data_1MUK
# 
_entry.id   1MUK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1MUK         
RCSB  RCSB017193   
WWPDB D_1000017193 
# 
_pdbx_database_status.entry_id                        1MUK 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2002-09-24 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tao, Y.'        1 
'Farsetta, D.L.' 2 
'Nibert, M.L.'   3 
'Harrison, S.C.' 4 
# 
_citation.id                        primary 
_citation.title                     'RNA Synthesis in a Cage-Structural Studies of Reovirus Polymerase lambda3' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            111 
_citation.page_first                733 
_citation.page_last                 745 
_citation.year                      2002 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12464184 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(02)01110-8' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tao, Y.'        1 
primary 'Farsetta, D.L.' 2 
primary 'Nibert, M.L.'   3 
primary 'Harrison, S.C.' 4 
# 
_cell.entry_id           1MUK 
_cell.length_a           70.874 
_cell.length_b           85.162 
_cell.length_c           248.641 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
# 
_symmetry.entry_id                         1MUK 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'MINOR CORE PROTEIN LAMBDA 3' 142423.797 1   ? ? ? ? 
2 water   nat water                         18.015     549 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSSMILTQFGPFIESISGITDQSNDVFEDAAKAFSMFTRSDVYKALDEIPFSDDAMLPIPPTIYTKPSHDSYYYIDALNR
VRRKTYQGPDDVYVPNCSIVELLEPHETLTSYGRLSEAIENRAKDGDSQARIATTYGRIAESQARQIKAPLEKFVLALLV
AEAGGSLYDPVLQKYDEIPDLSHNCPLWCFREICRHISGPLPDRAPYLYLSAGVFWLMSPRMTSAIPPLLSDLVNLAILQ
QTAGLDPSLVKLGVQICLHAAASSSYSWFILKTKSIFPQNTLHSMYESLEGGYCPNLEWLEPRSDYKFMYMGVMPLSAKY
ARSAPSNDKKARELGEKYGLSSVVGELRKRTKTYVKHDFASVRYIRDAMACTSGIFLVRTPTETVLQEYTQSPEIKVPIP
QKDWTGPIGEIRILKDTTSSIARYLYRTWYLAAARMAAQPRTWDPLFQAIMRSQYVTARGGSGAALRESLYAINVSLPDF
KGLPVKAATKIFQAAQLANLPFSHTSVAILADTSMGLRNQVQRRPRSIMPLNVPQQQVSAPHTLTADYINYHMNLSPTSG
SAVIEKVIPLGVYASSPPNQSINIDISACDASITWDFFLSVIMAAIHEGVASSSIGKPFMGVPASIVNDESVVGVRAARP
ISGMQNMIQHLSKLYKRGFSYRVNDSFSPGNDFTHMTTTFPSGSTATSTEHTANNSTMMETFLTVWGPEHTDDPDVLRLM
KSLTIQRNYVCQGDDGLMIIDGTTAGKVNSETIQNDLELISKYGEEFGWKYDIAYDGTAEYLKLYFIFGCRIPNLSRHPI
VGKERANSSAEEPWPAILDQIMGVFFNGVHDGLQWQRWIRYSWALCCAFSRQRTMIGESVGYLQYPMWSFVYWGLPLVKA
FGSDPWIFSWYMPTGDLGMYSWISLIRPLMTRWMVANGYVTDRCSTVFGNADYRRCFNELKLYQGYYMAQLPRNPKKSGR
AASREVREQFTQALSDYLMQNPELKSRVLRGRSEWEKYGAGIIHNPPSLFDVPHKWYQGAQEAAIATREELAEMDETLMR
ARRHSYSSFSKLLEAYLLVKWRMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGPMLQSTRKYFAQTLFMAKTVSGLD
VNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLL
PKDGRHLNTDIPPRMGWLRAILRFLGAGMVMTATGVAVDIYLEDIHGGGRSLGQRFMTWMRQEGRSA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSSMILTQFGPFIESISGITDQSNDVFEDAAKAFSMFTRSDVYKALDEIPFSDDAMLPIPPTIYTKPSHDSYYYIDALNR
VRRKTYQGPDDVYVPNCSIVELLEPHETLTSYGRLSEAIENRAKDGDSQARIATTYGRIAESQARQIKAPLEKFVLALLV
AEAGGSLYDPVLQKYDEIPDLSHNCPLWCFREICRHISGPLPDRAPYLYLSAGVFWLMSPRMTSAIPPLLSDLVNLAILQ
QTAGLDPSLVKLGVQICLHAAASSSYSWFILKTKSIFPQNTLHSMYESLEGGYCPNLEWLEPRSDYKFMYMGVMPLSAKY
ARSAPSNDKKARELGEKYGLSSVVGELRKRTKTYVKHDFASVRYIRDAMACTSGIFLVRTPTETVLQEYTQSPEIKVPIP
QKDWTGPIGEIRILKDTTSSIARYLYRTWYLAAARMAAQPRTWDPLFQAIMRSQYVTARGGSGAALRESLYAINVSLPDF
KGLPVKAATKIFQAAQLANLPFSHTSVAILADTSMGLRNQVQRRPRSIMPLNVPQQQVSAPHTLTADYINYHMNLSPTSG
SAVIEKVIPLGVYASSPPNQSINIDISACDASITWDFFLSVIMAAIHEGVASSSIGKPFMGVPASIVNDESVVGVRAARP
ISGMQNMIQHLSKLYKRGFSYRVNDSFSPGNDFTHMTTTFPSGSTATSTEHTANNSTMMETFLTVWGPEHTDDPDVLRLM
KSLTIQRNYVCQGDDGLMIIDGTTAGKVNSETIQNDLELISKYGEEFGWKYDIAYDGTAEYLKLYFIFGCRIPNLSRHPI
VGKERANSSAEEPWPAILDQIMGVFFNGVHDGLQWQRWIRYSWALCCAFSRQRTMIGESVGYLQYPMWSFVYWGLPLVKA
FGSDPWIFSWYMPTGDLGMYSWISLIRPLMTRWMVANGYVTDRCSTVFGNADYRRCFNELKLYQGYYMAQLPRNPKKSGR
AASREVREQFTQALSDYLMQNPELKSRVLRGRSEWEKYGAGIIHNPPSLFDVPHKWYQGAQEAAIATREELAEMDETLMR
ARRHSYSSFSKLLEAYLLVKWRMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGPMLQSTRKYFAQTLFMAKTVSGLD
VNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLL
PKDGRHLNTDIPPRMGWLRAILRFLGAGMVMTATGVAVDIYLEDIHGGGRSLGQRFMTWMRQEGRSA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    SER n 
1 3    SER n 
1 4    MET n 
1 5    ILE n 
1 6    LEU n 
1 7    THR n 
1 8    GLN n 
1 9    PHE n 
1 10   GLY n 
1 11   PRO n 
1 12   PHE n 
1 13   ILE n 
1 14   GLU n 
1 15   SER n 
1 16   ILE n 
1 17   SER n 
1 18   GLY n 
1 19   ILE n 
1 20   THR n 
1 21   ASP n 
1 22   GLN n 
1 23   SER n 
1 24   ASN n 
1 25   ASP n 
1 26   VAL n 
1 27   PHE n 
1 28   GLU n 
1 29   ASP n 
1 30   ALA n 
1 31   ALA n 
1 32   LYS n 
1 33   ALA n 
1 34   PHE n 
1 35   SER n 
1 36   MET n 
1 37   PHE n 
1 38   THR n 
1 39   ARG n 
1 40   SER n 
1 41   ASP n 
1 42   VAL n 
1 43   TYR n 
1 44   LYS n 
1 45   ALA n 
1 46   LEU n 
1 47   ASP n 
1 48   GLU n 
1 49   ILE n 
1 50   PRO n 
1 51   PHE n 
1 52   SER n 
1 53   ASP n 
1 54   ASP n 
1 55   ALA n 
1 56   MET n 
1 57   LEU n 
1 58   PRO n 
1 59   ILE n 
1 60   PRO n 
1 61   PRO n 
1 62   THR n 
1 63   ILE n 
1 64   TYR n 
1 65   THR n 
1 66   LYS n 
1 67   PRO n 
1 68   SER n 
1 69   HIS n 
1 70   ASP n 
1 71   SER n 
1 72   TYR n 
1 73   TYR n 
1 74   TYR n 
1 75   ILE n 
1 76   ASP n 
1 77   ALA n 
1 78   LEU n 
1 79   ASN n 
1 80   ARG n 
1 81   VAL n 
1 82   ARG n 
1 83   ARG n 
1 84   LYS n 
1 85   THR n 
1 86   TYR n 
1 87   GLN n 
1 88   GLY n 
1 89   PRO n 
1 90   ASP n 
1 91   ASP n 
1 92   VAL n 
1 93   TYR n 
1 94   VAL n 
1 95   PRO n 
1 96   ASN n 
1 97   CYS n 
1 98   SER n 
1 99   ILE n 
1 100  VAL n 
1 101  GLU n 
1 102  LEU n 
1 103  LEU n 
1 104  GLU n 
1 105  PRO n 
1 106  HIS n 
1 107  GLU n 
1 108  THR n 
1 109  LEU n 
1 110  THR n 
1 111  SER n 
1 112  TYR n 
1 113  GLY n 
1 114  ARG n 
1 115  LEU n 
1 116  SER n 
1 117  GLU n 
1 118  ALA n 
1 119  ILE n 
1 120  GLU n 
1 121  ASN n 
1 122  ARG n 
1 123  ALA n 
1 124  LYS n 
1 125  ASP n 
1 126  GLY n 
1 127  ASP n 
1 128  SER n 
1 129  GLN n 
1 130  ALA n 
1 131  ARG n 
1 132  ILE n 
1 133  ALA n 
1 134  THR n 
1 135  THR n 
1 136  TYR n 
1 137  GLY n 
1 138  ARG n 
1 139  ILE n 
1 140  ALA n 
1 141  GLU n 
1 142  SER n 
1 143  GLN n 
1 144  ALA n 
1 145  ARG n 
1 146  GLN n 
1 147  ILE n 
1 148  LYS n 
1 149  ALA n 
1 150  PRO n 
1 151  LEU n 
1 152  GLU n 
1 153  LYS n 
1 154  PHE n 
1 155  VAL n 
1 156  LEU n 
1 157  ALA n 
1 158  LEU n 
1 159  LEU n 
1 160  VAL n 
1 161  ALA n 
1 162  GLU n 
1 163  ALA n 
1 164  GLY n 
1 165  GLY n 
1 166  SER n 
1 167  LEU n 
1 168  TYR n 
1 169  ASP n 
1 170  PRO n 
1 171  VAL n 
1 172  LEU n 
1 173  GLN n 
1 174  LYS n 
1 175  TYR n 
1 176  ASP n 
1 177  GLU n 
1 178  ILE n 
1 179  PRO n 
1 180  ASP n 
1 181  LEU n 
1 182  SER n 
1 183  HIS n 
1 184  ASN n 
1 185  CYS n 
1 186  PRO n 
1 187  LEU n 
1 188  TRP n 
1 189  CYS n 
1 190  PHE n 
1 191  ARG n 
1 192  GLU n 
1 193  ILE n 
1 194  CYS n 
1 195  ARG n 
1 196  HIS n 
1 197  ILE n 
1 198  SER n 
1 199  GLY n 
1 200  PRO n 
1 201  LEU n 
1 202  PRO n 
1 203  ASP n 
1 204  ARG n 
1 205  ALA n 
1 206  PRO n 
1 207  TYR n 
1 208  LEU n 
1 209  TYR n 
1 210  LEU n 
1 211  SER n 
1 212  ALA n 
1 213  GLY n 
1 214  VAL n 
1 215  PHE n 
1 216  TRP n 
1 217  LEU n 
1 218  MET n 
1 219  SER n 
1 220  PRO n 
1 221  ARG n 
1 222  MET n 
1 223  THR n 
1 224  SER n 
1 225  ALA n 
1 226  ILE n 
1 227  PRO n 
1 228  PRO n 
1 229  LEU n 
1 230  LEU n 
1 231  SER n 
1 232  ASP n 
1 233  LEU n 
1 234  VAL n 
1 235  ASN n 
1 236  LEU n 
1 237  ALA n 
1 238  ILE n 
1 239  LEU n 
1 240  GLN n 
1 241  GLN n 
1 242  THR n 
1 243  ALA n 
1 244  GLY n 
1 245  LEU n 
1 246  ASP n 
1 247  PRO n 
1 248  SER n 
1 249  LEU n 
1 250  VAL n 
1 251  LYS n 
1 252  LEU n 
1 253  GLY n 
1 254  VAL n 
1 255  GLN n 
1 256  ILE n 
1 257  CYS n 
1 258  LEU n 
1 259  HIS n 
1 260  ALA n 
1 261  ALA n 
1 262  ALA n 
1 263  SER n 
1 264  SER n 
1 265  SER n 
1 266  TYR n 
1 267  SER n 
1 268  TRP n 
1 269  PHE n 
1 270  ILE n 
1 271  LEU n 
1 272  LYS n 
1 273  THR n 
1 274  LYS n 
1 275  SER n 
1 276  ILE n 
1 277  PHE n 
1 278  PRO n 
1 279  GLN n 
1 280  ASN n 
1 281  THR n 
1 282  LEU n 
1 283  HIS n 
1 284  SER n 
1 285  MET n 
1 286  TYR n 
1 287  GLU n 
1 288  SER n 
1 289  LEU n 
1 290  GLU n 
1 291  GLY n 
1 292  GLY n 
1 293  TYR n 
1 294  CYS n 
1 295  PRO n 
1 296  ASN n 
1 297  LEU n 
1 298  GLU n 
1 299  TRP n 
1 300  LEU n 
1 301  GLU n 
1 302  PRO n 
1 303  ARG n 
1 304  SER n 
1 305  ASP n 
1 306  TYR n 
1 307  LYS n 
1 308  PHE n 
1 309  MET n 
1 310  TYR n 
1 311  MET n 
1 312  GLY n 
1 313  VAL n 
1 314  MET n 
1 315  PRO n 
1 316  LEU n 
1 317  SER n 
1 318  ALA n 
1 319  LYS n 
1 320  TYR n 
1 321  ALA n 
1 322  ARG n 
1 323  SER n 
1 324  ALA n 
1 325  PRO n 
1 326  SER n 
1 327  ASN n 
1 328  ASP n 
1 329  LYS n 
1 330  LYS n 
1 331  ALA n 
1 332  ARG n 
1 333  GLU n 
1 334  LEU n 
1 335  GLY n 
1 336  GLU n 
1 337  LYS n 
1 338  TYR n 
1 339  GLY n 
1 340  LEU n 
1 341  SER n 
1 342  SER n 
1 343  VAL n 
1 344  VAL n 
1 345  GLY n 
1 346  GLU n 
1 347  LEU n 
1 348  ARG n 
1 349  LYS n 
1 350  ARG n 
1 351  THR n 
1 352  LYS n 
1 353  THR n 
1 354  TYR n 
1 355  VAL n 
1 356  LYS n 
1 357  HIS n 
1 358  ASP n 
1 359  PHE n 
1 360  ALA n 
1 361  SER n 
1 362  VAL n 
1 363  ARG n 
1 364  TYR n 
1 365  ILE n 
1 366  ARG n 
1 367  ASP n 
1 368  ALA n 
1 369  MET n 
1 370  ALA n 
1 371  CYS n 
1 372  THR n 
1 373  SER n 
1 374  GLY n 
1 375  ILE n 
1 376  PHE n 
1 377  LEU n 
1 378  VAL n 
1 379  ARG n 
1 380  THR n 
1 381  PRO n 
1 382  THR n 
1 383  GLU n 
1 384  THR n 
1 385  VAL n 
1 386  LEU n 
1 387  GLN n 
1 388  GLU n 
1 389  TYR n 
1 390  THR n 
1 391  GLN n 
1 392  SER n 
1 393  PRO n 
1 394  GLU n 
1 395  ILE n 
1 396  LYS n 
1 397  VAL n 
1 398  PRO n 
1 399  ILE n 
1 400  PRO n 
1 401  GLN n 
1 402  LYS n 
1 403  ASP n 
1 404  TRP n 
1 405  THR n 
1 406  GLY n 
1 407  PRO n 
1 408  ILE n 
1 409  GLY n 
1 410  GLU n 
1 411  ILE n 
1 412  ARG n 
1 413  ILE n 
1 414  LEU n 
1 415  LYS n 
1 416  ASP n 
1 417  THR n 
1 418  THR n 
1 419  SER n 
1 420  SER n 
1 421  ILE n 
1 422  ALA n 
1 423  ARG n 
1 424  TYR n 
1 425  LEU n 
1 426  TYR n 
1 427  ARG n 
1 428  THR n 
1 429  TRP n 
1 430  TYR n 
1 431  LEU n 
1 432  ALA n 
1 433  ALA n 
1 434  ALA n 
1 435  ARG n 
1 436  MET n 
1 437  ALA n 
1 438  ALA n 
1 439  GLN n 
1 440  PRO n 
1 441  ARG n 
1 442  THR n 
1 443  TRP n 
1 444  ASP n 
1 445  PRO n 
1 446  LEU n 
1 447  PHE n 
1 448  GLN n 
1 449  ALA n 
1 450  ILE n 
1 451  MET n 
1 452  ARG n 
1 453  SER n 
1 454  GLN n 
1 455  TYR n 
1 456  VAL n 
1 457  THR n 
1 458  ALA n 
1 459  ARG n 
1 460  GLY n 
1 461  GLY n 
1 462  SER n 
1 463  GLY n 
1 464  ALA n 
1 465  ALA n 
1 466  LEU n 
1 467  ARG n 
1 468  GLU n 
1 469  SER n 
1 470  LEU n 
1 471  TYR n 
1 472  ALA n 
1 473  ILE n 
1 474  ASN n 
1 475  VAL n 
1 476  SER n 
1 477  LEU n 
1 478  PRO n 
1 479  ASP n 
1 480  PHE n 
1 481  LYS n 
1 482  GLY n 
1 483  LEU n 
1 484  PRO n 
1 485  VAL n 
1 486  LYS n 
1 487  ALA n 
1 488  ALA n 
1 489  THR n 
1 490  LYS n 
1 491  ILE n 
1 492  PHE n 
1 493  GLN n 
1 494  ALA n 
1 495  ALA n 
1 496  GLN n 
1 497  LEU n 
1 498  ALA n 
1 499  ASN n 
1 500  LEU n 
1 501  PRO n 
1 502  PHE n 
1 503  SER n 
1 504  HIS n 
1 505  THR n 
1 506  SER n 
1 507  VAL n 
1 508  ALA n 
1 509  ILE n 
1 510  LEU n 
1 511  ALA n 
1 512  ASP n 
1 513  THR n 
1 514  SER n 
1 515  MET n 
1 516  GLY n 
1 517  LEU n 
1 518  ARG n 
1 519  ASN n 
1 520  GLN n 
1 521  VAL n 
1 522  GLN n 
1 523  ARG n 
1 524  ARG n 
1 525  PRO n 
1 526  ARG n 
1 527  SER n 
1 528  ILE n 
1 529  MET n 
1 530  PRO n 
1 531  LEU n 
1 532  ASN n 
1 533  VAL n 
1 534  PRO n 
1 535  GLN n 
1 536  GLN n 
1 537  GLN n 
1 538  VAL n 
1 539  SER n 
1 540  ALA n 
1 541  PRO n 
1 542  HIS n 
1 543  THR n 
1 544  LEU n 
1 545  THR n 
1 546  ALA n 
1 547  ASP n 
1 548  TYR n 
1 549  ILE n 
1 550  ASN n 
1 551  TYR n 
1 552  HIS n 
1 553  MET n 
1 554  ASN n 
1 555  LEU n 
1 556  SER n 
1 557  PRO n 
1 558  THR n 
1 559  SER n 
1 560  GLY n 
1 561  SER n 
1 562  ALA n 
1 563  VAL n 
1 564  ILE n 
1 565  GLU n 
1 566  LYS n 
1 567  VAL n 
1 568  ILE n 
1 569  PRO n 
1 570  LEU n 
1 571  GLY n 
1 572  VAL n 
1 573  TYR n 
1 574  ALA n 
1 575  SER n 
1 576  SER n 
1 577  PRO n 
1 578  PRO n 
1 579  ASN n 
1 580  GLN n 
1 581  SER n 
1 582  ILE n 
1 583  ASN n 
1 584  ILE n 
1 585  ASP n 
1 586  ILE n 
1 587  SER n 
1 588  ALA n 
1 589  CYS n 
1 590  ASP n 
1 591  ALA n 
1 592  SER n 
1 593  ILE n 
1 594  THR n 
1 595  TRP n 
1 596  ASP n 
1 597  PHE n 
1 598  PHE n 
1 599  LEU n 
1 600  SER n 
1 601  VAL n 
1 602  ILE n 
1 603  MET n 
1 604  ALA n 
1 605  ALA n 
1 606  ILE n 
1 607  HIS n 
1 608  GLU n 
1 609  GLY n 
1 610  VAL n 
1 611  ALA n 
1 612  SER n 
1 613  SER n 
1 614  SER n 
1 615  ILE n 
1 616  GLY n 
1 617  LYS n 
1 618  PRO n 
1 619  PHE n 
1 620  MET n 
1 621  GLY n 
1 622  VAL n 
1 623  PRO n 
1 624  ALA n 
1 625  SER n 
1 626  ILE n 
1 627  VAL n 
1 628  ASN n 
1 629  ASP n 
1 630  GLU n 
1 631  SER n 
1 632  VAL n 
1 633  VAL n 
1 634  GLY n 
1 635  VAL n 
1 636  ARG n 
1 637  ALA n 
1 638  ALA n 
1 639  ARG n 
1 640  PRO n 
1 641  ILE n 
1 642  SER n 
1 643  GLY n 
1 644  MET n 
1 645  GLN n 
1 646  ASN n 
1 647  MET n 
1 648  ILE n 
1 649  GLN n 
1 650  HIS n 
1 651  LEU n 
1 652  SER n 
1 653  LYS n 
1 654  LEU n 
1 655  TYR n 
1 656  LYS n 
1 657  ARG n 
1 658  GLY n 
1 659  PHE n 
1 660  SER n 
1 661  TYR n 
1 662  ARG n 
1 663  VAL n 
1 664  ASN n 
1 665  ASP n 
1 666  SER n 
1 667  PHE n 
1 668  SER n 
1 669  PRO n 
1 670  GLY n 
1 671  ASN n 
1 672  ASP n 
1 673  PHE n 
1 674  THR n 
1 675  HIS n 
1 676  MET n 
1 677  THR n 
1 678  THR n 
1 679  THR n 
1 680  PHE n 
1 681  PRO n 
1 682  SER n 
1 683  GLY n 
1 684  SER n 
1 685  THR n 
1 686  ALA n 
1 687  THR n 
1 688  SER n 
1 689  THR n 
1 690  GLU n 
1 691  HIS n 
1 692  THR n 
1 693  ALA n 
1 694  ASN n 
1 695  ASN n 
1 696  SER n 
1 697  THR n 
1 698  MET n 
1 699  MET n 
1 700  GLU n 
1 701  THR n 
1 702  PHE n 
1 703  LEU n 
1 704  THR n 
1 705  VAL n 
1 706  TRP n 
1 707  GLY n 
1 708  PRO n 
1 709  GLU n 
1 710  HIS n 
1 711  THR n 
1 712  ASP n 
1 713  ASP n 
1 714  PRO n 
1 715  ASP n 
1 716  VAL n 
1 717  LEU n 
1 718  ARG n 
1 719  LEU n 
1 720  MET n 
1 721  LYS n 
1 722  SER n 
1 723  LEU n 
1 724  THR n 
1 725  ILE n 
1 726  GLN n 
1 727  ARG n 
1 728  ASN n 
1 729  TYR n 
1 730  VAL n 
1 731  CYS n 
1 732  GLN n 
1 733  GLY n 
1 734  ASP n 
1 735  ASP n 
1 736  GLY n 
1 737  LEU n 
1 738  MET n 
1 739  ILE n 
1 740  ILE n 
1 741  ASP n 
1 742  GLY n 
1 743  THR n 
1 744  THR n 
1 745  ALA n 
1 746  GLY n 
1 747  LYS n 
1 748  VAL n 
1 749  ASN n 
1 750  SER n 
1 751  GLU n 
1 752  THR n 
1 753  ILE n 
1 754  GLN n 
1 755  ASN n 
1 756  ASP n 
1 757  LEU n 
1 758  GLU n 
1 759  LEU n 
1 760  ILE n 
1 761  SER n 
1 762  LYS n 
1 763  TYR n 
1 764  GLY n 
1 765  GLU n 
1 766  GLU n 
1 767  PHE n 
1 768  GLY n 
1 769  TRP n 
1 770  LYS n 
1 771  TYR n 
1 772  ASP n 
1 773  ILE n 
1 774  ALA n 
1 775  TYR n 
1 776  ASP n 
1 777  GLY n 
1 778  THR n 
1 779  ALA n 
1 780  GLU n 
1 781  TYR n 
1 782  LEU n 
1 783  LYS n 
1 784  LEU n 
1 785  TYR n 
1 786  PHE n 
1 787  ILE n 
1 788  PHE n 
1 789  GLY n 
1 790  CYS n 
1 791  ARG n 
1 792  ILE n 
1 793  PRO n 
1 794  ASN n 
1 795  LEU n 
1 796  SER n 
1 797  ARG n 
1 798  HIS n 
1 799  PRO n 
1 800  ILE n 
1 801  VAL n 
1 802  GLY n 
1 803  LYS n 
1 804  GLU n 
1 805  ARG n 
1 806  ALA n 
1 807  ASN n 
1 808  SER n 
1 809  SER n 
1 810  ALA n 
1 811  GLU n 
1 812  GLU n 
1 813  PRO n 
1 814  TRP n 
1 815  PRO n 
1 816  ALA n 
1 817  ILE n 
1 818  LEU n 
1 819  ASP n 
1 820  GLN n 
1 821  ILE n 
1 822  MET n 
1 823  GLY n 
1 824  VAL n 
1 825  PHE n 
1 826  PHE n 
1 827  ASN n 
1 828  GLY n 
1 829  VAL n 
1 830  HIS n 
1 831  ASP n 
1 832  GLY n 
1 833  LEU n 
1 834  GLN n 
1 835  TRP n 
1 836  GLN n 
1 837  ARG n 
1 838  TRP n 
1 839  ILE n 
1 840  ARG n 
1 841  TYR n 
1 842  SER n 
1 843  TRP n 
1 844  ALA n 
1 845  LEU n 
1 846  CYS n 
1 847  CYS n 
1 848  ALA n 
1 849  PHE n 
1 850  SER n 
1 851  ARG n 
1 852  GLN n 
1 853  ARG n 
1 854  THR n 
1 855  MET n 
1 856  ILE n 
1 857  GLY n 
1 858  GLU n 
1 859  SER n 
1 860  VAL n 
1 861  GLY n 
1 862  TYR n 
1 863  LEU n 
1 864  GLN n 
1 865  TYR n 
1 866  PRO n 
1 867  MET n 
1 868  TRP n 
1 869  SER n 
1 870  PHE n 
1 871  VAL n 
1 872  TYR n 
1 873  TRP n 
1 874  GLY n 
1 875  LEU n 
1 876  PRO n 
1 877  LEU n 
1 878  VAL n 
1 879  LYS n 
1 880  ALA n 
1 881  PHE n 
1 882  GLY n 
1 883  SER n 
1 884  ASP n 
1 885  PRO n 
1 886  TRP n 
1 887  ILE n 
1 888  PHE n 
1 889  SER n 
1 890  TRP n 
1 891  TYR n 
1 892  MET n 
1 893  PRO n 
1 894  THR n 
1 895  GLY n 
1 896  ASP n 
1 897  LEU n 
1 898  GLY n 
1 899  MET n 
1 900  TYR n 
1 901  SER n 
1 902  TRP n 
1 903  ILE n 
1 904  SER n 
1 905  LEU n 
1 906  ILE n 
1 907  ARG n 
1 908  PRO n 
1 909  LEU n 
1 910  MET n 
1 911  THR n 
1 912  ARG n 
1 913  TRP n 
1 914  MET n 
1 915  VAL n 
1 916  ALA n 
1 917  ASN n 
1 918  GLY n 
1 919  TYR n 
1 920  VAL n 
1 921  THR n 
1 922  ASP n 
1 923  ARG n 
1 924  CYS n 
1 925  SER n 
1 926  THR n 
1 927  VAL n 
1 928  PHE n 
1 929  GLY n 
1 930  ASN n 
1 931  ALA n 
1 932  ASP n 
1 933  TYR n 
1 934  ARG n 
1 935  ARG n 
1 936  CYS n 
1 937  PHE n 
1 938  ASN n 
1 939  GLU n 
1 940  LEU n 
1 941  LYS n 
1 942  LEU n 
1 943  TYR n 
1 944  GLN n 
1 945  GLY n 
1 946  TYR n 
1 947  TYR n 
1 948  MET n 
1 949  ALA n 
1 950  GLN n 
1 951  LEU n 
1 952  PRO n 
1 953  ARG n 
1 954  ASN n 
1 955  PRO n 
1 956  LYS n 
1 957  LYS n 
1 958  SER n 
1 959  GLY n 
1 960  ARG n 
1 961  ALA n 
1 962  ALA n 
1 963  SER n 
1 964  ARG n 
1 965  GLU n 
1 966  VAL n 
1 967  ARG n 
1 968  GLU n 
1 969  GLN n 
1 970  PHE n 
1 971  THR n 
1 972  GLN n 
1 973  ALA n 
1 974  LEU n 
1 975  SER n 
1 976  ASP n 
1 977  TYR n 
1 978  LEU n 
1 979  MET n 
1 980  GLN n 
1 981  ASN n 
1 982  PRO n 
1 983  GLU n 
1 984  LEU n 
1 985  LYS n 
1 986  SER n 
1 987  ARG n 
1 988  VAL n 
1 989  LEU n 
1 990  ARG n 
1 991  GLY n 
1 992  ARG n 
1 993  SER n 
1 994  GLU n 
1 995  TRP n 
1 996  GLU n 
1 997  LYS n 
1 998  TYR n 
1 999  GLY n 
1 1000 ALA n 
1 1001 GLY n 
1 1002 ILE n 
1 1003 ILE n 
1 1004 HIS n 
1 1005 ASN n 
1 1006 PRO n 
1 1007 PRO n 
1 1008 SER n 
1 1009 LEU n 
1 1010 PHE n 
1 1011 ASP n 
1 1012 VAL n 
1 1013 PRO n 
1 1014 HIS n 
1 1015 LYS n 
1 1016 TRP n 
1 1017 TYR n 
1 1018 GLN n 
1 1019 GLY n 
1 1020 ALA n 
1 1021 GLN n 
1 1022 GLU n 
1 1023 ALA n 
1 1024 ALA n 
1 1025 ILE n 
1 1026 ALA n 
1 1027 THR n 
1 1028 ARG n 
1 1029 GLU n 
1 1030 GLU n 
1 1031 LEU n 
1 1032 ALA n 
1 1033 GLU n 
1 1034 MET n 
1 1035 ASP n 
1 1036 GLU n 
1 1037 THR n 
1 1038 LEU n 
1 1039 MET n 
1 1040 ARG n 
1 1041 ALA n 
1 1042 ARG n 
1 1043 ARG n 
1 1044 HIS n 
1 1045 SER n 
1 1046 TYR n 
1 1047 SER n 
1 1048 SER n 
1 1049 PHE n 
1 1050 SER n 
1 1051 LYS n 
1 1052 LEU n 
1 1053 LEU n 
1 1054 GLU n 
1 1055 ALA n 
1 1056 TYR n 
1 1057 LEU n 
1 1058 LEU n 
1 1059 VAL n 
1 1060 LYS n 
1 1061 TRP n 
1 1062 ARG n 
1 1063 MET n 
1 1064 CYS n 
1 1065 GLU n 
1 1066 ALA n 
1 1067 ARG n 
1 1068 GLU n 
1 1069 PRO n 
1 1070 SER n 
1 1071 VAL n 
1 1072 ASP n 
1 1073 LEU n 
1 1074 ARG n 
1 1075 LEU n 
1 1076 PRO n 
1 1077 LEU n 
1 1078 CYS n 
1 1079 ALA n 
1 1080 GLY n 
1 1081 ILE n 
1 1082 ASP n 
1 1083 PRO n 
1 1084 LEU n 
1 1085 ASN n 
1 1086 SER n 
1 1087 ASP n 
1 1088 PRO n 
1 1089 PHE n 
1 1090 LEU n 
1 1091 LYS n 
1 1092 MET n 
1 1093 VAL n 
1 1094 SER n 
1 1095 VAL n 
1 1096 GLY n 
1 1097 PRO n 
1 1098 MET n 
1 1099 LEU n 
1 1100 GLN n 
1 1101 SER n 
1 1102 THR n 
1 1103 ARG n 
1 1104 LYS n 
1 1105 TYR n 
1 1106 PHE n 
1 1107 ALA n 
1 1108 GLN n 
1 1109 THR n 
1 1110 LEU n 
1 1111 PHE n 
1 1112 MET n 
1 1113 ALA n 
1 1114 LYS n 
1 1115 THR n 
1 1116 VAL n 
1 1117 SER n 
1 1118 GLY n 
1 1119 LEU n 
1 1120 ASP n 
1 1121 VAL n 
1 1122 ASN n 
1 1123 ALA n 
1 1124 ILE n 
1 1125 ASP n 
1 1126 SER n 
1 1127 ALA n 
1 1128 LEU n 
1 1129 LEU n 
1 1130 ARG n 
1 1131 LEU n 
1 1132 ARG n 
1 1133 THR n 
1 1134 LEU n 
1 1135 GLY n 
1 1136 ALA n 
1 1137 ASP n 
1 1138 LYS n 
1 1139 LYS n 
1 1140 ALA n 
1 1141 LEU n 
1 1142 THR n 
1 1143 ALA n 
1 1144 GLN n 
1 1145 LEU n 
1 1146 LEU n 
1 1147 MET n 
1 1148 VAL n 
1 1149 GLY n 
1 1150 LEU n 
1 1151 GLN n 
1 1152 GLU n 
1 1153 SER n 
1 1154 GLU n 
1 1155 ALA n 
1 1156 ASP n 
1 1157 ALA n 
1 1158 LEU n 
1 1159 ALA n 
1 1160 GLY n 
1 1161 LYS n 
1 1162 ILE n 
1 1163 MET n 
1 1164 LEU n 
1 1165 GLN n 
1 1166 ASP n 
1 1167 VAL n 
1 1168 ASN n 
1 1169 THR n 
1 1170 VAL n 
1 1171 GLN n 
1 1172 LEU n 
1 1173 ALA n 
1 1174 ARG n 
1 1175 VAL n 
1 1176 VAL n 
1 1177 ASN n 
1 1178 LEU n 
1 1179 ALA n 
1 1180 VAL n 
1 1181 PRO n 
1 1182 ASP n 
1 1183 THR n 
1 1184 TRP n 
1 1185 MET n 
1 1186 SER n 
1 1187 LEU n 
1 1188 ASP n 
1 1189 PHE n 
1 1190 ASP n 
1 1191 SER n 
1 1192 MET n 
1 1193 PHE n 
1 1194 LYS n 
1 1195 HIS n 
1 1196 HIS n 
1 1197 VAL n 
1 1198 LYS n 
1 1199 LEU n 
1 1200 LEU n 
1 1201 PRO n 
1 1202 LYS n 
1 1203 ASP n 
1 1204 GLY n 
1 1205 ARG n 
1 1206 HIS n 
1 1207 LEU n 
1 1208 ASN n 
1 1209 THR n 
1 1210 ASP n 
1 1211 ILE n 
1 1212 PRO n 
1 1213 PRO n 
1 1214 ARG n 
1 1215 MET n 
1 1216 GLY n 
1 1217 TRP n 
1 1218 LEU n 
1 1219 ARG n 
1 1220 ALA n 
1 1221 ILE n 
1 1222 LEU n 
1 1223 ARG n 
1 1224 PHE n 
1 1225 LEU n 
1 1226 GLY n 
1 1227 ALA n 
1 1228 GLY n 
1 1229 MET n 
1 1230 VAL n 
1 1231 MET n 
1 1232 THR n 
1 1233 ALA n 
1 1234 THR n 
1 1235 GLY n 
1 1236 VAL n 
1 1237 ALA n 
1 1238 VAL n 
1 1239 ASP n 
1 1240 ILE n 
1 1241 TYR n 
1 1242 LEU n 
1 1243 GLU n 
1 1244 ASP n 
1 1245 ILE n 
1 1246 HIS n 
1 1247 GLY n 
1 1248 GLY n 
1 1249 GLY n 
1 1250 ARG n 
1 1251 SER n 
1 1252 LEU n 
1 1253 GLY n 
1 1254 GLN n 
1 1255 ARG n 
1 1256 PHE n 
1 1257 MET n 
1 1258 THR n 
1 1259 TRP n 
1 1260 MET n 
1 1261 ARG n 
1 1262 GLN n 
1 1263 GLU n 
1 1264 GLY n 
1 1265 ARG n 
1 1266 SER n 
1 1267 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 L1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    T3D 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Reovirus sp.' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10891 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            SF21 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               AcNPV 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VL3_REOVD 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSSMILTQFGPFIESISGITDQSNDVFEDAAKAFSMFTRSDVYKALDEIPFSDDAMLPIPPTIYTKPSHDSYYYIDALNR
VRRKTYQGPDDVYVPNCSIVELLEPHETLTSYGRLSEAIENRAKDGDSQARIATTYGRIAESQARQIKAPLEKFVLALLV
AEAGGSLYDPVLQKYDEIPDLSHNCPLWCFREICRHISGPLPDRAPYLYLSAGVFWLMSPRMTSAIPPLLSDLVNLAILQ
QTAGLDPSLVKLGVQICLHAAASSSYSWFILKTKSIFPQNTLHSMYESLEGGYCPNLEWLEPRSDYKFMYMGVMPLSAKY
ARSAPSNDKKARELGEKYGLSSVVGELRKRTKTYVKHDFASVRYIRDAMACTSGIFLVRTPTETVLQEYTQSPEIKVPIP
QKDWTGPIGEIRILKDTTSSIARYLYRTWYLAAARMAAQPRTWDPLFQAIMRSQYVTARGGSGAALRESLYAINVSLPDF
KGLPVKAATKIFQAAQLANLPFSHTSVAILADTSMGLRNQVQRRPRSIMPLNVPQQQVSAPHTLTADYINYHMNLSPTSG
SAVIEKVIPLGVYASSPPNQSINIDISACDASITWDFFLSVIMAAIHEGVASSSIGKPFMGVPASIVNDESVVGVRAARP
ISGMQNMIQHLSKLYKRGFSYRVNDSFSPGNDFTHMTTTFPSGSTATSTEHTANNSTMMETFLTVWGPEHTDDPDVLRLM
KSLTIQRNYVCQGDDGLMIIDGTTAGKVNSETIQNDLELISKYGEEFGWKYDIAYDGTAEYLKLYFIFGCRIPNLSRHPI
VGKERANSSAEEPWPAILDQIMGVFFNGVHDGLQWQRWIRYSWALCCAFSRQRTMIGESVGYLQYPMWSFVYWGLPLVKA
FGSDPWIFSWYMPTGDLGMYSWISLIRPLMTRWMVANGYVTDRCSTVFGNADYRRCFNELKLYQGYYMAQLPRNPKKSGR
AASREVREQFTQALSDYLMQNPELKSRVLRGRSEWEKYGAGIIHNPPSLFDVPHKWYQGAQEAAIATREELAEMDETLMR
ARRHSYSSFSKLLEAYLLVKWRMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGPMLQSTRKYFAQTLFMAKTVSGLD
VNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLL
PKDGRHLNTDIPPRMGWLRAILRFLGAGMVMTATGVAVDIYLEDIHGGGRSLGQRFMTWMRQEGRSA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P17378 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1MUK 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 1267 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P17378 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1267 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       1267 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1MUK 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   53.28 
_exptl_crystal.density_Matthews      2.63 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'PEG4000, sodium chloride, HEPES, glycerol, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-05-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-C' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-C 
# 
_reflns.entry_id                     1MUK 
_reflns.d_resolution_high            2.49 
_reflns.d_resolution_low             42.94 
_reflns.limit_h_max                  28 
_reflns.limit_h_min                  0 
_reflns.limit_k_max                  34 
_reflns.limit_k_min                  0 
_reflns.limit_l_max                  99 
_reflns.limit_l_min                  0 
_reflns.number_all                   52366 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_F_max     2477003.57 
_reflns.observed_criterion_F_min     11.300000 
_reflns.B_iso_Wilson_estimate        32 
_reflns.observed_criterion_sigma_I   -2.0 
_reflns.number_obs                   52366 
_reflns.percent_possible_obs         97.9 
_reflns.pdbx_Rmerge_I_obs            0.069 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        24 
_reflns.pdbx_redundancy              6 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   85.0 
_reflns_shell.Rmerge_I_obs           0.267 
_reflns_shell.meanI_over_sigI_obs    4.7 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        4 
_reflns_shell.number_unique_all      4487 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1MUK 
_refine.ls_number_reflns_all                     53069 
_refine.ls_number_reflns_obs                     52134 
_refine.ls_percent_reflns_obs                    98.2 
_refine.ls_d_res_high                            2.50 
_refine.ls_d_res_low                             42.94 
_refine.B_iso_min                                2.71 
_refine.B_iso_max                                76.88 
_refine.B_iso_mean                               23.68 
_refine.occupancy_min                            0.00 
_refine.occupancy_max                            1.00 
_refine.aniso_B[1][1]                            0.93 
_refine.aniso_B[2][2]                            2.29 
_refine.aniso_B[3][3]                            -3.22 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_param_bsol                 21.5153 
_refine.solvent_model_param_ksol                 0.334817 
_refine.solvent_model_details                    'CNS bulk solvent model used' 
_refine.ls_R_factor_R_work                       0.208 
_refine.ls_R_factor_R_free                       0.239 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_number_reflns_R_free                  2767 
_refine.ls_percent_reflns_R_free                 5.3 
_refine.details                                  ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_R_factor_all                          0.215 
_refine.ls_R_factor_obs                          0.215 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          MIR+MAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            'random 5%' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1MUK 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     2.50 
_refine_analyze.Luzzati_coordinate_error_obs    0.27 
_refine_analyze.Luzzati_sigma_a_obs             0.30 
_refine_analyze.Luzzati_coordinate_error_free   0.33 
_refine_analyze.Luzzati_sigma_a_free            0.34 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9934 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             540 
_refine_hist.number_atoms_total               10474 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        42.94 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d           0.009 . ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg        1.4   . ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d 21.9  . ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d 0.98  . ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
2.50 2.61  6528 5844 5667 89.5  0.279 0.28  .021 177 2.7 8 . 'X-RAY DIFFRACTION' . 
2.61 2.75  6584 6437 6179 97.8  0.225 0.226 .014 258 3.9 8 . 'X-RAY DIFFRACTION' . 
2.75 2.92  6553 6448 6146 98.4  0.225 0.226 .013 302 4.6 8 . 'X-RAY DIFFRACTION' . 
2.92 3.15  6552 6531 6137 99.7  0.217 0.217 .011 394 6.0 8 . 'X-RAY DIFFRACTION' . 
3.15 3.47  6594 6587 6170 99.9  0.206 0.205 .010 417 6.3 8 . 'X-RAY DIFFRACTION' . 
3.47 3.97  6655 6646 6225 99.9  0.202 0.199 .010 421 6.3 8 . 'X-RAY DIFFRACTION' . 
3.97 5.00  6692 6690 6298 100.0 0.16  0.159 .008 392 5.9 8 . 'X-RAY DIFFRACTION' . 
5.00 42.94 6959 6951 6545 99.9  0.217 0.221 .011 406 5.8 8 . 'X-RAY DIFFRACTION' . 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1MUK 
_struct.title                     'reovirus lambda3 native structure' 
_struct.pdbx_descriptor           'MINOR CORE PROTEIN LAMBDA 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MUK 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
_struct_keywords.text            'single subunit polymerase fold, fingers, palm, thumb, right hand configuration, Viral protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               ? 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 3    ? ILE A 16   ? SER A 3    ILE A 16   1 ? 14 
HELX_P HELX_P2  2  SER A 23   ? PHE A 37   ? SER A 23   PHE A 37   1 ? 15 
HELX_P HELX_P3  3  THR A 38   ? GLU A 48   ? THR A 38   GLU A 48   1 ? 11 
HELX_P HELX_P4  4  SER A 52   ? MET A 56   ? SER A 52   MET A 56   5 ? 5  
HELX_P HELX_P5  5  PRO A 60   ? TYR A 64   ? PRO A 60   TYR A 64   5 ? 5  
HELX_P HELX_P6  6  SER A 68   ? SER A 71   ? SER A 68   SER A 71   5 ? 4  
HELX_P HELX_P7  7  ILE A 99   ? GLU A 101  ? ILE A 99   GLU A 101  5 ? 3  
HELX_P HELX_P8  8  SER A 116  ? ASP A 125  ? SER A 116  ASP A 125  1 ? 10 
HELX_P HELX_P9  9  ASP A 127  ? ARG A 145  ? ASP A 127  ARG A 145  1 ? 19 
HELX_P HELX_P10 10 PRO A 150  ? ALA A 163  ? PRO A 150  ALA A 163  1 ? 14 
HELX_P HELX_P11 11 ASP A 180  ? HIS A 183  ? ASP A 180  HIS A 183  5 ? 4  
HELX_P HELX_P12 12 ASN A 184  ? GLY A 199  ? ASN A 184  GLY A 199  1 ? 16 
HELX_P HELX_P13 13 ALA A 225  ? ALA A 243  ? ALA A 225  ALA A 243  1 ? 19 
HELX_P HELX_P14 14 ASP A 246  ? SER A 263  ? ASP A 246  SER A 263  1 ? 18 
HELX_P HELX_P15 15 SER A 265  ? LYS A 274  ? SER A 265  LYS A 274  1 ? 10 
HELX_P HELX_P16 16 SER A 275  ? ASN A 280  ? SER A 275  ASN A 280  1 ? 6  
HELX_P HELX_P17 17 THR A 281  ? MET A 285  ? THR A 281  MET A 285  5 ? 5  
HELX_P HELX_P18 18 PRO A 302  ? TYR A 306  ? PRO A 302  TYR A 306  5 ? 5  
HELX_P HELX_P19 19 SER A 317  ? ALA A 321  ? SER A 317  ALA A 321  5 ? 5  
HELX_P HELX_P20 20 ASN A 327  ? TYR A 338  ? ASN A 327  TYR A 338  1 ? 12 
HELX_P HELX_P21 21 LEU A 340  ? THR A 353  ? LEU A 340  THR A 353  1 ? 14 
HELX_P HELX_P22 22 ASP A 358  ? ALA A 370  ? ASP A 358  ALA A 370  1 ? 13 
HELX_P HELX_P23 23 THR A 380  ? TYR A 389  ? THR A 380  TYR A 389  1 ? 10 
HELX_P HELX_P24 24 PRO A 400  ? LYS A 402  ? PRO A 400  LYS A 402  5 ? 3  
HELX_P HELX_P25 25 ILE A 421  ? GLN A 439  ? ILE A 421  GLN A 439  1 ? 19 
HELX_P HELX_P26 26 PRO A 440  ? TRP A 443  ? PRO A 440  TRP A 443  5 ? 4  
HELX_P HELX_P27 27 ASP A 444  ? GLN A 454  ? ASP A 444  GLN A 454  1 ? 11 
HELX_P HELX_P28 28 SER A 462  ? ALA A 472  ? SER A 462  ALA A 472  1 ? 11 
HELX_P HELX_P29 29 THR A 489  ? ALA A 498  ? THR A 489  ALA A 498  1 ? 10 
HELX_P HELX_P30 30 PRO A 501  ? SER A 506  ? PRO A 501  SER A 506  1 ? 6  
HELX_P HELX_P31 31 VAL A 507  ? ALA A 511  ? VAL A 507  ALA A 511  5 ? 5  
HELX_P HELX_P32 32 ASN A 532  ? MET A 553  ? ASN A 532  MET A 553  1 ? 22 
HELX_P HELX_P33 33 ALA A 562  ? LYS A 566  ? ALA A 562  LYS A 566  5 ? 5  
HELX_P HELX_P34 34 VAL A 567  ? SER A 576  ? VAL A 567  SER A 576  1 ? 10 
HELX_P HELX_P35 35 ALA A 588  ? ILE A 593  ? ALA A 588  ILE A 593  1 ? 6  
HELX_P HELX_P36 36 PHE A 597  ? VAL A 610  ? PHE A 597  VAL A 610  1 ? 14 
HELX_P HELX_P37 37 VAL A 610  ? ILE A 615  ? VAL A 610  ILE A 615  1 ? 6  
HELX_P HELX_P38 38 SER A 642  ? GLY A 658  ? SER A 642  GLY A 658  1 ? 17 
HELX_P HELX_P39 39 ALA A 686  ? VAL A 705  ? ALA A 686  VAL A 705  1 ? 20 
HELX_P HELX_P40 40 VAL A 705  ? HIS A 710  ? VAL A 705  HIS A 710  1 ? 6  
HELX_P HELX_P41 41 ASP A 713  ? SER A 722  ? ASP A 713  SER A 722  1 ? 10 
HELX_P HELX_P42 42 ASN A 749  ? GLU A 766  ? ASN A 749  GLU A 766  1 ? 18 
HELX_P HELX_P43 43 ASN A 794  ? HIS A 798  ? ASN A 794  HIS A 798  5 ? 5  
HELX_P HELX_P44 44 PRO A 815  ? ASP A 831  ? PRO A 815  ASP A 831  1 ? 17 
HELX_P HELX_P45 45 GLN A 834  ? SER A 850  ? GLN A 834  SER A 850  1 ? 17 
HELX_P HELX_P46 46 PRO A 866  ? TRP A 873  ? PRO A 866  TRP A 873  1 ? 8  
HELX_P HELX_P47 47 THR A 894  ? ASN A 917  ? THR A 894  ASN A 917  1 ? 24 
HELX_P HELX_P48 48 ASP A 932  ? LEU A 940  ? ASP A 932  LEU A 940  1 ? 9  
HELX_P HELX_P49 49 LYS A 941  ? GLN A 950  ? LYS A 941  GLN A 950  1 ? 10 
HELX_P HELX_P50 50 GLU A 965  ? MET A 979  ? GLU A 965  MET A 979  1 ? 15 
HELX_P HELX_P51 51 ASN A 981  ? GLY A 999  ? ASN A 981  GLY A 999  1 ? 19 
HELX_P HELX_P52 52 SER A 1008 ? PHE A 1010 ? SER A 1008 PHE A 1010 5 ? 3  
HELX_P HELX_P53 53 ASP A 1011 ? ALA A 1023 ? ASP A 1011 ALA A 1023 1 ? 13 
HELX_P HELX_P54 54 THR A 1027 ? HIS A 1044 ? THR A 1027 HIS A 1044 1 ? 18 
HELX_P HELX_P55 55 SER A 1050 ? LEU A 1057 ? SER A 1050 LEU A 1057 1 ? 8  
HELX_P HELX_P56 56 ASN A 1085 ? GLY A 1096 ? ASN A 1085 GLY A 1096 1 ? 12 
HELX_P HELX_P57 57 SER A 1101 ? ALA A 1107 ? SER A 1101 ALA A 1107 1 ? 7  
HELX_P HELX_P58 58 GLN A 1108 ? LEU A 1110 ? GLN A 1108 LEU A 1110 5 ? 3  
HELX_P HELX_P59 59 ASP A 1120 ? LEU A 1134 ? ASP A 1120 LEU A 1134 1 ? 15 
HELX_P HELX_P60 60 ASP A 1137 ? MET A 1147 ? ASP A 1137 MET A 1147 1 ? 11 
HELX_P HELX_P61 61 GLN A 1151 ? GLN A 1165 ? GLN A 1151 GLN A 1165 1 ? 15 
HELX_P HELX_P62 62 ASN A 1168 ? ARG A 1174 ? ASN A 1168 ARG A 1174 1 ? 7  
HELX_P HELX_P63 63 VAL A 1175 ? ASN A 1177 ? VAL A 1175 ASN A 1177 5 ? 3  
HELX_P HELX_P64 64 PRO A 1181 ? MET A 1185 ? PRO A 1181 MET A 1185 5 ? 5  
HELX_P HELX_P65 65 ASP A 1188 ? HIS A 1196 ? ASP A 1188 HIS A 1196 1 ? 9  
HELX_P HELX_P66 66 TRP A 1217 ? ALA A 1233 ? TRP A 1217 ALA A 1233 1 ? 17 
HELX_P HELX_P67 67 GLY A 1247 ? GLU A 1263 ? GLY A 1247 GLU A 1263 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 301 A . ? GLU 301 A PRO 302 A ? PRO 302 A 1 -1.32 
2 PRO 577 A . ? PRO 577 A PRO 578 A ? PRO 578 A 1 0.97  
3 TRP 814 A . ? TRP 814 A PRO 815 A ? PRO 815 A 1 1.02  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 2 ? 
D ? 3 ? 
E ? 2 ? 
F ? 3 ? 
G ? 2 ? 
H ? 4 ? 
I ? 2 ? 
J ? 3 ? 
K ? 2 ? 
L ? 2 ? 
M ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 73   ? ILE A 75   ? TYR A 73   ILE A 75   
A 2 VAL A 81   ? ARG A 83   ? VAL A 81   ARG A 83   
B 1 LEU A 103  ? PRO A 105  ? LEU A 103  PRO A 105  
B 2 TYR A 112  ? LEU A 115  ? TYR A 112  LEU A 115  
B 3 VAL A 214  ? LEU A 217  ? VAL A 214  LEU A 217  
B 4 TYR A 207  ? TYR A 209  ? TYR A 207  TYR A 209  
C 1 TYR A 168  ? ASP A 169  ? TYR A 168  ASP A 169  
C 2 LYS A 174  ? TYR A 175  ? LYS A 174  TYR A 175  
D 1 PHE A 308  ? PRO A 315  ? PHE A 308  PRO A 315  
D 2 GLY A 291  ? TRP A 299  ? GLY A 291  TRP A 299  
D 3 LYS A 356  ? HIS A 357  ? LYS A 356  HIS A 357  
E 1 TRP A 404  ? ILE A 408  ? TRP A 404  ILE A 408  
E 2 ILE A 411  ? LEU A 414  ? ILE A 411  LEU A 414  
F 1 THR A 513  ? SER A 514  ? THR A 513  SER A 514  
F 2 PHE A 659  ? ASN A 664  ? PHE A 659  ASN A 664  
F 3 ASP A 672  ? THR A 677  ? ASP A 672  THR A 677  
G 1 GLY A 516  ? GLN A 520  ? GLY A 516  GLN A 520  
G 2 ARG A 523  ? ILE A 528  ? ARG A 523  ILE A 528  
H 1 TYR A 729  ? GLN A 732  ? TYR A 729  GLN A 732  
H 2 ASP A 735  ? ILE A 740  ? ASP A 735  ILE A 740  
H 3 GLN A 580  ? SER A 587  ? GLN A 580  SER A 587  
H 4 LYS A 770  ? ALA A 774  ? LYS A 770  ALA A 774  
I 1 SER A 625  ? ASP A 629  ? SER A 625  ASP A 629  
I 2 ALA A 637  ? ILE A 641  ? ALA A 637  ILE A 641  
J 1 ALA A 779  ? TYR A 781  ? ALA A 779  TYR A 781  
J 2 LEU A 784  ? ILE A 787  ? LEU A 784  ILE A 787  
J 3 CYS A 790  ? ILE A 792  ? CYS A 790  ILE A 792  
K 1 ARG A 851  ? ILE A 856  ? ARG A 851  ILE A 856  
K 2 SER A 859  ? GLN A 864  ? SER A 859  GLN A 864  
L 1 VAL A 920  ? SER A 925  ? VAL A 920  SER A 925  
L 2 GLY A 929  ? ALA A 931  ? GLY A 929  ALA A 931  
M 1 VAL A 1059 ? ALA A 1066 ? VAL A 1059 ALA A 1066 
M 2 VAL A 1238 ? ILE A 1245 ? VAL A 1238 ILE A 1245 
M 3 VAL A 1197 ? LYS A 1198 ? VAL A 1197 LYS A 1198 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 74   ? N TYR A 74   O ARG A 82   ? O ARG A 82   
B 1 2 N GLU A 104  ? N GLU A 104  O ARG A 114  ? O ARG A 114  
B 2 3 N GLY A 113  ? N GLY A 113  O TRP A 216  ? O TRP A 216  
B 3 4 O PHE A 215  ? O PHE A 215  N LEU A 208  ? N LEU A 208  
C 1 2 N ASP A 169  ? N ASP A 169  O LYS A 174  ? O LYS A 174  
D 1 2 O MET A 314  ? O MET A 314  N CYS A 294  ? N CYS A 294  
D 2 3 N GLY A 291  ? N GLY A 291  O HIS A 357  ? O HIS A 357  
E 1 2 N ILE A 408  ? N ILE A 408  O ILE A 411  ? O ILE A 411  
F 1 2 N THR A 513  ? N THR A 513  O SER A 660  ? O SER A 660  
F 2 3 N TYR A 661  ? N TYR A 661  O HIS A 675  ? O HIS A 675  
G 1 2 N ARG A 518  ? N ARG A 518  O ARG A 526  ? O ARG A 526  
H 1 2 N GLN A 732  ? N GLN A 732  O ASP A 735  ? O ASP A 735  
H 2 3 O GLY A 736  ? O GLY A 736  N ILE A 584  ? N ILE A 584  
H 3 4 N ASP A 585  ? N ASP A 585  O ASP A 772  ? O ASP A 772  
I 1 2 N ASP A 629  ? N ASP A 629  O ALA A 637  ? O ALA A 637  
J 1 2 N ALA A 779  ? N ALA A 779  O PHE A 786  ? O PHE A 786  
J 2 3 N TYR A 785  ? N TYR A 785  O ILE A 792  ? O ILE A 792  
K 1 2 N THR A 854  ? N THR A 854  O GLY A 861  ? O GLY A 861  
L 1 2 N SER A 925  ? N SER A 925  O GLY A 929  ? O GLY A 929  
M 1 2 N ARG A 1062 ? N ARG A 1062 O TYR A 1241 ? O TYR A 1241 
M 2 3 O LEU A 1242 ? O LEU A 1242 N LYS A 1198 ? N LYS A 1198 
# 
_atom_sites.entry_id                    1MUK 
_atom_sites.fract_transf_matrix[1][1]   0.014110 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011742 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004022 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . SER A 1 2    ? -30.214 108.820 54.075  1.00 62.98 ? 2    SER A N   1 
ATOM   2     C CA  . SER A 1 2    ? -31.356 109.584 53.502  1.00 61.86 ? 2    SER A CA  1 
ATOM   3     C C   . SER A 1 2    ? -32.684 108.918 53.875  1.00 60.52 ? 2    SER A C   1 
ATOM   4     O O   . SER A 1 2    ? -33.207 108.093 53.121  1.00 61.90 ? 2    SER A O   1 
ATOM   5     C CB  . SER A 1 2    ? -31.200 109.665 51.978  1.00 62.93 ? 2    SER A CB  1 
ATOM   6     O OG  . SER A 1 2    ? -29.926 110.194 51.638  1.00 63.05 ? 2    SER A OG  1 
ATOM   7     N N   . SER A 1 3    ? -33.211 109.286 55.046  1.00 57.92 ? 3    SER A N   1 
ATOM   8     C CA  . SER A 1 3    ? -34.468 108.751 55.568  1.00 54.62 ? 3    SER A CA  1 
ATOM   9     C C   . SER A 1 3    ? -34.659 107.274 55.243  1.00 51.47 ? 3    SER A C   1 
ATOM   10    O O   . SER A 1 3    ? -34.262 106.417 56.022  1.00 52.03 ? 3    SER A O   1 
ATOM   11    C CB  . SER A 1 3    ? -35.640 109.567 55.035  1.00 55.83 ? 3    SER A CB  1 
ATOM   12    O OG  . SER A 1 3    ? -35.480 110.928 55.393  1.00 58.50 ? 3    SER A OG  1 
ATOM   13    N N   . MET A 1 4    ? -35.265 106.973 54.100  1.00 47.22 ? 4    MET A N   1 
ATOM   14    C CA  . MET A 1 4    ? -35.480 105.586 53.703  1.00 43.49 ? 4    MET A CA  1 
ATOM   15    C C   . MET A 1 4    ? -34.140 104.828 53.747  1.00 41.15 ? 4    MET A C   1 
ATOM   16    O O   . MET A 1 4    ? -34.039 103.773 54.384  1.00 41.16 ? 4    MET A O   1 
ATOM   17    C CB  . MET A 1 4    ? -36.084 105.547 52.296  1.00 45.14 ? 4    MET A CB  1 
ATOM   18    C CG  . MET A 1 4    ? -36.677 104.211 51.870  1.00 46.94 ? 4    MET A CG  1 
ATOM   19    S SD  . MET A 1 4    ? -37.448 104.313 50.204  1.00 48.89 ? 4    MET A SD  1 
ATOM   20    C CE  . MET A 1 4    ? -38.991 105.151 50.593  1.00 48.30 ? 4    MET A CE  1 
ATOM   21    N N   . ILE A 1 5    ? -33.110 105.374 53.096  1.00 36.28 ? 5    ILE A N   1 
ATOM   22    C CA  . ILE A 1 5    ? -31.791 104.737 53.079  1.00 32.40 ? 5    ILE A CA  1 
ATOM   23    C C   . ILE A 1 5    ? -31.084 104.832 54.436  1.00 32.50 ? 5    ILE A C   1 
ATOM   24    O O   . ILE A 1 5    ? -30.578 103.833 54.966  1.00 30.54 ? 5    ILE A O   1 
ATOM   25    C CB  . ILE A 1 5    ? -30.868 105.366 51.998  1.00 29.62 ? 5    ILE A CB  1 
ATOM   26    C CG1 . ILE A 1 5    ? -31.453 105.137 50.608  1.00 27.31 ? 5    ILE A CG1 1 
ATOM   27    C CG2 . ILE A 1 5    ? -29.484 104.746 52.059  1.00 26.70 ? 5    ILE A CG2 1 
ATOM   28    C CD1 . ILE A 1 5    ? -31.608 103.686 50.237  1.00 26.05 ? 5    ILE A CD1 1 
ATOM   29    N N   . LEU A 1 6    ? -31.049 106.043 54.984  1.00 32.78 ? 6    LEU A N   1 
ATOM   30    C CA  . LEU A 1 6    ? -30.412 106.309 56.272  1.00 33.31 ? 6    LEU A CA  1 
ATOM   31    C C   . LEU A 1 6    ? -31.034 105.479 57.389  1.00 34.17 ? 6    LEU A C   1 
ATOM   32    O O   . LEU A 1 6    ? -30.330 104.991 58.278  1.00 35.14 ? 6    LEU A O   1 
ATOM   33    C CB  . LEU A 1 6    ? -30.536 107.794 56.613  1.00 33.39 ? 6    LEU A CB  1 
ATOM   34    C CG  . LEU A 1 6    ? -29.330 108.544 57.185  1.00 33.59 ? 6    LEU A CG  1 
ATOM   35    C CD1 . LEU A 1 6    ? -28.044 108.107 56.514  1.00 30.45 ? 6    LEU A CD1 1 
ATOM   36    C CD2 . LEU A 1 6    ? -29.562 110.041 56.980  1.00 33.21 ? 6    LEU A CD2 1 
ATOM   37    N N   . THR A 1 7    ? -32.355 105.323 57.339  1.00 33.47 ? 7    THR A N   1 
ATOM   38    C CA  . THR A 1 7    ? -33.080 104.557 58.342  1.00 32.02 ? 7    THR A CA  1 
ATOM   39    C C   . THR A 1 7    ? -32.695 103.087 58.284  1.00 31.24 ? 7    THR A C   1 
ATOM   40    O O   . THR A 1 7    ? -32.455 102.461 59.313  1.00 32.45 ? 7    THR A O   1 
ATOM   41    C CB  . THR A 1 7    ? -34.622 104.696 58.147  1.00 34.07 ? 7    THR A CB  1 
ATOM   42    O OG1 . THR A 1 7    ? -35.025 106.041 58.452  1.00 33.66 ? 7    THR A OG1 1 
ATOM   43    C CG2 . THR A 1 7    ? -35.384 103.720 59.050  1.00 32.45 ? 7    THR A CG2 1 
ATOM   44    N N   . GLN A 1 8    ? -32.610 102.538 57.079  1.00 30.08 ? 8    GLN A N   1 
ATOM   45    C CA  . GLN A 1 8    ? -32.270 101.125 56.926  1.00 28.34 ? 8    GLN A CA  1 
ATOM   46    C C   . GLN A 1 8    ? -30.800 100.701 56.923  1.00 24.70 ? 8    GLN A C   1 
ATOM   47    O O   . GLN A 1 8    ? -30.489 99.544  57.194  1.00 23.85 ? 8    GLN A O   1 
ATOM   48    C CB  . GLN A 1 8    ? -32.944 100.565 55.674  1.00 29.08 ? 8    GLN A CB  1 
ATOM   49    C CG  . GLN A 1 8    ? -34.321 100.043 55.953  1.00 31.89 ? 8    GLN A CG  1 
ATOM   50    C CD  . GLN A 1 8    ? -34.672 98.892  55.063  1.00 34.80 ? 8    GLN A CD  1 
ATOM   51    O OE1 . GLN A 1 8    ? -35.151 99.083  53.945  1.00 37.67 ? 8    GLN A OE1 1 
ATOM   52    N NE2 . GLN A 1 8    ? -34.422 97.674  55.542  1.00 35.85 ? 8    GLN A NE2 1 
ATOM   53    N N   . PHE A 1 9    ? -29.894 101.620 56.631  1.00 20.70 ? 9    PHE A N   1 
ATOM   54    C CA  . PHE A 1 9    ? -28.485 101.258 56.582  1.00 17.79 ? 9    PHE A CA  1 
ATOM   55    C C   . PHE A 1 9    ? -27.626 102.109 57.516  1.00 17.36 ? 9    PHE A C   1 
ATOM   56    O O   . PHE A 1 9    ? -26.397 102.022 57.490  1.00 16.51 ? 9    PHE A O   1 
ATOM   57    C CB  . PHE A 1 9    ? -27.982 101.404 55.142  1.00 15.13 ? 9    PHE A CB  1 
ATOM   58    C CG  . PHE A 1 9    ? -28.610 100.447 54.169  1.00 11.58 ? 9    PHE A CG  1 
ATOM   59    C CD1 . PHE A 1 9    ? -28.047 99.191  53.944  1.00 11.07 ? 9    PHE A CD1 1 
ATOM   60    C CD2 . PHE A 1 9    ? -29.744 100.809 53.452  1.00 12.41 ? 9    PHE A CD2 1 
ATOM   61    C CE1 . PHE A 1 9    ? -28.593 98.310  53.016  1.00 11.18 ? 9    PHE A CE1 1 
ATOM   62    C CE2 . PHE A 1 9    ? -30.306 99.938  52.518  1.00 12.30 ? 9    PHE A CE2 1 
ATOM   63    C CZ  . PHE A 1 9    ? -29.724 98.680  52.299  1.00 11.82 ? 9    PHE A CZ  1 
ATOM   64    N N   . GLY A 1 10   ? -28.286 102.933 58.328  1.00 17.39 ? 10   GLY A N   1 
ATOM   65    C CA  . GLY A 1 10   ? -27.601 103.816 59.258  1.00 15.61 ? 10   GLY A CA  1 
ATOM   66    C C   . GLY A 1 10   ? -26.293 103.327 59.860  1.00 15.88 ? 10   GLY A C   1 
ATOM   67    O O   . GLY A 1 10   ? -25.226 103.896 59.587  1.00 17.13 ? 10   GLY A O   1 
ATOM   68    N N   . PRO A 1 11   ? -26.338 102.283 60.696  1.00 13.63 ? 11   PRO A N   1 
ATOM   69    C CA  . PRO A 1 11   ? -25.130 101.748 61.326  1.00 13.72 ? 11   PRO A CA  1 
ATOM   70    C C   . PRO A 1 11   ? -24.034 101.275 60.363  1.00 14.62 ? 11   PRO A C   1 
ATOM   71    O O   . PRO A 1 11   ? -22.836 101.442 60.639  1.00 14.67 ? 11   PRO A O   1 
ATOM   72    C CB  . PRO A 1 11   ? -25.679 100.627 62.206  1.00 13.03 ? 11   PRO A CB  1 
ATOM   73    C CG  . PRO A 1 11   ? -27.039 101.156 62.589  1.00 11.83 ? 11   PRO A CG  1 
ATOM   74    C CD  . PRO A 1 11   ? -27.550 101.688 61.289  1.00 12.59 ? 11   PRO A CD  1 
ATOM   75    N N   . PHE A 1 12   ? -24.439 100.692 59.241  1.00 13.20 ? 12   PHE A N   1 
ATOM   76    C CA  . PHE A 1 12   ? -23.488 100.202 58.260  1.00 14.09 ? 12   PHE A CA  1 
ATOM   77    C C   . PHE A 1 12   ? -22.831 101.393 57.572  1.00 17.16 ? 12   PHE A C   1 
ATOM   78    O O   . PHE A 1 12   ? -21.631 101.387 57.274  1.00 17.44 ? 12   PHE A O   1 
ATOM   79    C CB  . PHE A 1 12   ? -24.209 99.344  57.223  1.00 14.98 ? 12   PHE A CB  1 
ATOM   80    C CG  . PHE A 1 12   ? -23.325 98.872  56.112  1.00 14.52 ? 12   PHE A CG  1 
ATOM   81    C CD1 . PHE A 1 12   ? -22.267 97.999  56.369  1.00 13.68 ? 12   PHE A CD1 1 
ATOM   82    C CD2 . PHE A 1 12   ? -23.541 99.302  54.811  1.00 13.33 ? 12   PHE A CD2 1 
ATOM   83    C CE1 . PHE A 1 12   ? -21.434 97.559  55.339  1.00 14.51 ? 12   PHE A CE1 1 
ATOM   84    C CE2 . PHE A 1 12   ? -22.713 98.873  53.763  1.00 13.52 ? 12   PHE A CE2 1 
ATOM   85    C CZ  . PHE A 1 12   ? -21.657 97.999  54.027  1.00 14.42 ? 12   PHE A CZ  1 
ATOM   86    N N   . ILE A 1 13   ? -23.635 102.422 57.328  1.00 18.16 ? 13   ILE A N   1 
ATOM   87    C CA  . ILE A 1 13   ? -23.160 103.625 56.667  1.00 18.69 ? 13   ILE A CA  1 
ATOM   88    C C   . ILE A 1 13   ? -22.029 104.276 57.438  1.00 19.18 ? 13   ILE A C   1 
ATOM   89    O O   . ILE A 1 13   ? -21.044 104.719 56.856  1.00 20.07 ? 13   ILE A O   1 
ATOM   90    C CB  . ILE A 1 13   ? -24.299 104.656 56.507  1.00 18.16 ? 13   ILE A CB  1 
ATOM   91    C CG1 . ILE A 1 13   ? -25.371 104.101 55.569  1.00 19.55 ? 13   ILE A CG1 1 
ATOM   92    C CG2 . ILE A 1 13   ? -23.741 105.972 55.993  1.00 14.17 ? 13   ILE A CG2 1 
ATOM   93    C CD1 . ILE A 1 13   ? -26.562 105.040 55.367  1.00 18.93 ? 13   ILE A CD1 1 
ATOM   94    N N   . GLU A 1 14   ? -22.172 104.337 58.755  1.00 21.14 ? 14   GLU A N   1 
ATOM   95    C CA  . GLU A 1 14   ? -21.152 104.964 59.573  1.00 22.44 ? 14   GLU A CA  1 
ATOM   96    C C   . GLU A 1 14   ? -19.907 104.102 59.707  1.00 21.91 ? 14   GLU A C   1 
ATOM   97    O O   . GLU A 1 14   ? -18.806 104.625 59.906  1.00 23.35 ? 14   GLU A O   1 
ATOM   98    C CB  . GLU A 1 14   ? -21.710 105.297 60.958  1.00 24.46 ? 14   GLU A CB  1 
ATOM   99    C CG  . GLU A 1 14   ? -22.931 106.189 60.923  1.00 30.07 ? 14   GLU A CG  1 
ATOM   100   C CD  . GLU A 1 14   ? -23.115 106.992 62.203  1.00 34.03 ? 14   GLU A CD  1 
ATOM   101   O OE1 . GLU A 1 14   ? -23.013 106.399 63.302  1.00 34.58 ? 14   GLU A OE1 1 
ATOM   102   O OE2 . GLU A 1 14   ? -23.371 108.217 62.102  1.00 35.80 ? 14   GLU A OE2 1 
ATOM   103   N N   . SER A 1 15   ? -20.076 102.790 59.585  1.00 21.00 ? 15   SER A N   1 
ATOM   104   C CA  . SER A 1 15   ? -18.950 101.879 59.718  1.00 20.87 ? 15   SER A CA  1 
ATOM   105   C C   . SER A 1 15   ? -18.065 101.873 58.471  1.00 21.36 ? 15   SER A C   1 
ATOM   106   O O   . SER A 1 15   ? -16.896 101.471 58.530  1.00 21.18 ? 15   SER A O   1 
ATOM   107   C CB  . SER A 1 15   ? -19.447 100.463 60.013  1.00 20.59 ? 15   SER A CB  1 
ATOM   108   O OG  . SER A 1 15   ? -20.040 99.871  58.872  1.00 22.49 ? 15   SER A OG  1 
ATOM   109   N N   . ILE A 1 16   ? -18.611 102.315 57.342  1.00 19.42 ? 16   ILE A N   1 
ATOM   110   C CA  . ILE A 1 16   ? -17.829 102.334 56.124  1.00 18.44 ? 16   ILE A CA  1 
ATOM   111   C C   . ILE A 1 16   ? -17.460 103.762 55.764  1.00 19.06 ? 16   ILE A C   1 
ATOM   112   O O   . ILE A 1 16   ? -16.909 104.033 54.682  1.00 18.39 ? 16   ILE A O   1 
ATOM   113   C CB  . ILE A 1 16   ? -18.576 101.653 54.956  1.00 19.90 ? 16   ILE A CB  1 
ATOM   114   C CG1 . ILE A 1 16   ? -19.875 102.393 54.650  1.00 18.74 ? 16   ILE A CG1 1 
ATOM   115   C CG2 . ILE A 1 16   ? -18.854 100.183 55.309  1.00 19.09 ? 16   ILE A CG2 1 
ATOM   116   C CD1 . ILE A 1 16   ? -20.551 101.909 53.398  1.00 20.28 ? 16   ILE A CD1 1 
ATOM   117   N N   . SER A 1 17   ? -17.771 104.679 56.678  1.00 17.86 ? 17   SER A N   1 
ATOM   118   C CA  . SER A 1 17   ? -17.425 106.079 56.488  1.00 18.03 ? 17   SER A CA  1 
ATOM   119   C C   . SER A 1 17   ? -16.303 106.501 57.436  1.00 18.24 ? 17   SER A C   1 
ATOM   120   O O   . SER A 1 17   ? -15.846 107.637 57.382  1.00 20.65 ? 17   SER A O   1 
ATOM   121   C CB  . SER A 1 17   ? -18.642 106.974 56.690  1.00 17.47 ? 17   SER A CB  1 
ATOM   122   O OG  . SER A 1 17   ? -19.484 106.924 55.554  1.00 16.57 ? 17   SER A OG  1 
ATOM   123   N N   . GLY A 1 18   ? -15.863 105.587 58.298  1.00 17.18 ? 18   GLY A N   1 
