data_1MT7
# 
_entry.id   1MT7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1MT7         
RCSB  RCSB017165   
WWPDB D_1000017165 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KJ4 'Inactive wild-type HIV-1 protease (D25N) complexed with its Gag substrate peptide MA-CA.' unspecified 
PDB 1MTR 'HIV-1 PROTEASE COMPLEXED WITH A CYCLIC PHE-ILE-VAL PEPTIDOMIMETIC INHIBITOR'              unspecified 
PDB 1MT8 .                                                                                          unspecified 
PDB 1MT9 .                                                                                          unspecified 
PDB 1MTB .                                                                                          unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1MT7 
_pdbx_database_status.recvd_initial_deposition_date   2002-09-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Prabu-Jeyabalan, M.' 1 
'Nalivaika, E.A.'     2 
'King, N.M.'          3 
'Schiffer, C.A.'      4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'Viability of drug-resistant human immunodeficiency virus type 1 protease variant: structural insights for better antiviral therapy' 
J.Virol.       77  1305 1315 2003 JOVIAM US 0022-538X 0825 ? 12502847 10.1128/JVI.77.2.1306-1315.2003 
1       
;How does a symmetric dimer recognize an asymmetric substrate? A substrate  
complex of HIV-1 protease
;
J.Mol.Biol.    301 1207 1220 2000 JMOBAK UK 0022-2836 0070 ? ?        10.1006/jmbi.2000.4018          
2       
;Substrate shape determines specificity of recognition for HIV-1 protease:  
Analysis of crystal structures of six substrate complexes
;
Structure      10  369  381  2002 STRUE6 UK 0969-2126 2005 ? ?        '10.1016/S0969-2126(02)00720-7' 
3       'Lack of synergy for inhibitors targeting a multi-drug resistant HIV-1 protease' 'Protein Sci.' 11  418  429  2002 PRCIEI 
US 0961-8368 0795 ? ?        10.1110/ps.2520102              
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Prabu-Jeyabalan, M.' 1  
primary 'Nalivaika, E.A.'     2  
primary 'King, N.M.'          3  
primary 'Schiffer, C.A.'      4  
1       'Prabu-Jeyabalan, M.' 5  
1       'Nalivaika, E.A.'     6  
1       'Schiffer, C.A.'      7  
2       'Prabu-Jeyabalan, M.' 8  
2       'Nalivaika, E.A.'     9  
2       'Schiffer, C.A.'      10 
3       'King, N.M.'          11 
3       'Melnick, L.'         12 
3       'Prabu-Jeyabalan, M.' 13 
3       'Nalivaika, E.A.'     14 
3       'Yang, S.-S.'         15 
3       'Gao, Y.'             16 
3       'Nie, X.'             17 
3       'Zepp, C.'            18 
3       'Heefner, D.L.'       19 
3       'Schiffer, C.A.'      20 
# 
_cell.entry_id           1MT7 
_cell.length_a           50.972 
_cell.length_b           57.858 
_cell.length_c           62.069 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1MT7 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.cell_setting                     orthorhombic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEASE RETROPEPSIN' 10772.724 2   3.4.23.16 'Q7K, D25N, L63P, V82A' ? ? 
2 polymer     syn 'Substrate analogue'   1161.264  1   ?         ?                       ? 
'MA-CA cleavage site of HIV-1 Gag polyprotein' 
3 non-polymer syn 'ACETATE ION'          59.044    6   ?         ?                       ? ? 
4 water       nat water                  18.015    132 ?         ?                       ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HIV-1 PROTEASE' 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.3.4.23.16 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPT
PANIIGRNLLTQIGCTLNF
;
;PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPT
PANIIGRNLLTQIGCTLNF
;
A,B ? 
2 'polypeptide(L)' no no VSQNYPIVQN                                                                                             
VSQNYPIVQN                                                                                             P   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  GLN n 
1 3  ILE n 
1 4  THR n 
1 5  LEU n 
1 6  TRP n 
1 7  LYS n 
1 8  ARG n 
1 9  PRO n 
1 10 LEU n 
1 11 VAL n 
1 12 THR n 
1 13 ILE n 
1 14 ARG n 
1 15 ILE n 
1 16 GLY n 
1 17 GLY n 
1 18 GLN n 
1 19 LEU n 
1 20 LYS n 
1 21 GLU n 
1 22 ALA n 
1 23 LEU n 
1 24 LEU n 
1 25 ASN n 
1 26 THR n 
1 27 GLY n 
1 28 ALA n 
1 29 ASP n 
1 30 ASP n 
1 31 THR n 
1 32 VAL n 
1 33 LEU n 
1 34 GLU n 
1 35 GLU n 
1 36 MET n 
1 37 ASN n 
1 38 LEU n 
1 39 PRO n 
1 40 GLY n 
1 41 LYS n 
1 42 TRP n 
1 43 LYS n 
1 44 PRO n 
1 45 LYS n 
1 46 MET n 
1 47 ILE n 
1 48 GLY n 
1 49 GLY n 
1 50 ILE n 
1 51 GLY n 
1 52 GLY n 
1 53 PHE n 
1 54 ILE n 
1 55 LYS n 
1 56 VAL n 
1 57 ARG n 
1 58 GLN n 
1 59 TYR n 
1 60 ASP n 
1 61 GLN n 
1 62 ILE n 
1 63 PRO n 
1 64 VAL n 
1 65 GLU n 
1 66 ILE n 
1 67 CYS n 
1 68 GLY n 
1 69 HIS n 
1 70 LYS n 
1 71 ALA n 
1 72 ILE n 
1 73 GLY n 
1 74 THR n 
1 75 VAL n 
1 76 LEU n 
1 77 VAL n 
1 78 GLY n 
1 79 PRO n 
1 80 THR n 
1 81 PRO n 
1 82 ALA n 
1 83 ASN n 
1 84 ILE n 
1 85 ILE n 
1 86 GLY n 
1 87 ARG n 
1 88 ASN n 
1 89 LEU n 
1 90 LEU n 
1 91 THR n 
1 92 GLN n 
1 93 ILE n 
1 94 GLY n 
1 95 CYS n 
1 96 THR n 
1 97 LEU n 
1 98 ASN n 
1 99 PHE n 
2 1  VAL n 
2 2  SER n 
2 3  GLN n 
2 4  ASN n 
2 5  TYR n 
2 6  PRO n 
2 7  ILE n 
2 8  VAL n 
2 9  GLN n 
2 10 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Lentivirus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human immunodeficiency virus 1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11676 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               TAP106 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pXC35-pEN18 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'This peptide sequence occurs naturally in Gag of HIV-1' 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 1 UNP POL_HV1A2    P03369 57  
;PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF
;
? 
2 2 UNP Q9YYH6_9HIV1 Q9YYH6 104 VSQNYPIVQN ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1MT7 A 1 ? 99 ? P03369 57  ? 155 ? 1 99 
2 1 1MT7 B 1 ? 99 ? P03369 57  ? 155 ? 1 99 
3 2 1MT7 P 1 ? 10 ? Q9YYH6 104 ? 113 ? 1 10 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1MT7 LYS A 7  ? UNP P03369 GLN 63  'ENGINEERED MUTATION' 7  1 
1 1MT7 ASN A 25 ? UNP P03369 ASP 81  'ENGINEERED MUTATION' 25 2 
1 1MT7 ALA A 82 ? UNP P03369 VAL 138 'ENGINEERED MUTATION' 82 3 
2 1MT7 LYS B 7  ? UNP P03369 GLN 63  'ENGINEERED MUTATION' 7  4 
2 1MT7 ASN B 25 ? UNP P03369 ASP 81  'ENGINEERED MUTATION' 25 5 
2 1MT7 ALA B 82 ? UNP P03369 VAL 138 'ENGINEERED MUTATION' 82 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'   ? 'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1MT7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   38.93 
_exptl_crystal.density_Matthews      2.01 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.2 
_exptl_crystal_grow.pdbx_details    
;sodium phosphate, sodium citrate, ammonium sulphate, pH 6.2, 
VAPOR DIFFUSION, HANGING DROP at 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2000-04-07 
_diffrn_detector.details                'Yale mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Yale Mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1MT7 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             39.39 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   14278 
_reflns.number_all                   14278 
_reflns.percent_possible_obs         94.9 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        5.8 
_reflns.B_iso_Wilson_estimate        18.4 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   74 
_reflns_shell.Rmerge_I_obs           0.19 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1086 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1MT7 
_refine.ls_number_reflns_obs                     14278 
_refine.ls_number_reflns_all                     14278 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             39.39 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    94.9 
_refine.ls_R_factor_obs                          0.201 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.201 
_refine.ls_R_factor_R_free                       0.227 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_number_reflns_R_free                  1415 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               24.0 
_refine.aniso_B[1][1]                            -2.68 
_refine.aniso_B[2][2]                            -0.68 
_refine.aniso_B[3][3]                            3.36 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.400899 
_refine.solvent_model_param_bsol                 69.0668 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1MTR 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1MT7 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.26 
_refine_analyze.Luzzati_sigma_a_free            0.17 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1545 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             132 
_refine_hist.number_atoms_total               1701 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        39.39 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.4  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.90  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        1.97 
_refine_ls_shell.number_reflns_R_work             898 
_refine_ls_shell.R_factor_R_work                  0.26 
_refine_ls_shell.percent_reflns_obs               74 
_refine_ls_shell.R_factor_R_free                  0.32 
_refine_ls_shell.R_factor_R_free_error            0.025 
_refine_ls_shell.percent_reflns_R_free            10.6 
_refine_ls_shell.number_reflns_R_free             107 
_refine_ls_shell.number_reflns_obs                1086 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
4 ACE.PARAM         ACE.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1MT7 
_struct.title                     
'Viability of a drug-resistant HIV-1 protease mutant: structural insights for better antiviral therapy' 
_struct.pdbx_descriptor           'PROTEASE RETROPEPSIN (E.C.3.4.23.16)/MA-CA cleavage site Decapeptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MT7 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE SUBSTRATE' 
_struct_keywords.text            
'Matrix, Capsid, Gag cleavage, drug resistance, substrate recognition, HYDROLASE-HYDROLASE SUBSTRATE complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 86 ? THR A 91 ? GLY A 86 THR A 91 1 ? 6 
HELX_P HELX_P2 2 GLN A 92 ? GLY A 94 ? GLN A 92 GLY A 94 5 ? 3 
HELX_P HELX_P3 3 GLY B 86 ? THR B 91 ? GLY B 86 THR B 91 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 5 ? 
D ? 4 ? 
E ? 3 ? 
F ? 5 ? 
G ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 2  ? ILE A 3  ? GLN A 2  ILE A 3  
A 2 THR B 96 ? ASN B 98 ? THR B 96 ASN B 98 
A 3 THR A 96 ? ASN A 98 ? THR A 96 ASN A 98 
A 4 GLN B 2  ? ILE B 3  ? GLN B 2  ILE B 3  
B 1 LEU A 10 ? VAL A 11 ? LEU A 10 VAL A 11 
B 2 ALA A 22 ? LEU A 24 ? ALA A 22 LEU A 24 
B 3 ILE A 84 ? ILE A 85 ? ILE A 84 ILE A 85 
C 1 THR A 31 ? LEU A 33 ? THR A 31 LEU A 33 
C 2 HIS A 69 ? VAL A 77 ? HIS A 69 VAL A 77 
C 3 GLY A 52 ? ILE A 66 ? GLY A 52 ILE A 66 
C 4 ILE A 13 ? ILE A 15 ? ILE A 13 ILE A 15 
C 5 GLN A 18 ? LEU A 19 ? GLN A 18 LEU A 19 
D 1 THR A 31 ? LEU A 33 ? THR A 31 LEU A 33 
D 2 HIS A 69 ? VAL A 77 ? HIS A 69 VAL A 77 
D 3 GLY A 52 ? ILE A 66 ? GLY A 52 ILE A 66 
D 4 LYS A 43 ? GLY A 49 ? LYS A 43 GLY A 49 
E 1 LEU B 10 ? VAL B 11 ? LEU B 10 VAL B 11 
E 2 ALA B 22 ? LEU B 24 ? ALA B 22 LEU B 24 
E 3 ILE B 84 ? ILE B 85 ? ILE B 84 ILE B 85 
F 1 THR B 31 ? LEU B 33 ? THR B 31 LEU B 33 
F 2 HIS B 69 ? VAL B 77 ? HIS B 69 VAL B 77 
F 3 GLY B 52 ? ILE B 66 ? GLY B 52 ILE B 66 
F 4 ILE B 13 ? ILE B 15 ? ILE B 13 ILE B 15 
F 5 GLN B 18 ? LEU B 19 ? GLN B 18 LEU B 19 
G 1 THR B 31 ? LEU B 33 ? THR B 31 LEU B 33 
G 2 HIS B 69 ? VAL B 77 ? HIS B 69 VAL B 77 
G 3 GLY B 52 ? ILE B 66 ? GLY B 52 ILE B 66 
G 4 LYS B 43 ? GLY B 49 ? LYS B 43 GLY B 49 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 3  ? N ILE A 3  O LEU B 97 ? O LEU B 97 
A 2 3 N ASN B 98 ? N ASN B 98 O THR A 96 ? O THR A 96 
A 3 4 O LEU A 97 ? O LEU A 97 N ILE B 3  ? N ILE B 3  
B 1 2 O VAL A 11 ? O VAL A 11 N ALA A 22 ? N ALA A 22 
B 2 3 O LEU A 23 ? O LEU A 23 N ILE A 85 ? N ILE A 85 
C 1 2 N THR A 31 ? N THR A 31 O THR A 74 ? O THR A 74 
C 2 3 O VAL A 77 ? O VAL A 77 N ARG A 57 ? N ARG A 57 
C 3 4 O GLU A 65 ? O GLU A 65 N ARG A 14 ? N ARG A 14 
C 4 5 N ILE A 15 ? N ILE A 15 O GLN A 18 ? O GLN A 18 
D 1 2 N THR A 31 ? N THR A 31 O THR A 74 ? O THR A 74 
D 2 3 O VAL A 77 ? O VAL A 77 N ARG A 57 ? N ARG A 57 
D 3 4 N GLN A 58 ? N GLN A 58 O LYS A 43 ? O LYS A 43 
E 1 2 O VAL B 11 ? O VAL B 11 N ALA B 22 ? N ALA B 22 
E 2 3 O LEU B 23 ? O LEU B 23 N ILE B 85 ? N ILE B 85 
F 1 2 N THR B 31 ? N THR B 31 O THR B 74 ? O THR B 74 
F 2 3 O VAL B 77 ? O VAL B 77 N ARG B 57 ? N ARG B 57 
F 3 4 O GLU B 65 ? O GLU B 65 N ARG B 14 ? N ARG B 14 
F 4 5 N ILE B 15 ? N ILE B 15 O GLN B 18 ? O GLN B 18 
G 1 2 N THR B 31 ? N THR B 31 O THR B 74 ? O THR B 74 
G 2 3 O VAL B 77 ? O VAL B 77 N ARG B 57 ? N ARG B 57 
G 3 4 N GLN B 58 ? N GLN B 58 O LYS B 43 ? O LYS B 43 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE ACT A 501'             
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACT A 502'             
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT A 503'             
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT A 504'             
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT B 505'             
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACT A 506'             
AC7 Software ? ? ? ? 22 'BINDING SITE FOR CHAIN P OF SUBSTRATE ANALOGUE' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 1  ARG A 8  ? ARG A 8   . ? 1_555 ? 
2  AC2 3  PRO A 1  ? PRO A 1   . ? 1_555 ? 
3  AC2 3  HIS A 69 ? HIS A 69  . ? 1_555 ? 
4  AC2 3  HOH K .  ? HOH B 563 . ? 1_555 ? 
5  AC3 4  GLY A 17 ? GLY A 17  . ? 1_555 ? 
6  AC3 4  ARG B 14 ? ARG B 14  . ? 1_455 ? 
7  AC3 4  GLY B 16 ? GLY B 16  . ? 1_455 ? 
8  AC3 4  GLY B 17 ? GLY B 17  . ? 1_455 ? 
9  AC4 5  GLY A 68 ? GLY A 68  . ? 1_555 ? 
10 AC4 5  HIS A 69 ? HIS A 69  . ? 1_555 ? 
11 AC4 5  LYS A 70 ? LYS A 70  . ? 1_555 ? 
12 AC4 5  PRO B 1  ? PRO B 1   . ? 4_456 ? 
13 AC4 5  LYS B 55 ? LYS B 55  . ? 3_555 ? 
14 AC5 4  ARG A 87 ? ARG A 87  . ? 1_555 ? 
15 AC5 4  TRP B 6  ? TRP B 6   . ? 1_555 ? 
16 AC5 4  LYS B 7  ? LYS B 7   . ? 1_555 ? 
17 AC5 4  ARG B 8  ? ARG B 8   . ? 1_555 ? 
18 AC6 4  ASN A 37 ? ASN A 37  . ? 1_555 ? 
19 AC6 4  HOH J .  ? HOH A 570 . ? 1_555 ? 
20 AC6 4  PRO B 39 ? PRO B 39  . ? 1_455 ? 
21 AC6 4  GLY B 40 ? GLY B 40  . ? 1_455 ? 
22 AC7 22 ASN A 25 ? ASN A 25  . ? 1_555 ? 
23 AC7 22 GLY A 27 ? GLY A 27  . ? 1_555 ? 
24 AC7 22 ALA A 28 ? ALA A 28  . ? 1_555 ? 
25 AC7 22 ASP A 29 ? ASP A 29  . ? 1_555 ? 
26 AC7 22 ASP A 30 ? ASP A 30  . ? 1_555 ? 
27 AC7 22 GLY A 48 ? GLY A 48  . ? 1_555 ? 
28 AC7 22 GLY A 49 ? GLY A 49  . ? 1_555 ? 
29 AC7 22 PRO A 81 ? PRO A 81  . ? 1_555 ? 
30 AC7 22 HOH J .  ? HOH A 510 . ? 1_555 ? 
31 AC7 22 ARG B 8  ? ARG B 8   . ? 1_555 ? 
32 AC7 22 ASN B 25 ? ASN B 25  . ? 1_555 ? 
33 AC7 22 GLY B 27 ? GLY B 27  . ? 1_555 ? 
34 AC7 22 ALA B 28 ? ALA B 28  . ? 1_555 ? 
35 AC7 22 GLY B 48 ? GLY B 48  . ? 1_555 ? 
36 AC7 22 GLY B 49 ? GLY B 49  . ? 1_555 ? 
37 AC7 22 PRO B 81 ? PRO B 81  . ? 1_555 ? 
38 AC7 22 ILE B 84 ? ILE B 84  . ? 1_555 ? 
39 AC7 22 HOH K .  ? HOH B 553 . ? 1_555 ? 
40 AC7 22 HOH K .  ? HOH B 554 . ? 1_555 ? 
41 AC7 22 HOH L .  ? HOH P 11  . ? 1_555 ? 
42 AC7 22 HOH L .  ? HOH P 12  . ? 1_555 ? 
43 AC7 22 HOH L .  ? HOH P 15  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1MT7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1MT7 
_atom_sites.fract_transf_matrix[1][1]   0.019619 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017284 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016111 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 1  ? -3.407  7.605   34.051 1.00 30.80 ? 1   PRO A N   1 
ATOM   2    C CA  . PRO A 1 1  ? -2.506  6.821   34.920 1.00 29.60 ? 1   PRO A CA  1 
ATOM   3    C C   . PRO A 1 1  ? -1.105  6.771   34.325 1.00 29.02 ? 1   PRO A C   1 
ATOM   4    O O   . PRO A 1 1  ? -0.897  7.163   33.177 1.00 29.50 ? 1   PRO A O   1 
ATOM   5    C CB  . PRO A 1 1  ? -3.091  5.424   34.990 1.00 31.61 ? 1   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 1  ? -3.715  5.313   33.599 1.00 30.81 ? 1   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 1  ? -4.349  6.698   33.368 1.00 31.23 ? 1   PRO A CD  1 
ATOM   8    N N   . GLN A 1 2  ? -0.151  6.297   35.119 1.00 27.37 ? 2   GLN A N   1 
ATOM   9    C CA  . GLN A 1 2  ? 1.225   6.154   34.670 1.00 24.91 ? 2   GLN A CA  1 
ATOM   10   C C   . GLN A 1 2  ? 1.434   4.667   34.415 1.00 24.18 ? 2   GLN A C   1 
ATOM   11   O O   . GLN A 1 2  ? 1.157   3.829   35.277 1.00 23.41 ? 2   GLN A O   1 
ATOM   12   C CB  . GLN A 1 2  ? 2.205   6.657   35.732 1.00 26.87 ? 2   GLN A CB  1 
ATOM   13   C CG  . GLN A 1 2  ? 3.654   6.319   35.427 1.00 27.32 ? 2   GLN A CG  1 
ATOM   14   C CD  . GLN A 1 2  ? 4.632   7.150   36.230 1.00 28.24 ? 2   GLN A CD  1 
ATOM   15   O OE1 . GLN A 1 2  ? 4.947   8.283   35.867 1.00 28.58 ? 2   GLN A OE1 1 
ATOM   16   N NE2 . GLN A 1 2  ? 5.113   6.592   37.335 1.00 29.60 ? 2   GLN A NE2 1 
ATOM   17   N N   . ILE A 1 3  ? 1.914   4.343   33.220 1.00 23.88 ? 3   ILE A N   1 
ATOM   18   C CA  . ILE A 1 3  ? 2.119   2.954   32.833 1.00 22.98 ? 3   ILE A CA  1 
ATOM   19   C C   . ILE A 1 3  ? 3.587   2.645   32.564 1.00 21.99 ? 3   ILE A C   1 
ATOM   20   O O   . ILE A 1 3  ? 4.224   3.299   31.735 1.00 21.39 ? 3   ILE A O   1 
ATOM   21   C CB  . ILE A 1 3  ? 1.284   2.630   31.567 1.00 22.59 ? 3   ILE A CB  1 
ATOM   22   C CG1 . ILE A 1 3  ? -0.203  2.870   31.856 1.00 23.85 ? 3   ILE A CG1 1 
ATOM   23   C CG2 . ILE A 1 3  ? 1.525   1.199   31.124 1.00 23.35 ? 3   ILE A CG2 1 
ATOM   24   C CD1 . ILE A 1 3  ? -1.123  2.626   30.669 1.00 23.73 ? 3   ILE A CD1 1 
ATOM   25   N N   . THR A 1 4  ? 4.121   1.655   33.276 1.00 20.37 ? 4   THR A N   1 
ATOM   26   C CA  . THR A 1 4  ? 5.513   1.252   33.093 1.00 19.46 ? 4   THR A CA  1 
ATOM   27   C C   . THR A 1 4  ? 5.550   0.311   31.894 1.00 19.76 ? 4   THR A C   1 
ATOM   28   O O   . THR A 1 4  ? 4.506   -0.165  31.445 1.00 19.66 ? 4   THR A O   1 
ATOM   29   C CB  . THR A 1 4  ? 6.066   0.538   34.344 1.00 18.76 ? 4   THR A CB  1 
ATOM   30   O OG1 . THR A 1 4  ? 5.191   -0.533  34.708 1.00 20.70 ? 4   THR A OG1 1 
ATOM   31   C CG2 . THR A 1 4  ? 6.178   1.514   35.505 1.00 19.66 ? 4   THR A CG2 1 
ATOM   32   N N   . LEU A 1 5  ? 6.746   0.020   31.395 1.00 19.44 ? 5   LEU A N   1 
ATOM   33   C CA  . LEU A 1 5  ? 6.869   -0.808  30.203 1.00 20.06 ? 5   LEU A CA  1 
ATOM   34   C C   . LEU A 1 5  ? 7.525   -2.178  30.345 1.00 19.50 ? 5   LEU A C   1 
ATOM   35   O O   . LEU A 1 5  ? 8.068   -2.709  29.376 1.00 19.12 ? 5   LEU A O   1 
ATOM   36   C CB  . LEU A 1 5  ? 7.588   0.012   29.127 1.00 19.84 ? 5   LEU A CB  1 
ATOM   37   C CG  . LEU A 1 5  ? 6.831   1.300   28.768 1.00 19.33 ? 5   LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 5  ? 7.721   2.240   27.961 1.00 17.05 ? 5   LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 5  ? 5.569   0.929   27.984 1.00 19.04 ? 5   LEU A CD2 1 
ATOM   40   N N   . TRP A 1 6  ? 7.467   -2.757  31.540 1.00 21.78 ? 6   TRP A N   1 
ATOM   41   C CA  . TRP A 1 6  ? 8.048   -4.075  31.759 1.00 22.60 ? 6   TRP A CA  1 
ATOM   42   C C   . TRP A 1 6  ? 7.159   -5.102  31.072 1.00 22.43 ? 6   TRP A C   1 
ATOM   43   O O   . TRP A 1 6  ? 7.618   -6.158  30.635 1.00 22.53 ? 6   TRP A O   1 
ATOM   44   C CB  . TRP A 1 6  ? 8.153   -4.364  33.257 1.00 25.10 ? 6   TRP A CB  1 
ATOM   45   C CG  . TRP A 1 6  ? 8.905   -3.295  33.984 1.00 27.89 ? 6   TRP A CG  1 
ATOM   46   C CD1 . TRP A 1 6  ? 8.381   -2.199  34.612 1.00 29.11 ? 6   TRP A CD1 1 
ATOM   47   C CD2 . TRP A 1 6  ? 10.328  -3.168  34.078 1.00 28.83 ? 6   TRP A CD2 1 
ATOM   48   N NE1 . TRP A 1 6  ? 9.391   -1.396  35.089 1.00 28.45 ? 6   TRP A NE1 1 
ATOM   49   C CE2 . TRP A 1 6  ? 10.595  -1.969  34.777 1.00 30.20 ? 6   TRP A CE2 1 
ATOM   50   C CE3 . TRP A 1 6  ? 11.403  -3.952  33.641 1.00 29.84 ? 6   TRP A CE3 1 
ATOM   51   C CZ2 . TRP A 1 6  ? 11.897  -1.533  35.042 1.00 28.79 ? 6   TRP A CZ2 1 
ATOM   52   C CZ3 . TRP A 1 6  ? 12.696  -3.518  33.906 1.00 29.72 ? 6   TRP A CZ3 1 
ATOM   53   C CH2 . TRP A 1 6  ? 12.930  -2.320  34.604 1.00 31.02 ? 6   TRP A CH2 1 
ATOM   54   N N   . LYS A 1 7  ? 5.879   -4.771  30.966 1.00 21.84 ? 7   LYS A N   1 
ATOM   55   C CA  . LYS A 1 7  ? 4.912   -5.643  30.314 1.00 23.00 ? 7   LYS A CA  1 
ATOM   56   C C   . LYS A 1 7  ? 4.302   -4.854  29.161 1.00 22.64 ? 7   LYS A C   1 
ATOM   57   O O   . LYS A 1 7  ? 4.414   -3.628  29.121 1.00 22.79 ? 7   LYS A O   1 
ATOM   58   C CB  . LYS A 1 7  ? 3.828   -6.065  31.307 1.00 22.93 ? 7   LYS A CB  1 
ATOM   59   N N   . ARG A 1 8  ? 3.676   -5.553  28.217 1.00 22.99 ? 8   ARG A N   1 
ATOM   60   C CA  . ARG A 1 8  ? 3.049   -4.885  27.082 1.00 23.20 ? 8   ARG A CA  1 
ATOM   61   C C   . ARG A 1 8  ? 1.979   -3.927  27.601 1.00 21.23 ? 8   ARG A C   1 
ATOM   62   O O   . ARG A 1 8  ? 1.256   -4.250  28.543 1.00 20.32 ? 8   ARG A O   1 
ATOM   63   C CB  . ARG A 1 8  ? 2.404   -5.912  26.149 1.00 25.04 ? 8   ARG A CB  1 
ATOM   64   C CG  . ARG A 1 8  ? 3.379   -6.892  25.520 1.00 30.98 ? 8   ARG A CG  1 
ATOM   65   C CD  . ARG A 1 8  ? 2.628   -7.945  24.720 1.00 35.16 ? 8   ARG A CD  1 
ATOM   66   N NE  . ARG A 1 8  ? 1.710   -8.705  25.566 1.00 38.04 ? 8   ARG A NE  1 
ATOM   67   C CZ  . ARG A 1 8  ? 0.830   -9.592  25.112 1.00 40.69 ? 8   ARG A CZ  1 
ATOM   68   N NH1 . ARG A 1 8  ? 0.037   -10.237 25.960 1.00 41.54 ? 8   ARG A NH1 1 
ATOM   69   N NH2 . ARG A 1 8  ? 0.734   -9.829  23.810 1.00 41.38 ? 8   ARG A NH2 1 
ATOM   70   N N   . PRO A 1 9  ? 1.869   -2.734  26.998 1.00 19.72 ? 9   PRO A N   1 
ATOM   71   C CA  . PRO A 1 9  ? 0.874   -1.741  27.419 1.00 19.30 ? 9   PRO A CA  1 
ATOM   72   C C   . PRO A 1 9  ? -0.523  -2.045  26.886 1.00 21.00 ? 9   PRO A C   1 
ATOM   73   O O   . PRO A 1 9  ? -1.054  -1.317  26.045 1.00 18.42 ? 9   PRO A O   1 
ATOM   74   C CB  . PRO A 1 9  ? 1.447   -0.432  26.873 1.00 19.09 ? 9   PRO A CB  1 
