.176  -15.598 -14.892 1.00 1.94  ? 12 LEU B HD23 4  
ATOM 7955  N N    . GLN B 1 13 ? -6.942  -14.773 -12.732 1.00 0.44  ? 13 GLN B N    4  
ATOM 7956  C CA   . GLN B 1 13 ? -7.853  -15.239 -11.647 1.00 0.46  ? 13 GLN B CA   4  
ATOM 7957  C C    . GLN B 1 13 ? -7.322  -14.667 -10.323 1.00 0.42  ? 13 GLN B C    4  
ATOM 7958  O O    . GLN B 1 13 ? -7.258  -15.349 -9.320  1.00 0.60  ? 13 GLN B O    4  
ATOM 7959  C CB   . GLN B 1 13 ? -7.865  -16.771 -11.585 1.00 0.53  ? 13 GLN B CB   4  
ATOM 7960  C CG   . GLN B 1 13 ? -6.579  -17.359 -12.189 1.00 1.12  ? 13 GLN B CG   4  
ATOM 7961  C CD   . GLN B 1 13 ? -6.317  -18.738 -11.581 1.00 1.40  ? 13 GLN B CD   4  
ATOM 7962  O OE1  . GLN B 1 13 ? -6.609  -19.748 -12.190 1.00 1.77  ? 13 GLN B OE1  4  
ATOM 7963  N NE2  . GLN B 1 13 ? -5.777  -18.826 -10.395 1.00 2.09  ? 13 GLN B NE2  4  
ATOM 7964  H H    . GLN B 1 13 ? -6.106  -14.352 -12.490 1.00 0.43  ? 13 GLN B H    4  
ATOM 7965  H HA   . GLN B 1 13 ? -8.851  -14.866 -11.826 1.00 0.47  ? 13 GLN B HA   4  
ATOM 7966  H HB2  . GLN B 1 13 ? -7.963  -17.093 -10.560 1.00 0.99  ? 13 GLN B HB2  4  
ATOM 7967  H HB3  . GLN B 1 13 ? -8.702  -17.121 -12.152 1.00 0.86  ? 13 GLN B HB3  4  
ATOM 7968  H HG2  . GLN B 1 13 ? -6.694  -17.451 -13.259 1.00 1.51  ? 13 GLN B HG2  4  
ATOM 7969  H HG3  . GLN B 1 13 ? -5.746  -16.707 -11.970 1.00 1.66  ? 13 GLN B HG3  4  
ATOM 7970  H HE21 . GLN B 1 13 ? -5.542  -18.011 -9.900  1.00 2.59  ? 13 GLN B HE21 4  
ATOM 7971  H HE22 . GLN B 1 13 ? -5.605  -19.705 -9.998  1.00 2.41  ? 13 GLN B HE22 4  
ATOM 7972  N N    . THR B 1 14 ? -6.911  -13.414 -10.365 1.00 0.37  ? 14 THR B N    4  
ATOM 7973  C CA   . THR B 1 14 ? -6.315  -12.693 -9.187  1.00 0.33  ? 14 THR B CA   4  
ATOM 7974  C C    . THR B 1 14 ? -5.636  -13.626 -8.187  1.00 0.35  ? 14 THR B C    4  
ATOM 7975  O O    . THR B 1 14 ? -6.261  -14.202 -7.313  1.00 0.39  ? 14 THR B O    4  
ATOM 7976  C CB   . THR B 1 14 ? -7.331  -11.843 -8.447  1.00 0.33  ? 14 THR B CB   4  
ATOM 7977  O OG1  . THR B 1 14 ? -8.530  -12.580 -8.228  1.00 0.39  ? 14 THR B OG1  4  
ATOM 7978  C CG2  . THR B 1 14 ? -7.620  -10.585 -9.260  1.00 0.32  ? 14 THR B CG2  4  
ATOM 7979  H H    . THR B 1 14 ? -6.973  -12.934 -11.217 1.00 0.51  ? 14 THR B H    4  
ATOM 7980  H HA   . THR B 1 14 ? -5.567  -12.030 -9.571  1.00 0.30  ? 14 THR B HA   4  
ATOM 7981  H HB   . THR B 1 14 ? -6.888  -11.554 -7.501  1.00 0.32  ? 14 THR B HB   4  
ATOM 7982  H HG1  . THR B 1 14 ? -8.436  -13.061 -7.403  1.00 0.95  ? 14 THR B HG1  4  
ATOM 7983  H HG21 . THR B 1 14 ? -6.687  -10.152 -9.590  1.00 1.06  ? 14 THR B HG21 4  
ATOM 7984  H HG22 . THR B 1 14 ? -8.221  -10.842 -10.117 1.00 1.03  ? 14 THR B HG22 4  
ATOM 7985  H HG23 . THR B 1 14 ? -8.148  -9.874  -8.644  1.00 1.06  ? 14 THR B HG23 4  
ATOM 7986  N N    . LEU B 1 15 ? -4.344  -13.722 -8.284  1.00 0.36  ? 15 LEU B N    4  
ATOM 7987  C CA   . LEU B 1 15 ? -3.570  -14.561 -7.326  1.00 0.42  ? 15 LEU B CA   4  
ATOM 7988  C C    . LEU B 1 15 ? -3.471  -13.809 -5.993  1.00 0.36  ? 15 LEU B C    4  
ATOM 7989  O O    . LEU B 1 15 ? -3.761  -12.629 -5.916  1.00 0.52  ? 15 LEU B O    4  
ATOM 7990  C CB   . LEU B 1 15 ? -2.171  -14.825 -7.891  1.00 0.57  ? 15 LEU B CB   4  
ATOM 7991  C CG   . LEU B 1 15 ? -2.290  -15.713 -9.134  1.00 0.65  ? 15 LEU B CG   4  
ATOM 7992  C CD1  . LEU B 1 15 ? -1.093  -15.473 -10.057 1.00 0.74  ? 15 LEU B CD1  4  
ATOM 7993  C CD2  . LEU B 1 15 ? -2.324  -17.182 -8.708  1.00 1.78  ? 15 LEU B CD2  4  
ATOM 7994  H H    . LEU B 1 15 ? -3.875  -13.203 -8.974  1.00 0.35  ? 15 LEU B H    4  
ATOM 7995  H HA   . LEU B 1 15 ? -4.084  -15.500 -7.173  1.00 0.51  ? 15 LEU B HA   4  
ATOM 7996  H HB2  . LEU B 1 15 ? -1.705  -13.887 -8.155  1.00 1.12  ? 15 LEU B HB2  4  
ATOM 7997  H HB3  . LEU B 1 15 ? -1.571  -15.329 -7.147  1.00 0.91  ? 15 LEU B HB3  4  
ATOM 7998  H HG   . LEU B 1 15 ? -3.202  -15.469 -9.660  1.00 1.32  ? 15 LEU B HG   4  
ATOM 7999  H HD11 . LEU B 1 15 ? -0.711  -14.475 -9.902  1.00 1.20  ? 15 LEU B HD11 4  
ATOM 8000  H HD12 . LEU B 1 15 ? -0.318  -16.192 -9.838  1.00 1.40  ? 15 LEU B HD12 4  
ATOM 8001  H HD13 . LEU B 1 15 ? -1.404  -15.583 -11.086 1.00 1.44  ? 15 LEU B HD13 4  
ATOM 8002  H HD21 . LEU B 1 15 ? -1.431  -17.415 -8.146  1.00 2.33  ? 15 LEU B HD21 4  
ATOM 8003  H HD22 . LEU B 1 15 ? -3.193  -17.358 -8.091  1.00 2.19  ? 15 LEU B HD22 4  
ATOM 8004  H HD23 . LEU B 1 15 ? -2.373  -17.811 -9.584  1.00 2.33  ? 15 LEU B HD23 4  
ATOM 8005  N N    . GLN B 1 16 ? -3.089  -14.480 -4.939  1.00 0.47  ? 16 GLN B N    4  
ATOM 8006  C CA   . GLN B 1 16 ? -3.003  -13.799 -3.616  1.00 0.42  ? 16 GLN B CA   4  
ATOM 8007  C C    . GLN B 1 16 ? -1.552  -13.475 -3.264  1.00 0.39  ? 16 GLN B C    4  
ATOM 8008  O O    . GLN B 1 16 ? -0.971  -14.047 -2.360  1.00 0.47  ? 16 GLN B O    4  
ATOM 8009  C CB   . GLN B 1 16 ? -3.626  -14.691 -2.535  1.00 0.49  ? 16 GLN B CB   4  
ATOM 8010  C CG   . GLN B 1 16 ? -5.059  -14.229 -2.257  1.00 0.60  ? 16 GLN B CG   4  
ATOM 8011  C CD   . GLN B 1 16 ? -5.535  -14.805 -0.921  1.00 0.78  ? 16 GLN B CD   4  
ATOM 8012  O OE1  . GLN B 1 16 ? -5.054  -14.418 0.127   1.00 1.48  ? 16 GLN B OE1  4  
ATOM 8013  N NE2  . GLN B 1 16 ? -6.470  -15.717 -0.910  1.00 1.31  ? 16 GLN B NE2  4  
ATOM 8014  H H    . GLN B 1 16 ? -2.874  -15.425 -5.016  1.00 0.72  ? 16 GLN B H    4  
ATOM 8015  H HA   . GLN B 1 16 ? -3.552  -12.871 -3.667  1.00 0.43  ? 16 GLN B HA   4  
ATOM 8016  H HB2  . GLN B 1 16 ? -3.637  -15.716 -2.876  1.00 0.51  ? 16 GLN B HB2  4  
ATOM 8017  H HB3  . GLN B 1 16 ? -3.045  -14.621 -1.627  1.00 0.50  ? 16 GLN B HB3  4  
ATOM 8018  H HG2  . GLN B 1 16 ? -5.086  -13.149 -2.215  1.00 0.75  ? 16 GLN B HG2  4  
ATOM 8019  H HG3  . GLN B 1 16 ? -5.707  -14.575 -3.047  1.00 0.72  ? 16 GLN B HG3  4  
ATOM 8020  H HE21 . GLN B 1 16 ? -6.861  -16.030 -1.752  1.00 1.97  ? 16 GLN B HE21 4  
ATOM 8021  H HE22 . GLN B 1 16 ? -6.780  -16.090 -0.058  1.00 1.46  ? 16 GLN B HE22 4  
ATOM 8022  N N    . GLY B 1 17 ? -0.985  -12.530 -3.962  1.00 0.37  ? 17 GLY B N    4  
ATOM 8023  C CA   . GLY B 1 17 ? 0.412   -12.100 -3.674  1.00 0.45  ? 17 GLY B CA   4  
ATOM 8024  C C    . GLY B 1 17 ? 1.400   -13.203 -4.019  1.00 0.41  ? 17 GLY B C    4  
ATOM 8025  O O    . GLY B 1 17 ? 1.857   -13.930 -3.155  1.00 0.57  ? 17 GLY B O    4  
ATOM 8026  H H    . GLY B 1 17 ? -1.492  -12.085 -4.670  1.00 0.35  ? 17 GLY B H    4  
ATOM 8027  H HA2  . GLY B 1 17 ? 0.640   -11.221 -4.258  1.00 0.56  ? 17 GLY B HA2  4  
ATOM 8028  H HA3  . GLY B 1 17 ? 0.501   -11.860 -2.625  1.00 0.59  ? 17 GLY B HA3  4  
ATOM 8029  N N    . ILE B 1 18 ? 1.759   -13.313 -5.269  1.00 0.39  ? 18 ILE B N    4  
ATOM 8030  C CA   . ILE B 1 18 ? 2.749   -14.346 -5.668  1.00 0.49  ? 18 ILE B CA   4  
ATOM 8031  C C    . ILE B 1 18 ? 4.150   -13.793 -5.390  1.00 0.51  ? 18 ILE B C    4  
ATOM 8032  O O    . ILE B 1 18 ? 4.300   -12.740 -4.791  1.00 0.72  ? 18 ILE B O    4  
ATOM 8033  C CB   . ILE B 1 18 ? 2.566   -14.735 -7.154  1.00 0.67  ? 18 ILE B CB   4  
ATOM 8034  C CG1  . ILE B 1 18 ? 3.381   -13.824 -8.083  1.00 0.72  ? 18 ILE B CG1  4  
ATOM 8035  C CG2  . ILE B 1 18 ? 1.084   -14.659 -7.540  1.00 0.74  ? 18 ILE B CG2  4  
ATOM 8036  C CD1  . ILE B 1 18 ? 3.062   -12.363 -7.796  1.00 0.67  ? 18 ILE B CD1  4  
ATOM 8037  H H    . ILE B 1 18 ? 1.398   -12.699 -5.936  1.00 0.44  ? 18 ILE B H    4  
ATOM 8038  H HA   . ILE B 1 18 ? 2.605   -15.218 -5.061  1.00 0.54  ? 18 ILE B HA   4  
ATOM 8039  H HB   . ILE B 1 18 ? 2.897   -15.749 -7.279  1.00 0.79  ? 18 ILE B HB   4  
ATOM 8040  H HG12 . ILE B 1 18 ? 4.435   -13.999 -7.924  1.00 0.70  ? 18 ILE B HG12 4  
ATOM 8041  H HG13 . ILE B 1 18 ? 3.133   -14.048 -9.110  1.00 0.91  ? 18 ILE B HG13 4  
ATOM 8042  H HG21 . ILE B 1 18 ? 0.475   -14.951 -6.697  1.00 1.30  ? 18 ILE B HG21 4  
ATOM 8043  H HG22 . ILE B 1 18 ? 0.837   -13.649 -7.831  1.00 1.15  ? 18 ILE B HG22 4  
ATOM 8044  H HG23 . ILE B 1 18 ? 0.894   -15.328 -8.367  1.00 1.25  ? 18 ILE B HG23 4  
ATOM 8045  H HD11 . ILE B 1 18 ? 1.993   -12.221 -7.814  1.00 1.17  ? 18 ILE B HD11 4  
ATOM 8046  H HD12 . ILE B 1 18 ? 3.444   -12.099 -6.822  1.00 1.16  ? 18 ILE B HD12 4  
ATOM 8047  H HD13 . ILE B 1 18 ? 3.525   -11.743 -8.544  1.00 1.21  ? 18 ILE B HD13 4  
ATOM 8048  N N    . HIS B 1 19 ? 5.173   -14.478 -5.803  1.00 0.45  ? 19 HIS B N    4  
ATOM 8049  C CA   . HIS B 1 19 ? 6.546   -13.970 -5.543  1.00 0.46  ? 19 HIS B CA   4  
ATOM 8050  C C    . HIS B 1 19 ? 7.030   -13.202 -6.792  1.00 0.38  ? 19 HIS B C    4  
ATOM 8051  O O    . HIS B 1 19 ? 6.692   -13.571 -7.902  1.00 0.35  ? 19 HIS B O    4  
ATOM 8052  C CB   . HIS B 1 19 ? 7.459   -15.159 -5.175  1.00 0.54  ? 19 HIS B CB   4  
ATOM 8053  C CG   . HIS B 1 19 ? 8.630   -15.274 -6.108  1.00 0.60  ? 19 HIS B CG   4  
ATOM 8054  N ND1  . HIS B 1 19 ? 9.934   -15.097 -5.679  1.00 0.76  ? 19 HIS B ND1  4  
ATOM 8055  C CD2  . HIS B 1 19 ? 8.707   -15.566 -7.443  1.00 0.60  ? 19 HIS B CD2  4  
ATOM 8056  C CE1  . HIS B 1 19 ? 10.734  -15.286 -6.741  1.00 0.81  ? 19 HIS B CE1  4  
ATOM 8057  N NE2  . HIS B 1 19 ? 10.038  -15.576 -7.843  1.00 0.74  ? 19 HIS B NE2  4  
ATOM 8058  H H    . HIS B 1 19 ? 5.038   -15.318 -6.283  1.00 0.55  ? 19 HIS B H    4  
ATOM 8059  H HA   . HIS B 1 19 ? 6.495   -13.293 -4.706  1.00 0.50  ? 19 HIS B HA   4  
ATOM 8060  H HB2  . HIS B 1 19 ? 7.825   -15.020 -4.169  1.00 0.64  ? 19 HIS B HB2  4  
ATOM 8061  H HB3  . HIS B 1 19 ? 6.881   -16.072 -5.217  1.00 0.52  ? 19 HIS B HB3  4  
ATOM 8062  H HD1  . HIS B 1 19 ? 10.221  -14.876 -4.769  1.00 0.84  ? 19 HIS B HD1  4  
ATOM 8063  H HD2  . HIS B 1 19 ? 7.858   -15.735 -8.087  1.00 0.55  ? 19 HIS B HD2  4  
ATOM 8064  H HE1  . HIS B 1 19 ? 11.808  -15.193 -6.712  1.00 0.93  ? 19 HIS B HE1  4  
ATOM 8065  N N    . PRO B 1 20 ? 7.777   -12.133 -6.578  1.00 0.39  ? 20 PRO B N    4  
ATOM 8066  C CA   . PRO B 1 20 ? 8.278   -11.292 -7.678  1.00 0.35  ? 20 PRO B CA   4  
ATOM 8067  C C    . PRO B 1 20 ? 9.445   -11.971 -8.421  1.00 0.37  ? 20 PRO B C    4  
ATOM 8068  O O    . PRO B 1 20 ? 9.253   -13.024 -8.996  1.00 0.43  ? 20 PRO B O    4  
ATOM 8069  C CB   . PRO B 1 20 ? 8.678   -9.988  -6.977  1.00 0.39  ? 20 PRO B CB   4  
ATOM 8070  C CG   . PRO B 1 20 ? 8.934   -10.352 -5.500  1.00 0.47  ? 20 PRO B CG   4  
ATOM 8071  C CD   . PRO B 1 20 ? 8.185   -11.667 -5.237  1.00 0.46  ? 20 PRO B CD   4  
ATOM 8072  H HA   . PRO B 1 20 ? 7.480   -11.093 -8.374  1.00 0.32  ? 20 PRO B HA   4  
ATOM 8073  H HB2  . PRO B 1 20 ? 9.565   -9.572  -7.424  1.00 0.40  ? 20 PRO B HB2  4  
ATOM 8074  H HB3  . PRO B 1 20 ? 7.869   -9.279  -7.037  1.00 0.40  ? 20 PRO B HB3  4  
ATOM 8075  H HG2  . PRO B 1 20 ? 9.993   -10.488 -5.331  1.00 0.50  ? 20 PRO B HG2  4  
ATOM 8076  H HG3  . PRO B 1 20 ? 8.548   -9.580  -4.855  1.00 0.51  ? 20 PRO B HG3  4  
ATOM 8077  H HD2  . PRO B 1 20 ? 8.843   -12.381 -4.769  1.00 0.50  ? 20 PRO B HD2  4  
ATOM 8078  H HD3  . PRO B 1 20 ? 7.318   -11.483 -4.626  1.00 0.47  ? 20 PRO B HD3  4  
ATOM 8079  N N    . LYS B 1 21 ? 10.629  -11.368 -8.473  1.00 0.38  ? 21 LYS B N    4  
ATOM 8080  C CA   . LYS B 1 21 ? 11.772  -11.966 -9.247  1.00 0.40  ? 21 LYS B CA   4  
ATOM 8081  C C    . LYS B 1 21 ? 11.486  -11.752 -10.740 1.00 0.38  ? 21 LYS B C    4  
ATOM 8082  O O    . LYS B 1 21 ? 12.296  -11.209 -11.469 1.00 0.42  ? 21 LYS B O    4  
ATOM 8083  C CB   . LYS B 1 21 ? 11.922  -13.462 -8.942  1.00 0.42  ? 21 LYS B CB   4  
ATOM 8084  C CG   . LYS B 1 21 ? 13.339  -13.923 -9.295  1.00 0.52  ? 21 LYS B CG   4  
ATOM 8085  C CD   . LYS B 1 21 ? 13.375  -15.452 -9.388  1.00 0.95  ? 21 LYS B CD   4  
ATOM 8086  C CE   . LYS B 1 21 ? 13.960  -16.036 -8.098  1.00 1.49  ? 21 LYS B CE   4  
ATOM 8087  N NZ   . LYS B 1 21 ? 14.791  -17.232 -8.421  1.00 2.16  ? 21 LYS B NZ   4  
ATOM 8088  H H    . LYS B 1 21 ? 10.757  -10.505 -8.042  1.00 0.41  ? 21 LYS B H    4  
ATOM 8089  H HA   . LYS B 1 21 ? 12.682  -11.451 -8.987  1.00 0.43  ? 21 LYS B HA   4  
ATOM 8090  H HB2  . LYS B 1 21 ? 11.743  -13.628 -7.893  1.00 0.42  ? 21 LYS B HB2  4  
ATOM 8091  H HB3  . LYS B 1 21 ? 11.207  -14.023 -9.524  1.00 0.41  ? 21 LYS B HB3  4  
ATOM 8092  H HG2  . LYS B 1 21 ? 13.630  -13.498 -10.245 1.00 0.96  ? 21 LYS B HG2  4  
ATOM 8093  H HG3  . LYS B 1 21 ? 14.024  -13.594 -8.529  1.00 0.83  ? 21 LYS B HG3  4  
ATOM 8094  H HD2  . LYS B 1 21 ? 12.371  -15.829 -9.530  1.00 1.56  ? 21 LYS B HD2  4  
ATOM 8095  H HD3  . LYS B 1 21 ? 13.991  -15.745 -10.225 1.00 1.65  ? 21 LYS B HD3  4  
ATOM 8096  H HE2  . LYS B 1 21 ? 14.575  -15.293 -7.612  1.00 1.90  ? 21 LYS B HE2  4  
ATOM 8097  H HE3  . LYS B 1 21 ? 13.157  -16.326 -7.437  1.00 1.94  ? 21 LYS B HE3  4  
ATOM 8098  H HZ1  . LYS B 1 21 ? 14.231  -17.904 -8.984  1.00 2.61  ? 21 LYS B HZ1  4  
ATOM 8099  H HZ2  . LYS B 1 21 ? 15.628  -16.936 -8.965  1.00 2.59  ? 21 LYS B HZ2  4  
ATOM 8100  H HZ3  . LYS B 1 21 ? 15.095  -17.691 -7.540  1.00 2.41  ? 21 LYS B HZ3  4  
ATOM 8101  N N    . ASN B 1 22 ? 10.310  -12.132 -11.175 1.00 0.36  ? 22 ASN B N    4  
ATOM 8102  C CA   . ASN B 1 22 ? 9.895   -11.927 -12.579 1.00 0.36  ? 22 ASN B CA   4  
ATOM 8103  C C    . ASN B 1 22 ? 9.036   -10.667 -12.598 1.00 0.34  ? 22 ASN B C    4  
ATOM 8104  O O    . ASN B 1 22 ? 9.248   -9.752  -13.361 1.00 0.36  ? 22 ASN B O    4  
ATOM 8105  C CB   . ASN B 1 22 ? 9.030   -13.110 -13.031 1.00 0.36  ? 22 ASN B CB   4  
ATOM 8106  C CG   . ASN B 1 22 ? 9.554   -14.422 -12.442 1.00 0.38  ? 22 ASN B CG   4  
ATOM 8107  O OD1  . ASN B 1 22 ? 10.532  -14.969 -12.911 1.00 0.43  ? 22 ASN B OD1  4  
ATOM 8108  N ND2  . ASN B 1 22 ? 8.931   -14.954 -11.422 1.00 0.37  ? 22 ASN B ND2  4  
ATOM 8109  H H    . ASN B 1 22 ? 9.669   -12.527 -10.558 1.00 0.35  ? 22 ASN B H    4  
ATOM 8110  H HA   . ASN B 1 22 ? 10.755  -11.815 -13.221 1.00 0.39  ? 22 ASN B HA   4  
ATOM 8111  H HB2  . ASN B 1 22 ? 8.015   -12.954 -12.696 1.00 0.33  ? 22 ASN B HB2  4  
ATOM 8112  H HB3  . ASN B 1 22 ? 9.041   -13.166 -14.098 1.00 0.38  ? 22 ASN B HB3  4  
ATOM 8113  H HD21 . ASN B 1 22 ? 8.140   -14.511 -11.044 1.00 0.34  ? 22 ASN B HD21 4  
ATOM 8114  H HD22 . ASN B 1 22 ? 9.252   -15.794 -11.035 1.00 0.40  ? 22 ASN B HD22 4  
ATOM 8115  N N    . ILE B 1 23 ? 8.069   -10.638 -11.726 1.00 0.31  ? 23 ILE B N    4  
ATOM 8116  C CA   . ILE B 1 23 ? 7.145   -9.488  -11.602 1.00 0.30  ? 23 ILE B CA   4  
ATOM 8117  C C    . ILE B 1 23 ? 7.944   -8.175  -11.511 1.00 0.34  ? 23 ILE B C    4  
ATOM 8118  O O    . ILE B 1 23 ? 8.579   -7.889  -10.513 1.00 0.37  ? 23 ILE B O    4  
ATOM 8119  C CB   . ILE B 1 23 ? 6.342   -9.728  -10.321 1.00 0.29  ? 23 ILE B CB   4  
ATOM 8120  C CG1  . ILE B 1 23 ? 5.132   -10.611 -10.629 1.00 0.27  ? 23 ILE B CG1  4  
ATOM 8121  C CG2  . ILE B 1 23 ? 5.877   -8.411  -9.722  1.00 0.33  ? 23 ILE B CG2  4  
ATOM 8122  C CD1  . ILE B 1 23 ? 5.590   -12.063 -10.784 1.00 0.26  ? 23 ILE B CD1  4  
ATOM 8123  H H    . ILE B 1 23 ? 7.949   -11.397 -11.121 1.00 0.31  ? 23 ILE B H    4  
ATOM 8124  H HA   . ILE B 1 23 ? 6.477   -9.459  -12.454 1.00 0.29  ? 23 ILE B HA   4  
ATOM 8125  H HB   . ILE B 1 23 ? 6.978   -10.238 -9.611  1.00 0.31  ? 23 ILE B HB   4  
ATOM 8126  H HG12 . ILE B 1 23 ? 4.420   -10.542 -9.820  1.00 0.29  ? 23 ILE B HG12 4  
ATOM 8127  H HG13 . ILE B 1 23 ? 4.670   -10.281 -11.546 1.00 0.26  ? 23 ILE B HG13 4  
ATOM 8128  H HG21 . ILE B 1 23 ? 5.613   -7.730  -10.516 1.00 1.08  ? 23 ILE B HG21 4  
ATOM 8129  H HG22 . ILE B 1 23 ? 5.019   -8.588  -9.094  1.00 1.01  ? 23 ILE B HG22 4  
ATOM 8130  H HG23 . ILE B 1 23 ? 6.677   -7.990  -9.132  1.00 1.12  ? 23 ILE B HG23 4  
ATOM 8131  H HD11 . ILE B 1 23 ? 6.315   -12.294 -10.017 1.00 1.01  ? 23 ILE B HD11 4  
ATOM 8132  H HD12 . ILE B 1 23 ? 4.742   -12.721 -10.689 1.00 1.04  ? 23 ILE B HD12 4  
ATOM 8133  H HD13 . ILE B 1 23 ? 6.042   -12.194 -11.756 1.00 1.04  ? 23 ILE B HD13 4  
ATOM 8134  N N    . GLN B 1 24 ? 7.916   -7.385  -12.554 1.00 0.36  ? 24 GLN B N    4  
ATOM 8135  C CA   . GLN B 1 24 ? 8.651   -6.100  -12.568 1.00 0.42  ? 24 GLN B CA   4  
ATOM 8136  C C    . GLN B 1 24 ? 7.679   -4.921  -12.469 1.00 0.37  ? 24 GLN B C    4  
ATOM 8137  O O    . GLN B 1 24 ? 8.074   -3.828  -12.104 1.00 0.39  ? 24 GLN B O    4  
ATOM 8138  C CB   . GLN B 1 24 ? 9.421   -6.026  -13.880 1.00 0.48  ? 24 GLN B CB   4  
ATOM 8139  C CG   . GLN B 1 24 ? 10.910  -5.759  -13.613 1.00 0.57  ? 24 GLN B CG   4  
ATOM 8140  C CD   . GLN B 1 24 ? 11.566  -6.962  -12.917 1.00 1.16  ? 24 GLN B CD   4  
ATOM 8141  O OE1  . GLN B 1 24 ? 10.897  -7.863  -12.452 1.00 1.83  ? 24 GLN B OE1  4  
ATOM 8142  N NE2  . GLN B 1 24 ? 12.867  -7.010  -12.822 1.00 1.58  ? 24 GLN B NE2  4  
ATOM 8143  H H    . GLN B 1 24 ? 7.406   -7.638  -13.352 1.00 0.36  ? 24 GLN B H    4  
ATOM 8144  H HA   . GLN B 1 24 ? 9.348   -6.061  -11.740 1.00 0.46  ? 24 GLN B HA   4  
ATOM 8145  H HB2  . GLN B 1 24 ? 9.318   -6.968  -14.402 1.00 0.48  ? 24 GLN B HB2  4  
ATOM 8146  H HB3  . GLN B 1 24 ? 9.004   -5.247  -14.481 1.00 0.48  ? 24 GLN B HB3  4  
ATOM 8147  H HG2  . GLN B 1 24 ? 11.410  -5.577  -14.553 1.00 0.65  ? 24 GLN B HG2  4  
ATOM 8148  H HG3  . GLN B 1 24 ? 11.007  -4.887  -12.983 1.00 0.92  ? 24 GLN B HG3  4  
ATOM 8149  H HE21 . GLN B 1 24 ? 13.414  -6.285  -13.191 1.00 1.79  ? 24 GLN B HE21 4  
ATOM 8150  H HE22 . GLN B 1 24 ? 13.297  -7.772  -12.380 1.00 2.03  ? 24 GLN B HE22 4  
ATOM 8151  N N    . SER B 1 25 ? 6.417   -5.115  -12.788 1.00 0.33  ? 25 SER B N    4  
ATOM 8152  C CA   . SER B 1 25 ? 5.460   -3.972  -12.701 1.00 0.29  ? 25 SER B CA   4  
ATOM 8153  C C    . SER B 1 25 ? 4.020   -4.465  -12.551 1.00 0.27  ? 25 SER B C    4  
ATOM 8154  O O    . SER B 1 25 ? 3.759   -5.649  -12.510 1.00 0.29  ? 25 SER B O    4  
ATOM 8155  C CB   . SER B 1 25 ? 5.548   -3.134  -13.961 1.00 0.31  ? 25 SER B CB   4  
ATOM 8156  O OG   . SER B 1 25 ? 5.384   -3.962  -15.106 1.00 0.34  ? 25 SER B OG   4  
ATOM 8157  H H    . SER B 1 25 ? 6.101   -6.002  -13.079 1.00 0.33  ? 25 SER B H    4  
ATOM 8158  H HA   . SER B 1 25 ? 5.720   -3.357  -11.858 1.00 0.29  ? 25 SER B HA   4  
ATOM 8159  H HB2  . SER B 1 25 ? 4.767   -2.401  -13.934 1.00 0.31  ? 25 SER B HB2  4  
ATOM 8160  H HB3  . SER B 1 25 ? 6.505   -2.637  -13.992 1.00 0.30  ? 25 SER B HB3  4  
ATOM 8161  H HG   . SER B 1 25 ? 5.543   -3.424  -15.884 1.00 0.88  ? 25 SER B HG   4  
ATOM 8162  N N    . VAL B 1 26 ? 3.088   -3.545  -12.472 1.00 0.25  ? 26 VAL B N    4  
ATOM 8163  C CA   . VAL B 1 26 ? 1.652   -3.916  -12.338 1.00 0.24  ? 26 VAL B CA   4  
ATOM 8164  C C    . VAL B 1 26 ? 0.783   -2.770  -12.855 1.00 0.25  ? 26 VAL B C    4  
ATOM 8165  O O    . VAL B 1 26 ? 1.193   -1.623  -12.888 1.00 0.26  ? 26 VAL B O    4  
ATOM 8166  C CB   . VAL B 1 26 ? 1.294   -4.189  -10.871 1.00 0.23  ? 26 VAL B CB   4  
ATOM 8167  C CG1  . VAL B 1 26 ? 2.025   -3.213  -9.967  1.00 0.25  ? 26 VAL B CG1  4  
ATOM 8168  C CG2  . VAL B 1 26 ? -0.219  -4.033  -10.669 1.00 0.26  ? 26 VAL B CG2  4  
ATOM 8169  H H    . VAL B 1 26 ? 3.336   -2.602  -12.504 1.00 0.25  ? 26 VAL B H    4  
ATOM 8170  H HA   . VAL B 1 26 ? 1.460   -4.800  -12.924 1.00 0.24  ? 26 VAL B HA   4  
ATOM 8171  H HB   . VAL B 1 26 ? 1.587   -5.182  -10.612 1.00 0.25  ? 26 VAL B HB   4  
ATOM 8172  H HG11 . VAL B 1 26 ? 3.054   -3.138  -10.286 1.00 1.00  ? 26 VAL B HG11 4  
ATOM 8173  H HG12 . VAL B 1 26 ? 1.553   -2.248  -10.030 1.00 1.01  ? 26 VAL B HG12 4  
ATOM 8174  H HG13 . VAL B 1 26 ? 1.986   -3.573  -8.952  1.00 1.08  ? 26 VAL B HG13 4  
ATOM 8175  H HG21 . VAL B 1 26 ? -0.743  -4.665  -11.372 1.00 1.05  ? 26 VAL B HG21 4  
ATOM 8176  H HG22 . VAL B 1 26 ? -0.483  -4.313  -9.665  1.00 1.04  ? 26 VAL B HG22 4  
ATOM 8177  H HG23 . VAL B 1 26 ? -0.499  -3.001  -10.841 1.00 1.04  ? 26 VAL B HG23 4  
ATOM 8178  N N    . ASN B 1 27 ? -0.423  -3.082  -13.244 1.00 0.25  ? 27 ASN B N    4  
ATOM 8179  C CA   . ASN B 1 27 ? -1.342  -2.044  -13.745 1.00 0.27  ? 27 ASN B CA   4  
ATOM 8180  C C    . ASN B 1 27 ? -2.700  -2.167  -13.070 1.00 0.25  ? 27 ASN B C    4  
ATOM 8181  O O    . ASN B 1 27 ? -3.300  -3.224  -13.040 1.00 0.42  ? 27 ASN B O    4  
ATOM 8182  C CB   . ASN B 1 27 ? -1.522  -2.154  -15.253 1.00 0.30  ? 27 ASN B CB   4  
ATOM 8183  C CG   . ASN B 1 27 ? -0.649  -3.262  -15.862 1.00 0.57  ? 27 ASN B CG   4  
ATOM 8184  O OD1  . ASN B 1 27 ? 0.564   -3.217  -15.772 1.00 0.94  ? 27 ASN B OD1  4  
ATOM 8185  N ND2  . ASN B 1 27 ? -1.214  -4.247  -16.500 1.00 0.72  ? 27 ASN B ND2  4  
ATOM 8186  H H    . ASN B 1 27 ? -0.721  -4.007  -13.199 1.00 0.26  ? 27 ASN B H    4  
ATOM 8187  H HA   . ASN B 1 27 ? -0.933  -1.083  -13.517 1.00 0.30  ? 27 ASN B HA   4  
ATOM 8188  H HB2  . ASN B 1 27 ? -2.561  -2.347  -15.475 1.00 0.46  ? 27 ASN B HB2  4  
ATOM 8189  H HB3  . ASN B 1 27 ? -1.240  -1.225  -15.670 1.00 0.51  ? 27 ASN B HB3  4  
ATOM 8190  H HD21 . ASN B 1 27 ? -2.191  -4.281  -16.586 1.00 0.75  ? 27 ASN B HD21 4  
ATOM 8191  H HD22 . ASN B 1 27 ? -0.663  -4.952  -16.896 1.00 0.99  ? 27 ASN B HD22 4  
ATOM 8192  N N    . VAL B 1 28 ? -3.193  -1.079  -12.545 1.00 0.28  ? 28 VAL B N    4  
ATOM 8193  C CA   . VAL B 1 28 ? -4.527  -1.106  -11.883 1.00 0.29  ? 28 VAL B CA   4  
ATOM 8194  C C    . VAL B 1 28 ? -5.509  -0.279  -12.719 1.00 0.31  ? 28 VAL B C    4  
ATOM 8195  O O    . VAL B 1 28 ? -5.182  0.792   -13.194 1.00 0.33  ? 28 VAL B O    4  
ATOM 8196  C CB   . VAL B 1 28 ? -4.417  -0.551  -10.455 1.00 0.34  ? 28 VAL B CB   4  
ATOM 8197  C CG1  . VAL B 1 28 ? -4.036  0.927   -10.492 1.00 0.55  ? 28 VAL B CG1  4  
ATOM 8198  C CG2  . VAL B 1 28 ? -5.758  -0.709  -9.730  1.00 0.72  ? 28 VAL B CG2  4  
ATOM 8199  H H    . VAL B 1 28 ? -2.690  -0.237  -12.604 1.00 0.44  ? 28 VAL B H    4  
ATOM 8200  H HA   . VAL B 1 28 ? -4.874  -2.126  -11.843 1.00 0.28  ? 28 VAL B HA   4  
ATOM 8201  H HB   . VAL B 1 28 ? -3.656  -1.097  -9.921  1.00 0.31  ? 28 VAL B HB   4  
ATOM 8202  H HG11 . VAL B 1 28 ? -3.393  1.110   -11.340 1.00 1.25  ? 28 VAL B HG11 4  
ATOM 8203  H HG12 . VAL B 1 28 ? -4.929  1.526   -10.582 1.00 1.09  ? 28 VAL B HG12 4  
ATOM 8204  H HG13 . VAL B 1 28 ? -3.517  1.184   -9.582  1.00 1.22  ? 28 VAL B HG13 4  
ATOM 8205  H HG21 . VAL B 1 28 ? -6.568  -0.594  -10.435 1.00 1.29  ? 28 VAL B HG21 4  
ATOM 8206  H HG22 . VAL B 1 28 ? -5.810  -1.690  -9.281  1.00 1.29  ? 28 VAL B HG22 4  
ATOM 8207  H HG23 . VAL B 1 28 ? -5.843  0.043   -8.959  1.00 1.29  ? 28 VAL B HG23 4  
ATOM 8208  N N    . LYS B 1 29 ? -6.700  -0.780  -12.910 1.00 0.35  ? 29 LYS B N    4  
ATOM 8209  C CA   . LYS B 1 29 ? -7.715  -0.051  -13.727 1.00 0.42  ? 29 LYS B CA   4  
ATOM 8210  C C    . LYS B 1 29 ? -9.067  -0.071  -13.005 1.00 0.37  ? 29 LYS B C    4  
ATOM 8211  O O    . LYS B 1 29 ? -9.315  -0.898  -12.141 1.00 0.35  ? 29 LYS B O    4  
ATOM 8212  C CB   . LYS B 1 29 ? -7.858  -0.746  -15.090 1.00 0.52  ? 29 LYS B CB   4  
ATOM 8213  C CG   . LYS B 1 29 ? -7.412  0.180   -16.229 1.00 1.08  ? 29 LYS B CG   4  
ATOM 8214  C CD   . LYS B 1 29 ? -8.362  1.379   -16.350 1.00 0.83  ? 29 LYS B CD   4  
ATOM 8215  C CE   . LYS B 1 29 ? -9.803  0.898   -16.547 1.00 0.77  ? 29 LYS B CE   4  
ATOM 8216  N NZ   . LYS B 1 29 ? -9.956  0.287   -17.901 1.00 1.23  ? 29 LYS B NZ   4  
ATOM 8217  H H    . LYS B 1 29 ? -6.927  -1.648  -12.519 1.00 0.35  ? 29 LYS B H    4  
ATOM 8218  H HA   . LYS B 1 29 ? -7.398  0.971   -13.873 1.00 0.52  ? 29 LYS B HA   4  
ATOM 8219  H HB2  . LYS B 1 29 ? -7.245  -1.633  -15.099 1.00 1.13  ? 29 LYS B HB2  4  
ATOM 8220  H HB3  . LYS B 1 29 ? -8.890  -1.026  -15.242 1.00 0.82  ? 29 LYS B HB3  4  
ATOM 8221  H HG2  . LYS B 1 29 ? -6.411  0.533   -16.030 1.00 1.70  ? 29 LYS B HG2  4  
ATOM 8222  H HG3  . LYS B 1 29 ? -7.416  -0.372  -17.157 1.00 2.02  ? 29 LYS B HG3  4  
ATOM 8223  H HD2  . LYS B 1 29 ? -8.304  1.973   -15.452 1.00 1.42  ? 29 LYS B HD2  4  
ATOM 8224  H HD3  . LYS B 1 29 ? -8.070  1.982   -17.196 1.00 1.53  ? 29 LYS B HD3  4  
ATOM 8225  H HE2  . LYS B 1 29 ? -10.041 0.164   -15.793 1.00 1.30  ? 29 LYS B HE2  4  
ATOM 8226  H HE3  . LYS B 1 29 ? -10.473 1.737   -16.453 1.00 1.10  ? 29 LYS B HE3  4  
ATOM 8227  H HZ1  . LYS B 1 29 ? -9.492  0.888   -18.610 1.00 1.80  ? 29 LYS B HZ1  4  
ATOM 8228  H HZ2  . LYS B 1 29 ? -9.517  -0.656  -17.907 1.00 1.54  ? 29 LYS B HZ2  4  
ATOM 8229  H HZ3  . LYS B 1 29 ? -10.968 0.200   -18.128 1.00 1.71  ? 29 LYS B HZ3  4  
ATOM 8230  N N    . SER B 1 30 ? -9.938  0.840   -13.363 1.00 0.39  ? 30 SER B N    4  
ATOM 8231  C CA   . SER B 1 30 ? -11.288 0.918   -12.727 1.00 0.39  ? 30 SER B CA   4  
ATOM 8232  C C    . SER B 1 30 ? -12.289 0.034   -13.516 1.00 0.34  ? 30 SER B C    4  
ATOM 8233  O O    . SER B 1 30 ? -11.915 -0.595  -14.490 1.00 0.35  ? 30 SER B O    4  
ATOM 8234  C CB   . SER B 1 30 ? -11.727 2.395   -12.741 1.00 0.52  ? 30 SER B CB   4  
ATOM 8235  O OG   . SER B 1 30 ? -12.498 2.663   -13.908 1.00 1.63  ? 30 SER B OG   4  
ATOM 8236  H H    . SER B 1 30 ? -9.699  1.486   -14.059 1.00 0.43  ? 30 SER B H    4  
ATOM 8237  H HA   . SER B 1 30 ? -11.225 0.565   -11.704 1.00 0.41  ? 30 SER B HA   4  
ATOM 8238  H HB2  . SER B 1 30 ? -12.319 2.608   -11.869 1.00 0.91  ? 30 SER B HB2  4  
ATOM 8239  H HB3  . SER B 1 30 ? -10.845 3.026   -12.733 1.00 0.92  ? 30 SER B HB3  4  
ATOM 8240  H HG   . SER B 1 30 ? -13.127 3.356   -13.695 1.00 2.13  ? 30 SER B HG   4  
ATOM 8241  N N    . PRO B 1 31 ? -13.534 0.004   -13.067 1.00 0.39  ? 31 PRO B N    4  
ATOM 8242  C CA   . PRO B 1 31 ? -14.603 -0.800  -13.714 1.00 0.44  ? 31 PRO B CA   4  
ATOM 8243  C C    . PRO B 1 31 ? -15.100 -0.134  -15.007 1.00 0.52  ? 31 PRO B C    4  
ATOM 8244  O O    . PRO B 1 31 ? -14.583 0.887   -15.423 1.00 0.59  ? 31 PRO B O    4  
ATOM 8245  C CB   . PRO B 1 31 ? -15.704 -0.849  -12.649 1.00 0.52  ? 31 PRO B CB   4  
ATOM 8246  C CG   . PRO B 1 31 ? -15.467 0.356   -11.710 1.00 0.56  ? 31 PRO B CG   4  
ATOM 8247  C CD   . PRO B 1 31 ? -13.994 0.768   -11.884 1.00 0.49  ? 31 PRO B CD   4  
ATOM 8248  H HA   . PRO B 1 31 ? -14.250 -1.798  -13.919 1.00 0.44  ? 31 PRO B HA   4  
ATOM 8249  H HB2  . PRO B 1 31 ? -16.676 -0.774  -13.116 1.00 0.58  ? 31 PRO B HB2  4  
ATOM 8250  H HB3  . PRO B 1 31 ? -15.633 -1.764  -12.085 1.00 0.55  ? 31 PRO B HB3  4  
ATOM 8251  H HG2  . PRO B 1 31 ? -16.118 1.174   -11.987 1.00 0.62  ? 31 PRO B HG2  4  
ATOM 8252  H HG3  . PRO B 1 31 ? -15.646 0.069   -10.687 1.00 0.64  ? 31 PRO B HG3  4  
ATOM 8253  H HD2  . PRO B 1 31 ? -13.923 1.831   -12.064 1.00 0.54  ? 31 PRO B HD2  4  
ATOM 8254  H HD3  . PRO B 1 31 ? -13.418 0.490   -11.014 1.00 0.52  ? 31 PRO B HD3  4  
ATOM 8255  N N    . GLY B 1 32 ? -16.097 -0.707  -15.654 1.00 0.59  ? 32 GLY B N    4  
ATOM 8256  C CA   . GLY B 1 32 ? -16.604 -0.097  -16.924 1.00 0.72  ? 32 GLY B CA   4  
ATOM 8257  C C    . GLY B 1 32 ? -17.731 -0.953  -17.522 1.00 0.91  ? 32 GLY B C    4  
ATOM 8258  O O    . GLY B 1 32 ? -18.894 -0.668  -17.305 1.00 1.05  ? 32 GLY B O    4  
ATOM 8259  H H    . GLY B 1 32 ? -16.504 -1.537  -15.307 1.00 0.60  ? 32 GLY B H    4  
ATOM 8260  H HA2  . GLY B 1 32 ? -16.981 0.895   -16.715 1.00 0.72  ? 32 GLY B HA2  4  
ATOM 8261  H HA3  . GLY B 1 32 ? -15.795 -0.028  -17.636 1.00 0.77  ? 32 GLY B HA3  4  
ATOM 8262  N N    . PRO B 1 33 ? -17.352 -1.973  -18.268 1.00 1.05  ? 33 PRO B N    4  
ATOM 8263  C CA   . PRO B 1 33 ? -18.318 -2.885  -18.923 1.00 1.30  ? 33 PRO B CA   4  
ATOM 8264  C C    . PRO B 1 33 ? -18.975 -3.820  -17.893 1.00 1.12  ? 33 PRO B C    4  
ATOM 8265  O O    . PRO B 1 33 ? -19.011 -3.518  -16.715 1.00 1.13  ? 33 PRO B O    4  
ATOM 8266  C CB   . PRO B 1 33 ? -17.454 -3.656  -19.933 1.00 1.62  ? 33 PRO B CB   4  
ATOM 8267  C CG   . PRO B 1 33 ? -15.997 -3.553  -19.433 1.00 1.55  ? 33 PRO B CG   4  
ATOM 8268  C CD   . PRO B 1 33 ? -15.933 -2.316  -18.520 1.00 1.17  ? 33 PRO B CD   4  
ATOM 8269  H HA   . PRO B 1 33 ? -19.070 -2.319  -19.447 1.00 1.48  ? 33 PRO B HA   4  
ATOM 8270  H HB2  . PRO B 1 33 ? -17.763 -4.692  -19.971 1.00 1.72  ? 33 PRO B HB2  4  
ATOM 8271  H HB3  . PRO B 1 33 ? -17.536 -3.207  -20.909 1.00 1.87  ? 33 PRO B HB3  4  
ATOM 8272  H HG2  . PRO B 1 33 ? -15.732 -4.441  -18.875 1.00 1.57  ? 33 PRO B HG2  4  
ATOM 8273  H HG3  . PRO B 1 33 ? -15.325 -3.424  -20.267 1.00 1.80  ? 33 PRO B HG3  4  
ATOM 8274  H HD2  . PRO B 1 33 ? -15.426 -2.559  -17.597 1.00 1.04  ? 33 PRO B HD2  4  
ATOM 8275  H HD3  . PRO B 1 33 ? -15.436 -1.500  -19.022 1.00 1.24  ? 33 PRO B HD3  4  
ATOM 8276  N N    . HIS B 1 34 ? -19.520 -4.938  -18.327 1.00 1.15  ? 34 HIS B N    4  
ATOM 8277  C CA   . HIS B 1 34 ? -20.195 -5.864  -17.355 1.00 1.18  ? 34 HIS B CA   4  
ATOM 8278  C C    . HIS B 1 34 ? -19.209 -6.397  -16.315 1.00 1.19  ? 34 HIS B C    4  
ATOM 8279  O O    . HIS B 1 34 ? -19.622 -6.778  -15.234 1.00 1.29  ? 34 HIS B O    4  
ATOM 8280  C CB   . HIS B 1 34 ? -20.893 -7.044  -18.061 1.00 1.36  ? 34 HIS B CB   4  
ATOM 8281  C CG   . HIS B 1 34 ? -20.169 -7.465  -19.316 1.00 1.55  ? 34 HIS B CG   4  
ATOM 8282  N ND1  . HIS B 1 34 ? -20.797 -7.459  -20.552 1.00 2.08  ? 34 HIS B ND1  4  
ATOM 8283  C CD2  . HIS B 1 34 ? -18.898 -7.943  -19.545 1.00 2.02  ? 34 HIS B CD2  4  
ATOM 8284  C CE1  . HIS B 1 34 ? -19.918 -7.919  -21.457 1.00 2.64  ? 34 HIS B CE1  4  
ATOM 8285  N NE2  . HIS B 1 34 ? -18.749 -8.230  -20.897 1.00 2.66  ? 34 HIS B NE2  4  
ATOM 8286  H H    . HIS B 1 34 ? -19.501 -5.154  -19.281 1.00 1.28  ? 34 HIS B H    4  
ATOM 8287  H HA   . HIS B 1 34 ? -20.945 -5.291  -16.819 1.00 1.14  ? 34 HIS B HA   4  
ATOM 8288  H HB2  . HIS B 1 34 ? -20.935 -7.882  -17.384 1.00 1.72  ? 34 HIS B HB2  4  
ATOM 8289  H HB3  . HIS B 1 34 ? -21.901 -6.751  -18.318 1.00 1.68  ? 34 HIS B HB3  4  
ATOM 8290  H HD1  . HIS B 1 34 ? -21.716 -7.170  -20.733 1.00 2.31  ? 34 HIS B HD1  4  
ATOM 8291  H HD2  . HIS B 1 34 ? -18.130 -8.071  -18.796 1.00 2.23  ? 34 HIS B HD2  4  
ATOM 8292  H HE1  . HIS B 1 34 ? -20.133 -8.026  -22.509 1.00 3.25  ? 34 HIS B HE1  4  
ATOM 8293  N N    . CYS B 1 35 ? -17.920 -6.392  -16.575 1.00 1.22  ? 35 CYS B N    4  
ATOM 8294  C CA   . CYS B 1 35 ? -16.984 -6.854  -15.511 1.00 1.29  ? 35 CYS B CA   4  
ATOM 8295  C C    . CYS B 1 35 ? -17.191 -5.904  -14.339 1.00 1.07  ? 35 CYS B C    4  
ATOM 8296  O O    . CYS B 1 35 ? -17.334 -6.318  -13.203 1.00 1.13  ? 35 CYS B O    4  
ATOM 8297  C CB   . CYS B 1 35 ? -15.530 -6.794  -15.985 1.00 1.59  ? 35 CYS B CB   4  
ATOM 8298  S SG   . CYS B 1 35 ? -14.469 -7.538  -14.718 1.00 2.40  ? 35 CYS B SG   4  
ATOM 8299  H H    . CYS B 1 35 ? -17.578 -6.044  -17.425 1.00 1.28  ? 35 CYS B H    4  
ATOM 8300  H HA   . CYS B 1 35 ? -17.238 -7.861  -15.214 1.00 1.39  ? 35 CYS B HA   4  
ATOM 8301  H HB2  . CYS B 1 35 ? -15.429 -7.341  -16.911 1.00 1.86  ? 35 CYS B HB2  4  
ATOM 8302  H HB3  . CYS B 1 35 ? -15.242 -5.764  -16.140 1.00 1.86  ? 35 CYS B HB3  4  
ATOM 8303  N N    . ALA B 1 36 ? -17.280 -4.624  -14.648 1.00 0.96  ? 36 ALA B N    4  
ATOM 8304  C CA   . ALA B 1 36 ? -17.555 -3.584  -13.621 1.00 0.90  ? 36 ALA B CA   4  
ATOM 8305  C C    . ALA B 1 36 ? -16.742 -3.828  -12.348 1.00 0.86  ? 36 ALA B C    4  
ATOM 8306  O O    . ALA B 1 36 ? -17.190 -3.578  -11.244 1.00 1.18  ? 36 ALA B O    4  
ATOM 8307  C CB   . ALA B 1 36 ? -19.042 -3.624  -13.324 1.00 1.09  ? 36 ALA B CB   4  
ATOM 8308  H H    . ALA B 1 36 ? -17.211 -4.353  -15.584 1.00 1.03  ? 36 ALA B H    4  
ATOM 8309  H HA   . ALA B 1 36 ? -17.304 -2.614  -14.021 1.00 0.98  ? 36 ALA B HA   4  
ATOM 8310  H HB1  . ALA B 1 36 ? -19.322 -4.631  -13.060 1.00 1.38  ? 36 ALA B HB1  4  
ATOM 8311  H HB2  . ALA B 1 36 ? -19.263 -2.956  -12.512 1.00 1.61  ? 36 ALA B HB2  4  
ATOM 8312  H HB3  . ALA B 1 36 ? -19.584 -3.319  -14.209 1.00 1.51  ? 36 ALA B HB3  4  
ATOM 8313  N N    . GLN B 1 37 ? -15.540 -4.296  -12.511 1.00 0.93  ? 37 GLN B N    4  
ATOM 8314  C CA   . GLN B 1 37 ? -14.654 -4.551  -11.342 1.00 0.88  ? 37 GLN B CA   4  
ATOM 8315  C C    . GLN B 1 37 ? -13.377 -3.738  -11.512 1.00 0.71  ? 37 GLN B C    4  
ATOM 8316  O O    . GLN B 1 37 ? -13.232 -2.971  -12.445 1.00 0.74  ? 37 GLN B O    4  
ATOM 8317  C CB   . GLN B 1 37 ? -14.292 -6.043  -11.275 1.00 0.99  ? 37 GLN B CB   4  
ATOM 8318  C CG   . GLN B 1 37 ? -14.440 -6.579  -9.844  1.00 1.66  ? 37 GLN B CG   4  
ATOM 8319  C CD   . GLN B 1 37 ? -15.812 -6.195  -9.277  1.00 2.34  ? 37 GLN B CD   4  
ATOM 8320  O OE1  . GLN B 1 37 ? -15.902 -5.395  -8.368  1.00 2.83  ? 37 GLN B OE1  4  
ATOM 8321  N NE2  . GLN B 1 37 ? -16.891 -6.732  -9.782  1.00 3.07  ? 37 GLN B NE2  4  
ATOM 8322  H H    . GLN B 1 37 ? -15.217 -4.470  -13.414 1.00 1.26  ? 37 GLN B H    4  
ATOM 8323  H HA   . GLN B 1 37 ? -15.158 -4.251  -10.436 1.00 0.95  ? 37 GLN B HA   4  
ATOM 8324  H HB2  . GLN B 1 37 ? -14.941 -6.591  -11.925 1.00 1.38  ? 37 GLN B HB2  4  
ATOM 8325  H HB3  . GLN B 1 37 ? -13.271 -6.177  -11.599 1.00 1.44  ? 37 GLN B HB3  4  
ATOM 8326  H HG2  . GLN B 1 37 ? -14.349 -7.657  -9.858  1.00 2.21  ? 37 GLN B HG2  4  
ATOM 8327  H HG3  . GLN B 1 37 ? -13.662 -6.166  -9.217  1.00 2.02  ? 37 GLN B HG3  4  
ATOM 8328  H HE21 . GLN B 1 37 ? -16.821 -7.377  -10.518 1.00 3.26  ? 37 GLN B HE21 4  
ATOM 8329  H HE22 . GLN B 1 37 ? -17.770 -6.490  -9.426  1.00 3.72  ? 37 GLN B HE22 4  
ATOM 8330  N N    . THR B 1 38 ? -12.443 -3.911  -10.627 1.00 0.60  ? 38 THR B N    4  
ATOM 8331  C CA   . THR B 1 38 ? -11.166 -3.162  -10.736 1.00 0.44  ? 38 THR B CA   4  
ATOM 8332  C C    . THR B 1 38 ? -10.247 -3.863  -11.736 1.00 0.35  ? 38 THR B C    4  
ATOM 8333  O O    . THR B 1 38 ? -10.673 -4.673  -12.540 1.00 0.42  ? 38 THR B O    4  
ATOM 8334  C CB   . THR B 1 38 ? -10.470 -3.109  -9.367  1.00 0.44  ? 38 THR B CB   4  
ATOM 8335  O OG1  . THR B 1 38 ? -11.320 -3.635  -8.354  1.00 0.60  ? 38 THR B OG1  4  
ATOM 8336  C CG2  . THR B 1 38 ? -10.134 -1.664  -9.052  1.00 0.44  ? 38 THR B CG2  4  
ATOM 8337  H H    . THR B 1 38 ? -12.579 -4.541  -9.894  1.00 0.68  ? 38 THR B H    4  
ATOM 8338  H HA   . THR B 1 38 ? -11.366 -2.157  -11.076 1.00 0.44  ? 38 THR B HA   4  
ATOM 8339  H HB   . THR B 1 38 ? -9.549  -3.682  -9.404  1.00 0.40  ? 38 THR B HB   4  
ATOM 8340  H HG1  . THR B 1 38 ? -10.989 -4.502  -8.109  1.00 1.03  ? 38 THR B HG1  4  
ATOM 8341  H HG21 . THR B 1 38 ? -9.497  -1.272  -9.830  1.00 1.11  ? 38 THR B HG21 4  
ATOM 8342  H HG22 . THR B 1 38 ? -11.046 -1.091  -9.007  1.00 1.08  ? 38 THR B HG22 4  
ATOM 8343  H HG23 . THR B 1 38 ? -9.622  -1.616  -8.106  1.00 1.06  ? 38 THR B HG23 4  
ATOM 8344  N N    . GLU B 1 39 ? -8.981  -3.582  -11.652 1.00 0.25  ? 39 GLU B N    4  
ATOM 8345  C CA   . GLU B 1 39 ? -7.992  -4.231  -12.527 1.00 0.25  ? 39 GLU B CA   4  
ATOM 8346  C C    . GLU B 1 39 ? -6.707  -4.199  -11.763 1.00 0.21  ? 39 GLU B C    4  
ATOM 8347  O O    . GLU B 1 39 ? -6.411  -3.233  -11.087 1.00 0.35  ? 39 GLU B O    4  
ATOM 8348  C CB   . GLU B 1 39 ? -7.781  -3.484  -13.830 1.00 0.33  ? 39 GLU B CB   4  
ATOM 8349  C CG   . GLU B 1 39 ? -8.117  -4.399  -15.013 1.00 0.60  ? 39 GLU B CG   4  
ATOM 8350  C CD   . GLU B 1 39 ? -8.112  -3.592  -16.315 1.00 0.80  ? 39 GLU B CD   4  
ATOM 8351  O OE1  . GLU B 1 39 ? -7.039  -3.383  -16.857 1.00 1.47  ? 39 GLU B OE1  4  
ATOM 8352  O OE2  . GLU B 1 39 ? -9.183  -3.200  -16.751 1.00 1.40  ? 39 GLU B OE2  4  
ATOM 8353  H H    . GLU B 1 39 ? -8.662  -2.958  -10.966 1.00 0.25  ? 39 GLU B H    4  
ATOM 8354  H HA   . GLU B 1 39 ? -8.288  -5.247  -12.712 1.00 0.31  ? 39 GLU B HA   4  
ATOM 8355  H HB2  . GLU B 1 39 ? -8.410  -2.606  -13.851 1.00 0.30  ? 39 GLU B HB2  4  
ATOM 8356  H HB3  . GLU B 1 39 ? -6.734  -3.193  -13.881 1.00 0.41  ? 39 GLU B HB3  4  
ATOM 8357  H HG2  . GLU B 1 39 ? -7.381  -5.187  -15.077 1.00 0.87  ? 39 GLU B HG2  4  
ATOM 8358  H HG3  . GLU B 1 39 ? -9.094  -4.831  -14.865 1.00 0.84  ? 39 GLU B HG3  4  
ATOM 8359  N N    . VAL B 1 40 ? -5.971  -5.241  -11.802 1.00 0.15  ? 40 VAL B N    4  
ATOM 8360  C CA   . VAL B 1 40 ? -4.747  -5.270  -11.014 1.00 0.19  ? 40 VAL B CA   4  
ATOM 8361  C C    . VAL B 1 40 ? -3.800  -6.278  -11.650 1.00 0.19  ? 40 VAL B C    4  
ATOM 8362  O O    . VAL B 1 40 ? -3.655  -7.389  -11.182 1.00 0.22  ? 40 VAL B O    4  
ATOM 8363  C CB   . VAL B 1 40 ? -5.169  -5.683  -9.598  1.00 0.24  ? 40 VAL B CB   4  
ATOM 8364  C CG1  . VAL B 1 40 ? -5.420  -4.419  -8.786  1.00 0.28  ? 40 VAL B CG1  4  
ATOM 8365  C CG2  . VAL B 1 40 ? -6.493  -6.470  -9.663  1.00 0.24  ? 40 VAL B CG2  4  
ATOM 8366  H H    . VAL B 1 40 ? -6.247  -6.026  -12.298 1.00 0.22  ? 40 VAL B H    4  
ATOM 8367  H HA   . VAL B 1 40 ? -4.313  -4.278  -11.013 1.00 0.23  ? 40 VAL B HA   4  
ATOM 8368  H HB   . VAL B 1 40 ? -4.404  -6.296  -9.141  1.00 0.29  ? 40 VAL B HB   4  
ATOM 8369  H HG11 . VAL B 1 40 ? -4.916  -3.586  -9.255  1.00 0.98  ? 40 VAL B HG11 4  
ATOM 8370  H HG12 . VAL B 1 40 ? -6.486  -4.221  -8.761  1.00 1.04  ? 40 VAL B HG12 4  
ATOM 8371  H HG13 . VAL B 1 40 ? -5.054  -4.552  -7.786  1.00 1.02  ? 40 VAL B HG13 4  
ATOM 8372  H HG21 . VAL B 1 40 ? -6.402  -7.273  -10.378 1.00 0.98  ? 40 VAL B HG21 4  
ATOM 8373  H HG22 . VAL B 1 40 ? -6.728  -6.871  -8.693  1.00 1.00  ? 40 VAL B HG22 4  
ATOM 8374  H HG23 . VAL B 1 40 ? -7.290  -5.803  -9.976  1.00 1.08  ? 40 VAL B HG23 4  
ATOM 8375  N N    . ILE B 1 41 ? -3.214  -5.913  -12.761 1.00 0.22  ? 41 ILE B N    4  
ATOM 8376  C CA   . ILE B 1 41 ? -2.351  -6.855  -13.494 1.00 0.25  ? 41 ILE B CA   4  
ATOM 8377  C C    . ILE B 1 41 ? -0.862  -6.592  -13.255 1.00 0.23  ? 41 ILE B C    4  
ATOM 8378  O O    . ILE B 1 41 ? -0.337  -5.574  -13.637 1.00 0.25  ? 41 ILE B O    4  
ATOM 8379  C CB   . ILE B 1 41 ? -2.687  -6.701  -14.970 1.00 0.30  ? 41 ILE B CB   4  
ATOM 8380  C CG1  . ILE B 1 41 ? -3.907  -7.581  -15.275 1.00 0.50  ? 41 ILE B CG1  4  
ATOM 8381  C CG2  . ILE B 1 41 ? -1.496  -7.127  -15.824 1.00 0.67  ? 41 ILE B CG2  4  
ATOM 8382  C CD1  . ILE B 1 41 ? -3.988  -7.896  -16.768 1.00 0.54  ? 41 ILE B CD1  4  
ATOM 8383  H H    . ILE B 1 41 ? -3.389  -5.028  -13.146 1.00 0.27  ? 41 ILE B H    4  
ATOM 8384  H HA   . ILE B 1 41 ? -2.593  -7.851  -13.189 1.00 0.26  ? 41 ILE B HA   4  
ATOM 8385  H HB   . ILE B 1 41 ? -2.921  -5.661  -15.170 1.00 0.48  ? 41 ILE B HB   4  
ATOM 8386  H HG12 . ILE B 1 41 ? -3.824  -8.506  -14.721 1.00 0.70  ? 41 ILE B HG12 4  
ATOM 8387  H HG13 . ILE B 1 41 ? -4.801  -7.065  -14.967 1.00 0.68  ? 41 ILE B HG13 4  
ATOM 8388  H HG21 . ILE B 1 41 ? -1.224  -8.139  -15.574 1.00 1.13  ? 41 ILE B HG21 4  
ATOM 8389  H HG22 . ILE B 1 41 ? -1.764  -7.069  -16.866 1.00 1.24  ? 41 ILE B HG22 4  
ATOM 8390  H HG23 . ILE B 1 41 ? -0.663  -6.469  -15.629 1.00 1.41  ? 41 ILE B HG23 4  
ATOM 8391  H HD11 . ILE B 1 41 ? -3.987  -6.976  -17.331 1.00 1.11  ? 41 ILE B HD11 4  
ATOM 8392  H HD12 . ILE B 1 41 ? -3.135  -8.495  -17.054 1.00 1.15  ? 41 ILE B HD12 4  
ATOM 8393  H HD13 . ILE B 1 41 ? -4.896  -8.444  -16.970 1.00 1.12  ? 41 ILE B HD13 4  
ATOM 8394  N N    . ALA B 1 42 ? -0.172  -7.542  -12.678 1.00 0.22  ? 42 ALA B N    4  
ATOM 8395  C CA   . ALA B 1 42 ? 1.292   -7.389  -12.461 1.00 0.22  ? 42 ALA B CA   4  
ATOM 8396  C C    . ALA B 1 42 ? 2.015   -7.874  -13.709 1.00 0.24  ? 42 ALA B C    4  
ATOM 8397  O O    . ALA B 1 42 ? 1.974   -9.045  -14.038 1.00 0.25  ? 42 ALA B O    4  
ATOM 8398  C CB   . ALA B 1 42 ? 1.714   -8.222  -11.262 1.00 0.21  ? 42 ALA B CB   4  
ATOM 8399  H H    . ALA B 1 42 ? -0.615  -8.381  -12.418 1.00 0.23  ? 42 ALA B H    4  
ATOM 8400  H HA   . ALA B 1 42 ? 1.536   -6.363  -12.288 1.00 0.23  ? 42 ALA B HA   4  
ATOM 8401  H HB1  . ALA B 1 42 ? 1.235   -9.188  -11.313 1.00 1.02  ? 42 ALA B HB1  4  
ATOM 8402  H HB2  . ALA B 1 42 ? 2.785   -8.345  -11.274 1.00 1.07  ? 42 ALA B HB2  4  
ATOM 8403  H HB3  . ALA B 1 42 ? 1.416   -7.716  -10.357 1.00 1.01  ? 42 ALA B HB3  4  
ATOM 8404  N N    . THR B 1 43 ? 2.672   -6.986  -14.415 1.00 0.28  ? 43 THR B N    4  
ATOM 8405  C CA   . THR B 1 43 ? 3.380   -7.419  -15.642 1.00 0.32  ? 43 THR B CA   4  
ATOM 8406  C C    . THR B 1 43 ? 4.607   -8.224  -15.252 1.00 0.32  ? 43 THR B C    4  
ATOM 8407  O O    . THR B 1 43 ? 5.445   -7.787  -14.478 1.00 0.33  ? 43 THR B O    4  
ATOM 8408  C CB   . THR B 1 43 ? 3.819   -6.226  -16.499 1.00 0.35  ? 43 THR B CB   4  
ATOM 8409  O OG1  . THR B 1 43 ? 2.878   -5.164  -16.382 1.00 0.39  ? 43 THR B OG1  4  
ATOM 8410  C CG2  . THR B 1 43 ? 3.922   -6.672  -17.957 1.00 0.39  ? 43 THR B CG2  4  
ATOM 8411  H H    . THR B 1 43 ? 2.696   -6.046  -14.137 1.00 0.28  ? 43 THR B H    4  
ATOM 8412  H HA   . THR B 1 43 ? 2.709   -8.048  -16.214 1.00 0.33  ? 43 THR B HA   4  
ATOM 8413  H HB   . THR B 1 43 ? 4.790   -5.890  -16.171 1.00 0.35  ? 43 THR B HB   4  
ATOM 8414  H HG1  . THR B 1 43 ? 2.024   -5.484  -16.685 1.00 0.89  ? 43 THR B HG1  4  
ATOM 8415  H HG21 . THR B 1 43 ? 4.607   -7.507  -18.027 1.00 1.06  ? 43 THR B HG21 4  
ATOM 8416  H HG22 . THR B 1 43 ? 2.947   -6.978  -18.309 1.00 1.06  ? 43 THR B HG22 4  
ATOM 8417  H HG23 . THR B 1 43 ? 4.286   -5.857  -18.561 1.00 1.07  ? 43 THR B HG23 4  
ATOM 8418  N N    . LEU B 1 44 ? 4.697   -9.406  -15.778 1.00 0.32  ? 44 LEU B N    4  
ATOM 8419  C CA   . LEU B 1 44 ? 5.829   -10.298 -15.469 1.00 0.32  ? 44 LEU B CA   4  
ATOM 8420  C C    . LEU B 1 44 ? 7.096   -9.846  -16.205 1.00 0.37  ? 44 LEU B C    4  
ATOM 8421  O O    . LEU B 1 44 ? 7.020   -9.177  -17.223 1.00 0.40  ? 44 LEU B O    4  
ATOM 8422  C CB   . LEU B 1 44 ? 5.450   -11.686 -15.949 1.00 0.34  ? 44 LEU B CB   4  
ATOM 8423  C CG   . LEU B 1 44 ? 4.853   -12.502 -14.812 1.00 0.33  ? 44 LEU B CG   4  
ATOM 8424  C CD1  . LEU B 1 44 ? 5.992   -13.279 -14.165 1.00 0.35  ? 44 LEU B CD1  4  