ATOM   124   C CA  . GLY A 1 18   ? -14.785 105.896 59.224  1.00 18.52 ? 18   GLY A CA  1 
ATOM   125   C C   . GLY A 1 18   ? -15.224 106.463 60.562  1.00 19.98 ? 18   GLY A C   1 
ATOM   126   O O   . GLY A 1 18   ? -14.414 106.974 61.324  1.00 19.25 ? 18   GLY A O   1 
ATOM   127   N N   . ILE A 1 19   ? -16.510 106.346 60.864  1.00 20.60 ? 19   ILE A N   1 
ATOM   128   C CA  . ILE A 1 19   ? -17.063 106.877 62.101  1.00 20.16 ? 19   ILE A CA  1 
ATOM   129   C C   . ILE A 1 19   ? -17.254 105.795 63.159  1.00 20.18 ? 19   ILE A C   1 
ATOM   130   O O   . ILE A 1 19   ? -17.165 106.055 64.354  1.00 18.85 ? 19   ILE A O   1 
ATOM   131   C CB  . ILE A 1 19   ? -18.432 107.543 61.813  1.00 19.12 ? 19   ILE A CB  1 
ATOM   132   C CG1 . ILE A 1 19   ? -18.227 108.769 60.916  1.00 16.31 ? 19   ILE A CG1 1 
ATOM   133   C CG2 . ILE A 1 19   ? -19.135 107.887 63.112  1.00 16.79 ? 19   ILE A CG2 1 
ATOM   134   C CD1 . ILE A 1 19   ? -19.471 109.223 60.208  1.00 17.30 ? 19   ILE A CD1 1 
ATOM   135   N N   . THR A 1 20   ? -17.499 104.581 62.692  1.00 20.77 ? 20   THR A N   1 
ATOM   136   C CA  . THR A 1 20   ? -17.760 103.428 63.546  1.00 22.94 ? 20   THR A CA  1 
ATOM   137   C C   . THR A 1 20   ? -16.928 102.227 63.103  1.00 22.05 ? 20   THR A C   1 
ATOM   138   O O   . THR A 1 20   ? -16.519 102.153 61.949  1.00 22.76 ? 20   THR A O   1 
ATOM   139   C CB  . THR A 1 20   ? -19.263 103.039 63.433  1.00 24.73 ? 20   THR A CB  1 
ATOM   140   O OG1 . THR A 1 20   ? -20.063 104.013 64.114  1.00 26.28 ? 20   THR A OG1 1 
ATOM   141   C CG2 . THR A 1 20   ? -19.516 101.673 64.020  1.00 28.83 ? 20   THR A CG2 1 
ATOM   142   N N   . ASP A 1 21   ? -16.673 101.288 64.010  1.00 21.12 ? 21   ASP A N   1 
ATOM   143   C CA  . ASP A 1 21   ? -15.939 100.084 63.636  1.00 18.39 ? 21   ASP A CA  1 
ATOM   144   C C   . ASP A 1 21   ? -16.866 99.256  62.756  1.00 17.67 ? 21   ASP A C   1 
ATOM   145   O O   . ASP A 1 21   ? -18.087 99.390  62.828  1.00 17.58 ? 21   ASP A O   1 
ATOM   146   C CB  . ASP A 1 21   ? -15.587 99.238  64.858  1.00 17.85 ? 21   ASP A CB  1 
ATOM   147   C CG  . ASP A 1 21   ? -14.476 99.842  65.701  1.00 19.79 ? 21   ASP A CG  1 
ATOM   148   O OD1 . ASP A 1 21   ? -13.832 100.805 65.255  1.00 19.95 ? 21   ASP A OD1 1 
ATOM   149   O OD2 . ASP A 1 21   ? -14.233 99.340  66.819  1.00 22.65 ? 21   ASP A OD2 1 
ATOM   150   N N   . GLN A 1 22   ? -16.285 98.414  61.914  1.00 17.31 ? 22   GLN A N   1 
ATOM   151   C CA  . GLN A 1 22   ? -17.067 97.523  61.068  1.00 16.88 ? 22   GLN A CA  1 
ATOM   152   C C   . GLN A 1 22   ? -17.270 96.260  61.912  1.00 16.47 ? 22   GLN A C   1 
ATOM   153   O O   . GLN A 1 22   ? -16.448 95.933  62.762  1.00 16.88 ? 22   GLN A O   1 
ATOM   154   C CB  . GLN A 1 22   ? -16.298 97.148  59.793  1.00 16.64 ? 22   GLN A CB  1 
ATOM   155   C CG  . GLN A 1 22   ? -15.945 98.298  58.882  1.00 16.57 ? 22   GLN A CG  1 
ATOM   156   C CD  . GLN A 1 22   ? -15.327 97.815  57.590  1.00 16.34 ? 22   GLN A CD  1 
ATOM   157   O OE1 . GLN A 1 22   ? -15.938 97.041  56.860  1.00 19.02 ? 22   GLN A OE1 1 
ATOM   158   N NE2 . GLN A 1 22   ? -14.115 98.261  57.300  1.00 14.48 ? 22   GLN A NE2 1 
ATOM   159   N N   . SER A 1 23   ? -18.355 95.545  61.681  1.00 15.64 ? 23   SER A N   1 
ATOM   160   C CA  . SER A 1 23   ? -18.617 94.335  62.446  1.00 15.28 ? 23   SER A CA  1 
ATOM   161   C C   . SER A 1 23   ? -19.495 93.475  61.567  1.00 15.75 ? 23   SER A C   1 
ATOM   162   O O   . SER A 1 23   ? -20.395 93.989  60.890  1.00 13.73 ? 23   SER A O   1 
ATOM   163   C CB  . SER A 1 23   ? -19.339 94.665  63.756  1.00 13.42 ? 23   SER A CB  1 
ATOM   164   O OG  . SER A 1 23   ? -20.485 95.479  63.514  1.00 18.14 ? 23   SER A OG  1 
ATOM   165   N N   . ASN A 1 24   ? -19.235 92.171  61.569  1.00 16.02 ? 24   ASN A N   1 
ATOM   166   C CA  . ASN A 1 24   ? -20.009 91.281  60.737  1.00 17.25 ? 24   ASN A CA  1 
ATOM   167   C C   . ASN A 1 24   ? -21.510 91.390  60.985  1.00 19.16 ? 24   ASN A C   1 
ATOM   168   O O   . ASN A 1 24   ? -22.302 91.326  60.041  1.00 21.45 ? 24   ASN A O   1 
ATOM   169   C CB  . ASN A 1 24   ? -19.566 89.846  60.921  1.00 16.53 ? 24   ASN A CB  1 
ATOM   170   C CG  . ASN A 1 24   ? -19.905 89.024  59.737  1.00 16.24 ? 24   ASN A CG  1 
ATOM   171   O OD1 . ASN A 1 24   ? -19.475 89.336  58.630  1.00 18.78 ? 24   ASN A OD1 1 
ATOM   172   N ND2 . ASN A 1 24   ? -20.694 87.982  59.934  1.00 17.59 ? 24   ASN A ND2 1 
ATOM   173   N N   . ASP A 1 25   ? -21.904 91.557  62.243  1.00 17.94 ? 25   ASP A N   1 
ATOM   174   C CA  . ASP A 1 25   ? -23.318 91.690  62.561  1.00 19.34 ? 25   ASP A CA  1 
ATOM   175   C C   . ASP A 1 25   ? -23.951 92.831  61.766  1.00 18.77 ? 25   ASP A C   1 
ATOM   176   O O   . ASP A 1 25   ? -25.001 92.669  61.137  1.00 18.02 ? 25   ASP A O   1 
ATOM   177   C CB  . ASP A 1 25   ? -23.515 91.943  64.060  1.00 21.13 ? 25   ASP A CB  1 
ATOM   178   C CG  . ASP A 1 25   ? -23.460 90.663  64.879  1.00 24.74 ? 25   ASP A CG  1 
ATOM   179   O OD1 . ASP A 1 25   ? -23.473 89.564  64.269  1.00 22.96 ? 25   ASP A OD1 1 
ATOM   180   O OD2 . ASP A 1 25   ? -23.411 90.756  66.132  1.00 26.26 ? 25   ASP A OD2 1 
ATOM   181   N N   . VAL A 1 26   ? -23.318 93.994  61.796  1.00 17.84 ? 26   VAL A N   1 
ATOM   182   C CA  . VAL A 1 26   ? -23.866 95.120  61.069  1.00 17.09 ? 26   VAL A CA  1 
ATOM   183   C C   . VAL A 1 26   ? -23.744 94.845  59.578  1.00 17.39 ? 26   VAL A C   1 
ATOM   184   O O   . VAL A 1 26   ? -24.681 95.094  58.818  1.00 17.61 ? 26   VAL A O   1 
ATOM   185   C CB  . VAL A 1 26   ? -23.143 96.415  61.469  1.00 17.33 ? 26   VAL A CB  1 
ATOM   186   C CG1 . VAL A 1 26   ? -23.516 97.573  60.543  1.00 13.75 ? 26   VAL A CG1 1 
ATOM   187   C CG2 . VAL A 1 26   ? -23.526 96.753  62.893  1.00 17.43 ? 26   VAL A CG2 1 
ATOM   188   N N   . PHE A 1 27   ? -22.606 94.300  59.158  1.00 15.97 ? 27   PHE A N   1 
ATOM   189   C CA  . PHE A 1 27   ? -22.420 94.005  57.743  1.00 15.06 ? 27   PHE A CA  1 
ATOM   190   C C   . PHE A 1 27   ? -23.531 93.092  57.249  1.00 15.01 ? 27   PHE A C   1 
ATOM   191   O O   . PHE A 1 27   ? -24.118 93.331  56.196  1.00 15.48 ? 27   PHE A O   1 
ATOM   192   C CB  . PHE A 1 27   ? -21.071 93.322  57.493  1.00 13.20 ? 27   PHE A CB  1 
ATOM   193   C CG  . PHE A 1 27   ? -20.811 93.010  56.041  1.00 13.40 ? 27   PHE A CG  1 
ATOM   194   C CD1 . PHE A 1 27   ? -20.285 93.977  55.191  1.00 12.37 ? 27   PHE A CD1 1 
ATOM   195   C CD2 . PHE A 1 27   ? -21.098 91.738  55.522  1.00 13.10 ? 27   PHE A CD2 1 
ATOM   196   C CE1 . PHE A 1 27   ? -20.044 93.689  53.851  1.00 13.26 ? 27   PHE A CE1 1 
ATOM   197   C CE2 . PHE A 1 27   ? -20.865 91.434  54.184  1.00 9.55  ? 27   PHE A CE2 1 
ATOM   198   C CZ  . PHE A 1 27   ? -20.335 92.410  53.341  1.00 14.00 ? 27   PHE A CZ  1 
ATOM   199   N N   . GLU A 1 28   ? -23.827 92.051  58.017  1.00 15.17 ? 28   GLU A N   1 
ATOM   200   C CA  . GLU A 1 28   ? -24.848 91.107  57.598  1.00 17.97 ? 28   GLU A CA  1 
ATOM   201   C C   . GLU A 1 28   ? -26.261 91.672  57.687  1.00 19.10 ? 28   GLU A C   1 
ATOM   202   O O   . GLU A 1 28   ? -27.140 91.267  56.922  1.00 19.58 ? 28   GLU A O   1 
ATOM   203   C CB  . GLU A 1 28   ? -24.716 89.795  58.381  1.00 17.84 ? 28   GLU A CB  1 
ATOM   204   C CG  . GLU A 1 28   ? -23.303 89.196  58.291  1.00 19.14 ? 28   GLU A CG  1 
ATOM   205   C CD  . GLU A 1 28   ? -23.241 87.713  58.586  1.00 18.70 ? 28   GLU A CD  1 
ATOM   206   O OE1 . GLU A 1 28   ? -24.079 87.203  59.369  1.00 23.03 ? 28   GLU A OE1 1 
ATOM   207   O OE2 . GLU A 1 28   ? -22.333 87.055  58.042  1.00 18.23 ? 28   GLU A OE2 1 
ATOM   208   N N   . ASP A 1 29   ? -26.488 92.605  58.609  1.00 19.87 ? 29   ASP A N   1 
ATOM   209   C CA  . ASP A 1 29   ? -27.806 93.223  58.709  1.00 20.22 ? 29   ASP A CA  1 
ATOM   210   C C   . ASP A 1 29   ? -27.985 94.045  57.438  1.00 17.96 ? 29   ASP A C   1 
ATOM   211   O O   . ASP A 1 29   ? -29.056 94.041  56.822  1.00 17.33 ? 29   ASP A O   1 
ATOM   212   C CB  . ASP A 1 29   ? -27.904 94.132  59.938  1.00 24.70 ? 29   ASP A CB  1 
ATOM   213   C CG  . ASP A 1 29   ? -28.002 93.350  61.240  1.00 30.54 ? 29   ASP A CG  1 
ATOM   214   O OD1 . ASP A 1 29   ? -28.756 92.339  61.274  1.00 32.84 ? 29   ASP A OD1 1 
ATOM   215   O OD2 . ASP A 1 29   ? -27.335 93.754  62.228  1.00 32.38 ? 29   ASP A OD2 1 
ATOM   216   N N   . ALA A 1 30   ? -26.924 94.747  57.049  1.00 15.14 ? 30   ALA A N   1 
ATOM   217   C CA  . ALA A 1 30   ? -26.943 95.548  55.834  1.00 14.14 ? 30   ALA A CA  1 
ATOM   218   C C   . ALA A 1 30   ? -27.203 94.613  54.635  1.00 14.37 ? 30   ALA A C   1 
ATOM   219   O O   . ALA A 1 30   ? -27.990 94.929  53.741  1.00 12.12 ? 30   ALA A O   1 
ATOM   220   C CB  . ALA A 1 30   ? -25.608 96.262  55.668  1.00 13.01 ? 30   ALA A CB  1 
ATOM   221   N N   . ALA A 1 31   ? -26.538 93.462  54.619  1.00 12.93 ? 31   ALA A N   1 
ATOM   222   C CA  . ALA A 1 31   ? -26.735 92.514  53.534  1.00 15.50 ? 31   ALA A CA  1 
ATOM   223   C C   . ALA A 1 31   ? -28.214 92.083  53.471  1.00 16.73 ? 31   ALA A C   1 
ATOM   224   O O   . ALA A 1 31   ? -28.811 92.020  52.397  1.00 16.01 ? 31   ALA A O   1 
ATOM   225   C CB  . ALA A 1 31   ? -25.826 91.306  53.727  1.00 12.85 ? 31   ALA A CB  1 
ATOM   226   N N   . LYS A 1 32   ? -28.802 91.793  54.622  1.00 18.65 ? 32   LYS A N   1 
ATOM   227   C CA  . LYS A 1 32   ? -30.200 91.410  54.661  1.00 21.59 ? 32   LYS A CA  1 
ATOM   228   C C   . LYS A 1 32   ? -31.049 92.566  54.119  1.00 21.94 ? 32   LYS A C   1 
ATOM   229   O O   . LYS A 1 32   ? -32.024 92.336  53.395  1.00 22.27 ? 32   LYS A O   1 
ATOM   230   C CB  . LYS A 1 32   ? -30.632 91.089  56.095  1.00 24.22 ? 32   LYS A CB  1 
ATOM   231   C CG  . LYS A 1 32   ? -29.989 89.830  56.683  1.00 30.31 ? 32   LYS A CG  1 
ATOM   232   C CD  . LYS A 1 32   ? -30.342 89.638  58.175  1.00 32.20 ? 32   LYS A CD  1 
ATOM   233   C CE  . LYS A 1 32   ? -29.598 88.450  58.790  1.00 33.81 ? 32   LYS A CE  1 
ATOM   234   N NZ  . LYS A 1 32   ? -29.836 88.288  60.256  1.00 34.61 ? 32   LYS A NZ  1 
ATOM   235   N N   . ALA A 1 33   ? -30.670 93.798  54.459  1.00 18.85 ? 33   ALA A N   1 
ATOM   236   C CA  . ALA A 1 33   ? -31.406 94.980  54.011  1.00 18.18 ? 33   ALA A CA  1 
ATOM   237   C C   . ALA A 1 33   ? -31.338 95.153  52.506  1.00 18.43 ? 33   ALA A C   1 
ATOM   238   O O   . ALA A 1 33   ? -32.330 95.519  51.869  1.00 20.07 ? 33   ALA A O   1 
ATOM   239   C CB  . ALA A 1 33   ? -30.876 96.250  54.708  1.00 15.98 ? 33   ALA A CB  1 
ATOM   240   N N   . PHE A 1 34   ? -30.172 94.898  51.929  1.00 17.65 ? 34   PHE A N   1 
ATOM   241   C CA  . PHE A 1 34   ? -30.027 95.037  50.484  1.00 19.69 ? 34   PHE A CA  1 
ATOM   242   C C   . PHE A 1 34   ? -30.919 94.036  49.745  1.00 21.53 ? 34   PHE A C   1 
ATOM   243   O O   . PHE A 1 34   ? -31.606 94.384  48.783  1.00 22.30 ? 34   PHE A O   1 
ATOM   244   C CB  . PHE A 1 34   ? -28.564 94.818  50.049  1.00 15.54 ? 34   PHE A CB  1 
ATOM   245   C CG  . PHE A 1 34   ? -27.697 96.044  50.155  1.00 13.04 ? 34   PHE A CG  1 
ATOM   246   C CD1 . PHE A 1 34   ? -27.853 97.104  49.264  1.00 12.25 ? 34   PHE A CD1 1 
ATOM   247   C CD2 . PHE A 1 34   ? -26.695 96.124  51.126  1.00 13.89 ? 34   PHE A CD2 1 
ATOM   248   C CE1 . PHE A 1 34   ? -27.024 98.230  49.331  1.00 10.48 ? 34   PHE A CE1 1 
ATOM   249   C CE2 . PHE A 1 34   ? -25.854 97.245  51.209  1.00 12.31 ? 34   PHE A CE2 1 
ATOM   250   C CZ  . PHE A 1 34   ? -26.019 98.300  50.306  1.00 12.14 ? 34   PHE A CZ  1 
ATOM   251   N N   . SER A 1 35   ? -30.904 92.793  50.205  1.00 23.12 ? 35   SER A N   1 
ATOM   252   C CA  . SER A 1 35   ? -31.663 91.734  49.568  1.00 25.40 ? 35   SER A CA  1 
ATOM   253   C C   . SER A 1 35   ? -33.168 91.835  49.743  1.00 26.55 ? 35   SER A C   1 
ATOM   254   O O   . SER A 1 35   ? -33.912 91.202  48.995  1.00 27.63 ? 35   SER A O   1 
ATOM   255   C CB  . SER A 1 35   ? -31.201 90.388  50.098  1.00 27.09 ? 35   SER A CB  1 
ATOM   256   O OG  . SER A 1 35   ? -31.537 90.281  51.470  1.00 34.21 ? 35   SER A OG  1 
ATOM   257   N N   . MET A 1 36   ? -33.620 92.608  50.725  1.00 26.49 ? 36   MET A N   1 
ATOM   258   C CA  . MET A 1 36   ? -35.051 92.745  50.959  1.00 28.40 ? 36   MET A CA  1 
ATOM   259   C C   . MET A 1 36   ? -35.613 94.008  50.322  1.00 28.00 ? 36   MET A C   1 
ATOM   260   O O   . MET A 1 36   ? -36.832 94.187  50.233  1.00 28.52 ? 36   MET A O   1 
ATOM   261   C CB  . MET A 1 36   ? -35.350 92.741  52.461  1.00 33.12 ? 36   MET A CB  1 
ATOM   262   C CG  . MET A 1 36   ? -35.118 91.395  53.149  1.00 39.63 ? 36   MET A CG  1 
ATOM   263   S SD  . MET A 1 36   ? -36.195 90.066  52.525  1.00 49.36 ? 36   MET A SD  1 
ATOM   264   C CE  . MET A 1 36   ? -35.091 89.156  51.386  1.00 44.64 ? 36   MET A CE  1 
ATOM   265   N N   . PHE A 1 37   ? -34.716 94.884  49.886  1.00 25.67 ? 37   PHE A N   1 
ATOM   266   C CA  . PHE A 1 37   ? -35.093 96.130  49.236  1.00 22.32 ? 37   PHE A CA  1 
ATOM   267   C C   . PHE A 1 37   ? -35.740 95.809  47.891  1.00 23.36 ? 37   PHE A C   1 
ATOM   268   O O   . PHE A 1 37   ? -35.094 95.242  47.002  1.00 22.67 ? 37   PHE A O   1 
ATOM   269   C CB  . PHE A 1 37   ? -33.852 96.979  48.978  1.00 20.51 ? 37   PHE A CB  1 
ATOM   270   C CG  . PHE A 1 37   ? -33.975 98.389  49.441  1.00 17.35 ? 37   PHE A CG  1 
ATOM   271   C CD1 . PHE A 1 37   ? -33.866 98.699  50.789  1.00 14.34 ? 37   PHE A CD1 1 
ATOM   272   C CD2 . PHE A 1 37   ? -34.213 99.411  48.532  1.00 15.68 ? 37   PHE A CD2 1 
ATOM   273   C CE1 . PHE A 1 37   ? -33.993 100.005 51.223  1.00 14.04 ? 37   PHE A CE1 1 
ATOM   274   C CE2 . PHE A 1 37   ? -34.343 100.725 48.961  1.00 14.55 ? 37   PHE A CE2 1 
ATOM   275   C CZ  . PHE A 1 37   ? -34.233 101.022 50.307  1.00 13.94 ? 37   PHE A CZ  1 
ATOM   276   N N   . THR A 1 38   ? -37.009 96.162  47.733  1.00 23.13 ? 38   THR A N   1 
ATOM   277   C CA  . THR A 1 38   ? -37.674 95.910  46.466  1.00 23.60 ? 38   THR A CA  1 
ATOM   278   C C   . THR A 1 38   ? -37.060 96.843  45.419  1.00 22.51 ? 38   THR A C   1 
ATOM   279   O O   . THR A 1 38   ? -36.563 97.932  45.734  1.00 20.27 ? 38   THR A O   1 
ATOM   280   C CB  . THR A 1 38   ? -39.193 96.203  46.532  1.00 25.97 ? 38   THR A CB  1 
ATOM   281   O OG1 . THR A 1 38   ? -39.396 97.620  46.577  1.00 28.61 ? 38   THR A OG1 1 
ATOM   282   C CG2 . THR A 1 38   ? -39.821 95.564  47.768  1.00 23.03 ? 38   THR A CG2 1 
ATOM   283   N N   . ARG A 1 39   ? -37.109 96.405  44.171  1.00 21.76 ? 39   ARG A N   1 
ATOM   284   C CA  . ARG A 1 39   ? -36.569 97.167  43.060  1.00 22.05 ? 39   ARG A CA  1 
ATOM   285   C C   . ARG A 1 39   ? -37.164 98.580  42.973  1.00 21.98 ? 39   ARG A C   1 
ATOM   286   O O   . ARG A 1 39   ? -36.432 99.568  42.901  1.00 23.42 ? 39   ARG A O   1 
ATOM   287   C CB  . ARG A 1 39   ? -36.825 96.394  41.768  1.00 22.12 ? 39   ARG A CB  1 
ATOM   288   C CG  . ARG A 1 39   ? -35.897 96.737  40.659  1.00 23.29 ? 39   ARG A CG  1 
ATOM   289   C CD  . ARG A 1 39   ? -36.100 95.820  39.465  1.00 27.02 ? 39   ARG A CD  1 
ATOM   290   N NE  . ARG A 1 39   ? -35.615 94.456  39.679  1.00 31.28 ? 39   ARG A NE  1 
ATOM   291   C CZ  . ARG A 1 39   ? -34.375 94.143  40.067  1.00 32.89 ? 39   ARG A CZ  1 
ATOM   292   N NH1 . ARG A 1 39   ? -33.482 95.093  40.299  1.00 32.54 ? 39   ARG A NH1 1 
ATOM   293   N NH2 . ARG A 1 39   ? -34.011 92.872  40.201  1.00 33.71 ? 39   ARG A NH2 1 
ATOM   294   N N   . SER A 1 40   ? -38.487 98.686  43.000  1.00 21.26 ? 40   SER A N   1 
ATOM   295   C CA  . SER A 1 40   ? -39.122 99.995  42.913  1.00 21.74 ? 40   SER A CA  1 
ATOM   296   C C   . SER A 1 40   ? -38.812 100.876 44.112  1.00 21.68 ? 40   SER A C   1 
ATOM   297   O O   . SER A 1 40   ? -38.933 102.099 44.038  1.00 20.70 ? 40   SER A O   1 
ATOM   298   C CB  . SER A 1 40   ? -40.639 99.854  42.758  1.00 22.30 ? 40   SER A CB  1 
ATOM   299   O OG  . SER A 1 40   ? -40.963 99.275  41.508  1.00 23.31 ? 40   SER A OG  1 
ATOM   300   N N   . ASP A 1 41   ? -38.422 100.271 45.227  1.00 22.42 ? 41   ASP A N   1 
ATOM   301   C CA  . ASP A 1 41   ? -38.097 101.084 46.387  1.00 23.63 ? 41   ASP A CA  1 
ATOM   302   C C   . ASP A 1 41   ? -36.847 101.888 46.103  1.00 23.01 ? 41   ASP A C   1 
ATOM   303   O O   . ASP A 1 41   ? -36.703 102.997 46.604  1.00 24.38 ? 41   ASP A O   1 
ATOM   304   C CB  . ASP A 1 41   ? -37.859 100.237 47.634  1.00 26.78 ? 41   ASP A CB  1 
ATOM   305   C CG  . ASP A 1 41   ? -39.131 99.995  48.437  1.00 29.57 ? 41   ASP A CG  1 
ATOM   306   O OD1 . ASP A 1 41   ? -39.885 100.959 48.674  1.00 28.42 ? 41   ASP A OD1 1 
ATOM   307   O OD2 . ASP A 1 41   ? -39.361 98.836  48.846  1.00 32.86 ? 41   ASP A OD2 1 
ATOM   308   N N   . VAL A 1 42   ? -35.937 101.336 45.305  1.00 20.51 ? 42   VAL A N   1 
ATOM   309   C CA  . VAL A 1 42   ? -34.713 102.053 44.994  1.00 18.59 ? 42   VAL A CA  1 
ATOM   310   C C   . VAL A 1 42   ? -35.085 103.358 44.304  1.00 18.76 ? 42   VAL A C   1 
ATOM   311   O O   . VAL A 1 42   ? -34.532 104.415 44.604  1.00 17.76 ? 42   VAL A O   1 
ATOM   312   C CB  . VAL A 1 42   ? -33.804 101.230 44.069  1.00 18.59 ? 42   VAL A CB  1 
ATOM   313   C CG1 . VAL A 1 42   ? -32.506 101.979 43.818  1.00 15.69 ? 42   VAL A CG1 1 
ATOM   314   C CG2 . VAL A 1 42   ? -33.520 99.876  44.694  1.00 16.78 ? 42   VAL A CG2 1 
ATOM   315   N N   . TYR A 1 43   ? -36.037 103.277 43.380  1.00 19.04 ? 43   TYR A N   1 
ATOM   316   C CA  . TYR A 1 43   ? -36.504 104.458 42.663  1.00 20.35 ? 43   TYR A CA  1 
ATOM   317   C C   . TYR A 1 43   ? -37.214 105.415 43.625  1.00 21.28 ? 43   TYR A C   1 
ATOM   318   O O   . TYR A 1 43   ? -37.134 106.639 43.470  1.00 23.58 ? 43   TYR A O   1 
ATOM   319   C CB  . TYR A 1 43   ? -37.429 104.044 41.514  1.00 18.78 ? 43   TYR A CB  1 
ATOM   320   C CG  . TYR A 1 43   ? -36.705 103.263 40.440  1.00 17.98 ? 43   TYR A CG  1 
ATOM   321   C CD1 . TYR A 1 43   ? -36.006 103.917 39.425  1.00 18.49 ? 43   TYR A CD1 1 
ATOM   322   C CD2 . TYR A 1 43   ? -36.667 101.868 40.465  1.00 17.25 ? 43   TYR A CD2 1 
ATOM   323   C CE1 . TYR A 1 43   ? -35.289 103.201 38.465  1.00 16.29 ? 43   TYR A CE1 1 
ATOM   324   C CE2 . TYR A 1 43   ? -35.948 101.147 39.507  1.00 14.89 ? 43   TYR A CE2 1 
ATOM   325   C CZ  . TYR A 1 43   ? -35.265 101.823 38.515  1.00 15.01 ? 43   TYR A CZ  1 
ATOM   326   O OH  . TYR A 1 43   ? -34.547 101.130 37.573  1.00 15.43 ? 43   TYR A OH  1 
ATOM   327   N N   . LYS A 1 44   ? -37.909 104.874 44.620  1.00 22.19 ? 44   LYS A N   1 
ATOM   328   C CA  . LYS A 1 44   ? -38.563 105.749 45.583  1.00 23.89 ? 44   LYS A CA  1 
ATOM   329   C C   . LYS A 1 44   ? -37.467 106.452 46.386  1.00 22.99 ? 44   LYS A C   1 
ATOM   330   O O   . LYS A 1 44   ? -37.610 107.611 46.762  1.00 24.82 ? 44   LYS A O   1 
ATOM   331   C CB  . LYS A 1 44   ? -39.497 104.964 46.519  1.00 25.90 ? 44   LYS A CB  1 
ATOM   332   C CG  . LYS A 1 44   ? -40.845 104.597 45.876  1.00 30.68 ? 44   LYS A CG  1 
ATOM   333   C CD  . LYS A 1 44   ? -41.937 104.325 46.914  1.00 32.36 ? 44   LYS A CD  1 
ATOM   334   C CE  . LYS A 1 44   ? -41.610 103.122 47.787  1.00 34.51 ? 44   LYS A CE  1 
ATOM   335   N NZ  . LYS A 1 44   ? -41.514 101.863 46.988  1.00 36.55 ? 44   LYS A NZ  1 
ATOM   336   N N   . ALA A 1 45   ? -36.369 105.748 46.638  1.00 20.85 ? 45   ALA A N   1 
ATOM   337   C CA  . ALA A 1 45   ? -35.255 106.331 47.372  1.00 19.56 ? 45   ALA A CA  1 
ATOM   338   C C   . ALA A 1 45   ? -34.675 107.476 46.535  1.00 19.00 ? 45   ALA A C   1 
ATOM   339   O O   . ALA A 1 45   ? -34.300 108.513 47.067  1.00 18.07 ? 45   ALA A O   1 
ATOM   340   C CB  . ALA A 1 45   ? -34.186 105.266 47.654  1.00 17.03 ? 45   ALA A CB  1 
ATOM   341   N N   . LEU A 1 46   ? -34.615 107.288 45.221  1.00 19.79 ? 46   LEU A N   1 
ATOM   342   C CA  . LEU A 1 46   ? -34.102 108.328 44.339  1.00 20.48 ? 46   LEU A CA  1 
ATOM   343   C C   . LEU A 1 46   ? -35.008 109.550 44.398  1.00 22.50 ? 46   LEU A C   1 
ATOM   344   O O   . LEU A 1 46   ? -34.523 110.680 44.329  1.00 23.20 ? 46   LEU A O   1 
ATOM   345   C CB  . LEU A 1 46   ? -33.998 107.816 42.897  1.00 17.83 ? 46   LEU A CB  1 
ATOM   346   C CG  . LEU A 1 46   ? -32.915 106.764 42.643  1.00 14.81 ? 46   LEU A CG  1 
ATOM   347   C CD1 . LEU A 1 46   ? -32.764 106.539 41.158  1.00 14.25 ? 46   LEU A CD1 1 
ATOM   348   C CD2 . LEU A 1 46   ? -31.591 107.238 43.201  1.00 15.36 ? 46   LEU A CD2 1 
ATOM   349   N N   . ASP A 1 47   ? -36.319 109.320 44.527  1.00 23.32 ? 47   ASP A N   1 
ATOM   350   C CA  . ASP A 1 47   ? -37.306 110.409 44.633  1.00 23.39 ? 47   ASP A CA  1 
ATOM   351   C C   . ASP A 1 47   ? -37.045 111.344 45.836  1.00 23.52 ? 47   ASP A C   1 
ATOM   352   O O   . ASP A 1 47   ? -37.311 112.548 45.766  1.00 21.96 ? 47   ASP A O   1 
ATOM   353   C CB  . ASP A 1 47   ? -38.729 109.853 44.800  1.00 23.49 ? 47   ASP A CB  1 
ATOM   354   C CG  . ASP A 1 47   ? -39.288 109.219 43.532  1.00 24.21 ? 47   ASP A CG  1 
ATOM   355   O OD1 . ASP A 1 47   ? -38.940 109.637 42.407  1.00 24.37 ? 47   ASP A OD1 1 
ATOM   356   O OD2 . ASP A 1 47   ? -40.118 108.304 43.674  1.00 24.92 ? 47   ASP A OD2 1 
ATOM   357   N N   . GLU A 1 48   ? -36.543 110.783 46.938  1.00 23.07 ? 48   GLU A N   1 
ATOM   358   C CA  . GLU A 1 48   ? -36.269 111.555 48.147  1.00 24.72 ? 48   GLU A CA  1 
ATOM   359   C C   . GLU A 1 48   ? -35.108 112.539 48.014  1.00 24.59 ? 48   GLU A C   1 
ATOM   360   O O   . GLU A 1 48   ? -34.981 113.462 48.820  1.00 26.04 ? 48   GLU A O   1 
ATOM   361   C CB  . GLU A 1 48   ? -35.998 110.617 49.331  1.00 26.26 ? 48   GLU A CB  1 
ATOM   362   C CG  . GLU A 1 48   ? -37.080 109.582 49.563  1.00 30.72 ? 48   GLU A CG  1 
ATOM   363   C CD  . GLU A 1 48   ? -36.990 108.938 50.940  1.00 35.79 ? 48   GLU A CD  1 
ATOM   364   O OE1 . GLU A 1 48   ? -35.888 108.475 51.318  1.00 36.23 ? 48   GLU A OE1 1 
ATOM   365   O OE2 . GLU A 1 48   ? -38.028 108.892 51.645  1.00 37.33 ? 48   GLU A OE2 1 
ATOM   366   N N   . ILE A 1 49   ? -34.258 112.349 47.011  1.00 22.02 ? 49   ILE A N   1 
ATOM   367   C CA  . ILE A 1 49   ? -33.124 113.246 46.812  1.00 21.56 ? 49   ILE A CA  1 
ATOM   368   C C   . ILE A 1 49   ? -33.553 114.602 46.215  1.00 21.97 ? 49   ILE A C   1 
ATOM   369   O O   . ILE A 1 49   ? -34.144 114.666 45.131  1.00 20.83 ? 49   ILE A O   1 
ATOM   370   C CB  . ILE A 1 49   ? -32.060 112.580 45.901  1.00 20.56 ? 49   ILE A CB  1 
ATOM   371   C CG1 . ILE A 1 49   ? -31.564 111.293 46.563  1.00 18.50 ? 49   ILE A CG1 1 
ATOM   372   C CG2 . ILE A 1 49   ? -30.917 113.547 45.623  1.00 17.17 ? 49   ILE A CG2 1 
ATOM   373   C CD1 . ILE A 1 49   ? -30.724 110.409 45.659  1.00 19.35 ? 49   ILE A CD1 1 
ATOM   374   N N   . PRO A 1 50   ? -33.247 115.704 46.924  1.00 22.38 ? 50   PRO A N   1 
ATOM   375   C CA  . PRO A 1 50   ? -33.572 117.077 46.524  1.00 22.70 ? 50   PRO A CA  1 
ATOM   376   C C   . PRO A 1 50   ? -32.584 117.581 45.484  1.00 23.96 ? 50   PRO A C   1 
ATOM   377   O O   . PRO A 1 50   ? -31.735 118.437 45.771  1.00 24.65 ? 50   PRO A O   1 
ATOM   378   C CB  . PRO A 1 50   ? -33.447 117.837 47.834  1.00 22.90 ? 50   PRO A CB  1 
ATOM   379   C CG  . PRO A 1 50   ? -32.235 117.185 48.437  1.00 21.84 ? 50   PRO A CG  1 
ATOM   380   C CD  . PRO A 1 50   ? -32.529 115.704 48.213  1.00 22.07 ? 50   PRO A CD  1 
ATOM   381   N N   . PHE A 1 51   ? -32.690 117.047 44.277  1.00 23.58 ? 51   PHE A N   1 
ATOM   382   C CA  . PHE A 1 51   ? -31.787 117.445 43.217  1.00 23.67 ? 51   PHE A CA  1 
ATOM   383   C C   . PHE A 1 51   ? -31.680 118.946 43.038  1.00 24.15 ? 51   PHE A C   1 
ATOM   384   O O   . PHE A 1 51   ? -32.664 119.664 43.147  1.00 23.97 ? 51   PHE A O   1 
ATOM   385   C CB  . PHE A 1 51   ? -32.201 116.787 41.907  1.00 23.02 ? 51   PHE A CB  1 
ATOM   386   C CG  . PHE A 1 51   ? -31.775 115.354 41.802  1.00 23.73 ? 51   PHE A CG  1 
ATOM   387   C CD1 . PHE A 1 51   ? -30.433 115.029 41.602  1.00 21.89 ? 51   PHE A CD1 1 
ATOM   388   C CD2 . PHE A 1 51   ? -32.702 114.325 41.928  1.00 21.72 ? 51   PHE A CD2 1 
ATOM   389   C CE1 . PHE A 1 51   ? -30.026 113.702 41.530  1.00 20.93 ? 51   PHE A CE1 1 
ATOM   390   C CE2 . PHE A 1 51   ? -32.301 113.000 41.859  1.00 20.45 ? 51   PHE A CE2 1 
ATOM   391   C CZ  . PHE A 1 51   ? -30.961 112.686 41.659  1.00 20.14 ? 51   PHE A CZ  1 
ATOM   392   N N   . SER A 1 52   ? -30.459 119.402 42.771  1.00 26.26 ? 52   SER A N   1 
ATOM   393   C CA  . SER A 1 52   ? -30.142 120.813 42.548  1.00 26.45 ? 52   SER A CA  1 
ATOM   394   C C   . SER A 1 52   ? -30.327 121.142 41.069  1.00 26.52 ? 52   SER A C   1 
ATOM   395   O O   . SER A 1 52   ? -30.219 120.254 40.216  1.00 26.62 ? 52   SER A O   1 
ATOM   396   C CB  . SER A 1 52   ? -28.690 121.087 42.970  1.00 28.44 ? 52   SER A CB  1 
ATOM   397   O OG  . SER A 1 52   ? -28.129 122.188 42.266  1.00 32.07 ? 52   SER A OG  1 
ATOM   398   N N   . ASP A 1 53   ? -30.604 122.406 40.753  1.00 25.27 ? 53   ASP A N   1 
ATOM   399   C CA  . ASP A 1 53   ? -30.798 122.773 39.360  1.00 25.93 ? 53   ASP A CA  1 
ATOM   400   C C   . ASP A 1 53   ? -29.578 122.429 38.510  1.00 25.01 ? 53   ASP A C   1 
ATOM   401   O O   . ASP A 1 53   ? -29.714 122.060 37.340  1.00 24.69 ? 53   ASP A O   1 
ATOM   402   C CB  . ASP A 1 53   ? -31.110 124.266 39.217  1.00 29.61 ? 53   ASP A CB  1 
ATOM   403   C CG  . ASP A 1 53   ? -32.509 124.617 39.692  1.00 35.06 ? 53   ASP A CG  1 
ATOM   404   O OD1 . ASP A 1 53   ? -33.434 123.799 39.483  1.00 38.51 ? 53   ASP A OD1 1 
ATOM   405   O OD2 . ASP A 1 53   ? -32.691 125.717 40.262  1.00 37.23 ? 53   ASP A OD2 1 
ATOM   406   N N   . ASP A 1 54   ? -28.388 122.538 39.093  1.00 23.20 ? 54   ASP A N   1 
ATOM   407   C CA  . ASP A 1 54   ? -27.178 122.248 38.337  1.00 22.34 ? 54   ASP A CA  1 
ATOM   408   C C   . ASP A 1 54   ? -27.030 120.781 37.955  1.00 20.20 ? 54   ASP A C   1 
ATOM   409   O O   . ASP A 1 54   ? -26.134 120.431 37.190  1.00 20.81 ? 54   ASP A O   1 
ATOM   410   C CB  . ASP A 1 54   ? -25.918 122.726 39.081  1.00 22.74 ? 54   ASP A CB  1 
ATOM   411   C CG  . ASP A 1 54   ? -25.749 122.086 40.455  1.00 25.96 ? 54   ASP A CG  1 
ATOM   412   O OD1 . ASP A 1 54   ? -25.904 120.845 40.592  1.00 24.62 ? 54   ASP A OD1 1 
ATOM   413   O OD2 . ASP A 1 54   ? -25.432 122.840 41.402  1.00 27.78 ? 54   ASP A OD2 1 
ATOM   414   N N   . ALA A 1 55   ? -27.903 119.925 38.474  1.00 17.29 ? 55   ALA A N   1 
ATOM   415   C CA  . ALA A 1 55   ? -27.831 118.507 38.130  1.00 18.63 ? 55   ALA A CA  1 
ATOM   416   C C   . ALA A 1 55   ? -28.790 118.203 36.983  1.00 19.20 ? 55   ALA A C   1 
ATOM   417   O O   . ALA A 1 55   ? -28.950 117.045 36.581  1.00 17.45 ? 55   ALA A O   1 
ATOM   418   C CB  . ALA A 1 55   ? -28.171 117.627 39.345  1.00 14.82 ? 55   ALA A CB  1 
ATOM   419   N N   . MET A 1 56   ? -29.408 119.250 36.442  1.00 20.48 ? 56   MET A N   1 
ATOM   420   C CA  . MET A 1 56   ? -30.366 119.064 35.371  1.00 22.96 ? 56   MET A CA  1 
ATOM   421   C C   . MET A 1 56   ? -29.954 119.607 34.024  1.00 23.69 ? 56   MET A C   1 
ATOM   422   O O   . MET A 1 56   ? -29.173 120.549 33.916  1.00 24.42 ? 56   MET A O   1 
ATOM   423   C CB  . MET A 1 56   ? -31.700 119.684 35.760  1.00 24.96 ? 56   MET A CB  1 
ATOM   424   C CG  . MET A 1 56   ? -32.297 119.123 37.032  1.00 27.99 ? 56   MET A CG  1 
ATOM   425   S SD  . MET A 1 56   ? -33.717 120.118 37.551  1.00 33.11 ? 56   MET A SD  1 
ATOM   426   C CE  . MET A 1 56   ? -33.823 119.716 39.339  1.00 31.60 ? 56   MET A CE  1 
ATOM   427   N N   . LEU A 1 57   ? -30.482 118.980 32.988  1.00 23.99 ? 57   LEU A N   1 
ATOM   428   C CA  . LEU A 1 57   ? -30.225 119.416 31.629  1.00 25.42 ? 57   LEU A CA  1 
ATOM   429   C C   . LEU A 1 57   ? -31.418 118.961 30.807  1.00 23.51 ? 57   LEU A C   1 
ATOM   430   O O   . LEU A 1 57   ? -32.183 118.106 31.235  1.00 24.38 ? 57   LEU A O   1 
ATOM   431   C CB  . LEU A 1 57   ? -28.905 118.842 31.097  1.00 25.57 ? 57   LEU A CB  1 
ATOM   432   C CG  . LEU A 1 57   ? -28.750 117.362 30.783  1.00 26.32 ? 57   LEU A CG  1 
ATOM   433   C CD1 . LEU A 1 57   ? -27.294 117.086 30.446  1.00 25.71 ? 57   LEU A CD1 1 
ATOM   434   C CD2 . LEU A 1 57   ? -29.175 116.527 31.967  1.00 30.03 ? 57   LEU A CD2 1 
ATOM   435   N N   . PRO A 1 58   ? -31.611 119.550 29.632  1.00 23.42 ? 58   PRO A N   1 
ATOM   436   C CA  . PRO A 1 58   ? -32.732 119.205 28.748  1.00 24.13 ? 58   PRO A CA  1 
ATOM   437   C C   . PRO A 1 58   ? -32.762 117.752 28.310  1.00 23.14 ? 58   PRO A C   1 
ATOM   438   O O   . PRO A 1 58   ? -31.770 117.242 27.809  1.00 27.37 ? 58   PRO A O   1 
ATOM   439   C CB  . PRO A 1 58   ? -32.529 120.141 27.563  1.00 23.11 ? 58   PRO A CB  1 
ATOM   440   C CG  . PRO A 1 58   ? -31.856 121.341 28.203  1.00 24.37 ? 58   PRO A CG  1 
ATOM   441   C CD  . PRO A 1 58   ? -30.843 120.682 29.091  1.00 23.48 ? 58   PRO A CD  1 
ATOM   442   N N   . ILE A 1 59   ? -33.883 117.075 28.504  1.00 21.66 ? 59   ILE A N   1 
ATOM   443   C CA  . ILE A 1 59   ? -33.972 115.691 28.060  1.00 21.59 ? 59   ILE A CA  1 
ATOM   444   C C   . ILE A 1 59   ? -34.815 115.603 26.782  1.00 22.37 ? 59   ILE A C   1 
ATOM   445   O O   . ILE A 1 59   ? -36.029 115.807 26.807  1.00 21.26 ? 59   ILE A O   1 
ATOM   446   C CB  . ILE A 1 59   ? -34.562 114.774 29.147  1.00 17.26 ? 59   ILE A CB  1 
ATOM   447   C CG1 . ILE A 1 59   ? -33.670 114.816 30.375  1.00 17.06 ? 59   ILE A CG1 1 
ATOM   448   C CG2 . ILE A 1 59   ? -34.621 113.336 28.654  1.00 15.82 ? 59   ILE A CG2 1 
ATOM   449   C CD1 . ILE A 1 59   ? -34.108 113.878 31.461  1.00 18.32 ? 59   ILE A CD1 1 
ATOM   450   N N   . PRO A 1 60   ? -34.162 115.288 25.646  1.00 24.00 ? 60   PRO A N   1 
ATOM   451   C CA  . PRO A 1 60   ? -34.756 115.153 24.307  1.00 24.70 ? 60   PRO A CA  1 
ATOM   452   C C   . PRO A 1 60   ? -36.034 114.328 24.329  1.00 25.55 ? 60   PRO A C   1 
ATOM   453   O O   . PRO A 1 60   ? -35.994 113.132 24.595  1.00 27.03 ? 60   PRO A O   1 
ATOM   454   C CB  . PRO A 1 60   ? -33.657 114.459 23.507  1.00 22.61 ? 60   PRO A CB  1 
ATOM   455   C CG  . PRO A 1 60   ? -32.414 114.933 24.170  1.00 23.46 ? 60   PRO A CG  1 
ATOM   456   C CD  . PRO A 1 60   ? -32.755 114.847 25.633  1.00 22.97 ? 60   PRO A CD  1 
ATOM   457   N N   . PRO A 1 61   ? -37.182 114.951 24.030  1.00 26.31 ? 61   PRO A N   1 
ATOM   458   C CA  . PRO A 1 61   ? -38.448 114.204 24.041  1.00 25.22 ? 61   PRO A CA  1 
ATOM   459   C C   . PRO A 1 61   ? -38.425 113.045 23.052  1.00 23.46 ? 61   PRO A C   1 
ATOM   460   O O   . PRO A 1 61   ? -39.070 112.022 23.266  1.00 22.43 ? 61   PRO A O   1 
ATOM   461   C CB  . PRO A 1 61   ? -39.487 115.263 23.661  1.00 25.84 ? 61   PRO A CB  1 
ATOM   462   C CG  . PRO A 1 61   ? -38.839 116.554 24.082  1.00 26.99 ? 61   PRO A CG  1 
ATOM   463   C CD  . PRO A 1 61   ? -37.405 116.356 23.653  1.00 25.18 ? 61   PRO A CD  1 
ATOM   464   N N   . THR A 1 62   ? -37.661 113.209 21.978  1.00 23.63 ? 62   THR A N   1 
ATOM   465   C CA  . THR A 1 62   ? -37.563 112.181 20.950  1.00 25.16 ? 62   THR A CA  1 
ATOM   466   C C   . THR A 1 62   ? -36.897 110.892 21.443  1.00 26.45 ? 62   THR A C   1 
ATOM   467   O O   . THR A 1 62   ? -36.804 109.907 20.711  1.00 29.00 ? 62   THR A O   1 
ATOM   468   C CB  . THR A 1 62   ? -36.801 112.706 19.711  1.00 24.76 ? 62   THR A CB  1 
ATOM   469   O OG1 . THR A 1 62   ? -35.412 112.841 20.019  1.00 25.42 ? 62   THR A OG1 1 
ATOM   470   C CG2 . THR A 1 62   ? -37.339 114.070 19.302  1.00 25.39 ? 62   THR A CG2 1 
ATOM   471   N N   . ILE A 1 63   ? -36.432 110.888 22.681  1.00 25.11 ? 63   ILE A N   1 
ATOM   472   C CA  . ILE A 1 63   ? -35.818 109.691 23.224  1.00 25.30 ? 63   ILE A CA  1 
ATOM   473   C C   . ILE A 1 63   ? -36.896 108.656 23.541  1.00 25.89 ? 63   ILE A C   1 
ATOM   474   O O   . ILE A 1 63   ? -36.644 107.449 23.512  1.00 25.88 ? 63   ILE A O   1 
ATOM   475   C CB  . ILE A 1 63   ? -35.037 110.030 24.511  1.00 26.29 ? 63   ILE A CB  1 
ATOM   476   C CG1 . ILE A 1 63   ? -33.612 110.447 24.151  1.00 25.37 ? 63   ILE A CG1 1 
ATOM   477   C CG2 . ILE A 1 63   ? -35.052 108.866 25.476  1.00 26.66 ? 63   ILE A CG2 1 
ATOM   478   C CD1 . ILE A 1 63   ? -32.795 110.836 25.350  1.00 26.45 ? 63   ILE A CD1 1 
ATOM   479   N N   . TYR A 1 64   ? -38.109 109.138 23.801  1.00 25.95 ? 64   TYR A N   1 
ATOM   480   C CA  . TYR A 1 64   ? -39.220 108.272 24.185  1.00 25.92 ? 64   TYR A CA  1 
ATOM   481   C C   . TYR A 1 64   ? -40.171 107.802 23.096  1.00 26.57 ? 64   TYR A C   1 
ATOM   482   O O   . TYR A 1 64   ? -40.797 106.757 23.220  1.00 28.12 ? 64   TYR A O   1 
ATOM   483   C CB  . TYR A 1 64   ? -40.048 108.966 25.257  1.00 24.38 ? 64   TYR A CB  1 
ATOM   484   C CG  . TYR A 1 64   ? -39.253 109.448 26.440  1.00 24.46 ? 64   TYR A CG  1 
ATOM   485   C CD1 . TYR A 1 64   ? -38.658 108.544 27.321  1.00 23.71 ? 64   TYR A CD1 1 
ATOM   486   C CD2 . TYR A 1 64   ? -39.127 110.814 26.710  1.00 23.87 ? 64   TYR A CD2 1 
ATOM   487   C CE1 . TYR A 1 64   ? -37.968 108.989 28.446  1.00 22.75 ? 64   TYR A CE1 1 
ATOM   488   C CE2 . TYR A 1 64   ? -38.433 111.266 27.831  1.00 22.95 ? 64   TYR A CE2 1 
ATOM   489   C CZ  . TYR A 1 64   ? -37.861 110.347 28.695  1.00 22.21 ? 64   TYR A CZ  1 
ATOM   490   O OH  . TYR A 1 64   ? -37.196 110.783 29.814  1.00 23.44 ? 64   TYR A OH  1 
ATOM   491   N N   . THR A 1 65   ? -40.312 108.565 22.034  1.00 27.23 ? 65   THR A N   1 
ATOM   492   C CA  . THR A 1 65   ? -41.242 108.160 20.991  1.00 28.55 ? 65   THR A CA  1 
ATOM   493   C C   . THR A 1 65   ? -40.451 107.634 19.819  1.00 27.28 ? 65   THR A C   1 
ATOM   494   O O   . THR A 1 65   ? -39.942 108.418 19.024  1.00 29.71 ? 65   THR A O   1 
ATOM   495   C CB  . THR A 1 65   ? -42.091 109.361 20.555  1.00 30.05 ? 65   THR A CB  1 
ATOM   496   O OG1 . THR A 1 65   ? -41.235 110.387 20.029  1.00 31.19 ? 65   THR A OG1 1 
ATOM   497   C CG2 . THR A 1 65   ? -42.838 109.928 21.756  1.00 30.62 ? 65   THR A CG2 1 
ATOM   498   N N   . LYS A 1 66   ? -40.337 106.316 19.708  1.00 24.99 ? 66   LYS A N   1 
ATOM   499   C CA  . LYS A 1 66   ? -39.552 105.745 18.618  1.00 23.61 ? 66   LYS A CA  1 
ATOM   500   C C   . LYS A 1 66   ? -40.328 104.891 17.630  1.00 23.46 ? 66   LYS A C   1 
ATOM   501   O O   . LYS A 1 66   ? -41.314 104.246 17.982  1.00 24.84 ? 66   LYS A O   1 
ATOM   502   C CB  . LYS A 1 66   ? -38.373 104.927 19.173  1.00 21.82 ? 66   LYS A CB  1 
ATOM   503   C CG  . LYS A 1 66   ? -37.210 105.767 19.664  1.00 19.11 ? 66   LYS A CG  1 
ATOM   504   C CD  . LYS A 1 66   ? -36.649 106.653 18.559  1.00 15.23 ? 66   LYS A CD  1 
ATOM   505   C CE  . LYS A 1 66   ? -35.539 107.554 19.091  1.00 15.30 ? 66   LYS A CE  1 
ATOM   506   N NZ  . LYS A 1 66   ? -35.054 108.551 18.108  1.00 11.35 ? 66   LYS A NZ  1 
ATOM   507   N N   . PRO A 1 67   ? -39.867 104.862 16.371  1.00 22.62 ? 67   PRO A N   1 
ATOM   508   C CA  . PRO A 1 67   ? -40.486 104.097 15.285  1.00 21.87 ? 67   PRO A CA  1 
ATOM   509   C C   . PRO A 1 67   ? -40.429 102.589 15.468  1.00 21.57 ? 67   PRO A C   1 
ATOM   510   O O   . PRO A 1 67   ? -39.687 102.062 16.302  1.00 21.34 ? 67   PRO A O   1 
ATOM   511   C CB  . PRO A 1 67   ? -39.681 104.518 14.050  1.00 19.53 ? 67   PRO A CB  1 
ATOM   512   C CG  . PRO A 1 67   ? -39.108 105.843 14.425  1.00 21.81 ? 67   PRO A CG  1 
ATOM   513   C CD  . PRO A 1 67   ? -38.730 105.649 15.863  1.00 20.94 ? 67   PRO A CD  1 
ATOM   514   N N   . SER A 1 68   ? -41.213 101.906 14.644  1.00 21.93 ? 68   SER A N   1 
ATOM   515   C CA  . SER A 1 68   ? -41.259 100.459 14.628  1.00 20.59 ? 68   SER A CA  1 
ATOM   516   C C   . SER A 1 68   ? -39.938 99.942  14.076  1.00 19.88 ? 68   SER A C   1 
ATOM   517   O O   . SER A 1 68   ? -39.309 100.577 13.239  1.00 19.24 ? 68   SER A O   1 
ATOM   518   C CB  . SER A 1 68   ? -42.390 99.980  13.723  1.00 19.58 ? 68   SER A CB  1 
ATOM   519   O OG  . SER A 1 68   ? -42.198 98.621  13.370  1.00 18.71 ? 68   SER A OG  1 
ATOM   520   N N   . HIS A 1 69   ? -39.523 98.781  14.548  1.00 20.32 ? 69   HIS A N   1 
ATOM   521   C CA  . HIS A 1 69   ? -38.283 98.188  14.084  1.00 20.62 ? 69   HIS A CA  1 
ATOM   522   C C   . HIS A 1 69   ? -38.396 97.781  12.612  1.00 20.62 ? 69   HIS A C   1 
ATOM   523   O O   . HIS A 1 69   ? -37.414 97.834  11.886  1.00 21.47 ? 69   HIS A O   1 
ATOM   524   C CB  . HIS A 1 69   ? -37.988 96.916  14.873  1.00 19.35 ? 69   HIS A CB  1 
ATOM   525   C CG  . HIS A 1 69   ? -38.900 95.785  14.506  1.00 20.20 ? 69   HIS A CG  1 
ATOM   526   N ND1 . HIS A 1 69   ? -40.212 95.724  14.924  1.00 19.25 ? 69   HIS A ND1 1 
ATOM   527   C CD2 . HIS A 1 69   ? -38.725 94.739  13.662  1.00 20.00 ? 69   HIS A CD2 1 
ATOM   528   C CE1 . HIS A 1 69   ? -40.806 94.692  14.352  1.00 19.33 ? 69   HIS A CE1 1 
ATOM   529   N NE2 . HIS A 1 69   ? -39.927 94.078  13.580  1.00 19.47 ? 69   HIS A NE2 1 
ATOM   530   N N   . ASP A 1 70   ? -39.590 97.375  12.180  1.00 20.40 ? 70   ASP A N   1 
ATOM   531   C CA  . ASP A 1 70   ? -39.771 96.865  10.824  1.00 20.24 ? 70   ASP A CA  1 
ATOM   532   C C   . ASP A 1 70   ? -39.067 97.519  9.619   1.00 21.48 ? 70   ASP A C   1 
ATOM   533   O O   . ASP A 1 70   ? -38.568 96.801  8.747   1.00 22.97 ? 70   ASP A O   1 
ATOM   534   C CB  . ASP A 1 70   ? -41.269 96.644  10.534  1.00 19.28 ? 70   ASP A CB  1 
ATOM   535   C CG  . ASP A 1 70   ? -42.067 97.928  10.442  1.00 22.50 ? 70   ASP A CG  1 
ATOM   536   O OD1 . ASP A 1 70   ? -41.538 99.010  10.786  1.00 24.43 ? 70   ASP A OD1 1 
ATOM   537   O OD2 . ASP A 1 70   ? -43.248 97.840  10.023  1.00 21.97 ? 70   ASP A OD2 1 
ATOM   538   N N   . SER A 1 71   ? -38.983 98.842  9.559   1.00 19.91 ? 71   SER A N   1 
ATOM   539   C CA  . SER A 1 71   ? -38.320 99.493  8.423   1.00 20.22 ? 71   SER A CA  1 
ATOM   540   C C   . SER A 1 71   ? -36.803 99.431  8.504   1.00 21.59 ? 71   SER A C   1 
ATOM   541   O O   . SER A 1 71   ? -36.095 99.924  7.615   1.00 20.80 ? 71   SER A O   1 
ATOM   542   C CB  . SER A 1 71   ? -38.748 100.951 8.344   1.00 19.64 ? 71   SER A CB  1 
ATOM   543   O OG  . SER A 1 71   ? -38.941 101.481 9.646   1.00 24.41 ? 71   SER A OG  1 
ATOM   544   N N   . TYR A 1 72   ? -36.312 98.814  9.573   1.00 21.08 ? 72   TYR A N   1 
ATOM   545   C CA  . TYR A 1 72   ? -34.883 98.708  9.824   1.00 19.55 ? 72   TYR A CA  1 
ATOM   546   C C   . TYR A 1 72   ? -34.251 97.391  9.421   1.00 18.84 ? 72   TYR A C   1 
ATOM   547   O O   . TYR A 1 72   ? -33.041 97.232  9.514   1.00 19.94 ? 72   TYR A O   1 
ATOM   548   C CB  . TYR A 1 72   ? -34.618 98.992  11.303  1.00 18.58 ? 72   TYR A CB  1 
ATOM   549   C CG  . TYR A 1 72   ? -34.701 100.460 11.616  1.00 20.07 ? 72   TYR A CG  1 
ATOM   550   C CD1 . TYR A 1 72   ? -33.636 101.311 11.329  1.00 19.32 ? 72   TYR A CD1 1 
ATOM   551   C CD2 . TYR A 1 72   ? -35.867 101.022 12.130  1.00 21.14 ? 72   TYR A CD2 1 
ATOM   552   C CE1 . TYR A 1 72   ? -33.730 102.684 11.544  1.00 18.51 ? 72   TYR A CE1 1 
ATOM   553   C CE2 . TYR A 1 72   ? -35.968 102.403 12.344  1.00 18.92 ? 72   TYR A CE2 1 
ATOM   554   C CZ  . TYR A 1 72   ? -34.894 103.219 12.048  1.00 18.16 ? 72   TYR A CZ  1 
ATOM   555   O OH  . TYR A 1 72   ? -34.986 104.577 12.248  1.00 21.57 ? 72   TYR A OH  1 
ATOM   556   N N   . TYR A 1 73   ? -35.064 96.449  8.968   1.00 18.49 ? 73   TYR A N   1 
ATOM   557   C CA  . TYR A 1 73   ? -34.542 95.156  8.551   1.00 18.04 ? 73   TYR A CA  1 
ATOM   558   C C   . TYR A 1 73   ? -35.114 94.745  7.208   1.00 19.50 ? 73   TYR A C   1 
ATOM   559   O O   . TYR A 1 73   ? -36.034 95.385  6.690   1.00 17.96 ? 73   TYR A O   1 
ATOM   560   C CB  . TYR A 1 73   ? -34.887 94.099  9.587   1.00 16.71 ? 73   TYR A CB  1 
ATOM   561   C CG  . TYR A 1 73   ? -34.252 94.346  10.935  1.00 16.39 ? 73   TYR A CG  1 
ATOM   562   C CD1 . TYR A 1 73   ? -33.089 93.676  11.307  1.00 14.79 ? 73   TYR A CD1 1 
ATOM   563   C CD2 . TYR A 1 73   ? -34.811 95.245  11.835  1.00 15.10 ? 73   TYR A CD2 1 
ATOM   564   C CE1 . TYR A 1 73   ? -32.504 93.887  12.534  1.00 14.95 ? 73   TYR A CE1 1 
ATOM   565   C CE2 . TYR A 1 73   ? -34.226 95.468  13.072  1.00 17.32 ? 73   TYR A CE2 1 
ATOM   566   C CZ  . TYR A 1 73   ? -33.076 94.781  13.410  1.00 16.32 ? 73   TYR A CZ  1 
ATOM   567   O OH  . TYR A 1 73   ? -32.494 94.976  14.628  1.00 19.90 ? 73   TYR A OH  1 
ATOM   568   N N   . TYR A 1 74   ? -34.547 93.681  6.649   1.00 20.07 ? 74   TYR A N   1 
ATOM   569   C CA  . TYR A 1 74   ? -34.999 93.135  5.377   1.00 20.73 ? 74   TYR A CA  1 
ATOM   570   C C   . TYR A 1 74   ? -34.428 91.722  5.228   1.00 21.65 ? 74   TYR A C   1 
ATOM   571   O O   . TYR A 1 74   ? -33.613 91.289  6.041   1.00 22.80 ? 74   TYR A O   1 
ATOM   572   C CB  . TYR A 1 74   ? -34.537 94.039  4.223   1.00 21.86 ? 74   TYR A CB  1 
ATOM   573   C CG  . TYR A 1 74   ? -33.074 93.914  3.827   1.00 20.11 ? 74   TYR A CG  1 
ATOM   574   C CD1 . TYR A 1 74   ? -32.663 92.970  2.891   1.00 19.60 ? 74   TYR A CD1 1 
ATOM   575   C CD2 . TYR A 1 74   ? -32.114 94.760  4.369   1.00 21.72 ? 74   TYR A CD2 1 
ATOM   576   C CE1 . TYR A 1 74   ? -31.331 92.877  2.498   1.00 22.00 ? 74   TYR A CE1 1 
ATOM   577   C CE2 . TYR A 1 74   ? -30.773 94.677  3.992   1.00 21.78 ? 74   TYR A CE2 1 
ATOM   578   C CZ  . TYR A 1 74   ? -30.385 93.735  3.055   1.00 23.11 ? 74   TYR A CZ  1 
ATOM   579   O OH  . TYR A 1 74   ? -29.051 93.640  2.692   1.00 21.87 ? 74   TYR A OH  1 
ATOM   580   N N   . ILE A 1 75   ? -34.874 90.995  4.210   1.00 21.68 ? 75   ILE A N   1 
ATOM   581   C CA  . ILE A 1 75   ? -34.365 89.650  3.960   1.00 21.20 ? 75   ILE A CA  1 
ATOM   582   C C   . ILE A 1 75   ? -33.474 89.736  2.712   1.00 22.26 ? 75   ILE A C   1 
ATOM   583   O O   . ILE A 1 75   ? -33.902 90.274  1.689   1.00 23.36 ? 75   ILE A O   1 
ATOM   584   C CB  . ILE A 1 75   ? -35.506 88.669  3.676   1.00 19.75 ? 75   ILE A CB  1 
ATOM   585   C CG1 . ILE A 1 75   ? -36.597 88.798  4.754   1.00 18.35 ? 75   ILE A CG1 1 
ATOM   586   C CG2 . ILE A 1 75   ? -34.936 87.251  3.591   1.00 18.25 ? 75   ILE A CG2 1 
ATOM   587   C CD1 . ILE A 1 75   ? -36.167 88.400  6.158   1.00 14.33 ? 75   ILE A CD1 1 
ATOM   588   N N   . ASP A 1 76   ? -32.246 89.230  2.770   1.00 20.68 ? 76   ASP A N   1 
ATOM   589   C CA  . ASP A 1 76   ? -31.401 89.335  1.584   1.00 20.72 ? 76   ASP A CA  1 
ATOM   590   C C   . ASP A 1 76   ? -31.547 88.177  0.597   1.00 19.67 ? 76   ASP A C   1 
ATOM   591   O O   . ASP A 1 76   ? -32.403 87.304  0.753   1.00 18.33 ? 76   ASP A O   1 
ATOM   592   C CB  . ASP A 1 76   ? -29.925 89.511  1.961   1.00 20.64 ? 76   ASP A CB  1 
ATOM   593   C CG  . ASP A 1 76   ? -29.380 88.358  2.773   1.00 21.56 ? 76   ASP A CG  1 
ATOM   594   O OD1 . ASP A 1 76   ? -29.791 87.200  2.551   1.00 20.59 ? 76   ASP A OD1 1 
ATOM   595   O OD2 . ASP A 1 76   ? -28.521 88.618  3.635   1.00 22.33 ? 76   ASP A OD2 1 
ATOM   596   N N   . ALA A 1 77   ? -30.706 88.190  -0.427  1.00 18.99 ? 77   ALA A N   1 
ATOM   597   C CA  . ALA A 1 77   ? -30.738 87.156  -1.454  1.00 21.32 ? 77   ALA A CA  1 
ATOM   598   C C   . ALA A 1 77   ? -30.554 85.735  -0.905  1.00 20.83 ? 77   ALA A C   1 
ATOM   599   O O   . ALA A 1 77   ? -31.096 84.777  -1.451  1.00 20.72 ? 77   ALA A O   1 
ATOM   600   C CB  . ALA A 1 77   ? -29.682 87.456  -2.519  1.00 20.64 ? 77   ALA A CB  1 
ATOM   601   N N   . LEU A 1 78   ? -29.787 85.600  0.169   1.00 22.10 ? 78   LEU A N   1 
ATOM   602   C CA  . LEU A 1 78   ? -29.555 84.298  0.775   1.00 21.31 ? 78   LEU A CA  1 
ATOM   603   C C   . LEU A 1 78   ? -30.567 84.038  1.896   1.00 22.32 ? 78   LEU A C   1 
ATOM   604   O O   . LEU A 1 78   ? -30.376 83.150  2.743   1.00 22.36 ? 78   LEU A O   1 
ATOM   605   C CB  . LEU A 1 78   ? -28.127 84.231  1.304   1.00 21.77 ? 78   LEU A CB  1 
ATOM   606   C CG  . LEU A 1 78   ? -27.087 84.512  0.214   1.00 24.83 ? 78   LEU A CG  1 
ATOM   607   C CD1 . LEU A 1 78   ? -25.670 84.448  0.800   1.00 23.76 ? 78   LEU A CD1 1 
ATOM   608   C CD2 . LEU A 1 78   ? -27.247 83.494  -0.914  1.00 22.73 ? 78   LEU A CD2 1 
ATOM   609   N N   . ASN A 1 79   ? -31.641 84.825  1.898   1.00 20.81 ? 79   ASN A N   1 
ATOM   610   C CA  . ASN A 1 79   ? -32.711 84.684  2.883   1.00 21.47 ? 79   ASN A CA  1 
ATOM   611   C C   . ASN A 1 79   ? -32.291 84.915  4.351   1.00 20.98 ? 79   ASN A C   1 
ATOM   612   O O   . ASN A 1 79   ? -32.939 84.399  5.278   1.00 17.74 ? 79   ASN A O   1 
ATOM   613   C CB  . ASN A 1 79   ? -33.361 83.297  2.735   1.00 22.32 ? 79   ASN A CB  1 
ATOM   614   C CG  . ASN A 1 79   ? -34.737 83.227  3.373   1.00 24.83 ? 79   ASN A CG  1 
ATOM   615   O OD1 . ASN A 1 79   ? -35.625 84.006  3.035   1.00 25.63 ? 79   ASN A OD1 1 
ATOM   616   N ND2 . ASN A 1 79   ? -34.918 82.296  4.303   1.00 27.80 ? 79   ASN A ND2 1 
ATOM   617   N N   . ARG A 1 80   ? -31.213 85.682  4.552   1.00 19.57 ? 80   ARG A N   1 
ATOM   618   C CA  . ARG A 1 80   ? -30.727 85.992  5.898   1.00 19.59 ? 80   ARG A CA  1 
ATOM   619   C C   . ARG A 1 80   ? -31.381 87.302  6.358   1.00 19.76 ? 80   ARG A C   1 
ATOM   620   O O   . ARG A 1 80   ? -31.459 88.254  5.581   1.00 19.59 ? 80   ARG A O   1 
ATOM   621   C CB  . ARG A 1 80   ? -29.199 86.206  5.930   1.00 19.75 ? 80   ARG A CB  1 
ATOM   622   C CG  . ARG A 1 80   ? -28.330 85.337  5.014   1.00 21.10 ? 80   ARG A CG  1 
ATOM   623   C CD  . ARG A 1 80   ? -26.889 85.266  5.551   1.00 22.46 ? 80   ARG A CD  1 
ATOM   624   N NE  . ARG A 1 80   ? -25.818 85.456  4.560   1.00 22.63 ? 80   ARG A NE  1 
ATOM   625   C CZ  . ARG A 1 80   ? -25.746 86.511  3.757   1.00 23.38 ? 80   ARG A CZ  1 
ATOM   626   N NH1 . ARG A 1 80   ? -26.681 87.437  3.830   1.00 23.98 ? 80   ARG A NH1 1 
ATOM   627   N NH2 . ARG A 1 80   ? -24.741 86.662  2.907   1.00 21.62 ? 80   ARG A NH2 1 
ATOM   628   N N   . VAL A 1 81   ? -31.859 87.355  7.602   1.00 17.97 ? 81   VAL A N   1 
ATOM   629   C CA  . VAL A 1 81   ? -32.435 88.597  8.116   1.00 17.55 ? 81   VAL A CA  1 
ATOM   630   C C   . VAL A 1 81   ? -31.275 89.582  8.242   1.00 18.94 ? 81   VAL A C   1 
ATOM   631   O O   . VAL A 1 81   ? -30.263 89.295  8.891   1.00 17.22 ? 81   VAL A O   1 
ATOM   632   C CB  . VAL A 1 81   ? -33.041 88.436  9.518   1.00 16.72 ? 81   VAL A CB  1 
ATOM   633   C CG1 . VAL A 1 81   ? -33.381 89.792  10.068  1.00 12.06 ? 81   VAL A CG1 1 
ATOM   634   C CG2 . VAL A 1 81   ? -34.285 87.559  9.464   1.00 18.84 ? 81   VAL A CG2 1 
ATOM   635   N N   . ARG A 1 82   ? -31.407 90.747  7.632   1.00 19.65 ? 82   ARG A N   1 
ATOM   636   C CA  . ARG A 1 82   ? -30.319 91.701  7.702   1.00 21.79 ? 82   ARG A CA  1 
ATOM   637   C C   . ARG A 1 82   ? -30.763 93.061  8.194   1.00 22.39 ? 82   ARG A C   1 
ATOM   638   O O   . ARG A 1 82   ? -31.950 93.364  8.268   1.00 24.04 ? 82   ARG A O   1 
ATOM   639   C CB  . ARG A 1 82   ? -29.661 91.839  6.322   1.00 22.02 ? 82   ARG A CB  1 
ATOM   640   C CG  . ARG A 1 82   ? -28.933 90.578  5.859   1.00 22.82 ? 82   ARG A CG  1 
ATOM   641   C CD  . ARG A 1 82   ? -27.539 90.486  6.450   1.00 21.66 ? 82   ARG A CD  1 
ATOM   642   N NE  . ARG A 1 82   ? -26.715 91.603  5.992   1.00 25.14 ? 82   ARG A NE  1 
ATOM   643   C CZ  . ARG A 1 82   ? -26.274 91.759  4.744   1.00 24.63 ? 82   ARG A CZ  1 
ATOM   644   N NH1 . ARG A 1 82   ? -26.567 90.862  3.810   1.00 22.91 ? 82   ARG A NH1 1 
ATOM   645   N NH2 . ARG A 1 82   ? -25.544 92.824  4.427   1.00 25.11 ? 82   ARG A NH2 1 
ATOM   646   N N   . ARG A 1 83   ? -29.791 93.882  8.537   1.00 21.67 ? 83   ARG A N   1 
ATOM   647   C CA  . ARG A 1 83   ? -30.097 95.213  8.983   1.00 22.95 ? 83   ARG A CA  1 
ATOM   648   C C   . ARG A 1 83   ? -30.157 96.098  7.736   1.00 24.25 ? 83   ARG A C   1 
ATOM   649   O O   . ARG A 1 83   ? -29.351 95.949  6.809   1.00 23.61 ? 83   ARG A O   1 
ATOM   650   C CB  . ARG A 1 83   ? -29.009 95.678  9.941   1.00 23.11 ? 83   ARG A CB  1 
ATOM   651   C CG  . ARG A 1 83   ? -29.224 97.033  10.496  1.00 26.51 ? 83   ARG A CG  1 
ATOM   652   C CD  . ARG A 1 83   ? -30.475 97.161  11.349  1.00 24.00 ? 83   ARG A CD  1 
ATOM   653   N NE  . ARG A 1 83   ? -30.335 98.367  12.154  1.00 24.52 ? 83   ARG A NE  1 
ATOM   654   C CZ  . ARG A 1 83   ? -30.212 99.590  11.655  1.00 24.35 ? 83   ARG A CZ  1 
ATOM   655   N NH1 . ARG A 1 83   ? -30.228 99.788  10.349  1.00 24.13 ? 83   ARG A NH1 1 
ATOM   656   N NH2 . ARG A 1 83   ? -30.033 100.620 12.469  1.00 29.52 ? 83   ARG A NH2 1 
ATOM   657   N N   . LYS A 1 84   ? -31.133 96.999  7.703   1.00 25.97 ? 84   LYS A N   1 
ATOM   658   C CA  . LYS A 1 84   ? -31.302 97.907  6.570   1.00 26.35 ? 84   LYS A CA  1 
ATOM   659   C C   . LYS A 1 84   ? -30.592 99.215  6.895   1.00 24.92 ? 84   LYS A C   1 
ATOM   660   O O   . LYS A 1 84   ? -30.965 99.918  7.830   1.00 26.67 ? 84   LYS A O   1 
ATOM   661   C CB  . LYS A 1 84   ? -32.789 98.166  6.330   1.00 27.48 ? 84   LYS A CB  1 
ATOM   662   C CG  . LYS A 1 84   ? -33.156 98.551  4.911   1.00 30.39 ? 84   LYS A CG  1 
ATOM   663   C CD  . LYS A 1 84   ? -32.438 99.796  4.441   1.00 35.38 ? 84   LYS A CD  1 
ATOM   664   C CE  . LYS A 1 84   ? -32.923 100.219 3.052   1.00 38.59 ? 84   LYS A CE  1 
ATOM   665   N NZ  . LYS A 1 84   ? -34.379 100.613 3.071   1.00 40.64 ? 84   LYS A NZ  1 