ATOM   75   C CG  . PRO A 1 9  ? 2.120   -0.860  25.622 1.00 20.06 ? 9   PRO A CG  1 
ATOM   76   C CD  . PRO A 1 9  ? 2.828   -2.142  26.045 1.00 20.86 ? 9   PRO A CD  1 
ATOM   77   N N   . LEU A 1 10 ? -1.109  -3.127  27.391 1.00 21.97 ? 10  LEU A N   1 
ATOM   78   C CA  . LEU A 1 10 ? -2.435  -3.570  26.980 1.00 24.63 ? 10  LEU A CA  1 
ATOM   79   C C   . LEU A 1 10 ? -3.540  -2.872  27.760 1.00 23.45 ? 10  LEU A C   1 
ATOM   80   O O   . LEU A 1 10 ? -3.449  -2.695  28.974 1.00 23.46 ? 10  LEU A O   1 
ATOM   81   C CB  . LEU A 1 10 ? -2.558  -5.089  27.163 1.00 27.18 ? 10  LEU A CB  1 
ATOM   82   C CG  . LEU A 1 10 ? -1.860  -5.973  26.123 1.00 30.09 ? 10  LEU A CG  1 
ATOM   83   C CD1 . LEU A 1 10 ? -1.799  -7.417  26.604 1.00 31.31 ? 10  LEU A CD1 1 
ATOM   84   C CD2 . LEU A 1 10 ? -2.621  -5.882  24.808 1.00 32.16 ? 10  LEU A CD2 1 
ATOM   85   N N   . VAL A 1 11 ? -4.588  -2.473  27.052 1.00 22.30 ? 11  VAL A N   1 
ATOM   86   C CA  . VAL A 1 11 ? -5.711  -1.804  27.688 1.00 21.65 ? 11  VAL A CA  1 
ATOM   87   C C   . VAL A 1 11 ? -7.008  -2.261  27.051 1.00 20.39 ? 11  VAL A C   1 
ATOM   88   O O   . VAL A 1 11 ? -7.009  -2.843  25.967 1.00 17.48 ? 11  VAL A O   1 
ATOM   89   C CB  . VAL A 1 11 ? -5.608  -0.265  27.550 1.00 23.11 ? 11  VAL A CB  1 
ATOM   90   C CG1 . VAL A 1 11 ? -4.328  0.227   28.193 1.00 24.76 ? 11  VAL A CG1 1 
ATOM   91   C CG2 . VAL A 1 11 ? -5.656  0.139   26.085 1.00 23.79 ? 11  VAL A CG2 1 
ATOM   92   N N   . THR A 1 12 ? -8.113  -2.009  27.739 1.00 20.30 ? 12  THR A N   1 
ATOM   93   C CA  . THR A 1 12 ? -9.415  -2.371  27.219 1.00 21.69 ? 12  THR A CA  1 
ATOM   94   C C   . THR A 1 12 ? -10.026 -1.125  26.589 1.00 21.71 ? 12  THR A C   1 
ATOM   95   O O   . THR A 1 12 ? -9.936  -0.023  27.135 1.00 19.92 ? 12  THR A O   1 
ATOM   96   C CB  . THR A 1 12 ? -10.337 -2.905  28.335 1.00 22.75 ? 12  THR A CB  1 
ATOM   97   O OG1 . THR A 1 12 ? -9.778  -4.114  28.870 1.00 22.78 ? 12  THR A OG1 1 
ATOM   98   C CG2 . THR A 1 12 ? -11.732 -3.196  27.790 1.00 22.66 ? 12  THR A CG2 1 
ATOM   99   N N   . ILE A 1 13 ? -10.625 -1.304  25.422 1.00 21.81 ? 13  ILE A N   1 
ATOM   100  C CA  . ILE A 1 13 ? -11.253 -0.197  24.724 1.00 22.00 ? 13  ILE A CA  1 
ATOM   101  C C   . ILE A 1 13 ? -12.671 -0.599  24.347 1.00 23.68 ? 13  ILE A C   1 
ATOM   102  O O   . ILE A 1 13 ? -13.018 -1.785  24.375 1.00 22.04 ? 13  ILE A O   1 
ATOM   103  C CB  . ILE A 1 13 ? -10.495 0.140   23.417 1.00 22.02 ? 13  ILE A CB  1 
ATOM   104  C CG1 . ILE A 1 13 ? -10.648 -1.018  22.423 1.00 22.76 ? 13  ILE A CG1 1 
ATOM   105  C CG2 . ILE A 1 13 ? -9.020  0.386   23.714 1.00 20.89 ? 13  ILE A CG2 1 
ATOM   106  C CD1 . ILE A 1 13 ? -10.056 -0.757  21.054 1.00 23.05 ? 13  ILE A CD1 1 
ATOM   107  N N   A ARG A 1 14 ? -13.484 0.394   24.003 0.50 23.40 ? 14  ARG A N   1 
ATOM   108  N N   B ARG A 1 14 ? -13.494 0.392   24.017 0.50 23.32 ? 14  ARG A N   1 
ATOM   109  C CA  A ARG A 1 14 ? -14.857 0.151   23.589 0.50 24.80 ? 14  ARG A CA  1 
ATOM   110  C CA  B ARG A 1 14 ? -14.863 0.141   23.588 0.50 24.66 ? 14  ARG A CA  1 
ATOM   111  C C   A ARG A 1 14 ? -15.056 0.833   22.244 0.50 23.52 ? 14  ARG A C   1 
ATOM   112  C C   B ARG A 1 14 ? -15.063 0.832   22.249 0.50 23.44 ? 14  ARG A C   1 
ATOM   113  O O   A ARG A 1 14 ? -14.814 2.034   22.105 0.50 22.91 ? 14  ARG A O   1 
ATOM   114  O O   B ARG A 1 14 ? -14.830 2.035   22.117 0.50 22.88 ? 14  ARG A O   1 
ATOM   115  C CB  A ARG A 1 14 ? -15.848 0.721   24.606 0.50 27.39 ? 14  ARG A CB  1 
ATOM   116  C CB  B ARG A 1 14 ? -15.888 0.671   24.599 0.50 27.13 ? 14  ARG A CB  1 
ATOM   117  C CG  A ARG A 1 14 ? -17.272 0.245   24.372 0.50 31.13 ? 14  ARG A CG  1 
ATOM   118  C CG  B ARG A 1 14 ? -17.314 0.631   24.050 0.50 30.53 ? 14  ARG A CG  1 
ATOM   119  C CD  A ARG A 1 14 ? -18.243 0.807   25.397 0.50 34.12 ? 14  ARG A CD  1 
ATOM   120  C CD  B ARG A 1 14 ? -18.398 0.628   25.125 0.50 33.99 ? 14  ARG A CD  1 
ATOM   121  N NE  A ARG A 1 14 ? -19.415 -0.054  25.531 0.50 35.75 ? 14  ARG A NE  1 
ATOM   122  N NE  B ARG A 1 14 ? -18.442 1.846   25.931 0.50 36.12 ? 14  ARG A NE  1 
ATOM   123  C CZ  A ARG A 1 14 ? -19.371 -1.285  26.029 0.50 36.39 ? 14  ARG A CZ  1 
ATOM   124  C CZ  B ARG A 1 14 ? -17.747 2.034   27.047 0.50 36.99 ? 14  ARG A CZ  1 
ATOM   125  N NH1 A ARG A 1 14 ? -18.219 -1.789  26.440 0.50 37.34 ? 14  ARG A NH1 1 
ATOM   126  N NH1 B ARG A 1 14 ? -16.942 1.085   27.502 0.50 38.34 ? 14  ARG A NH1 1 
ATOM   127  N NH2 A ARG A 1 14 ? -20.472 -2.018  26.109 0.50 37.42 ? 14  ARG A NH2 1 
ATOM   128  N NH2 B ARG A 1 14 ? -17.875 3.166   27.721 0.50 38.58 ? 14  ARG A NH2 1 
ATOM   129  N N   . ILE A 1 15 ? -15.486 0.061   21.254 1.00 22.69 ? 15  ILE A N   1 
ATOM   130  C CA  . ILE A 1 15 ? -15.708 0.592   19.921 1.00 23.20 ? 15  ILE A CA  1 
ATOM   131  C C   . ILE A 1 15 ? -16.868 -0.142  19.257 1.00 24.14 ? 15  ILE A C   1 
ATOM   132  O O   . ILE A 1 15 ? -16.988 -1.364  19.368 1.00 24.54 ? 15  ILE A O   1 
ATOM   133  C CB  . ILE A 1 15 ? -14.423 0.454   19.062 1.00 21.39 ? 15  ILE A CB  1 
ATOM   134  C CG1 . ILE A 1 15 ? -14.659 1.030   17.665 1.00 22.24 ? 15  ILE A CG1 1 
ATOM   135  C CG2 . ILE A 1 15 ? -13.990 -1.011  18.996 1.00 22.29 ? 15  ILE A CG2 1 
ATOM   136  C CD1 . ILE A 1 15 ? -13.427 1.028   16.785 1.00 20.49 ? 15  ILE A CD1 1 
ATOM   137  N N   . GLY A 1 16 ? -17.731 0.610   18.579 1.00 24.87 ? 16  GLY A N   1 
ATOM   138  C CA  . GLY A 1 16 ? -18.872 0.002   17.921 1.00 24.09 ? 16  GLY A CA  1 
ATOM   139  C C   . GLY A 1 16 ? -19.754 -0.717  18.925 1.00 24.85 ? 16  GLY A C   1 
ATOM   140  O O   . GLY A 1 16 ? -20.535 -1.595  18.559 1.00 25.15 ? 16  GLY A O   1 
ATOM   141  N N   . GLY A 1 17 ? -19.618 -0.343  20.195 1.00 24.01 ? 17  GLY A N   1 
ATOM   142  C CA  . GLY A 1 17 ? -20.402 -0.959  21.251 1.00 25.80 ? 17  GLY A CA  1 
ATOM   143  C C   . GLY A 1 17 ? -19.813 -2.250  21.797 1.00 26.51 ? 17  GLY A C   1 
ATOM   144  O O   . GLY A 1 17 ? -20.399 -2.874  22.683 1.00 26.45 ? 17  GLY A O   1 
ATOM   145  N N   . GLN A 1 18 ? -18.649 -2.643  21.287 1.00 27.66 ? 18  GLN A N   1 
ATOM   146  C CA  . GLN A 1 18 ? -17.992 -3.881  21.710 1.00 28.06 ? 18  GLN A CA  1 
ATOM   147  C C   . GLN A 1 18 ? -16.676 -3.623  22.445 1.00 27.38 ? 18  GLN A C   1 
ATOM   148  O O   . GLN A 1 18 ? -15.931 -2.710  22.089 1.00 25.93 ? 18  GLN A O   1 
ATOM   149  C CB  . GLN A 1 18 ? -17.717 -4.753  20.481 1.00 30.90 ? 18  GLN A CB  1 
ATOM   150  C CG  . GLN A 1 18 ? -17.249 -6.167  20.793 1.00 37.00 ? 18  GLN A CG  1 
ATOM   151  C CD  . GLN A 1 18 ? -16.776 -6.913  19.555 1.00 39.41 ? 18  GLN A CD  1 
ATOM   152  O OE1 . GLN A 1 18 ? -16.715 -8.144  19.542 1.00 41.95 ? 18  GLN A OE1 1 
ATOM   153  N NE2 . GLN A 1 18 ? -16.428 -6.169  18.511 1.00 41.75 ? 18  GLN A NE2 1 
ATOM   154  N N   . LEU A 1 19 ? -16.388 -4.431  23.463 1.00 24.49 ? 19  LEU A N   1 
ATOM   155  C CA  . LEU A 1 19 ? -15.145 -4.279  24.217 1.00 24.32 ? 19  LEU A CA  1 
ATOM   156  C C   . LEU A 1 19 ? -14.040 -5.104  23.565 1.00 24.73 ? 19  LEU A C   1 
ATOM   157  O O   . LEU A 1 19 ? -14.291 -6.207  23.077 1.00 25.28 ? 19  LEU A O   1 
ATOM   158  C CB  . LEU A 1 19 ? -15.317 -4.752  25.665 1.00 26.78 ? 19  LEU A CB  1 
ATOM   159  C CG  . LEU A 1 19 ? -16.385 -4.106  26.549 1.00 28.23 ? 19  LEU A CG  1 
ATOM   160  C CD1 . LEU A 1 19 ? -17.758 -4.600  26.129 1.00 29.80 ? 19  LEU A CD1 1 
ATOM   161  C CD2 . LEU A 1 19 ? -16.129 -4.464  28.007 1.00 27.49 ? 19  LEU A CD2 1 
ATOM   162  N N   . LYS A 1 20 ? -12.822 -4.569  23.558 1.00 24.44 ? 20  LYS A N   1 
ATOM   163  C CA  . LYS A 1 20 ? -11.673 -5.263  22.977 1.00 25.39 ? 20  LYS A CA  1 
ATOM   164  C C   . LYS A 1 20 ? -10.394 -4.895  23.713 1.00 22.79 ? 20  LYS A C   1 
ATOM   165  O O   . LYS A 1 20 ? -10.374 -3.972  24.520 1.00 26.33 ? 20  LYS A O   1 
ATOM   166  C CB  . LYS A 1 20 ? -11.508 -4.900  21.499 1.00 25.92 ? 20  LYS A CB  1 
ATOM   167  C CG  . LYS A 1 20 ? -12.649 -5.336  20.606 1.00 28.89 ? 20  LYS A CG  1 
ATOM   168  C CD  . LYS A 1 20 ? -12.274 -5.184  19.142 1.00 31.53 ? 20  LYS A CD  1 
ATOM   169  C CE  . LYS A 1 20 ? -13.229 -5.960  18.257 1.00 31.83 ? 20  LYS A CE  1 
ATOM   170  N NZ  . LYS A 1 20 ? -12.809 -5.938  16.838 1.00 35.40 ? 20  LYS A NZ  1 
ATOM   171  N N   . GLU A 1 21 ? -9.322  -5.623  23.435 1.00 22.31 ? 21  GLU A N   1 
ATOM   172  C CA  . GLU A 1 21 ? -8.044  -5.329  24.066 1.00 21.01 ? 21  GLU A CA  1 
ATOM   173  C C   . GLU A 1 21 ? -7.127  -4.769  22.988 1.00 20.36 ? 21  GLU A C   1 
ATOM   174  O O   . GLU A 1 21 ? -7.096  -5.273  21.862 1.00 21.34 ? 21  GLU A O   1 
ATOM   175  C CB  . GLU A 1 21 ? -7.449  -6.585  24.678 1.00 20.55 ? 21  GLU A CB  1 
ATOM   176  N N   . ALA A 1 22 ? -6.396  -3.714  23.322 1.00 17.96 ? 22  ALA A N   1 
ATOM   177  C CA  . ALA A 1 22 ? -5.495  -3.100  22.362 1.00 17.65 ? 22  ALA A CA  1 
ATOM   178  C C   . ALA A 1 22 ? -4.175  -2.741  23.022 1.00 17.73 ? 22  ALA A C   1 
ATOM   179  O O   . ALA A 1 22 ? -4.081  -2.682  24.247 1.00 18.09 ? 22  ALA A O   1 
ATOM   180  C CB  . ALA A 1 22 ? -6.141  -1.849  21.757 1.00 16.83 ? 22  ALA A CB  1 
ATOM   181  N N   A LEU A 1 23 ? -3.162  -2.499  22.196 0.50 18.13 ? 23  LEU A N   1 
ATOM   182  N N   B LEU A 1 23 ? -3.153  -2.506  22.205 0.50 18.86 ? 23  LEU A N   1 
ATOM   183  C CA  A LEU A 1 23 ? -1.832  -2.141  22.673 0.50 17.58 ? 23  LEU A CA  1 
ATOM   184  C CA  B LEU A 1 23 ? -1.838  -2.151  22.722 0.50 18.82 ? 23  LEU A CA  1 
ATOM   185  C C   A LEU A 1 23 ? -1.522  -0.673  22.393 0.50 17.68 ? 23  LEU A C   1 
ATOM   186  C C   B LEU A 1 23 ? -1.514  -0.693  22.405 0.50 18.50 ? 23  LEU A C   1 
ATOM   187  O O   A LEU A 1 23 ? -1.631  -0.217  21.254 0.50 17.49 ? 23  LEU A O   1 
ATOM   188  O O   B LEU A 1 23 ? -1.605  -0.264  21.253 0.50 18.21 ? 23  LEU A O   1 
ATOM   189  C CB  A LEU A 1 23 ? -0.783  -3.017  21.984 0.50 18.03 ? 23  LEU A CB  1 
ATOM   190  C CB  B LEU A 1 23 ? -0.767  -3.064  22.115 0.50 20.96 ? 23  LEU A CB  1 
ATOM   191  C CG  A LEU A 1 23 ? -0.693  -4.475  22.432 0.50 17.59 ? 23  LEU A CG  1 
ATOM   192  C CG  B LEU A 1 23 ? 0.599   -3.020  22.803 0.50 21.53 ? 23  LEU A CG  1 
ATOM   193  C CD1 A LEU A 1 23 ? -0.071  -5.325  21.334 0.50 17.57 ? 23  LEU A CD1 1 
ATOM   194  C CD1 B LEU A 1 23 ? 0.429   -3.463  24.242 0.50 23.62 ? 23  LEU A CD1 1 
ATOM   195  C CD2 A LEU A 1 23 ? 0.126   -4.550  23.713 0.50 17.38 ? 23  LEU A CD2 1 
ATOM   196  C CD2 B LEU A 1 23 ? 1.583   -3.932  22.102 0.50 24.34 ? 23  LEU A CD2 1 
ATOM   197  N N   . LEU A 1 24 ? -1.140  0.064   23.432 1.00 17.63 ? 24  LEU A N   1 
ATOM   198  C CA  . LEU A 1 24 ? -0.795  1.481   23.271 1.00 18.82 ? 24  LEU A CA  1 
ATOM   199  C C   . LEU A 1 24 ? 0.535   1.499   22.522 1.00 18.51 ? 24  LEU A C   1 
ATOM   200  O O   . LEU A 1 24 ? 1.566   1.094   23.060 1.00 18.68 ? 24  LEU A O   1 
ATOM   201  C CB  . LEU A 1 24 ? -0.662  2.152   24.641 1.00 16.03 ? 24  LEU A CB  1 
ATOM   202  C CG  . LEU A 1 24 ? -1.930  2.099   25.496 1.00 16.72 ? 24  LEU A CG  1 
ATOM   203  C CD1 . LEU A 1 24 ? -1.697  2.813   26.824 1.00 15.31 ? 24  LEU A CD1 1 
ATOM   204  C CD2 . LEU A 1 24 ? -3.077  2.743   24.736 1.00 16.45 ? 24  LEU A CD2 1 
ATOM   205  N N   . ASN A 1 25 ? 0.505   1.981   21.285 1.00 18.76 ? 25  ASN A N   1 
ATOM   206  C CA  . ASN A 1 25 ? 1.680   1.968   20.423 1.00 17.62 ? 25  ASN A CA  1 
ATOM   207  C C   . ASN A 1 25 ? 2.183   3.338   19.969 1.00 16.71 ? 25  ASN A C   1 
ATOM   208  O O   . ASN A 1 25 ? 1.663   3.911   19.013 1.00 16.30 ? 25  ASN A O   1 
ATOM   209  C CB  . ASN A 1 25 ? 1.341   1.109   19.201 1.00 20.47 ? 25  ASN A CB  1 
ATOM   210  C CG  . ASN A 1 25 ? 2.556   0.503   18.549 1.00 22.66 ? 25  ASN A CG  1 
ATOM   211  O OD1 . ASN A 1 25 ? 2.445   -0.498  17.842 1.00 24.15 ? 25  ASN A OD1 1 
ATOM   212  N ND2 . ASN A 1 25 ? 3.724   1.103   18.772 1.00 21.89 ? 25  ASN A ND2 1 
ATOM   213  N N   . THR A 1 26 ? 3.213   3.849   20.636 1.00 15.55 ? 26  THR A N   1 
ATOM   214  C CA  . THR A 1 26 ? 3.766   5.147   20.276 1.00 16.37 ? 26  THR A CA  1 
ATOM   215  C C   . THR A 1 26 ? 4.520   5.076   18.944 1.00 15.98 ? 26  THR A C   1 
ATOM   216  O O   . THR A 1 26 ? 4.843   6.104   18.348 1.00 17.48 ? 26  THR A O   1 
ATOM   217  C CB  . THR A 1 26 ? 4.708   5.663   21.373 1.00 14.78 ? 26  THR A CB  1 
ATOM   218  O OG1 . THR A 1 26 ? 5.785   4.736   21.551 1.00 14.96 ? 26  THR A OG1 1 
ATOM   219  C CG2 . THR A 1 26 ? 3.948   5.812   22.695 1.00 15.41 ? 26  THR A CG2 1 
ATOM   220  N N   . GLY A 1 27 ? 4.788   3.857   18.480 1.00 16.53 ? 27  GLY A N   1 
ATOM   221  C CA  . GLY A 1 27 ? 5.497   3.670   17.226 1.00 16.01 ? 27  GLY A CA  1 
ATOM   222  C C   . GLY A 1 27 ? 4.555   3.490   16.047 1.00 16.78 ? 27  GLY A C   1 
ATOM   223  O O   . GLY A 1 27 ? 4.956   3.069   14.963 1.00 16.32 ? 27  GLY A O   1 
ATOM   224  N N   . ALA A 1 28 ? 3.288   3.811   16.258 1.00 16.50 ? 28  ALA A N   1 
ATOM   225  C CA  . ALA A 1 28 ? 2.304   3.695   15.198 1.00 16.38 ? 28  ALA A CA  1 
ATOM   226  C C   . ALA A 1 28 ? 1.638   5.045   14.942 1.00 16.74 ? 28  ALA A C   1 
ATOM   227  O O   . ALA A 1 28 ? 1.133   5.690   15.870 1.00 14.14 ? 28  ALA A O   1 
ATOM   228  C CB  . ALA A 1 28 ? 1.259   2.647   15.571 1.00 17.58 ? 28  ALA A CB  1 
ATOM   229  N N   . ASP A 1 29 ? 1.658   5.485   13.687 1.00 15.23 ? 29  ASP A N   1 
ATOM   230  C CA  . ASP A 1 29 ? 1.021   6.751   13.322 1.00 15.53 ? 29  ASP A CA  1 
ATOM   231  C C   . ASP A 1 29 ? -0.490  6.633   13.501 1.00 16.30 ? 29  ASP A C   1 
ATOM   232  O O   . ASP A 1 29 ? -1.156  7.580   13.933 1.00 15.35 ? 29  ASP A O   1 
ATOM   233  C CB  . ASP A 1 29 ? 1.257   7.106   11.851 1.00 17.43 ? 29  ASP A CB  1 
ATOM   234  C CG  . ASP A 1 29 ? 2.711   7.342   11.512 1.00 17.44 ? 29  ASP A CG  1 
ATOM   235  O OD1 . ASP A 1 29 ? 3.530   7.583   12.422 1.00 18.58 ? 29  ASP A OD1 1 
ATOM   236  O OD2 . ASP A 1 29 ? 3.025   7.305   10.304 1.00 18.39 ? 29  ASP A OD2 1 
ATOM   237  N N   . ASP A 1 30 ? -1.023  5.465   13.151 1.00 16.12 ? 30  ASP A N   1 
ATOM   238  C CA  . ASP A 1 30 ? -2.463  5.222   13.212 1.00 18.28 ? 30  ASP A CA  1 
ATOM   239  C C   . ASP A 1 30 ? -2.934  4.097   14.132 1.00 16.40 ? 30  ASP A C   1 
ATOM   240  O O   . ASP A 1 30 ? -2.139  3.338   14.680 1.00 16.45 ? 30  ASP A O   1 
ATOM   241  C CB  . ASP A 1 30 ? -2.987  4.955   11.796 1.00 19.09 ? 30  ASP A CB  1 
ATOM   242  C CG  . ASP A 1 30 ? -2.980  6.198   10.926 1.00 21.74 ? 30  ASP A CG  1 
ATOM   243  O OD1 . ASP A 1 30 ? -3.821  7.093   11.158 1.00 27.03 ? 30  ASP A OD1 1 
ATOM   244  O OD2 . ASP A 1 30 ? -2.137  6.283   10.013 1.00 21.35 ? 30  ASP A OD2 1 
ATOM   245  N N   . THR A 1 31 ? -4.253  4.005   14.275 1.00 15.01 ? 31  THR A N   1 
ATOM   246  C CA  . THR A 1 31 ? -4.898  2.994   15.106 1.00 15.47 ? 31  THR A CA  1 
ATOM   247  C C   . THR A 1 31 ? -5.397  1.895   14.167 1.00 16.12 ? 31  THR A C   1 
ATOM   248  O O   . THR A 1 31 ? -6.245  2.132   13.301 1.00 16.00 ? 31  THR A O   1 
ATOM   249  C CB  . THR A 1 31 ? -6.061  3.630   15.901 1.00 14.99 ? 31  THR A CB  1 
ATOM   250  O OG1 . THR A 1 31 ? -5.521  4.571   16.838 1.00 14.81 ? 31  THR A OG1 1 
ATOM   251  C CG2 . THR A 1 31 ? -6.855  2.576   16.657 1.00 15.32 ? 31  THR A CG2 1 
ATOM   252  N N   . VAL A 1 32 ? -4.845  0.698   14.332 1.00 16.71 ? 32  VAL A N   1 
ATOM   253  C CA  . VAL A 1 32 ? -5.180  -0.435  13.475 1.00 14.95 ? 32  VAL A CA  1 
ATOM   254  C C   . VAL A 1 32 ? -5.715  -1.609  14.280 1.00 15.43 ? 32  VAL A C   1 
ATOM   255  O O   . VAL A 1 32 ? -5.058  -2.090  15.204 1.00 15.40 ? 32  VAL A O   1 
ATOM   256  C CB  . VAL A 1 32 ? -3.928  -0.906  12.688 1.00 14.62 ? 32  VAL A CB  1 
ATOM   257  C CG1 . VAL A 1 32 ? -4.330  -1.838  11.556 1.00 12.87 ? 32  VAL A CG1 1 
ATOM   258  C CG2 . VAL A 1 32 ? -3.165  0.309   12.155 1.00 15.50 ? 32  VAL A CG2 1 
ATOM   259  N N   . LEU A 1 33 ? -6.905  -2.074  13.908 1.00 15.96 ? 33  LEU A N   1 
ATOM   260  C CA  . LEU A 1 33 ? -7.545  -3.194  14.587 1.00 17.42 ? 33  LEU A CA  1 
ATOM   261  C C   . LEU A 1 33 ? -7.743  -4.370  13.643 1.00 17.97 ? 33  LEU A C   1 
ATOM   262  O O   . LEU A 1 33 ? -7.883  -4.196  12.432 1.00 18.16 ? 33  LEU A O   1 
ATOM   263  C CB  . LEU A 1 33 ? -8.911  -2.775  15.143 1.00 18.92 ? 33  LEU A CB  1 
ATOM   264  C CG  . LEU A 1 33 ? -8.968  -1.549  16.057 1.00 19.36 ? 33  LEU A CG  1 
ATOM   265  C CD1 . LEU A 1 33 ? -10.413 -1.288  16.455 1.00 20.06 ? 33  LEU A CD1 1 
ATOM   266  C CD2 . LEU A 1 33 ? -8.115  -1.773  17.288 1.00 20.29 ? 33  LEU A CD2 1 
ATOM   267  N N   . GLU A 1 34 ? -7.752  -5.565  14.219 1.00 19.31 ? 34  GLU A N   1 
ATOM   268  C CA  . GLU A 1 34 ? -7.943  -6.796  13.473 1.00 21.21 ? 34  GLU A CA  1 
ATOM   269  C C   . GLU A 1 34 ? -9.318  -6.766  12.819 1.00 22.31 ? 34  GLU A C   1 
ATOM   270  O O   . GLU A 1 34 ? -10.200 -6.019  13.249 1.00 20.38 ? 34  GLU A O   1 
ATOM   271  C CB  . GLU A 1 34 ? -7.832  -7.985  14.423 1.00 22.68 ? 34  GLU A CB  1 
ATOM   272  C CG  . GLU A 1 34 ? -6.620  -7.886  15.329 1.00 25.28 ? 34  GLU A CG  1 
ATOM   273  C CD  . GLU A 1 34 ? -6.654  -8.879  16.471 1.00 26.89 ? 34  GLU A CD  1 
ATOM   274  O OE1 . GLU A 1 34 ? -7.759  -9.246  16.913 1.00 29.28 ? 34  GLU A OE1 1 
ATOM   275  O OE2 . GLU A 1 34 ? -5.571  -9.278  16.936 1.00 29.35 ? 34  GLU A OE2 1 
ATOM   276  N N   . GLU A 1 35 ? -9.487  -7.580  11.781 1.00 23.61 ? 35  GLU A N   1 
ATOM   277  C CA  . GLU A 1 35 ? -10.739 -7.657  11.034 1.00 27.03 ? 35  GLU A CA  1 
ATOM   278  C C   . GLU A 1 35 ? -11.973 -7.620  11.929 1.00 25.76 ? 35  GLU A C   1 
ATOM   279  O O   . GLU A 1 35 ? -12.084 -8.398  12.876 1.00 24.76 ? 35  GLU A O   1 
ATOM   280  C CB  . GLU A 1 35 ? -10.757 -8.933  10.188 1.00 30.65 ? 35  GLU A CB  1 
ATOM   281  C CG  . GLU A 1 35 ? -11.824 -8.933  9.117  1.00 37.24 ? 35  GLU A CG  1 
ATOM   282  C CD  . GLU A 1 35 ? -11.775 -7.682  8.263  1.00 39.49 ? 35  GLU A CD  1 
ATOM   283  O OE1 . GLU A 1 35 ? -10.707 -7.389  7.683  1.00 42.69 ? 35  GLU A OE1 1 
ATOM   284  O OE2 . GLU A 1 35 ? -12.805 -6.985  8.182  1.00 41.03 ? 35  GLU A OE2 1 
ATOM   285  N N   . MET A 1 36 ? -12.889 -6.706  11.620 1.00 25.69 ? 36  MET A N   1 
ATOM   286  C CA  . MET A 1 36 ? -14.130 -6.551  12.371 1.00 26.99 ? 36  MET A CA  1 
ATOM   287  C C   . MET A 1 36 ? -15.093 -5.706  11.553 1.00 27.81 ? 36  MET A C   1 
ATOM   288  O O   . MET A 1 36 ? -14.707 -5.094  10.553 1.00 28.53 ? 36  MET A O   1 
ATOM   289  C CB  . MET A 1 36 ? -13.885 -5.838  13.704 1.00 25.57 ? 36  MET A CB  1 
ATOM   290  C CG  . MET A 1 36 ? -13.612 -4.334  13.545 1.00 28.01 ? 36  MET A CG  1 
ATOM   291  S SD  . MET A 1 36 ? -13.315 -3.460  15.095 1.00 26.90 ? 36  MET A SD  1 
ATOM   292  C CE  . MET A 1 36 ? -14.927 -3.610  15.877 1.00 27.65 ? 36  MET A CE  1 
ATOM   293  N N   . ASN A 1 37 ? -16.346 -5.667  11.992 1.00 27.67 ? 37  ASN A N   1 
ATOM   294  C CA  . ASN A 1 37 ? -17.368 -4.878  11.325 1.00 28.58 ? 37  ASN A CA  1 
ATOM   295  C C   . ASN A 1 37 ? -17.530 -3.548  12.053 1.00 27.65 ? 37  ASN A C   1 
ATOM   296  O O   . ASN A 1 37 ? -17.569 -3.506  13.281 1.00 27.79 ? 37  ASN A O   1 
ATOM   297  C CB  . ASN A 1 37 ? -18.691 -5.627  11.330 1.00 28.86 ? 37  ASN A CB  1 
ATOM   298  N N   . LEU A 1 38 ? -17.612 -2.466  11.290 1.00 27.53 ? 38  LEU A N   1 
ATOM   299  C CA  . LEU A 1 38 ? -17.809 -1.137  11.856 1.00 26.87 ? 38  LEU A CA  1 
ATOM   300  C C   . LEU A 1 38 ? -18.859 -0.431  11.020 1.00 27.18 ? 38  LEU A C   1 
ATOM   301  O O   . LEU A 1 38 ? -18.829 -0.502  9.795  1.00 25.99 ? 38  LEU A O   1 
ATOM   302  C CB  . LEU A 1 38 ? -16.510 -0.329  11.840 1.00 26.99 ? 38  LEU A CB  1 
ATOM   303  C CG  . LEU A 1 38 ? -15.519 -0.653  12.958 1.00 27.25 ? 38  LEU A CG  1 
ATOM   304  C CD1 . LEU A 1 38 ? -14.259 0.179   12.789 1.00 25.48 ? 38  LEU A CD1 1 
ATOM   305  C CD2 . LEU A 1 38 ? -16.169 -0.375  14.303 1.00 25.16 ? 38  LEU A CD2 1 
ATOM   306  N N   . PRO A 1 39 ? -19.807 0.257   11.672 1.00 29.42 ? 39  PRO A N   1 
ATOM   307  C CA  . PRO A 1 39 ? -20.862 0.968   10.946 1.00 29.35 ? 39  PRO A CA  1 
ATOM   308  C C   . PRO A 1 39 ? -20.343 2.149   10.131 1.00 29.73 ? 39  PRO A C   1 
ATOM   309  O O   . PRO A 1 39 ? -19.355 2.787   10.497 1.00 29.80 ? 39  PRO A O   1 
ATOM   310  C CB  . PRO A 1 39 ? -21.813 1.397   12.062 1.00 28.73 ? 39  PRO A CB  1 
ATOM   311  C CG  . PRO A 1 39 ? -20.882 1.626   13.214 1.00 29.77 ? 39  PRO A CG  1 
ATOM   312  C CD  . PRO A 1 39 ? -19.965 0.427   13.129 1.00 28.66 ? 39  PRO A CD  1 
ATOM   313  N N   . GLY A 1 40 ? -21.009 2.421   9.015  1.00 29.64 ? 40  GLY A N   1 
ATOM   314  C CA  . GLY A 1 40 ? -20.613 3.539   8.180  1.00 30.40 ? 40  GLY A CA  1 
ATOM   315  C C   . GLY A 1 40 ? -19.763 3.184   6.979  1.00 30.00 ? 40  GLY A C   1 
ATOM   316  O O   . GLY A 1 40 ? -19.438 2.020   6.738  1.00 30.04 ? 40  GLY A O   1 
ATOM   317  N N   . LYS A 1 41 ? -19.402 4.209   6.219  1.00 29.00 ? 41  LYS A N   1 
ATOM   318  C CA  . LYS A 1 41 ? -18.590 4.024   5.032  1.00 29.00 ? 41  LYS A CA  1 
ATOM   319  C C   . LYS A 1 41 ? -17.117 3.932   5.398  1.00 28.95 ? 41  LYS A C   1 
ATOM   320  O O   . LYS A 1 41 ? -16.695 4.384   6.465  1.00 28.36 ? 41  LYS A O   1 
ATOM   321  C CB  . LYS A 1 41 ? -18.812 5.183   4.067  1.00 31.21 ? 41  LYS A CB  1 
ATOM   322  N N   . TRP A 1 42 ? -16.345 3.329   4.505  1.00 28.05 ? 42  TRP A N   1 
ATOM   323  C CA  . TRP A 1 42 ? -14.908 3.193   4.691  1.00 28.39 ? 42  TRP A CA  1 
ATOM   324  C C   . TRP A 1 42 ? -14.247 3.357   3.330  1.00 28.48 ? 42  TRP A C   1 
ATOM   325  O O   . TRP A 1 42 ? -14.912 3.255   2.297  1.00 28.20 ? 42  TRP A O   1 
ATOM   326  C CB  . TRP A 1 42 ? -14.554 1.826   5.294  1.00 27.16 ? 42  TRP A CB  1 
ATOM   327  C CG  . TRP A 1 42 ? -15.010 0.645   4.492  1.00 26.97 ? 42  TRP A CG  1 
ATOM   328  C CD1 . TRP A 1 42 ? -16.199 -0.013  4.604  1.00 27.97 ? 42  TRP A CD1 1 
ATOM   329  C CD2 . TRP A 1 42 ? -14.280 -0.019  3.453  1.00 27.64 ? 42  TRP A CD2 1 
ATOM   330  N NE1 . TRP A 1 42 ? -16.256 -1.050  3.700  1.00 27.95 ? 42  TRP A NE1 1 
ATOM   331  C CE2 . TRP A 1 42 ? -15.092 -1.075  2.981  1.00 27.31 ? 42  TRP A CE2 1 
ATOM   332  C CE3 . TRP A 1 42 ? -13.019 0.177   2.874  1.00 27.08 ? 42  TRP A CE3 1 
ATOM   333  C CZ2 . TRP A 1 42 ? -14.681 -1.936  1.957  1.00 27.82 ? 42  TRP A CZ2 1 
ATOM   334  C CZ3 . TRP A 1 42 ? -12.610 -0.682  1.852  1.00 26.90 ? 42  TRP A CZ3 1 
ATOM   335  C CH2 . TRP A 1 42 ? -13.442 -1.724  1.406  1.00 27.71 ? 42  TRP A CH2 1 