ATOM 8425  C CD2  . LEU B 1 44 ? 4.154   -11.584 -13.779 1.00 0.29  ? 44 LEU B CD2  4  
ATOM 8426  H H    . LEU B 1 44 ? 3.993   -9.723  -16.378 1.00 0.33  ? 44 LEU B H    4  
ATOM 8427  H HA   . LEU B 1 44 ? 5.993   -10.310 -14.397 1.00 0.30  ? 44 LEU B HA   4  
ATOM 8428  H HB2  . LEU B 1 44 ? 4.727   -11.599 -16.740 1.00 0.37  ? 44 LEU B HB2  4  
ATOM 8429  H HB3  . LEU B 1 44 ? 6.332   -12.185 -16.321 1.00 0.37  ? 44 LEU B HB3  4  
ATOM 8430  H HG   . LEU B 1 44 ? 4.135   -13.193 -15.223 1.00 0.35  ? 44 LEU B HG   4  
ATOM 8431  H HD11 . LEU B 1 44 ? 6.828   -12.613 -14.006 1.00 1.02  ? 44 LEU B HD11 4  
ATOM 8432  H HD12 . LEU B 1 44 ? 5.668   -13.686 -13.225 1.00 1.19  ? 44 LEU B HD12 4  
ATOM 8433  H HD13 . LEU B 1 44 ? 6.296   -14.080 -14.826 1.00 1.02  ? 44 LEU B HD13 4  
ATOM 8434  H HD21 . LEU B 1 44 ? 3.482   -10.906 -14.290 1.00 1.02  ? 44 LEU B HD21 4  
ATOM 8435  H HD22 . LEU B 1 44 ? 3.587   -12.184 -13.082 1.00 1.04  ? 44 LEU B HD22 4  
ATOM 8436  H HD23 . LEU B 1 44 ? 4.893   -11.010 -13.239 1.00 1.02  ? 44 LEU B HD23 4  
ATOM 8437  N N    . LYS B 1 45 ? 8.250   -10.253 -15.709 1.00 0.38  ? 45 LYS B N    4  
ATOM 8438  C CA   . LYS B 1 45 ? 9.555   -9.910  -16.336 1.00 0.44  ? 45 LYS B CA   4  
ATOM 8439  C C    . LYS B 1 45 ? 9.591   -10.373 -17.782 1.00 0.49  ? 45 LYS B C    4  
ATOM 8440  O O    . LYS B 1 45 ? 10.089  -9.681  -18.650 1.00 0.54  ? 45 LYS B O    4  
ATOM 8441  C CB   . LYS B 1 45 ? 10.646  -10.633 -15.560 1.00 0.45  ? 45 LYS B CB   4  
ATOM 8442  C CG   . LYS B 1 45 ? 11.693  -9.638  -15.050 1.00 0.47  ? 45 LYS B CG   4  
ATOM 8443  C CD   . LYS B 1 45 ? 12.887  -9.612  -16.007 1.00 0.72  ? 45 LYS B CD   4  
ATOM 8444  C CE   . LYS B 1 45 ? 14.010  -8.765  -15.401 1.00 1.05  ? 45 LYS B CE   4  
ATOM 8445  N NZ   . LYS B 1 45 ? 15.277  -8.997  -16.155 1.00 1.42  ? 45 LYS B NZ   4  
ATOM 8446  H H    . LYS B 1 45 ? 8.261   -10.826 -14.922 1.00 0.37  ? 45 LYS B H    4  
ATOM 8447  H HA   . LYS B 1 45 ? 9.718   -8.846  -16.286 1.00 0.45  ? 45 LYS B HA   4  
ATOM 8448  H HB2  . LYS B 1 45 ? 10.200  -11.139 -14.720 1.00 0.41  ? 45 LYS B HB2  4  
ATOM 8449  H HB3  . LYS B 1 45 ? 11.096  -11.357 -16.195 1.00 0.49  ? 45 LYS B HB3  4  
ATOM 8450  H HG2  . LYS B 1 45 ? 11.255  -8.652  -14.991 1.00 0.52  ? 45 LYS B HG2  4  
ATOM 8451  H HG3  . LYS B 1 45 ? 12.028  -9.941  -14.069 1.00 0.54  ? 45 LYS B HG3  4  
ATOM 8452  H HD2  . LYS B 1 45 ? 13.242  -10.620 -16.167 1.00 0.99  ? 45 LYS B HD2  4  
ATOM 8453  H HD3  . LYS B 1 45 ? 12.585  -9.183  -16.950 1.00 0.93  ? 45 LYS B HD3  4  
ATOM 8454  H HE2  . LYS B 1 45 ? 13.744  -7.720  -15.459 1.00 1.47  ? 45 LYS B HE2  4  
ATOM 8455  H HE3  . LYS B 1 45 ? 14.152  -9.043  -14.367 1.00 1.41  ? 45 LYS B HE3  4  
ATOM 8456  H HZ1  . LYS B 1 45 ? 15.450  -10.018 -16.242 1.00 1.95  ? 45 LYS B HZ1  4  
ATOM 8457  H HZ2  . LYS B 1 45 ? 15.198  -8.577  -17.103 1.00 1.87  ? 45 LYS B HZ2  4  
ATOM 8458  H HZ3  . LYS B 1 45 ? 16.068  -8.553  -15.645 1.00 1.73  ? 45 LYS B HZ3  4  
ATOM 8459  N N    . ASN B 1 46 ? 9.048   -11.532 -18.048 1.00 0.49  ? 46 ASN B N    4  
ATOM 8460  C CA   . ASN B 1 46 ? 9.027   -12.039 -19.454 1.00 0.55  ? 46 ASN B CA   4  
ATOM 8461  C C    . ASN B 1 46 ? 8.090   -11.160 -20.315 1.00 0.58  ? 46 ASN B C    4  
ATOM 8462  O O    . ASN B 1 46 ? 7.925   -11.397 -21.497 1.00 0.75  ? 46 ASN B O    4  
ATOM 8463  C CB   . ASN B 1 46 ? 8.540   -13.496 -19.473 1.00 0.58  ? 46 ASN B CB   4  
ATOM 8464  C CG   . ASN B 1 46 ? 7.357   -13.677 -18.514 1.00 0.78  ? 46 ASN B CG   4  
ATOM 8465  O OD1  . ASN B 1 46 ? 6.476   -12.846 -18.457 1.00 1.67  ? 46 ASN B OD1  4  
ATOM 8466  N ND2  . ASN B 1 46 ? 7.305   -14.735 -17.749 1.00 0.81  ? 46 ASN B ND2  4  
ATOM 8467  H H    . ASN B 1 46 ? 8.639   -12.061 -17.320 1.00 0.47  ? 46 ASN B H    4  
ATOM 8468  H HA   . ASN B 1 46 ? 10.027  -11.992 -19.861 1.00 0.62  ? 46 ASN B HA   4  
ATOM 8469  H HB2  . ASN B 1 46 ? 8.231   -13.753 -20.471 1.00 0.73  ? 46 ASN B HB2  4  
ATOM 8470  H HB3  . ASN B 1 46 ? 9.347   -14.146 -19.170 1.00 0.75  ? 46 ASN B HB3  4  
ATOM 8471  H HD21 . ASN B 1 46 ? 8.017   -15.408 -17.790 1.00 1.39  ? 46 ASN B HD21 4  
ATOM 8472  H HD22 . ASN B 1 46 ? 6.552   -14.857 -17.133 1.00 0.88  ? 46 ASN B HD22 4  
ATOM 8473  N N    . GLY B 1 47 ? 7.470   -10.157 -19.723 1.00 0.50  ? 47 GLY B N    4  
ATOM 8474  C CA   . GLY B 1 47 ? 6.541   -9.271  -20.478 1.00 0.53  ? 47 GLY B CA   4  
ATOM 8475  C C    . GLY B 1 47 ? 5.166   -9.921  -20.495 1.00 0.52  ? 47 GLY B C    4  
ATOM 8476  O O    . GLY B 1 47 ? 4.453   -9.869  -21.480 1.00 0.60  ? 47 GLY B O    4  
ATOM 8477  H H    . GLY B 1 47 ? 7.604   -9.994  -18.772 1.00 0.52  ? 47 GLY B H    4  
ATOM 8478  H HA2  . GLY B 1 47 ? 6.480   -8.308  -19.980 1.00 0.53  ? 47 GLY B HA2  4  
ATOM 8479  H HA3  . GLY B 1 47 ? 6.893   -9.137  -21.486 1.00 0.59  ? 47 GLY B HA3  4  
ATOM 8480  N N    . ARG B 1 48 ? 4.787   -10.520 -19.394 1.00 0.47  ? 48 ARG B N    4  
ATOM 8481  C CA   . ARG B 1 48 ? 3.445   -11.171 -19.310 1.00 0.54  ? 48 ARG B CA   4  
ATOM 8482  C C    . ARG B 1 48 ? 2.638   -10.430 -18.256 1.00 0.43  ? 48 ARG B C    4  
ATOM 8483  O O    . ARG B 1 48 ? 3.020   -9.363  -17.829 1.00 0.37  ? 48 ARG B O    4  
ATOM 8484  C CB   . ARG B 1 48 ? 3.596   -12.647 -18.920 1.00 0.66  ? 48 ARG B CB   4  
ATOM 8485  C CG   . ARG B 1 48 ? 4.113   -13.447 -20.120 1.00 1.00  ? 48 ARG B CG   4  
ATOM 8486  C CD   . ARG B 1 48 ? 4.603   -14.820 -19.648 1.00 1.55  ? 48 ARG B CD   4  
ATOM 8487  N NE   . ARG B 1 48 ? 3.795   -15.892 -20.298 1.00 2.08  ? 48 ARG B NE   4  
ATOM 8488  C CZ   . ARG B 1 48 ? 3.220   -16.816 -19.570 1.00 2.34  ? 48 ARG B CZ   4  
ATOM 8489  N NH1  . ARG B 1 48 ? 3.952   -17.651 -18.876 1.00 2.89  ? 48 ARG B NH1  4  
ATOM 8490  N NH2  . ARG B 1 48 ? 1.915   -16.903 -19.536 1.00 2.67  ? 48 ARG B NH2  4  
ATOM 8491  H H    . ARG B 1 48 ? 5.387   -10.525 -18.607 1.00 0.43  ? 48 ARG B H    4  
ATOM 8492  H HA   . ARG B 1 48 ? 2.940   -11.098 -20.262 1.00 0.68  ? 48 ARG B HA   4  
ATOM 8493  H HB2  . ARG B 1 48 ? 4.292   -12.734 -18.101 1.00 1.19  ? 48 ARG B HB2  4  
ATOM 8494  H HB3  . ARG B 1 48 ? 2.637   -13.040 -18.618 1.00 1.23  ? 48 ARG B HB3  4  
ATOM 8495  H HG2  . ARG B 1 48 ? 3.316   -13.576 -20.838 1.00 1.43  ? 48 ARG B HG2  4  
ATOM 8496  H HG3  . ARG B 1 48 ? 4.931   -12.915 -20.581 1.00 1.63  ? 48 ARG B HG3  4  
ATOM 8497  H HD2  . ARG B 1 48 ? 5.642   -14.941 -19.915 1.00 1.85  ? 48 ARG B HD2  4  
ATOM 8498  H HD3  . ARG B 1 48 ? 4.500   -14.890 -18.574 1.00 1.85  ? 48 ARG B HD3  4  
ATOM 8499  H HE   . ARG B 1 48 ? 3.695   -15.906 -21.273 1.00 2.46  ? 48 ARG B HE   4  
ATOM 8500  H HH11 . ARG B 1 48 ? 4.949   -17.585 -18.903 1.00 3.28  ? 48 ARG B HH11 4  
ATOM 8501  H HH12 . ARG B 1 48 ? 3.514   -18.357 -18.320 1.00 3.24  ? 48 ARG B HH12 4  
ATOM 8502  H HH21 . ARG B 1 48 ? 1.356   -16.264 -20.067 1.00 2.93  ? 48 ARG B HH21 4  
ATOM 8503  H HH22 . ARG B 1 48 ? 1.473   -17.608 -18.981 1.00 3.04  ? 48 ARG B HH22 4  
ATOM 8504  N N    . LYS B 1 49 ? 1.524   -10.957 -17.838 1.00 0.45  ? 49 LYS B N    4  
ATOM 8505  C CA   . LYS B 1 49 ? 0.726   -10.240 -16.819 1.00 0.40  ? 49 LYS B CA   4  
ATOM 8506  C C    . LYS B 1 49 ? -0.038  -11.211 -15.922 1.00 0.38  ? 49 LYS B C    4  
ATOM 8507  O O    . LYS B 1 49 ? -0.426  -12.292 -16.324 1.00 0.54  ? 49 LYS B O    4  
ATOM 8508  C CB   . LYS B 1 49 ? -0.283  -9.310  -17.497 1.00 0.58  ? 49 LYS B CB   4  
ATOM 8509  C CG   . LYS B 1 49 ? -0.602  -9.771  -18.931 1.00 0.88  ? 49 LYS B CG   4  
ATOM 8510  C CD   . LYS B 1 49 ? -1.396  -11.085 -18.914 1.00 0.96  ? 49 LYS B CD   4  
ATOM 8511  C CE   . LYS B 1 49 ? -2.703  -10.901 -18.136 1.00 0.92  ? 49 LYS B CE   4  
ATOM 8512  N NZ   . LYS B 1 49 ? -3.773  -11.734 -18.755 1.00 1.06  ? 49 LYS B NZ   4  
ATOM 8513  H H    . LYS B 1 49 ? 1.208   -11.800 -18.201 1.00 0.55  ? 49 LYS B H    4  
ATOM 8514  H HA   . LYS B 1 49 ? 1.394   -9.645  -16.207 1.00 0.34  ? 49 LYS B HA   4  
ATOM 8515  H HB2  . LYS B 1 49 ? -1.191  -9.298  -16.914 1.00 0.59  ? 49 LYS B HB2  4  
ATOM 8516  H HB3  . LYS B 1 49 ? 0.132   -8.322  -17.531 1.00 0.69  ? 49 LYS B HB3  4  
ATOM 8517  H HG2  . LYS B 1 49 ? -1.185  -9.009  -19.427 1.00 1.06  ? 49 LYS B HG2  4  
ATOM 8518  H HG3  . LYS B 1 49 ? 0.321   -9.920  -19.471 1.00 1.13  ? 49 LYS B HG3  4  
ATOM 8519  H HD2  . LYS B 1 49 ? -1.623  -11.376 -19.929 1.00 0.98  ? 49 LYS B HD2  4  
ATOM 8520  H HD3  . LYS B 1 49 ? -0.806  -11.857 -18.446 1.00 1.23  ? 49 LYS B HD3  4  
ATOM 8521  H HE2  . LYS B 1 49 ? -2.558  -11.206 -17.110 1.00 0.97  ? 49 LYS B HE2  4  
ATOM 8522  H HE3  . LYS B 1 49 ? -2.996  -9.863  -18.164 1.00 0.86  ? 49 LYS B HE3  4  
ATOM 8523  H HZ1  . LYS B 1 49 ? -3.484  -12.733 -18.752 1.00 1.51  ? 49 LYS B HZ1  4  
ATOM 8524  H HZ2  . LYS B 1 49 ? -4.653  -11.628 -18.213 1.00 1.38  ? 49 LYS B HZ2  4  
ATOM 8525  H HZ3  . LYS B 1 49 ? -3.929  -11.424 -19.734 1.00 1.44  ? 49 LYS B HZ3  4  
ATOM 8526  N N    . ALA B 1 50 ? -0.282  -10.791 -14.713 1.00 0.27  ? 50 ALA B N    4  
ATOM 8527  C CA   . ALA B 1 50 ? -1.065  -11.624 -13.746 1.00 0.28  ? 50 ALA B CA   4  
ATOM 8528  C C    . ALA B 1 50 ? -2.006  -10.702 -13.006 1.00 0.24  ? 50 ALA B C    4  
ATOM 8529  O O    . ALA B 1 50 ? -1.749  -9.533  -12.904 1.00 0.21  ? 50 ALA B O    4  
ATOM 8530  C CB   . ALA B 1 50 ? -0.148  -12.261 -12.707 1.00 0.32  ? 50 ALA B CB   4  
ATOM 8531  H H    . ALA B 1 50 ? 0.033   -9.891  -14.442 1.00 0.29  ? 50 ALA B H    4  
ATOM 8532  H HA   . ALA B 1 50 ? -1.622  -12.384 -14.272 1.00 0.35  ? 50 ALA B HA   4  
ATOM 8533  H HB1  . ALA B 1 50 ? 0.596   -12.862 -13.197 1.00 1.03  ? 50 ALA B HB1  4  
ATOM 8534  H HB2  . ALA B 1 50 ? 0.331   -11.482 -12.132 1.00 1.05  ? 50 ALA B HB2  4  
ATOM 8535  H HB3  . ALA B 1 50 ? -0.739  -12.880 -12.044 1.00 1.08  ? 50 ALA B HB3  4  
ATOM 8536  N N    . CYS B 1 51 ? -3.053  -11.206 -12.428 1.00 0.25  ? 51 CYS B N    4  
ATOM 8537  C CA   . CYS B 1 51 ? -3.932  -10.314 -11.649 1.00 0.22  ? 51 CYS B CA   4  
ATOM 8538  C C    . CYS B 1 51 ? -3.890  -10.787 -10.217 1.00 0.22  ? 51 CYS B C    4  
ATOM 8539  O O    . CYS B 1 51 ? -3.670  -11.952 -9.960  1.00 0.25  ? 51 CYS B O    4  
ATOM 8540  C CB   . CYS B 1 51 ? -5.371  -10.358 -12.163 1.00 0.25  ? 51 CYS B CB   4  
ATOM 8541  S SG   . CYS B 1 51 ? -5.879  -8.687  -12.632 1.00 0.24  ? 51 CYS B SG   4  
ATOM 8542  H H    . CYS B 1 51 ? -3.232  -12.170 -12.454 1.00 0.28  ? 51 CYS B H    4  
ATOM 8543  H HA   . CYS B 1 51 ? -3.561  -9.305  -11.713 1.00 0.20  ? 51 CYS B HA   4  
ATOM 8544  H HB2  . CYS B 1 51 ? -5.429  -11.002 -13.019 1.00 0.28  ? 51 CYS B HB2  4  
ATOM 8545  H HB3  . CYS B 1 51 ? -6.023  -10.729 -11.387 1.00 0.27  ? 51 CYS B HB3  4  
ATOM 8546  N N    . LEU B 1 52 ? -4.075  -9.906  -9.287  1.00 0.21  ? 52 LEU B N    4  
ATOM 8547  C CA   . LEU B 1 52 ? -4.058  -10.318 -7.867  1.00 0.23  ? 52 LEU B CA   4  
ATOM 8548  C C    . LEU B 1 52 ? -5.210  -9.608  -7.164  1.00 0.25  ? 52 LEU B C    4  
ATOM 8549  O O    . LEU B 1 52 ? -5.811  -8.709  -7.715  1.00 0.25  ? 52 LEU B O    4  
ATOM 8550  C CB   . LEU B 1 52 ? -2.697  -10.021 -7.198  1.00 0.22  ? 52 LEU B CB   4  
ATOM 8551  C CG   . LEU B 1 52 ? -1.931  -8.929  -7.947  1.00 0.18  ? 52 LEU B CG   4  
ATOM 8552  C CD1  . LEU B 1 52 ? -1.505  -9.424  -9.343  1.00 0.17  ? 52 LEU B CD1  4  
ATOM 8553  C CD2  . LEU B 1 52 ? -2.815  -7.685  -8.036  1.00 0.18  ? 52 LEU B CD2  4  
ATOM 8554  H H    . LEU B 1 52 ? -4.222  -8.966  -9.519  1.00 0.20  ? 52 LEU B H    4  
ATOM 8555  H HA   . LEU B 1 52 ? -4.240  -11.365 -7.826  1.00 0.26  ? 52 LEU B HA   4  
ATOM 8556  H HB2  . LEU B 1 52 ? -2.863  -9.701  -6.183  1.00 0.25  ? 52 LEU B HB2  4  
ATOM 8557  H HB3  . LEU B 1 52 ? -2.104  -10.924 -7.189  1.00 0.24  ? 52 LEU B HB3  4  
ATOM 8558  H HG   . LEU B 1 52 ? -1.052  -8.687  -7.398  1.00 0.19  ? 52 LEU B HG   4  
ATOM 8559  H HD11 . LEU B 1 52 ? -1.629  -10.498 -9.399  1.00 0.95  ? 52 LEU B HD11 4  
ATOM 8560  H HD12 . LEU B 1 52 ? -2.115  -8.955  -10.100 1.00 1.00  ? 52 LEU B HD12 4  
ATOM 8561  H HD13 . LEU B 1 52 ? -0.467  -9.180  -9.513  1.00 0.98  ? 52 LEU B HD13 4  
ATOM 8562  H HD21 . LEU B 1 52 ? -3.693  -7.828  -7.418  1.00 0.96  ? 52 LEU B HD21 4  
ATOM 8563  H HD22 . LEU B 1 52 ? -2.266  -6.829  -7.680  1.00 0.97  ? 52 LEU B HD22 4  
ATOM 8564  H HD23 . LEU B 1 52 ? -3.116  -7.528  -9.056  1.00 1.01  ? 52 LEU B HD23 4  
ATOM 8565  N N    . ASN B 1 53 ? -5.557  -10.029 -5.982  1.00 0.29  ? 53 ASN B N    4  
ATOM 8566  C CA   . ASN B 1 53 ? -6.710  -9.393  -5.275  1.00 0.33  ? 53 ASN B CA   4  
ATOM 8567  C C    . ASN B 1 53 ? -6.222  -8.248  -4.380  1.00 0.34  ? 53 ASN B C    4  
ATOM 8568  O O    . ASN B 1 53 ? -5.824  -8.502  -3.270  1.00 0.37  ? 53 ASN B O    4  
ATOM 8569  C CB   . ASN B 1 53 ? -7.413  -10.433 -4.384  1.00 0.37  ? 53 ASN B CB   4  
ATOM 8570  C CG   . ASN B 1 53 ? -8.716  -10.902 -5.042  1.00 0.43  ? 53 ASN B CG   4  
ATOM 8571  O OD1  . ASN B 1 53 ? -8.965  -10.634 -6.201  1.00 1.07  ? 53 ASN B OD1  4  
ATOM 8572  N ND2  . ASN B 1 53 ? -9.569  -11.599 -4.340  1.00 0.93  ? 53 ASN B ND2  4  
ATOM 8573  H H    . ASN B 1 53 ? -5.076  -10.779 -5.573  1.00 0.31  ? 53 ASN B H    4  
ATOM 8574  H HA   . ASN B 1 53 ? -7.409  -9.026  -6.000  1.00 0.33  ? 53 ASN B HA   4  
ATOM 8575  H HB2  . ASN B 1 53 ? -6.759  -11.278 -4.230  1.00 0.41  ? 53 ASN B HB2  4  
ATOM 8576  H HB3  . ASN B 1 53 ? -7.644  -9.985  -3.427  1.00 0.41  ? 53 ASN B HB3  4  
ATOM 8577  H HD21 . ASN B 1 53 ? -9.373  -11.818 -3.405  1.00 1.59  ? 53 ASN B HD21 4  
ATOM 8578  H HD22 . ASN B 1 53 ? -10.408 -11.897 -4.747  1.00 0.93  ? 53 ASN B HD22 4  
ATOM 8579  N N    . PRO B 1 54 ? -6.294  -7.009  -4.835  1.00 0.34  ? 54 PRO B N    4  
ATOM 8580  C CA   . PRO B 1 54 ? -5.869  -5.875  -3.996  1.00 0.37  ? 54 PRO B CA   4  
ATOM 8581  C C    . PRO B 1 54 ? -6.755  -5.811  -2.749  1.00 0.43  ? 54 PRO B C    4  
ATOM 8582  O O    . PRO B 1 54 ? -6.307  -5.420  -1.689  1.00 0.46  ? 54 PRO B O    4  
ATOM 8583  C CB   . PRO B 1 54 ? -6.007  -4.659  -4.908  1.00 0.38  ? 54 PRO B CB   4  
ATOM 8584  C CG   . PRO B 1 54 ? -6.970  -5.085  -6.029  1.00 0.37  ? 54 PRO B CG   4  
ATOM 8585  C CD   . PRO B 1 54 ? -6.816  -6.605  -6.161  1.00 0.33  ? 54 PRO B CD   4  
ATOM 8586  H HA   . PRO B 1 54 ? -4.836  -5.998  -3.707  1.00 0.36  ? 54 PRO B HA   4  
ATOM 8587  H HB2  . PRO B 1 54 ? -6.417  -3.825  -4.355  1.00 0.42  ? 54 PRO B HB2  4  
ATOM 8588  H HB3  . PRO B 1 54 ? -5.050  -4.397  -5.329  1.00 0.36  ? 54 PRO B HB3  4  
ATOM 8589  H HG2  . PRO B 1 54 ? -7.983  -4.835  -5.759  1.00 0.41  ? 54 PRO B HG2  4  
ATOM 8590  H HG3  . PRO B 1 54 ? -6.697  -4.611  -6.953  1.00 0.36  ? 54 PRO B HG3  4  
ATOM 8591  H HD2  . PRO B 1 54 ? -7.773  -7.054  -6.364  1.00 0.35  ? 54 PRO B HD2  4  
ATOM 8592  H HD3  . PRO B 1 54 ? -6.101  -6.846  -6.934  1.00 0.28  ? 54 PRO B HD3  4  
ATOM 8593  N N    . ALA B 1 55 ? -7.984  -6.275  -2.850  1.00 0.45  ? 55 ALA B N    4  
ATOM 8594  C CA   . ALA B 1 55 ? -8.862  -6.331  -1.646  1.00 0.52  ? 55 ALA B CA   4  
ATOM 8595  C C    . ALA B 1 55 ? -8.181  -7.274  -0.643  1.00 0.53  ? 55 ALA B C    4  
ATOM 8596  O O    . ALA B 1 55 ? -8.271  -7.097  0.557   1.00 0.56  ? 55 ALA B O    4  
ATOM 8597  C CB   . ALA B 1 55 ? -10.237 -6.887  -2.029  1.00 0.55  ? 55 ALA B CB   4  
ATOM 8598  H H    . ALA B 1 55 ? -8.304  -6.642  -3.701  1.00 0.44  ? 55 ALA B H    4  
ATOM 8599  H HA   . ALA B 1 55 ? -8.963  -5.345  -1.216  1.00 0.53  ? 55 ALA B HA   4  
ATOM 8600  H HB1  . ALA B 1 55 ? -10.585 -6.399  -2.926  1.00 1.15  ? 55 ALA B HB1  4  
ATOM 8601  H HB2  . ALA B 1 55 ? -10.159 -7.950  -2.205  1.00 1.13  ? 55 ALA B HB2  4  
ATOM 8602  H HB3  . ALA B 1 55 ? -10.935 -6.705  -1.225  1.00 1.19  ? 55 ALA B HB3  4  
ATOM 8603  N N    . SER B 1 56 ? -7.460  -8.259  -1.153  1.00 0.50  ? 56 SER B N    4  
ATOM 8604  C CA   . SER B 1 56 ? -6.714  -9.208  -0.280  1.00 0.52  ? 56 SER B CA   4  
ATOM 8605  C C    . SER B 1 56 ? -5.654  -8.410  0.504   1.00 0.51  ? 56 SER B C    4  
ATOM 8606  O O    . SER B 1 56 ? -5.153  -7.419  0.006   1.00 0.52  ? 56 SER B O    4  
ATOM 8607  C CB   . SER B 1 56 ? -6.009  -10.259 -1.149  1.00 0.50  ? 56 SER B CB   4  
ATOM 8608  O OG   . SER B 1 56 ? -5.998  -11.507 -0.466  1.00 0.56  ? 56 SER B OG   4  
ATOM 8609  H H    . SER B 1 56 ? -7.390  -8.351  -2.125  1.00 0.48  ? 56 SER B H    4  
ATOM 8610  H HA   . SER B 1 56 ? -7.400  -9.693  0.386   1.00 0.55  ? 56 SER B HA   4  
ATOM 8611  H HB2  . SER B 1 56 ? -6.533  -10.369 -2.084  1.00 0.46  ? 56 SER B HB2  4  
ATOM 8612  H HB3  . SER B 1 56 ? -4.996  -9.936  -1.348  1.00 0.51  ? 56 SER B HB3  4  
ATOM 8613  H HG   . SER B 1 56 ? -6.663  -12.071 -0.867  1.00 1.02  ? 56 SER B HG   4  
ATOM 8614  N N    . PRO B 1 57 ? -5.329  -8.856  1.696   1.00 0.53  ? 57 PRO B N    4  
ATOM 8615  C CA   . PRO B 1 57 ? -4.320  -8.179  2.540   1.00 0.53  ? 57 PRO B CA   4  
ATOM 8616  C C    . PRO B 1 57 ? -2.913  -8.447  1.985   1.00 0.51  ? 57 PRO B C    4  
ATOM 8617  O O    . PRO B 1 57 ? -2.180  -7.528  1.650   1.00 0.51  ? 57 PRO B O    4  
ATOM 8618  C CB   . PRO B 1 57 ? -4.522  -8.810  3.922   1.00 0.59  ? 57 PRO B CB   4  
ATOM 8619  C CG   . PRO B 1 57 ? -5.230  -10.165 3.686   1.00 0.62  ? 57 PRO B CG   4  
ATOM 8620  C CD   . PRO B 1 57 ? -5.917  -10.068 2.310   1.00 0.58  ? 57 PRO B CD   4  
ATOM 8621  H HA   . PRO B 1 57 ? -4.514  -7.120  2.584   1.00 0.54  ? 57 PRO B HA   4  
ATOM 8622  H HB2  . PRO B 1 57 ? -3.564  -8.965  4.402   1.00 0.60  ? 57 PRO B HB2  4  
ATOM 8623  H HB3  . PRO B 1 57 ? -5.145  -8.176  4.533   1.00 0.63  ? 57 PRO B HB3  4  
ATOM 8624  H HG2  . PRO B 1 57 ? -4.503  -10.966 3.685   1.00 0.64  ? 57 PRO B HG2  4  
ATOM 8625  H HG3  . PRO B 1 57 ? -5.970  -10.336 4.452   1.00 0.67  ? 57 PRO B HG3  4  
ATOM 8626  H HD2  . PRO B 1 57 ? -5.694  -10.942 1.716   1.00 0.59  ? 57 PRO B HD2  4  
ATOM 8627  H HD3  . PRO B 1 57 ? -6.983  -9.947  2.426   1.00 0.60  ? 57 PRO B HD3  4  
ATOM 8628  N N    . ILE B 1 58 ? -2.552  -9.702  1.854   1.00 0.52  ? 58 ILE B N    4  
ATOM 8629  C CA   . ILE B 1 58 ? -1.218  -10.069 1.288   1.00 0.51  ? 58 ILE B CA   4  
ATOM 8630  C C    . ILE B 1 58 ? -1.045  -9.370  -0.049  1.00 0.45  ? 58 ILE B C    4  
ATOM 8631  O O    . ILE B 1 58 ? 0.000   -8.847  -0.369  1.00 0.44  ? 58 ILE B O    4  
ATOM 8632  C CB   . ILE B 1 58 ? -1.189  -11.592 1.065   1.00 0.54  ? 58 ILE B CB   4  
ATOM 8633  C CG1  . ILE B 1 58 ? -0.114  -12.228 1.955   1.00 0.62  ? 58 ILE B CG1  4  
ATOM 8634  C CG2  . ILE B 1 58 ? -0.900  -11.922 -0.412  1.00 0.49  ? 58 ILE B CG2  4  
ATOM 8635  C CD1  . ILE B 1 58 ? -0.571  -12.200 3.416   1.00 0.68  ? 58 ILE B CD1  4  
ATOM 8636  H H    . ILE B 1 58 ? -3.177  -10.413 2.107   1.00 0.55  ? 58 ILE B H    4  
ATOM 8637  H HA   . ILE B 1 58 ? -0.432  -9.770  1.962   1.00 0.55  ? 58 ILE B HA   4  
ATOM 8638  H HB   . ILE B 1 58 ? -2.157  -11.992 1.320   1.00 0.56  ? 58 ILE B HB   4  
ATOM 8639  H HG12 . ILE B 1 58 ? 0.045   -13.251 1.649   1.00 0.64  ? 58 ILE B HG12 4  
ATOM 8640  H HG13 . ILE B 1 58 ? 0.808   -11.676 1.858   1.00 0.62  ? 58 ILE B HG13 4  
ATOM 8641  H HG21 . ILE B 1 58 ? -0.091  -11.302 -0.772  1.00 1.14  ? 58 ILE B HG21 4  
ATOM 8642  H HG22 . ILE B 1 58 ? -0.628  -12.958 -0.504  1.00 1.10  ? 58 ILE B HG22 4  
ATOM 8643  H HG23 . ILE B 1 58 ? -1.787  -11.729 -1.004  1.00 1.12  ? 58 ILE B HG23 4  
ATOM 8644  H HD11 . ILE B 1 58 ? -1.629  -12.413 3.469   1.00 1.22  ? 58 ILE B HD11 4  
ATOM 8645  H HD12 . ILE B 1 58 ? -0.026  -12.944 3.978   1.00 1.22  ? 58 ILE B HD12 4  
ATOM 8646  H HD13 . ILE B 1 58 ? -0.379  -11.222 3.835   1.00 1.24  ? 58 ILE B HD13 4  
ATOM 8647  N N    . VAL B 1 59 ? -2.066  -9.407  -0.843  1.00 0.43  ? 59 VAL B N    4  
ATOM 8648  C CA   . VAL B 1 59 ? -2.000  -8.795  -2.173  1.00 0.40  ? 59 VAL B CA   4  
ATOM 8649  C C    . VAL B 1 59 ? -1.892  -7.282  -2.045  1.00 0.37  ? 59 VAL B C    4  
ATOM 8650  O O    . VAL B 1 59 ? -1.126  -6.661  -2.753  1.00 0.32  ? 59 VAL B O    4  
ATOM 8651  C CB   . VAL B 1 59 ? -3.262  -9.166  -2.915  1.00 0.51  ? 59 VAL B CB   4  
ATOM 8652  C CG1  . VAL B 1 59 ? -3.272  -8.485  -4.254  1.00 0.31  ? 59 VAL B CG1  4  
ATOM 8653  C CG2  . VAL B 1 59 ? -3.336  -10.678 -3.111  1.00 0.88  ? 59 VAL B CG2  4  
ATOM 8654  H H    . VAL B 1 59 ? -2.883  -9.875  -0.568  1.00 0.46  ? 59 VAL B H    4  
ATOM 8655  H HA   . VAL B 1 59 ? -1.129  -9.168  -2.688  1.00 0.41  ? 59 VAL B HA   4  
ATOM 8656  H HB   . VAL B 1 59 ? -4.108  -8.835  -2.341  1.00 0.84  ? 59 VAL B HB   4  
ATOM 8657  H HG11 . VAL B 1 59 ? -2.279  -8.510  -4.668  1.00 1.08  ? 59 VAL B HG11 4  
ATOM 8658  H HG12 . VAL B 1 59 ? -3.955  -9.002  -4.903  1.00 1.03  ? 59 VAL B HG12 4  
ATOM 8659  H HG13 . VAL B 1 59 ? -3.595  -7.466  -4.122  1.00 1.00  ? 59 VAL B HG13 4  
ATOM 8660  H HG21 . VAL B 1 59 ? -2.481  -11.003 -3.677  1.00 1.47  ? 59 VAL B HG21 4  
ATOM 8661  H HG22 . VAL B 1 59 ? -3.341  -11.167 -2.149  1.00 1.25  ? 59 VAL B HG22 4  
ATOM 8662  H HG23 . VAL B 1 59 ? -4.238  -10.928 -3.648  1.00 1.53  ? 59 VAL B HG23 4  
ATOM 8663  N N    . LYS B 1 60 ? -2.609  -6.680  -1.124  1.00 0.43  ? 60 LYS B N    4  
ATOM 8664  C CA   . LYS B 1 60 ? -2.470  -5.206  -0.937  1.00 0.43  ? 60 LYS B CA   4  
ATOM 8665  C C    . LYS B 1 60 ? -0.979  -4.916  -0.667  1.00 0.43  ? 60 LYS B C    4  
ATOM 8666  O O    . LYS B 1 60 ? -0.484  -3.827  -0.904  1.00 0.42  ? 60 LYS B O    4  
ATOM 8667  C CB   . LYS B 1 60 ? -3.299  -4.753  0.266   1.00 0.50  ? 60 LYS B CB   4  
ATOM 8668  C CG   . LYS B 1 60 ? -4.203  -3.588  -0.141  1.00 0.60  ? 60 LYS B CG   4  
ATOM 8669  C CD   . LYS B 1 60 ? -5.091  -3.195  1.043   1.00 0.91  ? 60 LYS B CD   4  
ATOM 8670  C CE   . LYS B 1 60 ? -6.470  -2.764  0.534   1.00 0.99  ? 60 LYS B CE   4  
ATOM 8671  N NZ   . LYS B 1 60 ? -7.413  -3.918  0.602   1.00 1.68  ? 60 LYS B NZ   4  
ATOM 8672  H H    . LYS B 1 60 ? -3.198  -7.199  -0.537  1.00 0.47  ? 60 LYS B H    4  
ATOM 8673  H HA   . LYS B 1 60 ? -2.795  -4.696  -1.837  1.00 0.40  ? 60 LYS B HA   4  
ATOM 8674  H HB2  . LYS B 1 60 ? -3.901  -5.577  0.615   1.00 0.65  ? 60 LYS B HB2  4  
ATOM 8675  H HB3  . LYS B 1 60 ? -2.636  -4.432  1.056   1.00 0.59  ? 60 LYS B HB3  4  
ATOM 8676  H HG2  . LYS B 1 60 ? -3.594  -2.744  -0.431  1.00 1.10  ? 60 LYS B HG2  4  
ATOM 8677  H HG3  . LYS B 1 60 ? -4.824  -3.886  -0.972  1.00 0.87  ? 60 LYS B HG3  4  
ATOM 8678  H HD2  . LYS B 1 60 ? -5.200  -4.041  1.707   1.00 1.39  ? 60 LYS B HD2  4  
ATOM 8679  H HD3  . LYS B 1 60 ? -4.635  -2.376  1.578   1.00 1.49  ? 60 LYS B HD3  4  
ATOM 8680  H HE2  . LYS B 1 60 ? -6.844  -1.959  1.149   1.00 1.20  ? 60 LYS B HE2  4  
ATOM 8681  H HE3  . LYS B 1 60 ? -6.387  -2.427  -0.488  1.00 1.40  ? 60 LYS B HE3  4  
ATOM 8682  H HZ1  . LYS B 1 60 ? -6.978  -4.749  0.150   1.00 2.15  ? 60 LYS B HZ1  4  
ATOM 8683  H HZ2  . LYS B 1 60 ? -7.625  -4.134  1.597   1.00 2.27  ? 60 LYS B HZ2  4  
ATOM 8684  H HZ3  . LYS B 1 60 ? -8.294  -3.676  0.107   1.00 1.91  ? 60 LYS B HZ3  4  
ATOM 8685  N N    . LYS B 1 61 ? -0.262  -5.934  -0.232  1.00 0.44  ? 61 LYS B N    4  
ATOM 8686  C CA   . LYS B 1 61 ? 1.193   -5.832  0.007   1.00 0.46  ? 61 LYS B CA   4  
ATOM 8687  C C    . LYS B 1 61 ? 1.838   -5.785  -1.361  1.00 0.42  ? 61 LYS B C    4  
ATOM 8688  O O    . LYS B 1 61 ? 2.601   -4.907  -1.670  1.00 0.44  ? 61 LYS B O    4  
ATOM 8689  C CB   . LYS B 1 61 ? 1.647   -7.098  0.723   1.00 0.51  ? 61 LYS B CB   4  
ATOM 8690  C CG   . LYS B 1 61 ? 2.657   -6.744  1.810   1.00 0.71  ? 61 LYS B CG   4  
ATOM 8691  C CD   . LYS B 1 61 ? 3.680   -7.874  1.936   1.00 1.02  ? 61 LYS B CD   4  
ATOM 8692  C CE   . LYS B 1 61 ? 4.884   -7.391  2.751   1.00 1.29  ? 61 LYS B CE   4  
ATOM 8693  N NZ   . LYS B 1 61 ? 4.537   -7.375  4.202   1.00 1.88  ? 61 LYS B NZ   4  
ATOM 8694  H H    . LYS B 1 61 ? -0.685  -6.799  -0.117  1.00 0.45  ? 61 LYS B H    4  
ATOM 8695  H HA   . LYS B 1 61 ? 1.433   -4.952  0.582   1.00 0.49  ? 61 LYS B HA   4  
ATOM 8696  H HB2  . LYS B 1 61 ? 0.784   -7.582  1.165   1.00 0.58  ? 61 LYS B HB2  4  
ATOM 8697  H HB3  . LYS B 1 61 ? 2.098   -7.770  0.004   1.00 0.65  ? 61 LYS B HB3  4  
ATOM 8698  H HG2  . LYS B 1 61 ? 3.160   -5.825  1.546   1.00 1.41  ? 61 LYS B HG2  4  
ATOM 8699  H HG3  . LYS B 1 61 ? 2.142   -6.619  2.749   1.00 1.04  ? 61 LYS B HG3  4  
ATOM 8700  H HD2  . LYS B 1 61 ? 3.221   -8.715  2.431   1.00 1.35  ? 61 LYS B HD2  4  
ATOM 8701  H HD3  . LYS B 1 61 ? 4.010   -8.171  0.952   1.00 1.75  ? 61 LYS B HD3  4  
ATOM 8702  H HE2  . LYS B 1 61 ? 5.718   -8.058  2.589   1.00 1.83  ? 61 LYS B HE2  4  
ATOM 8703  H HE3  . LYS B 1 61 ? 5.157   -6.394  2.435   1.00 1.54  ? 61 LYS B HE3  4  
ATOM 8704  H HZ1  . LYS B 1 61 ? 4.071   -8.269  4.458   1.00 2.28  ? 61 LYS B HZ1  4  
ATOM 8705  H HZ2  . LYS B 1 61 ? 5.405   -7.263  4.763   1.00 2.14  ? 61 LYS B HZ2  4  
ATOM 8706  H HZ3  . LYS B 1 61 ? 3.892   -6.582  4.396   1.00 2.45  ? 61 LYS B HZ3  4  
ATOM 8707  N N    . ILE B 1 62 ? 1.475   -6.737  -2.185  1.00 0.37  ? 62 ILE B N    4  
ATOM 8708  C CA   . ILE B 1 62 ? 1.971   -6.811  -3.579  1.00 0.34  ? 62 ILE B CA   4  
ATOM 8709  C C    . ILE B 1 62 ? 1.991   -5.409  -4.199  1.00 0.32  ? 62 ILE B C    4  
ATOM 8710  O O    . ILE B 1 62 ? 2.915   -5.061  -4.901  1.00 0.34  ? 62 ILE B O    4  
ATOM 8711  C CB   . ILE B 1 62 ? 1.015   -7.755  -4.344  1.00 0.32  ? 62 ILE B CB   4  
ATOM 8712  C CG1  . ILE B 1 62 ? 1.763   -8.986  -4.853  1.00 0.34  ? 62 ILE B CG1  4  
ATOM 8713  C CG2  . ILE B 1 62 ? 0.339   -7.041  -5.511  1.00 0.29  ? 62 ILE B CG2  4  
ATOM 8714  C CD1  . ILE B 1 62 ? 2.532   -9.609  -3.694  1.00 0.36  ? 62 ILE B CD1  4  
ATOM 8715  H H    . ILE B 1 62 ? 0.834   -7.412  -1.881  1.00 0.37  ? 62 ILE B H    4  
ATOM 8716  H HA   . ILE B 1 62 ? 2.966   -7.209  -3.580  1.00 0.36  ? 62 ILE B HA   4  
ATOM 8717  H HB   . ILE B 1 62 ? 0.255   -8.081  -3.658  1.00 0.32  ? 62 ILE B HB   4  
ATOM 8718  H HG12 . ILE B 1 62 ? 1.049   -9.704  -5.240  1.00 0.35  ? 62 ILE B HG12 4  
ATOM 8719  H HG13 . ILE B 1 62 ? 2.447   -8.702  -5.633  1.00 0.35  ? 62 ILE B HG13 4  
ATOM 8720  H HG21 . ILE B 1 62 ? 1.090   -6.657  -6.182  1.00 1.02  ? 62 ILE B HG21 4  
ATOM 8721  H HG22 . ILE B 1 62 ? -0.298  -7.736  -6.035  1.00 1.11  ? 62 ILE B HG22 4  
ATOM 8722  H HG23 . ILE B 1 62 ? -0.258  -6.225  -5.131  1.00 0.98  ? 62 ILE B HG23 4  
ATOM 8723  H HD11 . ILE B 1 62 ? 1.986   -9.444  -2.775  1.00 1.02  ? 62 ILE B HD11 4  
ATOM 8724  H HD12 . ILE B 1 62 ? 2.643   -10.667 -3.863  1.00 0.97  ? 62 ILE B HD12 4  
ATOM 8725  H HD13 . ILE B 1 62 ? 3.503   -9.147  -3.622  1.00 1.02  ? 62 ILE B HD13 4  
ATOM 8726  N N    . ILE B 1 63 ? 0.999   -4.593  -3.920  1.00 0.31  ? 63 ILE B N    4  
ATOM 8727  C CA   . ILE B 1 63 ? 1.005   -3.208  -4.479  1.00 0.31  ? 63 ILE B CA   4  
ATOM 8728  C C    . ILE B 1 63 ? 2.090   -2.407  -3.789  1.00 0.37  ? 63 ILE B C    4  
ATOM 8729  O O    . ILE B 1 63 ? 2.925   -1.786  -4.415  1.00 0.41  ? 63 ILE B O    4  
ATOM 8730  C CB   . ILE B 1 63 ? -0.322  -2.521  -4.179  1.00 0.32  ? 63 ILE B CB   4  
ATOM 8731  C CG1  . ILE B 1 63 ? -1.433  -3.224  -4.932  1.00 0.32  ? 63 ILE B CG1  4  
ATOM 8732  C CG2  . ILE B 1 63 ? -0.255  -1.049  -4.592  1.00 0.33  ? 63 ILE B CG2  4  
ATOM 8733  C CD1  . ILE B 1 63 ? -1.918  -4.385  -4.092  1.00 0.42  ? 63 ILE B CD1  4  
ATOM 8734  H H    . ILE B 1 63 ? 0.260   -4.884  -3.323  1.00 0.31  ? 63 ILE B H    4  
ATOM 8735  H HA   . ILE B 1 63 ? 1.176   -3.233  -5.544  1.00 0.30  ? 63 ILE B HA   4  
ATOM 8736  H HB   . ILE B 1 63 ? -0.517  -2.579  -3.117  1.00 0.35  ? 63 ILE B HB   4  
ATOM 8737  H HG12 . ILE B 1 63 ? -2.236  -2.542  -5.091  1.00 0.31  ? 63 ILE B HG12 4  
ATOM 8738  H HG13 . ILE B 1 63 ? -1.065  -3.588  -5.878  1.00 0.48  ? 63 ILE B HG13 4  
ATOM 8739  H HG21 . ILE B 1 63 ? 0.381   -0.945  -5.458  1.00 0.99  ? 63 ILE B HG21 4  
ATOM 8740  H HG22 . ILE B 1 63 ? -1.246  -0.694  -4.825  1.00 1.02  ? 63 ILE B HG22 4  
ATOM 8741  H HG23 . ILE B 1 63 ? 0.151   -0.467  -3.775  1.00 1.03  ? 63 ILE B HG23 4  
ATOM 8742  H HD11 . ILE B 1 63 ? -1.549  -4.267  -3.082  1.00 1.18  ? 63 ILE B HD11 4  
ATOM 8743  H HD12 . ILE B 1 63 ? -2.993  -4.398  -4.084  1.00 1.07  ? 63 ILE B HD12 4  
ATOM 8744  H HD13 . ILE B 1 63 ? -1.541  -5.304  -4.506  1.00 1.10  ? 63 ILE B HD13 4  
ATOM 8745  N N    . GLU B 1 64 ? 2.043   -2.402  -2.487  1.00 0.38  ? 64 GLU B N    4  
ATOM 8746  C CA   . GLU B 1 64 ? 3.020   -1.619  -1.695  1.00 0.46  ? 64 GLU B CA   4  
ATOM 8747  C C    . GLU B 1 64 ? 4.451   -2.109  -1.943  1.00 0.48  ? 64 GLU B C    4  
ATOM 8748  O O    . GLU B 1 64 ? 5.355   -1.316  -2.129  1.00 0.62  ? 64 GLU B O    4  
ATOM 8749  C CB   . GLU B 1 64 ? 2.699   -1.767  -0.212  1.00 0.48  ? 64 GLU B CB   4  
ATOM 8750  C CG   . GLU B 1 64 ? 1.713   -0.678  0.214   1.00 1.04  ? 64 GLU B CG   4  
ATOM 8751  C CD   . GLU B 1 64 ? 0.990   -1.116  1.491   1.00 1.40  ? 64 GLU B CD   4  
ATOM 8752  O OE1  . GLU B 1 64 ? 0.039   -1.874  1.380   1.00 2.00  ? 64 GLU B OE1  4  
ATOM 8753  O OE2  . GLU B 1 64 ? 1.400   -0.686  2.557   1.00 1.81  ? 64 GLU B OE2  4  
ATOM 8754  H H    . GLU B 1 64 ? 1.332   -2.906  -2.028  1.00 0.37  ? 64 GLU B H    4  
ATOM 8755  H HA   . GLU B 1 64 ? 2.932   -0.582  -1.982  1.00 0.48  ? 64 GLU B HA   4  
ATOM 8756  H HB2  . GLU B 1 64 ? 2.262   -2.742  -0.040  1.00 0.72  ? 64 GLU B HB2  4  
ATOM 8757  H HB3  . GLU B 1 64 ? 3.607   -1.676  0.359   1.00 0.75  ? 64 GLU B HB3  4  
ATOM 8758  H HG2  . GLU B 1 64 ? 2.251   0.240   0.399   1.00 1.39  ? 64 GLU B HG2  4  
ATOM 8759  H HG3  . GLU B 1 64 ? 0.989   -0.521  -0.571  1.00 1.43  ? 64 GLU B HG3  4  
ATOM 8760  N N    . LYS B 1 65 ? 4.671   -3.404  -1.937  1.00 0.47  ? 65 LYS B N    4  
ATOM 8761  C CA   . LYS B 1 65 ? 6.050   -3.922  -2.163  1.00 0.51  ? 65 LYS B CA   4  
ATOM 8762  C C    . LYS B 1 65 ? 6.446   -3.680  -3.615  1.00 0.50  ? 65 LYS B C    4  
ATOM 8763  O O    . LYS B 1 65 ? 7.556   -3.276  -3.889  1.00 0.55  ? 65 LYS B O    4  
ATOM 8764  C CB   . LYS B 1 65 ? 6.142   -5.413  -1.805  1.00 0.52  ? 65 LYS B CB   4  
ATOM 8765  C CG   . LYS B 1 65 ? 5.291   -6.253  -2.763  1.00 1.07  ? 65 LYS B CG   4  
ATOM 8766  C CD   . LYS B 1 65 ? 5.141   -7.669  -2.199  1.00 1.44  ? 65 LYS B CD   4  
ATOM 8767  C CE   . LYS B 1 65 ? 6.133   -8.604  -2.895  1.00 1.72  ? 65 LYS B CE   4  
ATOM 8768  N NZ   . LYS B 1 65 ? 6.055   -9.963  -2.286  1.00 2.15  ? 65 LYS B NZ   4  
ATOM 8769  H H    . LYS B 1 65 ? 3.932   -4.027  -1.779  1.00 0.54  ? 65 LYS B H    4  
ATOM 8770  H HA   . LYS B 1 65 ? 6.722   -3.361  -1.538  1.00 0.56  ? 65 LYS B HA   4  
ATOM 8771  H HB2  . LYS B 1 65 ? 7.172   -5.733  -1.872  1.00 0.91  ? 65 LYS B HB2  4  
ATOM 8772  H HB3  . LYS B 1 65 ? 5.788   -5.558  -0.795  1.00 1.09  ? 65 LYS B HB3  4  
ATOM 8773  H HG2  . LYS B 1 65 ? 4.316   -5.801  -2.869  1.00 1.56  ? 65 LYS B HG2  4  
ATOM 8774  H HG3  . LYS B 1 65 ? 5.773   -6.302  -3.727  1.00 1.65  ? 65 LYS B HG3  4  
ATOM 8775  H HD2  . LYS B 1 65 ? 5.342   -7.656  -1.136  1.00 1.78  ? 65 LYS B HD2  4  
ATOM 8776  H HD3  . LYS B 1 65 ? 4.135   -8.020  -2.368  1.00 1.92  ? 65 LYS B HD3  4  
ATOM 8777  H HE2  . LYS B 1 65 ? 5.889   -8.668  -3.946  1.00 2.13  ? 65 LYS B HE2  4  
ATOM 8778  H HE3  . LYS B 1 65 ? 7.133   -8.215  -2.781  1.00 2.04  ? 65 LYS B HE3  4  
ATOM 8779  H HZ1  . LYS B 1 65 ? 6.241   -9.896  -1.264  1.00 2.61  ? 65 LYS B HZ1  4  
ATOM 8780  H HZ2  . LYS B 1 65 ? 5.108   -10.362 -2.441  1.00 2.61  ? 65 LYS B HZ2  4  
ATOM 8781  H HZ3  . LYS B 1 65 ? 6.765   -10.581 -2.727  1.00 2.25  ? 65 LYS B HZ3  4  
ATOM 8782  N N    . MET B 1 66 ? 5.538   -3.865  -4.543  1.00 0.45  ? 66 MET B N    4  
ATOM 8783  C CA   . MET B 1 66 ? 5.867   -3.572  -5.960  1.00 0.46  ? 66 MET B CA   4  
ATOM 8784  C C    . MET B 1 66 ? 6.234   -2.086  -6.040  1.00 0.49  ? 66 MET B C    4  
ATOM 8785  O O    . MET B 1 66 ? 7.119   -1.684  -6.770  1.00 0.53  ? 66 MET B O    4  
ATOM 8786  C CB   . MET B 1 66 ? 4.649   -3.842  -6.840  1.00 0.42  ? 66 MET B CB   4  
ATOM 8787  C CG   . MET B 1 66 ? 4.646   -5.310  -7.274  1.00 0.40  ? 66 MET B CG   4  
ATOM 8788  S SD   . MET B 1 66 ? 5.910   -5.555  -8.546  1.00 1.14  ? 66 MET B SD   4  
ATOM 8789  C CE   . MET B 1 66 ? 5.092   -4.644  -9.879  1.00 0.37  ? 66 MET B CE   4  
ATOM 8790  H H    . MET B 1 66 ? 4.638   -4.155  -4.302  1.00 0.42  ? 66 MET B H    4  
ATOM 8791  H HA   . MET B 1 66 ? 6.697   -4.180  -6.273  1.00 0.47  ? 66 MET B HA   4  
ATOM 8792  H HB2  . MET B 1 66 ? 3.751   -3.623  -6.282  1.00 0.40  ? 66 MET B HB2  4  
ATOM 8793  H HB3  . MET B 1 66 ? 4.693   -3.209  -7.710  1.00 0.46  ? 66 MET B HB3  4  
ATOM 8794  H HG2  . MET B 1 66 ? 4.865   -5.941  -6.421  1.00 0.76  ? 66 MET B HG2  4  
ATOM 8795  H HG3  . MET B 1 66 ? 3.676   -5.571  -7.671  1.00 0.66  ? 66 MET B HG3  4  
ATOM 8796  H HE1  . MET B 1 66 ? 4.041   -4.528  -9.653  1.00 1.01  ? 66 MET B HE1  4  
ATOM 8797  H HE2  . MET B 1 66 ? 5.550   -3.669  -9.992  1.00 1.12  ? 66 MET B HE2  4  
ATOM 8798  H HE3  . MET B 1 66 ? 5.196   -5.192  -10.800 1.00 1.06  ? 66 MET B HE3  4  
ATOM 8799  N N    . LEU B 1 67 ? 5.553   -1.283  -5.250  1.00 0.50  ? 67 LEU B N    4  
ATOM 8800  C CA   . LEU B 1 67 ? 5.820   0.174   -5.197  1.00 0.54  ? 67 LEU B CA   4  
ATOM 8801  C C    . LEU B 1 67 ? 7.236   0.424   -4.661  1.00 0.60  ? 67 LEU B C    4  
ATOM 8802  O O    . LEU B 1 67 ? 7.891   1.372   -5.049  1.00 0.63  ? 67 LEU B O    4  
ATOM 8803  C CB   . LEU B 1 67 ? 4.811   0.822   -4.245  1.00 0.56  ? 67 LEU B CB   4  
ATOM 8804  C CG   . LEU B 1 67 ? 3.690   1.478   -5.046  1.00 0.53  ? 67 LEU B CG   4  
ATOM 8805  C CD1  . LEU B 1 67 ? 2.350   0.981   -4.514  1.00 0.53  ? 67 LEU B CD1  4  
ATOM 8806  C CD2  . LEU B 1 67 ? 3.768   2.996   -4.890  1.00 0.56  ? 67 LEU B CD2  4  
ATOM 8807  H H    . LEU B 1 67 ? 4.864   -1.654  -4.669  1.00 0.49  ? 67 LEU B H    4  
ATOM 8808  H HA   . LEU B 1 67 ? 5.710   0.596   -6.178  1.00 0.54  ? 67 LEU B HA   4  
ATOM 8809  H HB2  . LEU B 1 67 ? 4.392   0.062   -3.603  1.00 0.57  ? 67 LEU B HB2  4  
ATOM 8810  H HB3  . LEU B 1 67 ? 5.303   1.565   -3.640  1.00 0.60  ? 67 LEU B HB3  4  
ATOM 8811  H HG   . LEU B 1 67 ? 3.785   1.212   -6.089  1.00 0.51  ? 67 LEU B HG   4  
ATOM 8812  H HD11 . LEU B 1 67 ? 2.495   0.541   -3.537  1.00 1.08  ? 67 LEU B HD11 4  
ATOM 8813  H HD12 . LEU B 1 67 ? 1.663   1.807   -4.438  1.00 1.15  ? 67 LEU B HD12 4  
ATOM 8814  H HD13 . LEU B 1 67 ? 1.951   0.237   -5.186  1.00 1.18  ? 67 LEU B HD13 4  
ATOM 8815  H HD21 . LEU B 1 67 ? 4.184   3.238   -3.924  1.00 1.09  ? 67 LEU B HD21 4  
ATOM 8816  H HD22 . LEU B 1 67 ? 4.399   3.405   -5.666  1.00 1.19  ? 67 LEU B HD22 4  
ATOM 8817  H HD23 . LEU B 1 67 ? 2.778   3.419   -4.972  1.00 1.20  ? 67 LEU B HD23 4  
ATOM 8818  N N    . ASN B 1 68 ? 7.707   -0.415  -3.761  1.00 0.63  ? 68 ASN B N    4  
ATOM 8819  C CA   . ASN B 1 68 ? 9.083   -0.205  -3.193  1.00 0.69  ? 68 ASN B CA   4  
ATOM 8820  C C    . ASN B 1 68 ? 10.103  -1.108  -3.905  1.00 0.75  ? 68 ASN B C    4  
ATOM 8821  O O    . ASN B 1 68 ? 9.758   -2.115  -4.491  1.00 0.92  ? 68 ASN B O    4  
ATOM 8822  C CB   . ASN B 1 68 ? 9.084   -0.511  -1.686  1.00 0.78  ? 68 ASN B CB   4  
ATOM 8823  C CG   . ASN B 1 68 ? 10.332  0.098   -1.038  1.00 1.48  ? 68 ASN B CG   4  
ATOM 8824  O OD1  . ASN B 1 68 ? 10.540  1.295   -1.101  1.00 2.21  ? 68 ASN B OD1  4  
ATOM 8825  N ND2  . ASN B 1 68 ? 11.178  -0.678  -0.413  1.00 2.00  ? 68 ASN B ND2  4  
ATOM 8826  H H    . ASN B 1 68 ? 7.150   -1.179  -3.456  1.00 0.62  ? 68 ASN B H    4  
ATOM 8827  H HA   . ASN B 1 68 ? 9.368   0.827   -3.341  1.00 0.72  ? 68 ASN B HA   4  
ATOM 8828  H HB2  . ASN B 1 68 ? 8.203   -0.084  -1.227  1.00 1.16  ? 68 ASN B HB2  4  
ATOM 8829  H HB3  . ASN B 1 68 ? 9.089   -1.581  -1.533  1.00 1.06  ? 68 ASN B HB3  4  
ATOM 8830  H HD21 . ASN B 1 68 ? 11.014  -1.642  -0.360  1.00 2.13  ? 68 ASN B HD21 4  
ATOM 8831  H HD22 . ASN B 1 68 ? 11.979  -0.294  0.002   1.00 2.63  ? 68 ASN B HD22 4  
ATOM 8832  N N    . SER B 1 69 ? 11.367  -0.747  -3.849  1.00 0.87  ? 69 SER B N    4  
ATOM 8833  C CA   . SER B 1 69 ? 12.426  -1.565  -4.503  1.00 0.99  ? 69 SER B CA   4  
ATOM 8834  C C    . SER B 1 69 ? 13.805  -1.038  -4.080  1.00 1.13  ? 69 SER B C    4  
ATOM 8835  O O    . SER B 1 69 ? 14.303  -0.066  -4.622  1.00 1.69  ? 69 SER B O    4  
ATOM 8836  C CB   . SER B 1 69 ? 12.283  -1.485  -6.027  1.00 1.46  ? 69 SER B CB   4  
ATOM 8837  O OG   . SER B 1 69 ? 13.258  -2.323  -6.638  1.00 2.03  ? 69 SER B OG   4  
ATOM 8838  H H    . SER B 1 69 ? 11.618  0.061   -3.366  1.00 1.00  ? 69 SER B H    4  
ATOM 8839  H HA   . SER B 1 69 ? 12.324  -2.586  -4.183  1.00 1.09  ? 69 SER B HA   4  
ATOM 8840  H HB2  . SER B 1 69 ? 11.300  -1.816  -6.317  1.00 1.85  ? 69 SER B HB2  4  
ATOM 8841  H HB3  . SER B 1 69 ? 12.423  -0.461  -6.348  1.00 1.93  ? 69 SER B HB3  4  
ATOM 8842  H HG   . SER B 1 69 ? 12.824  -2.831  -7.327  1.00 2.38  ? 69 SER B HG   4  
ATOM 8843  N N    . ASP B 1 70 ? 14.420  -1.671  -3.110  1.00 1.22  ? 70 ASP B N    4  
ATOM 8844  C CA   . ASP B 1 70 ? 15.765  -1.216  -2.638  1.00 1.69  ? 70 ASP B CA   4  
ATOM 8845  C C    . ASP B 1 70 ? 16.463  -2.357  -1.889  1.00 1.89  ? 70 ASP B C    4  
ATOM 8846  O O    . ASP B 1 70 ? 15.846  -3.068  -1.116  1.00 2.34  ? 70 ASP B O    4  
ATOM 8847  C CB   . ASP B 1 70 ? 15.599  -0.015  -1.699  1.00 2.32  ? 70 ASP B CB   4  
ATOM 8848  C CG   . ASP B 1 70 ? 16.743  0.977   -1.923  1.00 3.13  ? 70 ASP B CG   4  
ATOM 8849  O OD1  . ASP B 1 70 ? 17.775  0.817   -1.291  1.00 3.65  ? 70 ASP B OD1  4  
ATOM 8850  O OD2  . ASP B 1 70 ? 16.569  1.880   -2.725  1.00 3.72  ? 70 ASP B OD2  4  
ATOM 8851  H H    . ASP B 1 70 ? 13.994  -2.446  -2.688  1.00 1.38  ? 70 ASP B H    4  
ATOM 8852  H HA   . ASP B 1 70 ? 16.364  -0.926  -3.489  1.00 2.07  ? 70 ASP B HA   4  
ATOM 8853  H HB2  . ASP B 1 70 ? 14.655  0.472   -1.902  1.00 2.46  ? 70 ASP B HB2  4  
ATOM 8854  H HB3  . ASP B 1 70 ? 15.615  -0.353  -0.673  1.00 2.72  ? 70 ASP B HB3  4  
ATOM 8855  N N    . LYS B 1 71 ? 17.747  -2.536  -2.120  1.00 2.37  ? 71 LYS B N    4  
ATOM 8856  C CA   . LYS B 1 71 ? 18.510  -3.630  -1.437  1.00 3.06  ? 71 LYS B CA   4  
ATOM 8857  C C    . LYS B 1 71 ? 17.895  -4.991  -1.803  1.00 3.94  ? 71 LYS B C    4  
ATOM 8858  O O    . LYS B 1 71 ? 17.729  -5.859  -0.964  1.00 4.55  ? 71 LYS B O    4  
ATOM 8859  C CB   . LYS B 1 71 ? 18.466  -3.421  0.085   1.00 3.59  ? 71 LYS B CB   4  
ATOM 8860  C CG   . LYS B 1 71 ? 19.671  -4.111  0.735   1.00 3.82  ? 71 LYS B CG   4  
ATOM 8861  C CD   . LYS B 1 71 ? 19.333  -4.473  2.183   1.00 4.61  ? 71 LYS B CD   4  
ATOM 8862  C CE   . LYS B 1 71 ? 20.569  -5.069  2.866   1.00 5.23  ? 71 LYS B CE   4  
ATOM 8863  N NZ   . LYS B 1 71 ? 20.149  -5.852  4.064   1.00 5.99  ? 71 LYS B NZ   4  
ATOM 8864  H H    . LYS B 1 71 ? 18.211  -1.949  -2.753  1.00 2.66  ? 71 LYS B H    4  
ATOM 8865  H HA   . LYS B 1 71 ? 19.536  -3.606  -1.771  1.00 3.09  ? 71 LYS B HA   4  
ATOM 8866  H HB2  . LYS B 1 71 ? 18.498  -2.363  0.302   1.00 3.68  ? 71 LYS B HB2  4  
ATOM 8867  H HB3  . LYS B 1 71 ? 17.555  -3.842  0.482   1.00 4.21  ? 71 LYS B HB3  4  
ATOM 8868  H HG2  . LYS B 1 71 ? 19.910  -5.009  0.184   1.00 3.92  ? 71 LYS B HG2  4  
ATOM 8869  H HG3  . LYS B 1 71 ? 20.519  -3.443  0.721   1.00 3.79  ? 71 LYS B HG3  4  
ATOM 8870  H HD2  . LYS B 1 71 ? 19.021  -3.585  2.713   1.00 4.80  ? 71 LYS B HD2  4  
ATOM 8871  H HD3  . LYS B 1 71 ? 18.534  -5.199  2.196   1.00 4.94  ? 71 LYS B HD3  4  
ATOM 8872  H HE2  . LYS B 1 71 ? 21.085  -5.719  2.175   1.00 5.31  ? 71 LYS B HE2  4  
ATOM 8873  H HE3  . LYS B 1 71 ? 21.229  -4.271  3.171   1.00 5.41  ? 71 LYS B HE3  4  
ATOM 8874  H HZ1  . LYS B 1 71 ? 19.471  -6.586  3.781   1.00 6.23  ? 71 LYS B HZ1  4  
ATOM 8875  H HZ2  . LYS B 1 71 ? 20.983  -6.301  4.493   1.00 6.33  ? 71 LYS B HZ2  4  
ATOM 8876  H HZ3  . LYS B 1 71 ? 19.703  -5.214  4.756   1.00 6.24  ? 71 LYS B HZ3  4  
ATOM 8877  N N    . SER B 1 72 ? 17.555  -5.177  -3.057  1.00 4.42  ? 72 SER B N    4  
ATOM 8878  C CA   . SER B 1 72 ? 16.949  -6.470  -3.497  1.00 5.58  ? 72 SER B CA   4  
ATOM 8879  C C    . SER B 1 72 ? 17.591  -6.921  -4.816  1.00 5.86  ? 72 SER B C    4  
ATOM 8880  O O    . SER B 1 72 ? 17.611  -6.132  -5.750  1.00 5.92  ? 72 SER B O    4  
ATOM 8881  C CB   . SER B 1 72 ? 15.442  -6.285  -3.693  1.00 6.45  ? 72 SER B CB   4  
ATOM 8882  O OG   . SER B 1 72 ? 14.785  -7.531  -3.505  1.00 6.62  ? 72 SER B OG   4  
ATOM 8883  O OXT  . SER B 1 72 ? 18.053  -8.049  -4.869  1.00 6.32  ? 72 SER B OXT  4  
ATOM 8884  H H    . SER B 1 72 ? 17.698  -4.460  -3.712  1.00 4.24  ? 72 SER B H    4  
ATOM 8885  H HA   . SER B 1 72 ? 17.122  -7.222  -2.741  1.00 5.92  ? 72 SER B HA   4  
ATOM 8886  H HB2  . SER B 1 72 ? 15.068  -5.575  -2.974  1.00 6.89  ? 72 SER B HB2  4  
ATOM 8887  H HB3  . SER B 1 72 ? 15.253  -5.913  -4.692  1.00 6.83  ? 72 SER B HB3  4  
ATOM 8888  H HG   . SER B 1 72 ? 14.521  -7.861  -4.367  1.00 7.10  ? 72 SER B HG   4  
ATOM 8889  N N    . ALA A 1 1  ? 16.331  21.560  -26.811 1.00 14.80 ? 1  ALA A N    5  
ATOM 8890  C CA   . ALA A 1 1  ? 15.708  20.252  -26.450 1.00 14.12 ? 1  ALA A CA   5  
ATOM 8891  C C    . ALA A 1 1  ? 15.812  20.033  -24.933 1.00 13.40 ? 1  ALA A C    5  
ATOM 8892  O O    . ALA A 1 1  ? 14.811  19.922  -24.252 1.00 13.47 ? 1  ALA A O    5  
ATOM 8893  C CB   . ALA A 1 1  ? 16.428  19.116  -27.187 1.00 14.17 ? 1  ALA A CB   5  
ATOM 8894  H H1   . ALA A 1 1  ? 15.948  22.308  -26.197 1.00 14.91 ? 1  ALA A H1   5  