ATOM   666   N N   . THR A 1 85   ? -29.575 99.538  6.113   1.00 23.75 ? 85   THR A N   1 
ATOM   667   C CA  . THR A 1 85   ? -28.780 100.749 6.305   1.00 23.37 ? 85   THR A CA  1 
ATOM   668   C C   . THR A 1 85   ? -29.400 102.088 5.892   1.00 23.81 ? 85   THR A C   1 
ATOM   669   O O   . THR A 1 85   ? -29.998 102.203 4.821   1.00 25.30 ? 85   THR A O   1 
ATOM   670   C CB  . THR A 1 85   ? -27.449 100.586 5.582   1.00 23.32 ? 85   THR A CB  1 
ATOM   671   O OG1 . THR A 1 85   ? -26.528 99.929  6.467   1.00 26.18 ? 85   THR A OG1 1 
ATOM   672   C CG2 . THR A 1 85   ? -26.914 101.933 5.101   1.00 21.51 ? 85   THR A CG2 1 
ATOM   673   N N   . TYR A 1 86   ? -29.225 103.101 6.743   1.00 23.98 ? 86   TYR A N   1 
ATOM   674   C CA  . TYR A 1 86   ? -29.745 104.448 6.493   1.00 22.63 ? 86   TYR A CA  1 
ATOM   675   C C   . TYR A 1 86   ? -28.697 105.543 6.738   1.00 22.55 ? 86   TYR A C   1 
ATOM   676   O O   . TYR A 1 86   ? -28.650 106.550 6.020   1.00 19.96 ? 86   TYR A O   1 
ATOM   677   C CB  . TYR A 1 86   ? -30.965 104.735 7.385   1.00 22.22 ? 86   TYR A CB  1 
ATOM   678   C CG  . TYR A 1 86   ? -32.224 104.010 6.978   1.00 22.67 ? 86   TYR A CG  1 
ATOM   679   C CD1 . TYR A 1 86   ? -32.839 104.274 5.755   1.00 23.84 ? 86   TYR A CD1 1 
ATOM   680   C CD2 . TYR A 1 86   ? -32.782 103.035 7.796   1.00 21.68 ? 86   TYR A CD2 1 
ATOM   681   C CE1 . TYR A 1 86   ? -33.982 103.571 5.352   1.00 25.06 ? 86   TYR A CE1 1 
ATOM   682   C CE2 . TYR A 1 86   ? -33.918 102.333 7.409   1.00 24.40 ? 86   TYR A CE2 1 
ATOM   683   C CZ  . TYR A 1 86   ? -34.513 102.603 6.186   1.00 25.12 ? 86   TYR A CZ  1 
ATOM   684   O OH  . TYR A 1 86   ? -35.626 101.894 5.799   1.00 26.48 ? 86   TYR A OH  1 
ATOM   685   N N   . GLN A 1 87   ? -27.867 105.360 7.761   1.00 23.07 ? 87   GLN A N   1 
ATOM   686   C CA  . GLN A 1 87   ? -26.854 106.362 8.079   1.00 23.36 ? 87   GLN A CA  1 
ATOM   687   C C   . GLN A 1 87   ? -25.462 105.923 7.673   1.00 22.66 ? 87   GLN A C   1 
ATOM   688   O O   . GLN A 1 87   ? -24.486 106.458 8.180   1.00 25.58 ? 87   GLN A O   1 
ATOM   689   C CB  . GLN A 1 87   ? -26.859 106.689 9.580   1.00 24.46 ? 87   GLN A CB  1 
ATOM   690   C CG  . GLN A 1 87   ? -28.152 107.285 10.097  1.00 29.23 ? 87   GLN A CG  1 
ATOM   691   C CD  . GLN A 1 87   ? -28.531 108.567 9.370   1.00 34.01 ? 87   GLN A CD  1 
ATOM   692   O OE1 . GLN A 1 87   ? -27.801 109.565 9.418   1.00 37.08 ? 87   GLN A OE1 1 
ATOM   693   N NE2 . GLN A 1 87   ? -29.674 108.547 8.688   1.00 33.97 ? 87   GLN A NE2 1 
ATOM   694   N N   . GLY A 1 88   ? -25.359 104.950 6.774   1.00 20.18 ? 88   GLY A N   1 
ATOM   695   C CA  . GLY A 1 88   ? -24.046 104.507 6.354   1.00 20.84 ? 88   GLY A CA  1 
ATOM   696   C C   . GLY A 1 88   ? -23.702 103.041 6.569   1.00 22.41 ? 88   GLY A C   1 
ATOM   697   O O   . GLY A 1 88   ? -24.419 102.307 7.244   1.00 22.43 ? 88   GLY A O   1 
ATOM   698   N N   . PRO A 1 89   ? -22.578 102.592 6.000   1.00 24.37 ? 89   PRO A N   1 
ATOM   699   C CA  . PRO A 1 89   ? -22.079 101.214 6.087   1.00 26.51 ? 89   PRO A CA  1 
ATOM   700   C C   . PRO A 1 89   ? -22.037 100.660 7.506   1.00 27.05 ? 89   PRO A C   1 
ATOM   701   O O   . PRO A 1 89   ? -22.158 99.451  7.710   1.00 28.86 ? 89   PRO A O   1 
ATOM   702   C CB  . PRO A 1 89   ? -20.680 101.314 5.481   1.00 26.26 ? 89   PRO A CB  1 
ATOM   703   C CG  . PRO A 1 89   ? -20.818 102.422 4.499   1.00 26.26 ? 89   PRO A CG  1 
ATOM   704   C CD  . PRO A 1 89   ? -21.623 103.444 5.270   1.00 23.95 ? 89   PRO A CD  1 
ATOM   705   N N   . ASP A 1 90   ? -21.856 101.545 8.480   1.00 26.08 ? 90   ASP A N   1 
ATOM   706   C CA  . ASP A 1 90   ? -21.786 101.143 9.878   1.00 26.24 ? 90   ASP A CA  1 
ATOM   707   C C   . ASP A 1 90   ? -23.141 100.949 10.541  1.00 23.91 ? 90   ASP A C   1 
ATOM   708   O O   . ASP A 1 90   ? -23.239 100.202 11.513  1.00 21.70 ? 90   ASP A O   1 
ATOM   709   C CB  . ASP A 1 90   ? -21.021 102.191 10.698  1.00 30.46 ? 90   ASP A CB  1 
ATOM   710   C CG  . ASP A 1 90   ? -19.532 102.120 10.493  1.00 31.89 ? 90   ASP A CG  1 
ATOM   711   O OD1 . ASP A 1 90   ? -18.974 101.023 10.681  1.00 34.40 ? 90   ASP A OD1 1 
ATOM   712   O OD2 . ASP A 1 90   ? -18.920 103.157 10.158  1.00 32.74 ? 90   ASP A OD2 1 
ATOM   713   N N   . ASP A 1 91   ? -24.162 101.634 10.025  1.00 20.08 ? 91   ASP A N   1 
ATOM   714   C CA  . ASP A 1 91   ? -25.506 101.597 10.593  1.00 19.74 ? 91   ASP A CA  1 
ATOM   715   C C   . ASP A 1 91   ? -26.154 100.218 10.534  1.00 18.98 ? 91   ASP A C   1 
ATOM   716   O O   . ASP A 1 91   ? -27.221 100.002 9.939   1.00 18.74 ? 91   ASP A O   1 
ATOM   717   C CB  . ASP A 1 91   ? -26.377 102.648 9.906   1.00 22.45 ? 91   ASP A CB  1 
ATOM   718   C CG  . ASP A 1 91   ? -27.784 102.683 10.455  1.00 22.30 ? 91   ASP A CG  1 
ATOM   719   O OD1 . ASP A 1 91   ? -27.971 102.246 11.614  1.00 19.27 ? 91   ASP A OD1 1 
ATOM   720   O OD2 . ASP A 1 91   ? -28.687 103.154 9.726   1.00 23.55 ? 91   ASP A OD2 1 
ATOM   721   N N   . VAL A 1 92   ? -25.504 99.303  11.232  1.00 16.02 ? 92   VAL A N   1 
ATOM   722   C CA  . VAL A 1 92   ? -25.889 97.919  11.271  1.00 13.90 ? 92   VAL A CA  1 
ATOM   723   C C   . VAL A 1 92   ? -26.228 97.373  12.680  1.00 12.78 ? 92   VAL A C   1 
ATOM   724   O O   . VAL A 1 92   ? -26.648 96.234  12.814  1.00 12.98 ? 92   VAL A O   1 
ATOM   725   C CB  . VAL A 1 92   ? -24.733 97.133  10.578  1.00 13.65 ? 92   VAL A CB  1 
ATOM   726   C CG1 . VAL A 1 92   ? -24.391 95.873  11.333  1.00 15.80 ? 92   VAL A CG1 1 
ATOM   727   C CG2 . VAL A 1 92   ? -25.112 96.846  9.132   1.00 9.28  ? 92   VAL A CG2 1 
ATOM   728   N N   . TYR A 1 93   ? -26.063 98.193  13.715  1.00 12.32 ? 93   TYR A N   1 
ATOM   729   C CA  . TYR A 1 93   ? -26.333 97.782  15.098  1.00 12.60 ? 93   TYR A CA  1 
ATOM   730   C C   . TYR A 1 93   ? -27.836 97.744  15.420  1.00 13.24 ? 93   TYR A C   1 
ATOM   731   O O   . TYR A 1 93   ? -28.665 97.685  14.513  1.00 16.40 ? 93   TYR A O   1 
ATOM   732   C CB  . TYR A 1 93   ? -25.593 98.733  16.060  1.00 12.23 ? 93   TYR A CB  1 
ATOM   733   C CG  . TYR A 1 93   ? -24.094 98.639  15.904  1.00 13.58 ? 93   TYR A CG  1 
ATOM   734   C CD1 . TYR A 1 93   ? -23.340 97.806  16.722  1.00 13.30 ? 93   TYR A CD1 1 
ATOM   735   C CD2 . TYR A 1 93   ? -23.442 99.271  14.839  1.00 15.94 ? 93   TYR A CD2 1 
ATOM   736   C CE1 . TYR A 1 93   ? -21.978 97.584  16.480  1.00 14.23 ? 93   TYR A CE1 1 
ATOM   737   C CE2 . TYR A 1 93   ? -22.077 99.053  14.590  1.00 15.57 ? 93   TYR A CE2 1 
ATOM   738   C CZ  . TYR A 1 93   ? -21.363 98.206  15.414  1.00 15.12 ? 93   TYR A CZ  1 
ATOM   739   O OH  . TYR A 1 93   ? -20.041 97.954  15.151  1.00 18.30 ? 93   TYR A OH  1 
ATOM   740   N N   . VAL A 1 94   ? -28.184 97.762  16.702  1.00 11.99 ? 94   VAL A N   1 
ATOM   741   C CA  . VAL A 1 94   ? -29.584 97.748  17.113  1.00 12.24 ? 94   VAL A CA  1 
ATOM   742   C C   . VAL A 1 94   ? -30.165 99.141  16.934  1.00 11.80 ? 94   VAL A C   1 
ATOM   743   O O   . VAL A 1 94   ? -29.619 100.121 17.414  1.00 12.04 ? 94   VAL A O   1 
ATOM   744   C CB  . VAL A 1 94   ? -29.766 97.334  18.612  1.00 12.33 ? 94   VAL A CB  1 
ATOM   745   C CG1 . VAL A 1 94   ? -31.231 97.403  18.985  1.00 11.12 ? 94   VAL A CG1 1 
ATOM   746   C CG2 . VAL A 1 94   ? -29.260 95.919  18.836  1.00 11.71 ? 94   VAL A CG2 1 
ATOM   747   N N   . PRO A 1 95   ? -31.299 99.241  16.245  1.00 12.61 ? 95   PRO A N   1 
ATOM   748   C CA  . PRO A 1 95   ? -31.964 100.523 15.992  1.00 11.31 ? 95   PRO A CA  1 
ATOM   749   C C   . PRO A 1 95   ? -32.815 100.993 17.178  1.00 11.07 ? 95   PRO A C   1 
ATOM   750   O O   . PRO A 1 95   ? -33.341 100.166 17.924  1.00 12.69 ? 95   PRO A O   1 
ATOM   751   C CB  . PRO A 1 95   ? -32.805 100.207 14.761  1.00 11.89 ? 95   PRO A CB  1 
ATOM   752   C CG  . PRO A 1 95   ? -33.278 98.800  15.078  1.00 10.73 ? 95   PRO A CG  1 
ATOM   753   C CD  . PRO A 1 95   ? -32.010 98.129  15.584  1.00 11.06 ? 95   PRO A CD  1 
ATOM   754   N N   . ASN A 1 96   ? -32.953 102.308 17.344  1.00 9.88  ? 96   ASN A N   1 
ATOM   755   C CA  . ASN A 1 96   ? -33.746 102.879 18.438  1.00 10.60 ? 96   ASN A CA  1 
ATOM   756   C C   . ASN A 1 96   ? -35.219 102.852 18.065  1.00 12.51 ? 96   ASN A C   1 
ATOM   757   O O   . ASN A 1 96   ? -35.751 103.780 17.442  1.00 10.76 ? 96   ASN A O   1 
ATOM   758   C CB  . ASN A 1 96   ? -33.299 104.309 18.722  1.00 9.47  ? 96   ASN A CB  1 
ATOM   759   C CG  . ASN A 1 96   ? -31.887 104.375 19.283  1.00 12.03 ? 96   ASN A CG  1 
ATOM   760   O OD1 . ASN A 1 96   ? -31.183 103.358 19.374  1.00 7.88  ? 96   ASN A OD1 1 
ATOM   761   N ND2 . ASN A 1 96   ? -31.460 105.580 19.656  1.00 11.16 ? 96   ASN A ND2 1 
ATOM   762   N N   . CYS A 1 97   ? -35.885 101.784 18.478  1.00 13.48 ? 97   CYS A N   1 
ATOM   763   C CA  . CYS A 1 97   ? -37.278 101.603 18.132  1.00 15.55 ? 97   CYS A CA  1 
ATOM   764   C C   . CYS A 1 97   ? -38.157 101.233 19.304  1.00 16.59 ? 97   CYS A C   1 
ATOM   765   O O   . CYS A 1 97   ? -37.674 100.975 20.424  1.00 13.79 ? 97   CYS A O   1 
ATOM   766   C CB  . CYS A 1 97   ? -37.382 100.503 17.068  1.00 15.39 ? 97   CYS A CB  1 
ATOM   767   S SG  . CYS A 1 97   ? -36.216 100.722 15.694  1.00 15.99 ? 97   CYS A SG  1 
ATOM   768   N N   . SER A 1 98   ? -39.460 101.203 19.024  1.00 16.77 ? 98   SER A N   1 
ATOM   769   C CA  . SER A 1 98   ? -40.446 100.828 20.019  1.00 17.98 ? 98   SER A CA  1 
ATOM   770   C C   . SER A 1 98   ? -40.220 99.341  20.295  1.00 18.10 ? 98   SER A C   1 
ATOM   771   O O   . SER A 1 98   ? -39.444 98.678  19.599  1.00 16.14 ? 98   SER A O   1 
ATOM   772   C CB  . SER A 1 98   ? -41.864 101.091 19.508  1.00 16.57 ? 98   SER A CB  1 
ATOM   773   O OG  . SER A 1 98   ? -42.048 100.557 18.213  1.00 20.79 ? 98   SER A OG  1 
ATOM   774   N N   . ILE A 1 99   ? -40.896 98.814  21.304  1.00 18.10 ? 99   ILE A N   1 
ATOM   775   C CA  . ILE A 1 99   ? -40.686 97.428  21.667  1.00 17.63 ? 99   ILE A CA  1 
ATOM   776   C C   . ILE A 1 99   ? -41.935 96.798  22.287  1.00 17.98 ? 99   ILE A C   1 
ATOM   777   O O   . ILE A 1 99   ? -42.148 95.580  22.189  1.00 18.62 ? 99   ILE A O   1 
ATOM   778   C CB  . ILE A 1 99   ? -39.488 97.348  22.663  1.00 17.15 ? 99   ILE A CB  1 
ATOM   779   C CG1 . ILE A 1 99   ? -39.248 95.906  23.137  1.00 18.58 ? 99   ILE A CG1 1 
ATOM   780   C CG2 . ILE A 1 99   ? -39.761 98.236  23.867  1.00 15.49 ? 99   ILE A CG2 1 
ATOM   781   C CD1 . ILE A 1 99   ? -38.842 94.957  22.055  1.00 14.90 ? 99   ILE A CD1 1 
ATOM   782   N N   . VAL A 1 100  ? -42.765 97.625  22.913  1.00 16.52 ? 100  VAL A N   1 
ATOM   783   C CA  . VAL A 1 100  ? -43.956 97.117  23.563  1.00 16.99 ? 100  VAL A CA  1 
ATOM   784   C C   . VAL A 1 100  ? -44.873 96.283  22.659  1.00 17.33 ? 100  VAL A C   1 
ATOM   785   O O   . VAL A 1 100  ? -45.298 95.196  23.046  1.00 16.68 ? 100  VAL A O   1 
ATOM   786   C CB  . VAL A 1 100  ? -44.771 98.260  24.197  1.00 18.53 ? 100  VAL A CB  1 
ATOM   787   C CG1 . VAL A 1 100  ? -45.572 99.015  23.128  1.00 17.63 ? 100  VAL A CG1 1 
ATOM   788   C CG2 . VAL A 1 100  ? -45.678 97.696  25.271  1.00 18.36 ? 100  VAL A CG2 1 
ATOM   789   N N   . GLU A 1 101  ? -45.161 96.769  21.455  1.00 16.27 ? 101  GLU A N   1 
ATOM   790   C CA  . GLU A 1 101  ? -46.043 96.045  20.556  1.00 18.02 ? 101  GLU A CA  1 
ATOM   791   C C   . GLU A 1 101  ? -45.589 94.609  20.243  1.00 19.47 ? 101  GLU A C   1 
ATOM   792   O O   . GLU A 1 101  ? -46.361 93.809  19.719  1.00 20.54 ? 101  GLU A O   1 
ATOM   793   C CB  . GLU A 1 101  ? -46.225 96.823  19.249  1.00 18.24 ? 101  GLU A CB  1 
ATOM   794   C CG  . GLU A 1 101  ? -45.025 96.768  18.317  1.00 21.47 ? 101  GLU A CG  1 
ATOM   795   C CD  . GLU A 1 101  ? -44.009 97.880  18.571  1.00 23.58 ? 101  GLU A CD  1 
ATOM   796   O OE1 . GLU A 1 101  ? -43.878 98.335  19.736  1.00 22.22 ? 101  GLU A OE1 1 
ATOM   797   O OE2 . GLU A 1 101  ? -43.335 98.288  17.594  1.00 24.45 ? 101  GLU A OE2 1 
ATOM   798   N N   . LEU A 1 102  ? -44.352 94.267  20.574  1.00 19.80 ? 102  LEU A N   1 
ATOM   799   C CA  . LEU A 1 102  ? -43.844 92.927  20.289  1.00 20.09 ? 102  LEU A CA  1 
ATOM   800   C C   . LEU A 1 102  ? -43.849 91.968  21.467  1.00 22.63 ? 102  LEU A C   1 
ATOM   801   O O   . LEU A 1 102  ? -43.420 90.821  21.313  1.00 23.93 ? 102  LEU A O   1 
ATOM   802   C CB  . LEU A 1 102  ? -42.405 93.011  19.777  1.00 18.72 ? 102  LEU A CB  1 
ATOM   803   C CG  . LEU A 1 102  ? -42.059 93.282  18.316  1.00 15.38 ? 102  LEU A CG  1 
ATOM   804   C CD1 . LEU A 1 102  ? -43.250 93.801  17.556  1.00 14.09 ? 102  LEU A CD1 1 
ATOM   805   C CD2 . LEU A 1 102  ? -40.892 94.251  18.281  1.00 13.56 ? 102  LEU A CD2 1 
ATOM   806   N N   . LEU A 1 103  ? -44.334 92.411  22.626  1.00 23.49 ? 103  LEU A N   1 
ATOM   807   C CA  . LEU A 1 103  ? -44.307 91.572  23.827  1.00 25.68 ? 103  LEU A CA  1 
ATOM   808   C C   . LEU A 1 103  ? -45.622 90.958  24.350  1.00 27.39 ? 103  LEU A C   1 
ATOM   809   O O   . LEU A 1 103  ? -46.717 91.438  24.059  1.00 26.43 ? 103  LEU A O   1 
ATOM   810   C CB  . LEU A 1 103  ? -43.653 92.376  24.956  1.00 24.89 ? 103  LEU A CB  1 
ATOM   811   C CG  . LEU A 1 103  ? -42.473 93.250  24.507  1.00 25.13 ? 103  LEU A CG  1 
ATOM   812   C CD1 . LEU A 1 103  ? -42.096 94.210  25.623  1.00 24.05 ? 103  LEU A CD1 1 
ATOM   813   C CD2 . LEU A 1 103  ? -41.292 92.386  24.104  1.00 22.68 ? 103  LEU A CD2 1 
ATOM   814   N N   . GLU A 1 104  ? -45.484 89.880  25.124  1.00 29.58 ? 104  GLU A N   1 
ATOM   815   C CA  . GLU A 1 104  ? -46.616 89.191  25.752  1.00 32.26 ? 104  GLU A CA  1 
ATOM   816   C C   . GLU A 1 104  ? -46.395 89.414  27.237  1.00 32.02 ? 104  GLU A C   1 
ATOM   817   O O   . GLU A 1 104  ? -45.324 89.114  27.753  1.00 31.39 ? 104  GLU A O   1 
ATOM   818   C CB  . GLU A 1 104  ? -46.584 87.680  25.497  1.00 34.61 ? 104  GLU A CB  1 
ATOM   819   C CG  . GLU A 1 104  ? -46.617 87.249  24.040  1.00 40.09 ? 104  GLU A CG  1 
ATOM   820   C CD  . GLU A 1 104  ? -46.556 85.729  23.878  1.00 43.29 ? 104  GLU A CD  1 
ATOM   821   O OE1 . GLU A 1 104  ? -45.872 85.073  24.700  1.00 41.78 ? 104  GLU A OE1 1 
ATOM   822   O OE2 . GLU A 1 104  ? -47.178 85.198  22.922  1.00 44.07 ? 104  GLU A OE2 1 
ATOM   823   N N   . PRO A 1 105  ? -47.400 89.937  27.946  1.00 32.32 ? 105  PRO A N   1 
ATOM   824   C CA  . PRO A 1 105  ? -47.246 90.179  29.383  1.00 32.51 ? 105  PRO A CA  1 
ATOM   825   C C   . PRO A 1 105  ? -46.710 88.956  30.124  1.00 32.74 ? 105  PRO A C   1 
ATOM   826   O O   . PRO A 1 105  ? -47.010 87.815  29.756  1.00 33.15 ? 105  PRO A O   1 
ATOM   827   C CB  . PRO A 1 105  ? -48.660 90.539  29.827  1.00 31.43 ? 105  PRO A CB  1 
ATOM   828   C CG  . PRO A 1 105  ? -49.228 91.208  28.619  1.00 32.89 ? 105  PRO A CG  1 
ATOM   829   C CD  . PRO A 1 105  ? -48.757 90.287  27.499  1.00 33.25 ? 105  PRO A CD  1 
ATOM   830   N N   . HIS A 1 106  ? -45.902 89.195  31.152  1.00 31.69 ? 106  HIS A N   1 
ATOM   831   C CA  . HIS A 1 106  ? -45.357 88.106  31.950  1.00 33.39 ? 106  HIS A CA  1 
ATOM   832   C C   . HIS A 1 106  ? -46.482 87.585  32.835  1.00 34.51 ? 106  HIS A C   1 
ATOM   833   O O   . HIS A 1 106  ? -47.390 88.335  33.189  1.00 34.19 ? 106  HIS A O   1 
ATOM   834   C CB  . HIS A 1 106  ? -44.192 88.604  32.813  1.00 33.07 ? 106  HIS A CB  1 
ATOM   835   C CG  . HIS A 1 106  ? -43.677 87.586  33.783  1.00 33.32 ? 106  HIS A CG  1 
ATOM   836   N ND1 . HIS A 1 106  ? -44.328 87.281  34.959  1.00 34.30 ? 106  HIS A ND1 1 
ATOM   837   C CD2 . HIS A 1 106  ? -42.589 86.779  33.735  1.00 34.23 ? 106  HIS A CD2 1 
ATOM   838   C CE1 . HIS A 1 106  ? -43.665 86.331  35.596  1.00 33.77 ? 106  HIS A CE1 1 
ATOM   839   N NE2 . HIS A 1 106  ? -42.606 86.009  34.874  1.00 34.93 ? 106  HIS A NE2 1 
ATOM   840   N N   . GLU A 1 107  ? -46.433 86.308  33.190  1.00 35.90 ? 107  GLU A N   1 
ATOM   841   C CA  . GLU A 1 107  ? -47.476 85.749  34.036  1.00 39.31 ? 107  GLU A CA  1 
ATOM   842   C C   . GLU A 1 107  ? -47.678 86.512  35.352  1.00 40.11 ? 107  GLU A C   1 
ATOM   843   O O   . GLU A 1 107  ? -48.753 87.068  35.590  1.00 41.35 ? 107  GLU A O   1 
ATOM   844   C CB  . GLU A 1 107  ? -47.195 84.273  34.334  1.00 42.34 ? 107  GLU A CB  1 
ATOM   845   C CG  . GLU A 1 107  ? -47.644 83.324  33.223  1.00 48.07 ? 107  GLU A CG  1 
ATOM   846   C CD  . GLU A 1 107  ? -47.871 81.899  33.722  1.00 51.39 ? 107  GLU A CD  1 
ATOM   847   O OE1 . GLU A 1 107  ? -48.513 81.743  34.793  1.00 52.65 ? 107  GLU A OE1 1 
ATOM   848   O OE2 . GLU A 1 107  ? -47.421 80.943  33.042  1.00 51.24 ? 107  GLU A OE2 1 
ATOM   849   N N   . THR A 1 108  ? -46.645 86.547  36.194  1.00 38.74 ? 108  THR A N   1 
ATOM   850   C CA  . THR A 1 108  ? -46.714 87.215  37.494  1.00 37.30 ? 108  THR A CA  1 
ATOM   851   C C   . THR A 1 108  ? -46.445 88.727  37.475  1.00 36.28 ? 108  THR A C   1 
ATOM   852   O O   . THR A 1 108  ? -47.072 89.483  38.221  1.00 35.71 ? 108  THR A O   1 
ATOM   853   C CB  . THR A 1 108  ? -45.734 86.552  38.488  1.00 37.95 ? 108  THR A CB  1 
ATOM   854   O OG1 . THR A 1 108  ? -46.040 85.157  38.600  1.00 38.62 ? 108  THR A OG1 1 
ATOM   855   C CG2 . THR A 1 108  ? -45.841 87.201  39.860  1.00 38.70 ? 108  THR A CG2 1 
ATOM   856   N N   . LEU A 1 109  ? -45.508 89.162  36.639  1.00 33.95 ? 109  LEU A N   1 
ATOM   857   C CA  . LEU A 1 109  ? -45.174 90.576  36.540  1.00 32.90 ? 109  LEU A CA  1 
ATOM   858   C C   . LEU A 1 109  ? -45.987 91.202  35.415  1.00 32.60 ? 109  LEU A C   1 
ATOM   859   O O   . LEU A 1 109  ? -45.451 91.538  34.360  1.00 33.49 ? 109  LEU A O   1 
ATOM   860   C CB  . LEU A 1 109  ? -43.685 90.740  36.253  1.00 32.46 ? 109  LEU A CB  1 
ATOM   861   C CG  . LEU A 1 109  ? -42.741 90.021  37.216  1.00 34.72 ? 109  LEU A CG  1 
ATOM   862   C CD1 . LEU A 1 109  ? -41.320 90.043  36.663  1.00 34.70 ? 109  LEU A CD1 1 
ATOM   863   C CD2 . LEU A 1 109  ? -42.805 90.679  38.587  1.00 34.69 ? 109  LEU A CD2 1 
ATOM   864   N N   . THR A 1 110  ? -47.279 91.368  35.655  1.00 32.43 ? 110  THR A N   1 
ATOM   865   C CA  . THR A 1 110  ? -48.199 91.924  34.667  1.00 33.89 ? 110  THR A CA  1 
ATOM   866   C C   . THR A 1 110  ? -47.768 93.186  33.915  1.00 33.30 ? 110  THR A C   1 
ATOM   867   O O   . THR A 1 110  ? -48.195 93.394  32.778  1.00 34.42 ? 110  THR A O   1 
ATOM   868   C CB  . THR A 1 110  ? -49.566 92.190  35.302  1.00 35.43 ? 110  THR A CB  1 
ATOM   869   O OG1 . THR A 1 110  ? -49.425 93.127  36.384  1.00 36.41 ? 110  THR A OG1 1 
ATOM   870   C CG2 . THR A 1 110  ? -50.149 90.886  35.821  1.00 35.84 ? 110  THR A CG2 1 
ATOM   871   N N   . SER A 1 111  ? -46.941 94.028  34.529  1.00 31.25 ? 111  SER A N   1 
ATOM   872   C CA  . SER A 1 111  ? -46.493 95.244  33.852  1.00 30.26 ? 111  SER A CA  1 
ATOM   873   C C   . SER A 1 111  ? -45.228 95.065  33.001  1.00 28.47 ? 111  SER A C   1 
ATOM   874   O O   . SER A 1 111  ? -44.734 96.017  32.398  1.00 26.74 ? 111  SER A O   1 
ATOM   875   C CB  . SER A 1 111  ? -46.279 96.366  34.870  1.00 30.97 ? 111  SER A CB  1 
ATOM   876   O OG  . SER A 1 111  ? -47.517 96.944  35.244  1.00 31.95 ? 111  SER A OG  1 
ATOM   877   N N   . TYR A 1 112  ? -44.713 93.841  32.947  1.00 26.61 ? 112  TYR A N   1 
ATOM   878   C CA  . TYR A 1 112  ? -43.522 93.549  32.158  1.00 24.88 ? 112  TYR A CA  1 
ATOM   879   C C   . TYR A 1 112  ? -43.859 92.529  31.097  1.00 24.81 ? 112  TYR A C   1 
ATOM   880   O O   . TYR A 1 112  ? -44.810 91.769  31.247  1.00 25.54 ? 112  TYR A O   1 
ATOM   881   C CB  . TYR A 1 112  ? -42.397 93.027  33.062  1.00 22.56 ? 112  TYR A CB  1 
ATOM   882   C CG  . TYR A 1 112  ? -41.827 94.108  33.952  1.00 19.59 ? 112  TYR A CG  1 
ATOM   883   C CD1 . TYR A 1 112  ? -40.896 95.024  33.461  1.00 18.21 ? 112  TYR A CD1 1 
ATOM   884   C CD2 . TYR A 1 112  ? -42.290 94.276  35.254  1.00 18.79 ? 112  TYR A CD2 1 
ATOM   885   C CE1 . TYR A 1 112  ? -40.447 96.084  34.242  1.00 17.69 ? 112  TYR A CE1 1 
ATOM   886   C CE2 . TYR A 1 112  ? -41.852 95.334  36.048  1.00 17.62 ? 112  TYR A CE2 1 
ATOM   887   C CZ  . TYR A 1 112  ? -40.934 96.233  35.538  1.00 18.97 ? 112  TYR A CZ  1 
ATOM   888   O OH  . TYR A 1 112  ? -40.494 97.264  36.332  1.00 15.82 ? 112  TYR A OH  1 
ATOM   889   N N   . GLY A 1 113  ? -43.087 92.525  30.016  1.00 25.41 ? 113  GLY A N   1 
ATOM   890   C CA  . GLY A 1 113  ? -43.329 91.583  28.942  1.00 25.33 ? 113  GLY A CA  1 
ATOM   891   C C   . GLY A 1 113  ? -42.061 91.084  28.274  1.00 26.91 ? 113  GLY A C   1 
ATOM   892   O O   . GLY A 1 113  ? -41.005 91.724  28.332  1.00 25.42 ? 113  GLY A O   1 
ATOM   893   N N   . ARG A 1 114  ? -42.185 89.932  27.625  1.00 28.49 ? 114  ARG A N   1 
ATOM   894   C CA  . ARG A 1 114  ? -41.089 89.286  26.922  1.00 30.00 ? 114  ARG A CA  1 
ATOM   895   C C   . ARG A 1 114  ? -41.503 89.186  25.457  1.00 29.67 ? 114  ARG A C   1 
ATOM   896   O O   . ARG A 1 114  ? -42.680 89.367  25.138  1.00 29.19 ? 114  ARG A O   1 
ATOM   897   C CB  . ARG A 1 114  ? -40.857 87.889  27.510  1.00 32.23 ? 114  ARG A CB  1 
ATOM   898   C CG  . ARG A 1 114  ? -39.643 87.167  26.965  1.00 39.53 ? 114  ARG A CG  1 
ATOM   899   C CD  . ARG A 1 114  ? -39.175 86.042  27.901  1.00 44.46 ? 114  ARG A CD  1 
ATOM   900   N NE  . ARG A 1 114  ? -37.944 85.392  27.429  1.00 48.14 ? 114  ARG A NE  1 
ATOM   901   C CZ  . ARG A 1 114  ? -36.755 85.989  27.331  1.00 49.48 ? 114  ARG A CZ  1 
ATOM   902   N NH1 . ARG A 1 114  ? -36.608 87.263  27.676  1.00 49.60 ? 114  ARG A NH1 1 
ATOM   903   N NH2 . ARG A 1 114  ? -35.707 85.311  26.870  1.00 49.98 ? 114  ARG A NH2 1 
ATOM   904   N N   . LEU A 1 115  ? -40.541 88.920  24.573  1.00 28.81 ? 115  LEU A N   1 
ATOM   905   C CA  . LEU A 1 115  ? -40.822 88.784  23.148  1.00 27.90 ? 115  LEU A CA  1 
ATOM   906   C C   . LEU A 1 115  ? -41.942 87.767  22.943  1.00 28.20 ? 115  LEU A C   1 
ATOM   907   O O   . LEU A 1 115  ? -41.891 86.667  23.487  1.00 26.30 ? 115  LEU A O   1 
ATOM   908   C CB  . LEU A 1 115  ? -39.566 88.325  22.405  1.00 28.17 ? 115  LEU A CB  1 
ATOM   909   C CG  . LEU A 1 115  ? -39.776 87.942  20.940  1.00 28.47 ? 115  LEU A CG  1 
ATOM   910   C CD1 . LEU A 1 115  ? -40.326 89.144  20.181  1.00 28.99 ? 115  LEU A CD1 1 
ATOM   911   C CD2 . LEU A 1 115  ? -38.472 87.460  20.336  1.00 27.60 ? 115  LEU A CD2 1 
ATOM   912   N N   . SER A 1 116  ? -42.946 88.137  22.154  1.00 29.58 ? 116  SER A N   1 
ATOM   913   C CA  . SER A 1 116  ? -44.101 87.266  21.895  1.00 33.03 ? 116  SER A CA  1 
ATOM   914   C C   . SER A 1 116  ? -43.775 85.838  21.460  1.00 34.21 ? 116  SER A C   1 
ATOM   915   O O   . SER A 1 116  ? -43.079 85.615  20.465  1.00 34.24 ? 116  SER A O   1 
ATOM   916   C CB  . SER A 1 116  ? -45.027 87.905  20.848  1.00 34.51 ? 116  SER A CB  1 
ATOM   917   O OG  . SER A 1 116  ? -45.994 86.977  20.382  1.00 34.68 ? 116  SER A OG  1 
ATOM   918   N N   . GLU A 1 117  ? -44.308 84.876  22.207  1.00 35.29 ? 117  GLU A N   1 
ATOM   919   C CA  . GLU A 1 117  ? -44.101 83.462  21.926  1.00 36.14 ? 117  GLU A CA  1 
ATOM   920   C C   . GLU A 1 117  ? -44.690 83.121  20.556  1.00 34.42 ? 117  GLU A C   1 
ATOM   921   O O   . GLU A 1 117  ? -44.171 82.272  19.832  1.00 33.82 ? 117  GLU A O   1 
ATOM   922   C CB  . GLU A 1 117  ? -44.774 82.615  23.007  1.00 38.80 ? 117  GLU A CB  1 
ATOM   923   C CG  . GLU A 1 117  ? -44.429 81.143  22.937  1.00 44.39 ? 117  GLU A CG  1 
ATOM   924   C CD  . GLU A 1 117  ? -45.479 80.271  23.598  1.00 47.06 ? 117  GLU A CD  1 
ATOM   925   O OE1 . GLU A 1 117  ? -45.801 80.513  24.783  1.00 49.52 ? 117  GLU A OE1 1 
ATOM   926   O OE2 . GLU A 1 117  ? -45.982 79.341  22.929  1.00 49.01 ? 117  GLU A OE2 1 
ATOM   927   N N   . ALA A 1 118  ? -45.782 83.788  20.209  1.00 32.75 ? 118  ALA A N   1 
ATOM   928   C CA  . ALA A 1 118  ? -46.414 83.562  18.919  1.00 32.05 ? 118  ALA A CA  1 
ATOM   929   C C   . ALA A 1 118  ? -45.493 84.044  17.794  1.00 30.77 ? 118  ALA A C   1 
ATOM   930   O O   . ALA A 1 118  ? -45.318 83.349  16.790  1.00 30.79 ? 118  ALA A O   1 
ATOM   931   C CB  . ALA A 1 118  ? -47.761 84.290  18.853  1.00 31.42 ? 118  ALA A CB  1 
ATOM   932   N N   . ILE A 1 119  ? -44.902 85.225  17.968  1.00 29.44 ? 119  ILE A N   1 
ATOM   933   C CA  . ILE A 1 119  ? -44.002 85.780  16.960  1.00 27.34 ? 119  ILE A CA  1 
ATOM   934   C C   . ILE A 1 119  ? -42.777 84.892  16.743  1.00 28.28 ? 119  ILE A C   1 
ATOM   935   O O   . ILE A 1 119  ? -42.332 84.720  15.606  1.00 28.53 ? 119  ILE A O   1 
ATOM   936   C CB  . ILE A 1 119  ? -43.534 87.215  17.334  1.00 25.53 ? 119  ILE A CB  1 
ATOM   937   C CG1 . ILE A 1 119  ? -44.743 88.155  17.412  1.00 25.05 ? 119  ILE A CG1 1 
ATOM   938   C CG2 . ILE A 1 119  ? -42.570 87.745  16.283  1.00 23.69 ? 119  ILE A CG2 1 
ATOM   939   C CD1 . ILE A 1 119  ? -44.413 89.607  17.712  1.00 19.45 ? 119  ILE A CD1 1 
ATOM   940   N N   . GLU A 1 120  ? -42.243 84.315  17.820  1.00 27.64 ? 120  GLU A N   1 
ATOM   941   C CA  . GLU A 1 120  ? -41.064 83.457  17.706  1.00 28.43 ? 120  GLU A CA  1 
ATOM   942   C C   . GLU A 1 120  ? -41.341 82.144  16.982  1.00 29.19 ? 120  GLU A C   1 
ATOM   943   O O   . GLU A 1 120  ? -40.505 81.668  16.216  1.00 27.90 ? 120  GLU A O   1 
ATOM   944   C CB  . GLU A 1 120  ? -40.462 83.141  19.081  1.00 28.01 ? 120  GLU A CB  1 
ATOM   945   C CG  . GLU A 1 120  ? -39.604 84.248  19.686  1.00 30.97 ? 120  GLU A CG  1 
ATOM   946   C CD  . GLU A 1 120  ? -38.427 83.701  20.502  1.00 32.79 ? 120  GLU A CD  1 
ATOM   947   O OE1 . GLU A 1 120  ? -38.589 82.653  21.167  1.00 32.53 ? 120  GLU A OE1 1 
ATOM   948   O OE2 . GLU A 1 120  ? -37.338 84.325  20.487  1.00 33.82 ? 120  GLU A OE2 1 
ATOM   949   N N   . ASN A 1 121  ? -42.505 81.551  17.232  1.00 30.46 ? 121  ASN A N   1 
ATOM   950   C CA  . ASN A 1 121  ? -42.861 80.292  16.586  1.00 29.72 ? 121  ASN A CA  1 
ATOM   951   C C   . ASN A 1 121  ? -43.208 80.575  15.147  1.00 29.19 ? 121  ASN A C   1 
ATOM   952   O O   . ASN A 1 121  ? -42.899 79.793  14.249  1.00 29.36 ? 121  ASN A O   1 
ATOM   953   C CB  . ASN A 1 121  ? -44.048 79.663  17.290  1.00 30.64 ? 121  ASN A CB  1 
ATOM   954   C CG  . ASN A 1 121  ? -43.730 79.285  18.703  1.00 32.41 ? 121  ASN A CG  1 
ATOM   955   O OD1 . ASN A 1 121  ? -44.606 79.311  19.567  1.00 34.88 ? 121  ASN A OD1 1 
ATOM   956   N ND2 . ASN A 1 121  ? -42.468 78.917  18.957  1.00 31.07 ? 121  ASN A ND2 1 
ATOM   957   N N   . ARG A 1 122  ? -43.848 81.712  14.930  1.00 28.89 ? 122  ARG A N   1 
ATOM   958   C CA  . ARG A 1 122  ? -44.217 82.102  13.587  1.00 30.40 ? 122  ARG A CA  1 
ATOM   959   C C   . ARG A 1 122  ? -42.921 82.304  12.809  1.00 29.87 ? 122  ARG A C   1 
ATOM   960   O O   . ARG A 1 122  ? -42.857 82.061  11.606  1.00 30.93 ? 122  ARG A O   1 
ATOM   961   C CB  . ARG A 1 122  ? -45.034 83.390  13.627  1.00 30.65 ? 122  ARG A CB  1 
ATOM   962   C CG  . ARG A 1 122  ? -45.896 83.615  12.413  1.00 29.65 ? 122  ARG A CG  1 
ATOM   963   C CD  . ARG A 1 122  ? -46.611 84.927  12.525  1.00 29.36 ? 122  ARG A CD  1 
ATOM   964   N NE  . ARG A 1 122  ? -47.506 84.929  13.671  1.00 31.05 ? 122  ARG A NE  1 
ATOM   965   C CZ  . ARG A 1 122  ? -47.669 85.969  14.476  1.00 30.53 ? 122  ARG A CZ  1 
ATOM   966   N NH1 . ARG A 1 122  ? -46.991 87.090  14.261  1.00 29.52 ? 122  ARG A NH1 1 
ATOM   967   N NH2 . ARG A 1 122  ? -48.510 85.887  15.496  1.00 32.40 ? 122  ARG A NH2 1 
ATOM   968   N N   . ALA A 1 123  ? -41.879 82.734  13.513  1.00 30.59 ? 123  ALA A N   1 
ATOM   969   C CA  . ALA A 1 123  ? -40.576 82.957  12.889  1.00 29.66 ? 123  ALA A CA  1 
ATOM   970   C C   . ALA A 1 123  ? -39.865 81.617  12.700  1.00 29.17 ? 123  ALA A C   1 
ATOM   971   O O   . ALA A 1 123  ? -39.189 81.397  11.693  1.00 28.60 ? 123  ALA A O   1 
ATOM   972   C CB  . ALA A 1 123  ? -39.725 83.898  13.760  1.00 27.69 ? 123  ALA A CB  1 
ATOM   973   N N   . LYS A 1 124  ? -40.028 80.727  13.673  1.00 28.99 ? 124  LYS A N   1 
ATOM   974   C CA  . LYS A 1 124  ? -39.402 79.416  13.617  1.00 31.27 ? 124  LYS A CA  1 
ATOM   975   C C   . LYS A 1 124  ? -39.912 78.643  12.416  1.00 32.78 ? 124  LYS A C   1 
ATOM   976   O O   . LYS A 1 124  ? -39.152 77.892  11.801  1.00 32.64 ? 124  LYS A O   1 
ATOM   977   C CB  . LYS A 1 124  ? -39.674 78.624  14.904  1.00 34.43 ? 124  LYS A CB  1 
ATOM   978   C CG  . LYS A 1 124  ? -39.057 79.255  16.166  1.00 39.81 ? 124  LYS A CG  1 
ATOM   979   C CD  . LYS A 1 124  ? -39.366 78.457  17.431  1.00 41.37 ? 124  LYS A CD  1 
ATOM   980   C CE  . LYS A 1 124  ? -39.063 79.255  18.711  1.00 43.70 ? 124  LYS A CE  1 
ATOM   981   N NZ  . LYS A 1 124  ? -37.614 79.525  18.934  1.00 43.27 ? 124  LYS A NZ  1 
ATOM   982   N N   . ASP A 1 125  ? -41.187 78.811  12.068  1.00 32.86 ? 125  ASP A N   1 
ATOM   983   C CA  . ASP A 1 125  ? -41.683 78.090  10.910  1.00 34.66 ? 125  ASP A CA  1 
ATOM   984   C C   . ASP A 1 125  ? -41.429 78.847  9.610   1.00 33.51 ? 125  ASP A C   1 
ATOM   985   O O   . ASP A 1 125  ? -41.966 78.496  8.557   1.00 33.22 ? 125  ASP A O   1 
ATOM   986   C CB  . ASP A 1 125  ? -43.169 77.690  11.060  1.00 38.38 ? 125  ASP A CB  1 
ATOM   987   C CG  . ASP A 1 125  ? -44.077 78.854  11.360  1.00 43.08 ? 125  ASP A CG  1 
ATOM   988   O OD1 . ASP A 1 125  ? -44.001 79.867  10.627  1.00 46.87 ? 125  ASP A OD1 1 
ATOM   989   O OD2 . ASP A 1 125  ? -44.883 78.746  12.319  1.00 44.66 ? 125  ASP A OD2 1 
ATOM   990   N N   . GLY A 1 126  ? -40.606 79.891  9.692   1.00 31.84 ? 126  GLY A N   1 
ATOM   991   C CA  . GLY A 1 126  ? -40.229 80.628  8.498   1.00 29.71 ? 126  GLY A CA  1 
ATOM   992   C C   . GLY A 1 126  ? -40.909 81.910  8.071   1.00 29.30 ? 126  GLY A C   1 
ATOM   993   O O   . GLY A 1 126  ? -40.591 82.425  7.001   1.00 29.89 ? 126  GLY A O   1 
ATOM   994   N N   . ASP A 1 127  ? -41.829 82.449  8.859   1.00 27.79 ? 127  ASP A N   1 
ATOM   995   C CA  . ASP A 1 127  ? -42.454 83.682  8.417   1.00 27.28 ? 127  ASP A CA  1 
ATOM   996   C C   . ASP A 1 127  ? -41.410 84.786  8.334   1.00 27.26 ? 127  ASP A C   1 
ATOM   997   O O   . ASP A 1 127  ? -40.594 84.955  9.230   1.00 27.06 ? 127  ASP A O   1 
ATOM   998   C CB  . ASP A 1 127  ? -43.579 84.133  9.348   1.00 26.36 ? 127  ASP A CB  1 
ATOM   999   C CG  . ASP A 1 127  ? -44.271 85.383  8.831   1.00 26.83 ? 127  ASP A CG  1 
ATOM   1000  O OD1 . ASP A 1 127  ? -44.984 85.295  7.808   1.00 29.02 ? 127  ASP A OD1 1 
ATOM   1001  O OD2 . ASP A 1 127  ? -44.084 86.463  9.424   1.00 27.01 ? 127  ASP A OD2 1 
ATOM   1002  N N   . SER A 1 128  ? -41.462 85.550  7.254   1.00 27.46 ? 128  SER A N   1 
ATOM   1003  C CA  . SER A 1 128  ? -40.518 86.624  7.027   1.00 28.00 ? 128  SER A CA  1 
ATOM   1004  C C   . SER A 1 128  ? -40.684 87.797  8.004   1.00 28.99 ? 128  SER A C   1 
ATOM   1005  O O   . SER A 1 128  ? -39.704 88.286  8.561   1.00 28.88 ? 128  SER A O   1 
ATOM   1006  C CB  . SER A 1 128  ? -40.659 87.094  5.580   1.00 27.98 ? 128  SER A CB  1 
ATOM   1007  O OG  . SER A 1 128  ? -39.604 87.949  5.207   1.00 31.23 ? 128  SER A OG  1 
ATOM   1008  N N   . GLN A 1 129  ? -41.918 88.245  8.229   1.00 29.34 ? 129  GLN A N   1 
ATOM   1009  C CA  . GLN A 1 129  ? -42.153 89.372  9.130   1.00 28.09 ? 129  GLN A CA  1 
ATOM   1010  C C   . GLN A 1 129  ? -41.751 89.041  10.570  1.00 26.82 ? 129  GLN A C   1 
ATOM   1011  O O   . GLN A 1 129  ? -41.146 89.860  11.275  1.00 26.92 ? 129  GLN A O   1 
ATOM   1012  C CB  . GLN A 1 129  ? -43.628 89.788  9.080   1.00 29.95 ? 129  GLN A CB  1 
ATOM   1013  C CG  . GLN A 1 129  ? -43.960 91.019  9.922   1.00 34.83 ? 129  GLN A CG  1 
ATOM   1014  C CD  . GLN A 1 129  ? -45.432 91.426  9.845   1.00 37.15 ? 129  GLN A CD  1 
ATOM   1015  O OE1 . GLN A 1 129  ? -45.999 91.543  8.755   1.00 39.92 ? 129  GLN A OE1 1 
ATOM   1016  N NE2 . GLN A 1 129  ? -46.048 91.659  11.001  1.00 36.46 ? 129  GLN A NE2 1 
ATOM   1017  N N   . ALA A 1 130  ? -42.090 87.836  11.003  1.00 24.18 ? 130  ALA A N   1 
ATOM   1018  C CA  . ALA A 1 130  ? -41.761 87.407  12.346  1.00 22.69 ? 130  ALA A CA  1 
ATOM   1019  C C   . ALA A 1 130  ? -40.242 87.224  12.528  1.00 22.42 ? 130  ALA A C   1 
ATOM   1020  O O   . ALA A 1 130  ? -39.697 87.597  13.565  1.00 24.22 ? 130  ALA A O   1 
ATOM   1021  C CB  . ALA A 1 130  ? -42.510 86.117  12.675  1.00 20.61 ? 130  ALA A CB  1 
ATOM   1022  N N   . ARG A 1 131  ? -39.557 86.661  11.534  1.00 20.78 ? 131  ARG A N   1 
ATOM   1023  C CA  . ARG A 1 131  ? -38.106 86.482  11.644  1.00 20.50 ? 131  ARG A CA  1 
ATOM   1024  C C   . ARG A 1 131  ? -37.470 87.840  11.947  1.00 21.16 ? 131  ARG A C   1 
ATOM   1025  O O   . ARG A 1 131  ? -36.552 87.942  12.765  1.00 20.22 ? 131  ARG A O   1 
ATOM   1026  C CB  . ARG A 1 131  ? -37.515 85.917  10.344  1.00 18.91 ? 131  ARG A CB  1 
ATOM   1027  C CG  . ARG A 1 131  ? -37.825 84.443  10.094  1.00 19.63 ? 131  ARG A CG  1 
ATOM   1028  C CD  . ARG A 1 131  ? -37.278 83.993  8.755   1.00 19.19 ? 131  ARG A CD  1 
ATOM   1029  N NE  . ARG A 1 131  ? -35.820 83.975  8.750   1.00 18.44 ? 131  ARG A NE  1 
ATOM   1030  C CZ  . ARG A 1 131  ? -35.069 84.144  7.667   1.00 20.01 ? 131  ARG A CZ  1 
ATOM   1031  N NH1 . ARG A 1 131  ? -35.625 84.350  6.479   1.00 19.85 ? 131  ARG A NH1 1 
ATOM   1032  N NH2 . ARG A 1 131  ? -33.749 84.111  7.776   1.00 21.99 ? 131  ARG A NH2 1 
ATOM   1033  N N   . ILE A 1 132  ? -37.976 88.880  11.286  1.00 20.57 ? 132  ILE A N   1 
ATOM   1034  C CA  . ILE A 1 132  ? -37.469 90.225  11.485  1.00 21.38 ? 132  ILE A CA  1 
ATOM   1035  C C   . ILE A 1 132  ? -37.740 90.694  12.906  1.00 20.62 ? 132  ILE A C   1 
ATOM   1036  O O   . ILE A 1 132  ? -36.839 91.201  13.570  1.00 19.58 ? 132  ILE A O   1 
ATOM   1037  C CB  . ILE A 1 132  ? -38.128 91.235  10.527  1.00 23.51 ? 132  ILE A CB  1 
ATOM   1038  C CG1 . ILE A 1 132  ? -37.804 90.872  9.079   1.00 24.97 ? 132  ILE A CG1 1 
ATOM   1039  C CG2 . ILE A 1 132  ? -37.663 92.645  10.858  1.00 21.02 ? 132  ILE A CG2 1 
ATOM   1040  C CD1 . ILE A 1 132  ? -36.338 90.789  8.792   1.00 29.25 ? 132  ILE A CD1 1 
ATOM   1041  N N   . ALA A 1 133  ? -38.976 90.525  13.370  1.00 19.12 ? 133  ALA A N   1 
ATOM   1042  C CA  . ALA A 1 133  ? -39.330 90.963  14.722  1.00 17.94 ? 133  ALA A CA  1 
ATOM   1043  C C   . ALA A 1 133  ? -38.574 90.152  15.769  1.00 15.96 ? 133  ALA A C   1 
ATOM   1044  O O   . ALA A 1 133  ? -38.172 90.681  16.804  1.00 16.02 ? 133  ALA A O   1 
ATOM   1045  C CB  . ALA A 1 133  ? -40.843 90.846  14.948  1.00 16.60 ? 133  ALA A CB  1 
ATOM   1046  N N   . THR A 1 134  ? -38.379 88.868  15.509  1.00 13.34 ? 134  THR A N   1 
ATOM   1047  C CA  . THR A 1 134  ? -37.657 88.051  16.467  1.00 13.64 ? 134  THR A CA  1 
ATOM   1048  C C   . THR A 1 134  ? -36.190 88.486  16.509  1.00 13.81 ? 134  THR A C   1 
ATOM   1049  O O   . THR A 1 134  ? -35.592 88.558  17.588  1.00 14.57 ? 134  THR A O   1 
ATOM   1050  C CB  . THR A 1 134  ? -37.763 86.554  16.131  1.00 12.32 ? 134  THR A CB  1 
ATOM   1051  O OG1 . THR A 1 134  ? -39.130 86.149  16.242  1.00 17.31 ? 134  THR A OG1 1 
ATOM   1052  C CG2 . THR A 1 134  ? -36.950 85.731  17.094  1.00 10.33 ? 134  THR A CG2 1 
ATOM   1053  N N   . THR A 1 135  ? -35.610 88.789  15.349  1.00 10.80 ? 135  THR A N   1 
ATOM   1054  C CA  . THR A 1 135  ? -34.223 89.225  15.323  1.00 9.96  ? 135  THR A CA  1 
ATOM   1055  C C   . THR A 1 135  ? -34.097 90.505  16.169  1.00 8.73  ? 135  THR A C   1 
ATOM   1056  O O   . THR A 1 135  ? -33.255 90.587  17.066  1.00 7.31  ? 135  THR A O   1 
ATOM   1057  C CB  . THR A 1 135  ? -33.733 89.490  13.865  1.00 11.58 ? 135  THR A CB  1 
ATOM   1058  O OG1 . THR A 1 135  ? -33.797 88.275  13.112  1.00 12.50 ? 135  THR A OG1 1 
ATOM   1059  C CG2 . THR A 1 135  ? -32.302 89.994  13.854  1.00 6.27  ? 135  THR A CG2 1 
ATOM   1060  N N   . TYR A 1 136  ? -34.948 91.487  15.895  1.00 7.23  ? 136  TYR A N   1 
ATOM   1061  C CA  . TYR A 1 136  ? -34.935 92.750  16.637  1.00 8.01  ? 136  TYR A CA  1 
ATOM   1062  C C   . TYR A 1 136  ? -35.135 92.534  18.126  1.00 9.08  ? 136  TYR A C   1 
ATOM   1063  O O   . TYR A 1 136  ? -34.381 93.059  18.952  1.00 9.99  ? 136  TYR A O   1 
ATOM   1064  C CB  . TYR A 1 136  ? -36.030 93.681  16.140  1.00 7.24  ? 136  TYR A CB  1 
ATOM   1065  C CG  . TYR A 1 136  ? -36.209 94.906  16.997  1.00 8.37  ? 136  TYR A CG  1 
ATOM   1066  C CD1 . TYR A 1 136  ? -35.210 95.875  17.091  1.00 5.77  ? 136  TYR A CD1 1 
ATOM   1067  C CD2 . TYR A 1 136  ? -37.386 95.098  17.720  1.00 8.05  ? 136  TYR A CD2 1 
ATOM   1068  C CE1 . TYR A 1 136  ? -35.388 96.999  17.882  1.00 6.17  ? 136  TYR A CE1 1 
ATOM   1069  C CE2 . TYR A 1 136  ? -37.571 96.210  18.504  1.00 5.18  ? 136  TYR A CE2 1 
ATOM   1070  C CZ  . TYR A 1 136  ? -36.576 97.157  18.584  1.00 6.27  ? 136  TYR A CZ  1 
ATOM   1071  O OH  . TYR A 1 136  ? -36.782 98.249  19.382  1.00 7.87  ? 136  TYR A OH  1 
ATOM   1072  N N   . GLY A 1 137  ? -36.163 91.770  18.467  1.00 10.10 ? 137  GLY A N   1 
ATOM   1073  C CA  . GLY A 1 137  ? -36.430 91.493  19.864  1.00 12.74 ? 137  GLY A CA  1 
ATOM   1074  C C   . GLY A 1 137  ? -35.234 90.884  20.577  1.00 12.85 ? 137  GLY A C   1 
ATOM   1075  O O   . GLY A 1 137  ? -34.843 91.358  21.636  1.00 11.99 ? 137  GLY A O   1 
ATOM   1076  N N   . ARG A 1 138  ? -34.658 89.840  19.985  1.00 14.51 ? 138  ARG A N   1 
ATOM   1077  C CA  . ARG A 1 138  ? -33.505 89.148  20.550  1.00 14.26 ? 138  ARG A CA  1 
ATOM   1078  C C   . ARG A 1 138  ? -32.248 90.008  20.621  1.00 15.99 ? 138  ARG A C   1 
ATOM   1079  O O   . ARG A 1 138  ? -31.510 89.955  21.613  1.00 16.66 ? 138  ARG A O   1 
ATOM   1080  C CB  . ARG A 1 138  ? -33.181 87.896  19.735  1.00 13.13 ? 138  ARG A CB  1 
ATOM   1081  C CG  . ARG A 1 138  ? -34.152 86.764  19.903  1.00 15.98 ? 138  ARG A CG  1 
ATOM   1082  C CD  . ARG A 1 138  ? -33.700 85.545  19.108  1.00 19.00 ? 138  ARG A CD  1 
ATOM   1083  N NE  . ARG A 1 138  ? -34.640 84.434  19.235  1.00 20.65 ? 138  ARG A NE  1 
ATOM   1084  C CZ  . ARG A 1 138  ? -34.614 83.338  18.484  1.00 22.05 ? 138  ARG A CZ  1 
ATOM   1085  N NH1 . ARG A 1 138  ? -33.693 83.196  17.549  1.00 21.34 ? 138  ARG A NH1 1 
ATOM   1086  N NH2 . ARG A 1 138  ? -35.524 82.387  18.657  1.00 23.95 ? 138  ARG A NH2 1 
ATOM   1087  N N   . ILE A 1 139  ? -31.995 90.792  19.574  1.00 15.65 ? 139  ILE A N   1 
ATOM   1088  C CA  . ILE A 1 139  ? -30.798 91.615  19.559  1.00 15.83 ? 139  ILE A CA  1 
ATOM   1089  C C   . ILE A 1 139  ? -30.935 92.775  20.528  1.00 15.72 ? 139  ILE A C   1 
ATOM   1090  O O   . ILE A 1 139  ? -29.969 93.147  21.187  1.00 17.12 ? 139  ILE A O   1 
ATOM   1091  C CB  . ILE A 1 139  ? -30.459 92.125  18.120  1.00 17.24 ? 139  ILE A CB  1 
ATOM   1092  C CG1 . ILE A 1 139  ? -28.985 92.541  18.052  1.00 18.98 ? 139  ILE A CG1 1 
ATOM   1093  C CG2 . ILE A 1 139  ? -31.325 93.318  17.741  1.00 14.73 ? 139  ILE A CG2 1 
ATOM   1094  C CD1 . ILE A 1 139  ? -28.009 91.422  18.420  1.00 19.83 ? 139  ILE A CD1 1 
ATOM   1095  N N   . ALA A 1 140  ? -32.130 93.344  20.640  1.00 15.38 ? 140  ALA A N   1 
ATOM   1096  C CA  . ALA A 1 140  ? -32.327 94.445  21.586  1.00 15.76 ? 140  ALA A CA  1 
ATOM   1097  C C   . ALA A 1 140  ? -32.104 93.901  23.000  1.00 16.01 ? 140  ALA A C   1 
ATOM   1098  O O   . ALA A 1 140  ? -31.464 94.540  23.835  1.00 16.24 ? 140  ALA A O   1 
ATOM   1099  C CB  . ALA A 1 140  ? -33.725 95.008  21.457  1.00 15.63 ? 140  ALA A CB  1 
ATOM   1100  N N   . GLU A 1 141  ? -32.637 92.710  23.253  1.00 14.73 ? 141  GLU A N   1 
ATOM   1101  C CA  . GLU A 1 141  ? -32.482 92.052  24.535  1.00 16.14 ? 141  GLU A CA  1 
ATOM   1102  C C   . GLU A 1 141  ? -30.991 91.900  24.849  1.00 16.97 ? 141  GLU A C   1 
ATOM   1103  O O   . GLU A 1 141  ? -30.509 92.369  25.887  1.00 17.42 ? 141  GLU A O   1 
ATOM   1104  C CB  . GLU A 1 141  ? -33.139 90.675  24.492  1.00 17.20 ? 141  GLU A CB  1 
ATOM   1105  C CG  . GLU A 1 141  ? -32.739 89.767  25.647  1.00 18.74 ? 141  GLU A CG  1 
ATOM   1106  C CD  . GLU A 1 141  ? -33.545 88.492  25.677  1.00 21.20 ? 141  GLU A CD  1 
ATOM   1107  O OE1 . GLU A 1 141  ? -33.557 87.761  24.656  1.00 21.93 ? 141  GLU A OE1 1 
ATOM   1108  O OE2 . GLU A 1 141  ? -34.173 88.227  26.722  1.00 23.15 ? 141  GLU A OE2 1 
ATOM   1109  N N   . SER A 1 142  ? -30.267 91.228  23.956  1.00 15.58 ? 142  SER A N   1 
ATOM   1110  C CA  . SER A 1 142  ? -28.832 91.044  24.130  1.00 15.21 ? 142  SER A CA  1 
ATOM   1111  C C   . SER A 1 142  ? -28.188 92.373  24.521  1.00 15.70 ? 142  SER A C   1 
ATOM   1112  O O   . SER A 1 142  ? -27.373 92.432  25.446  1.00 15.95 ? 142  SER A O   1 
ATOM   1113  C CB  . SER A 1 142  ? -28.196 90.539  22.839  1.00 15.10 ? 142  SER A CB  1 
ATOM   1114  O OG  . SER A 1 142  ? -26.827 90.281  23.040  1.00 15.81 ? 142  SER A OG  1 
ATOM   1115  N N   . GLN A 1 143  ? -28.551 93.444  23.821  1.00 13.93 ? 143  GLN A N   1 
ATOM   1116  C CA  . GLN A 1 143  ? -27.993 94.751  24.153  1.00 12.85 ? 143  GLN A CA  1 
ATOM   1117  C C   . GLN A 1 143  ? -28.321 95.120  25.613  1.00 12.10 ? 143  GLN A C   1 
ATOM   1118  O O   . GLN A 1 143  ? -27.479 95.672  26.331  1.00 11.62 ? 143  GLN A O   1 
ATOM   1119  C CB  . GLN A 1 143  ? -28.527 95.814  23.187  1.00 11.84 ? 143  GLN A CB  1 
ATOM   1120  C CG  . GLN A 1 143  ? -28.207 97.247  23.581  1.00 11.34 ? 143  GLN A CG  1 
ATOM   1121  C CD  . GLN A 1 143  ? -28.526 98.250  22.476  1.00 11.49 ? 143  GLN A CD  1 
ATOM   1122  O OE1 . GLN A 1 143  ? -27.666 98.601  21.677  1.00 15.28 ? 143  GLN A OE1 1 
ATOM   1123  N NE2 . GLN A 1 143  ? -29.768 98.698  22.423  1.00 12.02 ? 143  GLN A NE2 1 
ATOM   1124  N N   . ALA A 1 144  ? -29.529 94.794  26.063  1.00 9.88  ? 144  ALA A N   1 
ATOM   1125  C CA  . ALA A 1 144  ? -29.913 95.098  27.430  1.00 10.81 ? 144  ALA A CA  1 
ATOM   1126  C C   . ALA A 1 144  ? -29.200 94.217  28.473  1.00 13.30 ? 144  ALA A C   1 
ATOM   1127  O O   . ALA A 1 144  ? -29.131 94.590  29.640  1.00 16.79 ? 144  ALA A O   1 
ATOM   1128  C CB  . ALA A 1 144  ? -31.413 94.978  27.585  1.00 10.28 ? 144  ALA A CB  1 
ATOM   1129  N N   . ARG A 1 145  ? -28.657 93.075  28.056  1.00 12.57 ? 145  ARG A N   1 
ATOM   1130  C CA  . ARG A 1 145  ? -27.960 92.162  28.972  1.00 15.41 ? 145  ARG A CA  1 
ATOM   1131  C C   . ARG A 1 145  ? -26.468 92.392  29.165  1.00 14.64 ? 145  ARG A C   1 
ATOM   1132  O O   . ARG A 1 145  ? -25.846 91.659  29.921  1.00 15.54 ? 145  ARG A O   1 
ATOM   1133  C CB  . ARG A 1 145  ? -28.095 90.699  28.506  1.00 17.14 ? 145  ARG A CB  1 
ATOM   1134  C CG  . ARG A 1 145  ? -29.369 89.998  28.851  1.00 16.73 ? 145  ARG A CG  1 
ATOM   1135  C CD  . ARG A 1 145  ? -29.302 88.593  28.300  1.00 20.61 ? 145  ARG A CD  1 
ATOM   1136  N NE  . ARG A 1 145  ? -28.587 87.684  29.190  1.00 23.04 ? 145  ARG A NE  1 
ATOM   1137  C CZ  . ARG A 1 145  ? -27.690 86.788  28.793  1.00 22.23 ? 145  ARG A CZ  1 
ATOM   1138  N NH1 . ARG A 1 145  ? -27.375 86.675  27.515  1.00 24.13 ? 145  ARG A NH1 1 
ATOM   1139  N NH2 . ARG A 1 145  ? -27.125 85.981  29.676  1.00 25.81 ? 145  ARG A NH2 1 
ATOM   1140  N N   . GLN A 1 146  ? -25.881 93.364  28.478  1.00 15.15 ? 146  GLN A N   1 
ATOM   1141  C CA  . GLN A 1 146  ? -24.435 93.591  28.589  1.00 14.10 ? 146  GLN A CA  1 
ATOM   1142  C C   . GLN A 1 146  ? -23.968 94.230  29.901  1.00 12.99 ? 146  GLN A C   1 
ATOM   1143  O O   . GLN A 1 146  ? -23.144 95.140  29.900  1.00 12.45 ? 146  GLN A O   1 
ATOM   1144  C CB  . GLN A 1 146  ? -23.939 94.441  27.416  1.00 13.82 ? 146  GLN A CB  1 
ATOM   1145  C CG  . GLN A 1 146  ? -24.212 93.877  26.030  1.00 13.19 ? 146  GLN A CG  1 
ATOM   1146  C CD  . GLN A 1 146  ? -23.695 92.464  25.829  1.00 12.70 ? 146  GLN A CD  1 
ATOM   1147  O OE1 . GLN A 1 146  ? -24.477 91.531  25.683  1.00 14.35 ? 146  GLN A OE1 1 
ATOM   1148  N NE2 . GLN A 1 146  ? -22.378 92.301  25.813  1.00 12.46 ? 146  GLN A NE2 1 
ATOM   1149  N N   . ILE A 1 147  ? -24.497 93.736  31.014  1.00 13.04 ? 147  ILE A N   1 
ATOM   1150  C CA  . ILE A 1 147  ? -24.146 94.234  32.338  1.00 10.91 ? 147  ILE A CA  1 
ATOM   1151  C C   . ILE A 1 147  ? -23.944 93.035  33.267  1.00 11.52 ? 147  ILE A C   1 
ATOM   1152  O O   . ILE A 1 147  ? -24.329 91.903  32.926  1.00 10.30 ? 147  ILE A O   1 
ATOM   1153  C CB  . ILE A 1 147  ? -25.237 95.181  32.885  1.00 8.61  ? 147  ILE A CB  1 
ATOM   1154  C CG1 . ILE A 1 147  ? -26.611 94.502  32.824  1.00 6.06  ? 147  ILE A CG1 1 
ATOM   1155  C CG2 . ILE A 1 147  ? -25.266 96.471  32.047  1.00 4.00  ? 147  ILE A CG2 1 
ATOM   1156  C CD1 . ILE A 1 147  ? -27.757 95.402  33.287  1.00 6.04  ? 147  ILE A CD1 1 
ATOM   1157  N N   . LYS A 1 148  ? -23.318 93.291  34.417  1.00 9.93  ? 148  LYS A N   1 
ATOM   1158  C CA  . LYS A 1 148  ? -23.013 92.256  35.397  1.00 10.13 ? 148  LYS A CA  1 
ATOM   1159  C C   . LYS A 1 148  ? -24.196 91.852  36.218  1.00 9.89  ? 148  LYS A C   1 
ATOM   1160  O O   . LYS A 1 148  ? -24.322 90.694  36.581  1.00 13.32 ? 148  LYS A O   1 
ATOM   1161  C CB  . LYS A 1 148  ? -21.926 92.721  36.374  1.00 10.16 ? 148  LYS A CB  1 
ATOM   1162  C CG  . LYS A 1 148  ? -20.609 93.093  35.736  1.00 10.20 ? 148  LYS A CG  1 
ATOM   1163  C CD  . LYS A 1 148  ? -19.633 93.607  36.785  1.00 9.66  ? 148  LYS A CD  1 
ATOM   1164  C CE  . LYS A 1 148  ? -18.257 93.862  36.190  1.00 7.05  ? 148  LYS A CE  1 
ATOM   1165  N NZ  . LYS A 1 148  ? -18.290 95.038  35.299  1.00 6.70  ? 148  LYS A NZ  1 
ATOM   1166  N N   . ALA A 1 149  ? -25.051 92.819  36.527  1.00 9.84  ? 149  ALA A N   1 
ATOM   1167  C CA  . ALA A 1 149  ? -26.216 92.584  37.363  1.00 10.13 ? 149  ALA A CA  1 
ATOM   1168  C C   . ALA A 1 149  ? -27.181 93.741  37.193  1.00 10.28 ? 149  ALA A C   1 
ATOM   1169  O O   . ALA A 1 149  ? -26.888 94.693  36.480  1.00 10.89 ? 149  ALA A O   1 
ATOM   1170  C CB  . ALA A 1 149  ? -25.777 92.472  38.836  1.00 9.35  ? 149  ALA A CB  1 
ATOM   1171  N N   . PRO A 1 150  ? -28.343 93.680  37.864  1.00 10.17 ? 150  PRO A N   1 
ATOM   1172  C CA  . PRO A 1 150  ? -29.349 94.746  37.768  1.00 10.21 ? 150  PRO A CA  1 
ATOM   1173  C C   . PRO A 1 150  ? -28.799 96.108  38.167  1.00 10.86 ? 150  PRO A C   1 
ATOM   1174  O O   . PRO A 1 150  ? -28.136 96.236  39.193  1.00 12.54 ? 150  PRO A O   1 
ATOM   1175  C CB  . PRO A 1 150  ? -30.444 94.280  38.728  1.00 8.95  ? 150  PRO A CB  1 
ATOM   1176  C CG  . PRO A 1 150  ? -30.312 92.785  38.704  1.00 6.75  ? 150  PRO A CG  1 
ATOM   1177  C CD  . PRO A 1 150  ? -28.819 92.583  38.728  1.00 8.88  ? 150  PRO A CD  1 
ATOM   1178  N N   . LEU A 1 151  ? -29.080 97.128  37.367  1.00 10.79 ? 151  LEU A N   1 
ATOM   1179  C CA  . LEU A 1 151  ? -28.603 98.462  37.688  1.00 11.45 ? 151  LEU A CA  1 
ATOM   1180  C C   . LEU A 1 151  ? -28.988 98.902  39.107  1.00 12.65 ? 151  LEU A C   1 
ATOM   1181  O O   . LEU A 1 151  ? -28.215 99.590  39.775  1.00 14.78 ? 151  LEU A O   1 
ATOM   1182  C CB  . LEU A 1 151  ? -29.125 99.473  36.663  1.00 10.30 ? 151  LEU A CB  1 
ATOM   1183  C CG  . LEU A 1 151  ? -28.583 99.261  35.241  1.00 10.30 ? 151  LEU A CG  1 
ATOM   1184  C CD1 . LEU A 1 151  ? -29.042 100.398 34.332  1.00 8.88  ? 151  LEU A CD1 1 
ATOM   1185  C CD2 . LEU A 1 151  ? -27.043 99.180  35.271  1.00 5.67  ? 151  LEU A CD2 1 
ATOM   1186  N N   . GLU A 1 152  ? -30.166 98.498  39.573  1.00 11.98 ? 152  GLU A N   1 
ATOM   1187  C CA  . GLU A 1 152  ? -30.625 98.871  40.909  1.00 12.16 ? 152  GLU A CA  1 
ATOM   1188  C C   . GLU A 1 152  ? -29.665 98.475  42.040  1.00 13.62 ? 152  GLU A C   1 
ATOM   1189  O O   . GLU A 1 152  ? -29.677 99.082  43.104  1.00 14.48 ? 152  GLU A O   1 
ATOM   1190  C CB  . GLU A 1 152  ? -32.003 98.264  41.183  1.00 11.82 ? 152  GLU A CB  1 
ATOM   1191  C CG  . GLU A 1 152  ? -33.141 98.835  40.324  1.00 10.30 ? 152  GLU A CG  1 
ATOM   1192  C CD  . GLU A 1 152  ? -33.221 98.222  38.921  1.00 8.60  ? 152  GLU A CD  1 
ATOM   1193  O OE1 . GLU A 1 152  ? -32.564 97.181  38.675  1.00 6.81  ? 152  GLU A OE1 1 
ATOM   1194  O OE2 . GLU A 1 152  ? -33.960 98.784  38.076  1.00 6.45  ? 152  GLU A OE2 1 
ATOM   1195  N N   . LYS A 1 153  ? -28.847 97.453  41.821  1.00 14.69 ? 153  LYS A N   1 
ATOM   1196  C CA  . LYS A 1 153  ? -27.883 97.019  42.831  1.00 15.47 ? 153  LYS A CA  1 
ATOM   1197  C C   . LYS A 1 153  ? -26.800 98.080  42.945  1.00 14.27 ? 153  LYS A C   1 
ATOM   1198  O O   . LYS A 1 153  ? -26.450 98.524  44.037  1.00 12.33 ? 153  LYS A O   1 
ATOM   1199  C CB  . LYS A 1 153  ? -27.233 95.680  42.431  1.00 17.42 ? 153  LYS A CB  1 
ATOM   1200  C CG  . LYS A 1 153  ? -28.079 94.430  42.696  1.00 15.33 ? 153  LYS A CG  1 
ATOM   1201  C CD  . LYS A 1 153  ? -28.002 94.038  44.150  1.00 16.12 ? 153  LYS A CD  1 
ATOM   1202  C CE  . LYS A 1 153  ? -28.753 92.754  44.419  1.00 16.45 ? 153  LYS A CE  1 
ATOM   1203  N NZ  . LYS A 1 153  ? -28.870 92.513  45.874  1.00 18.66 ? 153  LYS A NZ  1 
ATOM   1204  N N   . PHE A 1 154  ? -26.271 98.484  41.798  1.00 14.10 ? 154  PHE A N   1 
ATOM   1205  C CA  . PHE A 1 154  ? -25.224 99.500  41.765  1.00 14.09 ? 154  PHE A CA  1 
ATOM   1206  C C   . PHE A 1 154  ? -25.709 100.850 42.255  1.00 14.03 ? 154  PHE A C   1 
ATOM   1207  O O   . PHE A 1 154  ? -24.950 101.573 42.904  1.00 16.49 ? 154  PHE A O   1 
ATOM   1208  C CB  . PHE A 1 154  ? -24.657 99.620  40.362  1.00 12.63 ? 154  PHE A CB  1 