ATOM   336  N N   . LYS A 1 43 ? -12.946 3.627   3.331  1.00 28.43 ? 43  LYS A N   1 
ATOM   337  C CA  . LYS A 1 43 ? -12.196 3.803   2.091  1.00 27.81 ? 43  LYS A CA  1 
ATOM   338  C C   . LYS A 1 43 ? -10.960 2.909   2.114  1.00 27.69 ? 43  LYS A C   1 
ATOM   339  O O   . LYS A 1 43 ? -10.383 2.674   3.175  1.00 24.44 ? 43  LYS A O   1 
ATOM   340  C CB  . LYS A 1 43 ? -11.780 5.266   1.937  1.00 29.31 ? 43  LYS A CB  1 
ATOM   341  N N   . PRO A 1 44 ? -10.552 2.383   0.944  1.00 27.20 ? 44  PRO A N   1 
ATOM   342  C CA  . PRO A 1 44 ? -9.371  1.513   0.865  1.00 26.83 ? 44  PRO A CA  1 
ATOM   343  C C   . PRO A 1 44 ? -8.096  2.316   1.104  1.00 26.10 ? 44  PRO A C   1 
ATOM   344  O O   . PRO A 1 44 ? -7.941  3.422   0.583  1.00 25.89 ? 44  PRO A O   1 
ATOM   345  C CB  . PRO A 1 44 ? -9.439  0.956   -0.558 1.00 28.83 ? 44  PRO A CB  1 
ATOM   346  C CG  . PRO A 1 44 ? -10.904 1.024   -0.894 1.00 28.79 ? 44  PRO A CG  1 
ATOM   347  C CD  . PRO A 1 44 ? -11.295 2.367   -0.327 1.00 27.80 ? 44  PRO A CD  1 
ATOM   348  N N   . LYS A 1 45 ? -7.185  1.759   1.891  1.00 23.93 ? 45  LYS A N   1 
ATOM   349  C CA  . LYS A 1 45 ? -5.935  2.441   2.193  1.00 22.30 ? 45  LYS A CA  1 
ATOM   350  C C   . LYS A 1 45 ? -4.805  1.438   2.375  1.00 20.57 ? 45  LYS A C   1 
ATOM   351  O O   . LYS A 1 45 ? -5.048  0.270   2.654  1.00 21.12 ? 45  LYS A O   1 
ATOM   352  C CB  . LYS A 1 45 ? -6.091  3.262   3.473  1.00 23.29 ? 45  LYS A CB  1 
ATOM   353  C CG  . LYS A 1 45 ? -4.873  4.093   3.832  1.00 29.43 ? 45  LYS A CG  1 
ATOM   354  C CD  . LYS A 1 45 ? -5.026  4.748   5.194  1.00 32.91 ? 45  LYS A CD  1 
ATOM   355  C CE  . LYS A 1 45 ? -3.895  5.728   5.456  1.00 34.82 ? 45  LYS A CE  1 
ATOM   356  N NZ  . LYS A 1 45 ? -4.037  6.390   6.773  1.00 36.95 ? 45  LYS A NZ  1 
ATOM   357  N N   . MET A 1 46 ? -3.571  1.901   2.207  1.00 19.88 ? 46  MET A N   1 
ATOM   358  C CA  . MET A 1 46 ? -2.400  1.050   2.390  1.00 20.34 ? 46  MET A CA  1 
ATOM   359  C C   . MET A 1 46 ? -1.489  1.675   3.439  1.00 19.14 ? 46  MET A C   1 
ATOM   360  O O   . MET A 1 46 ? -1.252  2.887   3.425  1.00 21.94 ? 46  MET A O   1 
ATOM   361  C CB  . MET A 1 46 ? -1.645  0.878   1.070  1.00 22.51 ? 46  MET A CB  1 
ATOM   362  C CG  . MET A 1 46 ? -2.371  -0.007  0.071  1.00 25.11 ? 46  MET A CG  1 
ATOM   363  S SD  . MET A 1 46 ? -1.366  -0.399  -1.374 1.00 26.40 ? 46  MET A SD  1 
ATOM   364  C CE  . MET A 1 46 ? -0.134  -1.499  -0.637 1.00 26.59 ? 46  MET A CE  1 
ATOM   365  N N   . ILE A 1 47 ? -0.983  0.848   4.350  1.00 18.67 ? 47  ILE A N   1 
ATOM   366  C CA  . ILE A 1 47 ? -0.100  1.320   5.413  1.00 16.92 ? 47  ILE A CA  1 
ATOM   367  C C   . ILE A 1 47 ? 1.156   0.462   5.486  1.00 16.36 ? 47  ILE A C   1 
ATOM   368  O O   . ILE A 1 47 ? 1.187   -0.652  4.965  1.00 16.69 ? 47  ILE A O   1 
ATOM   369  C CB  . ILE A 1 47 ? -0.802  1.290   6.796  1.00 15.86 ? 47  ILE A CB  1 
ATOM   370  C CG1 . ILE A 1 47 ? -1.187  -0.151  7.164  1.00 13.50 ? 47  ILE A CG1 1 
ATOM   371  C CG2 . ILE A 1 47 ? -2.020  2.200   6.769  1.00 16.86 ? 47  ILE A CG2 1 
ATOM   372  C CD1 . ILE A 1 47 ? -1.774  -0.308  8.572  1.00 12.86 ? 47  ILE A CD1 1 
ATOM   373  N N   . GLY A 1 48 ? 2.191   0.993   6.132  1.00 17.75 ? 48  GLY A N   1 
ATOM   374  C CA  . GLY A 1 48 ? 3.446   0.271   6.254  1.00 17.93 ? 48  GLY A CA  1 
ATOM   375  C C   . GLY A 1 48 ? 3.756   -0.208  7.660  1.00 19.09 ? 48  GLY A C   1 
ATOM   376  O O   . GLY A 1 48 ? 3.354   0.410   8.653  1.00 19.57 ? 48  GLY A O   1 
ATOM   377  N N   . GLY A 1 49 ? 4.479   -1.317  7.736  1.00 16.98 ? 49  GLY A N   1 
ATOM   378  C CA  . GLY A 1 49 ? 4.855   -1.895  9.014  1.00 18.88 ? 49  GLY A CA  1 
ATOM   379  C C   . GLY A 1 49 ? 6.273   -2.425  8.965  1.00 18.17 ? 49  GLY A C   1 
ATOM   380  O O   . GLY A 1 49 ? 6.961   -2.258  7.959  1.00 19.77 ? 49  GLY A O   1 
ATOM   381  N N   . ILE A 1 50 ? 6.708   -3.074  10.041 1.00 17.70 ? 50  ILE A N   1 
ATOM   382  C CA  . ILE A 1 50 ? 8.056   -3.616  10.118 1.00 19.95 ? 50  ILE A CA  1 
ATOM   383  C C   . ILE A 1 50 ? 8.354   -4.610  8.988  1.00 19.84 ? 50  ILE A C   1 
ATOM   384  O O   . ILE A 1 50 ? 9.472   -4.658  8.480  1.00 18.60 ? 50  ILE A O   1 
ATOM   385  C CB  . ILE A 1 50 ? 8.294   -4.305  11.496 1.00 20.31 ? 50  ILE A CB  1 
ATOM   386  C CG1 . ILE A 1 50 ? 9.784   -4.601  11.697 1.00 22.57 ? 50  ILE A CG1 1 
ATOM   387  C CG2 . ILE A 1 50 ? 7.496   -5.592  11.582 1.00 20.76 ? 50  ILE A CG2 1 
ATOM   388  C CD1 . ILE A 1 50 ? 10.665  -3.368  11.627 1.00 22.31 ? 50  ILE A CD1 1 
ATOM   389  N N   . GLY A 1 51 ? 7.346   -5.378  8.581  1.00 17.85 ? 51  GLY A N   1 
ATOM   390  C CA  . GLY A 1 51 ? 7.551   -6.363  7.529  1.00 19.12 ? 51  GLY A CA  1 
ATOM   391  C C   . GLY A 1 51 ? 7.143   -5.956  6.124  1.00 19.49 ? 51  GLY A C   1 
ATOM   392  O O   . GLY A 1 51 ? 7.400   -6.684  5.165  1.00 18.20 ? 51  GLY A O   1 
ATOM   393  N N   . GLY A 1 52 ? 6.510   -4.797  5.984  1.00 19.42 ? 52  GLY A N   1 
ATOM   394  C CA  . GLY A 1 52 ? 6.085   -4.367  4.666  1.00 18.25 ? 52  GLY A CA  1 
ATOM   395  C C   . GLY A 1 52 ? 4.756   -3.642  4.695  1.00 19.02 ? 52  GLY A C   1 
ATOM   396  O O   . GLY A 1 52 ? 4.340   -3.143  5.740  1.00 18.45 ? 52  GLY A O   1 
ATOM   397  N N   . PHE A 1 53 ? 4.077   -3.600  3.554  1.00 18.91 ? 53  PHE A N   1 
ATOM   398  C CA  . PHE A 1 53 ? 2.801   -2.897  3.459  1.00 19.98 ? 53  PHE A CA  1 
ATOM   399  C C   . PHE A 1 53 ? 1.589   -3.813  3.371  1.00 18.62 ? 53  PHE A C   1 
ATOM   400  O O   . PHE A 1 53 ? 1.672   -4.911  2.822  1.00 20.33 ? 53  PHE A O   1 
ATOM   401  C CB  . PHE A 1 53 ? 2.821   -1.970  2.239  1.00 21.43 ? 53  PHE A CB  1 
ATOM   402  C CG  . PHE A 1 53 ? 3.791   -0.829  2.359  1.00 24.47 ? 53  PHE A CG  1 
ATOM   403  C CD1 . PHE A 1 53 ? 5.144   -1.063  2.599  1.00 26.71 ? 53  PHE A CD1 1 
ATOM   404  C CD2 . PHE A 1 53 ? 3.355   0.483   2.231  1.00 27.00 ? 53  PHE A CD2 1 
ATOM   405  C CE1 . PHE A 1 53 ? 6.046   -0.004  2.713  1.00 26.91 ? 53  PHE A CE1 1 
ATOM   406  C CE2 . PHE A 1 53 ? 4.251   1.550   2.343  1.00 28.23 ? 53  PHE A CE2 1 
ATOM   407  C CZ  . PHE A 1 53 ? 5.598   1.303   2.583  1.00 26.76 ? 53  PHE A CZ  1 
ATOM   408  N N   . ILE A 1 54 ? 0.462   -3.350  3.913  1.00 17.60 ? 54  ILE A N   1 
ATOM   409  C CA  . ILE A 1 54 ? -0.787  -4.106  3.871  1.00 17.81 ? 54  ILE A CA  1 
ATOM   410  C C   . ILE A 1 54 ? -1.944  -3.194  3.471  1.00 17.10 ? 54  ILE A C   1 
ATOM   411  O O   . ILE A 1 54 ? -1.832  -1.972  3.528  1.00 17.13 ? 54  ILE A O   1 
ATOM   412  C CB  . ILE A 1 54 ? -1.147  -4.729  5.243  1.00 17.38 ? 54  ILE A CB  1 
ATOM   413  C CG1 . ILE A 1 54 ? -1.398  -3.617  6.266  1.00 16.38 ? 54  ILE A CG1 1 
ATOM   414  C CG2 . ILE A 1 54 ? -0.035  -5.673  5.704  1.00 16.89 ? 54  ILE A CG2 1 
ATOM   415  C CD1 . ILE A 1 54 ? -1.860  -4.123  7.627  1.00 19.21 ? 54  ILE A CD1 1 
ATOM   416  N N   . LYS A 1 55 ? -3.053  -3.804  3.067  1.00 18.20 ? 55  LYS A N   1 
ATOM   417  C CA  . LYS A 1 55 ? -4.245  -3.060  2.685  1.00 20.33 ? 55  LYS A CA  1 
ATOM   418  C C   . LYS A 1 55 ? -5.200  -3.068  3.873  1.00 20.19 ? 55  LYS A C   1 
ATOM   419  O O   . LYS A 1 55 ? -5.362  -4.094  4.536  1.00 19.28 ? 55  LYS A O   1 
ATOM   420  C CB  . LYS A 1 55 ? -4.938  -3.713  1.486  1.00 21.19 ? 55  LYS A CB  1 
ATOM   421  C CG  . LYS A 1 55 ? -4.074  -3.819  0.241  1.00 25.98 ? 55  LYS A CG  1 
ATOM   422  C CD  . LYS A 1 55 ? -4.922  -4.033  -1.008 1.00 28.84 ? 55  LYS A CD  1 
ATOM   423  C CE  . LYS A 1 55 ? -5.833  -5.238  -0.885 1.00 29.97 ? 55  LYS A CE  1 
ATOM   424  N NZ  . LYS A 1 55 ? -6.661  -5.428  -2.113 1.00 30.89 ? 55  LYS A NZ  1 
ATOM   425  N N   . VAL A 1 56 ? -5.824  -1.926  4.139  1.00 18.15 ? 56  VAL A N   1 
ATOM   426  C CA  . VAL A 1 56 ? -6.765  -1.810  5.245  1.00 19.05 ? 56  VAL A CA  1 
ATOM   427  C C   . VAL A 1 56 ? -7.995  -1.001  4.844  1.00 19.25 ? 56  VAL A C   1 
ATOM   428  O O   . VAL A 1 56 ? -8.030  -0.399  3.774  1.00 18.65 ? 56  VAL A O   1 
ATOM   429  C CB  . VAL A 1 56 ? -6.116  -1.119  6.469  1.00 17.79 ? 56  VAL A CB  1 
ATOM   430  C CG1 . VAL A 1 56 ? -4.938  -1.936  6.965  1.00 16.84 ? 56  VAL A CG1 1 
ATOM   431  C CG2 . VAL A 1 56 ? -5.669  0.285   6.101  1.00 18.31 ? 56  VAL A CG2 1 
ATOM   432  N N   . ARG A 1 57 ? -9.009  -1.012  5.703  1.00 21.75 ? 57  ARG A N   1 
ATOM   433  C CA  . ARG A 1 57 ? -10.226 -0.249  5.462  1.00 21.33 ? 57  ARG A CA  1 
ATOM   434  C C   . ARG A 1 57 ? -10.178 0.936   6.420  1.00 22.06 ? 57  ARG A C   1 
ATOM   435  O O   . ARG A 1 57 ? -10.011 0.754   7.624  1.00 21.43 ? 57  ARG A O   1 
ATOM   436  C CB  . ARG A 1 57 ? -11.467 -1.102  5.747  1.00 22.37 ? 57  ARG A CB  1 
ATOM   437  C CG  . ARG A 1 57 ? -11.549 -2.374  4.910  1.00 27.44 ? 57  ARG A CG  1 
ATOM   438  C CD  . ARG A 1 57 ? -12.986 -2.867  4.788  1.00 30.72 ? 57  ARG A CD  1 
ATOM   439  N NE  . ARG A 1 57 ? -13.606 -3.128  6.083  1.00 32.45 ? 57  ARG A NE  1 
ATOM   440  C CZ  . ARG A 1 57 ? -13.258 -4.121  6.893  1.00 33.48 ? 57  ARG A CZ  1 
ATOM   441  N NH1 . ARG A 1 57 ? -12.289 -4.956  6.544  1.00 37.10 ? 57  ARG A NH1 1 
ATOM   442  N NH2 . ARG A 1 57 ? -13.883 -4.284  8.051  1.00 36.01 ? 57  ARG A NH2 1 
ATOM   443  N N   . GLN A 1 58 ? -10.317 2.147   5.890  1.00 19.08 ? 58  GLN A N   1 
ATOM   444  C CA  . GLN A 1 58 ? -10.260 3.336   6.726  1.00 18.82 ? 58  GLN A CA  1 
ATOM   445  C C   . GLN A 1 58 ? -11.636 3.869   7.092  1.00 20.09 ? 58  GLN A C   1 
ATOM   446  O O   . GLN A 1 58 ? -12.414 4.248   6.218  1.00 19.50 ? 58  GLN A O   1 
ATOM   447  C CB  . GLN A 1 58 ? -9.464  4.443   6.023  1.00 20.06 ? 58  GLN A CB  1 
ATOM   448  C CG  . GLN A 1 58 ? -9.321  5.721   6.846  1.00 20.27 ? 58  GLN A CG  1 
ATOM   449  C CD  . GLN A 1 58 ? -8.567  6.820   6.111  1.00 24.40 ? 58  GLN A CD  1 
ATOM   450  O OE1 . GLN A 1 58 ? -7.563  6.563   5.457  1.00 26.83 ? 58  GLN A OE1 1 
ATOM   451  N NE2 . GLN A 1 58 ? -9.042  8.055   6.236  1.00 25.68 ? 58  GLN A NE2 1 
ATOM   452  N N   . TYR A 1 59 ? -11.933 3.873   8.390  1.00 19.42 ? 59  TYR A N   1 
ATOM   453  C CA  . TYR A 1 59 ? -13.195 4.402   8.898  1.00 21.96 ? 59  TYR A CA  1 
ATOM   454  C C   . TYR A 1 59 ? -12.858 5.714   9.593  1.00 21.81 ? 59  TYR A C   1 
ATOM   455  O O   . TYR A 1 59 ? -11.935 5.768   10.406 1.00 20.74 ? 59  TYR A O   1 
ATOM   456  C CB  . TYR A 1 59 ? -13.832 3.452   9.914  1.00 22.21 ? 59  TYR A CB  1 
ATOM   457  C CG  . TYR A 1 59 ? -14.277 2.123   9.349  1.00 24.38 ? 59  TYR A CG  1 
ATOM   458  C CD1 . TYR A 1 59 ? -13.365 1.090   9.135  1.00 25.28 ? 59  TYR A CD1 1 
ATOM   459  C CD2 . TYR A 1 59 ? -15.619 1.889   9.055  1.00 26.03 ? 59  TYR A CD2 1 
ATOM   460  C CE1 . TYR A 1 59 ? -13.784 -0.147  8.648  1.00 26.53 ? 59  TYR A CE1 1 
ATOM   461  C CE2 . TYR A 1 59 ? -16.046 0.659   8.566  1.00 25.42 ? 59  TYR A CE2 1 
ATOM   462  C CZ  . TYR A 1 59 ? -15.127 -0.353  8.369  1.00 26.58 ? 59  TYR A CZ  1 
ATOM   463  O OH  . TYR A 1 59 ? -15.555 -1.573  7.910  1.00 28.03 ? 59  TYR A OH  1 
ATOM   464  N N   . ASP A 1 60 ? -13.596 6.771   9.268  1.00 22.42 ? 60  ASP A N   1 
ATOM   465  C CA  . ASP A 1 60 ? -13.351 8.076   9.868  1.00 23.44 ? 60  ASP A CA  1 
ATOM   466  C C   . ASP A 1 60 ? -14.354 8.451   10.954 1.00 22.51 ? 60  ASP A C   1 
ATOM   467  O O   . ASP A 1 60 ? -15.486 7.961   10.977 1.00 20.07 ? 60  ASP A O   1 
ATOM   468  C CB  . ASP A 1 60 ? -13.355 9.172   8.794  1.00 26.36 ? 60  ASP A CB  1 
ATOM   469  C CG  . ASP A 1 60 ? -12.220 9.025   7.795  1.00 30.19 ? 60  ASP A CG  1 
ATOM   470  O OD1 . ASP A 1 60 ? -11.074 8.752   8.216  1.00 32.50 ? 60  ASP A OD1 1 
ATOM   471  O OD2 . ASP A 1 60 ? -12.471 9.197   6.584  1.00 31.93 ? 60  ASP A OD2 1 
ATOM   472  N N   . GLN A 1 61 ? -13.909 9.326   11.850 1.00 21.41 ? 61  GLN A N   1 
ATOM   473  C CA  . GLN A 1 61 ? -14.721 9.845   12.943 1.00 21.88 ? 61  GLN A CA  1 
ATOM   474  C C   . GLN A 1 61 ? -15.417 8.768   13.763 1.00 21.55 ? 61  GLN A C   1 
ATOM   475  O O   . GLN A 1 61 ? -16.616 8.866   14.040 1.00 21.39 ? 61  GLN A O   1 
ATOM   476  C CB  . GLN A 1 61 ? -15.759 10.820  12.374 1.00 23.20 ? 61  GLN A CB  1 
ATOM   477  C CG  . GLN A 1 61 ? -16.016 12.039  13.241 1.00 25.01 ? 61  GLN A CG  1 
ATOM   478  C CD  . GLN A 1 61 ? -16.822 13.095  12.515 1.00 27.64 ? 61  GLN A CD  1 
ATOM   479  O OE1 . GLN A 1 61 ? -16.495 13.471  11.387 1.00 27.45 ? 61  GLN A OE1 1 
ATOM   480  N NE2 . GLN A 1 61 ? -17.877 13.585  13.156 1.00 25.62 ? 61  GLN A NE2 1 
ATOM   481  N N   . ILE A 1 62 ? -14.662 7.751   14.164 1.00 19.84 ? 62  ILE A N   1 
ATOM   482  C CA  . ILE A 1 62 ? -15.214 6.651   14.953 1.00 19.09 ? 62  ILE A CA  1 
ATOM   483  C C   . ILE A 1 62 ? -14.961 6.821   16.451 1.00 18.67 ? 62  ILE A C   1 
ATOM   484  O O   . ILE A 1 62 ? -13.825 7.004   16.882 1.00 17.48 ? 62  ILE A O   1 
ATOM   485  C CB  . ILE A 1 62 ? -14.608 5.294   14.523 1.00 17.93 ? 62  ILE A CB  1 
ATOM   486  C CG1 . ILE A 1 62 ? -14.924 5.018   13.053 1.00 16.64 ? 62  ILE A CG1 1 
ATOM   487  C CG2 . ILE A 1 62 ? -15.147 4.178   15.412 1.00 19.84 ? 62  ILE A CG2 1 
ATOM   488  C CD1 . ILE A 1 62 ? -16.411 4.878   12.745 1.00 16.54 ? 62  ILE A CD1 1 
ATOM   489  N N   . PRO A 1 63 ? -16.024 6.765   17.265 1.00 19.35 ? 63  PRO A N   1 
ATOM   490  C CA  . PRO A 1 63 ? -15.858 6.913   18.717 1.00 19.07 ? 63  PRO A CA  1 
ATOM   491  C C   . PRO A 1 63 ? -15.123 5.714   19.318 1.00 20.64 ? 63  PRO A C   1 
ATOM   492  O O   . PRO A 1 63 ? -15.448 4.564   19.024 1.00 20.13 ? 63  PRO A O   1 
ATOM   493  C CB  . PRO A 1 63 ? -17.296 7.006   19.226 1.00 19.71 ? 63  PRO A CB  1 
ATOM   494  C CG  . PRO A 1 63 ? -18.042 7.599   18.046 1.00 20.11 ? 63  PRO A CG  1 
ATOM   495  C CD  . PRO A 1 63 ? -17.447 6.834   16.889 1.00 19.51 ? 63  PRO A CD  1 
ATOM   496  N N   . VAL A 1 64 ? -14.137 5.985   20.166 1.00 20.04 ? 64  VAL A N   1 
ATOM   497  C CA  . VAL A 1 64 ? -13.375 4.921   20.809 1.00 19.73 ? 64  VAL A CA  1 
ATOM   498  C C   . VAL A 1 64 ? -13.053 5.327   22.238 1.00 21.65 ? 64  VAL A C   1 
ATOM   499  O O   . VAL A 1 64 ? -12.458 6.381   22.463 1.00 22.19 ? 64  VAL A O   1 
ATOM   500  C CB  . VAL A 1 64 ? -12.034 4.655   20.078 1.00 20.34 ? 64  VAL A CB  1 
ATOM   501  C CG1 . VAL A 1 64 ? -11.273 3.540   20.781 1.00 22.59 ? 64  VAL A CG1 1 
ATOM   502  C CG2 . VAL A 1 64 ? -12.287 4.296   18.626 1.00 19.80 ? 64  VAL A CG2 1 
ATOM   503  N N   . GLU A 1 65 ? -13.462 4.505   23.201 1.00 21.45 ? 65  GLU A N   1 
ATOM   504  C CA  . GLU A 1 65 ? -13.175 4.785   24.603 1.00 23.26 ? 65  GLU A CA  1 
ATOM   505  C C   . GLU A 1 65 ? -11.981 3.930   24.994 1.00 23.29 ? 65  GLU A C   1 
ATOM   506  O O   . GLU A 1 65 ? -12.022 2.700   24.896 1.00 23.68 ? 65  GLU A O   1 
ATOM   507  C CB  . GLU A 1 65 ? -14.368 4.447   25.499 1.00 25.48 ? 65  GLU A CB  1 
ATOM   508  C CG  . GLU A 1 65 ? -14.105 4.750   26.966 1.00 29.62 ? 65  GLU A CG  1 
ATOM   509  C CD  . GLU A 1 65 ? -15.263 4.367   27.863 1.00 32.62 ? 65  GLU A CD  1 
ATOM   510  O OE1 . GLU A 1 65 ? -16.315 5.035   27.785 1.00 32.66 ? 65  GLU A OE1 1 
ATOM   511  O OE2 . GLU A 1 65 ? -15.116 3.396   28.641 1.00 34.44 ? 65  GLU A OE2 1 
ATOM   512  N N   . ILE A 1 66 ? -10.921 4.593   25.435 1.00 22.48 ? 66  ILE A N   1 
ATOM   513  C CA  . ILE A 1 66 ? -9.681  3.927   25.807 1.00 22.26 ? 66  ILE A CA  1 
ATOM   514  C C   . ILE A 1 66 ? -9.416  4.113   27.293 1.00 23.35 ? 66  ILE A C   1 
ATOM   515  O O   . ILE A 1 66 ? -9.148  5.223   27.738 1.00 21.71 ? 66  ILE A O   1 
ATOM   516  C CB  . ILE A 1 66 ? -8.509  4.529   25.000 1.00 22.03 ? 66  ILE A CB  1 
ATOM   517  C CG1 . ILE A 1 66 ? -8.883  4.557   23.511 1.00 21.39 ? 66  ILE A CG1 1 
ATOM   518  C CG2 . ILE A 1 66 ? -7.239  3.732   25.246 1.00 22.04 ? 66  ILE A CG2 1 
ATOM   519  C CD1 . ILE A 1 66 ? -7.925  5.328   22.631 1.00 23.25 ? 66  ILE A CD1 1 
ATOM   520  N N   . CYS A 1 67 ? -9.482  3.024   28.055 1.00 25.82 ? 67  CYS A N   1 
ATOM   521  C CA  . CYS A 1 67 ? -9.261  3.094   29.493 1.00 28.32 ? 67  CYS A CA  1 
ATOM   522  C C   . CYS A 1 67 ? -10.132 4.162   30.138 1.00 28.06 ? 67  CYS A C   1 
ATOM   523  O O   . CYS A 1 67 ? -9.700  4.844   31.065 1.00 29.11 ? 67  CYS A O   1 
ATOM   524  C CB  . CYS A 1 67 ? -7.798  3.403   29.800 1.00 31.21 ? 67  CYS A CB  1 
ATOM   525  S SG  . CYS A 1 67 ? -6.724  1.980   29.742 1.00 40.79 ? 67  CYS A SG  1 
ATOM   526  N N   . GLY A 1 68 ? -11.352 4.316   29.640 1.00 27.86 ? 68  GLY A N   1 
ATOM   527  C CA  . GLY A 1 68 ? -12.249 5.307   30.203 1.00 27.64 ? 68  GLY A CA  1 
ATOM   528  C C   . GLY A 1 68 ? -12.101 6.696   29.613 1.00 26.59 ? 68  GLY A C   1 
ATOM   529  O O   . GLY A 1 68 ? -12.813 7.616   30.019 1.00 27.71 ? 68  GLY A O   1 
ATOM   530  N N   . HIS A 1 69 ? -11.181 6.862   28.665 1.00 24.68 ? 69  HIS A N   1 
ATOM   531  C CA  . HIS A 1 69 ? -10.979 8.160   28.031 1.00 24.23 ? 69  HIS A CA  1 
ATOM   532  C C   . HIS A 1 69 ? -11.582 8.144   26.637 1.00 24.23 ? 69  HIS A C   1 
ATOM   533  O O   . HIS A 1 69 ? -11.384 7.199   25.869 1.00 23.92 ? 69  HIS A O   1 
ATOM   534  C CB  . HIS A 1 69 ? -9.491  8.508   27.961 1.00 24.88 ? 69  HIS A CB  1 
ATOM   535  C CG  . HIS A 1 69 ? -8.896  8.863   29.289 1.00 26.35 ? 69  HIS A CG  1 
ATOM   536  N ND1 . HIS A 1 69 ? -8.783  7.957   30.318 1.00 28.04 ? 69  HIS A ND1 1 
ATOM   537  C CD2 . HIS A 1 69 ? -8.403  10.034  29.758 1.00 25.97 ? 69  HIS A CD2 1 
ATOM   538  C CE1 . HIS A 1 69 ? -8.245  8.554   31.370 1.00 26.70 ? 69  HIS A CE1 1 
ATOM   539  N NE2 . HIS A 1 69 ? -8.006  9.813   31.056 1.00 27.39 ? 69  HIS A NE2 1 
ATOM   540  N N   . LYS A 1 70 ? -12.316 9.202   26.315 1.00 22.19 ? 70  LYS A N   1 
ATOM   541  C CA  . LYS A 1 70 ? -12.984 9.297   25.033 1.00 21.52 ? 70  LYS A CA  1 
ATOM   542  C C   . LYS A 1 70 ? -12.159 9.900   23.907 1.00 21.76 ? 70  LYS A C   1 
ATOM   543  O O   . LYS A 1 70 ? -11.462 10.904  24.071 1.00 20.80 ? 70  LYS A O   1 
ATOM   544  C CB  . LYS A 1 70 ? -14.288 10.074  25.191 1.00 23.81 ? 70  LYS A CB  1 
ATOM   545  N N   . ALA A 1 71 ? -12.255 9.263   22.751 1.00 19.77 ? 71  ALA A N   1 
ATOM   546  C CA  . ALA A 1 71 ? -11.575 9.725   21.558 1.00 19.66 ? 71  ALA A CA  1 
ATOM   547  C C   . ALA A 1 71 ? -12.550 9.488   20.416 1.00 19.03 ? 71  ALA A C   1 
ATOM   548  O O   . ALA A 1 71 ? -13.433 8.639   20.519 1.00 16.79 ? 71  ALA A O   1 
ATOM   549  C CB  . ALA A 1 71 ? -10.294 8.919   21.337 1.00 19.66 ? 71  ALA A CB  1 
ATOM   550  N N   . ILE A 1 72 ? -12.420 10.266  19.350 1.00 17.43 ? 72  ILE A N   1 
ATOM   551  C CA  . ILE A 1 72 ? -13.261 10.089  18.173 1.00 18.46 ? 72  ILE A CA  1 
ATOM   552  C C   . ILE A 1 72 ? -12.347 10.400  17.005 1.00 17.62 ? 72  ILE A C   1 
ATOM   553  O O   . ILE A 1 72 ? -11.943 11.551  16.808 1.00 18.02 ? 72  ILE A O   1 
ATOM   554  C CB  . ILE A 1 72 ? -14.475 11.056  18.145 1.00 19.46 ? 72  ILE A CB  1 
ATOM   555  C CG1 . ILE A 1 72 ? -15.361 10.832  19.372 1.00 19.02 ? 72  ILE A CG1 1 
ATOM   556  C CG2 . ILE A 1 72 ? -15.298 10.812  16.879 1.00 20.72 ? 72  ILE A CG2 1 
ATOM   557  C CD1 . ILE A 1 72 ? -16.578 11.762  19.443 1.00 21.31 ? 72  ILE A CD1 1 
ATOM   558  N N   . GLY A 1 73 ? -11.997 9.372   16.242 1.00 17.63 ? 73  GLY A N   1 
ATOM   559  C CA  . GLY A 1 73 ? -11.110 9.589   15.118 1.00 17.69 ? 73  GLY A CA  1 
ATOM   560  C C   . GLY A 1 73 ? -11.009 8.429   14.150 1.00 17.70 ? 73  GLY A C   1 
ATOM   561  O O   . GLY A 1 73 ? -11.847 7.529   14.140 1.00 16.48 ? 73  GLY A O   1 
ATOM   562  N N   . THR A 1 74 ? -9.959  8.459   13.335 1.00 19.18 ? 74  THR A N   1 
ATOM   563  C CA  . THR A 1 74 ? -9.724  7.432   12.333 1.00 18.40 ? 74  THR A CA  1 
ATOM   564  C C   . THR A 1 74 ? -9.314  6.089   12.926 1.00 17.37 ? 74  THR A C   1 
ATOM   565  O O   . THR A 1 74 ? -8.490  6.014   13.837 1.00 17.75 ? 74  THR A O   1 
ATOM   566  C CB  . THR A 1 74 ? -8.636  7.883   11.336 1.00 19.91 ? 74  THR A CB  1 
ATOM   567  O OG1 . THR A 1 74 ? -9.079  9.060   10.652 1.00 22.15 ? 74  THR A OG1 1 
ATOM   568  C CG2 . THR A 1 74 ? -8.355  6.785   10.309 1.00 20.84 ? 74  THR A CG2 1 
ATOM   569  N N   . VAL A 1 75 ? -9.912  5.028   12.400 1.00 15.11 ? 75  VAL A N   1 
ATOM   570  C CA  . VAL A 1 75 ? -9.613  3.672   12.836 1.00 17.18 ? 75  VAL A CA  1 
ATOM   571  C C   . VAL A 1 75 ? -9.427  2.818   11.588 1.00 18.80 ? 75  VAL A C   1 
ATOM   572  O O   . VAL A 1 75 ? -10.299 2.794   10.717 1.00 18.71 ? 75  VAL A O   1 
ATOM   573  C CB  . VAL A 1 75 ? -10.763 3.076   13.677 1.00 17.54 ? 75  VAL A CB  1 
ATOM   574  C CG1 . VAL A 1 75 ? -10.461 1.615   14.012 1.00 18.65 ? 75  VAL A CG1 1 
ATOM   575  C CG2 . VAL A 1 75 ? -10.944 3.887   14.955 1.00 19.29 ? 75  VAL A CG2 1 
ATOM   576  N N   . LEU A 1 76 ? -8.291  2.132   11.500 1.00 17.32 ? 76  LEU A N   1 
ATOM   577  C CA  . LEU A 1 76 ? -8.011  1.280   10.353 1.00 17.28 ? 76  LEU A CA  1 
ATOM   578  C C   . LEU A 1 76 ? -8.284  -0.178  10.718 1.00 17.63 ? 76  LEU A C   1 
ATOM   579  O O   . LEU A 1 76 ? -8.019  -0.612  11.841 1.00 17.79 ? 76  LEU A O   1 
ATOM   580  C CB  . LEU A 1 76 ? -6.554  1.453   9.903  1.00 16.43 ? 76  LEU A CB  1 
ATOM   581  C CG  . LEU A 1 76 ? -6.078  2.901   9.714  1.00 15.72 ? 76  LEU A CG  1 
ATOM   582  C CD1 . LEU A 1 76 ? -4.650  2.907   9.199  1.00 17.34 ? 76  LEU A CD1 1 
ATOM   583  C CD2 . LEU A 1 76 ? -6.986  3.639   8.731  1.00 17.34 ? 76  LEU A CD2 1 
ATOM   584  N N   . VAL A 1 77 ? -8.830  -0.932  9.771  1.00 17.41 ? 77  VAL A N   1 
ATOM   585  C CA  . VAL A 1 77 ? -9.124  -2.338  10.014 1.00 17.48 ? 77  VAL A CA  1 
ATOM   586  C C   . VAL A 1 77 ? -8.484  -3.206  8.949  1.00 17.32 ? 77  VAL A C   1 
ATOM   587  O O   . VAL A 1 77 ? -8.736  -3.031  7.761  1.00 18.62 ? 77  VAL A O   1 
ATOM   588  C CB  . VAL A 1 77 ? -10.642 -2.597  10.028 1.00 16.93 ? 77  VAL A CB  1 
ATOM   589  C CG1 . VAL A 1 77 ? -10.921 -4.078  10.257 1.00 18.09 ? 77  VAL A CG1 1 
ATOM   590  C CG2 . VAL A 1 77 ? -11.291 -1.757  11.117 1.00 19.99 ? 77  VAL A CG2 1 
ATOM   591  N N   . GLY A 1 78 ? -7.657  -4.149  9.380  1.00 18.82 ? 78  GLY A N   1 
ATOM   592  C CA  . GLY A 1 78 ? -6.996  -5.020  8.428  1.00 19.01 ? 78  GLY A CA  1 
ATOM   593  C C   . GLY A 1 78 ? -6.189  -6.119  9.085  1.00 19.11 ? 78  GLY A C   1 
ATOM   594  O O   . GLY A 1 78 ? -6.316  -6.349  10.285 1.00 19.85 ? 78  GLY A O   1 
ATOM   595  N N   . PRO A 1 79 ? -5.337  -6.813  8.316  1.00 20.45 ? 79  PRO A N   1 