ATOM 8895  H H2   . ALA A 1 1  ? 17.362  21.503  -26.687 1.00 15.01 ? 1  ALA A H2   5  
ATOM 8896  H H3   . ALA A 1 1  ? 16.116  21.784  -27.803 1.00 15.11 ? 1  ALA A H3   5  
ATOM 8897  H HA   . ALA A 1 1  ? 14.668  20.263  -26.738 1.00 14.26 ? 1  ALA A HA   5  
ATOM 8898  H HB1  . ALA A 1 1  ? 16.740  19.460  -28.163 1.00 14.25 ? 1  ALA A HB1  5  
ATOM 8899  H HB2  . ALA A 1 1  ? 17.293  18.807  -26.621 1.00 14.03 ? 1  ALA A HB2  5  
ATOM 8900  H HB3  . ALA A 1 1  ? 15.755  18.278  -27.301 1.00 14.43 ? 1  ALA A HB3  5  
ATOM 8901  N N    . SER A 1 2  ? 17.019  19.976  -24.406 1.00 12.87 ? 2  SER A N    5  
ATOM 8902  C CA   . SER A 1 2  ? 17.219  19.768  -22.931 1.00 12.29 ? 2  SER A CA   5  
ATOM 8903  C C    . SER A 1 2  ? 16.740  18.365  -22.519 1.00 11.44 ? 2  SER A C    5  
ATOM 8904  O O    . SER A 1 2  ? 16.023  17.700  -23.247 1.00 11.39 ? 2  SER A O    5  
ATOM 8905  C CB   . SER A 1 2  ? 16.457  20.850  -22.142 1.00 12.48 ? 2  SER A CB   5  
ATOM 8906  O OG   . SER A 1 2  ? 15.237  20.321  -21.631 1.00 12.82 ? 2  SER A OG   5  
ATOM 8907  H H    . SER A 1 2  ? 17.803  20.072  -24.986 1.00 12.96 ? 2  SER A H    5  
ATOM 8908  H HA   . SER A 1 2  ? 18.273  19.851  -22.709 1.00 12.52 ? 2  SER A HA   5  
ATOM 8909  H HB2  . SER A 1 2  ? 17.064  21.187  -21.318 1.00 12.65 ? 2  SER A HB2  5  
ATOM 8910  H HB3  . SER A 1 2  ? 16.250  21.687  -22.795 1.00 12.40 ? 2  SER A HB3  5  
ATOM 8911  H HG   . SER A 1 2  ? 14.519  20.625  -22.194 1.00 12.81 ? 2  SER A HG   5  
ATOM 8912  N N    . VAL A 1 3  ? 17.131  17.913  -21.350 1.00 10.93 ? 3  VAL A N    5  
ATOM 8913  C CA   . VAL A 1 3  ? 16.703  16.559  -20.882 1.00 10.23 ? 3  VAL A CA   5  
ATOM 8914  C C    . VAL A 1 3  ? 16.927  16.437  -19.367 1.00 9.33  ? 3  VAL A C    5  
ATOM 8915  O O    . VAL A 1 3  ? 17.992  16.739  -18.858 1.00 9.35  ? 3  VAL A O    5  
ATOM 8916  C CB   . VAL A 1 3  ? 17.503  15.472  -21.623 1.00 10.49 ? 3  VAL A CB   5  
ATOM 8917  C CG1  . VAL A 1 3  ? 19.001  15.624  -21.335 1.00 10.45 ? 3  VAL A CG1  5  
ATOM 8918  C CG2  . VAL A 1 3  ? 17.034  14.086  -21.162 1.00 11.15 ? 3  VAL A CG2  5  
ATOM 8919  H H    . VAL A 1 3  ? 17.708  18.467  -20.782 1.00 11.13 ? 3  VAL A H    5  
ATOM 8920  H HA   . VAL A 1 3  ? 15.651  16.431  -21.092 1.00 10.38 ? 3  VAL A HA   5  
ATOM 8921  H HB   . VAL A 1 3  ? 17.334  15.570  -22.687 1.00 10.48 ? 3  VAL A HB   5  
ATOM 8922  H HG11 . VAL A 1 3  ? 19.246  16.671  -21.238 1.00 10.31 ? 3  VAL A HG11 5  
ATOM 8923  H HG12 . VAL A 1 3  ? 19.244  15.111  -20.416 1.00 10.52 ? 3  VAL A HG12 5  
ATOM 8924  H HG13 . VAL A 1 3  ? 19.569  15.195  -22.147 1.00 10.71 ? 3  VAL A HG13 5  
ATOM 8925  H HG21 . VAL A 1 3  ? 15.969  13.997  -21.315 1.00 11.26 ? 3  VAL A HG21 5  
ATOM 8926  H HG22 . VAL A 1 3  ? 17.545  13.325  -21.731 1.00 11.32 ? 3  VAL A HG22 5  
ATOM 8927  H HG23 . VAL A 1 3  ? 17.258  13.962  -20.113 1.00 11.52 ? 3  VAL A HG23 5  
ATOM 8928  N N    . ALA A 1 4  ? 15.929  15.983  -18.652 1.00 8.73  ? 4  ALA A N    5  
ATOM 8929  C CA   . ALA A 1 4  ? 16.063  15.818  -17.172 1.00 7.94  ? 4  ALA A CA   5  
ATOM 8930  C C    . ALA A 1 4  ? 16.119  14.324  -16.840 1.00 7.00  ? 4  ALA A C    5  
ATOM 8931  O O    . ALA A 1 4  ? 16.222  13.492  -17.724 1.00 7.01  ? 4  ALA A O    5  
ATOM 8932  C CB   . ALA A 1 4  ? 14.855  16.458  -16.477 1.00 8.20  ? 4  ALA A CB   5  
ATOM 8933  H H    . ALA A 1 4  ? 15.087  15.740  -19.092 1.00 8.94  ? 4  ALA A H    5  
ATOM 8934  H HA   . ALA A 1 4  ? 16.970  16.296  -16.832 1.00 8.12  ? 4  ALA A HA   5  
ATOM 8935  H HB1  . ALA A 1 4  ? 14.600  17.381  -16.976 1.00 8.32  ? 4  ALA A HB1  5  
ATOM 8936  H HB2  . ALA A 1 4  ? 14.015  15.781  -16.520 1.00 8.35  ? 4  ALA A HB2  5  
ATOM 8937  H HB3  . ALA A 1 4  ? 15.100  16.662  -15.445 1.00 8.38  ? 4  ALA A HB3  5  
ATOM 8938  N N    . THR A 1 5  ? 16.052  13.973  -15.578 1.00 6.46  ? 5  THR A N    5  
ATOM 8939  C CA   . THR A 1 5  ? 16.097  12.526  -15.189 1.00 5.78  ? 5  THR A CA   5  
ATOM 8940  C C    . THR A 1 5  ? 14.939  11.776  -15.862 1.00 4.91  ? 5  THR A C    5  
ATOM 8941  O O    . THR A 1 5  ? 13.892  12.342  -16.117 1.00 4.67  ? 5  THR A O    5  
ATOM 8942  C CB   . THR A 1 5  ? 15.981  12.385  -13.664 1.00 6.14  ? 5  THR A CB   5  
ATOM 8943  O OG1  . THR A 1 5  ? 14.895  13.173  -13.188 1.00 6.54  ? 5  THR A OG1  5  
ATOM 8944  C CG2  . THR A 1 5  ? 17.287  12.840  -13.004 1.00 6.80  ? 5  THR A CG2  5  
ATOM 8945  H H    . THR A 1 5  ? 15.971  14.662  -14.886 1.00 6.71  ? 5  THR A H    5  
ATOM 8946  H HA   . THR A 1 5  ? 17.034  12.099  -15.516 1.00 5.96  ? 5  THR A HA   5  
ATOM 8947  H HB   . THR A 1 5  ? 15.805  11.350  -13.416 1.00 5.97  ? 5  THR A HB   5  
ATOM 8948  H HG1  . THR A 1 5  ? 15.209  14.069  -13.040 1.00 6.80  ? 5  THR A HG1  5  
ATOM 8949  H HG21 . THR A 1 5  ? 18.111  12.676  -13.684 1.00 7.20  ? 5  THR A HG21 5  
ATOM 8950  H HG22 . THR A 1 5  ? 17.223  13.892  -12.765 1.00 7.12  ? 5  THR A HG22 5  
ATOM 8951  H HG23 . THR A 1 5  ? 17.449  12.275  -12.099 1.00 6.85  ? 5  THR A HG23 5  
ATOM 8952  N N    . GLU A 1 6  ? 15.133  10.508  -16.161 1.00 4.60  ? 6  GLU A N    5  
ATOM 8953  C CA   . GLU A 1 6  ? 14.070  9.693   -16.835 1.00 3.81  ? 6  GLU A CA   5  
ATOM 8954  C C    . GLU A 1 6  ? 13.888  10.201  -18.266 1.00 3.24  ? 6  GLU A C    5  
ATOM 8955  O O    . GLU A 1 6  ? 13.278  11.231  -18.492 1.00 3.60  ? 6  GLU A O    5  
ATOM 8956  C CB   . GLU A 1 6  ? 12.732  9.799   -16.089 1.00 4.36  ? 6  GLU A CB   5  
ATOM 8957  C CG   . GLU A 1 6  ? 12.940  9.603   -14.585 1.00 5.18  ? 6  GLU A CG   5  
ATOM 8958  C CD   . GLU A 1 6  ? 12.023  10.560  -13.817 1.00 5.79  ? 6  GLU A CD   5  
ATOM 8959  O OE1  . GLU A 1 6  ? 10.867  10.218  -13.628 1.00 6.16  ? 6  GLU A OE1  5  
ATOM 8960  O OE2  . GLU A 1 6  ? 12.491  11.619  -13.436 1.00 6.17  ? 6  GLU A OE2  5  
ATOM 8961  H H    . GLU A 1 6  ? 15.993  10.089  -15.953 1.00 5.01  ? 6  GLU A H    5  
ATOM 8962  H HA   . GLU A 1 6  ? 14.384  8.661   -16.862 1.00 3.44  ? 6  GLU A HA   5  
ATOM 8963  H HB2  . GLU A 1 6  ? 12.301  10.771  -16.268 1.00 4.83  ? 6  GLU A HB2  5  
ATOM 8964  H HB3  . GLU A 1 6  ? 12.059  9.037   -16.456 1.00 4.03  ? 6  GLU A HB3  5  
ATOM 8965  H HG2  . GLU A 1 6  ? 12.702  8.583   -14.319 1.00 5.45  ? 6  GLU A HG2  5  
ATOM 8966  H HG3  . GLU A 1 6  ? 13.967  9.811   -14.329 1.00 5.43  ? 6  GLU A HG3  5  
ATOM 8967  N N    . LEU A 1 7  ? 14.422  9.500   -19.237 1.00 2.59  ? 7  LEU A N    5  
ATOM 8968  C CA   . LEU A 1 7  ? 14.289  9.957   -20.642 1.00 2.31  ? 7  LEU A CA   5  
ATOM 8969  C C    . LEU A 1 7  ? 13.466  8.917   -21.388 1.00 1.55  ? 7  LEU A C    5  
ATOM 8970  O O    . LEU A 1 7  ? 12.370  9.178   -21.851 1.00 1.73  ? 7  LEU A O    5  
ATOM 8971  C CB   . LEU A 1 7  ? 15.663  10.116  -21.321 1.00 2.51  ? 7  LEU A CB   5  
ATOM 8972  C CG   . LEU A 1 7  ? 16.836  10.165  -20.318 1.00 3.14  ? 7  LEU A CG   5  
ATOM 8973  C CD1  . LEU A 1 7  ? 16.512  11.029  -19.092 1.00 3.94  ? 7  LEU A CD1  5  
ATOM 8974  C CD2  . LEU A 1 7  ? 17.143  8.753   -19.859 1.00 3.07  ? 7  LEU A CD2  5  
ATOM 8975  H H    . LEU A 1 7  ? 14.916  8.677   -19.043 1.00 2.53  ? 7  LEU A H    5  
ATOM 8976  H HA   . LEU A 1 7  ? 13.781  10.894  -20.654 1.00 2.80  ? 7  LEU A HA   5  
ATOM 8977  H HB2  . LEU A 1 7  ? 15.820  9.291   -21.998 1.00 2.07  ? 7  LEU A HB2  5  
ATOM 8978  H HB3  . LEU A 1 7  ? 15.652  11.021  -21.883 1.00 2.88  ? 7  LEU A HB3  5  
ATOM 8979  H HG   . LEU A 1 7  ? 17.706  10.571  -20.812 1.00 3.32  ? 7  LEU A HG   5  
ATOM 8980  H HD11 . LEU A 1 7  ? 15.629  11.618  -19.284 1.00 4.28  ? 7  LEU A HD11 5  
ATOM 8981  H HD12 . LEU A 1 7  ? 16.333  10.384  -18.239 1.00 4.27  ? 7  LEU A HD12 5  
ATOM 8982  H HD13 . LEU A 1 7  ? 17.344  11.678  -18.877 1.00 4.25  ? 7  LEU A HD13 5  
ATOM 8983  H HD21 . LEU A 1 7  ? 16.537  8.060   -20.422 1.00 3.18  ? 7  LEU A HD21 5  
ATOM 8984  H HD22 . LEU A 1 7  ? 18.185  8.542   -20.028 1.00 3.21  ? 7  LEU A HD22 5  
ATOM 8985  H HD23 . LEU A 1 7  ? 16.914  8.661   -18.808 1.00 3.36  ? 7  LEU A HD23 5  
ATOM 8986  N N    . ARG A 1 8  ? 13.991  7.728   -21.461 1.00 1.31  ? 8  ARG A N    5  
ATOM 8987  C CA   . ARG A 1 8  ? 13.283  6.594   -22.119 1.00 1.48  ? 8  ARG A CA   5  
ATOM 8988  C C    . ARG A 1 8  ? 11.896  6.445   -21.492 1.00 1.32  ? 8  ARG A C    5  
ATOM 8989  O O    . ARG A 1 8  ? 10.897  6.291   -22.169 1.00 1.92  ? 8  ARG A O    5  
ATOM 8990  C CB   . ARG A 1 8  ? 14.077  5.326   -21.830 1.00 2.16  ? 8  ARG A CB   5  
ATOM 8991  C CG   . ARG A 1 8  ? 14.804  4.857   -23.094 1.00 2.68  ? 8  ARG A CG   5  
ATOM 8992  C CD   . ARG A 1 8  ? 14.121  3.604   -23.647 1.00 2.99  ? 8  ARG A CD   5  
ATOM 8993  N NE   . ARG A 1 8  ? 14.659  2.394   -22.958 1.00 3.47  ? 8  ARG A NE   5  
ATOM 8994  C CZ   . ARG A 1 8  ? 13.862  1.400   -22.664 1.00 3.94  ? 8  ARG A CZ   5  
ATOM 8995  N NH1  . ARG A 1 8  ? 13.244  1.377   -21.512 1.00 4.42  ? 8  ARG A NH1  5  
ATOM 8996  N NH2  . ARG A 1 8  ? 13.688  0.428   -23.522 1.00 4.33  ? 8  ARG A NH2  5  
ATOM 8997  H H    . ARG A 1 8  ? 14.864  7.572   -21.048 1.00 1.63  ? 8  ARG A H    5  
ATOM 8998  H HA   . ARG A 1 8  ? 13.207  6.757   -23.181 1.00 1.84  ? 8  ARG A HA   5  
ATOM 8999  H HB2  . ARG A 1 8  ? 14.796  5.543   -21.049 1.00 2.23  ? 8  ARG A HB2  5  
ATOM 9000  H HB3  . ARG A 1 8  ? 13.404  4.555   -21.487 1.00 2.53  ? 8  ARG A HB3  5  
ATOM 9001  H HG2  . ARG A 1 8  ? 14.777  5.641   -23.837 1.00 2.98  ? 8  ARG A HG2  5  
ATOM 9002  H HG3  . ARG A 1 8  ? 15.831  4.627   -22.854 1.00 2.97  ? 8  ARG A HG3  5  
ATOM 9003  H HD2  . ARG A 1 8  ? 13.056  3.672   -23.478 1.00 3.17  ? 8  ARG A HD2  5  
ATOM 9004  H HD3  . ARG A 1 8  ? 14.312  3.530   -24.707 1.00 3.16  ? 8  ARG A HD3  5  
ATOM 9005  H HE   . ARG A 1 8  ? 15.611  2.343   -22.728 1.00 3.66  ? 8  ARG A HE   5  
ATOM 9006  H HH11 . ARG A 1 8  ? 13.380  2.120   -20.857 1.00 4.48  ? 8  ARG A HH11 5  
ATOM 9007  H HH12 . ARG A 1 8  ? 12.635  0.617   -21.286 1.00 4.97  ? 8  ARG A HH12 5  
ATOM 9008  H HH21 . ARG A 1 8  ? 14.163  0.446   -24.403 1.00 4.37  ? 8  ARG A HH21 5  
ATOM 9009  H HH22 . ARG A 1 8  ? 13.079  -0.334  -23.300 1.00 4.82  ? 8  ARG A HH22 5  
ATOM 9010  N N    . CYS A 1 9  ? 11.865  6.484   -20.186 1.00 0.86  ? 9  CYS A N    5  
ATOM 9011  C CA   . CYS A 1 9  ? 10.594  6.347   -19.420 1.00 0.66  ? 9  CYS A CA   5  
ATOM 9012  C C    . CYS A 1 9  ? 9.580   7.422   -19.862 1.00 0.61  ? 9  CYS A C    5  
ATOM 9013  O O    . CYS A 1 9  ? 9.917   8.355   -20.568 1.00 0.84  ? 9  CYS A O    5  
ATOM 9014  C CB   . CYS A 1 9  ? 10.933  6.482   -17.932 1.00 0.66  ? 9  CYS A CB   5  
ATOM 9015  S SG   . CYS A 1 9  ? 12.271  5.310   -17.527 1.00 0.94  ? 9  CYS A SG   5  
ATOM 9016  H H    . CYS A 1 9  ? 12.703  6.598   -19.698 1.00 1.09  ? 9  CYS A H    5  
ATOM 9017  H HA   . CYS A 1 9  ? 10.174  5.368   -19.600 1.00 0.74  ? 9  CYS A HA   5  
ATOM 9018  H HB2  . CYS A 1 9  ? 11.249  7.492   -17.721 1.00 0.78  ? 9  CYS A HB2  5  
ATOM 9019  H HB3  . CYS A 1 9  ? 10.061  6.248   -17.343 1.00 0.69  ? 9  CYS A HB3  5  
ATOM 9020  N N    . GLN A 1 10 ? 8.331   7.273   -19.480 1.00 0.51  ? 10 GLN A N    5  
ATOM 9021  C CA   . GLN A 1 10 ? 7.276   8.253   -19.913 1.00 0.47  ? 10 GLN A CA   5  
ATOM 9022  C C    . GLN A 1 10 ? 6.900   9.239   -18.792 1.00 0.39  ? 10 GLN A C    5  
ATOM 9023  O O    . GLN A 1 10 ? 6.260   10.238  -19.058 1.00 0.40  ? 10 GLN A O    5  
ATOM 9024  C CB   . GLN A 1 10 ? 6.018   7.481   -20.324 1.00 0.53  ? 10 GLN A CB   5  
ATOM 9025  C CG   . GLN A 1 10 ? 5.816   7.574   -21.843 1.00 0.64  ? 10 GLN A CG   5  
ATOM 9026  C CD   . GLN A 1 10 ? 4.358   7.251   -22.197 1.00 1.20  ? 10 GLN A CD   5  
ATOM 9027  O OE1  . GLN A 1 10 ? 3.798   6.289   -21.707 1.00 1.87  ? 10 GLN A OE1  5  
ATOM 9028  N NE2  . GLN A 1 10 ? 3.717   8.017   -23.040 1.00 1.84  ? 10 GLN A NE2  5  
ATOM 9029  H H    . GLN A 1 10 ? 8.083   6.499   -18.932 1.00 0.64  ? 10 GLN A H    5  
ATOM 9030  H HA   . GLN A 1 10 ? 7.639   8.810   -20.765 1.00 0.52  ? 10 GLN A HA   5  
ATOM 9031  H HB2  . GLN A 1 10 ? 6.124   6.446   -20.037 1.00 0.58  ? 10 GLN A HB2  5  
ATOM 9032  H HB3  . GLN A 1 10 ? 5.163   7.904   -19.822 1.00 0.50  ? 10 GLN A HB3  5  
ATOM 9033  H HG2  . GLN A 1 10 ? 6.053   8.574   -22.176 1.00 1.10  ? 10 GLN A HG2  5  
ATOM 9034  H HG3  . GLN A 1 10 ? 6.467   6.867   -22.335 1.00 1.15  ? 10 GLN A HG3  5  
ATOM 9035  H HE21 . GLN A 1 10 ? 4.166   8.791   -23.440 1.00 2.04  ? 10 GLN A HE21 5  
ATOM 9036  H HE22 . GLN A 1 10 ? 2.787   7.817   -23.273 1.00 2.45  ? 10 GLN A HE22 5  
ATOM 9037  N N    . CYS A 1 11 ? 7.264   8.966   -17.551 1.00 0.34  ? 11 CYS A N    5  
ATOM 9038  C CA   . CYS A 1 11 ? 6.905   9.889   -16.412 1.00 0.31  ? 11 CYS A CA   5  
ATOM 9039  C C    . CYS A 1 11 ? 6.982   11.357  -16.852 1.00 0.36  ? 11 CYS A C    5  
ATOM 9040  O O    . CYS A 1 11 ? 7.961   11.789  -17.436 1.00 0.50  ? 11 CYS A O    5  
ATOM 9041  C CB   . CYS A 1 11 ? 7.873   9.676   -15.251 1.00 0.30  ? 11 CYS A CB   5  
ATOM 9042  S SG   . CYS A 1 11 ? 7.482   8.140   -14.385 1.00 0.30  ? 11 CYS A SG   5  
ATOM 9043  H H    . CYS A 1 11 ? 7.764   8.148   -17.364 1.00 0.36  ? 11 CYS A H    5  
ATOM 9044  H HA   . CYS A 1 11 ? 5.902   9.671   -16.073 1.00 0.31  ? 11 CYS A HA   5  
ATOM 9045  H HB2  . CYS A 1 11 ? 8.875   9.623   -15.627 1.00 0.34  ? 11 CYS A HB2  5  
ATOM 9046  H HB3  . CYS A 1 11 ? 7.792   10.500  -14.568 1.00 0.31  ? 11 CYS A HB3  5  
ATOM 9047  N N    . LEU A 1 12 ? 5.960   12.127  -16.560 1.00 0.40  ? 12 LEU A N    5  
ATOM 9048  C CA   . LEU A 1 12 ? 5.968   13.573  -16.942 1.00 0.44  ? 12 LEU A CA   5  
ATOM 9049  C C    . LEU A 1 12 ? 6.999   14.272  -16.053 1.00 0.45  ? 12 LEU A C    5  
ATOM 9050  O O    . LEU A 1 12 ? 8.042   14.707  -16.500 1.00 0.48  ? 12 LEU A O    5  
ATOM 9051  C CB   . LEU A 1 12 ? 4.571   14.200  -16.704 1.00 0.49  ? 12 LEU A CB   5  
ATOM 9052  C CG   . LEU A 1 12 ? 3.447   13.243  -17.127 1.00 0.82  ? 12 LEU A CG   5  
ATOM 9053  C CD1  . LEU A 1 12 ? 2.107   13.802  -16.645 1.00 1.04  ? 12 LEU A CD1  5  
ATOM 9054  C CD2  . LEU A 1 12 ? 3.417   13.113  -18.649 1.00 1.56  ? 12 LEU A CD2  5  
ATOM 9055  H H    . LEU A 1 12 ? 5.198   11.757  -16.072 1.00 0.49  ? 12 LEU A H    5  
ATOM 9056  H HA   . LEU A 1 12 ? 6.248   13.677  -17.980 1.00 0.48  ? 12 LEU A HA   5  
ATOM 9057  H HB2  . LEU A 1 12 ? 4.455   14.427  -15.655 1.00 0.97  ? 12 LEU A HB2  5  
ATOM 9058  H HB3  . LEU A 1 12 ? 4.488   15.113  -17.273 1.00 0.98  ? 12 LEU A HB3  5  
ATOM 9059  H HG   . LEU A 1 12 ? 3.607   12.273  -16.683 1.00 1.56  ? 12 LEU A HG   5  
ATOM 9060  H HD11 . LEU A 1 12 ? 2.090   14.872  -16.788 1.00 1.31  ? 12 LEU A HD11 5  
ATOM 9061  H HD12 . LEU A 1 12 ? 1.303   13.352  -17.209 1.00 1.71  ? 12 LEU A HD12 5  
ATOM 9062  H HD13 . LEU A 1 12 ? 1.980   13.577  -15.596 1.00 1.40  ? 12 LEU A HD13 5  
ATOM 9063  H HD21 . LEU A 1 12 ? 3.377   14.096  -19.093 1.00 2.03  ? 12 LEU A HD21 5  
ATOM 9064  H HD22 . LEU A 1 12 ? 4.305   12.600  -18.983 1.00 2.07  ? 12 LEU A HD22 5  
ATOM 9065  H HD23 . LEU A 1 12 ? 2.543   12.549  -18.942 1.00 2.10  ? 12 LEU A HD23 5  
ATOM 9066  N N    . GLN A 1 13 ? 6.697   14.342  -14.787 1.00 0.43  ? 13 GLN A N    5  
ATOM 9067  C CA   . GLN A 1 13 ? 7.596   14.961  -13.776 1.00 0.45  ? 13 GLN A CA   5  
ATOM 9068  C C    . GLN A 1 13 ? 6.989   14.657  -12.399 1.00 0.42  ? 13 GLN A C    5  
ATOM 9069  O O    . GLN A 1 13 ? 6.906   15.510  -11.538 1.00 0.60  ? 13 GLN A O    5  
ATOM 9070  C CB   . GLN A 1 13 ? 7.660   16.470  -14.008 1.00 0.52  ? 13 GLN A CB   5  
ATOM 9071  C CG   . GLN A 1 13 ? 8.971   16.840  -14.712 1.00 1.11  ? 13 GLN A CG   5  
ATOM 9072  C CD   . GLN A 1 13 ? 8.678   17.767  -15.898 1.00 1.40  ? 13 GLN A CD   5  
ATOM 9073  O OE1  . GLN A 1 13 ? 8.928   17.414  -17.033 1.00 1.77  ? 13 GLN A OE1  5  
ATOM 9074  N NE2  . GLN A 1 13 ? 8.158   18.946  -15.682 1.00 2.09  ? 13 GLN A NE2  5  
ATOM 9075  H H    . GLN A 1 13 ? 5.854   13.962  -14.486 1.00 0.42  ? 13 GLN A H    5  
ATOM 9076  H HA   . GLN A 1 13 ? 8.581   14.526  -13.846 1.00 0.46  ? 13 GLN A HA   5  
ATOM 9077  H HB2  . GLN A 1 13 ? 6.823   16.773  -14.622 1.00 0.98  ? 13 GLN A HB2  5  
ATOM 9078  H HB3  . GLN A 1 13 ? 7.604   16.969  -13.062 1.00 0.85  ? 13 GLN A HB3  5  
ATOM 9079  H HG2  . GLN A 1 13 ? 9.622   17.345  -14.014 1.00 1.50  ? 13 GLN A HG2  5  
ATOM 9080  H HG3  . GLN A 1 13 ? 9.455   15.944  -15.071 1.00 1.66  ? 13 GLN A HG3  5  
ATOM 9081  H HE21 . GLN A 1 13 ? 7.956   19.234  -14.767 1.00 2.59  ? 13 GLN A HE21 5  
ATOM 9082  H HE22 . GLN A 1 13 ? 7.968   19.542  -16.437 1.00 2.41  ? 13 GLN A HE22 5  
ATOM 9083  N N    . THR A 1 14 ? 6.524   13.433  -12.242 1.00 0.36  ? 14 THR A N    5  
ATOM 9084  C CA   . THR A 1 14 ? 5.842   12.957  -10.995 1.00 0.32  ? 14 THR A CA   5  
ATOM 9085  C C    . THR A 1 14 ? 5.076   14.064  -10.278 1.00 0.35  ? 14 THR A C    5  
ATOM 9086  O O    . THR A 1 14 ? 5.615   14.809  -9.478  1.00 0.39  ? 14 THR A O    5  
ATOM 9087  C CB   . THR A 1 14 ? 6.790   12.296  -10.020 1.00 0.32  ? 14 THR A CB   5  
ATOM 9088  O OG1  . THR A 1 14 ? 7.982   13.063  -9.890  1.00 0.38  ? 14 THR A OG1  5  
ATOM 9089  C CG2  . THR A 1 14 ? 7.108   10.890  -10.522 1.00 0.31  ? 14 THR A CG2  5  
ATOM 9090  H H    . THR A 1 14 ? 6.600   12.808  -12.993 1.00 0.51  ? 14 THR A H    5  
ATOM 9091  H HA   . THR A 1 14 ? 5.133   12.216  -11.297 1.00 0.30  ? 14 THR A HA   5  
ATOM 9092  H HB   . THR A 1 14 ? 6.279   12.221  -9.068  1.00 0.32  ? 14 THR A HB   5  
ATOM 9093  H HG1  . THR A 1 14 ? 8.448   12.760  -9.108  1.00 0.69  ? 14 THR A HG1  5  
ATOM 9094  H HG21 . THR A 1 14 ? 6.193   10.412  -10.842 1.00 1.01  ? 14 THR A HG21 5  
ATOM 9095  H HG22 . THR A 1 14 ? 7.791   10.953  -11.355 1.00 1.05  ? 14 THR A HG22 5  
ATOM 9096  H HG23 . THR A 1 14 ? 7.554   10.317  -9.727  1.00 1.08  ? 14 THR A HG23 5  
ATOM 9097  N N    . LEU A 1 15 ? 3.805   14.133  -10.536 1.00 0.36  ? 15 LEU A N    5  
ATOM 9098  C CA   . LEU A 1 15 ? 2.951   15.150  -9.860  1.00 0.41  ? 15 LEU A CA   5  
ATOM 9099  C C    . LEU A 1 15 ? 2.712   14.709  -8.410  1.00 0.35  ? 15 LEU A C    5  
ATOM 9100  O O    . LEU A 1 15 ? 2.966   13.574  -8.049  1.00 0.52  ? 15 LEU A O    5  
ATOM 9101  C CB   . LEU A 1 15 ? 1.615   15.278  -10.600 1.00 0.57  ? 15 LEU A CB   5  
ATOM 9102  C CG   . LEU A 1 15 ? 1.863   15.877  -11.988 1.00 0.64  ? 15 LEU A CG   5  
ATOM 9103  C CD1  . LEU A 1 15 ? 0.797   15.377  -12.968 1.00 0.74  ? 15 LEU A CD1  5  
ATOM 9104  C CD2  . LEU A 1 15 ? 1.803   17.404  -11.900 1.00 1.76  ? 15 LEU A CD2  5  
ATOM 9105  H H    . LEU A 1 15 ? 3.407   13.485  -11.161 1.00 0.35  ? 15 LEU A H    5  
ATOM 9106  H HA   . LEU A 1 15 ? 3.459   16.104  -9.863  1.00 0.51  ? 15 LEU A HA   5  
ATOM 9107  H HB2  . LEU A 1 15 ? 1.164   14.301  -10.700 1.00 1.12  ? 15 LEU A HB2  5  
ATOM 9108  H HB3  . LEU A 1 15 ? 0.955   15.925  -10.042 1.00 0.90  ? 15 LEU A HB3  5  
ATOM 9109  H HG   . LEU A 1 15 ? 2.840   15.574  -12.339 1.00 1.32  ? 15 LEU A HG   5  
ATOM 9110  H HD11 . LEU A 1 15 ? 0.411   14.427  -12.629 1.00 1.29  ? 15 LEU A HD11 5  
ATOM 9111  H HD12 . LEU A 1 15 ? -0.009  16.095  -13.020 1.00 1.44  ? 15 LEU A HD12 5  
ATOM 9112  H HD13 . LEU A 1 15 ? 1.237   15.258  -13.947 1.00 1.31  ? 15 LEU A HD13 5  
ATOM 9113  H HD21 . LEU A 1 15 ? 2.480   17.746  -11.131 1.00 2.29  ? 15 LEU A HD21 5  
ATOM 9114  H HD22 . LEU A 1 15 ? 2.091   17.830  -12.849 1.00 2.30  ? 15 LEU A HD22 5  
ATOM 9115  H HD23 . LEU A 1 15 ? 0.797   17.711  -11.657 1.00 2.30  ? 15 LEU A HD23 5  
ATOM 9116  N N    . GLN A 1 16 ? 2.243   15.597  -7.577  1.00 0.47  ? 16 GLN A N    5  
ATOM 9117  C CA   . GLN A 1 16 ? 2.008   15.236  -6.150  1.00 0.41  ? 16 GLN A CA   5  
ATOM 9118  C C    . GLN A 1 16 ? 0.523   14.976  -5.906  1.00 0.39  ? 16 GLN A C    5  
ATOM 9119  O O    . GLN A 1 16 ? -0.162  15.740  -5.249  1.00 0.47  ? 16 GLN A O    5  
ATOM 9120  C CB   . GLN A 1 16 ? 2.504   16.367  -5.242  1.00 0.48  ? 16 GLN A CB   5  
ATOM 9121  C CG   . GLN A 1 16 ? 3.924   16.054  -4.765  1.00 0.60  ? 16 GLN A CG   5  
ATOM 9122  C CD   . GLN A 1 16 ? 4.382   17.134  -3.781  1.00 0.77  ? 16 GLN A CD   5  
ATOM 9123  O OE1  . GLN A 1 16 ? 4.973   18.119  -4.176  1.00 1.48  ? 16 GLN A OE1  5  
ATOM 9124  N NE2  . GLN A 1 16 ? 4.133   16.991  -2.506  1.00 1.31  ? 16 GLN A NE2  5  
ATOM 9125  H H    . GLN A 1 16 ? 2.057   16.498  -7.885  1.00 0.72  ? 16 GLN A H    5  
ATOM 9126  H HA   . GLN A 1 16 ? 2.550   14.331  -5.925  1.00 0.43  ? 16 GLN A HA   5  
ATOM 9127  H HB2  . GLN A 1 16 ? 2.504   17.297  -5.791  1.00 0.51  ? 16 GLN A HB2  5  
ATOM 9128  H HB3  . GLN A 1 16 ? 1.852   16.456  -4.386  1.00 0.49  ? 16 GLN A HB3  5  
ATOM 9129  H HG2  . GLN A 1 16 ? 3.934   15.091  -4.276  1.00 0.75  ? 16 GLN A HG2  5  
ATOM 9130  H HG3  . GLN A 1 16 ? 4.592   16.036  -5.613  1.00 0.72  ? 16 GLN A HG3  5  
ATOM 9131  H HE21 . GLN A 1 16 ? 3.657   16.197  -2.184  1.00 1.98  ? 16 GLN A HE21 5  
ATOM 9132  H HE22 . GLN A 1 16 ? 4.424   17.678  -1.871  1.00 1.46  ? 16 GLN A HE22 5  
ATOM 9133  N N    . GLY A 1 17 ? 0.037   13.878  -6.416  1.00 0.36  ? 17 GLY A N    5  
ATOM 9134  C CA   . GLY A 1 17 ? -1.389  13.500  -6.210  1.00 0.45  ? 17 GLY A CA   5  
ATOM 9135  C C    . GLY A 1 17 ? -2.317  14.514  -6.868  1.00 0.41  ? 17 GLY A C    5  
ATOM 9136  O O    . GLY A 1 17 ? -2.824  15.413  -6.221  1.00 0.57  ? 17 GLY A O    5  
ATOM 9137  H H    . GLY A 1 17 ? 0.627   13.285  -6.927  1.00 0.34  ? 17 GLY A H    5  
ATOM 9138  H HA2  . GLY A 1 17 ? -1.565  12.526  -6.640  1.00 0.56  ? 17 GLY A HA2  5  
ATOM 9139  H HA3  . GLY A 1 17 ? -1.599  13.465  -5.152  1.00 0.59  ? 17 GLY A HA3  5  
ATOM 9140  N N    . ILE A 1 18 ? -2.568  14.359  -8.140  1.00 0.39  ? 18 ILE A N    5  
ATOM 9141  C CA   . ILE A 1 18 ? -3.494  15.293  -8.831  1.00 0.49  ? 18 ILE A CA   5  
ATOM 9142  C C    . ILE A 1 18 ? -4.926  14.827  -8.563  1.00 0.50  ? 18 ILE A C    5  
ATOM 9143  O O    . ILE A 1 18 ? -5.154  13.941  -7.756  1.00 0.72  ? 18 ILE A O    5  
ATOM 9144  C CB   . ILE A 1 18 ? -3.178  15.368  -10.345 1.00 0.67  ? 18 ILE A CB   5  
ATOM 9145  C CG1  . ILE A 1 18 ? -3.923  14.282  -11.137 1.00 0.72  ? 18 ILE A CG1  5  
ATOM 9146  C CG2  . ILE A 1 18 ? -1.671  15.222  -10.578 1.00 0.74  ? 18 ILE A CG2  5  
ATOM 9147  C CD1  . ILE A 1 18 ? -3.623  12.912  -10.546 1.00 0.66  ? 18 ILE A CD1  5  
ATOM 9148  H H    . ILE A 1 18 ? -2.170  13.614  -8.628  1.00 0.45  ? 18 ILE A H    5  
ATOM 9149  H HA   . ILE A 1 18 ? -3.377  16.272  -8.409  1.00 0.54  ? 18 ILE A HA   5  
ATOM 9150  H HB   . ILE A 1 18 ? -3.484  16.333  -10.704 1.00 0.79  ? 18 ILE A HB   5  
ATOM 9151  H HG12 . ILE A 1 18 ? -4.984  14.467  -11.093 1.00 0.70  ? 18 ILE A HG12 5  
ATOM 9152  H HG13 . ILE A 1 18 ? -3.598  14.305  -12.166 1.00 0.91  ? 18 ILE A HG13 5  
ATOM 9153  H HG21 . ILE A 1 18 ? -1.134  15.670  -9.755  1.00 1.14  ? 18 ILE A HG21 5  
ATOM 9154  H HG22 . ILE A 1 18 ? -1.414  14.174  -10.647 1.00 1.33  ? 18 ILE A HG22 5  
ATOM 9155  H HG23 . ILE A 1 18 ? -1.399  15.719  -11.497 1.00 1.17  ? 18 ILE A HG23 5  
ATOM 9156  H HD11 . ILE A 1 18 ? -2.555  12.792  -10.451 1.00 1.04  ? 18 ILE A HD11 5  
ATOM 9157  H HD12 . ILE A 1 18 ? -4.084  12.835  -9.573  1.00 1.35  ? 18 ILE A HD12 5  
ATOM 9158  H HD13 . ILE A 1 18 ? -4.019  12.150  -11.196 1.00 1.18  ? 18 ILE A HD13 5  
ATOM 9159  N N    . HIS A 1 19 ? -5.890  15.409  -9.209  1.00 0.45  ? 19 HIS A N    5  
ATOM 9160  C CA   . HIS A 1 19 ? -7.294  14.990  -8.963  1.00 0.47  ? 19 HIS A CA   5  
ATOM 9161  C C    . HIS A 1 19 ? -7.694  13.944  -10.027 1.00 0.39  ? 19 HIS A C    5  
ATOM 9162  O O    . HIS A 1 19 ? -7.258  14.033  -11.160 1.00 0.35  ? 19 HIS A O    5  
ATOM 9163  C CB   . HIS A 1 19 ? -8.199  16.243  -8.981  1.00 0.54  ? 19 HIS A CB   5  
ATOM 9164  C CG   . HIS A 1 19 ? -9.283  16.131  -10.013 1.00 0.60  ? 19 HIS A CG   5  
ATOM 9165  N ND1  . HIS A 1 19 ? -10.622 16.076  -9.673  1.00 0.75  ? 19 HIS A ND1  5  
ATOM 9166  C CD2  . HIS A 1 19 ? -9.236  16.073  -11.379 1.00 0.60  ? 19 HIS A CD2  5  
ATOM 9167  C CE1  . HIS A 1 19 ? -11.323 15.989  -10.815 1.00 0.81  ? 19 HIS A CE1  5  
ATOM 9168  N NE2  . HIS A 1 19 ? -10.526 15.986  -11.888 1.00 0.74  ? 19 HIS A NE2  5  
ATOM 9169  H H    . HIS A 1 19 ? -5.689  16.118  -9.851  1.00 0.55  ? 19 HIS A H    5  
ATOM 9170  H HA   . HIS A 1 19 ? -7.339  14.539  -7.985  1.00 0.50  ? 19 HIS A HA   5  
ATOM 9171  H HB2  . HIS A 1 19 ? -8.651  16.363  -8.010  1.00 0.64  ? 19 HIS A HB2  5  
ATOM 9172  H HB3  . HIS A 1 19 ? -7.592  17.111  -9.196  1.00 0.52  ? 19 HIS A HB3  5  
ATOM 9173  H HD1  . HIS A 1 19 ? -10.992 16.097  -8.765  1.00 0.84  ? 19 HIS A HD1  5  
ATOM 9174  H HD2  . HIS A 1 19 ? -8.329  16.070  -11.964 1.00 0.55  ? 19 HIS A HD2  5  
ATOM 9175  H HE1  . HIS A 1 19 ? -12.396 15.913  -10.858 1.00 0.93  ? 19 HIS A HE1  5  
ATOM 9176  N N    . PRO A 1 20 ? -8.488  12.964  -9.631  1.00 0.39  ? 20 PRO A N    5  
ATOM 9177  C CA   . PRO A 1 20 ? -8.919  11.888  -10.538 1.00 0.35  ? 20 PRO A CA   5  
ATOM 9178  C C    . PRO A 1 20 ? -10.020 12.376  -11.503 1.00 0.37  ? 20 PRO A C    5  
ATOM 9179  O O    . PRO A 1 20 ? -9.771  13.268  -12.292 1.00 0.43  ? 20 PRO A O    5  
ATOM 9180  C CB   . PRO A 1 20 ? -9.394  10.785  -9.585  1.00 0.40  ? 20 PRO A CB   5  
ATOM 9181  C CG   . PRO A 1 20 ? -9.758  11.486  -8.260  1.00 0.47  ? 20 PRO A CG   5  
ATOM 9182  C CD   . PRO A 1 20 ? -9.014  12.829  -8.257  1.00 0.46  ? 20 PRO A CD   5  
ATOM 9183  H HA   . PRO A 1 20 ? -8.076  11.533  -11.109 1.00 0.32  ? 20 PRO A HA   5  
ATOM 9184  H HB2  . PRO A 1 20 ? -10.248 10.271  -9.989  1.00 0.40  ? 20 PRO A HB2  5  
ATOM 9185  H HB3  . PRO A 1 20 ? -8.592  10.085  -9.412  1.00 0.40  ? 20 PRO A HB3  5  
ATOM 9186  H HG2  . PRO A 1 20 ? -10.824 11.652  -8.212  1.00 0.50  ? 20 PRO A HG2  5  
ATOM 9187  H HG3  . PRO A 1 20 ? -9.433  10.889  -7.425  1.00 0.52  ? 20 PRO A HG3  5  
ATOM 9188  H HD2  . PRO A 1 20 ? -9.699  13.630  -8.032  1.00 0.50  ? 20 PRO A HD2  5  
ATOM 9189  H HD3  . PRO A 1 20 ? -8.204  12.802  -7.549  1.00 0.47  ? 20 PRO A HD3  5  
ATOM 9190  N N    . LYS A 1 21 ? -11.204 11.773  -11.503 1.00 0.38  ? 21 LYS A N    5  
ATOM 9191  C CA   . LYS A 1 21 ? -12.283 12.162  -12.475 1.00 0.40  ? 21 LYS A CA   5  
ATOM 9192  C C    . LYS A 1 21 ? -11.895 11.607  -13.852 1.00 0.38  ? 21 LYS A C    5  
ATOM 9193  O O    . LYS A 1 21 ? -12.666 10.921  -14.498 1.00 0.42  ? 21 LYS A O    5  
ATOM 9194  C CB   . LYS A 1 21 ? -12.464 13.684  -12.544 1.00 0.42  ? 21 LYS A CB   5  
ATOM 9195  C CG   . LYS A 1 21 ? -13.808 14.006  -13.207 1.00 0.51  ? 21 LYS A CG   5  
ATOM 9196  C CD   . LYS A 1 21 ? -14.243 15.430  -12.847 1.00 0.98  ? 21 LYS A CD   5  
ATOM 9197  C CE   . LYS A 1 21 ? -13.499 16.437  -13.729 1.00 1.47  ? 21 LYS A CE   5  
ATOM 9198  N NZ   . LYS A 1 21 ? -14.347 17.647  -13.931 1.00 2.14  ? 21 LYS A NZ   5  
ATOM 9199  H H    . LYS A 1 21 ? -11.371 11.032  -10.895 1.00 0.41  ? 21 LYS A H    5  
ATOM 9200  H HA   . LYS A 1 21 ? -13.211 11.705  -12.166 1.00 0.43  ? 21 LYS A HA   5  
ATOM 9201  H HB2  . LYS A 1 21 ? -12.448 14.092  -11.545 1.00 0.42  ? 21 LYS A HB2  5  
ATOM 9202  H HB3  . LYS A 1 21 ? -11.665 14.119  -13.126 1.00 0.40  ? 21 LYS A HB3  5  
ATOM 9203  H HG2  . LYS A 1 21 ? -13.707 13.921  -14.279 1.00 0.97  ? 21 LYS A HG2  5  
ATOM 9204  H HG3  . LYS A 1 21 ? -14.554 13.307  -12.860 1.00 0.86  ? 21 LYS A HG3  5  
ATOM 9205  H HD2  . LYS A 1 21 ? -15.307 15.529  -13.008 1.00 1.62  ? 21 LYS A HD2  5  
ATOM 9206  H HD3  . LYS A 1 21 ? -14.017 15.626  -11.810 1.00 1.69  ? 21 LYS A HD3  5  
ATOM 9207  H HE2  . LYS A 1 21 ? -12.574 16.722  -13.249 1.00 1.83  ? 21 LYS A HE2  5  
ATOM 9208  H HE3  . LYS A 1 21 ? -13.283 15.986  -14.687 1.00 1.91  ? 21 LYS A HE3  5  
ATOM 9209  H HZ1  . LYS A 1 21 ? -15.254 17.370  -14.356 1.00 2.32  ? 21 LYS A HZ1  5  
ATOM 9210  H HZ2  . LYS A 1 21 ? -14.519 18.106  -13.012 1.00 2.71  ? 21 LYS A HZ2  5  
ATOM 9211  H HZ3  . LYS A 1 21 ? -13.858 18.311  -14.563 1.00 2.51  ? 21 LYS A HZ3  5  
ATOM 9212  N N    . ASN A 1 22 ? -10.683 11.865  -14.273 1.00 0.36  ? 22 ASN A N    5  
ATOM 9213  C CA   . ASN A 1 22 ? -10.174 11.340  -15.558 1.00 0.36  ? 22 ASN A CA   5  
ATOM 9214  C C    . ASN A 1 22 ? -9.328  10.117  -15.223 1.00 0.34  ? 22 ASN A C    5  
ATOM 9215  O O    . ASN A 1 22 ? -9.492  9.048   -15.767 1.00 0.36  ? 22 ASN A O    5  
ATOM 9216  C CB   . ASN A 1 22 ? -9.268  12.387  -16.213 1.00 0.36  ? 22 ASN A CB   5  
ATOM 9217  C CG   . ASN A 1 22 ? -9.804  13.800  -15.969 1.00 0.38  ? 22 ASN A CG   5  
ATOM 9218  O OD1  . ASN A 1 22 ? -10.749 14.226  -16.603 1.00 0.42  ? 22 ASN A OD1  5  
ATOM 9219  N ND2  . ASN A 1 22 ? -9.231  14.548  -15.062 1.00 0.37  ? 22 ASN A ND2  5  
ATOM 9220  H H    . ASN A 1 22 ? -10.077 12.387  -13.718 1.00 0.35  ? 22 ASN A H    5  
ATOM 9221  H HA   . ASN A 1 22 ? -10.988 11.075  -16.213 1.00 0.39  ? 22 ASN A HA   5  
ATOM 9222  H HB2  . ASN A 1 22 ? -8.276  12.310  -15.792 1.00 0.33  ? 22 ASN A HB2  5  
ATOM 9223  H HB3  . ASN A 1 22 ? -9.217  12.201  -17.264 1.00 0.38  ? 22 ASN A HB3  5  
ATOM 9224  H HD21 . ASN A 1 22 ? -8.468  14.201  -14.550 1.00 0.34  ? 22 ASN A HD21 5  
ATOM 9225  H HD22 . ASN A 1 22 ? -9.560  15.454  -14.894 1.00 0.39  ? 22 ASN A HD22 5  
ATOM 9226  N N    . ILE A 1 23 ? -8.427  10.296  -14.299 1.00 0.31  ? 23 ILE A N    5  
ATOM 9227  C CA   . ILE A 1 23 ? -7.528  9.210   -13.850 1.00 0.30  ? 23 ILE A CA   5  
ATOM 9228  C C    . ILE A 1 23 ? -8.345  7.938   -13.552 1.00 0.34  ? 23 ILE A C    5  
ATOM 9229  O O    . ILE A 1 23 ? -9.086  7.872   -12.589 1.00 0.37  ? 23 ILE A O    5  
ATOM 9230  C CB   . ILE A 1 23 ? -6.832  9.730   -12.588 1.00 0.29  ? 23 ILE A CB   5  
ATOM 9231  C CG1  . ILE A 1 23 ? -5.581  10.518  -12.979 1.00 0.27  ? 23 ILE A CG1  5  
ATOM 9232  C CG2  . ILE A 1 23 ? -6.447  8.583   -11.670 1.00 0.33  ? 23 ILE A CG2  5  
ATOM 9233  C CD1  . ILE A 1 23 ? -5.993  11.891  -13.514 1.00 0.26  ? 23 ILE A CD1  5  
ATOM 9234  H H    . ILE A 1 23 ? -8.344  11.175  -13.879 1.00 0.31  ? 23 ILE A H    5  
ATOM 9235  H HA   . ILE A 1 23 ? -6.791  9.005   -14.617 1.00 0.29  ? 23 ILE A HA   5  
ATOM 9236  H HB   . ILE A 1 23 ? -7.514  10.387  -12.070 1.00 0.31  ? 23 ILE A HB   5  
ATOM 9237  H HG12 . ILE A 1 23 ? -4.950  10.644  -12.112 1.00 0.29  ? 23 ILE A HG12 5  
ATOM 9238  H HG13 . ILE A 1 23 ? -5.040  9.982   -13.744 1.00 0.26  ? 23 ILE A HG13 5  
ATOM 9239  H HG21 . ILE A 1 23 ? -6.153  7.734   -12.265 1.00 1.08  ? 23 ILE A HG21 5  
ATOM 9240  H HG22 . ILE A 1 23 ? -5.630  8.889   -11.040 1.00 1.00  ? 23 ILE A HG22 5  
ATOM 9241  H HG23 . ILE A 1 23 ? -7.298  8.321   -11.058 1.00 1.10  ? 23 ILE A HG23 5  
ATOM 9242  H HD11 . ILE A 1 23 ? -6.773  12.301  -12.889 1.00 0.97  ? 23 ILE A HD11 5  
ATOM 9243  H HD12 . ILE A 1 23 ? -5.140  12.551  -13.507 1.00 1.04  ? 23 ILE A HD12 5  
ATOM 9244  H HD13 . ILE A 1 23 ? -6.360  11.786  -14.524 1.00 1.03  ? 23 ILE A HD13 5  
ATOM 9245  N N    . GLN A 1 24 ? -8.212  6.939   -14.386 1.00 0.36  ? 24 GLN A N    5  
ATOM 9246  C CA   . GLN A 1 24 ? -8.952  5.672   -14.201 1.00 0.42  ? 24 GLN A CA   5  
ATOM 9247  C C    . GLN A 1 24 ? -8.002  4.562   -13.744 1.00 0.37  ? 24 GLN A C    5  
ATOM 9248  O O    . GLN A 1 24 ? -8.434  3.583   -13.162 1.00 0.39  ? 24 GLN A O    5  
ATOM 9249  C CB   . GLN A 1 24 ? -9.565  5.306   -15.547 1.00 0.48  ? 24 GLN A CB   5  
ATOM 9250  C CG   . GLN A 1 24 ? -11.079 5.080   -15.409 1.00 0.57  ? 24 GLN A CG   5  
ATOM 9251  C CD   . GLN A 1 24 ? -11.790 6.365   -14.959 1.00 1.16  ? 24 GLN A CD   5  
ATOM 9252  O OE1  . GLN A 1 24 ? -11.165 7.366   -14.679 1.00 1.82  ? 24 GLN A OE1  5  
ATOM 9253  N NE2  . GLN A 1 24 ? -13.094 6.375   -14.875 1.00 1.58  ? 24 GLN A NE2  5  
ATOM 9254  H H    . GLN A 1 24 ? -7.617  7.021   -15.161 1.00 0.36  ? 24 GLN A H    5  
ATOM 9255  H HA   . GLN A 1 24 ? -9.738  5.797   -13.468 1.00 0.46  ? 24 GLN A HA   5  
ATOM 9256  H HB2  . GLN A 1 24 ? -9.391  6.116   -16.242 1.00 0.48  ? 24 GLN A HB2  5  
ATOM 9257  H HB3  . GLN A 1 24 ? -9.089  4.423   -15.916 1.00 0.48  ? 24 GLN A HB3  5  
ATOM 9258  H HG2  . GLN A 1 24 ? -11.477 4.770   -16.364 1.00 0.66  ? 24 GLN A HG2  5  
ATOM 9259  H HG3  . GLN A 1 24 ? -11.255 4.301   -14.683 1.00 0.91  ? 24 GLN A HG3  5  
ATOM 9260  H HE21 . GLN A 1 24 ? -13.607 5.571   -15.096 1.00 1.80  ? 24 GLN A HE21 5  
ATOM 9261  H HE22 . GLN A 1 24 ? -13.559 7.189   -14.587 1.00 2.04  ? 24 GLN A HE22 5  
ATOM 9262  N N    . SER A 1 25 ? -6.715  4.696   -13.990 1.00 0.33  ? 25 SER A N    5  
ATOM 9263  C CA   . SER A 1 25 ? -5.774  3.625   -13.556 1.00 0.29  ? 25 SER A CA   5  
ATOM 9264  C C    . SER A 1 25 ? -4.362  4.171   -13.378 1.00 0.27  ? 25 SER A C    5  
ATOM 9265  O O    . SER A 1 25 ? -4.106  5.346   -13.549 1.00 0.29  ? 25 SER A O    5  
ATOM 9266  C CB   . SER A 1 25 ? -5.729  2.517   -14.593 1.00 0.31  ? 25 SER A CB   5  
ATOM 9267  O OG   . SER A 1 25 ? -5.220  3.026   -15.819 1.00 0.34  ? 25 SER A OG   5  
ATOM 9268  H H    . SER A 1 25 ? -6.374  5.494   -14.452 1.00 0.33  ? 25 SER A H    5  
ATOM 9269  H HA   . SER A 1 25 ? -6.115  3.213   -12.623 1.00 0.29  ? 25 SER A HA   5  
ATOM 9270  H HB2  . SER A 1 25 ? -5.083  1.739   -14.234 1.00 0.31  ? 25 SER A HB2  5  
ATOM 9271  H HB3  . SER A 1 25 ? -6.719  2.121   -14.737 1.00 0.30  ? 25 SER A HB3  5  
ATOM 9272  H HG   . SER A 1 25 ? -4.367  2.616   -15.980 1.00 0.78  ? 25 SER A HG   5  
ATOM 9273  N N    . VAL A 1 26 ? -3.447  3.303   -13.032 1.00 0.25  ? 26 VAL A N    5  
ATOM 9274  C CA   . VAL A 1 26 ? -2.037  3.720   -12.840 1.00 0.24  ? 26 VAL A CA   5  
ATOM 9275  C C    . VAL A 1 26 ? -1.127  2.498   -12.933 1.00 0.25  ? 26 VAL A C    5  
ATOM 9276  O O    . VAL A 1 26 ? -1.549  1.370   -12.761 1.00 0.26  ? 26 VAL A O    5  
ATOM 9277  C CB   . VAL A 1 26 ? -1.852  4.381   -11.467 1.00 0.23  ? 26 VAL A CB   5  
ATOM 9278  C CG1  . VAL A 1 26 ? -2.586  3.579   -10.411 1.00 0.24  ? 26 VAL A CG1  5  
ATOM 9279  C CG2  . VAL A 1 26 ? -0.360  4.444   -11.114 1.00 0.26  ? 26 VAL A CG2  5  
ATOM 9280  H H    . VAL A 1 26 ? -3.694  2.367   -12.900 1.00 0.25  ? 26 VAL A H    5  
ATOM 9281  H HA   . VAL A 1 26 ? -1.769  4.422   -13.613 1.00 0.24  ? 26 VAL A HA   5  
ATOM 9282  H HB   . VAL A 1 26 ? -2.257  5.369   -11.488 1.00 0.25  ? 26 VAL A HB   5  
ATOM 9283  H HG11 . VAL A 1 26 ? -3.582  3.358   -10.763 1.00 1.00  ? 26 VAL A HG11 5  
ATOM 9284  H HG12 . VAL A 1 26 ? -2.053  2.661   -10.230 1.00 1.10  ? 26 VAL A HG12 5  
ATOM 9285  H HG13 . VAL A 1 26 ? -2.641  4.155   -9.502  1.00 1.01  ? 26 VAL A HG13 5  
ATOM 9286  H HG21 . VAL A 1 26 ? 0.177   4.932   -11.914 1.00 1.06  ? 26 VAL A HG21 5  
ATOM 9287  H HG22 . VAL A 1 26 ? -0.225  4.995   -10.200 1.00 1.05  ? 26 VAL A HG22 5  
ATOM 9288  H HG23 . VAL A 1 26 ? 0.022   3.439   -10.990 1.00 1.03  ? 26 VAL A HG23 5  
ATOM 9289  N N    . ASN A 1 27 ? 0.123   2.732   -13.196 1.00 0.25  ? 27 ASN A N    5  
ATOM 9290  C CA   . ASN A 1 27 ? 1.099   1.645   -13.299 1.00 0.27  ? 27 ASN A CA   5  
ATOM 9291  C C    . ASN A 1 27 ? 2.268   1.930   -12.366 1.00 0.25  ? 27 ASN A C    5  
ATOM 9292  O O    . ASN A 1 27 ? 2.632   3.068   -12.149 1.00 0.42  ? 27 ASN A O    5  
ATOM 9293  C CB   . ASN A 1 27 ? 1.626   1.569   -14.717 1.00 0.30  ? 27 ASN A CB   5  
ATOM 9294  C CG   . ASN A 1 27 ? 0.500   1.808   -15.734 1.00 0.57  ? 27 ASN A CG   5  
ATOM 9295  O OD1  . ASN A 1 27 ? -0.536  1.176   -15.672 1.00 0.95  ? 27 ASN A OD1  5  
ATOM 9296  N ND2  . ASN A 1 27 ? 0.666   2.695   -16.677 1.00 0.72  ? 27 ASN A ND2  5  
ATOM 9297  H H    . ASN A 1 27 ? 0.423   3.646   -13.323 1.00 0.26  ? 27 ASN A H    5  
ATOM 9298  H HA   . ASN A 1 27 ? 0.642   0.716   -13.034 1.00 0.30  ? 27 ASN A HA   5  
ATOM 9299  H HB2  . ASN A 1 27 ? 2.401   2.306   -14.848 1.00 0.45  ? 27 ASN A HB2  5  
ATOM 9300  H HB3  . ASN A 1 27 ? 2.034   0.607   -14.863 1.00 0.51  ? 27 ASN A HB3  5  
ATOM 9301  H HD21 . ASN A 1 27 ? 1.503   3.202   -16.734 1.00 0.75  ? 27 ASN A HD21 5  
ATOM 9302  H HD22 . ASN A 1 27 ? -0.048  2.855   -17.328 1.00 0.99  ? 27 ASN A HD22 5  
ATOM 9303  N N    . VAL A 1 28 ? 2.868   0.909   -11.831 1.00 0.28  ? 28 VAL A N    5  
ATOM 9304  C CA   . VAL A 1 28 ? 4.039   1.122   -10.929 1.00 0.28  ? 28 VAL A CA   5  
ATOM 9305  C C    . VAL A 1 28 ? 5.131   0.099   -11.276 1.00 0.31  ? 28 VAL A C    5  
ATOM 9306  O O    . VAL A 1 28 ? 4.973   -1.087  -11.070 1.00 0.33  ? 28 VAL A O    5  
ATOM 9307  C CB   . VAL A 1 28 ? 3.605   0.995   -9.458  1.00 0.34  ? 28 VAL A CB   5  
ATOM 9308  C CG1  . VAL A 1 28 ? 2.975   -0.375  -9.207  1.00 0.55  ? 28 VAL A CG1  5  
ATOM 9309  C CG2  . VAL A 1 28 ? 4.819   1.179   -8.540  1.00 0.71  ? 28 VAL A CG2  5  
ATOM 9310  H H    . VAL A 1 28 ? 2.557   -0.001  -12.040 1.00 0.43  ? 28 VAL A H    5  
ATOM 9311  H HA   . VAL A 1 28 ? 4.424   2.119   -11.099 1.00 0.28  ? 28 VAL A HA   5  
ATOM 9312  H HB   . VAL A 1 28 ? 2.875   1.760   -9.241  1.00 0.31  ? 28 VAL A HB   5  
ATOM 9313  H HG11 . VAL A 1 28 ? 2.516   -0.732  -10.116 1.00 1.11  ? 28 VAL A HG11 5  
ATOM 9314  H HG12 . VAL A 1 28 ? 3.739   -1.069  -8.892  1.00 1.11  ? 28 VAL A HG12 5  
ATOM 9315  H HG13 . VAL A 1 28 ? 2.227   -0.288  -8.434  1.00 1.30  ? 28 VAL A HG13 5  
ATOM 9316  H HG21 . VAL A 1 28 ? 5.717   0.888   -9.065  1.00 1.37  ? 28 VAL A HG21 5  
ATOM 9317  H HG22 . VAL A 1 28 ? 4.894   2.216   -8.248  1.00 1.24  ? 28 VAL A HG22 5  
ATOM 9318  H HG23 . VAL A 1 28 ? 4.702   0.564   -7.660  1.00 1.22  ? 28 VAL A HG23 5  
ATOM 9319  N N    . LYS A 1 29 ? 6.226   0.563   -11.828 1.00 0.35  ? 29 LYS A N    5  
ATOM 9320  C CA   . LYS A 1 29 ? 7.335   -0.356  -12.236 1.00 0.42  ? 29 LYS A CA   5  
ATOM 9321  C C    . LYS A 1 29 ? 8.631   0.002   -11.482 1.00 0.37  ? 29 LYS A C    5  
ATOM 9322  O O    . LYS A 1 29 ? 8.781   1.089   -10.952 1.00 0.35  ? 29 LYS A O    5  
ATOM 9323  C CB   . LYS A 1 29 ? 7.522   -0.218  -13.764 1.00 0.52  ? 29 LYS A CB   5  
ATOM 9324  C CG   . LYS A 1 29 ? 8.864   -0.801  -14.235 1.00 1.08  ? 29 LYS A CG   5  
ATOM 9325  C CD   . LYS A 1 29 ? 8.821   -2.333  -14.220 1.00 0.83  ? 29 LYS A CD   5  
ATOM 9326  C CE   . LYS A 1 29 ? 8.078   -2.844  -15.458 1.00 0.76  ? 29 LYS A CE   5  
ATOM 9327  N NZ   . LYS A 1 29 ? 9.006   -2.863  -16.625 1.00 1.23  ? 29 LYS A NZ   5  
ATOM 9328  H H    . LYS A 1 29 ? 6.308   1.521   -11.995 1.00 0.35  ? 29 LYS A H    5  
ATOM 9329  H HA   . LYS A 1 29 ? 7.060   -1.373  -12.001 1.00 0.52  ? 29 LYS A HA   5  
ATOM 9330  H HB2  . LYS A 1 29 ? 6.719   -0.736  -14.265 1.00 1.12  ? 29 LYS A HB2  5  
ATOM 9331  H HB3  . LYS A 1 29 ? 7.480   0.826   -14.029 1.00 0.82  ? 29 LYS A HB3  5  
ATOM 9332  H HG2  . LYS A 1 29 ? 9.061   -0.464  -15.239 1.00 1.70  ? 29 LYS A HG2  5  
ATOM 9333  H HG3  . LYS A 1 29 ? 9.651   -0.460  -13.586 1.00 2.02  ? 29 LYS A HG3  5  
ATOM 9334  H HD2  . LYS A 1 29 ? 9.828   -2.720  -14.223 1.00 1.42  ? 29 LYS A HD2  5  
ATOM 9335  H HD3  . LYS A 1 29 ? 8.311   -2.670  -13.333 1.00 1.54  ? 29 LYS A HD3  5  
ATOM 9336  H HE2  . LYS A 1 29 ? 7.716   -3.844  -15.272 1.00 1.30  ? 29 LYS A HE2  5  
ATOM 9337  H HE3  . LYS A 1 29 ? 7.243   -2.193  -15.672 1.00 1.09  ? 29 LYS A HE3  5  
ATOM 9338  H HZ1  . LYS A 1 29 ? 9.880   -3.361  -16.366 1.00 1.71  ? 29 LYS A HZ1  5  
ATOM 9339  H HZ2  . LYS A 1 29 ? 8.552   -3.355  -17.420 1.00 1.61  ? 29 LYS A HZ2  5  
ATOM 9340  H HZ3  . LYS A 1 29 ? 9.232   -1.886  -16.904 1.00 1.74  ? 29 LYS A HZ3  5  
ATOM 9341  N N    . SER A 1 30 ? 9.558   -0.927  -11.430 1.00 0.38  ? 30 SER A N    5  
ATOM 9342  C CA   . SER A 1 30 ? 10.856  -0.702  -10.720 1.00 0.39  ? 30 SER A CA   5  
ATOM 9343  C C    . SER A 1 30 ? 11.868  -0.016  -11.674 1.00 0.34  ? 30 SER A C    5  
ATOM 9344  O O    . SER A 1 30 ? 11.543  0.266   -12.811 1.00 0.35  ? 30 SER A O    5  
ATOM 9345  C CB   . SER A 1 30 ? 11.377  -2.079  -10.263 1.00 0.52  ? 30 SER A CB   5  
ATOM 9346  O OG   . SER A 1 30 ? 12.327  -2.580  -11.200 1.00 1.63  ? 30 SER A OG   5  
ATOM 9347  H H    . SER A 1 30 ? 9.393   -1.792  -11.859 1.00 0.43  ? 30 SER A H    5  
ATOM 9348  H HA   . SER A 1 30 ? 10.690  -0.072  -9.856  1.00 0.41  ? 30 SER A HA   5  
ATOM 9349  H HB2  . SER A 1 30 ? 11.845  -1.989  -9.300  1.00 0.91  ? 30 SER A HB2  5  
ATOM 9350  H HB3  . SER A 1 30 ? 10.542  -2.766  -10.187 1.00 0.92  ? 30 SER A HB3  5  
ATOM 9351  H HG   . SER A 1 30 ? 12.970  -3.104  -10.719 1.00 2.01  ? 30 SER A HG   5  
ATOM 9352  N N    . PRO A 1 31 ? 13.072  0.234   -11.182 1.00 0.39  ? 31 PRO A N    5  
ATOM 9353  C CA   . PRO A 1 31 ? 14.143  0.883   -11.979 1.00 0.44  ? 31 PRO A CA   5  
ATOM 9354  C C    . PRO A 1 31 ? 14.767  -0.107  -12.973 1.00 0.52  ? 31 PRO A C    5  
ATOM 9355  O O    . PRO A 1 31 ? 14.320  -1.233  -13.093 1.00 0.58  ? 31 PRO A O    5  
ATOM 9356  C CB   . PRO A 1 31 ? 15.158  1.326   -10.921 1.00 0.52  ? 31 PRO A CB   5  
ATOM 9357  C CG   . PRO A 1 31 ? 14.911  0.445   -9.676  1.00 0.56  ? 31 PRO A CG   5  
ATOM 9358  C CD   . PRO A 1 31 ? 13.477  -0.104  -9.799  1.00 0.49  ? 31 PRO A CD   5  
ATOM 9359  H HA   . PRO A 1 31 ? 13.758  1.743   -12.501 1.00 0.44  ? 31 PRO A HA   5  
ATOM 9360  H HB2  . PRO A 1 31 ? 16.165  1.181   -11.289 1.00 0.59  ? 31 PRO A HB2  5  
ATOM 9361  H HB3  . PRO A 1 31 ? 15.000  2.361   -10.668 1.00 0.56  ? 31 PRO A HB3  5  
ATOM 9362  H HG2  . PRO A 1 31 ? 15.622  -0.370  -9.652  1.00 0.63  ? 31 PRO A HG2  5  
ATOM 9363  H HG3  . PRO A 1 31 ? 14.997  1.039   -8.779  1.00 0.64  ? 31 PRO A HG3  5  
ATOM 9364  H HD2  . PRO A 1 31 ? 13.475  -1.174  -9.651  1.00 0.54  ? 31 PRO A HD2  5  