ATOM   1209  C CG  . PHE A 1 154  ? -23.917 98.403  39.922  1.00 14.60 ? 154  PHE A CG  1 
ATOM   1210  C CD1 . PHE A 1 154  ? -22.554 98.266  40.189  1.00 15.85 ? 154  PHE A CD1 1 
ATOM   1211  C CD2 . PHE A 1 154  ? -24.578 97.389  39.233  1.00 12.89 ? 154  PHE A CD2 1 
ATOM   1212  C CE1 . PHE A 1 154  ? -21.855 97.129  39.771  1.00 14.81 ? 154  PHE A CE1 1 
ATOM   1213  C CE2 . PHE A 1 154  ? -23.904 96.266  38.817  1.00 12.47 ? 154  PHE A CE2 1 
ATOM   1214  C CZ  . PHE A 1 154  ? -22.533 96.131  39.083  1.00 15.08 ? 154  PHE A CZ  1 
ATOM   1215  N N   . VAL A 1 155  ? -26.966 101.186 41.964  1.00 13.64 ? 155  VAL A N   1 
ATOM   1216  C CA  . VAL A 1 155  ? -27.530 102.460 42.416  1.00 13.73 ? 155  VAL A CA  1 
ATOM   1217  C C   . VAL A 1 155  ? -27.775 102.402 43.921  1.00 14.26 ? 155  VAL A C   1 
ATOM   1218  O O   . VAL A 1 155  ? -27.408 103.315 44.662  1.00 15.11 ? 155  VAL A O   1 
ATOM   1219  C CB  . VAL A 1 155  ? -28.876 102.789 41.706  1.00 13.34 ? 155  VAL A CB  1 
ATOM   1220  C CG1 . VAL A 1 155  ? -29.533 104.014 42.365  1.00 11.74 ? 155  VAL A CG1 1 
ATOM   1221  C CG2 . VAL A 1 155  ? -28.631 103.057 40.226  1.00 11.65 ? 155  VAL A CG2 1 
ATOM   1222  N N   . LEU A 1 156  ? -28.392 101.319 44.377  1.00 14.42 ? 156  LEU A N   1 
ATOM   1223  C CA  . LEU A 1 156  ? -28.669 101.191 45.793  1.00 13.15 ? 156  LEU A CA  1 
ATOM   1224  C C   . LEU A 1 156  ? -27.349 101.291 46.544  1.00 13.00 ? 156  LEU A C   1 
ATOM   1225  O O   . LEU A 1 156  ? -27.223 102.058 47.509  1.00 13.63 ? 156  LEU A O   1 
ATOM   1226  C CB  . LEU A 1 156  ? -29.376 99.867  46.094  1.00 11.29 ? 156  LEU A CB  1 
ATOM   1227  C CG  . LEU A 1 156  ? -29.866 99.748  47.538  1.00 13.33 ? 156  LEU A CG  1 
ATOM   1228  C CD1 . LEU A 1 156  ? -30.743 100.955 47.887  1.00 10.29 ? 156  LEU A CD1 1 
ATOM   1229  C CD2 . LEU A 1 156  ? -30.622 98.439  47.719  1.00 11.86 ? 156  LEU A CD2 1 
ATOM   1230  N N   . ALA A 1 157  ? -26.346 100.549 46.096  1.00 12.11 ? 157  ALA A N   1 
ATOM   1231  C CA  . ALA A 1 157  ? -25.063 100.622 46.786  1.00 12.83 ? 157  ALA A CA  1 
ATOM   1232  C C   . ALA A 1 157  ? -24.547 102.066 46.774  1.00 13.51 ? 157  ALA A C   1 
ATOM   1233  O O   . ALA A 1 157  ? -24.075 102.569 47.802  1.00 15.15 ? 157  ALA A O   1 
ATOM   1234  C CB  . ALA A 1 157  ? -24.036 99.671  46.146  1.00 11.34 ? 157  ALA A CB  1 
ATOM   1235  N N   . LEU A 1 158  ? -24.646 102.750 45.633  1.00 12.28 ? 158  LEU A N   1 
ATOM   1236  C CA  . LEU A 1 158  ? -24.166 104.129 45.594  1.00 12.19 ? 158  LEU A CA  1 
ATOM   1237  C C   . LEU A 1 158  ? -24.922 105.025 46.607  1.00 13.89 ? 158  LEU A C   1 
ATOM   1238  O O   . LEU A 1 158  ? -24.322 105.902 47.243  1.00 12.15 ? 158  LEU A O   1 
ATOM   1239  C CB  . LEU A 1 158  ? -24.279 104.699 44.175  1.00 10.90 ? 158  LEU A CB  1 
ATOM   1240  C CG  . LEU A 1 158  ? -23.790 106.142 44.017  1.00 10.05 ? 158  LEU A CG  1 
ATOM   1241  C CD1 . LEU A 1 158  ? -22.364 106.265 44.464  1.00 7.93  ? 158  LEU A CD1 1 
ATOM   1242  C CD2 . LEU A 1 158  ? -23.925 106.574 42.573  1.00 11.46 ? 158  LEU A CD2 1 
ATOM   1243  N N   . LEU A 1 159  ? -26.230 104.809 46.765  1.00 13.89 ? 159  LEU A N   1 
ATOM   1244  C CA  . LEU A 1 159  ? -26.991 105.604 47.725  1.00 14.46 ? 159  LEU A CA  1 
ATOM   1245  C C   . LEU A 1 159  ? -26.522 105.303 49.158  1.00 14.63 ? 159  LEU A C   1 
ATOM   1246  O O   . LEU A 1 159  ? -26.374 106.201 49.981  1.00 14.09 ? 159  LEU A O   1 
ATOM   1247  C CB  . LEU A 1 159  ? -28.488 105.306 47.623  1.00 14.17 ? 159  LEU A CB  1 
ATOM   1248  C CG  . LEU A 1 159  ? -29.275 105.740 46.388  1.00 16.35 ? 159  LEU A CG  1 
ATOM   1249  C CD1 . LEU A 1 159  ? -30.653 105.079 46.430  1.00 15.86 ? 159  LEU A CD1 1 
ATOM   1250  C CD2 . LEU A 1 159  ? -29.409 107.253 46.337  1.00 14.40 ? 159  LEU A CD2 1 
ATOM   1251  N N   . VAL A 1 160  ? -26.282 104.036 49.454  1.00 14.31 ? 160  VAL A N   1 
ATOM   1252  C CA  . VAL A 1 160  ? -25.861 103.684 50.791  1.00 15.58 ? 160  VAL A CA  1 
ATOM   1253  C C   . VAL A 1 160  ? -24.485 104.262 51.104  1.00 16.88 ? 160  VAL A C   1 
ATOM   1254  O O   . VAL A 1 160  ? -24.283 104.856 52.171  1.00 17.53 ? 160  VAL A O   1 
ATOM   1255  C CB  . VAL A 1 160  ? -25.906 102.142 50.977  1.00 15.17 ? 160  VAL A CB  1 
ATOM   1256  C CG1 . VAL A 1 160  ? -25.161 101.716 52.242  1.00 14.21 ? 160  VAL A CG1 1 
ATOM   1257  C CG2 . VAL A 1 160  ? -27.372 101.697 51.063  1.00 14.22 ? 160  VAL A CG2 1 
ATOM   1258  N N   . ALA A 1 161  ? -23.554 104.124 50.166  1.00 16.00 ? 161  ALA A N   1 
ATOM   1259  C CA  . ALA A 1 161  ? -22.205 104.634 50.368  1.00 16.47 ? 161  ALA A CA  1 
ATOM   1260  C C   . ALA A 1 161  ? -22.158 106.153 50.526  1.00 16.74 ? 161  ALA A C   1 
ATOM   1261  O O   . ALA A 1 161  ? -21.444 106.670 51.392  1.00 18.17 ? 161  ALA A O   1 
ATOM   1262  C CB  . ALA A 1 161  ? -21.312 104.206 49.222  1.00 17.39 ? 161  ALA A CB  1 
ATOM   1263  N N   . GLU A 1 162  ? -22.931 106.861 49.702  1.00 15.59 ? 162  GLU A N   1 
ATOM   1264  C CA  . GLU A 1 162  ? -22.959 108.323 49.732  1.00 13.19 ? 162  GLU A CA  1 
ATOM   1265  C C   . GLU A 1 162  ? -23.741 108.950 50.874  1.00 10.81 ? 162  GLU A C   1 
ATOM   1266  O O   . GLU A 1 162  ? -23.538 110.114 51.210  1.00 8.01  ? 162  GLU A O   1 
ATOM   1267  C CB  . GLU A 1 162  ? -23.455 108.860 48.388  1.00 14.41 ? 162  GLU A CB  1 
ATOM   1268  C CG  . GLU A 1 162  ? -22.488 108.558 47.235  1.00 14.59 ? 162  GLU A CG  1 
ATOM   1269  C CD  . GLU A 1 162  ? -21.114 109.172 47.456  1.00 16.69 ? 162  GLU A CD  1 
ATOM   1270  O OE1 . GLU A 1 162  ? -21.011 110.414 47.408  1.00 17.24 ? 162  GLU A OE1 1 
ATOM   1271  O OE2 . GLU A 1 162  ? -20.138 108.424 47.689  1.00 17.22 ? 162  GLU A OE2 1 
ATOM   1272  N N   . ALA A 1 163  ? -24.613 108.178 51.504  1.00 12.40 ? 163  ALA A N   1 
ATOM   1273  C CA  . ALA A 1 163  ? -25.380 108.719 52.620  1.00 13.15 ? 163  ALA A CA  1 
ATOM   1274  C C   . ALA A 1 163  ? -24.427 108.999 53.788  1.00 15.03 ? 163  ALA A C   1 
ATOM   1275  O O   . ALA A 1 163  ? -24.818 109.602 54.790  1.00 16.19 ? 163  ALA A O   1 
ATOM   1276  C CB  . ALA A 1 163  ? -26.457 107.741 53.037  1.00 9.31  ? 163  ALA A CB  1 
ATOM   1277  N N   . GLY A 1 164  ? -23.173 108.569 53.640  1.00 15.08 ? 164  GLY A N   1 
ATOM   1278  C CA  . GLY A 1 164  ? -22.185 108.776 54.674  1.00 14.55 ? 164  GLY A CA  1 
ATOM   1279  C C   . GLY A 1 164  ? -21.546 110.144 54.598  1.00 16.87 ? 164  GLY A C   1 
ATOM   1280  O O   . GLY A 1 164  ? -20.767 110.510 55.472  1.00 17.92 ? 164  GLY A O   1 
ATOM   1281  N N   . GLY A 1 165  ? -21.864 110.902 53.553  1.00 17.60 ? 165  GLY A N   1 
ATOM   1282  C CA  . GLY A 1 165  ? -21.298 112.235 53.407  1.00 16.79 ? 165  GLY A CA  1 
ATOM   1283  C C   . GLY A 1 165  ? -19.817 112.263 53.070  1.00 17.20 ? 165  GLY A C   1 
ATOM   1284  O O   . GLY A 1 165  ? -19.194 111.227 52.834  1.00 17.65 ? 165  GLY A O   1 
ATOM   1285  N N   . SER A 1 166  ? -19.243 113.460 53.042  1.00 17.07 ? 166  SER A N   1 
ATOM   1286  C CA  . SER A 1 166  ? -17.831 113.610 52.733  1.00 16.11 ? 166  SER A CA  1 
ATOM   1287  C C   . SER A 1 166  ? -16.928 112.844 53.688  1.00 15.72 ? 166  SER A C   1 
ATOM   1288  O O   . SER A 1 166  ? -17.224 112.703 54.878  1.00 13.46 ? 166  SER A O   1 
ATOM   1289  C CB  . SER A 1 166  ? -17.448 115.085 52.742  1.00 18.85 ? 166  SER A CB  1 
ATOM   1290  O OG  . SER A 1 166  ? -18.057 115.759 51.646  1.00 27.55 ? 166  SER A OG  1 
ATOM   1291  N N   . LEU A 1 167  ? -15.818 112.355 53.148  1.00 14.57 ? 167  LEU A N   1 
ATOM   1292  C CA  . LEU A 1 167  ? -14.861 111.605 53.929  1.00 13.98 ? 167  LEU A CA  1 
ATOM   1293  C C   . LEU A 1 167  ? -13.637 112.427 54.326  1.00 14.99 ? 167  LEU A C   1 
ATOM   1294  O O   . LEU A 1 167  ? -13.117 113.233 53.539  1.00 14.30 ? 167  LEU A O   1 
ATOM   1295  C CB  . LEU A 1 167  ? -14.444 110.356 53.159  1.00 14.53 ? 167  LEU A CB  1 
ATOM   1296  C CG  . LEU A 1 167  ? -15.174 109.029 53.458  1.00 16.08 ? 167  LEU A CG  1 
ATOM   1297  C CD1 . LEU A 1 167  ? -16.485 109.276 54.168  1.00 13.65 ? 167  LEU A CD1 1 
ATOM   1298  C CD2 . LEU A 1 167  ? -15.371 108.238 52.143  1.00 16.02 ? 167  LEU A CD2 1 
ATOM   1299  N N   . TYR A 1 168  ? -13.197 112.215 55.569  1.00 14.96 ? 168  TYR A N   1 
ATOM   1300  C CA  . TYR A 1 168  ? -12.046 112.911 56.135  1.00 13.39 ? 168  TYR A CA  1 
ATOM   1301  C C   . TYR A 1 168  ? -10.758 112.211 55.758  1.00 12.00 ? 168  TYR A C   1 
ATOM   1302  O O   . TYR A 1 168  ? -10.561 111.067 56.118  1.00 9.80  ? 168  TYR A O   1 
ATOM   1303  C CB  . TYR A 1 168  ? -12.179 112.948 57.664  1.00 15.02 ? 168  TYR A CB  1 
ATOM   1304  C CG  . TYR A 1 168  ? -11.092 113.727 58.383  1.00 13.92 ? 168  TYR A CG  1 
ATOM   1305  C CD1 . TYR A 1 168  ? -10.974 115.109 58.236  1.00 13.57 ? 168  TYR A CD1 1 
ATOM   1306  C CD2 . TYR A 1 168  ? -10.207 113.080 59.242  1.00 14.73 ? 168  TYR A CD2 1 
ATOM   1307  C CE1 . TYR A 1 168  ? -9.998  115.831 58.938  1.00 15.33 ? 168  TYR A CE1 1 
ATOM   1308  C CE2 . TYR A 1 168  ? -9.230  113.786 59.949  1.00 14.46 ? 168  TYR A CE2 1 
ATOM   1309  C CZ  . TYR A 1 168  ? -9.127  115.161 59.797  1.00 16.20 ? 168  TYR A CZ  1 
ATOM   1310  O OH  . TYR A 1 168  ? -8.164  115.849 60.505  1.00 13.58 ? 168  TYR A OH  1 
ATOM   1311  N N   . ASP A 1 169  ? -9.875  112.897 55.041  1.00 13.57 ? 169  ASP A N   1 
ATOM   1312  C CA  . ASP A 1 169  ? -8.610  112.289 54.642  1.00 14.95 ? 169  ASP A CA  1 
ATOM   1313  C C   . ASP A 1 169  ? -7.626  112.307 55.804  1.00 14.59 ? 169  ASP A C   1 
ATOM   1314  O O   . ASP A 1 169  ? -7.225  113.362 56.260  1.00 16.01 ? 169  ASP A O   1 
ATOM   1315  C CB  . ASP A 1 169  ? -8.000  113.024 53.445  1.00 17.37 ? 169  ASP A CB  1 
ATOM   1316  C CG  . ASP A 1 169  ? -6.703  112.382 52.961  1.00 19.26 ? 169  ASP A CG  1 
ATOM   1317  O OD1 . ASP A 1 169  ? -5.724  112.301 53.738  1.00 21.53 ? 169  ASP A OD1 1 
ATOM   1318  O OD2 . ASP A 1 169  ? -6.659  111.951 51.793  1.00 24.43 ? 169  ASP A OD2 1 
ATOM   1319  N N   . PRO A 1 170  ? -7.200  111.129 56.271  1.00 16.05 ? 170  PRO A N   1 
ATOM   1320  C CA  . PRO A 1 170  ? -6.260  111.019 57.391  1.00 17.74 ? 170  PRO A CA  1 
ATOM   1321  C C   . PRO A 1 170  ? -4.924  111.736 57.174  1.00 18.67 ? 170  PRO A C   1 
ATOM   1322  O O   . PRO A 1 170  ? -4.333  112.245 58.116  1.00 21.21 ? 170  PRO A O   1 
ATOM   1323  C CB  . PRO A 1 170  ? -6.066  109.508 57.547  1.00 17.72 ? 170  PRO A CB  1 
ATOM   1324  C CG  . PRO A 1 170  ? -7.204  108.901 56.748  1.00 18.48 ? 170  PRO A CG  1 
ATOM   1325  C CD  . PRO A 1 170  ? -7.384  109.822 55.615  1.00 15.03 ? 170  PRO A CD  1 
ATOM   1326  N N   . VAL A 1 171  ? -4.442  111.772 55.940  1.00 18.76 ? 171  VAL A N   1 
ATOM   1327  C CA  . VAL A 1 171  ? -3.171  112.430 55.663  1.00 19.39 ? 171  VAL A CA  1 
ATOM   1328  C C   . VAL A 1 171  ? -3.307  113.938 55.441  1.00 18.64 ? 171  VAL A C   1 
ATOM   1329  O O   . VAL A 1 171  ? -2.539  114.720 55.989  1.00 17.98 ? 171  VAL A O   1 
ATOM   1330  C CB  . VAL A 1 171  ? -2.483  111.797 54.425  1.00 20.31 ? 171  VAL A CB  1 
ATOM   1331  C CG1 . VAL A 1 171  ? -1.212  112.565 54.074  1.00 19.66 ? 171  VAL A CG1 1 
ATOM   1332  C CG2 . VAL A 1 171  ? -2.155  110.334 54.709  1.00 19.11 ? 171  VAL A CG2 1 
ATOM   1333  N N   . LEU A 1 172  ? -4.280  114.334 54.628  1.00 18.71 ? 172  LEU A N   1 
ATOM   1334  C CA  . LEU A 1 172  ? -4.516  115.743 54.329  1.00 19.15 ? 172  LEU A CA  1 
ATOM   1335  C C   . LEU A 1 172  ? -5.185  116.458 55.497  1.00 19.68 ? 172  LEU A C   1 
ATOM   1336  O O   . LEU A 1 172  ? -5.156  117.689 55.599  1.00 20.26 ? 172  LEU A O   1 
ATOM   1337  C CB  . LEU A 1 172  ? -5.401  115.877 53.083  1.00 18.07 ? 172  LEU A CB  1 
ATOM   1338  C CG  . LEU A 1 172  ? -4.828  115.271 51.801  1.00 19.14 ? 172  LEU A CG  1 
ATOM   1339  C CD1 . LEU A 1 172  ? -5.829  115.463 50.657  1.00 16.64 ? 172  LEU A CD1 1 
ATOM   1340  C CD2 . LEU A 1 172  ? -3.482  115.921 51.481  1.00 14.63 ? 172  LEU A CD2 1 
ATOM   1341  N N   . GLN A 1 173  ? -5.809  115.670 56.360  1.00 18.10 ? 173  GLN A N   1 
ATOM   1342  C CA  . GLN A 1 173  ? -6.497  116.192 57.518  1.00 18.58 ? 173  GLN A CA  1 
ATOM   1343  C C   . GLN A 1 173  ? -7.617  117.178 57.203  1.00 17.35 ? 173  GLN A C   1 
ATOM   1344  O O   . GLN A 1 173  ? -7.745  118.212 57.835  1.00 16.70 ? 173  GLN A O   1 
ATOM   1345  C CB  . GLN A 1 173  ? -5.485  116.794 58.489  1.00 19.56 ? 173  GLN A CB  1 
ATOM   1346  C CG  . GLN A 1 173  ? -4.709  115.706 59.215  1.00 21.83 ? 173  GLN A CG  1 
ATOM   1347  C CD  . GLN A 1 173  ? -3.784  116.235 60.299  1.00 23.61 ? 173  GLN A CD  1 
ATOM   1348  O OE1 . GLN A 1 173  ? -2.707  116.772 60.012  1.00 23.98 ? 173  GLN A OE1 1 
ATOM   1349  N NE2 . GLN A 1 173  ? -4.200  116.080 61.554  1.00 21.49 ? 173  GLN A NE2 1 
ATOM   1350  N N   . LYS A 1 174  ? -8.431  116.828 56.217  1.00 16.54 ? 174  LYS A N   1 
ATOM   1351  C CA  . LYS A 1 174  ? -9.585  117.626 55.827  1.00 17.58 ? 174  LYS A CA  1 
ATOM   1352  C C   . LYS A 1 174  ? -10.609 116.771 55.065  1.00 17.01 ? 174  LYS A C   1 
ATOM   1353  O O   . LYS A 1 174  ? -10.286 115.719 54.514  1.00 17.69 ? 174  LYS A O   1 
ATOM   1354  C CB  . LYS A 1 174  ? -9.164  118.828 54.978  1.00 17.76 ? 174  LYS A CB  1 
ATOM   1355  C CG  . LYS A 1 174  ? -8.137  118.528 53.914  1.00 19.01 ? 174  LYS A CG  1 
ATOM   1356  C CD  . LYS A 1 174  ? -8.411  119.352 52.658  1.00 23.12 ? 174  LYS A CD  1 
ATOM   1357  C CE  . LYS A 1 174  ? -8.516  120.840 52.944  1.00 25.13 ? 174  LYS A CE  1 
ATOM   1358  N NZ  . LYS A 1 174  ? -8.947  121.615 51.737  1.00 27.57 ? 174  LYS A NZ  1 
ATOM   1359  N N   . TYR A 1 175  ? -11.851 117.219 55.051  1.00 16.66 ? 175  TYR A N   1 
ATOM   1360  C CA  . TYR A 1 175  ? -12.899 116.489 54.356  1.00 18.00 ? 175  TYR A CA  1 
ATOM   1361  C C   . TYR A 1 175  ? -12.775 116.785 52.871  1.00 17.91 ? 175  TYR A C   1 
ATOM   1362  O O   . TYR A 1 175  ? -12.289 117.850 52.493  1.00 17.97 ? 175  TYR A O   1 
ATOM   1363  C CB  . TYR A 1 175  ? -14.267 116.931 54.875  1.00 16.58 ? 175  TYR A CB  1 
ATOM   1364  C CG  . TYR A 1 175  ? -14.600 116.384 56.245  1.00 18.03 ? 175  TYR A CG  1 
ATOM   1365  C CD1 . TYR A 1 175  ? -15.211 115.130 56.386  1.00 18.45 ? 175  TYR A CD1 1 
ATOM   1366  C CD2 . TYR A 1 175  ? -14.304 117.114 57.403  1.00 16.24 ? 175  TYR A CD2 1 
ATOM   1367  C CE1 . TYR A 1 175  ? -15.520 114.622 57.642  1.00 19.89 ? 175  TYR A CE1 1 
ATOM   1368  C CE2 . TYR A 1 175  ? -14.603 116.614 58.663  1.00 17.49 ? 175  TYR A CE2 1 
ATOM   1369  C CZ  . TYR A 1 175  ? -15.209 115.369 58.780  1.00 19.88 ? 175  TYR A CZ  1 
ATOM   1370  O OH  . TYR A 1 175  ? -15.482 114.850 60.025  1.00 19.68 ? 175  TYR A OH  1 
ATOM   1371  N N   . ASP A 1 176  ? -13.187 115.843 52.025  1.00 18.59 ? 176  ASP A N   1 
ATOM   1372  C CA  . ASP A 1 176  ? -13.100 116.078 50.591  1.00 18.35 ? 176  ASP A CA  1 
ATOM   1373  C C   . ASP A 1 176  ? -14.211 117.064 50.237  1.00 18.81 ? 176  ASP A C   1 
ATOM   1374  O O   . ASP A 1 176  ? -15.145 117.249 51.011  1.00 17.48 ? 176  ASP A O   1 
ATOM   1375  C CB  . ASP A 1 176  ? -13.258 114.769 49.817  1.00 18.15 ? 176  ASP A CB  1 
ATOM   1376  C CG  . ASP A 1 176  ? -14.652 114.185 49.924  1.00 20.19 ? 176  ASP A CG  1 
ATOM   1377  O OD1 . ASP A 1 176  ? -15.619 114.851 49.491  1.00 18.92 ? 176  ASP A OD1 1 
ATOM   1378  O OD2 . ASP A 1 176  ? -14.779 113.053 50.434  1.00 21.51 ? 176  ASP A OD2 1 
ATOM   1379  N N   . GLU A 1 177  ? -14.108 117.713 49.085  1.00 19.85 ? 177  GLU A N   1 
ATOM   1380  C CA  . GLU A 1 177  ? -15.136 118.666 48.698  1.00 22.56 ? 177  GLU A CA  1 
ATOM   1381  C C   . GLU A 1 177  ? -15.935 118.168 47.497  1.00 22.31 ? 177  GLU A C   1 
ATOM   1382  O O   . GLU A 1 177  ? -16.517 118.955 46.743  1.00 21.77 ? 177  GLU A O   1 
ATOM   1383  C CB  . GLU A 1 177  ? -14.498 120.020 48.406  1.00 25.24 ? 177  GLU A CB  1 
ATOM   1384  C CG  . GLU A 1 177  ? -13.462 120.410 49.449  1.00 32.89 ? 177  GLU A CG  1 
ATOM   1385  C CD  . GLU A 1 177  ? -12.990 121.843 49.304  1.00 37.68 ? 177  GLU A CD  1 
ATOM   1386  O OE1 . GLU A 1 177  ? -12.810 122.292 48.147  1.00 39.60 ? 177  GLU A OE1 1 
ATOM   1387  O OE2 . GLU A 1 177  ? -12.792 122.514 50.348  1.00 41.06 ? 177  GLU A OE2 1 
ATOM   1388  N N   . ILE A 1 178  ? -15.956 116.848 47.332  1.00 21.19 ? 178  ILE A N   1 
ATOM   1389  C CA  . ILE A 1 178  ? -16.699 116.223 46.252  1.00 20.44 ? 178  ILE A CA  1 
ATOM   1390  C C   . ILE A 1 178  ? -18.192 116.417 46.501  1.00 18.37 ? 178  ILE A C   1 
ATOM   1391  O O   . ILE A 1 178  ? -18.711 116.023 47.531  1.00 18.50 ? 178  ILE A O   1 
ATOM   1392  C CB  . ILE A 1 178  ? -16.357 114.734 46.166  1.00 20.79 ? 178  ILE A CB  1 
ATOM   1393  C CG1 . ILE A 1 178  ? -14.935 114.586 45.622  1.00 20.64 ? 178  ILE A CG1 1 
ATOM   1394  C CG2 . ILE A 1 178  ? -17.345 114.011 45.257  1.00 21.56 ? 178  ILE A CG2 1 
ATOM   1395  C CD1 . ILE A 1 178  ? -14.366 113.206 45.801  1.00 20.55 ? 178  ILE A CD1 1 
ATOM   1396  N N   . PRO A 1 179  ? -18.896 117.044 45.549  1.00 17.24 ? 179  PRO A N   1 
ATOM   1397  C CA  . PRO A 1 179  ? -20.340 117.311 45.646  1.00 16.92 ? 179  PRO A CA  1 
ATOM   1398  C C   . PRO A 1 179  ? -21.222 116.109 46.002  1.00 15.94 ? 179  PRO A C   1 
ATOM   1399  O O   . PRO A 1 179  ? -20.964 114.983 45.575  1.00 17.26 ? 179  PRO A O   1 
ATOM   1400  C CB  . PRO A 1 179  ? -20.664 117.896 44.274  1.00 16.37 ? 179  PRO A CB  1 
ATOM   1401  C CG  . PRO A 1 179  ? -19.387 118.635 43.930  1.00 15.58 ? 179  PRO A CG  1 
ATOM   1402  C CD  . PRO A 1 179  ? -18.332 117.626 44.319  1.00 15.69 ? 179  PRO A CD  1 
ATOM   1403  N N   . ASP A 1 180  ? -22.265 116.342 46.786  1.00 15.09 ? 180  ASP A N   1 
ATOM   1404  C CA  . ASP A 1 180  ? -23.139 115.238 47.151  1.00 17.79 ? 180  ASP A CA  1 
ATOM   1405  C C   . ASP A 1 180  ? -24.101 114.893 46.006  1.00 17.22 ? 180  ASP A C   1 
ATOM   1406  O O   . ASP A 1 180  ? -24.175 115.607 44.996  1.00 17.10 ? 180  ASP A O   1 
ATOM   1407  C CB  . ASP A 1 180  ? -23.890 115.535 48.468  1.00 19.95 ? 180  ASP A CB  1 
ATOM   1408  C CG  . ASP A 1 180  ? -24.936 116.627 48.335  1.00 24.30 ? 180  ASP A CG  1 
ATOM   1409  O OD1 . ASP A 1 180  ? -25.256 117.261 49.367  1.00 25.80 ? 180  ASP A OD1 1 
ATOM   1410  O OD2 . ASP A 1 180  ? -25.449 116.841 47.216  1.00 25.75 ? 180  ASP A OD2 1 
ATOM   1411  N N   . LEU A 1 181  ? -24.828 113.793 46.168  1.00 15.40 ? 181  LEU A N   1 
ATOM   1412  C CA  . LEU A 1 181  ? -25.736 113.314 45.136  1.00 14.04 ? 181  LEU A CA  1 
ATOM   1413  C C   . LEU A 1 181  ? -26.763 114.289 44.590  1.00 14.32 ? 181  LEU A C   1 
ATOM   1414  O O   . LEU A 1 181  ? -27.250 114.101 43.468  1.00 15.23 ? 181  LEU A O   1 
ATOM   1415  C CB  . LEU A 1 181  ? -26.436 112.033 45.600  1.00 11.82 ? 181  LEU A CB  1 
ATOM   1416  C CG  . LEU A 1 181  ? -25.537 110.795 45.676  1.00 11.68 ? 181  LEU A CG  1 
ATOM   1417  C CD1 . LEU A 1 181  ? -26.396 109.565 45.958  1.00 8.37  ? 181  LEU A CD1 1 
ATOM   1418  C CD2 . LEU A 1 181  ? -24.755 110.632 44.361  1.00 6.58  ? 181  LEU A CD2 1 
ATOM   1419  N N   . SER A 1 182  ? -27.080 115.334 45.348  1.00 13.09 ? 182  SER A N   1 
ATOM   1420  C CA  . SER A 1 182  ? -28.059 116.312 44.878  1.00 14.23 ? 182  SER A CA  1 
ATOM   1421  C C   . SER A 1 182  ? -27.521 117.094 43.680  1.00 14.68 ? 182  SER A C   1 
ATOM   1422  O O   . SER A 1 182  ? -28.254 117.840 43.046  1.00 15.85 ? 182  SER A O   1 
ATOM   1423  C CB  . SER A 1 182  ? -28.444 117.284 46.004  1.00 12.28 ? 182  SER A CB  1 
ATOM   1424  O OG  . SER A 1 182  ? -27.618 118.432 45.998  1.00 16.96 ? 182  SER A OG  1 
ATOM   1425  N N   . HIS A 1 183  ? -26.241 116.897 43.368  1.00 15.94 ? 183  HIS A N   1 
ATOM   1426  C CA  . HIS A 1 183  ? -25.571 117.575 42.260  1.00 16.15 ? 183  HIS A CA  1 
ATOM   1427  C C   . HIS A 1 183  ? -25.124 116.587 41.187  1.00 16.31 ? 183  HIS A C   1 
ATOM   1428  O O   . HIS A 1 183  ? -24.369 116.947 40.281  1.00 15.39 ? 183  HIS A O   1 
ATOM   1429  C CB  . HIS A 1 183  ? -24.329 118.308 42.769  1.00 18.15 ? 183  HIS A CB  1 
ATOM   1430  C CG  . HIS A 1 183  ? -24.620 119.388 43.762  1.00 19.79 ? 183  HIS A CG  1 
ATOM   1431  N ND1 . HIS A 1 183  ? -25.120 120.619 43.398  1.00 19.81 ? 183  HIS A ND1 1 
ATOM   1432  C CD2 . HIS A 1 183  ? -24.472 119.424 45.106  1.00 19.35 ? 183  HIS A CD2 1 
ATOM   1433  C CE1 . HIS A 1 183  ? -25.266 121.368 44.475  1.00 19.13 ? 183  HIS A CE1 1 
ATOM   1434  N NE2 . HIS A 1 183  ? -24.881 120.667 45.524  1.00 20.44 ? 183  HIS A NE2 1 
ATOM   1435  N N   . ASN A 1 184  ? -25.582 115.345 41.293  1.00 16.02 ? 184  ASN A N   1 
ATOM   1436  C CA  . ASN A 1 184  ? -25.192 114.296 40.351  1.00 15.49 ? 184  ASN A CA  1 
ATOM   1437  C C   . ASN A 1 184  ? -26.178 114.240 39.168  1.00 16.64 ? 184  ASN A C   1 
ATOM   1438  O O   . ASN A 1 184  ? -27.258 113.642 39.269  1.00 14.68 ? 184  ASN A O   1 
ATOM   1439  C CB  . ASN A 1 184  ? -25.145 112.965 41.118  1.00 15.26 ? 184  ASN A CB  1 
ATOM   1440  C CG  . ASN A 1 184  ? -24.434 111.854 40.362  1.00 15.58 ? 184  ASN A CG  1 
ATOM   1441  O OD1 . ASN A 1 184  ? -24.873 111.429 39.294  1.00 19.03 ? 184  ASN A OD1 1 
ATOM   1442  N ND2 . ASN A 1 184  ? -23.336 111.364 40.929  1.00 14.01 ? 184  ASN A ND2 1 
ATOM   1443  N N   . CYS A 1 185  ? -25.805 114.884 38.059  1.00 16.55 ? 185  CYS A N   1 
ATOM   1444  C CA  . CYS A 1 185  ? -26.645 114.924 36.862  1.00 17.13 ? 185  CYS A CA  1 
ATOM   1445  C C   . CYS A 1 185  ? -26.910 113.525 36.295  1.00 18.39 ? 185  CYS A C   1 
ATOM   1446  O O   . CYS A 1 185  ? -28.036 113.214 35.884  1.00 18.43 ? 185  CYS A O   1 
ATOM   1447  C CB  . CYS A 1 185  ? -26.004 115.819 35.804  1.00 20.10 ? 185  CYS A CB  1 
ATOM   1448  S SG  . CYS A 1 185  ? -26.884 115.839 34.237  1.00 24.47 ? 185  CYS A SG  1 
ATOM   1449  N N   . PRO A 1 186  ? -25.882 112.657 36.247  1.00 18.20 ? 186  PRO A N   1 
ATOM   1450  C CA  . PRO A 1 186  ? -26.219 111.335 35.711  1.00 17.81 ? 186  PRO A CA  1 
ATOM   1451  C C   . PRO A 1 186  ? -27.389 110.708 36.501  1.00 15.39 ? 186  PRO A C   1 
ATOM   1452  O O   . PRO A 1 186  ? -28.355 110.236 35.899  1.00 16.75 ? 186  PRO A O   1 
ATOM   1453  C CB  . PRO A 1 186  ? -24.913 110.555 35.870  1.00 17.79 ? 186  PRO A CB  1 
ATOM   1454  C CG  . PRO A 1 186  ? -23.872 111.611 35.690  1.00 16.67 ? 186  PRO A CG  1 
ATOM   1455  C CD  . PRO A 1 186  ? -24.435 112.767 36.503  1.00 16.66 ? 186  PRO A CD  1 
ATOM   1456  N N   . LEU A 1 187  ? -27.315 110.729 37.834  1.00 13.94 ? 187  LEU A N   1 
ATOM   1457  C CA  . LEU A 1 187  ? -28.378 110.151 38.680  1.00 14.77 ? 187  LEU A CA  1 
ATOM   1458  C C   . LEU A 1 187  ? -29.744 110.813 38.489  1.00 14.43 ? 187  LEU A C   1 
ATOM   1459  O O   . LEU A 1 187  ? -30.777 110.137 38.473  1.00 13.24 ? 187  LEU A O   1 
ATOM   1460  C CB  . LEU A 1 187  ? -28.017 110.231 40.170  1.00 14.24 ? 187  LEU A CB  1 
ATOM   1461  C CG  . LEU A 1 187  ? -28.160 108.953 41.017  1.00 15.39 ? 187  LEU A CG  1 
ATOM   1462  C CD1 . LEU A 1 187  ? -28.716 109.308 42.379  1.00 12.65 ? 187  LEU A CD1 1 
ATOM   1463  C CD2 . LEU A 1 187  ? -29.053 107.940 40.331  1.00 12.24 ? 187  LEU A CD2 1 
ATOM   1464  N N   . TRP A 1 188  ? -29.742 112.138 38.367  1.00 15.40 ? 188  TRP A N   1 
ATOM   1465  C CA  . TRP A 1 188  ? -30.971 112.889 38.169  1.00 15.87 ? 188  TRP A CA  1 
ATOM   1466  C C   . TRP A 1 188  ? -31.622 112.405 36.871  1.00 18.39 ? 188  TRP A C   1 
ATOM   1467  O O   . TRP A 1 188  ? -32.832 112.153 36.839  1.00 17.65 ? 188  TRP A O   1 
ATOM   1468  C CB  . TRP A 1 188  ? -30.690 114.397 38.079  1.00 13.91 ? 188  TRP A CB  1 
ATOM   1469  C CG  . TRP A 1 188  ? -31.940 115.171 37.816  1.00 14.45 ? 188  TRP A CG  1 
ATOM   1470  C CD1 . TRP A 1 188  ? -32.921 115.464 38.708  1.00 13.38 ? 188  TRP A CD1 1 
ATOM   1471  C CD2 . TRP A 1 188  ? -32.407 115.633 36.543  1.00 14.43 ? 188  TRP A CD2 1 
ATOM   1472  N NE1 . TRP A 1 188  ? -33.974 116.069 38.077  1.00 13.68 ? 188  TRP A NE1 1 
ATOM   1473  C CE2 . TRP A 1 188  ? -33.686 116.185 36.746  1.00 14.35 ? 188  TRP A CE2 1 
ATOM   1474  C CE3 . TRP A 1 188  ? -31.869 115.624 35.253  1.00 14.26 ? 188  TRP A CE3 1 
ATOM   1475  C CZ2 . TRP A 1 188  ? -34.443 116.729 35.706  1.00 14.84 ? 188  TRP A CZ2 1 
ATOM   1476  C CZ3 . TRP A 1 188  ? -32.620 116.159 34.214  1.00 18.74 ? 188  TRP A CZ3 1 
ATOM   1477  C CH2 . TRP A 1 188  ? -33.899 116.704 34.449  1.00 16.30 ? 188  TRP A CH2 1 
ATOM   1478  N N   . CYS A 1 189  ? -30.820 112.280 35.805  1.00 19.09 ? 189  CYS A N   1 
ATOM   1479  C CA  . CYS A 1 189  ? -31.326 111.803 34.515  1.00 21.14 ? 189  CYS A CA  1 
ATOM   1480  C C   . CYS A 1 189  ? -31.915 110.410 34.647  1.00 20.10 ? 189  CYS A C   1 
ATOM   1481  O O   . CYS A 1 189  ? -33.005 110.129 34.130  1.00 19.13 ? 189  CYS A O   1 
ATOM   1482  C CB  . CYS A 1 189  ? -30.219 111.753 33.466  1.00 23.80 ? 189  CYS A CB  1 
ATOM   1483  S SG  . CYS A 1 189  ? -29.831 113.330 32.744  1.00 31.79 ? 189  CYS A SG  1 
ATOM   1484  N N   . PHE A 1 190  ? -31.179 109.534 35.321  1.00 18.62 ? 190  PHE A N   1 
ATOM   1485  C CA  . PHE A 1 190  ? -31.644 108.168 35.525  1.00 17.69 ? 190  PHE A CA  1 
ATOM   1486  C C   . PHE A 1 190  ? -33.052 108.224 36.152  1.00 18.71 ? 190  PHE A C   1 
ATOM   1487  O O   . PHE A 1 190  ? -33.980 107.547 35.698  1.00 18.96 ? 190  PHE A O   1 
ATOM   1488  C CB  . PHE A 1 190  ? -30.673 107.438 36.455  1.00 16.01 ? 190  PHE A CB  1 
ATOM   1489  C CG  . PHE A 1 190  ? -31.007 105.994 36.680  1.00 13.92 ? 190  PHE A CG  1 
ATOM   1490  C CD1 . PHE A 1 190  ? -30.589 105.028 35.786  1.00 13.55 ? 190  PHE A CD1 1 
ATOM   1491  C CD2 . PHE A 1 190  ? -31.753 105.608 37.788  1.00 15.13 ? 190  PHE A CD2 1 
ATOM   1492  C CE1 . PHE A 1 190  ? -30.904 103.700 35.986  1.00 15.68 ? 190  PHE A CE1 1 
ATOM   1493  C CE2 . PHE A 1 190  ? -32.080 104.284 38.001  1.00 16.72 ? 190  PHE A CE2 1 
ATOM   1494  C CZ  . PHE A 1 190  ? -31.657 103.323 37.102  1.00 16.61 ? 190  PHE A CZ  1 
ATOM   1495  N N   . ARG A 1 191  ? -33.218 109.046 37.184  1.00 17.27 ? 191  ARG A N   1 
ATOM   1496  C CA  . ARG A 1 191  ? -34.515 109.138 37.822  1.00 17.97 ? 191  ARG A CA  1 
ATOM   1497  C C   . ARG A 1 191  ? -35.593 109.665 36.874  1.00 19.60 ? 191  ARG A C   1 
ATOM   1498  O O   . ARG A 1 191  ? -36.658 109.055 36.759  1.00 20.84 ? 191  ARG A O   1 
ATOM   1499  C CB  . ARG A 1 191  ? -34.449 110.018 39.072  1.00 17.15 ? 191  ARG A CB  1 
ATOM   1500  C CG  . ARG A 1 191  ? -35.658 109.854 39.979  1.00 15.07 ? 191  ARG A CG  1 
ATOM   1501  C CD  . ARG A 1 191  ? -35.628 110.821 41.128  1.00 15.30 ? 191  ARG A CD  1 
ATOM   1502  N NE  . ARG A 1 191  ? -35.799 112.196 40.676  1.00 20.59 ? 191  ARG A NE  1 
ATOM   1503  C CZ  . ARG A 1 191  ? -35.821 113.253 41.487  1.00 20.32 ? 191  ARG A CZ  1 
ATOM   1504  N NH1 . ARG A 1 191  ? -35.676 113.082 42.796  1.00 19.48 ? 191  ARG A NH1 1 
ATOM   1505  N NH2 . ARG A 1 191  ? -36.009 114.473 40.991  1.00 17.33 ? 191  ARG A NH2 1 
ATOM   1506  N N   . GLU A 1 192  ? -35.324 110.778 36.185  1.00 20.65 ? 192  GLU A N   1 
ATOM   1507  C CA  . GLU A 1 192  ? -36.312 111.363 35.271  1.00 20.69 ? 192  GLU A CA  1 
ATOM   1508  C C   . GLU A 1 192  ? -36.674 110.473 34.099  1.00 19.85 ? 192  GLU A C   1 
ATOM   1509  O O   . GLU A 1 192  ? -37.855 110.320 33.782  1.00 19.04 ? 192  GLU A O   1 
ATOM   1510  C CB  . GLU A 1 192  ? -35.838 112.708 34.731  1.00 20.90 ? 192  GLU A CB  1 
ATOM   1511  C CG  . GLU A 1 192  ? -35.683 113.768 35.797  1.00 29.16 ? 192  GLU A CG  1 
ATOM   1512  C CD  . GLU A 1 192  ? -37.012 114.223 36.397  1.00 33.29 ? 192  GLU A CD  1 
ATOM   1513  O OE1 . GLU A 1 192  ? -37.864 114.765 35.645  1.00 34.55 ? 192  GLU A OE1 1 
ATOM   1514  O OE2 . GLU A 1 192  ? -37.195 114.038 37.622  1.00 34.46 ? 192  GLU A OE2 1 
ATOM   1515  N N   . ILE A 1 193  ? -35.661 109.889 33.458  1.00 18.34 ? 193  ILE A N   1 
ATOM   1516  C CA  . ILE A 1 193  ? -35.883 109.029 32.308  1.00 14.27 ? 193  ILE A CA  1 
ATOM   1517  C C   . ILE A 1 193  ? -36.865 107.943 32.715  1.00 14.77 ? 193  ILE A C   1 
ATOM   1518  O O   . ILE A 1 193  ? -37.936 107.794 32.118  1.00 14.60 ? 193  ILE A O   1 
ATOM   1519  C CB  . ILE A 1 193  ? -34.562 108.367 31.837  1.00 14.63 ? 193  ILE A CB  1 
ATOM   1520  C CG1 . ILE A 1 193  ? -33.536 109.440 31.461  1.00 11.35 ? 193  ILE A CG1 1 
ATOM   1521  C CG2 . ILE A 1 193  ? -34.831 107.405 30.656  1.00 11.32 ? 193  ILE A CG2 1 
ATOM   1522  C CD1 . ILE A 1 193  ? -33.798 110.113 30.179  1.00 12.10 ? 193  ILE A CD1 1 
ATOM   1523  N N   . CYS A 1 194  ? -36.496 107.193 33.748  1.00 14.30 ? 194  CYS A N   1 
ATOM   1524  C CA  . CYS A 1 194  ? -37.318 106.098 34.248  1.00 13.81 ? 194  CYS A CA  1 
ATOM   1525  C C   . CYS A 1 194  ? -38.696 106.544 34.719  1.00 13.97 ? 194  CYS A C   1 
ATOM   1526  O O   . CYS A 1 194  ? -39.695 105.898 34.406  1.00 16.90 ? 194  CYS A O   1 
ATOM   1527  C CB  . CYS A 1 194  ? -36.579 105.369 35.368  1.00 13.34 ? 194  CYS A CB  1 
ATOM   1528  S SG  . CYS A 1 194  ? -35.038 104.582 34.807  1.00 17.26 ? 194  CYS A SG  1 
ATOM   1529  N N   . ARG A 1 195  ? -38.763 107.647 35.452  1.00 12.22 ? 195  ARG A N   1 
ATOM   1530  C CA  . ARG A 1 195  ? -40.039 108.140 35.930  1.00 12.84 ? 195  ARG A CA  1 
ATOM   1531  C C   . ARG A 1 195  ? -40.937 108.461 34.723  1.00 13.41 ? 195  ARG A C   1 
ATOM   1532  O O   . ARG A 1 195  ? -42.110 108.081 34.686  1.00 13.63 ? 195  ARG A O   1 
ATOM   1533  C CB  . ARG A 1 195  ? -39.825 109.388 36.808  1.00 15.13 ? 195  ARG A CB  1 
ATOM   1534  C CG  . ARG A 1 195  ? -41.098 109.982 37.424  1.00 18.84 ? 195  ARG A CG  1 
ATOM   1535  C CD  . ARG A 1 195  ? -40.826 111.304 38.159  1.00 23.80 ? 195  ARG A CD  1 
ATOM   1536  N NE  . ARG A 1 195  ? -40.078 111.130 39.412  1.00 30.19 ? 195  ARG A NE  1 
ATOM   1537  C CZ  . ARG A 1 195  ? -39.628 112.133 40.169  1.00 30.15 ? 195  ARG A CZ  1 
ATOM   1538  N NH1 . ARG A 1 195  ? -39.840 113.391 39.805  1.00 30.85 ? 195  ARG A NH1 1 
ATOM   1539  N NH2 . ARG A 1 195  ? -38.981 111.884 41.300  1.00 29.60 ? 195  ARG A NH2 1 
ATOM   1540  N N   . HIS A 1 196  ? -40.383 109.139 33.727  1.00 11.60 ? 196  HIS A N   1 
ATOM   1541  C CA  . HIS A 1 196  ? -41.172 109.489 32.562  1.00 13.69 ? 196  HIS A CA  1 
ATOM   1542  C C   . HIS A 1 196  ? -41.693 108.226 31.889  1.00 15.27 ? 196  HIS A C   1 
ATOM   1543  O O   . HIS A 1 196  ? -42.811 108.196 31.376  1.00 15.52 ? 196  HIS A O   1 
ATOM   1544  C CB  . HIS A 1 196  ? -40.344 110.292 31.552  1.00 14.31 ? 196  HIS A CB  1 
ATOM   1545  C CG  . HIS A 1 196  ? -41.125 110.731 30.349  1.00 16.68 ? 196  HIS A CG  1 
ATOM   1546  N ND1 . HIS A 1 196  ? -42.017 111.782 30.380  1.00 17.13 ? 196  HIS A ND1 1 
ATOM   1547  C CD2 . HIS A 1 196  ? -41.207 110.213 29.102  1.00 17.87 ? 196  HIS A CD2 1 
ATOM   1548  C CE1 . HIS A 1 196  ? -42.615 111.890 29.210  1.00 14.19 ? 196  HIS A CE1 1 
ATOM   1549  N NE2 . HIS A 1 196  ? -42.142 110.949 28.415  1.00 18.29 ? 196  HIS A NE2 1 
ATOM   1550  N N   . ILE A 1 197  ? -40.883 107.176 31.900  1.00 15.50 ? 197  ILE A N   1 
ATOM   1551  C CA  . ILE A 1 197  ? -41.282 105.940 31.259  1.00 14.70 ? 197  ILE A CA  1 
ATOM   1552  C C   . ILE A 1 197  ? -42.302 105.168 32.055  1.00 14.83 ? 197  ILE A C   1 
ATOM   1553  O O   . ILE A 1 197  ? -43.202 104.569 31.484  1.00 16.14 ? 197  ILE A O   1 
ATOM   1554  C CB  . ILE A 1 197  ? -40.077 105.020 31.002  1.00 14.09 ? 197  ILE A CB  1 
ATOM   1555  C CG1 . ILE A 1 197  ? -39.109 105.694 30.029  1.00 13.61 ? 197  ILE A CG1 1 
ATOM   1556  C CG2 . ILE A 1 197  ? -40.559 103.683 30.448  1.00 13.30 ? 197  ILE A CG2 1 
ATOM   1557  C CD1 . ILE A 1 197  ? -37.890 104.848 29.699  1.00 16.06 ? 197  ILE A CD1 1 
ATOM   1558  N N   . SER A 1 198  ? -42.174 105.163 33.371  1.00 14.82 ? 198  SER A N   1 
ATOM   1559  C CA  . SER A 1 198  ? -43.134 104.404 34.166  1.00 17.70 ? 198  SER A CA  1 
ATOM   1560  C C   . SER A 1 198  ? -44.487 105.108 34.268  1.00 17.13 ? 198  SER A C   1 
ATOM   1561  O O   . SER A 1 198  ? -45.525 104.450 34.354  1.00 15.78 ? 198  SER A O   1 
ATOM   1562  C CB  . SER A 1 198  ? -42.568 104.110 35.571  1.00 16.88 ? 198  SER A CB  1 
ATOM   1563  O OG  . SER A 1 198  ? -42.095 105.286 36.202  1.00 19.46 ? 198  SER A OG  1 
ATOM   1564  N N   . GLY A 1 199  ? -44.464 106.440 34.253  1.00 17.59 ? 199  GLY A N   1 
ATOM   1565  C CA  . GLY A 1 199  ? -45.691 107.212 34.355  1.00 18.38 ? 199  GLY A CA  1 
ATOM   1566  C C   . GLY A 1 199  ? -46.518 106.827 35.570  1.00 19.26 ? 199  GLY A C   1 
ATOM   1567  O O   . GLY A 1 199  ? -46.023 106.876 36.698  1.00 20.82 ? 199  GLY A O   1 
ATOM   1568  N N   . PRO A 1 200  ? -47.777 106.416 35.376  1.00 18.72 ? 200  PRO A N   1 
ATOM   1569  C CA  . PRO A 1 200  ? -48.633 106.031 36.499  1.00 19.09 ? 200  PRO A CA  1 
ATOM   1570  C C   . PRO A 1 200  ? -48.362 104.619 37.014  1.00 19.21 ? 200  PRO A C   1 
ATOM   1571  O O   . PRO A 1 200  ? -48.780 104.266 38.112  1.00 19.08 ? 200  PRO A O   1 
ATOM   1572  C CB  . PRO A 1 200  ? -50.030 106.160 35.912  1.00 19.26 ? 200  PRO A CB  1 
ATOM   1573  C CG  . PRO A 1 200  ? -49.814 105.644 34.509  1.00 20.20 ? 200  PRO A CG  1 
ATOM   1574  C CD  . PRO A 1 200  ? -48.510 106.321 34.099  1.00 19.45 ? 200  PRO A CD  1 
ATOM   1575  N N   . LEU A 1 201  ? -47.668 103.811 36.224  1.00 18.81 ? 201  LEU A N   1 
ATOM   1576  C CA  . LEU A 1 201  ? -47.392 102.445 36.635  1.00 20.83 ? 201  LEU A CA  1 
ATOM   1577  C C   . LEU A 1 201  ? -46.637 102.383 37.960  1.00 21.33 ? 201  LEU A C   1 
ATOM   1578  O O   . LEU A 1 201  ? -45.721 103.162 38.192  1.00 21.62 ? 201  LEU A O   1 
ATOM   1579  C CB  . LEU A 1 201  ? -46.599 101.720 35.546  1.00 21.52 ? 201  LEU A CB  1 
ATOM   1580  C CG  . LEU A 1 201  ? -47.325 101.635 34.198  1.00 22.34 ? 201  LEU A CG  1 
ATOM   1581  C CD1 . LEU A 1 201  ? -46.381 101.092 33.148  1.00 20.67 ? 201  LEU A CD1 1 
ATOM   1582  C CD2 . LEU A 1 201  ? -48.571 100.769 34.326  1.00 20.32 ? 201  LEU A CD2 1 
ATOM   1583  N N   . PRO A 1 202  ? -47.028 101.454 38.850  1.00 22.03 ? 202  PRO A N   1 
ATOM   1584  C CA  . PRO A 1 202  ? -46.416 101.251 40.168  1.00 23.29 ? 202  PRO A CA  1 
ATOM   1585  C C   . PRO A 1 202  ? -44.982 100.742 40.026  1.00 23.66 ? 202  PRO A C   1 
ATOM   1586  O O   . PRO A 1 202  ? -44.127 101.011 40.870  1.00 25.28 ? 202  PRO A O   1 
ATOM   1587  C CB  . PRO A 1 202  ? -47.327 100.215 40.825  1.00 22.42 ? 202  PRO A CB  1 
ATOM   1588  C CG  . PRO A 1 202  ? -48.635 100.429 40.138  1.00 25.17 ? 202  PRO A CG  1 
ATOM   1589  C CD  . PRO A 1 202  ? -48.222 100.606 38.706  1.00 23.24 ? 202  PRO A CD  1 
ATOM   1590  N N   . ASP A 1 203  ? -44.734 99.985  38.965  1.00 21.72 ? 203  ASP A N   1 
ATOM   1591  C CA  . ASP A 1 203  ? -43.401 99.474  38.700  1.00 21.28 ? 203  ASP A CA  1 
ATOM   1592  C C   . ASP A 1 203  ? -42.537 100.624 38.179  1.00 20.75 ? 203  ASP A C   1 
ATOM   1593  O O   . ASP A 1 203  ? -42.907 101.310 37.224  1.00 20.72 ? 203  ASP A O   1 
ATOM   1594  C CB  . ASP A 1 203  ? -43.490 98.348  37.681  1.00 22.05 ? 203  ASP A CB  1 
ATOM   1595  C CG  . ASP A 1 203  ? -44.239 97.146  38.226  1.00 25.58 ? 203  ASP A CG  1 
ATOM   1596  O OD1 . ASP A 1 203  ? -43.740 96.540  39.206  1.00 25.03 ? 203  ASP A OD1 1 
ATOM   1597  O OD2 . ASP A 1 203  ? -45.325 96.819  37.690  1.00 25.97 ? 203  ASP A OD2 1 
ATOM   1598  N N   . ARG A 1 204  ? -41.395 100.844 38.819  1.00 19.52 ? 204  ARG A N   1 
ATOM   1599  C CA  . ARG A 1 204  ? -40.494 101.930 38.439  1.00 17.39 ? 204  ARG A CA  1 
ATOM   1600  C C   . ARG A 1 204  ? -39.375 101.517 37.480  1.00 16.84 ? 204  ARG A C   1 
ATOM   1601  O O   . ARG A 1 204  ? -38.864 102.341 36.733  1.00 16.88 ? 204  ARG A O   1 
ATOM   1602  C CB  . ARG A 1 204  ? -39.903 102.562 39.705  1.00 16.16 ? 204  ARG A CB  1 
ATOM   1603  C CG  . ARG A 1 204  ? -40.965 103.102 40.707  1.00 15.17 ? 204  ARG A CG  1 
ATOM   1604  C CD  . ARG A 1 204  ? -41.702 104.325 40.166  1.00 11.65 ? 204  ARG A CD  1 
ATOM   1605  N NE  . ARG A 1 204  ? -40.764 105.413 39.888  1.00 13.95 ? 204  ARG A NE  1 
ATOM   1606  C CZ  . ARG A 1 204  ? -40.352 106.319 40.775  1.00 11.61 ? 204  ARG A CZ  1 
ATOM   1607  N NH1 . ARG A 1 204  ? -40.800 106.298 42.023  1.00 10.98 ? 204  ARG A NH1 1 
ATOM   1608  N NH2 . ARG A 1 204  ? -39.466 107.239 40.415  1.00 13.40 ? 204  ARG A NH2 1 
ATOM   1609  N N   . ALA A 1 205  ? -39.007 100.240 37.491  1.00 17.65 ? 205  ALA A N   1 
ATOM   1610  C CA  . ALA A 1 205  ? -37.945 99.741  36.619  1.00 18.08 ? 205  ALA A CA  1 
ATOM   1611  C C   . ALA A 1 205  ? -38.381 99.642  35.165  1.00 18.50 ? 205  ALA A C   1 
ATOM   1612  O O   . ALA A 1 205  ? -39.376 98.996  34.852  1.00 17.83 ? 205  ALA A O   1 
ATOM   1613  C CB  . ALA A 1 205  ? -37.467 98.374  37.096  1.00 17.56 ? 205  ALA A CB  1 
ATOM   1614  N N   . PRO A 1 206  ? -37.636 100.290 34.257  1.00 19.27 ? 206  PRO A N   1 
ATOM   1615  C CA  . PRO A 1 206  ? -37.925 100.282 32.817  1.00 18.55 ? 206  PRO A CA  1 
ATOM   1616  C C   . PRO A 1 206  ? -37.722 98.909  32.176  1.00 17.70 ? 206  PRO A C   1 
ATOM   1617  O O   . PRO A 1 206  ? -38.284 98.630  31.134  1.00 17.58 ? 206  PRO A O   1 
ATOM   1618  C CB  . PRO A 1 206  ? -36.960 101.322 32.266  1.00 20.79 ? 206  PRO A CB  1 
ATOM   1619  C CG  . PRO A 1 206  ? -36.833 102.290 33.420  1.00 22.74 ? 206  PRO A CG  1 
ATOM   1620  C CD  . PRO A 1 206  ? -36.668 101.349 34.590  1.00 20.39 ? 206  PRO A CD  1 
ATOM   1621  N N   . TYR A 1 207  ? -36.895 98.070  32.789  1.00 18.07 ? 207  TYR A N   1 
ATOM   1622  C CA  . TYR A 1 207  ? -36.657 96.707  32.307  1.00 19.65 ? 207  TYR A CA  1 
ATOM   1623  C C   . TYR A 1 207  ? -36.081 95.904  33.459  1.00 20.53 ? 207  TYR A C   1 
ATOM   1624  O O   . TYR A 1 207  ? -35.513 96.474  34.387  1.00 20.25 ? 207  TYR A O   1 
ATOM   1625  C CB  . TYR A 1 207  ? -35.682 96.675  31.124  1.00 20.09 ? 207  TYR A CB  1 
ATOM   1626  C CG  . TYR A 1 207  ? -34.229 96.937  31.479  1.00 22.21 ? 207  TYR A CG  1 
ATOM   1627  C CD1 . TYR A 1 207  ? -33.286 95.901  31.494  1.00 20.45 ? 207  TYR A CD1 1 
ATOM   1628  C CD2 . TYR A 1 207  ? -33.784 98.236  31.741  1.00 22.69 ? 207  TYR A CD2 1 
ATOM   1629  C CE1 . TYR A 1 207  ? -31.937 96.161  31.752  1.00 21.85 ? 207  TYR A CE1 1 
ATOM   1630  C CE2 . TYR A 1 207  ? -32.436 98.506  32.000  1.00 22.65 ? 207  TYR A CE2 1 
ATOM   1631  C CZ  . TYR A 1 207  ? -31.519 97.471  32.001  1.00 23.95 ? 207  TYR A CZ  1 
ATOM   1632  O OH  . TYR A 1 207  ? -30.189 97.771  32.224  1.00 24.86 ? 207  TYR A OH  1 
ATOM   1633  N N   . LEU A 1 208  ? -36.241 94.588  33.415  1.00 21.36 ? 208  LEU A N   1 
ATOM   1634  C CA  . LEU A 1 208  ? -35.722 93.742  34.477  1.00 23.08 ? 208  LEU A CA  1 
ATOM   1635  C C   . LEU A 1 208  ? -34.623 92.866  33.899  1.00 26.82 ? 208  LEU A C   1 
ATOM   1636  O O   . LEU A 1 208  ? -34.841 92.171  32.900  1.00 26.90 ? 208  LEU A O   1 
ATOM   1637  C CB  . LEU A 1 208  ? -36.831 92.858  35.054  1.00 20.59 ? 208  LEU A CB  1 
ATOM   1638  C CG  . LEU A 1 208  ? -38.116 93.563  35.499  1.00 20.81 ? 208  LEU A CG  1 
ATOM   1639  C CD1 . LEU A 1 208  ? -39.116 92.546  36.046  1.00 19.35 ? 208  LEU A CD1 1 
ATOM   1640  C CD2 . LEU A 1 208  ? -37.788 94.606  36.558  1.00 20.54 ? 208  LEU A CD2 1 
ATOM   1641  N N   . TYR A 1 209  ? -33.439 92.923  34.512  1.00 28.70 ? 209  TYR A N   1 
ATOM   1642  C CA  . TYR A 1 209  ? -32.303 92.117  34.069  1.00 29.86 ? 209  TYR A CA  1 
ATOM   1643  C C   . TYR A 1 209  ? -32.421 90.723  34.670  1.00 30.41 ? 209  TYR A C   1 
ATOM   1644  O O   . TYR A 1 209  ? -32.394 90.558  35.887  1.00 30.19 ? 209  TYR A O   1 
ATOM   1645  C CB  . TYR A 1 209  ? -30.973 92.743  34.513  1.00 29.32 ? 209  TYR A CB  1 
ATOM   1646  C CG  . TYR A 1 209  ? -29.799 91.802  34.337  1.00 30.26 ? 209  TYR A CG  1 
ATOM   1647  C CD1 . TYR A 1 209  ? -29.044 91.806  33.165  1.00 30.35 ? 209  TYR A CD1 1 
ATOM   1648  C CD2 . TYR A 1 209  ? -29.488 90.858  35.319  1.00 29.34 ? 209  TYR A CD2 1 
ATOM   1649  C CE1 . TYR A 1 209  ? -28.008 90.891  32.974  1.00 30.71 ? 209  TYR A CE1 1 
ATOM   1650  C CE2 . TYR A 1 209  ? -28.465 89.940  35.137  1.00 30.67 ? 209  TYR A CE2 1 
ATOM   1651  C CZ  . TYR A 1 209  ? -27.729 89.961  33.961  1.00 31.83 ? 209  TYR A CZ  1 
ATOM   1652  O OH  . TYR A 1 209  ? -26.731 89.036  33.769  1.00 33.27 ? 209  TYR A OH  1 
ATOM   1653  N N   . LEU A 1 210  ? -32.525 89.720  33.809  1.00 32.60 ? 210  LEU A N   1 
ATOM   1654  C CA  . LEU A 1 210  ? -32.658 88.335  34.256  1.00 33.67 ? 210  LEU A CA  1 
ATOM   1655  C C   . LEU A 1 210  ? -31.428 87.529  33.904  1.00 34.37 ? 210  LEU A C   1 
ATOM   1656  O O   . LEU A 1 210  ? -30.640 87.917  33.040  1.00 35.98 ? 210  LEU A O   1 
ATOM   1657  C CB  . LEU A 1 210  ? -33.865 87.692  33.590  1.00 33.33 ? 210  LEU A CB  1 
ATOM   1658  C CG  . LEU A 1 210  ? -35.042 88.655  33.529  1.00 34.58 ? 210  LEU A CG  1 
ATOM   1659  C CD1 . LEU A 1 210  ? -35.947 88.261  32.365  1.00 33.03 ? 210  LEU A CD1 1 
ATOM   1660  C CD2 . LEU A 1 210  ? -35.757 88.687  34.886  1.00 31.28 ? 210  LEU A CD2 1 
ATOM   1661  N N   . SER A 1 211  ? -31.305 86.384  34.564  1.00 35.65 ? 211  SER A N   1 
ATOM   1662  C CA  . SER A 1 211  ? -30.194 85.457  34.388  1.00 36.76 ? 211  SER A CA  1 
ATOM   1663  C C   . SER A 1 211  ? -29.825 85.160  32.937  1.00 36.52 ? 211  SER A C   1 
ATOM   1664  O O   . SER A 1 211  ? -28.660 84.890  32.635  1.00 36.30 ? 211  SER A O   1 
ATOM   1665  C CB  . SER A 1 211  ? -30.514 84.143  35.106  1.00 38.32 ? 211  SER A CB  1 
ATOM   1666  O OG  . SER A 1 211  ? -31.734 83.598  34.625  1.00 40.33 ? 211  SER A OG  1 
ATOM   1667  N N   . ALA A 1 212  ? -30.802 85.199  32.040  1.00 35.79 ? 212  ALA A N   1 
ATOM   1668  C CA  . ALA A 1 212  ? -30.514 84.909  30.641  1.00 37.76 ? 212  ALA A CA  1 
ATOM   1669  C C   . ALA A 1 212  ? -31.268 85.827  29.686  1.00 38.62 ? 212  ALA A C   1 
ATOM   1670  O O   . ALA A 1 212  ? -31.008 85.848  28.477  1.00 38.89 ? 212  ALA A O   1 
ATOM   1671  C CB  . ALA A 1 212  ? -30.857 83.454  30.339  1.00 36.80 ? 212  ALA A CB  1 
ATOM   1672  N N   . GLY A 1 213  ? -32.203 86.593  30.231  1.00 38.55 ? 213  GLY A N   1 
ATOM   1673  C CA  . GLY A 1 213  ? -32.979 87.472  29.385  1.00 36.21 ? 213  GLY A CA  1 
ATOM   1674  C C   . GLY A 1 213  ? -33.387 88.769  30.045  1.00 34.32 ? 213  GLY A C   1 
ATOM   1675  O O   . GLY A 1 213  ? -32.822 89.188  31.057  1.00 35.42 ? 213  GLY A O   1 
ATOM   1676  N N   . VAL A 1 214  ? -34.400 89.391  29.461  1.00 30.70 ? 214  VAL A N   1 
ATOM   1677  C CA  . VAL A 1 214  ? -34.895 90.662  29.936  1.00 26.17 ? 214  VAL A CA  1 
ATOM   1678  C C   . VAL A 1 214  ? -36.402 90.777  29.728  1.00 23.40 ? 214  VAL A C   1 
ATOM   1679  O O   . VAL A 1 214  ? -36.981 90.108  28.875  1.00 21.11 ? 214  VAL A O   1 
ATOM   1680  C CB  . VAL A 1 214  ? -34.166 91.795  29.177  1.00 26.41 ? 214  VAL A CB  1 
ATOM   1681  C CG1 . VAL A 1 214  ? -34.930 93.100  29.267  1.00 25.46 ? 214  VAL A CG1 1 
ATOM   1682  C CG2 . VAL A 1 214  ? -32.771 91.954  29.750  1.00 27.13 ? 214  VAL A CG2 1 
ATOM   1683  N N   . PHE A 1 215  ? -37.032 91.611  30.539  1.00 20.16 ? 215  PHE A N   1 
ATOM   1684  C CA  . PHE A 1 215  ? -38.449 91.868  30.419  1.00 19.74 ? 215  PHE A CA  1 
ATOM   1685  C C   . PHE A 1 215  ? -38.513 93.371  30.366  1.00 19.24 ? 215  PHE A C   1 
ATOM   1686  O O   . PHE A 1 215  ? -37.766 94.044  31.066  1.00 20.91 ? 215  PHE A O   1 
ATOM   1687  C CB  . PHE A 1 215  ? -39.207 91.361  31.635  1.00 21.06 ? 215  PHE A CB  1 
ATOM   1688  C CG  . PHE A 1 215  ? -39.427 89.881  31.635  1.00 22.40 ? 215  PHE A CG  1 
ATOM   1689  C CD1 . PHE A 1 215  ? -40.057 89.260  30.566  1.00 24.74 ? 215  PHE A CD1 1 
ATOM   1690  C CD2 . PHE A 1 215  ? -39.036 89.109  32.716  1.00 23.54 ? 215  PHE A CD2 1 
ATOM   1691  C CE1 . PHE A 1 215  ? -40.293 87.879  30.577  1.00 25.66 ? 215  PHE A CE1 1 
ATOM   1692  C CE2 . PHE A 1 215  ? -39.268 87.735  32.736  1.00 25.36 ? 215  PHE A CE2 1 
ATOM   1693  C CZ  . PHE A 1 215  ? -39.900 87.119  31.661  1.00 24.72 ? 215  PHE A CZ  1 
ATOM   1694  N N   . TRP A 1 216  ? -39.378 93.913  29.525  1.00 19.43 ? 216  TRP A N   1 
ATOM   1695  C CA  . TRP A 1 216  ? -39.471 95.360  29.437  1.00 18.62 ? 216  TRP A CA  1 
ATOM   1696  C C   . TRP A 1 216  ? -40.757 95.853  30.119  1.00 19.15 ? 216  TRP A C   1 
ATOM   1697  O O   . TRP A 1 216  ? -41.782 95.166  30.133  1.00 19.04 ? 216  TRP A O   1 
ATOM   1698  C CB  . TRP A 1 216  ? -39.454 95.812  27.966  1.00 17.84 ? 216  TRP A CB  1 
ATOM   1699  C CG  . TRP A 1 216  ? -38.417 95.136  27.083  1.00 18.70 ? 216  TRP A CG  1 
ATOM   1700  C CD1 . TRP A 1 216  ? -38.384 93.815  26.720  1.00 18.51 ? 216  TRP A CD1 1 
ATOM   1701  C CD2 . TRP A 1 216  ? -37.277 95.752  26.449  1.00 17.28 ? 216  TRP A CD2 1 
ATOM   1702  N NE1 . TRP A 1 216  ? -37.307 93.576  25.902  1.00 18.90 ? 216  TRP A NE1 1 
ATOM   1703  C CE2 . TRP A 1 216  ? -36.613 94.745  25.715  1.00 16.98 ? 216  TRP A CE2 1 
ATOM   1704  C CE3 . TRP A 1 216  ? -36.768 97.060  26.416  1.00 16.85 ? 216  TRP A CE3 1 
ATOM   1705  C CZ2 . TRP A 1 216  ? -35.451 94.997  24.972  1.00 15.13 ? 216  TRP A CZ2 1 
ATOM   1706  C CZ3 . TRP A 1 216  ? -35.616 97.310  25.675  1.00 17.16 ? 216  TRP A CZ3 1 
ATOM   1707  C CH2 . TRP A 1 216  ? -34.975 96.281  24.957  1.00 16.05 ? 216  TRP A CH2 1 
ATOM   1708  N N   . LEU A 1 217  ? -40.690 97.038  30.709  1.00 18.15 ? 217  LEU A N   1 
ATOM   1709  C CA  . LEU A 1 217  ? -41.859 97.618  31.334  1.00 17.48 ? 217  LEU A CA  1 
ATOM   1710  C C   . LEU A 1 217  ? -42.778 97.895  30.140  1.00 19.59 ? 217  LEU A C   1 
ATOM   1711  O O   . LEU A 1 217  ? -42.361 98.502  29.147  1.00 18.33 ? 217  LEU A O   1 
ATOM   1712  C CB  . LEU A 1 217  ? -41.479 98.913  32.039  1.00 15.42 ? 217  LEU A CB  1 
ATOM   1713  C CG  . LEU A 1 217  ? -42.617 99.623  32.763  1.00 17.41 ? 217  LEU A CG  1 
ATOM   1714  C CD1 . LEU A 1 217  ? -43.130 98.723  33.888  1.00 17.06 ? 217  LEU A CD1 1 
ATOM   1715  C CD2 . LEU A 1 217  ? -42.132 100.966 33.304  1.00 14.87 ? 217  LEU A CD2 1 
ATOM   1716  N N   . MET A 1 218  ? -44.018 97.426  30.229  1.00 21.73 ? 218  MET A N   1 
ATOM   1717  C CA  . MET A 1 218  ? -44.994 97.583  29.155  1.00 22.01 ? 218  MET A CA  1 
ATOM   1718  C C   . MET A 1 218  ? -45.413 99.031  28.923  1.00 22.10 ? 218  MET A C   1 
ATOM   1719  O O   . MET A 1 218  ? -46.598 99.340  28.953  1.00 23.34 ? 218  MET A O   1 
ATOM   1720  C CB  . MET A 1 218  ? -46.229 96.757  29.482  1.00 25.04 ? 218  MET A CB  1 
ATOM   1721  C CG  . MET A 1 218  ? -45.978 95.275  29.581  1.00 25.71 ? 218  MET A CG  1 
ATOM   1722  S SD  . MET A 1 218  ? -45.789 94.600  27.945  1.00 35.02 ? 218  MET A SD  1 
ATOM   1723  C CE  . MET A 1 218  ? -47.425 93.968  27.629  1.00 27.19 ? 218  MET A CE  1 
ATOM   1724  N N   . SER A 1 219  ? -44.449 99.913  28.684  1.00 19.79 ? 219  SER A N   1 
ATOM   1725  C CA  . SER A 1 219  ? -44.746 101.319 28.469  1.00 18.08 ? 219  SER A CA  1 
ATOM   1726  C C   . SER A 1 219  ? -44.476 101.692 27.021  1.00 18.41 ? 219  SER A C   1 
ATOM   1727  O O   . SER A 1 219  ? -43.456 101.301 26.460  1.00 19.69 ? 219  SER A O   1 
ATOM   1728  C CB  . SER A 1 219  ? -43.884 102.178 29.402  1.00 18.37 ? 219  SER A CB  1 
ATOM   1729  O OG  . SER A 1 219  ? -43.874 103.544 29.017  1.00 15.00 ? 219  SER A OG  1 
ATOM   1730  N N   . PRO A 1 220  ? -45.387 102.463 26.398  1.00 16.38 ? 220  PRO A N   1 
ATOM   1731  C CA  . PRO A 1 220  ? -45.244 102.888 25.003  1.00 14.74 ? 220  PRO A CA  1 
ATOM   1732  C C   . PRO A 1 220  ? -44.119 103.899 24.874  1.00 16.22 ? 220  PRO A C   1 
ATOM   1733  O O   . PRO A 1 220  ? -43.712 104.264 23.773  1.00 15.69 ? 220  PRO A O   1 
ATOM   1734  C CB  . PRO A 1 220  ? -46.607 103.496 24.691  1.00 12.05 ? 220  PRO A CB  1 
ATOM   1735  C CG  . PRO A 1 220  ? -46.971 104.135 25.978  1.00 12.17 ? 220  PRO A CG  1 
ATOM   1736  C CD  . PRO A 1 220  ? -46.579 103.079 27.010  1.00 13.94 ? 220  PRO A CD  1 
ATOM   1737  N N   . ARG A 1 221  ? -43.631 104.353 26.020  1.00 17.73 ? 221  ARG A N   1 
ATOM   1738  C CA  . ARG A 1 221  ? -42.549 105.327 26.065  1.00 19.53 ? 221  ARG A CA  1 
ATOM   1739  C C   . ARG A 1 221  ? -41.187 104.646 26.191  1.00 18.88 ? 221  ARG A C   1 
ATOM   1740  O O   . ARG A 1 221  ? -40.148 105.300 26.136  1.00 19.54 ? 221  ARG A O   1 
ATOM   1741  C CB  . ARG A 1 221  ? -42.783 106.293 27.226  1.00 18.30 ? 221  ARG A CB  1 
ATOM   1742  C CG  . ARG A 1 221  ? -43.798 107.358 26.883  1.00 21.12 ? 221  ARG A CG  1 
ATOM   1743  C CD  . ARG A 1 221  ? -44.265 108.159 28.085  1.00 22.52 ? 221  ARG A CD  1 
ATOM   1744  N NE  . ARG A 1 221  ? -45.372 107.498 28.776  1.00 25.35 ? 221  ARG A NE  1 
ATOM   1745  C CZ  . ARG A 1 221  ? -45.220 106.560 29.698  1.00 23.91 ? 221  ARG A CZ  1 
ATOM   1746  N NH1 . ARG A 1 221  ? -44.002 106.178 30.038  1.00 27.85 ? 221  ARG A NH1 1 
ATOM   1747  N NH2 . ARG A 1 221  ? -46.273 106.017 30.283  1.00 21.33 ? 221  ARG A NH2 1 
ATOM   1748  N N   . MET A 1 222  ? -41.209 103.326 26.360  1.00 17.06 ? 222  MET A N   1 
ATOM   1749  C CA  . MET A 1 222  ? -39.988 102.557 26.472  1.00 16.09 ? 222  MET A CA  1 
ATOM   1750  C C   . MET A 1 222  ? -39.381 102.361 25.077  1.00 14.89 ? 222  MET A C   1 