ATOM   596  C CA  . PRO A 1 79 ? -4.510  -7.903  8.840  1.00 18.81 ? 79  PRO A CA  1 
ATOM   597  C C   . PRO A 1 79 ? -3.361  -7.514  9.764  1.00 19.93 ? 79  PRO A C   1 
ATOM   598  O O   . PRO A 1 79 ? -2.216  -7.895  9.534  1.00 18.23 ? 79  PRO A O   1 
ATOM   599  C CB  . PRO A 1 79 ? -4.025  -8.609  7.570  1.00 19.81 ? 79  PRO A CB  1 
ATOM   600  C CG  . PRO A 1 79 ? -3.932  -7.499  6.585  1.00 21.58 ? 79  PRO A CG  1 
ATOM   601  C CD  . PRO A 1 79 ? -5.204  -6.712  6.852  1.00 19.62 ? 79  PRO A CD  1 
ATOM   602  N N   . THR A 1 80 ? -3.661  -6.749  10.807 1.00 19.52 ? 80  THR A N   1 
ATOM   603  C CA  . THR A 1 80 ? -2.625  -6.382  11.759 1.00 19.20 ? 80  THR A CA  1 
ATOM   604  C C   . THR A 1 80 ? -2.465  -7.568  12.712 1.00 19.96 ? 80  THR A C   1 
ATOM   605  O O   . THR A 1 80 ? -3.426  -8.294  12.979 1.00 20.97 ? 80  THR A O   1 
ATOM   606  C CB  . THR A 1 80 ? -3.003  -5.113  12.559 1.00 17.54 ? 80  THR A CB  1 
ATOM   607  O OG1 . THR A 1 80 ? -2.010  -4.877  13.566 1.00 19.91 ? 80  THR A OG1 1 
ATOM   608  C CG2 . THR A 1 80 ? -4.379  -5.269  13.220 1.00 18.03 ? 80  THR A CG2 1 
ATOM   609  N N   . PRO A 1 81 ? -1.244  -7.804  13.211 1.00 20.11 ? 81  PRO A N   1 
ATOM   610  C CA  . PRO A 1 81 ? -1.001  -8.918  14.132 1.00 21.29 ? 81  PRO A CA  1 
ATOM   611  C C   . PRO A 1 81 ? -1.640  -8.731  15.504 1.00 21.97 ? 81  PRO A C   1 
ATOM   612  O O   . PRO A 1 81 ? -1.759  -9.684  16.281 1.00 19.96 ? 81  PRO A O   1 
ATOM   613  C CB  . PRO A 1 81 ? 0.521   -8.977  14.204 1.00 22.83 ? 81  PRO A CB  1 
ATOM   614  C CG  . PRO A 1 81 ? 0.926   -7.552  13.966 1.00 22.74 ? 81  PRO A CG  1 
ATOM   615  C CD  . PRO A 1 81 ? 0.025   -7.161  12.828 1.00 22.50 ? 81  PRO A CD  1 
ATOM   616  N N   . ALA A 1 82 ? -2.048  -7.501  15.795 1.00 19.56 ? 82  ALA A N   1 
ATOM   617  C CA  . ALA A 1 82 ? -2.674  -7.180  17.069 1.00 19.84 ? 82  ALA A CA  1 
ATOM   618  C C   . ALA A 1 82 ? -3.364  -5.827  16.982 1.00 19.54 ? 82  ALA A C   1 
ATOM   619  O O   . ALA A 1 82 ? -2.998  -4.986  16.157 1.00 19.31 ? 82  ALA A O   1 
ATOM   620  C CB  . ALA A 1 82 ? -1.625  -7.156  18.176 1.00 20.47 ? 82  ALA A CB  1 
ATOM   621  N N   . ASN A 1 83 ? -4.371  -5.625  17.826 1.00 18.66 ? 83  ASN A N   1 
ATOM   622  C CA  . ASN A 1 83 ? -5.091  -4.362  17.856 1.00 18.44 ? 83  ASN A CA  1 
ATOM   623  C C   . ASN A 1 83 ? -4.149  -3.333  18.468 1.00 18.04 ? 83  ASN A C   1 
ATOM   624  O O   . ASN A 1 83 ? -3.625  -3.538  19.565 1.00 18.98 ? 83  ASN A O   1 
ATOM   625  C CB  . ASN A 1 83 ? -6.349  -4.462  18.729 1.00 17.35 ? 83  ASN A CB  1 
ATOM   626  C CG  . ASN A 1 83 ? -7.371  -5.450  18.190 1.00 19.50 ? 83  ASN A CG  1 
ATOM   627  O OD1 . ASN A 1 83 ? -7.620  -5.517  16.984 1.00 18.49 ? 83  ASN A OD1 1 
ATOM   628  N ND2 . ASN A 1 83 ? -7.987  -6.211  19.092 1.00 18.43 ? 83  ASN A ND2 1 
ATOM   629  N N   . ILE A 1 84 ? -3.927  -2.226  17.773 1.00 17.27 ? 84  ILE A N   1 
ATOM   630  C CA  . ILE A 1 84 ? -3.042  -1.206  18.315 1.00 15.80 ? 84  ILE A CA  1 
ATOM   631  C C   . ILE A 1 84 ? -3.661  0.185   18.322 1.00 15.75 ? 84  ILE A C   1 
ATOM   632  O O   . ILE A 1 84 ? -4.429  0.559   17.428 1.00 15.59 ? 84  ILE A O   1 
ATOM   633  C CB  . ILE A 1 84 ? -1.700  -1.141  17.546 1.00 15.65 ? 84  ILE A CB  1 
ATOM   634  C CG1 . ILE A 1 84 ? -1.942  -0.717  16.096 1.00 16.30 ? 84  ILE A CG1 1 
ATOM   635  C CG2 . ILE A 1 84 ? -1.004  -2.500  17.590 1.00 16.46 ? 84  ILE A CG2 1 
ATOM   636  C CD1 . ILE A 1 84 ? -0.663  -0.628  15.266 1.00 17.54 ? 84  ILE A CD1 1 
ATOM   637  N N   . ILE A 1 85 ? -3.338  0.942   19.361 1.00 15.96 ? 85  ILE A N   1 
ATOM   638  C CA  . ILE A 1 85 ? -3.827  2.304   19.474 1.00 14.38 ? 85  ILE A CA  1 
ATOM   639  C C   . ILE A 1 85 ? -2.642  3.178   19.088 1.00 14.92 ? 85  ILE A C   1 
ATOM   640  O O   . ILE A 1 85 ? -1.631  3.202   19.793 1.00 13.75 ? 85  ILE A O   1 
ATOM   641  C CB  . ILE A 1 85 ? -4.258  2.635   20.913 1.00 15.21 ? 85  ILE A CB  1 
ATOM   642  C CG1 . ILE A 1 85 ? -5.317  1.630   21.389 1.00 16.27 ? 85  ILE A CG1 1 
ATOM   643  C CG2 . ILE A 1 85 ? -4.810  4.058   20.969 1.00 15.24 ? 85  ILE A CG2 1 
ATOM   644  C CD1 . ILE A 1 85 ? -6.556  1.556   20.505 1.00 19.37 ? 85  ILE A CD1 1 
ATOM   645  N N   . GLY A 1 86 ? -2.771  3.878   17.963 1.00 13.78 ? 86  GLY A N   1 
ATOM   646  C CA  . GLY A 1 86 ? -1.701  4.731   17.483 1.00 14.35 ? 86  GLY A CA  1 
ATOM   647  C C   . GLY A 1 86 ? -1.745  6.164   17.975 1.00 14.93 ? 86  GLY A C   1 
ATOM   648  O O   . GLY A 1 86 ? -2.616  6.545   18.759 1.00 13.19 ? 86  GLY A O   1 
ATOM   649  N N   . ARG A 1 87 ? -0.801  6.966   17.488 1.00 15.05 ? 87  ARG A N   1 
ATOM   650  C CA  . ARG A 1 87 ? -0.690  8.363   17.884 1.00 15.34 ? 87  ARG A CA  1 
ATOM   651  C C   . ARG A 1 87 ? -1.918  9.216   17.597 1.00 15.45 ? 87  ARG A C   1 
ATOM   652  O O   . ARG A 1 87 ? -2.229  10.115  18.370 1.00 15.99 ? 87  ARG A O   1 
ATOM   653  C CB  . ARG A 1 87 ? 0.552   9.001   17.243 1.00 13.76 ? 87  ARG A CB  1 
ATOM   654  C CG  . ARG A 1 87 ? 1.870   8.445   17.793 1.00 12.44 ? 87  ARG A CG  1 
ATOM   655  C CD  . ARG A 1 87 ? 3.107   9.226   17.321 1.00 13.10 ? 87  ARG A CD  1 
ATOM   656  N NE  . ARG A 1 87 ? 3.274   9.184   15.866 1.00 16.92 ? 87  ARG A NE  1 
ATOM   657  C CZ  . ARG A 1 87 ? 2.800   10.103  15.030 1.00 17.55 ? 87  ARG A CZ  1 
ATOM   658  N NH1 . ARG A 1 87 ? 2.134   11.152  15.498 1.00 15.55 ? 87  ARG A NH1 1 
ATOM   659  N NH2 . ARG A 1 87 ? 2.968   9.963   13.720 1.00 14.60 ? 87  ARG A NH2 1 
ATOM   660  N N   . ASN A 1 88 ? -2.617  8.946   16.499 1.00 16.41 ? 88  ASN A N   1 
ATOM   661  C CA  . ASN A 1 88 ? -3.800  9.742   16.178 1.00 15.83 ? 88  ASN A CA  1 
ATOM   662  C C   . ASN A 1 88 ? -4.808  9.737   17.339 1.00 16.74 ? 88  ASN A C   1 
ATOM   663  O O   . ASN A 1 88 ? -5.449  10.750  17.607 1.00 18.25 ? 88  ASN A O   1 
ATOM   664  C CB  . ASN A 1 88 ? -4.459  9.241   14.882 1.00 16.33 ? 88  ASN A CB  1 
ATOM   665  C CG  . ASN A 1 88 ? -5.216  7.937   15.065 1.00 16.89 ? 88  ASN A CG  1 
ATOM   666  O OD1 . ASN A 1 88 ? -6.410  7.853   14.758 1.00 19.72 ? 88  ASN A OD1 1 
ATOM   667  N ND2 . ASN A 1 88 ? -4.532  6.914   15.550 1.00 13.86 ? 88  ASN A ND2 1 
ATOM   668  N N   . LEU A 1 89 ? -4.949  8.613   18.039 1.00 15.08 ? 89  LEU A N   1 
ATOM   669  C CA  . LEU A 1 89 ? -5.880  8.574   19.163 1.00 16.31 ? 89  LEU A CA  1 
ATOM   670  C C   . LEU A 1 89 ? -5.177  8.797   20.499 1.00 16.66 ? 89  LEU A C   1 
ATOM   671  O O   . LEU A 1 89 ? -5.781  9.301   21.444 1.00 17.72 ? 89  LEU A O   1 
ATOM   672  C CB  . LEU A 1 89 ? -6.648  7.254   19.194 1.00 17.64 ? 89  LEU A CB  1 
ATOM   673  C CG  . LEU A 1 89 ? -7.536  6.981   17.976 1.00 17.83 ? 89  LEU A CG  1 
ATOM   674  C CD1 . LEU A 1 89 ? -8.358  5.728   18.235 1.00 18.02 ? 89  LEU A CD1 1 
ATOM   675  C CD2 . LEU A 1 89 ? -8.457  8.181   17.705 1.00 18.63 ? 89  LEU A CD2 1 
ATOM   676  N N   . LEU A 1 90 ? -3.899  8.431   20.579 1.00 16.45 ? 90  LEU A N   1 
ATOM   677  C CA  . LEU A 1 90 ? -3.150  8.625   21.819 1.00 16.47 ? 90  LEU A CA  1 
ATOM   678  C C   . LEU A 1 90 ? -3.091  10.114  22.163 1.00 16.15 ? 90  LEU A C   1 
ATOM   679  O O   . LEU A 1 90 ? -3.193  10.495  23.324 1.00 17.18 ? 90  LEU A O   1 
ATOM   680  C CB  . LEU A 1 90 ? -1.732  8.057   21.686 1.00 15.47 ? 90  LEU A CB  1 
ATOM   681  C CG  . LEU A 1 90 ? -1.604  6.525   21.672 1.00 13.89 ? 90  LEU A CG  1 
ATOM   682  C CD1 . LEU A 1 90 ? -0.150  6.126   21.458 1.00 12.80 ? 90  LEU A CD1 1 
ATOM   683  C CD2 . LEU A 1 90 ? -2.113  5.956   22.976 1.00 14.06 ? 90  LEU A CD2 1 
ATOM   684  N N   . THR A 1 91 ? -2.933  10.953  21.147 1.00 16.36 ? 91  THR A N   1 
ATOM   685  C CA  . THR A 1 91 ? -2.882  12.391  21.368 1.00 17.06 ? 91  THR A CA  1 
ATOM   686  C C   . THR A 1 91 ? -4.227  12.885  21.902 1.00 18.16 ? 91  THR A C   1 
ATOM   687  O O   . THR A 1 91 ? -4.275  13.795  22.728 1.00 16.49 ? 91  THR A O   1 
ATOM   688  C CB  . THR A 1 91 ? -2.554  13.147  20.068 1.00 19.19 ? 91  THR A CB  1 
ATOM   689  O OG1 . THR A 1 91 ? -3.494  12.778  19.054 1.00 20.49 ? 91  THR A OG1 1 
ATOM   690  C CG2 . THR A 1 91 ? -1.148  12.808  19.597 1.00 20.25 ? 91  THR A CG2 1 
ATOM   691  N N   . GLN A 1 92 ? -5.315  12.270  21.443 1.00 15.89 ? 92  GLN A N   1 
ATOM   692  C CA  . GLN A 1 92 ? -6.653  12.662  21.882 1.00 16.13 ? 92  GLN A CA  1 
ATOM   693  C C   . GLN A 1 92 ? -6.936  12.440  23.359 1.00 17.29 ? 92  GLN A C   1 
ATOM   694  O O   . GLN A 1 92 ? -7.734  13.168  23.948 1.00 18.63 ? 92  GLN A O   1 
ATOM   695  C CB  . GLN A 1 92 ? -7.725  11.948  21.058 1.00 15.36 ? 92  GLN A CB  1 
ATOM   696  C CG  . GLN A 1 92 ? -7.881  12.505  19.658 1.00 15.34 ? 92  GLN A CG  1 
ATOM   697  C CD  . GLN A 1 92 ? -9.215  12.127  19.035 1.00 18.89 ? 92  GLN A CD  1 
ATOM   698  O OE1 . GLN A 1 92 ? -10.210 11.947  19.739 1.00 17.56 ? 92  GLN A OE1 1 
ATOM   699  N NE2 . GLN A 1 92 ? -9.246  12.026  17.711 1.00 16.94 ? 92  GLN A NE2 1 
ATOM   700  N N   . ILE A 1 93 ? -6.301  11.438  23.962 1.00 17.43 ? 93  ILE A N   1 
ATOM   701  C CA  . ILE A 1 93 ? -6.522  11.183  25.377 1.00 16.46 ? 93  ILE A CA  1 
ATOM   702  C C   . ILE A 1 93 ? -5.418  11.808  26.223 1.00 16.92 ? 93  ILE A C   1 
ATOM   703  O O   . ILE A 1 93 ? -5.348  11.575  27.429 1.00 18.20 ? 93  ILE A O   1 
ATOM   704  C CB  . ILE A 1 93 ? -6.636  9.671   25.679 1.00 16.63 ? 93  ILE A CB  1 
ATOM   705  C CG1 . ILE A 1 93 ? -5.339  8.949   25.315 1.00 17.23 ? 93  ILE A CG1 1 
ATOM   706  C CG2 . ILE A 1 93 ? -7.820  9.084   24.900 1.00 18.27 ? 93  ILE A CG2 1 
ATOM   707  C CD1 . ILE A 1 93 ? -5.366  7.451   25.621 1.00 19.14 ? 93  ILE A CD1 1 
ATOM   708  N N   . GLY A 1 94 ? -4.561  12.594  25.574 1.00 17.84 ? 94  GLY A N   1 
ATOM   709  C CA  . GLY A 1 94 ? -3.476  13.286  26.256 1.00 19.92 ? 94  GLY A CA  1 
ATOM   710  C C   . GLY A 1 94 ? -2.285  12.452  26.700 1.00 19.68 ? 94  GLY A C   1 
ATOM   711  O O   . GLY A 1 94 ? -1.595  12.812  27.656 1.00 20.05 ? 94  GLY A O   1 
ATOM   712  N N   . CYS A 1 95 ? -2.032  11.354  25.997 1.00 19.04 ? 95  CYS A N   1 
ATOM   713  C CA  . CYS A 1 95 ? -0.933  10.459  26.328 1.00 19.51 ? 95  CYS A CA  1 
ATOM   714  C C   . CYS A 1 95 ? 0.423   11.020  25.896 1.00 20.08 ? 95  CYS A C   1 
ATOM   715  O O   . CYS A 1 95 ? 0.564   11.558  24.797 1.00 21.39 ? 95  CYS A O   1 
ATOM   716  C CB  . CYS A 1 95 ? -1.170  9.095   25.666 1.00 18.58 ? 95  CYS A CB  1 
ATOM   717  S SG  . CYS A 1 95 ? -0.003  7.804   26.148 1.00 24.11 ? 95  CYS A SG  1 
ATOM   718  N N   . THR A 1 96 ? 1.414   10.901  26.774 1.00 21.88 ? 96  THR A N   1 
ATOM   719  C CA  . THR A 1 96 ? 2.767   11.373  26.490 1.00 21.47 ? 96  THR A CA  1 
ATOM   720  C C   . THR A 1 96 ? 3.786   10.358  27.006 1.00 19.95 ? 96  THR A C   1 
ATOM   721  O O   . THR A 1 96 ? 3.454   9.484   27.802 1.00 19.01 ? 96  THR A O   1 
ATOM   722  C CB  . THR A 1 96 ? 3.070   12.725  27.184 1.00 23.84 ? 96  THR A CB  1 
ATOM   723  O OG1 . THR A 1 96 ? 2.976   12.566  28.607 1.00 22.83 ? 96  THR A OG1 1 
ATOM   724  C CG2 . THR A 1 96 ? 2.097   13.801  26.721 1.00 25.85 ? 96  THR A CG2 1 
ATOM   725  N N   . LEU A 1 97 ? 5.021   10.473  26.533 1.00 19.57 ? 97  LEU A N   1 
ATOM   726  C CA  . LEU A 1 97 ? 6.100   9.596   26.978 1.00 18.79 ? 97  LEU A CA  1 
ATOM   727  C C   . LEU A 1 97 ? 6.915   10.419  27.967 1.00 18.36 ? 97  LEU A C   1 
ATOM   728  O O   . LEU A 1 97 ? 7.157   11.602  27.733 1.00 19.43 ? 97  LEU A O   1 
ATOM   729  C CB  . LEU A 1 97 ? 6.976   9.175   25.796 1.00 17.11 ? 97  LEU A CB  1 
ATOM   730  C CG  . LEU A 1 97 ? 6.453   8.053   24.896 1.00 18.17 ? 97  LEU A CG  1 
ATOM   731  C CD1 . LEU A 1 97 ? 7.322   7.947   23.632 1.00 17.36 ? 97  LEU A CD1 1 
ATOM   732  C CD2 . LEU A 1 97 ? 6.464   6.735   25.673 1.00 18.27 ? 97  LEU A CD2 1 
ATOM   733  N N   . ASN A 1 98 ? 7.345   9.799   29.063 1.00 19.19 ? 98  ASN A N   1 
ATOM   734  C CA  . ASN A 1 98 ? 8.096   10.519  30.087 1.00 19.59 ? 98  ASN A CA  1 
ATOM   735  C C   . ASN A 1 98 ? 9.252   9.721   30.691 1.00 19.25 ? 98  ASN A C   1 
ATOM   736  O O   . ASN A 1 98 ? 9.101   8.548   31.019 1.00 18.99 ? 98  ASN A O   1 
ATOM   737  C CB  . ASN A 1 98 ? 7.145   10.924  31.221 1.00 19.90 ? 98  ASN A CB  1 
ATOM   738  C CG  . ASN A 1 98 ? 6.040   11.856  30.761 1.00 20.16 ? 98  ASN A CG  1 
ATOM   739  O OD1 . ASN A 1 98 ? 6.208   13.073  30.746 1.00 21.94 ? 98  ASN A OD1 1 
ATOM   740  N ND2 . ASN A 1 98 ? 4.903   11.287  30.382 1.00 21.36 ? 98  ASN A ND2 1 
ATOM   741  N N   . PHE A 1 99 ? 10.405  10.368  30.836 1.00 19.72 ? 99  PHE A N   1 
ATOM   742  C CA  . PHE A 1 99 ? 11.569  9.736   31.447 1.00 22.81 ? 99  PHE A CA  1 
ATOM   743  C C   . PHE A 1 99 ? 12.535  10.789  31.989 1.00 23.05 ? 99  PHE A C   1 
ATOM   744  O O   . PHE A 1 99 ? 12.163  11.984  31.978 1.00 24.20 ? 99  PHE A O   1 
ATOM   745  C CB  . PHE A 1 99 ? 12.290  8.793   30.463 1.00 24.04 ? 99  PHE A CB  1 
ATOM   746  C CG  . PHE A 1 99 ? 12.846  9.470   29.238 1.00 25.78 ? 99  PHE A CG  1 
ATOM   747  C CD1 . PHE A 1 99 ? 12.035  9.739   28.142 1.00 25.13 ? 99  PHE A CD1 1 
ATOM   748  C CD2 . PHE A 1 99 ? 14.194  9.815   29.175 1.00 25.10 ? 99  PHE A CD2 1 
ATOM   749  C CE1 . PHE A 1 99 ? 12.558  10.341  26.997 1.00 27.99 ? 99  PHE A CE1 1 
ATOM   750  C CE2 . PHE A 1 99 ? 14.727  10.415  28.042 1.00 27.49 ? 99  PHE A CE2 1 
ATOM   751  C CZ  . PHE A 1 99 ? 13.909  10.680  26.947 1.00 28.72 ? 99  PHE A CZ  1 
ATOM   752  O OXT . PHE A 1 99 ? 13.636  10.413  32.436 1.00 21.45 ? 99  PHE A OXT 1 
ATOM   753  N N   . PRO B 1 1  ? 12.496  14.128  30.543 1.00 28.91 ? 1   PRO B N   1 
ATOM   754  C CA  . PRO B 1 1  ? 11.734  15.021  29.646 1.00 27.73 ? 1   PRO B CA  1 
ATOM   755  C C   . PRO B 1 1  ? 10.356  14.434  29.374 1.00 26.03 ? 1   PRO B C   1 
ATOM   756  O O   . PRO B 1 1  ? 10.059  13.313  29.786 1.00 23.99 ? 1   PRO B O   1 
ATOM   757  C CB  . PRO B 1 1  ? 12.515  15.126  28.342 1.00 27.95 ? 1   PRO B CB  1 
ATOM   758  C CG  . PRO B 1 1  ? 13.912  14.644  28.761 1.00 29.84 ? 1   PRO B CG  1 
ATOM   759  C CD  . PRO B 1 1  ? 13.662  13.583  29.828 1.00 29.55 ? 1   PRO B CD  1 
ATOM   760  N N   . GLN B 1 2  ? 9.522   15.208  28.686 1.00 26.12 ? 2   GLN B N   1 
ATOM   761  C CA  . GLN B 1 2  ? 8.183   14.771  28.306 1.00 26.57 ? 2   GLN B CA  1 
ATOM   762  C C   . GLN B 1 2  ? 8.054   14.959  26.800 1.00 26.10 ? 2   GLN B C   1 
ATOM   763  O O   . GLN B 1 2  ? 8.238   16.064  26.286 1.00 27.33 ? 2   GLN B O   1 
ATOM   764  C CB  . GLN B 1 2  ? 7.095   15.589  29.007 1.00 27.39 ? 2   GLN B CB  1 
ATOM   765  C CG  . GLN B 1 2  ? 5.690   15.074  28.689 1.00 29.21 ? 2   GLN B CG  1 
ATOM   766  C CD  . GLN B 1 2  ? 4.586   15.882  29.339 1.00 30.96 ? 2   GLN B CD  1 
ATOM   767  O OE1 . GLN B 1 2  ? 4.183   16.929  28.831 1.00 31.14 ? 2   GLN B OE1 1 
ATOM   768  N NE2 . GLN B 1 2  ? 4.092   15.400  30.475 1.00 31.02 ? 2   GLN B NE2 1 
ATOM   769  N N   . ILE B 1 3  ? 7.742   13.874  26.098 1.00 24.61 ? 3   ILE B N   1 
ATOM   770  C CA  . ILE B 1 3  ? 7.597   13.900  24.648 1.00 22.87 ? 3   ILE B CA  1 
ATOM   771  C C   . ILE B 1 3  ? 6.142   13.673  24.247 1.00 22.93 ? 3   ILE B C   1 
ATOM   772  O O   . ILE B 1 3  ? 5.554   12.632  24.563 1.00 20.99 ? 3   ILE B O   1 
ATOM   773  C CB  . ILE B 1 3  ? 8.480   12.808  24.001 1.00 24.14 ? 3   ILE B CB  1 
ATOM   774  C CG1 . ILE B 1 3  ? 9.948   13.061  24.357 1.00 23.97 ? 3   ILE B CG1 1 
ATOM   775  C CG2 . ILE B 1 3  ? 8.288   12.790  22.487 1.00 24.08 ? 3   ILE B CG2 1 
ATOM   776  C CD1 . ILE B 1 3  ? 10.893  11.999  23.857 1.00 25.65 ? 3   ILE B CD1 1 
ATOM   777  N N   . THR B 1 4  ? 5.555   14.650  23.564 1.00 21.84 ? 4   THR B N   1 
ATOM   778  C CA  . THR B 1 4  ? 4.173   14.516  23.126 1.00 21.63 ? 4   THR B CA  1 
ATOM   779  C C   . THR B 1 4  ? 4.124   13.611  21.907 1.00 20.06 ? 4   THR B C   1 
ATOM   780  O O   . THR B 1 4  ? 5.163   13.220  21.383 1.00 19.96 ? 4   THR B O   1 
ATOM   781  C CB  . THR B 1 4  ? 3.543   15.882  22.801 1.00 21.98 ? 4   THR B CB  1 
ATOM   782  O OG1 . THR B 1 4  ? 4.411   16.624  21.937 1.00 23.10 ? 4   THR B OG1 1 
ATOM   783  C CG2 . THR B 1 4  ? 3.299   16.660  24.088 1.00 22.76 ? 4   THR B CG2 1 
ATOM   784  N N   . LEU B 1 5  ? 2.923   13.281  21.447 1.00 19.42 ? 5   LEU B N   1 
ATOM   785  C CA  . LEU B 1 5  ? 2.808   12.383  20.306 1.00 18.89 ? 5   LEU B CA  1 
ATOM   786  C C   . LEU B 1 5  ? 2.205   12.987  19.037 1.00 19.58 ? 5   LEU B C   1 
ATOM   787  O O   . LEU B 1 5  ? 1.736   12.263  18.156 1.00 16.58 ? 5   LEU B O   1 
ATOM   788  C CB  . LEU B 1 5  ? 2.036   11.135  20.738 1.00 17.09 ? 5   LEU B CB  1 
ATOM   789  C CG  . LEU B 1 5  ? 2.729   10.363  21.869 1.00 15.63 ? 5   LEU B CG  1 
ATOM   790  C CD1 . LEU B 1 5  ? 1.797   9.287   22.424 1.00 16.79 ? 5   LEU B CD1 1 
ATOM   791  C CD2 . LEU B 1 5  ? 4.027   9.750   21.346 1.00 18.60 ? 5   LEU B CD2 1 
ATOM   792  N N   . TRP B 1 6  ? 2.243   14.314  18.938 1.00 18.60 ? 6   TRP B N   1 
ATOM   793  C CA  . TRP B 1 6  ? 1.720   15.016  17.769 1.00 20.46 ? 6   TRP B CA  1 
ATOM   794  C C   . TRP B 1 6  ? 2.453   14.522  16.530 1.00 20.27 ? 6   TRP B C   1 
ATOM   795  O O   . TRP B 1 6  ? 1.872   14.404  15.449 1.00 18.09 ? 6   TRP B O   1 
ATOM   796  C CB  . TRP B 1 6  ? 1.927   16.525  17.916 1.00 19.99 ? 6   TRP B CB  1 
ATOM   797  C CG  . TRP B 1 6  ? 1.115   17.145  19.001 1.00 20.54 ? 6   TRP B CG  1 
ATOM   798  C CD1 . TRP B 1 6  ? 1.583   17.804  20.103 1.00 20.83 ? 6   TRP B CD1 1 
ATOM   799  C CD2 . TRP B 1 6  ? -0.315  17.220  19.067 1.00 19.29 ? 6   TRP B CD2 1 
ATOM   800  N NE1 . TRP B 1 6  ? 0.536   18.287  20.845 1.00 19.35 ? 6   TRP B NE1 1 
ATOM   801  C CE2 . TRP B 1 6  ? -0.640  17.945  20.235 1.00 20.14 ? 6   TRP B CE2 1 
ATOM   802  C CE3 . TRP B 1 6  ? -1.352  16.745  18.254 1.00 19.23 ? 6   TRP B CE3 1 
ATOM   803  C CZ2 . TRP B 1 6  ? -1.962  18.213  20.608 1.00 19.63 ? 6   TRP B CZ2 1 
ATOM   804  C CZ3 . TRP B 1 6  ? -2.672  17.013  18.627 1.00 18.82 ? 6   TRP B CZ3 1 
ATOM   805  C CH2 . TRP B 1 6  ? -2.959  17.741  19.796 1.00 19.02 ? 6   TRP B CH2 1 
ATOM   806  N N   . LYS B 1 7  ? 3.740   14.245  16.703 1.00 19.63 ? 7   LYS B N   1 
ATOM   807  C CA  . LYS B 1 7  ? 4.580   13.739  15.629 1.00 20.06 ? 7   LYS B CA  1 
ATOM   808  C C   . LYS B 1 7  ? 5.288   12.509  16.179 1.00 18.39 ? 7   LYS B C   1 
ATOM   809  O O   . LYS B 1 7  ? 5.228   12.241  17.379 1.00 18.50 ? 7   LYS B O   1 
ATOM   810  C CB  . LYS B 1 7  ? 5.623   14.785  15.227 1.00 22.69 ? 7   LYS B CB  1 
ATOM   811  C CG  . LYS B 1 7  ? 5.049   16.163  14.919 1.00 26.29 ? 7   LYS B CG  1 
ATOM   812  C CD  . LYS B 1 7  ? 4.280   16.183  13.608 1.00 29.80 ? 7   LYS B CD  1 
ATOM   813  C CE  . LYS B 1 7  ? 3.818   17.595  13.283 1.00 31.09 ? 7   LYS B CE  1 
ATOM   814  N NZ  . LYS B 1 7  ? 3.149   17.700  11.962 1.00 35.43 ? 7   LYS B NZ  1 
ATOM   815  N N   . ARG B 1 8  ? 5.956   11.766  15.304 1.00 18.70 ? 8   ARG B N   1 
ATOM   816  C CA  . ARG B 1 8  ? 6.680   10.573  15.718 1.00 19.38 ? 8   ARG B CA  1 
ATOM   817  C C   . ARG B 1 8  ? 7.669   10.968  16.810 1.00 19.41 ? 8   ARG B C   1 
ATOM   818  O O   . ARG B 1 8  ? 8.393   11.956  16.669 1.00 20.25 ? 8   ARG B O   1 
ATOM   819  C CB  . ARG B 1 8  ? 7.415   9.970   14.514 1.00 20.47 ? 8   ARG B CB  1 
ATOM   820  C CG  . ARG B 1 8  ? 6.462   9.489   13.434 1.00 20.34 ? 8   ARG B CG  1 
ATOM   821  C CD  . ARG B 1 8  ? 7.143   9.192   12.104 1.00 22.47 ? 8   ARG B CD  1 
ATOM   822  N NE  . ARG B 1 8  ? 6.158   8.800   11.094 1.00 23.82 ? 8   ARG B NE  1 
ATOM   823  C CZ  . ARG B 1 8  ? 6.313   8.943   9.780  1.00 24.25 ? 8   ARG B CZ  1 
ATOM   824  N NH1 . ARG B 1 8  ? 7.425   9.474   9.281  1.00 23.10 ? 8   ARG B NH1 1 
ATOM   825  N NH2 . ARG B 1 8  ? 5.342   8.564   8.960  1.00 21.92 ? 8   ARG B NH2 1 
ATOM   826  N N   . PRO B 1 9  ? 7.691   10.220  17.927 1.00 18.67 ? 9   PRO B N   1 
ATOM   827  C CA  . PRO B 1 9  ? 8.608   10.524  19.029 1.00 19.32 ? 9   PRO B CA  1 
ATOM   828  C C   . PRO B 1 9  ? 10.052  10.124  18.727 1.00 21.13 ? 9   PRO B C   1 
ATOM   829  O O   . PRO B 1 9  ? 10.535  9.079   19.179 1.00 18.89 ? 9   PRO B O   1 
ATOM   830  C CB  . PRO B 1 9  ? 8.007   9.746   20.195 1.00 20.30 ? 9   PRO B CB  1 
ATOM   831  C CG  . PRO B 1 9  ? 7.431   8.543   19.520 1.00 18.58 ? 9   PRO B CG  1 
ATOM   832  C CD  . PRO B 1 9  ? 6.758   9.143   18.305 1.00 18.91 ? 9   PRO B CD  1 
ATOM   833  N N   . LEU B 1 10 ? 10.730  10.971  17.958 1.00 22.12 ? 10  LEU B N   1 
ATOM   834  C CA  . LEU B 1 10 ? 12.116  10.746  17.570 1.00 21.88 ? 10  LEU B CA  1 
ATOM   835  C C   . LEU B 1 10 ? 13.108  11.357  18.562 1.00 23.01 ? 10  LEU B C   1 
ATOM   836  O O   . LEU B 1 10 ? 12.922  12.472  19.046 1.00 22.54 ? 10  LEU B O   1 
ATOM   837  C CB  . LEU B 1 10 ? 12.370  11.330  16.176 1.00 24.17 ? 10  LEU B CB  1 
ATOM   838  C CG  . LEU B 1 10 ? 11.626  10.692  14.997 1.00 25.52 ? 10  LEU B CG  1 
ATOM   839  C CD1 . LEU B 1 10 ? 11.935  11.465  13.719 1.00 28.15 ? 10  LEU B CD1 1 
ATOM   840  C CD2 . LEU B 1 10 ? 12.045  9.234   14.850 1.00 26.66 ? 10  LEU B CD2 1 
ATOM   841  N N   . VAL B 1 11 ? 14.164  10.613  18.861 1.00 20.93 ? 11  VAL B N   1 
ATOM   842  C CA  . VAL B 1 11 ? 15.189  11.079  19.779 1.00 21.30 ? 11  VAL B CA  1 
ATOM   843  C C   . VAL B 1 11 ? 16.556  10.665  19.251 1.00 21.10 ? 11  VAL B C   1 
ATOM   844  O O   . VAL B 1 11 ? 16.658  9.824   18.361 1.00 19.45 ? 11  VAL B O   1 
ATOM   845  C CB  . VAL B 1 11 ? 14.999  10.480  21.193 1.00 22.72 ? 11  VAL B CB  1 
ATOM   846  C CG1 . VAL B 1 11 ? 13.644  10.878  21.750 1.00 21.20 ? 11  VAL B CG1 1 
ATOM   847  C CG2 . VAL B 1 11 ? 15.136  8.959   21.145 1.00 22.42 ? 11  VAL B CG2 1 
ATOM   848  N N   . THR B 1 12 ? 17.608  11.272  19.785 1.00 20.77 ? 12  THR B N   1 
ATOM   849  C CA  . THR B 1 12 ? 18.953  10.920  19.362 1.00 19.55 ? 12  THR B CA  1 
ATOM   850  C C   . THR B 1 12 ? 19.476  9.838   20.289 1.00 20.60 ? 12  THR B C   1 
ATOM   851  O O   . THR B 1 12 ? 19.246  9.880   21.498 1.00 21.76 ? 12  THR B O   1 
ATOM   852  C CB  . THR B 1 12 ? 19.909  12.124  19.442 1.00 19.26 ? 12  THR B CB  1 
ATOM   853  O OG1 . THR B 1 12 ? 19.404  13.191  18.634 1.00 20.86 ? 12  THR B OG1 1 
ATOM   854  C CG2 . THR B 1 12 ? 21.290  11.736  18.944 1.00 21.20 ? 12  THR B CG2 1 
ATOM   855  N N   . ILE B 1 13 ? 20.163  8.862   19.716 1.00 21.30 ? 13  ILE B N   1 