ATOM 9365  H HD3  . PRO A 1 31 ? 12.824  0.380   -9.090  1.00 0.52  ? 31 PRO A HD3  5  
ATOM 9366  N N    . GLY A 1 32 ? 15.793  0.299   -13.694 1.00 0.60  ? 32 GLY A N    5  
ATOM 9367  C CA   . GLY A 1 32 ? 16.415  -0.645  -14.675 1.00 0.73  ? 32 GLY A CA   5  
ATOM 9368  C C    . GLY A 1 32 ? 17.323  0.112   -15.651 1.00 0.91  ? 32 GLY A C    5  
ATOM 9369  O O    . GLY A 1 32 ? 18.532  0.057   -15.524 1.00 1.05  ? 32 GLY A O    5  
ATOM 9370  H H    . GLY A 1 32 ? 16.150  1.218   -13.590 1.00 0.61  ? 32 GLY A H    5  
ATOM 9371  H HA2  . GLY A 1 32 ? 16.999  -1.380  -14.141 1.00 0.73  ? 32 GLY A HA2  5  
ATOM 9372  H HA3  . GLY A 1 32 ? 15.636  -1.145  -15.232 1.00 0.79  ? 32 GLY A HA3  5  
ATOM 9373  N N    . PRO A 1 33 ? 16.721  0.795   -16.605 1.00 1.04  ? 33 PRO A N    5  
ATOM 9374  C CA   . PRO A 1 33 ? 17.473  1.562   -17.619 1.00 1.28  ? 33 PRO A CA   5  
ATOM 9375  C C    . PRO A 1 33 ? 18.088  2.828   -17.004 1.00 1.12  ? 33 PRO A C    5  
ATOM 9376  O O    . PRO A 1 33 ? 18.256  2.924   -15.802 1.00 1.13  ? 33 PRO A O    5  
ATOM 9377  C CB   . PRO A 1 33 ? 16.415  1.892   -18.683 1.00 1.58  ? 33 PRO A CB   5  
ATOM 9378  C CG   . PRO A 1 33 ? 15.043  1.785   -17.984 1.00 1.49  ? 33 PRO A CG   5  
ATOM 9379  C CD   . PRO A 1 33 ? 15.247  0.871   -16.762 1.00 1.14  ? 33 PRO A CD   5  
ATOM 9380  H HA   . PRO A 1 33 ? 18.243  0.948   -18.054 1.00 1.47  ? 33 PRO A HA   5  
ATOM 9381  H HB2  . PRO A 1 33 ? 16.566  2.897   -19.057 1.00 1.67  ? 33 PRO A HB2  5  
ATOM 9382  H HB3  . PRO A 1 33 ? 16.469  1.183   -19.492 1.00 1.82  ? 33 PRO A HB3  5  
ATOM 9383  H HG2  . PRO A 1 33 ? 14.711  2.764   -17.667 1.00 1.50  ? 33 PRO A HG2  5  
ATOM 9384  H HG3  . PRO A 1 33 ? 14.320  1.344   -18.652 1.00 1.73  ? 33 PRO A HG3  5  
ATOM 9385  H HD2  . PRO A 1 33 ? 14.786  1.311   -15.891 1.00 1.03  ? 33 PRO A HD2  5  
ATOM 9386  H HD3  . PRO A 1 33 ? 14.840  -0.110  -16.952 1.00 1.20  ? 33 PRO A HD3  5  
ATOM 9387  N N    . HIS A 1 34 ? 18.455  3.785   -17.822 1.00 1.15  ? 34 HIS A N    5  
ATOM 9388  C CA   . HIS A 1 34 ? 19.094  5.034   -17.290 1.00 1.18  ? 34 HIS A CA   5  
ATOM 9389  C C    . HIS A 1 34 ? 18.153  5.805   -16.356 1.00 1.17  ? 34 HIS A C    5  
ATOM 9390  O O    . HIS A 1 34 ? 18.631  6.537   -15.507 1.00 1.26  ? 34 HIS A O    5  
ATOM 9391  C CB   . HIS A 1 34 ? 19.570  5.956   -18.429 1.00 1.36  ? 34 HIS A CB   5  
ATOM 9392  C CG   . HIS A 1 34 ? 18.656  5.867   -19.621 1.00 1.55  ? 34 HIS A CG   5  
ATOM 9393  N ND1  . HIS A 1 34 ? 19.144  5.813   -20.917 1.00 2.08  ? 34 HIS A ND1  5  
ATOM 9394  C CD2  . HIS A 1 34 ? 17.288  5.821   -19.734 1.00 2.02  ? 34 HIS A CD2  5  
ATOM 9395  C CE1  . HIS A 1 34 ? 18.088  5.739   -21.744 1.00 2.65  ? 34 HIS A CE1  5  
ATOM 9396  N NE2  . HIS A 1 34 ? 16.936  5.741   -21.075 1.00 2.66  ? 34 HIS A NE2  5  
ATOM 9397  H H    . HIS A 1 34 ? 18.334  3.668   -18.786 1.00 1.28  ? 34 HIS A H    5  
ATOM 9398  H HA   . HIS A 1 34 ? 19.957  4.739   -16.704 1.00 1.15  ? 34 HIS A HA   5  
ATOM 9399  H HB2  . HIS A 1 34 ? 19.589  6.976   -18.075 1.00 1.71  ? 34 HIS A HB2  5  
ATOM 9400  H HB3  . HIS A 1 34 ? 20.569  5.666   -18.724 1.00 1.68  ? 34 HIS A HB3  5  
ATOM 9401  H HD1  . HIS A 1 34 ? 20.087  5.825   -21.182 1.00 2.32  ? 34 HIS A HD1  5  
ATOM 9402  H HD2  . HIS A 1 34 ? 16.592  5.849   -18.908 1.00 2.22  ? 34 HIS A HD2  5  
ATOM 9403  H HE1  . HIS A 1 34 ? 18.164  5.684   -22.820 1.00 3.26  ? 34 HIS A HE1  5  
ATOM 9404  N N    . CYS A 1 35 ? 16.841  5.631   -16.426 1.00 1.17  ? 35 CYS A N    5  
ATOM 9405  C CA   . CYS A 1 35 ? 15.988  6.357   -15.430 1.00 1.21  ? 35 CYS A CA   5  
ATOM 9406  C C    . CYS A 1 35 ? 16.412  5.790   -14.069 1.00 1.02  ? 35 CYS A C    5  
ATOM 9407  O O    . CYS A 1 35 ? 16.588  6.508   -13.103 1.00 1.08  ? 35 CYS A O    5  
ATOM 9408  C CB   . CYS A 1 35 ? 14.477  6.117   -15.626 1.00 1.45  ? 35 CYS A CB   5  
ATOM 9409  S SG   . CYS A 1 35 ? 13.933  6.448   -17.323 1.00 1.19  ? 35 CYS A SG   5  
ATOM 9410  H H    . CYS A 1 35 ? 16.444  5.000   -17.066 1.00 1.22  ? 35 CYS A H    5  
ATOM 9411  H HA   . CYS A 1 35 ? 16.207  7.416   -15.467 1.00 1.30  ? 35 CYS A HA   5  
ATOM 9412  H HB2  . CYS A 1 35 ? 14.248  5.100   -15.383 1.00 2.02  ? 35 CYS A HB2  5  
ATOM 9413  H HB3  . CYS A 1 35 ? 13.939  6.772   -14.955 1.00 2.07  ? 35 CYS A HB3  5  
ATOM 9414  N N    . ALA A 1 36 ? 16.645  4.486   -14.042 1.00 0.94  ? 36 ALA A N    5  
ATOM 9415  C CA   . ALA A 1 36 ? 17.138  3.779   -12.825 1.00 0.89  ? 36 ALA A CA   5  
ATOM 9416  C C    . ALA A 1 36 ? 16.382  4.194   -11.560 1.00 0.85  ? 36 ALA A C    5  
ATOM 9417  O O    . ALA A 1 36 ? 16.918  4.184   -10.466 1.00 1.18  ? 36 ALA A O    5  
ATOM 9418  C CB   . ALA A 1 36 ? 18.615  4.083   -12.689 1.00 1.08  ? 36 ALA A CB   5  
ATOM 9419  H H    . ALA A 1 36 ? 16.537  3.969   -14.864 1.00 1.02  ? 36 ALA A H    5  
ATOM 9420  H HA   . ALA A 1 36 ? 17.019  2.717   -12.968 1.00 0.94  ? 36 ALA A HA   5  
ATOM 9421  H HB1  . ALA A 1 36 ? 19.070  4.043   -13.670 1.00 1.69  ? 36 ALA A HB1  5  
ATOM 9422  H HB2  . ALA A 1 36 ? 18.737  5.067   -12.273 1.00 1.40  ? 36 ALA A HB2  5  
ATOM 9423  H HB3  . ALA A 1 36 ? 19.071  3.350   -12.048 1.00 1.48  ? 36 ALA A HB3  5  
ATOM 9424  N N    . GLN A 1 37 ? 15.133  4.516   -11.705 1.00 0.93  ? 37 GLN A N    5  
ATOM 9425  C CA   . GLN A 1 37 ? 14.299  4.893   -10.526 1.00 0.89  ? 37 GLN A CA   5  
ATOM 9426  C C    . GLN A 1 37 ? 12.981  4.121   -10.595 1.00 0.71  ? 37 GLN A C    5  
ATOM 9427  O O    . GLN A 1 37 ? 12.800  3.269   -11.442 1.00 0.74  ? 37 GLN A O    5  
ATOM 9428  C CB   . GLN A 1 37 ? 14.019  6.400   -10.526 1.00 0.99  ? 37 GLN A CB   5  
ATOM 9429  C CG   . GLN A 1 37 ? 13.160  6.786   -11.736 1.00 1.66  ? 37 GLN A CG   5  
ATOM 9430  C CD   . GLN A 1 37 ? 12.647  8.216   -11.551 1.00 2.34  ? 37 GLN A CD   5  
ATOM 9431  O OE1  . GLN A 1 37 ? 11.455  8.443   -11.509 1.00 2.82  ? 37 GLN A OE1  5  
ATOM 9432  N NE2  . GLN A 1 37 ? 13.500  9.196   -11.430 1.00 3.07  ? 37 GLN A NE2  5  
ATOM 9433  H H    . GLN A 1 37 ? 14.733  4.485   -12.594 1.00 1.27  ? 37 GLN A H    5  
ATOM 9434  H HA   . GLN A 1 37 ? 14.822  4.625   -9.619  1.00 0.95  ? 37 GLN A HA   5  
ATOM 9435  H HB2  . GLN A 1 37 ? 13.494  6.663   -9.619  1.00 1.38  ? 37 GLN A HB2  5  
ATOM 9436  H HB3  . GLN A 1 37 ? 14.950  6.934   -10.563 1.00 1.44  ? 37 GLN A HB3  5  
ATOM 9437  H HG2  . GLN A 1 37 ? 13.754  6.727   -12.636 1.00 2.22  ? 37 GLN A HG2  5  
ATOM 9438  H HG3  . GLN A 1 37 ? 12.320  6.112   -11.812 1.00 2.02  ? 37 GLN A HG3  5  
ATOM 9439  H HE21 . GLN A 1 37 ? 14.464  9.016   -11.459 1.00 3.26  ? 37 GLN A HE21 5  
ATOM 9440  H HE22 . GLN A 1 37 ? 13.178  10.114  -11.308 1.00 3.72  ? 37 GLN A HE22 5  
ATOM 9441  N N    . THR A 1 38 ? 12.060  4.408   -9.719  1.00 0.60  ? 38 THR A N    5  
ATOM 9442  C CA   . THR A 1 38 ? 10.760  3.681   -9.748  1.00 0.44  ? 38 THR A CA   5  
ATOM 9443  C C    . THR A 1 38 ? 9.962   4.065   -11.002 1.00 0.35  ? 38 THR A C    5  
ATOM 9444  O O    . THR A 1 38 ? 10.477  4.649   -11.939 1.00 0.42  ? 38 THR A O    5  
ATOM 9445  C CB   . THR A 1 38 ? 9.929   4.025   -8.501  1.00 0.44  ? 38 THR A CB   5  
ATOM 9446  O OG1  . THR A 1 38 ? 10.711  4.770   -7.569  1.00 0.60  ? 38 THR A OG1  5  
ATOM 9447  C CG2  . THR A 1 38 ? 9.460   2.728   -7.856  1.00 0.44  ? 38 THR A CG2  5  
ATOM 9448  H H    . THR A 1 38 ? 12.222  5.098   -9.043  1.00 0.68  ? 38 THR A H    5  
ATOM 9449  H HA   . THR A 1 38 ? 10.952  2.618   -9.763  1.00 0.44  ? 38 THR A HA   5  
ATOM 9450  H HB   . THR A 1 38 ? 9.060   4.604   -8.792  1.00 0.40  ? 38 THR A HB   5  
ATOM 9451  H HG1  . THR A 1 38 ? 11.371  4.182   -7.193  1.00 0.96  ? 38 THR A HG1  5  
ATOM 9452  H HG21 . THR A 1 38 ? 10.252  1.996   -7.907  1.00 1.13  ? 38 THR A HG21 5  
ATOM 9453  H HG22 . THR A 1 38 ? 9.203   2.914   -6.826  1.00 1.10  ? 38 THR A HG22 5  
ATOM 9454  H HG23 . THR A 1 38 ? 8.595   2.360   -8.387  1.00 1.11  ? 38 THR A HG23 5  
ATOM 9455  N N    . GLU A 1 39 ? 8.696   3.761   -10.997 1.00 0.25  ? 39 GLU A N    5  
ATOM 9456  C CA   . GLU A 1 39 ? 7.811   4.104   -12.128 1.00 0.25  ? 39 GLU A CA   5  
ATOM 9457  C C    . GLU A 1 39 ? 6.436   4.211   -11.546 1.00 0.21  ? 39 GLU A C    5  
ATOM 9458  O O    . GLU A 1 39 ? 6.053   3.413   -10.711 1.00 0.35  ? 39 GLU A O    5  
ATOM 9459  C CB   . GLU A 1 39 ? 7.777   3.018   -13.189 1.00 0.33  ? 39 GLU A CB   5  
ATOM 9460  C CG   . GLU A 1 39 ? 8.379   3.547   -14.493 1.00 0.60  ? 39 GLU A CG   5  
ATOM 9461  C CD   . GLU A 1 39 ? 9.223   2.452   -15.149 1.00 0.80  ? 39 GLU A CD   5  
ATOM 9462  O OE1  . GLU A 1 39 ? 10.301  2.180   -14.647 1.00 1.40  ? 39 GLU A OE1  5  
ATOM 9463  O OE2  . GLU A 1 39 ? 8.777   1.906   -16.145 1.00 1.47  ? 39 GLU A OE2  5  
ATOM 9464  H H    . GLU A 1 39 ? 8.304   3.323   -10.213 1.00 0.25  ? 39 GLU A H    5  
ATOM 9465  H HA   . GLU A 1 39 ? 8.110   5.045   -12.555 1.00 0.31  ? 39 GLU A HA   5  
ATOM 9466  H HB2  . GLU A 1 39 ? 8.334   2.158   -12.849 1.00 0.30  ? 39 GLU A HB2  5  
ATOM 9467  H HB3  . GLU A 1 39 ? 6.737   2.744   -13.354 1.00 0.41  ? 39 GLU A HB3  5  
ATOM 9468  H HG2  . GLU A 1 39 ? 7.583   3.840   -15.163 1.00 0.88  ? 39 GLU A HG2  5  
ATOM 9469  H HG3  . GLU A 1 39 ? 9.003   4.401   -14.280 1.00 0.85  ? 39 GLU A HG3  5  
ATOM 9470  N N    . VAL A 1 40 ? 5.709   5.200   -11.914 1.00 0.15  ? 40 VAL A N    5  
ATOM 9471  C CA   . VAL A 1 40 ? 4.394   5.367   -11.309 1.00 0.19  ? 40 VAL A CA   5  
ATOM 9472  C C    . VAL A 1 40 ? 3.519   6.173   -12.262 1.00 0.19  ? 40 VAL A C    5  
ATOM 9473  O O    . VAL A 1 40 ? 3.369   7.365   -12.113 1.00 0.21  ? 40 VAL A O    5  
ATOM 9474  C CB   . VAL A 1 40 ? 4.631   6.108   -9.987  1.00 0.23  ? 40 VAL A CB   5  
ATOM 9475  C CG1  . VAL A 1 40 ? 4.812   5.076   -8.881  1.00 0.28  ? 40 VAL A CG1  5  
ATOM 9476  C CG2  . VAL A 1 40 ? 5.931   6.929   -10.081 1.00 0.24  ? 40 VAL A CG2  5  
ATOM 9477  H H    . VAL A 1 40 ? 6.045   5.860   -12.538 1.00 0.22  ? 40 VAL A H    5  
ATOM 9478  H HA   . VAL A 1 40 ? 3.971   4.390   -11.128 1.00 0.23  ? 40 VAL A HA   5  
ATOM 9479  H HB   . VAL A 1 40 ? 3.804   6.764   -9.772  1.00 0.29  ? 40 VAL A HB   5  
ATOM 9480  H HG11 . VAL A 1 40 ? 4.324   4.157   -9.165  1.00 1.00  ? 40 VAL A HG11 5  
ATOM 9481  H HG12 . VAL A 1 40 ? 5.871   4.890   -8.743  1.00 1.08  ? 40 VAL A HG12 5  
ATOM 9482  H HG13 . VAL A 1 40 ? 4.390   5.448   -7.967  1.00 1.04  ? 40 VAL A HG13 5  
ATOM 9483  H HG21 . VAL A 1 40 ? 5.888   7.580   -10.941 1.00 1.04  ? 40 VAL A HG21 5  
ATOM 9484  H HG22 . VAL A 1 40 ? 6.059   7.514   -9.189  1.00 1.03  ? 40 VAL A HG22 5  
ATOM 9485  H HG23 . VAL A 1 40 ? 6.773   6.253   -10.189 1.00 1.01  ? 40 VAL A HG23 5  
ATOM 9486  N N    . ILE A 1 41 ? 2.989   5.534   -13.278 1.00 0.23  ? 41 ILE A N    5  
ATOM 9487  C CA   . ILE A 1 41 ? 2.191   6.269   -14.290 1.00 0.25  ? 41 ILE A CA   5  
ATOM 9488  C C    . ILE A 1 41 ? 0.679   6.088   -14.099 1.00 0.23  ? 41 ILE A C    5  
ATOM 9489  O O    . ILE A 1 41 ? 0.162   5.006   -14.236 1.00 0.25  ? 41 ILE A O    5  
ATOM 9490  C CB   . ILE A 1 41 ? 2.616   5.751   -15.666 1.00 0.30  ? 41 ILE A CB   5  
ATOM 9491  C CG1  . ILE A 1 41 ? 3.815   6.591   -16.143 1.00 0.50  ? 41 ILE A CG1  5  
ATOM 9492  C CG2  . ILE A 1 41 ? 1.456   5.856   -16.660 1.00 0.67  ? 41 ILE A CG2  5  
ATOM 9493  C CD1  . ILE A 1 41 ? 3.922   6.574   -17.670 1.00 0.54  ? 41 ILE A CD1  5  
ATOM 9494  H H    . ILE A 1 41 ? 3.160   4.576   -13.402 1.00 0.27  ? 41 ILE A H    5  
ATOM 9495  H HA   . ILE A 1 41 ? 2.435   7.309   -14.227 1.00 0.26  ? 41 ILE A HA   5  
ATOM 9496  H HB   . ILE A 1 41 ? 2.911   4.711   -15.570 1.00 0.48  ? 41 ILE A HB   5  
ATOM 9497  H HG12 . ILE A 1 41 ? 3.687   7.610   -15.810 1.00 0.70  ? 41 ILE A HG12 5  
ATOM 9498  H HG13 . ILE A 1 41 ? 4.718   6.189   -15.717 1.00 0.69  ? 41 ILE A HG13 5  
ATOM 9499  H HG21 . ILE A 1 41 ? 1.057   6.858   -16.637 1.00 1.20  ? 41 ILE A HG21 5  
ATOM 9500  H HG22 . ILE A 1 41 ? 1.810   5.628   -17.651 1.00 1.18  ? 41 ILE A HG22 5  
ATOM 9501  H HG23 . ILE A 1 41 ? 0.686   5.153   -16.384 1.00 1.38  ? 41 ILE A HG23 5  
ATOM 9502  H HD11 . ILE A 1 41 ? 3.899   5.554   -18.020 1.00 1.22  ? 41 ILE A HD11 5  
ATOM 9503  H HD12 . ILE A 1 41 ? 3.092   7.121   -18.093 1.00 1.02  ? 41 ILE A HD12 5  
ATOM 9504  H HD13 . ILE A 1 41 ? 4.848   7.039   -17.968 1.00 1.14  ? 41 ILE A HD13 5  
ATOM 9505  N N    . ALA A 1 42 ? -0.038  7.158   -13.855 1.00 0.22  ? 42 ALA A N    5  
ATOM 9506  C CA   . ALA A 1 42 ? -1.519  7.060   -13.723 1.00 0.22  ? 42 ALA A CA   5  
ATOM 9507  C C    . ALA A 1 42 ? -2.131  7.225   -15.105 1.00 0.24  ? 42 ALA A C    5  
ATOM 9508  O O    . ALA A 1 42 ? -2.017  8.271   -15.716 1.00 0.25  ? 42 ALA A O    5  
ATOM 9509  C CB   . ALA A 1 42 ? -2.030  8.156   -12.801 1.00 0.21  ? 42 ALA A CB   5  
ATOM 9510  H H    . ALA A 1 42 ? 0.394   8.040   -13.806 1.00 0.23  ? 42 ALA A H    5  
ATOM 9511  H HA   . ALA A 1 42 ? -1.791  6.106   -13.330 1.00 0.23  ? 42 ALA A HA   5  
ATOM 9512  H HB1  . ALA A 1 42 ? -1.467  9.059   -12.974 1.00 1.00  ? 42 ALA A HB1  5  
ATOM 9513  H HB2  . ALA A 1 42 ? -3.075  8.336   -13.007 1.00 0.95  ? 42 ALA A HB2  5  
ATOM 9514  H HB3  . ALA A 1 42 ? -1.911  7.842   -11.776 1.00 1.00  ? 42 ALA A HB3  5  
ATOM 9515  N N    . THR A 1 43 ? -2.772  6.203   -15.615 1.00 0.28  ? 43 THR A N    5  
ATOM 9516  C CA   . THR A 1 43 ? -3.367  6.326   -16.966 1.00 0.32  ? 43 THR A CA   5  
ATOM 9517  C C    . THR A 1 43 ? -4.634  7.162   -16.882 1.00 0.32  ? 43 THR A C    5  
ATOM 9518  O O    . THR A 1 43 ? -5.535  6.889   -16.108 1.00 0.34  ? 43 THR A O    5  
ATOM 9519  C CB   . THR A 1 43 ? -3.711  4.957   -17.558 1.00 0.35  ? 43 THR A CB   5  
ATOM 9520  O OG1  . THR A 1 43 ? -2.758  3.988   -17.136 1.00 0.39  ? 43 THR A OG1  5  
ATOM 9521  C CG2  . THR A 1 43 ? -3.709  5.058   -19.083 1.00 0.39  ? 43 THR A CG2  5  
ATOM 9522  H H    . THR A 1 43 ? -2.857  5.366   -15.114 1.00 0.28  ? 43 THR A H    5  
ATOM 9523  H HA   . THR A 1 43 ? -2.651  6.829   -17.604 1.00 0.32  ? 43 THR A HA   5  
ATOM 9524  H HB   . THR A 1 43 ? -4.696  4.667   -17.233 1.00 0.35  ? 43 THR A HB   5  
ATOM 9525  H HG1  . THR A 1 43 ? -1.886  4.288   -17.405 1.00 0.89  ? 43 THR A HG1  5  
ATOM 9526  H HG21 . THR A 1 43 ? -4.396  5.835   -19.390 1.00 1.07  ? 43 THR A HG21 5  
ATOM 9527  H HG22 . THR A 1 43 ? -2.715  5.300   -19.425 1.00 1.05  ? 43 THR A HG22 5  
ATOM 9528  H HG23 . THR A 1 43 ? -4.019  4.116   -19.507 1.00 1.07  ? 43 THR A HG23 5  
ATOM 9529  N N    . LEU A 1 44 ? -4.683  8.191   -17.665 1.00 0.32  ? 44 LEU A N    5  
ATOM 9530  C CA   . LEU A 1 44 ? -5.842  9.100   -17.668 1.00 0.32  ? 44 LEU A CA   5  
ATOM 9531  C C    . LEU A 1 44 ? -7.048  8.456   -18.360 1.00 0.37  ? 44 LEU A C    5  
ATOM 9532  O O    . LEU A 1 44 ? -6.900  7.553   -19.165 1.00 0.40  ? 44 LEU A O    5  
ATOM 9533  C CB   . LEU A 1 44 ? -5.432  10.335  -18.442 1.00 0.34  ? 44 LEU A CB   5  
ATOM 9534  C CG   . LEU A 1 44 ? -4.953  11.418  -17.490 1.00 0.32  ? 44 LEU A CG   5  
ATOM 9535  C CD1  . LEU A 1 44 ? -6.169  12.250  -17.102 1.00 0.35  ? 44 LEU A CD1  5  
ATOM 9536  C CD2  . LEU A 1 44 ? -4.280  10.795  -16.237 1.00 0.28  ? 44 LEU A CD2  5  
ATOM 9537  H H    . LEU A 1 44 ? -3.926  8.388   -18.254 1.00 0.33  ? 44 LEU A H    5  
ATOM 9538  H HA   . LEU A 1 44 ? -6.086  9.369   -16.647 1.00 0.30  ? 44 LEU A HA   5  
ATOM 9539  H HB2  . LEU A 1 44 ? -4.635  10.076  -19.115 1.00 0.37  ? 44 LEU A HB2  5  
ATOM 9540  H HB3  . LEU A 1 44 ? -6.277  10.699  -19.008 1.00 0.37  ? 44 LEU A HB3  5  
ATOM 9541  H HG   . LEU A 1 44 ? -4.241  12.041  -18.007 1.00 0.34  ? 44 LEU A HG   5  
ATOM 9542  H HD11 . LEU A 1 44 ? -6.985  11.589  -16.845 1.00 1.03  ? 44 LEU A HD11 5  
ATOM 9543  H HD12 . LEU A 1 44 ? -5.930  12.877  -16.261 1.00 1.05  ? 44 LEU A HD12 5  
ATOM 9544  H HD13 . LEU A 1 44 ? -6.463  12.864  -17.944 1.00 1.07  ? 44 LEU A HD13 5  
ATOM 9545  H HD21 . LEU A 1 44 ? -3.560  10.047  -16.546 1.00 1.03  ? 44 LEU A HD21 5  
ATOM 9546  H HD22 . LEU A 1 44 ? -3.773  11.565  -15.673 1.00 1.04  ? 44 LEU A HD22 5  
ATOM 9547  H HD23 . LEU A 1 44 ? -5.028  10.329  -15.613 1.00 1.08  ? 44 LEU A HD23 5  
ATOM 9548  N N    . LYS A 1 45 ? -8.234  8.961   -18.071 1.00 0.38  ? 45 LYS A N    5  
ATOM 9549  C CA   . LYS A 1 45 ? -9.491  8.453   -18.683 1.00 0.44  ? 45 LYS A CA   5  
ATOM 9550  C C    . LYS A 1 45 ? -9.418  8.513   -20.199 1.00 0.49  ? 45 LYS A C    5  
ATOM 9551  O O    . LYS A 1 45 ? -9.863  7.609   -20.882 1.00 0.54  ? 45 LYS A O    5  
ATOM 9552  C CB   . LYS A 1 45 ? -10.630 9.347   -18.213 1.00 0.45  ? 45 LYS A CB   5  
ATOM 9553  C CG   . LYS A 1 45 ? -11.726 8.509   -17.547 1.00 0.47  ? 45 LYS A CG   5  
ATOM 9554  C CD   . LYS A 1 45 ? -12.804 8.161   -18.577 1.00 0.72  ? 45 LYS A CD   5  
ATOM 9555  C CE   . LYS A 1 45 ? -13.327 6.747   -18.310 1.00 1.05  ? 45 LYS A CE   5  
ATOM 9556  N NZ   . LYS A 1 45 ? -14.017 6.230   -19.527 1.00 1.42  ? 45 LYS A NZ   5  
ATOM 9557  H H    . LYS A 1 45 ? -8.301  9.713   -17.456 1.00 0.37  ? 45 LYS A H    5  
ATOM 9558  H HA   . LYS A 1 45 ? -9.670  7.440   -18.365 1.00 0.44  ? 45 LYS A HA   5  
ATOM 9559  H HB2  . LYS A 1 45 ? -10.246 10.059  -17.500 1.00 0.42  ? 45 LYS A HB2  5  
ATOM 9560  H HB3  . LYS A 1 45 ? -11.020 9.877   -19.048 1.00 0.49  ? 45 LYS A HB3  5  
ATOM 9561  H HG2  . LYS A 1 45 ? -11.296 7.601   -17.154 1.00 0.52  ? 45 LYS A HG2  5  
ATOM 9562  H HG3  . LYS A 1 45 ? -12.172 9.074   -16.742 1.00 0.54  ? 45 LYS A HG3  5  
ATOM 9563  H HD2  . LYS A 1 45 ? -13.618 8.868   -18.500 1.00 0.99  ? 45 LYS A HD2  5  
ATOM 9564  H HD3  . LYS A 1 45 ? -12.383 8.205   -19.570 1.00 0.94  ? 45 LYS A HD3  5  
ATOM 9565  H HE2  . LYS A 1 45 ? -12.500 6.099   -18.064 1.00 1.46  ? 45 LYS A HE2  5  
ATOM 9566  H HE3  . LYS A 1 45 ? -14.023 6.772   -17.485 1.00 1.42  ? 45 LYS A HE3  5  
ATOM 9567  H HZ1  . LYS A 1 45 ? -13.346 6.208   -20.323 1.00 1.84  ? 45 LYS A HZ1  5  
ATOM 9568  H HZ2  . LYS A 1 45 ? -14.368 5.270   -19.344 1.00 1.86  ? 45 LYS A HZ2  5  
ATOM 9569  H HZ3  . LYS A 1 45 ? -14.818 6.851   -19.764 1.00 1.80  ? 45 LYS A HZ3  5  
ATOM 9570  N N    . ASN A 1 46 ? -8.857  9.565   -20.731 1.00 0.49  ? 46 ASN A N    5  
ATOM 9571  C CA   . ASN A 1 46 ? -8.753  9.673   -22.215 1.00 0.55  ? 46 ASN A CA   5  
ATOM 9572  C C    . ASN A 1 46 ? -7.697  8.678   -22.747 1.00 0.57  ? 46 ASN A C    5  
ATOM 9573  O O    . ASN A 1 46 ? -7.408  8.645   -23.930 1.00 0.75  ? 46 ASN A O    5  
ATOM 9574  C CB   . ASN A 1 46 ? -8.377  11.111  -22.591 1.00 0.58  ? 46 ASN A CB   5  
ATOM 9575  C CG   . ASN A 1 46 ? -6.957  11.430  -22.118 1.00 0.78  ? 46 ASN A CG   5  
ATOM 9576  O OD1  . ASN A 1 46 ? -5.997  11.092  -22.779 1.00 1.66  ? 46 ASN A OD1  5  
ATOM 9577  N ND2  . ASN A 1 46 ? -6.783  12.078  -20.997 1.00 0.81  ? 46 ASN A ND2  5  
ATOM 9578  H H    . ASN A 1 46 ? -8.499  10.283  -20.152 1.00 0.47  ? 46 ASN A H    5  
ATOM 9579  H HA   . ASN A 1 46 ? -9.711  9.432   -22.653 1.00 0.62  ? 46 ASN A HA   5  
ATOM 9580  H HB2  . ASN A 1 46 ? -8.431  11.221  -23.658 1.00 0.73  ? 46 ASN A HB2  5  
ATOM 9581  H HB3  . ASN A 1 46 ? -9.070  11.794  -22.125 1.00 0.74  ? 46 ASN A HB3  5  
ATOM 9582  H HD21 . ASN A 1 46 ? -7.559  12.355  -20.465 1.00 1.39  ? 46 ASN A HD21 5  
ATOM 9583  H HD22 . ASN A 1 46 ? -5.878  12.288  -20.689 1.00 0.88  ? 46 ASN A HD22 5  
ATOM 9584  N N    . GLY A 1 47 ? -7.115  7.876   -21.879 1.00 0.50  ? 47 GLY A N    5  
ATOM 9585  C CA   . GLY A 1 47 ? -6.080  6.895   -22.309 1.00 0.53  ? 47 GLY A CA   5  
ATOM 9586  C C    . GLY A 1 47 ? -4.727  7.594   -22.319 1.00 0.51  ? 47 GLY A C    5  
ATOM 9587  O O    . GLY A 1 47 ? -3.881  7.325   -23.150 1.00 0.60  ? 47 GLY A O    5  
ATOM 9588  H H    . GLY A 1 47 ? -7.350  7.927   -20.934 1.00 0.52  ? 47 GLY A H    5  
ATOM 9589  H HA2  . GLY A 1 47 ? -6.054  6.068   -21.608 1.00 0.52  ? 47 GLY A HA2  5  
ATOM 9590  H HA3  . GLY A 1 47 ? -6.304  6.528   -23.296 1.00 0.59  ? 47 GLY A HA3  5  
ATOM 9591  N N    . ARG A 1 48 ? -4.519  8.485   -21.381 1.00 0.47  ? 48 ARG A N    5  
ATOM 9592  C CA   . ARG A 1 48 ? -3.218  9.210   -21.303 1.00 0.54  ? 48 ARG A CA   5  
ATOM 9593  C C    . ARG A 1 48 ? -2.462  8.683   -20.096 1.00 0.42  ? 48 ARG A C    5  
ATOM 9594  O O    . ARG A 1 48 ? -2.833  7.678   -19.529 1.00 0.37  ? 48 ARG A O    5  
ATOM 9595  C CB   . ARG A 1 48 ? -3.472  10.712  -21.140 1.00 0.66  ? 48 ARG A CB   5  
ATOM 9596  C CG   . ARG A 1 48 ? -3.162  11.422  -22.455 1.00 1.00  ? 48 ARG A CG   5  
ATOM 9597  C CD   . ARG A 1 48 ? -3.523  12.905  -22.337 1.00 1.55  ? 48 ARG A CD   5  
ATOM 9598  N NE   . ARG A 1 48 ? -3.277  13.580  -23.647 1.00 2.08  ? 48 ARG A NE   5  
ATOM 9599  C CZ   . ARG A 1 48 ? -3.757  14.775  -23.873 1.00 2.34  ? 48 ARG A CZ   5  
ATOM 9600  N NH1  . ARG A 1 48 ? -5.045  14.947  -24.022 1.00 2.67  ? 48 ARG A NH1  5  
ATOM 9601  N NH2  . ARG A 1 48 ? -2.946  15.799  -23.960 1.00 2.89  ? 48 ARG A NH2  5  
ATOM 9602  H H    . ARG A 1 48 ? -5.224  8.665   -20.713 1.00 0.43  ? 48 ARG A H    5  
ATOM 9603  H HA   . ARG A 1 48 ? -2.639  9.031   -22.196 1.00 0.68  ? 48 ARG A HA   5  
ATOM 9604  H HB2  . ARG A 1 48 ? -4.504  10.876  -20.874 1.00 1.19  ? 48 ARG A HB2  5  
ATOM 9605  H HB3  . ARG A 1 48 ? -2.834  11.106  -20.362 1.00 1.23  ? 48 ARG A HB3  5  
ATOM 9606  H HG2  . ARG A 1 48 ? -2.109  11.323  -22.677 1.00 1.43  ? 48 ARG A HG2  5  
ATOM 9607  H HG3  . ARG A 1 48 ? -3.740  10.974  -23.249 1.00 1.63  ? 48 ARG A HG3  5  
ATOM 9608  H HD2  . ARG A 1 48 ? -4.566  13.002  -22.068 1.00 1.84  ? 48 ARG A HD2  5  
ATOM 9609  H HD3  . ARG A 1 48 ? -2.911  13.364  -21.574 1.00 1.84  ? 48 ARG A HD3  5  
ATOM 9610  H HE   . ARG A 1 48 ? -2.755  13.125  -24.340 1.00 2.46  ? 48 ARG A HE   5  
ATOM 9611  H HH11 . ARG A 1 48 ? -5.664  14.163  -23.961 1.00 2.92  ? 48 ARG A HH11 5  
ATOM 9612  H HH12 . ARG A 1 48 ? -5.412  15.861  -24.198 1.00 3.04  ? 48 ARG A HH12 5  
ATOM 9613  H HH21 . ARG A 1 48 ? -1.960  15.668  -23.852 1.00 3.28  ? 48 ARG A HH21 5  
ATOM 9614  H HH22 . ARG A 1 48 ? -3.312  16.714  -24.136 1.00 3.23  ? 48 ARG A HH22 5  
ATOM 9615  N N    . LYS A 1 49 ? -1.411  9.333   -19.692 1.00 0.45  ? 49 LYS A N    5  
ATOM 9616  C CA   . LYS A 1 49 ? -0.665  8.840   -18.514 1.00 0.39  ? 49 LYS A CA   5  
ATOM 9617  C C    . LYS A 1 49 ? 0.100   9.974   -17.832 1.00 0.38  ? 49 LYS A C    5  
ATOM 9618  O O    . LYS A 1 49 ? 0.532   10.927  -18.452 1.00 0.54  ? 49 LYS A O    5  
ATOM 9619  C CB   . LYS A 1 49 ? 0.319   7.743   -18.924 1.00 0.58  ? 49 LYS A CB   5  
ATOM 9620  C CG   . LYS A 1 49 ? 0.743   7.879   -20.399 1.00 0.89  ? 49 LYS A CG   5  
ATOM 9621  C CD   . LYS A 1 49 ? 1.540   9.170   -20.621 1.00 0.96  ? 49 LYS A CD   5  
ATOM 9622  C CE   . LYS A 1 49 ? 2.773   9.192   -19.713 1.00 0.92  ? 49 LYS A CE   5  
ATOM 9623  N NZ   . LYS A 1 49 ? 3.734   10.218  -20.207 1.00 1.06  ? 49 LYS A NZ   5  
ATOM 9624  H H    . LYS A 1 49 ? -1.115  10.130  -20.159 1.00 0.55  ? 49 LYS A H    5  
ATOM 9625  H HA   . LYS A 1 49 ? -1.372  8.425   -17.808 1.00 0.34  ? 49 LYS A HA   5  
ATOM 9626  H HB2  . LYS A 1 49 ? 1.191   7.798   -18.289 1.00 0.59  ? 49 LYS A HB2  5  
ATOM 9627  H HB3  . LYS A 1 49 ? -0.160  6.794   -18.787 1.00 0.69  ? 49 LYS A HB3  5  
ATOM 9628  H HG2  . LYS A 1 49 ? 1.355   7.033   -20.672 1.00 1.06  ? 49 LYS A HG2  5  
ATOM 9629  H HG3  . LYS A 1 49 ? -0.139  7.895   -21.022 1.00 1.14  ? 49 LYS A HG3  5  
ATOM 9630  H HD2  . LYS A 1 49 ? 1.857   9.218   -21.653 1.00 0.98  ? 49 LYS A HD2  5  
ATOM 9631  H HD3  . LYS A 1 49 ? 0.917   10.022  -20.400 1.00 1.23  ? 49 LYS A HD3  5  
ATOM 9632  H HE2  . LYS A 1 49 ? 2.474   9.435   -18.704 1.00 0.97  ? 49 LYS A HE2  5  
ATOM 9633  H HE3  . LYS A 1 49 ? 3.246   8.222   -19.725 1.00 0.87  ? 49 LYS A HE3  5  
ATOM 9634  H HZ1  . LYS A 1 49 ? 3.213   11.062  -20.522 1.00 1.54  ? 49 LYS A HZ1  5  
ATOM 9635  H HZ2  . LYS A 1 49 ? 4.386   10.479  -19.440 1.00 1.19  ? 49 LYS A HZ2  5  
ATOM 9636  H HZ3  . LYS A 1 49 ? 4.276   9.831   -21.005 1.00 1.66  ? 49 LYS A HZ3  5  
ATOM 9637  N N    . ALA A 1 50 ? 0.284   9.842   -16.550 1.00 0.27  ? 50 ALA A N    5  
ATOM 9638  C CA   . ALA A 1 50 ? 1.047   10.867  -15.769 1.00 0.28  ? 50 ALA A CA   5  
ATOM 9639  C C    . ALA A 1 50 ? 1.905   10.140  -14.761 1.00 0.24  ? 50 ALA A C    5  
ATOM 9640  O O    . ALA A 1 50 ? 1.613   9.025   -14.422 1.00 0.21  ? 50 ALA A O    5  
ATOM 9641  C CB   . ALA A 1 50 ? 0.100   11.770  -14.989 1.00 0.32  ? 50 ALA A CB   5  
ATOM 9642  H H    . ALA A 1 50 ? -0.073  9.040   -16.094 1.00 0.29  ? 50 ALA A H    5  
ATOM 9643  H HA   . ALA A 1 50 ? 1.667   11.455  -16.428 1.00 0.34  ? 50 ALA A HA   5  
ATOM 9644  H HB1  . ALA A 1 50 ? -0.677  11.168  -14.539 1.00 1.06  ? 50 ALA A HB1  5  
ATOM 9645  H HB2  . ALA A 1 50 ? 0.656   12.275  -14.209 1.00 1.04  ? 50 ALA A HB2  5  
ATOM 9646  H HB3  . ALA A 1 50 ? -0.337  12.496  -15.650 1.00 1.10  ? 50 ALA A HB3  5  
ATOM 9647  N N    . CYS A 1 51 ? 2.911   10.761  -14.217 1.00 0.25  ? 51 CYS A N    5  
ATOM 9648  C CA   . CYS A 1 51 ? 3.693   10.061  -13.185 1.00 0.22  ? 51 CYS A CA   5  
ATOM 9649  C C    . CYS A 1 51 ? 3.528   10.851  -11.908 1.00 0.22  ? 51 CYS A C    5  
ATOM 9650  O O    . CYS A 1 51 ? 3.334   12.046  -11.951 1.00 0.24  ? 51 CYS A O    5  
ATOM 9651  C CB   . CYS A 1 51 ? 5.171   9.948   -13.573 1.00 0.24  ? 51 CYS A CB   5  
ATOM 9652  S SG   . CYS A 1 51 ? 5.492   8.232   -14.059 1.00 0.26  ? 51 CYS A SG   5  
ATOM 9653  H H    . CYS A 1 51 ? 3.115   11.697  -14.437 1.00 0.28  ? 51 CYS A H    5  
ATOM 9654  H HA   . CYS A 1 51 ? 3.289   9.074   -13.056 1.00 0.20  ? 51 CYS A HA   5  
ATOM 9655  H HB2  . CYS A 1 51 ? 5.384   10.608  -14.395 1.00 0.28  ? 51 CYS A HB2  5  
ATOM 9656  H HB3  . CYS A 1 51 ? 5.790   10.206  -12.728 1.00 0.27  ? 51 CYS A HB3  5  
ATOM 9657  N N    . LEU A 1 52 ? 3.569   10.207  -10.780 1.00 0.21  ? 52 LEU A N    5  
ATOM 9658  C CA   . LEU A 1 52 ? 3.409   10.942  -9.501  1.00 0.23  ? 52 LEU A CA   5  
ATOM 9659  C C    . LEU A 1 52 ? 4.485   10.448  -8.539  1.00 0.25  ? 52 LEU A C    5  
ATOM 9660  O O    . LEU A 1 52 ? 5.180   9.495   -8.824  1.00 0.25  ? 52 LEU A O    5  
ATOM 9661  C CB   . LEU A 1 52 ? 1.988   10.784  -8.915  1.00 0.22  ? 52 LEU A CB   5  
ATOM 9662  C CG   . LEU A 1 52 ? 1.285   9.540   -9.463  1.00 0.18  ? 52 LEU A CG   5  
ATOM 9663  C CD1  . LEU A 1 52 ? 0.998   9.695   -10.971 1.00 0.17  ? 52 LEU A CD1  5  
ATOM 9664  C CD2  . LEU A 1 52 ? 2.162   8.320   -9.177  1.00 0.19  ? 52 LEU A CD2  5  
ATOM 9665  H H    . LEU A 1 52 ? 3.688   9.236   -10.771 1.00 0.20  ? 52 LEU A H    5  
ATOM 9666  H HA   . LEU A 1 52 ? 3.586   11.974  -9.691  1.00 0.25  ? 52 LEU A HA   5  
ATOM 9667  H HB2  . LEU A 1 52 ? 2.055   10.704  -7.843  1.00 0.25  ? 52 LEU A HB2  5  
ATOM 9668  H HB3  . LEU A 1 52 ? 1.404   11.658  -9.165  1.00 0.24  ? 52 LEU A HB3  5  
ATOM 9669  H HG   . LEU A 1 52 ? 0.356   9.421   -8.958  1.00 0.19  ? 52 LEU A HG   5  
ATOM 9670  H HD11 . LEU A 1 52 ? 1.162   10.726  -11.264 1.00 0.98  ? 52 LEU A HD11 5  
ATOM 9671  H HD12 . LEU A 1 52 ? 1.655   9.054   -11.537 1.00 1.01  ? 52 LEU A HD12 5  
ATOM 9672  H HD13 . LEU A 1 52 ? -0.028  9.429   -11.174 1.00 0.98  ? 52 LEU A HD13 5  
ATOM 9673  H HD21 . LEU A 1 52 ? 3.018   8.628   -8.589  1.00 0.98  ? 52 LEU A HD21 5  
ATOM 9674  H HD22 . LEU A 1 52 ? 1.593   7.593   -8.620  1.00 1.03  ? 52 LEU A HD22 5  
ATOM 9675  H HD23 . LEU A 1 52 ? 2.497   7.891   -10.103 1.00 1.00  ? 52 LEU A HD23 5  
ATOM 9676  N N    . ASN A 1 53 ? 4.666   11.106  -7.430  1.00 0.29  ? 53 ASN A N    5  
ATOM 9677  C CA   . ASN A 1 53 ? 5.741   10.684  -6.481  1.00 0.32  ? 53 ASN A CA   5  
ATOM 9678  C C    . ASN A 1 53 ? 5.182   9.733   -5.411  1.00 0.34  ? 53 ASN A C    5  
ATOM 9679  O O    . ASN A 1 53 ? 4.673   10.200  -4.422  1.00 0.37  ? 53 ASN A O    5  
ATOM 9680  C CB   . ASN A 1 53 ? 6.304   11.925  -5.775  1.00 0.36  ? 53 ASN A CB   5  
ATOM 9681  C CG   . ASN A 1 53 ? 7.470   12.501  -6.579  1.00 0.43  ? 53 ASN A CG   5  
ATOM 9682  O OD1  . ASN A 1 53 ? 7.324   13.506  -7.247  1.00 1.07  ? 53 ASN A OD1  5  
ATOM 9683  N ND2  . ASN A 1 53 ? 8.632   11.907  -6.539  1.00 0.93  ? 53 ASN A ND2  5  
ATOM 9684  H H    . ASN A 1 53 ? 4.116   11.894  -7.236  1.00 0.30  ? 53 ASN A H    5  
ATOM 9685  H HA   . ASN A 1 53 ? 6.531   10.208  -7.029  1.00 0.33  ? 53 ASN A HA   5  
ATOM 9686  H HB2  . ASN A 1 53 ? 5.527   12.668  -5.682  1.00 0.40  ? 53 ASN A HB2  5  
ATOM 9687  H HB3  . ASN A 1 53 ? 6.652   11.648  -4.791  1.00 0.40  ? 53 ASN A HB3  5  
ATOM 9688  H HD21 . ASN A 1 53 ? 8.751   11.099  -5.996  1.00 1.59  ? 53 ASN A HD21 5  
ATOM 9689  H HD22 . ASN A 1 53 ? 9.385   12.268  -7.051  1.00 0.93  ? 53 ASN A HD22 5  
ATOM 9690  N N    . PRO A 1 54 ? 5.315   8.426   -5.583  1.00 0.34  ? 54 PRO A N    5  
ATOM 9691  C CA   . PRO A 1 54 ? 4.822   7.475   -4.565  1.00 0.37  ? 54 PRO A CA   5  
ATOM 9692  C C    . PRO A 1 54 ? 5.584   7.697   -3.255  1.00 0.43  ? 54 PRO A C    5  
ATOM 9693  O O    . PRO A 1 54 ? 5.041   7.510   -2.182  1.00 0.46  ? 54 PRO A O    5  
ATOM 9694  C CB   . PRO A 1 54 ? 5.071   6.100   -5.184  1.00 0.37  ? 54 PRO A CB   5  
ATOM 9695  C CG   . PRO A 1 54 ? 6.139   6.320   -6.268  1.00 0.36  ? 54 PRO A CG   5  
ATOM 9696  C CD   . PRO A 1 54 ? 5.968   7.773   -6.738  1.00 0.32  ? 54 PRO A CD   5  
ATOM 9697  H HA   . PRO A 1 54 ? 3.765   7.617   -4.406  1.00 0.36  ? 54 PRO A HA   5  
ATOM 9698  H HB2  . PRO A 1 54 ? 5.432   5.411   -4.432  1.00 0.41  ? 54 PRO A HB2  5  
ATOM 9699  H HB3  . PRO A 1 54 ? 4.166   5.723   -5.634  1.00 0.35  ? 54 PRO A HB3  5  
ATOM 9700  H HG2  . PRO A 1 54 ? 7.121   6.177   -5.851  1.00 0.40  ? 54 PRO A HG2  5  
ATOM 9701  H HG3  . PRO A 1 54 ? 5.978   5.651   -7.089  1.00 0.36  ? 54 PRO A HG3  5  
ATOM 9702  H HD2  . PRO A 1 54 ? 6.931   8.204   -6.947  1.00 0.34  ? 54 PRO A HD2  5  
ATOM 9703  H HD3  . PRO A 1 54 ? 5.324   7.816   -7.603  1.00 0.28  ? 54 PRO A HD3  5  
ATOM 9704  N N    . ALA A 1 55 ? 6.811   8.174   -3.334  1.00 0.45  ? 55 ALA A N    5  
ATOM 9705  C CA   . ALA A 1 55 ? 7.566   8.499   -2.090  1.00 0.51  ? 55 ALA A CA   5  
ATOM 9706  C C    . ALA A 1 55 ? 6.787   9.613   -1.375  1.00 0.52  ? 55 ALA A C    5  
ATOM 9707  O O    . ALA A 1 55 ? 6.760   9.691   -0.161  1.00 0.56  ? 55 ALA A O    5  
ATOM 9708  C CB   . ALA A 1 55 ? 8.973   8.993   -2.445  1.00 0.54  ? 55 ALA A CB   5  
ATOM 9709  H H    . ALA A 1 55 ? 7.207   8.372   -4.209  1.00 0.43  ? 55 ALA A H    5  
ATOM 9710  H HA   . ALA A 1 55 ? 7.626   7.626   -1.456  1.00 0.53  ? 55 ALA A HA   5  
ATOM 9711  H HB1  . ALA A 1 55 ? 8.911   9.708   -3.252  1.00 1.19  ? 55 ALA A HB1  5  
ATOM 9712  H HB2  . ALA A 1 55 ? 9.419   9.464   -1.581  1.00 1.06  ? 55 ALA A HB2  5  
ATOM 9713  H HB3  . ALA A 1 55 ? 9.582   8.155   -2.752  1.00 1.13  ? 55 ALA A HB3  5  
ATOM 9714  N N    . SER A 1 56 ? 6.117   10.452  -2.145  1.00 0.50  ? 56 SER A N    5  
ATOM 9715  C CA   . SER A 1 56 ? 5.286   11.544  -1.565  1.00 0.51  ? 56 SER A CA   5  
ATOM 9716  C C    . SER A 1 56 ? 4.145   10.906  -0.748  1.00 0.51  ? 56 SER A C    5  
ATOM 9717  O O    . SER A 1 56 ? 3.688   9.831   -1.085  1.00 0.51  ? 56 SER A O    5  
ATOM 9718  C CB   . SER A 1 56 ? 4.681   12.380  -2.699  1.00 0.50  ? 56 SER A CB   5  
ATOM 9719  O OG   . SER A 1 56 ? 4.640   13.748  -2.310  1.00 0.56  ? 56 SER A OG   5  
ATOM 9720  H H    . SER A 1 56 ? 6.143   10.339  -3.116  1.00 0.47  ? 56 SER A H    5  
ATOM 9721  H HA   . SER A 1 56 ? 5.898   12.169  -0.945  1.00 0.54  ? 56 SER A HA   5  
ATOM 9722  H HB2  . SER A 1 56 ? 5.284   12.280  -3.586  1.00 0.46  ? 56 SER A HB2  5  
ATOM 9723  H HB3  . SER A 1 56 ? 3.680   12.025  -2.913  1.00 0.51  ? 56 SER A HB3  5  
ATOM 9724  H HG   . SER A 1 56 ? 5.355   14.206  -2.758  1.00 1.08  ? 56 SER A HG   5  
ATOM 9725  N N    . PRO A 1 57 ? 3.704   11.580  0.292   1.00 0.53  ? 57 PRO A N    5  
ATOM 9726  C CA   . PRO A 1 57 ? 2.607   11.075  1.146   1.00 0.53  ? 57 PRO A CA   5  
ATOM 9727  C C    . PRO A 1 57 ? 1.266   11.222  0.413   1.00 0.51  ? 57 PRO A C    5  
ATOM 9728  O O    . PRO A 1 57 ? 0.541   10.257  0.222   1.00 0.51  ? 57 PRO A O    5  
ATOM 9729  C CB   . PRO A 1 57 ? 2.678   11.967  2.390   1.00 0.59  ? 57 PRO A CB   5  
ATOM 9730  C CG   . PRO A 1 57 ? 3.421   13.256  1.964   1.00 0.62  ? 57 PRO A CG   5  
ATOM 9731  C CD   . PRO A 1 57 ? 4.240   12.896  0.708   1.00 0.58  ? 57 PRO A CD   5  
ATOM 9732  H HA   . PRO A 1 57 ? 2.782   10.046  1.417   1.00 0.54  ? 57 PRO A HA   5  
ATOM 9733  H HB2  . PRO A 1 57 ? 1.679   12.207  2.731   1.00 0.60  ? 57 PRO A HB2  5  
ATOM 9734  H HB3  . PRO A 1 57 ? 3.229   11.471  3.173   1.00 0.62  ? 57 PRO A HB3  5  
ATOM 9735  H HG2  . PRO A 1 57 ? 2.708   14.035  1.734   1.00 0.63  ? 57 PRO A HG2  5  
ATOM 9736  H HG3  . PRO A 1 57 ? 4.085   13.579  2.750   1.00 0.67  ? 57 PRO A HG3  5  
ATOM 9737  H HD2  . PRO A 1 57 ? 4.083   13.633  -0.066  1.00 0.59  ? 57 PRO A HD2  5  
ATOM 9738  H HD3  . PRO A 1 57 ? 5.288   12.812  0.950   1.00 0.59  ? 57 PRO A HD3  5  
ATOM 9739  N N    . ILE A 1 58 ? 0.955   12.418  -0.027  1.00 0.52  ? 58 ILE A N    5  
ATOM 9740  C CA   . ILE A 1 58 ? -0.312  12.659  -0.785  1.00 0.51  ? 58 ILE A CA   5  
ATOM 9741  C C    . ILE A 1 58 ? -0.381  11.687  -1.949  1.00 0.45  ? 58 ILE A C    5  
ATOM 9742  O O    . ILE A 1 58 ? -1.405  11.113  -2.248  1.00 0.44  ? 58 ILE A O    5  
ATOM 9743  C CB   . ILE A 1 58 ? -0.280  14.099  -1.332  1.00 0.54  ? 58 ILE A CB   5  
ATOM 9744  C CG1  . ILE A 1 58 ? -1.430  14.910  -0.723  1.00 0.62  ? 58 ILE A CG1  5  
ATOM 9745  C CG2  . ILE A 1 58 ? -0.399  14.110  -2.869  1.00 0.49  ? 58 ILE A CG2  5  
ATOM 9746  C CD1  . ILE A 1 58 ? -1.154  15.163  0.761   1.00 0.68  ? 58 ILE A CD1  5  
ATOM 9747  H H    . ILE A 1 58 ? 1.573   13.162  0.123   1.00 0.55  ? 58 ILE A H    5  
ATOM 9748  H HA   . ILE A 1 58 ? -1.166  12.519  -0.141  1.00 0.55  ? 58 ILE A HA   5  
ATOM 9749  H HB   . ILE A 1 58 ? 0.662   14.545  -1.061  1.00 0.56  ? 58 ILE A HB   5  
ATOM 9750  H HG12 . ILE A 1 58 ? -1.516  15.855  -1.240  1.00 0.64  ? 58 ILE A HG12 5  
ATOM 9751  H HG13 . ILE A 1 58 ? -2.352  14.358  -0.826  1.00 0.62  ? 58 ILE A HG13 5  
ATOM 9752  H HG21 . ILE A 1 58 ? -1.180  13.431  -3.179  1.00 1.11  ? 58 ILE A HG21 5  
ATOM 9753  H HG22 . ILE A 1 58 ? -0.631  15.104  -3.208  1.00 1.12  ? 58 ILE A HG22 5  
ATOM 9754  H HG23 . ILE A 1 58 ? 0.542   13.793  -3.303  1.00 1.14  ? 58 ILE A HG23 5  
ATOM 9755  H HD11 . ILE A 1 58 ? -0.089  15.253  0.921   1.00 1.10  ? 58 ILE A HD11 5  
ATOM 9756  H HD12 . ILE A 1 58 ? -1.641  16.078  1.066   1.00 1.28  ? 58 ILE A HD12 5  
ATOM 9757  H HD13 . ILE A 1 58 ? -1.538  14.340  1.344   1.00 1.15  ? 58 ILE A HD13 5  
ATOM 9758  N N    . VAL A 1 59 ? 0.708   11.549  -2.632  1.00 0.43  ? 59 VAL A N    5  
ATOM 9759  C CA   . VAL A 1 59 ? 0.750   10.667  -3.803  1.00 0.40  ? 59 VAL A CA   5  
ATOM 9760  C C    . VAL A 1 59 ? 0.612   9.214   -3.363  1.00 0.37  ? 59 VAL A C    5  
ATOM 9761  O O    . VAL A 1 59 ? -0.098  8.451   -3.983  1.00 0.33  ? 59 VAL A O    5  
ATOM 9762  C CB   . VAL A 1 59 ? 2.076   10.891  -4.491  1.00 0.51  ? 59 VAL A CB   5  
ATOM 9763  C CG1  . VAL A 1 59 ? 2.236   9.907   -5.614  1.00 0.31  ? 59 VAL A CG1  5  
ATOM 9764  C CG2  . VAL A 1 59 ? 2.149   12.313  -5.040  1.00 0.88  ? 59 VAL A CG2  5  
ATOM 9765  H H    . VAL A 1 59 ? 1.507   12.064  -2.389  1.00 0.46  ? 59 VAL A H    5  
ATOM 9766  H HA   . VAL A 1 59 ? -0.068  10.915  -4.458  1.00 0.41  ? 59 VAL A HA   5  
ATOM 9767  H HB   . VAL A 1 59 ? 2.862   10.742  -3.775  1.00 0.83  ? 59 VAL A HB   5  
ATOM 9768  H HG11 . VAL A 1 59 ? 1.291   9.780   -6.108  1.00 1.01  ? 59 VAL A HG11 5  
ATOM 9769  H HG12 . VAL A 1 59 ? 2.967   10.283  -6.306  1.00 1.11  ? 59 VAL A HG12 5  
ATOM 9770  H HG13 . VAL A 1 59 ? 2.570   8.966   -5.204  1.00 1.09  ? 59 VAL A HG13 5  
ATOM 9771  H HG21 . VAL A 1 59 ? 1.267   12.860  -4.740  1.00 1.47  ? 59 VAL A HG21 5  
ATOM 9772  H HG22 . VAL A 1 59 ? 3.026   12.805  -4.651  1.00 1.52  ? 59 VAL A HG22 5  
ATOM 9773  H HG23 . VAL A 1 59 ? 2.202   12.282  -6.119  1.00 1.24  ? 59 VAL A HG23 5  
ATOM 9774  N N    . LYS A 1 60 ? 1.237   8.831   -2.273  1.00 0.43  ? 60 LYS A N    5  
ATOM 9775  C CA   . LYS A 1 60 ? 1.060   7.433   -1.781  1.00 0.43  ? 60 LYS A CA   5  
ATOM 9776  C C    . LYS A 1 60 ? -0.452  7.204   -1.579  1.00 0.43  ? 60 LYS A C    5  
ATOM 9777  O O    . LYS A 1 60 ? -0.944  6.089   -1.610  1.00 0.42  ? 60 LYS A O    5  
ATOM 9778  C CB   . LYS A 1 60 ? 1.780   7.260   -0.446  1.00 0.50  ? 60 LYS A CB   5  
ATOM 9779  C CG   . LYS A 1 60 ? 2.385   5.858   -0.363  1.00 0.60  ? 60 LYS A CG   5  
ATOM 9780  C CD   . LYS A 1 60 ? 2.624   5.496   1.105   1.00 0.91  ? 60 LYS A CD   5  
ATOM 9781  C CE   . LYS A 1 60 ? 3.679   4.391   1.196   1.00 0.99  ? 60 LYS A CE   5  
ATOM 9782  N NZ   . LYS A 1 60 ? 3.607   3.744   2.538   1.00 1.67  ? 60 LYS A NZ   5  
ATOM 9783  H H    . LYS A 1 60 ? 1.776   9.470   -1.761  1.00 0.47  ? 60 LYS A H    5  
ATOM 9784  H HA   . LYS A 1 60 ? 1.452   6.738   -2.516  1.00 0.40  ? 60 LYS A HA   5  
ATOM 9785  H HB2  . LYS A 1 60 ? 2.562   8.000   -0.363  1.00 0.65  ? 60 LYS A HB2  5  
ATOM 9786  H HB3  . LYS A 1 60 ? 1.073   7.394   0.361   1.00 0.59  ? 60 LYS A HB3  5  
ATOM 9787  H HG2  . LYS A 1 60 ? 1.703   5.146   -0.805  1.00 1.10  ? 60 LYS A HG2  5  
ATOM 9788  H HG3  . LYS A 1 60 ? 3.324   5.838   -0.895  1.00 0.87  ? 60 LYS A HG3  5  
ATOM 9789  H HD2  . LYS A 1 60 ? 2.970   6.369   1.639   1.00 1.38  ? 60 LYS A HD2  5  
ATOM 9790  H HD3  . LYS A 1 60 ? 1.701   5.147   1.545   1.00 1.48  ? 60 LYS A HD3  5  
ATOM 9791  H HE2  . LYS A 1 60 ? 3.495   3.653   0.430   1.00 1.20  ? 60 LYS A HE2  5  
ATOM 9792  H HE3  . LYS A 1 60 ? 4.661   4.819   1.056   1.00 1.40  ? 60 LYS A HE3  5  
ATOM 9793  H HZ1  . LYS A 1 60 ? 3.633   4.474   3.278   1.00 2.22  ? 60 LYS A HZ1  5  
ATOM 9794  H HZ2  . LYS A 1 60 ? 2.721   3.203   2.615   1.00 2.08  ? 60 LYS A HZ2  5  
ATOM 9795  H HZ3  . LYS A 1 60 ? 4.416   3.104   2.659   1.00 2.01  ? 60 LYS A HZ3  5  
ATOM 9796  N N    . LYS A 1 61 ? -1.184  8.291   -1.439  1.00 0.45  ? 61 LYS A N    5  
ATOM 9797  C CA   . LYS A 1 61 ? -2.653  8.246   -1.305  1.00 0.46  ? 61 LYS A CA   5  
ATOM 9798  C C    . LYS A 1 61 ? -3.187  7.907   -2.679  1.00 0.42  ? 61 LYS A C    5  
ATOM 9799  O O    . LYS A 1 61 ? -3.945  6.990   -2.853  1.00 0.44  ? 61 LYS A O    5  
ATOM 9800  C CB   . LYS A 1 61 ? -3.133  9.640   -0.915  1.00 0.51  ? 61 LYS A CB   5  
ATOM 9801  C CG   . LYS A 1 61 ? -4.242  9.537   0.125   1.00 0.72  ? 61 LYS A CG   5  
ATOM 9802  C CD   . LYS A 1 61 ? -5.299  10.604  -0.157  1.00 1.03  ? 61 LYS A CD   5  
ATOM 9803  C CE   . LYS A 1 61 ? -6.547  10.325  0.684   1.00 1.30  ? 61 LYS A CE   5  
ATOM 9804  N NZ   . LYS A 1 61 ? -7.286  11.596  0.922   1.00 1.87  ? 61 LYS A NZ   5  
ATOM 9805  H H    . LYS A 1 61 ? -0.756  9.160   -1.480  1.00 0.46  ? 61 LYS A H    5  
ATOM 9806  H HA   . LYS A 1 61 ? -2.955  7.512   -0.576  1.00 0.49  ? 61 LYS A HA   5  
ATOM 9807  H HB2  . LYS A 1 61 ? -2.298  10.199  -0.511  1.00 0.58  ? 61 LYS A HB2  5  
ATOM 9808  H HB3  . LYS A 1 61 ? -3.501  10.148  -1.798  1.00 0.66  ? 61 LYS A HB3  5  
ATOM 9809  H HG2  . LYS A 1 61 ? -4.693  8.556   0.073   1.00 1.41  ? 61 LYS A HG2  5  
ATOM 9810  H HG3  . LYS A 1 61 ? -3.826  9.694   1.109   1.00 1.05  ? 61 LYS A HG3  5  
ATOM 9811  H HD2  . LYS A 1 61 ? -4.900  11.575  0.094   1.00 1.37  ? 61 LYS A HD2  5  
ATOM 9812  H HD3  . LYS A 1 61 ? -5.559  10.582  -1.205  1.00 1.76  ? 61 LYS A HD3  5  
ATOM 9813  H HE2  . LYS A 1 61 ? -7.185  9.630   0.158   1.00 1.85  ? 61 LYS A HE2  5  
ATOM 9814  H HE3  . LYS A 1 61 ? -6.253  9.896   1.631   1.00 1.55  ? 61 LYS A HE3  5  
ATOM 9815  H HZ1  . LYS A 1 61 ? -6.631  12.315  1.293   1.00 2.42  ? 61 LYS A HZ1  5  
ATOM 9816  H HZ2  . LYS A 1 61 ? -7.699  11.931  0.029   1.00 2.11  ? 61 LYS A HZ2  5  
ATOM 9817  H HZ3  . LYS A 1 61 ? -8.046  11.432  1.613   1.00 2.27  ? 61 LYS A HZ3  5  
ATOM 9818  N N    . ILE A 1 62 ? -2.736  8.649   -3.659  1.00 0.37  ? 62 ILE A N    5  
ATOM 9819  C CA   . ILE A 1 62 ? -3.119  8.417   -5.073  1.00 0.34  ? 62 ILE A CA   5  
ATOM 9820  C C    . ILE A 1 62 ? -3.127  6.913   -5.369  1.00 0.33  ? 62 ILE A C    5  
ATOM 9821  O O    . ILE A 1 62 ? -3.994  6.425   -6.062  1.00 0.34  ? 62 ILE A O    5  
ATOM 9822  C CB   . ILE A 1 62 ? -2.080  9.163   -5.941  1.00 0.32  ? 62 ILE A CB   5  
ATOM 9823  C CG1  . ILE A 1 62 ? -2.745  10.265  -6.764  1.00 0.34  ? 62 ILE A CG1  5  
ATOM 9824  C CG2  . ILE A 1 62 ? -1.332  8.210   -6.870  1.00 0.30  ? 62 ILE A CG2  5  
ATOM 9825  C CD1  . ILE A 1 62 ? -3.603  11.122  -5.841  1.00 0.36  ? 62 ILE A CD1  5  
ATOM 9826  H H    . ILE A 1 62 ? -2.105  9.369   -3.458  1.00 0.37  ? 62 ILE A H    5  
ATOM 9827  H HA   . ILE A 1 62 ? -4.102  8.812   -5.243  1.00 0.36  ? 62 ILE A HA   5  
ATOM 9828  H HB   . ILE A 1 62 ? -1.366  9.621   -5.281  1.00 0.33  ? 62 ILE A HB   5  
ATOM 9829  H HG12 . ILE A 1 62 ? -1.978  10.883  -7.218  1.00 0.35  ? 62 ILE A HG12 5  
ATOM 9830  H HG13 . ILE A 1 62 ? -3.357  9.829   -7.532  1.00 0.35  ? 62 ILE A HG13 5  
ATOM 9831  H HG21 . ILE A 1 62 ? -2.035  7.704   -7.510  1.00 1.02  ? 62 ILE A HG21 5  
ATOM 9832  H HG22 . ILE A 1 62 ? -0.631  8.770   -7.468  1.00 1.06  ? 62 ILE A HG22 5  
ATOM 9833  H HG23 . ILE A 1 62 ? -0.796  7.483   -6.277  1.00 1.07  ? 62 ILE A HG23 5  
ATOM 9834  H HD11 . ILE A 1 62 ? -3.084  11.264  -4.904  1.00 1.05  ? 62 ILE A HD11 5  