ATOM   1751  O O   . MET A 1 222  ? -40.089 102.313 24.074  1.00 14.76 ? 222  MET A O   1 
ATOM   1752  C CB  . MET A 1 222  ? -40.270 101.201 27.129  1.00 13.09 ? 222  MET A CB  1 
ATOM   1753  C CG  . MET A 1 222  ? -39.011 100.381 27.388  1.00 13.25 ? 222  MET A CG  1 
ATOM   1754  S SD  . MET A 1 222  ? -37.798 101.278 28.391  1.00 16.34 ? 222  MET A SD  1 
ATOM   1755  C CE  . MET A 1 222  ? -36.530 100.060 28.627  1.00 10.52 ? 222  MET A CE  1 
ATOM   1756  N N   . THR A 1 223  ? -38.065 102.236 25.034  1.00 14.61 ? 223  THR A N   1 
ATOM   1757  C CA  . THR A 1 223  ? -37.329 102.068 23.785  1.00 15.18 ? 223  THR A CA  1 
ATOM   1758  C C   . THR A 1 223  ? -36.208 101.055 23.962  1.00 15.12 ? 223  THR A C   1 
ATOM   1759  O O   . THR A 1 223  ? -35.787 100.784 25.084  1.00 16.70 ? 223  THR A O   1 
ATOM   1760  C CB  . THR A 1 223  ? -36.700 103.391 23.375  1.00 13.59 ? 223  THR A CB  1 
ATOM   1761  O OG1 . THR A 1 223  ? -37.731 104.295 22.959  1.00 16.74 ? 223  THR A OG1 1 
ATOM   1762  C CG2 . THR A 1 223  ? -35.706 103.189 22.289  1.00 13.67 ? 223  THR A CG2 1 
ATOM   1763  N N   . SER A 1 224  ? -35.712 100.506 22.857  1.00 16.27 ? 224  SER A N   1 
ATOM   1764  C CA  . SER A 1 224  ? -34.624 99.540  22.925  1.00 16.05 ? 224  SER A CA  1 
ATOM   1765  C C   . SER A 1 224  ? -33.353 100.246 23.345  1.00 15.55 ? 224  SER A C   1 
ATOM   1766  O O   . SER A 1 224  ? -32.408 99.614  23.793  1.00 17.83 ? 224  SER A O   1 
ATOM   1767  C CB  . SER A 1 224  ? -34.397 98.890  21.573  1.00 16.24 ? 224  SER A CB  1 
ATOM   1768  O OG  . SER A 1 224  ? -34.009 99.868  20.628  1.00 17.61 ? 224  SER A OG  1 
ATOM   1769  N N   . ALA A 1 225  ? -33.330 101.561 23.207  1.00 14.96 ? 225  ALA A N   1 
ATOM   1770  C CA  . ALA A 1 225  ? -32.144 102.323 23.569  1.00 16.81 ? 225  ALA A CA  1 
ATOM   1771  C C   . ALA A 1 225  ? -32.032 102.649 25.070  1.00 17.40 ? 225  ALA A C   1 
ATOM   1772  O O   . ALA A 1 225  ? -30.946 102.995 25.562  1.00 20.69 ? 225  ALA A O   1 
ATOM   1773  C CB  . ALA A 1 225  ? -32.087 103.625 22.741  1.00 13.98 ? 225  ALA A CB  1 
ATOM   1774  N N   . ILE A 1 226  ? -33.130 102.524 25.805  1.00 15.12 ? 226  ILE A N   1 
ATOM   1775  C CA  . ILE A 1 226  ? -33.108 102.868 27.222  1.00 14.38 ? 226  ILE A CA  1 
ATOM   1776  C C   . ILE A 1 226  ? -32.110 102.097 28.114  1.00 13.38 ? 226  ILE A C   1 
ATOM   1777  O O   . ILE A 1 226  ? -31.427 102.700 28.942  1.00 15.06 ? 226  ILE A O   1 
ATOM   1778  C CB  . ILE A 1 226  ? -34.547 102.800 27.802  1.00 12.26 ? 226  ILE A CB  1 
ATOM   1779  C CG1 . ILE A 1 226  ? -35.420 103.811 27.057  1.00 12.71 ? 226  ILE A CG1 1 
ATOM   1780  C CG2 . ILE A 1 226  ? -34.550 103.104 29.287  1.00 9.51  ? 226  ILE A CG2 1 
ATOM   1781  C CD1 . ILE A 1 226  ? -34.918 105.257 27.157  1.00 10.31 ? 226  ILE A CD1 1 
ATOM   1782  N N   . PRO A 1 227  ? -32.018 100.767 27.970  1.00 12.43 ? 227  PRO A N   1 
ATOM   1783  C CA  . PRO A 1 227  ? -31.059 100.046 28.824  1.00 13.04 ? 227  PRO A CA  1 
ATOM   1784  C C   . PRO A 1 227  ? -29.608 100.560 28.664  1.00 14.53 ? 227  PRO A C   1 
ATOM   1785  O O   . PRO A 1 227  ? -28.932 100.848 29.653  1.00 16.14 ? 227  PRO A O   1 
ATOM   1786  C CB  . PRO A 1 227  ? -31.226 98.592  28.380  1.00 11.34 ? 227  PRO A CB  1 
ATOM   1787  C CG  . PRO A 1 227  ? -32.691 98.543  27.959  1.00 11.30 ? 227  PRO A CG  1 
ATOM   1788  C CD  . PRO A 1 227  ? -32.861 99.834  27.196  1.00 11.88 ? 227  PRO A CD  1 
ATOM   1789  N N   . PRO A 1 228  ? -29.105 100.670 27.421  1.00 14.94 ? 228  PRO A N   1 
ATOM   1790  C CA  . PRO A 1 228  ? -27.732 101.164 27.278  1.00 14.01 ? 228  PRO A CA  1 
ATOM   1791  C C   . PRO A 1 228  ? -27.571 102.551 27.907  1.00 13.64 ? 228  PRO A C   1 
ATOM   1792  O O   . PRO A 1 228  ? -26.615 102.795 28.661  1.00 11.12 ? 228  PRO A O   1 
ATOM   1793  C CB  . PRO A 1 228  ? -27.526 101.190 25.760  1.00 15.50 ? 228  PRO A CB  1 
ATOM   1794  C CG  . PRO A 1 228  ? -28.400 100.077 25.280  1.00 17.51 ? 228  PRO A CG  1 
ATOM   1795  C CD  . PRO A 1 228  ? -29.653 100.254 26.115  1.00 16.36 ? 228  PRO A CD  1 
ATOM   1796  N N   . LEU A 1 229  ? -28.505 103.453 27.586  1.00 11.82 ? 229  LEU A N   1 
ATOM   1797  C CA  . LEU A 1 229  ? -28.483 104.809 28.131  1.00 11.24 ? 229  LEU A CA  1 
ATOM   1798  C C   . LEU A 1 229  ? -28.379 104.793 29.644  1.00 12.41 ? 229  LEU A C   1 
ATOM   1799  O O   . LEU A 1 229  ? -27.512 105.453 30.231  1.00 12.49 ? 229  LEU A O   1 
ATOM   1800  C CB  . LEU A 1 229  ? -29.750 105.582 27.767  1.00 9.89  ? 229  LEU A CB  1 
ATOM   1801  C CG  . LEU A 1 229  ? -29.795 106.943 28.485  1.00 8.09  ? 229  LEU A CG  1 
ATOM   1802  C CD1 . LEU A 1 229  ? -28.652 107.816 27.960  1.00 2.82  ? 229  LEU A CD1 1 
ATOM   1803  C CD2 . LEU A 1 229  ? -31.139 107.625 28.257  1.00 8.24  ? 229  LEU A CD2 1 
ATOM   1804  N N   . LEU A 1 230  ? -29.287 104.051 30.273  1.00 12.94 ? 230  LEU A N   1 
ATOM   1805  C CA  . LEU A 1 230  ? -29.311 103.945 31.725  1.00 12.11 ? 230  LEU A CA  1 
ATOM   1806  C C   . LEU A 1 230  ? -28.010 103.376 32.275  1.00 12.92 ? 230  LEU A C   1 
ATOM   1807  O O   . LEU A 1 230  ? -27.509 103.824 33.307  1.00 13.47 ? 230  LEU A O   1 
ATOM   1808  C CB  . LEU A 1 230  ? -30.496 103.078 32.166  1.00 11.20 ? 230  LEU A CB  1 
ATOM   1809  C CG  . LEU A 1 230  ? -31.865 103.704 31.853  1.00 9.93  ? 230  LEU A CG  1 
ATOM   1810  C CD1 . LEU A 1 230  ? -32.994 102.790 32.318  1.00 8.85  ? 230  LEU A CD1 1 
ATOM   1811  C CD2 . LEU A 1 230  ? -31.959 105.052 32.530  1.00 4.21  ? 230  LEU A CD2 1 
ATOM   1812  N N   . SER A 1 231  ? -27.443 102.402 31.574  1.00 12.92 ? 231  SER A N   1 
ATOM   1813  C CA  . SER A 1 231  ? -26.212 101.792 32.033  1.00 10.38 ? 231  SER A CA  1 
ATOM   1814  C C   . SER A 1 231  ? -25.062 102.793 32.011  1.00 10.04 ? 231  SER A C   1 
ATOM   1815  O O   . SER A 1 231  ? -24.182 102.752 32.877  1.00 11.01 ? 231  SER A O   1 
ATOM   1816  C CB  . SER A 1 231  ? -25.884 100.568 31.180  1.00 10.03 ? 231  SER A CB  1 
ATOM   1817  O OG  . SER A 1 231  ? -25.191 100.928 30.009  1.00 10.91 ? 231  SER A OG  1 
ATOM   1818  N N   . ASP A 1 232  ? -25.055 103.691 31.030  1.00 9.02  ? 232  ASP A N   1 
ATOM   1819  C CA  . ASP A 1 232  ? -23.980 104.690 30.963  1.00 8.62  ? 232  ASP A CA  1 
ATOM   1820  C C   . ASP A 1 232  ? -24.142 105.677 32.110  1.00 8.36  ? 232  ASP A C   1 
ATOM   1821  O O   . ASP A 1 232  ? -23.167 106.064 32.751  1.00 8.44  ? 232  ASP A O   1 
ATOM   1822  C CB  . ASP A 1 232  ? -24.010 105.474 29.642  1.00 7.28  ? 232  ASP A CB  1 
ATOM   1823  C CG  . ASP A 1 232  ? -23.182 104.833 28.543  1.00 8.62  ? 232  ASP A CG  1 
ATOM   1824  O OD1 . ASP A 1 232  ? -22.181 104.149 28.841  1.00 11.74 ? 232  ASP A OD1 1 
ATOM   1825  O OD2 . ASP A 1 232  ? -23.513 105.045 27.358  1.00 9.98  ? 232  ASP A OD2 1 
ATOM   1826  N N   . LEU A 1 233  ? -25.390 106.075 32.360  1.00 8.60  ? 233  LEU A N   1 
ATOM   1827  C CA  . LEU A 1 233  ? -25.702 107.030 33.417  1.00 9.48  ? 233  LEU A CA  1 
ATOM   1828  C C   . LEU A 1 233  ? -25.278 106.542 34.787  1.00 8.35  ? 233  LEU A C   1 
ATOM   1829  O O   . LEU A 1 233  ? -24.732 107.303 35.570  1.00 8.37  ? 233  LEU A O   1 
ATOM   1830  C CB  . LEU A 1 233  ? -27.206 107.374 33.404  1.00 9.29  ? 233  LEU A CB  1 
ATOM   1831  C CG  . LEU A 1 233  ? -27.660 108.092 32.112  1.00 10.33 ? 233  LEU A CG  1 
ATOM   1832  C CD1 . LEU A 1 233  ? -29.149 108.464 32.150  1.00 8.14  ? 233  LEU A CD1 1 
ATOM   1833  C CD2 . LEU A 1 233  ? -26.832 109.344 31.939  1.00 8.56  ? 233  LEU A CD2 1 
ATOM   1834  N N   . VAL A 1 234  ? -25.510 105.268 35.079  1.00 10.67 ? 234  VAL A N   1 
ATOM   1835  C CA  . VAL A 1 234  ? -25.120 104.731 36.373  1.00 10.42 ? 234  VAL A CA  1 
ATOM   1836  C C   . VAL A 1 234  ? -23.604 104.786 36.531  1.00 11.12 ? 234  VAL A C   1 
ATOM   1837  O O   . VAL A 1 234  ? -23.111 105.225 37.582  1.00 11.61 ? 234  VAL A O   1 
ATOM   1838  C CB  . VAL A 1 234  ? -25.637 103.277 36.567  1.00 12.39 ? 234  VAL A CB  1 
ATOM   1839  C CG1 . VAL A 1 234  ? -24.997 102.628 37.827  1.00 6.87  ? 234  VAL A CG1 1 
ATOM   1840  C CG2 . VAL A 1 234  ? -27.179 103.305 36.698  1.00 11.10 ? 234  VAL A CG2 1 
ATOM   1841  N N   . ASN A 1 235  ? -22.860 104.370 35.501  1.00 9.59  ? 235  ASN A N   1 
ATOM   1842  C CA  . ASN A 1 235  ? -21.402 104.416 35.594  1.00 10.51 ? 235  ASN A CA  1 
ATOM   1843  C C   . ASN A 1 235  ? -20.933 105.830 35.864  1.00 11.76 ? 235  ASN A C   1 
ATOM   1844  O O   . ASN A 1 235  ? -20.057 106.053 36.721  1.00 10.61 ? 235  ASN A O   1 
ATOM   1845  C CB  . ASN A 1 235  ? -20.719 103.938 34.310  1.00 11.59 ? 235  ASN A CB  1 
ATOM   1846  C CG  . ASN A 1 235  ? -20.789 102.441 34.131  1.00 11.36 ? 235  ASN A CG  1 
ATOM   1847  O OD1 . ASN A 1 235  ? -20.775 101.676 35.108  1.00 13.92 ? 235  ASN A OD1 1 
ATOM   1848  N ND2 . ASN A 1 235  ? -20.856 102.006 32.882  1.00 7.87  ? 235  ASN A ND2 1 
ATOM   1849  N N   . LEU A 1 236  ? -21.505 106.788 35.128  1.00 10.33 ? 236  LEU A N   1 
ATOM   1850  C CA  . LEU A 1 236  ? -21.112 108.170 35.302  1.00 7.79  ? 236  LEU A CA  1 
ATOM   1851  C C   . LEU A 1 236  ? -21.454 108.644 36.694  1.00 9.09  ? 236  LEU A C   1 
ATOM   1852  O O   . LEU A 1 236  ? -20.648 109.332 37.332  1.00 10.67 ? 236  LEU A O   1 
ATOM   1853  C CB  . LEU A 1 236  ? -21.781 109.059 34.270  1.00 7.64  ? 236  LEU A CB  1 
ATOM   1854  C CG  . LEU A 1 236  ? -21.316 108.837 32.831  1.00 10.88 ? 236  LEU A CG  1 
ATOM   1855  C CD1 . LEU A 1 236  ? -22.071 109.786 31.889  1.00 9.08  ? 236  LEU A CD1 1 
ATOM   1856  C CD2 . LEU A 1 236  ? -19.819 109.070 32.730  1.00 9.40  ? 236  LEU A CD2 1 
ATOM   1857  N N   . ALA A 1 237  ? -22.637 108.266 37.177  1.00 7.49  ? 237  ALA A N   1 
ATOM   1858  C CA  . ALA A 1 237  ? -23.077 108.671 38.508  1.00 7.22  ? 237  ALA A CA  1 
ATOM   1859  C C   . ALA A 1 237  ? -22.080 108.246 39.590  1.00 7.31  ? 237  ALA A C   1 
ATOM   1860  O O   . ALA A 1 237  ? -21.706 109.046 40.457  1.00 4.63  ? 237  ALA A O   1 
ATOM   1861  C CB  . ALA A 1 237  ? -24.436 108.084 38.796  1.00 7.35  ? 237  ALA A CB  1 
ATOM   1862  N N   . ILE A 1 238  ? -21.666 106.979 39.519  1.00 9.62  ? 238  ILE A N   1 
ATOM   1863  C CA  . ILE A 1 238  ? -20.703 106.375 40.445  1.00 10.38 ? 238  ILE A CA  1 
ATOM   1864  C C   . ILE A 1 238  ? -19.305 107.003 40.296  1.00 12.37 ? 238  ILE A C   1 
ATOM   1865  O O   . ILE A 1 238  ? -18.667 107.341 41.301  1.00 11.72 ? 238  ILE A O   1 
ATOM   1866  C CB  . ILE A 1 238  ? -20.597 104.850 40.195  1.00 9.75  ? 238  ILE A CB  1 
ATOM   1867  C CG1 . ILE A 1 238  ? -21.943 104.185 40.485  1.00 13.68 ? 238  ILE A CG1 1 
ATOM   1868  C CG2 . ILE A 1 238  ? -19.522 104.234 41.076  1.00 11.33 ? 238  ILE A CG2 1 
ATOM   1869  C CD1 . ILE A 1 238  ? -22.097 102.754 39.919  1.00 10.37 ? 238  ILE A CD1 1 
ATOM   1870  N N   . LEU A 1 239  ? -18.838 107.170 39.055  1.00 11.66 ? 239  LEU A N   1 
ATOM   1871  C CA  . LEU A 1 239  ? -17.514 107.750 38.821  1.00 12.97 ? 239  LEU A CA  1 
ATOM   1872  C C   . LEU A 1 239  ? -17.410 109.195 39.302  1.00 15.41 ? 239  LEU A C   1 
ATOM   1873  O O   . LEU A 1 239  ? -16.355 109.615 39.792  1.00 18.14 ? 239  LEU A O   1 
ATOM   1874  C CB  . LEU A 1 239  ? -17.124 107.677 37.341  1.00 10.64 ? 239  LEU A CB  1 
ATOM   1875  C CG  . LEU A 1 239  ? -17.076 106.302 36.663  1.00 8.77  ? 239  LEU A CG  1 
ATOM   1876  C CD1 . LEU A 1 239  ? -16.514 106.466 35.271  1.00 5.96  ? 239  LEU A CD1 1 
ATOM   1877  C CD2 . LEU A 1 239  ? -16.224 105.341 37.455  1.00 9.42  ? 239  LEU A CD2 1 
ATOM   1878  N N   . GLN A 1 240  ? -18.490 109.963 39.169  1.00 16.75 ? 240  GLN A N   1 
ATOM   1879  C CA  . GLN A 1 240  ? -18.464 111.344 39.626  1.00 15.17 ? 240  GLN A CA  1 
ATOM   1880  C C   . GLN A 1 240  ? -18.281 111.361 41.137  1.00 14.05 ? 240  GLN A C   1 
ATOM   1881  O O   . GLN A 1 240  ? -17.621 112.245 41.676  1.00 15.07 ? 240  GLN A O   1 
ATOM   1882  C CB  . GLN A 1 240  ? -19.755 112.085 39.266  1.00 16.95 ? 240  GLN A CB  1 
ATOM   1883  C CG  . GLN A 1 240  ? -19.774 113.513 39.815  1.00 18.76 ? 240  GLN A CG  1 
ATOM   1884  C CD  . GLN A 1 240  ? -20.850 114.374 39.207  1.00 21.29 ? 240  GLN A CD  1 
ATOM   1885  O OE1 . GLN A 1 240  ? -21.150 114.261 38.020  1.00 23.10 ? 240  GLN A OE1 1 
ATOM   1886  N NE2 . GLN A 1 240  ? -21.427 115.266 40.013  1.00 22.19 ? 240  GLN A NE2 1 
ATOM   1887  N N   . GLN A 1 241  ? -18.861 110.387 41.827  1.00 12.18 ? 241  GLN A N   1 
ATOM   1888  C CA  . GLN A 1 241  ? -18.716 110.359 43.272  1.00 12.06 ? 241  GLN A CA  1 
ATOM   1889  C C   . GLN A 1 241  ? -17.428 109.676 43.684  1.00 13.06 ? 241  GLN A C   1 
ATOM   1890  O O   . GLN A 1 241  ? -16.870 109.998 44.728  1.00 14.32 ? 241  GLN A O   1 
ATOM   1891  C CB  . GLN A 1 241  ? -19.893 109.640 43.952  1.00 8.71  ? 241  GLN A CB  1 
ATOM   1892  C CG  . GLN A 1 241  ? -21.253 110.259 43.726  1.00 7.64  ? 241  GLN A CG  1 
ATOM   1893  C CD  . GLN A 1 241  ? -21.297 111.754 43.968  1.00 9.66  ? 241  GLN A CD  1 
ATOM   1894  O OE1 . GLN A 1 241  ? -21.441 112.532 43.029  1.00 13.21 ? 241  GLN A OE1 1 
ATOM   1895  N NE2 . GLN A 1 241  ? -21.174 112.165 45.227  1.00 11.06 ? 241  GLN A NE2 1 
ATOM   1896  N N   . THR A 1 242  ? -16.938 108.752 42.858  1.00 15.19 ? 242  THR A N   1 
ATOM   1897  C CA  . THR A 1 242  ? -15.729 108.008 43.205  1.00 15.11 ? 242  THR A CA  1 
ATOM   1898  C C   . THR A 1 242  ? -14.430 108.381 42.520  1.00 15.69 ? 242  THR A C   1 
ATOM   1899  O O   . THR A 1 242  ? -13.352 107.969 42.963  1.00 17.53 ? 242  THR A O   1 
ATOM   1900  C CB  . THR A 1 242  ? -15.946 106.513 43.025  1.00 14.29 ? 242  THR A CB  1 
ATOM   1901  O OG1 . THR A 1 242  ? -16.301 106.248 41.666  1.00 14.68 ? 242  THR A OG1 1 
ATOM   1902  C CG2 . THR A 1 242  ? -17.061 106.034 43.956  1.00 14.07 ? 242  THR A CG2 1 
ATOM   1903  N N   . ALA A 1 243  ? -14.497 109.140 41.440  1.00 14.96 ? 243  ALA A N   1 
ATOM   1904  C CA  . ALA A 1 243  ? -13.254 109.543 40.796  1.00 15.02 ? 243  ALA A CA  1 
ATOM   1905  C C   . ALA A 1 243  ? -13.170 111.048 40.955  1.00 15.68 ? 243  ALA A C   1 
ATOM   1906  O O   . ALA A 1 243  ? -12.223 111.685 40.475  1.00 16.25 ? 243  ALA A O   1 
ATOM   1907  C CB  . ALA A 1 243  ? -13.261 109.168 39.333  1.00 13.29 ? 243  ALA A CB  1 
ATOM   1908  N N   . GLY A 1 244  ? -14.180 111.599 41.635  1.00 13.80 ? 244  GLY A N   1 
ATOM   1909  C CA  . GLY A 1 244  ? -14.256 113.027 41.857  1.00 13.42 ? 244  GLY A CA  1 
ATOM   1910  C C   . GLY A 1 244  ? -14.249 113.784 40.543  1.00 14.50 ? 244  GLY A C   1 
ATOM   1911  O O   . GLY A 1 244  ? -13.748 114.903 40.475  1.00 13.90 ? 244  GLY A O   1 
ATOM   1912  N N   . LEU A 1 245  ? -14.802 113.170 39.497  1.00 14.81 ? 245  LEU A N   1 
ATOM   1913  C CA  . LEU A 1 245  ? -14.852 113.790 38.179  1.00 15.36 ? 245  LEU A CA  1 
ATOM   1914  C C   . LEU A 1 245  ? -15.477 115.161 38.244  1.00 14.95 ? 245  LEU A C   1 
ATOM   1915  O O   . LEU A 1 245  ? -16.424 115.395 38.998  1.00 14.79 ? 245  LEU A O   1 
ATOM   1916  C CB  . LEU A 1 245  ? -15.690 112.956 37.202  1.00 17.63 ? 245  LEU A CB  1 
ATOM   1917  C CG  . LEU A 1 245  ? -15.314 111.525 36.824  1.00 18.93 ? 245  LEU A CG  1 
ATOM   1918  C CD1 . LEU A 1 245  ? -16.393 110.972 35.894  1.00 16.66 ? 245  LEU A CD1 1 
ATOM   1919  C CD2 . LEU A 1 245  ? -13.930 111.500 36.156  1.00 16.85 ? 245  LEU A CD2 1 
ATOM   1920  N N   . ASP A 1 246  ? -14.957 116.066 37.428  1.00 15.52 ? 246  ASP A N   1 
ATOM   1921  C CA  . ASP A 1 246  ? -15.505 117.412 37.366  1.00 16.33 ? 246  ASP A CA  1 
ATOM   1922  C C   . ASP A 1 246  ? -16.980 117.285 36.956  1.00 14.32 ? 246  ASP A C   1 
ATOM   1923  O O   . ASP A 1 246  ? -17.288 116.828 35.858  1.00 14.25 ? 246  ASP A O   1 
ATOM   1924  C CB  . ASP A 1 246  ? -14.746 118.234 36.331  1.00 16.81 ? 246  ASP A CB  1 
ATOM   1925  C CG  . ASP A 1 246  ? -15.269 119.650 36.222  1.00 20.33 ? 246  ASP A CG  1 
ATOM   1926  O OD1 . ASP A 1 246  ? -16.437 119.900 36.600  1.00 20.79 ? 246  ASP A OD1 1 
ATOM   1927  O OD2 . ASP A 1 246  ? -14.512 120.512 35.741  1.00 23.10 ? 246  ASP A OD2 1 
ATOM   1928  N N   . PRO A 1 247  ? -17.910 117.697 37.830  1.00 13.90 ? 247  PRO A N   1 
ATOM   1929  C CA  . PRO A 1 247  ? -19.339 117.592 37.490  1.00 13.50 ? 247  PRO A CA  1 
ATOM   1930  C C   . PRO A 1 247  ? -19.711 118.229 36.155  1.00 14.19 ? 247  PRO A C   1 
ATOM   1931  O O   . PRO A 1 247  ? -20.600 117.740 35.452  1.00 17.02 ? 247  PRO A O   1 
ATOM   1932  C CB  . PRO A 1 247  ? -20.036 118.284 38.663  1.00 12.11 ? 247  PRO A CB  1 
ATOM   1933  C CG  . PRO A 1 247  ? -19.052 118.109 39.801  1.00 13.71 ? 247  PRO A CG  1 
ATOM   1934  C CD  . PRO A 1 247  ? -17.720 118.358 39.130  1.00 11.42 ? 247  PRO A CD  1 
ATOM   1935  N N   . SER A 1 248  ? -19.031 119.314 35.798  1.00 13.76 ? 248  SER A N   1 
ATOM   1936  C CA  . SER A 1 248  ? -19.339 120.002 34.544  1.00 15.38 ? 248  SER A CA  1 
ATOM   1937  C C   . SER A 1 248  ? -18.926 119.205 33.314  1.00 15.07 ? 248  SER A C   1 
ATOM   1938  O O   . SER A 1 248  ? -19.582 119.299 32.278  1.00 18.91 ? 248  SER A O   1 
ATOM   1939  C CB  . SER A 1 248  ? -18.699 121.406 34.502  1.00 13.96 ? 248  SER A CB  1 
ATOM   1940  O OG  . SER A 1 248  ? -17.286 121.335 34.541  1.00 16.67 ? 248  SER A OG  1 
ATOM   1941  N N   . LEU A 1 249  ? -17.840 118.439 33.407  1.00 13.40 ? 249  LEU A N   1 
ATOM   1942  C CA  . LEU A 1 249  ? -17.429 117.619 32.272  1.00 11.81 ? 249  LEU A CA  1 
ATOM   1943  C C   . LEU A 1 249  ? -18.410 116.473 32.177  1.00 11.19 ? 249  LEU A C   1 
ATOM   1944  O O   . LEU A 1 249  ? -18.867 116.123 31.099  1.00 11.60 ? 249  LEU A O   1 
ATOM   1945  C CB  . LEU A 1 249  ? -16.013 117.082 32.451  1.00 11.16 ? 249  LEU A CB  1 
ATOM   1946  C CG  . LEU A 1 249  ? -14.924 118.128 32.203  1.00 14.11 ? 249  LEU A CG  1 
ATOM   1947  C CD1 . LEU A 1 249  ? -13.548 117.538 32.462  1.00 14.58 ? 249  LEU A CD1 1 
ATOM   1948  C CD2 . LEU A 1 249  ? -15.034 118.636 30.773  1.00 13.64 ? 249  LEU A CD2 1 
ATOM   1949  N N   . VAL A 1 250  ? -18.751 115.903 33.325  1.00 11.95 ? 250  VAL A N   1 
ATOM   1950  C CA  . VAL A 1 250  ? -19.696 114.808 33.371  1.00 11.20 ? 250  VAL A CA  1 
ATOM   1951  C C   . VAL A 1 250  ? -20.984 115.159 32.612  1.00 13.29 ? 250  VAL A C   1 
ATOM   1952  O O   . VAL A 1 250  ? -21.417 114.383 31.763  1.00 15.37 ? 250  VAL A O   1 
ATOM   1953  C CB  . VAL A 1 250  ? -20.004 114.428 34.835  1.00 11.19 ? 250  VAL A CB  1 
ATOM   1954  C CG1 . VAL A 1 250  ? -21.034 113.310 34.894  1.00 6.29  ? 250  VAL A CG1 1 
ATOM   1955  C CG2 . VAL A 1 250  ? -18.716 114.003 35.527  1.00 8.89  ? 250  VAL A CG2 1 
ATOM   1956  N N   . LYS A 1 251  ? -21.590 116.314 32.891  1.00 13.90 ? 251  LYS A N   1 
ATOM   1957  C CA  . LYS A 1 251  ? -22.819 116.702 32.184  1.00 15.98 ? 251  LYS A CA  1 
ATOM   1958  C C   . LYS A 1 251  ? -22.662 116.654 30.668  1.00 16.30 ? 251  LYS A C   1 
ATOM   1959  O O   . LYS A 1 251  ? -23.632 116.413 29.951  1.00 16.13 ? 251  LYS A O   1 
ATOM   1960  C CB  . LYS A 1 251  ? -23.296 118.102 32.592  1.00 19.38 ? 251  LYS A CB  1 
ATOM   1961  C CG  . LYS A 1 251  ? -23.809 118.176 34.022  1.00 25.21 ? 251  LYS A CG  1 
ATOM   1962  C CD  . LYS A 1 251  ? -24.244 119.576 34.408  1.00 27.21 ? 251  LYS A CD  1 
ATOM   1963  C CE  . LYS A 1 251  ? -25.554 119.954 33.745  1.00 30.00 ? 251  LYS A CE  1 
ATOM   1964  N NZ  . LYS A 1 251  ? -26.003 121.293 34.228  1.00 34.25 ? 251  LYS A NZ  1 
ATOM   1965  N N   . LEU A 1 252  ? -21.454 116.891 30.167  1.00 15.10 ? 252  LEU A N   1 
ATOM   1966  C CA  . LEU A 1 252  ? -21.244 116.810 28.726  1.00 15.28 ? 252  LEU A CA  1 
ATOM   1967  C C   . LEU A 1 252  ? -21.442 115.363 28.277  1.00 15.60 ? 252  LEU A C   1 
ATOM   1968  O O   . LEU A 1 252  ? -22.145 115.084 27.302  1.00 16.74 ? 252  LEU A O   1 
ATOM   1969  C CB  . LEU A 1 252  ? -19.831 117.281 28.351  1.00 13.45 ? 252  LEU A CB  1 
ATOM   1970  C CG  . LEU A 1 252  ? -19.505 118.739 28.668  1.00 10.86 ? 252  LEU A CG  1 
ATOM   1971  C CD1 . LEU A 1 252  ? -18.121 119.058 28.114  1.00 9.28  ? 252  LEU A CD1 1 
ATOM   1972  C CD2 . LEU A 1 252  ? -20.579 119.658 28.064  1.00 2.71  ? 252  LEU A CD2 1 
ATOM   1973  N N   . GLY A 1 253  ? -20.813 114.441 28.998  1.00 16.59 ? 253  GLY A N   1 
ATOM   1974  C CA  . GLY A 1 253  ? -20.942 113.038 28.673  1.00 15.27 ? 253  GLY A CA  1 
ATOM   1975  C C   . GLY A 1 253  ? -22.391 112.596 28.700  1.00 15.87 ? 253  GLY A C   1 
ATOM   1976  O O   . GLY A 1 253  ? -22.802 111.768 27.888  1.00 16.46 ? 253  GLY A O   1 
ATOM   1977  N N   . VAL A 1 254  ? -23.180 113.125 29.634  1.00 16.13 ? 254  VAL A N   1 
ATOM   1978  C CA  . VAL A 1 254  ? -24.590 112.741 29.680  1.00 16.02 ? 254  VAL A CA  1 
ATOM   1979  C C   . VAL A 1 254  ? -25.282 113.231 28.411  1.00 15.32 ? 254  VAL A C   1 
ATOM   1980  O O   . VAL A 1 254  ? -26.079 112.508 27.819  1.00 16.55 ? 254  VAL A O   1 
ATOM   1981  C CB  . VAL A 1 254  ? -25.300 113.309 30.922  1.00 17.25 ? 254  VAL A CB  1 
ATOM   1982  C CG1 . VAL A 1 254  ? -26.816 113.080 30.813  1.00 14.05 ? 254  VAL A CG1 1 
ATOM   1983  C CG2 . VAL A 1 254  ? -24.746 112.634 32.174  1.00 14.26 ? 254  VAL A CG2 1 
ATOM   1984  N N   . GLN A 1 255  ? -24.964 114.450 27.987  1.00 14.98 ? 255  GLN A N   1 
ATOM   1985  C CA  . GLN A 1 255  ? -25.536 114.996 26.764  1.00 16.88 ? 255  GLN A CA  1 
ATOM   1986  C C   . GLN A 1 255  ? -25.285 114.062 25.599  1.00 16.99 ? 255  GLN A C   1 
ATOM   1987  O O   . GLN A 1 255  ? -26.210 113.697 24.868  1.00 18.26 ? 255  GLN A O   1 
ATOM   1988  C CB  . GLN A 1 255  ? -24.912 116.332 26.414  1.00 19.40 ? 255  GLN A CB  1 
ATOM   1989  C CG  . GLN A 1 255  ? -25.569 117.516 27.062  1.00 26.18 ? 255  GLN A CG  1 
ATOM   1990  C CD  . GLN A 1 255  ? -24.947 118.837 26.617  1.00 29.86 ? 255  GLN A CD  1 
ATOM   1991  O OE1 . GLN A 1 255  ? -24.830 119.116 25.411  1.00 28.77 ? 255  GLN A OE1 1 
ATOM   1992  N NE2 . GLN A 1 255  ? -24.555 119.659 27.592  1.00 29.58 ? 255  GLN A NE2 1 
ATOM   1993  N N   . ILE A 1 256  ? -24.025 113.677 25.422  1.00 16.14 ? 256  ILE A N   1 
ATOM   1994  C CA  . ILE A 1 256  ? -23.681 112.799 24.317  1.00 14.14 ? 256  ILE A CA  1 
ATOM   1995  C C   . ILE A 1 256  ? -24.537 111.540 24.344  1.00 14.59 ? 256  ILE A C   1 
ATOM   1996  O O   . ILE A 1 256  ? -25.018 111.102 23.295  1.00 13.15 ? 256  ILE A O   1 
ATOM   1997  C CB  . ILE A 1 256  ? -22.159 112.452 24.327  1.00 12.82 ? 256  ILE A CB  1 
ATOM   1998  C CG1 . ILE A 1 256  ? -21.361 113.722 23.969  1.00 12.17 ? 256  ILE A CG1 1 
ATOM   1999  C CG2 . ILE A 1 256  ? -21.859 111.282 23.339  1.00 6.27  ? 256  ILE A CG2 1 
ATOM   2000  C CD1 . ILE A 1 256  ? -19.841 113.580 24.027  1.00 10.62 ? 256  ILE A CD1 1 
ATOM   2001  N N   . CYS A 1 257  ? -24.751 110.979 25.537  1.00 14.78 ? 257  CYS A N   1 
ATOM   2002  C CA  . CYS A 1 257  ? -25.554 109.767 25.664  1.00 15.48 ? 257  CYS A CA  1 
ATOM   2003  C C   . CYS A 1 257  ? -27.011 110.059 25.308  1.00 15.79 ? 257  CYS A C   1 
ATOM   2004  O O   . CYS A 1 257  ? -27.648 109.292 24.571  1.00 15.55 ? 257  CYS A O   1 
ATOM   2005  C CB  . CYS A 1 257  ? -25.450 109.197 27.083  1.00 17.29 ? 257  CYS A CB  1 
ATOM   2006  S SG  . CYS A 1 257  ? -23.762 108.625 27.564  1.00 18.69 ? 257  CYS A SG  1 
ATOM   2007  N N   . LEU A 1 258  ? -27.540 111.166 25.827  1.00 15.31 ? 258  LEU A N   1 
ATOM   2008  C CA  . LEU A 1 258  ? -28.915 111.554 25.519  1.00 15.06 ? 258  LEU A CA  1 
ATOM   2009  C C   . LEU A 1 258  ? -29.061 111.672 23.994  1.00 16.25 ? 258  LEU A C   1 
ATOM   2010  O O   . LEU A 1 258  ? -30.061 111.222 23.419  1.00 14.83 ? 258  LEU A O   1 
ATOM   2011  C CB  . LEU A 1 258  ? -29.262 112.877 26.200  1.00 12.82 ? 258  LEU A CB  1 
ATOM   2012  C CG  . LEU A 1 258  ? -29.475 112.760 27.711  1.00 12.98 ? 258  LEU A CG  1 
ATOM   2013  C CD1 . LEU A 1 258  ? -29.683 114.116 28.325  1.00 7.96  ? 258  LEU A CD1 1 
ATOM   2014  C CD2 . LEU A 1 258  ? -30.671 111.859 27.974  1.00 12.17 ? 258  LEU A CD2 1 
ATOM   2015  N N   . HIS A 1 259  ? -28.057 112.255 23.339  1.00 16.18 ? 259  HIS A N   1 
ATOM   2016  C CA  . HIS A 1 259  ? -28.092 112.375 21.888  1.00 17.40 ? 259  HIS A CA  1 
ATOM   2017  C C   . HIS A 1 259  ? -28.053 111.000 21.222  1.00 17.64 ? 259  HIS A C   1 
ATOM   2018  O O   . HIS A 1 259  ? -28.673 110.797 20.176  1.00 17.07 ? 259  HIS A O   1 
ATOM   2019  C CB  . HIS A 1 259  ? -26.926 113.213 21.380  1.00 18.34 ? 259  HIS A CB  1 
ATOM   2020  C CG  . HIS A 1 259  ? -27.175 114.684 21.447  1.00 22.45 ? 259  HIS A CG  1 
ATOM   2021  N ND1 . HIS A 1 259  ? -27.347 115.357 22.637  1.00 24.75 ? 259  HIS A ND1 1 
ATOM   2022  C CD2 . HIS A 1 259  ? -27.296 115.611 20.466  1.00 21.91 ? 259  HIS A CD2 1 
ATOM   2023  C CE1 . HIS A 1 259  ? -27.563 116.639 22.387  1.00 22.58 ? 259  HIS A CE1 1 
ATOM   2024  N NE2 . HIS A 1 259  ? -27.536 116.818 21.080  1.00 21.06 ? 259  HIS A NE2 1 
ATOM   2025  N N   . ALA A 1 260  ? -27.331 110.058 21.824  1.00 16.19 ? 260  ALA A N   1 
ATOM   2026  C CA  . ALA A 1 260  ? -27.255 108.711 21.265  1.00 16.39 ? 260  ALA A CA  1 
ATOM   2027  C C   . ALA A 1 260  ? -28.631 108.025 21.351  1.00 16.26 ? 260  ALA A C   1 
ATOM   2028  O O   . ALA A 1 260  ? -29.038 107.293 20.438  1.00 15.79 ? 260  ALA A O   1 
ATOM   2029  C CB  . ALA A 1 260  ? -26.187 107.879 22.004  1.00 14.70 ? 260  ALA A CB  1 
ATOM   2030  N N   . ALA A 1 261  ? -29.342 108.268 22.450  1.00 14.83 ? 261  ALA A N   1 
ATOM   2031  C CA  . ALA A 1 261  ? -30.670 107.686 22.644  1.00 12.43 ? 261  ALA A CA  1 
ATOM   2032  C C   . ALA A 1 261  ? -31.683 108.380 21.730  1.00 11.51 ? 261  ALA A C   1 
ATOM   2033  O O   . ALA A 1 261  ? -32.662 107.771 21.296  1.00 9.71  ? 261  ALA A O   1 
ATOM   2034  C CB  . ALA A 1 261  ? -31.091 107.841 24.094  1.00 10.32 ? 261  ALA A CB  1 
ATOM   2035  N N   . ALA A 1 262  ? -31.439 109.661 21.457  1.00 10.03 ? 262  ALA A N   1 
ATOM   2036  C CA  . ALA A 1 262  ? -32.311 110.459 20.601  1.00 11.38 ? 262  ALA A CA  1 
ATOM   2037  C C   . ALA A 1 262  ? -32.133 110.095 19.125  1.00 11.93 ? 262  ALA A C   1 
ATOM   2038  O O   . ALA A 1 262  ? -33.014 110.354 18.309  1.00 11.70 ? 262  ALA A O   1 
ATOM   2039  C CB  . ALA A 1 262  ? -32.025 111.950 20.800  1.00 7.52  ? 262  ALA A CB  1 
ATOM   2040  N N   . SER A 1 263  ? -30.998 109.487 18.796  1.00 12.78 ? 263  SER A N   1 
ATOM   2041  C CA  . SER A 1 263  ? -30.697 109.111 17.417  1.00 14.41 ? 263  SER A CA  1 
ATOM   2042  C C   . SER A 1 263  ? -31.450 107.856 17.005  1.00 15.26 ? 263  SER A C   1 
ATOM   2043  O O   . SER A 1 263  ? -32.312 107.372 17.735  1.00 15.77 ? 263  SER A O   1 
ATOM   2044  C CB  . SER A 1 263  ? -29.187 108.881 17.235  1.00 13.15 ? 263  SER A CB  1 
ATOM   2045  O OG  . SER A 1 263  ? -28.764 107.693 17.881  1.00 15.30 ? 263  SER A OG  1 
ATOM   2046  N N   . SER A 1 264  ? -31.109 107.325 15.837  1.00 15.65 ? 264  SER A N   1 
ATOM   2047  C CA  . SER A 1 264  ? -31.769 106.126 15.337  1.00 15.56 ? 264  SER A CA  1 
ATOM   2048  C C   . SER A 1 264  ? -31.060 104.854 15.780  1.00 15.22 ? 264  SER A C   1 
ATOM   2049  O O   . SER A 1 264  ? -31.549 103.759 15.522  1.00 14.84 ? 264  SER A O   1 
ATOM   2050  C CB  . SER A 1 264  ? -31.841 106.164 13.811  1.00 13.35 ? 264  SER A CB  1 
ATOM   2051  O OG  . SER A 1 264  ? -30.561 106.406 13.251  1.00 14.54 ? 264  SER A OG  1 
ATOM   2052  N N   . SER A 1 265  ? -29.911 104.999 16.440  1.00 15.48 ? 265  SER A N   1 
ATOM   2053  C CA  . SER A 1 265  ? -29.153 103.837 16.900  1.00 14.81 ? 265  SER A CA  1 
ATOM   2054  C C   . SER A 1 265  ? -28.071 104.239 17.895  1.00 16.67 ? 265  SER A C   1 
ATOM   2055  O O   . SER A 1 265  ? -26.999 104.727 17.522  1.00 16.51 ? 265  SER A O   1 
ATOM   2056  C CB  . SER A 1 265  ? -28.527 103.126 15.707  1.00 15.07 ? 265  SER A CB  1 
ATOM   2057  O OG  . SER A 1 265  ? -27.864 101.942 16.104  1.00 17.52 ? 265  SER A OG  1 
ATOM   2058  N N   . TYR A 1 266  ? -28.374 104.030 19.171  1.00 17.66 ? 266  TYR A N   1 
ATOM   2059  C CA  . TYR A 1 266  ? -27.484 104.364 20.277  1.00 17.67 ? 266  TYR A CA  1 
ATOM   2060  C C   . TYR A 1 266  ? -26.059 103.858 20.086  1.00 18.09 ? 266  TYR A C   1 
ATOM   2061  O O   . TYR A 1 266  ? -25.079 104.607 20.163  1.00 18.93 ? 266  TYR A O   1 
ATOM   2062  C CB  . TYR A 1 266  ? -28.026 103.753 21.556  1.00 16.11 ? 266  TYR A CB  1 
ATOM   2063  C CG  . TYR A 1 266  ? -27.397 104.306 22.795  1.00 16.06 ? 266  TYR A CG  1 
ATOM   2064  C CD1 . TYR A 1 266  ? -27.993 105.372 23.467  1.00 14.44 ? 266  TYR A CD1 1 
ATOM   2065  C CD2 . TYR A 1 266  ? -26.212 103.767 23.310  1.00 16.07 ? 266  TYR A CD2 1 
ATOM   2066  C CE1 . TYR A 1 266  ? -27.440 105.895 24.625  1.00 15.45 ? 266  TYR A CE1 1 
ATOM   2067  C CE2 . TYR A 1 266  ? -25.636 104.287 24.486  1.00 15.83 ? 266  TYR A CE2 1 
ATOM   2068  C CZ  . TYR A 1 266  ? -26.266 105.356 25.137  1.00 16.20 ? 266  TYR A CZ  1 
ATOM   2069  O OH  . TYR A 1 266  ? -25.755 105.889 26.303  1.00 13.57 ? 266  TYR A OH  1 
ATOM   2070  N N   . SER A 1 267  ? -25.959 102.558 19.875  1.00 18.10 ? 267  SER A N   1 
ATOM   2071  C CA  . SER A 1 267  ? -24.676 101.909 19.699  1.00 17.60 ? 267  SER A CA  1 
ATOM   2072  C C   . SER A 1 267  ? -23.892 102.502 18.520  1.00 15.74 ? 267  SER A C   1 
ATOM   2073  O O   . SER A 1 267  ? -22.697 102.779 18.638  1.00 12.53 ? 267  SER A O   1 
ATOM   2074  C CB  . SER A 1 267  ? -24.919 100.425 19.511  1.00 18.97 ? 267  SER A CB  1 
ATOM   2075  O OG  . SER A 1 267  ? -23.701 99.733  19.379  1.00 29.76 ? 267  SER A OG  1 
ATOM   2076  N N   . TRP A 1 268  ? -24.576 102.707 17.396  1.00 14.76 ? 268  TRP A N   1 
ATOM   2077  C CA  . TRP A 1 268  ? -23.959 103.290 16.196  1.00 13.97 ? 268  TRP A CA  1 
ATOM   2078  C C   . TRP A 1 268  ? -23.453 104.717 16.474  1.00 12.47 ? 268  TRP A C   1 
ATOM   2079  O O   . TRP A 1 268  ? -22.321 105.071 16.126  1.00 11.64 ? 268  TRP A O   1 
ATOM   2080  C CB  . TRP A 1 268  ? -24.979 103.322 15.044  1.00 14.72 ? 268  TRP A CB  1 
ATOM   2081  C CG  . TRP A 1 268  ? -24.510 104.072 13.816  1.00 16.57 ? 268  TRP A CG  1 
ATOM   2082  C CD1 . TRP A 1 268  ? -23.657 103.618 12.853  1.00 15.97 ? 268  TRP A CD1 1 
ATOM   2083  C CD2 . TRP A 1 268  ? -24.793 105.441 13.487  1.00 18.27 ? 268  TRP A CD2 1 
ATOM   2084  N NE1 . TRP A 1 268  ? -23.388 104.614 11.955  1.00 18.57 ? 268  TRP A NE1 1 
ATOM   2085  C CE2 . TRP A 1 268  ? -24.072 105.744 12.317  1.00 17.90 ? 268  TRP A CE2 1 
ATOM   2086  C CE3 . TRP A 1 268  ? -25.591 106.440 14.071  1.00 19.65 ? 268  TRP A CE3 1 
ATOM   2087  C CZ2 . TRP A 1 268  ? -24.112 107.007 11.717  1.00 20.07 ? 268  TRP A CZ2 1 
ATOM   2088  C CZ3 . TRP A 1 268  ? -25.636 107.688 13.479  1.00 20.12 ? 268  TRP A CZ3 1 
ATOM   2089  C CH2 . TRP A 1 268  ? -24.900 107.961 12.306  1.00 21.96 ? 268  TRP A CH2 1 
ATOM   2090  N N   . PHE A 1 269  ? -24.302 105.523 17.108  1.00 10.77 ? 269  PHE A N   1 
ATOM   2091  C CA  . PHE A 1 269  ? -23.978 106.908 17.436  1.00 10.87 ? 269  PHE A CA  1 
ATOM   2092  C C   . PHE A 1 269  ? -22.727 107.000 18.324  1.00 10.77 ? 269  PHE A C   1 
ATOM   2093  O O   . PHE A 1 269  ? -21.858 107.844 18.103  1.00 11.41 ? 269  PHE A O   1 
ATOM   2094  C CB  . PHE A 1 269  ? -25.174 107.563 18.140  1.00 9.83  ? 269  PHE A CB  1 
ATOM   2095  C CG  . PHE A 1 269  ? -25.086 109.064 18.225  1.00 11.53 ? 269  PHE A CG  1 
ATOM   2096  C CD1 . PHE A 1 269  ? -25.620 109.864 17.216  1.00 12.13 ? 269  PHE A CD1 1 
ATOM   2097  C CD2 . PHE A 1 269  ? -24.435 109.679 19.294  1.00 13.87 ? 269  PHE A CD2 1 
ATOM   2098  C CE1 . PHE A 1 269  ? -25.506 111.263 17.259  1.00 12.62 ? 269  PHE A CE1 1 
ATOM   2099  C CE2 . PHE A 1 269  ? -24.309 111.075 19.352  1.00 15.35 ? 269  PHE A CE2 1 
ATOM   2100  C CZ  . PHE A 1 269  ? -24.849 111.872 18.328  1.00 14.43 ? 269  PHE A CZ  1 
ATOM   2101  N N   . ILE A 1 270  ? -22.644 106.130 19.325  1.00 11.10 ? 270  ILE A N   1 
ATOM   2102  C CA  . ILE A 1 270  ? -21.508 106.101 20.240  1.00 10.17 ? 270  ILE A CA  1 
ATOM   2103  C C   . ILE A 1 270  ? -20.245 105.728 19.484  1.00 11.98 ? 270  ILE A C   1 
ATOM   2104  O O   . ILE A 1 270  ? -19.171 106.293 19.718  1.00 12.85 ? 270  ILE A O   1 
ATOM   2105  C CB  . ILE A 1 270  ? -21.730 105.072 21.371  1.00 9.36  ? 270  ILE A CB  1 
ATOM   2106  C CG1 . ILE A 1 270  ? -22.868 105.549 22.283  1.00 5.56  ? 270  ILE A CG1 1 
ATOM   2107  C CG2 . ILE A 1 270  ? -20.429 104.841 22.136  1.00 3.90  ? 270  ILE A CG2 1 
ATOM   2108  C CD1 . ILE A 1 270  ? -22.646 106.932 22.878  1.00 2.71  ? 270  ILE A CD1 1 
ATOM   2109  N N   . LEU A 1 271  ? -20.378 104.766 18.581  1.00 12.62 ? 271  LEU A N   1 
ATOM   2110  C CA  . LEU A 1 271  ? -19.255 104.329 17.764  1.00 14.58 ? 271  LEU A CA  1 
ATOM   2111  C C   . LEU A 1 271  ? -18.695 105.495 16.928  1.00 15.51 ? 271  LEU A C   1 
ATOM   2112  O O   . LEU A 1 271  ? -17.477 105.667 16.808  1.00 15.15 ? 271  LEU A O   1 
ATOM   2113  C CB  . LEU A 1 271  ? -19.707 103.205 16.825  1.00 14.55 ? 271  LEU A CB  1 
ATOM   2114  C CG  . LEU A 1 271  ? -18.676 102.677 15.824  1.00 13.92 ? 271  LEU A CG  1 
ATOM   2115  C CD1 . LEU A 1 271  ? -17.554 101.974 16.573  1.00 13.51 ? 271  LEU A CD1 1 
ATOM   2116  C CD2 . LEU A 1 271  ? -19.349 101.706 14.880  1.00 15.41 ? 271  LEU A CD2 1 
ATOM   2117  N N   . LYS A 1 272  ? -19.593 106.300 16.366  1.00 14.96 ? 272  LYS A N   1 
ATOM   2118  C CA  . LYS A 1 272  ? -19.181 107.417 15.518  1.00 15.99 ? 272  LYS A CA  1 
ATOM   2119  C C   . LYS A 1 272  ? -18.639 108.617 16.266  1.00 15.35 ? 272  LYS A C   1 
ATOM   2120  O O   . LYS A 1 272  ? -17.836 109.366 15.715  1.00 17.07 ? 272  LYS A O   1 
ATOM   2121  C CB  . LYS A 1 272  ? -20.349 107.882 14.641  1.00 15.31 ? 272  LYS A CB  1 
ATOM   2122  C CG  . LYS A 1 272  ? -21.091 106.741 13.942  1.00 19.20 ? 272  LYS A CG  1 
ATOM   2123  C CD  . LYS A 1 272  ? -20.581 106.464 12.522  1.00 19.37 ? 272  LYS A CD  1 
ATOM   2124  C CE  . LYS A 1 272  ? -19.139 105.988 12.475  1.00 14.66 ? 272  LYS A CE  1 
ATOM   2125  N NZ  . LYS A 1 272  ? -18.846 105.593 11.082  1.00 12.43 ? 272  LYS A NZ  1 
ATOM   2126  N N   . THR A 1 273  ? -19.068 108.810 17.509  1.00 13.53 ? 273  THR A N   1 
ATOM   2127  C CA  . THR A 1 273  ? -18.610 109.959 18.271  1.00 13.42 ? 273  THR A CA  1 
ATOM   2128  C C   . THR A 1 273  ? -17.682 109.668 19.442  1.00 13.81 ? 273  THR A C   1 
ATOM   2129  O O   . THR A 1 273  ? -17.335 110.585 20.184  1.00 12.25 ? 273  THR A O   1 
ATOM   2130  C CB  . THR A 1 273  ? -19.789 110.728 18.814  1.00 14.27 ? 273  THR A CB  1 
ATOM   2131  O OG1 . THR A 1 273  ? -20.501 109.898 19.743  1.00 16.03 ? 273  THR A OG1 1 
ATOM   2132  C CG2 . THR A 1 273  ? -20.711 111.130 17.680  1.00 14.56 ? 273  THR A CG2 1 
ATOM   2133  N N   . LYS A 1 274  ? -17.274 108.408 19.602  1.00 14.75 ? 274  LYS A N   1 
ATOM   2134  C CA  . LYS A 1 274  ? -16.394 107.997 20.708  1.00 16.07 ? 274  LYS A CA  1 
ATOM   2135  C C   . LYS A 1 274  ? -15.081 108.782 20.834  1.00 16.51 ? 274  LYS A C   1 
ATOM   2136  O O   . LYS A 1 274  ? -14.435 108.764 21.894  1.00 17.77 ? 274  LYS A O   1 
ATOM   2137  C CB  . LYS A 1 274  ? -16.037 106.510 20.581  1.00 18.01 ? 274  LYS A CB  1 
ATOM   2138  C CG  . LYS A 1 274  ? -15.085 106.222 19.431  1.00 17.83 ? 274  LYS A CG  1 
ATOM   2139  C CD  . LYS A 1 274  ? -14.852 104.740 19.234  1.00 22.08 ? 274  LYS A CD  1 
ATOM   2140  C CE  . LYS A 1 274  ? -14.132 104.477 17.916  1.00 24.04 ? 274  LYS A CE  1 
ATOM   2141  N NZ  . LYS A 1 274  ? -13.932 103.026 17.658  1.00 27.76 ? 274  LYS A NZ  1 
ATOM   2142  N N   . SER A 1 275  ? -14.667 109.455 19.768  1.00 14.89 ? 275  SER A N   1 
ATOM   2143  C CA  . SER A 1 275  ? -13.412 110.194 19.829  1.00 16.07 ? 275  SER A CA  1 
ATOM   2144  C C   . SER A 1 275  ? -13.539 111.607 20.406  1.00 15.42 ? 275  SER A C   1 
ATOM   2145  O O   . SER A 1 275  ? -12.530 112.219 20.738  1.00 15.14 ? 275  SER A O   1 
ATOM   2146  C CB  . SER A 1 275  ? -12.765 110.277 18.440  1.00 13.67 ? 275  SER A CB  1 
ATOM   2147  O OG  . SER A 1 275  ? -13.302 111.358 17.702  1.00 18.61 ? 275  SER A OG  1 
ATOM   2148  N N   . ILE A 1 276  ? -14.766 112.118 20.523  1.00 15.43 ? 276  ILE A N   1 
ATOM   2149  C CA  . ILE A 1 276  ? -14.994 113.475 21.041  1.00 16.42 ? 276  ILE A CA  1 
ATOM   2150  C C   . ILE A 1 276  ? -14.093 113.927 22.197  1.00 16.64 ? 276  ILE A C   1 
ATOM   2151  O O   . ILE A 1 276  ? -13.302 114.869 22.054  1.00 17.28 ? 276  ILE A O   1 
ATOM   2152  C CB  . ILE A 1 276  ? -16.446 113.687 21.521  1.00 15.75 ? 276  ILE A CB  1 
ATOM   2153  C CG1 . ILE A 1 276  ? -17.414 113.647 20.341  1.00 20.29 ? 276  ILE A CG1 1 
ATOM   2154  C CG2 . ILE A 1 276  ? -16.565 115.019 22.208  1.00 15.30 ? 276  ILE A CG2 1 
ATOM   2155  C CD1 . ILE A 1 276  ? -17.160 114.702 19.297  1.00 21.96 ? 276  ILE A CD1 1 
ATOM   2156  N N   . PHE A 1 277  ? -14.222 113.270 23.341  1.00 15.14 ? 277  PHE A N   1 
ATOM   2157  C CA  . PHE A 1 277  ? -13.450 113.657 24.516  1.00 15.65 ? 277  PHE A CA  1 
ATOM   2158  C C   . PHE A 1 277  ? -11.921 113.571 24.399  1.00 16.46 ? 277  PHE A C   1 
ATOM   2159  O O   . PHE A 1 277  ? -11.214 114.498 24.807  1.00 15.58 ? 277  PHE A O   1 
ATOM   2160  C CB  . PHE A 1 277  ? -13.954 112.873 25.734  1.00 14.49 ? 277  PHE A CB  1 
ATOM   2161  C CG  . PHE A 1 277  ? -15.337 113.309 26.211  1.00 15.21 ? 277  PHE A CG  1 
ATOM   2162  C CD1 . PHE A 1 277  ? -15.559 114.618 26.660  1.00 13.75 ? 277  PHE A CD1 1 
ATOM   2163  C CD2 . PHE A 1 277  ? -16.408 112.413 26.221  1.00 13.44 ? 277  PHE A CD2 1 
ATOM   2164  C CE1 . PHE A 1 277  ? -16.830 115.031 27.113  1.00 13.38 ? 277  PHE A CE1 1 
ATOM   2165  C CE2 . PHE A 1 277  ? -17.689 112.817 26.672  1.00 15.29 ? 277  PHE A CE2 1 
ATOM   2166  C CZ  . PHE A 1 277  ? -17.897 114.132 27.120  1.00 13.46 ? 277  PHE A CZ  1 
ATOM   2167  N N   . PRO A 1 278  ? -11.386 112.473 23.835  1.00 15.98 ? 278  PRO A N   1 
ATOM   2168  C CA  . PRO A 1 278  ? -9.926  112.381 23.721  1.00 15.14 ? 278  PRO A CA  1 
ATOM   2169  C C   . PRO A 1 278  ? -9.345  113.393 22.726  1.00 16.10 ? 278  PRO A C   1 
ATOM   2170  O O   . PRO A 1 278  ? -8.341  114.072 22.994  1.00 15.52 ? 278  PRO A O   1 
ATOM   2171  C CB  . PRO A 1 278  ? -9.702  110.943 23.253  1.00 14.44 ? 278  PRO A CB  1 
ATOM   2172  C CG  . PRO A 1 278  ? -10.912 110.212 23.733  1.00 13.92 ? 278  PRO A CG  1 
ATOM   2173  C CD  . PRO A 1 278  ? -12.020 111.190 23.489  1.00 15.72 ? 278  PRO A CD  1 
ATOM   2174  N N   . GLN A 1 279  ? -9.982  113.475 21.570  1.00 15.63 ? 279  GLN A N   1 
ATOM   2175  C CA  . GLN A 1 279  ? -9.527  114.361 20.525  1.00 16.84 ? 279  GLN A CA  1 
ATOM   2176  C C   . GLN A 1 279  ? -9.506  115.805 20.995  1.00 16.34 ? 279  GLN A C   1 
ATOM   2177  O O   . GLN A 1 279  ? -8.525  116.518 20.782  1.00 16.70 ? 279  GLN A O   1 
ATOM   2178  C CB  . GLN A 1 279  ? -10.416 114.203 19.286  1.00 17.28 ? 279  GLN A CB  1 
ATOM   2179  C CG  . GLN A 1 279  ? -10.080 115.136 18.147  1.00 17.88 ? 279  GLN A CG  1 
ATOM   2180  C CD  . GLN A 1 279  ? -10.832 114.788 16.871  1.00 20.54 ? 279  GLN A CD  1 
ATOM   2181  O OE1 . GLN A 1 279  ? -12.041 114.559 16.898  1.00 20.30 ? 279  GLN A OE1 1 
ATOM   2182  N NE2 . GLN A 1 279  ? -10.116 114.751 15.743  1.00 19.94 ? 279  GLN A NE2 1 
ATOM   2183  N N   . ASN A 1 280  ? -10.563 116.232 21.672  1.00 16.20 ? 280  ASN A N   1 
ATOM   2184  C CA  . ASN A 1 280  ? -10.626 117.608 22.120  1.00 16.01 ? 280  ASN A CA  1 
ATOM   2185  C C   . ASN A 1 280  ? -9.960  117.941 23.459  1.00 16.86 ? 280  ASN A C   1 
ATOM   2186  O O   . ASN A 1 280  ? -10.018 119.090 23.923  1.00 15.94 ? 280  ASN A O   1 
ATOM   2187  C CB  . ASN A 1 280  ? -12.075 118.064 22.080  1.00 16.83 ? 280  ASN A CB  1 
ATOM   2188  C CG  . ASN A 1 280  ? -12.618 118.087 20.665  1.00 16.24 ? 280  ASN A CG  1 
ATOM   2189  O OD1 . ASN A 1 280  ? -12.236 118.934 19.851  1.00 17.34 ? 280  ASN A OD1 1 
ATOM   2190  N ND2 . ASN A 1 280  ? -13.494 117.146 20.357  1.00 17.14 ? 280  ASN A ND2 1 
ATOM   2191  N N   . THR A 1 281  ? -9.319  116.943 24.069  1.00 16.20 ? 281  THR A N   1 
ATOM   2192  C CA  . THR A 1 281  ? -8.587  117.146 25.318  1.00 16.04 ? 281  THR A CA  1 
ATOM   2193  C C   . THR A 1 281  ? -7.181  116.568 25.148  1.00 15.77 ? 281  THR A C   1 
ATOM   2194  O O   . THR A 1 281  ? -6.258  117.281 24.751  1.00 15.99 ? 281  THR A O   1 
ATOM   2195  C CB  . THR A 1 281  ? -9.289  116.476 26.543  1.00 17.68 ? 281  THR A CB  1 
ATOM   2196  O OG1 . THR A 1 281  ? -9.444  115.066 26.316  1.00 16.79 ? 281  THR A OG1 1 
ATOM   2197  C CG2 . THR A 1 281  ? -10.656 117.125 26.796  1.00 14.62 ? 281  THR A CG2 1 
ATOM   2198  N N   . LEU A 1 282  ? -7.031  115.272 25.421  1.00 14.89 ? 282  LEU A N   1 
ATOM   2199  C CA  . LEU A 1 282  ? -5.743  114.577 25.297  1.00 13.55 ? 282  LEU A CA  1 
ATOM   2200  C C   . LEU A 1 282  ? -4.940  114.962 24.051  1.00 13.16 ? 282  LEU A C   1 
ATOM   2201  O O   . LEU A 1 282  ? -3.780  115.353 24.160  1.00 11.22 ? 282  LEU A O   1 
ATOM   2202  C CB  . LEU A 1 282  ? -5.950  113.050 25.306  1.00 9.88  ? 282  LEU A CB  1 
ATOM   2203  C CG  . LEU A 1 282  ? -4.709  112.168 25.099  1.00 7.53  ? 282  LEU A CG  1 
ATOM   2204  C CD1 . LEU A 1 282  ? -3.699  112.391 26.229  1.00 7.49  ? 282  LEU A CD1 1 
ATOM   2205  C CD2 . LEU A 1 282  ? -5.128  110.718 25.058  1.00 6.49  ? 282  LEU A CD2 1 
ATOM   2206  N N   . HIS A 1 283  ? -5.570  114.858 22.881  1.00 13.42 ? 283  HIS A N   1 
ATOM   2207  C CA  . HIS A 1 283  ? -4.916  115.162 21.608  1.00 13.18 ? 283  HIS A CA  1 
ATOM   2208  C C   . HIS A 1 283  ? -4.776  116.651 21.221  1.00 13.28 ? 283  HIS A C   1 
ATOM   2209  O O   . HIS A 1 283  ? -4.361  116.952 20.102  1.00 11.04 ? 283  HIS A O   1 
ATOM   2210  C CB  . HIS A 1 283  ? -5.622  114.427 20.448  1.00 14.29 ? 283  HIS A CB  1 
ATOM   2211  C CG  . HIS A 1 283  ? -5.774  112.942 20.644  1.00 16.16 ? 283  HIS A CG  1 
ATOM   2212  N ND1 . HIS A 1 283  ? -4.905  112.188 21.407  1.00 16.52 ? 283  HIS A ND1 1 
ATOM   2213  C CD2 . HIS A 1 283  ? -6.679  112.069 20.136  1.00 15.33 ? 283  HIS A CD2 1 
ATOM   2214  C CE1 . HIS A 1 283  ? -5.270  110.917 21.361  1.00 14.74 ? 283  HIS A CE1 1 
ATOM   2215  N NE2 . HIS A 1 283  ? -6.342  110.818 20.597  1.00 14.25 ? 283  HIS A NE2 1 
ATOM   2216  N N   . SER A 1 284  ? -5.091  117.577 22.126  1.00 13.03 ? 284  SER A N   1 
ATOM   2217  C CA  . SER A 1 284  ? -4.995  119.003 21.798  1.00 12.77 ? 284  SER A CA  1 
ATOM   2218  C C   . SER A 1 284  ? -4.359  119.803 22.922  1.00 15.61 ? 284  SER A C   1 
ATOM   2219  O O   . SER A 1 284  ? -4.423  121.043 22.937  1.00 17.10 ? 284  SER A O   1 
ATOM   2220  C CB  . SER A 1 284  ? -6.382  119.588 21.528  1.00 10.35 ? 284  SER A CB  1 
ATOM   2221  O OG  . SER A 1 284  ? -7.071  118.853 20.544  1.00 11.63 ? 284  SER A OG  1 
ATOM   2222  N N   . MET A 1 285  ? -3.752  119.095 23.865  1.00 15.53 ? 285  MET A N   1 
ATOM   2223  C CA  . MET A 1 285  ? -3.136  119.745 25.004  1.00 15.01 ? 285  MET A CA  1 
ATOM   2224  C C   . MET A 1 285  ? -1.857  120.500 24.689  1.00 16.60 ? 285  MET A C   1 
ATOM   2225  O O   . MET A 1 285  ? -1.117  120.181 23.746  1.00 16.60 ? 285  MET A O   1 
ATOM   2226  C CB  . MET A 1 285  ? -2.838  118.719 26.087  1.00 14.20 ? 285  MET A CB  1 
ATOM   2227  C CG  . MET A 1 285  ? -4.068  118.007 26.639  1.00 14.78 ? 285  MET A CG  1 
ATOM   2228  S SD  . MET A 1 285  ? -5.174  119.121 27.500  1.00 14.72 ? 285  MET A SD  1 
ATOM   2229  C CE  . MET A 1 285  ? -4.230  119.467 28.999  1.00 12.74 ? 285  MET A CE  1 
ATOM   2230  N N   . TYR A 1 286  ? -1.624  121.526 25.495  1.00 16.67 ? 286  TYR A N   1 
ATOM   2231  C CA  . TYR A 1 286  ? -0.429  122.338 25.415  1.00 16.95 ? 286  TYR A CA  1 
ATOM   2232  C C   . TYR A 1 286  ? -0.122  123.018 24.092  1.00 20.08 ? 286  TYR A C   1 
ATOM   2233  O O   . TYR A 1 286  ? 1.007   122.959 23.592  1.00 19.54 ? 286  TYR A O   1 
ATOM   2234  C CB  . TYR A 1 286  ? 0.758   121.492 25.888  1.00 14.07 ? 286  TYR A CB  1 
ATOM   2235  C CG  . TYR A 1 286  ? 0.407   120.684 27.136  1.00 16.28 ? 286  TYR A CG  1 
ATOM   2236  C CD1 . TYR A 1 286  ? -0.334  121.268 28.179  1.00 13.54 ? 286  TYR A CD1 1 
ATOM   2237  C CD2 . TYR A 1 286  ? 0.796   119.348 27.274  1.00 11.37 ? 286  TYR A CD2 1 
ATOM   2238  C CE1 . TYR A 1 286  ? -0.669  120.550 29.307  1.00 12.55 ? 286  TYR A CE1 1 
ATOM   2239  C CE2 . TYR A 1 286  ? 0.464   118.625 28.402  1.00 10.18 ? 286  TYR A CE2 1 
ATOM   2240  C CZ  . TYR A 1 286  ? -0.267  119.229 29.420  1.00 13.02 ? 286  TYR A CZ  1 
ATOM   2241  O OH  . TYR A 1 286  ? -0.579  118.536 30.575  1.00 9.88  ? 286  TYR A OH  1 
ATOM   2242  N N   . GLU A 1 287  ? -1.124  123.677 23.521  1.00 23.14 ? 287  GLU A N   1 
ATOM   2243  C CA  . GLU A 1 287  ? -0.887  124.407 22.288  1.00 26.75 ? 287  GLU A CA  1 
ATOM   2244  C C   . GLU A 1 287  ? 0.096   125.511 22.733  1.00 26.59 ? 287  GLU A C   1 
ATOM   2245  O O   . GLU A 1 287  ? 0.925   126.005 21.959  1.00 26.38 ? 287  GLU A O   1 
ATOM   2246  C CB  . GLU A 1 287  ? -2.199  124.982 21.751  1.00 30.80 ? 287  GLU A CB  1 
ATOM   2247  C CG  . GLU A 1 287  ? -2.200  125.156 20.239  1.00 38.82 ? 287  GLU A CG  1 
ATOM   2248  C CD  . GLU A 1 287  ? -3.603  125.243 19.641  1.00 44.24 ? 287  GLU A CD  1 
ATOM   2249  O OE1 . GLU A 1 287  ? -4.288  124.192 19.563  1.00 43.77 ? 287  GLU A OE1 1 
ATOM   2250  O OE2 . GLU A 1 287  ? -4.014  126.367 19.254  1.00 46.63 ? 287  GLU A OE2 1 
ATOM   2251  N N   . SER A 1 288  ? 0.009   125.866 24.009  1.00 25.91 ? 288  SER A N   1 
ATOM   2252  C CA  . SER A 1 288  ? 0.913   126.839 24.607  1.00 27.54 ? 288  SER A CA  1 
ATOM   2253  C C   . SER A 1 288  ? 1.448   126.206 25.877  1.00 27.58 ? 288  SER A C   1 
ATOM   2254  O O   . SER A 1 288  ? 0.713   126.015 26.831  1.00 31.83 ? 288  SER A O   1 
ATOM   2255  C CB  . SER A 1 288  ? 0.197   128.150 24.947  1.00 24.97 ? 288  SER A CB  1 
ATOM   2256  O OG  . SER A 1 288  ? -0.097  128.869 23.762  1.00 26.43 ? 288  SER A OG  1 
ATOM   2257  N N   . LEU A 1 289  ? 2.717   125.836 25.873  1.00 27.23 ? 289  LEU A N   1 
ATOM   2258  C CA  . LEU A 1 289  ? 3.313   125.240 27.046  1.00 27.77 ? 289  LEU A CA  1 
ATOM   2259  C C   . LEU A 1 289  ? 4.151   126.333 27.685  1.00 28.26 ? 289  LEU A C   1 
ATOM   2260  O O   . LEU A 1 289  ? 5.063   126.877 27.076  1.00 28.96 ? 289  LEU A O   1 
ATOM   2261  C CB  . LEU A 1 289  ? 4.176   124.043 26.665  1.00 27.73 ? 289  LEU A CB  1 
ATOM   2262  C CG  . LEU A 1 289  ? 4.693   123.285 27.885  1.00 26.52 ? 289  LEU A CG  1 
ATOM   2263  C CD1 . LEU A 1 289  ? 3.518   122.871 28.776  1.00 24.25 ? 289  LEU A CD1 1 
ATOM   2264  C CD2 . LEU A 1 289  ? 5.488   122.077 27.421  1.00 26.07 ? 289  LEU A CD2 1 
ATOM   2265  N N   . GLU A 1 290  ? 3.841   126.635 28.929  1.00 28.62 ? 290  GLU A N   1 
ATOM   2266  C CA  . GLU A 1 290  ? 4.497   127.712 29.636  1.00 29.30 ? 290  GLU A CA  1 
ATOM   2267  C C   . GLU A 1 290  ? 5.240   127.234 30.881  1.00 29.13 ? 290  GLU A C   1 
ATOM   2268  O O   . GLU A 1 290  ? 5.894   128.037 31.553  1.00 27.35 ? 290  GLU A O   1 
ATOM   2269  C CB  . GLU A 1 290  ? 3.406   128.719 29.994  1.00 31.04 ? 290  GLU A CB  1 
ATOM   2270  C CG  . GLU A 1 290  ? 3.792   129.960 30.718  1.00 35.46 ? 290  GLU A CG  1 
ATOM   2271  C CD  . GLU A 1 290  ? 2.558   130.777 31.061  1.00 37.45 ? 290  GLU A CD  1 
ATOM   2272  O OE1 . GLU A 1 290  ? 1.762   131.063 30.136  1.00 37.33 ? 290  GLU A OE1 1 
ATOM   2273  O OE2 . GLU A 1 290  ? 2.379   131.126 32.249  1.00 38.85 ? 290  GLU A OE2 1 
ATOM   2274  N N   . GLY A 1 291  ? 5.136   125.937 31.187  1.00 27.72 ? 291  GLY A N   1 
ATOM   2275  C CA  . GLY A 1 291  ? 5.811   125.404 32.358  1.00 27.21 ? 291  GLY A CA  1 
ATOM   2276  C C   . GLY A 1 291  ? 5.359   124.031 32.836  1.00 27.30 ? 291  GLY A C   1 
ATOM   2277  O O   . GLY A 1 291  ? 4.502   123.392 32.220  1.00 26.21 ? 291  GLY A O   1 
ATOM   2278  N N   . GLY A 1 292  ? 5.937   123.591 33.957  1.00 25.93 ? 292  GLY A N   1 
ATOM   2279  C CA  . GLY A 1 292  ? 5.627   122.287 34.521  1.00 24.05 ? 292  GLY A CA  1 
ATOM   2280  C C   . GLY A 1 292  ? 6.817   121.335 34.384  1.00 23.92 ? 292  GLY A C   1 
ATOM   2281  O O   . GLY A 1 292  ? 7.867   121.720 33.862  1.00 24.00 ? 292  GLY A O   1 
ATOM   2282  N N   . TYR A 1 293  ? 6.654   120.088 34.819  1.00 22.26 ? 293  TYR A N   1 
ATOM   2283  C CA  . TYR A 1 293  ? 7.734   119.102 34.766  1.00 20.79 ? 293  TYR A CA  1 
ATOM   2284  C C   . TYR A 1 293  ? 7.301   117.752 34.186  1.00 20.80 ? 293  TYR A C   1 
ATOM   2285  O O   . TYR A 1 293  ? 6.133   117.392 34.242  1.00 21.65 ? 293  TYR A O   1 
ATOM   2286  C CB  . TYR A 1 293  ? 8.270   118.877 36.177  1.00 20.69 ? 293  TYR A CB  1 
ATOM   2287  C CG  . TYR A 1 293  ? 8.809   120.128 36.808  1.00 21.75 ? 293  TYR A CG  1 
ATOM   2288  C CD1 . TYR A 1 293  ? 10.104  120.569 36.515  1.00 24.18 ? 293  TYR A CD1 1 
ATOM   2289  C CD2 . TYR A 1 293  ? 8.007   120.917 37.631  1.00 19.45 ? 293  TYR A CD2 1 
ATOM   2290  C CE1 . TYR A 1 293  ? 10.586  121.773 37.019  1.00 25.44 ? 293  TYR A CE1 1 
ATOM   2291  C CE2 . TYR A 1 293  ? 8.469   122.120 38.143  1.00 22.51 ? 293  TYR A CE2 1 
ATOM   2292  C CZ  . TYR A 1 293  ? 9.764   122.546 37.830  1.00 25.68 ? 293  TYR A CZ  1 