ATOM   856  C CA  . ILE B 1 13 ? 20.747  7.779   20.491 1.00 22.90 ? 13  ILE B CA  1 
ATOM   857  C C   . ILE B 1 13 ? 22.205  7.649   20.086 1.00 22.65 ? 13  ILE B C   1 
ATOM   858  O O   . ILE B 1 13 ? 22.614  8.136   19.031 1.00 23.93 ? 13  ILE B O   1 
ATOM   859  C CB  . ILE B 1 13 ? 20.062  6.422   20.210 1.00 22.07 ? 13  ILE B CB  1 
ATOM   860  C CG1 . ILE B 1 13 ? 20.168  6.087   18.722 1.00 22.38 ? 13  ILE B CG1 1 
ATOM   861  C CG2 . ILE B 1 13 ? 18.606  6.460   20.659 1.00 20.54 ? 13  ILE B CG2 1 
ATOM   862  C CD1 . ILE B 1 13 ? 19.766  4.664   18.386 1.00 23.85 ? 13  ILE B CD1 1 
ATOM   863  N N   . ARG B 1 14 ? 22.986  6.996   20.932 1.00 22.93 ? 14  ARG B N   1 
ATOM   864  C CA  . ARG B 1 14 ? 24.393  6.774   20.645 1.00 23.01 ? 14  ARG B CA  1 
ATOM   865  C C   . ARG B 1 14 ? 24.604  5.272   20.711 1.00 21.76 ? 14  ARG B C   1 
ATOM   866  O O   . ARG B 1 14 ? 24.277  4.639   21.716 1.00 20.65 ? 14  ARG B O   1 
ATOM   867  C CB  . ARG B 1 14 ? 25.269  7.472   21.689 1.00 24.75 ? 14  ARG B CB  1 
ATOM   868  C CG  . ARG B 1 14 ? 26.749  7.541   21.329 1.00 30.72 ? 14  ARG B CG  1 
ATOM   869  C CD  . ARG B 1 14 ? 27.515  8.330   22.386 1.00 34.89 ? 14  ARG B CD  1 
ATOM   870  N NE  . ARG B 1 14 ? 28.742  8.925   21.864 1.00 39.88 ? 14  ARG B NE  1 
ATOM   871  C CZ  . ARG B 1 14 ? 29.801  8.236   21.446 1.00 40.71 ? 14  ARG B CZ  1 
ATOM   872  N NH1 . ARG B 1 14 ? 29.797  6.909   21.483 1.00 40.99 ? 14  ARG B NH1 1 
ATOM   873  N NH2 . ARG B 1 14 ? 30.866  8.879   20.988 1.00 39.34 ? 14  ARG B NH2 1 
ATOM   874  N N   . ILE B 1 15 ? 25.138  4.699   19.640 1.00 23.43 ? 15  ILE B N   1 
ATOM   875  C CA  . ILE B 1 15 ? 25.377  3.266   19.599 1.00 25.59 ? 15  ILE B CA  1 
ATOM   876  C C   . ILE B 1 15 ? 26.493  2.903   18.634 1.00 27.63 ? 15  ILE B C   1 
ATOM   877  O O   . ILE B 1 15 ? 26.577  3.446   17.533 1.00 26.40 ? 15  ILE B O   1 
ATOM   878  C CB  . ILE B 1 15 ? 24.110  2.505   19.179 1.00 26.24 ? 15  ILE B CB  1 
ATOM   879  C CG1 . ILE B 1 15 ? 24.406  1.003   19.120 1.00 28.00 ? 15  ILE B CG1 1 
ATOM   880  C CG2 . ILE B 1 15 ? 23.622  3.015   17.828 1.00 25.76 ? 15  ILE B CG2 1 
ATOM   881  C CD1 . ILE B 1 15 ? 23.189  0.146   18.876 1.00 30.12 ? 15  ILE B CD1 1 
ATOM   882  N N   . GLY B 1 16 ? 27.345  1.975   19.059 1.00 30.42 ? 16  GLY B N   1 
ATOM   883  C CA  . GLY B 1 16 ? 28.450  1.541   18.225 1.00 31.55 ? 16  GLY B CA  1 
ATOM   884  C C   . GLY B 1 16 ? 29.307  2.699   17.760 1.00 33.42 ? 16  GLY B C   1 
ATOM   885  O O   . GLY B 1 16 ? 29.888  2.652   16.675 1.00 33.99 ? 16  GLY B O   1 
ATOM   886  N N   . GLY B 1 17 ? 29.378  3.743   18.581 1.00 34.29 ? 17  GLY B N   1 
ATOM   887  C CA  . GLY B 1 17 ? 30.172  4.908   18.239 1.00 35.11 ? 17  GLY B CA  1 
ATOM   888  C C   . GLY B 1 17 ? 29.472  5.882   17.307 1.00 35.96 ? 17  GLY B C   1 
ATOM   889  O O   . GLY B 1 17 ? 30.062  6.882   16.893 1.00 36.22 ? 17  GLY B O   1 
ATOM   890  N N   . GLN B 1 18 ? 28.215  5.598   16.976 1.00 34.91 ? 18  GLN B N   1 
ATOM   891  C CA  . GLN B 1 18 ? 27.447  6.461   16.081 1.00 33.88 ? 18  GLN B CA  1 
ATOM   892  C C   . GLN B 1 18 ? 26.264  7.139   16.766 1.00 32.25 ? 18  GLN B C   1 
ATOM   893  O O   . GLN B 1 18 ? 25.733  6.639   17.760 1.00 30.80 ? 18  GLN B O   1 
ATOM   894  C CB  . GLN B 1 18 ? 26.901  5.660   14.894 1.00 35.60 ? 18  GLN B CB  1 
ATOM   895  C CG  . GLN B 1 18 ? 27.928  5.153   13.899 1.00 37.45 ? 18  GLN B CG  1 
ATOM   896  C CD  . GLN B 1 18 ? 27.268  4.493   12.701 1.00 39.12 ? 18  GLN B CD  1 
ATOM   897  O OE1 . GLN B 1 18 ? 26.635  3.443   12.825 1.00 39.62 ? 18  GLN B OE1 1 
ATOM   898  N NE2 . GLN B 1 18 ? 27.399  5.115   11.535 1.00 39.78 ? 18  GLN B NE2 1 
ATOM   899  N N   . LEU B 1 19 ? 25.861  8.282   16.221 1.00 30.39 ? 19  LEU B N   1 
ATOM   900  C CA  . LEU B 1 19 ? 24.710  9.018   16.725 1.00 29.57 ? 19  LEU B CA  1 
ATOM   901  C C   . LEU B 1 19 ? 23.637  8.843   15.664 1.00 28.56 ? 19  LEU B C   1 
ATOM   902  O O   . LEU B 1 19 ? 23.887  9.065   14.478 1.00 27.64 ? 19  LEU B O   1 
ATOM   903  C CB  . LEU B 1 19 ? 25.023  10.508  16.899 1.00 30.31 ? 19  LEU B CB  1 
ATOM   904  C CG  . LEU B 1 19 ? 25.857  10.937  18.107 1.00 29.49 ? 19  LEU B CG  1 
ATOM   905  C CD1 . LEU B 1 19 ? 25.880  12.453  18.181 1.00 30.10 ? 19  LEU B CD1 1 
ATOM   906  C CD2 . LEU B 1 19 ? 25.257  10.368  19.381 1.00 30.93 ? 19  LEU B CD2 1 
ATOM   907  N N   . LYS B 1 20 ? 22.449  8.433   16.090 1.00 26.44 ? 20  LYS B N   1 
ATOM   908  C CA  . LYS B 1 20 ? 21.349  8.214   15.166 1.00 26.12 ? 20  LYS B CA  1 
ATOM   909  C C   . LYS B 1 20 ? 20.042  8.766   15.719 1.00 25.63 ? 20  LYS B C   1 
ATOM   910  O O   . LYS B 1 20 ? 19.938  9.106   16.898 1.00 24.81 ? 20  LYS B O   1 
ATOM   911  C CB  . LYS B 1 20 ? 21.164  6.717   14.907 1.00 27.76 ? 20  LYS B CB  1 
ATOM   912  C CG  . LYS B 1 20 ? 22.372  5.996   14.341 1.00 30.17 ? 20  LYS B CG  1 
ATOM   913  C CD  . LYS B 1 20 ? 22.171  4.494   14.447 1.00 31.28 ? 20  LYS B CD  1 
ATOM   914  C CE  . LYS B 1 20 ? 23.294  3.726   13.773 1.00 33.91 ? 20  LYS B CE  1 
ATOM   915  N NZ  . LYS B 1 20 ? 23.243  3.877   12.296 1.00 32.10 ? 20  LYS B NZ  1 
ATOM   916  N N   . GLU B 1 21 ? 19.048  8.838   14.843 1.00 23.97 ? 21  GLU B N   1 
ATOM   917  C CA  . GLU B 1 21 ? 17.720  9.305   15.198 1.00 24.44 ? 21  GLU B CA  1 
ATOM   918  C C   . GLU B 1 21 ? 16.883  8.034   15.318 1.00 22.93 ? 21  GLU B C   1 
ATOM   919  O O   . GLU B 1 21 ? 16.890  7.200   14.409 1.00 19.71 ? 21  GLU B O   1 
ATOM   920  C CB  . GLU B 1 21 ? 17.187  10.205  14.083 1.00 27.97 ? 21  GLU B CB  1 
ATOM   921  C CG  . GLU B 1 21 ? 15.732  10.592  14.204 1.00 33.59 ? 21  GLU B CG  1 
ATOM   922  C CD  . GLU B 1 21 ? 15.282  11.471  13.046 1.00 38.04 ? 21  GLU B CD  1 
ATOM   923  O OE1 . GLU B 1 21 ? 15.687  12.652  13.002 1.00 37.87 ? 21  GLU B OE1 1 
ATOM   924  O OE2 . GLU B 1 21 ? 14.534  10.975  12.174 1.00 39.88 ? 21  GLU B OE2 1 
ATOM   925  N N   . ALA B 1 22 ? 16.192  7.867   16.444 1.00 19.01 ? 22  ALA B N   1 
ATOM   926  C CA  . ALA B 1 22 ? 15.370  6.676   16.650 1.00 19.39 ? 22  ALA B CA  1 
ATOM   927  C C   . ALA B 1 22 ? 14.001  7.013   17.241 1.00 19.87 ? 22  ALA B C   1 
ATOM   928  O O   . ALA B 1 22 ? 13.827  8.039   17.897 1.00 20.08 ? 22  ALA B O   1 
ATOM   929  C CB  . ALA B 1 22 ? 16.106  5.677   17.543 1.00 17.67 ? 22  ALA B CB  1 
ATOM   930  N N   . LEU B 1 23 ? 13.038  6.131   16.998 1.00 19.94 ? 23  LEU B N   1 
ATOM   931  C CA  . LEU B 1 23 ? 11.661  6.309   17.452 1.00 19.86 ? 23  LEU B CA  1 
ATOM   932  C C   . LEU B 1 23 ? 11.352  5.516   18.727 1.00 19.72 ? 23  LEU B C   1 
ATOM   933  O O   . LEU B 1 23 ? 11.546  4.300   18.763 1.00 18.37 ? 23  LEU B O   1 
ATOM   934  C CB  . LEU B 1 23 ? 10.726  5.861   16.323 1.00 22.21 ? 23  LEU B CB  1 
ATOM   935  C CG  . LEU B 1 23 ? 9.205   5.963   16.417 1.00 23.57 ? 23  LEU B CG  1 
ATOM   936  C CD1 . LEU B 1 23 ? 8.786   7.413   16.364 1.00 24.98 ? 23  LEU B CD1 1 
ATOM   937  C CD2 . LEU B 1 23 ? 8.585   5.203   15.254 1.00 25.77 ? 23  LEU B CD2 1 
ATOM   938  N N   . LEU B 1 24 ? 10.890  6.200   19.776 1.00 18.28 ? 24  LEU B N   1 
ATOM   939  C CA  . LEU B 1 24 ? 10.529  5.517   21.022 1.00 17.48 ? 24  LEU B CA  1 
ATOM   940  C C   . LEU B 1 24 ? 9.294   4.698   20.673 1.00 17.87 ? 24  LEU B C   1 
ATOM   941  O O   . LEU B 1 24 ? 8.254   5.259   20.350 1.00 18.05 ? 24  LEU B O   1 
ATOM   942  C CB  . LEU B 1 24 ? 10.206  6.533   22.120 1.00 20.34 ? 24  LEU B CB  1 
ATOM   943  C CG  . LEU B 1 24 ? 11.356  7.093   22.969 1.00 23.77 ? 24  LEU B CG  1 
ATOM   944  C CD1 . LEU B 1 24 ? 12.726  6.677   22.435 1.00 20.67 ? 24  LEU B CD1 1 
ATOM   945  C CD2 . LEU B 1 24 ? 11.217  8.597   23.022 1.00 25.20 ? 24  LEU B CD2 1 
ATOM   946  N N   . ASN B 1 25 ? 9.405   3.377   20.766 1.00 15.57 ? 25  ASN B N   1 
ATOM   947  C CA  . ASN B 1 25 ? 8.317   2.494   20.359 1.00 16.67 ? 25  ASN B CA  1 
ATOM   948  C C   . ASN B 1 25 ? 7.776   1.544   21.425 1.00 14.64 ? 25  ASN B C   1 
ATOM   949  O O   . ASN B 1 25 ? 8.317   0.460   21.638 1.00 12.43 ? 25  ASN B O   1 
ATOM   950  C CB  . ASN B 1 25 ? 8.801   1.712   19.130 1.00 17.88 ? 25  ASN B CB  1 
ATOM   951  C CG  . ASN B 1 25 ? 7.755   0.783   18.564 1.00 20.03 ? 25  ASN B CG  1 
ATOM   952  O OD1 . ASN B 1 25 ? 6.558   0.979   18.759 1.00 21.16 ? 25  ASN B OD1 1 
ATOM   953  N ND2 . ASN B 1 25 ? 8.206   -0.232  17.833 1.00 20.99 ? 25  ASN B ND2 1 
ATOM   954  N N   . THR B 1 26 ? 6.691   1.947   22.080 1.00 15.40 ? 26  THR B N   1 
ATOM   955  C CA  . THR B 1 26 ? 6.090   1.118   23.121 1.00 16.74 ? 26  THR B CA  1 
ATOM   956  C C   . THR B 1 26 ? 5.430   -0.138  22.563 1.00 16.90 ? 26  THR B C   1 
ATOM   957  O O   . THR B 1 26 ? 5.070   -1.041  23.318 1.00 17.73 ? 26  THR B O   1 
ATOM   958  C CB  . THR B 1 26 ? 5.021   1.892   23.919 1.00 17.85 ? 26  THR B CB  1 
ATOM   959  O OG1 . THR B 1 26 ? 3.984   2.336   23.030 1.00 17.93 ? 26  THR B OG1 1 
ATOM   960  C CG2 . THR B 1 26 ? 5.647   3.085   24.634 1.00 15.58 ? 26  THR B CG2 1 
ATOM   961  N N   . GLY B 1 27 ? 5.270   -0.193  21.246 1.00 16.08 ? 27  GLY B N   1 
ATOM   962  C CA  . GLY B 1 27 ? 4.632   -1.342  20.625 1.00 18.49 ? 27  GLY B CA  1 
ATOM   963  C C   . GLY B 1 27 ? 5.533   -2.530  20.337 1.00 18.07 ? 27  GLY B C   1 
ATOM   964  O O   . GLY B 1 27 ? 5.094   -3.516  19.735 1.00 17.39 ? 27  GLY B O   1 
ATOM   965  N N   . ALA B 1 28 ? 6.793   -2.445  20.752 1.00 18.51 ? 28  ALA B N   1 
ATOM   966  C CA  . ALA B 1 28 ? 7.732   -3.539  20.528 1.00 20.24 ? 28  ALA B CA  1 
ATOM   967  C C   . ALA B 1 28 ? 8.627   -3.752  21.739 1.00 20.89 ? 28  ALA B C   1 
ATOM   968  O O   . ALA B 1 28 ? 9.043   -2.792  22.385 1.00 18.67 ? 28  ALA B O   1 
ATOM   969  C CB  . ALA B 1 28 ? 8.591   -3.245  19.296 1.00 21.02 ? 28  ALA B CB  1 
ATOM   970  N N   . ASP B 1 29 ? 8.921   -5.009  22.061 1.00 22.82 ? 29  ASP B N   1 
ATOM   971  C CA  . ASP B 1 29 ? 9.803   -5.276  23.192 1.00 24.41 ? 29  ASP B CA  1 
ATOM   972  C C   . ASP B 1 29 ? 11.252  -5.173  22.719 1.00 24.15 ? 29  ASP B C   1 
ATOM   973  O O   . ASP B 1 29 ? 12.134  -4.777  23.479 1.00 25.06 ? 29  ASP B O   1 
ATOM   974  C CB  . ASP B 1 29 ? 9.540   -6.664  23.784 1.00 26.94 ? 29  ASP B CB  1 
ATOM   975  C CG  . ASP B 1 29 ? 10.346  -6.917  25.051 1.00 29.70 ? 29  ASP B CG  1 
ATOM   976  O OD1 . ASP B 1 29 ? 10.408  -6.012  25.914 1.00 29.03 ? 29  ASP B OD1 1 
ATOM   977  O OD2 . ASP B 1 29 ? 10.910  -8.021  25.188 1.00 30.69 ? 29  ASP B OD2 1 
ATOM   978  N N   . ASP B 1 30 ? 11.489  -5.514  21.455 1.00 22.80 ? 30  ASP B N   1 
ATOM   979  C CA  . ASP B 1 30 ? 12.831  -5.456  20.885 1.00 22.78 ? 30  ASP B CA  1 
ATOM   980  C C   . ASP B 1 30 ? 13.180  -4.081  20.342 1.00 21.16 ? 30  ASP B C   1 
ATOM   981  O O   . ASP B 1 30 ? 12.298  -3.268  20.054 1.00 19.37 ? 30  ASP B O   1 
ATOM   982  C CB  . ASP B 1 30 ? 12.983  -6.456  19.737 1.00 26.66 ? 30  ASP B CB  1 
ATOM   983  C CG  . ASP B 1 30 ? 12.897  -7.889  20.192 1.00 29.50 ? 30  ASP B CG  1 
ATOM   984  O OD1 . ASP B 1 30 ? 13.653  -8.276  21.109 1.00 35.80 ? 30  ASP B OD1 1 
ATOM   985  O OD2 . ASP B 1 30 ? 12.079  -8.632  19.621 1.00 32.26 ? 30  ASP B OD2 1 
ATOM   986  N N   . THR B 1 31 ? 14.481  -3.844  20.200 1.00 18.62 ? 31  THR B N   1 
ATOM   987  C CA  . THR B 1 31 ? 15.013  -2.604  19.644 1.00 19.11 ? 31  THR B CA  1 
ATOM   988  C C   . THR B 1 31 ? 15.621  -2.993  18.293 1.00 18.87 ? 31  THR B C   1 
ATOM   989  O O   . THR B 1 31 ? 16.465  -3.889  18.223 1.00 17.89 ? 31  THR B O   1 
ATOM   990  C CB  . THR B 1 31 ? 16.105  -2.017  20.557 1.00 18.65 ? 31  THR B CB  1 
ATOM   991  O OG1 . THR B 1 31 ? 15.490  -1.458  21.722 1.00 19.27 ? 31  THR B OG1 1 
ATOM   992  C CG2 . THR B 1 31 ? 16.899  -0.941  19.832 1.00 20.25 ? 31  THR B CG2 1 
ATOM   993  N N   . VAL B 1 32 ? 15.184  -2.339  17.222 1.00 18.41 ? 32  VAL B N   1 
ATOM   994  C CA  . VAL B 1 32 ? 15.692  -2.667  15.893 1.00 17.66 ? 32  VAL B CA  1 
ATOM   995  C C   . VAL B 1 32 ? 16.304  -1.460  15.190 1.00 17.79 ? 32  VAL B C   1 
ATOM   996  O O   . VAL B 1 32 ? 15.658  -0.425  15.047 1.00 16.24 ? 32  VAL B O   1 
ATOM   997  C CB  . VAL B 1 32 ? 14.569  -3.238  14.993 1.00 17.82 ? 32  VAL B CB  1 
ATOM   998  C CG1 . VAL B 1 32 ? 15.180  -3.898  13.750 1.00 19.47 ? 32  VAL B CG1 1 
ATOM   999  C CG2 . VAL B 1 32 ? 13.724  -4.239  15.771 1.00 18.52 ? 32  VAL B CG2 1 
ATOM   1000 N N   . LEU B 1 33 ? 17.550  -1.600  14.744 1.00 18.96 ? 33  LEU B N   1 
ATOM   1001 C CA  . LEU B 1 33 ? 18.231  -0.514  14.059 1.00 18.56 ? 33  LEU B CA  1 
ATOM   1002 C C   . LEU B 1 33 ? 18.512  -0.820  12.596 1.00 19.60 ? 33  LEU B C   1 
ATOM   1003 O O   . LEU B 1 33 ? 18.752  -1.974  12.218 1.00 17.33 ? 33  LEU B O   1 
ATOM   1004 C CB  . LEU B 1 33 ? 19.552  -0.182  14.759 1.00 19.41 ? 33  LEU B CB  1 
ATOM   1005 C CG  . LEU B 1 33 ? 19.489  0.202   16.241 1.00 20.45 ? 33  LEU B CG  1 
ATOM   1006 C CD1 . LEU B 1 33 ? 20.874  0.620   16.703 1.00 21.94 ? 33  LEU B CD1 1 
ATOM   1007 C CD2 . LEU B 1 33 ? 18.512  1.340   16.451 1.00 20.70 ? 33  LEU B CD2 1 
ATOM   1008 N N   . GLU B 1 34 ? 18.474  0.230   11.781 1.00 20.24 ? 34  GLU B N   1 
ATOM   1009 C CA  . GLU B 1 34 ? 18.745  0.115   10.357 1.00 22.73 ? 34  GLU B CA  1 
ATOM   1010 C C   . GLU B 1 34 ? 20.126  -0.503  10.167 1.00 23.73 ? 34  GLU B C   1 
ATOM   1011 O O   . GLU B 1 34 ? 21.009  -0.352  11.015 1.00 21.99 ? 34  GLU B O   1 
ATOM   1012 C CB  . GLU B 1 34 ? 18.685  1.493   9.698  1.00 25.98 ? 34  GLU B CB  1 
ATOM   1013 C CG  . GLU B 1 34 ? 17.267  1.999   9.463  1.00 30.75 ? 34  GLU B CG  1 
ATOM   1014 C CD  . GLU B 1 34 ? 17.208  3.484   9.149  1.00 34.05 ? 34  GLU B CD  1 
ATOM   1015 O OE1 . GLU B 1 34 ? 18.084  3.973   8.408  1.00 35.71 ? 34  GLU B OE1 1 
ATOM   1016 O OE2 . GLU B 1 34 ? 16.277  4.162   9.638  1.00 34.89 ? 34  GLU B OE2 1 
ATOM   1017 N N   . GLU B 1 35 ? 20.298  -1.208  9.055  1.00 24.20 ? 35  GLU B N   1 
ATOM   1018 C CA  . GLU B 1 35 ? 21.559  -1.870  8.750  1.00 26.39 ? 35  GLU B CA  1 
ATOM   1019 C C   . GLU B 1 35 ? 22.772  -1.024  9.116  1.00 26.27 ? 35  GLU B C   1 
ATOM   1020 O O   . GLU B 1 35 ? 22.885  0.130   8.705  1.00 27.13 ? 35  GLU B O   1 
ATOM   1021 C CB  . GLU B 1 35 ? 21.614  -2.229  7.261  1.00 27.83 ? 35  GLU B CB  1 
ATOM   1022 C CG  . GLU B 1 35 ? 22.846  -3.019  6.864  1.00 29.06 ? 35  GLU B CG  1 
ATOM   1023 C CD  . GLU B 1 35 ? 23.025  -4.264  7.707  1.00 30.62 ? 35  GLU B CD  1 
ATOM   1024 O OE1 . GLU B 1 35 ? 22.097  -5.099  7.734  1.00 30.63 ? 35  GLU B OE1 1 
ATOM   1025 O OE2 . GLU B 1 35 ? 24.089  -4.406  8.345  1.00 32.26 ? 35  GLU B OE2 1 
ATOM   1026 N N   . MET B 1 36 ? 23.662  -1.607  9.911  1.00 25.40 ? 36  MET B N   1 
ATOM   1027 C CA  . MET B 1 36 ? 24.891  -0.949  10.327 1.00 27.36 ? 36  MET B CA  1 
ATOM   1028 C C   . MET B 1 36 ? 25.903  -2.065  10.572 1.00 28.08 ? 36  MET B C   1 
ATOM   1029 O O   . MET B 1 36 ? 25.543  -3.150  11.032 1.00 27.14 ? 36  MET B O   1 
ATOM   1030 C CB  . MET B 1 36 ? 24.662  -0.107  11.590 1.00 25.48 ? 36  MET B CB  1 
ATOM   1031 C CG  . MET B 1 36 ? 24.342  -0.891  12.843 1.00 26.44 ? 36  MET B CG  1 
ATOM   1032 S SD  . MET B 1 36 ? 24.176  0.217   14.260 1.00 28.32 ? 36  MET B SD  1 
ATOM   1033 C CE  . MET B 1 36 ? 25.829  0.917   14.328 1.00 26.62 ? 36  MET B CE  1 
ATOM   1034 N N   . ASN B 1 37 ? 27.167  -1.801  10.263 1.00 29.94 ? 37  ASN B N   1 
ATOM   1035 C CA  . ASN B 1 37 ? 28.200  -2.820  10.403 1.00 31.61 ? 37  ASN B CA  1 
ATOM   1036 C C   . ASN B 1 37 ? 28.855  -2.931  11.779 1.00 31.52 ? 37  ASN B C   1 
ATOM   1037 O O   . ASN B 1 37 ? 30.044  -2.649  11.933 1.00 30.87 ? 37  ASN B O   1 
ATOM   1038 C CB  . ASN B 1 37 ? 29.265  -2.602  9.318  1.00 33.47 ? 37  ASN B CB  1 
ATOM   1039 C CG  . ASN B 1 37 ? 30.186  -3.793  9.157  1.00 36.91 ? 37  ASN B CG  1 
ATOM   1040 O OD1 . ASN B 1 37 ? 29.750  -4.942  9.240  1.00 36.86 ? 37  ASN B OD1 1 
ATOM   1041 N ND2 . ASN B 1 37 ? 31.466  -3.526  8.909  1.00 38.66 ? 37  ASN B ND2 1 
ATOM   1042 N N   . LEU B 1 38 ? 28.076  -3.367  12.771 1.00 32.44 ? 38  LEU B N   1 
ATOM   1043 C CA  . LEU B 1 38 ? 28.569  -3.536  14.142 1.00 32.00 ? 38  LEU B CA  1 
ATOM   1044 C C   . LEU B 1 38 ? 29.490  -4.741  14.312 1.00 31.58 ? 38  LEU B C   1 
ATOM   1045 O O   . LEU B 1 38 ? 29.242  -5.811  13.755 1.00 32.41 ? 38  LEU B O   1 
ATOM   1046 C CB  . LEU B 1 38 ? 27.407  -3.713  15.126 1.00 32.04 ? 38  LEU B CB  1 
ATOM   1047 C CG  . LEU B 1 38 ? 26.598  -2.527  15.643 1.00 33.32 ? 38  LEU B CG  1 
ATOM   1048 C CD1 . LEU B 1 38 ? 25.518  -3.054  16.587 1.00 31.08 ? 38  LEU B CD1 1 
ATOM   1049 C CD2 . LEU B 1 38 ? 27.508  -1.541  16.373 1.00 30.39 ? 38  LEU B CD2 1 
ATOM   1050 N N   . PRO B 1 39 ? 30.569  -4.582  15.094 1.00 30.11 ? 39  PRO B N   1 
ATOM   1051 C CA  . PRO B 1 39 ? 31.507  -5.682  15.329 1.00 29.18 ? 39  PRO B CA  1 
ATOM   1052 C C   . PRO B 1 39 ? 30.964  -6.633  16.400 1.00 29.58 ? 39  PRO B C   1 
ATOM   1053 O O   . PRO B 1 39 ? 30.064  -6.275  17.163 1.00 28.07 ? 39  PRO B O   1 
ATOM   1054 C CB  . PRO B 1 39 ? 32.771  -4.960  15.783 1.00 30.20 ? 39  PRO B CB  1 
ATOM   1055 C CG  . PRO B 1 39 ? 32.225  -3.778  16.522 1.00 28.15 ? 39  PRO B CG  1 
ATOM   1056 C CD  . PRO B 1 39 ? 31.114  -3.309  15.604 1.00 30.09 ? 39  PRO B CD  1 
ATOM   1057 N N   . GLY B 1 40 ? 31.506  -7.844  16.450 1.00 28.89 ? 40  GLY B N   1 
ATOM   1058 C CA  . GLY B 1 40 ? 31.059  -8.801  17.446 1.00 29.55 ? 40  GLY B CA  1 
ATOM   1059 C C   . GLY B 1 40 ? 30.229  -9.937  16.879 1.00 28.34 ? 40  GLY B C   1 
ATOM   1060 O O   . GLY B 1 40 ? 29.805  -9.900  15.724 1.00 27.44 ? 40  GLY B O   1 
ATOM   1061 N N   . LYS B 1 41 ? 29.997  -10.955 17.701 1.00 27.45 ? 41  LYS B N   1 
ATOM   1062 C CA  . LYS B 1 41 ? 29.213  -12.107 17.280 1.00 26.42 ? 41  LYS B CA  1 
ATOM   1063 C C   . LYS B 1 41 ? 27.731  -11.772 17.356 1.00 26.30 ? 41  LYS B C   1 
ATOM   1064 O O   . LYS B 1 41 ? 27.329  -10.830 18.037 1.00 25.82 ? 41  LYS B O   1 
ATOM   1065 C CB  . LYS B 1 41 ? 29.522  -13.301 18.164 1.00 26.62 ? 41  LYS B CB  1 
ATOM   1066 N N   . TRP B 1 42 ? 26.923  -12.545 16.644 1.00 24.96 ? 42  TRP B N   1 
ATOM   1067 C CA  . TRP B 1 42 ? 25.486  -12.334 16.639 1.00 25.09 ? 42  TRP B CA  1 
ATOM   1068 C C   . TRP B 1 42 ? 24.774  -13.639 16.319 1.00 25.38 ? 42  TRP B C   1 
ATOM   1069 O O   . TRP B 1 42 ? 25.412  -14.640 15.995 1.00 24.80 ? 42  TRP B O   1 
ATOM   1070 C CB  . TRP B 1 42 ? 25.112  -11.278 15.600 1.00 25.37 ? 42  TRP B CB  1 
ATOM   1071 C CG  . TRP B 1 42 ? 25.710  -11.535 14.256 1.00 26.57 ? 42  TRP B CG  1 
ATOM   1072 C CD1 . TRP B 1 42 ? 26.946  -11.152 13.820 1.00 28.44 ? 42  TRP B CD1 1 
ATOM   1073 C CD2 . TRP B 1 42 ? 25.108  -12.253 13.174 1.00 27.81 ? 42  TRP B CD2 1 
ATOM   1074 N NE1 . TRP B 1 42 ? 27.151  -11.584 12.532 1.00 27.29 ? 42  TRP B NE1 1 
ATOM   1075 C CE2 . TRP B 1 42 ? 26.038  -12.262 12.111 1.00 28.07 ? 42  TRP B CE2 1 
ATOM   1076 C CE3 . TRP B 1 42 ? 23.872  -12.889 12.999 1.00 27.54 ? 42  TRP B CE3 1 
ATOM   1077 C CZ2 . TRP B 1 42 ? 25.771  -12.885 10.888 1.00 29.22 ? 42  TRP B CZ2 1 
ATOM   1078 C CZ3 . TRP B 1 42 ? 23.607  -13.508 11.781 1.00 29.40 ? 42  TRP B CZ3 1 
ATOM   1079 C CH2 . TRP B 1 42 ? 24.553  -13.500 10.742 1.00 29.13 ? 42  TRP B CH2 1 
ATOM   1080 N N   . LYS B 1 43 ? 23.450  -13.622 16.418 1.00 24.96 ? 43  LYS B N   1 
ATOM   1081 C CA  . LYS B 1 43 ? 22.645  -14.797 16.123 1.00 24.60 ? 43  LYS B CA  1 
ATOM   1082 C C   . LYS B 1 43 ? 21.493  -14.380 15.221 1.00 24.05 ? 43  LYS B C   1 
ATOM   1083 O O   . LYS B 1 43 ? 20.948  -13.287 15.366 1.00 23.62 ? 43  LYS B O   1 
ATOM   1084 C CB  . LYS B 1 43 ? 22.109  -15.415 17.421 1.00 24.81 ? 43  LYS B CB  1 
ATOM   1085 N N   . PRO B 1 44 ? 21.120  -15.244 14.264 1.00 23.96 ? 44  PRO B N   1 
ATOM   1086 C CA  . PRO B 1 44 ? 20.023  -14.956 13.338 1.00 23.62 ? 44  PRO B CA  1 
ATOM   1087 C C   . PRO B 1 44 ? 18.709  -14.907 14.097 1.00 20.84 ? 44  PRO B C   1 
ATOM   1088 O O   . PRO B 1 44 ? 18.526  -15.624 15.083 1.00 20.36 ? 44  PRO B O   1 
ATOM   1089 C CB  . PRO B 1 44 ? 20.061  -16.137 12.367 1.00 23.14 ? 44  PRO B CB  1 
ATOM   1090 C CG  . PRO B 1 44 ? 21.476  -16.614 12.442 1.00 25.38 ? 44  PRO B CG  1 
ATOM   1091 C CD  . PRO B 1 44 ? 21.779  -16.512 13.909 1.00 25.43 ? 44  PRO B CD  1 
ATOM   1092 N N   . LYS B 1 45 ? 17.792  -14.071 13.630 1.00 20.62 ? 45  LYS B N   1 
ATOM   1093 C CA  . LYS B 1 45 ? 16.493  -13.947 14.276 1.00 20.09 ? 45  LYS B CA  1 
ATOM   1094 C C   . LYS B 1 45 ? 15.479  -13.413 13.274 1.00 20.23 ? 45  LYS B C   1 
ATOM   1095 O O   . LYS B 1 45 ? 15.839  -12.709 12.331 1.00 20.24 ? 45  LYS B O   1 
ATOM   1096 C CB  . LYS B 1 45 ? 16.595  -12.987 15.466 1.00 20.76 ? 45  LYS B CB  1 
ATOM   1097 C CG  . LYS B 1 45 ? 15.364  -12.914 16.355 1.00 23.58 ? 45  LYS B CG  1 
ATOM   1098 C CD  . LYS B 1 45 ? 15.501  -11.743 17.320 1.00 24.91 ? 45  LYS B CD  1 
ATOM   1099 C CE  . LYS B 1 45 ? 14.261  -11.560 18.178 1.00 27.63 ? 45  LYS B CE  1 
ATOM   1100 N NZ  . LYS B 1 45 ? 14.123  -12.634 19.190 1.00 30.52 ? 45  LYS B NZ  1 
ATOM   1101 N N   . MET B 1 46 ? 14.212  -13.761 13.485 1.00 18.79 ? 46  MET B N   1 
ATOM   1102 C CA  . MET B 1 46 ? 13.126  -13.304 12.625 1.00 20.62 ? 46  MET B CA  1 
ATOM   1103 C C   . MET B 1 46 ? 12.134  -12.530 13.485 1.00 18.40 ? 46  MET B C   1 
ATOM   1104 O O   . MET B 1 46 ? 11.708  -13.019 14.529 1.00 17.83 ? 46  MET B O   1 
ATOM   1105 C CB  . MET B 1 46 ? 12.410  -14.502 11.992 1.00 22.58 ? 46  MET B CB  1 
ATOM   1106 C CG  . MET B 1 46 ? 13.233  -15.273 10.985 1.00 29.43 ? 46  MET B CG  1 
ATOM   1107 S SD  . MET B 1 46 ? 13.258  -14.447 9.405  1.00 36.94 ? 46  MET B SD  1 
ATOM   1108 C CE  . MET B 1 46 ? 11.824  -15.205 8.621  1.00 33.23 ? 46  MET B CE  1 
ATOM   1109 N N   . ILE B 1 47 ? 11.774  -11.325 13.058 1.00 18.42 ? 47  ILE B N   1 
ATOM   1110 C CA  . ILE B 1 47 ? 10.812  -10.520 13.806 1.00 18.15 ? 47  ILE B CA  1 
ATOM   1111 C C   . ILE B 1 47 ? 9.644   -10.140 12.902 1.00 18.75 ? 47  ILE B C   1 
ATOM   1112 O O   . ILE B 1 47 ? 9.822   -9.903  11.704 1.00 15.37 ? 47  ILE B O   1 
ATOM   1113 C CB  . ILE B 1 47 ? 11.459  -9.241  14.381 1.00 20.09 ? 47  ILE B CB  1 
ATOM   1114 C CG1 . ILE B 1 47 ? 12.122  -8.427  13.267 1.00 20.48 ? 47  ILE B CG1 1 
ATOM   1115 C CG2 . ILE B 1 47 ? 12.463  -9.621  15.445 1.00 18.98 ? 47  ILE B CG2 1 
ATOM   1116 C CD1 . ILE B 1 47 ? 12.639  -7.069  13.724 1.00 21.87 ? 47  ILE B CD1 1 