ATOM 9835  H HD12 . ILE A 1 62 ? -3.783  12.078  -6.305  1.00 1.01  ? 62 ILE A HD12 5  
ATOM 9836  H HD13 . ILE A 1 62 ? -4.542  10.621  -5.661  1.00 1.08  ? 62 ILE A HD13 5  
ATOM 9837  N N    . ILE A 1 63 ? -2.184  6.174   -4.828  1.00 0.31  ? 63 ILE A N    5  
ATOM 9838  C CA   . ILE A 1 63 ? -2.174  4.701   -5.067  1.00 0.31  ? 63 ILE A CA   5  
ATOM 9839  C C    . ILE A 1 63 ? -3.321  4.072   -4.301  1.00 0.37  ? 63 ILE A C    5  
ATOM 9840  O O    . ILE A 1 63 ? -4.115  3.324   -4.838  1.00 0.41  ? 63 ILE A O    5  
ATOM 9841  C CB   . ILE A 1 63 ? -0.882  4.098   -4.525  1.00 0.32  ? 63 ILE A CB   5  
ATOM 9842  C CG1  . ILE A 1 63 ? 0.290   4.629   -5.324  1.00 0.32  ? 63 ILE A CG1  5  
ATOM 9843  C CG2  . ILE A 1 63 ? -0.934  2.571   -4.615  1.00 0.34  ? 63 ILE A CG2  5  
ATOM 9844  C CD1  . ILE A 1 63 ? 0.737   5.936   -4.707  1.00 0.42  ? 63 ILE A CD1  5  
ATOM 9845  H H    . ILE A 1 63 ? -1.494  6.588   -4.247  1.00 0.32  ? 63 ILE A H    5  
ATOM 9846  H HA   . ILE A 1 63 ? -2.267  4.491   -6.122  1.00 0.30  ? 63 ILE A HA   5  
ATOM 9847  H HB   . ILE A 1 63 ? -0.768  4.386   -3.490  1.00 0.35  ? 63 ILE A HB   5  
ATOM 9848  H HG12 . ILE A 1 63 ? 1.090   3.927   -5.283  1.00 0.31  ? 63 ILE A HG12 5  
ATOM 9849  H HG13 . ILE A 1 63 ? -0.005  4.793   -6.350  1.00 0.48  ? 63 ILE A HG13 5  
ATOM 9850  H HG21 . ILE A 1 63 ? -1.686  2.275   -5.332  1.00 1.03  ? 63 ILE A HG21 5  
ATOM 9851  H HG22 . ILE A 1 63 ? 0.027   2.194   -4.922  1.00 1.03  ? 63 ILE A HG22 5  
ATOM 9852  H HG23 . ILE A 1 63 ? -1.186  2.166   -3.643  1.00 1.02  ? 63 ILE A HG23 5  
ATOM 9853  H HD11 . ILE A 1 63 ? 0.284   6.038   -3.731  1.00 1.06  ? 63 ILE A HD11 5  
ATOM 9854  H HD12 . ILE A 1 63 ? 1.808   5.940   -4.612  1.00 1.07  ? 63 ILE A HD12 5  
ATOM 9855  H HD13 . ILE A 1 63 ? 0.421   6.751   -5.337  1.00 1.16  ? 63 ILE A HD13 5  
ATOM 9856  N N    . GLU A 1 64 ? -3.375  4.358   -3.032  1.00 0.39  ? 64 GLU A N    5  
ATOM 9857  C CA   . GLU A 1 64 ? -4.425  3.768   -2.167  1.00 0.46  ? 64 GLU A CA   5  
ATOM 9858  C C    . GLU A 1 64 ? -5.824  4.198   -2.630  1.00 0.49  ? 64 GLU A C    5  
ATOM 9859  O O    . GLU A 1 64 ? -6.731  3.392   -2.700  1.00 0.62  ? 64 GLU A O    5  
ATOM 9860  C CB   . GLU A 1 64 ? -4.216  4.234   -0.730  1.00 0.49  ? 64 GLU A CB   5  
ATOM 9861  C CG   . GLU A 1 64 ? -3.423  3.180   0.044   1.00 1.04  ? 64 GLU A CG   5  
ATOM 9862  C CD   . GLU A 1 64 ? -3.080  3.718   1.436   1.00 1.41  ? 64 GLU A CD   5  
ATOM 9863  O OE1  . GLU A 1 64 ? -2.068  4.390   1.556   1.00 1.81  ? 64 GLU A OE1  5  
ATOM 9864  O OE2  . GLU A 1 64 ? -3.836  3.451   2.356   1.00 2.00  ? 64 GLU A OE2  5  
ATOM 9865  H H    . GLU A 1 64 ? -2.692  4.953   -2.641  1.00 0.37  ? 64 GLU A H    5  
ATOM 9866  H HA   . GLU A 1 64 ? -4.334  2.694   -2.215  1.00 0.49  ? 64 GLU A HA   5  
ATOM 9867  H HB2  . GLU A 1 64 ? -3.673  5.167   -0.735  1.00 0.72  ? 64 GLU A HB2  5  
ATOM 9868  H HB3  . GLU A 1 64 ? -5.176  4.378   -0.260  1.00 0.75  ? 64 GLU A HB3  5  
ATOM 9869  H HG2  . GLU A 1 64 ? -4.018  2.282   0.140   1.00 1.39  ? 64 GLU A HG2  5  
ATOM 9870  H HG3  . GLU A 1 64 ? -2.511  2.953   -0.487  1.00 1.44  ? 64 GLU A HG3  5  
ATOM 9871  N N    . LYS A 1 65 ? -6.009  5.460   -2.935  1.00 0.48  ? 65 LYS A N    5  
ATOM 9872  C CA   . LYS A 1 65 ? -7.347  5.936   -3.384  1.00 0.51  ? 65 LYS A CA   5  
ATOM 9873  C C    . LYS A 1 65 ? -7.643  5.347   -4.756  1.00 0.51  ? 65 LYS A C    5  
ATOM 9874  O O    . LYS A 1 65 ? -8.737  4.879   -5.007  1.00 0.56  ? 65 LYS A O    5  
ATOM 9875  C CB   . LYS A 1 65 ? -7.369  7.467   -3.441  1.00 0.52  ? 65 LYS A CB   5  
ATOM 9876  C CG   . LYS A 1 65 ? -8.654  7.943   -4.127  1.00 1.07  ? 65 LYS A CG   5  
ATOM 9877  C CD   . LYS A 1 65 ? -8.949  9.390   -3.723  1.00 1.45  ? 65 LYS A CD   5  
ATOM 9878  C CE   . LYS A 1 65 ? -9.653  9.408   -2.363  1.00 1.72  ? 65 LYS A CE   5  
ATOM 9879  N NZ   . LYS A 1 65 ? -10.347 10.715  -2.174  1.00 2.15  ? 65 LYS A NZ   5  
ATOM 9880  H H    . LYS A 1 65 ? -5.267  6.094   -2.866  1.00 0.54  ? 65 LYS A H    5  
ATOM 9881  H HA   . LYS A 1 65 ? -8.088  5.584   -2.690  1.00 0.56  ? 65 LYS A HA   5  
ATOM 9882  H HB2  . LYS A 1 65 ? -7.329  7.862   -2.436  1.00 0.92  ? 65 LYS A HB2  5  
ATOM 9883  H HB3  . LYS A 1 65 ? -6.514  7.818   -3.999  1.00 1.10  ? 65 LYS A HB3  5  
ATOM 9884  H HG2  . LYS A 1 65 ? -8.530  7.888   -5.199  1.00 1.56  ? 65 LYS A HG2  5  
ATOM 9885  H HG3  . LYS A 1 65 ? -9.477  7.313   -3.827  1.00 1.65  ? 65 LYS A HG3  5  
ATOM 9886  H HD2  . LYS A 1 65 ? -8.024  9.945   -3.660  1.00 1.79  ? 65 LYS A HD2  5  
ATOM 9887  H HD3  . LYS A 1 65 ? -9.591  9.844   -4.464  1.00 1.92  ? 65 LYS A HD3  5  
ATOM 9888  H HE2  . LYS A 1 65 ? -10.377 8.608   -2.322  1.00 2.13  ? 65 LYS A HE2  5  
ATOM 9889  H HE3  . LYS A 1 65 ? -8.923  9.273   -1.579  1.00 2.04  ? 65 LYS A HE3  5  
ATOM 9890  H HZ1  . LYS A 1 65 ? -9.720  11.490  -2.473  1.00 2.47  ? 65 LYS A HZ1  5  
ATOM 9891  H HZ2  . LYS A 1 65 ? -11.214 10.734  -2.746  1.00 2.64  ? 65 LYS A HZ2  5  
ATOM 9892  H HZ3  . LYS A 1 65 ? -10.590 10.835  -1.170  1.00 2.41  ? 65 LYS A HZ3  5  
ATOM 9893  N N    . MET A 1 66 ? -6.670  5.322   -5.631  1.00 0.46  ? 66 MET A N    5  
ATOM 9894  C CA   . MET A 1 66 ? -6.893  4.701   -6.960  1.00 0.46  ? 66 MET A CA   5  
ATOM 9895  C C    . MET A 1 66 ? -7.294  3.241   -6.721  1.00 0.50  ? 66 MET A C    5  
ATOM 9896  O O    . MET A 1 66 ? -8.123  2.684   -7.414  1.00 0.54  ? 66 MET A O    5  
ATOM 9897  C CB   . MET A 1 66 ? -5.606  4.766   -7.775  1.00 0.42  ? 66 MET A CB   5  
ATOM 9898  C CG   . MET A 1 66 ? -5.542  6.106   -8.515  1.00 0.40  ? 66 MET A CG   5  
ATOM 9899  S SD   . MET A 1 66 ? -6.676  6.052   -9.921  1.00 1.14  ? 66 MET A SD   5  
ATOM 9900  C CE   . MET A 1 66 ? -5.762  4.843   -10.909 1.00 0.37  ? 66 MET A CE   5  
ATOM 9901  H H    . MET A 1 66 ? -5.789  5.676   -5.399  1.00 0.42  ? 66 MET A H    5  
ATOM 9902  H HA   . MET A 1 66 ? -7.683  5.224   -7.472  1.00 0.48  ? 66 MET A HA   5  
ATOM 9903  H HB2  . MET A 1 66 ? -4.759  4.672   -7.113  1.00 0.40  ? 66 MET A HB2  5  
ATOM 9904  H HB3  . MET A 1 66 ? -5.596  3.959   -8.488  1.00 0.46  ? 66 MET A HB3  5  
ATOM 9905  H HG2  . MET A 1 66 ? -5.833  6.908   -7.847  1.00 0.76  ? 66 MET A HG2  5  
ATOM 9906  H HG3  . MET A 1 66 ? -4.536  6.281   -8.866  1.00 0.67  ? 66 MET A HG3  5  
ATOM 9907  H HE1  . MET A 1 66 ? -4.776  4.703   -10.498 1.00 1.09  ? 66 MET A HE1  5  
ATOM 9908  H HE2  . MET A 1 66 ? -6.289  3.897   -10.907 1.00 1.06  ? 66 MET A HE2  5  
ATOM 9909  H HE3  . MET A 1 66 ? -5.677  5.209   -11.921 1.00 1.05  ? 66 MET A HE3  5  
ATOM 9910  N N    . LEU A 1 67 ? -6.723  2.645   -5.696  1.00 0.50  ? 67 LEU A N    5  
ATOM 9911  C CA   . LEU A 1 67 ? -7.054  1.249   -5.319  1.00 0.55  ? 67 LEU A CA   5  
ATOM 9912  C C    . LEU A 1 67 ? -8.512  1.188   -4.847  1.00 0.60  ? 67 LEU A C    5  
ATOM 9913  O O    . LEU A 1 67 ? -9.197  0.203   -5.049  1.00 0.64  ? 67 LEU A O    5  
ATOM 9914  C CB   . LEU A 1 67 ? -6.146  0.824   -4.162  1.00 0.56  ? 67 LEU A CB   5  
ATOM 9915  C CG   . LEU A 1 67 ? -5.016  -0.062  -4.679  1.00 0.53  ? 67 LEU A CG   5  
ATOM 9916  C CD1  . LEU A 1 67 ? -3.682  0.538   -4.245  1.00 0.53  ? 67 LEU A CD1  5  
ATOM 9917  C CD2  . LEU A 1 67 ? -5.160  -1.469  -4.091  1.00 0.56  ? 67 LEU A CD2  5  
ATOM 9918  H H    . LEU A 1 67 ? -6.084  3.137   -5.150  1.00 0.49  ? 67 LEU A H    5  
ATOM 9919  H HA   . LEU A 1 67 ? -6.901  0.599   -6.160  1.00 0.55  ? 67 LEU A HA   5  
ATOM 9920  H HB2  . LEU A 1 67 ? -5.724  1.705   -3.705  1.00 0.57  ? 67 LEU A HB2  5  
ATOM 9921  H HB3  . LEU A 1 67 ? -6.719  0.286   -3.426  1.00 0.60  ? 67 LEU A HB3  5  
ATOM 9922  H HG   . LEU A 1 67 ? -5.057  -0.112  -5.758  1.00 0.51  ? 67 LEU A HG   5  
ATOM 9923  H HD11 . LEU A 1 67 ? -3.846  1.217   -3.419  1.00 1.24  ? 67 LEU A HD11 5  
ATOM 9924  H HD12 . LEU A 1 67 ? -3.014  -0.249  -3.935  1.00 1.19  ? 67 LEU A HD12 5  
ATOM 9925  H HD13 . LEU A 1 67 ? -3.247  1.078   -5.072  1.00 0.98  ? 67 LEU A HD13 5  
ATOM 9926  H HD21 . LEU A 1 67 ? -6.172  -1.818  -4.235  1.00 1.16  ? 67 LEU A HD21 5  
ATOM 9927  H HD22 . LEU A 1 67 ? -4.475  -2.139  -4.589  1.00 1.18  ? 67 LEU A HD22 5  
ATOM 9928  H HD23 . LEU A 1 67 ? -4.935  -1.443  -3.035  1.00 1.13  ? 67 LEU A HD23 5  
ATOM 9929  N N    . ASN A 1 68 ? -8.985  2.240   -4.208  1.00 0.63  ? 68 ASN A N    5  
ATOM 9930  C CA   . ASN A 1 68 ? -10.400 2.245   -3.709  1.00 0.70  ? 68 ASN A CA   5  
ATOM 9931  C C    . ASN A 1 68 ? -11.323 2.904   -4.747  1.00 0.76  ? 68 ASN A C    5  
ATOM 9932  O O    . ASN A 1 68 ? -11.317 4.109   -4.913  1.00 0.92  ? 68 ASN A O    5  
ATOM 9933  C CB   . ASN A 1 68 ? -10.495 3.015   -2.380  1.00 0.78  ? 68 ASN A CB   5  
ATOM 9934  C CG   . ASN A 1 68 ? -11.844 2.718   -1.718  1.00 1.48  ? 68 ASN A CG   5  
ATOM 9935  O OD1  . ASN A 1 68 ? -12.674 3.595   -1.587  1.00 2.21  ? 68 ASN A OD1  5  
ATOM 9936  N ND2  . ASN A 1 68 ? -12.099 1.510   -1.293  1.00 2.00  ? 68 ASN A ND2  5  
ATOM 9937  H H    . ASN A 1 68 ? -8.400  3.026   -4.057  1.00 0.62  ? 68 ASN A H    5  
ATOM 9938  H HA   . ASN A 1 68 ? -10.718 1.225   -3.546  1.00 0.72  ? 68 ASN A HA   5  
ATOM 9939  H HB2  . ASN A 1 68 ? -9.696  2.705   -1.719  1.00 1.16  ? 68 ASN A HB2  5  
ATOM 9940  H HB3  . ASN A 1 68 ? -10.417 4.078   -2.567  1.00 1.06  ? 68 ASN A HB3  5  
ATOM 9941  H HD21 . ASN A 1 68 ? -11.431 0.800   -1.398  1.00 2.14  ? 68 ASN A HD21 5  
ATOM 9942  H HD22 . ASN A 1 68 ? -12.961 1.312   -0.870  1.00 2.63  ? 68 ASN A HD22 5  
ATOM 9943  N N    . SER A 1 69 ? -12.124 2.121   -5.438  1.00 0.87  ? 69 SER A N    5  
ATOM 9944  C CA   . SER A 1 69 ? -13.056 2.691   -6.455  1.00 0.99  ? 69 SER A CA   5  
ATOM 9945  C C    . SER A 1 69 ? -13.963 1.577   -6.998  1.00 1.13  ? 69 SER A C    5  
ATOM 9946  O O    . SER A 1 69 ? -13.717 1.023   -8.055  1.00 1.69  ? 69 SER A O    5  
ATOM 9947  C CB   . SER A 1 69 ? -12.256 3.315   -7.604  1.00 1.46  ? 69 SER A CB   5  
ATOM 9948  O OG   . SER A 1 69 ? -13.147 3.982   -8.489  1.00 2.02  ? 69 SER A OG   5  
ATOM 9949  H H    . SER A 1 69 ? -12.120 1.159   -5.280  1.00 1.01  ? 69 SER A H    5  
ATOM 9950  H HA   . SER A 1 69 ? -13.662 3.445   -5.986  1.00 1.09  ? 69 SER A HA   5  
ATOM 9951  H HB2  . SER A 1 69 ? -11.549 4.026   -7.210  1.00 1.86  ? 69 SER A HB2  5  
ATOM 9952  H HB3  . SER A 1 69 ? -11.721 2.537   -8.132  1.00 1.93  ? 69 SER A HB3  5  
ATOM 9953  H HG   . SER A 1 69 ? -12.652 4.659   -8.955  1.00 2.26  ? 69 SER A HG   5  
ATOM 9954  N N    . ASP A 1 70 ? -15.009 1.244   -6.277  1.00 1.22  ? 70 ASP A N    5  
ATOM 9955  C CA   . ASP A 1 70 ? -15.935 0.163   -6.742  1.00 1.68  ? 70 ASP A CA   5  
ATOM 9956  C C    . ASP A 1 70 ? -17.374 0.488   -6.310  1.00 1.89  ? 70 ASP A C    5  
ATOM 9957  O O    . ASP A 1 70 ? -18.049 -0.318  -5.694  1.00 2.34  ? 70 ASP A O    5  
ATOM 9958  C CB   . ASP A 1 70 ? -15.497 -1.177  -6.135  1.00 2.32  ? 70 ASP A CB   5  
ATOM 9959  C CG   . ASP A 1 70 ? -14.207 -1.656  -6.810  1.00 3.12  ? 70 ASP A CG   5  
ATOM 9960  O OD1  . ASP A 1 70 ? -14.295 -2.193  -7.903  1.00 3.64  ? 70 ASP A OD1  5  
ATOM 9961  O OD2  . ASP A 1 70 ? -13.152 -1.475  -6.223  1.00 3.72  ? 70 ASP A OD2  5  
ATOM 9962  H H    . ASP A 1 70 ? -15.184 1.703   -5.428  1.00 1.39  ? 70 ASP A H    5  
ATOM 9963  H HA   . ASP A 1 70 ? -15.894 0.099   -7.819  1.00 2.07  ? 70 ASP A HA   5  
ATOM 9964  H HB2  . ASP A 1 70 ? -15.325 -1.054  -5.076  1.00 2.46  ? 70 ASP A HB2  5  
ATOM 9965  H HB3  . ASP A 1 70 ? -16.274 -1.912  -6.289  1.00 2.72  ? 70 ASP A HB3  5  
ATOM 9966  N N    . LYS A 1 71 ? -17.852 1.666   -6.638  1.00 2.37  ? 71 LYS A N    5  
ATOM 9967  C CA   . LYS A 1 71 ? -19.248 2.050   -6.259  1.00 3.07  ? 71 LYS A CA   5  
ATOM 9968  C C    . LYS A 1 71 ? -19.700 3.241   -7.110  1.00 3.94  ? 71 LYS A C    5  
ATOM 9969  O O    . LYS A 1 71 ? -20.714 3.185   -7.781  1.00 4.56  ? 71 LYS A O    5  
ATOM 9970  C CB   . LYS A 1 71 ? -19.297 2.427   -4.774  1.00 3.59  ? 71 LYS A CB   5  
ATOM 9971  C CG   . LYS A 1 71 ? -20.744 2.364   -4.276  1.00 3.79  ? 71 LYS A CG   5  
ATOM 9972  C CD   . LYS A 1 71 ? -20.809 2.823   -2.816  1.00 4.62  ? 71 LYS A CD   5  
ATOM 9973  C CE   . LYS A 1 71 ? -20.737 1.606   -1.889  1.00 5.22  ? 71 LYS A CE   5  
ATOM 9974  N NZ   . LYS A 1 71 ? -22.086 0.979   -1.779  1.00 5.99  ? 71 LYS A NZ   5  
ATOM 9975  H H    . LYS A 1 71 ? -17.292 2.297   -7.138  1.00 2.66  ? 71 LYS A H    5  
ATOM 9976  H HA   . LYS A 1 71 ? -19.906 1.217   -6.439  1.00 3.10  ? 71 LYS A HA   5  
ATOM 9977  H HB2  . LYS A 1 71 ? -18.691 1.735   -4.206  1.00 3.70  ? 71 LYS A HB2  5  
ATOM 9978  H HB3  . LYS A 1 71 ? -18.918 3.429   -4.643  1.00 4.21  ? 71 LYS A HB3  5  
ATOM 9979  H HG2  . LYS A 1 71 ? -21.362 3.008   -4.884  1.00 3.86  ? 71 LYS A HG2  5  
ATOM 9980  H HG3  . LYS A 1 71 ? -21.105 1.348   -4.348  1.00 3.74  ? 71 LYS A HG3  5  
ATOM 9981  H HD2  . LYS A 1 71 ? -19.978 3.483   -2.610  1.00 4.84  ? 71 LYS A HD2  5  
ATOM 9982  H HD3  . LYS A 1 71 ? -21.736 3.349   -2.646  1.00 4.97  ? 71 LYS A HD3  5  
ATOM 9983  H HE2  . LYS A 1 71 ? -20.038 0.888   -2.293  1.00 5.27  ? 71 LYS A HE2  5  
ATOM 9984  H HE3  . LYS A 1 71 ? -20.405 1.919   -0.910  1.00 5.40  ? 71 LYS A HE3  5  
ATOM 9985  H HZ1  . LYS A 1 71 ? -22.794 1.709   -1.563  1.00 6.11  ? 71 LYS A HZ1  5  
ATOM 9986  H HZ2  . LYS A 1 71 ? -22.330 0.517   -2.679  1.00 6.30  ? 71 LYS A HZ2  5  
ATOM 9987  H HZ3  . LYS A 1 71 ? -22.076 0.269   -1.018  1.00 6.39  ? 71 LYS A HZ3  5  
ATOM 9988  N N    . SER A 1 72 ? -18.953 4.315   -7.083  1.00 4.42  ? 72 SER A N    5  
ATOM 9989  C CA   . SER A 1 72 ? -19.322 5.520   -7.886  1.00 5.58  ? 72 SER A CA   5  
ATOM 9990  C C    . SER A 1 72 ? -18.072 6.082   -8.578  1.00 5.86  ? 72 SER A C    5  
ATOM 9991  O O    . SER A 1 72 ? -17.070 6.261   -7.904  1.00 5.92  ? 72 SER A O    5  
ATOM 9992  C CB   . SER A 1 72 ? -19.920 6.584   -6.962  1.00 6.45  ? 72 SER A CB   5  
ATOM 9993  O OG   . SER A 1 72 ? -20.475 7.630   -7.748  1.00 6.62  ? 72 SER A OG   5  
ATOM 9994  O OXT  . SER A 1 72 ? -18.142 6.323   -9.772  1.00 6.32  ? 72 SER A OXT  5  
ATOM 9995  H H    . SER A 1 72 ? -18.142 4.327   -6.533  1.00 4.24  ? 72 SER A H    5  
ATOM 9996  H HA   . SER A 1 72 ? -20.051 5.243   -8.634  1.00 5.92  ? 72 SER A HA   5  
ATOM 9997  H HB2  . SER A 1 72 ? -20.697 6.144   -6.358  1.00 6.89  ? 72 SER A HB2  5  
ATOM 9998  H HB3  . SER A 1 72 ? -19.145 6.976   -6.317  1.00 6.83  ? 72 SER A HB3  5  
ATOM 9999  H HG   . SER A 1 72 ? -21.382 7.395   -7.960  1.00 6.94  ? 72 SER A HG   5  
ATOM 10000 N N    . ALA B 1 1  ? -14.817 -23.895 -25.105 1.00 14.81 ? 1  ALA B N    5  
ATOM 10001 C CA   . ALA B 1 1  ? -14.224 -22.543 -24.879 1.00 14.13 ? 1  ALA B CA   5  
ATOM 10002 C C    . ALA B 1 1  ? -14.540 -22.072 -23.452 1.00 13.41 ? 1  ALA B C    5  
ATOM 10003 O O    . ALA B 1 1  ? -13.643 -21.841 -22.663 1.00 13.48 ? 1  ALA B O    5  
ATOM 10004 C CB   . ALA B 1 1  ? -14.804 -21.549 -25.893 1.00 14.18 ? 1  ALA B CB   5  
ATOM 10005 H H1   . ALA B 1 1  ? -14.582 -24.514 -24.302 1.00 14.87 ? 1  ALA B H1   5  
ATOM 10006 H H2   . ALA B 1 1  ? -15.850 -23.814 -25.190 1.00 15.26 ? 1  ALA B H2   5  
ATOM 10007 H H3   . ALA B 1 1  ? -14.430 -24.301 -25.979 1.00 14.93 ? 1  ALA B H3   5  
ATOM 10008 H HA   . ALA B 1 1  ? -13.153 -22.599 -25.008 1.00 14.27 ? 1  ALA B HA   5  
ATOM 10009 H HB1  . ALA B 1 1  ? -15.881 -21.540 -25.814 1.00 13.94 ? 1  ALA B HB1  5  
ATOM 10010 H HB2  . ALA B 1 1  ? -14.419 -20.561 -25.689 1.00 14.35 ? 1  ALA B HB2  5  
ATOM 10011 H HB3  . ALA B 1 1  ? -14.520 -21.846 -26.892 1.00 14.46 ? 1  ALA B HB3  5  
ATOM 10012 N N    . SER B 1 2  ? -15.808 -21.932 -23.122 1.00 12.88 ? 2  SER B N    5  
ATOM 10013 C CA   . SER B 1 2  ? -16.213 -21.480 -21.747 1.00 12.30 ? 2  SER B CA   5  
ATOM 10014 C C    . SER B 1 2  ? -15.773 -20.023 -21.513 1.00 11.45 ? 2  SER B C    5  
ATOM 10015 O O    . SER B 1 2  ? -14.951 -19.486 -22.234 1.00 11.40 ? 2  SER B O    5  
ATOM 10016 C CB   . SER B 1 2  ? -15.590 -22.407 -20.686 1.00 12.49 ? 2  SER B CB   5  
ATOM 10017 O OG   . SER B 1 2  ? -14.443 -21.793 -20.106 1.00 12.82 ? 2  SER B OG   5  
ATOM 10018 H H    . SER B 1 2  ? -16.503 -22.130 -23.783 1.00 12.97 ? 2  SER B H    5  
ATOM 10019 H HA   . SER B 1 2  ? -17.290 -21.532 -21.669 1.00 12.53 ? 2  SER B HA   5  
ATOM 10020 H HB2  . SER B 1 2  ? -16.313 -22.600 -19.910 1.00 12.66 ? 2  SER B HB2  5  
ATOM 10021 H HB3  . SER B 1 2  ? -15.312 -23.343 -21.151 1.00 12.41 ? 2  SER B HB3  5  
ATOM 10022 H HG   . SER B 1 2  ? -13.661 -22.185 -20.504 1.00 13.11 ? 2  SER B HG   5  
ATOM 10023 N N    . VAL B 1 3  ? -16.319 -19.385 -20.505 1.00 10.94 ? 3  VAL B N    5  
ATOM 10024 C CA   . VAL B 1 3  ? -15.938 -17.968 -20.216 1.00 10.24 ? 3  VAL B CA   5  
ATOM 10025 C C    . VAL B 1 3  ? -16.372 -17.590 -18.791 1.00 9.35  ? 3  VAL B C    5  
ATOM 10026 O O    . VAL B 1 3  ? -17.503 -17.805 -18.396 1.00 9.36  ? 3  VAL B O    5  
ATOM 10027 C CB   . VAL B 1 3  ? -16.609 -17.028 -21.235 1.00 10.50 ? 3  VAL B CB   5  
ATOM 10028 C CG1  . VAL B 1 3  ? -18.134 -17.151 -21.147 1.00 10.46 ? 3  VAL B CG1  5  
ATOM 10029 C CG2  . VAL B 1 3  ? -16.199 -15.580 -20.946 1.00 11.15 ? 3  VAL B CG2  5  
ATOM 10030 H H    . VAL B 1 3  ? -16.978 -19.838 -19.939 1.00 11.14 ? 3  VAL B H    5  
ATOM 10031 H HA   . VAL B 1 3  ? -14.865 -17.868 -20.295 1.00 10.39 ? 3  VAL B HA   5  
ATOM 10032 H HB   . VAL B 1 3  ? -16.288 -17.298 -22.231 1.00 10.49 ? 3  VAL B HB   5  
ATOM 10033 H HG11 . VAL B 1 3  ? -18.406 -18.189 -21.020 1.00 10.59 ? 3  VAL B HG11 5  
ATOM 10034 H HG12 . VAL B 1 3  ? -18.494 -16.579 -20.305 1.00 10.33 ? 3  VAL B HG12 5  
ATOM 10035 H HG13 . VAL B 1 3  ? -18.579 -16.773 -22.056 1.00 10.64 ? 3  VAL B HG13 5  
ATOM 10036 H HG21 . VAL B 1 3  ? -15.138 -15.538 -20.744 1.00 11.42 ? 3  VAL B HG21 5  
ATOM 10037 H HG22 . VAL B 1 3  ? -16.426 -14.962 -21.802 1.00 11.34 ? 3  VAL B HG22 5  
ATOM 10038 H HG23 . VAL B 1 3  ? -16.743 -15.216 -20.086 1.00 11.36 ? 3  VAL B HG23 5  
ATOM 10039 N N    . ALA B 1 4  ? -15.475 -17.017 -18.028 1.00 8.75  ? 4  ALA B N    5  
ATOM 10040 C CA   . ALA B 1 4  ? -15.812 -16.602 -16.632 1.00 7.96  ? 4  ALA B CA   5  
ATOM 10041 C C    . ALA B 1 4  ? -15.892 -15.072 -16.577 1.00 7.01  ? 4  ALA B C    5  
ATOM 10042 O O    . ALA B 1 4  ? -15.843 -14.411 -17.595 1.00 7.03  ? 4  ALA B O    5  
ATOM 10043 C CB   . ALA B 1 4  ? -14.723 -17.097 -15.674 1.00 8.21  ? 4  ALA B CB   5  
ATOM 10044 H H    . ALA B 1 4  ? -14.574 -16.848 -18.379 1.00 8.95  ? 4  ALA B H    5  
ATOM 10045 H HA   . ALA B 1 4  ? -16.765 -17.022 -16.347 1.00 8.13  ? 4  ALA B HA   5  
ATOM 10046 H HB1  . ALA B 1 4  ? -14.307 -18.021 -16.049 1.00 8.38  ? 4  ALA B HB1  5  
ATOM 10047 H HB2  . ALA B 1 4  ? -13.941 -16.355 -15.602 1.00 8.31  ? 4  ALA B HB2  5  
ATOM 10048 H HB3  . ALA B 1 4  ? -15.151 -17.265 -14.698 1.00 8.39  ? 4  ALA B HB3  5  
ATOM 10049 N N    . THR B 1 5  ? -16.011 -14.507 -15.399 1.00 6.47  ? 5  THR B N    5  
ATOM 10050 C CA   . THR B 1 5  ? -16.090 -13.014 -15.281 1.00 5.79  ? 5  THR B CA   5  
ATOM 10051 C C    . THR B 1 5  ? -14.838 -12.383 -15.906 1.00 4.92  ? 5  THR B C    5  
ATOM 10052 O O    . THR B 1 5  ? -13.774 -12.976 -15.906 1.00 4.69  ? 5  THR B O    5  
ATOM 10053 C CB   . THR B 1 5  ? -16.181 -12.609 -13.803 1.00 6.15  ? 5  THR B CB   5  
ATOM 10054 O OG1  . THR B 1 5  ? -15.201 -13.316 -13.052 1.00 6.56  ? 5  THR B OG1  5  
ATOM 10055 C CG2  . THR B 1 5  ? -17.574 -12.939 -13.264 1.00 6.81  ? 5  THR B CG2  5  
ATOM 10056 H H    . THR B 1 5  ? -16.049 -15.063 -14.593 1.00 6.72  ? 5  THR B H    5  
ATOM 10057 H HA   . THR B 1 5  ? -16.966 -12.661 -15.804 1.00 5.97  ? 5  THR B HA   5  
ATOM 10058 H HB   . THR B 1 5  ? -16.007 -11.549 -13.710 1.00 5.99  ? 5  THR B HB   5  
ATOM 10059 H HG1  . THR B 1 5  ? -14.818 -12.706 -12.417 1.00 6.97  ? 5  THR B HG1  5  
ATOM 10060 H HG21 . THR B 1 5  ? -18.310 -12.761 -14.034 1.00 7.02  ? 5  THR B HG21 5  
ATOM 10061 H HG22 . THR B 1 5  ? -17.608 -13.977 -12.967 1.00 7.11  ? 5  THR B HG22 5  
ATOM 10062 H HG23 . THR B 1 5  ? -17.787 -12.313 -12.410 1.00 7.08  ? 5  THR B HG23 5  
ATOM 10063 N N    . GLU B 1 6  ? -14.967 -11.188 -16.446 1.00 4.62  ? 6  GLU B N    5  
ATOM 10064 C CA   . GLU B 1 6  ? -13.803 -10.496 -17.091 1.00 3.82  ? 6  GLU B CA   5  
ATOM 10065 C C    . GLU B 1 6  ? -13.429 -11.240 -18.375 1.00 3.24  ? 6  GLU B C    5  
ATOM 10066 O O    . GLU B 1 6  ? -12.803 -12.284 -18.334 1.00 3.60  ? 6  GLU B O    5  
ATOM 10067 C CB   . GLU B 1 6  ? -12.588 -10.468 -16.151 1.00 4.37  ? 6  GLU B CB   5  
ATOM 10068 C CG   . GLU B 1 6  ? -13.000 -9.999  -14.751 1.00 5.20  ? 6  GLU B CG   5  
ATOM 10069 C CD   . GLU B 1 6  ? -12.221 -10.796 -13.700 1.00 5.80  ? 6  GLU B CD   5  
ATOM 10070 O OE1  . GLU B 1 6  ? -11.107 -10.407 -13.394 1.00 6.17  ? 6  GLU B OE1  5  
ATOM 10071 O OE2  . GLU B 1 6  ? -12.753 -11.783 -13.220 1.00 6.18  ? 6  GLU B OE2  5  
ATOM 10072 H H    . GLU B 1 6  ? -15.840 -10.744 -16.437 1.00 5.02  ? 6  GLU B H    5  
ATOM 10073 H HA   . GLU B 1 6  ? -14.087 -9.482  -17.339 1.00 3.46  ? 6  GLU B HA   5  
ATOM 10074 H HB2  . GLU B 1 6  ? -12.164 -11.459 -16.087 1.00 4.83  ? 6  GLU B HB2  5  
ATOM 10075 H HB3  . GLU B 1 6  ? -11.848 -9.791  -16.549 1.00 4.04  ? 6  GLU B HB3  5  
ATOM 10076 H HG2  . GLU B 1 6  ? -12.776 -8.947  -14.645 1.00 5.47  ? 6  GLU B HG2  5  
ATOM 10077 H HG3  . GLU B 1 6  ? -14.057 -10.158 -14.609 1.00 5.45  ? 6  GLU B HG3  5  
ATOM 10078 N N    . LEU B 1 7  ? -13.803 -10.712 -19.514 1.00 2.60  ? 7  LEU B N    5  
ATOM 10079 C CA   . LEU B 1 7  ? -13.466 -11.384 -20.795 1.00 2.31  ? 7  LEU B CA   5  
ATOM 10080 C C    . LEU B 1 7  ? -12.535 -10.466 -21.571 1.00 1.54  ? 7  LEU B C    5  
ATOM 10081 O O    . LEU B 1 7  ? -11.410 -10.807 -21.887 1.00 1.71  ? 7  LEU B O    5  
ATOM 10082 C CB   . LEU B 1 7  ? -14.721 -11.645 -21.653 1.00 2.52  ? 7  LEU B CB   5  
ATOM 10083 C CG   . LEU B 1 7  ? -16.026 -11.640 -20.838 1.00 3.16  ? 7  LEU B CG   5  
ATOM 10084 C CD1  . LEU B 1 7  ? -15.883 -12.464 -19.558 1.00 3.96  ? 7  LEU B CD1  5  
ATOM 10085 C CD2  . LEU B 1 7  ? -16.387 -10.206 -20.486 1.00 3.09  ? 7  LEU B CD2  5  
ATOM 10086 H H    . LEU B 1 7  ? -14.297 -9.871  -19.530 1.00 2.54  ? 7  LEU B H    5  
ATOM 10087 H HA   . LEU B 1 7  ? -12.977 -12.312 -20.590 1.00 2.79  ? 7  LEU B HA   5  
ATOM 10088 H HB2  . LEU B 1 7  ? -14.788 -10.886 -22.417 1.00 2.09  ? 7  LEU B HB2  5  
ATOM 10089 H HB3  . LEU B 1 7  ? -14.610 -12.593 -22.121 1.00 2.90  ? 7  LEU B HB3  5  
ATOM 10090 H HG   . LEU B 1 7  ? -16.815 -12.065 -21.440 1.00 3.35  ? 7  LEU B HG   5  
ATOM 10091 H HD11 . LEU B 1 7  ? -14.965 -13.031 -19.592 1.00 4.19  ? 7  LEU B HD11 5  
ATOM 10092 H HD12 . LEU B 1 7  ? -15.866 -11.802 -18.703 1.00 4.26  ? 7  LEU B HD12 5  
ATOM 10093 H HD13 . LEU B 1 7  ? -16.720 -13.138 -19.471 1.00 4.38  ? 7  LEU B HD13 5  
ATOM 10094 H HD21 . LEU B 1 7  ? -15.696 -9.537  -20.977 1.00 3.19  ? 7  LEU B HD21 5  
ATOM 10095 H HD22 . LEU B 1 7  ? -17.388 -9.999  -20.819 1.00 3.29  ? 7  LEU B HD22 5  
ATOM 10096 H HD23 . LEU B 1 7  ? -16.320 -10.071 -19.417 1.00 3.35  ? 7  LEU B HD23 5  
ATOM 10097 N N    . ARG B 1 8  ? -13.025 -9.295  -21.864 1.00 1.31  ? 8  ARG B N    5  
ATOM 10098 C CA   . ARG B 1 8  ? -12.242 -8.275  -22.613 1.00 1.49  ? 8  ARG B CA   5  
ATOM 10099 C C    . ARG B 1 8  ? -10.891 -8.032  -21.935 1.00 1.33  ? 8  ARG B C    5  
ATOM 10100 O O    . ARG B 1 8  ? -9.855  -8.037  -22.573 1.00 1.98  ? 8  ARG B O    5  
ATOM 10101 C CB   . ARG B 1 8  ? -13.035 -6.974  -22.597 1.00 2.16  ? 8  ARG B CB   5  
ATOM 10102 C CG   . ARG B 1 8  ? -13.654 -6.724  -23.978 1.00 2.69  ? 8  ARG B CG   5  
ATOM 10103 C CD   . ARG B 1 8  ? -12.858 -5.639  -24.706 1.00 3.00  ? 8  ARG B CD   5  
ATOM 10104 N NE   . ARG B 1 8  ? -13.439 -4.301  -24.392 1.00 3.47  ? 8  ARG B NE   5  
ATOM 10105 C CZ   . ARG B 1 8  ? -12.652 -3.286  -24.150 1.00 3.94  ? 8  ARG B CZ   5  
ATOM 10106 N NH1  . ARG B 1 8  ? -12.203 -3.082  -22.938 1.00 4.43  ? 8  ARG B NH1  5  
ATOM 10107 N NH2  . ARG B 1 8  ? -12.317 -2.475  -25.119 1.00 4.33  ? 8  ARG B NH2  5  
ATOM 10108 H H    . ARG B 1 8  ? -13.936 -9.082  -21.580 1.00 1.64  ? 8  ARG B H    5  
ATOM 10109 H HA   . ARG B 1 8  ? -12.094 -8.599  -23.626 1.00 1.85  ? 8  ARG B HA   5  
ATOM 10110 H HB2  . ARG B 1 8  ? -13.818 -7.057  -21.851 1.00 2.24  ? 8  ARG B HB2  5  
ATOM 10111 H HB3  . ARG B 1 8  ? -12.380 -6.157  -22.337 1.00 2.53  ? 8  ARG B HB3  5  
ATOM 10112 H HG2  . ARG B 1 8  ? -13.630 -7.638  -24.554 1.00 2.99  ? 8  ARG B HG2  5  
ATOM 10113 H HG3  . ARG B 1 8  ? -14.676 -6.400  -23.860 1.00 2.99  ? 8  ARG B HG3  5  
ATOM 10114 H HD2  . ARG B 1 8  ? -11.828 -5.669  -24.383 1.00 3.17  ? 8  ARG B HD2  5  
ATOM 10115 H HD3  . ARG B 1 8  ? -12.907 -5.811  -25.770 1.00 3.16  ? 8  ARG B HD3  5  
ATOM 10116 H HE   . ARG B 1 8  ? -14.412 -4.182  -24.369 1.00 3.66  ? 8  ARG B HE   5  
ATOM 10117 H HH11 . ARG B 1 8  ? -12.462 -3.702  -22.197 1.00 4.49  ? 8  ARG B HH11 5  
ATOM 10118 H HH12 . ARG B 1 8  ? -11.601 -2.306  -22.751 1.00 4.97  ? 8  ARG B HH12 5  
ATOM 10119 H HH21 . ARG B 1 8  ? -12.662 -2.631  -26.044 1.00 4.37  ? 8  ARG B HH21 5  
ATOM 10120 H HH22 . ARG B 1 8  ? -11.715 -1.697  -24.936 1.00 4.82  ? 8  ARG B HH22 5  
ATOM 10121 N N    . CYS B 1 9  ? -10.910 -7.796  -20.648 1.00 0.80  ? 9  CYS B N    5  
ATOM 10122 C CA   . CYS B 1 9  ? -9.648  -7.524  -19.897 1.00 0.67  ? 9  CYS B CA   5  
ATOM 10123 C C    . CYS B 1 9  ? -8.670  -8.700  -20.010 1.00 0.60  ? 9  CYS B C    5  
ATOM 10124 O O    . CYS B 1 9  ? -8.952  -9.712  -20.627 1.00 0.78  ? 9  CYS B O    5  
ATOM 10125 C CB   . CYS B 1 9  ? -9.983  -7.283  -18.427 1.00 0.79  ? 9  CYS B CB   5  
ATOM 10126 S SG   . CYS B 1 9  ? -10.683 -5.629  -18.244 1.00 1.22  ? 9  CYS B SG   5  
ATOM 10127 H H    . CYS B 1 9  ? -11.767 -7.778  -20.176 1.00 0.99  ? 9  CYS B H    5  
ATOM 10128 H HA   . CYS B 1 9  ? -9.180  -6.638  -20.301 1.00 0.83  ? 9  CYS B HA   5  
ATOM 10129 H HB2  . CYS B 1 9  ? -10.696 -8.021  -18.093 1.00 0.89  ? 9  CYS B HB2  5  
ATOM 10130 H HB3  . CYS B 1 9  ? -9.086  -7.361  -17.838 1.00 0.93  ? 9  CYS B HB3  5  
ATOM 10131 N N    . GLN B 1 10 ? -7.510  -8.554  -19.422 1.00 0.50  ? 10 GLN B N    5  
ATOM 10132 C CA   . GLN B 1 10 ? -6.477  -9.630  -19.490 1.00 0.47  ? 10 GLN B CA   5  
ATOM 10133 C C    . GLN B 1 10 ? -6.398  -10.414 -18.168 1.00 0.40  ? 10 GLN B C    5  
ATOM 10134 O O    . GLN B 1 10 ? -5.804  -11.474 -18.125 1.00 0.43  ? 10 GLN B O    5  
ATOM 10135 C CB   . GLN B 1 10 ? -5.120  -8.989  -19.772 1.00 0.53  ? 10 GLN B CB   5  
ATOM 10136 C CG   . GLN B 1 10 ? -4.722  -9.247  -21.227 1.00 0.64  ? 10 GLN B CG   5  
ATOM 10137 C CD   . GLN B 1 10 ? -3.241  -8.919  -21.423 1.00 1.21  ? 10 GLN B CD   5  
ATOM 10138 O OE1  . GLN B 1 10 ? -2.779  -7.867  -21.023 1.00 1.88  ? 10 GLN B OE1  5  
ATOM 10139 N NE2  . GLN B 1 10 ? -2.472  -9.781  -22.028 1.00 1.84  ? 10 GLN B NE2  5  
ATOM 10140 H H    . GLN B 1 10 ? -7.313  -7.722  -18.941 1.00 0.61  ? 10 GLN B H    5  
ATOM 10141 H HA   . GLN B 1 10 ? -6.721  -10.308 -20.293 1.00 0.53  ? 10 GLN B HA   5  
ATOM 10142 H HB2  . GLN B 1 10 ? -5.178  -7.924  -19.598 1.00 0.58  ? 10 GLN B HB2  5  
ATOM 10143 H HB3  . GLN B 1 10 ? -4.383  -9.418  -19.114 1.00 0.51  ? 10 GLN B HB3  5  
ATOM 10144 H HG2  . GLN B 1 10 ? -4.893  -10.285 -21.468 1.00 1.12  ? 10 GLN B HG2  5  
ATOM 10145 H HG3  . GLN B 1 10 ? -5.315  -8.624  -21.879 1.00 1.14  ? 10 GLN B HG3  5  
ATOM 10146 H HE21 . GLN B 1 10 ? -2.843  -10.629 -22.353 1.00 2.04  ? 10 GLN B HE21 5  
ATOM 10147 H HE22 . GLN B 1 10 ? -1.522  -9.582  -22.160 1.00 2.46  ? 10 GLN B HE22 5  
ATOM 10148 N N    . CYS B 1 11 ? -6.968  -9.886  -17.100 1.00 0.35  ? 11 CYS B N    5  
ATOM 10149 C CA   . CYS B 1 11 ? -6.931  -10.569 -15.747 1.00 0.32  ? 11 CYS B CA   5  
ATOM 10150 C C    . CYS B 1 11 ? -6.886  -12.098 -15.904 1.00 0.37  ? 11 CYS B C    5  
ATOM 10151 O O    . CYS B 1 11 ? -7.740  -12.684 -16.546 1.00 0.51  ? 11 CYS B O    5  
ATOM 10152 C CB   . CYS B 1 11 ? -8.185  -10.215 -14.919 1.00 0.33  ? 11 CYS B CB   5  
ATOM 10153 S SG   . CYS B 1 11 ? -9.320  -9.146  -15.848 1.00 0.49  ? 11 CYS B SG   5  
ATOM 10154 H H    . CYS B 1 11 ? -7.410  -9.021  -17.184 1.00 0.37  ? 11 CYS B H    5  
ATOM 10155 H HA   . CYS B 1 11 ? -6.053  -10.241 -15.206 1.00 0.33  ? 11 CYS B HA   5  
ATOM 10156 H HB2  . CYS B 1 11 ? -8.700  -11.124 -14.652 1.00 0.41  ? 11 CYS B HB2  5  
ATOM 10157 H HB3  . CYS B 1 11 ? -7.881  -9.709  -14.015 1.00 0.33  ? 11 CYS B HB3  5  
ATOM 10158 N N    . LEU B 1 12 ? -5.915  -12.751 -15.301 1.00 0.40  ? 12 LEU B N    5  
ATOM 10159 C CA   . LEU B 1 12 ? -5.843  -14.242 -15.395 1.00 0.45  ? 12 LEU B CA   5  
ATOM 10160 C C    . LEU B 1 12 ? -6.988  -14.799 -14.543 1.00 0.45  ? 12 LEU B C    5  
ATOM 10161 O O    . LEU B 1 12 ? -7.958  -15.332 -15.041 1.00 0.49  ? 12 LEU B O    5  
ATOM 10162 C CB   . LEU B 1 12 ? -4.493  -14.766 -14.842 1.00 0.49  ? 12 LEU B CB   5  
ATOM 10163 C CG   . LEU B 1 12 ? -3.322  -13.871 -15.265 1.00 0.83  ? 12 LEU B CG   5  
ATOM 10164 C CD1  . LEU B 1 12 ? -2.070  -14.301 -14.499 1.00 1.04  ? 12 LEU B CD1  5  
ATOM 10165 C CD2  . LEU B 1 12 ? -3.064  -14.017 -16.764 1.00 1.56  ? 12 LEU B CD2  5  
ATOM 10166 H H    . LEU B 1 12 ? -5.257  -12.263 -14.767 1.00 0.49  ? 12 LEU B H    5  
ATOM 10167 H HA   . LEU B 1 12 ? -5.968  -14.553 -16.422 1.00 0.48  ? 12 LEU B HA   5  
ATOM 10168 H HB2  . LEU B 1 12 ? -4.535  -14.792 -13.764 1.00 0.99  ? 12 LEU B HB2  5  
ATOM 10169 H HB3  . LEU B 1 12 ? -4.321  -15.766 -15.210 1.00 0.99  ? 12 LEU B HB3  5  
ATOM 10170 H HG   . LEU B 1 12 ? -3.547  -12.841 -15.033 1.00 1.56  ? 12 LEU B HG   5  
ATOM 10171 H HD11 . LEU B 1 12 ? -2.037  -15.379 -14.436 1.00 1.52  ? 12 LEU B HD11 5  
ATOM 10172 H HD12 . LEU B 1 12 ? -1.191  -13.944 -15.015 1.00 1.64  ? 12 LEU B HD12 5  
ATOM 10173 H HD13 . LEU B 1 12 ? -2.097  -13.884 -13.503 1.00 1.49  ? 12 LEU B HD13 5  
ATOM 10174 H HD21 . LEU B 1 12 ? -2.883  -15.055 -16.998 1.00 1.94  ? 12 LEU B HD21 5  
ATOM 10175 H HD22 . LEU B 1 12 ? -3.923  -13.667 -17.313 1.00 2.16  ? 12 LEU B HD22 5  
ATOM 10176 H HD23 . LEU B 1 12 ? -2.197  -13.431 -17.036 1.00 1.96  ? 12 LEU B HD23 5  
ATOM 10177 N N    . GLN B 1 13 ? -6.862  -14.633 -13.255 1.00 0.44  ? 13 GLN B N    5  
ATOM 10178 C CA   . GLN B 1 13 ? -7.891  -15.084 -12.279 1.00 0.46  ? 13 GLN B CA   5  
ATOM 10179 C C    . GLN B 1 13 ? -7.466  -14.550 -10.903 1.00 0.42  ? 13 GLN B C    5  
ATOM 10180 O O    . GLN B 1 13 ? -7.520  -15.243 -9.907  1.00 0.60  ? 13 GLN B O    5  
ATOM 10181 C CB   . GLN B 1 13 ? -7.941  -16.612 -12.263 1.00 0.53  ? 13 GLN B CB   5  
ATOM 10182 C CG   . GLN B 1 13 ? -9.152  -17.111 -13.063 1.00 1.12  ? 13 GLN B CG   5  
ATOM 10183 C CD   . GLN B 1 13 ? -8.717  -18.224 -14.023 1.00 1.40  ? 13 GLN B CD   5  
ATOM 10184 O OE1  . GLN B 1 13 ? -8.810  -18.075 -15.225 1.00 1.77  ? 13 GLN B OE1  5  
ATOM 10185 N NE2  . GLN B 1 13 ? -8.245  -19.342 -13.541 1.00 2.09  ? 13 GLN B NE2  5  
ATOM 10186 H H    . GLN B 1 13 ? -6.070  -14.184 -12.916 1.00 0.43  ? 13 GLN B H    5  
ATOM 10187 H HA   . GLN B 1 13 ? -8.854  -14.678 -12.548 1.00 0.47  ? 13 GLN B HA   5  
ATOM 10188 H HB2  . GLN B 1 13 ? -7.034  -17.005 -12.701 1.00 0.99  ? 13 GLN B HB2  5  
ATOM 10189 H HB3  . GLN B 1 13 ? -8.016  -16.946 -11.248 1.00 0.86  ? 13 GLN B HB3  5  
ATOM 10190 H HG2  . GLN B 1 13 ? -9.898  -17.494 -12.381 1.00 1.51  ? 13 GLN B HG2  5  
ATOM 10191 H HG3  . GLN B 1 13 ? -9.571  -16.293 -13.630 1.00 1.66  ? 13 GLN B HG3  5  
ATOM 10192 H HE21 . GLN B 1 13 ? -8.168  -19.468 -12.571 1.00 2.59  ? 13 GLN B HE21 5  
ATOM 10193 H HE22 . GLN B 1 13 ? -7.964  -20.059 -14.150 1.00 2.41  ? 13 GLN B HE22 5  
ATOM 10194 N N    . THR B 1 14 ? -7.002  -13.313 -10.891 1.00 0.37  ? 14 THR B N    5  
ATOM 10195 C CA   . THR B 1 14 ? -6.486  -12.630 -9.659  1.00 0.33  ? 14 THR B CA   5  
ATOM 10196 C C    . THR B 1 14 ? -5.855  -13.596 -8.661  1.00 0.35  ? 14 THR B C    5  
ATOM 10197 O O    . THR B 1 14 ? -6.520  -14.194 -7.834  1.00 0.39  ? 14 THR B O    5  
ATOM 10198 C CB   . THR B 1 14 ? -7.545  -11.814 -8.949  1.00 0.33  ? 14 THR B CB   5  
ATOM 10199 O OG1  . THR B 1 14 ? -8.764  -12.545 -8.866  1.00 0.39  ? 14 THR B OG1  5  
ATOM 10200 C CG2  . THR B 1 14 ? -7.757  -10.509 -9.709  1.00 0.32  ? 14 THR B CG2  5  
ATOM 10201 H H    . THR B 1 14 ? -6.964  -12.825 -11.739 1.00 0.51  ? 14 THR B H    5  
ATOM 10202 H HA   . THR B 1 14 ? -5.722  -11.950 -9.976  1.00 0.30  ? 14 THR B HA   5  
ATOM 10203 H HB   . THR B 1 14 ? -7.172  -11.585 -7.958  1.00 0.32  ? 14 THR B HB   5  
ATOM 10204 H HG1  . THR B 1 14 ? -9.329  -12.112 -8.221  1.00 0.95  ? 14 THR B HG1  5  
ATOM 10205 H HG21 . THR B 1 14 ? -6.795  -10.095 -9.978  1.00 1.03  ? 14 THR B HG21 5  
ATOM 10206 H HG22 . THR B 1 14 ? -8.329  -10.701 -10.603 1.00 1.06  ? 14 THR B HG22 5  
ATOM 10207 H HG23 . THR B 1 14 ? -8.286  -9.808  -9.081  1.00 1.06  ? 14 THR B HG23 5  
ATOM 10208 N N    . LEU B 1 15 ? -4.563  -13.705 -8.714  1.00 0.36  ? 15 LEU B N    5  
ATOM 10209 C CA   . LEU B 1 15 ? -3.839  -14.590 -7.756  1.00 0.42  ? 15 LEU B CA   5  
ATOM 10210 C C    . LEU B 1 15 ? -3.796  -13.899 -6.386  1.00 0.36  ? 15 LEU B C    5  
ATOM 10211 O O    . LEU B 1 15 ? -4.076  -12.720 -6.268  1.00 0.52  ? 15 LEU B O    5  
ATOM 10212 C CB   . LEU B 1 15 ? -2.414  -14.847 -8.257  1.00 0.57  ? 15 LEU B CB   5  
ATOM 10213 C CG   . LEU B 1 15 ? -2.474  -15.662 -9.553  1.00 0.65  ? 15 LEU B CG   5  
ATOM 10214 C CD1  . LEU B 1 15 ? -1.272  -15.317 -10.436 1.00 0.74  ? 15 LEU B CD1  5  
ATOM 10215 C CD2  . LEU B 1 15 ? -2.453  -17.155 -9.217  1.00 1.78  ? 15 LEU B CD2  5  
ATOM 10216 H H    . LEU B 1 15 ? -4.063  -13.172 -9.376  1.00 0.35  ? 15 LEU B H    5  
ATOM 10217 H HA   . LEU B 1 15 ? -4.367  -15.529 -7.666  1.00 0.51  ? 15 LEU B HA   5  
ATOM 10218 H HB2  . LEU B 1 15 ? -1.920  -13.905 -8.442  1.00 1.12  ? 15 LEU B HB2  5  
ATOM 10219 H HB3  . LEU B 1 15 ? -1.866  -15.403 -7.511  1.00 0.91  ? 15 LEU B HB3  5  
ATOM 10220 H HG   . LEU B 1 15 ? -3.386  -15.425 -10.083 1.00 1.32  ? 15 LEU B HG   5  
ATOM 10221 H HD11 . LEU B 1 15 ? -0.927  -14.321 -10.203 1.00 1.44  ? 15 LEU B HD11 5  
ATOM 10222 H HD12 . LEU B 1 15 ? -0.477  -16.026 -10.255 1.00 1.20  ? 15 LEU B HD12 5  
ATOM 10223 H HD13 . LEU B 1 15 ? -1.564  -15.363 -11.475 1.00 1.40  ? 15 LEU B HD13 5  
ATOM 10224 H HD21 . LEU B 1 15 ? -1.726  -17.339 -8.439  1.00 2.33  ? 15 LEU B HD21 5  
ATOM 10225 H HD22 . LEU B 1 15 ? -3.430  -17.460 -8.874  1.00 2.19  ? 15 LEU B HD22 5  
ATOM 10226 H HD23 . LEU B 1 15 ? -2.188  -17.719 -10.099 1.00 2.33  ? 15 LEU B HD23 5  
ATOM 10227 N N    . GLN B 1 16 ? -3.465  -14.624 -5.352  1.00 0.47  ? 16 GLN B N    5  
ATOM 10228 C CA   . GLN B 1 16 ? -3.426  -14.016 -3.992  1.00 0.42  ? 16 GLN B CA   5  
ATOM 10229 C C    . GLN B 1 16 ? -1.988  -13.698 -3.588  1.00 0.39  ? 16 GLN B C    5  
ATOM 10230 O O    . GLN B 1 16 ? -1.427  -14.303 -2.692  1.00 0.47  ? 16 GLN B O    5  
ATOM 10231 C CB   . GLN B 1 16 ? -4.060  -14.975 -2.977  1.00 0.49  ? 16 GLN B CB   5  
ATOM 10232 C CG   . GLN B 1 16 ? -5.530  -14.600 -2.768  1.00 0.60  ? 16 GLN B CG   5  
ATOM 10233 C CD   . GLN B 1 16 ? -6.143  -15.511 -1.702  1.00 0.78  ? 16 GLN B CD   5  
ATOM 10234 O OE1  . GLN B 1 16 ? -6.706  -16.540 -2.019  1.00 1.48  ? 16 GLN B OE1  5  
ATOM 10235 N NE2  . GLN B 1 16 ? -6.060  -15.176 -0.443  1.00 1.31  ? 16 GLN B NE2  5  
ATOM 10236 H H    . GLN B 1 16 ? -3.255  -15.566 -5.469  1.00 0.72  ? 16 GLN B H    5  
ATOM 10237 H HA   . GLN B 1 16 ? -3.983  -13.090 -4.008  1.00 0.43  ? 16 GLN B HA   5  
ATOM 10238 H HB2  . GLN B 1 16 ? -3.996  -15.987 -3.349  1.00 0.51  ? 16 GLN B HB2  5  
ATOM 10239 H HB3  . GLN B 1 16 ? -3.537  -14.904 -2.036  1.00 0.50  ? 16 GLN B HB3  5  
ATOM 10240 H HG2  . GLN B 1 16 ? -5.595  -13.571 -2.445  1.00 0.75  ? 16 GLN B HG2  5  
ATOM 10241 H HG3  . GLN B 1 16 ? -6.068  -14.721 -3.696  1.00 0.72  ? 16 GLN B HG3  5  
ATOM 10242 H HE21 . GLN B 1 16 ? -5.606  -14.346 -0.182  1.00 1.97  ? 16 GLN B HE21 5  
ATOM 10243 H HE22 . GLN B 1 16 ? -6.450  -15.756 0.245   1.00 1.46  ? 16 GLN B HE22 5  
ATOM 10244 N N    . GLY B 1 17 ? -1.405  -12.725 -4.233  1.00 0.37  ? 17 GLY B N    5  
ATOM 10245 C CA   . GLY B 1 17 ? -0.019  -12.303 -3.889  1.00 0.45  ? 17 GLY B CA   5  
ATOM 10246 C C    . GLY B 1 17 ? 0.975   -13.400 -4.232  1.00 0.41  ? 17 GLY B C    5  
ATOM 10247 O O    . GLY B 1 17 ? 1.380   -14.171 -3.380  1.00 0.57  ? 17 GLY B O    5  
ATOM 10248 H H    . GLY B 1 17 ? -1.893  -12.255 -4.939  1.00 0.35  ? 17 GLY B H    5  
ATOM 10249 H HA2  . GLY B 1 17 ? 0.227   -11.411 -4.443  1.00 0.56  ? 17 GLY B HA2  5  
ATOM 10250 H HA3  . GLY B 1 17 ? 0.036   -12.093 -2.832  1.00 0.59  ? 17 GLY B HA3  5  
ATOM 10251 N N    . ILE B 1 18 ? 1.399   -13.455 -5.464  1.00 0.39  ? 18 ILE B N    5  
ATOM 10252 C CA   . ILE B 1 18 ? 2.399   -14.480 -5.856  1.00 0.49  ? 18 ILE B CA   5  
ATOM 10253 C C    . ILE B 1 18 ? 3.784   -13.958 -5.470  1.00 0.51  ? 18 ILE B C    5  
ATOM 10254 O O    . ILE B 1 18 ? 3.905   -12.948 -4.797  1.00 0.72  ? 18 ILE B O    5  
ATOM 10255 C CB   . ILE B 1 18 ? 2.298   -14.805 -7.367  1.00 0.67  ? 18 ILE B CB   5  
ATOM 10256 C CG1  . ILE B 1 18 ? 3.159   -13.857 -8.212  1.00 0.72  ? 18 ILE B CG1  5  
ATOM 10257 C CG2  . ILE B 1 18 ? 0.839   -14.715 -7.828  1.00 0.74  ? 18 ILE B CG2  5  
ATOM 10258 C CD1  . ILE B 1 18 ? 2.797   -12.411 -7.902  1.00 0.67  ? 18 ILE B CD1  5  
ATOM 10259 H H    . ILE B 1 18 ? 1.081   -12.807 -6.120  1.00 0.44  ? 18 ILE B H    5  
ATOM 10260 H HA   . ILE B 1 18 ? 2.213   -15.377 -5.298  1.00 0.54  ? 18 ILE B HA   5  
ATOM 10261 H HB   . ILE B 1 18 ? 2.638   -15.813 -7.516  1.00 0.79  ? 18 ILE B HB   5  
ATOM 10262 H HG12 . ILE B 1 18 ? 4.202   -14.021 -7.991  1.00 0.70  ? 18 ILE B HG12 5  
ATOM 10263 H HG13 . ILE B 1 18 ? 2.981   -14.051 -9.260  1.00 0.91  ? 18 ILE B HG13 5  
ATOM 10264 H HG21 . ILE B 1 18 ? 0.187   -15.028 -7.026  1.00 1.30  ? 18 ILE B HG21 5  
ATOM 10265 H HG22 . ILE B 1 18 ? 0.608   -13.696 -8.102  1.00 1.15  ? 18 ILE B HG22 5  
ATOM 10266 H HG23 . ILE B 1 18 ? 0.693   -15.359 -8.682  1.00 1.25  ? 18 ILE B HG23 5  
ATOM 10267 H HD11 . ILE B 1 18 ? 1.728   -12.289 -7.974  1.00 1.21  ? 18 ILE B HD11 5  
ATOM 10268 H HD12 . ILE B 1 18 ? 3.121   -12.170 -6.902  1.00 1.17  ? 18 ILE B HD12 5  
ATOM 10269 H HD13 . ILE B 1 18 ? 3.285   -11.762 -8.609  1.00 1.16  ? 18 ILE B HD13 5  
ATOM 10270 N N    . HIS B 1 19 ? 4.821   -14.626 -5.868  1.00 0.45  ? 19 HIS B N    5  
ATOM 10271 C CA   . HIS B 1 19 ? 6.181   -14.154 -5.498  1.00 0.46  ? 19 HIS B CA   5  
ATOM 10272 C C    . HIS B 1 19 ? 6.740   -13.299 -6.657  1.00 0.38  ? 19 HIS B C    5  
ATOM 10273 O O    . HIS B 1 19 ? 6.469   -13.585 -7.808  1.00 0.35  ? 19 HIS B O    5  
ATOM 10274 C CB   . HIS B 1 19 ? 7.061   -15.381 -5.174  1.00 0.54  ? 19 HIS B CB   5  
ATOM 10275 C CG   . HIS B 1 19 ? 8.282   -15.435 -6.046  1.00 0.60  ? 19 HIS B CG   5  
ATOM 10276 N ND1  . HIS B 1 19 ? 9.559   -15.307 -5.533  1.00 0.76  ? 19 HIS B ND1  5  
ATOM 10277 C CD2  . HIS B 1 19 ? 8.430   -15.612 -7.394  1.00 0.60  ? 19 HIS B CD2  5  
ATOM 10278 C CE1  . HIS B 1 19 ? 10.416  -15.409 -6.560  1.00 0.81  ? 19 HIS B CE1  5  
ATOM 10279 N NE2  . HIS B 1 19 ? 9.780   -15.598 -7.721  1.00 0.74  ? 19 HIS B NE2  5  
ATOM 10280 H H    . HIS B 1 19 ? 4.705   -15.435 -6.405  1.00 0.55  ? 19 HIS B H    5  
ATOM 10281 H HA   . HIS B 1 19 ? 6.091   -13.544 -4.615  1.00 0.50  ? 19 HIS B HA   5  
ATOM 10282 H HB2  . HIS B 1 19 ? 7.370   -15.330 -4.143  1.00 0.64  ? 19 HIS B HB2  5  
ATOM 10283 H HB3  . HIS B 1 19 ? 6.480   -16.280 -5.322  1.00 0.52  ? 19 HIS B HB3  5  
ATOM 10284 H HD1  . HIS B 1 19 ? 9.796   -15.169 -4.591  1.00 0.84  ? 19 HIS B HD1  5  
ATOM 10285 H HD2  . HIS B 1 19 ? 7.617   -15.718 -8.095  1.00 0.55  ? 19 HIS B HD2  5  
ATOM 10286 H HE1  . HIS B 1 19 ? 11.485  -15.329 -6.463  1.00 0.93  ? 19 HIS B HE1  5  
ATOM 10287 N N    . PRO B 1 20 ? 7.482   -12.257 -6.324  1.00 0.39  ? 20 PRO B N    5  
ATOM 10288 C CA   . PRO B 1 20 ? 8.051   -11.346 -7.330  1.00 0.35  ? 20 PRO B CA   5  
ATOM 10289 C C    . PRO B 1 20 ? 9.269   -11.980 -8.034  1.00 0.37  ? 20 PRO B C    5  
ATOM 10290 O O    . PRO B 1 20 ? 9.121   -12.996 -8.684  1.00 0.43  ? 20 PRO B O    5  
ATOM 10291 C CB   . PRO B 1 20 ? 8.402   -10.093 -6.520  1.00 0.39  ? 20 PRO B CB   5  
ATOM 10292 C CG   . PRO B 1 20 ? 8.566   -10.555 -5.057  1.00 0.47  ? 20 PRO B CG   5  
ATOM 10293 C CD   . PRO B 1 20 ? 7.808   -11.884 -4.932  1.00 0.46  ? 20 PRO B CD   5  
ATOM 10294 H HA   . PRO B 1 20 ? 7.302   -11.103 -8.064  1.00 0.32  ? 20 PRO B HA   5  
ATOM 10295 H HB2  . PRO B 1 20 ? 9.312   -9.647  -6.881  1.00 0.40  ? 20 PRO B HB2  5  
ATOM 10296 H HB3  . PRO B 1 20 ? 7.594   -9.382  -6.582  1.00 0.40  ? 20 PRO B HB3  5  
ATOM 10297 H HG2  . PRO B 1 20 ? 9.613   -10.701 -4.832  1.00 0.50  ? 20 PRO B HG2  5  
ATOM 10298 H HG3  . PRO B 1 20 ? 8.137   -9.828  -4.388  1.00 0.51  ? 20 PRO B HG3  5  
ATOM 10299 H HD2  . PRO B 1 20 ? 8.442   -12.629 -4.478  1.00 0.50  ? 20 PRO B HD2  5  
ATOM 10300 H HD3  . PRO B 1 20 ? 6.907   -11.744 -4.362  1.00 0.47  ? 20 PRO B HD3  5  
ATOM 10301 N N    . LYS B 1 21 ? 10.449  -11.373 -7.970  1.00 0.38  ? 21 LYS B N    5  
ATOM 10302 C CA   . LYS B 1 21 ? 11.650  -11.912 -8.701  1.00 0.40  ? 21 LYS B CA   5  
ATOM 10303 C C    . LYS B 1 21 ? 11.466  -11.603 -10.193 1.00 0.38  ? 21 LYS B C    5  
ATOM 10304 O O    . LYS B 1 21 ? 12.328  -11.032 -10.831 1.00 0.42  ? 21 LYS B O    5  