ATOM   2293  O OH  . TYR A 1 293  ? 10.243  123.740 38.315  1.00 26.45 ? 293  TYR A OH  1 
ATOM   2294  N N   . CYS A 1 294  ? 8.248   117.009 33.629  1.00 18.86 ? 294  CYS A N   1 
ATOM   2295  C CA  . CYS A 1 294  ? 7.952   115.698 33.081  1.00 18.07 ? 294  CYS A CA  1 
ATOM   2296  C C   . CYS A 1 294  ? 9.133   114.788 33.423  1.00 18.11 ? 294  CYS A C   1 
ATOM   2297  O O   . CYS A 1 294  ? 10.244  115.258 33.658  1.00 17.53 ? 294  CYS A O   1 
ATOM   2298  C CB  . CYS A 1 294  ? 7.727   115.774 31.570  1.00 17.07 ? 294  CYS A CB  1 
ATOM   2299  S SG  . CYS A 1 294  ? 9.205   115.845 30.541  1.00 21.66 ? 294  CYS A SG  1 
ATOM   2300  N N   . PRO A 1 295  ? 8.905   113.473 33.462  1.00 17.23 ? 295  PRO A N   1 
ATOM   2301  C CA  . PRO A 1 295  ? 9.960   112.512 33.790  1.00 17.23 ? 295  PRO A CA  1 
ATOM   2302  C C   . PRO A 1 295  ? 11.133  112.566 32.822  1.00 17.01 ? 295  PRO A C   1 
ATOM   2303  O O   . PRO A 1 295  ? 10.986  112.943 31.666  1.00 17.92 ? 295  PRO A O   1 
ATOM   2304  C CB  . PRO A 1 295  ? 9.260   111.158 33.680  1.00 15.78 ? 295  PRO A CB  1 
ATOM   2305  C CG  . PRO A 1 295  ? 7.810   111.488 33.656  1.00 18.90 ? 295  PRO A CG  1 
ATOM   2306  C CD  . PRO A 1 295  ? 7.735   112.778 32.919  1.00 16.43 ? 295  PRO A CD  1 
ATOM   2307  N N   . ASN A 1 296  ? 12.300  112.186 33.315  1.00 16.61 ? 296  ASN A N   1 
ATOM   2308  C CA  . ASN A 1 296  ? 13.492  112.108 32.499  1.00 16.90 ? 296  ASN A CA  1 
ATOM   2309  C C   . ASN A 1 296  ? 14.008  110.701 32.736  1.00 16.94 ? 296  ASN A C   1 
ATOM   2310  O O   . ASN A 1 296  ? 14.698  110.437 33.723  1.00 16.73 ? 296  ASN A O   1 
ATOM   2311  C CB  . ASN A 1 296  ? 14.545  113.124 32.925  1.00 18.97 ? 296  ASN A CB  1 
ATOM   2312  C CG  . ASN A 1 296  ? 15.887  112.875 32.253  1.00 20.44 ? 296  ASN A CG  1 
ATOM   2313  O OD1 . ASN A 1 296  ? 15.954  112.265 31.190  1.00 21.64 ? 296  ASN A OD1 1 
ATOM   2314  N ND2 . ASN A 1 296  ? 16.960  113.348 32.870  1.00 23.38 ? 296  ASN A ND2 1 
ATOM   2315  N N   . LEU A 1 297  ? 13.643  109.797 31.834  1.00 15.19 ? 297  LEU A N   1 
ATOM   2316  C CA  . LEU A 1 297  ? 14.051  108.413 31.937  1.00 14.17 ? 297  LEU A CA  1 
ATOM   2317  C C   . LEU A 1 297  ? 15.147  108.034 30.951  1.00 13.51 ? 297  LEU A C   1 
ATOM   2318  O O   . LEU A 1 297  ? 15.281  108.624 29.878  1.00 10.81 ? 297  LEU A O   1 
ATOM   2319  C CB  . LEU A 1 297  ? 12.839  107.493 31.718  1.00 14.64 ? 297  LEU A CB  1 
ATOM   2320  C CG  . LEU A 1 297  ? 12.035  106.951 32.917  1.00 16.14 ? 297  LEU A CG  1 
ATOM   2321  C CD1 . LEU A 1 297  ? 11.710  108.054 33.932  1.00 12.63 ? 297  LEU A CD1 1 
ATOM   2322  C CD2 . LEU A 1 297  ? 10.752  106.299 32.394  1.00 13.41 ? 297  LEU A CD2 1 
ATOM   2323  N N   . GLU A 1 298  ? 15.946  107.049 31.349  1.00 14.02 ? 298  GLU A N   1 
ATOM   2324  C CA  . GLU A 1 298  ? 16.991  106.510 30.501  1.00 12.68 ? 298  GLU A CA  1 
ATOM   2325  C C   . GLU A 1 298  ? 16.542  105.090 30.173  1.00 13.54 ? 298  GLU A C   1 
ATOM   2326  O O   . GLU A 1 298  ? 16.156  104.333 31.062  1.00 13.66 ? 298  GLU A O   1 
ATOM   2327  C CB  . GLU A 1 298  ? 18.336  106.494 31.225  1.00 13.25 ? 298  GLU A CB  1 
ATOM   2328  C CG  . GLU A 1 298  ? 19.331  105.516 30.617  1.00 18.48 ? 298  GLU A CG  1 
ATOM   2329  C CD  . GLU A 1 298  ? 20.750  106.059 30.499  1.00 20.55 ? 298  GLU A CD  1 
ATOM   2330  O OE1 . GLU A 1 298  ? 20.955  107.029 29.742  1.00 20.91 ? 298  GLU A OE1 1 
ATOM   2331  O OE2 . GLU A 1 298  ? 21.661  105.501 31.154  1.00 22.06 ? 298  GLU A OE2 1 
ATOM   2332  N N   . TRP A 1 299  ? 16.555  104.737 28.892  1.00 15.02 ? 299  TRP A N   1 
ATOM   2333  C CA  . TRP A 1 299  ? 16.151  103.399 28.467  1.00 13.50 ? 299  TRP A CA  1 
ATOM   2334  C C   . TRP A 1 299  ? 17.423  102.557 28.504  1.00 13.40 ? 299  TRP A C   1 
ATOM   2335  O O   . TRP A 1 299  ? 18.350  102.802 27.742  1.00 14.40 ? 299  TRP A O   1 
ATOM   2336  C CB  . TRP A 1 299  ? 15.582  103.463 27.051  1.00 12.42 ? 299  TRP A CB  1 
ATOM   2337  C CG  . TRP A 1 299  ? 14.858  102.223 26.614  1.00 15.77 ? 299  TRP A CG  1 
ATOM   2338  C CD1 . TRP A 1 299  ? 14.876  101.001 27.221  1.00 15.87 ? 299  TRP A CD1 1 
ATOM   2339  C CD2 . TRP A 1 299  ? 13.999  102.088 25.471  1.00 14.85 ? 299  TRP A CD2 1 
ATOM   2340  N NE1 . TRP A 1 299  ? 14.079  100.118 26.532  1.00 13.78 ? 299  TRP A NE1 1 
ATOM   2341  C CE2 . TRP A 1 299  ? 13.530  100.761 25.456  1.00 13.44 ? 299  TRP A CE2 1 
ATOM   2342  C CE3 . TRP A 1 299  ? 13.583  102.963 24.462  1.00 14.91 ? 299  TRP A CE3 1 
ATOM   2343  C CZ2 . TRP A 1 299  ? 12.665  100.287 24.471  1.00 13.18 ? 299  TRP A CZ2 1 
ATOM   2344  C CZ3 . TRP A 1 299  ? 12.722  102.487 23.485  1.00 14.59 ? 299  TRP A CZ3 1 
ATOM   2345  C CH2 . TRP A 1 299  ? 12.275  101.163 23.499  1.00 12.26 ? 299  TRP A CH2 1 
ATOM   2346  N N   . LEU A 1 300  ? 17.475  101.588 29.412  1.00 13.55 ? 300  LEU A N   1 
ATOM   2347  C CA  . LEU A 1 300  ? 18.641  100.724 29.564  1.00 13.52 ? 300  LEU A CA  1 
ATOM   2348  C C   . LEU A 1 300  ? 18.849  99.770  28.389  1.00 14.94 ? 300  LEU A C   1 
ATOM   2349  O O   . LEU A 1 300  ? 17.927  99.518  27.612  1.00 13.59 ? 300  LEU A O   1 
ATOM   2350  C CB  . LEU A 1 300  ? 18.516  99.899  30.855  1.00 13.54 ? 300  LEU A CB  1 
ATOM   2351  C CG  . LEU A 1 300  ? 19.001  100.486 32.192  1.00 15.75 ? 300  LEU A CG  1 
ATOM   2352  C CD1 . LEU A 1 300  ? 18.370  101.834 32.437  1.00 16.80 ? 300  LEU A CD1 1 
ATOM   2353  C CD2 . LEU A 1 300  ? 18.649  99.531  33.326  1.00 12.53 ? 300  LEU A CD2 1 
ATOM   2354  N N   . GLU A 1 301  ? 20.065  99.237  28.276  1.00 15.66 ? 301  GLU A N   1 
ATOM   2355  C CA  . GLU A 1 301  ? 20.410  98.285  27.220  1.00 17.90 ? 301  GLU A CA  1 
ATOM   2356  C C   . GLU A 1 301  ? 20.411  96.901  27.869  1.00 17.22 ? 301  GLU A C   1 
ATOM   2357  O O   . GLU A 1 301  ? 20.854  96.741  29.004  1.00 17.80 ? 301  GLU A O   1 
ATOM   2358  C CB  . GLU A 1 301  ? 21.807  98.568  26.667  1.00 22.13 ? 301  GLU A CB  1 
ATOM   2359  C CG  . GLU A 1 301  ? 22.058  99.997  26.177  1.00 27.81 ? 301  GLU A CG  1 
ATOM   2360  C CD  . GLU A 1 301  ? 21.353  100.299 24.871  1.00 32.38 ? 301  GLU A CD  1 
ATOM   2361  O OE1 . GLU A 1 301  ? 21.151  99.351  24.076  1.00 33.84 ? 301  GLU A OE1 1 
ATOM   2362  O OE2 . GLU A 1 301  ? 21.012  101.481 24.630  1.00 36.21 ? 301  GLU A OE2 1 
ATOM   2363  N N   . PRO A 1 302  ? 19.921  95.876  27.163  1.00 15.53 ? 302  PRO A N   1 
ATOM   2364  C CA  . PRO A 1 302  ? 19.335  95.868  25.819  1.00 13.44 ? 302  PRO A CA  1 
ATOM   2365  C C   . PRO A 1 302  ? 17.947  96.503  25.859  1.00 12.14 ? 302  PRO A C   1 
ATOM   2366  O O   . PRO A 1 302  ? 17.150  96.183  26.743  1.00 12.11 ? 302  PRO A O   1 
ATOM   2367  C CB  . PRO A 1 302  ? 19.243  94.376  25.488  1.00 12.53 ? 302  PRO A CB  1 
ATOM   2368  C CG  . PRO A 1 302  ? 20.104  93.693  26.529  1.00 14.79 ? 302  PRO A CG  1 
ATOM   2369  C CD  . PRO A 1 302  ? 19.894  94.527  27.743  1.00 13.14 ? 302  PRO A CD  1 
ATOM   2370  N N   . ARG A 1 303  ? 17.643  97.376  24.905  1.00 12.44 ? 303  ARG A N   1 
ATOM   2371  C CA  . ARG A 1 303  ? 16.335  98.009  24.889  1.00 14.42 ? 303  ARG A CA  1 
ATOM   2372  C C   . ARG A 1 303  ? 15.200  96.986  24.999  1.00 16.18 ? 303  ARG A C   1 
ATOM   2373  O O   . ARG A 1 303  ? 14.147  97.291  25.565  1.00 16.69 ? 303  ARG A O   1 
ATOM   2374  C CB  . ARG A 1 303  ? 16.168  98.874  23.636  1.00 15.41 ? 303  ARG A CB  1 
ATOM   2375  C CG  . ARG A 1 303  ? 16.429  100.389 23.858  1.00 16.06 ? 303  ARG A CG  1 
ATOM   2376  C CD  . ARG A 1 303  ? 16.304  101.134 22.541  1.00 19.10 ? 303  ARG A CD  1 
ATOM   2377  N NE  . ARG A 1 303  ? 16.268  102.597 22.627  1.00 20.14 ? 303  ARG A NE  1 
ATOM   2378  C CZ  . ARG A 1 303  ? 17.130  103.336 23.315  1.00 23.20 ? 303  ARG A CZ  1 
ATOM   2379  N NH1 . ARG A 1 303  ? 18.109  102.754 24.014  1.00 26.20 ? 303  ARG A NH1 1 
ATOM   2380  N NH2 . ARG A 1 303  ? 17.046  104.662 23.265  1.00 19.59 ? 303  ARG A NH2 1 
ATOM   2381  N N   . SER A 1 304  ? 15.434  95.767  24.510  1.00 15.62 ? 304  SER A N   1 
ATOM   2382  C CA  . SER A 1 304  ? 14.426  94.710  24.546  1.00 17.38 ? 304  SER A CA  1 
ATOM   2383  C C   . SER A 1 304  ? 14.064  94.206  25.944  1.00 18.35 ? 304  SER A C   1 
ATOM   2384  O O   . SER A 1 304  ? 13.146  93.398  26.095  1.00 19.77 ? 304  SER A O   1 
ATOM   2385  C CB  . SER A 1 304  ? 14.874  93.518  23.698  1.00 18.71 ? 304  SER A CB  1 
ATOM   2386  O OG  . SER A 1 304  ? 15.940  92.825  24.323  1.00 23.01 ? 304  SER A OG  1 
ATOM   2387  N N   . ASP A 1 305  ? 14.796  94.651  26.958  1.00 18.32 ? 305  ASP A N   1 
ATOM   2388  C CA  . ASP A 1 305  ? 14.506  94.254  28.331  1.00 19.59 ? 305  ASP A CA  1 
ATOM   2389  C C   . ASP A 1 305  ? 13.416  95.160  28.905  1.00 17.91 ? 305  ASP A C   1 
ATOM   2390  O O   . ASP A 1 305  ? 12.822  94.843  29.928  1.00 16.16 ? 305  ASP A O   1 
ATOM   2391  C CB  . ASP A 1 305  ? 15.756  94.374  29.204  1.00 24.12 ? 305  ASP A CB  1 
ATOM   2392  C CG  . ASP A 1 305  ? 16.534  93.093  29.278  1.00 28.96 ? 305  ASP A CG  1 
ATOM   2393  O OD1 . ASP A 1 305  ? 16.220  92.179  28.478  1.00 34.19 ? 305  ASP A OD1 1 
ATOM   2394  O OD2 . ASP A 1 305  ? 17.458  93.003  30.126  1.00 30.42 ? 305  ASP A OD2 1 
ATOM   2395  N N   . TYR A 1 306  ? 13.179  96.288  28.238  1.00 15.43 ? 306  TYR A N   1 
ATOM   2396  C CA  . TYR A 1 306  ? 12.173  97.260  28.660  1.00 13.98 ? 306  TYR A CA  1 
ATOM   2397  C C   . TYR A 1 306  ? 12.405  97.712  30.085  1.00 13.13 ? 306  TYR A C   1 
ATOM   2398  O O   . TYR A 1 306  ? 11.467  97.867  30.850  1.00 12.96 ? 306  TYR A O   1 
ATOM   2399  C CB  . TYR A 1 306  ? 10.776  96.654  28.523  1.00 12.56 ? 306  TYR A CB  1 
ATOM   2400  C CG  . TYR A 1 306  ? 10.441  96.342  27.096  1.00 11.89 ? 306  TYR A CG  1 
ATOM   2401  C CD1 . TYR A 1 306  ? 10.290  97.370  26.149  1.00 13.34 ? 306  TYR A CD1 1 
ATOM   2402  C CD2 . TYR A 1 306  ? 10.343  95.022  26.661  1.00 14.01 ? 306  TYR A CD2 1 
ATOM   2403  C CE1 . TYR A 1 306  ? 10.052  97.082  24.808  1.00 11.07 ? 306  TYR A CE1 1 
ATOM   2404  C CE2 . TYR A 1 306  ? 10.112  94.723  25.322  1.00 14.25 ? 306  TYR A CE2 1 
ATOM   2405  C CZ  . TYR A 1 306  ? 9.968   95.753  24.408  1.00 13.35 ? 306  TYR A CZ  1 
ATOM   2406  O OH  . TYR A 1 306  ? 9.743   95.433  23.098  1.00 15.63 ? 306  TYR A OH  1 
ATOM   2407  N N   . LYS A 1 307  ? 13.670  97.906  30.433  1.00 13.96 ? 307  LYS A N   1 
ATOM   2408  C CA  . LYS A 1 307  ? 14.053  98.333  31.764  1.00 13.53 ? 307  LYS A CA  1 
ATOM   2409  C C   . LYS A 1 307  ? 14.518  99.773  31.673  1.00 15.01 ? 307  LYS A C   1 
ATOM   2410  O O   . LYS A 1 307  ? 15.423  100.109 30.901  1.00 13.66 ? 307  LYS A O   1 
ATOM   2411  C CB  . LYS A 1 307  ? 15.175  97.454  32.283  1.00 15.14 ? 307  LYS A CB  1 
ATOM   2412  C CG  . LYS A 1 307  ? 15.423  97.600  33.753  1.00 21.02 ? 307  LYS A CG  1 
ATOM   2413  C CD  . LYS A 1 307  ? 16.559  96.700  34.221  1.00 20.83 ? 307  LYS A CD  1 
ATOM   2414  C CE  . LYS A 1 307  ? 16.781  96.855  35.722  1.00 20.94 ? 307  LYS A CE  1 
ATOM   2415  N NZ  . LYS A 1 307  ? 18.120  96.352  36.131  1.00 21.43 ? 307  LYS A NZ  1 
ATOM   2416  N N   . PHE A 1 308  ? 13.880  100.623 32.470  1.00 15.36 ? 308  PHE A N   1 
ATOM   2417  C CA  . PHE A 1 308  ? 14.171  102.045 32.494  1.00 13.56 ? 308  PHE A CA  1 
ATOM   2418  C C   . PHE A 1 308  ? 14.654  102.507 33.860  1.00 14.98 ? 308  PHE A C   1 
ATOM   2419  O O   . PHE A 1 308  ? 14.401  101.855 34.883  1.00 17.47 ? 308  PHE A O   1 
ATOM   2420  C CB  . PHE A 1 308  ? 12.902  102.808 32.134  1.00 12.84 ? 308  PHE A CB  1 
ATOM   2421  C CG  . PHE A 1 308  ? 12.348  102.459 30.787  1.00 12.53 ? 308  PHE A CG  1 
ATOM   2422  C CD1 . PHE A 1 308  ? 12.618  103.260 29.680  1.00 12.41 ? 308  PHE A CD1 1 
ATOM   2423  C CD2 . PHE A 1 308  ? 11.554  101.330 30.619  1.00 12.77 ? 308  PHE A CD2 1 
ATOM   2424  C CE1 . PHE A 1 308  ? 12.099  102.943 28.416  1.00 11.90 ? 308  PHE A CE1 1 
ATOM   2425  C CE2 . PHE A 1 308  ? 11.033  101.004 29.368  1.00 11.71 ? 308  PHE A CE2 1 
ATOM   2426  C CZ  . PHE A 1 308  ? 11.311  101.818 28.261  1.00 11.85 ? 308  PHE A CZ  1 
ATOM   2427  N N   . MET A 1 309  ? 15.357  103.630 33.881  1.00 14.63 ? 309  MET A N   1 
ATOM   2428  C CA  . MET A 1 309  ? 15.824  104.197 35.138  1.00 14.25 ? 309  MET A CA  1 
ATOM   2429  C C   . MET A 1 309  ? 15.461  105.672 35.169  1.00 14.43 ? 309  MET A C   1 
ATOM   2430  O O   . MET A 1 309  ? 15.694  106.410 34.204  1.00 12.72 ? 309  MET A O   1 
ATOM   2431  C CB  . MET A 1 309  ? 17.327  104.006 35.312  1.00 15.18 ? 309  MET A CB  1 
ATOM   2432  C CG  . MET A 1 309  ? 17.702  102.589 35.705  1.00 17.08 ? 309  MET A CG  1 
ATOM   2433  S SD  . MET A 1 309  ? 19.432  102.409 36.218  1.00 25.05 ? 309  MET A SD  1 
ATOM   2434  C CE  . MET A 1 309  ? 19.297  102.768 37.973  1.00 14.16 ? 309  MET A CE  1 
ATOM   2435  N N   . TYR A 1 310  ? 14.849  106.077 36.278  1.00 14.08 ? 310  TYR A N   1 
ATOM   2436  C CA  . TYR A 1 310  ? 14.412  107.442 36.479  1.00 13.60 ? 310  TYR A CA  1 
ATOM   2437  C C   . TYR A 1 310  ? 15.587  108.313 36.849  1.00 16.15 ? 310  TYR A C   1 
ATOM   2438  O O   . TYR A 1 310  ? 16.254  108.057 37.850  1.00 15.35 ? 310  TYR A O   1 
ATOM   2439  C CB  . TYR A 1 310  ? 13.390  107.482 37.602  1.00 14.22 ? 310  TYR A CB  1 
ATOM   2440  C CG  . TYR A 1 310  ? 13.102  108.868 38.123  1.00 15.32 ? 310  TYR A CG  1 
ATOM   2441  C CD1 . TYR A 1 310  ? 12.231  109.724 37.444  1.00 14.17 ? 310  TYR A CD1 1 
ATOM   2442  C CD2 . TYR A 1 310  ? 13.691  109.322 39.311  1.00 15.28 ? 310  TYR A CD2 1 
ATOM   2443  C CE1 . TYR A 1 310  ? 11.943  110.993 37.936  1.00 16.75 ? 310  TYR A CE1 1 
ATOM   2444  C CE2 . TYR A 1 310  ? 13.412  110.593 39.811  1.00 15.31 ? 310  TYR A CE2 1 
ATOM   2445  C CZ  . TYR A 1 310  ? 12.533  111.422 39.121  1.00 17.61 ? 310  TYR A CZ  1 
ATOM   2446  O OH  . TYR A 1 310  ? 12.233  112.674 39.613  1.00 19.87 ? 310  TYR A OH  1 
ATOM   2447  N N   . MET A 1 311  ? 15.824  109.360 36.065  1.00 18.25 ? 311  MET A N   1 
ATOM   2448  C CA  . MET A 1 311  ? 16.943  110.253 36.327  1.00 19.94 ? 311  MET A CA  1 
ATOM   2449  C C   . MET A 1 311  ? 16.586  111.648 36.835  1.00 20.57 ? 311  MET A C   1 
ATOM   2450  O O   . MET A 1 311  ? 17.476  112.473 37.048  1.00 22.20 ? 311  MET A O   1 
ATOM   2451  C CB  . MET A 1 311  ? 17.809  110.365 35.077  1.00 20.16 ? 311  MET A CB  1 
ATOM   2452  C CG  . MET A 1 311  ? 18.327  109.015 34.625  1.00 25.18 ? 311  MET A CG  1 
ATOM   2453  S SD  . MET A 1 311  ? 19.647  109.109 33.395  1.00 30.27 ? 311  MET A SD  1 
ATOM   2454  C CE  . MET A 1 311  ? 18.697  109.681 31.908  1.00 27.05 ? 311  MET A CE  1 
ATOM   2455  N N   . GLY A 1 312  ? 15.301  111.911 37.050  1.00 20.56 ? 312  GLY A N   1 
ATOM   2456  C CA  . GLY A 1 312  ? 14.896  113.224 37.529  1.00 19.94 ? 312  GLY A CA  1 
ATOM   2457  C C   . GLY A 1 312  ? 13.777  113.843 36.711  1.00 20.73 ? 312  GLY A C   1 
ATOM   2458  O O   . GLY A 1 312  ? 13.070  113.156 35.984  1.00 19.87 ? 312  GLY A O   1 
ATOM   2459  N N   . VAL A 1 313  ? 13.621  115.153 36.819  1.00 21.72 ? 313  VAL A N   1 
ATOM   2460  C CA  . VAL A 1 313  ? 12.574  115.850 36.090  1.00 22.11 ? 313  VAL A CA  1 
ATOM   2461  C C   . VAL A 1 313  ? 13.138  116.709 34.968  1.00 23.49 ? 313  VAL A C   1 
ATOM   2462  O O   . VAL A 1 313  ? 14.290  117.142 35.024  1.00 23.71 ? 313  VAL A O   1 
ATOM   2463  C CB  . VAL A 1 313  ? 11.771  116.756 37.034  1.00 22.04 ? 313  VAL A CB  1 
ATOM   2464  C CG1 . VAL A 1 313  ? 11.272  115.957 38.220  1.00 21.73 ? 313  VAL A CG1 1 
ATOM   2465  C CG2 . VAL A 1 313  ? 12.641  117.893 37.512  1.00 21.06 ? 313  VAL A CG2 1 
ATOM   2466  N N   . MET A 1 314  ? 12.303  116.958 33.963  1.00 24.96 ? 314  MET A N   1 
ATOM   2467  C CA  . MET A 1 314  ? 12.647  117.771 32.792  1.00 25.53 ? 314  MET A CA  1 
ATOM   2468  C C   . MET A 1 314  ? 11.755  119.018 32.800  1.00 24.45 ? 314  MET A C   1 
ATOM   2469  O O   . MET A 1 314  ? 10.551  118.940 32.559  1.00 23.19 ? 314  MET A O   1 
ATOM   2470  C CB  . MET A 1 314  ? 12.399  116.959 31.519  1.00 28.66 ? 314  MET A CB  1 
ATOM   2471  C CG  . MET A 1 314  ? 12.388  117.756 30.228  1.00 32.34 ? 314  MET A CG  1 
ATOM   2472  S SD  . MET A 1 314  ? 14.033  118.112 29.637  1.00 36.35 ? 314  MET A SD  1 
ATOM   2473  C CE  . MET A 1 314  ? 14.181  119.833 30.142  1.00 37.40 ? 314  MET A CE  1 
ATOM   2474  N N   . PRO A 1 315  ? 12.340  120.184 33.083  1.00 23.75 ? 315  PRO A N   1 
ATOM   2475  C CA  . PRO A 1 315  ? 11.612  121.458 33.134  1.00 23.63 ? 315  PRO A CA  1 
ATOM   2476  C C   . PRO A 1 315  ? 10.980  121.749 31.793  1.00 23.52 ? 315  PRO A C   1 
ATOM   2477  O O   . PRO A 1 315  ? 11.662  121.719 30.768  1.00 25.28 ? 315  PRO A O   1 
ATOM   2478  C CB  . PRO A 1 315  ? 12.705  122.476 33.468  1.00 24.64 ? 315  PRO A CB  1 
ATOM   2479  C CG  . PRO A 1 315  ? 13.764  121.647 34.149  1.00 25.50 ? 315  PRO A CG  1 
ATOM   2480  C CD  . PRO A 1 315  ? 13.773  120.388 33.329  1.00 23.16 ? 315  PRO A CD  1 
ATOM   2481  N N   . LEU A 1 316  ? 9.691   122.045 31.784  1.00 22.29 ? 316  LEU A N   1 
ATOM   2482  C CA  . LEU A 1 316  ? 9.022   122.321 30.523  1.00 21.98 ? 316  LEU A CA  1 
ATOM   2483  C C   . LEU A 1 316  ? 8.992   123.807 30.176  1.00 23.32 ? 316  LEU A C   1 
ATOM   2484  O O   . LEU A 1 316  ? 9.064   124.674 31.055  1.00 24.08 ? 316  LEU A O   1 
ATOM   2485  C CB  . LEU A 1 316  ? 7.600   121.747 30.563  1.00 20.03 ? 316  LEU A CB  1 
ATOM   2486  C CG  . LEU A 1 316  ? 7.561   120.224 30.805  1.00 18.40 ? 316  LEU A CG  1 
ATOM   2487  C CD1 . LEU A 1 316  ? 6.142   119.766 31.111  1.00 14.40 ? 316  LEU A CD1 1 
ATOM   2488  C CD2 . LEU A 1 316  ? 8.131   119.502 29.603  1.00 15.33 ? 316  LEU A CD2 1 
ATOM   2489  N N   . SER A 1 317  ? 8.905   124.099 28.884  1.00 23.48 ? 317  SER A N   1 
ATOM   2490  C CA  . SER A 1 317  ? 8.840   125.480 28.417  1.00 24.63 ? 317  SER A CA  1 
ATOM   2491  C C   . SER A 1 317  ? 8.240   125.494 27.018  1.00 25.86 ? 317  SER A C   1 
ATOM   2492  O O   . SER A 1 317  ? 7.932   124.441 26.465  1.00 27.34 ? 317  SER A O   1 
ATOM   2493  C CB  . SER A 1 317  ? 10.234  126.136 28.433  1.00 24.29 ? 317  SER A CB  1 
ATOM   2494  O OG  . SER A 1 317  ? 11.161  125.487 27.578  1.00 27.89 ? 317  SER A OG  1 
ATOM   2495  N N   . ALA A 1 318  ? 8.051   126.683 26.456  1.00 27.34 ? 318  ALA A N   1 
ATOM   2496  C CA  . ALA A 1 318  ? 7.471   126.819 25.123  1.00 26.80 ? 318  ALA A CA  1 
ATOM   2497  C C   . ALA A 1 318  ? 8.167   125.903 24.122  1.00 27.52 ? 318  ALA A C   1 
ATOM   2498  O O   . ALA A 1 318  ? 7.576   125.486 23.133  1.00 27.49 ? 318  ALA A O   1 
ATOM   2499  C CB  . ALA A 1 318  ? 7.571   128.263 24.668  1.00 24.42 ? 318  ALA A CB  1 
ATOM   2500  N N   . LYS A 1 319  ? 9.435   125.610 24.393  1.00 28.93 ? 319  LYS A N   1 
ATOM   2501  C CA  . LYS A 1 319  ? 10.269  124.741 23.559  1.00 30.53 ? 319  LYS A CA  1 
ATOM   2502  C C   . LYS A 1 319  ? 9.557   123.406 23.239  1.00 30.48 ? 319  LYS A C   1 
ATOM   2503  O O   . LYS A 1 319  ? 9.675   122.875 22.129  1.00 30.77 ? 319  LYS A O   1 
ATOM   2504  C CB  . LYS A 1 319  ? 11.586  124.483 24.319  1.00 34.42 ? 319  LYS A CB  1 
ATOM   2505  C CG  . LYS A 1 319  ? 12.657  123.665 23.620  1.00 36.49 ? 319  LYS A CG  1 
ATOM   2506  C CD  . LYS A 1 319  ? 13.837  123.368 24.575  1.00 39.62 ? 319  LYS A CD  1 
ATOM   2507  C CE  . LYS A 1 319  ? 15.021  122.716 23.826  1.00 43.05 ? 319  LYS A CE  1 
ATOM   2508  N NZ  . LYS A 1 319  ? 16.143  122.260 24.710  1.00 45.32 ? 319  LYS A NZ  1 
ATOM   2509  N N   . TYR A 1 320  ? 8.803   122.885 24.210  1.00 27.90 ? 320  TYR A N   1 
ATOM   2510  C CA  . TYR A 1 320  ? 8.097   121.612 24.053  1.00 24.47 ? 320  TYR A CA  1 
ATOM   2511  C C   . TYR A 1 320  ? 6.593   121.685 23.812  1.00 22.47 ? 320  TYR A C   1 
ATOM   2512  O O   . TYR A 1 320  ? 5.912   120.663 23.895  1.00 22.31 ? 320  TYR A O   1 
ATOM   2513  C CB  . TYR A 1 320  ? 8.350   120.727 25.272  1.00 23.82 ? 320  TYR A CB  1 
ATOM   2514  C CG  . TYR A 1 320  ? 9.810   120.445 25.524  1.00 22.82 ? 320  TYR A CG  1 
ATOM   2515  C CD1 . TYR A 1 320  ? 10.601  119.854 24.544  1.00 21.96 ? 320  TYR A CD1 1 
ATOM   2516  C CD2 . TYR A 1 320  ? 10.401  120.766 26.743  1.00 24.11 ? 320  TYR A CD2 1 
ATOM   2517  C CE1 . TYR A 1 320  ? 11.950  119.587 24.762  1.00 24.51 ? 320  TYR A CE1 1 
ATOM   2518  C CE2 . TYR A 1 320  ? 11.754  120.500 26.979  1.00 25.92 ? 320  TYR A CE2 1 
ATOM   2519  C CZ  . TYR A 1 320  ? 12.520  119.911 25.979  1.00 26.62 ? 320  TYR A CZ  1 
ATOM   2520  O OH  . TYR A 1 320  ? 13.855  119.645 26.196  1.00 31.01 ? 320  TYR A OH  1 
ATOM   2521  N N   . ALA A 1 321  ? 6.074   122.871 23.515  1.00 18.99 ? 321  ALA A N   1 
ATOM   2522  C CA  . ALA A 1 321  ? 4.647   123.019 23.258  1.00 19.37 ? 321  ALA A CA  1 
ATOM   2523  C C   . ALA A 1 321  ? 4.236   122.092 22.112  1.00 19.73 ? 321  ALA A C   1 
ATOM   2524  O O   . ALA A 1 321  ? 5.066   121.726 21.288  1.00 20.42 ? 321  ALA A O   1 
ATOM   2525  C CB  . ALA A 1 321  ? 4.317   124.468 22.911  1.00 16.01 ? 321  ALA A CB  1 
ATOM   2526  N N   . ARG A 1 322  ? 2.959   121.713 22.065  1.00 20.50 ? 322  ARG A N   1 
ATOM   2527  C CA  . ARG A 1 322  ? 2.455   120.816 21.025  1.00 21.87 ? 322  ARG A CA  1 
ATOM   2528  C C   . ARG A 1 322  ? 2.957   121.267 19.661  1.00 23.46 ? 322  ARG A C   1 
ATOM   2529  O O   . ARG A 1 322  ? 2.802   122.433 19.302  1.00 25.77 ? 322  ARG A O   1 
ATOM   2530  C CB  . ARG A 1 322  ? 0.921   120.798 21.043  1.00 21.76 ? 322  ARG A CB  1 
ATOM   2531  C CG  . ARG A 1 322  ? 0.274   119.737 20.158  1.00 22.90 ? 322  ARG A CG  1 
ATOM   2532  C CD  . ARG A 1 322  ? -1.256  119.704 20.330  1.00 21.06 ? 322  ARG A CD  1 
ATOM   2533  N NE  . ARG A 1 322  ? -1.831  118.539 19.670  1.00 22.68 ? 322  ARG A NE  1 
ATOM   2534  C CZ  . ARG A 1 322  ? -1.947  118.390 18.352  1.00 25.56 ? 322  ARG A CZ  1 
ATOM   2535  N NH1 . ARG A 1 322  ? -1.543  119.345 17.527  1.00 28.00 ? 322  ARG A NH1 1 
ATOM   2536  N NH2 . ARG A 1 322  ? -2.429  117.260 17.850  1.00 25.49 ? 322  ARG A NH2 1 
ATOM   2537  N N   . SER A 1 323  ? 3.567   120.351 18.910  1.00 24.38 ? 323  SER A N   1 
ATOM   2538  C CA  . SER A 1 323  ? 4.089   120.675 17.588  1.00 24.09 ? 323  SER A CA  1 
ATOM   2539  C C   . SER A 1 323  ? 3.469   119.774 16.533  1.00 26.47 ? 323  SER A C   1 
ATOM   2540  O O   . SER A 1 323  ? 3.681   119.967 15.336  1.00 26.86 ? 323  SER A O   1 
ATOM   2541  C CB  . SER A 1 323  ? 5.602   120.497 17.554  1.00 23.39 ? 323  SER A CB  1 
ATOM   2542  O OG  . SER A 1 323  ? 5.945   119.123 17.504  1.00 23.38 ? 323  SER A OG  1 
ATOM   2543  N N   . ALA A 1 324  ? 2.708   118.780 16.974  1.00 28.02 ? 324  ALA A N   1 
ATOM   2544  C CA  . ALA A 1 324  ? 2.064   117.855 16.042  1.00 29.02 ? 324  ALA A CA  1 
ATOM   2545  C C   . ALA A 1 324  ? 0.967   118.572 15.266  1.00 28.65 ? 324  ALA A C   1 
ATOM   2546  O O   . ALA A 1 324  ? 0.508   119.639 15.670  1.00 28.95 ? 324  ALA A O   1 
ATOM   2547  C CB  . ALA A 1 324  ? 1.470   116.658 16.807  1.00 28.15 ? 324  ALA A CB  1 
ATOM   2548  N N   . PRO A 1 325  ? 0.538   117.996 14.137  1.00 28.33 ? 325  PRO A N   1 
ATOM   2549  C CA  . PRO A 1 325  ? -0.515  118.602 13.321  1.00 29.46 ? 325  PRO A CA  1 
ATOM   2550  C C   . PRO A 1 325  ? -1.768  118.951 14.141  1.00 30.91 ? 325  PRO A C   1 
ATOM   2551  O O   . PRO A 1 325  ? -2.168  118.203 15.044  1.00 30.48 ? 325  PRO A O   1 
ATOM   2552  C CB  . PRO A 1 325  ? -0.790  117.528 12.270  1.00 29.21 ? 325  PRO A CB  1 
ATOM   2553  C CG  . PRO A 1 325  ? 0.553   116.950 12.053  1.00 29.12 ? 325  PRO A CG  1 
ATOM   2554  C CD  . PRO A 1 325  ? 1.091   116.806 13.468  1.00 29.25 ? 325  PRO A CD  1 
ATOM   2555  N N   . SER A 1 326  ? -2.367  120.099 13.822  1.00 29.63 ? 326  SER A N   1 
ATOM   2556  C CA  . SER A 1 326  ? -3.573  120.563 14.492  1.00 29.05 ? 326  SER A CA  1 
ATOM   2557  C C   . SER A 1 326  ? -4.726  119.674 14.048  1.00 27.31 ? 326  SER A C   1 
ATOM   2558  O O   . SER A 1 326  ? -4.694  119.124 12.955  1.00 27.38 ? 326  SER A O   1 
ATOM   2559  C CB  . SER A 1 326  ? -3.863  122.009 14.087  1.00 31.53 ? 326  SER A CB  1 
ATOM   2560  O OG  . SER A 1 326  ? -5.139  122.425 14.545  1.00 35.30 ? 326  SER A OG  1 
ATOM   2561  N N   . ASN A 1 327  ? -5.743  119.527 14.886  1.00 25.52 ? 327  ASN A N   1 
ATOM   2562  C CA  . ASN A 1 327  ? -6.878  118.694 14.516  1.00 24.17 ? 327  ASN A CA  1 
ATOM   2563  C C   . ASN A 1 327  ? -8.214  119.425 14.684  1.00 22.61 ? 327  ASN A C   1 
ATOM   2564  O O   . ASN A 1 327  ? -9.283  118.839 14.519  1.00 20.47 ? 327  ASN A O   1 
ATOM   2565  C CB  . ASN A 1 327  ? -6.843  117.370 15.304  1.00 24.96 ? 327  ASN A CB  1 
ATOM   2566  C CG  . ASN A 1 327  ? -6.912  117.563 16.814  1.00 26.72 ? 327  ASN A CG  1 
ATOM   2567  O OD1 . ASN A 1 327  ? -6.206  118.394 17.395  1.00 28.87 ? 327  ASN A OD1 1 
ATOM   2568  N ND2 . ASN A 1 327  ? -7.752  116.771 17.460  1.00 26.58 ? 327  ASN A ND2 1 
ATOM   2569  N N   . ASP A 1 328  ? -8.124  120.722 14.979  1.00 23.21 ? 328  ASP A N   1 
ATOM   2570  C CA  . ASP A 1 328  ? -9.278  121.605 15.164  1.00 22.66 ? 328  ASP A CA  1 
ATOM   2571  C C   . ASP A 1 328  ? -10.345 121.455 14.078  1.00 23.42 ? 328  ASP A C   1 
ATOM   2572  O O   . ASP A 1 328  ? -11.530 121.335 14.371  1.00 23.50 ? 328  ASP A O   1 
ATOM   2573  C CB  . ASP A 1 328  ? -8.809  123.065 15.198  1.00 21.95 ? 328  ASP A CB  1 
ATOM   2574  C CG  . ASP A 1 328  ? -9.952  124.049 15.424  1.00 22.93 ? 328  ASP A CG  1 
ATOM   2575  O OD1 . ASP A 1 328  ? -10.418 124.196 16.580  1.00 22.12 ? 328  ASP A OD1 1 
ATOM   2576  O OD2 . ASP A 1 328  ? -10.391 124.675 14.434  1.00 24.57 ? 328  ASP A OD2 1 
ATOM   2577  N N   . LYS A 1 329  ? -9.920  121.475 12.822  1.00 25.02 ? 329  LYS A N   1 
ATOM   2578  C CA  . LYS A 1 329  ? -10.849 121.356 11.711  1.00 27.34 ? 329  LYS A CA  1 
ATOM   2579  C C   . LYS A 1 329  ? -11.599 120.021 11.744  1.00 27.18 ? 329  LYS A C   1 
ATOM   2580  O O   . LYS A 1 329  ? -12.832 119.998 11.821  1.00 28.06 ? 329  LYS A O   1 
ATOM   2581  C CB  . LYS A 1 329  ? -10.096 121.520 10.381  1.00 29.83 ? 329  LYS A CB  1 
ATOM   2582  C CG  . LYS A 1 329  ? -10.999 121.597 9.143   1.00 32.63 ? 329  LYS A CG  1 
ATOM   2583  C CD  . LYS A 1 329  ? -10.181 121.684 7.865   1.00 35.53 ? 329  LYS A CD  1 
ATOM   2584  C CE  . LYS A 1 329  ? -11.077 121.695 6.630   1.00 37.98 ? 329  LYS A CE  1 
ATOM   2585  N NZ  . LYS A 1 329  ? -10.289 121.676 5.355   1.00 39.76 ? 329  LYS A NZ  1 
ATOM   2586  N N   . LYS A 1 330  ? -10.861 118.916 11.683  1.00 27.08 ? 330  LYS A N   1 
ATOM   2587  C CA  . LYS A 1 330  ? -11.480 117.592 11.716  1.00 27.91 ? 330  LYS A CA  1 
ATOM   2588  C C   . LYS A 1 330  ? -12.382 117.443 12.945  1.00 25.30 ? 330  LYS A C   1 
ATOM   2589  O O   . LYS A 1 330  ? -13.535 117.023 12.834  1.00 23.90 ? 330  LYS A O   1 
ATOM   2590  C CB  . LYS A 1 330  ? -10.415 116.492 11.751  1.00 30.91 ? 330  LYS A CB  1 
ATOM   2591  C CG  . LYS A 1 330  ? -9.549  116.378 10.510  1.00 35.80 ? 330  LYS A CG  1 
ATOM   2592  C CD  . LYS A 1 330  ? -8.856  115.005 10.445  1.00 40.26 ? 330  LYS A CD  1 
ATOM   2593  C CE  . LYS A 1 330  ? -7.966  114.713 11.674  1.00 41.93 ? 330  LYS A CE  1 
ATOM   2594  N NZ  . LYS A 1 330  ? -6.707  115.529 11.721  1.00 41.78 ? 330  LYS A NZ  1 
ATOM   2595  N N   . ALA A 1 331  ? -11.841 117.791 14.111  1.00 22.28 ? 331  ALA A N   1 
ATOM   2596  C CA  . ALA A 1 331  ? -12.577 117.696 15.364  1.00 21.25 ? 331  ALA A CA  1 
ATOM   2597  C C   . ALA A 1 331  ? -13.913 118.436 15.297  1.00 21.06 ? 331  ALA A C   1 
ATOM   2598  O O   . ALA A 1 331  ? -14.958 117.880 15.643  1.00 17.94 ? 331  ALA A O   1 
ATOM   2599  C CB  . ALA A 1 331  ? -11.729 118.242 16.500  1.00 19.97 ? 331  ALA A CB  1 
ATOM   2600  N N   . ARG A 1 332  ? -13.879 119.691 14.849  1.00 21.29 ? 332  ARG A N   1 
ATOM   2601  C CA  . ARG A 1 332  ? -15.106 120.473 14.740  1.00 20.43 ? 332  ARG A CA  1 
ATOM   2602  C C   . ARG A 1 332  ? -16.047 119.923 13.684  1.00 19.87 ? 332  ARG A C   1 
ATOM   2603  O O   . ARG A 1 332  ? -17.261 120.008 13.830  1.00 20.26 ? 332  ARG A O   1 
ATOM   2604  C CB  . ARG A 1 332  ? -14.788 121.933 14.451  1.00 17.84 ? 332  ARG A CB  1 
ATOM   2605  C CG  . ARG A 1 332  ? -14.140 122.612 15.630  1.00 16.53 ? 332  ARG A CG  1 
ATOM   2606  C CD  . ARG A 1 332  ? -13.759 124.024 15.304  1.00 14.20 ? 332  ARG A CD  1 
ATOM   2607  N NE  . ARG A 1 332  ? -13.052 124.641 16.414  1.00 11.77 ? 332  ARG A NE  1 
ATOM   2608  C CZ  . ARG A 1 332  ? -13.646 125.061 17.519  1.00 11.67 ? 332  ARG A CZ  1 
ATOM   2609  N NH1 . ARG A 1 332  ? -14.957 124.932 17.638  1.00 11.62 ? 332  ARG A NH1 1 
ATOM   2610  N NH2 . ARG A 1 332  ? -12.929 125.587 18.508  1.00 9.83  ? 332  ARG A NH2 1 
ATOM   2611  N N   . GLU A 1 333  ? -15.497 119.347 12.626  1.00 20.33 ? 333  GLU A N   1 
ATOM   2612  C CA  . GLU A 1 333  ? -16.358 118.791 11.597  1.00 21.08 ? 333  GLU A CA  1 
ATOM   2613  C C   . GLU A 1 333  ? -17.110 117.615 12.193  1.00 20.73 ? 333  GLU A C   1 
ATOM   2614  O O   . GLU A 1 333  ? -18.308 117.473 11.963  1.00 22.33 ? 333  GLU A O   1 
ATOM   2615  C CB  . GLU A 1 333  ? -15.546 118.345 10.373  1.00 23.27 ? 333  GLU A CB  1 
ATOM   2616  C CG  . GLU A 1 333  ? -14.905 119.496 9.599   1.00 28.65 ? 333  GLU A CG  1 
ATOM   2617  C CD  . GLU A 1 333  ? -14.182 119.038 8.327   1.00 32.68 ? 333  GLU A CD  1 
ATOM   2618  O OE1 . GLU A 1 333  ? -13.433 118.037 8.389   1.00 36.40 ? 333  GLU A OE1 1 
ATOM   2619  O OE2 . GLU A 1 333  ? -14.349 119.684 7.267   1.00 33.11 ? 333  GLU A OE2 1 
ATOM   2620  N N   . LEU A 1 334  ? -16.418 116.781 12.973  1.00 21.07 ? 334  LEU A N   1 
ATOM   2621  C CA  . LEU A 1 334  ? -17.058 115.616 13.603  1.00 20.17 ? 334  LEU A CA  1 
ATOM   2622  C C   . LEU A 1 334  ? -18.249 116.041 14.457  1.00 19.23 ? 334  LEU A C   1 
ATOM   2623  O O   . LEU A 1 334  ? -19.333 115.471 14.351  1.00 19.76 ? 334  LEU A O   1 
ATOM   2624  C CB  . LEU A 1 334  ? -16.069 114.840 14.479  1.00 20.75 ? 334  LEU A CB  1 
ATOM   2625  C CG  . LEU A 1 334  ? -16.699 113.616 15.163  1.00 21.59 ? 334  LEU A CG  1 
ATOM   2626  C CD1 . LEU A 1 334  ? -16.752 112.461 14.186  1.00 21.19 ? 334  LEU A CD1 1 
ATOM   2627  C CD2 . LEU A 1 334  ? -15.884 113.212 16.384  1.00 23.63 ? 334  LEU A CD2 1 
ATOM   2628  N N   . GLY A 1 335  ? -18.046 117.050 15.292  1.00 18.19 ? 335  GLY A N   1 
ATOM   2629  C CA  . GLY A 1 335  ? -19.121 117.535 16.138  1.00 20.48 ? 335  GLY A CA  1 
ATOM   2630  C C   . GLY A 1 335  ? -20.344 118.014 15.367  1.00 21.12 ? 335  GLY A C   1 
ATOM   2631  O O   . GLY A 1 335  ? -21.469 117.567 15.633  1.00 19.05 ? 335  GLY A O   1 
ATOM   2632  N N   . GLU A 1 336  ? -20.125 118.935 14.424  1.00 21.94 ? 336  GLU A N   1 
ATOM   2633  C CA  . GLU A 1 336  ? -21.196 119.482 13.583  1.00 21.36 ? 336  GLU A CA  1 
ATOM   2634  C C   . GLU A 1 336  ? -22.010 118.358 12.947  1.00 22.46 ? 336  GLU A C   1 
ATOM   2635  O O   . GLU A 1 336  ? -23.246 118.389 12.943  1.00 22.63 ? 336  GLU A O   1 
ATOM   2636  C CB  . GLU A 1 336  ? -20.602 120.342 12.463  1.00 20.95 ? 336  GLU A CB  1 
ATOM   2637  C CG  . GLU A 1 336  ? -20.026 121.670 12.918  1.00 24.66 ? 336  GLU A CG  1 
ATOM   2638  C CD  . GLU A 1 336  ? -21.091 122.715 13.204  1.00 28.88 ? 336  GLU A CD  1 
ATOM   2639  O OE1 . GLU A 1 336  ? -22.298 122.371 13.241  1.00 28.55 ? 336  GLU A OE1 1 
ATOM   2640  O OE2 . GLU A 1 336  ? -20.712 123.890 13.397  1.00 32.70 ? 336  GLU A OE2 1 
ATOM   2641  N N   . LYS A 1 337  ? -21.296 117.371 12.407  1.00 20.53 ? 337  LYS A N   1 
ATOM   2642  C CA  . LYS A 1 337  ? -21.906 116.231 11.750  1.00 18.69 ? 337  LYS A CA  1 
ATOM   2643  C C   . LYS A 1 337  ? -22.829 115.380 12.632  1.00 18.95 ? 337  LYS A C   1 
ATOM   2644  O O   . LYS A 1 337  ? -23.762 114.752 12.123  1.00 17.52 ? 337  LYS A O   1 
ATOM   2645  C CB  . LYS A 1 337  ? -20.817 115.340 11.161  1.00 19.00 ? 337  LYS A CB  1 
ATOM   2646  C CG  . LYS A 1 337  ? -21.373 114.174 10.370  1.00 20.00 ? 337  LYS A CG  1 
ATOM   2647  C CD  . LYS A 1 337  ? -20.298 113.332 9.732   1.00 21.46 ? 337  LYS A CD  1 
ATOM   2648  C CE  . LYS A 1 337  ? -20.954 112.302 8.829   1.00 26.28 ? 337  LYS A CE  1 
ATOM   2649  N NZ  . LYS A 1 337  ? -19.948 111.521 8.068   1.00 30.35 ? 337  LYS A NZ  1 
ATOM   2650  N N   . TYR A 1 338  ? -22.569 115.337 13.939  1.00 17.60 ? 338  TYR A N   1 
ATOM   2651  C CA  . TYR A 1 338  ? -23.412 114.539 14.837  1.00 17.80 ? 338  TYR A CA  1 
ATOM   2652  C C   . TYR A 1 338  ? -24.159 115.360 15.877  1.00 18.14 ? 338  TYR A C   1 
ATOM   2653  O O   . TYR A 1 338  ? -24.473 114.868 16.956  1.00 19.82 ? 338  TYR A O   1 
ATOM   2654  C CB  . TYR A 1 338  ? -22.581 113.454 15.532  1.00 15.54 ? 338  TYR A CB  1 
ATOM   2655  C CG  . TYR A 1 338  ? -22.011 112.444 14.559  1.00 15.65 ? 338  TYR A CG  1 
ATOM   2656  C CD1 . TYR A 1 338  ? -22.844 111.546 13.892  1.00 14.60 ? 338  TYR A CD1 1 
ATOM   2657  C CD2 . TYR A 1 338  ? -20.646 112.432 14.252  1.00 12.83 ? 338  TYR A CD2 1 
ATOM   2658  C CE1 . TYR A 1 338  ? -22.330 110.664 12.936  1.00 14.81 ? 338  TYR A CE1 1 
ATOM   2659  C CE2 . TYR A 1 338  ? -20.126 111.562 13.309  1.00 13.29 ? 338  TYR A CE2 1 
ATOM   2660  C CZ  . TYR A 1 338  ? -20.973 110.679 12.649  1.00 14.59 ? 338  TYR A CZ  1 
ATOM   2661  O OH  . TYR A 1 338  ? -20.466 109.820 11.698  1.00 15.96 ? 338  TYR A OH  1 
ATOM   2662  N N   . GLY A 1 339  ? -24.441 116.614 15.543  1.00 18.48 ? 339  GLY A N   1 
ATOM   2663  C CA  . GLY A 1 339  ? -25.159 117.482 16.452  1.00 18.81 ? 339  GLY A CA  1 
ATOM   2664  C C   . GLY A 1 339  ? -24.505 117.723 17.802  1.00 20.54 ? 339  GLY A C   1 
ATOM   2665  O O   . GLY A 1 339  ? -25.211 117.946 18.787  1.00 18.78 ? 339  GLY A O   1 
ATOM   2666  N N   . LEU A 1 340  ? -23.171 117.722 17.853  1.00 21.25 ? 340  LEU A N   1 
ATOM   2667  C CA  . LEU A 1 340  ? -22.466 117.931 19.116  1.00 22.84 ? 340  LEU A CA  1 
ATOM   2668  C C   . LEU A 1 340  ? -21.435 119.070 19.121  1.00 23.18 ? 340  LEU A C   1 
ATOM   2669  O O   . LEU A 1 340  ? -20.558 119.116 20.000  1.00 23.18 ? 340  LEU A O   1 
ATOM   2670  C CB  . LEU A 1 340  ? -21.775 116.624 19.526  1.00 22.12 ? 340  LEU A CB  1 
ATOM   2671  C CG  . LEU A 1 340  ? -22.706 115.417 19.572  1.00 21.87 ? 340  LEU A CG  1 
ATOM   2672  C CD1 . LEU A 1 340  ? -21.945 114.182 20.036  1.00 21.33 ? 340  LEU A CD1 1 
ATOM   2673  C CD2 . LEU A 1 340  ? -23.864 115.717 20.507  1.00 21.65 ? 340  LEU A CD2 1 
ATOM   2674  N N   . SER A 1 341  ? -21.542 119.994 18.170  1.00 22.53 ? 341  SER A N   1 
ATOM   2675  C CA  . SER A 1 341  ? -20.578 121.089 18.079  1.00 23.80 ? 341  SER A CA  1 
ATOM   2676  C C   . SER A 1 341  ? -20.421 121.925 19.356  1.00 23.00 ? 341  SER A C   1 
ATOM   2677  O O   . SER A 1 341  ? -19.331 122.426 19.644  1.00 21.44 ? 341  SER A O   1 
ATOM   2678  C CB  . SER A 1 341  ? -20.923 121.996 16.883  1.00 25.95 ? 341  SER A CB  1 
ATOM   2679  O OG  . SER A 1 341  ? -22.274 122.422 16.932  1.00 31.74 ? 341  SER A OG  1 
ATOM   2680  N N   . SER A 1 342  ? -21.496 122.070 20.125  1.00 22.53 ? 342  SER A N   1 
ATOM   2681  C CA  . SER A 1 342  ? -21.436 122.840 21.369  1.00 23.00 ? 342  SER A CA  1 
ATOM   2682  C C   . SER A 1 342  ? -20.503 122.153 22.358  1.00 22.31 ? 342  SER A C   1 
ATOM   2683  O O   . SER A 1 342  ? -19.766 122.806 23.104  1.00 22.49 ? 342  SER A O   1 
ATOM   2684  C CB  . SER A 1 342  ? -22.822 122.939 21.988  1.00 23.98 ? 342  SER A CB  1 
ATOM   2685  O OG  . SER A 1 342  ? -23.363 121.637 22.131  1.00 28.84 ? 342  SER A OG  1 
ATOM   2686  N N   . VAL A 1 343  ? -20.562 120.824 22.364  1.00 21.17 ? 343  VAL A N   1 
ATOM   2687  C CA  . VAL A 1 343  ? -19.731 120.010 23.235  1.00 19.21 ? 343  VAL A CA  1 
ATOM   2688  C C   . VAL A 1 343  ? -18.280 120.090 22.770  1.00 18.76 ? 343  VAL A C   1 
ATOM   2689  O O   . VAL A 1 343  ? -17.370 120.298 23.573  1.00 19.06 ? 343  VAL A O   1 
ATOM   2690  C CB  . VAL A 1 343  ? -20.216 118.548 23.217  1.00 18.95 ? 343  VAL A CB  1 
ATOM   2691  C CG1 . VAL A 1 343  ? -19.193 117.640 23.850  1.00 16.06 ? 343  VAL A CG1 1 
ATOM   2692  C CG2 . VAL A 1 343  ? -21.534 118.452 23.950  1.00 14.97 ? 343  VAL A CG2 1 
ATOM   2693  N N   . VAL A 1 344  ? -18.053 119.924 21.475  1.00 17.57 ? 344  VAL A N   1 
ATOM   2694  C CA  . VAL A 1 344  ? -16.690 120.022 20.973  1.00 17.60 ? 344  VAL A CA  1 
ATOM   2695  C C   . VAL A 1 344  ? -16.153 121.433 21.264  1.00 18.70 ? 344  VAL A C   1 
ATOM   2696  O O   . VAL A 1 344  ? -15.059 121.592 21.817  1.00 18.57 ? 344  VAL A O   1 
ATOM   2697  C CB  . VAL A 1 344  ? -16.626 119.738 19.448  1.00 17.51 ? 344  VAL A CB  1 
ATOM   2698  C CG1 . VAL A 1 344  ? -15.250 120.081 18.904  1.00 14.55 ? 344  VAL A CG1 1 
ATOM   2699  C CG2 . VAL A 1 344  ? -16.950 118.279 19.181  1.00 12.50 ? 344  VAL A CG2 1 
ATOM   2700  N N   . GLY A 1 345  ? -16.944 122.448 20.918  1.00 19.85 ? 345  GLY A N   1 
ATOM   2701  C CA  . GLY A 1 345  ? -16.539 123.826 21.133  1.00 18.34 ? 345  GLY A CA  1 
ATOM   2702  C C   . GLY A 1 345  ? -16.145 124.118 22.565  1.00 20.22 ? 345  GLY A C   1 
ATOM   2703  O O   . GLY A 1 345  ? -15.098 124.726 22.811  1.00 19.89 ? 345  GLY A O   1 
ATOM   2704  N N   . GLU A 1 346  ? -16.985 123.687 23.509  1.00 20.48 ? 346  GLU A N   1 
ATOM   2705  C CA  . GLU A 1 346  ? -16.728 123.893 24.934  1.00 20.42 ? 346  GLU A CA  1 
ATOM   2706  C C   . GLU A 1 346  ? -15.440 123.183 25.354  1.00 19.69 ? 346  GLU A C   1 
ATOM   2707  O O   . GLU A 1 346  ? -14.599 123.760 26.043  1.00 19.13 ? 346  GLU A O   1 
ATOM   2708  C CB  . GLU A 1 346  ? -17.911 123.373 25.757  1.00 21.30 ? 346  GLU A CB  1 
ATOM   2709  C CG  . GLU A 1 346  ? -17.779 123.518 27.266  1.00 25.66 ? 346  GLU A CG  1 
ATOM   2710  C CD  . GLU A 1 346  ? -17.634 124.964 27.714  1.00 31.45 ? 346  GLU A CD  1 
ATOM   2711  O OE1 . GLU A 1 346  ? -18.167 125.859 27.015  1.00 34.30 ? 346  GLU A OE1 1 
ATOM   2712  O OE2 . GLU A 1 346  ? -17.005 125.208 28.773  1.00 31.79 ? 346  GLU A OE2 1 
ATOM   2713  N N   . LEU A 1 347  ? -15.284 121.931 24.929  1.00 18.59 ? 347  LEU A N   1 
ATOM   2714  C CA  . LEU A 1 347  ? -14.089 121.163 25.268  1.00 17.13 ? 347  LEU A CA  1 
ATOM   2715  C C   . LEU A 1 347  ? -12.812 121.809 24.733  1.00 16.03 ? 347  LEU A C   1 
ATOM   2716  O O   . LEU A 1 347  ? -11.801 121.854 25.442  1.00 12.79 ? 347  LEU A O   1 
ATOM   2717  C CB  . LEU A 1 347  ? -14.208 119.720 24.752  1.00 16.38 ? 347  LEU A CB  1 
ATOM   2718  C CG  . LEU A 1 347  ? -15.100 118.781 25.577  1.00 16.54 ? 347  LEU A CG  1 
ATOM   2719  C CD1 . LEU A 1 347  ? -15.305 117.473 24.853  1.00 15.60 ? 347  LEU A CD1 1 
ATOM   2720  C CD2 . LEU A 1 347  ? -14.461 118.536 26.938  1.00 15.14 ? 347  LEU A CD2 1 
ATOM   2721  N N   . ARG A 1 348  ? -12.858 122.311 23.494  1.00 16.11 ? 348  ARG A N   1 
ATOM   2722  C CA  . ARG A 1 348  ? -11.682 122.951 22.886  1.00 14.70 ? 348  ARG A CA  1 
ATOM   2723  C C   . ARG A 1 348  ? -11.299 124.198 23.658  1.00 14.47 ? 348  ARG A C   1 
ATOM   2724  O O   . ARG A 1 348  ? -10.119 124.434 23.945  1.00 15.25 ? 348  ARG A O   1 
ATOM   2725  C CB  . ARG A 1 348  ? -11.946 123.298 21.424  1.00 14.15 ? 348  ARG A CB  1 
ATOM   2726  C CG  . ARG A 1 348  ? -11.967 122.080 20.509  1.00 14.40 ? 348  ARG A CG  1 
ATOM   2727  C CD  . ARG A 1 348  ? -11.060 122.285 19.313  1.00 15.35 ? 348  ARG A CD  1 
ATOM   2728  N NE  . ARG A 1 348  ? -10.418 121.035 18.927  1.00 17.99 ? 348  ARG A NE  1 
ATOM   2729  C CZ  . ARG A 1 348  ? -9.163  120.947 18.509  1.00 17.07 ? 348  ARG A CZ  1 
ATOM   2730  N NH1 . ARG A 1 348  ? -8.411  122.032 18.420  1.00 16.65 ? 348  ARG A NH1 1 
ATOM   2731  N NH2 . ARG A 1 348  ? -8.657  119.772 18.193  1.00 20.00 ? 348  ARG A NH2 1 
ATOM   2732  N N   . LYS A 1 349  ? -12.310 124.980 24.015  1.00 15.08 ? 349  LYS A N   1 
ATOM   2733  C CA  . LYS A 1 349  ? -12.113 126.194 24.786  1.00 14.98 ? 349  LYS A CA  1 
ATOM   2734  C C   . LYS A 1 349  ? -11.497 125.870 26.146  1.00 15.57 ? 349  LYS A C   1 
ATOM   2735  O O   . LYS A 1 349  ? -10.536 126.508 26.566  1.00 17.77 ? 349  LYS A O   1 
ATOM   2736  C CB  . LYS A 1 349  ? -13.445 126.915 24.981  1.00 15.05 ? 349  LYS A CB  1 
ATOM   2737  C CG  . LYS A 1 349  ? -13.361 128.107 25.912  1.00 18.69 ? 349  LYS A CG  1 
ATOM   2738  C CD  . LYS A 1 349  ? -14.722 128.757 26.100  1.00 23.14 ? 349  LYS A CD  1 
ATOM   2739  C CE  . LYS A 1 349  ? -14.690 129.834 27.167  1.00 24.59 ? 349  LYS A CE  1 
ATOM   2740  N NZ  . LYS A 1 349  ? -16.035 130.461 27.311  1.00 27.98 ? 349  LYS A NZ  1 
ATOM   2741  N N   . ARG A 1 350  ? -12.041 124.887 26.850  1.00 15.33 ? 350  ARG A N   1 
ATOM   2742  C CA  . ARG A 1 350  ? -11.464 124.556 28.138  1.00 17.32 ? 350  ARG A CA  1 
ATOM   2743  C C   . ARG A 1 350  ? -10.017 124.077 27.989  1.00 17.30 ? 350  ARG A C   1 
ATOM   2744  O O   . ARG A 1 350  ? -9.140  124.494 28.746  1.00 17.11 ? 350  ARG A O   1 
ATOM   2745  C CB  . ARG A 1 350  ? -12.311 123.503 28.861  1.00 18.82 ? 350  ARG A CB  1 
ATOM   2746  C CG  . ARG A 1 350  ? -13.662 124.038 29.323  1.00 20.03 ? 350  ARG A CG  1 
ATOM   2747  C CD  . ARG A 1 350  ? -14.449 123.025 30.111  1.00 20.81 ? 350  ARG A CD  1 
ATOM   2748  N NE  . ARG A 1 350  ? -13.782 122.719 31.370  1.00 25.11 ? 350  ARG A NE  1 
ATOM   2749  C CZ  . ARG A 1 350  ? -14.362 122.072 32.375  1.00 24.67 ? 350  ARG A CZ  1 
ATOM   2750  N NH1 . ARG A 1 350  ? -15.618 121.665 32.255  1.00 25.91 ? 350  ARG A NH1 1 
ATOM   2751  N NH2 . ARG A 1 350  ? -13.697 121.854 33.500  1.00 23.07 ? 350  ARG A NH2 1 
ATOM   2752  N N   . THR A 1 351  ? -9.758  123.230 27.000  1.00 15.83 ? 351  THR A N   1 
ATOM   2753  C CA  . THR A 1 351  ? -8.413  122.716 26.798  1.00 16.37 ? 351  THR A CA  1 
ATOM   2754  C C   . THR A 1 351  ? -7.340  123.787 26.610  1.00 17.38 ? 351  THR A C   1 
ATOM   2755  O O   . THR A 1 351  ? -6.225  123.631 27.097  1.00 18.23 ? 351  THR A O   1 
ATOM   2756  C CB  . THR A 1 351  ? -8.395  121.747 25.616  1.00 17.08 ? 351  THR A CB  1 
ATOM   2757  O OG1 . THR A 1 351  ? -9.068  120.543 26.017  1.00 19.86 ? 351  THR A OG1 1 
ATOM   2758  C CG2 . THR A 1 351  ? -6.958  121.434 25.156  1.00 10.37 ? 351  THR A CG2 1 
ATOM   2759  N N   . LYS A 1 352  ? -7.667  124.874 25.920  1.00 18.53 ? 352  LYS A N   1 
ATOM   2760  C CA  . LYS A 1 352  ? -6.689  125.937 25.702  1.00 18.38 ? 352  LYS A CA  1 
ATOM   2761  C C   . LYS A 1 352  ? -6.272  126.659 26.984  1.00 17.88 ? 352  LYS A C   1 
ATOM   2762  O O   . LYS A 1 352  ? -5.209  127.286 27.015  1.00 16.32 ? 352  LYS A O   1 
ATOM   2763  C CB  . LYS A 1 352  ? -7.211  126.958 24.684  1.00 21.17 ? 352  LYS A CB  1 
ATOM   2764  C CG  . LYS A 1 352  ? -7.132  126.481 23.241  1.00 26.05 ? 352  LYS A CG  1 
ATOM   2765  C CD  . LYS A 1 352  ? -7.839  127.439 22.270  1.00 28.85 ? 352  LYS A CD  1 
ATOM   2766  C CE  . LYS A 1 352  ? -7.928  126.845 20.849  1.00 31.16 ? 352  LYS A CE  1 
ATOM   2767  N NZ  . LYS A 1 352  ? -8.784  125.605 20.756  1.00 30.25 ? 352  LYS A NZ  1 
ATOM   2768  N N   . THR A 1 353  ? -7.087  126.566 28.037  1.00 16.06 ? 353  THR A N   1 
ATOM   2769  C CA  . THR A 1 353  ? -6.753  127.232 29.293  1.00 15.14 ? 353  THR A CA  1 
ATOM   2770  C C   . THR A 1 353  ? -5.613  126.594 30.064  1.00 15.76 ? 353  THR A C   1 
ATOM   2771  O O   . THR A 1 353  ? -4.999  127.254 30.896  1.00 18.46 ? 353  THR A O   1 
ATOM   2772  C CB  . THR A 1 353  ? -7.940  127.307 30.252  1.00 14.95 ? 353  THR A CB  1 
ATOM   2773  O OG1 . THR A 1 353  ? -8.233  125.994 30.753  1.00 13.03 ? 353  THR A OG1 1 
ATOM   2774  C CG2 . THR A 1 353  ? -9.151  127.903 29.551  1.00 13.44 ? 353  THR A CG2 1 
ATOM   2775  N N   . TYR A 1 354  ? -5.330  125.317 29.820  1.00 15.64 ? 354  TYR A N   1 
ATOM   2776  C CA  . TYR A 1 354  ? -4.221  124.659 30.527  1.00 16.42 ? 354  TYR A CA  1 
ATOM   2777  C C   . TYR A 1 354  ? -2.935  124.981 29.783  1.00 16.23 ? 354  TYR A C   1 
ATOM   2778  O O   . TYR A 1 354  ? -2.685  124.490 28.687  1.00 17.24 ? 354  TYR A O   1 
ATOM   2779  C CB  . TYR A 1 354  ? -4.442  123.148 30.605  1.00 13.57 ? 354  TYR A CB  1 
ATOM   2780  C CG  . TYR A 1 354  ? -5.667  122.805 31.417  1.00 14.08 ? 354  TYR A CG  1 
ATOM   2781  C CD1 . TYR A 1 354  ? -5.605  122.716 32.814  1.00 13.01 ? 354  TYR A CD1 1 
ATOM   2782  C CD2 . TYR A 1 354  ? -6.911  122.646 30.794  1.00 12.22 ? 354  TYR A CD2 1 
ATOM   2783  C CE1 . TYR A 1 354  ? -6.752  122.476 33.569  1.00 12.67 ? 354  TYR A CE1 1 
ATOM   2784  C CE2 . TYR A 1 354  ? -8.060  122.420 31.536  1.00 13.24 ? 354  TYR A CE2 1 
ATOM   2785  C CZ  . TYR A 1 354  ? -7.977  122.334 32.923  1.00 14.45 ? 354  TYR A CZ  1 
ATOM   2786  O OH  . TYR A 1 354  ? -9.125  122.113 33.649  1.00 14.96 ? 354  TYR A OH  1 
ATOM   2787  N N   . VAL A 1 355  ? -2.126  125.818 30.408  1.00 17.24 ? 355  VAL A N   1 
ATOM   2788  C CA  . VAL A 1 355  ? -0.897  126.287 29.818  1.00 18.78 ? 355  VAL A CA  1 
ATOM   2789  C C   . VAL A 1 355  ? 0.305   125.672 30.503  1.00 19.17 ? 355  VAL A C   1 
ATOM   2790  O O   . VAL A 1 355  ? 1.447   125.885 30.099  1.00 19.19 ? 355  VAL A O   1 
ATOM   2791  C CB  . VAL A 1 355  ? -0.876  127.829 29.869  1.00 19.77 ? 355  VAL A CB  1 
ATOM   2792  C CG1 . VAL A 1 355  ? 0.420   128.352 29.377  1.00 24.24 ? 355  VAL A CG1 1 
ATOM   2793  C CG2 . VAL A 1 355  ? -1.992  128.371 28.978  1.00 18.82 ? 355  VAL A CG2 1 
ATOM   2794  N N   . LYS A 1 356  ? 0.041   124.895 31.544  1.00 19.70 ? 356  LYS A N   1 
ATOM   2795  C CA  . LYS A 1 356  ? 1.109   124.189 32.245  1.00 21.01 ? 356  LYS A CA  1 
ATOM   2796  C C   . LYS A 1 356  ? 0.726   122.719 32.288  1.00 19.59 ? 356  LYS A C   1 
ATOM   2797  O O   . LYS A 1 356  ? -0.455  122.374 32.291  1.00 18.29 ? 356  LYS A O   1 
ATOM   2798  C CB  . LYS A 1 356  ? 1.277   124.690 33.679  1.00 24.39 ? 356  LYS A CB  1 
ATOM   2799  C CG  . LYS A 1 356  ? 1.977   126.020 33.815  1.00 30.06 ? 356  LYS A CG  1 
ATOM   2800  C CD  . LYS A 1 356  ? 1.770   126.596 35.214  1.00 35.47 ? 356  LYS A CD  1 
ATOM   2801  C CE  . LYS A 1 356  ? 2.358   125.691 36.306  1.00 40.02 ? 356  LYS A CE  1 
ATOM   2802  N NZ  . LYS A 1 356  ? 1.986   126.147 37.693  1.00 41.79 ? 356  LYS A NZ  1 
ATOM   2803  N N   . HIS A 1 357  ? 1.732   121.856 32.292  1.00 18.69 ? 357  HIS A N   1 
ATOM   2804  C CA  . HIS A 1 357  ? 1.502   120.429 32.387  1.00 16.37 ? 357  HIS A CA  1 
ATOM   2805  C C   . HIS A 1 357  ? 1.713   120.090 33.856  1.00 15.42 ? 357  HIS A C   1 
ATOM   2806  O O   . HIS A 1 357  ? 2.831   120.168 34.361  1.00 13.67 ? 357  HIS A O   1 
ATOM   2807  C CB  . HIS A 1 357  ? 2.503   119.659 31.538  1.00 17.01 ? 357  HIS A CB  1 
ATOM   2808  C CG  . HIS A 1 357  ? 2.553   118.199 31.853  1.00 17.13 ? 357  HIS A CG  1 
ATOM   2809  N ND1 . HIS A 1 357  ? 1.679   117.285 31.300  1.00 15.14 ? 357  HIS A ND1 1 
ATOM   2810  C CD2 . HIS A 1 357  ? 3.342   117.500 32.704  1.00 14.62 ? 357  HIS A CD2 1 
ATOM   2811  C CE1 . HIS A 1 357  ? 1.930   116.089 31.800  1.00 16.93 ? 357  HIS A CE1 1 
ATOM   2812  N NE2 . HIS A 1 357  ? 2.934   116.192 32.654  1.00 16.88 ? 357  HIS A NE2 1 
ATOM   2813  N N   . ASP A 1 358  ? 0.629   119.749 34.542  1.00 15.02 ? 358  ASP A N   1 
ATOM   2814  C CA  . ASP A 1 358  ? 0.696   119.401 35.956  1.00 15.49 ? 358  ASP A CA  1 
ATOM   2815  C C   . ASP A 1 358  ? -0.467  118.492 36.368  1.00 14.11 ? 358  ASP A C   1 
ATOM   2816  O O   . ASP A 1 358  ? -1.291  118.106 35.527  1.00 14.49 ? 358  ASP A O   1 
ATOM   2817  C CB  . ASP A 1 358  ? 0.715   120.674 36.825  1.00 17.79 ? 358  ASP A CB  1 
ATOM   2818  C CG  . ASP A 1 358  ? -0.451  121.617 36.539  1.00 19.68 ? 358  ASP A CG  1 
ATOM   2819  O OD1 . ASP A 1 358  ? -1.532  121.169 36.084  1.00 20.81 ? 358  ASP A OD1 1 
ATOM   2820  O OD2 . ASP A 1 358  ? -0.286  122.826 36.800  1.00 20.94 ? 358  ASP A OD2 1 
ATOM   2821  N N   . PHE A 1 359  ? -0.535  118.149 37.653  1.00 12.52 ? 359  PHE A N   1 
ATOM   2822  C CA  . PHE A 1 359  ? -1.598  117.272 38.148  1.00 11.50 ? 359  PHE A CA  1 
ATOM   2823  C C   . PHE A 1 359  ? -2.961  117.741 37.663  1.00 10.57 ? 359  PHE A C   1 
ATOM   2824  O O   . PHE A 1 359  ? -3.734  116.967 37.096  1.00 10.28 ? 359  PHE A O   1 
ATOM   2825  C CB  . PHE A 1 359  ? -1.575  117.222 39.668  1.00 9.44  ? 359  PHE A CB  1 
ATOM   2826  C CG  . PHE A 1 359  ? -0.263  116.759 40.237  1.00 11.93 ? 359  PHE A CG  1 
ATOM   2827  C CD1 . PHE A 1 359  ? 0.242   115.496 39.926  1.00 10.34 ? 359  PHE A CD1 1 
ATOM   2828  C CD2 . PHE A 1 359  ? 0.474   117.588 41.089  1.00 10.25 ? 359  PHE A CD2 1 
ATOM   2829  C CE1 . PHE A 1 359  ? 1.465   115.062 40.449  1.00 11.08 ? 359  PHE A CE1 1 
ATOM   2830  C CE2 . PHE A 1 359  ? 1.689   117.165 41.612  1.00 9.18  ? 359  PHE A CE2 1 
ATOM   2831  C CZ  . PHE A 1 359  ? 2.190   115.898 41.293  1.00 10.06 ? 359  PHE A CZ  1 
ATOM   2832  N N   . ALA A 1 360  ? -3.238  119.021 37.877  1.00 10.57 ? 360  ALA A N   1 
ATOM   2833  C CA  . ALA A 1 360  ? -4.499  119.620 37.451  1.00 11.23 ? 360  ALA A CA  1 
ATOM   2834  C C   . ALA A 1 360  ? -4.848  119.334 35.988  1.00 10.43 ? 360  ALA A C   1 