ATOM   1117 N N   . GLY B 1 48 ? 8.442   -10.092 13.470 1.00 17.91 ? 48  GLY B N   1 
ATOM   1118 C CA  . GLY B 1 48 ? 7.288   -9.772  12.652 1.00 18.12 ? 48  GLY B CA  1 
ATOM   1119 C C   . GLY B 1 48 ? 6.356   -8.709  13.197 1.00 18.53 ? 48  GLY B C   1 
ATOM   1120 O O   . GLY B 1 48 ? 6.353   -8.404  14.390 1.00 18.83 ? 48  GLY B O   1 
ATOM   1121 N N   . GLY B 1 49 ? 5.556   -8.157  12.294 1.00 18.85 ? 49  GLY B N   1 
ATOM   1122 C CA  . GLY B 1 49 ? 4.595   -7.126  12.636 1.00 16.66 ? 49  GLY B CA  1 
ATOM   1123 C C   . GLY B 1 49 ? 3.753   -6.859  11.403 1.00 18.17 ? 49  GLY B C   1 
ATOM   1124 O O   . GLY B 1 49 ? 3.589   -7.747  10.563 1.00 17.97 ? 49  GLY B O   1 
ATOM   1125 N N   . ILE B 1 50 ? 3.220   -5.649  11.276 1.00 16.53 ? 50  ILE B N   1 
ATOM   1126 C CA  . ILE B 1 50 ? 2.410   -5.327  10.111 1.00 16.82 ? 50  ILE B CA  1 
ATOM   1127 C C   . ILE B 1 50 ? 3.259   -5.518  8.855  1.00 16.62 ? 50  ILE B C   1 
ATOM   1128 O O   . ILE B 1 50 ? 4.374   -5.006  8.769  1.00 17.14 ? 50  ILE B O   1 
ATOM   1129 C CB  . ILE B 1 50 ? 1.889   -3.873  10.181 1.00 17.94 ? 50  ILE B CB  1 
ATOM   1130 C CG1 . ILE B 1 50 ? 0.844   -3.761  11.300 1.00 19.86 ? 50  ILE B CG1 1 
ATOM   1131 C CG2 . ILE B 1 50 ? 1.309   -3.454  8.834  1.00 17.07 ? 50  ILE B CG2 1 
ATOM   1132 C CD1 . ILE B 1 50 ? 0.329   -2.354  11.542 1.00 19.57 ? 50  ILE B CD1 1 
ATOM   1133 N N   . GLY B 1 51 ? 2.734   -6.276  7.894  1.00 16.31 ? 51  GLY B N   1 
ATOM   1134 C CA  . GLY B 1 51 ? 3.467   -6.517  6.668  1.00 17.18 ? 51  GLY B CA  1 
ATOM   1135 C C   . GLY B 1 51 ? 4.166   -7.865  6.632  1.00 20.10 ? 51  GLY B C   1 
ATOM   1136 O O   . GLY B 1 51 ? 4.496   -8.366  5.560  1.00 20.55 ? 51  GLY B O   1 
ATOM   1137 N N   . GLY B 1 52 ? 4.396   -8.455  7.800  1.00 19.36 ? 52  GLY B N   1 
ATOM   1138 C CA  . GLY B 1 52 ? 5.050   -9.751  7.846  1.00 19.86 ? 52  GLY B CA  1 
ATOM   1139 C C   . GLY B 1 52 ? 6.343   -9.760  8.637  1.00 19.00 ? 52  GLY B C   1 
ATOM   1140 O O   . GLY B 1 52 ? 6.534   -8.937  9.538  1.00 15.54 ? 52  GLY B O   1 
ATOM   1141 N N   . PHE B 1 53 ? 7.240   -10.679 8.283  1.00 18.65 ? 53  PHE B N   1 
ATOM   1142 C CA  . PHE B 1 53 ? 8.522   -10.824 8.980  1.00 18.63 ? 53  PHE B CA  1 
ATOM   1143 C C   . PHE B 1 53 ? 9.763   -10.431 8.182  1.00 18.74 ? 53  PHE B C   1 
ATOM   1144 O O   . PHE B 1 53 ? 9.791   -10.536 6.955  1.00 18.68 ? 53  PHE B O   1 
ATOM   1145 C CB  . PHE B 1 53 ? 8.721   -12.275 9.435  1.00 19.46 ? 53  PHE B CB  1 
ATOM   1146 C CG  . PHE B 1 53 ? 7.832   -12.695 10.568 1.00 18.75 ? 53  PHE B CG  1 
ATOM   1147 C CD1 . PHE B 1 53 ? 6.465   -12.881 10.373 1.00 17.85 ? 53  PHE B CD1 1 
ATOM   1148 C CD2 . PHE B 1 53 ? 8.368   -12.921 11.833 1.00 18.65 ? 53  PHE B CD2 1 
ATOM   1149 C CE1 . PHE B 1 53 ? 5.648   -13.287 11.418 1.00 16.89 ? 53  PHE B CE1 1 
ATOM   1150 C CE2 . PHE B 1 53 ? 7.560   -13.329 12.887 1.00 19.52 ? 53  PHE B CE2 1 
ATOM   1151 C CZ  . PHE B 1 53 ? 6.195   -13.512 12.678 1.00 18.57 ? 53  PHE B CZ  1 
ATOM   1152 N N   . ILE B 1 54 ? 10.794  -9.990  8.899  1.00 18.94 ? 54  ILE B N   1 
ATOM   1153 C CA  . ILE B 1 54 ? 12.068  -9.636  8.282  1.00 20.03 ? 54  ILE B CA  1 
ATOM   1154 C C   . ILE B 1 54 ? 13.193  -10.338 9.044  1.00 19.42 ? 54  ILE B C   1 
ATOM   1155 O O   . ILE B 1 54 ? 13.041  -10.680 10.216 1.00 19.82 ? 54  ILE B O   1 
ATOM   1156 C CB  . ILE B 1 54 ? 12.338  -8.113  8.301  1.00 18.72 ? 54  ILE B CB  1 
ATOM   1157 C CG1 . ILE B 1 54 ? 12.358  -7.593  9.739  1.00 19.73 ? 54  ILE B CG1 1 
ATOM   1158 C CG2 . ILE B 1 54 ? 11.293  -7.391  7.473  1.00 20.80 ? 54  ILE B CG2 1 
ATOM   1159 C CD1 . ILE B 1 54 ? 12.906  -6.177  9.856  1.00 21.21 ? 54  ILE B CD1 1 
ATOM   1160 N N   . LYS B 1 55 ? 14.320  -10.552 8.374  1.00 19.49 ? 55  LYS B N   1 
ATOM   1161 C CA  . LYS B 1 55 ? 15.462  -11.213 8.992  1.00 19.33 ? 55  LYS B CA  1 
ATOM   1162 C C   . LYS B 1 55 ? 16.420  -10.170 9.561  1.00 19.40 ? 55  LYS B C   1 
ATOM   1163 O O   . LYS B 1 55 ? 16.734  -9.176  8.902  1.00 17.58 ? 55  LYS B O   1 
ATOM   1164 C CB  . LYS B 1 55 ? 16.180  -12.071 7.954  1.00 21.33 ? 55  LYS B CB  1 
ATOM   1165 C CG  . LYS B 1 55 ? 15.224  -12.910 7.127  1.00 26.07 ? 55  LYS B CG  1 
ATOM   1166 C CD  . LYS B 1 55 ? 15.916  -13.598 5.971  1.00 28.73 ? 55  LYS B CD  1 
ATOM   1167 C CE  . LYS B 1 55 ? 14.901  -14.353 5.128  1.00 30.35 ? 55  LYS B CE  1 
ATOM   1168 N NZ  . LYS B 1 55 ? 15.555  -15.021 3.986  1.00 34.79 ? 55  LYS B NZ  1 
ATOM   1169 N N   . VAL B 1 56 ? 16.879  -10.399 10.787 1.00 17.85 ? 56  VAL B N   1 
ATOM   1170 C CA  . VAL B 1 56 ? 17.792  -9.470  11.444 1.00 17.49 ? 56  VAL B CA  1 
ATOM   1171 C C   . VAL B 1 56 ? 18.892  -10.191 12.202 1.00 17.73 ? 56  VAL B C   1 
ATOM   1172 O O   . VAL B 1 56 ? 18.811  -11.394 12.436 1.00 16.49 ? 56  VAL B O   1 
ATOM   1173 C CB  . VAL B 1 56 ? 17.047  -8.561  12.454 1.00 17.56 ? 56  VAL B CB  1 
ATOM   1174 C CG1 . VAL B 1 56 ? 16.031  -7.707  11.730 1.00 17.07 ? 56  VAL B CG1 1 
ATOM   1175 C CG2 . VAL B 1 56 ? 16.363  -9.409  13.527 1.00 16.08 ? 56  VAL B CG2 1 
ATOM   1176 N N   . ARG B 1 57 ? 19.921  -9.433  12.576 1.00 16.48 ? 57  ARG B N   1 
ATOM   1177 C CA  . ARG B 1 57 ? 21.050  -9.951  13.339 1.00 19.14 ? 57  ARG B CA  1 
ATOM   1178 C C   . ARG B 1 57 ? 20.912  -9.485  14.780 1.00 18.72 ? 57  ARG B C   1 
ATOM   1179 O O   . ARG B 1 57 ? 20.745  -8.296  15.042 1.00 17.05 ? 57  ARG B O   1 
ATOM   1180 C CB  . ARG B 1 57 ? 22.365  -9.434  12.753 1.00 20.26 ? 57  ARG B CB  1 
ATOM   1181 C CG  . ARG B 1 57 ? 22.858  -10.243 11.569 1.00 24.59 ? 57  ARG B CG  1 
ATOM   1182 C CD  . ARG B 1 57 ? 23.282  -9.364  10.417 1.00 27.20 ? 57  ARG B CD  1 
ATOM   1183 N NE  . ARG B 1 57 ? 24.056  -8.201  10.835 1.00 26.01 ? 57  ARG B NE  1 
ATOM   1184 C CZ  . ARG B 1 57 ? 24.092  -7.071  10.137 1.00 26.31 ? 57  ARG B CZ  1 
ATOM   1185 N NH1 . ARG B 1 57 ? 23.399  -6.981  9.011  1.00 27.46 ? 57  ARG B NH1 1 
ATOM   1186 N NH2 . ARG B 1 57 ? 24.805  -6.036  10.556 1.00 25.69 ? 57  ARG B NH2 1 
ATOM   1187 N N   . GLN B 1 58 ? 20.978  -10.429 15.710 1.00 18.54 ? 58  GLN B N   1 
ATOM   1188 C CA  . GLN B 1 58 ? 20.840  -10.115 17.122 1.00 20.43 ? 58  GLN B CA  1 
ATOM   1189 C C   . GLN B 1 58 ? 22.171  -9.925  17.831 1.00 20.72 ? 58  GLN B C   1 
ATOM   1190 O O   . GLN B 1 58 ? 22.979  -10.848 17.890 1.00 20.85 ? 58  GLN B O   1 
ATOM   1191 C CB  . GLN B 1 58 ? 20.075  -11.227 17.825 1.00 20.06 ? 58  GLN B CB  1 
ATOM   1192 C CG  . GLN B 1 58 ? 19.939  -11.035 19.322 1.00 20.49 ? 58  GLN B CG  1 
ATOM   1193 C CD  . GLN B 1 58 ? 19.226  -12.194 19.975 1.00 22.72 ? 58  GLN B CD  1 
ATOM   1194 O OE1 . GLN B 1 58 ? 18.302  -12.768 19.397 1.00 23.60 ? 58  GLN B OE1 1 
ATOM   1195 N NE2 . GLN B 1 58 ? 19.638  -12.541 21.192 1.00 24.23 ? 58  GLN B NE2 1 
ATOM   1196 N N   . TYR B 1 59 ? 22.388  -8.726  18.366 1.00 20.55 ? 59  TYR B N   1 
ATOM   1197 C CA  . TYR B 1 59 ? 23.607  -8.417  19.111 1.00 22.07 ? 59  TYR B CA  1 
ATOM   1198 C C   . TYR B 1 59 ? 23.229  -8.225  20.580 1.00 21.81 ? 59  TYR B C   1 
ATOM   1199 O O   . TYR B 1 59 ? 22.247  -7.551  20.893 1.00 21.43 ? 59  TYR B O   1 
ATOM   1200 C CB  . TYR B 1 59 ? 24.279  -7.146  18.577 1.00 22.26 ? 59  TYR B CB  1 
ATOM   1201 C CG  . TYR B 1 59 ? 24.831  -7.274  17.173 1.00 23.25 ? 59  TYR B CG  1 
ATOM   1202 C CD1 . TYR B 1 59 ? 23.994  -7.182  16.061 1.00 24.42 ? 59  TYR B CD1 1 
ATOM   1203 C CD2 . TYR B 1 59 ? 26.193  -7.497  16.957 1.00 24.90 ? 59  TYR B CD2 1 
ATOM   1204 C CE1 . TYR B 1 59 ? 24.496  -7.306  14.769 1.00 25.07 ? 59  TYR B CE1 1 
ATOM   1205 C CE2 . TYR B 1 59 ? 26.709  -7.624  15.667 1.00 22.82 ? 59  TYR B CE2 1 
ATOM   1206 C CZ  . TYR B 1 59 ? 25.856  -7.526  14.580 1.00 25.84 ? 59  TYR B CZ  1 
ATOM   1207 O OH  . TYR B 1 59 ? 26.358  -7.641  13.306 1.00 25.34 ? 59  TYR B OH  1 
ATOM   1208 N N   . ASP B 1 60 ? 24.008  -8.821  21.477 1.00 22.53 ? 60  ASP B N   1 
ATOM   1209 C CA  . ASP B 1 60 ? 23.737  -8.732  22.906 1.00 22.36 ? 60  ASP B CA  1 
ATOM   1210 C C   . ASP B 1 60 ? 24.709  -7.837  23.668 1.00 22.70 ? 60  ASP B C   1 
ATOM   1211 O O   . ASP B 1 60 ? 25.830  -7.597  23.224 1.00 21.67 ? 60  ASP B O   1 
ATOM   1212 C CB  . ASP B 1 60 ? 23.763  -10.131 23.519 1.00 24.56 ? 60  ASP B CB  1 
ATOM   1213 C CG  . ASP B 1 60 ? 22.650  -11.021 22.993 1.00 26.31 ? 60  ASP B CG  1 
ATOM   1214 O OD1 . ASP B 1 60 ? 22.847  -12.251 22.958 1.00 26.49 ? 60  ASP B OD1 1 
ATOM   1215 O OD2 . ASP B 1 60 ? 21.576  -10.495 22.625 1.00 26.76 ? 60  ASP B OD2 1 
ATOM   1216 N N   . GLN B 1 61 ? 24.261  -7.350  24.821 1.00 23.62 ? 61  GLN B N   1 
ATOM   1217 C CA  . GLN B 1 61 ? 25.078  -6.503  25.682 1.00 25.50 ? 61  GLN B CA  1 
ATOM   1218 C C   . GLN B 1 61 ? 25.685  -5.312  24.957 1.00 23.95 ? 61  GLN B C   1 
ATOM   1219 O O   . GLN B 1 61 ? 26.867  -5.023  25.113 1.00 22.90 ? 61  GLN B O   1 
ATOM   1220 C CB  . GLN B 1 61 ? 26.195  -7.338  26.315 1.00 28.93 ? 61  GLN B CB  1 
ATOM   1221 C CG  . GLN B 1 61 ? 25.691  -8.438  27.222 1.00 34.67 ? 61  GLN B CG  1 
ATOM   1222 C CD  . GLN B 1 61 ? 24.876  -7.895  28.376 1.00 38.82 ? 61  GLN B CD  1 
ATOM   1223 O OE1 . GLN B 1 61 ? 25.379  -7.131  29.198 1.00 42.12 ? 61  GLN B OE1 1 
ATOM   1224 N NE2 . GLN B 1 61 ? 23.608  -8.284  28.442 1.00 41.50 ? 61  GLN B NE2 1 
ATOM   1225 N N   . ILE B 1 62 ? 24.872  -4.618  24.168 1.00 22.36 ? 62  ILE B N   1 
ATOM   1226 C CA  . ILE B 1 62 ? 25.347  -3.459  23.429 1.00 21.75 ? 62  ILE B CA  1 
ATOM   1227 C C   . ILE B 1 62 ? 24.976  -2.172  24.158 1.00 22.47 ? 62  ILE B C   1 
ATOM   1228 O O   . ILE B 1 62 ? 23.810  -1.950  24.476 1.00 22.85 ? 62  ILE B O   1 
ATOM   1229 C CB  . ILE B 1 62 ? 24.725  -3.400  22.018 1.00 19.76 ? 62  ILE B CB  1 
ATOM   1230 C CG1 . ILE B 1 62 ? 25.027  -4.690  21.249 1.00 19.73 ? 62  ILE B CG1 1 
ATOM   1231 C CG2 . ILE B 1 62 ? 25.261  -2.194  21.271 1.00 20.61 ? 62  ILE B CG2 1 
ATOM   1232 C CD1 . ILE B 1 62 ? 26.502  -4.922  20.966 1.00 16.56 ? 62  ILE B CD1 1 
ATOM   1233 N N   . PRO B 1 63 ? 25.968  -1.314  24.447 1.00 23.80 ? 63  PRO B N   1 
ATOM   1234 C CA  . PRO B 1 63 ? 25.689  -0.051  25.139 1.00 23.57 ? 63  PRO B CA  1 
ATOM   1235 C C   . PRO B 1 63 ? 24.953  0.894   24.198 1.00 25.15 ? 63  PRO B C   1 
ATOM   1236 O O   . PRO B 1 63 ? 25.376  1.097   23.059 1.00 24.59 ? 63  PRO B O   1 
ATOM   1237 C CB  . PRO B 1 63 ? 27.079  0.481   25.482 1.00 24.09 ? 63  PRO B CB  1 
ATOM   1238 C CG  . PRO B 1 63 ? 27.934  -0.745  25.505 1.00 23.33 ? 63  PRO B CG  1 
ATOM   1239 C CD  . PRO B 1 63 ? 27.418  -1.541  24.344 1.00 22.42 ? 63  PRO B CD  1 
ATOM   1240 N N   . VAL B 1 64 ? 23.853  1.463   24.675 1.00 25.35 ? 64  VAL B N   1 
ATOM   1241 C CA  . VAL B 1 64 ? 23.056  2.397   23.884 1.00 25.72 ? 64  VAL B CA  1 
ATOM   1242 C C   . VAL B 1 64 ? 22.660  3.567   24.778 1.00 26.56 ? 64  VAL B C   1 
ATOM   1243 O O   . VAL B 1 64 ? 22.075  3.366   25.840 1.00 27.11 ? 64  VAL B O   1 
ATOM   1244 C CB  . VAL B 1 64 ? 21.754  1.734   23.349 1.00 26.70 ? 64  VAL B CB  1 
ATOM   1245 C CG1 . VAL B 1 64 ? 20.871  2.783   22.658 1.00 26.64 ? 64  VAL B CG1 1 
ATOM   1246 C CG2 . VAL B 1 64 ? 22.091  0.619   22.375 1.00 25.03 ? 64  VAL B CG2 1 
ATOM   1247 N N   . GLU B 1 65 ? 22.986  4.786   24.359 1.00 25.29 ? 65  GLU B N   1 
ATOM   1248 C CA  . GLU B 1 65 ? 22.619  5.952   25.147 1.00 26.09 ? 65  GLU B CA  1 
ATOM   1249 C C   . GLU B 1 65 ? 21.459  6.648   24.447 1.00 25.60 ? 65  GLU B C   1 
ATOM   1250 O O   . GLU B 1 65 ? 21.532  6.945   23.256 1.00 25.85 ? 65  GLU B O   1 
ATOM   1251 C CB  . GLU B 1 65 ? 23.806  6.901   25.289 1.00 27.76 ? 65  GLU B CB  1 
ATOM   1252 C CG  . GLU B 1 65 ? 23.670  7.861   26.454 1.00 33.37 ? 65  GLU B CG  1 
ATOM   1253 C CD  . GLU B 1 65 ? 24.838  8.817   26.554 1.00 35.93 ? 65  GLU B CD  1 
ATOM   1254 O OE1 . GLU B 1 65 ? 25.010  9.636   25.628 1.00 38.92 ? 65  GLU B OE1 1 
ATOM   1255 O OE2 . GLU B 1 65 ? 25.581  8.748   27.556 1.00 37.32 ? 65  GLU B OE2 1 
ATOM   1256 N N   . ILE B 1 66 ? 20.387  6.889   25.194 1.00 24.78 ? 66  ILE B N   1 
ATOM   1257 C CA  . ILE B 1 66 ? 19.184  7.523   24.661 1.00 24.92 ? 66  ILE B CA  1 
ATOM   1258 C C   . ILE B 1 66 ? 18.966  8.874   25.330 1.00 25.14 ? 66  ILE B C   1 
ATOM   1259 O O   . ILE B 1 66 ? 18.589  8.943   26.497 1.00 23.45 ? 66  ILE B O   1 
ATOM   1260 C CB  . ILE B 1 66 ? 17.956  6.627   24.917 1.00 24.63 ? 66  ILE B CB  1 
ATOM   1261 C CG1 . ILE B 1 66 ? 18.206  5.236   24.330 1.00 25.27 ? 66  ILE B CG1 1 
ATOM   1262 C CG2 . ILE B 1 66 ? 16.709  7.253   24.307 1.00 25.09 ? 66  ILE B CG2 1 
ATOM   1263 C CD1 . ILE B 1 66 ? 17.339  4.154   24.921 1.00 27.34 ? 66  ILE B CD1 1 
ATOM   1264 N N   . CYS B 1 67 ? 19.204  9.948   24.585 1.00 28.68 ? 67  CYS B N   1 
ATOM   1265 C CA  . CYS B 1 67 ? 19.043  11.296  25.119 1.00 30.75 ? 67  CYS B CA  1 
ATOM   1266 C C   . CYS B 1 67 ? 19.770  11.461  26.442 1.00 30.83 ? 67  CYS B C   1 
ATOM   1267 O O   . CYS B 1 67 ? 19.208  11.981  27.408 1.00 31.25 ? 67  CYS B O   1 
ATOM   1268 C CB  . CYS B 1 67 ? 17.565  11.622  25.314 1.00 34.18 ? 67  CYS B CB  1 
ATOM   1269 S SG  . CYS B 1 67 ? 16.672  11.822  23.781 1.00 40.90 ? 67  CYS B SG  1 
ATOM   1270 N N   . GLY B 1 68 ? 21.017  11.002  26.484 1.00 30.11 ? 68  GLY B N   1 
ATOM   1271 C CA  . GLY B 1 68 ? 21.809  11.124  27.693 1.00 29.05 ? 68  GLY B CA  1 
ATOM   1272 C C   . GLY B 1 68 ? 21.539  10.071  28.748 1.00 28.07 ? 68  GLY B C   1 
ATOM   1273 O O   . GLY B 1 68 ? 22.175  10.072  29.797 1.00 28.73 ? 68  GLY B O   1 
ATOM   1274 N N   . HIS B 1 69 ? 20.588  9.182   28.486 1.00 25.16 ? 69  HIS B N   1 
ATOM   1275 C CA  . HIS B 1 69 ? 20.269  8.122   29.432 1.00 23.88 ? 69  HIS B CA  1 
ATOM   1276 C C   . HIS B 1 69 ? 20.913  6.829   28.952 1.00 22.92 ? 69  HIS B C   1 
ATOM   1277 O O   . HIS B 1 69 ? 20.612  6.339   27.865 1.00 22.50 ? 69  HIS B O   1 
ATOM   1278 C CB  . HIS B 1 69 ? 18.753  7.955   29.555 1.00 24.48 ? 69  HIS B CB  1 
ATOM   1279 C CG  . HIS B 1 69 ? 18.080  9.090   30.267 1.00 23.77 ? 69  HIS B CG  1 
ATOM   1280 N ND1 . HIS B 1 69 ? 17.696  9.016   31.587 1.00 24.63 ? 69  HIS B ND1 1 
ATOM   1281 C CD2 . HIS B 1 69 ? 17.770  10.342  29.852 1.00 24.70 ? 69  HIS B CD2 1 
ATOM   1282 C CE1 . HIS B 1 69 ? 17.178  10.176  31.958 1.00 24.09 ? 69  HIS B CE1 1 
ATOM   1283 N NE2 . HIS B 1 69 ? 17.211  10.996  30.924 1.00 23.99 ? 69  HIS B NE2 1 
ATOM   1284 N N   . LYS B 1 70 ? 21.813  6.292   29.768 1.00 21.47 ? 70  LYS B N   1 
ATOM   1285 C CA  . LYS B 1 70 ? 22.530  5.068   29.432 1.00 22.64 ? 70  LYS B CA  1 
ATOM   1286 C C   . LYS B 1 70 ? 21.704  3.798   29.574 1.00 22.06 ? 70  LYS B C   1 
ATOM   1287 O O   . LYS B 1 70 ? 20.918  3.646   30.508 1.00 23.14 ? 70  LYS B O   1 
ATOM   1288 C CB  . LYS B 1 70 ? 23.784  4.934   30.300 1.00 23.76 ? 70  LYS B CB  1 
ATOM   1289 C CG  . LYS B 1 70 ? 24.891  5.919   29.970 1.00 26.56 ? 70  LYS B CG  1 
ATOM   1290 C CD  . LYS B 1 70 ? 26.045  5.761   30.952 1.00 29.23 ? 70  LYS B CD  1 
ATOM   1291 C CE  . LYS B 1 70 ? 27.337  6.300   30.370 1.00 31.28 ? 70  LYS B CE  1 
ATOM   1292 N NZ  . LYS B 1 70 ? 27.209  7.704   29.917 1.00 34.99 ? 70  LYS B NZ  1 
ATOM   1293 N N   . ALA B 1 71 ? 21.908  2.883   28.637 1.00 21.11 ? 71  ALA B N   1 
ATOM   1294 C CA  . ALA B 1 71 ? 21.218  1.607   28.646 1.00 20.79 ? 71  ALA B CA  1 
ATOM   1295 C C   . ALA B 1 71 ? 22.166  0.601   28.014 1.00 20.72 ? 71  ALA B C   1 
ATOM   1296 O O   . ALA B 1 71 ? 23.180  0.980   27.428 1.00 21.01 ? 71  ALA B O   1 
ATOM   1297 C CB  . ALA B 1 71 ? 19.922  1.696   27.844 1.00 21.91 ? 71  ALA B CB  1 
ATOM   1298 N N   . ILE B 1 72 ? 21.847  -0.678  28.152 1.00 20.13 ? 72  ILE B N   1 
ATOM   1299 C CA  . ILE B 1 72 ? 22.668  -1.726  27.569 1.00 21.15 ? 72  ILE B CA  1 
ATOM   1300 C C   . ILE B 1 72 ? 21.838  -2.995  27.470 1.00 20.10 ? 72  ILE B C   1 
ATOM   1301 O O   . ILE B 1 72 ? 21.257  -3.455  28.452 1.00 20.54 ? 72  ILE B O   1 
ATOM   1302 C CB  . ILE B 1 72 ? 23.961  -1.976  28.403 1.00 20.64 ? 72  ILE B CB  1 
ATOM   1303 C CG1 . ILE B 1 72 ? 24.787  -3.096  27.757 1.00 22.02 ? 72  ILE B CG1 1 
ATOM   1304 C CG2 . ILE B 1 72 ? 23.605  -2.300  29.850 1.00 23.10 ? 72  ILE B CG2 1 
ATOM   1305 C CD1 . ILE B 1 72 ? 26.124  -3.362  28.448 1.00 22.38 ? 72  ILE B CD1 1 
ATOM   1306 N N   . GLY B 1 73 ? 21.761  -3.539  26.263 1.00 19.90 ? 73  GLY B N   1 
ATOM   1307 C CA  . GLY B 1 73 ? 20.985  -4.744  26.061 1.00 21.05 ? 73  GLY B CA  1 
ATOM   1308 C C   . GLY B 1 73 ? 21.011  -5.233  24.631 1.00 19.54 ? 73  GLY B C   1 
ATOM   1309 O O   . GLY B 1 73 ? 21.881  -4.864  23.841 1.00 18.79 ? 73  GLY B O   1 
ATOM   1310 N N   . THR B 1 74 ? 20.031  -6.054  24.286 1.00 19.53 ? 74  THR B N   1 
ATOM   1311 C CA  . THR B 1 74 ? 19.971  -6.613  22.950 1.00 20.33 ? 74  THR B CA  1 
ATOM   1312 C C   . THR B 1 74 ? 19.491  -5.649  21.881 1.00 19.46 ? 74  THR B C   1 
ATOM   1313 O O   . THR B 1 74 ? 18.506  -4.936  22.050 1.00 19.49 ? 74  THR B O   1 
ATOM   1314 C CB  . THR B 1 74 ? 19.088  -7.867  22.927 1.00 21.15 ? 74  THR B CB  1 
ATOM   1315 O OG1 . THR B 1 74 ? 19.630  -8.832  23.835 1.00 22.94 ? 74  THR B OG1 1 
ATOM   1316 C CG2 . THR B 1 74 ? 19.038  -8.462  21.526 1.00 21.35 ? 74  THR B CG2 1 
ATOM   1317 N N   . VAL B 1 75 ? 20.211  -5.635  20.768 1.00 20.06 ? 75  VAL B N   1 
ATOM   1318 C CA  . VAL B 1 75 ? 19.860  -4.782  19.650 1.00 19.77 ? 75  VAL B CA  1 
ATOM   1319 C C   . VAL B 1 75 ? 19.821  -5.644  18.399 1.00 20.38 ? 75  VAL B C   1 
ATOM   1320 O O   . VAL B 1 75 ? 20.707  -6.469  18.183 1.00 20.27 ? 75  VAL B O   1 
ATOM   1321 C CB  . VAL B 1 75 ? 20.889  -3.649  19.474 1.00 21.73 ? 75  VAL B CB  1 
ATOM   1322 C CG1 . VAL B 1 75 ? 20.575  -2.845  18.222 1.00 21.60 ? 75  VAL B CG1 1 
ATOM   1323 C CG2 . VAL B 1 75 ? 20.861  -2.742  20.703 1.00 21.38 ? 75  VAL B CG2 1 
ATOM   1324 N N   . LEU B 1 76 ? 18.773  -5.470  17.600 1.00 19.39 ? 76  LEU B N   1 
ATOM   1325 C CA  . LEU B 1 76 ? 18.617  -6.219  16.363 1.00 19.56 ? 76  LEU B CA  1 
ATOM   1326 C C   . LEU B 1 76 ? 18.957  -5.294  15.198 1.00 19.21 ? 76  LEU B C   1 
ATOM   1327 O O   . LEU B 1 76 ? 18.526  -4.138  15.162 1.00 19.84 ? 76  LEU B O   1 
ATOM   1328 C CB  . LEU B 1 76 ? 17.177  -6.734  16.230 1.00 20.47 ? 76  LEU B CB  1 
ATOM   1329 C CG  . LEU B 1 76 ? 16.601  -7.454  17.459 1.00 19.09 ? 76  LEU B CG  1 
ATOM   1330 C CD1 . LEU B 1 76 ? 15.174  -7.923  17.170 1.00 17.37 ? 76  LEU B CD1 1 
ATOM   1331 C CD2 . LEU B 1 76 ? 17.495  -8.636  17.832 1.00 19.16 ? 76  LEU B CD2 1 
ATOM   1332 N N   . VAL B 1 77 ? 19.749  -5.793  14.257 1.00 18.99 ? 77  VAL B N   1 
ATOM   1333 C CA  . VAL B 1 77 ? 20.134  -4.998  13.099 1.00 17.56 ? 77  VAL B CA  1 
ATOM   1334 C C   . VAL B 1 77 ? 19.662  -5.673  11.813 1.00 18.25 ? 77  VAL B C   1 
ATOM   1335 O O   . VAL B 1 77 ? 19.918  -6.854  11.585 1.00 17.43 ? 77  VAL B O   1 
ATOM   1336 C CB  . VAL B 1 77 ? 21.667  -4.800  13.047 1.00 18.60 ? 77  VAL B CB  1 
ATOM   1337 C CG1 . VAL B 1 77 ? 22.042  -3.945  11.853 1.00 20.55 ? 77  VAL B CG1 1 
ATOM   1338 C CG2 . VAL B 1 77 ? 22.145  -4.143  14.325 1.00 16.11 ? 77  VAL B CG2 1 
ATOM   1339 N N   . GLY B 1 78 ? 18.976  -4.912  10.971 1.00 17.99 ? 78  GLY B N   1 
ATOM   1340 C CA  . GLY B 1 78 ? 18.478  -5.468  9.732  1.00 20.29 ? 78  GLY B CA  1 
ATOM   1341 C C   . GLY B 1 78 ? 17.782  -4.439  8.866  1.00 20.43 ? 78  GLY B C   1 
ATOM   1342 O O   . GLY B 1 78 ? 17.836  -3.247  9.156  1.00 20.17 ? 78  GLY B O   1 
ATOM   1343 N N   . PRO B 1 79 ? 17.109  -4.878  7.792  1.00 21.49 ? 79  PRO B N   1 
ATOM   1344 C CA  . PRO B 1 79 ? 16.397  -3.996  6.868  1.00 22.56 ? 79  PRO B CA  1 
ATOM   1345 C C   . PRO B 1 79 ? 15.091  -3.395  7.392  1.00 24.28 ? 79  PRO B C   1 
ATOM   1346 O O   . PRO B 1 79 ? 14.055  -3.467  6.733  1.00 23.55 ? 79  PRO B O   1 
ATOM   1347 C CB  . PRO B 1 79 ? 16.185  -4.887  5.646  1.00 21.63 ? 79  PRO B CB  1 
ATOM   1348 C CG  . PRO B 1 79 ? 15.993  -6.236  6.259  1.00 21.42 ? 79  PRO B CG  1 
ATOM   1349 C CD  . PRO B 1 79 ? 17.088  -6.271  7.309  1.00 21.00 ? 79  PRO B CD  1 
ATOM   1350 N N   . THR B 1 80 ? 15.135  -2.802  8.581  1.00 24.02 ? 80  THR B N   1 
ATOM   1351 C CA  . THR B 1 80 ? 13.938  -2.174  9.122  1.00 23.31 ? 80  THR B CA  1 
ATOM   1352 C C   . THR B 1 80 ? 13.766  -0.812  8.461  1.00 22.97 ? 80  THR B C   1 
ATOM   1353 O O   . THR B 1 80 ? 14.747  -0.126  8.178  1.00 24.47 ? 80  THR B O   1 
ATOM   1354 C CB  . THR B 1 80 ? 14.030  -1.964  10.651 1.00 23.17 ? 80  THR B CB  1 
ATOM   1355 O OG1 . THR B 1 80 ? 12.928  -1.154  11.083 1.00 22.02 ? 80  THR B OG1 1 
ATOM   1356 C CG2 . THR B 1 80 ? 15.339  -1.280  11.027 1.00 21.02 ? 80  THR B CG2 1 
ATOM   1357 N N   . PRO B 1 81 ? 12.517  -0.409  8.185  1.00 23.74 ? 81  PRO B N   1 
ATOM   1358 C CA  . PRO B 1 81 ? 12.313  0.902   7.559  1.00 24.36 ? 81  PRO B CA  1 
ATOM   1359 C C   . PRO B 1 81 ? 12.538  2.076   8.529  1.00 24.33 ? 81  PRO B C   1 
ATOM   1360 O O   . PRO B 1 81 ? 12.377  3.238   8.155  1.00 24.50 ? 81  PRO B O   1 
ATOM   1361 C CB  . PRO B 1 81 ? 10.874  0.819   7.039  1.00 23.43 ? 81  PRO B CB  1 
ATOM   1362 C CG  . PRO B 1 81 ? 10.221  -0.139  7.980  1.00 24.34 ? 81  PRO B CG  1 
ATOM   1363 C CD  . PRO B 1 81 ? 11.274  -1.202  8.178  1.00 23.38 ? 81  PRO B CD  1 
ATOM   1364 N N   . ALA B 1 82 ? 12.920  1.771   9.769  1.00 22.88 ? 82  ALA B N   1 
ATOM   1365 C CA  . ALA B 1 82 ? 13.167  2.813   10.769 1.00 22.64 ? 82  ALA B CA  1 
ATOM   1366 C C   . ALA B 1 82 ? 13.852  2.300   12.037 1.00 20.01 ? 82  ALA B C   1 
ATOM   1367 O O   . ALA B 1 82 ? 13.637  1.157   12.447 1.00 21.24 ? 82  ALA B O   1 
ATOM   1368 C CB  . ALA B 1 82 ? 11.851  3.493   11.143 1.00 23.94 ? 82  ALA B CB  1 
ATOM   1369 N N   . ASN B 1 83 ? 14.683  3.143   12.652 1.00 19.01 ? 83  ASN B N   1 
ATOM   1370 C CA  . ASN B 1 83 ? 15.352  2.774   13.905 1.00 20.44 ? 83  ASN B CA  1 
ATOM   1371 C C   . ASN B 1 83 ? 14.252  2.802   14.962 1.00 20.31 ? 83  ASN B C   1 
ATOM   1372 O O   . ASN B 1 83 ? 13.570  3.821   15.131 1.00 19.49 ? 83  ASN B O   1 
ATOM   1373 C CB  . ASN B 1 83 ? 16.458  3.771   14.245 1.00 20.59 ? 83  ASN B CB  1 
ATOM   1374 C CG  . ASN B 1 83 ? 17.593  3.737   13.239 1.00 23.33 ? 83  ASN B CG  1 
ATOM   1375 O OD1 . ASN B 1 83 ? 18.050  2.666   12.843 1.00 23.83 ? 83  ASN B OD1 1 
ATOM   1376 N ND2 . ASN B 1 83 ? 18.060  4.910   12.826 1.00 22.32 ? 83  ASN B ND2 1 