ATOM 10305 C CB   . LYS B 1 21 ? 11.815  -13.422 -8.484  1.00 0.42  ? 21 LYS B CB   5  
ATOM 10306 C CG   . LYS B 1 21 ? 13.235  -13.838 -8.887  1.00 0.52  ? 21 LYS B CG   5  
ATOM 10307 C CD   . LYS B 1 21 ? 13.593  -15.179 -8.237  1.00 0.95  ? 21 LYS B CD   5  
ATOM 10308 C CE   . LYS B 1 21 ? 12.971  -16.325 -9.040  1.00 1.49  ? 21 LYS B CE   5  
ATOM 10309 N NZ   . LYS B 1 21 ? 13.810  -17.549 -8.895  1.00 2.16  ? 21 LYS B NZ   5  
ATOM 10310 H H    . LYS B 1 21 ? 10.540  -10.537 -7.480  1.00 0.41  ? 21 LYS B H    5  
ATOM 10311 H HA   . LYS B 1 21 ? 12.530  -11.400 -8.346  1.00 0.43  ? 21 LYS B HA   5  
ATOM 10312 H HB2  . LYS B 1 21 ? 11.653  -13.654 -7.442  1.00 0.42  ? 21 LYS B HB2  5  
ATOM 10313 H HB3  . LYS B 1 21 ? 11.100  -13.957 -9.090  1.00 0.41  ? 21 LYS B HB3  5  
ATOM 10314 H HG2  . LYS B 1 21 ? 13.288  -13.934 -9.961  1.00 0.96  ? 21 LYS B HG2  5  
ATOM 10315 H HG3  . LYS B 1 21 ? 13.935  -13.085 -8.558  1.00 0.83  ? 21 LYS B HG3  5  
ATOM 10316 H HD2  . LYS B 1 21 ? 14.668  -15.292 -8.223  1.00 1.56  ? 21 LYS B HD2  5  
ATOM 10317 H HD3  . LYS B 1 21 ? 13.217  -15.203 -7.226  1.00 1.65  ? 21 LYS B HD3  5  
ATOM 10318 H HE2  . LYS B 1 21 ? 11.976  -16.525 -8.669  1.00 1.90  ? 21 LYS B HE2  5  
ATOM 10319 H HE3  . LYS B 1 21 ? 12.916  -16.047 -10.082 1.00 1.94  ? 21 LYS B HE3  5  
ATOM 10320 H HZ1  . LYS B 1 21 ? 14.799  -17.323 -9.124  1.00 2.41  ? 21 LYS B HZ1  5  
ATOM 10321 H HZ2  . LYS B 1 21 ? 13.754  -17.895 -7.916  1.00 2.61  ? 21 LYS B HZ2  5  
ATOM 10322 H HZ3  . LYS B 1 21 ? 13.464  -18.286 -9.544  1.00 2.59  ? 21 LYS B HZ3  5  
ATOM 10323 N N    . ASN B 1 22 ? 10.319  -11.940 -10.729 1.00 0.36  ? 22 ASN B N    5  
ATOM 10324 C CA   . ASN B 1 22 ? 10.004  -11.645 -12.143 1.00 0.36  ? 22 ASN B CA   5  
ATOM 10325 C C    . ASN B 1 22 ? 9.138   -10.391 -12.143 1.00 0.34  ? 22 ASN B C    5  
ATOM 10326 O O    . ASN B 1 22 ? 9.392   -9.429  -12.833 1.00 0.36  ? 22 ASN B O    5  
ATOM 10327 C CB   . ASN B 1 22 ? 9.182   -12.798 -12.731 1.00 0.36  ? 22 ASN B CB   5  
ATOM 10328 C CG   . ASN B 1 22 ? 9.657   -14.144 -12.178 1.00 0.38  ? 22 ASN B CG   5  
ATOM 10329 O OD1  . ASN B 1 22 ? 10.675  -14.662 -12.592 1.00 0.43  ? 22 ASN B OD1  5  
ATOM 10330 N ND2  . ASN B 1 22 ? 8.952   -14.731 -11.248 1.00 0.37  ? 22 ASN B ND2  5  
ATOM 10331 H H    . ASN B 1 22 ? 9.634   -12.364 -10.184 1.00 0.35  ? 22 ASN B H    5  
ATOM 10332 H HA   . ASN B 1 22 ? 10.906  -11.489 -12.713 1.00 0.39  ? 22 ASN B HA   5  
ATOM 10333 H HB2  . ASN B 1 22 ? 8.143   -12.659 -12.471 1.00 0.33  ? 22 ASN B HB2  5  
ATOM 10334 H HB3  . ASN B 1 22 ? 9.281   -12.793 -13.794 1.00 0.38  ? 22 ASN B HB3  5  
ATOM 10335 H HD21 . ASN B 1 22 ? 8.130   -14.309 -10.914 1.00 0.34  ? 22 ASN B HD21 5  
ATOM 10336 H HD22 . ASN B 1 22 ? 9.241   -15.593 -10.883 1.00 0.40  ? 22 ASN B HD22 5  
ATOM 10337 N N    . ILE B 1 23 ? 8.114   -10.418 -11.339 1.00 0.31  ? 23 ILE B N    5  
ATOM 10338 C CA   . ILE B 1 23 ? 7.176   -9.279  -11.211 1.00 0.30  ? 23 ILE B CA   5  
ATOM 10339 C C    . ILE B 1 23 ? 7.962   -7.967  -11.020 1.00 0.34  ? 23 ILE B C    5  
ATOM 10340 O O    . ILE B 1 23 ? 8.559   -7.730  -9.986  1.00 0.37  ? 23 ILE B O    5  
ATOM 10341 C CB   . ILE B 1 23 ? 6.302   -9.586  -9.991  1.00 0.29  ? 23 ILE B CB   5  
ATOM 10342 C CG1  . ILE B 1 23 ? 5.107   -10.440 -10.416 1.00 0.27  ? 23 ILE B CG1  5  
ATOM 10343 C CG2  . ILE B 1 23 ? 5.809   -8.303  -9.342  1.00 0.33  ? 23 ILE B CG2  5  
ATOM 10344 C CD1  . ILE B 1 23 ? 5.568   -11.881 -10.645 1.00 0.26  ? 23 ILE B CD1  5  
ATOM 10345 H H    . ILE B 1 23 ? 7.960   -11.213 -10.790 1.00 0.31  ? 23 ILE B H    5  
ATOM 10346 H HA   . ILE B 1 23 ? 6.557   -9.213  -12.098 1.00 0.29  ? 23 ILE B HA   5  
ATOM 10347 H HB   . ILE B 1 23 ? 6.895   -10.140 -9.278  1.00 0.31  ? 23 ILE B HB   5  
ATOM 10348 H HG12 . ILE B 1 23 ? 4.356   -10.421 -9.640  1.00 0.29  ? 23 ILE B HG12 5  
ATOM 10349 H HG13 . ILE B 1 23 ? 4.690   -10.047 -11.331 1.00 0.26  ? 23 ILE B HG13 5  
ATOM 10350 H HG21 . ILE B 1 23 ? 5.613   -7.569  -10.107 1.00 1.08  ? 23 ILE B HG21 5  
ATOM 10351 H HG22 . ILE B 1 23 ? 4.906   -8.506  -8.791  1.00 1.01  ? 23 ILE B HG22 5  
ATOM 10352 H HG23 . ILE B 1 23 ? 6.569   -7.934  -8.669  1.00 1.12  ? 23 ILE B HG23 5  
ATOM 10353 H HD11 . ILE B 1 23 ? 6.244   -12.171 -9.854  1.00 1.04  ? 23 ILE B HD11 5  
ATOM 10354 H HD12 . ILE B 1 23 ? 4.712   -12.538 -10.647 1.00 1.01  ? 23 ILE B HD12 5  
ATOM 10355 H HD13 . ILE B 1 23 ? 6.078   -11.947 -11.595 1.00 1.04  ? 23 ILE B HD13 5  
ATOM 10356 N N    . GLN B 1 24 ? 7.962   -7.125  -12.021 1.00 0.36  ? 24 GLN B N    5  
ATOM 10357 C CA   . GLN B 1 24 ? 8.685   -5.834  -11.950 1.00 0.42  ? 24 GLN B CA   5  
ATOM 10358 C C    . GLN B 1 24 ? 7.694   -4.674  -11.827 1.00 0.37  ? 24 GLN B C    5  
ATOM 10359 O O    . GLN B 1 24 ? 8.051   -3.606  -11.367 1.00 0.39  ? 24 GLN B O    5  
ATOM 10360 C CB   . GLN B 1 24 ? 9.490   -5.694  -13.236 1.00 0.48  ? 24 GLN B CB   5  
ATOM 10361 C CG   . GLN B 1 24 ? 10.971  -5.431  -12.923 1.00 0.57  ? 24 GLN B CG   5  
ATOM 10362 C CD   . GLN B 1 24 ? 11.595  -6.618  -12.171 1.00 1.16  ? 24 GLN B CD   5  
ATOM 10363 O OE1  . GLN B 1 24 ? 10.920  -7.566  -11.821 1.00 1.83  ? 24 GLN B OE1  5  
ATOM 10364 N NE2  . GLN B 1 24 ? 12.873  -6.605  -11.906 1.00 1.58  ? 24 GLN B NE2  5  
ATOM 10365 H H    . GLN B 1 24 ? 7.482   -7.341  -12.848 1.00 0.36  ? 24 GLN B H    5  
ATOM 10366 H HA   . GLN B 1 24 ? 9.357   -5.824  -11.101 1.00 0.46  ? 24 GLN B HA   5  
ATOM 10367 H HB2  . GLN B 1 24 ? 9.407   -6.613  -13.802 1.00 0.48  ? 24 GLN B HB2  5  
ATOM 10368 H HB3  . GLN B 1 24 ? 9.083   -4.893  -13.814 1.00 0.48  ? 24 GLN B HB3  5  
ATOM 10369 H HG2  . GLN B 1 24 ? 11.505  -5.278  -13.849 1.00 0.65  ? 24 GLN B HG2  5  
ATOM 10370 H HG3  . GLN B 1 24 ? 11.053  -4.543  -12.315 1.00 0.92  ? 24 GLN B HG3  5  
ATOM 10371 H HE21 . GLN B 1 24 ? 13.425  -5.843  -12.185 1.00 1.79  ? 24 GLN B HE21 5  
ATOM 10372 H HE22 . GLN B 1 24 ? 13.281  -7.356  -11.426 1.00 2.03  ? 24 GLN B HE22 5  
ATOM 10373 N N    . SER B 1 25 ? 6.454   -4.861  -12.229 1.00 0.33  ? 25 SER B N    5  
ATOM 10374 C CA   . SER B 1 25 ? 5.474   -3.742  -12.122 1.00 0.29  ? 25 SER B CA   5  
ATOM 10375 C C    . SER B 1 25 ? 4.044   -4.266  -12.052 1.00 0.27  ? 25 SER B C    5  
ATOM 10376 O O    . SER B 1 25 ? 3.800   -5.456  -12.053 1.00 0.29  ? 25 SER B O    5  
ATOM 10377 C CB   . SER B 1 25 ? 5.589   -2.830  -13.328 1.00 0.31  ? 25 SER B CB   5  
ATOM 10378 O OG   . SER B 1 25 ? 5.244   -3.547  -14.505 1.00 0.34  ? 25 SER B OG   5  
ATOM 10379 H H    . SER B 1 25 ? 6.171   -5.731  -12.592 1.00 0.33  ? 25 SER B H    5  
ATOM 10380 H HA   . SER B 1 25 ? 5.687   -3.173  -11.235 1.00 0.29  ? 25 SER B HA   5  
ATOM 10381 H HB2  . SER B 1 25 ? 4.912   -2.010  -13.201 1.00 0.31  ? 25 SER B HB2  5  
ATOM 10382 H HB3  . SER B 1 25 ? 6.594   -2.455  -13.400 1.00 0.30  ? 25 SER B HB3  5  
ATOM 10383 H HG   . SER B 1 25 ? 5.024   -2.910  -15.189 1.00 0.88  ? 25 SER B HG   5  
ATOM 10384 N N    . VAL B 1 26 ? 3.100   -3.364  -11.992 1.00 0.25  ? 26 VAL B N    5  
ATOM 10385 C CA   . VAL B 1 26 ? 1.670   -3.758  -11.931 1.00 0.24  ? 26 VAL B CA   5  
ATOM 10386 C C    . VAL B 1 26 ? 0.799   -2.579  -12.358 1.00 0.25  ? 26 VAL B C    5  
ATOM 10387 O O    . VAL B 1 26 ? 1.208   -1.434  -12.325 1.00 0.26  ? 26 VAL B O    5  
ATOM 10388 C CB   . VAL B 1 26 ? 1.289   -4.176  -10.504 1.00 0.23  ? 26 VAL B CB   5  
ATOM 10389 C CG1  . VAL B 1 26 ? 1.879   -3.196  -9.510  1.00 0.25  ? 26 VAL B CG1  5  
ATOM 10390 C CG2  . VAL B 1 26 ? -0.238  -4.192  -10.355 1.00 0.26  ? 26 VAL B CG2  5  
ATOM 10391 H H    . VAL B 1 26 ? 3.337   -2.415  -11.990 1.00 0.25  ? 26 VAL B H    5  
ATOM 10392 H HA   . VAL B 1 26 ? 1.504   -4.585  -12.602 1.00 0.24  ? 26 VAL B HA   5  
ATOM 10393 H HB   . VAL B 1 26 ? 1.679   -5.148  -10.301 1.00 0.25  ? 26 VAL B HB   5  
ATOM 10394 H HG11 . VAL B 1 26 ? 2.920   -3.034  -9.750  1.00 1.01  ? 26 VAL B HG11 5  
ATOM 10395 H HG12 . VAL B 1 26 ? 1.343   -2.264  -9.571  1.00 1.08  ? 26 VAL B HG12 5  
ATOM 10396 H HG13 . VAL B 1 26 ? 1.794   -3.605  -8.518  1.00 1.00  ? 26 VAL B HG13 5  
ATOM 10397 H HG21 . VAL B 1 26 ? -0.668  -4.818  -11.126 1.00 1.05  ? 26 VAL B HG21 5  
ATOM 10398 H HG22 . VAL B 1 26 ? -0.505  -4.579  -9.388  1.00 1.04  ? 26 VAL B HG22 5  
ATOM 10399 H HG23 . VAL B 1 26 ? -0.619  -3.185  -10.460 1.00 1.04  ? 26 VAL B HG23 5  
ATOM 10400 N N    . ASN B 1 27 ? -0.405  -2.871  -12.746 1.00 0.25  ? 27 ASN B N    5  
ATOM 10401 C CA   . ASN B 1 27 ? -1.344  -1.827  -13.170 1.00 0.27  ? 27 ASN B CA   5  
ATOM 10402 C C    . ASN B 1 27 ? -2.634  -1.962  -12.372 1.00 0.25  ? 27 ASN B C    5  
ATOM 10403 O O    . ASN B 1 27 ? -3.039  -3.049  -12.015 1.00 0.42  ? 27 ASN B O    5  
ATOM 10404 C CB   . ASN B 1 27 ? -1.669  -2.005  -14.640 1.00 0.30  ? 27 ASN B CB   5  
ATOM 10405 C CG   . ASN B 1 27 ? -0.418  -2.409  -15.433 1.00 0.57  ? 27 ASN B CG   5  
ATOM 10406 O OD1  . ASN B 1 27 ? 0.610   -1.766  -15.342 1.00 0.94  ? 27 ASN B OD1  5  
ATOM 10407 N ND2  . ASN B 1 27 ? -0.466  -3.451  -16.219 1.00 0.72  ? 27 ASN B ND2  5  
ATOM 10408 H H    . ASN B 1 27 ? -0.696  -3.796  -12.756 1.00 0.26  ? 27 ASN B H    5  
ATOM 10409 H HA   . ASN B 1 27 ? -0.915  -0.863  -13.009 1.00 0.30  ? 27 ASN B HA   5  
ATOM 10410 H HB2  . ASN B 1 27 ? -2.431  -2.759  -14.746 1.00 0.46  ? 27 ASN B HB2  5  
ATOM 10411 H HB3  . ASN B 1 27 ? -2.037  -1.085  -15.005 1.00 0.51  ? 27 ASN B HB3  5  
ATOM 10412 H HD21 . ASN B 1 27 ? -1.296  -3.967  -16.299 1.00 0.75  ? 27 ASN B HD21 5  
ATOM 10413 H HD22 . ASN B 1 27 ? 0.328   -3.718  -16.727 1.00 0.99  ? 27 ASN B HD22 5  
ATOM 10414 N N    . VAL B 1 28 ? -3.290  -0.870  -12.112 1.00 0.28  ? 28 VAL B N    5  
ATOM 10415 C CA   . VAL B 1 28 ? -4.578  -0.937  -11.357 1.00 0.29  ? 28 VAL B CA   5  
ATOM 10416 C C    . VAL B 1 28 ? -5.598  0.000   -12.021 1.00 0.31  ? 28 VAL B C    5  
ATOM 10417 O O    . VAL B 1 28 ? -5.459  1.206   -11.993 1.00 0.33  ? 28 VAL B O    5  
ATOM 10418 C CB   . VAL B 1 28 ? -4.351  -0.556  -9.884  1.00 0.34  ? 28 VAL B CB   5  
ATOM 10419 C CG1  . VAL B 1 28 ? -3.728  0.835   -9.785  1.00 0.55  ? 28 VAL B CG1  5  
ATOM 10420 C CG2  . VAL B 1 28 ? -5.687  -0.573  -9.135  1.00 0.72  ? 28 VAL B CG2  5  
ATOM 10421 H H    . VAL B 1 28 ? -2.943  -0.007  -12.430 1.00 0.44  ? 28 VAL B H    5  
ATOM 10422 H HA   . VAL B 1 28 ? -4.949  -1.952  -11.407 1.00 0.28  ? 28 VAL B HA   5  
ATOM 10423 H HB   . VAL B 1 28 ? -3.681  -1.274  -9.436  1.00 0.31  ? 28 VAL B HB   5  
ATOM 10424 H HG11 . VAL B 1 28 ? -3.121  1.021   -10.658 1.00 1.25  ? 28 VAL B HG11 5  
ATOM 10425 H HG12 . VAL B 1 28 ? -4.510  1.576   -9.725  1.00 1.09  ? 28 VAL B HG12 5  
ATOM 10426 H HG13 . VAL B 1 28 ? -3.111  0.889   -8.901  1.00 1.22  ? 28 VAL B HG13 5  
ATOM 10427 H HG21 . VAL B 1 28 ? -6.144  -1.546  -9.236  1.00 1.29  ? 28 VAL B HG21 5  
ATOM 10428 H HG22 . VAL B 1 28 ? -5.517  -0.363  -8.089  1.00 1.29  ? 28 VAL B HG22 5  
ATOM 10429 H HG23 . VAL B 1 28 ? -6.344  0.178   -9.550  1.00 1.29  ? 28 VAL B HG23 5  
ATOM 10430 N N    . LYS B 1 29 ? -6.606  -0.564  -12.641 1.00 0.35  ? 29 LYS B N    5  
ATOM 10431 C CA   . LYS B 1 29 ? -7.636  0.260   -13.350 1.00 0.42  ? 29 LYS B CA   5  
ATOM 10432 C C    . LYS B 1 29 ? -9.029  0.021   -12.733 1.00 0.37  ? 29 LYS B C    5  
ATOM 10433 O O    . LYS B 1 29 ? -9.265  -0.961  -12.053 1.00 0.35  ? 29 LYS B O    5  
ATOM 10434 C CB   . LYS B 1 29 ? -7.612  -0.140  -14.844 1.00 0.52  ? 29 LYS B CB   5  
ATOM 10435 C CG   . LYS B 1 29 ? -8.868  0.339   -15.589 1.00 1.08  ? 29 LYS B CG   5  
ATOM 10436 C CD   . LYS B 1 29 ? -8.805  1.850   -15.835 1.00 0.83  ? 29 LYS B CD   5  
ATOM 10437 C CE   . LYS B 1 29 ? -7.882  2.147   -17.020 1.00 0.77  ? 29 LYS B CE   5  
ATOM 10438 N NZ   . LYS B 1 29 ? -8.637  1.982   -18.296 1.00 1.23  ? 29 LYS B NZ   5  
ATOM 10439 H H    . LYS B 1 29 ? -6.673  -1.539  -12.658 1.00 0.35  ? 29 LYS B H    5  
ATOM 10440 H HA   . LYS B 1 29 ? -7.383  1.305   -13.258 1.00 0.52  ? 29 LYS B HA   5  
ATOM 10441 H HB2  . LYS B 1 29 ? -6.740  0.294   -15.309 1.00 1.13  ? 29 LYS B HB2  5  
ATOM 10442 H HB3  . LYS B 1 29 ? -7.548  -1.214  -14.918 1.00 0.82  ? 29 LYS B HB3  5  
ATOM 10443 H HG2  . LYS B 1 29 ? -8.929  -0.170  -16.538 1.00 1.70  ? 29 LYS B HG2  5  
ATOM 10444 H HG3  . LYS B 1 29 ? -9.742  0.108   -15.007 1.00 2.02  ? 29 LYS B HG3  5  
ATOM 10445 H HD2  . LYS B 1 29 ? -9.796  2.219   -16.052 1.00 1.42  ? 29 LYS B HD2  5  
ATOM 10446 H HD3  . LYS B 1 29 ? -8.426  2.343   -14.955 1.00 1.53  ? 29 LYS B HD3  5  
ATOM 10447 H HE2  . LYS B 1 29 ? -7.518  3.162   -16.946 1.00 1.30  ? 29 LYS B HE2  5  
ATOM 10448 H HE3  . LYS B 1 29 ? -7.046  1.463   -17.005 1.00 1.10  ? 29 LYS B HE3  5  
ATOM 10449 H HZ1  . LYS B 1 29 ? -9.488  2.577   -18.275 1.00 1.80  ? 29 LYS B HZ1  5  
ATOM 10450 H HZ2  . LYS B 1 29 ? -8.034  2.269   -19.093 1.00 1.54  ? 29 LYS B HZ2  5  
ATOM 10451 H HZ3  . LYS B 1 29 ? -8.910  0.984   -18.409 1.00 1.71  ? 29 LYS B HZ3  5  
ATOM 10452 N N    . SER B 1 30 ? -9.942  0.936   -12.968 1.00 0.39  ? 30 SER B N    5  
ATOM 10453 C CA   . SER B 1 30 ? -11.328 0.821   -12.415 1.00 0.39  ? 30 SER B CA   5  
ATOM 10454 C C    . SER B 1 30 ? -12.211 -0.021  -13.375 1.00 0.34  ? 30 SER B C    5  
ATOM 10455 O O    . SER B 1 30 ? -11.734 -0.489  -14.391 1.00 0.35  ? 30 SER B O    5  
ATOM 10456 C CB   . SER B 1 30 ? -11.887 2.250   -12.264 1.00 0.52  ? 30 SER B CB   5  
ATOM 10457 O OG   . SER B 1 30 ? -12.701 2.583   -13.385 1.00 1.63  ? 30 SER B OG   5  
ATOM 10458 H H    . SER B 1 30 ? -9.709  1.718   -13.510 1.00 0.43  ? 30 SER B H    5  
ATOM 10459 H HA   . SER B 1 30 ? -11.290 0.341   -11.446 1.00 0.41  ? 30 SER B HA   5  
ATOM 10460 H HB2  . SER B 1 30 ? -12.476 2.316   -11.367 1.00 0.91  ? 30 SER B HB2  5  
ATOM 10461 H HB3  . SER B 1 30 ? -11.058 2.948   -12.195 1.00 0.92  ? 30 SER B HB3  5  
ATOM 10462 H HG   . SER B 1 30 ? -12.131 2.668   -14.153 1.00 2.13  ? 30 SER B HG   5  
ATOM 10463 N N    . PRO B 1 31 ? -13.477 -0.189  -13.025 1.00 0.39  ? 31 PRO B N    5  
ATOM 10464 C CA   . PRO B 1 31 ? -14.438 -0.968  -13.845 1.00 0.44  ? 31 PRO B CA   5  
ATOM 10465 C C    . PRO B 1 31 ? -14.891 -0.167  -15.076 1.00 0.52  ? 31 PRO B C    5  
ATOM 10466 O O    . PRO B 1 31 ? -14.385 0.910   -15.338 1.00 0.59  ? 31 PRO B O    5  
ATOM 10467 C CB   . PRO B 1 31 ? -15.603 -1.224  -12.883 1.00 0.52  ? 31 PRO B CB   5  
ATOM 10468 C CG   . PRO B 1 31 ? -15.515 -0.141  -11.784 1.00 0.56  ? 31 PRO B CG   5  
ATOM 10469 C CD   . PRO B 1 31 ? -14.066 0.377   -11.790 1.00 0.49  ? 31 PRO B CD   5  
ATOM 10470 H HA   . PRO B 1 31 ? -14.003 -1.904  -14.151 1.00 0.44  ? 31 PRO B HA   5  
ATOM 10471 H HB2  . PRO B 1 31 ? -16.544 -1.146  -13.411 1.00 0.58  ? 31 PRO B HB2  5  
ATOM 10472 H HB3  . PRO B 1 31 ? -15.507 -2.200  -12.438 1.00 0.55  ? 31 PRO B HB3  5  
ATOM 10473 H HG2  . PRO B 1 31 ? -16.202 0.665   -12.003 1.00 0.62  ? 31 PRO B HG2  5  
ATOM 10474 H HG3  . PRO B 1 31 ? -15.743 -0.572  -10.821 1.00 0.64  ? 31 PRO B HG3  5  
ATOM 10475 H HD2  . PRO B 1 31 ? -14.058 1.457   -11.823 1.00 0.54  ? 31 PRO B HD2  5  
ATOM 10476 H HD3  . PRO B 1 31 ? -13.531 0.019   -10.923 1.00 0.52  ? 31 PRO B HD3  5  
ATOM 10477 N N    . GLY B 1 32 ? -15.834 -0.681  -15.841 1.00 0.59  ? 32 GLY B N    5  
ATOM 10478 C CA   . GLY B 1 32 ? -16.288 0.075   -17.052 1.00 0.72  ? 32 GLY B CA   5  
ATOM 10479 C C    . GLY B 1 32 ? -17.077 -0.839  -18.001 1.00 0.91  ? 32 GLY B C    5  
ATOM 10480 O O    . GLY B 1 32 ? -18.290 -0.763  -18.048 1.00 1.05  ? 32 GLY B O    5  
ATOM 10481 H H    . GLY B 1 32 ? -16.238 -1.557  -15.620 1.00 0.60  ? 32 GLY B H    5  
ATOM 10482 H HA2  . GLY B 1 32 ? -16.919 0.895   -16.742 1.00 0.72  ? 32 GLY B HA2  5  
ATOM 10483 H HA3  . GLY B 1 32 ? -15.427 0.466   -17.572 1.00 0.77  ? 32 GLY B HA3  5  
ATOM 10484 N N    . PRO B 1 33 ? -16.370 -1.672  -18.740 1.00 1.05  ? 33 PRO B N    5  
ATOM 10485 C CA   . PRO B 1 33 ? -16.998 -2.598  -19.707 1.00 1.30  ? 33 PRO B CA   5  
ATOM 10486 C C    . PRO B 1 33 ? -17.715 -3.745  -18.977 1.00 1.12  ? 33 PRO B C    5  
ATOM 10487 O O    . PRO B 1 33 ? -18.011 -3.647  -17.800 1.00 1.13  ? 33 PRO B O    5  
ATOM 10488 C CB   . PRO B 1 33 ? -15.815 -3.102  -20.546 1.00 1.62  ? 33 PRO B CB   5  
ATOM 10489 C CG   . PRO B 1 33 ? -14.547 -2.881  -19.693 1.00 1.55  ? 33 PRO B CG   5  
ATOM 10490 C CD   . PRO B 1 33 ? -14.892 -1.776  -18.677 1.00 1.17  ? 33 PRO B CD   5  
ATOM 10491 H HA   . PRO B 1 33 ? -17.692 -2.066  -20.337 1.00 1.48  ? 33 PRO B HA   5  
ATOM 10492 H HB2  . PRO B 1 33 ? -15.938 -4.153  -20.767 1.00 1.72  ? 33 PRO B HB2  5  
ATOM 10493 H HB3  . PRO B 1 33 ? -15.742 -2.534  -21.460 1.00 1.87  ? 33 PRO B HB3  5  
ATOM 10494 H HG2  . PRO B 1 33 ? -14.285 -3.794  -19.176 1.00 1.57  ? 33 PRO B HG2  5  
ATOM 10495 H HG3  . PRO B 1 33 ? -13.730 -2.559  -20.318 1.00 1.80  ? 33 PRO B HG3  5  
ATOM 10496 H HD2  . PRO B 1 33 ? -14.566 -2.065  -17.690 1.00 1.04  ? 33 PRO B HD2  5  
ATOM 10497 H HD3  . PRO B 1 33 ? -14.439 -0.841  -18.969 1.00 1.24  ? 33 PRO B HD3  5  
ATOM 10498 N N    . HIS B 1 34 ? -18.011 -4.823  -19.668 1.00 1.15  ? 34 HIS B N    5  
ATOM 10499 C CA   . HIS B 1 34 ? -18.726 -5.970  -19.007 1.00 1.18  ? 34 HIS B CA   5  
ATOM 10500 C C    . HIS B 1 34 ? -17.904 -6.521  -17.839 1.00 1.19  ? 34 HIS B C    5  
ATOM 10501 O O    . HIS B 1 34 ? -18.458 -7.128  -16.939 1.00 1.29  ? 34 HIS B O    5  
ATOM 10502 C CB   . HIS B 1 34 ? -19.037 -7.097  -20.012 1.00 1.36  ? 34 HIS B CB   5  
ATOM 10503 C CG   . HIS B 1 34 ? -17.946 -7.225  -21.046 1.00 1.55  ? 34 HIS B CG   5  
ATOM 10504 N ND1  . HIS B 1 34 ? -18.228 -7.364  -22.396 1.00 2.08  ? 34 HIS B ND1  5  
ATOM 10505 C CD2  . HIS B 1 34 ? -16.578 -7.243  -20.944 1.00 2.02  ? 34 HIS B CD2  5  
ATOM 10506 C CE1  . HIS B 1 34 ? -17.055 -7.458  -23.046 1.00 2.64  ? 34 HIS B CE1  5  
ATOM 10507 N NE2  . HIS B 1 34 ? -16.019 -7.389  -22.209 1.00 2.66  ? 34 HIS B NE2  5  
ATOM 10508 H H    . HIS B 1 34 ? -17.778 -4.871  -20.617 1.00 1.28  ? 34 HIS B H    5  
ATOM 10509 H HA   . HIS B 1 34 ? -19.659 -5.596  -18.599 1.00 1.14  ? 34 HIS B HA   5  
ATOM 10510 H HB2  . HIS B 1 34 ? -19.131 -8.031  -19.481 1.00 1.72  ? 34 HIS B HB2  5  
ATOM 10511 H HB3  . HIS B 1 34 ? -19.971 -6.878  -20.509 1.00 1.68  ? 34 HIS B HB3  5  
ATOM 10512 H HD1  . HIS B 1 34 ? -19.118 -7.387  -22.802 1.00 2.31  ? 34 HIS B HD1  5  
ATOM 10513 H HD2  . HIS B 1 34 ? -16.020 -7.165  -20.023 1.00 2.23  ? 34 HIS B HD2  5  
ATOM 10514 H HE1  . HIS B 1 34 ? -16.963 -7.575  -24.116 1.00 3.25  ? 34 HIS B HE1  5  
ATOM 10515 N N    . CYS B 1 35 ? -16.609 -6.277  -17.794 1.00 1.22  ? 35 CYS B N    5  
ATOM 10516 C CA   . CYS B 1 35 ? -15.824 -6.751  -16.618 1.00 1.29  ? 35 CYS B CA   5  
ATOM 10517 C C    . CYS B 1 35 ? -16.410 -6.024  -15.404 1.00 1.07  ? 35 CYS B C    5  
ATOM 10518 O O    . CYS B 1 35 ? -16.634 -6.606  -14.358 1.00 1.13  ? 35 CYS B O    5  
ATOM 10519 C CB   . CYS B 1 35 ? -14.331 -6.419  -16.795 1.00 1.59  ? 35 CYS B CB   5  
ATOM 10520 S SG   . CYS B 1 35 ? -14.013 -4.670  -16.416 1.00 2.40  ? 35 CYS B SG   5  
ATOM 10521 H H    . CYS B 1 35 ? -16.177 -5.747  -18.496 1.00 1.28  ? 35 CYS B H    5  
ATOM 10522 H HA   . CYS B 1 35 ? -15.955 -7.819  -16.501 1.00 1.39  ? 35 CYS B HA   5  
ATOM 10523 H HB2  . CYS B 1 35 ? -13.749 -7.040  -16.130 1.00 1.86  ? 35 CYS B HB2  5  
ATOM 10524 H HB3  . CYS B 1 35 ? -14.041 -6.624  -17.816 1.00 1.86  ? 35 CYS B HB3  5  
ATOM 10525 N N    . ALA B 1 36 ? -16.726 -4.758  -15.597 1.00 0.96  ? 36 ALA B N    5  
ATOM 10526 C CA   . ALA B 1 36 ? -17.377 -3.919  -14.553 1.00 0.90  ? 36 ALA B CA   5  
ATOM 10527 C C    . ALA B 1 36 ? -16.789 -4.150  -13.155 1.00 0.86  ? 36 ALA B C    5  
ATOM 10528 O O    . ALA B 1 36 ? -17.466 -4.014  -12.153 1.00 1.18  ? 36 ALA B O    5  
ATOM 10529 C CB   . ALA B 1 36 ? -18.853 -4.246  -14.574 1.00 1.09  ? 36 ALA B CB   5  
ATOM 10530 H H    . ALA B 1 36 ? -16.574 -4.363  -16.479 1.00 1.03  ? 36 ALA B H    5  
ATOM 10531 H HA   . ALA B 1 36 ? -17.252 -2.882  -14.814 1.00 0.98  ? 36 ALA B HA   5  
ATOM 10532 H HB1  . ALA B 1 36 ? -19.185 -4.294  -15.602 1.00 1.38  ? 36 ALA B HB1  5  
ATOM 10533 H HB2  . ALA B 1 36 ? -19.012 -5.200  -14.100 1.00 1.61  ? 36 ALA B HB2  5  
ATOM 10534 H HB3  . ALA B 1 36 ? -19.395 -3.478  -14.052 1.00 1.51  ? 36 ALA B HB3  5  
ATOM 10535 N N    . GLN B 1 37 ? -15.526 -4.454  -13.087 1.00 0.93  ? 37 GLN B N    5  
ATOM 10536 C CA   . GLN B 1 37 ? -14.856 -4.652  -11.767 1.00 0.88  ? 37 GLN B CA   5  
ATOM 10537 C C    . GLN B 1 37 ? -13.524 -3.903  -11.781 1.00 0.71  ? 37 GLN B C    5  
ATOM 10538 O O    . GLN B 1 37 ? -13.207 -3.206  -12.723 1.00 0.74  ? 37 GLN B O    5  
ATOM 10539 C CB   . GLN B 1 37 ? -14.614 -6.142  -11.496 1.00 0.99  ? 37 GLN B CB   5  
ATOM 10540 C CG   . GLN B 1 37 ? -13.590 -6.715  -12.485 1.00 1.66  ? 37 GLN B CG   5  
ATOM 10541 C CD   . GLN B 1 37 ? -13.117 -8.082  -11.982 1.00 2.34  ? 37 GLN B CD   5  
ATOM 10542 O OE1  . GLN B 1 37 ? -11.943 -8.278  -11.740 1.00 2.83  ? 37 GLN B OE1  5  
ATOM 10543 N NE2  . GLN B 1 37 ? -13.985 -9.042  -11.807 1.00 3.07  ? 37 GLN B NE2  5  
ATOM 10544 H H    . GLN B 1 37 ? -15.009 -4.525  -13.912 1.00 1.26  ? 37 GLN B H    5  
ATOM 10545 H HA   . GLN B 1 37 ? -15.483 -4.243  -10.987 1.00 0.95  ? 37 GLN B HA   5  
ATOM 10546 H HB2  . GLN B 1 37 ? -14.241 -6.263  -10.490 1.00 1.38  ? 37 GLN B HB2  5  
ATOM 10547 H HB3  . GLN B 1 37 ? -15.542 -6.675  -11.594 1.00 1.44  ? 37 GLN B HB3  5  
ATOM 10548 H HG2  . GLN B 1 37 ? -14.046 -6.823  -13.459 1.00 2.21  ? 37 GLN B HG2  5  
ATOM 10549 H HG3  . GLN B 1 37 ? -12.744 -6.048  -12.554 1.00 2.02  ? 37 GLN B HG3  5  
ATOM 10550 H HE21 . GLN B 1 37 ? -14.934 -8.887  -11.998 1.00 3.26  ? 37 GLN B HE21 5  
ATOM 10551 H HE22 . GLN B 1 37 ? -13.687 -9.918  -11.483 1.00 3.72  ? 37 GLN B HE22 5  
ATOM 10552 N N    . THR B 1 38 ? -12.740 -4.038  -10.749 1.00 0.60  ? 38 THR B N    5  
ATOM 10553 C CA   . THR B 1 38 ? -11.431 -3.324  -10.715 1.00 0.44  ? 38 THR B CA   5  
ATOM 10554 C C    . THR B 1 38 ? -10.474 -3.909  -11.763 1.00 0.35  ? 38 THR B C    5  
ATOM 10555 O O    . THR B 1 38 ? -10.861 -4.645  -12.651 1.00 0.42  ? 38 THR B O    5  
ATOM 10556 C CB   . THR B 1 38 ? -10.790 -3.453  -9.322  1.00 0.44  ? 38 THR B CB   5  
ATOM 10557 O OG1  . THR B 1 38 ? -11.710 -4.034  -8.400  1.00 0.60  ? 38 THR B OG1  5  
ATOM 10558 C CG2  . THR B 1 38 ? -10.389 -2.066  -8.839  1.00 0.44  ? 38 THR B CG2  5  
ATOM 10559 H H    . THR B 1 38 ? -13.011 -4.604  -9.996  1.00 0.68  ? 38 THR B H    5  
ATOM 10560 H HA   . THR B 1 38 ? -11.596 -2.279  -10.932 1.00 0.44  ? 38 THR B HA   5  
ATOM 10561 H HB   . THR B 1 38 ? -9.901  -4.070  -9.388  1.00 0.40  ? 38 THR B HB   5  
ATOM 10562 H HG1  . THR B 1 38 ? -12.409 -3.397  -8.230  1.00 1.03  ? 38 THR B HG1  5  
ATOM 10563 H HG21 . THR B 1 38 ? -11.259 -1.426  -8.830  1.00 1.08  ? 38 THR B HG21 5  
ATOM 10564 H HG22 . THR B 1 38 ? -9.980  -2.137  -7.846  1.00 1.06  ? 38 THR B HG22 5  
ATOM 10565 H HG23 . THR B 1 38 ? -9.647  -1.657  -9.510  1.00 1.11  ? 38 THR B HG23 5  
ATOM 10566 N N    . GLU B 1 39 ? -9.215  -3.598  -11.630 1.00 0.25  ? 39 GLU B N    5  
ATOM 10567 C CA   . GLU B 1 39 ? -8.183  -4.119  -12.550 1.00 0.25  ? 39 GLU B CA   5  
ATOM 10568 C C    . GLU B 1 39 ? -6.907  -4.114  -11.767 1.00 0.21  ? 39 GLU B C    5  
ATOM 10569 O O    . GLU B 1 39 ? -6.635  -3.180  -11.033 1.00 0.35  ? 39 GLU B O    5  
ATOM 10570 C CB   . GLU B 1 39 ? -7.982  -3.230  -13.763 1.00 0.33  ? 39 GLU B CB   5  
ATOM 10571 C CG   . GLU B 1 39 ? -8.404  -3.978  -15.030 1.00 0.60  ? 39 GLU B CG   5  
ATOM 10572 C CD   . GLU B 1 39 ? -9.135  -3.020  -15.973 1.00 0.80  ? 39 GLU B CD   5  
ATOM 10573 O OE1  . GLU B 1 39 ? -10.268 -2.677  -15.678 1.00 1.40  ? 39 GLU B OE1  5  
ATOM 10574 O OE2  . GLU B 1 39 ? -8.549  -2.646  -16.975 1.00 1.47  ? 39 GLU B OE2  5  
ATOM 10575 H H    . GLU B 1 39 ? -8.931  -3.033  -10.882 1.00 0.25  ? 39 GLU B H    5  
ATOM 10576 H HA   . GLU B 1 39 ? -8.432  -5.123  -12.848 1.00 0.31  ? 39 GLU B HA   5  
ATOM 10577 H HB2  . GLU B 1 39 ? -8.566  -2.328  -13.656 1.00 0.30  ? 39 GLU B HB2  5  
ATOM 10578 H HB3  . GLU B 1 39 ? -6.924  -2.982  -13.824 1.00 0.41  ? 39 GLU B HB3  5  
ATOM 10579 H HG2  . GLU B 1 39 ? -7.526  -4.371  -15.523 1.00 0.87  ? 39 GLU B HG2  5  
ATOM 10580 H HG3  . GLU B 1 39 ? -9.063  -4.791  -14.766 1.00 0.84  ? 39 GLU B HG3  5  
ATOM 10581 N N    . VAL B 1 40 ? -6.152  -5.144  -11.853 1.00 0.15  ? 40 VAL B N    5  
ATOM 10582 C CA   . VAL B 1 40 ? -4.939  -5.196  -11.046 1.00 0.19  ? 40 VAL B CA   5  
ATOM 10583 C C    . VAL B 1 40 ? -3.949  -6.146  -11.714 1.00 0.19  ? 40 VAL B C    5  
ATOM 10584 O O    . VAL B 1 40 ? -3.839  -7.294  -11.343 1.00 0.22  ? 40 VAL B O    5  
ATOM 10585 C CB   . VAL B 1 40 ? -5.374  -5.708  -9.667  1.00 0.24  ? 40 VAL B CB   5  
ATOM 10586 C CG1  . VAL B 1 40 ? -5.702  -4.509  -8.788  1.00 0.28  ? 40 VAL B CG1  5  
ATOM 10587 C CG2  . VAL B 1 40 ? -6.657  -6.551  -9.813  1.00 0.24  ? 40 VAL B CG2  5  
ATOM 10588 H H    . VAL B 1 40 ? -6.406  -5.903  -12.398 1.00 0.22  ? 40 VAL B H    5  
ATOM 10589 H HA   . VAL B 1 40 ? -4.530  -4.199  -10.973 1.00 0.23  ? 40 VAL B HA   5  
ATOM 10590 H HB   . VAL B 1 40 ? -4.595  -6.308  -9.228  1.00 0.29  ? 40 VAL B HB   5  
ATOM 10591 H HG11 . VAL B 1 40 ? -5.172  -3.642  -9.150  1.00 1.04  ? 40 VAL B HG11 5  
ATOM 10592 H HG12 . VAL B 1 40 ? -6.769  -4.319  -8.831  1.00 1.02  ? 40 VAL B HG12 5  
ATOM 10593 H HG13 . VAL B 1 40 ? -5.415  -4.716  -7.773  1.00 0.98  ? 40 VAL B HG13 5  
ATOM 10594 H HG21 . VAL B 1 40 ? -6.492  -7.338  -10.531 1.00 1.00  ? 40 VAL B HG21 5  
ATOM 10595 H HG22 . VAL B 1 40 ? -6.924  -6.975  -8.862  1.00 1.08  ? 40 VAL B HG22 5  
ATOM 10596 H HG23 . VAL B 1 40 ? -7.464  -5.915  -10.160 1.00 0.98  ? 40 VAL B HG23 5  
ATOM 10597 N N    . ILE B 1 41 ? -3.273  -5.686  -12.738 1.00 0.22  ? 41 ILE B N    5  
ATOM 10598 C CA   . ILE B 1 41 ? -2.352  -6.576  -13.488 1.00 0.25  ? 41 ILE B CA   5  
ATOM 10599 C C    . ILE B 1 41 ? -0.878  -6.341  -13.128 1.00 0.23  ? 41 ILE B C    5  
ATOM 10600 O O    . ILE B 1 41 ? -0.340  -5.290  -13.374 1.00 0.25  ? 41 ILE B O    5  
ATOM 10601 C CB   . ILE B 1 41 ? -2.583  -6.308  -14.976 1.00 0.30  ? 41 ILE B CB   5  
ATOM 10602 C CG1  . ILE B 1 41 ? -3.716  -7.232  -15.458 1.00 0.50  ? 41 ILE B CG1  5  
ATOM 10603 C CG2  . ILE B 1 41 ? -1.300  -6.568  -15.772 1.00 0.67  ? 41 ILE B CG2  5  
ATOM 10604 C CD1  . ILE B 1 41 ? -3.615  -7.483  -16.965 1.00 0.54  ? 41 ILE B CD1  5  
ATOM 10605 H H    . ILE B 1 41 ? -3.411  -4.766  -13.047 1.00 0.27  ? 41 ILE B H    5  
ATOM 10606 H HA   . ILE B 1 41 ? -2.611  -7.594  -13.278 1.00 0.26  ? 41 ILE B HA   5  
ATOM 10607 H HB   . ILE B 1 41 ? -2.876  -5.271  -15.100 1.00 0.48  ? 41 ILE B HB   5  
ATOM 10608 H HG12 . ILE B 1 41 ? -3.649  -8.177  -14.938 1.00 0.70  ? 41 ILE B HG12 5  
ATOM 10609 H HG13 . ILE B 1 41 ? -4.664  -6.773  -15.235 1.00 0.68  ? 41 ILE B HG13 5  
ATOM 10610 H HG21 . ILE B 1 41 ? -0.919  -7.547  -15.525 1.00 1.24  ? 41 ILE B HG21 5  
ATOM 10611 H HG22 . ILE B 1 41 ? -1.515  -6.514  -16.826 1.00 1.41  ? 41 ILE B HG22 5  
ATOM 10612 H HG23 . ILE B 1 41 ? -0.566  -5.819  -15.516 1.00 1.13  ? 41 ILE B HG23 5  
ATOM 10613 H HD11 . ILE B 1 41 ? -3.559  -6.539  -17.484 1.00 1.15  ? 41 ILE B HD11 5  
ATOM 10614 H HD12 . ILE B 1 41 ? -2.726  -8.062  -17.172 1.00 1.12  ? 41 ILE B HD12 5  
ATOM 10615 H HD13 . ILE B 1 41 ? -4.484  -8.029  -17.297 1.00 1.11  ? 41 ILE B HD13 5  
ATOM 10616 N N    . ALA B 1 42 ? -0.210  -7.344  -12.610 1.00 0.22  ? 42 ALA B N    5  
ATOM 10617 C CA   . ALA B 1 42 ? 1.239   -7.204  -12.295 1.00 0.22  ? 42 ALA B CA   5  
ATOM 10618 C C    . ALA B 1 42 ? 2.034   -7.593  -13.529 1.00 0.24  ? 42 ALA B C    5  
ATOM 10619 O O    . ALA B 1 42 ? 1.989   -8.728  -13.966 1.00 0.25  ? 42 ALA B O    5  
ATOM 10620 C CB   . ALA B 1 42 ? 1.605   -8.120  -11.137 1.00 0.21  ? 42 ALA B CB   5  
ATOM 10621 H H    . ALA B 1 42 ? -0.652  -8.209  -12.470 1.00 0.23  ? 42 ALA B H    5  
ATOM 10622 H HA   . ALA B 1 42 ? 1.466   -6.193  -12.036 1.00 0.23  ? 42 ALA B HA   5  
ATOM 10623 H HB1  . ALA B 1 42 ? 1.107   -9.068  -11.264 1.00 1.07  ? 42 ALA B HB1  5  
ATOM 10624 H HB2  . ALA B 1 42 ? 2.674   -8.268  -11.124 1.00 1.01  ? 42 ALA B HB2  5  
ATOM 10625 H HB3  . ALA B 1 42 ? 1.290   -7.665  -10.211 1.00 1.02  ? 42 ALA B HB3  5  
ATOM 10626 N N    . THR B 1 43 ? 2.759   -6.668  -14.109 1.00 0.28  ? 43 THR B N    5  
ATOM 10627 C CA   . THR B 1 43 ? 3.535   -7.012  -15.323 1.00 0.32  ? 43 THR B CA   5  
ATOM 10628 C C    . THR B 1 43 ? 4.763   -7.810  -14.921 1.00 0.32  ? 43 THR B C    5  
ATOM 10629 O O    . THR B 1 43 ? 5.555   -7.401  -14.088 1.00 0.33  ? 43 THR B O    5  
ATOM 10630 C CB   . THR B 1 43 ? 3.978   -5.761  -16.084 1.00 0.35  ? 43 THR B CB   5  
ATOM 10631 O OG1  . THR B 1 43 ? 2.990   -4.742  -15.967 1.00 0.39  ? 43 THR B OG1  5  
ATOM 10632 C CG2  . THR B 1 43 ? 4.185   -6.118  -17.555 1.00 0.39  ? 43 THR B CG2  5  
ATOM 10633 H H    . THR B 1 43 ? 2.786   -5.757  -13.748 1.00 0.28  ? 43 THR B H    5  
ATOM 10634 H HA   . THR B 1 43 ? 2.908   -7.622  -15.962 1.00 0.33  ? 43 THR B HA   5  
ATOM 10635 H HB   . THR B 1 43 ? 4.913   -5.410  -15.679 1.00 0.35  ? 43 THR B HB   5  
ATOM 10636 H HG1  . THR B 1 43 ? 2.159   -5.091  -16.303 1.00 0.89  ? 43 THR B HG1  5  
ATOM 10637 H HG21 . THR B 1 43 ? 4.896   -6.930  -17.627 1.00 1.06  ? 43 THR B HG21 5  
ATOM 10638 H HG22 . THR B 1 43 ? 3.245   -6.424  -17.985 1.00 1.07  ? 43 THR B HG22 5  
ATOM 10639 H HG23 . THR B 1 43 ? 4.565   -5.259  -18.085 1.00 1.06  ? 43 THR B HG23 5  
ATOM 10640 N N    . LEU B 1 44 ? 4.905   -8.958  -15.504 1.00 0.32  ? 44 LEU B N    5  
ATOM 10641 C CA   . LEU B 1 44 ? 6.040   -9.843  -15.190 1.00 0.32  ? 44 LEU B CA   5  
ATOM 10642 C C    . LEU B 1 44 ? 7.341   -9.316  -15.806 1.00 0.37  ? 44 LEU B C    5  
ATOM 10643 O O    . LEU B 1 44 ? 7.319   -8.564  -16.765 1.00 0.40  ? 44 LEU B O    5  
ATOM 10644 C CB   . LEU B 1 44 ? 5.724   -11.196 -15.793 1.00 0.34  ? 44 LEU B CB   5  
ATOM 10645 C CG   . LEU B 1 44 ? 5.102   -12.106 -14.748 1.00 0.33  ? 44 LEU B CG   5  
ATOM 10646 C CD1  . LEU B 1 44 ? 6.240   -12.850 -14.057 1.00 0.35  ? 44 LEU B CD1  5  
ATOM 10647 C CD2  . LEU B 1 44 ? 4.271   -11.287 -13.725 1.00 0.29  ? 44 LEU B CD2  5  
ATOM 10648 H H    . LEU B 1 44 ? 4.235   -9.258  -16.149 1.00 0.33  ? 44 LEU B H    5  
ATOM 10649 H HA   . LEU B 1 44 ? 6.136   -9.933  -14.115 1.00 0.30  ? 44 LEU B HA   5  
ATOM 10650 H HB2  . LEU B 1 44 ? 5.030   -11.063 -16.605 1.00 0.37  ? 44 LEU B HB2  5  
ATOM 10651 H HB3  . LEU B 1 44 ? 6.634   -11.643 -16.167 1.00 0.37  ? 44 LEU B HB3  5  
ATOM 10652 H HG   . LEU B 1 44 ? 4.460   -12.815 -15.245 1.00 0.35  ? 44 LEU B HG   5  
ATOM 10653 H HD11 . LEU B 1 44 ? 7.027   -12.148 -13.817 1.00 1.02  ? 44 LEU B HD11 5  
ATOM 10654 H HD12 . LEU B 1 44 ? 5.880   -13.314 -13.157 1.00 1.02  ? 44 LEU B HD12 5  
ATOM 10655 H HD13 . LEU B 1 44 ? 6.630   -13.604 -14.727 1.00 1.19  ? 44 LEU B HD13 5  
ATOM 10656 H HD21 . LEU B 1 44 ? 3.611   -10.608 -14.253 1.00 1.02  ? 44 LEU B HD21 5  
ATOM 10657 H HD22 . LEU B 1 44 ? 3.678   -11.953 -13.116 1.00 1.04  ? 44 LEU B HD22 5  
ATOM 10658 H HD23 . LEU B 1 44 ? 4.932   -10.714 -13.090 1.00 1.02  ? 44 LEU B HD23 5  
ATOM 10659 N N    . LYS B 1 45 ? 8.466   -9.753  -15.272 1.00 0.38  ? 45 LYS B N    5  
ATOM 10660 C CA   . LYS B 1 45 ? 9.804   -9.344  -15.779 1.00 0.44  ? 45 LYS B CA   5  
ATOM 10661 C C    . LYS B 1 45 ? 9.943   -9.663  -17.256 1.00 0.49  ? 45 LYS B C    5  
ATOM 10662 O O    . LYS B 1 45 ? 10.493  -8.885  -18.014 1.00 0.54  ? 45 LYS B O    5  
ATOM 10663 C CB   . LYS B 1 45 ? 10.853  -10.133 -15.007 1.00 0.45  ? 45 LYS B CB   5  
ATOM 10664 C CG   . LYS B 1 45 ? 11.857  -9.183  -14.347 1.00 0.47  ? 45 LYS B CG   5  
ATOM 10665 C CD   . LYS B 1 45 ? 13.072  -9.006  -15.261 1.00 0.72  ? 45 LYS B CD   5  
ATOM 10666 C CE   . LYS B 1 45 ? 13.578  -7.564  -15.162 1.00 1.05  ? 45 LYS B CE   5  
ATOM 10667 N NZ   . LYS B 1 45 ? 14.433  -7.252  -16.343 1.00 1.42  ? 45 LYS B NZ   5  
ATOM 10668 H H    . LYS B 1 45 ? 8.435   -10.389 -14.535 1.00 0.37  ? 45 LYS B H    5  
ATOM 10669 H HA   . LYS B 1 45 ? 9.952   -8.292  -15.616 1.00 0.45  ? 45 LYS B HA   5  
ATOM 10670 H HB2  . LYS B 1 45 ? 10.362  -10.716 -14.245 1.00 0.41  ? 45 LYS B HB2  5  
ATOM 10671 H HB3  . LYS B 1 45 ? 11.348  -10.795 -15.676 1.00 0.49  ? 45 LYS B HB3  5  
ATOM 10672 H HG2  . LYS B 1 45 ? 11.388  -8.225  -14.179 1.00 0.52  ? 45 LYS B HG2  5  
ATOM 10673 H HG3  . LYS B 1 45 ? 12.177  -9.598  -13.403 1.00 0.54  ? 45 LYS B HG3  5  
ATOM 10674 H HD2  . LYS B 1 45 ? 13.855  -9.684  -14.954 1.00 0.99  ? 45 LYS B HD2  5  
ATOM 10675 H HD3  . LYS B 1 45 ? 12.790  -9.217  -16.281 1.00 0.93  ? 45 LYS B HD3  5  
ATOM 10676 H HE2  . LYS B 1 45 ? 12.736  -6.888  -15.140 1.00 1.47  ? 45 LYS B HE2  5  
ATOM 10677 H HE3  . LYS B 1 45 ? 14.157  -7.447  -14.258 1.00 1.41  ? 45 LYS B HE3  5  
ATOM 10678 H HZ1  . LYS B 1 45 ? 15.230  -7.922  -16.383 1.00 1.73  ? 45 LYS B HZ1  5  
ATOM 10679 H HZ2  . LYS B 1 45 ? 13.869  -7.331  -17.212 1.00 1.95  ? 45 LYS B HZ2  5  
ATOM 10680 H HZ3  . LYS B 1 45 ? 14.800  -6.283  -16.259 1.00 1.87  ? 45 LYS B HZ3  5  
ATOM 10681 N N    . ASN B 1 46 ? 9.448   -10.796 -17.675 1.00 0.49  ? 46 ASN B N    5  
ATOM 10682 C CA   . ASN B 1 46 ? 9.551   -11.156 -19.119 1.00 0.55  ? 46 ASN B CA   5  
ATOM 10683 C C    . ASN B 1 46 ? 8.596   -10.275 -19.956 1.00 0.58  ? 46 ASN B C    5  
ATOM 10684 O O    . ASN B 1 46 ? 8.477   -10.447 -21.156 1.00 0.75  ? 46 ASN B O    5  
ATOM 10685 C CB   . ASN B 1 46 ? 9.209   -12.640 -19.295 1.00 0.58  ? 46 ASN B CB   5  
ATOM 10686 C CG   . ASN B 1 46 ? 7.732   -12.887 -18.977 1.00 0.78  ? 46 ASN B CG   5  
ATOM 10687 O OD1  . ASN B 1 46 ? 6.879   -12.675 -19.814 1.00 1.67  ? 46 ASN B OD1  5  
ATOM 10688 N ND2  . ASN B 1 46 ? 7.394   -13.335 -17.798 1.00 0.81  ? 46 ASN B ND2  5  
ATOM 10689 H H    . ASN B 1 46 ? 9.002   -11.409 -17.039 1.00 0.47  ? 46 ASN B H    5  
ATOM 10690 H HA   . ASN B 1 46 ? 10.566  -10.986 -19.451 1.00 0.62  ? 46 ASN B HA   5  
ATOM 10691 H HB2  . ASN B 1 46 ? 9.409   -12.931 -20.309 1.00 0.73  ? 46 ASN B HB2  5  
ATOM 10692 H HB3  . ASN B 1 46 ? 9.819   -13.229 -18.627 1.00 0.75  ? 46 ASN B HB3  5  
ATOM 10693 H HD21 . ASN B 1 46 ? 8.082   -13.511 -17.123 1.00 1.39  ? 46 ASN B HD21 5  
ATOM 10694 H HD22 . ASN B 1 46 ? 6.451   -13.498 -17.588 1.00 0.88  ? 46 ASN B HD22 5  
ATOM 10695 N N    . GLY B 1 47 ? 7.913   -9.341  -19.328 1.00 0.50  ? 47 GLY B N    5  
ATOM 10696 C CA   . GLY B 1 47 ? 6.964   -8.456  -20.059 1.00 0.53  ? 47 GLY B CA   5  
ATOM 10697 C C    . GLY B 1 47 ? 5.615   -9.158  -20.142 1.00 0.52  ? 47 GLY B C    5  
ATOM 10698 O O    . GLY B 1 47 ? 4.897   -9.038  -21.117 1.00 0.60  ? 47 GLY B O    5  
ATOM 10699 H H    . GLY B 1 47 ? 8.012   -9.229  -18.364 1.00 0.52  ? 47 GLY B H    5  
ATOM 10700 H HA2  . GLY B 1 47 ? 6.853   -7.523  -19.518 1.00 0.53  ? 47 GLY B HA2  5  
ATOM 10701 H HA3  . GLY B 1 47 ? 7.331   -8.259  -21.052 1.00 0.59  ? 47 GLY B HA3  5  
ATOM 10702 N N    . ARG B 1 48 ? 5.266   -9.881  -19.108 1.00 0.47  ? 48 ARG B N    5  
ATOM 10703 C CA   . ARG B 1 48 ? 3.956   -10.595 -19.090 1.00 0.54  ? 48 ARG B CA   5  
ATOM 10704 C C    . ARG B 1 48 ? 3.047   -9.876  -18.106 1.00 0.43  ? 48 ARG B C    5  
ATOM 10705 O O    . ARG B 1 48 ? 3.353   -8.788  -17.669 1.00 0.37  ? 48 ARG B O    5  
ATOM 10706 C CB   . ARG B 1 48 ? 4.162   -12.045 -18.641 1.00 0.66  ? 48 ARG B CB   5  
ATOM 10707 C CG   . ARG B 1 48 ? 4.023   -12.974 -19.845 1.00 1.00  ? 48 ARG B CG   5  
ATOM 10708 C CD   . ARG B 1 48 ? 4.341   -14.411 -19.425 1.00 1.55  ? 48 ARG B CD   5  
ATOM 10709 N NE   . ARG B 1 48 ? 4.272   -15.302 -20.621 1.00 2.08  ? 48 ARG B NE   5  
ATOM 10710 C CZ   . ARG B 1 48 ? 4.762   -16.512 -20.570 1.00 2.34  ? 48 ARG B CZ   5  
ATOM 10711 N NH1  . ARG B 1 48 ? 6.056   -16.692 -20.502 1.00 2.67  ? 48 ARG B NH1  5  
ATOM 10712 N NH2  . ARG B 1 48 ? 3.957   -17.544 -20.590 1.00 2.89  ? 48 ARG B NH2  5  
ATOM 10713 H H    . ARG B 1 48 ? 5.867   -9.942  -18.327 1.00 0.43  ? 48 ARG B H    5  
ATOM 10714 H HA   . ARG B 1 48 ? 3.509   -10.576 -20.073 1.00 0.68  ? 48 ARG B HA   5  
ATOM 10715 H HB2  . ARG B 1 48 ? 5.146   -12.151 -18.215 1.00 1.19  ? 48 ARG B HB2  5  
ATOM 10716 H HB3  . ARG B 1 48 ? 3.420   -12.304 -17.902 1.00 1.23  ? 48 ARG B HB3  5  
ATOM 10717 H HG2  . ARG B 1 48 ? 3.012   -12.922 -20.222 1.00 1.43  ? 48 ARG B HG2  5  
ATOM 10718 H HG3  . ARG B 1 48 ? 4.711   -12.665 -20.617 1.00 1.63  ? 48 ARG B HG3  5  
ATOM 10719 H HD2  . ARG B 1 48 ? 5.333   -14.451 -18.999 1.00 1.85  ? 48 ARG B HD2  5  
ATOM 10720 H HD3  . ARG B 1 48 ? 3.621   -14.737 -18.689 1.00 1.85  ? 48 ARG B HD3  5  
ATOM 10721 H HE   . ARG B 1 48 ? 3.858   -14.979 -21.449 1.00 2.46  ? 48 ARG B HE   5  
ATOM 10722 H HH11 . ARG B 1 48 ? 6.671   -15.903 -20.491 1.00 2.93  ? 48 ARG B HH11 5  
ATOM 10723 H HH12 . ARG B 1 48 ? 6.432   -17.619 -20.464 1.00 3.04  ? 48 ARG B HH12 5  
ATOM 10724 H HH21 . ARG B 1 48 ? 2.968   -17.406 -20.647 1.00 3.28  ? 48 ARG B HH21 5  
ATOM 10725 H HH22 . ARG B 1 48 ? 4.330   -18.472 -20.554 1.00 3.24  ? 48 ARG B HH22 5  
ATOM 10726 N N    . LYS B 1 49 ? 1.939   -10.456 -17.749 1.00 0.45  ? 49 LYS B N    5  
ATOM 10727 C CA   . LYS B 1 49 ? 1.045   -9.775  -16.785 1.00 0.40  ? 49 LYS B CA   5  
ATOM 10728 C C    . LYS B 1 49 ? 0.181   -10.783 -16.027 1.00 0.38  ? 49 LYS B C    5  
ATOM 10729 O O    . LYS B 1 49 ? -0.173  -11.836 -16.527 1.00 0.54  ? 49 LYS B O    5  
ATOM 10730 C CB   . LYS B 1 49 ? 0.141   -8.775  -17.507 1.00 0.58  ? 49 LYS B CB   5  
ATOM 10731 C CG   . LYS B 1 49 ? -0.073  -9.160  -18.983 1.00 0.88  ? 49 LYS B CG   5  
ATOM 10732 C CD   . LYS B 1 49 ? -0.841  -10.482 -19.099 1.00 0.96  ? 49 LYS B CD   5  
ATOM 10733 C CE   . LYS B 1 49 ? -2.181  -10.380 -18.365 1.00 0.92  ? 49 LYS B CE   5  
ATOM 10734 N NZ   . LYS B 1 49 ? -3.071  -11.491 -18.804 1.00 1.06  ? 49 LYS B NZ   5  
ATOM 10735 H H    . LYS B 1 49 ? 1.697   -11.322 -18.112 1.00 0.55  ? 49 LYS B H    5  
ATOM 10736 H HA   . LYS B 1 49 ? 1.657   -9.238  -16.073 1.00 0.34  ? 49 LYS B HA   5  
ATOM 10737 H HB2  . LYS B 1 49 ? -0.811  -8.732  -17.000 1.00 0.59  ? 49 LYS B HB2  5  
ATOM 10738 H HB3  . LYS B 1 49 ? 0.608   -7.810  -17.464 1.00 0.69  ? 49 LYS B HB3  5  
ATOM 10739 H HG2  . LYS B 1 49 ? -0.634  -8.379  -19.476 1.00 1.06  ? 49 LYS B HG2  5  
ATOM 10740 H HG3  . LYS B 1 49 ? 0.887   -9.264  -19.466 1.00 1.13  ? 49 LYS B HG3  5  
ATOM 10741 H HD2  . LYS B 1 49 ? -1.022  -10.698 -20.141 1.00 0.98  ? 49 LYS B HD2  5  
ATOM 10742 H HD3  . LYS B 1 49 ? -0.255  -11.278 -18.667 1.00 1.23  ? 49 LYS B HD3  5  
ATOM 10743 H HE2  . LYS B 1 49 ? -2.015  -10.450 -17.300 1.00 0.97  ? 49 LYS B HE2  5  
ATOM 10744 H HE3  . LYS B 1 49 ? -2.645  -9.433  -18.595 1.00 0.86  ? 49 LYS B HE3  5  
ATOM 10745 H HZ1  . LYS B 1 49 ? -2.543  -12.385 -18.798 1.00 1.38  ? 49 LYS B HZ1  5  
ATOM 10746 H HZ2  . LYS B 1 49 ? -3.882  -11.561 -18.155 1.00 1.44  ? 49 LYS B HZ2  5  
ATOM 10747 H HZ3  . LYS B 1 49 ? -3.414  -11.302 -19.766 1.00 1.51  ? 49 LYS B HZ3  5  
ATOM 10748 N N    . ALA B 1 50 ? -0.170  -10.438 -14.821 1.00 0.27  ? 50 ALA B N    5  
ATOM 10749 C CA   . ALA B 1 50 ? -1.039  -11.328 -13.985 1.00 0.28  ? 50 ALA B CA   5  
ATOM 10750 C C    . ALA B 1 50 ? -2.016  -10.461 -13.224 1.00 0.24  ? 50 ALA B C    5  
ATOM 10751 O O    . ALA B 1 50 ? -1.763  -9.306  -13.021 1.00 0.21  ? 50 ALA B O    5  
ATOM 10752 C CB   . ALA B 1 50 ? -0.205  -12.082 -12.958 1.00 0.32  ? 50 ALA B CB   5  
ATOM 10753 H H    . ALA B 1 50 ? 0.131   -9.566  -14.465 1.00 0.29  ? 50 ALA B H    5  
ATOM 10754 H HA   . ALA B 1 50 ? -1.573  -12.021 -14.614 1.00 0.35  ? 50 ALA B HA   5  
ATOM 10755 H HB1  . ALA B 1 50 ? 0.296   -11.373 -12.316 1.00 1.03  ? 50 ALA B HB1  5  
ATOM 10756 H HB2  . ALA B 1 50 ? -0.858  -12.705 -12.360 1.00 1.05  ? 50 ALA B HB2  5  
ATOM 10757 H HB3  . ALA B 1 50 ? 0.520   -12.695 -13.460 1.00 1.08  ? 50 ALA B HB3  5  
ATOM 10758 N N    . CYS B 1 51 ? -3.098  -11.002 -12.743 1.00 0.25  ? 51 CYS B N    5  
ATOM 10759 C CA   . CYS B 1 51 ? -4.015  -10.162 -11.953 1.00 0.22  ? 51 CYS B CA   5  
ATOM 10760 C C    . CYS B 1 51 ? -4.014  -10.705 -10.545 1.00 0.22  ? 51 CYS B C    5  
ATOM 10761 O O    . CYS B 1 51 ? -3.804  -11.882 -10.342 1.00 0.25  ? 51 CYS B O    5  
ATOM 10762 C CB   . CYS B 1 51 ? -5.436  -10.205 -12.521 1.00 0.25  ? 51 CYS B CB   5  
ATOM 10763 S SG   . CYS B 1 51 ? -5.954  -8.527  -12.962 1.00 0.24  ? 51 CYS B SG   5  
ATOM 10764 H H    . CYS B 1 51 ? -3.281  -11.960 -12.850 1.00 0.28  ? 51 CYS B H    5  
ATOM 10765 H HA   . CYS B 1 51 ? -3.656  -9.149  -11.956 1.00 0.20  ? 51 CYS B HA   5  
ATOM 10766 H HB2  . CYS B 1 51 ? -5.458  -10.826 -13.397 1.00 0.28  ? 51 CYS B HB2  5  
ATOM 10767 H HB3  . CYS B 1 51 ? -6.112  -10.605 -11.780 1.00 0.27  ? 51 CYS B HB3  5  
ATOM 10768 N N    . LEU B 1 52 ? -4.229  -9.872  -9.574  1.00 0.21  ? 52 LEU B N    5  
ATOM 10769 C CA   . LEU B 1 52 ? -4.255  -10.358 -8.176  1.00 0.23  ? 52 LEU B CA   5  
ATOM 10770 C C    . LEU B 1 52 ? -5.455  -9.715  -7.484  1.00 0.25  ? 52 LEU B C    5  
ATOM 10771 O O    . LEU B 1 52 ? -6.078  -8.826  -8.025  1.00 0.25  ? 52 LEU B O    5  
ATOM 10772 C CB   . LEU B 1 52 ? -2.931  -10.065 -7.436  1.00 0.22  ? 52 LEU B CB   5  
ATOM 10773 C CG   . LEU B 1 52 ? -2.151  -8.929  -8.101  1.00 0.18  ? 52 LEU B CG   5  
ATOM 10774 C CD1  . LEU B 1 52 ? -1.652  -9.355  -9.497  1.00 0.17  ? 52 LEU B CD1  5  
ATOM 10775 C CD2  . LEU B 1 52 ? -3.053  -7.696  -8.170  1.00 0.18  ? 52 LEU B CD2  5  