ATOM   2835  O O   . ALA A 1 360  ? -5.972  118.929 35.692  1.00 12.68 ? 360  ALA A O   1 
ATOM   2836  C CB  . ALA A 1 360  ? -4.469  121.127 37.686  1.00 7.29  ? 360  ALA A CB  1 
ATOM   2837  N N   . SER A 1 361  ? -3.900  119.532 35.077  1.00 9.40  ? 361  SER A N   1 
ATOM   2838  C CA  . SER A 1 361  ? -4.185  119.306 33.660  1.00 10.22 ? 361  SER A CA  1 
ATOM   2839  C C   . SER A 1 361  ? -4.392  117.836 33.252  1.00 9.68  ? 361  SER A C   1 
ATOM   2840  O O   . SER A 1 361  ? -5.311  117.526 32.492  1.00 9.81  ? 361  SER A O   1 
ATOM   2841  C CB  . SER A 1 361  ? -3.103  119.955 32.774  1.00 7.23  ? 361  SER A CB  1 
ATOM   2842  O OG  . SER A 1 361  ? -1.811  119.427 33.011  1.00 9.24  ? 361  SER A OG  1 
ATOM   2843  N N   . VAL A 1 362  ? -3.556  116.928 33.743  1.00 9.57  ? 362  VAL A N   1 
ATOM   2844  C CA  . VAL A 1 362  ? -3.728  115.537 33.368  1.00 9.73  ? 362  VAL A CA  1 
ATOM   2845  C C   . VAL A 1 362  ? -5.010  114.994 33.995  1.00 10.94 ? 362  VAL A C   1 
ATOM   2846  O O   . VAL A 1 362  ? -5.689  114.148 33.401  1.00 10.06 ? 362  VAL A O   1 
ATOM   2847  C CB  . VAL A 1 362  ? -2.492  114.679 33.754  1.00 10.72 ? 362  VAL A CB  1 
ATOM   2848  C CG1 . VAL A 1 362  ? -1.302  115.085 32.872  1.00 7.34  ? 362  VAL A CG1 1 
ATOM   2849  C CG2 . VAL A 1 362  ? -2.155  114.852 35.227  1.00 8.95  ? 362  VAL A CG2 1 
ATOM   2850  N N   . ARG A 1 363  ? -5.359  115.505 35.176  1.00 10.68 ? 363  ARG A N   1 
ATOM   2851  C CA  . ARG A 1 363  ? -6.593  115.091 35.849  1.00 10.42 ? 363  ARG A CA  1 
ATOM   2852  C C   . ARG A 1 363  ? -7.778  115.568 35.005  1.00 10.88 ? 363  ARG A C   1 
ATOM   2853  O O   . ARG A 1 363  ? -8.817  114.910 34.936  1.00 10.51 ? 363  ARG A O   1 
ATOM   2854  C CB  . ARG A 1 363  ? -6.689  115.696 37.261  1.00 7.83  ? 363  ARG A CB  1 
ATOM   2855  C CG  . ARG A 1 363  ? -8.028  115.387 37.975  1.00 8.24  ? 363  ARG A CG  1 
ATOM   2856  C CD  . ARG A 1 363  ? -8.065  115.913 39.421  1.00 6.91  ? 363  ARG A CD  1 
ATOM   2857  N NE  . ARG A 1 363  ? -7.371  115.047 40.377  1.00 8.20  ? 363  ARG A NE  1 
ATOM   2858  C CZ  . ARG A 1 363  ? -7.966  114.128 41.138  1.00 11.54 ? 363  ARG A CZ  1 
ATOM   2859  N NH1 . ARG A 1 363  ? -9.283  113.942 41.063  1.00 10.70 ? 363  ARG A NH1 1 
ATOM   2860  N NH2 . ARG A 1 363  ? -7.248  113.393 41.991  1.00 10.30 ? 363  ARG A NH2 1 
ATOM   2861  N N   . TYR A 1 364  ? -7.605  116.720 34.365  1.00 11.71 ? 364  TYR A N   1 
ATOM   2862  C CA  . TYR A 1 364  ? -8.642  117.293 33.525  1.00 12.87 ? 364  TYR A CA  1 
ATOM   2863  C C   . TYR A 1 364  ? -8.912  116.351 32.348  1.00 13.55 ? 364  TYR A C   1 
ATOM   2864  O O   . TYR A 1 364  ? -10.071 116.060 32.025  1.00 13.25 ? 364  TYR A O   1 
ATOM   2865  C CB  . TYR A 1 364  ? -8.199  118.672 33.014  1.00 14.29 ? 364  TYR A CB  1 
ATOM   2866  C CG  . TYR A 1 364  ? -8.962  119.134 31.788  1.00 15.77 ? 364  TYR A CG  1 
ATOM   2867  C CD1 . TYR A 1 364  ? -10.297 119.536 31.875  1.00 14.44 ? 364  TYR A CD1 1 
ATOM   2868  C CD2 . TYR A 1 364  ? -8.360  119.120 30.534  1.00 14.40 ? 364  TYR A CD2 1 
ATOM   2869  C CE1 . TYR A 1 364  ? -11.001 119.908 30.740  1.00 15.60 ? 364  TYR A CE1 1 
ATOM   2870  C CE2 . TYR A 1 364  ? -9.054  119.486 29.405  1.00 15.70 ? 364  TYR A CE2 1 
ATOM   2871  C CZ  . TYR A 1 364  ? -10.370 119.878 29.512  1.00 15.29 ? 364  TYR A CZ  1 
ATOM   2872  O OH  . TYR A 1 364  ? -11.039 120.228 28.372  1.00 15.96 ? 364  TYR A OH  1 
ATOM   2873  N N   . ILE A 1 365  ? -7.832  115.885 31.720  1.00 12.42 ? 365  ILE A N   1 
ATOM   2874  C CA  . ILE A 1 365  ? -7.908  114.960 30.589  1.00 11.43 ? 365  ILE A CA  1 
ATOM   2875  C C   . ILE A 1 365  ? -8.599  113.678 31.049  1.00 11.11 ? 365  ILE A C   1 
ATOM   2876  O O   . ILE A 1 365  ? -9.545  113.186 30.408  1.00 11.47 ? 365  ILE A O   1 
ATOM   2877  C CB  . ILE A 1 365  ? -6.489  114.570 30.080  1.00 13.24 ? 365  ILE A CB  1 
ATOM   2878  C CG1 . ILE A 1 365  ? -5.741  115.810 29.598  1.00 14.10 ? 365  ILE A CG1 1 
ATOM   2879  C CG2 . ILE A 1 365  ? -6.582  113.530 28.974  1.00 12.92 ? 365  ILE A CG2 1 
ATOM   2880  C CD1 . ILE A 1 365  ? -4.300  115.525 29.213  1.00 16.68 ? 365  ILE A CD1 1 
ATOM   2881  N N   . ARG A 1 366  ? -8.124  113.147 32.170  1.00 8.21  ? 366  ARG A N   1 
ATOM   2882  C CA  . ARG A 1 366  ? -8.668  111.913 32.700  1.00 7.44  ? 366  ARG A CA  1 
ATOM   2883  C C   . ARG A 1 366  ? -10.159 112.054 32.923  1.00 8.23  ? 366  ARG A C   1 
ATOM   2884  O O   . ARG A 1 366  ? -10.950 111.215 32.487  1.00 8.58  ? 366  ARG A O   1 
ATOM   2885  C CB  . ARG A 1 366  ? -7.939  111.526 33.995  1.00 5.53  ? 366  ARG A CB  1 
ATOM   2886  C CG  . ARG A 1 366  ? -8.526  110.334 34.726  1.00 3.09  ? 366  ARG A CG  1 
ATOM   2887  C CD  . ARG A 1 366  ? -9.618  110.783 35.682  1.00 9.52  ? 366  ARG A CD  1 
ATOM   2888  N NE  . ARG A 1 366  ? -9.442  110.094 36.945  1.00 16.37 ? 366  ARG A NE  1 
ATOM   2889  C CZ  . ARG A 1 366  ? -9.762  110.588 38.125  1.00 16.27 ? 366  ARG A CZ  1 
ATOM   2890  N NH1 . ARG A 1 366  ? -10.291 111.798 38.221  1.00 14.83 ? 366  ARG A NH1 1 
ATOM   2891  N NH2 . ARG A 1 366  ? -9.511  109.869 39.209  1.00 22.59 ? 366  ARG A NH2 1 
ATOM   2892  N N   . ASP A 1 367  ? -10.543 113.126 33.593  1.00 9.32  ? 367  ASP A N   1 
ATOM   2893  C CA  . ASP A 1 367  ? -11.950 113.364 33.861  1.00 12.14 ? 367  ASP A CA  1 
ATOM   2894  C C   . ASP A 1 367  ? -12.757 113.394 32.586  1.00 13.34 ? 367  ASP A C   1 
ATOM   2895  O O   . ASP A 1 367  ? -13.843 112.812 32.517  1.00 13.45 ? 367  ASP A O   1 
ATOM   2896  C CB  . ASP A 1 367  ? -12.123 114.681 34.605  1.00 12.01 ? 367  ASP A CB  1 
ATOM   2897  C CG  . ASP A 1 367  ? -11.798 114.544 36.061  1.00 12.45 ? 367  ASP A CG  1 
ATOM   2898  O OD1 . ASP A 1 367  ? -10.954 113.687 36.380  1.00 16.33 ? 367  ASP A OD1 1 
ATOM   2899  O OD2 . ASP A 1 367  ? -12.373 115.280 36.881  1.00 16.85 ? 367  ASP A OD2 1 
ATOM   2900  N N   . ALA A 1 368  ? -12.216 114.065 31.575  1.00 13.22 ? 368  ALA A N   1 
ATOM   2901  C CA  . ALA A 1 368  ? -12.906 114.188 30.305  1.00 13.37 ? 368  ALA A CA  1 
ATOM   2902  C C   . ALA A 1 368  ? -13.043 112.826 29.654  1.00 13.74 ? 368  ALA A C   1 
ATOM   2903  O O   . ALA A 1 368  ? -14.107 112.487 29.132  1.00 13.11 ? 368  ALA A O   1 
ATOM   2904  C CB  . ALA A 1 368  ? -12.140 115.145 29.372  1.00 13.70 ? 368  ALA A CB  1 
ATOM   2905  N N   . MET A 1 369  ? -11.975 112.033 29.720  1.00 13.47 ? 369  MET A N   1 
ATOM   2906  C CA  . MET A 1 369  ? -11.987 110.724 29.087  1.00 12.05 ? 369  MET A CA  1 
ATOM   2907  C C   . MET A 1 369  ? -12.817 109.688 29.812  1.00 12.00 ? 369  MET A C   1 
ATOM   2908  O O   . MET A 1 369  ? -13.045 108.587 29.300  1.00 12.45 ? 369  MET A O   1 
ATOM   2909  C CB  . MET A 1 369  ? -10.548 110.233 28.861  1.00 9.48  ? 369  MET A CB  1 
ATOM   2910  C CG  . MET A 1 369  ? -9.928  110.818 27.594  1.00 6.75  ? 369  MET A CG  1 
ATOM   2911  S SD  . MET A 1 369  ? -8.182  110.442 27.345  1.00 14.97 ? 369  MET A SD  1 
ATOM   2912  C CE  . MET A 1 369  ? -8.272  108.688 26.837  1.00 10.55 ? 369  MET A CE  1 
ATOM   2913  N N   . ALA A 1 370  ? -13.304 110.047 30.991  1.00 11.95 ? 370  ALA A N   1 
ATOM   2914  C CA  . ALA A 1 370  ? -14.111 109.115 31.769  1.00 11.16 ? 370  ALA A CA  1 
ATOM   2915  C C   . ALA A 1 370  ? -15.566 109.247 31.378  1.00 10.88 ? 370  ALA A C   1 
ATOM   2916  O O   . ALA A 1 370  ? -16.394 108.409 31.734  1.00 10.81 ? 370  ALA A O   1 
ATOM   2917  C CB  . ALA A 1 370  ? -13.954 109.405 33.251  1.00 7.18  ? 370  ALA A CB  1 
ATOM   2918  N N   . CYS A 1 371  ? -15.868 110.300 30.635  1.00 11.17 ? 371  CYS A N   1 
ATOM   2919  C CA  . CYS A 1 371  ? -17.241 110.579 30.260  1.00 13.41 ? 371  CYS A CA  1 
ATOM   2920  C C   . CYS A 1 371  ? -17.769 109.868 29.025  1.00 13.63 ? 371  CYS A C   1 
ATOM   2921  O O   . CYS A 1 371  ? -18.965 109.913 28.760  1.00 15.64 ? 371  CYS A O   1 
ATOM   2922  C CB  . CYS A 1 371  ? -17.420 112.091 30.134  1.00 13.16 ? 371  CYS A CB  1 
ATOM   2923  S SG  . CYS A 1 371  ? -17.059 112.984 31.708  1.00 16.77 ? 371  CYS A SG  1 
ATOM   2924  N N   . THR A 1 372  ? -16.882 109.201 28.290  1.00 12.57 ? 372  THR A N   1 
ATOM   2925  C CA  . THR A 1 372  ? -17.235 108.467 27.077  1.00 11.63 ? 372  THR A CA  1 
ATOM   2926  C C   . THR A 1 372  ? -18.101 107.259 27.429  1.00 11.04 ? 372  THR A C   1 
ATOM   2927  O O   . THR A 1 372  ? -17.891 106.621 28.461  1.00 11.66 ? 372  THR A O   1 
ATOM   2928  C CB  . THR A 1 372  ? -15.959 107.971 26.381  1.00 13.08 ? 372  THR A CB  1 
ATOM   2929  O OG1 . THR A 1 372  ? -15.020 109.047 26.335  1.00 14.78 ? 372  THR A OG1 1 
ATOM   2930  C CG2 . THR A 1 372  ? -16.242 107.467 24.960  1.00 9.95  ? 372  THR A CG2 1 
ATOM   2931  N N   . SER A 1 373  ? -19.068 106.939 26.575  1.00 11.29 ? 373  SER A N   1 
ATOM   2932  C CA  . SER A 1 373  ? -19.940 105.795 26.828  1.00 10.88 ? 373  SER A CA  1 
ATOM   2933  C C   . SER A 1 373  ? -19.111 104.547 27.021  1.00 10.61 ? 373  SER A C   1 
ATOM   2934  O O   . SER A 1 373  ? -18.126 104.334 26.314  1.00 12.96 ? 373  SER A O   1 
ATOM   2935  C CB  . SER A 1 373  ? -20.888 105.560 25.665  1.00 10.01 ? 373  SER A CB  1 
ATOM   2936  O OG  . SER A 1 373  ? -21.452 104.268 25.776  1.00 13.33 ? 373  SER A OG  1 
ATOM   2937  N N   . GLY A 1 374  ? -19.508 103.717 27.972  1.00 10.82 ? 374  GLY A N   1 
ATOM   2938  C CA  . GLY A 1 374  ? -18.761 102.502 28.225  1.00 11.03 ? 374  GLY A CA  1 
ATOM   2939  C C   . GLY A 1 374  ? -19.539 101.256 27.849  1.00 12.12 ? 374  GLY A C   1 
ATOM   2940  O O   . GLY A 1 374  ? -19.278 100.173 28.365  1.00 14.04 ? 374  GLY A O   1 
ATOM   2941  N N   . ILE A 1 375  ? -20.495 101.385 26.940  1.00 10.65 ? 375  ILE A N   1 
ATOM   2942  C CA  . ILE A 1 375  ? -21.278 100.222 26.573  1.00 10.28 ? 375  ILE A CA  1 
ATOM   2943  C C   . ILE A 1 375  ? -20.508 99.267  25.674  1.00 12.46 ? 375  ILE A C   1 
ATOM   2944  O O   . ILE A 1 375  ? -19.603 99.667  24.938  1.00 12.52 ? 375  ILE A O   1 
ATOM   2945  C CB  . ILE A 1 375  ? -22.564 100.622 25.848  1.00 9.56  ? 375  ILE A CB  1 
ATOM   2946  C CG1 . ILE A 1 375  ? -22.223 101.349 24.551  1.00 9.13  ? 375  ILE A CG1 1 
ATOM   2947  C CG2 . ILE A 1 375  ? -23.401 101.546 26.728  1.00 11.30 ? 375  ILE A CG2 1 
ATOM   2948  C CD1 . ILE A 1 375  ? -23.377 101.401 23.591  1.00 7.45  ? 375  ILE A CD1 1 
ATOM   2949  N N   . PHE A 1 376  ? -20.867 97.992  25.753  1.00 12.53 ? 376  PHE A N   1 
ATOM   2950  C CA  . PHE A 1 376  ? -20.256 96.979  24.910  1.00 12.08 ? 376  PHE A CA  1 
ATOM   2951  C C   . PHE A 1 376  ? -21.174 96.964  23.697  1.00 13.39 ? 376  PHE A C   1 
ATOM   2952  O O   . PHE A 1 376  ? -22.308 96.511  23.796  1.00 16.38 ? 376  PHE A O   1 
ATOM   2953  C CB  . PHE A 1 376  ? -20.295 95.620  25.606  1.00 10.90 ? 376  PHE A CB  1 
ATOM   2954  C CG  . PHE A 1 376  ? -19.212 95.426  26.640  1.00 11.25 ? 376  PHE A CG  1 
ATOM   2955  C CD1 . PHE A 1 376  ? -17.920 95.060  26.255  1.00 8.47  ? 376  PHE A CD1 1 
ATOM   2956  C CD2 . PHE A 1 376  ? -19.497 95.557  27.999  1.00 9.43  ? 376  PHE A CD2 1 
ATOM   2957  C CE1 . PHE A 1 376  ? -16.933 94.821  27.201  1.00 7.24  ? 376  PHE A CE1 1 
ATOM   2958  C CE2 . PHE A 1 376  ? -18.507 95.319  28.959  1.00 11.08 ? 376  PHE A CE2 1 
ATOM   2959  C CZ  . PHE A 1 376  ? -17.225 94.947  28.558  1.00 7.74  ? 376  PHE A CZ  1 
ATOM   2960  N N   . LEU A 1 377  ? -20.702 97.471  22.567  1.00 11.50 ? 377  LEU A N   1 
ATOM   2961  C CA  . LEU A 1 377  ? -21.521 97.526  21.367  1.00 12.89 ? 377  LEU A CA  1 
ATOM   2962  C C   . LEU A 1 377  ? -22.045 96.155  20.949  1.00 13.74 ? 377  LEU A C   1 
ATOM   2963  O O   . LEU A 1 377  ? -21.314 95.169  20.936  1.00 13.28 ? 377  LEU A O   1 
ATOM   2964  C CB  . LEU A 1 377  ? -20.732 98.170  20.220  1.00 12.74 ? 377  LEU A CB  1 
ATOM   2965  C CG  . LEU A 1 377  ? -20.475 99.677  20.327  1.00 13.51 ? 377  LEU A CG  1 
ATOM   2966  C CD1 . LEU A 1 377  ? -19.742 100.002 21.598  1.00 14.11 ? 377  LEU A CD1 1 
ATOM   2967  C CD2 . LEU A 1 377  ? -19.658 100.134 19.137  1.00 16.13 ? 377  LEU A CD2 1 
ATOM   2968  N N   . VAL A 1 378  ? -23.323 96.100  20.590  1.00 14.46 ? 378  VAL A N   1 
ATOM   2969  C CA  . VAL A 1 378  ? -23.923 94.835  20.194  1.00 11.92 ? 378  VAL A CA  1 
ATOM   2970  C C   . VAL A 1 378  ? -24.591 94.871  18.837  1.00 10.41 ? 378  VAL A C   1 
ATOM   2971  O O   . VAL A 1 378  ? -25.260 95.836  18.497  1.00 9.23  ? 378  VAL A O   1 
ATOM   2972  C CB  . VAL A 1 378  ? -24.984 94.401  21.224  1.00 12.77 ? 378  VAL A CB  1 
ATOM   2973  C CG1 . VAL A 1 378  ? -25.976 93.427  20.593  1.00 12.20 ? 378  VAL A CG1 1 
ATOM   2974  C CG2 . VAL A 1 378  ? -24.314 93.786  22.426  1.00 10.70 ? 378  VAL A CG2 1 
ATOM   2975  N N   . ARG A 1 379  ? -24.389 93.802  18.071  1.00 11.39 ? 379  ARG A N   1 
ATOM   2976  C CA  . ARG A 1 379  ? -25.019 93.622  16.764  1.00 11.30 ? 379  ARG A CA  1 
ATOM   2977  C C   . ARG A 1 379  ? -25.064 92.120  16.524  1.00 11.83 ? 379  ARG A C   1 
ATOM   2978  O O   . ARG A 1 379  ? -24.375 91.361  17.196  1.00 12.74 ? 379  ARG A O   1 
ATOM   2979  C CB  . ARG A 1 379  ? -24.250 94.344  15.646  1.00 11.21 ? 379  ARG A CB  1 
ATOM   2980  C CG  . ARG A 1 379  ? -22.850 93.864  15.390  1.00 10.93 ? 379  ARG A CG  1 
ATOM   2981  C CD  . ARG A 1 379  ? -22.253 94.589  14.191  1.00 9.63  ? 379  ARG A CD  1 
ATOM   2982  N NE  . ARG A 1 379  ? -20.869 94.184  13.976  1.00 10.41 ? 379  ARG A NE  1 
ATOM   2983  C CZ  . ARG A 1 379  ? -20.005 94.830  13.203  1.00 12.40 ? 379  ARG A CZ  1 
ATOM   2984  N NH1 . ARG A 1 379  ? -20.379 95.923  12.558  1.00 13.31 ? 379  ARG A NH1 1 
ATOM   2985  N NH2 . ARG A 1 379  ? -18.755 94.389  13.089  1.00 16.12 ? 379  ARG A NH2 1 
ATOM   2986  N N   . THR A 1 380  ? -25.878 91.678  15.583  1.00 11.63 ? 380  THR A N   1 
ATOM   2987  C CA  . THR A 1 380  ? -25.997 90.246  15.332  1.00 11.43 ? 380  THR A CA  1 
ATOM   2988  C C   . THR A 1 380  ? -24.719 89.692  14.696  1.00 12.03 ? 380  THR A C   1 
ATOM   2989  O O   . THR A 1 380  ? -23.994 90.422  14.010  1.00 12.45 ? 380  THR A O   1 
ATOM   2990  C CB  . THR A 1 380  ? -27.181 89.947  14.381  1.00 8.88  ? 380  THR A CB  1 
ATOM   2991  O OG1 . THR A 1 380  ? -26.874 90.483  13.094  1.00 11.37 ? 380  THR A OG1 1 
ATOM   2992  C CG2 . THR A 1 380  ? -28.478 90.583  14.883  1.00 2.71  ? 380  THR A CG2 1 
ATOM   2993  N N   . PRO A 1 381  ? -24.424 88.395  14.919  1.00 12.06 ? 381  PRO A N   1 
ATOM   2994  C CA  . PRO A 1 381  ? -23.222 87.797  14.337  1.00 12.37 ? 381  PRO A CA  1 
ATOM   2995  C C   . PRO A 1 381  ? -23.247 87.935  12.828  1.00 13.59 ? 381  PRO A C   1 
ATOM   2996  O O   . PRO A 1 381  ? -22.221 88.203  12.205  1.00 16.60 ? 381  PRO A O   1 
ATOM   2997  C CB  . PRO A 1 381  ? -23.299 86.347  14.802  1.00 9.48  ? 381  PRO A CB  1 
ATOM   2998  C CG  . PRO A 1 381  ? -23.892 86.486  16.151  1.00 9.04  ? 381  PRO A CG  1 
ATOM   2999  C CD  . PRO A 1 381  ? -25.026 87.473  15.905  1.00 12.05 ? 381  PRO A CD  1 
ATOM   3000  N N   . THR A 1 382  ? -24.422 87.763  12.239  1.00 13.74 ? 382  THR A N   1 
ATOM   3001  C CA  . THR A 1 382  ? -24.555 87.905  10.793  1.00 14.78 ? 382  THR A CA  1 
ATOM   3002  C C   . THR A 1 382  ? -23.943 89.231  10.334  1.00 15.67 ? 382  THR A C   1 
ATOM   3003  O O   . THR A 1 382  ? -23.194 89.272  9.359   1.00 17.60 ? 382  THR A O   1 
ATOM   3004  C CB  . THR A 1 382  ? -26.026 87.910  10.348  1.00 11.49 ? 382  THR A CB  1 
ATOM   3005  O OG1 . THR A 1 382  ? -26.645 86.686  10.735  1.00 15.03 ? 382  THR A OG1 1 
ATOM   3006  C CG2 . THR A 1 382  ? -26.119 88.057  8.857   1.00 8.31  ? 382  THR A CG2 1 
ATOM   3007  N N   . GLU A 1 383  ? -24.275 90.312  11.033  1.00 15.47 ? 383  GLU A N   1 
ATOM   3008  C CA  . GLU A 1 383  ? -23.761 91.625  10.671  1.00 17.33 ? 383  GLU A CA  1 
ATOM   3009  C C   . GLU A 1 383  ? -22.249 91.713  10.831  1.00 17.40 ? 383  GLU A C   1 
ATOM   3010  O O   . GLU A 1 383  ? -21.571 92.248  9.967   1.00 17.26 ? 383  GLU A O   1 
ATOM   3011  C CB  . GLU A 1 383  ? -24.430 92.718  11.503  1.00 16.42 ? 383  GLU A CB  1 
ATOM   3012  C CG  . GLU A 1 383  ? -25.925 92.887  11.264  1.00 19.71 ? 383  GLU A CG  1 
ATOM   3013  C CD  . GLU A 1 383  ? -26.273 93.226  9.824   1.00 21.00 ? 383  GLU A CD  1 
ATOM   3014  O OE1 . GLU A 1 383  ? -25.397 93.780  9.125   1.00 21.58 ? 383  GLU A OE1 1 
ATOM   3015  O OE2 . GLU A 1 383  ? -27.429 92.952  9.401   1.00 20.97 ? 383  GLU A OE2 1 
ATOM   3016  N N   . THR A 1 384  ? -21.721 91.197  11.934  1.00 18.17 ? 384  THR A N   1 
ATOM   3017  C CA  . THR A 1 384  ? -20.278 91.232  12.138  1.00 19.13 ? 384  THR A CA  1 
ATOM   3018  C C   . THR A 1 384  ? -19.571 90.416  11.060  1.00 19.22 ? 384  THR A C   1 
ATOM   3019  O O   . THR A 1 384  ? -18.578 90.859  10.499  1.00 18.05 ? 384  THR A O   1 
ATOM   3020  C CB  . THR A 1 384  ? -19.880 90.665  13.509  1.00 18.18 ? 384  THR A CB  1 
ATOM   3021  O OG1 . THR A 1 384  ? -20.323 91.553  14.540  1.00 20.97 ? 384  THR A OG1 1 
ATOM   3022  C CG2 . THR A 1 384  ? -18.386 90.519  13.600  1.00 18.42 ? 384  THR A CG2 1 
ATOM   3023  N N   . VAL A 1 385  ? -20.085 89.228  10.766  1.00 20.38 ? 385  VAL A N   1 
ATOM   3024  C CA  . VAL A 1 385  ? -19.463 88.392  9.751   1.00 23.37 ? 385  VAL A CA  1 
ATOM   3025  C C   . VAL A 1 385  ? -19.418 89.095  8.401   1.00 24.52 ? 385  VAL A C   1 
ATOM   3026  O O   . VAL A 1 385  ? -18.377 89.132  7.740   1.00 24.84 ? 385  VAL A O   1 
ATOM   3027  C CB  . VAL A 1 385  ? -20.222 87.082  9.548   1.00 23.96 ? 385  VAL A CB  1 
ATOM   3028  C CG1 . VAL A 1 385  ? -19.567 86.267  8.452   1.00 25.16 ? 385  VAL A CG1 1 
ATOM   3029  C CG2 . VAL A 1 385  ? -20.247 86.307  10.825  1.00 27.56 ? 385  VAL A CG2 1 
ATOM   3030  N N   . LEU A 1 386  ? -20.550 89.654  7.994   1.00 23.98 ? 386  LEU A N   1 
ATOM   3031  C CA  . LEU A 1 386  ? -20.625 90.316  6.710   1.00 24.84 ? 386  LEU A CA  1 
ATOM   3032  C C   . LEU A 1 386  ? -19.834 91.618  6.600   1.00 27.82 ? 386  LEU A C   1 
ATOM   3033  O O   . LEU A 1 386  ? -19.550 92.070  5.492   1.00 28.94 ? 386  LEU A O   1 
ATOM   3034  C CB  . LEU A 1 386  ? -22.092 90.534  6.319   1.00 20.49 ? 386  LEU A CB  1 
ATOM   3035  C CG  . LEU A 1 386  ? -22.872 89.230  6.128   1.00 18.81 ? 386  LEU A CG  1 
ATOM   3036  C CD1 . LEU A 1 386  ? -24.223 89.532  5.520   1.00 15.97 ? 386  LEU A CD1 1 
ATOM   3037  C CD2 . LEU A 1 386  ? -22.095 88.270  5.224   1.00 14.99 ? 386  LEU A CD2 1 
ATOM   3038  N N   . GLN A 1 387  ? -19.454 92.219  7.725   1.00 30.37 ? 387  GLN A N   1 
ATOM   3039  C CA  . GLN A 1 387  ? -18.689 93.458  7.653   1.00 32.65 ? 387  GLN A CA  1 
ATOM   3040  C C   . GLN A 1 387  ? -17.182 93.253  7.813   1.00 34.07 ? 387  GLN A C   1 
ATOM   3041  O O   . GLN A 1 387  ? -16.394 93.953  7.186   1.00 35.11 ? 387  GLN A O   1 
ATOM   3042  C CB  . GLN A 1 387  ? -19.183 94.473  8.694   1.00 33.11 ? 387  GLN A CB  1 
ATOM   3043  C CG  . GLN A 1 387  ? -19.392 95.882  8.113   1.00 37.09 ? 387  GLN A CG  1 
ATOM   3044  C CD  . GLN A 1 387  ? -19.067 97.028  9.088   1.00 39.17 ? 387  GLN A CD  1 
ATOM   3045  O OE1 . GLN A 1 387  ? -19.129 98.200  8.710   1.00 38.49 ? 387  GLN A OE1 1 
ATOM   3046  N NE2 . GLN A 1 387  ? -18.719 96.692  10.335  1.00 37.40 ? 387  GLN A NE2 1 
ATOM   3047  N N   . GLU A 1 388  ? -16.776 92.284  8.628   1.00 36.54 ? 388  GLU A N   1 
ATOM   3048  C CA  . GLU A 1 388  ? -15.351 92.042  8.871   1.00 39.46 ? 388  GLU A CA  1 
ATOM   3049  C C   . GLU A 1 388  ? -14.698 90.955  7.991   1.00 41.10 ? 388  GLU A C   1 
ATOM   3050  O O   . GLU A 1 388  ? -13.504 90.680  8.127   1.00 40.97 ? 388  GLU A O   1 
ATOM   3051  C CB  . GLU A 1 388  ? -15.132 91.695  10.356  1.00 41.16 ? 388  GLU A CB  1 
ATOM   3052  C CG  . GLU A 1 388  ? -15.856 92.608  11.370  1.00 46.02 ? 388  GLU A CG  1 
ATOM   3053  C CD  . GLU A 1 388  ? -15.520 94.104  11.238  1.00 48.63 ? 388  GLU A CD  1 
ATOM   3054  O OE1 . GLU A 1 388  ? -14.325 94.464  11.346  1.00 50.46 ? 388  GLU A OE1 1 
ATOM   3055  O OE2 . GLU A 1 388  ? -16.458 94.922  11.042  1.00 48.79 ? 388  GLU A OE2 1 
ATOM   3056  N N   . TYR A 1 389  ? -15.459 90.352  7.080   1.00 43.08 ? 389  TYR A N   1 
ATOM   3057  C CA  . TYR A 1 389  ? -14.908 89.300  6.224   1.00 44.76 ? 389  TYR A CA  1 
ATOM   3058  C C   . TYR A 1 389  ? -15.332 89.458  4.772   1.00 45.34 ? 389  TYR A C   1 
ATOM   3059  O O   . TYR A 1 389  ? -15.319 88.501  4.008   1.00 45.36 ? 389  TYR A O   1 
ATOM   3060  C CB  . TYR A 1 389  ? -15.372 87.926  6.723   1.00 46.01 ? 389  TYR A CB  1 
ATOM   3061  C CG  . TYR A 1 389  ? -14.925 87.607  8.131   1.00 47.84 ? 389  TYR A CG  1 
ATOM   3062  C CD1 . TYR A 1 389  ? -13.662 87.074  8.379   1.00 48.89 ? 389  TYR A CD1 1 
ATOM   3063  C CD2 . TYR A 1 389  ? -15.757 87.862  9.221   1.00 48.17 ? 389  TYR A CD2 1 
ATOM   3064  C CE1 . TYR A 1 389  ? -13.238 86.801  9.679   1.00 49.94 ? 389  TYR A CE1 1 
ATOM   3065  C CE2 . TYR A 1 389  ? -15.346 87.593  10.521  1.00 49.86 ? 389  TYR A CE2 1 
ATOM   3066  C CZ  . TYR A 1 389  ? -14.087 87.061  10.745  1.00 50.80 ? 389  TYR A CZ  1 
ATOM   3067  O OH  . TYR A 1 389  ? -13.674 86.764  12.026  1.00 51.89 ? 389  TYR A OH  1 
ATOM   3068  N N   . THR A 1 390  ? -15.691 90.665  4.375   1.00 48.15 ? 390  THR A N   1 
ATOM   3069  C CA  . THR A 1 390  ? -16.167 90.856  3.022   1.00 51.32 ? 390  THR A CA  1 
ATOM   3070  C C   . THR A 1 390  ? -15.184 91.465  2.028   1.00 52.72 ? 390  THR A C   1 
ATOM   3071  O O   . THR A 1 390  ? -15.260 91.203  0.823   1.00 53.32 ? 390  THR A O   1 
ATOM   3072  C CB  . THR A 1 390  ? -17.456 91.705  3.058   1.00 51.73 ? 390  THR A CB  1 
ATOM   3073  O OG1 . THR A 1 390  ? -18.465 91.051  2.283   1.00 52.89 ? 390  THR A OG1 1 
ATOM   3074  C CG2 . THR A 1 390  ? -17.200 93.119  2.531   1.00 52.05 ? 390  THR A CG2 1 
ATOM   3075  N N   . GLN A 1 391  ? -14.255 92.267  2.521   1.00 54.27 ? 391  GLN A N   1 
ATOM   3076  C CA  . GLN A 1 391  ? -13.329 92.920  1.610   1.00 57.28 ? 391  GLN A CA  1 
ATOM   3077  C C   . GLN A 1 391  ? -11.894 92.434  1.729   1.00 55.89 ? 391  GLN A C   1 
ATOM   3078  O O   . GLN A 1 391  ? -11.424 92.081  2.811   1.00 56.50 ? 391  GLN A O   1 
ATOM   3079  C CB  . GLN A 1 391  ? -13.379 94.451  1.803   1.00 60.64 ? 391  GLN A CB  1 
ATOM   3080  C CG  . GLN A 1 391  ? -14.718 95.134  1.440   1.00 64.98 ? 391  GLN A CG  1 
ATOM   3081  C CD  . GLN A 1 391  ? -14.664 96.641  1.629   1.00 67.88 ? 391  GLN A CD  1 
ATOM   3082  O OE1 . GLN A 1 391  ? -14.190 97.126  2.672   1.00 69.13 ? 391  GLN A OE1 1 
ATOM   3083  N NE2 . GLN A 1 391  ? -15.157 97.395  0.626   1.00 68.55 ? 391  GLN A NE2 1 
ATOM   3084  N N   . SER A 1 392  ? -11.202 92.440  0.597   1.00 53.59 ? 392  SER A N   1 
ATOM   3085  C CA  . SER A 1 392  ? -9.814  92.020  0.540   1.00 52.01 ? 392  SER A CA  1 
ATOM   3086  C C   . SER A 1 392  ? -8.936  93.270  0.469   1.00 49.79 ? 392  SER A C   1 
ATOM   3087  O O   . SER A 1 392  ? -9.425  94.367  0.221   1.00 49.77 ? 392  SER A O   1 
ATOM   3088  C CB  . SER A 1 392  ? -9.589  91.138  -0.695  1.00 52.39 ? 392  SER A CB  1 
ATOM   3089  O OG  . SER A 1 392  ? -10.343 89.939  -0.611  1.00 52.58 ? 392  SER A OG  1 
ATOM   3090  N N   . PRO A 1 393  ? -7.630  93.124  0.707   1.00 47.80 ? 393  PRO A N   1 
ATOM   3091  C CA  . PRO A 1 393  ? -6.761  94.300  0.642   1.00 46.72 ? 393  PRO A CA  1 
ATOM   3092  C C   . PRO A 1 393  ? -6.470  94.641  -0.816  1.00 44.51 ? 393  PRO A C   1 
ATOM   3093  O O   . PRO A 1 393  ? -6.545  93.773  -1.683  1.00 44.58 ? 393  PRO A O   1 
ATOM   3094  C CB  . PRO A 1 393  ? -5.510  93.826  1.371   1.00 47.66 ? 393  PRO A CB  1 
ATOM   3095  C CG  . PRO A 1 393  ? -5.422  92.387  0.926   1.00 46.73 ? 393  PRO A CG  1 
ATOM   3096  C CD  . PRO A 1 393  ? -6.864  91.924  1.091   1.00 47.44 ? 393  PRO A CD  1 
ATOM   3097  N N   . GLU A 1 394  ? -6.152  95.897  -1.099  1.00 42.07 ? 394  GLU A N   1 
ATOM   3098  C CA  . GLU A 1 394  ? -5.827  96.254  -2.473  1.00 39.84 ? 394  GLU A CA  1 
ATOM   3099  C C   . GLU A 1 394  ? -4.311  96.277  -2.623  1.00 37.23 ? 394  GLU A C   1 
ATOM   3100  O O   . GLU A 1 394  ? -3.653  97.191  -2.125  1.00 36.04 ? 394  GLU A O   1 
ATOM   3101  C CB  . GLU A 1 394  ? -6.375  97.632  -2.848  1.00 42.58 ? 394  GLU A CB  1 
ATOM   3102  C CG  . GLU A 1 394  ? -6.272  97.915  -4.356  1.00 46.59 ? 394  GLU A CG  1 
ATOM   3103  C CD  . GLU A 1 394  ? -6.538  99.369  -4.727  1.00 48.67 ? 394  GLU A CD  1 
ATOM   3104  O OE1 . GLU A 1 394  ? -7.382  100.009 -4.055  1.00 49.94 ? 394  GLU A OE1 1 
ATOM   3105  O OE2 . GLU A 1 394  ? -5.914  99.861  -5.703  1.00 48.24 ? 394  GLU A OE2 1 
ATOM   3106  N N   . ILE A 1 395  ? -3.760  95.265  -3.289  1.00 33.61 ? 395  ILE A N   1 
ATOM   3107  C CA  . ILE A 1 395  ? -2.324  95.198  -3.513  1.00 31.19 ? 395  ILE A CA  1 
ATOM   3108  C C   . ILE A 1 395  ? -2.027  96.118  -4.689  1.00 30.16 ? 395  ILE A C   1 
ATOM   3109  O O   . ILE A 1 395  ? -2.165  95.710  -5.843  1.00 29.42 ? 395  ILE A O   1 
ATOM   3110  C CB  . ILE A 1 395  ? -1.858  93.782  -3.903  1.00 30.59 ? 395  ILE A CB  1 
ATOM   3111  C CG1 . ILE A 1 395  ? -2.293  92.757  -2.855  1.00 32.27 ? 395  ILE A CG1 1 
ATOM   3112  C CG2 . ILE A 1 395  ? -0.358  93.771  -4.055  1.00 30.10 ? 395  ILE A CG2 1 
ATOM   3113  C CD1 . ILE A 1 395  ? -1.767  93.028  -1.487  1.00 34.36 ? 395  ILE A CD1 1 
ATOM   3114  N N   . LYS A 1 396  ? -1.612  97.348  -4.408  1.00 27.87 ? 396  LYS A N   1 
ATOM   3115  C CA  . LYS A 1 396  ? -1.352  98.285  -5.490  1.00 28.90 ? 396  LYS A CA  1 
ATOM   3116  C C   . LYS A 1 396  ? -0.187  97.918  -6.407  1.00 28.09 ? 396  LYS A C   1 
ATOM   3117  O O   . LYS A 1 396  ? -0.137  98.388  -7.545  1.00 28.36 ? 396  LYS A O   1 
ATOM   3118  C CB  . LYS A 1 396  ? -1.188  99.711  -4.951  1.00 28.95 ? 396  LYS A CB  1 
ATOM   3119  C CG  . LYS A 1 396  ? -2.513  100.393 -4.629  1.00 27.48 ? 396  LYS A CG  1 
ATOM   3120  C CD  . LYS A 1 396  ? -2.314  101.891 -4.443  1.00 29.67 ? 396  LYS A CD  1 
ATOM   3121  C CE  . LYS A 1 396  ? -3.638  102.647 -4.326  1.00 31.12 ? 396  LYS A CE  1 
ATOM   3122  N NZ  . LYS A 1 396  ? -3.440  104.127 -4.341  1.00 30.81 ? 396  LYS A NZ  1 
ATOM   3123  N N   . VAL A 1 397  ? 0.740   97.092  -5.922  1.00 26.09 ? 397  VAL A N   1 
ATOM   3124  C CA  . VAL A 1 397  ? 1.872   96.637  -6.735  1.00 24.74 ? 397  VAL A CA  1 
ATOM   3125  C C   . VAL A 1 397  ? 2.049   95.138  -6.493  1.00 23.82 ? 397  VAL A C   1 
ATOM   3126  O O   . VAL A 1 397  ? 2.916   94.723  -5.731  1.00 23.93 ? 397  VAL A O   1 
ATOM   3127  C CB  . VAL A 1 397  ? 3.203   97.342  -6.356  1.00 25.89 ? 397  VAL A CB  1 
ATOM   3128  C CG1 . VAL A 1 397  ? 4.308   96.912  -7.330  1.00 23.64 ? 397  VAL A CG1 1 
ATOM   3129  C CG2 . VAL A 1 397  ? 3.042   98.849  -6.376  1.00 23.63 ? 397  VAL A CG2 1 
ATOM   3130  N N   . PRO A 1 398  ? 1.232   94.306  -7.153  1.00 22.76 ? 398  PRO A N   1 
ATOM   3131  C CA  . PRO A 1 398  ? 1.290   92.846  -7.005  1.00 21.26 ? 398  PRO A CA  1 
ATOM   3132  C C   . PRO A 1 398  ? 2.655   92.254  -7.306  1.00 20.30 ? 398  PRO A C   1 
ATOM   3133  O O   . PRO A 1 398  ? 3.520   92.886  -7.914  1.00 18.27 ? 398  PRO A O   1 
ATOM   3134  C CB  . PRO A 1 398  ? 0.254   92.337  -8.012  1.00 21.37 ? 398  PRO A CB  1 
ATOM   3135  C CG  . PRO A 1 398  ? -0.630  93.534  -8.277  1.00 23.63 ? 398  PRO A CG  1 
ATOM   3136  C CD  . PRO A 1 398  ? 0.342   94.679  -8.267  1.00 22.79 ? 398  PRO A CD  1 
ATOM   3137  N N   . ILE A 1 399  ? 2.842   91.014  -6.888  1.00 20.29 ? 399  ILE A N   1 
ATOM   3138  C CA  . ILE A 1 399  ? 4.095   90.344  -7.165  1.00 20.62 ? 399  ILE A CA  1 
ATOM   3139  C C   . ILE A 1 399  ? 3.937   89.779  -8.574  1.00 21.46 ? 399  ILE A C   1 
ATOM   3140  O O   . ILE A 1 399  ? 3.008   89.020  -8.847  1.00 20.95 ? 399  ILE A O   1 
ATOM   3141  C CB  . ILE A 1 399  ? 4.356   89.229  -6.137  1.00 17.26 ? 399  ILE A CB  1 
ATOM   3142  C CG1 . ILE A 1 399  ? 4.589   89.865  -4.759  1.00 15.90 ? 399  ILE A CG1 1 
ATOM   3143  C CG2 . ILE A 1 399  ? 5.529   88.390  -6.569  1.00 13.85 ? 399  ILE A CG2 1 
ATOM   3144  C CD1 . ILE A 1 399  ? 4.516   88.892  -3.597  1.00 14.37 ? 399  ILE A CD1 1 
ATOM   3145  N N   . PRO A 1 400  ? 4.824   90.182  -9.497  1.00 23.29 ? 400  PRO A N   1 
ATOM   3146  C CA  . PRO A 1 400  ? 4.759   89.704  -10.879 1.00 24.62 ? 400  PRO A CA  1 
ATOM   3147  C C   . PRO A 1 400  ? 4.634   88.189  -10.905 1.00 26.80 ? 400  PRO A C   1 
ATOM   3148  O O   . PRO A 1 400  ? 5.358   87.494  -10.194 1.00 26.24 ? 400  PRO A O   1 
ATOM   3149  C CB  . PRO A 1 400  ? 6.092   90.167  -11.475 1.00 23.92 ? 400  PRO A CB  1 
ATOM   3150  C CG  . PRO A 1 400  ? 6.398   91.405  -10.716 1.00 22.79 ? 400  PRO A CG  1 
ATOM   3151  C CD  . PRO A 1 400  ? 6.027   91.008  -9.285  1.00 24.70 ? 400  PRO A CD  1 
ATOM   3152  N N   . GLN A 1 401  ? 3.715   87.693  -11.728 1.00 27.61 ? 401  GLN A N   1 
ATOM   3153  C CA  . GLN A 1 401  ? 3.485   86.266  -11.884 1.00 27.65 ? 401  GLN A CA  1 
ATOM   3154  C C   . GLN A 1 401  ? 4.782   85.557  -12.325 1.00 27.14 ? 401  GLN A C   1 
ATOM   3155  O O   . GLN A 1 401  ? 5.076   84.442  -11.886 1.00 24.03 ? 401  GLN A O   1 
ATOM   3156  C CB  . GLN A 1 401  ? 2.390   86.067  -12.925 1.00 30.41 ? 401  GLN A CB  1 
ATOM   3157  C CG  . GLN A 1 401  ? 1.886   84.652  -13.090 1.00 36.64 ? 401  GLN A CG  1 
ATOM   3158  C CD  . GLN A 1 401  ? 0.831   84.559  -14.186 1.00 42.09 ? 401  GLN A CD  1 
ATOM   3159  O OE1 . GLN A 1 401  ? -0.175  85.289  -14.165 1.00 43.73 ? 401  GLN A OE1 1 
ATOM   3160  N NE2 . GLN A 1 401  ? 1.055   83.668  -15.157 1.00 42.88 ? 401  GLN A NE2 1 
ATOM   3161  N N   . LYS A 1 402  ? 5.565   86.220  -13.173 1.00 26.84 ? 402  LYS A N   1 
ATOM   3162  C CA  . LYS A 1 402  ? 6.815   85.644  -13.662 1.00 27.10 ? 402  LYS A CA  1 
ATOM   3163  C C   . LYS A 1 402  ? 7.902   85.527  -12.597 1.00 27.52 ? 402  LYS A C   1 
ATOM   3164  O O   . LYS A 1 402  ? 8.933   84.888  -12.827 1.00 26.78 ? 402  LYS A O   1 
ATOM   3165  C CB  . LYS A 1 402  ? 7.357   86.458  -14.838 1.00 27.58 ? 402  LYS A CB  1 
ATOM   3166  C CG  . LYS A 1 402  ? 7.817   87.861  -14.485 1.00 31.26 ? 402  LYS A CG  1 
ATOM   3167  C CD  . LYS A 1 402  ? 8.532   88.519  -15.664 1.00 32.73 ? 402  LYS A CD  1 
ATOM   3168  C CE  . LYS A 1 402  ? 9.037   89.906  -15.300 1.00 36.53 ? 402  LYS A CE  1 
ATOM   3169  N NZ  . LYS A 1 402  ? 10.023  89.871  -14.181 1.00 35.41 ? 402  LYS A NZ  1 
ATOM   3170  N N   . ASP A 1 403  ? 7.683   86.134  -11.433 1.00 27.01 ? 403  ASP A N   1 
ATOM   3171  C CA  . ASP A 1 403  ? 8.684   86.058  -10.377 1.00 28.21 ? 403  ASP A CA  1 
ATOM   3172  C C   . ASP A 1 403  ? 8.608   84.793  -9.498  1.00 27.22 ? 403  ASP A C   1 
ATOM   3173  O O   . ASP A 1 403  ? 9.407   84.615  -8.572  1.00 26.04 ? 403  ASP A O   1 
ATOM   3174  C CB  . ASP A 1 403  ? 8.640   87.323  -9.513  1.00 29.57 ? 403  ASP A CB  1 
ATOM   3175  C CG  . ASP A 1 403  ? 9.197   88.541  -10.237 1.00 32.09 ? 403  ASP A CG  1 
ATOM   3176  O OD1 . ASP A 1 403  ? 9.813   88.371  -11.318 1.00 30.00 ? 403  ASP A OD1 1 
ATOM   3177  O OD2 . ASP A 1 403  ? 9.022   89.668  -9.717  1.00 33.54 ? 403  ASP A OD2 1 
ATOM   3178  N N   . TRP A 1 404  ? 7.657   83.914  -9.798  1.00 25.08 ? 404  TRP A N   1 
ATOM   3179  C CA  . TRP A 1 404  ? 7.527   82.661  -9.058  1.00 24.90 ? 404  TRP A CA  1 
ATOM   3180  C C   . TRP A 1 404  ? 8.083   81.498  -9.896  1.00 24.41 ? 404  TRP A C   1 
ATOM   3181  O O   . TRP A 1 404  ? 8.069   81.547  -11.130 1.00 24.16 ? 404  TRP A O   1 
ATOM   3182  C CB  . TRP A 1 404  ? 6.059   82.370  -8.720  1.00 21.88 ? 404  TRP A CB  1 
ATOM   3183  C CG  . TRP A 1 404  ? 5.411   83.394  -7.859  1.00 21.22 ? 404  TRP A CG  1 
ATOM   3184  C CD1 . TRP A 1 404  ? 4.660   84.456  -8.268  1.00 20.69 ? 404  TRP A CD1 1 
ATOM   3185  C CD2 . TRP A 1 404  ? 5.440   83.449  -6.426  1.00 21.34 ? 404  TRP A CD2 1 
ATOM   3186  N NE1 . TRP A 1 404  ? 4.215   85.173  -7.178  1.00 19.50 ? 404  TRP A NE1 1 
ATOM   3187  C CE2 . TRP A 1 404  ? 4.687   84.580  -6.037  1.00 21.31 ? 404  TRP A CE2 1 
ATOM   3188  C CE3 . TRP A 1 404  ? 6.042   82.660  -5.437  1.00 19.44 ? 404  TRP A CE3 1 
ATOM   3189  C CZ2 . TRP A 1 404  ? 4.503   84.931  -4.690  1.00 21.95 ? 404  TRP A CZ2 1 
ATOM   3190  C CZ3 . TRP A 1 404  ? 5.861   83.007  -4.100  1.00 19.81 ? 404  TRP A CZ3 1 
ATOM   3191  C CH2 . TRP A 1 404  ? 5.102   84.138  -3.738  1.00 20.63 ? 404  TRP A CH2 1 
ATOM   3192  N N   . THR A 1 405  ? 8.569   80.456  -9.228  1.00 23.33 ? 405  THR A N   1 
ATOM   3193  C CA  . THR A 1 405  ? 9.087   79.293  -9.937  1.00 23.40 ? 405  THR A CA  1 
ATOM   3194  C C   . THR A 1 405  ? 7.914   78.351  -10.150 1.00 22.82 ? 405  THR A C   1 
ATOM   3195  O O   . THR A 1 405  ? 6.772   78.701  -9.856  1.00 19.41 ? 405  THR A O   1 
ATOM   3196  C CB  . THR A 1 405  ? 10.148  78.510  -9.112  1.00 23.79 ? 405  THR A CB  1 
ATOM   3197  O OG1 . THR A 1 405  ? 9.552   78.046  -7.892  1.00 23.73 ? 405  THR A OG1 1 
ATOM   3198  C CG2 . THR A 1 405  ? 11.357  79.383  -8.799  1.00 23.79 ? 405  THR A CG2 1 
ATOM   3199  N N   . GLY A 1 406  ? 8.210   77.160  -10.667 1.00 24.05 ? 406  GLY A N   1 
ATOM   3200  C CA  . GLY A 1 406  ? 7.173   76.171  -10.860 1.00 25.53 ? 406  GLY A CA  1 
ATOM   3201  C C   . GLY A 1 406  ? 6.848   75.712  -9.452  1.00 27.29 ? 406  GLY A C   1 
ATOM   3202  O O   . GLY A 1 406  ? 7.619   75.995  -8.532  1.00 28.17 ? 406  GLY A O   1 
ATOM   3203  N N   . PRO A 1 407  ? 5.738   74.994  -9.241  1.00 27.33 ? 407  PRO A N   1 
ATOM   3204  C CA  . PRO A 1 407  ? 5.375   74.536  -7.899  1.00 27.35 ? 407  PRO A CA  1 
ATOM   3205  C C   . PRO A 1 407  ? 6.243   73.423  -7.320  1.00 26.94 ? 407  PRO A C   1 
ATOM   3206  O O   . PRO A 1 407  ? 6.835   72.630  -8.045  1.00 26.92 ? 407  PRO A O   1 
ATOM   3207  C CB  . PRO A 1 407  ? 3.932   74.064  -8.067  1.00 27.00 ? 407  PRO A CB  1 
ATOM   3208  C CG  . PRO A 1 407  ? 3.488   74.637  -9.394  1.00 29.51 ? 407  PRO A CG  1 
ATOM   3209  C CD  . PRO A 1 407  ? 4.729   74.570  -10.222 1.00 29.12 ? 407  PRO A CD  1 
ATOM   3210  N N   . ILE A 1 408  ? 6.310   73.404  -5.997  1.00 26.28 ? 408  ILE A N   1 
ATOM   3211  C CA  . ILE A 1 408  ? 7.006   72.382  -5.248  1.00 26.09 ? 408  ILE A CA  1 
ATOM   3212  C C   . ILE A 1 408  ? 5.890   72.002  -4.292  1.00 24.76 ? 408  ILE A C   1 
ATOM   3213  O O   . ILE A 1 408  ? 5.845   72.453  -3.159  1.00 27.57 ? 408  ILE A O   1 
ATOM   3214  C CB  . ILE A 1 408  ? 8.203   72.934  -4.458  1.00 26.84 ? 408  ILE A CB  1 
ATOM   3215  C CG1 . ILE A 1 408  ? 9.276   73.417  -5.414  1.00 27.27 ? 408  ILE A CG1 1 
ATOM   3216  C CG2 . ILE A 1 408  ? 8.762   71.853  -3.556  1.00 24.77 ? 408  ILE A CG2 1 
ATOM   3217  C CD1 . ILE A 1 408  ? 10.505  74.004  -4.719  1.00 27.90 ? 408  ILE A CD1 1 
ATOM   3218  N N   . GLY A 1 409  ? 4.971   71.188  -4.787  1.00 23.21 ? 409  GLY A N   1 
ATOM   3219  C CA  . GLY A 1 409  ? 3.827   70.808  -4.001  1.00 22.13 ? 409  GLY A CA  1 
ATOM   3220  C C   . GLY A 1 409  ? 2.799   71.919  -4.075  1.00 23.18 ? 409  GLY A C   1 
ATOM   3221  O O   . GLY A 1 409  ? 2.320   72.261  -5.147  1.00 23.37 ? 409  GLY A O   1 
ATOM   3222  N N   . GLU A 1 410  ? 2.466   72.490  -2.930  1.00 23.94 ? 410  GLU A N   1 
ATOM   3223  C CA  . GLU A 1 410  ? 1.475   73.545  -2.861  1.00 26.29 ? 410  GLU A CA  1 
ATOM   3224  C C   . GLU A 1 410  ? 2.080   74.937  -2.993  1.00 25.79 ? 410  GLU A C   1 
ATOM   3225  O O   . GLU A 1 410  ? 1.368   75.902  -3.240  1.00 25.20 ? 410  GLU A O   1 
ATOM   3226  C CB  . GLU A 1 410  ? 0.728   73.462  -1.526  1.00 28.55 ? 410  GLU A CB  1 
ATOM   3227  C CG  . GLU A 1 410  ? -0.160  72.244  -1.344  1.00 30.15 ? 410  GLU A CG  1 
ATOM   3228  C CD  . GLU A 1 410  ? -1.454  72.346  -2.126  1.00 32.86 ? 410  GLU A CD  1 
ATOM   3229  O OE1 . GLU A 1 410  ? -1.857  73.491  -2.453  1.00 33.14 ? 410  GLU A OE1 1 
ATOM   3230  O OE2 . GLU A 1 410  ? -2.075  71.287  -2.397  1.00 31.98 ? 410  GLU A OE2 1 
ATOM   3231  N N   . ILE A 1 411  ? 3.393   75.041  -2.831  1.00 26.25 ? 411  ILE A N   1 
ATOM   3232  C CA  . ILE A 1 411  ? 4.040   76.345  -2.885  1.00 26.41 ? 411  ILE A CA  1 
ATOM   3233  C C   . ILE A 1 411  ? 4.931   76.610  -4.094  1.00 26.33 ? 411  ILE A C   1 
ATOM   3234  O O   . ILE A 1 411  ? 5.277   75.705  -4.853  1.00 26.86 ? 411  ILE A O   1 
ATOM   3235  C CB  . ILE A 1 411  ? 4.905   76.566  -1.648  1.00 26.75 ? 411  ILE A CB  1 
ATOM   3236  C CG1 . ILE A 1 411  ? 6.170   75.722  -1.751  1.00 27.47 ? 411  ILE A CG1 1 
ATOM   3237  C CG2 . ILE A 1 411  ? 4.144   76.161  -0.405  1.00 27.83 ? 411  ILE A CG2 1 
ATOM   3238  C CD1 . ILE A 1 411  ? 7.169   76.017  -0.666  1.00 29.23 ? 411  ILE A CD1 1 
ATOM   3239  N N   . ARG A 1 412  ? 5.305   77.874  -4.238  1.00 25.87 ? 412  ARG A N   1 
ATOM   3240  C CA  . ARG A 1 412  ? 6.183   78.336  -5.306  1.00 25.23 ? 412  ARG A CA  1 
ATOM   3241  C C   . ARG A 1 412  ? 7.269   79.207  -4.666  1.00 24.00 ? 412  ARG A C   1 
ATOM   3242  O O   . ARG A 1 412  ? 7.005   79.976  -3.741  1.00 23.96 ? 412  ARG A O   1 
ATOM   3243  C CB  . ARG A 1 412  ? 5.403   79.166  -6.326  1.00 26.52 ? 412  ARG A CB  1 
ATOM   3244  C CG  . ARG A 1 412  ? 4.433   78.388  -7.190  1.00 28.71 ? 412  ARG A CG  1 
ATOM   3245  C CD  . ARG A 1 412  ? 3.467   79.340  -7.865  1.00 32.45 ? 412  ARG A CD  1 
ATOM   3246  N NE  . ARG A 1 412  ? 2.623   78.678  -8.855  1.00 38.98 ? 412  ARG A NE  1 
ATOM   3247  C CZ  . ARG A 1 412  ? 3.009   78.372  -10.094 1.00 42.85 ? 412  ARG A CZ  1 
ATOM   3248  N NH1 . ARG A 1 412  ? 4.238   78.668  -10.512 1.00 43.36 ? 412  ARG A NH1 1 
ATOM   3249  N NH2 . ARG A 1 412  ? 2.161   77.772  -10.923 1.00 44.02 ? 412  ARG A NH2 1 
ATOM   3250  N N   . ILE A 1 413  ? 8.495   79.074  -5.145  1.00 22.96 ? 413  ILE A N   1 
ATOM   3251  C CA  . ILE A 1 413  ? 9.579   79.867  -4.608  1.00 22.98 ? 413  ILE A CA  1 
ATOM   3252  C C   . ILE A 1 413  ? 9.619   81.223  -5.304  1.00 23.13 ? 413  ILE A C   1 
ATOM   3253  O O   . ILE A 1 413  ? 9.401   81.325  -6.511  1.00 21.63 ? 413  ILE A O   1 
ATOM   3254  C CB  . ILE A 1 413  ? 10.923  79.155  -4.796  1.00 23.51 ? 413  ILE A CB  1 
ATOM   3255  C CG1 . ILE A 1 413  ? 10.958  77.900  -3.925  1.00 25.48 ? 413  ILE A CG1 1 
ATOM   3256  C CG2 . ILE A 1 413  ? 12.064  80.088  -4.429  1.00 23.59 ? 413  ILE A CG2 1 
ATOM   3257  C CD1 . ILE A 1 413  ? 12.201  77.042  -4.111  1.00 26.02 ? 413  ILE A CD1 1 
ATOM   3258  N N   . LEU A 1 414  ? 9.877   82.266  -4.526  1.00 23.57 ? 414  LEU A N   1 
ATOM   3259  C CA  . LEU A 1 414  ? 9.961   83.620  -5.051  1.00 24.30 ? 414  LEU A CA  1 
ATOM   3260  C C   . LEU A 1 414  ? 11.411  83.798  -5.508  1.00 25.43 ? 414  LEU A C   1 
ATOM   3261  O O   . LEU A 1 414  ? 12.345  83.753  -4.696  1.00 25.94 ? 414  LEU A O   1 
ATOM   3262  C CB  . LEU A 1 414  ? 9.580   84.613  -3.941  1.00 23.10 ? 414  LEU A CB  1 
ATOM   3263  C CG  . LEU A 1 414  ? 9.201   86.085  -4.193  1.00 23.05 ? 414  LEU A CG  1 
ATOM   3264  C CD1 . LEU A 1 414  ? 10.432  86.939  -4.145  1.00 24.76 ? 414  LEU A CD1 1 
ATOM   3265  C CD2 . LEU A 1 414  ? 8.453   86.245  -5.500  1.00 21.05 ? 414  LEU A CD2 1 
ATOM   3266  N N   . LYS A 1 415  ? 11.597  83.960  -6.814  1.00 26.07 ? 415  LYS A N   1 
ATOM   3267  C CA  . LYS A 1 415  ? 12.933  84.118  -7.376  1.00 28.49 ? 415  LYS A CA  1 
ATOM   3268  C C   . LYS A 1 415  ? 13.640  85.307  -6.741  1.00 28.97 ? 415  LYS A C   1 
ATOM   3269  O O   . LYS A 1 415  ? 13.013  86.313  -6.423  1.00 28.60 ? 415  LYS A O   1 
ATOM   3270  C CB  . LYS A 1 415  ? 12.863  84.306  -8.902  1.00 30.06 ? 415  LYS A CB  1 
ATOM   3271  C CG  . LYS A 1 415  ? 12.070  83.231  -9.642  1.00 31.43 ? 415  LYS A CG  1 
ATOM   3272  C CD  . LYS A 1 415  ? 11.988  83.510  -11.144 1.00 34.43 ? 415  LYS A CD  1 
ATOM   3273  C CE  . LYS A 1 415  ? 11.100  82.483  -11.846 1.00 36.79 ? 415  LYS A CE  1 
ATOM   3274  N NZ  . LYS A 1 415  ? 10.744  82.855  -13.252 1.00 38.60 ? 415  LYS A NZ  1 
ATOM   3275  N N   . ASP A 1 416  ? 14.947  85.181  -6.554  1.00 31.30 ? 416  ASP A N   1 
ATOM   3276  C CA  . ASP A 1 416  ? 15.735  86.245  -5.959  1.00 33.97 ? 416  ASP A CA  1 
ATOM   3277  C C   . ASP A 1 416  ? 15.851  87.439  -6.910  1.00 33.76 ? 416  ASP A C   1 
ATOM   3278  O O   . ASP A 1 416  ? 16.051  88.576  -6.471  1.00 34.55 ? 416  ASP A O   1 
ATOM   3279  C CB  . ASP A 1 416  ? 17.132  85.729  -5.614  1.00 39.26 ? 416  ASP A CB  1 
ATOM   3280  C CG  . ASP A 1 416  ? 17.676  86.338  -4.325  1.00 45.80 ? 416  ASP A CG  1 
ATOM   3281  O OD1 . ASP A 1 416  ? 17.576  87.580  -4.154  1.00 48.14 ? 416  ASP A OD1 1 
ATOM   3282  O OD2 . ASP A 1 416  ? 18.207  85.569  -3.484  1.00 48.41 ? 416  ASP A OD2 1 
ATOM   3283  N N   . THR A 1 417  ? 15.723  87.182  -8.209  1.00 32.23 ? 417  THR A N   1 
ATOM   3284  C CA  . THR A 1 417  ? 15.824  88.244  -9.207  1.00 31.00 ? 417  THR A CA  1 
ATOM   3285  C C   . THR A 1 417  ? 14.647  89.200  -9.143  1.00 29.31 ? 417  THR A C   1 
ATOM   3286  O O   . THR A 1 417  ? 14.668  90.245  -9.774  1.00 28.84 ? 417  THR A O   1 
ATOM   3287  C CB  . THR A 1 417  ? 15.879  87.682  -10.661 1.00 31.68 ? 417  THR A CB  1 
ATOM   3288  O OG1 . THR A 1 417  ? 14.568  87.262  -11.074 1.00 32.02 ? 417  THR A OG1 1 
ATOM   3289  C CG2 . THR A 1 417  ? 16.854  86.505  -10.747 1.00 29.70 ? 417  THR A CG2 1 
ATOM   3290  N N   . THR A 1 418  ? 13.622  88.840  -8.379  1.00 29.29 ? 418  THR A N   1 
ATOM   3291  C CA  . THR A 1 418  ? 12.429  89.670  -8.280  1.00 27.98 ? 418  THR A CA  1 
ATOM   3292  C C   . THR A 1 418  ? 12.717  91.086  -7.836  1.00 29.12 ? 418  THR A C   1 
ATOM   3293  O O   . THR A 1 418  ? 13.622  91.338  -7.037  1.00 31.10 ? 418  THR A O   1 
ATOM   3294  C CB  . THR A 1 418  ? 11.406  89.105  -7.311  1.00 26.23 ? 418  THR A CB  1 
ATOM   3295  O OG1 . THR A 1 418  ? 10.189  89.839  -7.460  1.00 23.18 ? 418  THR A OG1 1 
ATOM   3296  C CG2 . THR A 1 418  ? 11.895  89.247  -5.870  1.00 23.38 ? 418  THR A CG2 1 
ATOM   3297  N N   . SER A 1 419  ? 11.913  92.005  -8.346  1.00 28.51 ? 419  SER A N   1 
ATOM   3298  C CA  . SER A 1 419  ? 12.073  93.409  -8.035  1.00 28.65 ? 419  SER A CA  1 
ATOM   3299  C C   . SER A 1 419  ? 11.094  93.832  -6.960  1.00 27.59 ? 419  SER A C   1 
ATOM   3300  O O   . SER A 1 419  ? 11.255  94.888  -6.350  1.00 28.52 ? 419  SER A O   1 
ATOM   3301  C CB  . SER A 1 419  ? 11.851  94.236  -9.303  1.00 29.89 ? 419  SER A CB  1 
ATOM   3302  O OG  . SER A 1 419  ? 10.667  93.812  -9.965  1.00 32.92 ? 419  SER A OG  1 
ATOM   3303  N N   . SER A 1 420  ? 10.082  93.002  -6.732  1.00 26.02 ? 420  SER A N   1 
ATOM   3304  C CA  . SER A 1 420  ? 9.049   93.278  -5.734  1.00 24.24 ? 420  SER A CA  1 
ATOM   3305  C C   . SER A 1 420  ? 9.572   93.484  -4.318  1.00 24.80 ? 420  SER A C   1 
ATOM   3306  O O   . SER A 1 420  ? 10.667  93.029  -3.966  1.00 24.63 ? 420  SER A O   1 
ATOM   3307  C CB  . SER A 1 420  ? 8.025   92.141  -5.711  1.00 23.78 ? 420  SER A CB  1 
ATOM   3308  O OG  . SER A 1 420  ? 7.109   92.295  -4.643  1.00 22.84 ? 420  SER A OG  1 
ATOM   3309  N N   . ILE A 1 421  ? 8.769   94.167  -3.508  1.00 24.18 ? 421  ILE A N   1 
ATOM   3310  C CA  . ILE A 1 421  ? 9.123   94.411  -2.122  1.00 24.16 ? 421  ILE A CA  1 
ATOM   3311  C C   . ILE A 1 421  ? 9.087   93.069  -1.388  1.00 22.61 ? 421  ILE A C   1 
ATOM   3312  O O   . ILE A 1 421  ? 9.712   92.908  -0.349  1.00 22.37 ? 421  ILE A O   1 
ATOM   3313  C CB  . ILE A 1 421  ? 8.124   95.384  -1.436  1.00 25.76 ? 421  ILE A CB  1 
ATOM   3314  C CG1 . ILE A 1 421  ? 7.750   96.511  -2.401  1.00 28.37 ? 421  ILE A CG1 1 
ATOM   3315  C CG2 . ILE A 1 421  ? 8.762   95.998  -0.192  1.00 22.51 ? 421  ILE A CG2 1 
ATOM   3316  C CD1 . ILE A 1 421  ? 6.819   97.565  -1.805  1.00 30.23 ? 421  ILE A CD1 1 
ATOM   3317  N N   . ALA A 1 422  ? 8.361   92.107  -1.945  1.00 21.27 ? 422  ALA A N   1 
ATOM   3318  C CA  . ALA A 1 422  ? 8.244   90.780  -1.344  1.00 22.70 ? 422  ALA A CA  1 
ATOM   3319  C C   . ALA A 1 422  ? 9.618   90.170  -1.072  1.00 22.52 ? 422  ALA A C   1 
ATOM   3320  O O   . ALA A 1 422  ? 9.811   89.414  -0.114  1.00 21.68 ? 422  ALA A O   1 
ATOM   3321  C CB  . ALA A 1 422  ? 7.441   89.870  -2.257  1.00 22.81 ? 422  ALA A CB  1 
ATOM   3322  N N   . ARG A 1 423  ? 10.562  90.500  -1.940  1.00 22.75 ? 423  ARG A N   1 
ATOM   3323  C CA  . ARG A 1 423  ? 11.932  90.034  -1.823  1.00 23.39 ? 423  ARG A CA  1 
ATOM   3324  C C   . ARG A 1 423  ? 12.396  90.094  -0.357  1.00 21.47 ? 423  ARG A C   1 
ATOM   3325  O O   . ARG A 1 423  ? 12.923  89.117  0.177   1.00 19.21 ? 423  ARG A O   1 
ATOM   3326  C CB  . ARG A 1 423  ? 12.797  90.930  -2.706  1.00 27.92 ? 423  ARG A CB  1 
ATOM   3327  C CG  . ARG A 1 423  ? 14.309  90.756  -2.671  1.00 32.10 ? 423  ARG A CG  1 
ATOM   3328  C CD  . ARG A 1 423  ? 14.870  91.844  -3.590  1.00 36.86 ? 423  ARG A CD  1 
ATOM   3329  N NE  . ARG A 1 423  ? 16.314  91.842  -3.778  1.00 41.44 ? 423  ARG A NE  1 
ATOM   3330  C CZ  . ARG A 1 423  ? 16.956  92.772  -4.483  1.00 44.88 ? 423  ARG A CZ  1 
ATOM   3331  N NH1 . ARG A 1 423  ? 16.271  93.760  -5.048  1.00 44.21 ? 423  ARG A NH1 1 
ATOM   3332  N NH2 . ARG A 1 423  ? 18.276  92.718  -4.634  1.00 46.30 ? 423  ARG A NH2 1 
ATOM   3333  N N   . TYR A 1 424  ? 12.172  91.239  0.286   1.00 18.60 ? 424  TYR A N   1 
ATOM   3334  C CA  . TYR A 1 424  ? 12.580  91.450  1.670   1.00 16.60 ? 424  TYR A CA  1 
ATOM   3335  C C   . TYR A 1 424  ? 11.761  90.671  2.690   1.00 15.74 ? 424  TYR A C   1 
ATOM   3336  O O   . TYR A 1 424  ? 12.312  90.165  3.669   1.00 14.26 ? 424  TYR A O   1 
ATOM   3337  C CB  . TYR A 1 424  ? 12.554  92.945  1.983   1.00 17.71 ? 424  TYR A CB  1 
ATOM   3338  C CG  . TYR A 1 424  ? 13.462  93.736  1.061   1.00 18.31 ? 424  TYR A CG  1 
ATOM   3339  C CD1 . TYR A 1 424  ? 14.853  93.629  1.157   1.00 15.50 ? 424  TYR A CD1 1 
ATOM   3340  C CD2 . TYR A 1 424  ? 12.927  94.515  0.028   1.00 17.59 ? 424  TYR A CD2 1 
ATOM   3341  C CE1 . TYR A 1 424  ? 15.681  94.272  0.241   1.00 19.06 ? 424  TYR A CE1 1 
ATOM   3342  C CE2 . TYR A 1 424  ? 13.742  95.158  -0.895  1.00 16.64 ? 424  TYR A CE2 1 
ATOM   3343  C CZ  . TYR A 1 424  ? 15.115  95.031  -0.788  1.00 19.39 ? 424  TYR A CZ  1 
ATOM   3344  O OH  . TYR A 1 424  ? 15.921  95.624  -1.729  1.00 20.43 ? 424  TYR A OH  1 
ATOM   3345  N N   . LEU A 1 425  ? 10.453  90.571  2.462   1.00 14.63 ? 425  LEU A N   1 
ATOM   3346  C CA  . LEU A 1 425  ? 9.576   89.825  3.359   1.00 13.70 ? 425  LEU A CA  1 
ATOM   3347  C C   . LEU A 1 425  ? 10.002  88.365  3.314   1.00 15.99 ? 425  LEU A C   1 
ATOM   3348  O O   . LEU A 1 425  ? 9.853   87.618  4.283   1.00 15.88 ? 425  LEU A O   1 
ATOM   3349  C CB  . LEU A 1 425  ? 8.122   89.938  2.908   1.00 11.78 ? 425  LEU A CB  1 
ATOM   3350  C CG  . LEU A 1 425  ? 7.141   89.059  3.689   1.00 11.31 ? 425  LEU A CG  1 
ATOM   3351  C CD1 . LEU A 1 425  ? 6.927   89.637  5.074   1.00 7.14  ? 425  LEU A CD1 1 
ATOM   3352  C CD2 . LEU A 1 425  ? 5.819   88.958  2.938   1.00 10.29 ? 425  LEU A CD2 1 
ATOM   3353  N N   . TYR A 1 426  ? 10.535  87.969  2.167   1.00 16.54 ? 426  TYR A N   1 
ATOM   3354  C CA  . TYR A 1 426  ? 10.989  86.608  1.971   1.00 18.28 ? 426  TYR A CA  1 
ATOM   3355  C C   . TYR A 1 426  ? 12.283  86.349  2.736   1.00 18.57 ? 426  TYR A C   1 
ATOM   3356  O O   . TYR A 1 426  ? 12.319  85.483  3.610   1.00 19.29 ? 426  TYR A O   1 
ATOM   3357  C CB  . TYR A 1 426  ? 11.179  86.343  0.473   1.00 17.85 ? 426  TYR A CB  1 
ATOM   3358  C CG  . TYR A 1 426  ? 11.488  84.912  0.141   1.00 17.51 ? 426  TYR A CG  1 
ATOM   3359  C CD1 . TYR A 1 426  ? 12.811  84.473  0.010   1.00 18.82 ? 426  TYR A CD1 1 
ATOM   3360  C CD2 . TYR A 1 426  ? 10.461  83.990  -0.052  1.00 16.87 ? 426  TYR A CD2 1 
ATOM   3361  C CE1 . TYR A 1 426  ? 13.098  83.148  -0.312  1.00 17.47 ? 426  TYR A CE1 1 
ATOM   3362  C CE2 . TYR A 1 426  ? 10.736  82.669  -0.368  1.00 17.43 ? 426  TYR A CE2 1 
ATOM   3363  C CZ  . TYR A 1 426  ? 12.053  82.256  -0.497  1.00 17.01 ? 426  TYR A CZ  1 
ATOM   3364  O OH  . TYR A 1 426  ? 12.317  80.948  -0.800  1.00 19.65 ? 426  TYR A OH  1 
ATOM   3365  N N   . ARG A 1 427  ? 13.332  87.106  2.414   1.00 19.75 ? 427  ARG A N   1 
ATOM   3366  C CA  . ARG A 1 427  ? 14.638  86.959  3.069   1.00 22.61 ? 427  ARG A CA  1 
ATOM   3367  C C   . ARG A 1 427  ? 14.555  86.843  4.592   1.00 22.01 ? 427  ARG A C   1 
ATOM   3368  O O   . ARG A 1 427  ? 15.193  85.964  5.200   1.00 20.23 ? 427  ARG A O   1 
ATOM   3369  C CB  . ARG A 1 427  ? 15.565  88.130  2.694   1.00 25.64 ? 427  ARG A CB  1 
ATOM   3370  C CG  . ARG A 1 427  ? 16.121  88.034  1.267   1.00 33.06 ? 427  ARG A CG  1 
ATOM   3371  C CD  . ARG A 1 427  ? 16.909  89.287  0.840   1.00 37.51 ? 427  ARG A CD  1 
ATOM   3372  N NE  . ARG A 1 427  ? 17.270  89.249  -0.581  1.00 40.32 ? 427  ARG A NE  1 
ATOM   3373  C CZ  . ARG A 1 427  ? 17.791  90.271  -1.257  1.00 42.43 ? 427  ARG A CZ  1 
ATOM   3374  N NH1 . ARG A 1 427  ? 18.020  91.429  -0.648  1.00 43.24 ? 427  ARG A NH1 1 
ATOM   3375  N NH2 . ARG A 1 427  ? 18.080  90.137  -2.549  1.00 42.04 ? 427  ARG A NH2 1 
ATOM   3376  N N   . THR A 1 428  ? 13.757  87.725  5.194   1.00 20.53 ? 428  THR A N   1 