ATOM   1377 N N   A ILE B 1 84 ? 14.097  1.682   15.664 0.34 19.27 ? 84  ILE B N   1 
ATOM   1378 N N   B ILE B 1 84 ? 14.089  1.689   15.671 0.33 19.29 ? 84  ILE B N   1 
ATOM   1379 N N   C ILE B 1 84 ? 14.063  1.684   15.664 0.33 19.23 ? 84  ILE B N   1 
ATOM   1380 C CA  A ILE B 1 84 ? 13.074  1.518   16.694 0.34 19.52 ? 84  ILE B CA  1 
ATOM   1381 C CA  B ILE B 1 84 ? 13.053  1.561   16.691 0.33 19.48 ? 84  ILE B CA  1 
ATOM   1382 C CA  C ILE B 1 84 ? 13.026  1.592   16.694 0.33 19.36 ? 84  ILE B CA  1 
ATOM   1383 C C   A ILE B 1 84 ? 13.638  1.198   18.076 0.34 18.83 ? 84  ILE B C   1 
ATOM   1384 C C   B ILE B 1 84 ? 13.589  1.181   18.071 0.33 18.72 ? 84  ILE B C   1 
ATOM   1385 C C   C ILE B 1 84 ? 13.594  1.201   18.059 0.33 18.72 ? 84  ILE B C   1 
ATOM   1386 O O   A ILE B 1 84 ? 14.400  0.246   18.230 0.34 19.38 ? 84  ILE B O   1 
ATOM   1387 O O   B ILE B 1 84 ? 14.271  0.169   18.218 0.33 18.89 ? 84  ILE B O   1 
ATOM   1388 O O   C ILE B 1 84 ? 14.324  0.219   18.183 0.33 19.10 ? 84  ILE B O   1 
ATOM   1389 C CB  A ILE B 1 84 ? 12.122  0.353   16.338 0.34 18.73 ? 84  ILE B CB  1 
ATOM   1390 C CB  B ILE B 1 84 ? 12.025  0.494   16.261 0.33 18.99 ? 84  ILE B CB  1 
ATOM   1391 C CB  C ILE B 1 84 ? 11.907  0.567   16.281 0.33 18.64 ? 84  ILE B CB  1 
ATOM   1392 C CG1 A ILE B 1 84 ? 11.373  0.648   15.041 0.34 19.85 ? 84  ILE B CG1 1 
ATOM   1393 C CG1 B ILE B 1 84 ? 11.245  0.986   15.041 0.33 19.95 ? 84  ILE B CG1 1 
ATOM   1394 C CG1 C ILE B 1 84 ? 12.045  -0.758  17.042 0.33 19.33 ? 84  ILE B CG1 1 
ATOM   1395 C CG2 A ILE B 1 84 ? 11.152  0.107   17.483 0.34 20.35 ? 84  ILE B CG2 1 
ATOM   1396 C CG2 B ILE B 1 84 ? 11.105  0.153   17.418 0.33 20.56 ? 84  ILE B CG2 1 
ATOM   1397 C CG2 C ILE B 1 84 ? 11.993  0.278   14.797 0.33 20.65 ? 84  ILE B CG2 1 
ATOM   1398 C CD1 A ILE B 1 84 ? 10.535  -0.526  14.557 0.34 16.86 ? 84  ILE B CD1 1 
ATOM   1399 C CD1 B ILE B 1 84 ? 10.458  2.251   15.281 0.33 18.61 ? 84  ILE B CD1 1 
ATOM   1400 C CD1 C ILE B 1 84 ? 11.323  -0.797  18.385 0.33 15.67 ? 84  ILE B CD1 1 
ATOM   1401 N N   . ILE B 1 85 ? 13.260  1.984   19.080 1.00 18.36 ? 85  ILE B N   1 
ATOM   1402 C CA  . ILE B 1 85 ? 13.712  1.713   20.443 1.00 16.95 ? 85  ILE B CA  1 
ATOM   1403 C C   . ILE B 1 85 ? 12.547  1.013   21.160 1.00 16.44 ? 85  ILE B C   1 
ATOM   1404 O O   . ILE B 1 85 ? 11.497  1.615   21.383 1.00 16.32 ? 85  ILE B O   1 
ATOM   1405 C CB  . ILE B 1 85 ? 14.084  3.003   21.208 1.00 16.30 ? 85  ILE B CB  1 
ATOM   1406 C CG1 . ILE B 1 85 ? 15.228  3.726   20.491 1.00 15.84 ? 85  ILE B CG1 1 
ATOM   1407 C CG2 . ILE B 1 85 ? 14.512  2.657   22.623 1.00 16.28 ? 85  ILE B CG2 1 
ATOM   1408 C CD1 . ILE B 1 85 ? 16.455  2.849   20.256 1.00 15.07 ? 85  ILE B CD1 1 
ATOM   1409 N N   . GLY B 1 86 ? 12.737  -0.261  21.502 1.00 14.94 ? 86  GLY B N   1 
ATOM   1410 C CA  . GLY B 1 86 ? 11.693  -1.034  22.160 1.00 15.37 ? 86  GLY B CA  1 
ATOM   1411 C C   . GLY B 1 86 ? 11.658  -0.975  23.677 1.00 16.96 ? 86  GLY B C   1 
ATOM   1412 O O   . GLY B 1 86 ? 12.510  -0.348  24.308 1.00 16.46 ? 86  GLY B O   1 
ATOM   1413 N N   . ARG B 1 87 ? 10.676  -1.651  24.269 1.00 15.43 ? 87  ARG B N   1 
ATOM   1414 C CA  . ARG B 1 87 ? 10.515  -1.647  25.717 1.00 17.42 ? 87  ARG B CA  1 
ATOM   1415 C C   . ARG B 1 87 ? 11.719  -2.182  26.489 1.00 19.78 ? 87  ARG B C   1 
ATOM   1416 O O   . ARG B 1 87 ? 11.937  -1.789  27.641 1.00 19.77 ? 87  ARG B O   1 
ATOM   1417 C CB  . ARG B 1 87 ? 9.258   -2.434  26.124 1.00 18.78 ? 87  ARG B CB  1 
ATOM   1418 C CG  . ARG B 1 87 ? 7.950   -1.798  25.659 1.00 18.31 ? 87  ARG B CG  1 
ATOM   1419 C CD  . ARG B 1 87 ? 6.719   -2.534  26.205 1.00 20.28 ? 87  ARG B CD  1 
ATOM   1420 N NE  . ARG B 1 87 ? 6.555   -3.863  25.621 1.00 20.16 ? 87  ARG B NE  1 
ATOM   1421 C CZ  . ARG B 1 87 ? 6.862   -5.006  26.227 1.00 25.80 ? 87  ARG B CZ  1 
ATOM   1422 N NH1 . ARG B 1 87 ? 7.356   -5.007  27.461 1.00 23.80 ? 87  ARG B NH1 1 
ATOM   1423 N NH2 . ARG B 1 87 ? 6.671   -6.158  25.593 1.00 26.89 ? 87  ARG B NH2 1 
ATOM   1424 N N   . ASN B 1 88 ? 12.499  -3.067  25.870 1.00 19.69 ? 88  ASN B N   1 
ATOM   1425 C CA  . ASN B 1 88 ? 13.659  -3.624  26.555 1.00 20.74 ? 88  ASN B CA  1 
ATOM   1426 C C   . ASN B 1 88 ? 14.604  -2.525  27.032 1.00 21.01 ? 88  ASN B C   1 
ATOM   1427 O O   . ASN B 1 88 ? 15.155  -2.606  28.128 1.00 21.78 ? 88  ASN B O   1 
ATOM   1428 C CB  . ASN B 1 88 ? 14.396  -4.655  25.663 1.00 20.32 ? 88  ASN B CB  1 
ATOM   1429 C CG  . ASN B 1 88 ? 15.110  -4.032  24.447 1.00 22.57 ? 88  ASN B CG  1 
ATOM   1430 O OD1 . ASN B 1 88 ? 14.536  -3.232  23.694 1.00 19.31 ? 88  ASN B OD1 1 
ATOM   1431 N ND2 . ASN B 1 88 ? 16.372  -4.437  24.238 1.00 17.31 ? 88  ASN B ND2 1 
ATOM   1432 N N   . LEU B 1 89 ? 14.769  -1.483  26.226 1.00 20.95 ? 89  LEU B N   1 
ATOM   1433 C CA  . LEU B 1 89 ? 15.650  -0.378  26.594 1.00 18.98 ? 89  LEU B CA  1 
ATOM   1434 C C   . LEU B 1 89 ? 14.877  0.787   27.219 1.00 18.51 ? 89  LEU B C   1 
ATOM   1435 O O   . LEU B 1 89 ? 15.424  1.551   28.013 1.00 17.98 ? 89  LEU B O   1 
ATOM   1436 C CB  . LEU B 1 89 ? 16.426  0.106   25.365 1.00 17.57 ? 89  LEU B CB  1 
ATOM   1437 C CG  . LEU B 1 89 ? 17.347  -0.925  24.701 1.00 18.95 ? 89  LEU B CG  1 
ATOM   1438 C CD1 . LEU B 1 89 ? 18.187  -0.244  23.632 1.00 19.42 ? 89  LEU B CD1 1 
ATOM   1439 C CD2 . LEU B 1 89 ? 18.247  -1.559  25.746 1.00 16.86 ? 89  LEU B CD2 1 
ATOM   1440 N N   . LEU B 1 90 ? 13.606  0.922   26.855 1.00 16.93 ? 90  LEU B N   1 
ATOM   1441 C CA  . LEU B 1 90 ? 12.782  1.997   27.401 1.00 17.06 ? 90  LEU B CA  1 
ATOM   1442 C C   . LEU B 1 90 ? 12.651  1.883   28.918 1.00 17.58 ? 90  LEU B C   1 
ATOM   1443 O O   . LEU B 1 90 ? 12.663  2.893   29.627 1.00 18.60 ? 90  LEU B O   1 
ATOM   1444 C CB  . LEU B 1 90 ? 11.397  1.983   26.749 1.00 15.67 ? 90  LEU B CB  1 
ATOM   1445 C CG  . LEU B 1 90 ? 11.375  2.359   25.265 1.00 15.60 ? 90  LEU B CG  1 
ATOM   1446 C CD1 . LEU B 1 90 ? 9.961   2.232   24.727 1.00 14.80 ? 90  LEU B CD1 1 
ATOM   1447 C CD2 . LEU B 1 90 ? 11.874  3.786   25.085 1.00 15.02 ? 90  LEU B CD2 1 
ATOM   1448 N N   . THR B 1 91 ? 12.530  0.658   29.422 1.00 18.12 ? 91  THR B N   1 
ATOM   1449 C CA  . THR B 1 91 ? 12.419  0.466   30.866 1.00 19.79 ? 91  THR B CA  1 
ATOM   1450 C C   . THR B 1 91 ? 13.725  0.856   31.552 1.00 20.53 ? 91  THR B C   1 
ATOM   1451 O O   . THR B 1 91 ? 13.714  1.417   32.646 1.00 17.75 ? 91  THR B O   1 
ATOM   1452 C CB  . THR B 1 91 ? 12.093  -0.995  31.236 1.00 20.42 ? 91  THR B CB  1 
ATOM   1453 O OG1 . THR B 1 91 ? 13.038  -1.870  30.614 1.00 20.82 ? 91  THR B OG1 1 
ATOM   1454 C CG2 . THR B 1 91 ? 10.682  -1.360  30.788 1.00 19.77 ? 91  THR B CG2 1 
ATOM   1455 N N   . GLN B 1 92 ? 14.846  0.565   30.899 1.00 19.60 ? 92  GLN B N   1 
ATOM   1456 C CA  . GLN B 1 92 ? 16.152  0.883   31.454 1.00 20.35 ? 92  GLN B CA  1 
ATOM   1457 C C   . GLN B 1 92 ? 16.342  2.378   31.693 1.00 20.11 ? 92  GLN B C   1 
ATOM   1458 O O   . GLN B 1 92 ? 17.047  2.771   32.627 1.00 21.84 ? 92  GLN B O   1 
ATOM   1459 C CB  . GLN B 1 92 ? 17.263  0.341   30.544 1.00 19.79 ? 92  GLN B CB  1 
ATOM   1460 C CG  . GLN B 1 92 ? 17.455  -1.169  30.647 1.00 20.91 ? 92  GLN B CG  1 
ATOM   1461 C CD  . GLN B 1 92 ? 18.627  -1.671  29.819 1.00 23.19 ? 92  GLN B CD  1 
ATOM   1462 O OE1 . GLN B 1 92 ? 19.604  -0.956  29.619 1.00 25.12 ? 92  GLN B OE1 1 
ATOM   1463 N NE2 . GLN B 1 92 ? 18.541  -2.913  29.353 1.00 23.92 ? 92  GLN B NE2 1 
ATOM   1464 N N   . ILE B 1 93 ? 15.716  3.214   30.865 1.00 19.44 ? 93  ILE B N   1 
ATOM   1465 C CA  . ILE B 1 93 ? 15.846  4.657   31.039 1.00 18.77 ? 93  ILE B CA  1 
ATOM   1466 C C   . ILE B 1 93 ? 14.687  5.258   31.828 1.00 18.41 ? 93  ILE B C   1 
ATOM   1467 O O   . ILE B 1 93 ? 14.564  6.477   31.928 1.00 18.15 ? 93  ILE B O   1 
ATOM   1468 C CB  . ILE B 1 93 ? 16.001  5.400   29.680 1.00 20.13 ? 93  ILE B CB  1 
ATOM   1469 C CG1 . ILE B 1 93 ? 14.725  5.282   28.842 1.00 18.35 ? 93  ILE B CG1 1 
ATOM   1470 C CG2 . ILE B 1 93 ? 17.195  4.838   28.926 1.00 20.05 ? 93  ILE B CG2 1 
ATOM   1471 C CD1 . ILE B 1 93 ? 14.815  6.015   27.519 1.00 21.08 ? 93  ILE B CD1 1 
ATOM   1472 N N   . GLY B 1 94 ? 13.848  4.393   32.394 1.00 18.74 ? 94  GLY B N   1 
ATOM   1473 C CA  . GLY B 1 94 ? 12.726  4.841   33.207 1.00 21.05 ? 94  GLY B CA  1 
ATOM   1474 C C   . GLY B 1 94 ? 11.602  5.539   32.467 1.00 21.53 ? 94  GLY B C   1 
ATOM   1475 O O   . GLY B 1 94 ? 10.963  6.443   33.007 1.00 20.64 ? 94  GLY B O   1 
ATOM   1476 N N   . CYS B 1 95 ? 11.352  5.110   31.235 1.00 21.08 ? 95  CYS B N   1 
ATOM   1477 C CA  . CYS B 1 95 ? 10.307  5.701   30.403 1.00 19.64 ? 95  CYS B CA  1 
ATOM   1478 C C   . CYS B 1 95 ? 8.919   5.133   30.692 1.00 19.87 ? 95  CYS B C   1 
ATOM   1479 O O   . CYS B 1 95 ? 8.743   3.922   30.839 1.00 20.51 ? 95  CYS B O   1 
ATOM   1480 C CB  . CYS B 1 95 ? 10.645  5.487   28.923 1.00 20.09 ? 95  CYS B CB  1 
ATOM   1481 S SG  . CYS B 1 95 ? 9.597   6.384   27.769 1.00 22.40 ? 95  CYS B SG  1 
ATOM   1482 N N   . THR B 1 96 ? 7.930   6.018   30.764 1.00 18.67 ? 96  THR B N   1 
ATOM   1483 C CA  . THR B 1 96 ? 6.557   5.602   31.013 1.00 18.67 ? 96  THR B CA  1 
ATOM   1484 C C   . THR B 1 96 ? 5.599   6.307   30.059 1.00 17.46 ? 96  THR B C   1 
ATOM   1485 O O   . THR B 1 96 ? 5.980   7.242   29.355 1.00 15.49 ? 96  THR B O   1 
ATOM   1486 C CB  . THR B 1 96 ? 6.107   5.934   32.458 1.00 18.75 ? 96  THR B CB  1 
ATOM   1487 O OG1 . THR B 1 96 ? 6.232   7.345   32.689 1.00 19.73 ? 96  THR B OG1 1 
ATOM   1488 C CG2 . THR B 1 96 ? 6.944   5.180   33.470 1.00 19.48 ? 96  THR B CG2 1 
ATOM   1489 N N   . LEU B 1 97 ? 4.363   5.820   30.030 1.00 17.04 ? 97  LEU B N   1 
ATOM   1490 C CA  . LEU B 1 97 ? 3.297   6.416   29.231 1.00 19.46 ? 97  LEU B CA  1 
ATOM   1491 C C   . LEU B 1 97 ? 2.384   7.035   30.278 1.00 20.08 ? 97  LEU B C   1 
ATOM   1492 O O   . LEU B 1 97 ? 2.087   6.398   31.286 1.00 20.51 ? 97  LEU B O   1 
ATOM   1493 C CB  . LEU B 1 97 ? 2.519   5.349   28.460 1.00 18.24 ? 97  LEU B CB  1 
ATOM   1494 C CG  . LEU B 1 97 ? 3.083   4.860   27.124 1.00 19.11 ? 97  LEU B CG  1 
ATOM   1495 C CD1 . LEU B 1 97 ? 2.234   3.705   26.621 1.00 18.93 ? 97  LEU B CD1 1 
ATOM   1496 C CD2 . LEU B 1 97 ? 3.080   5.998   26.114 1.00 19.60 ? 97  LEU B CD2 1 
ATOM   1497 N N   . ASN B 1 98 ? 1.932   8.263   30.050 1.00 21.10 ? 98  ASN B N   1 
ATOM   1498 C CA  . ASN B 1 98 ? 1.072   8.916   31.030 1.00 22.55 ? 98  ASN B CA  1 
ATOM   1499 C C   . ASN B 1 98 ? -0.096  9.685   30.412 1.00 22.32 ? 98  ASN B C   1 
ATOM   1500 O O   . ASN B 1 98 ? 0.080   10.418  29.441 1.00 22.14 ? 98  ASN B O   1 
ATOM   1501 C CB  . ASN B 1 98 ? 1.906   9.878   31.887 1.00 22.36 ? 98  ASN B CB  1 
ATOM   1502 C CG  . ASN B 1 98 ? 3.123   9.207   32.513 1.00 25.59 ? 98  ASN B CG  1 
ATOM   1503 O OD1 . ASN B 1 98 ? 4.078   8.842   31.824 1.00 25.65 ? 98  ASN B OD1 1 
ATOM   1504 N ND2 . ASN B 1 98 ? 3.089   9.039   33.828 1.00 26.16 ? 98  ASN B ND2 1 
ATOM   1505 N N   . PHE B 1 99 ? -1.285  9.507   30.983 1.00 23.83 ? 99  PHE B N   1 
ATOM   1506 C CA  . PHE B 1 99 ? -2.482  10.214  30.529 1.00 25.89 ? 99  PHE B CA  1 
ATOM   1507 C C   . PHE B 1 99 ? -3.559  10.182  31.614 1.00 27.67 ? 99  PHE B C   1 
ATOM   1508 O O   . PHE B 1 99 ? -4.717  10.553  31.322 1.00 28.27 ? 99  PHE B O   1 
ATOM   1509 C CB  . PHE B 1 99 ? -3.036  9.607   29.230 1.00 25.00 ? 99  PHE B CB  1 
ATOM   1510 C CG  . PHE B 1 99 ? -3.476  8.179   29.356 1.00 27.01 ? 99  PHE B CG  1 
ATOM   1511 C CD1 . PHE B 1 99 ? -2.560  7.138   29.220 1.00 27.26 ? 99  PHE B CD1 1 
ATOM   1512 C CD2 . PHE B 1 99 ? -4.811  7.869   29.595 1.00 27.22 ? 99  PHE B CD2 1 
ATOM   1513 C CE1 . PHE B 1 99 ? -2.970  5.810   29.319 1.00 27.24 ? 99  PHE B CE1 1 
ATOM   1514 C CE2 . PHE B 1 99 ? -5.232  6.549   29.697 1.00 27.67 ? 99  PHE B CE2 1 
ATOM   1515 C CZ  . PHE B 1 99 ? -4.309  5.514   29.558 1.00 28.53 ? 99  PHE B CZ  1 
ATOM   1516 O OXT . PHE B 1 99 ? -3.219  9.803   32.754 1.00 27.08 ? 99  PHE B OXT 1 
ATOM   1517 N N   . VAL C 2 1  ? 2.134   5.014   3.117  1.00 36.66 ? 1   VAL P N   1 
ATOM   1518 C CA  . VAL C 2 1  ? 2.921   6.096   3.782  1.00 35.94 ? 1   VAL P CA  1 
ATOM   1519 C C   . VAL C 2 1  ? 2.842   6.014   5.289  1.00 33.51 ? 1   VAL P C   1 
ATOM   1520 O O   . VAL C 2 1  ? 3.859   6.123   5.962  1.00 36.10 ? 1   VAL P O   1 
ATOM   1521 C CB  . VAL C 2 1  ? 2.428   7.492   3.389  1.00 37.20 ? 1   VAL P CB  1 
ATOM   1522 C CG1 . VAL C 2 1  ? 3.290   8.555   4.050  1.00 38.13 ? 1   VAL P CG1 1 
ATOM   1523 C CG2 . VAL C 2 1  ? 2.455   7.628   1.900  1.00 39.03 ? 1   VAL P CG2 1 
ATOM   1524 N N   . SER C 2 2  ? 1.631   5.859   5.815  1.00 29.39 ? 2   SER P N   1 
ATOM   1525 C CA  . SER C 2 2  ? 1.443   5.745   7.254  1.00 25.42 ? 2   SER P CA  1 
ATOM   1526 C C   . SER C 2 2  ? 2.352   4.628   7.755  1.00 22.66 ? 2   SER P C   1 
ATOM   1527 O O   . SER C 2 2  ? 2.357   3.538   7.186  1.00 21.11 ? 2   SER P O   1 
ATOM   1528 C CB  . SER C 2 2  ? -0.015  5.406   7.560  1.00 26.54 ? 2   SER P CB  1 
ATOM   1529 O OG  . SER C 2 2  ? -0.179  5.046   8.917  1.00 29.83 ? 2   SER P OG  1 
ATOM   1530 N N   . GLN C 2 3  ? 3.104   4.897   8.821  1.00 21.14 ? 3   GLN P N   1 
ATOM   1531 C CA  . GLN C 2 3  ? 4.036   3.918   9.390  1.00 19.91 ? 3   GLN P CA  1 
ATOM   1532 C C   . GLN C 2 3  ? 3.598   3.432   10.774 1.00 19.32 ? 3   GLN P C   1 
ATOM   1533 O O   . GLN C 2 3  ? 3.299   4.235   11.652 1.00 19.39 ? 3   GLN P O   1 
ATOM   1534 C CB  . GLN C 2 3  ? 5.442   4.533   9.461  1.00 21.53 ? 3   GLN P CB  1 
ATOM   1535 C CG  . GLN C 2 3  ? 6.026   4.890   8.091  1.00 24.35 ? 3   GLN P CG  1 
ATOM   1536 C CD  . GLN C 2 3  ? 7.433   5.474   8.162  1.00 26.12 ? 3   GLN P CD  1 
ATOM   1537 O OE1 . GLN C 2 3  ? 8.294   4.961   8.871  1.00 25.65 ? 3   GLN P OE1 1 
ATOM   1538 N NE2 . GLN C 2 3  ? 7.672   6.548   7.408  1.00 26.34 ? 3   GLN P NE2 1 
ATOM   1539 N N   . ASN C 2 4  ? 3.572   2.114   10.963 1.00 20.11 ? 4   ASN P N   1 
ATOM   1540 C CA  . ASN C 2 4  ? 3.139   1.527   12.231 1.00 18.56 ? 4   ASN P CA  1 
ATOM   1541 C C   . ASN C 2 4  ? 4.049   0.364   12.626 1.00 18.90 ? 4   ASN P C   1 
ATOM   1542 O O   . ASN C 2 4  ? 4.119   -0.656  11.931 1.00 18.19 ? 4   ASN P O   1 
ATOM   1543 C CB  . ASN C 2 4  ? 1.689   1.078   12.088 1.00 17.32 ? 4   ASN P CB  1 
ATOM   1544 C CG  . ASN C 2 4  ? 0.816   2.163   11.486 1.00 17.18 ? 4   ASN P CG  1 
ATOM   1545 O OD1 . ASN C 2 4  ? 0.693   2.277   10.259 1.00 19.34 ? 4   ASN P OD1 1 
ATOM   1546 N ND2 . ASN C 2 4  ? 0.239   2.992   12.340 1.00 14.77 ? 4   ASN P ND2 1 
ATOM   1547 N N   . TYR C 2 5  ? 4.726   0.510   13.762 1.00 18.66 ? 5   TYR P N   1 
ATOM   1548 C CA  . TYR C 2 5  ? 5.691   -0.496  14.187 1.00 18.39 ? 5   TYR P CA  1 
ATOM   1549 C C   . TYR C 2 5  ? 5.468   -1.471  15.342 1.00 20.14 ? 5   TYR P C   1 
ATOM   1550 O O   . TYR C 2 5  ? 6.333   -1.624  16.212 1.00 18.27 ? 5   TYR P O   1 
ATOM   1551 C CB  . TYR C 2 5  ? 7.043   0.200   14.362 1.00 19.53 ? 5   TYR P CB  1 
ATOM   1552 C CG  . TYR C 2 5  ? 7.504   0.816   13.066 1.00 21.09 ? 5   TYR P CG  1 
ATOM   1553 C CD1 . TYR C 2 5  ? 7.779   0.017   11.959 1.00 22.63 ? 5   TYR P CD1 1 
ATOM   1554 C CD2 . TYR C 2 5  ? 7.584   2.201   12.917 1.00 23.08 ? 5   TYR P CD2 1 
ATOM   1555 C CE1 . TYR C 2 5  ? 8.113   0.579   10.732 1.00 25.12 ? 5   TYR P CE1 1 
ATOM   1556 C CE2 . TYR C 2 5  ? 7.919   2.776   11.692 1.00 23.63 ? 5   TYR P CE2 1 
ATOM   1557 C CZ  . TYR C 2 5  ? 8.179   1.957   10.603 1.00 25.39 ? 5   TYR P CZ  1 
ATOM   1558 O OH  . TYR C 2 5  ? 8.482   2.508   9.378  1.00 25.04 ? 5   TYR P OH  1 
ATOM   1559 N N   . PRO C 2 6  ? 4.306   -2.148  15.382 1.00 20.34 ? 6   PRO P N   1 
ATOM   1560 C CA  . PRO C 2 6  ? 4.161   -3.089  16.494 1.00 20.08 ? 6   PRO P CA  1 
ATOM   1561 C C   . PRO C 2 6  ? 4.989   -4.322  16.110 1.00 21.46 ? 6   PRO P C   1 
ATOM   1562 O O   . PRO C 2 6  ? 5.137   -4.623  14.923 1.00 21.41 ? 6   PRO P O   1 
ATOM   1563 C CB  . PRO C 2 6  ? 2.664   -3.390  16.499 1.00 20.22 ? 6   PRO P CB  1 
ATOM   1564 C CG  . PRO C 2 6  ? 2.302   -3.285  15.043 1.00 20.97 ? 6   PRO P CG  1 
ATOM   1565 C CD  . PRO C 2 6  ? 3.046   -2.027  14.627 1.00 20.68 ? 6   PRO P CD  1 
ATOM   1566 N N   . ILE C 2 7  ? 5.555   -5.011  17.095 1.00 20.68 ? 7   ILE P N   1 
ATOM   1567 C CA  . ILE C 2 7  ? 6.325   -6.220  16.822 1.00 23.04 ? 7   ILE P CA  1 
ATOM   1568 C C   . ILE C 2 7  ? 5.797   -7.328  17.723 1.00 22.82 ? 7   ILE P C   1 
ATOM   1569 O O   . ILE C 2 7  ? 5.664   -7.144  18.929 1.00 24.18 ? 7   ILE P O   1 
ATOM   1570 C CB  . ILE C 2 7  ? 7.841   -6.011  17.069 1.00 22.64 ? 7   ILE P CB  1 
ATOM   1571 C CG1 . ILE C 2 7  ? 8.405   -5.050  16.021 1.00 21.27 ? 7   ILE P CG1 1 
ATOM   1572 C CG2 . ILE C 2 7  ? 8.577   -7.344  16.992 1.00 23.94 ? 7   ILE P CG2 1 
ATOM   1573 C CD1 . ILE C 2 7  ? 9.914   -4.846  16.107 1.00 21.91 ? 7   ILE P CD1 1 
ATOM   1574 N N   . VAL C 2 8  ? 5.473   -8.468  17.123 1.00 25.60 ? 8   VAL P N   1 
ATOM   1575 C CA  . VAL C 2 8  ? 4.940   -9.609  17.858 1.00 28.32 ? 8   VAL P CA  1 
ATOM   1576 C C   . VAL C 2 8  ? 5.994   -10.359 18.669 1.00 30.03 ? 8   VAL P C   1 
ATOM   1577 O O   . VAL C 2 8  ? 5.689   -10.715 19.828 1.00 32.26 ? 8   VAL P O   1 
ATOM   1578 C CB  . VAL C 2 8  ? 4.240   -10.608 16.903 1.00 28.35 ? 8   VAL P CB  1 
ATOM   1579 C CG1 . VAL C 2 8  ? 3.068   -9.929  16.218 1.00 28.08 ? 8   VAL P CG1 1 
ATOM   1580 C CG2 . VAL C 2 8  ? 5.231   -11.130 15.873 1.00 28.95 ? 8   VAL P CG2 1 
HETATM 1581 C C   . ACT D 3 .  ? 3.602   -9.472  28.890 1.00 52.67 ? 501 ACT A C   1 
HETATM 1582 O O   . ACT D 3 .  ? 2.990   -8.393  28.176 1.00 52.88 ? 501 ACT A O   1 
HETATM 1583 O OXT . ACT D 3 .  ? 2.775   -10.298 29.528 1.00 53.67 ? 501 ACT A OXT 1 
HETATM 1584 C CH3 . ACT D 3 .  ? 5.109   -9.667  28.914 1.00 52.92 ? 501 ACT A CH3 1 
HETATM 1585 C C   . ACT E 3 .  ? -7.121  8.135   35.363 1.00 58.73 ? 502 ACT A C   1 
HETATM 1586 O O   . ACT E 3 .  ? -7.519  6.795   35.046 1.00 58.28 ? 502 ACT A O   1 
HETATM 1587 O OXT . ACT E 3 .  ? -7.896  9.109   34.889 1.00 58.94 ? 502 ACT A OXT 1 
HETATM 1588 C CH3 . ACT E 3 .  ? -5.887  8.432   36.197 1.00 58.04 ? 502 ACT A CH3 1 
HETATM 1589 C C   . ACT F 3 .  ? -21.537 3.451   22.387 1.00 50.34 ? 503 ACT A C   1 
HETATM 1590 O O   . ACT F 3 .  ? -22.472 4.143   21.549 1.00 50.41 ? 503 ACT A O   1 
HETATM 1591 O OXT . ACT F 3 .  ? -21.823 3.420   23.689 1.00 49.96 ? 503 ACT A OXT 1 
HETATM 1592 C CH3 . ACT F 3 .  ? -20.287 2.783   21.822 1.00 50.24 ? 503 ACT A CH3 1 
HETATM 1593 C C   . ACT G 3 .  ? -12.567 12.136  28.987 1.00 53.52 ? 504 ACT A C   1 
HETATM 1594 O O   . ACT G 3 .  ? -13.477 13.053  28.370 1.00 55.03 ? 504 ACT A O   1 
HETATM 1595 O OXT . ACT G 3 .  ? -11.432 12.655  29.450 1.00 54.23 ? 504 ACT A OXT 1 
HETATM 1596 C CH3 . ACT G 3 .  ? -12.882 10.662  29.114 1.00 54.77 ? 504 ACT A CH3 1 
HETATM 1597 C C   . ACT H 3 .  ? -16.998 -8.908  13.859 1.00 51.12 ? 506 ACT A C   1 
HETATM 1598 O O   . ACT H 3 .  ? -16.738 -8.715  15.254 1.00 51.29 ? 506 ACT A O   1 
HETATM 1599 O OXT . ACT H 3 .  ? -17.885 -8.084  13.305 1.00 51.83 ? 506 ACT A OXT 1 
HETATM 1600 C CH3 . ACT H 3 .  ? -16.298 -9.985  13.054 1.00 51.10 ? 506 ACT A CH3 1 
HETATM 1601 C C   . ACT I 3 .  ? 4.690   12.484  11.783 1.00 54.61 ? 505 ACT B C   1 
HETATM 1602 O O   . ACT I 3 .  ? 3.707   12.774  12.784 1.00 55.25 ? 505 ACT B O   1 
HETATM 1603 O OXT . ACT I 3 .  ? 5.964   12.652  12.139 1.00 53.17 ? 505 ACT B OXT 1 
HETATM 1604 C CH3 . ACT I 3 .  ? 4.300   12.001  10.393 1.00 55.33 ? 505 ACT B CH3 1 
HETATM 1605 O O   . HOH J 4 .  ? 10.371  -3.874  5.842  1.00 29.53 ? 507 HOH A O   1 
HETATM 1606 O O   . HOH J 4 .  ? 5.055   7.037   15.596 1.00 14.60 ? 508 HOH A O   1 
HETATM 1607 O O   . HOH J 4 .  ? -6.002  5.411   12.527 1.00 16.95 ? 509 HOH A O   1 
HETATM 1608 O O   . HOH J 4 .  ? 5.357   5.647   13.322 1.00 16.91 ? 510 HOH A O   1 
HETATM 1609 O O   . HOH J 4 .  ? -2.968  -6.549  2.696  1.00 20.66 ? 511 HOH A O   1 
HETATM 1610 O O   . HOH J 4 .  ? -0.033  15.948  29.184 1.00 44.02 ? 512 HOH A O   1 
HETATM 1611 O O   . HOH J 4 .  ? 7.190   16.087  34.441 1.00 59.05 ? 513 HOH A O   1 
HETATM 1612 O O   . HOH J 4 .  ? 5.966   -4.674  1.416  1.00 24.99 ? 514 HOH A O   1 
HETATM 1613 O O   . HOH J 4 .  ? -9.768  -8.122  21.724 1.00 29.03 ? 515 HOH A O   1 
HETATM 1614 O O   . HOH J 4 .  ? 0.717   13.667  23.061 1.00 20.98 ? 516 HOH A O   1 
HETATM 1615 O O   . HOH J 4 .  ? -7.799  10.430  13.853 1.00 17.55 ? 517 HOH A O   1 
HETATM 1616 O O   . HOH J 4 .  ? -7.042  11.420  11.545 1.00 37.31 ? 518 HOH A O   1 
HETATM 1617 O O   . HOH J 4 .  ? -4.929  3.187   -1.846 1.00 57.49 ? 519 HOH A O   1 
HETATM 1618 O O   . HOH J 4 .  ? -0.801  -8.273  21.689 1.00 56.37 ? 520 HOH A O   1 
HETATM 1619 O O   . HOH J 4 .  ? 11.275  9.915   36.741 1.00 22.15 ? 521 HOH A O   1 
HETATM 1620 O O   . HOH J 4 .  ? 0.325   -7.967  8.663  1.00 25.15 ? 522 HOH A O   1 
HETATM 1621 O O   . HOH J 4 .  ? -1.488  -9.269  32.503 1.00 50.53 ? 523 HOH A O   1 
HETATM 1622 O O   . HOH J 4 .  ? -5.136  -10.364 32.854 1.00 64.13 ? 524 HOH A O   1 
HETATM 1623 O O   . HOH J 4 .  ? -12.635 1.953   28.088 1.00 34.87 ? 525 HOH A O   1 
HETATM 1624 O O   . HOH J 4 .  ? -7.014  10.822  3.260  1.00 44.45 ? 526 HOH A O   1 
HETATM 1625 O O   . HOH J 4 .  ? -3.269  4.496   0.938  1.00 30.13 ? 527 HOH A O   1 
HETATM 1626 O O   . HOH J 4 .  ? 4.894   -2.689  33.332 1.00 29.55 ? 528 HOH A O   1 
HETATM 1627 O O   . HOH J 4 .  ? -8.577  12.290  28.012 1.00 28.66 ? 529 HOH A O   1 
HETATM 1628 O O   . HOH J 4 .  ? 9.024   10.360  35.150 1.00 22.30 ? 530 HOH A O   1 
HETATM 1629 O O   . HOH J 4 .  ? -0.618  15.464  24.367 1.00 42.87 ? 531 HOH A O   1 
HETATM 1630 O O   . HOH J 4 .  ? -8.095  12.944  9.924  1.00 31.78 ? 532 HOH A O   1 
HETATM 1631 O O   . HOH J 4 .  ? 8.843   -9.006  4.578  1.00 24.93 ? 533 HOH A O   1 
HETATM 1632 O O   . HOH J 4 .  ? 6.901   -0.679  5.764  1.00 19.13 ? 534 HOH A O   1 
HETATM 1633 O O   . HOH J 4 .  ? 7.333   -6.846  1.973  1.00 23.21 ? 535 HOH A O   1 
HETATM 1634 O O   . HOH J 4 .  ? 3.307   -7.103  1.591  1.00 29.97 ? 536 HOH A O   1 
HETATM 1635 O O   . HOH J 4 .  ? 9.539   -5.509  3.418  1.00 31.60 ? 537 HOH A O   1 
HETATM 1636 O O   . HOH J 4 .  ? 11.027  -8.225  2.858  1.00 29.65 ? 538 HOH A O   1 