ATOM 10776 H H    . LEU B 1 52 ? -4.373  -8.922  -9.761  1.00 0.20  ? 52 LEU B H    5  
ATOM 10777 H HA   . LEU B 1 52 ? -4.411  -11.411 -8.196  1.00 0.26  ? 52 LEU B HA   5  
ATOM 10778 H HB2  . LEU B 1 52 ? -3.149  -9.792  -6.417  1.00 0.25  ? 52 LEU B HB2  5  
ATOM 10779 H HB3  . LEU B 1 52 ? -2.323  -10.958 -7.436  1.00 0.24  ? 52 LEU B HB3  5  
ATOM 10780 H HG   . LEU B 1 52 ? -1.304  -8.700  -7.501  1.00 0.19  ? 52 LEU B HG   5  
ATOM 10781 H HD11 . LEU B 1 52 ? -1.768  -10.427 -9.611  1.00 0.98  ? 52 LEU B HD11 5  
ATOM 10782 H HD12 . LEU B 1 52 ? -2.224  -8.851  -10.262 1.00 0.95  ? 52 LEU B HD12 5  
ATOM 10783 H HD13 . LEU B 1 52 ? -0.607  -9.100  -9.604  1.00 1.00  ? 52 LEU B HD13 5  
ATOM 10784 H HD21 . LEU B 1 52 ? -3.972  -7.896  -7.631  1.00 0.96  ? 52 LEU B HD21 5  
ATOM 10785 H HD22 . LEU B 1 52 ? -2.552  -6.858  -7.714  1.00 0.97  ? 52 LEU B HD22 5  
ATOM 10786 H HD23 . LEU B 1 52 ? -3.281  -7.473  -9.196  1.00 1.01  ? 52 LEU B HD23 5  
ATOM 10787 N N    . ASN B 1 53 ? -5.815  -10.182 -6.325  1.00 0.29  ? 53 ASN B N    5  
ATOM 10788 C CA   . ASN B 1 53 ? -7.013  -9.616  -5.631  1.00 0.33  ? 53 ASN B CA   5  
ATOM 10789 C C    . ASN B 1 53 ? -6.605  -8.486  -4.673  1.00 0.34  ? 53 ASN B C    5  
ATOM 10790 O O    . ASN B 1 53 ? -6.251  -8.770  -3.554  1.00 0.37  ? 53 ASN B O    5  
ATOM 10791 C CB   . ASN B 1 53 ? -7.689  -10.723 -4.811  1.00 0.37  ? 53 ASN B CB   5  
ATOM 10792 C CG   . ASN B 1 53 ? -8.740  -11.437 -5.663  1.00 0.43  ? 53 ASN B CG   5  
ATOM 10793 O OD1  . ASN B 1 53 ? -8.518  -12.538 -6.125  1.00 1.07  ? 53 ASN B OD1  5  
ATOM 10794 N ND2  . ASN B 1 53 ? -9.888  -10.856 -5.883  1.00 0.93  ? 53 ASN B ND2  5  
ATOM 10795 H H    . ASN B 1 53 ? -5.317  -10.924 -5.924  1.00 0.31  ? 53 ASN B H    5  
ATOM 10796 H HA   . ASN B 1 53 ? -7.709  -9.251  -6.363  1.00 0.33  ? 53 ASN B HA   5  
ATOM 10797 H HB2  . ASN B 1 53 ? -6.945  -11.433 -4.483  1.00 0.41  ? 53 ASN B HB2  5  
ATOM 10798 H HB3  . ASN B 1 53 ? -8.168  -10.286 -3.946  1.00 0.41  ? 53 ASN B HB3  5  
ATOM 10799 H HD21 . ASN B 1 53 ? -10.070 -9.971  -5.504  1.00 1.59  ? 53 ASN B HD21 5  
ATOM 10800 H HD22 . ASN B 1 53 ? -10.568 -11.304 -6.428  1.00 0.93  ? 53 ASN B HD22 5  
ATOM 10801 N N    . PRO B 1 54 ? -6.691  -7.230  -5.083  1.00 0.34  ? 54 PRO B N    5  
ATOM 10802 C CA   . PRO B 1 54 ? -6.339  -6.113  -4.180  1.00 0.37  ? 54 PRO B CA   5  
ATOM 10803 C C    . PRO B 1 54 ? -7.276  -6.121  -2.970  1.00 0.43  ? 54 PRO B C    5  
ATOM 10804 O O    . PRO B 1 54 ? -6.885  -5.752  -1.879  1.00 0.46  ? 54 PRO B O    5  
ATOM 10805 C CB   . PRO B 1 54 ? -6.485  -4.865  -5.051  1.00 0.38  ? 54 PRO B CB   5  
ATOM 10806 C CG   . PRO B 1 54 ? -7.392  -5.280  -6.219  1.00 0.37  ? 54 PRO B CG   5  
ATOM 10807 C CD   . PRO B 1 54 ? -7.165  -6.787  -6.413  1.00 0.33  ? 54 PRO B CD   5  
ATOM 10808 H HA   . PRO B 1 54 ? -5.315  -6.211  -3.856  1.00 0.36  ? 54 PRO B HA   5  
ATOM 10809 H HB2  . PRO B 1 54 ? -6.942  -4.066  -4.483  1.00 0.42  ? 54 PRO B HB2  5  
ATOM 10810 H HB3  . PRO B 1 54 ? -5.523  -4.556  -5.427  1.00 0.36  ? 54 PRO B HB3  5  
ATOM 10811 H HG2  . PRO B 1 54 ? -8.423  -5.090  -5.969  1.00 0.41  ? 54 PRO B HG2  5  
ATOM 10812 H HG3  . PRO B 1 54 ? -7.118  -4.752  -7.110  1.00 0.36  ? 54 PRO B HG3  5  
ATOM 10813 H HD2  . PRO B 1 54 ? -8.089  -7.266  -6.687  1.00 0.35  ? 54 PRO B HD2  5  
ATOM 10814 H HD3  . PRO B 1 54 ? -6.401  -6.959  -7.156  1.00 0.28  ? 54 PRO B HD3  5  
ATOM 10815 N N    . ALA B 1 55 ? -8.486  -6.616  -3.137  1.00 0.45  ? 55 ALA B N    5  
ATOM 10816 C CA   . ALA B 1 55 ? -9.410  -6.734  -1.972  1.00 0.52  ? 55 ALA B CA   5  
ATOM 10817 C C    . ALA B 1 55 ? -8.751  -7.700  -0.977  1.00 0.53  ? 55 ALA B C    5  
ATOM 10818 O O    . ALA B 1 55 ? -8.890  -7.568  0.225   1.00 0.56  ? 55 ALA B O    5  
ATOM 10819 C CB   . ALA B 1 55 ? -10.761 -7.297  -2.429  1.00 0.55  ? 55 ALA B CB   5  
ATOM 10820 H H    . ALA B 1 55 ? -8.762  -6.960  -4.013  1.00 0.44  ? 55 ALA B H    5  
ATOM 10821 H HA   . ALA B 1 55 ? -9.547  -5.766  -1.511  1.00 0.53  ? 55 ALA B HA   5  
ATOM 10822 H HB1  . ALA B 1 55 ? -11.120 -6.731  -3.276  1.00 1.19  ? 55 ALA B HB1  5  
ATOM 10823 H HB2  . ALA B 1 55 ? -10.644 -8.333  -2.712  1.00 1.15  ? 55 ALA B HB2  5  
ATOM 10824 H HB3  . ALA B 1 55 ? -11.473 -7.223  -1.620  1.00 1.13  ? 55 ALA B HB3  5  
ATOM 10825 N N    . SER B 1 56 ? -7.995  -8.652  -1.493  1.00 0.50  ? 56 SER B N    5  
ATOM 10826 C CA   . SER B 1 56 ? -7.265  -9.621  -0.627  1.00 0.52  ? 56 SER B CA   5  
ATOM 10827 C C    . SER B 1 56 ? -6.242  -8.841  0.222   1.00 0.51  ? 56 SER B C    5  
ATOM 10828 O O    . SER B 1 56 ? -5.727  -7.836  -0.227  1.00 0.52  ? 56 SER B O    5  
ATOM 10829 C CB   . SER B 1 56 ? -6.518  -10.628 -1.509  1.00 0.50  ? 56 SER B CB   5  
ATOM 10830 O OG   . SER B 1 56 ? -6.567  -11.915 -0.905  1.00 0.56  ? 56 SER B OG   5  
ATOM 10831 H H    . SER B 1 56 ? -7.889  -8.709  -2.464  1.00 0.48  ? 56 SER B H    5  
ATOM 10832 H HA   . SER B 1 56 ? -7.965  -10.142 -0.001  1.00 0.55  ? 56 SER B HA   5  
ATOM 10833 H HB2  . SER B 1 56 ? -6.983  -10.674 -2.481  1.00 0.46  ? 56 SER B HB2  5  
ATOM 10834 H HB3  . SER B 1 56 ? -5.489  -10.311 -1.625  1.00 0.51  ? 56 SER B HB3  5  
ATOM 10835 H HG   . SER B 1 56 ? -5.702  -12.100 -0.530  1.00 1.02  ? 56 SER B HG   5  
ATOM 10836 N N    . PRO B 1 57 ? -5.962  -9.322  1.414   1.00 0.53  ? 57 PRO B N    5  
ATOM 10837 C CA   . PRO B 1 57 ? -4.988  -8.667  2.315   1.00 0.53  ? 57 PRO B CA   5  
ATOM 10838 C C    . PRO B 1 57 ? -3.560  -8.921  1.812   1.00 0.51  ? 57 PRO B C    5  
ATOM 10839 O O    . PRO B 1 57 ? -2.806  -7.995  1.558   1.00 0.51  ? 57 PRO B O    5  
ATOM 10840 C CB   . PRO B 1 57 ? -5.244  -9.335  3.670   1.00 0.59  ? 57 PRO B CB   5  
ATOM 10841 C CG   . PRO B 1 57 ? -5.938  -10.684 3.369   1.00 0.62  ? 57 PRO B CG   5  
ATOM 10842 C CD   . PRO B 1 57 ? -6.568  -10.552 1.969   1.00 0.58  ? 57 PRO B CD   5  
ATOM 10843 H HA   . PRO B 1 57 ? -5.186  -7.609  2.380   1.00 0.54  ? 57 PRO B HA   5  
ATOM 10844 H HB2  . PRO B 1 57 ? -4.306  -9.502  4.183   1.00 0.60  ? 57 PRO B HB2  5  
ATOM 10845 H HB3  . PRO B 1 57 ? -5.892  -8.718  4.272   1.00 0.63  ? 57 PRO B HB3  5  
ATOM 10846 H HG2  . PRO B 1 57 ? -5.210  -11.484 3.377   1.00 0.64  ? 57 PRO B HG2  5  
ATOM 10847 H HG3  . PRO B 1 57 ? -6.708  -10.876 4.099   1.00 0.67  ? 57 PRO B HG3  5  
ATOM 10848 H HD2  . PRO B 1 57 ? -6.318  -11.410 1.360   1.00 0.59  ? 57 PRO B HD2  5  
ATOM 10849 H HD3  . PRO B 1 57 ? -7.639  -10.437 2.044   1.00 0.60  ? 57 PRO B HD3  5  
ATOM 10850 N N    . ILE B 1 58 ? -3.203  -10.172 1.636   1.00 0.52  ? 58 ILE B N    5  
ATOM 10851 C CA   . ILE B 1 58 ? -1.845  -10.523 1.115   1.00 0.51  ? 58 ILE B CA   5  
ATOM 10852 C C    . ILE B 1 58 ? -1.606  -9.763  -0.178  1.00 0.45  ? 58 ILE B C    5  
ATOM 10853 O O    . ILE B 1 58 ? -0.542  -9.240  -0.430  1.00 0.44  ? 58 ILE B O    5  
ATOM 10854 C CB   . ILE B 1 58 ? -1.816  -12.035 0.823   1.00 0.54  ? 58 ILE B CB   5  
ATOM 10855 C CG1  . ILE B 1 58 ? -0.769  -12.716 1.712   1.00 0.62  ? 58 ILE B CG1  5  
ATOM 10856 C CG2  . ILE B 1 58 ? -1.488  -12.305 -0.658  1.00 0.49  ? 58 ILE B CG2  5  
ATOM 10857 C CD1  . ILE B 1 58 ? -1.265  -12.747 3.160   1.00 0.68  ? 58 ILE B CD1  5  
ATOM 10858 H H    . ILE B 1 58 ? -3.844  -10.888 1.826   1.00 0.55  ? 58 ILE B H    5  
ATOM 10859 H HA   . ILE B 1 58 ? -1.089  -10.263 1.837   1.00 0.55  ? 58 ILE B HA   5  
ATOM 10860 H HB   . ILE B 1 58 ? -2.791  -12.441 1.035   1.00 0.56  ? 58 ILE B HB   5  
ATOM 10861 H HG12 . ILE B 1 58 ? -0.607  -13.726 1.366   1.00 0.64  ? 58 ILE B HG12 5  
ATOM 10862 H HG13 . ILE B 1 58 ? 0.158   -12.166 1.663   1.00 0.62  ? 58 ILE B HG13 5  
ATOM 10863 H HG21 . ILE B 1 58 ? -0.664  -11.678 -0.970  1.00 1.10  ? 58 ILE B HG21 5  
ATOM 10864 H HG22 . ILE B 1 58 ? -1.221  -13.339 -0.787  1.00 1.12  ? 58 ILE B HG22 5  
ATOM 10865 H HG23 . ILE B 1 58 ? -2.357  -12.079 -1.267  1.00 1.14  ? 58 ILE B HG23 5  
ATOM 10866 H HD11 . ILE B 1 58 ? -1.442  -11.739 3.503   1.00 1.22  ? 58 ILE B HD11 5  
ATOM 10867 H HD12 . ILE B 1 58 ? -2.182  -13.313 3.215   1.00 1.22  ? 58 ILE B HD12 5  
ATOM 10868 H HD13 . ILE B 1 58 ? -0.517  -13.213 3.786   1.00 1.24  ? 58 ILE B HD13 5  
ATOM 10869 N N    . VAL B 1 59 ? -2.592  -9.753  -1.014  1.00 0.43  ? 59 VAL B N    5  
ATOM 10870 C CA   . VAL B 1 59 ? -2.466  -9.083  -2.311  1.00 0.40  ? 59 VAL B CA   5  
ATOM 10871 C C    . VAL B 1 59 ? -2.357  -7.578  -2.110  1.00 0.37  ? 59 VAL B C    5  
ATOM 10872 O O    . VAL B 1 59 ? -1.548  -6.930  -2.743  1.00 0.32  ? 59 VAL B O    5  
ATOM 10873 C CB   . VAL B 1 59 ? -3.700  -9.413  -3.114  1.00 0.51  ? 59 VAL B CB   5  
ATOM 10874 C CG1  . VAL B 1 59 ? -3.672  -8.655  -4.412  1.00 0.31  ? 59 VAL B CG1  5  
ATOM 10875 C CG2  . VAL B 1 59 ? -3.759  -10.909 -3.399  1.00 0.88  ? 59 VAL B CG2  5  
ATOM 10876 H H    . VAL B 1 59 ? -3.423  -10.225 -0.793  1.00 0.46  ? 59 VAL B H    5  
ATOM 10877 H HA   . VAL B 1 59 ? -1.578  -9.440  -2.806  1.00 0.41  ? 59 VAL B HA   5  
ATOM 10878 H HB   . VAL B 1 59 ? -4.567  -9.119  -2.550  1.00 0.84  ? 59 VAL B HB   5  
ATOM 10879 H HG11 . VAL B 1 59 ? -2.661  -8.621  -4.777  1.00 1.03  ? 59 VAL B HG11 5  
ATOM 10880 H HG12 . VAL B 1 59 ? -4.302  -9.157  -5.122  1.00 1.00  ? 59 VAL B HG12 5  
ATOM 10881 H HG13 . VAL B 1 59 ? -4.038  -7.657  -4.238  1.00 1.08  ? 59 VAL B HG13 5  
ATOM 10882 H HG21 . VAL B 1 59 ? -2.870  -11.203 -3.927  1.00 1.53  ? 59 VAL B HG21 5  
ATOM 10883 H HG22 . VAL B 1 59 ? -3.823  -11.452 -2.468  1.00 1.47  ? 59 VAL B HG22 5  
ATOM 10884 H HG23 . VAL B 1 59 ? -4.626  -11.128 -4.004  1.00 1.25  ? 59 VAL B HG23 5  
ATOM 10885 N N    . LYS B 1 60 ? -3.123  -7.016  -1.204  1.00 0.43  ? 60 LYS B N    5  
ATOM 10886 C CA   . LYS B 1 60 ? -2.991  -5.553  -0.938  1.00 0.43  ? 60 LYS B CA   5  
ATOM 10887 C C    . LYS B 1 60 ? -1.517  -5.282  -0.569  1.00 0.43  ? 60 LYS B C    5  
ATOM 10888 O O    . LYS B 1 60 ? -1.008  -4.186  -0.719  1.00 0.42  ? 60 LYS B O    5  
ATOM 10889 C CB   . LYS B 1 60 ? -3.885  -5.162  0.236   1.00 0.50  ? 60 LYS B CB   5  
ATOM 10890 C CG   . LYS B 1 60 ? -4.485  -3.777  -0.010  1.00 0.60  ? 60 LYS B CG   5  
ATOM 10891 C CD   . LYS B 1 60 ? -4.937  -3.177  1.323   1.00 0.91  ? 60 LYS B CD   5  
ATOM 10892 C CE   . LYS B 1 60 ? -5.946  -2.057  1.067   1.00 0.99  ? 60 LYS B CE   5  
ATOM 10893 N NZ   . LYS B 1 60 ? -6.073  -1.214  2.290   1.00 1.68  ? 60 LYS B NZ   5  
ATOM 10894 H H    . LYS B 1 60 ? -3.746  -7.559  -0.677  1.00 0.47  ? 60 LYS B H    5  
ATOM 10895 H HA   . LYS B 1 60 ? -3.266  -4.997  -1.828  1.00 0.40  ? 60 LYS B HA   5  
ATOM 10896 H HB2  . LYS B 1 60 ? -4.677  -5.888  0.340   1.00 0.65  ? 60 LYS B HB2  5  
ATOM 10897 H HB3  . LYS B 1 60 ? -3.295  -5.141  1.142   1.00 0.59  ? 60 LYS B HB3  5  
ATOM 10898 H HG2  . LYS B 1 60 ? -3.739  -3.136  -0.461  1.00 1.10  ? 60 LYS B HG2  5  
ATOM 10899 H HG3  . LYS B 1 60 ? -5.335  -3.862  -0.671  1.00 0.87  ? 60 LYS B HG3  5  
ATOM 10900 H HD2  . LYS B 1 60 ? -5.398  -3.947  1.924   1.00 1.39  ? 60 LYS B HD2  5  
ATOM 10901 H HD3  . LYS B 1 60 ? -4.081  -2.776  1.846   1.00 1.49  ? 60 LYS B HD3  5  
ATOM 10902 H HE2  . LYS B 1 60 ? -5.606  -1.448  0.243   1.00 1.20  ? 60 LYS B HE2  5  
ATOM 10903 H HE3  . LYS B 1 60 ? -6.907  -2.486  0.825   1.00 1.40  ? 60 LYS B HE3  5  
ATOM 10904 H HZ1  . LYS B 1 60 ? -5.137  -0.845  2.556   1.00 2.27  ? 60 LYS B HZ1  5  
ATOM 10905 H HZ2  . LYS B 1 60 ? -6.713  -0.418  2.098   1.00 1.91  ? 60 LYS B HZ2  5  
ATOM 10906 H HZ3  . LYS B 1 60 ? -6.455  -1.789  3.068   1.00 2.15  ? 60 LYS B HZ3  5  
ATOM 10907 N N    . LYS B 1 61 ? -0.829  -6.324  -0.147  1.00 0.44  ? 61 LYS B N    5  
ATOM 10908 C CA   . LYS B 1 61 ? 0.608   -6.246  0.180   1.00 0.46  ? 61 LYS B CA   5  
ATOM 10909 C C    . LYS B 1 61 ? 1.332   -6.141  -1.144  1.00 0.42  ? 61 LYS B C    5  
ATOM 10910 O O    . LYS B 1 61 ? 2.120   -5.259  -1.363  1.00 0.44  ? 61 LYS B O    5  
ATOM 10911 C CB   . LYS B 1 61 ? 1.007   -7.549  0.862   1.00 0.51  ? 61 LYS B CB   5  
ATOM 10912 C CG   . LYS B 1 61 ? 1.966   -7.262  2.011   1.00 0.71  ? 61 LYS B CG   5  
ATOM 10913 C CD   . LYS B 1 61 ? 3.023   -8.363  2.075   1.00 1.02  ? 61 LYS B CD   5  
ATOM 10914 C CE   . LYS B 1 61 ? 4.166   -7.923  2.993   1.00 1.29  ? 61 LYS B CE   5  
ATOM 10915 N NZ   . LYS B 1 61 ? 4.825   -9.123  3.583   1.00 1.88  ? 61 LYS B NZ   5  
ATOM 10916 H H    . LYS B 1 61 ? -1.261  -7.191  -0.100  1.00 0.45  ? 61 LYS B H    5  
ATOM 10917 H HA   . LYS B 1 61 ? 0.819   -5.397  0.810   1.00 0.49  ? 61 LYS B HA   5  
ATOM 10918 H HB2  . LYS B 1 61 ? 0.115   -8.037  1.238   1.00 0.58  ? 61 LYS B HB2  5  
ATOM 10919 H HB3  . LYS B 1 61 ? 1.484   -8.198  0.137   1.00 0.65  ? 61 LYS B HB3  5  
ATOM 10920 H HG2  . LYS B 1 61 ? 2.445   -6.307  1.850   1.00 1.41  ? 61 LYS B HG2  5  
ATOM 10921 H HG3  . LYS B 1 61 ? 1.416   -7.238  2.939   1.00 1.04  ? 61 LYS B HG3  5  
ATOM 10922 H HD2  . LYS B 1 61 ? 2.573   -9.266  2.459   1.00 1.35  ? 61 LYS B HD2  5  
ATOM 10923 H HD3  . LYS B 1 61 ? 3.410   -8.546  1.084   1.00 1.75  ? 61 LYS B HD3  5  
ATOM 10924 H HE2  . LYS B 1 61 ? 4.890   -7.360  2.423   1.00 1.83  ? 61 LYS B HE2  5  
ATOM 10925 H HE3  . LYS B 1 61 ? 3.772   -7.303  3.785   1.00 1.54  ? 61 LYS B HE3  5  
ATOM 10926 H HZ1  . LYS B 1 61 ? 5.042   -9.807  2.831   1.00 2.28  ? 61 LYS B HZ1  5  
ATOM 10927 H HZ2  . LYS B 1 61 ? 5.706   -8.837  4.057   1.00 2.14  ? 61 LYS B HZ2  5  
ATOM 10928 H HZ3  . LYS B 1 61 ? 4.187   -9.564  4.276   1.00 2.45  ? 61 LYS B HZ3  5  
ATOM 10929 N N    . ILE B 1 62 ? 1.012   -7.044  -2.036  1.00 0.37  ? 62 ILE B N    5  
ATOM 10930 C CA   . ILE B 1 62 ? 1.590   -7.054  -3.401  1.00 0.34  ? 62 ILE B CA   5  
ATOM 10931 C C    . ILE B 1 62 ? 1.661   -5.622  -3.945  1.00 0.32  ? 62 ILE B C    5  
ATOM 10932 O O    . ILE B 1 62 ? 2.624   -5.251  -4.583  1.00 0.34  ? 62 ILE B O    5  
ATOM 10933 C CB   . ILE B 1 62 ? 0.670   -7.946  -4.266  1.00 0.32  ? 62 ILE B CB   5  
ATOM 10934 C CG1  . ILE B 1 62 ? 1.425   -9.165  -4.790  1.00 0.34  ? 62 ILE B CG1  5  
ATOM 10935 C CG2  . ILE B 1 62 ? 0.071   -7.171  -5.437  1.00 0.29  ? 62 ILE B CG2  5  
ATOM 10936 C CD1  . ILE B 1 62 ? 2.136   -9.845  -3.626  1.00 0.36  ? 62 ILE B CD1  5  
ATOM 10937 H H    . ILE B 1 62 ? 0.348   -7.726  -1.805  1.00 0.37  ? 62 ILE B H    5  
ATOM 10938 H HA   . ILE B 1 62 ? 2.581   -7.463  -3.363  1.00 0.36  ? 62 ILE B HA   5  
ATOM 10939 H HB   . ILE B 1 62 ? -0.134  -8.291  -3.642  1.00 0.32  ? 62 ILE B HB   5  
ATOM 10940 H HG12 . ILE B 1 62 ? 0.719   -9.859  -5.233  1.00 0.35  ? 62 ILE B HG12 5  
ATOM 10941 H HG13 . ILE B 1 62 ? 2.144   -8.862  -5.528  1.00 0.35  ? 62 ILE B HG13 5  
ATOM 10942 H HG21 . ILE B 1 62 ? 0.864   -6.775  -6.050  1.00 0.98  ? 62 ILE B HG21 5  
ATOM 10943 H HG22 . ILE B 1 62 ? -0.548  -7.831  -6.023  1.00 1.02  ? 62 ILE B HG22 5  
ATOM 10944 H HG23 . ILE B 1 62 ? -0.531  -6.360  -5.056  1.00 1.11  ? 62 ILE B HG23 5  
ATOM 10945 H HD11 . ILE B 1 62 ? 1.493   -9.829  -2.758  1.00 1.02  ? 62 ILE B HD11 5  
ATOM 10946 H HD12 . ILE B 1 62 ? 2.361   -10.865 -3.889  1.00 1.02  ? 62 ILE B HD12 5  
ATOM 10947 H HD13 . ILE B 1 62 ? 3.050   -9.314  -3.407  1.00 0.97  ? 62 ILE B HD13 5  
ATOM 10948 N N    . ILE B 1 63 ? 0.665   -4.810  -3.675  1.00 0.31  ? 63 ILE B N    5  
ATOM 10949 C CA   . ILE B 1 63 ? 0.709   -3.400  -4.160  1.00 0.31  ? 63 ILE B CA   5  
ATOM 10950 C C    . ILE B 1 63 ? 1.747   -2.639  -3.360  1.00 0.37  ? 63 ILE B C    5  
ATOM 10951 O O    . ILE B 1 63 ? 2.619   -1.986  -3.899  1.00 0.41  ? 63 ILE B O    5  
ATOM 10952 C CB   . ILE B 1 63 ? -0.636  -2.726  -3.915  1.00 0.32  ? 63 ILE B CB   5  
ATOM 10953 C CG1  . ILE B 1 63 ? -1.694  -3.397  -4.768  1.00 0.32  ? 63 ILE B CG1  5  
ATOM 10954 C CG2  . ILE B 1 63 ? -0.550  -1.235  -4.257  1.00 0.33  ? 63 ILE B CG2  5  
ATOM 10955 C CD1  . ILE B 1 63 ? -2.242  -4.584  -4.005  1.00 0.42  ? 63 ILE B CD1  5  
ATOM 10956 H H    . ILE B 1 63 ? -0.107  -5.125  -3.133  1.00 0.31  ? 63 ILE B H    5  
ATOM 10957 H HA   . ILE B 1 63 ? 0.951   -3.371  -5.211  1.00 0.30  ? 63 ILE B HA   5  
ATOM 10958 H HB   . ILE B 1 63 ? -0.899  -2.832  -2.872  1.00 0.35  ? 63 ILE B HB   5  
ATOM 10959 H HG12 . ILE B 1 63 ? -2.482  -2.705  -4.958  1.00 0.31  ? 63 ILE B HG12 5  
ATOM 10960 H HG13 . ILE B 1 63 ? -1.262  -3.731  -5.698  1.00 0.48  ? 63 ILE B HG13 5  
ATOM 10961 H HG21 . ILE B 1 63 ? 0.304   -1.059  -4.895  1.00 0.99  ? 63 ILE B HG21 5  
ATOM 10962 H HG22 . ILE B 1 63 ? -1.449  -0.928  -4.764  1.00 1.02  ? 63 ILE B HG22 5  
ATOM 10963 H HG23 . ILE B 1 63 ? -0.438  -0.667  -3.343  1.00 1.03  ? 63 ILE B HG23 5  
ATOM 10964 H HD11 . ILE B 1 63 ? -1.933  -4.510  -2.970  1.00 1.07  ? 63 ILE B HD11 5  
ATOM 10965 H HD12 . ILE B 1 63 ? -3.315  -4.583  -4.063  1.00 1.10  ? 63 ILE B HD12 5  
ATOM 10966 H HD13 . ILE B 1 63 ? -1.851  -5.491  -4.432  1.00 1.18  ? 63 ILE B HD13 5  
ATOM 10967 N N    . GLU B 1 64 ? 1.618   -2.703  -2.065  1.00 0.38  ? 64 GLU B N    5  
ATOM 10968 C CA   . GLU B 1 64 ? 2.546   -1.964  -1.175  1.00 0.46  ? 64 GLU B CA   5  
ATOM 10969 C C    . GLU B 1 64 ? 3.990   -2.453  -1.356  1.00 0.48  ? 64 GLU B C    5  
ATOM 10970 O O    . GLU B 1 64 ? 4.909   -1.663  -1.434  1.00 0.62  ? 64 GLU B O    5  
ATOM 10971 C CB   . GLU B 1 64 ? 2.132   -2.181  0.277   1.00 0.48  ? 64 GLU B CB   5  
ATOM 10972 C CG   . GLU B 1 64 ? 1.252   -1.019  0.742   1.00 1.04  ? 64 GLU B CG   5  
ATOM 10973 C CD   . GLU B 1 64 ? 0.710   -1.317  2.142   1.00 1.40  ? 64 GLU B CD   5  
ATOM 10974 O OE1  . GLU B 1 64 ? -0.319  -1.968  2.231   1.00 1.81  ? 64 GLU B OE1  5  
ATOM 10975 O OE2  . GLU B 1 64 ? 1.332   -0.890  3.100   1.00 2.00  ? 64 GLU B OE2  5  
ATOM 10976 H H    . GLU B 1 64 ? 0.880   -3.229  -1.679  1.00 0.37  ? 64 GLU B H    5  
ATOM 10977 H HA   . GLU B 1 64 ? 2.477   -0.915  -1.416  1.00 0.48  ? 64 GLU B HA   5  
ATOM 10978 H HB2  . GLU B 1 64 ? 1.581   -3.107  0.354   1.00 0.72  ? 64 GLU B HB2  5  
ATOM 10979 H HB3  . GLU B 1 64 ? 3.014   -2.235  0.895   1.00 0.75  ? 64 GLU B HB3  5  
ATOM 10980 H HG2  . GLU B 1 64 ? 1.839   -0.113  0.767   1.00 1.39  ? 64 GLU B HG2  5  
ATOM 10981 H HG3  . GLU B 1 64 ? 0.427   -0.896  0.058   1.00 1.43  ? 64 GLU B HG3  5  
ATOM 10982 N N    . LYS B 1 65 ? 4.197   -3.748  -1.414  1.00 0.47  ? 65 LYS B N    5  
ATOM 10983 C CA   . LYS B 1 65 ? 5.577   -4.280  -1.584  1.00 0.51  ? 65 LYS B CA   5  
ATOM 10984 C C    . LYS B 1 65 ? 6.071   -3.930  -2.980  1.00 0.50  ? 65 LYS B C    5  
ATOM 10985 O O    . LYS B 1 65 ? 7.194   -3.500  -3.151  1.00 0.55  ? 65 LYS B O    5  
ATOM 10986 C CB   . LYS B 1 65 ? 5.584   -5.798  -1.377  1.00 0.52  ? 65 LYS B CB   5  
ATOM 10987 C CG   . LYS B 1 65 ? 6.945   -6.372  -1.784  1.00 1.07  ? 65 LYS B CG   5  
ATOM 10988 C CD   . LYS B 1 65 ? 7.161   -7.725  -1.103  1.00 1.44  ? 65 LYS B CD   5  
ATOM 10989 C CE   . LYS B 1 65 ? 7.663   -7.506  0.326   1.00 1.72  ? 65 LYS B CE   5  
ATOM 10990 N NZ   . LYS B 1 65 ? 8.311   -8.751  0.828   1.00 2.15  ? 65 LYS B NZ   5  
ATOM 10991 H H    . LYS B 1 65 ? 3.443   -4.367  -1.343  1.00 0.54  ? 65 LYS B H    5  
ATOM 10992 H HA   . LYS B 1 65 ? 6.219   -3.808  -0.863  1.00 0.56  ? 65 LYS B HA   5  
ATOM 10993 H HB2  . LYS B 1 65 ? 5.398   -6.017  -0.336  1.00 0.91  ? 65 LYS B HB2  5  
ATOM 10994 H HB3  . LYS B 1 65 ? 4.812   -6.247  -1.982  1.00 1.09  ? 65 LYS B HB3  5  
ATOM 10995 H HG2  . LYS B 1 65 ? 6.973   -6.502  -2.857  1.00 1.56  ? 65 LYS B HG2  5  
ATOM 10996 H HG3  . LYS B 1 65 ? 7.727   -5.692  -1.483  1.00 1.65  ? 65 LYS B HG3  5  
ATOM 10997 H HD2  . LYS B 1 65 ? 6.228   -8.271  -1.079  1.00 1.78  ? 65 LYS B HD2  5  
ATOM 10998 H HD3  . LYS B 1 65 ? 7.894   -8.292  -1.657  1.00 1.92  ? 65 LYS B HD3  5  
ATOM 10999 H HE2  . LYS B 1 65 ? 8.381   -6.699  0.335   1.00 2.13  ? 65 LYS B HE2  5  
ATOM 11000 H HE3  . LYS B 1 65 ? 6.830   -7.252  0.965   1.00 2.04  ? 65 LYS B HE3  5  
ATOM 11001 H HZ1  . LYS B 1 65 ? 7.732   -9.575  0.569   1.00 2.25  ? 65 LYS B HZ1  5  
ATOM 11002 H HZ2  . LYS B 1 65 ? 9.258   -8.844  0.404   1.00 2.61  ? 65 LYS B HZ2  5  
ATOM 11003 H HZ3  . LYS B 1 65 ? 8.398   -8.704  1.863   1.00 2.61  ? 65 LYS B HZ3  5  
ATOM 11004 N N    . MET B 1 66 ? 5.229   -4.064  -3.975  1.00 0.45  ? 66 MET B N    5  
ATOM 11005 C CA   . MET B 1 66 ? 5.645   -3.678  -5.346  1.00 0.46  ? 66 MET B CA   5  
ATOM 11006 C C    . MET B 1 66 ? 6.028   -2.193  -5.303  1.00 0.49  ? 66 MET B C    5  
ATOM 11007 O O    . MET B 1 66 ? 6.953   -1.754  -5.960  1.00 0.53  ? 66 MET B O    5  
ATOM 11008 C CB   . MET B 1 66 ? 4.483   -3.892  -6.309  1.00 0.42  ? 66 MET B CB   5  
ATOM 11009 C CG   . MET B 1 66 ? 4.505   -5.338  -6.815  1.00 0.40  ? 66 MET B CG   5  
ATOM 11010 S SD   . MET B 1 66 ? 5.828   -5.511  -8.039  1.00 1.14  ? 66 MET B SD   5  
ATOM 11011 C CE   . MET B 1 66 ? 5.077   -4.498  -9.333  1.00 0.37  ? 66 MET B CE   5  
ATOM 11012 H H    . MET B 1 66 ? 4.319   -4.383  -3.812  1.00 0.42  ? 66 MET B H    5  
ATOM 11013 H HA   . MET B 1 66 ? 6.491   -4.271  -5.645  1.00 0.47  ? 66 MET B HA   5  
ATOM 11014 H HB2  . MET B 1 66 ? 3.552   -3.696  -5.797  1.00 0.40  ? 66 MET B HB2  5  
ATOM 11015 H HB3  . MET B 1 66 ? 4.584   -3.218  -7.142  1.00 0.46  ? 66 MET B HB3  5  
ATOM 11016 H HG2  . MET B 1 66 ? 4.689   -6.012  -5.986  1.00 0.76  ? 66 MET B HG2  5  
ATOM 11017 H HG3  . MET B 1 66 ? 3.557   -5.582  -7.269  1.00 0.66  ? 66 MET B HG3  5  
ATOM 11018 H HE1  . MET B 1 66 ? 4.041   -4.298  -9.091  1.00 1.12  ? 66 MET B HE1  5  
ATOM 11019 H HE2  . MET B 1 66 ? 5.607   -3.561  -9.420  1.00 1.06  ? 66 MET B HE2  5  
ATOM 11020 H HE3  . MET B 1 66 ? 5.132   -5.028  -10.270 1.00 1.01  ? 66 MET B HE3  5  
ATOM 11021 N N    . LEU B 1 67 ? 5.328   -1.436  -4.486  1.00 0.50  ? 67 LEU B N    5  
ATOM 11022 C CA   . LEU B 1 67 ? 5.623   0.006   -4.310  1.00 0.54  ? 67 LEU B CA   5  
ATOM 11023 C C    . LEU B 1 67 ? 7.002   0.161   -3.654  1.00 0.60  ? 67 LEU B C    5  
ATOM 11024 O O    . LEU B 1 67 ? 7.723   1.104   -3.922  1.00 0.63  ? 67 LEU B O    5  
ATOM 11025 C CB   . LEU B 1 67 ? 4.568   0.613   -3.380  1.00 0.56  ? 67 LEU B CB   5  
ATOM 11026 C CG   . LEU B 1 67 ? 3.534   1.387   -4.193  1.00 0.53  ? 67 LEU B CG   5  
ATOM 11027 C CD1  . LEU B 1 67 ? 2.144   0.856   -3.852  1.00 0.53  ? 67 LEU B CD1  5  
ATOM 11028 C CD2  . LEU B 1 67 ? 3.615   2.876   -3.840  1.00 0.56  ? 67 LEU B CD2  5  
ATOM 11029 H H    . LEU B 1 67 ? 4.613   -1.835  -3.959  1.00 0.49  ? 67 LEU B H    5  
ATOM 11030 H HA   . LEU B 1 67 ? 5.598   0.502   -5.261  1.00 0.54  ? 67 LEU B HA   5  
ATOM 11031 H HB2  . LEU B 1 67 ? 4.075   -0.182  -2.843  1.00 0.57  ? 67 LEU B HB2  5  
ATOM 11032 H HB3  . LEU B 1 67 ? 5.041   1.275   -2.673  1.00 0.60  ? 67 LEU B HB3  5  
ATOM 11033 H HG   . LEU B 1 67 ? 3.725   1.251   -5.248  1.00 0.51  ? 67 LEU B HG   5  
ATOM 11034 H HD11 . LEU B 1 67 ? 2.182   0.330   -2.908  1.00 1.08  ? 67 LEU B HD11 5  
ATOM 11035 H HD12 . LEU B 1 67 ? 1.451   1.678   -3.777  1.00 1.15  ? 67 LEU B HD12 5  
ATOM 11036 H HD13 . LEU B 1 67 ? 1.820   0.178   -4.627  1.00 1.18  ? 67 LEU B HD13 5  
ATOM 11037 H HD21 . LEU B 1 67 ? 3.887   2.985   -2.801  1.00 1.09  ? 67 LEU B HD21 5  
ATOM 11038 H HD22 . LEU B 1 67 ? 4.361   3.352   -4.459  1.00 1.19  ? 67 LEU B HD22 5  
ATOM 11039 H HD23 . LEU B 1 67 ? 2.655   3.339   -4.012  1.00 1.20  ? 67 LEU B HD23 5  
ATOM 11040 N N    . ASN B 1 68 ? 7.365   -0.762  -2.786  1.00 0.63  ? 68 ASN B N    5  
ATOM 11041 C CA   . ASN B 1 68 ? 8.696   -0.668  -2.099  1.00 0.69  ? 68 ASN B CA   5  
ATOM 11042 C C    . ASN B 1 68 ? 9.745   -1.485  -2.870  1.00 0.75  ? 68 ASN B C    5  
ATOM 11043 O O    . ASN B 1 68 ? 9.746   -2.702  -2.828  1.00 0.92  ? 68 ASN B O    5  
ATOM 11044 C CB   . ASN B 1 68 ? 8.593   -1.200  -0.659  1.00 0.78  ? 68 ASN B CB   5  
ATOM 11045 C CG   . ASN B 1 68 ? 9.840   -0.781  0.126   1.00 1.48  ? 68 ASN B CG   5  
ATOM 11046 O OD1  . ASN B 1 68 ? 10.631  -1.615  0.519   1.00 2.21  ? 68 ASN B OD1  5  
ATOM 11047 N ND2  . ASN B 1 68 ? 10.051  0.485   0.370   1.00 2.00  ? 68 ASN B ND2  5  
ATOM 11048 H H    . ASN B 1 68 ? 6.754   -1.517  -2.587  1.00 0.62  ? 68 ASN B H    5  
ATOM 11049 H HA   . ASN B 1 68 ? 9.003   0.368   -2.070  1.00 0.72  ? 68 ASN B HA   5  
ATOM 11050 H HB2  . ASN B 1 68 ? 7.715   -0.790  -0.178  1.00 1.16  ? 68 ASN B HB2  5  
ATOM 11051 H HB3  . ASN B 1 68 ? 8.528   -2.279  -0.672  1.00 1.06  ? 68 ASN B HB3  5  
ATOM 11052 H HD21 . ASN B 1 68 ? 9.415   1.159   0.053   1.00 2.13  ? 68 ASN B HD21 5  
ATOM 11053 H HD22 . ASN B 1 68 ? 10.848  0.760   0.869   1.00 2.63  ? 68 ASN B HD22 5  
ATOM 11054 N N    . SER B 1 69 ? 10.647  -0.823  -3.565  1.00 0.87  ? 69 SER B N    5  
ATOM 11055 C CA   . SER B 1 69 ? 11.704  -1.549  -4.328  1.00 0.99  ? 69 SER B CA   5  
ATOM 11056 C C    . SER B 1 69 ? 12.693  -0.534  -4.920  1.00 1.13  ? 69 SER B C    5  
ATOM 11057 O O    . SER B 1 69 ? 12.606  -0.170  -6.079  1.00 1.69  ? 69 SER B O    5  
ATOM 11058 C CB   . SER B 1 69 ? 11.064  -2.368  -5.455  1.00 1.46  ? 69 SER B CB   5  
ATOM 11059 O OG   . SER B 1 69 ? 12.064  -3.159  -6.086  1.00 2.03  ? 69 SER B OG   5  
ATOM 11060 H H    . SER B 1 69 ? 10.635  0.151   -3.575  1.00 1.00  ? 69 SER B H    5  
ATOM 11061 H HA   . SER B 1 69 ? 12.228  -2.206  -3.657  1.00 1.09  ? 69 SER B HA   5  
ATOM 11062 H HB2  . SER B 1 69 ? 10.306  -3.016  -5.049  1.00 1.85  ? 69 SER B HB2  5  
ATOM 11063 H HB3  . SER B 1 69 ? 10.614  -1.697  -6.175  1.00 1.93  ? 69 SER B HB3  5  
ATOM 11064 H HG   . SER B 1 69 ? 11.666  -3.995  -6.340  1.00 2.38  ? 69 SER B HG   5  
ATOM 11065 N N    . ASP B 1 70 ? 13.633  -0.074  -4.128  1.00 1.22  ? 70 ASP B N    5  
ATOM 11066 C CA   . ASP B 1 70 ? 14.630  0.921   -4.635  1.00 1.69  ? 70 ASP B CA   5  
ATOM 11067 C C    . ASP B 1 70 ? 15.991  0.688   -3.957  1.00 1.89  ? 70 ASP B C    5  
ATOM 11068 O O    . ASP B 1 70 ? 16.585  1.595   -3.399  1.00 2.34  ? 70 ASP B O    5  
ATOM 11069 C CB   . ASP B 1 70 ? 14.131  2.342   -4.332  1.00 2.32  ? 70 ASP B CB   5  
ATOM 11070 C CG   . ASP B 1 70 ? 12.955  2.685   -5.253  1.00 3.13  ? 70 ASP B CG   5  
ATOM 11071 O OD1  . ASP B 1 70 ? 13.203  3.031   -6.397  1.00 3.65  ? 70 ASP B OD1  5  
ATOM 11072 O OD2  . ASP B 1 70 ? 11.826  2.596   -4.798  1.00 3.72  ? 70 ASP B OD2  5  
ATOM 11073 H H    . ASP B 1 70 ? 13.681  -0.381  -3.197  1.00 1.38  ? 70 ASP B H    5  
ATOM 11074 H HA   . ASP B 1 70 ? 14.742  0.801   -5.703  1.00 2.07  ? 70 ASP B HA   5  
ATOM 11075 H HB2  . ASP B 1 70 ? 13.812  2.397   -3.302  1.00 2.46  ? 70 ASP B HB2  5  
ATOM 11076 H HB3  . ASP B 1 70 ? 14.933  3.047   -4.498  1.00 2.72  ? 70 ASP B HB3  5  
ATOM 11077 N N    . LYS B 1 71 ? 16.492  -0.524  -4.009  1.00 2.37  ? 71 LYS B N    5  
ATOM 11078 C CA   . LYS B 1 71 ? 17.816  -0.823  -3.379  1.00 3.06  ? 71 LYS B CA   5  
ATOM 11079 C C    . LYS B 1 71 ? 18.366  -2.137  -3.943  1.00 3.94  ? 71 LYS B C    5  
ATOM 11080 O O    . LYS B 1 71 ? 19.465  -2.185  -4.465  1.00 4.55  ? 71 LYS B O    5  
ATOM 11081 C CB   . LYS B 1 71 ? 17.652  -0.942  -1.859  1.00 3.59  ? 71 LYS B CB   5  
ATOM 11082 C CG   . LYS B 1 71 ? 19.018  -0.791  -1.182  1.00 3.82  ? 71 LYS B CG   5  
ATOM 11083 C CD   . LYS B 1 71 ? 18.868  -0.976  0.330   1.00 4.61  ? 71 LYS B CD   5  
ATOM 11084 C CE   . LYS B 1 71 ? 18.683  0.389   0.999   1.00 5.23  ? 71 LYS B CE   5  
ATOM 11085 N NZ   . LYS B 1 71 ? 20.015  1.022   1.226   1.00 5.99  ? 71 LYS B NZ   5  
ATOM 11086 H H    . LYS B 1 71 ? 15.999  -1.236  -4.468  1.00 2.66  ? 71 LYS B H    5  
ATOM 11087 H HA   . LYS B 1 71 ? 18.505  -0.026  -3.603  1.00 3.09  ? 71 LYS B HA   5  
ATOM 11088 H HB2  . LYS B 1 71 ? 16.988  -0.165  -1.507  1.00 3.68  ? 71 LYS B HB2  5  
ATOM 11089 H HB3  . LYS B 1 71 ? 17.237  -1.908  -1.615  1.00 4.21  ? 71 LYS B HB3  5  
ATOM 11090 H HG2  . LYS B 1 71 ? 19.696  -1.537  -1.572  1.00 3.92  ? 71 LYS B HG2  5  
ATOM 11091 H HG3  . LYS B 1 71 ? 19.413  0.193   -1.386  1.00 3.79  ? 71 LYS B HG3  5  
ATOM 11092 H HD2  . LYS B 1 71 ? 18.007  -1.597  0.533   1.00 4.80  ? 71 LYS B HD2  5  
ATOM 11093 H HD3  . LYS B 1 71 ? 19.754  -1.451  0.724   1.00 4.94  ? 71 LYS B HD3  5  
ATOM 11094 H HE2  . LYS B 1 71 ? 18.087  1.025   0.362   1.00 5.31  ? 71 LYS B HE2  5  
ATOM 11095 H HE3  . LYS B 1 71 ? 18.181  0.259   1.947   1.00 5.41  ? 71 LYS B HE3  5  
ATOM 11096 H HZ1  . LYS B 1 71 ? 20.595  0.403   1.829   1.00 6.24  ? 71 LYS B HZ1  5  
ATOM 11097 H HZ2  . LYS B 1 71 ? 20.492  1.164   0.312   1.00 6.23  ? 71 LYS B HZ2  5  
ATOM 11098 H HZ3  . LYS B 1 71 ? 19.886  1.941   1.693   1.00 6.33  ? 71 LYS B HZ3  5  
ATOM 11099 N N    . SER B 1 72 ? 17.608  -3.199  -3.840  1.00 4.42  ? 72 SER B N    5  
ATOM 11100 C CA   . SER B 1 72 ? 18.069  -4.518  -4.366  1.00 5.58  ? 72 SER B CA   5  
ATOM 11101 C C    . SER B 1 72 ? 16.921  -5.203  -5.119  1.00 5.86  ? 72 SER B C    5  
ATOM 11102 O O    . SER B 1 72 ? 15.831  -5.275  -4.570  1.00 5.92  ? 72 SER B O    5  
ATOM 11103 C CB   . SER B 1 72 ? 18.519  -5.403  -3.201  1.00 6.45  ? 72 SER B CB   5  
ATOM 11104 O OG   . SER B 1 72 ? 19.160  -6.565  -3.712  1.00 6.62  ? 72 SER B OG   5  
ATOM 11105 O OXT  . SER B 1 72 ? 17.151  -5.644  -6.233  1.00 6.32  ? 72 SER B OXT  5  
ATOM 11106 H H    . SER B 1 72 ? 16.729  -3.125  -3.415  1.00 4.24  ? 72 SER B H    5  
ATOM 11107 H HA   . SER B 1 72 ? 18.898  -4.365  -5.041  1.00 5.92  ? 72 SER B HA   5  
ATOM 11108 H HB2  . SER B 1 72 ? 19.213  -4.860  -2.580  1.00 6.89  ? 72 SER B HB2  5  
ATOM 11109 H HB3  . SER B 1 72 ? 17.658  -5.685  -2.610  1.00 6.83  ? 72 SER B HB3  5  
ATOM 11110 H HG   . SER B 1 72 ? 20.087  -6.356  -3.850  1.00 7.10  ? 72 SER B HG   5  
ATOM 11111 N N    . ALA A 1 1  ? 14.235  9.768   -30.295 1.00 14.80 ? 1  ALA A N    6  
ATOM 11112 C CA   . ALA A 1 1  ? 15.057  10.992  -30.066 1.00 14.12 ? 1  ALA A CA   6  
ATOM 11113 C C    . ALA A 1 1  ? 15.244  11.210  -28.559 1.00 13.40 ? 1  ALA A C    6  
ATOM 11114 O O    . ALA A 1 1  ? 14.372  11.725  -27.884 1.00 13.47 ? 1  ALA A O    6  
ATOM 11115 C CB   . ALA A 1 1  ? 14.350  12.207  -30.680 1.00 14.17 ? 1  ALA A CB   6  
ATOM 11116 H H1   . ALA A 1 1  ? 13.336  9.849   -29.778 1.00 14.91 ? 1  ALA A H1   6  
ATOM 11117 H H2   . ALA A 1 1  ? 14.042  9.663   -31.312 1.00 15.01 ? 1  ALA A H2   6  
ATOM 11118 H H3   . ALA A 1 1  ? 14.756  8.933   -29.957 1.00 15.11 ? 1  ALA A H3   6  
ATOM 11119 H HA   . ALA A 1 1  ? 16.023  10.867  -30.533 1.00 14.26 ? 1  ALA A HA   6  
ATOM 11120 H HB1  . ALA A 1 1  ? 13.287  12.131  -30.507 1.00 14.43 ? 1  ALA A HB1  6  
ATOM 11121 H HB2  . ALA A 1 1  ? 14.726  13.111  -30.222 1.00 14.25 ? 1  ALA A HB2  6  
ATOM 11122 H HB3  . ALA A 1 1  ? 14.541  12.236  -31.742 1.00 14.03 ? 1  ALA A HB3  6  
ATOM 11123 N N    . SER A 1 2  ? 16.378  10.818  -28.029 1.00 12.87 ? 2  SER A N    6  
ATOM 11124 C CA   . SER A 1 2  ? 16.631  10.998  -26.567 1.00 12.29 ? 2  SER A CA   6  
ATOM 11125 C C    . SER A 1 2  ? 18.134  11.174  -26.325 1.00 11.44 ? 2  SER A C    6  
ATOM 11126 O O    . SER A 1 2  ? 18.911  10.249  -26.484 1.00 11.39 ? 2  SER A O    6  
ATOM 11127 C CB   . SER A 1 2  ? 16.127  9.770   -25.798 1.00 12.48 ? 2  SER A CB   6  
ATOM 11128 O OG   . SER A 1 2  ? 16.619  8.585   -26.413 1.00 12.82 ? 2  SER A OG   6  
ATOM 11129 H H    . SER A 1 2  ? 17.064  10.404  -28.595 1.00 12.96 ? 2  SER A H    6  
ATOM 11130 H HA   . SER A 1 2  ? 16.108  11.876  -26.219 1.00 12.52 ? 2  SER A HA   6  
ATOM 11131 H HB2  . SER A 1 2  ? 16.480  9.812   -24.781 1.00 12.65 ? 2  SER A HB2  6  
ATOM 11132 H HB3  . SER A 1 2  ? 15.045  9.765   -25.800 1.00 12.40 ? 2  SER A HB3  6  
ATOM 11133 H HG   . SER A 1 2  ? 15.919  8.220   -26.960 1.00 12.81 ? 2  SER A HG   6  
ATOM 11134 N N    . VAL A 1 3  ? 18.549  12.358  -25.944 1.00 10.93 ? 3  VAL A N    6  
ATOM 11135 C CA   . VAL A 1 3  ? 20.002  12.605  -25.689 1.00 10.23 ? 3  VAL A CA   6  
ATOM 11136 C C    . VAL A 1 3  ? 20.217  12.857  -24.186 1.00 9.33  ? 3  VAL A C    6  
ATOM 11137 O O    . VAL A 1 3  ? 20.849  13.818  -23.787 1.00 9.35  ? 3  VAL A O    6  
ATOM 11138 C CB   . VAL A 1 3  ? 20.467  13.822  -26.506 1.00 10.49 ? 3  VAL A CB   6  
ATOM 11139 C CG1  . VAL A 1 3  ? 21.993  13.940  -26.436 1.00 10.45 ? 3  VAL A CG1  6  
ATOM 11140 C CG2  . VAL A 1 3  ? 20.042  13.654  -27.970 1.00 11.15 ? 3  VAL A CG2  6  
ATOM 11141 H H    . VAL A 1 3  ? 17.903  13.086  -25.824 1.00 11.13 ? 3  VAL A H    6  
ATOM 11142 H HA   . VAL A 1 3  ? 20.569  11.735  -25.987 1.00 10.38 ? 3  VAL A HA   6  
ATOM 11143 H HB   . VAL A 1 3  ? 20.019  14.719  -26.100 1.00 10.48 ? 3  VAL A HB   6  
ATOM 11144 H HG11 . VAL A 1 3  ? 22.424  12.961  -26.286 1.00 10.31 ? 3  VAL A HG11 6  
ATOM 11145 H HG12 . VAL A 1 3  ? 22.365  14.360  -27.358 1.00 10.52 ? 3  VAL A HG12 6  
ATOM 11146 H HG13 . VAL A 1 3  ? 22.267  14.582  -25.612 1.00 10.71 ? 3  VAL A HG13 6  
ATOM 11147 H HG21 . VAL A 1 3  ? 18.975  13.494  -28.019 1.00 11.32 ? 3  VAL A HG21 6  
ATOM 11148 H HG22 . VAL A 1 3  ? 20.299  14.544  -28.524 1.00 11.52 ? 3  VAL A HG22 6  
ATOM 11149 H HG23 . VAL A 1 3  ? 20.553  12.804  -28.398 1.00 11.26 ? 3  VAL A HG23 6  
ATOM 11150 N N    . ALA A 1 4  ? 19.689  11.989  -23.354 1.00 8.73  ? 4  ALA A N    6  
ATOM 11151 C CA   . ALA A 1 4  ? 19.849  12.155  -21.874 1.00 7.94  ? 4  ALA A CA   6  
ATOM 11152 C C    . ALA A 1 4  ? 19.278  10.925  -21.154 1.00 7.00  ? 4  ALA A C    6  
ATOM 11153 O O    . ALA A 1 4  ? 18.866  9.964   -21.778 1.00 7.01  ? 4  ALA A O    6  
ATOM 11154 C CB   . ALA A 1 4  ? 19.094  13.409  -21.416 1.00 8.20  ? 4  ALA A CB   6  
ATOM 11155 H H    . ALA A 1 4  ? 19.187  11.224  -23.705 1.00 8.94  ? 4  ALA A H    6  
ATOM 11156 H HA   . ALA A 1 4  ? 20.897  12.258  -21.634 1.00 8.12  ? 4  ALA A HA   6  
ATOM 11157 H HB1  . ALA A 1 4  ? 18.101  13.407  -21.841 1.00 8.35  ? 4  ALA A HB1  6  
ATOM 11158 H HB2  . ALA A 1 4  ? 19.023  13.414  -20.339 1.00 8.38  ? 4  ALA A HB2  6  
ATOM 11159 H HB3  . ALA A 1 4  ? 19.625  14.290  -21.747 1.00 8.32  ? 4  ALA A HB3  6  
ATOM 11160 N N    . THR A 1 5  ? 19.252  10.951  -19.842 1.00 6.46  ? 5  THR A N    6  
ATOM 11161 C CA   . THR A 1 5  ? 18.709  9.789   -19.068 1.00 5.78  ? 5  THR A CA   6  
ATOM 11162 C C    . THR A 1 5  ? 17.181  9.716   -19.234 1.00 4.91  ? 5  THR A C    6  
ATOM 11163 O O    . THR A 1 5  ? 16.548  10.668  -19.654 1.00 4.67  ? 5  THR A O    6  
ATOM 11164 C CB   . THR A 1 5  ? 19.064  9.948   -17.578 1.00 6.14  ? 5  THR A CB   6  
ATOM 11165 O OG1  . THR A 1 5  ? 18.418  8.930   -16.821 1.00 6.54  ? 5  THR A OG1  6  
ATOM 11166 C CG2  . THR A 1 5  ? 18.614  11.321  -17.066 1.00 6.80  ? 5  THR A CG2  6  
ATOM 11167 H H    . THR A 1 5  ? 19.591  11.737  -19.365 1.00 6.71  ? 5  THR A H    6  
ATOM 11168 H HA   . THR A 1 5  ? 19.149  8.877   -19.444 1.00 5.96  ? 5  THR A HA   6  
ATOM 11169 H HB   . THR A 1 5  ? 20.132  9.858   -17.455 1.00 5.97  ? 5  THR A HB   6  
ATOM 11170 H HG1  . THR A 1 5  ? 18.922  8.794   -16.015 1.00 6.80  ? 5  THR A HG1  6  
ATOM 11171 H HG21 . THR A 1 5  ? 17.732  11.637  -17.605 1.00 6.85  ? 5  THR A HG21 6  
ATOM 11172 H HG22 . THR A 1 5  ? 18.386  11.256  -16.013 1.00 7.20  ? 5  THR A HG22 6  
ATOM 11173 H HG23 . THR A 1 5  ? 19.406  12.038  -17.220 1.00 7.12  ? 5  THR A HG23 6  
ATOM 11174 N N    . GLU A 1 6  ? 16.598  8.587   -18.894 1.00 4.60  ? 6  GLU A N    6  
ATOM 11175 C CA   . GLU A 1 6  ? 15.115  8.404   -19.005 1.00 3.81  ? 6  GLU A CA   6  
ATOM 11176 C C    . GLU A 1 6  ? 14.680  8.439   -20.477 1.00 3.24  ? 6  GLU A C    6  
ATOM 11177 O O    . GLU A 1 6  ? 14.480  9.493   -21.053 1.00 3.60  ? 6  GLU A O    6  
ATOM 11178 C CB   . GLU A 1 6  ? 14.384  9.504   -18.218 1.00 4.36  ? 6  GLU A CB   6  
ATOM 11179 C CG   . GLU A 1 6  ? 14.919  9.553   -16.782 1.00 5.18  ? 6  GLU A CG   6  
ATOM 11180 C CD   . GLU A 1 6  ? 13.904  10.257  -15.877 1.00 5.79  ? 6  GLU A CD   6  
ATOM 11181 O OE1  . GLU A 1 6  ? 13.006  9.588   -15.394 1.00 6.17  ? 6  GLU A OE1  6  
ATOM 11182 O OE2  . GLU A 1 6  ? 14.044  11.452  -15.681 1.00 6.16  ? 6  GLU A OE2  6  
ATOM 11183 H H    . GLU A 1 6  ? 17.145  7.849   -18.557 1.00 5.01  ? 6  GLU A H    6  
ATOM 11184 H HA   . GLU A 1 6  ? 14.851  7.442   -18.588 1.00 3.44  ? 6  GLU A HA   6  
ATOM 11185 H HB2  . GLU A 1 6  ? 14.547  10.459  -18.695 1.00 4.83  ? 6  GLU A HB2  6  
ATOM 11186 H HB3  . GLU A 1 6  ? 13.326  9.288   -18.197 1.00 4.03  ? 6  GLU A HB3  6  
ATOM 11187 H HG2  . GLU A 1 6  ? 15.082  8.546   -16.426 1.00 5.45  ? 6  GLU A HG2  6  
ATOM 11188 H HG3  . GLU A 1 6  ? 15.852  10.097  -16.765 1.00 5.43  ? 6  GLU A HG3  6  
ATOM 11189 N N    . LEU A 1 7  ? 14.512  7.285   -21.079 1.00 2.59  ? 7  LEU A N    6  
ATOM 11190 C CA   . LEU A 1 7  ? 14.068  7.217   -22.495 1.00 2.31  ? 7  LEU A CA   6  
ATOM 11191 C C    . LEU A 1 7  ? 12.741  6.475   -22.498 1.00 1.55  ? 7  LEU A C    6  
ATOM 11192 O O    . LEU A 1 7  ? 11.712  6.992   -22.891 1.00 1.73  ? 7  LEU A O    6  
ATOM 11193 C CB   . LEU A 1 7  ? 15.063  6.437   -23.378 1.00 2.51  ? 7  LEU A CB   6  
ATOM 11194 C CG   . LEU A 1 7  ? 16.471  6.351   -22.769 1.00 3.14  ? 7  LEU A CG   6  
ATOM 11195 C CD1  . LEU A 1 7  ? 16.966  7.736   -22.341 1.00 3.94  ? 7  LEU A CD1  6  
ATOM 11196 C CD2  . LEU A 1 7  ? 16.442  5.409   -21.570 1.00 3.07  ? 7  LEU A CD2  6  
ATOM 11197 H H    . LEU A 1 7  ? 14.654  6.454   -20.590 1.00 2.53  ? 7  LEU A H    6  
ATOM 11198 H HA   . LEU A 1 7  ? 13.938  8.209   -22.880 1.00 2.80  ? 7  LEU A HA   6  
ATOM 11199 H HB2  . LEU A 1 7  ? 14.690  5.436   -23.529 1.00 2.07  ? 7  LEU A HB2  6  
ATOM 11200 H HB3  . LEU A 1 7  ? 15.122  6.926   -24.320 1.00 2.88  ? 7  LEU A HB3  6  
ATOM 11201 H HG   . LEU A 1 7  ? 17.149  5.954   -23.512 1.00 3.32  ? 7  LEU A HG   6  
ATOM 11202 H HD11 . LEU A 1 7  ? 16.276  8.491   -22.686 1.00 4.25  ? 7  LEU A HD11 6  
ATOM 11203 H HD12 . LEU A 1 7  ? 17.038  7.778   -21.264 1.00 4.28  ? 7  LEU A HD12 6  
ATOM 11204 H HD13 . LEU A 1 7  ? 17.940  7.918   -22.771 1.00 4.27  ? 7  LEU A HD13 6  
ATOM 11205 H HD21 . LEU A 1 7  ? 15.488  4.902   -21.538 1.00 3.36  ? 7  LEU A HD21 6  
ATOM 11206 H HD22 . LEU A 1 7  ? 17.231  4.684   -21.664 1.00 3.18  ? 7  LEU A HD22 6  
ATOM 11207 H HD23 . LEU A 1 7  ? 16.574  5.979   -20.663 1.00 3.21  ? 7  LEU A HD23 6  
ATOM 11208 N N    . ARG A 1 8  ? 12.786  5.260   -22.025 1.00 1.31  ? 8  ARG A N    6  
ATOM 11209 C CA   . ARG A 1 8  ? 11.573  4.409   -21.926 1.00 1.48  ? 8  ARG A CA   6  
ATOM 11210 C C    . ARG A 1 8  ? 10.531  5.124   -21.059 1.00 1.32  ? 8  ARG A C    6  
ATOM 11211 O O    . ARG A 1 8  ? 9.380   5.262   -21.432 1.00 1.92  ? 8  ARG A O    6  
ATOM 11212 C CB   . ARG A 1 8  ? 11.972  3.100   -21.244 1.00 2.16  ? 8  ARG A CB   6  
ATOM 11213 C CG   . ARG A 1 8  ? 12.019  1.963   -22.269 1.00 2.68  ? 8  ARG A CG   6  
ATOM 11214 C CD   . ARG A 1 8  ? 10.698  1.193   -22.245 1.00 2.99  ? 8  ARG A CD   6  
ATOM 11215 N NE   . ARG A 1 8  ? 10.754  0.074   -23.231 1.00 3.47  ? 8  ARG A NE   6  
ATOM 11216 C CZ   . ARG A 1 8  ? 10.537  0.307   -24.498 1.00 3.94  ? 8  ARG A CZ   6  
ATOM 11217 N NH1  . ARG A 1 8  ? 9.311   0.398   -24.945 1.00 4.33  ? 8  ARG A NH1  6  
ATOM 11218 N NH2  . ARG A 1 8  ? 11.546  0.448   -25.319 1.00 4.42  ? 8  ARG A NH2  6  
ATOM 11219 H H    . ARG A 1 8  ? 13.641  4.908   -21.709 1.00 1.63  ? 8  ARG A H    6  
ATOM 11220 H HA   . ARG A 1 8  ? 11.177  4.213   -22.906 1.00 1.84  ? 8  ARG A HA   6  
ATOM 11221 H HB2  . ARG A 1 8  ? 12.951  3.223   -20.794 1.00 2.23  ? 8  ARG A HB2  6  
ATOM 11222 H HB3  . ARG A 1 8  ? 11.253  2.864   -20.473 1.00 2.53  ? 8  ARG A HB3  6  
ATOM 11223 H HG2  . ARG A 1 8  ? 12.180  2.373   -23.255 1.00 2.98  ? 8  ARG A HG2  6  
ATOM 11224 H HG3  . ARG A 1 8  ? 12.829  1.291   -22.023 1.00 2.97  ? 8  ARG A HG3  6  
ATOM 11225 H HD2  . ARG A 1 8  ? 10.535  0.791   -21.255 1.00 3.17  ? 8  ARG A HD2  6  
ATOM 11226 H HD3  . ARG A 1 8  ? 9.888   1.859   -22.500 1.00 3.16  ? 8  ARG A HD3  6  
ATOM 11227 H HE   . ARG A 1 8  ? 10.955  -0.835  -22.927 1.00 3.66  ? 8  ARG A HE   6  
ATOM 11228 H HH11 . ARG A 1 8  ? 8.541   0.291   -24.317 1.00 4.37  ? 8  ARG A HH11 6  
ATOM 11229 H HH12 . ARG A 1 8  ? 9.143   0.575   -25.915 1.00 4.82  ? 8  ARG A HH12 6  
ATOM 11230 H HH21 . ARG A 1 8  ? 12.484  0.378   -24.976 1.00 4.48  ? 8  ARG A HH21 6  
ATOM 11231 H HH22 . ARG A 1 8  ? 11.383  0.625   -26.290 1.00 4.97  ? 8  ARG A HH22 6  
ATOM 11232 N N    . CYS A 1 9  ? 10.955  5.571   -19.899 1.00 0.86  ? 9  CYS A N    6  
ATOM 11233 C CA   . CYS A 1 9  ? 10.038  6.284   -18.953 1.00 0.66  ? 9  CYS A CA   6  
ATOM 11234 C C    . CYS A 1 9  ? 9.673   7.661   -19.524 1.00 0.61  ? 9  CYS A C    6  
ATOM 11235 O O    . CYS A 1 9  ? 10.489  8.335   -20.125 1.00 0.84  ? 9  CYS A O    6  
ATOM 11236 C CB   . CYS A 1 9  ? 10.712  6.469   -17.576 1.00 0.66  ? 9  CYS A CB   6  
ATOM 11237 S SG   . CYS A 1 9  ? 12.056  5.257   -17.358 1.00 0.94  ? 9  CYS A SG   6  
ATOM 11238 H H    . CYS A 1 9  ? 11.889  5.432   -19.653 1.00 1.09  ? 9  CYS A H    6  
ATOM 11239 H HA   . CYS A 1 9  ? 9.135   5.702   -18.831 1.00 0.74  ? 9  CYS A HA   6  
ATOM 11240 H HB2  . CYS A 1 9  ? 11.102  7.470   -17.503 1.00 0.78  ? 9  CYS A HB2  6  
ATOM 11241 H HB3  . CYS A 1 9  ? 9.975   6.323   -16.802 1.00 0.69  ? 9  CYS A HB3  6  
ATOM 11242 N N    . GLN A 1 10 ? 8.443   8.070   -19.340 1.00 0.51  ? 10 GLN A N    6  
ATOM 11243 C CA   . GLN A 1 10 ? 7.981   9.392   -19.866 1.00 0.47  ? 10 GLN A CA   6  
ATOM 11244 C C    . GLN A 1 10 ? 7.512   10.313  -18.726 1.00 0.39  ? 10 GLN A C    6  
ATOM 11245 O O    . GLN A 1 10 ? 7.167   11.451  -18.975 1.00 0.40  ? 10 GLN A O    6  