HETATM 1637 O O   . HOH J 4 .  ? 13.595  -7.730  4.221  1.00 25.54 ? 539 HOH A O   1 
HETATM 1638 O O   . HOH J 4 .  ? 1.374   -8.877  2.225  1.00 36.32 ? 540 HOH A O   1 
HETATM 1639 O O   . HOH J 4 .  ? -1.178  -8.693  2.752  1.00 32.59 ? 541 HOH A O   1 
HETATM 1640 O O   . HOH J 4 .  ? 0.450   13.274  29.639 1.00 27.79 ? 542 HOH A O   1 
HETATM 1641 O O   . HOH J 4 .  ? 2.663   -1.792  30.138 1.00 24.34 ? 543 HOH A O   1 
HETATM 1642 O O   . HOH J 4 .  ? -6.500  -0.173  31.819 1.00 51.14 ? 544 HOH A O   1 
HETATM 1643 O O   . HOH J 4 .  ? -9.946  -8.025  18.746 1.00 37.36 ? 545 HOH A O   1 
HETATM 1644 O O   . HOH J 4 .  ? -10.302 -6.141  16.301 1.00 42.19 ? 546 HOH A O   1 
HETATM 1645 O O   . HOH J 4 .  ? -0.800  10.040  13.387 1.00 30.74 ? 547 HOH A O   1 
HETATM 1646 O O   . HOH J 4 .  ? 8.786   -1.668  4.143  1.00 36.21 ? 548 HOH A O   1 
HETATM 1647 O O   . HOH J 4 .  ? 9.566   0.949   3.721  1.00 40.78 ? 549 HOH A O   1 
HETATM 1648 O O   . HOH J 4 .  ? -7.019  -5.900  3.999  1.00 30.32 ? 550 HOH A O   1 
HETATM 1649 O O   . HOH J 4 .  ? -15.654 6.614   7.182  1.00 36.47 ? 551 HOH A O   1 
HETATM 1650 O O   . HOH J 4 .  ? -15.529 8.674   22.514 1.00 23.51 ? 552 HOH A O   1 
HETATM 1651 O O   . HOH J 4 .  ? -3.254  14.329  16.411 1.00 30.09 ? 553 HOH A O   1 
HETATM 1652 O O   . HOH J 4 .  ? 7.960   14.292  32.732 1.00 29.45 ? 554 HOH A O   1 
HETATM 1653 O O   . HOH J 4 .  ? 9.743   12.521  33.494 1.00 29.59 ? 555 HOH A O   1 
HETATM 1654 O O   . HOH J 4 .  ? -10.426 12.304  25.893 1.00 27.50 ? 556 HOH A O   1 
HETATM 1655 O O   . HOH J 4 .  ? -2.049  -9.860  4.824  1.00 38.19 ? 557 HOH A O   1 
HETATM 1656 O O   . HOH J 4 .  ? -2.876  16.449  24.227 1.00 40.42 ? 558 HOH A O   1 
HETATM 1657 O O   . HOH J 4 .  ? -4.958  -7.775  19.480 1.00 34.92 ? 559 HOH A O   1 
HETATM 1658 O O   . HOH J 4 .  ? 2.174   0.119   35.005 1.00 30.87 ? 560 HOH A O   1 
HETATM 1659 O O   . HOH J 4 .  ? -7.460  -2.038  33.429 1.00 34.71 ? 561 HOH A O   1 
HETATM 1660 O O   . HOH J 4 .  ? -3.740  0.458   32.442 1.00 43.59 ? 562 HOH A O   1 
HETATM 1661 O O   . HOH J 4 .  ? -5.146  7.712   8.591  1.00 47.59 ? 563 HOH A O   1 
HETATM 1662 O O   . HOH J 4 .  ? -17.576 4.601   9.083  1.00 40.01 ? 564 HOH A O   1 
HETATM 1663 O O   . HOH J 4 .  ? -8.979  -4.418  3.232  1.00 35.89 ? 565 HOH A O   1 
HETATM 1664 O O   . HOH J 4 .  ? -15.619 -4.675  4.739  1.00 43.76 ? 566 HOH A O   1 
HETATM 1665 O O   . HOH J 4 .  ? 6.742   10.393  36.674 1.00 36.16 ? 567 HOH A O   1 
HETATM 1666 O O   . HOH J 4 .  ? 0.290   -6.475  29.760 1.00 28.40 ? 568 HOH A O   1 
HETATM 1667 O O   . HOH J 4 .  ? -18.085 -6.601  23.843 1.00 40.95 ? 569 HOH A O   1 
HETATM 1668 O O   . HOH J 4 .  ? -15.014 -7.684  16.677 1.00 39.12 ? 570 HOH A O   1 
HETATM 1669 O O   . HOH J 4 .  ? -17.562 -11.494 19.726 1.00 45.02 ? 571 HOH A O   1 
HETATM 1670 O O   . HOH J 4 .  ? -3.104  14.354  29.609 1.00 32.24 ? 572 HOH A O   1 
HETATM 1671 O O   . HOH J 4 .  ? -0.284  -9.841  6.804  1.00 42.70 ? 573 HOH A O   1 
HETATM 1672 O O   . HOH K 4 .  ? 5.102   -3.781  23.584 1.00 21.51 ? 506 HOH B O   1 
HETATM 1673 O O   . HOH K 4 .  ? 9.876   10.358  11.082 1.00 43.01 ? 507 HOH B O   1 
HETATM 1674 O O   . HOH K 4 .  ? 20.583  10.507  32.740 1.00 33.37 ? 508 HOH B O   1 
HETATM 1675 O O   . HOH K 4 .  ? 30.349  8.472   29.287 1.00 36.40 ? 509 HOH B O   1 
HETATM 1676 O O   . HOH K 4 .  ? 19.862  8.414   11.798 1.00 37.01 ? 510 HOH B O   1 
HETATM 1677 O O   . HOH K 4 .  ? 18.011  -6.857  26.640 1.00 26.58 ? 511 HOH B O   1 
HETATM 1678 O O   . HOH K 4 .  ? 18.202  -14.869 24.667 1.00 43.15 ? 512 HOH B O   1 
HETATM 1679 O O   . HOH K 4 .  ? 29.197  -8.507  24.427 1.00 59.67 ? 513 HOH B O   1 
HETATM 1680 O O   . HOH K 4 .  ? 10.542  4.609   5.580  1.00 43.64 ? 514 HOH B O   1 
HETATM 1681 O O   . HOH K 4 .  ? 4.673   21.050  9.026  1.00 43.93 ? 515 HOH B O   1 
HETATM 1682 O O   . HOH K 4 .  ? 8.635   7.963   33.803 1.00 27.82 ? 516 HOH B O   1 
HETATM 1683 O O   . HOH K 4 .  ? 0.983   10.105  35.230 1.00 31.90 ? 517 HOH B O   1 
HETATM 1684 O O   . HOH K 4 .  ? 5.148   18.590  18.916 1.00 37.97 ? 518 HOH B O   1 
HETATM 1685 O O   . HOH K 4 .  ? 13.431  -15.636 15.489 1.00 21.77 ? 519 HOH B O   1 
HETATM 1686 O O   . HOH K 4 .  ? 27.701  0.752   21.721 1.00 21.87 ? 520 HOH B O   1 
HETATM 1687 O O   . HOH K 4 .  ? 10.938  -12.466 21.087 1.00 35.73 ? 521 HOH B O   1 
HETATM 1688 O O   . HOH K 4 .  ? 6.949   -16.758 15.239 1.00 24.77 ? 522 HOH B O   1 
HETATM 1689 O O   . HOH K 4 .  ? 9.058   1.558   32.132 1.00 19.85 ? 523 HOH B O   1 
HETATM 1690 O O   . HOH K 4 .  ? 8.172   16.565  21.676 1.00 33.16 ? 524 HOH B O   1 
HETATM 1691 O O   . HOH K 4 .  ? 9.367   14.506  18.939 1.00 40.77 ? 525 HOH B O   1 
HETATM 1692 O O   . HOH K 4 .  ? 4.805   15.826  19.274 1.00 21.94 ? 526 HOH B O   1 
HETATM 1693 O O   . HOH K 4 .  ? 18.268  12.461  15.672 1.00 43.85 ? 527 HOH B O   1 
HETATM 1694 O O   . HOH K 4 .  ? 24.124  -12.791 19.936 1.00 49.91 ? 528 HOH B O   1 
HETATM 1695 O O   . HOH K 4 .  ? 24.163  6.319   11.330 1.00 37.10 ? 529 HOH B O   1 
HETATM 1696 O O   . HOH K 4 .  ? 21.304  12.005  15.067 1.00 37.44 ? 530 HOH B O   1 
HETATM 1697 O O   . HOH K 4 .  ? 16.304  -5.975  20.943 1.00 14.46 ? 531 HOH B O   1 
HETATM 1698 O O   . HOH K 4 .  ? 32.410  -7.014  9.023  1.00 39.69 ? 532 HOH B O   1 
HETATM 1699 O O   . HOH K 4 .  ? 29.998  -6.050  20.627 1.00 29.80 ? 533 HOH B O   1 
HETATM 1700 O O   . HOH K 4 .  ? 16.784  13.965  30.998 1.00 35.27 ? 534 HOH B O   1 
HETATM 1701 O O   . HOH K 4 .  ? 6.852   18.344  25.563 1.00 33.56 ? 535 HOH B O   1 
HETATM 1702 O O   . HOH K 4 .  ? 6.798   13.394  19.226 1.00 30.42 ? 536 HOH B O   1 
HETATM 1703 O O   . HOH K 4 .  ? 22.468  10.296  23.301 1.00 39.21 ? 537 HOH B O   1 
HETATM 1704 O O   . HOH K 4 .  ? 26.227  4.440   24.880 1.00 34.13 ? 538 HOH B O   1 
HETATM 1705 O O   . HOH K 4 .  ? 33.323  3.270   18.137 1.00 19.42 ? 539 HOH B O   1 
HETATM 1706 O O   . HOH K 4 .  ? 32.118  3.418   15.592 1.00 28.28 ? 540 HOH B O   1 
HETATM 1707 O O   . HOH K 4 .  ? 20.956  2.271   12.217 1.00 35.10 ? 541 HOH B O   1 
HETATM 1708 O O   . HOH K 4 .  ? 17.591  -0.642  7.185  1.00 34.37 ? 542 HOH B O   1 
HETATM 1709 O O   . HOH K 4 .  ? 27.666  0.594   8.805  1.00 33.86 ? 543 HOH B O   1 
HETATM 1710 O O   . HOH K 4 .  ? 19.277  1.283   6.192  1.00 30.27 ? 544 HOH B O   1 
HETATM 1711 O O   . HOH K 4 .  ? 28.298  -14.556 14.831 1.00 25.18 ? 545 HOH B O   1 
HETATM 1712 O O   . HOH K 4 .  ? 12.731  -15.820 18.370 1.00 34.27 ? 546 HOH B O   1 
HETATM 1713 O O   . HOH K 4 .  ? 11.359  -18.265 19.326 1.00 19.26 ? 547 HOH B O   1 
HETATM 1714 O O   . HOH K 4 .  ? 4.848   18.772  26.973 1.00 30.70 ? 548 HOH B O   1 
HETATM 1715 O O   . HOH K 4 .  ? 5.359   -7.892  3.098  1.00 30.13 ? 549 HOH B O   1 
HETATM 1716 O O   . HOH K 4 .  ? 21.934  -9.564  7.884  1.00 33.98 ? 550 HOH B O   1 
HETATM 1717 O O   . HOH K 4 .  ? 21.705  -8.382  25.975 1.00 21.32 ? 551 HOH B O   1 
HETATM 1718 O O   . HOH K 4 .  ? 4.361   -5.704  21.835 1.00 31.04 ? 552 HOH B O   1 
HETATM 1719 O O   . HOH K 4 .  ? 2.214   -3.697  19.494 1.00 30.27 ? 553 HOH B O   1 
HETATM 1720 O O   . HOH K 4 .  ? 7.572   -7.254  21.072 1.00 26.15 ? 554 HOH B O   1 
HETATM 1721 O O   . HOH K 4 .  ? 23.317  2.697   9.340  1.00 38.02 ? 555 HOH B O   1 
HETATM 1722 O O   . HOH K 4 .  ? 29.285  -3.896  19.074 1.00 33.19 ? 556 HOH B O   1 
HETATM 1723 O O   . HOH K 4 .  ? 19.253  -18.533 20.848 1.00 36.60 ? 557 HOH B O   1 
HETATM 1724 O O   . HOH K 4 .  ? 6.358   -12.917 6.646  1.00 28.75 ? 558 HOH B O   1 
HETATM 1725 O O   . HOH K 4 .  ? 6.629   -10.934 4.530  1.00 47.36 ? 559 HOH B O   1 
HETATM 1726 O O   . HOH K 4 .  ? 6.037   -7.242  23.271 1.00 39.17 ? 560 HOH B O   1 
HETATM 1727 O O   . HOH K 4 .  ? 22.291  11.037  12.651 1.00 44.15 ? 561 HOH B O   1 
HETATM 1728 O O   . HOH K 4 .  ? 22.897  12.888  22.345 1.00 47.99 ? 562 HOH B O   1 
HETATM 1729 O O   . HOH K 4 .  ? -6.090  10.847  33.582 1.00 36.77 ? 563 HOH B O   1 
HETATM 1730 O O   . HOH K 4 .  ? 8.469   -11.163 16.064 1.00 24.69 ? 564 HOH B O   1 
HETATM 1731 O O   . HOH L 4 .  ? 4.806   -3.374  12.372 1.00 16.36 ? 11  HOH P O   1 
HETATM 1732 O O   . HOH L 4 .  ? 6.880   1.828   6.937  1.00 28.12 ? 12  HOH P O   1 
HETATM 1733 O O   . HOH L 4 .  ? 5.704   7.658   1.596  1.00 44.35 ? 13  HOH P O   1 
HETATM 1734 O O   . HOH L 4 .  ? 7.975   3.327   5.086  1.00 36.24 ? 14  HOH P O   1 
HETATM 1735 O O   . HOH L 4 .  ? -1.075  5.651   4.588  1.00 31.56 ? 15  HOH P O   1 
HETATM 1736 O O   . HOH L 4 .  ? 5.106   -15.058 16.239 1.00 34.67 ? 16  HOH P O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  1  1  PRO PRO A . n 
A 1 2  GLN 2  2  2  GLN GLN A . n 
A 1 3  ILE 3  3  3  ILE ILE A . n 
A 1 4  THR 4  4  4  THR THR A . n 
A 1 5  LEU 5  5  5  LEU LEU A . n 
A 1 6  TRP 6  6  6  TRP TRP A . n 
A 1 7  LYS 7  7  7  LYS LYS A . n 
A 1 8  ARG 8  8  8  ARG ARG A . n 
A 1 9  PRO 9  9  9  PRO PRO A . n 
A 1 10 LEU 10 10 10 LEU LEU A . n 
A 1 11 VAL 11 11 11 VAL VAL A . n 
A 1 12 THR 12 12 12 THR THR A . n 
A 1 13 ILE 13 13 13 ILE ILE A . n 
A 1 14 ARG 14 14 14 ARG ARG A . n 
A 1 15 ILE 15 15 15 ILE ILE A . n 
A 1 16 GLY 16 16 16 GLY GLY A . n 
A 1 17 GLY 17 17 17 GLY GLY A . n 
A 1 18 GLN 18 18 18 GLN GLN A . n 
A 1 19 LEU 19 19 19 LEU LEU A . n 
A 1 20 LYS 20 20 20 LYS LYS A . n 
A 1 21 GLU 21 21 21 GLU GLU A . n 
A 1 22 ALA 22 22 22 ALA ALA A . n 
A 1 23 LEU 23 23 23 LEU LEU A . n 
A 1 24 LEU 24 24 24 LEU LEU A . n 
A 1 25 ASN 25 25 25 ASN ASN A . n 
A 1 26 THR 26 26 26 THR THR A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 ALA 28 28 28 ALA ALA A . n 
A 1 29 ASP 29 29 29 ASP ASP A . n 
A 1 30 ASP 30 30 30 ASP ASP A . n 
A 1 31 THR 31 31 31 THR THR A . n 
A 1 32 VAL 32 32 32 VAL VAL A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 GLU 34 34 34 GLU GLU A . n 
A 1 35 GLU 35 35 35 GLU GLU A . n 
A 1 36 MET 36 36 36 MET MET A . n 
A 1 37 ASN 37 37 37 ASN ASN A . n 
A 1 38 LEU 38 38 38 LEU LEU A . n 
A 1 39 PRO 39 39 39 PRO PRO A . n 
A 1 40 GLY 40 40 40 GLY GLY A . n 
A 1 41 LYS 41 41 41 LYS LYS A . n 
A 1 42 TRP 42 42 42 TRP TRP A . n 
A 1 43 LYS 43 43 43 LYS LYS A . n 
A 1 44 PRO 44 44 44 PRO PRO A . n 
A 1 45 LYS 45 45 45 LYS LYS A . n 
A 1 46 MET 46 46 46 MET MET A . n 
A 1 47 ILE 47 47 47 ILE ILE A . n 
A 1 48 GLY 48 48 48 GLY GLY A . n 
A 1 49 GLY 49 49 49 GLY GLY A . n 
A 1 50 ILE 50 50 50 ILE ILE A . n 
A 1 51 GLY 51 51 51 GLY GLY A . n 
A 1 52 GLY 52 52 52 GLY GLY A . n 
A 1 53 PHE 53 53 53 PHE PHE A . n 
A 1 54 ILE 54 54 54 ILE ILE A . n 
A 1 55 LYS 55 55 55 LYS LYS A . n 
A 1 56 VAL 56 56 56 VAL VAL A . n 
A 1 57 ARG 57 57 57 ARG ARG A . n 
A 1 58 GLN 58 58 58 GLN GLN A . n 
A 1 59 TYR 59 59 59 TYR TYR A . n 
A 1 60 ASP 60 60 60 ASP ASP A . n 
A 1 61 GLN 61 61 61 GLN GLN A . n 
A 1 62 ILE 62 62 62 ILE ILE A . n 
A 1 63 PRO 63 63 63 PRO PRO A . n 
A 1 64 VAL 64 64 64 VAL VAL A . n 
A 1 65 GLU 65 65 65 GLU GLU A . n 
A 1 66 ILE 66 66 66 ILE ILE A . n 
A 1 67 CYS 67 67 67 CYS CYS A . n 
A 1 68 GLY 68 68 68 GLY GLY A . n 
A 1 69 HIS 69 69 69 HIS HIS A . n 
A 1 70 LYS 70 70 70 LYS LYS A . n 
A 1 71 ALA 71 71 71 ALA ALA A . n 
A 1 72 ILE 72 72 72 ILE ILE A . n 
A 1 73 GLY 73 73 73 GLY GLY A . n 
A 1 74 THR 74 74 74 THR THR A . n 
A 1 75 VAL 75 75 75 VAL VAL A . n 
A 1 76 LEU 76 76 76 LEU LEU A . n 
A 1 77 VAL 77 77 77 VAL VAL A . n 
A 1 78 GLY 78 78 78 GLY GLY A . n 
A 1 79 PRO 79 79 79 PRO PRO A . n 
A 1 80 THR 80 80 80 THR THR A . n 
A 1 81 PRO 81 81 81 PRO PRO A . n 
A 1 82 ALA 82 82 82 ALA ALA A . n 
A 1 83 ASN 83 83 83 ASN ASN A . n 
A 1 84 ILE 84 84 84 ILE ILE A . n 
A 1 85 ILE 85 85 85 ILE ILE A . n 
A 1 86 GLY 86 86 86 GLY GLY A . n 
A 1 87 ARG 87 87 87 ARG ARG A . n 
A 1 88 ASN 88 88 88 ASN ASN A . n 
A 1 89 LEU 89 89 89 LEU LEU A . n 
A 1 90 LEU 90 90 90 LEU LEU A . n 
A 1 91 THR 91 91 91 THR THR A . n 
A 1 92 GLN 92 92 92 GLN GLN A . n 
A 1 93 ILE 93 93 93 ILE ILE A . n 
A 1 94 GLY 94 94 94 GLY GLY A . n 
A 1 95 CYS 95 95 95 CYS CYS A . n 
A 1 96 THR 96 96 96 THR THR A . n 
A 1 97 LEU 97 97 97 LEU LEU A . n 
A 1 98 ASN 98 98 98 ASN ASN A . n 
A 1 99 PHE 99 99 99 PHE PHE A . n 
B 1 1  PRO 1  1  1  PRO PRO B . n 
B 1 2  GLN 2  2  2  GLN GLN B . n 
B 1 3  ILE 3  3  3  ILE ILE B . n 
B 1 4  THR 4  4  4  THR THR B . n 
B 1 5  LEU 5  5  5  LEU LEU B . n 
B 1 6  TRP 6  6  6  TRP TRP B . n 
B 1 7  LYS 7  7  7  LYS LYS B . n 
B 1 8  ARG 8  8  8  ARG ARG B . n 
B 1 9  PRO 9  9  9  PRO PRO B . n 
B 1 10 LEU 10 10 10 LEU LEU B . n 
B 1 11 VAL 11 11 11 VAL VAL B . n 
B 1 12 THR 12 12 12 THR THR B . n 
B 1 13 ILE 13 13 13 ILE ILE B . n 
B 1 14 ARG 14 14 14 ARG ARG B . n 
B 1 15 ILE 15 15 15 ILE ILE B . n 
B 1 16 GLY 16 16 16 GLY GLY B . n 
B 1 17 GLY 17 17 17 GLY GLY B . n 
B 1 18 GLN 18 18 18 GLN GLN B . n 
B 1 19 LEU 19 19 19 LEU LEU B . n 
B 1 20 LYS 20 20 20 LYS LYS B . n 
B 1 21 GLU 21 21 21 GLU GLU B . n 
B 1 22 ALA 22 22 22 ALA ALA B . n 
B 1 23 LEU 23 23 23 LEU LEU B . n 
B 1 24 LEU 24 24 24 LEU LEU B . n 
B 1 25 ASN 25 25 25 ASN ASN B . n 
B 1 26 THR 26 26 26 THR THR B . n 
B 1 27 GLY 27 27 27 GLY GLY B . n 
B 1 28 ALA 28 28 28 ALA ALA B . n 
B 1 29 ASP 29 29 29 ASP ASP B . n 
B 1 30 ASP 30 30 30 ASP ASP B . n 
B 1 31 THR 31 31 31 THR THR B . n 
B 1 32 VAL 32 32 32 VAL VAL B . n 
B 1 33 LEU 33 33 33 LEU LEU B . n 
B 1 34 GLU 34 34 34 GLU GLU B . n 
B 1 35 GLU 35 35 35 GLU GLU B . n 
B 1 36 MET 36 36 36 MET MET B . n 
B 1 37 ASN 37 37 37 ASN ASN B . n 
B 1 38 LEU 38 38 38 LEU LEU B . n 
B 1 39 PRO 39 39 39 PRO PRO B . n 
B 1 40 GLY 40 40 40 GLY GLY B . n 
B 1 41 LYS 41 41 41 LYS LYS B . n 
B 1 42 TRP 42 42 42 TRP TRP B . n 
B 1 43 LYS 43 43 43 LYS LYS B . n 
B 1 44 PRO 44 44 44 PRO PRO B . n 
B 1 45 LYS 45 45 45 LYS LYS B . n 
B 1 46 MET 46 46 46 MET MET B . n 
B 1 47 ILE 47 47 47 ILE ILE B . n 
B 1 48 GLY 48 48 48 GLY GLY B . n 
B 1 49 GLY 49 49 49 GLY GLY B . n 
B 1 50 ILE 50 50 50 ILE ILE B . n 
B 1 51 GLY 51 51 51 GLY GLY B . n 
B 1 52 GLY 52 52 52 GLY GLY B . n 
B 1 53 PHE 53 53 53 PHE PHE B . n 
B 1 54 ILE 54 54 54 ILE ILE B . n 
B 1 55 LYS 55 55 55 LYS LYS B . n 
B 1 56 VAL 56 56 56 VAL VAL B . n 
B 1 57 ARG 57 57 57 ARG ARG B . n 
B 1 58 GLN 58 58 58 GLN GLN B . n 
B 1 59 TYR 59 59 59 TYR TYR B . n 
B 1 60 ASP 60 60 60 ASP ASP B . n 
B 1 61 GLN 61 61 61 GLN GLN B . n 
B 1 62 ILE 62 62 62 ILE ILE B . n 
B 1 63 PRO 63 63 63 PRO PRO B . n 
B 1 64 VAL 64 64 64 VAL VAL B . n 
B 1 65 GLU 65 65 65 GLU GLU B . n 
B 1 66 ILE 66 66 66 ILE ILE B . n 
B 1 67 CYS 67 67 67 CYS CYS B . n 
B 1 68 GLY 68 68 68 GLY GLY B . n 
B 1 69 HIS 69 69 69 HIS HIS B . n 
B 1 70 LYS 70 70 70 LYS LYS B . n 
B 1 71 ALA 71 71 71 ALA ALA B . n 
B 1 72 ILE 72 72 72 ILE ILE B . n 
B 1 73 GLY 73 73 73 GLY GLY B . n 
B 1 74 THR 74 74 74 THR THR B . n 
B 1 75 VAL 75 75 75 VAL VAL B . n 
B 1 76 LEU 76 76 76 LEU LEU B . n 
B 1 77 VAL 77 77 77 VAL VAL B . n 
B 1 78 GLY 78 78 78 GLY GLY B . n 
B 1 79 PRO 79 79 79 PRO PRO B . n 
B 1 80 THR 80 80 80 THR THR B . n 
B 1 81 PRO 81 81 81 PRO PRO B . n 
B 1 82 ALA 82 82 82 ALA ALA B . n 
B 1 83 ASN 83 83 83 ASN ASN B . n 
B 1 84 ILE 84 84 84 ILE ILE B . n 
B 1 85 ILE 85 85 85 ILE ILE B . n 
B 1 86 GLY 86 86 86 GLY GLY B . n 
B 1 87 ARG 87 87 87 ARG ARG B . n 
B 1 88 ASN 88 88 88 ASN ASN B . n 
B 1 89 LEU 89 89 89 LEU LEU B . n 
B 1 90 LEU 90 90 90 LEU LEU B . n 
B 1 91 THR 91 91 91 THR THR B . n 
B 1 92 GLN 92 92 92 GLN GLN B . n 
B 1 93 ILE 93 93 93 ILE ILE B . n 
B 1 94 GLY 94 94 94 GLY GLY B . n 
B 1 95 CYS 95 95 95 CYS CYS B . n 
B 1 96 THR 96 96 96 THR THR B . n 
B 1 97 LEU 97 97 97 LEU LEU B . n 
B 1 98 ASN 98 98 98 ASN ASN B . n 
B 1 99 PHE 99 99 99 PHE PHE B . n 
C 2 1  VAL 1  1  1  VAL VAL P . n 
C 2 2  SER 2  2  2  SER SER P . n 
C 2 3  GLN 3  3  3  GLN GLN P . n 
C 2 4  ASN 4  4  4  ASN ASN P . n 
C 2 5  TYR 5  5  5  TYR TYR P . n 
C 2 6  PRO 6  6  6  PRO PRO P . n 
C 2 7  ILE 7  7  7  ILE ILE P . n 
C 2 8  VAL 8  8  8  VAL VAL P . n 
C 2 9  GLN 9  9  ?  ?   ?   P . n 
C 2 10 ASN 10 10 ?  ?   ?   P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 ACT 1  501 501 ACT ACT A . 
E 3 ACT 1  502 502 ACT ACT A . 
F 3 ACT 1  503 503 ACT ACT A . 
G 3 ACT 1  504 504 ACT ACT A . 
H 3 ACT 1  506 506 ACT ACT A . 
I 3 ACT 1  505 505 ACT ACT B . 
J 4 HOH 1  507 2   HOH HOH A . 
J 4 HOH 2  508 5   HOH HOH A . 
J 4 HOH 3  509 6   HOH HOH A . 
J 4 HOH 4  510 7   HOH HOH A . 
J 4 HOH 5  511 10  HOH HOH A . 
J 4 HOH 6  512 11  HOH HOH A . 
J 4 HOH 7  513 14  HOH HOH A . 
J 4 HOH 8  514 17  HOH HOH A . 
J 4 HOH 9  515 19  HOH HOH A . 
J 4 HOH 10 516 22  HOH HOH A . 
J 4 HOH 11 517 24  HOH HOH A . 
J 4 HOH 12 518 25  HOH HOH A . 
J 4 HOH 13 519 28  HOH HOH A . 
J 4 HOH 14 520 31  HOH HOH A . 
J 4 HOH 15 521 33  HOH HOH A . 
J 4 HOH 16 522 36  HOH HOH A . 
J 4 HOH 17 523 38  HOH HOH A . 
J 4 HOH 18 524 39  HOH HOH A . 
J 4 HOH 19 525 41  HOH HOH A . 
J 4 HOH 20 526 43  HOH HOH A . 
J 4 HOH 21 527 45  HOH HOH A . 
J 4 HOH 22 528 48  HOH HOH A . 
J 4 HOH 23 529 61  HOH HOH A . 
J 4 HOH 24 530 64  HOH HOH A . 
J 4 HOH 25 531 67  HOH HOH A . 
J 4 HOH 26 532 80  HOH HOH A . 
J 4 HOH 27 533 81  HOH HOH A . 
J 4 HOH 28 534 83  HOH HOH A . 
J 4 HOH 29 535 85  HOH HOH A . 
J 4 HOH 30 536 87  HOH HOH A . 
J 4 HOH 31 537 89  HOH HOH A . 
J 4 HOH 32 538 90  HOH HOH A . 
J 4 HOH 33 539 91  HOH HOH A . 
J 4 HOH 34 540 93  HOH HOH A . 
J 4 HOH 35 541 94  HOH HOH A . 
J 4 HOH 36 542 98  HOH HOH A . 
J 4 HOH 37 543 99  HOH HOH A . 
J 4 HOH 38 544 102 HOH HOH A . 
J 4 HOH 39 545 103 HOH HOH A . 
J 4 HOH 40 546 104 HOH HOH A . 
J 4 HOH 41 547 106 HOH HOH A . 
J 4 HOH 42 548 108 HOH HOH A . 
J 4 HOH 43 549 109 HOH HOH A . 
J 4 HOH 44 550 110 HOH HOH A . 
J 4 HOH 45 551 111 HOH HOH A . 
J 4 HOH 46 552 112 HOH HOH A . 
J 4 HOH 47 553 113 HOH HOH A . 
J 4 HOH 48 554 114 HOH HOH A . 
J 4 HOH 49 555 115 HOH HOH A . 
J 4 HOH 50 556 119 HOH HOH A . 
J 4 HOH 51 557 120 HOH HOH A . 
J 4 HOH 52 558 121 HOH HOH A . 
J 4 HOH 53 559 122 HOH HOH A . 
J 4 HOH 54 560 126 HOH HOH A . 
J 4 HOH 55 561 131 HOH HOH A . 
J 4 HOH 56 562 132 HOH HOH A . 
J 4 HOH 57 563 133 HOH HOH A . 
J 4 HOH 58 564 134 HOH HOH A . 
J 4 HOH 59 565 135 HOH HOH A . 
J 4 HOH 60 566 136 HOH HOH A . 
J 4 HOH 61 567 137 HOH HOH A . 
J 4 HOH 62 568 139 HOH HOH A . 
J 4 HOH 63 569 142 HOH HOH A . 
J 4 HOH 64 570 148 HOH HOH A . 
J 4 HOH 65 571 149 HOH HOH A . 
J 4 HOH 66 572 144 HOH HOH A . 
J 4 HOH 67 573 145 HOH HOH A . 
K 4 HOH 1  506 4   HOH HOH B . 
K 4 HOH 2  507 8   HOH HOH B . 
K 4 HOH 3  508 15  HOH HOH B . 
K 4 HOH 4  509 16  HOH HOH B . 
K 4 HOH 5  510 18  HOH HOH B . 
K 4 HOH 6  511 23  HOH HOH B . 
K 4 HOH 7  512 26  HOH HOH B . 
K 4 HOH 8  513 27  HOH HOH B . 
K 4 HOH 9  514 29  HOH HOH B . 
K 4 HOH 10 515 30  HOH HOH B . 
K 4 HOH 11 516 32  HOH HOH B . 
K 4 HOH 12 517 34  HOH HOH B . 
K 4 HOH 13 518 35  HOH HOH B . 
K 4 HOH 14 519 40  HOH HOH B . 
K 4 HOH 15 520 42  HOH HOH B . 
K 4 HOH 16 521 46  HOH HOH B . 
K 4 HOH 17 522 47  HOH HOH B . 
K 4 HOH 18 523 49  HOH HOH B . 
K 4 HOH 19 524 50  HOH HOH B . 
K 4 HOH 20 525 51  HOH HOH B . 
K 4 HOH 21 526 52  HOH HOH B . 
K 4 HOH 22 527 53  HOH HOH B . 
K 4 HOH 23 528 54  HOH HOH B . 
K 4 HOH 24 529 55  HOH HOH B . 
K 4 HOH 25 530 56  HOH HOH B . 
K 4 HOH 26 531 57  HOH HOH B . 
K 4 HOH 27 532 58  HOH HOH B . 
K 4 HOH 28 533 59  HOH HOH B . 
K 4 HOH 29 534 62  HOH HOH B . 
K 4 HOH 30 535 65  HOH HOH B . 
K 4 HOH 31 536 66  HOH HOH B . 
K 4 HOH 32 537 68  HOH HOH B . 
K 4 HOH 33 538 69  HOH HOH B . 
K 4 HOH 34 539 70  HOH HOH B . 
K 4 HOH 35 540 71  HOH HOH B . 
K 4 HOH 36 541 72  HOH HOH B . 
K 4 HOH 37 542 73  HOH HOH B . 
K 4 HOH 38 543 74  HOH HOH B . 
K 4 HOH 39 544 75  HOH HOH B . 
K 4 HOH 40 545 76  HOH HOH B . 
K 4 HOH 41 546 78  HOH HOH B . 
K 4 HOH 42 547 79  HOH HOH B . 
K 4 HOH 43 548 86  HOH HOH B . 
K 4 HOH 44 549 92  HOH HOH B . 
K 4 HOH 45 550 95  HOH HOH B . 
K 4 HOH 46 551 96  HOH HOH B . 
K 4 HOH 47 552 101 HOH HOH B . 
K 4 HOH 48 553 105 HOH HOH B . 
K 4 HOH 49 554 124 HOH HOH B . 
K 4 HOH 50 555 125 HOH HOH B . 
K 4 HOH 51 556 127 HOH HOH B . 
K 4 HOH 52 557 128 HOH HOH B . 
K 4 HOH 53 558 129 HOH HOH B . 
K 4 HOH 54 559 130 HOH HOH B . 
K 4 HOH 55 560 138 HOH HOH B . 
K 4 HOH 56 561 141 HOH HOH B . 
K 4 HOH 57 562 143 HOH HOH B . 
K 4 HOH 58 563 150 HOH HOH B . 
K 4 HOH 59 564 147 HOH HOH B . 
L 4 HOH 1  11  1   HOH HOH P . 
L 4 HOH 2  12  84  HOH HOH P . 
L 4 HOH 3  13  116 HOH HOH P . 
L 4 HOH 4  14  117 HOH HOH P . 
L 4 HOH 5  15  118 HOH HOH P . 
L 4 HOH 6  16  140 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6200 ? 
1 MORE         -35  ? 
1 'SSA (A^2)'  9280 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-01-07 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SCALEPACK 'data scaling' . ? 1 
CNS       refinement     . ? 2 
CNS       phasing        . ? 3 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    TYR 
_pdbx_validate_torsion.auth_asym_id    P 
_pdbx_validate_torsion.auth_seq_id     5 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -107.48 
_pdbx_validate_torsion.psi             48.72 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 7  ? CG  ? A LYS 7  CG  
2  1 Y 1 A LYS 7  ? CD  ? A LYS 7  CD  
3  1 Y 1 A LYS 7  ? CE  ? A LYS 7  CE  
4  1 Y 1 A LYS 7  ? NZ  ? A LYS 7  NZ  
5  1 Y 1 A GLU 21 ? CG  ? A GLU 21 CG  
6  1 Y 1 A GLU 21 ? CD  ? A GLU 21 CD  
7  1 Y 1 A GLU 21 ? OE1 ? A GLU 21 OE1 
8  1 Y 1 A GLU 21 ? OE2 ? A GLU 21 OE2 
9  1 Y 1 A ASN 37 ? CG  ? A ASN 37 CG  
10 1 Y 1 A ASN 37 ? OD1 ? A ASN 37 OD1 
11 1 Y 1 A ASN 37 ? ND2 ? A ASN 37 ND2 
12 1 Y 1 A LYS 41 ? CG  ? A LYS 41 CG  
13 1 Y 1 A LYS 41 ? CD  ? A LYS 41 CD  
14 1 Y 1 A LYS 41 ? CE  ? A LYS 41 CE  
15 1 Y 1 A LYS 41 ? NZ  ? A LYS 41 NZ  
16 1 Y 1 A LYS 43 ? CG  ? A LYS 43 CG  
17 1 Y 1 A LYS 43 ? CD  ? A LYS 43 CD  
18 1 Y 1 A LYS 43 ? CE  ? A LYS 43 CE  
19 1 Y 1 A LYS 43 ? NZ  ? A LYS 43 NZ  
20 1 Y 1 A LYS 70 ? CG  ? A LYS 70 CG  
21 1 Y 1 A LYS 70 ? CD  ? A LYS 70 CD  
22 1 Y 1 A LYS 70 ? CE  ? A LYS 70 CE  
23 1 Y 1 A LYS 70 ? NZ  ? A LYS 70 NZ  
24 1 Y 1 B LYS 41 ? CG  ? B LYS 41 CG  
25 1 Y 1 B LYS 41 ? CD  ? B LYS 41 CD  
26 1 Y 1 B LYS 41 ? CE  ? B LYS 41 CE  
27 1 Y 1 B LYS 41 ? NZ  ? B LYS 41 NZ  
28 1 Y 1 B LYS 43 ? CG  ? B LYS 43 CG  
29 1 Y 1 B LYS 43 ? CD  ? B LYS 43 CD  
30 1 Y 1 B LYS 43 ? CE  ? B LYS 43 CE  
31 1 Y 1 B LYS 43 ? NZ  ? B LYS 43 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 P GLN 9  ? C GLN 9  
2 1 Y 1 P ASN 10 ? C ASN 10 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ACETATE ION' ACT 
4 water         HOH 
#