ATOM 11246 C CB   . GLN A 1 10 ? 6.797   9.149   -20.786 1.00 0.53  ? 10 GLN A CB   6  
ATOM 11247 C CG   . GLN A 1 10 ? 7.196   9.400   -22.241 1.00 0.64  ? 10 GLN A CG   6  
ATOM 11248 C CD   . GLN A 1 10 ? 7.192   10.905  -22.539 1.00 1.20  ? 10 GLN A CD   6  
ATOM 11249 O OE1  . GLN A 1 10 ? 6.154   11.484  -22.793 1.00 1.87  ? 10 GLN A OE1  6  
ATOM 11250 N NE2  . GLN A 1 10 ? 8.319   11.566  -22.524 1.00 1.84  ? 10 GLN A NE2  6  
ATOM 11251 H H    . GLN A 1 10 ? 7.813   7.497   -18.861 1.00 0.64  ? 10 GLN A H    6  
ATOM 11252 H HA   . GLN A 1 10 ? 8.777   9.868   -20.419 1.00 0.52  ? 10 GLN A HA   6  
ATOM 11253 H HB2  . GLN A 1 10 ? 6.473   8.127   -20.671 1.00 0.58  ? 10 GLN A HB2  6  
ATOM 11254 H HB3  . GLN A 1 10 ? 5.996   9.811   -20.505 1.00 0.50  ? 10 GLN A HB3  6  
ATOM 11255 H HG2  . GLN A 1 10 ? 8.186   9.001   -22.412 1.00 1.10  ? 10 GLN A HG2  6  
ATOM 11256 H HG3  . GLN A 1 10 ? 6.494   8.903   -22.892 1.00 1.15  ? 10 GLN A HG3  6  
ATOM 11257 H HE21 . GLN A 1 10 ? 9.158   11.101  -22.325 1.00 2.04  ? 10 GLN A HE21 6  
ATOM 11258 H HE22 . GLN A 1 10 ? 8.324   12.527  -22.713 1.00 2.45  ? 10 GLN A HE22 6  
ATOM 11259 N N    . CYS A 1 11 ? 7.474   9.813   -17.499 1.00 0.34  ? 11 CYS A N    6  
ATOM 11260 C CA   . CYS A 1 11 ? 7.007   10.613  -16.303 1.00 0.31  ? 11 CYS A CA   6  
ATOM 11261 C C    . CYS A 1 11 ? 7.080   12.123  -16.568 1.00 0.36  ? 11 CYS A C    6  
ATOM 11262 O O    . CYS A 1 11 ? 8.131   12.661  -16.870 1.00 0.50  ? 11 CYS A O    6  
ATOM 11263 C CB   . CYS A 1 11 ? 7.876   10.275  -15.095 1.00 0.30  ? 11 CYS A CB   6  
ATOM 11264 S SG   . CYS A 1 11 ? 7.665   8.530   -14.654 1.00 0.30  ? 11 CYS A SG   6  
ATOM 11265 H H    . CYS A 1 11 ? 7.742   8.886   -17.365 1.00 0.36  ? 11 CYS A H    6  
ATOM 11266 H HA   . CYS A 1 11 ? 5.986   10.346  -16.072 1.00 0.31  ? 11 CYS A HA   6  
ATOM 11267 H HB2  . CYS A 1 11 ? 8.912   10.461  -15.331 1.00 0.34  ? 11 CYS A HB2  6  
ATOM 11268 H HB3  . CYS A 1 11 ? 7.583   10.889  -14.267 1.00 0.31  ? 11 CYS A HB3  6  
ATOM 11269 N N    . LEU A 1 12 ? 5.964   12.804  -16.448 1.00 0.40  ? 12 LEU A N    6  
ATOM 11270 C CA   . LEU A 1 12 ? 5.938   14.282  -16.687 1.00 0.44  ? 12 LEU A CA   6  
ATOM 11271 C C    . LEU A 1 12 ? 6.907   14.935  -15.703 1.00 0.45  ? 12 LEU A C    6  
ATOM 11272 O O    . LEU A 1 12 ? 7.893   15.538  -16.079 1.00 0.48  ? 12 LEU A O    6  
ATOM 11273 C CB   . LEU A 1 12 ? 4.513   14.841  -16.451 1.00 0.49  ? 12 LEU A CB   6  
ATOM 11274 C CG   . LEU A 1 12 ? 3.432   13.868  -16.951 1.00 0.82  ? 12 LEU A CG   6  
ATOM 11275 C CD1  . LEU A 1 12 ? 2.056   14.514  -16.774 1.00 1.04  ? 12 LEU A CD1  6  
ATOM 11276 C CD2  . LEU A 1 12 ? 3.650   13.549  -18.431 1.00 1.56  ? 12 LEU A CD2  6  
ATOM 11277 H H    . LEU A 1 12 ? 5.144   12.343  -16.188 1.00 0.49  ? 12 LEU A H    6  
ATOM 11278 H HA   . LEU A 1 12 ? 6.250   14.492  -17.699 1.00 0.48  ? 12 LEU A HA   6  
ATOM 11279 H HB2  . LEU A 1 12 ? 4.368   15.006  -15.393 1.00 0.97  ? 12 LEU A HB2  6  
ATOM 11280 H HB3  . LEU A 1 12 ? 4.409   15.781  -16.971 1.00 0.98  ? 12 LEU A HB3  6  
ATOM 11281 H HG   . LEU A 1 12 ? 3.472   12.956  -16.373 1.00 1.56  ? 12 LEU A HG   6  
ATOM 11282 H HD11 . LEU A 1 12 ? 2.051   15.484  -17.251 1.00 1.31  ? 12 LEU A HD11 6  
ATOM 11283 H HD12 . LEU A 1 12 ? 1.303   13.887  -17.226 1.00 1.71  ? 12 LEU A HD12 6  
ATOM 11284 H HD13 . LEU A 1 12 ? 1.846   14.629  -15.721 1.00 1.40  ? 12 LEU A HD13 6  
ATOM 11285 H HD21 . LEU A 1 12 ? 3.784   14.467  -18.980 1.00 2.03  ? 12 LEU A HD21 6  
ATOM 11286 H HD22 . LEU A 1 12 ? 4.527   12.929  -18.540 1.00 2.07  ? 12 LEU A HD22 6  
ATOM 11287 H HD23 . LEU A 1 12 ? 2.788   13.021  -18.814 1.00 2.10  ? 12 LEU A HD23 6  
ATOM 11288 N N    . GLN A 1 13 ? 6.611   14.789  -14.444 1.00 0.43  ? 13 GLN A N    6  
ATOM 11289 C CA   . GLN A 1 13 ? 7.454   15.348  -13.352 1.00 0.45  ? 13 GLN A CA   6  
ATOM 11290 C C    . GLN A 1 13 ? 6.834   14.905  -12.023 1.00 0.42  ? 13 GLN A C    6  
ATOM 11291 O O    . GLN A 1 13 ? 6.692   15.683  -11.100 1.00 0.60  ? 13 GLN A O    6  
ATOM 11292 C CB   . GLN A 1 13 ? 7.451   16.872  -13.444 1.00 0.52  ? 13 GLN A CB   6  
ATOM 11293 C CG   . GLN A 1 13 ? 8.759   17.363  -14.070 1.00 1.11  ? 13 GLN A CG   6  
ATOM 11294 C CD   . GLN A 1 13 ? 9.163   18.699  -13.440 1.00 1.40  ? 13 GLN A CD   6  
ATOM 11295 O OE1  . GLN A 1 13 ? 9.631   18.738  -12.319 1.00 1.77  ? 13 GLN A OE1  6  
ATOM 11296 N NE2  . GLN A 1 13 ? 9.003   19.804  -14.118 1.00 2.09  ? 13 GLN A NE2  6  
ATOM 11297 H H    . GLN A 1 13 ? 5.809   14.290  -14.205 1.00 0.42  ? 13 GLN A H    6  
ATOM 11298 H HA   . GLN A 1 13 ? 8.460   14.968  -13.434 1.00 0.46  ? 13 GLN A HA   6  
ATOM 11299 H HB2  . GLN A 1 13 ? 6.619   17.191  -14.056 1.00 0.98  ? 13 GLN A HB2  6  
ATOM 11300 H HB3  . GLN A 1 13 ? 7.342   17.279  -12.460 1.00 0.85  ? 13 GLN A HB3  6  
ATOM 11301 H HG2  . GLN A 1 13 ? 9.537   16.633  -13.897 1.00 1.50  ? 13 GLN A HG2  6  
ATOM 11302 H HG3  . GLN A 1 13 ? 8.621   17.496  -15.132 1.00 1.66  ? 13 GLN A HG3  6  
ATOM 11303 H HE21 . GLN A 1 13 ? 8.627   19.776  -15.023 1.00 2.59  ? 13 GLN A HE21 6  
ATOM 11304 H HE22 . GLN A 1 13 ? 9.260   20.663  -13.721 1.00 2.41  ? 13 GLN A HE22 6  
ATOM 11305 N N    . THR A 1 14 ? 6.432   13.652  -11.968 1.00 0.36  ? 14 THR A N    6  
ATOM 11306 C CA   . THR A 1 14 ? 5.751   13.067  -10.771 1.00 0.32  ? 14 THR A CA   6  
ATOM 11307 C C    . THR A 1 14 ? 4.897   14.099  -10.042 1.00 0.35  ? 14 THR A C    6  
ATOM 11308 O O    . THR A 1 14 ? 5.342   14.797  -9.147  1.00 0.39  ? 14 THR A O    6  
ATOM 11309 C CB   . THR A 1 14 ? 6.715   12.425  -9.802  1.00 0.32  ? 14 THR A CB   6  
ATOM 11310 O OG1  . THR A 1 14 ? 7.813   13.291  -9.542  1.00 0.38  ? 14 THR A OG1  6  
ATOM 11311 C CG2  . THR A 1 14 ? 7.203   11.109  -10.402 1.00 0.31  ? 14 THR A CG2  6  
ATOM 11312 H H    . THR A 1 14 ? 6.552   13.086  -12.759 1.00 0.51  ? 14 THR A H    6  
ATOM 11313 H HA   . THR A 1 14 ? 5.099   12.298  -11.128 1.00 0.30  ? 14 THR A HA   6  
ATOM 11314 H HB   . THR A 1 14 ? 6.168   12.216  -8.894  1.00 0.32  ? 14 THR A HB   6  
ATOM 11315 H HG1  . THR A 1 14 ? 7.562   13.884  -8.828  1.00 0.69  ? 14 THR A HG1  6  
ATOM 11316 H HG21 . THR A 1 14 ? 6.349   10.506  -10.680 1.00 1.01  ? 14 THR A HG21 6  
ATOM 11317 H HG22 . THR A 1 14 ? 7.798   11.314  -11.280 1.00 1.05  ? 14 THR A HG22 6  
ATOM 11318 H HG23 . THR A 1 14 ? 7.796   10.579  -9.676  1.00 1.08  ? 14 THR A HG23 6  
ATOM 11319 N N    . LEU A 1 15 ? 3.659   14.168  -10.418 1.00 0.36  ? 15 LEU A N    6  
ATOM 11320 C CA   . LEU A 1 15 ? 2.718   15.127  -9.771  1.00 0.41  ? 15 LEU A CA   6  
ATOM 11321 C C    . LEU A 1 15 ? 2.422   14.651  -8.347  1.00 0.35  ? 15 LEU A C    6  
ATOM 11322 O O    . LEU A 1 15 ? 2.531   13.479  -8.039  1.00 0.52  ? 15 LEU A O    6  
ATOM 11323 C CB   . LEU A 1 15 ? 1.419   15.205  -10.580 1.00 0.57  ? 15 LEU A CB   6  
ATOM 11324 C CG   . LEU A 1 15 ? 1.715   15.784  -11.968 1.00 0.64  ? 15 LEU A CG   6  
ATOM 11325 C CD1  . LEU A 1 15 ? 0.595   15.399  -12.939 1.00 0.74  ? 15 LEU A CD1  6  
ATOM 11326 C CD2  . LEU A 1 15 ? 1.809   17.310  -11.878 1.00 1.76  ? 15 LEU A CD2  6  
ATOM 11327 H H    . LEU A 1 15 ? 3.345   13.565  -11.128 1.00 0.35  ? 15 LEU A H    6  
ATOM 11328 H HA   . LEU A 1 15 ? 3.176   16.106  -9.733  1.00 0.51  ? 15 LEU A HA   6  
ATOM 11329 H HB2  . LEU A 1 15 ? 0.999   14.214  -10.682 1.00 1.12  ? 15 LEU A HB2  6  
ATOM 11330 H HB3  . LEU A 1 15 ? 0.715   15.844  -10.067 1.00 0.90  ? 15 LEU A HB3  6  
ATOM 11331 H HG   . LEU A 1 15 ? 2.653   15.386  -12.330 1.00 1.32  ? 15 LEU A HG   6  
ATOM 11332 H HD11 . LEU A 1 15 ? 0.121   14.490  -12.601 1.00 1.29  ? 15 LEU A HD11 6  
ATOM 11333 H HD12 . LEU A 1 15 ? -0.137  16.193  -12.978 1.00 1.44  ? 15 LEU A HD12 6  
ATOM 11334 H HD13 . LEU A 1 15 ? 1.011   15.244  -13.923 1.00 1.31  ? 15 LEU A HD13 6  
ATOM 11335 H HD21 . LEU A 1 15 ? 2.457   17.583  -11.059 1.00 2.29  ? 15 LEU A HD21 6  
ATOM 11336 H HD22 . LEU A 1 15 ? 2.212   17.701  -12.801 1.00 2.30  ? 15 LEU A HD22 6  
ATOM 11337 H HD23 . LEU A 1 15 ? 0.825   17.723  -11.711 1.00 2.30  ? 15 LEU A HD23 6  
ATOM 11338 N N    . GLN A 1 16 ? 2.066   15.555  -7.475  1.00 0.47  ? 16 GLN A N    6  
ATOM 11339 C CA   . GLN A 1 16 ? 1.781   15.171  -6.064  1.00 0.41  ? 16 GLN A CA   6  
ATOM 11340 C C    . GLN A 1 16 ? 0.302   14.819  -5.901  1.00 0.39  ? 16 GLN A C    6  
ATOM 11341 O O    . GLN A 1 16 ? -0.431  15.467  -5.177  1.00 0.47  ? 16 GLN A O    6  
ATOM 11342 C CB   . GLN A 1 16 ? 2.153   16.332  -5.135  1.00 0.48  ? 16 GLN A CB   6  
ATOM 11343 C CG   . GLN A 1 16 ? 3.627   16.218  -4.737  1.00 0.60  ? 16 GLN A CG   6  
ATOM 11344 C CD   . GLN A 1 16 ? 4.501   16.911  -5.787  1.00 0.77  ? 16 GLN A CD   6  
ATOM 11345 O OE1  . GLN A 1 16 ? 5.242   16.264  -6.500  1.00 1.48  ? 16 GLN A OE1  6  
ATOM 11346 N NE2  . GLN A 1 16 ? 4.447   18.211  -5.912  1.00 1.31  ? 16 GLN A NE2  6  
ATOM 11347 H H    . GLN A 1 16 ? 1.999   16.487  -7.745  1.00 0.72  ? 16 GLN A H    6  
ATOM 11348 H HA   . GLN A 1 16 ? 2.372   14.300  -5.807  1.00 0.43  ? 16 GLN A HA   6  
ATOM 11349 H HB2  . GLN A 1 16 ? 1.987   17.268  -5.647  1.00 0.51  ? 16 GLN A HB2  6  
ATOM 11350 H HB3  . GLN A 1 16 ? 1.540   16.293  -4.249  1.00 0.49  ? 16 GLN A HB3  6  
ATOM 11351 H HG2  . GLN A 1 16 ? 3.776   16.691  -3.777  1.00 0.75  ? 16 GLN A HG2  6  
ATOM 11352 H HG3  . GLN A 1 16 ? 3.905   15.176  -4.672  1.00 0.72  ? 16 GLN A HG3  6  
ATOM 11353 H HE21 . GLN A 1 16 ? 3.851   18.735  -5.336  1.00 1.98  ? 16 GLN A HE21 6  
ATOM 11354 H HE22 . GLN A 1 16 ? 5.002   18.662  -6.582  1.00 1.46  ? 16 GLN A HE22 6  
ATOM 11355 N N    . GLY A 1 17 ? -0.126  13.777  -6.559  1.00 0.36  ? 17 GLY A N    6  
ATOM 11356 C CA   . GLY A 1 17 ? -1.539  13.328  -6.438  1.00 0.45  ? 17 GLY A CA   6  
ATOM 11357 C C    . GLY A 1 17 ? -2.487  14.378  -6.999  1.00 0.41  ? 17 GLY A C    6  
ATOM 11358 O O    . GLY A 1 17 ? -3.011  15.203  -6.273  1.00 0.57  ? 17 GLY A O    6  
ATOM 11359 H H    . GLY A 1 17 ? 0.495   13.274  -7.124  1.00 0.34  ? 17 GLY A H    6  
ATOM 11360 H HA2  . GLY A 1 17 ? -1.666  12.406  -6.984  1.00 0.56  ? 17 GLY A HA2  6  
ATOM 11361 H HA3  . GLY A 1 17 ? -1.773  13.160  -5.398  1.00 0.59  ? 17 GLY A HA3  6  
ATOM 11362 N N    . ILE A 1 18 ? -2.738  14.333  -8.279  1.00 0.39  ? 18 ILE A N    6  
ATOM 11363 C CA   . ILE A 1 18 ? -3.683  15.308  -8.881  1.00 0.49  ? 18 ILE A CA   6  
ATOM 11364 C C    . ILE A 1 18 ? -5.103  14.802  -8.624  1.00 0.50  ? 18 ILE A C    6  
ATOM 11365 O O    . ILE A 1 18 ? -5.306  13.852  -7.887  1.00 0.72  ? 18 ILE A O    6  
ATOM 11366 C CB   . ILE A 1 18 ? -3.401  15.499  -10.391 1.00 0.67  ? 18 ILE A CB   6  
ATOM 11367 C CG1  . ILE A 1 18 ? -4.137  14.455  -11.243 1.00 0.72  ? 18 ILE A CG1  6  
ATOM 11368 C CG2  . ILE A 1 18 ? -1.895  15.409  -10.664 1.00 0.74  ? 18 ILE A CG2  6  
ATOM 11369 C CD1  . ILE A 1 18 ? -3.792  13.056  -10.757 1.00 0.66  ? 18 ILE A CD1  6  
ATOM 11370 H H    . ILE A 1 18 ? -2.328  13.643  -8.834  1.00 0.45  ? 18 ILE A H    6  
ATOM 11371 H HA   . ILE A 1 18 ? -3.570  16.251  -8.388  1.00 0.54  ? 18 ILE A HA   6  
ATOM 11372 H HB   . ILE A 1 18 ? -3.737  16.480  -10.673 1.00 0.79  ? 18 ILE A HB   6  
ATOM 11373 H HG12 . ILE A 1 18 ? -5.201  14.612  -11.164 1.00 0.70  ? 18 ILE A HG12 6  
ATOM 11374 H HG13 . ILE A 1 18 ? -3.835  14.559  -12.275 1.00 0.91  ? 18 ILE A HG13 6  
ATOM 11375 H HG21 . ILE A 1 18 ? -1.352  15.836  -9.834  1.00 1.17  ? 18 ILE A HG21 6  
ATOM 11376 H HG22 . ILE A 1 18 ? -1.610  14.375  -10.787 1.00 1.14  ? 18 ILE A HG22 6  
ATOM 11377 H HG23 . ILE A 1 18 ? -1.661  15.957  -11.565 1.00 1.33  ? 18 ILE A HG23 6  
ATOM 11378 H HD11 . ILE A 1 18 ? -2.720  12.956  -10.692 1.00 1.18  ? 18 ILE A HD11 6  
ATOM 11379 H HD12 . ILE A 1 18 ? -4.229  12.900  -9.782  1.00 1.04  ? 18 ILE A HD12 6  
ATOM 11380 H HD13 . ILE A 1 18 ? -4.184  12.332  -11.450 1.00 1.35  ? 18 ILE A HD13 6  
ATOM 11381 N N    . HIS A 1 19 ? -6.086  15.420  -9.202  1.00 0.45  ? 19 HIS A N    6  
ATOM 11382 C CA   . HIS A 1 19 ? -7.477  14.960  -8.960  1.00 0.47  ? 19 HIS A CA   6  
ATOM 11383 C C    . HIS A 1 19 ? -7.849  13.927  -10.047 1.00 0.39  ? 19 HIS A C    6  
ATOM 11384 O O    . HIS A 1 19 ? -7.432  14.065  -11.183 1.00 0.35  ? 19 HIS A O    6  
ATOM 11385 C CB   . HIS A 1 19 ? -8.416  16.186  -8.947  1.00 0.54  ? 19 HIS A CB   6  
ATOM 11386 C CG   . HIS A 1 19 ? -9.496  16.071  -9.981  1.00 0.60  ? 19 HIS A CG   6  
ATOM 11387 N ND1  . HIS A 1 19 ? -10.832 15.963  -9.644  1.00 0.75  ? 19 HIS A ND1  6  
ATOM 11388 C CD2  . HIS A 1 19 ? -9.449  16.062  -11.348 1.00 0.60  ? 19 HIS A CD2  6  
ATOM 11389 C CE1  . HIS A 1 19 ? -11.530 15.894  -10.786 1.00 0.81  ? 19 HIS A CE1  6  
ATOM 11390 N NE2  . HIS A 1 19 ? -10.735 15.952  -11.859 1.00 0.74  ? 19 HIS A NE2  6  
ATOM 11391 H H    . HIS A 1 19 ? -5.907  16.180  -9.790  1.00 0.55  ? 19 HIS A H    6  
ATOM 11392 H HA   . HIS A 1 19 ? -7.506  14.486  -7.993  1.00 0.50  ? 19 HIS A HA   6  
ATOM 11393 H HB2  . HIS A 1 19 ? -8.872  16.268  -7.973  1.00 0.64  ? 19 HIS A HB2  6  
ATOM 11394 H HB3  . HIS A 1 19 ? -7.835  17.077  -9.139  1.00 0.52  ? 19 HIS A HB3  6  
ATOM 11395 H HD1  . HIS A 1 19 ? -11.201 15.941  -8.736  1.00 0.84  ? 19 HIS A HD1  6  
ATOM 11396 H HD2  . HIS A 1 19 ? -8.543  16.100  -11.932 1.00 0.55  ? 19 HIS A HD2  6  
ATOM 11397 H HE1  . HIS A 1 19 ? -12.601 15.782  -10.831 1.00 0.93  ? 19 HIS A HE1  6  
ATOM 11398 N N    . PRO A 1 20 ? -8.595  12.905  -9.667  1.00 0.39  ? 20 PRO A N    6  
ATOM 11399 C CA   . PRO A 1 20 ? -8.995  11.836  -10.599 1.00 0.35  ? 20 PRO A CA   6  
ATOM 11400 C C    . PRO A 1 20 ? -10.095 12.323  -11.562 1.00 0.37  ? 20 PRO A C    6  
ATOM 11401 O O    . PRO A 1 20 ? -9.873  13.269  -12.293 1.00 0.43  ? 20 PRO A O    6  
ATOM 11402 C CB   . PRO A 1 20 ? -9.452  10.703  -9.672  1.00 0.40  ? 20 PRO A CB   6  
ATOM 11403 C CG   . PRO A 1 20 ? -9.835  11.368  -8.334  1.00 0.47  ? 20 PRO A CG   6  
ATOM 11404 C CD   . PRO A 1 20 ? -9.099  12.714  -8.290  1.00 0.46  ? 20 PRO A CD   6  
ATOM 11405 H HA   . PRO A 1 20 ? -8.139  11.511  -11.170 1.00 0.32  ? 20 PRO A HA   6  
ATOM 11406 H HB2  . PRO A 1 20 ? -10.295 10.184  -10.090 1.00 0.40  ? 20 PRO A HB2  6  
ATOM 11407 H HB3  . PRO A 1 20 ? -8.639  10.015  -9.510  1.00 0.40  ? 20 PRO A HB3  6  
ATOM 11408 H HG2  . PRO A 1 20 ? -10.902 11.527  -8.293  1.00 0.50  ? 20 PRO A HG2  6  
ATOM 11409 H HG3  . PRO A 1 20 ? -9.516  10.753  -7.510  1.00 0.52  ? 20 PRO A HG3  6  
ATOM 11410 H HD2  . PRO A 1 20 ? -9.785  13.501  -8.022  1.00 0.50  ? 20 PRO A HD2  6  
ATOM 11411 H HD3  . PRO A 1 20 ? -8.279  12.664  -7.595  1.00 0.47  ? 20 PRO A HD3  6  
ATOM 11412 N N    . LYS A 1 21 ? -11.248 11.668  -11.625 1.00 0.38  ? 21 LYS A N    6  
ATOM 11413 C CA   . LYS A 1 21 ? -12.318 12.070  -12.602 1.00 0.40  ? 21 LYS A CA   6  
ATOM 11414 C C    . LYS A 1 21 ? -11.876 11.607  -13.998 1.00 0.38  ? 21 LYS A C    6  
ATOM 11415 O O    . LYS A 1 21 ? -12.606 10.934  -14.701 1.00 0.42  ? 21 LYS A O    6  
ATOM 11416 C CB   . LYS A 1 21 ? -12.543 13.588  -12.587 1.00 0.42  ? 21 LYS A CB   6  
ATOM 11417 C CG   . LYS A 1 21 ? -13.912 13.911  -13.192 1.00 0.51  ? 21 LYS A CG   6  
ATOM 11418 C CD   . LYS A 1 21 ? -14.366 15.302  -12.735 1.00 0.98  ? 21 LYS A CD   6  
ATOM 11419 C CE   . LYS A 1 21 ? -15.125 15.188  -11.408 1.00 1.47  ? 21 LYS A CE   6  
ATOM 11420 N NZ   . LYS A 1 21 ? -16.540 14.800  -11.673 1.00 2.14  ? 21 LYS A NZ   6  
ATOM 11421 H H    . LYS A 1 21 ? -11.396 10.885  -11.065 1.00 0.41  ? 21 LYS A H    6  
ATOM 11422 H HA   . LYS A 1 21 ? -13.236 11.568  -12.342 1.00 0.43  ? 21 LYS A HA   6  
ATOM 11423 H HB2  . LYS A 1 21 ? -12.507 13.942  -11.568 1.00 0.42  ? 21 LYS A HB2  6  
ATOM 11424 H HB3  . LYS A 1 21 ? -11.773 14.073  -13.166 1.00 0.40  ? 21 LYS A HB3  6  
ATOM 11425 H HG2  . LYS A 1 21 ? -13.841 13.891  -14.270 1.00 0.97  ? 21 LYS A HG2  6  
ATOM 11426 H HG3  . LYS A 1 21 ? -14.631 13.175  -12.865 1.00 0.86  ? 21 LYS A HG3  6  
ATOM 11427 H HD2  . LYS A 1 21 ? -13.503 15.938  -12.604 1.00 1.62  ? 21 LYS A HD2  6  
ATOM 11428 H HD3  . LYS A 1 21 ? -15.018 15.730  -13.483 1.00 1.69  ? 21 LYS A HD3  6  
ATOM 11429 H HE2  . LYS A 1 21 ? -14.657 14.436  -10.789 1.00 1.83  ? 21 LYS A HE2  6  
ATOM 11430 H HE3  . LYS A 1 21 ? -15.101 16.139  -10.898 1.00 1.91  ? 21 LYS A HE3  6  
ATOM 11431 H HZ1  . LYS A 1 21 ? -16.989 15.520  -12.276 1.00 2.71  ? 21 LYS A HZ1  6  
ATOM 11432 H HZ2  . LYS A 1 21 ? -16.565 13.880  -12.155 1.00 2.51  ? 21 LYS A HZ2  6  
ATOM 11433 H HZ3  . LYS A 1 21 ? -17.055 14.731  -10.773 1.00 2.32  ? 21 LYS A HZ3  6  
ATOM 11434 N N    . ASN A 1 22 ? -10.660 11.925  -14.370 1.00 0.36  ? 22 ASN A N    6  
ATOM 11435 C CA   . ASN A 1 22 ? -10.102 11.487  -15.666 1.00 0.36  ? 22 ASN A CA   6  
ATOM 11436 C C    . ASN A 1 22 ? -9.245  10.260  -15.373 1.00 0.34  ? 22 ASN A C    6  
ATOM 11437 O O    . ASN A 1 22 ? -9.402  9.209   -15.958 1.00 0.36  ? 22 ASN A O    6  
ATOM 11438 C CB   . ASN A 1 22 ? -9.198  12.587  -16.232 1.00 0.36  ? 22 ASN A CB   6  
ATOM 11439 C CG   . ASN A 1 22 ? -9.756  13.974  -15.895 1.00 0.38  ? 22 ASN A CG   6  
ATOM 11440 O OD1  . ASN A 1 22 ? -10.697 14.432  -16.511 1.00 0.42  ? 22 ASN A OD1  6  
ATOM 11441 N ND2  . ASN A 1 22 ? -9.203  14.664  -14.932 1.00 0.37  ? 22 ASN A ND2  6  
ATOM 11442 H H    . ASN A 1 22 ? -10.086 12.432  -13.769 1.00 0.35  ? 22 ASN A H    6  
ATOM 11443 H HA   . ASN A 1 22 ? -10.892 11.245  -16.360 1.00 0.39  ? 22 ASN A HA   6  
ATOM 11444 H HB2  . ASN A 1 22 ? -8.212  12.491  -15.803 1.00 0.33  ? 22 ASN A HB2  6  
ATOM 11445 H HB3  . ASN A 1 22 ? -9.130  12.476  -17.293 1.00 0.38  ? 22 ASN A HB3  6  
ATOM 11446 H HD21 . ASN A 1 22 ? -8.442  14.292  -14.436 1.00 0.34  ? 22 ASN A HD21 6  
ATOM 11447 H HD22 . ASN A 1 22 ? -9.547  15.552  -14.706 1.00 0.39  ? 22 ASN A HD22 6  
ATOM 11448 N N    . ILE A 1 23 ? -8.353  10.412  -14.431 1.00 0.31  ? 23 ILE A N    6  
ATOM 11449 C CA   . ILE A 1 23 ? -7.448  9.317   -14.007 1.00 0.30  ? 23 ILE A CA   6  
ATOM 11450 C C    . ILE A 1 23 ? -8.245  8.011   -13.866 1.00 0.34  ? 23 ILE A C    6  
ATOM 11451 O O    . ILE A 1 23 ? -9.055  7.854   -12.970 1.00 0.37  ? 23 ILE A O    6  
ATOM 11452 C CB   . ILE A 1 23 ? -6.855  9.758   -12.665 1.00 0.29  ? 23 ILE A CB   6  
ATOM 11453 C CG1  . ILE A 1 23 ? -5.590  10.581  -12.914 1.00 0.27  ? 23 ILE A CG1  6  
ATOM 11454 C CG2  . ILE A 1 23 ? -6.521  8.557   -11.795 1.00 0.33  ? 23 ILE A CG2  6  
ATOM 11455 C CD1  . ILE A 1 23 ? -5.979  11.950  -13.476 1.00 0.26  ? 23 ILE A CD1  6  
ATOM 11456 H H    . ILE A 1 23 ? -8.287  11.273  -13.975 1.00 0.31  ? 23 ILE A H    6  
ATOM 11457 H HA   . ILE A 1 23 ? -6.656  9.189   -14.735 1.00 0.29  ? 23 ILE A HA   6  
ATOM 11458 H HB   . ILE A 1 23 ? -7.580  10.374  -12.156 1.00 0.31  ? 23 ILE A HB   6  
ATOM 11459 H HG12 . ILE A 1 23 ? -5.056  10.710  -11.984 1.00 0.29  ? 23 ILE A HG12 6  
ATOM 11460 H HG13 . ILE A 1 23 ? -4.961  10.068  -13.624 1.00 0.26  ? 23 ILE A HG13 6  
ATOM 11461 H HG21 . ILE A 1 23 ? -6.131  7.765   -12.413 1.00 1.00  ? 23 ILE A HG21 6  
ATOM 11462 H HG22 . ILE A 1 23 ? -5.788  8.843   -11.059 1.00 1.10  ? 23 ILE A HG22 6  
ATOM 11463 H HG23 . ILE A 1 23 ? -7.420  8.223   -11.298 1.00 1.08  ? 23 ILE A HG23 6  
ATOM 11464 H HD11 . ILE A 1 23 ? -6.794  12.358  -12.896 1.00 1.04  ? 23 ILE A HD11 6  
ATOM 11465 H HD12 . ILE A 1 23 ? -5.131  12.616  -13.424 1.00 1.03  ? 23 ILE A HD12 6  
ATOM 11466 H HD13 . ILE A 1 23 ? -6.290  11.841  -14.504 1.00 0.97  ? 23 ILE A HD13 6  
ATOM 11467 N N    . GLN A 1 24 ? -8.034  7.090   -14.769 1.00 0.36  ? 24 GLN A N    6  
ATOM 11468 C CA   . GLN A 1 24 ? -8.764  5.807   -14.745 1.00 0.42  ? 24 GLN A CA   6  
ATOM 11469 C C    . GLN A 1 24 ? -7.851  4.677   -14.251 1.00 0.37  ? 24 GLN A C    6  
ATOM 11470 O O    . GLN A 1 24 ? -8.331  3.658   -13.792 1.00 0.39  ? 24 GLN A O    6  
ATOM 11471 C CB   . GLN A 1 24 ? -9.206  5.524   -16.174 1.00 0.48  ? 24 GLN A CB   6  
ATOM 11472 C CG   . GLN A 1 24 ? -10.723 5.345   -16.233 1.00 0.57  ? 24 GLN A CG   6  
ATOM 11473 C CD   . GLN A 1 24 ? -11.104 4.648   -17.543 1.00 1.16  ? 24 GLN A CD   6  
ATOM 11474 O OE1  . GLN A 1 24 ? -10.876 5.175   -18.614 1.00 1.82  ? 24 GLN A OE1  6  
ATOM 11475 N NE2  . GLN A 1 24 ? -11.680 3.477   -17.503 1.00 1.58  ? 24 GLN A NE2  6  
ATOM 11476 H H    . GLN A 1 24 ? -7.396  7.248   -15.496 1.00 0.36  ? 24 GLN A H    6  
ATOM 11477 H HA   . GLN A 1 24 ? -9.634  5.879   -14.104 1.00 0.46  ? 24 GLN A HA   6  
ATOM 11478 H HB2  . GLN A 1 24 ? -8.923  6.359   -16.800 1.00 0.48  ? 24 GLN A HB2  6  
ATOM 11479 H HB3  . GLN A 1 24 ? -8.711  4.645   -16.522 1.00 0.48  ? 24 GLN A HB3  6  
ATOM 11480 H HG2  . GLN A 1 24 ? -11.049 4.744   -15.396 1.00 0.66  ? 24 GLN A HG2  6  
ATOM 11481 H HG3  . GLN A 1 24 ? -11.202 6.311   -16.191 1.00 0.91  ? 24 GLN A HG3  6  
ATOM 11482 H HE21 . GLN A 1 24 ? -11.866 3.050   -16.640 1.00 1.80  ? 24 GLN A HE21 6  
ATOM 11483 H HE22 . GLN A 1 24 ? -11.926 3.023   -18.336 1.00 2.04  ? 24 GLN A HE22 6  
ATOM 11484 N N    . SER A 1 25 ? -6.547  4.837   -14.339 1.00 0.33  ? 25 SER A N    6  
ATOM 11485 C CA   . SER A 1 25 ? -5.641  3.743   -13.872 1.00 0.29  ? 25 SER A CA   6  
ATOM 11486 C C    . SER A 1 25 ? -4.209  4.249   -13.684 1.00 0.27  ? 25 SER A C    6  
ATOM 11487 O O    . SER A 1 25 ? -3.911  5.403   -13.911 1.00 0.29  ? 25 SER A O    6  
ATOM 11488 C CB   . SER A 1 25 ? -5.625  2.619   -14.896 1.00 0.31  ? 25 SER A CB   6  
ATOM 11489 O OG   . SER A 1 25 ? -5.222  3.128   -16.164 1.00 0.34  ? 25 SER A OG   6  
ATOM 11490 H H    . SER A 1 25 ? -6.167  5.666   -14.711 1.00 0.33  ? 25 SER A H    6  
ATOM 11491 H HA   . SER A 1 25 ? -6.002  3.356   -12.936 1.00 0.29  ? 25 SER A HA   6  
ATOM 11492 H HB2  . SER A 1 25 ? -4.925  1.873   -14.572 1.00 0.31  ? 25 SER A HB2  6  
ATOM 11493 H HB3  . SER A 1 25 ? -6.607  2.182   -14.964 1.00 0.30  ? 25 SER A HB3  6  
ATOM 11494 H HG   . SER A 1 25 ? -4.312  2.861   -16.314 1.00 0.78  ? 25 SER A HG   6  
ATOM 11495 N N    . VAL A 1 26 ? -3.327  3.372   -13.269 1.00 0.25  ? 26 VAL A N    6  
ATOM 11496 C CA   . VAL A 1 26 ? -1.901  3.753   -13.063 1.00 0.24  ? 26 VAL A CA   6  
ATOM 11497 C C    . VAL A 1 26 ? -1.017  2.512   -13.220 1.00 0.25  ? 26 VAL A C    6  
ATOM 11498 O O    . VAL A 1 26 ? -1.464  1.390   -13.072 1.00 0.26  ? 26 VAL A O    6  
ATOM 11499 C CB   . VAL A 1 26 ? -1.691  4.348   -11.661 1.00 0.23  ? 26 VAL A CB   6  
ATOM 11500 C CG1  . VAL A 1 26 ? -2.574  3.637   -10.651 1.00 0.24  ? 26 VAL A CG1  6  
ATOM 11501 C CG2  . VAL A 1 26 ? -0.222  4.194   -11.241 1.00 0.26  ? 26 VAL A CG2  6  
ATOM 11502 H H    . VAL A 1 26 ? -3.608  2.453   -13.091 1.00 0.25  ? 26 VAL A H    6  
ATOM 11503 H HA   . VAL A 1 26 ? -1.626  4.486   -13.805 1.00 0.24  ? 26 VAL A HA   6  
ATOM 11504 H HB   . VAL A 1 26 ? -1.950  5.384   -11.674 1.00 0.25  ? 26 VAL A HB   6  
ATOM 11505 H HG11 . VAL A 1 26 ? -3.520  3.398   -11.111 1.00 1.00  ? 26 VAL A HG11 6  
ATOM 11506 H HG12 . VAL A 1 26 ? -2.089  2.732   -10.328 1.00 1.10  ? 26 VAL A HG12 6  
ATOM 11507 H HG13 . VAL A 1 26 ? -2.737  4.286   -9.805  1.00 1.01  ? 26 VAL A HG13 6  
ATOM 11508 H HG21 . VAL A 1 26 ? 0.414   4.665   -11.977 1.00 1.05  ? 26 VAL A HG21 6  
ATOM 11509 H HG22 . VAL A 1 26 ? -0.068  4.656   -10.283 1.00 1.03  ? 26 VAL A HG22 6  
ATOM 11510 H HG23 . VAL A 1 26 ? 0.025   3.142   -11.178 1.00 1.06  ? 26 VAL A HG23 6  
ATOM 11511 N N    . ASN A 1 27 ? 0.242   2.722   -13.500 1.00 0.25  ? 27 ASN A N    6  
ATOM 11512 C CA   . ASN A 1 27 ? 1.181   1.594   -13.653 1.00 0.27  ? 27 ASN A CA   6  
ATOM 11513 C C    . ASN A 1 27 ? 2.449   1.865   -12.849 1.00 0.25  ? 27 ASN A C    6  
ATOM 11514 O O    . ASN A 1 27 ? 3.067   2.905   -12.969 1.00 0.42  ? 27 ASN A O    6  
ATOM 11515 C CB   . ASN A 1 27 ? 1.542   1.377   -15.116 1.00 0.30  ? 27 ASN A CB   6  
ATOM 11516 C CG   . ASN A 1 27 ? 0.810   2.360   -16.047 1.00 0.57  ? 27 ASN A CG   6  
ATOM 11517 O OD1  . ASN A 1 27 ? -0.405  2.384   -16.098 1.00 0.95  ? 27 ASN A OD1  6  
ATOM 11518 N ND2  . ASN A 1 27 ? 1.505   3.160   -16.807 1.00 0.72  ? 27 ASN A ND2  6  
ATOM 11519 H H    . ASN A 1 27 ? 0.568   3.631   -13.604 1.00 0.26  ? 27 ASN A H    6  
ATOM 11520 H HA   . ASN A 1 27 ? 0.717   0.707   -13.273 1.00 0.30  ? 27 ASN A HA   6  
ATOM 11521 H HB2  . ASN A 1 27 ? 2.608   1.483   -15.242 1.00 0.45  ? 27 ASN A HB2  6  
ATOM 11522 H HB3  . ASN A 1 27 ? 1.253   0.389   -15.365 1.00 0.51  ? 27 ASN A HB3  6  
ATOM 11523 H HD21 . ASN A 1 27 ? 2.484   3.135   -16.783 1.00 0.75  ? 27 ASN A HD21 6  
ATOM 11524 H HD22 . ASN A 1 27 ? 1.047   3.787   -17.404 1.00 0.99  ? 27 ASN A HD22 6  
ATOM 11525 N N    . VAL A 1 28 ? 2.837   0.922   -12.035 1.00 0.28  ? 28 VAL A N    6  
ATOM 11526 C CA   . VAL A 1 28 ? 4.068   1.097   -11.207 1.00 0.28  ? 28 VAL A CA   6  
ATOM 11527 C C    . VAL A 1 28 ? 5.114   0.053   -11.611 1.00 0.31  ? 28 VAL A C    6  
ATOM 11528 O O    . VAL A 1 28 ? 4.847   -1.131  -11.624 1.00 0.33  ? 28 VAL A O    6  
ATOM 11529 C CB   . VAL A 1 28 ? 3.716   0.954   -9.717  1.00 0.34  ? 28 VAL A CB   6  
ATOM 11530 C CG1  . VAL A 1 28 ? 3.120   -0.427  -9.441  1.00 0.55  ? 28 VAL A CG1  6  
ATOM 11531 C CG2  . VAL A 1 28 ? 4.975   1.140   -8.863  1.00 0.71  ? 28 VAL A CG2  6  
ATOM 11532 H H    . VAL A 1 28 ? 2.315   0.093   -11.973 1.00 0.43  ? 28 VAL A H    6  
ATOM 11533 H HA   . VAL A 1 28 ? 4.468   2.085   -11.383 1.00 0.28  ? 28 VAL A HA   6  
ATOM 11534 H HB   . VAL A 1 28 ? 2.992   1.705   -9.454  1.00 0.31  ? 28 VAL A HB   6  
ATOM 11535 H HG11 . VAL A 1 28 ? 2.566   -0.760  -10.305 1.00 1.11  ? 28 VAL A HG11 6  
ATOM 11536 H HG12 . VAL A 1 28 ? 3.915   -1.127  -9.231  1.00 1.11  ? 28 VAL A HG12 6  
ATOM 11537 H HG13 . VAL A 1 28 ? 2.459   -0.367  -8.591  1.00 1.30  ? 28 VAL A HG13 6  
ATOM 11538 H HG21 . VAL A 1 28 ? 5.489   2.039   -9.168  1.00 1.22  ? 28 VAL A HG21 6  
ATOM 11539 H HG22 . VAL A 1 28 ? 4.695   1.222   -7.824  1.00 1.37  ? 28 VAL A HG22 6  
ATOM 11540 H HG23 . VAL A 1 28 ? 5.628   0.290   -8.993  1.00 1.24  ? 28 VAL A HG23 6  
ATOM 11541 N N    . LYS A 1 29 ? 6.301   0.498   -11.939 1.00 0.35  ? 29 LYS A N    6  
ATOM 11542 C CA   . LYS A 1 29 ? 7.389   -0.439  -12.355 1.00 0.42  ? 29 LYS A CA   6  
ATOM 11543 C C    . LYS A 1 29 ? 8.670   -0.116  -11.571 1.00 0.37  ? 29 LYS A C    6  
ATOM 11544 O O    . LYS A 1 29 ? 8.839   0.980   -11.064 1.00 0.35  ? 29 LYS A O    6  
ATOM 11545 C CB   . LYS A 1 29 ? 7.647   -0.269  -13.861 1.00 0.52  ? 29 LYS A CB   6  
ATOM 11546 C CG   . LYS A 1 29 ? 8.528   -1.411  -14.380 1.00 1.08  ? 29 LYS A CG   6  
ATOM 11547 C CD   . LYS A 1 29 ? 8.046   -1.848  -15.766 1.00 0.83  ? 29 LYS A CD   6  
ATOM 11548 C CE   . LYS A 1 29 ? 8.502   -3.285  -16.036 1.00 0.76  ? 29 LYS A CE   6  
ATOM 11549 N NZ   . LYS A 1 29 ? 8.748   -3.469  -17.495 1.00 1.23  ? 29 LYS A NZ   6  
ATOM 11550 H H    . LYS A 1 29 ? 6.477   1.458   -11.913 1.00 0.35  ? 29 LYS A H    6  
ATOM 11551 H HA   . LYS A 1 29 ? 7.089   -1.456  -12.152 1.00 0.52  ? 29 LYS A HA   6  
ATOM 11552 H HB2  . LYS A 1 29 ? 6.703   -0.276  -14.387 1.00 1.12  ? 29 LYS A HB2  6  
ATOM 11553 H HB3  . LYS A 1 29 ? 8.145   0.672   -14.035 1.00 0.82  ? 29 LYS A HB3  6  
ATOM 11554 H HG2  . LYS A 1 29 ? 9.551   -1.071  -14.447 1.00 1.70  ? 29 LYS A HG2  6  
ATOM 11555 H HG3  . LYS A 1 29 ? 8.470   -2.248  -13.702 1.00 2.02  ? 29 LYS A HG3  6  
ATOM 11556 H HD2  . LYS A 1 29 ? 6.967   -1.799  -15.805 1.00 1.42  ? 29 LYS A HD2  6  
ATOM 11557 H HD3  . LYS A 1 29 ? 8.465   -1.193  -16.516 1.00 1.54  ? 29 LYS A HD3  6  
ATOM 11558 H HE2  . LYS A 1 29 ? 9.413   -3.482  -15.492 1.00 1.30  ? 29 LYS A HE2  6  
ATOM 11559 H HE3  . LYS A 1 29 ? 7.735   -3.972  -15.712 1.00 1.09  ? 29 LYS A HE3  6  
ATOM 11560 H HZ1  . LYS A 1 29 ? 9.450   -2.773  -17.821 1.00 1.71  ? 29 LYS A HZ1  6  
ATOM 11561 H HZ2  . LYS A 1 29 ? 9.109   -4.428  -17.668 1.00 1.61  ? 29 LYS A HZ2  6  
ATOM 11562 H HZ3  . LYS A 1 29 ? 7.858   -3.334  -18.017 1.00 1.74  ? 29 LYS A HZ3  6  
ATOM 11563 N N    . SER A 1 30 ? 9.567   -1.065  -11.466 1.00 0.38  ? 30 SER A N    6  
ATOM 11564 C CA   . SER A 1 30 ? 10.838  -0.831  -10.717 1.00 0.39  ? 30 SER A CA   6  
ATOM 11565 C C    . SER A 1 30 ? 11.878  -0.159  -11.650 1.00 0.34  ? 30 SER A C    6  
ATOM 11566 O O    . SER A 1 30 ? 11.629  -0.005  -12.831 1.00 0.35  ? 30 SER A O    6  
ATOM 11567 C CB   . SER A 1 30 ? 11.355  -2.177  -10.204 1.00 0.52  ? 30 SER A CB   6  
ATOM 11568 O OG   . SER A 1 30 ? 11.522  -2.110  -8.794  1.00 1.63  ? 30 SER A OG   6  
ATOM 11569 H H    . SER A 1 30 ? 9.401   -1.939  -11.877 1.00 0.43  ? 30 SER A H    6  
ATOM 11570 H HA   . SER A 1 30 ? 10.638  -0.181  -9.879  1.00 0.41  ? 30 SER A HA   6  
ATOM 11571 H HB2  . SER A 1 30 ? 10.637  -2.949  -10.437 1.00 0.91  ? 30 SER A HB2  6  
ATOM 11572 H HB3  . SER A 1 30 ? 12.296  -2.408  -10.681 1.00 0.92  ? 30 SER A HB3  6  
ATOM 11573 H HG   . SER A 1 30 ? 12.019  -2.883  -8.518  1.00 2.01  ? 30 SER A HG   6  
ATOM 11574 N N    . PRO A 1 31 ? 13.006  0.245   -11.086 1.00 0.39  ? 31 PRO A N    6  
ATOM 11575 C CA   . PRO A 1 31 ? 14.086  0.935   -11.843 1.00 0.44  ? 31 PRO A CA   6  
ATOM 11576 C C    . PRO A 1 31 ? 14.910  -0.037  -12.708 1.00 0.52  ? 31 PRO A C    6  
ATOM 11577 O O    . PRO A 1 31 ? 14.570  -1.197  -12.849 1.00 0.58  ? 31 PRO A O    6  
ATOM 11578 C CB   . PRO A 1 31 ? 14.956  1.539   -10.741 1.00 0.52  ? 31 PRO A CB   6  
ATOM 11579 C CG   . PRO A 1 31 ? 14.688  0.716   -9.462  1.00 0.56  ? 31 PRO A CG   6  
ATOM 11580 C CD   . PRO A 1 31 ? 13.315  0.052   -9.650  1.00 0.49  ? 31 PRO A CD   6  
ATOM 11581 H HA   . PRO A 1 31 ? 13.675  1.723   -12.452 1.00 0.44  ? 31 PRO A HA   6  
ATOM 11582 H HB2  . PRO A 1 31 ? 16.000  1.479   -11.014 1.00 0.59  ? 31 PRO A HB2  6  
ATOM 11583 H HB3  . PRO A 1 31 ? 14.673  2.564   -10.572 1.00 0.56  ? 31 PRO A HB3  6  
ATOM 11584 H HG2  . PRO A 1 31 ? 15.454  -0.038  -9.342  1.00 0.63  ? 31 PRO A HG2  6  
ATOM 11585 H HG3  . PRO A 1 31 ? 14.665  1.364   -8.600  1.00 0.64  ? 31 PRO A HG3  6  
ATOM 11586 H HD2  . PRO A 1 31 ? 13.373  -1.001  -9.410  1.00 0.54  ? 31 PRO A HD2  6  
ATOM 11587 H HD3  . PRO A 1 31 ? 12.575  0.543   -9.038  1.00 0.52  ? 31 PRO A HD3  6  
ATOM 11588 N N    . GLY A 1 32 ? 15.999  0.439   -13.289 1.00 0.60  ? 32 GLY A N    6  
ATOM 11589 C CA   . GLY A 1 32 ? 16.846  -0.452  -14.144 1.00 0.73  ? 32 GLY A CA   6  
ATOM 11590 C C    . GLY A 1 32 ? 18.084  0.309   -14.660 1.00 0.91  ? 32 GLY A C    6  
ATOM 11591 O O    . GLY A 1 32 ? 19.093  0.363   -13.982 1.00 1.05  ? 32 GLY A O    6  
ATOM 11592 H H    . GLY A 1 32 ? 16.255  1.380   -13.159 1.00 0.61  ? 32 GLY A H    6  
ATOM 11593 H HA2  . GLY A 1 32 ? 17.169  -1.302  -13.559 1.00 0.73  ? 32 GLY A HA2  6  
ATOM 11594 H HA3  . GLY A 1 32 ? 16.265  -0.799  -14.984 1.00 0.79  ? 32 GLY A HA3  6  
ATOM 11595 N N    . PRO A 1 33 ? 17.974  0.860   -15.855 1.00 1.04  ? 33 PRO A N    6  
ATOM 11596 C CA   . PRO A 1 33 ? 19.080  1.611   -16.505 1.00 1.28  ? 33 PRO A CA   6  
ATOM 11597 C C    . PRO A 1 33 ? 19.200  3.026   -15.904 1.00 1.12  ? 33 PRO A C    6  
ATOM 11598 O O    . PRO A 1 33 ? 18.832  3.245   -14.765 1.00 1.13  ? 33 PRO A O    6  
ATOM 11599 C CB   . PRO A 1 33 ? 18.649  1.661   -17.979 1.00 1.58  ? 33 PRO A CB   6  
ATOM 11600 C CG   . PRO A 1 33 ? 17.115  1.465   -17.997 1.00 1.49  ? 33 PRO A CG   6  
ATOM 11601 C CD   . PRO A 1 33 ? 16.739  0.789   -16.668 1.00 1.14  ? 33 PRO A CD   6  
ATOM 11602 H HA   . PRO A 1 33 ? 20.011  1.077   -16.409 1.00 1.47  ? 33 PRO A HA   6  
ATOM 11603 H HB2  . PRO A 1 33 ? 18.909  2.615   -18.414 1.00 1.67  ? 33 PRO A HB2  6  
ATOM 11604 H HB3  . PRO A 1 33 ? 19.122  0.861   -18.527 1.00 1.82  ? 33 PRO A HB3  6  
ATOM 11605 H HG2  . PRO A 1 33 ? 16.623  2.424   -18.080 1.00 1.50  ? 33 PRO A HG2  6  
ATOM 11606 H HG3  . PRO A 1 33 ? 16.832  0.830   -18.822 1.00 1.73  ? 33 PRO A HG3  6  
ATOM 11607 H HD2  . PRO A 1 33 ? 15.935  1.329   -16.186 1.00 1.03  ? 33 PRO A HD2  6  
ATOM 11608 H HD3  . PRO A 1 33 ? 16.460  -0.240  -16.833 1.00 1.20  ? 33 PRO A HD3  6  
ATOM 11609 N N    . HIS A 1 34 ? 19.712  3.990   -16.658 1.00 1.15  ? 34 HIS A N    6  
ATOM 11610 C CA   . HIS A 1 34 ? 19.838  5.390   -16.109 1.00 1.18  ? 34 HIS A CA   6  
ATOM 11611 C C    . HIS A 1 34 ? 18.480  5.852   -15.570 1.00 1.17  ? 34 HIS A C    6  
ATOM 11612 O O    . HIS A 1 34 ? 18.423  6.633   -14.638 1.00 1.26  ? 34 HIS A O    6  
ATOM 11613 C CB   . HIS A 1 34 ? 20.365  6.391   -17.160 1.00 1.36  ? 34 HIS A CB   6  
ATOM 11614 C CG   . HIS A 1 34 ? 20.077  5.926   -18.563 1.00 1.55  ? 34 HIS A CG   6  
ATOM 11615 N ND1  . HIS A 1 34 ? 21.079  5.470   -19.408 1.00 2.08  ? 34 HIS A ND1  6  
ATOM 11616 C CD2  . HIS A 1 34 ? 18.915  5.851   -19.286 1.00 2.02  ? 34 HIS A CD2  6  
ATOM 11617 C CE1  . HIS A 1 34 ? 20.505  5.147   -20.580 1.00 2.65  ? 34 HIS A CE1  6  
ATOM 11618 N NE2  . HIS A 1 34 ? 19.188  5.360   -20.560 1.00 2.66  ? 34 HIS A NE2  6  
ATOM 11619 H H    . HIS A 1 34 ? 20.007  3.790   -17.568 1.00 1.28  ? 34 HIS A H    6  
ATOM 11620 H HA   . HIS A 1 34 ? 20.527  5.361   -15.270 1.00 1.15  ? 34 HIS A HA   6  
ATOM 11621 H HB2  . HIS A 1 34 ? 19.890  7.346   -17.005 1.00 1.71  ? 34 HIS A HB2  6  
ATOM 11622 H HB3  . HIS A 1 34 ? 21.432  6.505   -17.036 1.00 1.68  ? 34 HIS A HB3  6  
ATOM 11623 H HD1  . HIS A 1 34 ? 22.032  5.394   -19.188 1.00 2.32  ? 34 HIS A HD1  6  
ATOM 11624 H HD2  . HIS A 1 34 ? 17.938  6.125   -18.922 1.00 2.22  ? 34 HIS A HD2  6  
ATOM 11625 H HE1  . HIS A 1 34 ? 21.044  4.764   -21.433 1.00 3.26  ? 34 HIS A HE1  6  
ATOM 11626 N N    . CYS A 1 35 ? 17.389  5.307   -16.076 1.00 1.17  ? 35 CYS A N    6  
ATOM 11627 C CA   . CYS A 1 35 ? 16.045  5.630   -15.500 1.00 1.21  ? 35 CYS A CA   6  
ATOM 11628 C C    . CYS A 1 35 ? 15.944  4.723   -14.266 1.00 1.02  ? 35 CYS A C    6  
ATOM 11629 O O    . CYS A 1 35 ? 15.089  3.863   -14.149 1.00 1.08  ? 35 CYS A O    6  
ATOM 11630 C CB   . CYS A 1 35 ? 14.963  5.272   -16.517 1.00 1.45  ? 35 CYS A CB   6  
ATOM 11631 S SG   . CYS A 1 35 ? 13.423  6.181   -16.189 1.00 1.19  ? 35 CYS A SG   6  
ATOM 11632 H H    . CYS A 1 35 ? 17.461  4.628   -16.778 1.00 1.22  ? 35 CYS A H    6  
ATOM 11633 H HA   . CYS A 1 35 ? 15.987  6.673   -15.217 1.00 1.30  ? 35 CYS A HA   6  
ATOM 11634 H HB2  . CYS A 1 35 ? 15.321  5.518   -17.502 1.00 2.02  ? 35 CYS A HB2  6  
ATOM 11635 H HB3  . CYS A 1 35 ? 14.774  4.211   -16.461 1.00 2.07  ? 35 CYS A HB3  6  
ATOM 11636 N N    . ALA A 1 36 ? 16.903  4.881   -13.393 1.00 0.94  ? 36 ALA A N    6  
ATOM 11637 C CA   . ALA A 1 36 ? 17.040  4.030   -12.180 1.00 0.89  ? 36 ALA A CA   6  
ATOM 11638 C C    . ALA A 1 36 ? 16.064  4.422   -11.068 1.00 0.85  ? 36 ALA A C    6  
ATOM 11639 O O    . ALA A 1 36 ? 16.157  3.924   -9.960  1.00 1.18  ? 36 ALA A O    6  
ATOM 11640 C CB   . ALA A 1 36 ? 18.479  4.150   -11.689 1.00 1.08  ? 36 ALA A CB   6  
ATOM 11641 H H    . ALA A 1 36 ? 17.586  5.546   -13.576 1.00 1.02  ? 36 ALA A H    6  
ATOM 11642 H HA   . ALA A 1 36 ? 16.857  3.004   -12.453 1.00 0.94  ? 36 ALA A HA   6  
ATOM 11643 H HB1  . ALA A 1 36 ? 18.844  5.146   -11.897 1.00 1.48  ? 36 ALA A HB1  6  
ATOM 11644 H HB2  . ALA A 1 36 ? 18.516  3.962   -10.630 1.00 1.69  ? 36 ALA A HB2  6  
ATOM 11645 H HB3  . ALA A 1 36 ? 19.092  3.429   -12.210 1.00 1.40  ? 36 ALA A HB3  6  
ATOM 11646 N N    . GLN A 1 37 ? 15.099  5.254   -11.353 1.00 0.93  ? 37 GLN A N    6  
ATOM 11647 C CA   . GLN A 1 37 ? 14.089  5.590   -10.311 1.00 0.89  ? 37 GLN A CA   6  
ATOM 11648 C C    . GLN A 1 37 ? 12.928  4.615   -10.490 1.00 0.71  ? 37 GLN A C    6  
ATOM 11649 O O    . GLN A 1 37 ? 12.945  3.783   -11.380 1.00 0.74  ? 37 GLN A O    6  
ATOM 11650 C CB   . GLN A 1 37 ? 13.586  7.034   -10.458 1.00 0.99  ? 37 GLN A CB   6  
ATOM 11651 C CG   . GLN A 1 37 ? 13.025  7.278   -11.866 1.00 1.66  ? 37 GLN A CG   6  
ATOM 11652 C CD   . GLN A 1 37 ? 14.010  8.131   -12.670 1.00 2.34  ? 37 GLN A CD   6  
ATOM 11653 O OE1  . GLN A 1 37 ? 14.675  7.637   -13.557 1.00 2.82  ? 37 GLN A OE1  6  
ATOM 11654 N NE2  . GLN A 1 37 ? 14.134  9.404   -12.398 1.00 3.07  ? 37 GLN A NE2  6  
ATOM 11655 H H    . GLN A 1 37 ? 15.014  5.615   -12.253 1.00 1.27  ? 37 GLN A H    6  
ATOM 11656 H HA   . GLN A 1 37 ? 14.525  5.454   -9.329  1.00 0.95  ? 37 GLN A HA   6  
ATOM 11657 H HB2  . GLN A 1 37 ? 12.805  7.211   -9.732  1.00 1.38  ? 37 GLN A HB2  6  
ATOM 11658 H HB3  . GLN A 1 37 ? 14.396  7.711   -10.271 1.00 1.44  ? 37 GLN A HB3  6  
ATOM 11659 H HG2  . GLN A 1 37 ? 12.873  6.331   -12.365 1.00 2.22  ? 37 GLN A HG2  6  
ATOM 11660 H HG3  . GLN A 1 37 ? 12.082  7.798   -11.788 1.00 2.02  ? 37 GLN A HG3  6  
ATOM 11661 H HE21 . GLN A 1 37 ? 13.600  9.808   -11.681 1.00 3.26  ? 37 GLN A HE21 6  
ATOM 11662 H HE22 . GLN A 1 37 ? 14.761  9.956   -12.911 1.00 3.72  ? 37 GLN A HE22 6  
ATOM 11663 N N    . THR A 1 38 ? 11.925  4.695   -9.668  1.00 0.60  ? 38 THR A N    6  
ATOM 11664 C CA   . THR A 1 38 ? 10.785  3.757   -9.821  1.00 0.44  ? 38 THR A CA   6  
ATOM 11665 C C    . THR A 1 38 ? 9.961   4.132   -11.059 1.00 0.35  ? 38 THR A C    6  
ATOM 11666 O O    . THR A 1 38 ? 10.429  4.814   -11.950 1.00 0.42  ? 38 THR A O    6  
ATOM 11667 C CB   . THR A 1 38 ? 9.899   3.793   -8.571  1.00 0.44  ? 38 THR A CB   6  
ATOM 11668 O OG1  . THR A 1 38 ? 10.580  4.437   -7.500  1.00 0.60  ? 38 THR A OG1  6  
ATOM 11669 C CG2  . THR A 1 38 ? 9.577   2.357   -8.186  1.00 0.44  ? 38 THR A CG2  6  
ATOM 11670 H H    . THR A 1 38 ? 11.921  5.363   -8.954  1.00 0.68  ? 38 THR A H    6  
ATOM 11671 H HA   . THR A 1 38 ? 11.171  2.756   -9.948  1.00 0.44  ? 38 THR A HA   6  
ATOM 11672 H HB   . THR A 1 38 ? 8.977   4.320   -8.788  1.00 0.40  ? 38 THR A HB   6  
ATOM 11673 H HG1  . THR A 1 38 ? 10.128  5.264   -7.314  1.00 0.96  ? 38 THR A HG1  6  
ATOM 11674 H HG21 . THR A 1 38 ? 10.423  1.727   -8.423  1.00 1.13  ? 38 THR A HG21 6  
ATOM 11675 H HG22 . THR A 1 38 ? 9.370   2.305   -7.131  1.00 1.10  ? 38 THR A HG22 6  
ATOM 11676 H HG23 . THR A 1 38 ? 8.715   2.023   -8.744  1.00 1.11  ? 38 THR A HG23 6  
ATOM 11677 N N    . GLU A 1 39 ? 8.726   3.711   -11.099 1.00 0.25  ? 39 GLU A N    6  
ATOM 11678 C CA   . GLU A 1 39 ? 7.839   4.036   -12.235 1.00 0.25  ? 39 GLU A CA   6  
ATOM 11679 C C    . GLU A 1 39 ? 6.467   4.158   -11.654 1.00 0.21  ? 39 GLU A C    6  
ATOM 11680 O O    . GLU A 1 39 ? 6.065   3.349   -10.840 1.00 0.35  ? 39 GLU A O    6  
ATOM 11681 C CB   . GLU A 1 39 ? 7.800   2.925   -13.268 1.00 0.33  ? 39 GLU A CB   6  
ATOM 11682 C CG   . GLU A 1 39 ? 8.428   3.400   -14.582 1.00 0.60  ? 39 GLU A CG   6  
ATOM 11683 C CD   . GLU A 1 39 ? 9.958   3.304   -14.494 1.00 0.80  ? 39 GLU A CD   6  
ATOM 11684 O OE1  . GLU A 1 39 ? 10.454  2.216   -14.250 1.00 1.40  ? 39 GLU A OE1  6  
ATOM 11685 O OE2  . GLU A 1 39 ? 10.606  4.321   -14.676 1.00 1.47  ? 39 GLU A OE2  6  
ATOM 11686 H H    . GLU A 1 39 ? 8.360   3.197   -10.350 1.00 0.25  ? 39 GLU A H    6  
ATOM 11687 H HA   . GLU A 1 39 ? 8.140   4.966   -12.686 1.00 0.31  ? 39 GLU A HA   6  
ATOM 11688 H HB2  . GLU A 1 39 ? 8.336   2.066   -12.896 1.00 0.30  ? 39 GLU A HB2  6  
ATOM 11689 H HB3  . GLU A 1 39 ? 6.757   2.663   -13.438 1.00 0.41  ? 39 GLU A HB3  6  
ATOM 11690 H HG2  . GLU A 1 39 ? 8.076   2.779   -15.392 1.00 0.88  ? 39 GLU A HG2  6  
ATOM 11691 H HG3  . GLU A 1 39 ? 8.145   4.425   -14.767 1.00 0.85  ? 39 GLU A HG3  6  
ATOM 11692 N N    . VAL A 1 40 ? 5.767   5.167   -12.001 1.00 0.15  ? 40 VAL A N    6  
ATOM 11693 C CA   . VAL A 1 40 ? 4.454   5.351   -11.399 1.00 0.19  ? 40 VAL A CA   6  
ATOM 11694 C C    . VAL A 1 40 ? 3.612   6.209   -12.335 1.00 0.19  ? 40 VAL A C    6  
ATOM 11695 O O    . VAL A 1 40 ? 3.514   7.404   -12.170 1.00 0.21  ? 40 VAL A O    6  
ATOM 11696 C CB   . VAL A 1 40 ? 4.703   6.050   -10.058 1.00 0.23  ? 40 VAL A CB   6  
ATOM 11697 C CG1  . VAL A 1 40 ? 4.848   4.987   -8.977  1.00 0.28  ? 40 VAL A CG1  6  
ATOM 11698 C CG2  . VAL A 1 40 ? 6.024   6.840   -10.126 1.00 0.24  ? 40 VAL A CG2  6  
ATOM 11699 H H    . VAL A 1 40 ? 6.120   5.833   -12.608 1.00 0.22  ? 40 VAL A H    6  
ATOM 11700 H HA   . VAL A 1 40 ? 4.001   4.381   -11.250 1.00 0.23  ? 40 VAL A HA   6  
ATOM 11701 H HB   . VAL A 1 40 ? 3.891   6.721   -9.831  1.00 0.29  ? 40 VAL A HB   6  
ATOM 11702 H HG11 . VAL A 1 40 ? 4.302   4.103   -9.266  1.00 1.08  ? 40 VAL A HG11 6  
ATOM 11703 H HG12 . VAL A 1 40 ? 5.897   4.738   -8.866  1.00 1.04  ? 40 VAL A HG12 6  
ATOM 11704 H HG13 . VAL A 1 40 ? 4.467   5.364   -8.045  1.00 1.00  ? 40 VAL A HG13 6  
ATOM 11705 H HG21 . VAL A 1 40 ? 6.026   7.467   -11.004 1.00 1.03  ? 40 VAL A HG21 6  
ATOM 11706 H HG22 . VAL A 1 40 ? 6.131   7.448   -9.246  1.00 1.01  ? 40 VAL A HG22 6  
ATOM 11707 H HG23 . VAL A 1 40 ? 6.854   6.145   -10.183 1.00 1.04  ? 40 VAL A HG23 6  
ATOM 11708 N N    . ILE A 1 41 ? 3.056   5.608   -13.353 1.00 0.23  ? 41 ILE A N    6  
ATOM 11709 C CA   . ILE A 1 41 ? 2.287   6.383   -14.348 1.00 0.25  ? 41 ILE A CA   6  
ATOM 11710 C C    . ILE A 1 41 ? 0.781   6.196   -14.179 1.00 0.23  ? 41 ILE A C    6  
ATOM 11711 O O    . ILE A 1 41 ? 0.281   5.105   -14.238 1.00 0.25  ? 41 ILE A O    6  
ATOM 11712 C CB   . ILE A 1 41 ? 2.714   5.887   -15.719 1.00 0.30  ? 41 ILE A CB   6  
ATOM 11713 C CG1  . ILE A 1 41 ? 4.003   6.597   -16.131 1.00 0.50  ? 41 ILE A CG1  6  
ATOM 11714 C CG2  . ILE A 1 41 ? 1.624   6.163   -16.749 1.00 0.67  ? 41 ILE A CG2  6  
ATOM 11715 C CD1  . ILE A 1 41 ? 3.783   8.112   -16.172 1.00 0.54  ? 41 ILE A C