ATOM   3377  C CA  . THR A 1 428  ? 13.580  87.753  6.633   1.00 19.52 ? 428  THR A CA  1 
ATOM   3378  C C   . THR A 1 428  ? 12.960  86.478  7.204   1.00 19.58 ? 428  THR A C   1 
ATOM   3379  O O   . THR A 1 428  ? 13.481  85.927  8.185   1.00 18.28 ? 428  THR A O   1 
ATOM   3380  C CB  . THR A 1 428  ? 12.738  88.957  7.052   1.00 20.45 ? 428  THR A CB  1 
ATOM   3381  O OG1 . THR A 1 428  ? 13.463  90.155  6.758   1.00 21.53 ? 428  THR A OG1 1 
ATOM   3382  C CG2 . THR A 1 428  ? 12.437  88.911  8.541   1.00 19.55 ? 428  THR A CG2 1 
ATOM   3383  N N   . TRP A 1 429  ? 11.865  86.007  6.604   1.00 17.70 ? 429  TRP A N   1 
ATOM   3384  C CA  . TRP A 1 429  ? 11.222  84.788  7.092   1.00 16.29 ? 429  TRP A CA  1 
ATOM   3385  C C   . TRP A 1 429  ? 12.084  83.564  6.801   1.00 18.02 ? 429  TRP A C   1 
ATOM   3386  O O   . TRP A 1 429  ? 12.121  82.622  7.592   1.00 19.56 ? 429  TRP A O   1 
ATOM   3387  C CB  . TRP A 1 429  ? 9.831   84.602  6.476   1.00 13.89 ? 429  TRP A CB  1 
ATOM   3388  C CG  . TRP A 1 429  ? 8.747   85.432  7.123   1.00 13.52 ? 429  TRP A CG  1 
ATOM   3389  C CD1 . TRP A 1 429  ? 8.400   86.718  6.816   1.00 13.22 ? 429  TRP A CD1 1 
ATOM   3390  C CD2 . TRP A 1 429  ? 7.885   85.035  8.198   1.00 12.89 ? 429  TRP A CD2 1 
ATOM   3391  N NE1 . TRP A 1 429  ? 7.377   87.148  7.630   1.00 10.41 ? 429  TRP A NE1 1 
ATOM   3392  C CE2 . TRP A 1 429  ? 7.041   86.137  8.489   1.00 12.51 ? 429  TRP A CE2 1 
ATOM   3393  C CE3 . TRP A 1 429  ? 7.744   83.859  8.944   1.00 11.11 ? 429  TRP A CE3 1 
ATOM   3394  C CZ2 . TRP A 1 429  ? 6.072   86.098  9.492   1.00 13.11 ? 429  TRP A CZ2 1 
ATOM   3395  C CZ3 . TRP A 1 429  ? 6.778   83.815  9.945   1.00 13.77 ? 429  TRP A CZ3 1 
ATOM   3396  C CH2 . TRP A 1 429  ? 5.954   84.929  10.209  1.00 15.95 ? 429  TRP A CH2 1 
ATOM   3397  N N   . TYR A 1 430  ? 12.785  83.587  5.672   1.00 18.03 ? 430  TYR A N   1 
ATOM   3398  C CA  . TYR A 1 430  ? 13.666  82.488  5.288   1.00 18.78 ? 430  TYR A CA  1 
ATOM   3399  C C   . TYR A 1 430  ? 14.770  82.373  6.323   1.00 17.49 ? 430  TYR A C   1 
ATOM   3400  O O   . TYR A 1 430  ? 15.026  81.302  6.863   1.00 18.23 ? 430  TYR A O   1 
ATOM   3401  C CB  . TYR A 1 430  ? 14.300  82.775  3.920   1.00 20.27 ? 430  TYR A CB  1 
ATOM   3402  C CG  . TYR A 1 430  ? 15.229  81.695  3.376   1.00 19.32 ? 430  TYR A CG  1 
ATOM   3403  C CD1 . TYR A 1 430  ? 14.747  80.700  2.522   1.00 19.86 ? 430  TYR A CD1 1 
ATOM   3404  C CD2 . TYR A 1 430  ? 16.594  81.719  3.654   1.00 20.30 ? 430  TYR A CD2 1 
ATOM   3405  C CE1 . TYR A 1 430  ? 15.593  79.764  1.947   1.00 20.76 ? 430  TYR A CE1 1 
ATOM   3406  C CE2 . TYR A 1 430  ? 17.461  80.789  3.087   1.00 22.92 ? 430  TYR A CE2 1 
ATOM   3407  C CZ  . TYR A 1 430  ? 16.954  79.814  2.228   1.00 25.87 ? 430  TYR A CZ  1 
ATOM   3408  O OH  . TYR A 1 430  ? 17.811  78.910  1.627   1.00 28.64 ? 430  TYR A OH  1 
ATOM   3409  N N   . LEU A 1 431  ? 15.423  83.497  6.582   1.00 18.25 ? 431  LEU A N   1 
ATOM   3410  C CA  . LEU A 1 431  ? 16.512  83.560  7.544   1.00 20.00 ? 431  LEU A CA  1 
ATOM   3411  C C   . LEU A 1 431  ? 16.053  83.003  8.885   1.00 18.57 ? 431  LEU A C   1 
ATOM   3412  O O   . LEU A 1 431  ? 16.652  82.067  9.426   1.00 18.20 ? 431  LEU A O   1 
ATOM   3413  C CB  . LEU A 1 431  ? 16.967  85.011  7.723   1.00 23.61 ? 431  LEU A CB  1 
ATOM   3414  C CG  . LEU A 1 431  ? 18.466  85.283  7.627   1.00 24.79 ? 431  LEU A CG  1 
ATOM   3415  C CD1 . LEU A 1 431  ? 19.219  84.279  8.489   1.00 25.04 ? 431  LEU A CD1 1 
ATOM   3416  C CD2 . LEU A 1 431  ? 18.901  85.163  6.166   1.00 28.96 ? 431  LEU A CD2 1 
ATOM   3417  N N   . ALA A 1 432  ? 14.981  83.585  9.413   1.00 16.17 ? 432  ALA A N   1 
ATOM   3418  C CA  . ALA A 1 432  ? 14.439  83.157  10.691  1.00 14.37 ? 432  ALA A CA  1 
ATOM   3419  C C   . ALA A 1 432  ? 14.124  81.657  10.722  1.00 14.02 ? 432  ALA A C   1 
ATOM   3420  O O   . ALA A 1 432  ? 14.482  80.967  11.673  1.00 12.72 ? 432  ALA A O   1 
ATOM   3421  C CB  . ALA A 1 432  ? 13.200  83.964  11.018  1.00 12.45 ? 432  ALA A CB  1 
ATOM   3422  N N   . ALA A 1 433  ? 13.454  81.156  9.686   1.00 15.05 ? 433  ALA A N   1 
ATOM   3423  C CA  . ALA A 1 433  ? 13.112  79.736  9.627   1.00 15.72 ? 433  ALA A CA  1 
ATOM   3424  C C   . ALA A 1 433  ? 14.369  78.896  9.803   1.00 16.76 ? 433  ALA A C   1 
ATOM   3425  O O   . ALA A 1 433  ? 14.420  77.994  10.652  1.00 18.24 ? 433  ALA A O   1 
ATOM   3426  C CB  . ALA A 1 433  ? 12.434  79.395  8.303   1.00 11.49 ? 433  ALA A CB  1 
ATOM   3427  N N   . ALA A 1 434  ? 15.389  79.214  9.014   1.00 15.88 ? 434  ALA A N   1 
ATOM   3428  C CA  . ALA A 1 434  ? 16.656  78.495  9.076   1.00 14.56 ? 434  ALA A CA  1 
ATOM   3429  C C   . ALA A 1 434  ? 17.292  78.502  10.464  1.00 14.83 ? 434  ALA A C   1 
ATOM   3430  O O   . ALA A 1 434  ? 17.808  77.481  10.907  1.00 16.73 ? 434  ALA A O   1 
ATOM   3431  C CB  . ALA A 1 434  ? 17.635  79.075  8.052   1.00 12.23 ? 434  ALA A CB  1 
ATOM   3432  N N   . ARG A 1 435  ? 17.268  79.637  11.156  1.00 15.61 ? 435  ARG A N   1 
ATOM   3433  C CA  . ARG A 1 435  ? 17.879  79.697  12.481  1.00 15.79 ? 435  ARG A CA  1 
ATOM   3434  C C   . ARG A 1 435  ? 17.020  78.995  13.503  1.00 16.64 ? 435  ARG A C   1 
ATOM   3435  O O   . ARG A 1 435  ? 17.519  78.335  14.423  1.00 16.73 ? 435  ARG A O   1 
ATOM   3436  C CB  . ARG A 1 435  ? 18.121  81.143  12.887  1.00 15.48 ? 435  ARG A CB  1 
ATOM   3437  C CG  . ARG A 1 435  ? 19.110  81.813  11.960  1.00 15.20 ? 435  ARG A CG  1 
ATOM   3438  C CD  . ARG A 1 435  ? 19.402  83.243  12.336  1.00 13.96 ? 435  ARG A CD  1 
ATOM   3439  N NE  . ARG A 1 435  ? 20.327  83.809  11.368  1.00 14.38 ? 435  ARG A NE  1 
ATOM   3440  C CZ  . ARG A 1 435  ? 20.775  85.054  11.403  1.00 14.87 ? 435  ARG A CZ  1 
ATOM   3441  N NH1 . ARG A 1 435  ? 20.373  85.867  12.365  1.00 18.26 ? 435  ARG A NH1 1 
ATOM   3442  N NH2 . ARG A 1 435  ? 21.631  85.478  10.483  1.00 14.64 ? 435  ARG A NH2 1 
ATOM   3443  N N   . MET A 1 436  ? 15.715  79.123  13.323  1.00 18.01 ? 436  MET A N   1 
ATOM   3444  C CA  . MET A 1 436  ? 14.767  78.480  14.212  1.00 18.34 ? 436  MET A CA  1 
ATOM   3445  C C   . MET A 1 436  ? 14.990  76.970  14.097  1.00 19.71 ? 436  MET A C   1 
ATOM   3446  O O   . MET A 1 436  ? 15.268  76.291  15.099  1.00 20.53 ? 436  MET A O   1 
ATOM   3447  C CB  . MET A 1 436  ? 13.351  78.879  13.797  1.00 18.59 ? 436  MET A CB  1 
ATOM   3448  C CG  . MET A 1 436  ? 12.227  78.146  14.504  1.00 17.73 ? 436  MET A CG  1 
ATOM   3449  S SD  . MET A 1 436  ? 11.943  76.522  13.832  1.00 19.31 ? 436  MET A SD  1 
ATOM   3450  C CE  . MET A 1 436  ? 11.647  75.637  15.323  1.00 21.21 ? 436  MET A CE  1 
ATOM   3451  N N   . ALA A 1 437  ? 14.910  76.458  12.870  1.00 18.22 ? 437  ALA A N   1 
ATOM   3452  C CA  . ALA A 1 437  ? 15.101  75.034  12.617  1.00 18.60 ? 437  ALA A CA  1 
ATOM   3453  C C   . ALA A 1 437  ? 16.486  74.503  12.988  1.00 18.53 ? 437  ALA A C   1 
ATOM   3454  O O   . ALA A 1 437  ? 16.635  73.314  13.267  1.00 20.82 ? 437  ALA A O   1 
ATOM   3455  C CB  . ALA A 1 437  ? 14.816  74.721  11.148  1.00 19.13 ? 437  ALA A CB  1 
ATOM   3456  N N   . ALA A 1 438  ? 17.500  75.358  12.984  1.00 17.15 ? 438  ALA A N   1 
ATOM   3457  C CA  . ALA A 1 438  ? 18.853  74.898  13.321  1.00 19.88 ? 438  ALA A CA  1 
ATOM   3458  C C   . ALA A 1 438  ? 19.083  74.752  14.824  1.00 20.68 ? 438  ALA A C   1 
ATOM   3459  O O   . ALA A 1 438  ? 20.105  74.220  15.250  1.00 20.51 ? 438  ALA A O   1 
ATOM   3460  C CB  . ALA A 1 438  ? 19.909  75.856  12.740  1.00 17.40 ? 438  ALA A CB  1 
ATOM   3461  N N   . GLN A 1 439  ? 18.149  75.242  15.629  1.00 21.81 ? 439  GLN A N   1 
ATOM   3462  C CA  . GLN A 1 439  ? 18.306  75.144  17.073  1.00 22.85 ? 439  GLN A CA  1 
ATOM   3463  C C   . GLN A 1 439  ? 18.103  73.707  17.492  1.00 22.17 ? 439  GLN A C   1 
ATOM   3464  O O   . GLN A 1 439  ? 17.105  73.087  17.133  1.00 23.24 ? 439  GLN A O   1 
ATOM   3465  C CB  . GLN A 1 439  ? 17.291  76.030  17.790  1.00 23.31 ? 439  GLN A CB  1 
ATOM   3466  C CG  . GLN A 1 439  ? 17.450  77.495  17.500  1.00 24.92 ? 439  GLN A CG  1 
ATOM   3467  C CD  . GLN A 1 439  ? 16.405  78.311  18.197  1.00 27.77 ? 439  GLN A CD  1 
ATOM   3468  O OE1 . GLN A 1 439  ? 15.206  78.030  18.084  1.00 28.16 ? 439  GLN A OE1 1 
ATOM   3469  N NE2 . GLN A 1 439  ? 16.840  79.333  18.922  1.00 29.30 ? 439  GLN A NE2 1 
ATOM   3470  N N   . PRO A 1 440  ? 19.059  73.152  18.244  1.00 21.84 ? 440  PRO A N   1 
ATOM   3471  C CA  . PRO A 1 440  ? 18.980  71.768  18.715  1.00 20.88 ? 440  PRO A CA  1 
ATOM   3472  C C   . PRO A 1 440  ? 17.672  71.517  19.470  1.00 21.94 ? 440  PRO A C   1 
ATOM   3473  O O   . PRO A 1 440  ? 17.048  70.462  19.333  1.00 21.03 ? 440  PRO A O   1 
ATOM   3474  C CB  . PRO A 1 440  ? 20.206  71.649  19.615  1.00 20.84 ? 440  PRO A CB  1 
ATOM   3475  C CG  . PRO A 1 440  ? 21.184  72.586  18.976  1.00 20.37 ? 440  PRO A CG  1 
ATOM   3476  C CD  . PRO A 1 440  ? 20.330  73.780  18.649  1.00 20.94 ? 440  PRO A CD  1 
ATOM   3477  N N   . ARG A 1 441  ? 17.257  72.503  20.256  1.00 23.68 ? 441  ARG A N   1 
ATOM   3478  C CA  . ARG A 1 441  ? 16.031  72.399  21.043  1.00 26.88 ? 441  ARG A CA  1 
ATOM   3479  C C   . ARG A 1 441  ? 14.793  72.098  20.195  1.00 26.05 ? 441  ARG A C   1 
ATOM   3480  O O   . ARG A 1 441  ? 13.910  71.350  20.611  1.00 26.08 ? 441  ARG A O   1 
ATOM   3481  C CB  . ARG A 1 441  ? 15.810  73.691  21.827  1.00 30.11 ? 441  ARG A CB  1 
ATOM   3482  C CG  . ARG A 1 441  ? 14.497  73.734  22.582  1.00 36.09 ? 441  ARG A CG  1 
ATOM   3483  C CD  . ARG A 1 441  ? 13.820  75.071  22.367  1.00 42.35 ? 441  ARG A CD  1 
ATOM   3484  N NE  . ARG A 1 441  ? 14.762  76.170  22.561  1.00 45.55 ? 441  ARG A NE  1 
ATOM   3485  C CZ  . ARG A 1 441  ? 14.477  77.449  22.345  1.00 47.27 ? 441  ARG A CZ  1 
ATOM   3486  N NH1 . ARG A 1 441  ? 13.260  77.799  21.922  1.00 46.06 ? 441  ARG A NH1 1 
ATOM   3487  N NH2 . ARG A 1 441  ? 15.413  78.374  22.557  1.00 47.29 ? 441  ARG A NH2 1 
ATOM   3488  N N   . THR A 1 442  ? 14.720  72.692  19.013  1.00 25.02 ? 442  THR A N   1 
ATOM   3489  C CA  . THR A 1 442  ? 13.591  72.452  18.126  1.00 23.57 ? 442  THR A CA  1 
ATOM   3490  C C   . THR A 1 442  ? 13.335  70.957  17.947  1.00 24.43 ? 442  THR A C   1 
ATOM   3491  O O   . THR A 1 442  ? 12.187  70.537  17.777  1.00 23.66 ? 442  THR A O   1 
ATOM   3492  C CB  . THR A 1 442  ? 13.844  73.033  16.737  1.00 21.80 ? 442  THR A CB  1 
ATOM   3493  O OG1 . THR A 1 442  ? 13.929  74.454  16.825  1.00 19.53 ? 442  THR A OG1 1 
ATOM   3494  C CG2 . THR A 1 442  ? 12.732  72.631  15.787  1.00 19.94 ? 442  THR A CG2 1 
ATOM   3495  N N   . TRP A 1 443  ? 14.405  70.161  17.984  1.00 24.56 ? 443  TRP A N   1 
ATOM   3496  C CA  . TRP A 1 443  ? 14.294  68.716  17.797  1.00 25.25 ? 443  TRP A CA  1 
ATOM   3497  C C   . TRP A 1 443  ? 14.236  67.909  19.095  1.00 25.44 ? 443  TRP A C   1 
ATOM   3498  O O   . TRP A 1 443  ? 14.345  66.680  19.076  1.00 26.15 ? 443  TRP A O   1 
ATOM   3499  C CB  . TRP A 1 443  ? 15.441  68.226  16.901  1.00 24.09 ? 443  TRP A CB  1 
ATOM   3500  C CG  . TRP A 1 443  ? 15.529  69.058  15.671  1.00 25.13 ? 443  TRP A CG  1 
ATOM   3501  C CD1 . TRP A 1 443  ? 16.437  70.054  15.404  1.00 24.48 ? 443  TRP A CD1 1 
ATOM   3502  C CD2 . TRP A 1 443  ? 14.565  69.105  14.618  1.00 25.43 ? 443  TRP A CD2 1 
ATOM   3503  N NE1 . TRP A 1 443  ? 16.083  70.725  14.256  1.00 23.90 ? 443  TRP A NE1 1 
ATOM   3504  C CE2 . TRP A 1 443  ? 14.936  70.165  13.756  1.00 25.21 ? 443  TRP A CE2 1 
ATOM   3505  C CE3 . TRP A 1 443  ? 13.411  68.361  14.326  1.00 24.69 ? 443  TRP A CE3 1 
ATOM   3506  C CZ2 . TRP A 1 443  ? 14.194  70.494  12.619  1.00 25.94 ? 443  TRP A CZ2 1 
ATOM   3507  C CZ3 . TRP A 1 443  ? 12.676  68.685  13.203  1.00 25.08 ? 443  TRP A CZ3 1 
ATOM   3508  C CH2 . TRP A 1 443  ? 13.068  69.747  12.361  1.00 27.19 ? 443  TRP A CH2 1 
ATOM   3509  N N   . ASP A 1 444  ? 14.057  68.603  20.215  1.00 24.82 ? 444  ASP A N   1 
ATOM   3510  C CA  . ASP A 1 444  ? 13.951  67.944  21.514  1.00 26.10 ? 444  ASP A CA  1 
ATOM   3511  C C   . ASP A 1 444  ? 12.486  67.528  21.711  1.00 24.91 ? 444  ASP A C   1 
ATOM   3512  O O   . ASP A 1 444  ? 11.576  68.351  21.583  1.00 24.58 ? 444  ASP A O   1 
ATOM   3513  C CB  . ASP A 1 444  ? 14.369  68.903  22.642  1.00 29.65 ? 444  ASP A CB  1 
ATOM   3514  C CG  . ASP A 1 444  ? 14.221  68.279  24.033  1.00 33.12 ? 444  ASP A CG  1 
ATOM   3515  O OD1 . ASP A 1 444  ? 13.362  67.385  24.213  1.00 32.33 ? 444  ASP A OD1 1 
ATOM   3516  O OD2 . ASP A 1 444  ? 14.955  68.698  24.956  1.00 36.71 ? 444  ASP A OD2 1 
ATOM   3517  N N   . PRO A 1 445  ? 12.242  66.243  22.024  1.00 23.53 ? 445  PRO A N   1 
ATOM   3518  C CA  . PRO A 1 445  ? 10.890  65.714  22.237  1.00 21.39 ? 445  PRO A CA  1 
ATOM   3519  C C   . PRO A 1 445  ? 10.046  66.551  23.198  1.00 19.99 ? 445  PRO A C   1 
ATOM   3520  O O   . PRO A 1 445  ? 8.847   66.732  22.975  1.00 20.11 ? 445  PRO A O   1 
ATOM   3521  C CB  . PRO A 1 445  ? 11.157  64.313  22.773  1.00 20.75 ? 445  PRO A CB  1 
ATOM   3522  C CG  . PRO A 1 445  ? 12.376  63.928  22.057  1.00 19.78 ? 445  PRO A CG  1 
ATOM   3523  C CD  . PRO A 1 445  ? 13.237  65.165  22.153  1.00 22.45 ? 445  PRO A CD  1 
ATOM   3524  N N   . LEU A 1 446  ? 10.668  67.051  24.266  1.00 18.61 ? 446  LEU A N   1 
ATOM   3525  C CA  . LEU A 1 446  ? 9.959   67.871  25.251  1.00 16.33 ? 446  LEU A CA  1 
ATOM   3526  C C   . LEU A 1 446  ? 9.420   69.122  24.605  1.00 15.72 ? 446  LEU A C   1 
ATOM   3527  O O   . LEU A 1 446  ? 8.255   69.498  24.799  1.00 15.09 ? 446  LEU A O   1 
ATOM   3528  C CB  . LEU A 1 446  ? 10.878  68.285  26.400  1.00 15.74 ? 446  LEU A CB  1 
ATOM   3529  C CG  . LEU A 1 446  ? 10.220  69.267  27.385  1.00 16.02 ? 446  LEU A CG  1 
ATOM   3530  C CD1 . LEU A 1 446  ? 8.968   68.632  27.984  1.00 13.94 ? 446  LEU A CD1 1 
ATOM   3531  C CD2 . LEU A 1 446  ? 11.196  69.659  28.472  1.00 15.45 ? 446  LEU A CD2 1 
ATOM   3532  N N   . PHE A 1 447  ? 10.284  69.776  23.843  1.00 15.92 ? 447  PHE A N   1 
ATOM   3533  C CA  . PHE A 1 447  ? 9.897   70.989  23.161  1.00 17.75 ? 447  PHE A CA  1 
ATOM   3534  C C   . PHE A 1 447  ? 8.711   70.745  22.248  1.00 18.21 ? 447  PHE A C   1 
ATOM   3535  O O   . PHE A 1 447  ? 7.813   71.586  22.150  1.00 19.64 ? 447  PHE A O   1 
ATOM   3536  C CB  . PHE A 1 447  ? 11.041  71.539  22.329  1.00 18.60 ? 447  PHE A CB  1 
ATOM   3537  C CG  . PHE A 1 447  ? 10.669  72.768  21.573  1.00 20.30 ? 447  PHE A CG  1 
ATOM   3538  C CD1 . PHE A 1 447  ? 10.351  73.939  22.255  1.00 22.02 ? 447  PHE A CD1 1 
ATOM   3539  C CD2 . PHE A 1 447  ? 10.602  72.755  20.185  1.00 17.72 ? 447  PHE A CD2 1 
ATOM   3540  C CE1 . PHE A 1 447  ? 9.967   75.089  21.557  1.00 22.87 ? 447  PHE A CE1 1 
ATOM   3541  C CE2 . PHE A 1 447  ? 10.226  73.888  19.485  1.00 19.10 ? 447  PHE A CE2 1 
ATOM   3542  C CZ  . PHE A 1 447  ? 9.908   75.059  20.172  1.00 22.04 ? 447  PHE A CZ  1 
ATOM   3543  N N   . GLN A 1 448  ? 8.713   69.597  21.578  1.00 17.83 ? 448  GLN A N   1 
ATOM   3544  C CA  . GLN A 1 448  ? 7.628   69.253  20.672  1.00 18.43 ? 448  GLN A CA  1 
ATOM   3545  C C   . GLN A 1 448  ? 6.357   68.853  21.409  1.00 18.83 ? 448  GLN A C   1 
ATOM   3546  O O   . GLN A 1 448  ? 5.258   68.991  20.880  1.00 20.62 ? 448  GLN A O   1 
ATOM   3547  C CB  . GLN A 1 448  ? 8.060   68.141  19.728  1.00 17.23 ? 448  GLN A CB  1 
ATOM   3548  C CG  . GLN A 1 448  ? 9.163   68.562  18.794  1.00 18.83 ? 448  GLN A CG  1 
ATOM   3549  C CD  . GLN A 1 448  ? 9.506   67.484  17.790  1.00 18.76 ? 448  GLN A CD  1 
ATOM   3550  O OE1 . GLN A 1 448  ? 10.596  67.485  17.213  1.00 20.74 ? 448  GLN A OE1 1 
ATOM   3551  N NE2 . GLN A 1 448  ? 8.576   66.562  17.569  1.00 16.62 ? 448  GLN A NE2 1 
ATOM   3552  N N   . ALA A 1 449  ? 6.498   68.337  22.621  1.00 19.35 ? 449  ALA A N   1 
ATOM   3553  C CA  . ALA A 1 449  ? 5.323   67.983  23.396  1.00 19.13 ? 449  ALA A CA  1 
ATOM   3554  C C   . ALA A 1 449  ? 4.704   69.325  23.781  1.00 20.06 ? 449  ALA A C   1 
ATOM   3555  O O   . ALA A 1 449  ? 3.489   69.493  23.756  1.00 21.65 ? 449  ALA A O   1 
ATOM   3556  C CB  . ALA A 1 449  ? 5.720   67.201  24.646  1.00 17.18 ? 449  ALA A CB  1 
ATOM   3557  N N   . ILE A 1 450  ? 5.557   70.290  24.115  1.00 20.48 ? 450  ILE A N   1 
ATOM   3558  C CA  . ILE A 1 450  ? 5.088   71.614  24.514  1.00 21.59 ? 450  ILE A CA  1 
ATOM   3559  C C   . ILE A 1 450  ? 4.301   72.275  23.383  1.00 22.26 ? 450  ILE A C   1 
ATOM   3560  O O   . ILE A 1 450  ? 3.224   72.824  23.602  1.00 23.05 ? 450  ILE A O   1 
ATOM   3561  C CB  . ILE A 1 450  ? 6.282   72.502  24.957  1.00 18.98 ? 450  ILE A CB  1 
ATOM   3562  C CG1 . ILE A 1 450  ? 6.848   71.956  26.269  1.00 20.48 ? 450  ILE A CG1 1 
ATOM   3563  C CG2 . ILE A 1 450  ? 5.860   73.933  25.117  1.00 16.64 ? 450  ILE A CG2 1 
ATOM   3564  C CD1 . ILE A 1 450  ? 8.076   72.714  26.823  1.00 20.32 ? 450  ILE A CD1 1 
ATOM   3565  N N   . MET A 1 451  ? 4.834   72.204  22.171  1.00 23.94 ? 451  MET A N   1 
ATOM   3566  C CA  . MET A 1 451  ? 4.166   72.785  21.013  1.00 23.98 ? 451  MET A CA  1 
ATOM   3567  C C   . MET A 1 451  ? 2.839   72.086  20.737  1.00 24.69 ? 451  MET A C   1 
ATOM   3568  O O   . MET A 1 451  ? 1.878   72.727  20.305  1.00 26.37 ? 451  MET A O   1 
ATOM   3569  C CB  . MET A 1 451  ? 5.070   72.689  19.792  1.00 22.61 ? 451  MET A CB  1 
ATOM   3570  C CG  . MET A 1 451  ? 6.221   73.656  19.832  1.00 24.52 ? 451  MET A CG  1 
ATOM   3571  S SD  . MET A 1 451  ? 5.583   75.337  19.814  1.00 27.82 ? 451  MET A SD  1 
ATOM   3572  C CE  . MET A 1 451  ? 5.783   75.795  21.479  1.00 28.87 ? 451  MET A CE  1 
ATOM   3573  N N   . ARG A 1 452  ? 2.788   70.780  21.000  1.00 23.91 ? 452  ARG A N   1 
ATOM   3574  C CA  . ARG A 1 452  ? 1.576   69.998  20.787  1.00 23.96 ? 452  ARG A CA  1 
ATOM   3575  C C   . ARG A 1 452  ? 0.531   70.206  21.879  1.00 23.67 ? 452  ARG A C   1 
ATOM   3576  O O   . ARG A 1 452  ? -0.656  69.989  21.659  1.00 23.54 ? 452  ARG A O   1 
ATOM   3577  C CB  . ARG A 1 452  ? 1.918   68.513  20.699  1.00 24.05 ? 452  ARG A CB  1 
ATOM   3578  C CG  . ARG A 1 452  ? 2.537   68.082  19.383  1.00 25.78 ? 452  ARG A CG  1 
ATOM   3579  C CD  . ARG A 1 452  ? 3.127   66.694  19.525  1.00 25.52 ? 452  ARG A CD  1 
ATOM   3580  N NE  . ARG A 1 452  ? 2.129   65.756  20.026  1.00 27.31 ? 452  ARG A NE  1 
ATOM   3581  C CZ  . ARG A 1 452  ? 1.191   65.203  19.268  1.00 27.21 ? 452  ARG A CZ  1 
ATOM   3582  N NH1 . ARG A 1 452  ? 1.135   65.497  17.976  1.00 27.95 ? 452  ARG A NH1 1 
ATOM   3583  N NH2 . ARG A 1 452  ? 0.313   64.365  19.799  1.00 24.79 ? 452  ARG A NH2 1 
ATOM   3584  N N   . SER A 1 453  ? 0.970   70.631  23.057  1.00 24.56 ? 453  SER A N   1 
ATOM   3585  C CA  . SER A 1 453  ? 0.058   70.849  24.174  1.00 25.17 ? 453  SER A CA  1 
ATOM   3586  C C   . SER A 1 453  ? -0.421  72.292  24.222  1.00 26.36 ? 453  SER A C   1 
ATOM   3587  O O   . SER A 1 453  ? -1.338  72.623  24.962  1.00 25.92 ? 453  SER A O   1 
ATOM   3588  C CB  . SER A 1 453  ? 0.763   70.537  25.488  1.00 25.27 ? 453  SER A CB  1 
ATOM   3589  O OG  . SER A 1 453  ? 1.658   71.590  25.821  1.00 29.27 ? 453  SER A OG  1 
ATOM   3590  N N   . GLN A 1 454  ? 0.213   73.148  23.434  1.00 27.11 ? 454  GLN A N   1 
ATOM   3591  C CA  . GLN A 1 454  ? -0.125  74.557  23.426  1.00 28.96 ? 454  GLN A CA  1 
ATOM   3592  C C   . GLN A 1 454  ? -1.598  74.797  23.149  1.00 27.82 ? 454  GLN A C   1 
ATOM   3593  O O   . GLN A 1 454  ? -2.236  75.607  23.809  1.00 27.35 ? 454  GLN A O   1 
ATOM   3594  C CB  . GLN A 1 454  ? 0.716   75.284  22.378  1.00 32.37 ? 454  GLN A CB  1 
ATOM   3595  C CG  . GLN A 1 454  ? 0.858   76.778  22.604  1.00 36.22 ? 454  GLN A CG  1 
ATOM   3596  C CD  . GLN A 1 454  ? 1.319   77.498  21.343  1.00 40.80 ? 454  GLN A CD  1 
ATOM   3597  O OE1 . GLN A 1 454  ? 2.065   76.938  20.526  1.00 40.04 ? 454  GLN A OE1 1 
ATOM   3598  N NE2 . GLN A 1 454  ? 0.883   78.751  21.182  1.00 41.33 ? 454  GLN A NE2 1 
ATOM   3599  N N   . TYR A 1 455  ? -2.137  74.077  22.176  1.00 27.03 ? 455  TYR A N   1 
ATOM   3600  C CA  . TYR A 1 455  ? -3.529  74.249  21.799  1.00 25.31 ? 455  TYR A CA  1 
ATOM   3601  C C   . TYR A 1 455  ? -4.476  73.203  22.364  1.00 24.73 ? 455  TYR A C   1 
ATOM   3602  O O   . TYR A 1 455  ? -5.649  73.181  22.015  1.00 24.80 ? 455  TYR A O   1 
ATOM   3603  C CB  . TYR A 1 455  ? -3.627  74.297  20.274  1.00 24.09 ? 455  TYR A CB  1 
ATOM   3604  C CG  . TYR A 1 455  ? -2.778  73.256  19.592  1.00 23.63 ? 455  TYR A CG  1 
ATOM   3605  C CD1 . TYR A 1 455  ? -3.182  71.919  19.552  1.00 23.90 ? 455  TYR A CD1 1 
ATOM   3606  C CD2 . TYR A 1 455  ? -1.569  73.602  18.982  1.00 22.56 ? 455  TYR A CD2 1 
ATOM   3607  C CE1 . TYR A 1 455  ? -2.414  70.952  18.917  1.00 21.53 ? 455  TYR A CE1 1 
ATOM   3608  C CE2 . TYR A 1 455  ? -0.788  72.636  18.342  1.00 22.00 ? 455  TYR A CE2 1 
ATOM   3609  C CZ  . TYR A 1 455  ? -1.221  71.316  18.312  1.00 22.31 ? 455  TYR A CZ  1 
ATOM   3610  O OH  . TYR A 1 455  ? -0.493  70.357  17.645  1.00 24.20 ? 455  TYR A OH  1 
ATOM   3611  N N   . VAL A 1 456  ? -3.968  72.338  23.235  1.00 25.43 ? 456  VAL A N   1 
ATOM   3612  C CA  . VAL A 1 456  ? -4.797  71.312  23.863  1.00 24.48 ? 456  VAL A CA  1 
ATOM   3613  C C   . VAL A 1 456  ? -5.418  71.986  25.065  1.00 23.99 ? 456  VAL A C   1 
ATOM   3614  O O   . VAL A 1 456  ? -4.857  71.966  26.153  1.00 25.32 ? 456  VAL A O   1 
ATOM   3615  C CB  . VAL A 1 456  ? -3.947  70.114  24.329  1.00 24.92 ? 456  VAL A CB  1 
ATOM   3616  C CG1 . VAL A 1 456  ? -4.820  69.110  25.117  1.00 22.47 ? 456  VAL A CG1 1 
ATOM   3617  C CG2 . VAL A 1 456  ? -3.295  69.447  23.114  1.00 21.39 ? 456  VAL A CG2 1 
ATOM   3618  N N   . THR A 1 457  ? -6.580  72.594  24.873  1.00 24.00 ? 457  THR A N   1 
ATOM   3619  C CA  . THR A 1 457  ? -7.217  73.311  25.966  1.00 22.91 ? 457  THR A CA  1 
ATOM   3620  C C   . THR A 1 457  ? -8.719  73.097  26.093  1.00 24.35 ? 457  THR A C   1 
ATOM   3621  O O   . THR A 1 457  ? -9.317  72.287  25.381  1.00 22.10 ? 457  THR A O   1 
ATOM   3622  C CB  . THR A 1 457  ? -6.972  74.836  25.838  1.00 21.74 ? 457  THR A CB  1 
ATOM   3623  O OG1 . THR A 1 457  ? -7.588  75.323  24.640  1.00 21.66 ? 457  THR A OG1 1 
ATOM   3624  C CG2 . THR A 1 457  ? -5.486  75.138  25.797  1.00 19.87 ? 457  THR A CG2 1 
ATOM   3625  N N   . ALA A 1 458  ? -9.314  73.863  27.006  1.00 25.61 ? 458  ALA A N   1 
ATOM   3626  C CA  . ALA A 1 458  ? -10.738 73.794  27.284  1.00 26.18 ? 458  ALA A CA  1 
ATOM   3627  C C   . ALA A 1 458  ? -11.538 74.563  26.249  1.00 27.53 ? 458  ALA A C   1 
ATOM   3628  O O   . ALA A 1 458  ? -12.728 74.307  26.066  1.00 28.83 ? 458  ALA A O   1 
ATOM   3629  C CB  . ALA A 1 458  ? -11.016 74.333  28.673  1.00 23.23 ? 458  ALA A CB  1 
ATOM   3630  N N   . ARG A 1 459  ? -10.886 75.498  25.567  1.00 29.03 ? 459  ARG A N   1 
ATOM   3631  C CA  . ARG A 1 459  ? -11.557 76.293  24.540  1.00 31.95 ? 459  ARG A CA  1 
ATOM   3632  C C   . ARG A 1 459  ? -12.002 75.450  23.338  1.00 30.20 ? 459  ARG A C   1 
ATOM   3633  O O   . ARG A 1 459  ? -11.436 74.392  23.061  1.00 28.33 ? 459  ARG A O   1 
ATOM   3634  C CB  . ARG A 1 459  ? -10.632 77.399  24.029  1.00 36.91 ? 459  ARG A CB  1 
ATOM   3635  C CG  . ARG A 1 459  ? -10.219 78.432  25.057  1.00 45.01 ? 459  ARG A CG  1 
ATOM   3636  C CD  . ARG A 1 459  ? -9.437  79.535  24.356  1.00 52.14 ? 459  ARG A CD  1 
ATOM   3637  N NE  . ARG A 1 459  ? -9.091  80.642  25.242  1.00 56.37 ? 459  ARG A NE  1 
ATOM   3638  C CZ  . ARG A 1 459  ? -8.626  81.816  24.821  1.00 58.71 ? 459  ARG A CZ  1 
ATOM   3639  N NH1 . ARG A 1 459  ? -8.449  82.040  23.518  1.00 57.77 ? 459  ARG A NH1 1 
ATOM   3640  N NH2 . ARG A 1 459  ? -8.350  82.770  25.705  1.00 60.23 ? 459  ARG A NH2 1 
ATOM   3641  N N   . GLY A 1 460  ? -13.004 75.946  22.614  1.00 29.67 ? 460  GLY A N   1 
ATOM   3642  C CA  . GLY A 1 460  ? -13.506 75.237  21.448  1.00 28.81 ? 460  GLY A CA  1 
ATOM   3643  C C   . GLY A 1 460  ? -12.508 75.193  20.301  1.00 28.99 ? 460  GLY A C   1 
ATOM   3644  O O   . GLY A 1 460  ? -11.649 76.070  20.177  1.00 26.82 ? 460  GLY A O   1 
ATOM   3645  N N   . GLY A 1 461  ? -12.620 74.162  19.465  1.00 29.20 ? 461  GLY A N   1 
ATOM   3646  C CA  . GLY A 1 461  ? -11.724 74.014  18.330  1.00 27.63 ? 461  GLY A CA  1 
ATOM   3647  C C   . GLY A 1 461  ? -12.475 73.586  17.080  1.00 27.01 ? 461  GLY A C   1 
ATOM   3648  O O   . GLY A 1 461  ? -11.951 72.832  16.259  1.00 26.18 ? 461  GLY A O   1 
ATOM   3649  N N   . SER A 1 462  ? -13.705 74.074  16.936  1.00 26.45 ? 462  SER A N   1 
ATOM   3650  C CA  . SER A 1 462  ? -14.554 73.747  15.794  1.00 25.54 ? 462  SER A CA  1 
ATOM   3651  C C   . SER A 1 462  ? -14.784 72.237  15.715  1.00 26.80 ? 462  SER A C   1 
ATOM   3652  O O   . SER A 1 462  ? -14.759 71.645  14.628  1.00 25.78 ? 462  SER A O   1 
ATOM   3653  C CB  . SER A 1 462  ? -13.914 74.254  14.497  1.00 25.28 ? 462  SER A CB  1 
ATOM   3654  O OG  . SER A 1 462  ? -13.773 75.666  14.491  1.00 24.30 ? 462  SER A OG  1 
ATOM   3655  N N   . GLY A 1 463  ? -15.016 71.629  16.883  1.00 28.23 ? 463  GLY A N   1 
ATOM   3656  C CA  . GLY A 1 463  ? -15.247 70.191  16.982  1.00 28.65 ? 463  GLY A CA  1 
ATOM   3657  C C   . GLY A 1 463  ? -16.246 69.593  16.001  1.00 28.66 ? 463  GLY A C   1 
ATOM   3658  O O   . GLY A 1 463  ? -16.016 68.531  15.419  1.00 27.41 ? 463  GLY A O   1 
ATOM   3659  N N   . ALA A 1 464  ? -17.364 70.278  15.815  1.00 29.23 ? 464  ALA A N   1 
ATOM   3660  C CA  . ALA A 1 464  ? -18.390 69.806  14.899  1.00 29.90 ? 464  ALA A CA  1 
ATOM   3661  C C   . ALA A 1 464  ? -17.873 69.586  13.472  1.00 29.65 ? 464  ALA A C   1 
ATOM   3662  O O   . ALA A 1 464  ? -18.016 68.490  12.908  1.00 28.56 ? 464  ALA A O   1 
ATOM   3663  C CB  . ALA A 1 464  ? -19.549 70.795  14.877  1.00 30.20 ? 464  ALA A CB  1 
ATOM   3664  N N   . ALA A 1 465  ? -17.285 70.631  12.893  1.00 28.13 ? 465  ALA A N   1 
ATOM   3665  C CA  . ALA A 1 465  ? -16.777 70.556  11.529  1.00 28.03 ? 465  ALA A CA  1 
ATOM   3666  C C   . ALA A 1 465  ? -15.660 69.527  11.360  1.00 27.46 ? 465  ALA A C   1 
ATOM   3667  O O   . ALA A 1 465  ? -15.542 68.902  10.306  1.00 24.40 ? 465  ALA A O   1 
ATOM   3668  C CB  . ALA A 1 465  ? -16.303 71.941  11.066  1.00 27.34 ? 465  ALA A CB  1 
ATOM   3669  N N   . LEU A 1 466  ? -14.840 69.353  12.390  1.00 29.14 ? 466  LEU A N   1 
ATOM   3670  C CA  . LEU A 1 466  ? -13.753 68.384  12.308  1.00 30.97 ? 466  LEU A CA  1 
ATOM   3671  C C   . LEU A 1 466  ? -14.330 66.978  12.161  1.00 32.13 ? 466  LEU A C   1 
ATOM   3672  O O   . LEU A 1 466  ? -13.920 66.217  11.284  1.00 31.79 ? 466  LEU A O   1 
ATOM   3673  C CB  . LEU A 1 466  ? -12.855 68.456  13.550  1.00 29.49 ? 466  LEU A CB  1 
ATOM   3674  C CG  . LEU A 1 466  ? -11.790 67.360  13.586  1.00 28.58 ? 466  LEU A CG  1 
ATOM   3675  C CD1 . LEU A 1 466  ? -10.414 67.976  13.699  1.00 26.94 ? 466  LEU A CD1 1 
ATOM   3676  C CD2 . LEU A 1 466  ? -12.072 66.408  14.739  1.00 28.33 ? 466  LEU A CD2 1 
ATOM   3677  N N   . ARG A 1 467  ? -15.293 66.642  13.012  1.00 34.36 ? 467  ARG A N   1 
ATOM   3678  C CA  . ARG A 1 467  ? -15.920 65.330  12.952  1.00 38.08 ? 467  ARG A CA  1 
ATOM   3679  C C   . ARG A 1 467  ? -16.621 65.106  11.616  1.00 38.72 ? 467  ARG A C   1 
ATOM   3680  O O   . ARG A 1 467  ? -16.690 63.978  11.135  1.00 39.50 ? 467  ARG A O   1 
ATOM   3681  C CB  . ARG A 1 467  ? -16.923 65.164  14.096  1.00 40.42 ? 467  ARG A CB  1 
ATOM   3682  C CG  . ARG A 1 467  ? -17.695 63.852  14.050  1.00 44.20 ? 467  ARG A CG  1 
ATOM   3683  C CD  . ARG A 1 467  ? -18.271 63.504  15.411  1.00 48.30 ? 467  ARG A CD  1 
ATOM   3684  N NE  . ARG A 1 467  ? -18.187 62.066  15.671  1.00 50.71 ? 467  ARG A NE  1 
ATOM   3685  C CZ  . ARG A 1 467  ? -18.360 61.508  16.866  1.00 51.83 ? 467  ARG A CZ  1 
ATOM   3686  N NH1 . ARG A 1 467  ? -18.630 62.266  17.925  1.00 51.43 ? 467  ARG A NH1 1 
ATOM   3687  N NH2 . ARG A 1 467  ? -18.254 60.191  17.003  1.00 52.56 ? 467  ARG A NH2 1 
ATOM   3688  N N   . GLU A 1 468  ? -17.133 66.180  11.018  1.00 39.16 ? 468  GLU A N   1 
ATOM   3689  C CA  . GLU A 1 468  ? -17.825 66.083  9.734   1.00 39.74 ? 468  GLU A CA  1 
ATOM   3690  C C   . GLU A 1 468  ? -16.853 65.880  8.574   1.00 39.85 ? 468  GLU A C   1 
ATOM   3691  O O   . GLU A 1 468  ? -17.068 65.023  7.714   1.00 39.63 ? 468  GLU A O   1 
ATOM   3692  C CB  . GLU A 1 468  ? -18.679 67.333  9.502   1.00 40.36 ? 468  GLU A CB  1 
ATOM   3693  C CG  . GLU A 1 468  ? -19.980 67.328  10.289  1.00 41.73 ? 468  GLU A CG  1 
ATOM   3694  C CD  . GLU A 1 468  ? -20.653 68.691  10.356  1.00 43.60 ? 468  GLU A CD  1 
ATOM   3695  O OE1 . GLU A 1 468  ? -20.762 69.369  9.303   1.00 43.61 ? 468  GLU A OE1 1 
ATOM   3696  O OE2 . GLU A 1 468  ? -21.085 69.075  11.468  1.00 43.67 ? 468  GLU A OE2 1 
ATOM   3697  N N   . SER A 1 469  ? -15.779 66.660  8.548   1.00 39.23 ? 469  SER A N   1 
ATOM   3698  C CA  . SER A 1 469  ? -14.802 66.521  7.479   1.00 38.34 ? 469  SER A CA  1 
ATOM   3699  C C   . SER A 1 469  ? -14.142 65.156  7.611   1.00 38.27 ? 469  SER A C   1 
ATOM   3700  O O   . SER A 1 469  ? -13.826 64.511  6.616   1.00 38.00 ? 469  SER A O   1 
ATOM   3701  C CB  . SER A 1 469  ? -13.742 67.621  7.563   1.00 36.17 ? 469  SER A CB  1 
ATOM   3702  O OG  . SER A 1 469  ? -12.889 67.426  8.674   1.00 37.37 ? 469  SER A OG  1 
ATOM   3703  N N   . LEU A 1 470  ? -13.942 64.712  8.847   1.00 38.58 ? 470  LEU A N   1 
ATOM   3704  C CA  . LEU A 1 470  ? -13.319 63.422  9.081   1.00 38.70 ? 470  LEU A CA  1 
ATOM   3705  C C   . LEU A 1 470  ? -14.316 62.320  8.776   1.00 41.88 ? 470  LEU A C   1 
ATOM   3706  O O   . LEU A 1 470  ? -13.963 61.294  8.196   1.00 43.49 ? 470  LEU A O   1 
ATOM   3707  C CB  . LEU A 1 470  ? -12.844 63.322  10.524  1.00 34.79 ? 470  LEU A CB  1 
ATOM   3708  C CG  . LEU A 1 470  ? -11.360 63.036  10.753  1.00 33.88 ? 470  LEU A CG  1 
ATOM   3709  C CD1 . LEU A 1 470  ? -10.484 63.879  9.843   1.00 32.04 ? 470  LEU A CD1 1 
ATOM   3710  C CD2 . LEU A 1 470  ? -11.039 63.319  12.197  1.00 31.17 ? 470  LEU A CD2 1 
ATOM   3711  N N   . TYR A 1 471  ? -15.570 62.529  9.152   1.00 44.43 ? 471  TYR A N   1 
ATOM   3712  C CA  . TYR A 1 471  ? -16.577 61.519  8.883   1.00 47.09 ? 471  TYR A CA  1 
ATOM   3713  C C   . TYR A 1 471  ? -16.727 61.293  7.377   1.00 46.04 ? 471  TYR A C   1 
ATOM   3714  O O   . TYR A 1 471  ? -17.081 60.197  6.934   1.00 46.19 ? 471  TYR A O   1 
ATOM   3715  C CB  . TYR A 1 471  ? -17.927 61.925  9.487   1.00 51.41 ? 471  TYR A CB  1 
ATOM   3716  C CG  . TYR A 1 471  ? -19.077 61.271  8.773   1.00 56.78 ? 471  TYR A CG  1 
ATOM   3717  C CD1 . TYR A 1 471  ? -19.596 61.829  7.602   1.00 59.25 ? 471  TYR A CD1 1 
ATOM   3718  C CD2 . TYR A 1 471  ? -19.560 60.028  9.184   1.00 59.38 ? 471  TYR A CD2 1 
ATOM   3719  C CE1 . TYR A 1 471  ? -20.556 61.161  6.850   1.00 61.49 ? 471  TYR A CE1 1 
ATOM   3720  C CE2 . TYR A 1 471  ? -20.523 59.350  8.437   1.00 61.76 ? 471  TYR A CE2 1 
ATOM   3721  C CZ  . TYR A 1 471  ? -21.013 59.924  7.269   1.00 62.19 ? 471  TYR A CZ  1 
ATOM   3722  O OH  . TYR A 1 471  ? -21.949 59.260  6.511   1.00 64.54 ? 471  TYR A OH  1 
ATOM   3723  N N   . ALA A 1 472  ? -16.448 62.337  6.602   1.00 45.13 ? 472  ALA A N   1 
ATOM   3724  C CA  . ALA A 1 472  ? -16.566 62.290  5.147   1.00 42.95 ? 472  ALA A CA  1 
ATOM   3725  C C   . ALA A 1 472  ? -15.574 61.349  4.468   1.00 42.11 ? 472  ALA A C   1 
ATOM   3726  O O   . ALA A 1 472  ? -15.612 61.173  3.249   1.00 41.51 ? 472  ALA A O   1 
ATOM   3727  C CB  . ALA A 1 472  ? -16.417 63.695  4.574   1.00 41.52 ? 472  ALA A CB  1 
ATOM   3728  N N   . ILE A 1 473  ? -14.679 60.751  5.245   1.00 40.92 ? 473  ILE A N   1 
ATOM   3729  C CA  . ILE A 1 473  ? -13.713 59.836  4.664   1.00 39.43 ? 473  ILE A CA  1 
ATOM   3730  C C   . ILE A 1 473  ? -13.673 58.511  5.412   1.00 40.69 ? 473  ILE A C   1 
ATOM   3731  O O   . ILE A 1 473  ? -12.664 57.806  5.405   1.00 40.97 ? 473  ILE A O   1 
ATOM   3732  C CB  . ILE A 1 473  ? -12.300 60.454  4.616   1.00 37.49 ? 473  ILE A CB  1 
ATOM   3733  C CG1 . ILE A 1 473  ? -11.797 60.760  6.023   1.00 34.89 ? 473  ILE A CG1 1 
ATOM   3734  C CG2 . ILE A 1 473  ? -12.325 61.721  3.776   1.00 36.59 ? 473  ILE A CG2 1 
ATOM   3735  C CD1 . ILE A 1 473  ? -10.339 61.149  6.046   1.00 33.27 ? 473  ILE A CD1 1 
ATOM   3736  N N   . ASN A 1 474  ? -14.786 58.185  6.057   1.00 41.32 ? 474  ASN A N   1 
ATOM   3737  C CA  . ASN A 1 474  ? -14.925 56.933  6.788   1.00 43.52 ? 474  ASN A CA  1 
ATOM   3738  C C   . ASN A 1 474  ? -13.913 56.705  7.896   1.00 42.93 ? 474  ASN A C   1 
ATOM   3739  O O   . ASN A 1 474  ? -13.466 55.582  8.134   1.00 42.99 ? 474  ASN A O   1 
ATOM   3740  C CB  . ASN A 1 474  ? -14.901 55.767  5.802   1.00 45.27 ? 474  ASN A CB  1 
ATOM   3741  C CG  . ASN A 1 474  ? -15.908 55.947  4.686   1.00 46.81 ? 474  ASN A CG  1 
ATOM   3742  O OD1 . ASN A 1 474  ? -17.106 56.098  4.936   1.00 47.70 ? 474  ASN A OD1 1 
ATOM   3743  N ND2 . ASN A 1 474  ? -15.428 55.946  3.448   1.00 47.57 ? 474  ASN A ND2 1 
ATOM   3744  N N   . VAL A 1 475  ? -13.553 57.790  8.565   1.00 43.26 ? 475  VAL A N   1 
ATOM   3745  C CA  . VAL A 1 475  ? -12.639 57.738  9.686   1.00 43.32 ? 475  VAL A CA  1 
ATOM   3746  C C   . VAL A 1 475  ? -13.483 58.178  10.867  1.00 44.91 ? 475  VAL A C   1 
ATOM   3747  O O   . VAL A 1 475  ? -13.701 59.377  11.063  1.00 45.61 ? 475  VAL A O   1 
ATOM   3748  C CB  . VAL A 1 475  ? -11.481 58.723  9.523   1.00 42.54 ? 475  VAL A CB  1 
ATOM   3749  C CG1 . VAL A 1 475  ? -10.632 58.730  10.790  1.00 41.82 ? 475  VAL A CG1 1 
ATOM   3750  C CG2 . VAL A 1 475  ? -10.642 58.338  8.316   1.00 41.86 ? 475  VAL A CG2 1 
ATOM   3751  N N   . SER A 1 476  ? -13.984 57.218  11.636  1.00 44.81 ? 476  SER A N   1 
ATOM   3752  C CA  . SER A 1 476  ? -14.805 57.567  12.779  1.00 46.62 ? 476  SER A CA  1 
ATOM   3753  C C   . SER A 1 476  ? -13.955 57.729  14.037  1.00 46.84 ? 476  SER A C   1 
ATOM   3754  O O   . SER A 1 476  ? -13.012 56.965  14.282  1.00 46.01 ? 476  SER A O   1 
ATOM   3755  C CB  . SER A 1 476  ? -15.892 56.517  13.005  1.00 47.96 ? 476  SER A CB  1 
ATOM   3756  O OG  . SER A 1 476  ? -16.781 56.940  14.025  1.00 48.76 ? 476  SER A OG  1 
ATOM   3757  N N   . LEU A 1 477  ? -14.294 58.747  14.818  1.00 46.26 ? 477  LEU A N   1 
ATOM   3758  C CA  . LEU A 1 477  ? -13.581 59.052  16.046  1.00 46.23 ? 477  LEU A CA  1 
ATOM   3759  C C   . LEU A 1 477  ? -14.370 58.564  17.253  1.00 46.45 ? 477  LEU A C   1 
ATOM   3760  O O   . LEU A 1 477  ? -15.604 58.629  17.264  1.00 46.76 ? 477  LEU A O   1 
ATOM   3761  C CB  . LEU A 1 477  ? -13.380 60.558  16.167  1.00 45.26 ? 477  LEU A CB  1 
ATOM   3762  C CG  . LEU A 1 477  ? -12.698 61.303  15.025  1.00 44.37 ? 477  LEU A CG  1 
ATOM   3763  C CD1 . LEU A 1 477  ? -12.814 62.791  15.301  1.00 45.76 ? 477  LEU A CD1 1 
ATOM   3764  C CD2 . LEU A 1 477  ? -11.236 60.887  14.900  1.00 44.17 ? 477  LEU A CD2 1 
ATOM   3765  N N   . PRO A 1 478  ? -13.665 58.079  18.289  1.00 45.85 ? 478  PRO A N   1 
ATOM   3766  C CA  . PRO A 1 478  ? -14.306 57.583  19.509  1.00 45.51 ? 478  PRO A CA  1 
ATOM   3767  C C   . PRO A 1 478  ? -15.235 58.649  20.081  1.00 45.44 ? 478  PRO A C   1 
ATOM   3768  O O   . PRO A 1 478  ? -14.941 59.843  20.018  1.00 43.58 ? 478  PRO A O   1 
ATOM   3769  C CB  . PRO A 1 478  ? -13.121 57.295  20.425  1.00 45.07 ? 478  PRO A CB  1 
ATOM   3770  C CG  . PRO A 1 478  ? -12.046 56.920  19.471  1.00 45.98 ? 478  PRO A CG  1 
ATOM   3771  C CD  . PRO A 1 478  ? -12.202 57.952  18.384  1.00 45.73 ? 478  PRO A CD  1 
ATOM   3772  N N   . ASP A 1 479  ? -16.358 58.213  20.636  1.00 46.43 ? 479  ASP A N   1 
ATOM   3773  C CA  . ASP A 1 479  ? -17.328 59.142  21.203  1.00 46.83 ? 479  ASP A CA  1 
ATOM   3774  C C   . ASP A 1 479  ? -17.220 59.269  22.717  1.00 44.80 ? 479  ASP A C   1 
ATOM   3775  O O   . ASP A 1 479  ? -17.777 60.198  23.295  1.00 42.84 ? 479  ASP A O   1 
ATOM   3776  C CB  . ASP A 1 479  ? -18.749 58.706  20.830  1.00 49.11 ? 479  ASP A CB  1 
ATOM   3777  C CG  . ASP A 1 479  ? -18.994 57.230  21.100  1.00 51.76 ? 479  ASP A CG  1 
ATOM   3778  O OD1 . ASP A 1 479  ? -18.732 56.766  22.233  1.00 52.26 ? 479  ASP A OD1 1 
ATOM   3779  O OD2 . ASP A 1 479  ? -19.450 56.531  20.174  1.00 55.12 ? 479  ASP A OD2 1 
ATOM   3780  N N   . PHE A 1 480  ? -16.498 58.345  23.351  1.00 44.36 ? 480  PHE A N   1 
ATOM   3781  C CA  . PHE A 1 480  ? -16.348 58.359  24.809  1.00 45.54 ? 480  PHE A CA  1 
ATOM   3782  C C   . PHE A 1 480  ? -17.732 58.534  25.438  1.00 46.47 ? 480  PHE A C   1 
ATOM   3783  O O   . PHE A 1 480  ? -17.945 59.424  26.270  1.00 47.10 ? 480  PHE A O   1 
ATOM   3784  C CB  . PHE A 1 480  ? -15.421 59.507  25.253  1.00 43.06 ? 480  PHE A CB  1 
ATOM   3785  C CG  . PHE A 1 480  ? -14.019 59.374  24.754  1.00 40.76 ? 480  PHE A CG  1 
ATOM   3786  C CD1 . PHE A 1 480  ? -13.236 58.297  25.138  1.00 39.60 ? 480  PHE A CD1 1 
ATOM   3787  C CD2 . PHE A 1 480  ? -13.500 60.290  23.852  1.00 40.72 ? 480  PHE A CD2 1 
ATOM   3788  C CE1 . PHE A 1 480  ? -11.957 58.129  24.629  1.00 39.13 ? 480  PHE A CE1 1 
ATOM   3789  C CE2 . PHE A 1 480  ? -12.220 60.132  23.334  1.00 39.51 ? 480  PHE A CE2 1 
ATOM   3790  C CZ  . PHE A 1 480  ? -11.447 59.047  23.723  1.00 38.93 ? 480  PHE A CZ  1 
ATOM   3791  N N   . LYS A 1 481  ? -18.670 57.684  25.031  1.00 46.89 ? 481  LYS A N   1 
ATOM   3792  C CA  . LYS A 1 481  ? -20.036 57.761  25.533  1.00 48.26 ? 481  LYS A CA  1 
ATOM   3793  C C   . LYS A 1 481  ? -20.125 57.642  27.054  1.00 47.73 ? 481  LYS A C   1 
ATOM   3794  O O   . LYS A 1 481  ? -19.644 56.672  27.639  1.00 47.25 ? 481  LYS A O   1 
ATOM   3795  C CB  . LYS A 1 481  ? -20.897 56.677  24.880  1.00 49.54 ? 481  LYS A CB  1 
ATOM   3796  C CG  . LYS A 1 481  ? -22.379 56.753  25.241  1.00 50.89 ? 481  LYS A CG  1 
ATOM   3797  C CD  . LYS A 1 481  ? -23.161 55.641  24.567  1.00 51.67 ? 481  LYS A CD  1 
ATOM   3798  C CE  . LYS A 1 481  ? -24.648 55.715  24.879  1.00 52.63 ? 481  LYS A CE  1 
ATOM   3799  N NZ  . LYS A 1 481  ? -25.408 54.629  24.188  1.00 52.19 ? 481  LYS A NZ  1 
ATOM   3800  N N   . GLY A 1 482  ? -20.728 58.641  27.691  1.00 47.33 ? 482  GLY A N   1 
ATOM   3801  C CA  . GLY A 1 482  ? -20.872 58.593  29.131  1.00 47.54 ? 482  GLY A CA  1 
ATOM   3802  C C   . GLY A 1 482  ? -19.921 59.427  29.969  1.00 48.07 ? 482  GLY A C   1 
ATOM   3803  O O   . GLY A 1 482  ? -20.056 59.440  31.191  1.00 48.42 ? 482  GLY A O   1 
ATOM   3804  N N   . LEU A 1 483  ? -18.966 60.116  29.347  1.00 47.65 ? 483  LEU A N   1 
ATOM   3805  C CA  . LEU A 1 483  ? -18.029 60.948  30.104  1.00 47.34 ? 483  LEU A CA  1 
ATOM   3806  C C   . LEU A 1 483  ? -18.540 62.375  30.357  1.00 46.42 ? 483  LEU A C   1 
ATOM   3807  O O   . LEU A 1 483  ? -18.821 63.121  29.419  1.00 46.50 ? 483  LEU A O   1 
ATOM   3808  C CB  . LEU A 1 483  ? -16.677 61.021  29.393  1.00 48.19 ? 483  LEU A CB  1 
ATOM   3809  C CG  . LEU A 1 483  ? -15.532 60.225  30.017  1.00 48.95 ? 483  LEU A CG  1 
ATOM   3810  C CD1 . LEU A 1 483  ? -14.233 60.721  29.431  1.00 49.06 ? 483  LEU A CD1 1 
ATOM   3811  C CD2 . LEU A 1 483  ? -15.507 60.412  31.519  1.00 49.65 ? 483  LEU A CD2 1 
ATOM   3812  N N   . PRO A 1 484  ? -18.645 62.774  31.638  1.00 45.46 ? 484  PRO A N   1 
ATOM   3813  C CA  . PRO A 1 484  ? -19.115 64.098  32.070  1.00 44.21 ? 484  PRO A CA  1 
ATOM   3814  C C   . PRO A 1 484  ? -18.209 65.267  31.677  1.00 42.74 ? 484  PRO A C   1 
ATOM   3815  O O   . PRO A 1 484  ? -17.983 66.178  32.479  1.00 42.79 ? 484  PRO A O   1 
ATOM   3816  C CB  . PRO A 1 484  ? -19.206 63.955  33.591  1.00 43.86 ? 484  PRO A CB  1 
ATOM   3817  C CG  . PRO A 1 484  ? -19.403 62.499  33.793  1.00 44.88 ? 484  PRO A CG  1 
ATOM   3818  C CD  . PRO A 1 484  ? -18.437 61.907  32.806  1.00 44.71 ? 484  PRO A CD  1 
ATOM   3819  N N   . VAL A 1 485  ? -17.691 65.250  30.456  1.00 39.87 ? 485  VAL A N   1 
ATOM   3820  C CA  . VAL A 1 485  ? -16.821 66.330  30.019  1.00 36.94 ? 485  VAL A CA  1 
ATOM   3821  C C   . VAL A 1 485  ? -17.441 67.106  28.869  1.00 36.32 ? 485  VAL A C   1 
ATOM   3822  O O   . VAL A 1 485  ? -18.272 66.580  28.122  1.00 35.37 ? 485  VAL A O   1 
ATOM   3823  C CB  . VAL A 1 485  ? -15.450 65.797  29.564  1.00 35.29 ? 485  VAL A CB  1 
ATOM   3824  C CG1 . VAL A 1 485  ? -14.808 64.994  30.686  1.00 35.30 ? 485  VAL A CG1 1 
ATOM   3825  C CG2 . VAL A 1 485  ? -15.612 64.950  28.315  1.00 34.78 ? 485  VAL A CG2 1 
ATOM   3826  N N   . LYS A 1 486  ? -17.041 68.365  28.737  1.00 34.77 ? 486  LYS A N   1 
ATOM   3827  C CA  . LYS A 1 486  ? -17.535 69.200  27.654  1.00 34.37 ? 486  LYS A CA  1 
ATOM   3828  C C   . LYS A 1 486  ? -16.842 68.746  26.357  1.00 34.34 ? 486  LYS A C   1 
ATOM   3829  O O   . LYS A 1 486  ? -15.652 68.997  26.148  1.00 34.46 ? 486  LYS A O   1 
ATOM   3830  C CB  . LYS A 1 486  ? -17.223 70.672  27.941  1.00 32.86 ? 486  LYS A CB  1 
ATOM   3831  C CG  . LYS A 1 486  ? -17.772 71.609  26.900  1.00 33.49 ? 486  LYS A CG  1 
ATOM   3832  C CD  . LYS A 1 486  ? -17.438 73.050  27.200  1.00 33.09 ? 486  LYS A CD  1 
ATOM   3833  C CE  . LYS A 1 486  ? -18.035 73.949  26.125  1.00 33.91 ? 486  LYS A CE  1 
ATOM   3834  N NZ  . LYS A 1 486  ? -17.716 75.388  26.325  1.00 33.89 ? 486  LYS A NZ  1 
ATOM   3835  N N   . ALA A 1 487  ? -17.589 68.065  25.495  1.00 33.89 ? 487  ALA A N   1 
ATOM   3836  C CA  . ALA A 1 487  ? -17.044 67.566  24.237  1.00 32.36 ? 487  ALA A CA  1 
ATOM   3837  C C   . ALA A 1 487  ? -16.508 68.682  23.345  1.00 31.51 ? 487  ALA A C   1 
ATOM   3838  O O   . ALA A 1 487  ? -15.524 68.492  22.627  1.00 30.14 ? 487  ALA A O   1 
ATOM   3839  C CB  . ALA A 1 487  ? -18.111 66.769  23.489  1.00 31.10 ? 487  ALA A CB  1 
ATOM   3840  N N   . ALA A 1 488  ? -17.153 69.845  23.394  1.00 30.83 ? 488  ALA A N   1 
ATOM   3841  C CA  . ALA A 1 488  ? -16.731 70.968  22.565  1.00 30.39 ? 488  ALA A CA  1 
ATOM   3842  C C   . ALA A 1 488  ? -15.452 71.622  23.071  1.00 29.40 ? 488  ALA A C   1 
ATOM   3843  O O   . ALA A 1 488  ? -15.390 72.836  23.245  1.00 30.13 ? 488  ALA A O   1 
ATOM   3844  C CB  . ALA A 1 488  ? -17.844 72.003  22.467  1.00 30.29 ? 488  ALA A CB  1 
ATOM   3845  N N   . THR A 1 489  ? -14.430 70.811  23.304  1.00 28.28 ? 489  THR A N   1 
ATOM   3846  C CA  . THR A 1 489  ? -13.150 71.326  23.764  1.00 28.53 ? 489  THR A CA  1 
ATOM   3847  C C   . THR A 1 489  ? -12.035 70.638  22.987  1.00 28.33 ? 489  THR A C   1 
ATOM   3848  O O   . THR A 1 489  ? -12.140 69.454  22.649  1.00 28.83 ? 489  THR A O   1 
ATOM   3849  C CB  . THR A 1 489  ? -12.924 71.026  25.243  1.00 29.39 ? 489  THR A CB  1 
ATOM   3850  O OG1 . THR A 1 489  ? -12.833 69.606  25.421  1.00 27.94 ? 489  THR A OG1 1 
ATOM   3851  C CG2 . THR A 1 489  ? -14.072 71.578  26.081  1.00 30.14 ? 489  THR A CG2 1 
ATOM   3852  N N   . LYS A 1 490  ? -10.966 71.373  22.707  1.00 26.91 ? 490  LYS A N   1 
ATOM   3853  C CA  . LYS A 1 490  ? -9.842  70.796  21.991  1.00 24.93 ? 490  LYS A CA  1 
ATOM   3854  C C   . LYS A 1 490  ? -9.250  69.626  22.792  1.00 24.97 ? 490  LYS A C   1 
ATOM   3855  O O   . LYS A 1 490  ? -8.668  68.707  22.218  1.00 25.77 ? 490  LYS A O   1 
ATOM   3856  C CB  . LYS A 1 490  ? -8.812  71.881  21.696  1.00 21.74 ? 490  LYS A CB  1 
ATOM   3857  C CG  . LYS A 1 490  ? -9.301  72.839  20.610  1.00 21.31 ? 490  LYS A CG  1 
ATOM   3858  C CD  . LYS A 1 490  ? -8.227  73.817  20.184  1.00 20.94 ? 490  LYS A CD  1 
ATOM   3859  C CE  . LYS A 1 490  ? -8.229  75.044  21.055  1.00 21.40 ? 490  LYS A CE  1 
ATOM   3860  N NZ  . LYS A 1 490  ? -7.075  75.916  20.725  1.00 25.57 ? 490  LYS A NZ  1 
ATOM   3861  N N   . ILE A 1 491  ? -9.425  69.653  24.113  1.00 23.63 ? 491  ILE A N   1 
ATOM   3862  C CA  . ILE A 1 491  ? -8.959  68.574  24.976  1.00 22.01 ? 491  ILE A CA  1 
ATOM   3863  C C   . ILE A 1 491  ? -9.676  67.294  24.521  1.00 23.56 ? 491  ILE A C   1 
ATOM   3864  O O   . ILE A 1 491  ? -9.055  66.243  24.338  1.00 24.06 ? 491  ILE A O   1 
ATOM   3865  C CB  . ILE A 1 491  ? -9.301  68.872  26.456  1.00 20.44 ? 491  ILE A CB  1 
ATOM   3866  C CG1 . ILE A 1 491  ? -8.361  69.952  26.980  1.00 19.70 ? 491  ILE A CG1 1 
ATOM   3867  C CG2 . ILE A 1 491  ? -9.217  67.610  27.296  1.00 19.25 ? 491  ILE A CG2 1 
ATOM   3868  C CD1 . ILE A 1 491  ? -8.605  70.347  28.407  1.00 19.35 ? 491  ILE A CD1 1 
ATOM   3869  N N   . PHE A 1 492  ? -10.988 67.392  24.334  1.00 24.13 ? 492  PHE A N   1 
ATOM   3870  C CA  . PHE A 1 492  ? -11.771 66.255  23.877  1.00 24.86 ? 492  PHE A CA  1 
ATOM   3871  C C   . PHE A 1 492  ? -11.266 65.867  22.484  1.00 24.19 ? 492  PHE A C   1 
ATOM   3872  O O   . PHE A 1 492  ? -11.086 64.690  22.173  1.00 24.74 ? 492  PHE A O   1 
ATOM   3873  C CB  . PHE A 1 492  ? -13.253 66.627  23.812  1.00 26.08 ? 492  PHE A CB  1 
ATOM   3874  C CG  . PHE A 1 492  ? -14.161 65.461  23.527  1.00 28.31 ? 492  PHE A CG  1 
ATOM   3875  C CD1 . PHE A 1 492  ? -14.457 64.530  24.519  1.00 29.45 ? 492  PHE A CD1 1 
ATOM   3876  C CD2 . PHE A 1 492  ? -14.718 65.288  22.263  1.00 27.92 ? 492  PHE A CD2 1 
ATOM   3877  C CE1 . PHE A 1 492  ? -15.302 63.438  24.251  1.00 28.84 ? 492  PHE A CE1 1 
ATOM   3878  C CE2 . PHE A 1 492  ? -15.555 64.209  21.990  1.00 28.62 ? 492  PHE A CE2 1 
ATOM   3879  C CZ  . PHE A 1 492  ? -15.848 63.282  22.988  1.00 28.16 ? 492  PHE A CZ  1 
ATOM   3880  N N   . GLN A 1 493  ? -11.042 66.868  21.643  1.00 23.63 ? 493  GLN A N   1 
ATOM   3881  C CA  . GLN A 1 493  ? -10.537 66.620  20.300  1.00 23.53 ? 493  GLN A CA  1 
ATOM   3882  C C   . GLN A 1 493  ? -9.236  65.825  20.346  1.00 22.94 ? 493  GLN A C   1 
ATOM   3883  O O   . GLN A 1 493  ? -9.039  64.898  19.563  1.00 22.62 ? 493  GLN A O   1 
ATOM   3884  C CB  . GLN A 1 493  ? -10.292 67.942  19.566  1.00 22.60 ? 493  GLN A CB  1 
ATOM   3885  C CG  . GLN A 1 493  ? -11.442 68.400  18.692  1.00 24.01 ? 493  GLN A CG  1 
ATOM   3886  C CD  . GLN A 1 493  ? -11.093 69.613  17.842  1.00 26.22 ? 493  GLN A CD  1 
ATOM   3887  O OE1 . GLN A 1 493  ? -10.078 69.627  17.128  1.00 28.40 ? 493  GLN A OE1 1 
ATOM   3888  N NE2 . GLN A 1 493  ? -11.941 70.635  17.899  1.00 25.60 ? 493  GLN A NE2 1 
ATOM   3889  N N   . ALA A 1 494  ? -8.348  66.199  21.265  1.00 23.20 ? 494  ALA A N   1 
ATOM   3890  C CA  . ALA A 1 494  ? -7.061  65.532  21.401  1.00 23.69 ? 494  ALA A CA  1 
ATOM   3891  C C   . ALA A 1 494  ? -7.286  64.071  21.738  1.00 24.78 ? 494  ALA A C   1 
ATOM   3892  O O   . ALA A 1 494  ? -6.643  63.179  21.180  1.00 24.77 ? 494  ALA A O   1 
ATOM   3893  C CB  . ALA A 1 494  ? -6.233  66.207  22.488  1.00 22.46 ? 494  ALA A CB  1 
ATOM   3894  N N   . ALA A 1 495  ? -8.205  63.832  22.662  1.00 25.30 ? 495  ALA A N   1 
ATOM   3895  C CA  . ALA A 1 495  ? -8.521  62.474  23.063  1.00 26.15 ? 495  ALA A CA  1 
ATOM   3896  C C   . ALA A 1 495  ? -8.985  61.645  21.866  1.00 25.46 ? 495  ALA A C   1 
ATOM   3897  O O   . ALA A 1 495  ? -8.578  60.493  21.719  1.00 26.50 ? 495  ALA A O   1 
ATOM   3898  C CB  . ALA A 1 495  ? -9.592  62.484  24.141  1.00 26.86 ? 495  ALA A CB  1 
ATOM   3899  N N   . GLN A 1 496  ? -9.827  62.224  21.013  1.00 24.32 ? 496  GLN A N   1 
ATOM   3900  C CA  . GLN A 1 496  ? -10.330 61.499  19.843  1.00 24.37 ? 496  GLN A CA  1 
ATOM   3901  C C   . GLN A 1 496  ? -9.274  61.210  18.767  1.00 24.57 ? 496  GLN A C   1 
ATOM   3902  O O   . GLN A 1 496  ? -9.313  60.170  18.104  1.00 23.42 ? 496  GLN A O   1 
ATOM   3903  C CB  . GLN A 1 496  ? -11.483 62.272  19.192  1.00 24.56 ? 496  GLN A CB  1 
ATOM   3904  C CG  . GLN A 1 496  ? -12.771 62.310  19.992  1.00 27.04 ? 496  GLN A CG  1 
ATOM   3905  C CD  . GLN A 1 496  ? -13.889 63.037  19.259  1.00 26.95 ? 496  GLN A CD  1 
ATOM   3906  O OE1 . GLN A 1 496  ? -13.779 64.226  18.963  1.00 30.12 ? 496  GLN A OE1 1 
ATOM   3907  N NE2 . GLN A 1 496  ? -14.968 62.325  18.962  1.00 27.70 ? 496  GLN A NE2 1 
ATOM   3908  N N   . LEU A 1 497  ? -8.330  62.126  18.597  1.00 25.27 ? 497  LEU A N   1 
ATOM   3909  C CA  . LEU A 1 497  ? -7.315  61.981  17.565  1.00 25.76 ? 497  LEU A CA  1 
ATOM   3910  C C   . LEU A 1 497  ? -6.097  61.190  18.003  1.00 25.80 ? 497  LEU A C   1 
ATOM   3911  O O   . LEU A 1 497  ? -5.417  60.578  17.189  1.00 25.23 ? 497  LEU A O   1 
ATOM   3912  C CB  . LEU A 1 497  ? -6.901  63.378  17.075  1.00 25.93 ? 497  LEU A CB  1 
ATOM   3913  C CG  . LEU A 1 497  ? -8.069  64.199  16.512  1.00 24.92 ? 497  LEU A CG  1 
ATOM   3914  C CD1 . LEU A 1 497  ? -7.751  65.677  16.497  1.00 22.79 ? 497  LEU A CD1 1 
ATOM   3915  C CD2 . LEU A 1 497  ? -8.387  63.697  15.117  1.00 26.46 ? 497  LEU A CD2 1 
ATOM   3916  N N   . ALA A 1 498  ? -5.848  61.196  19.302  1.00 27.60 ? 498  ALA A N   1 
ATOM   3917  C CA  . ALA A 1 498  ? -4.706  60.516  19.907  1.00 28.82 ? 498  ALA A CA  1 
ATOM   3918  C C   . ALA A 1 498  ? -4.042  59.345  19.171  1.00 30.17 ? 498  ALA A C   1 
ATOM   3919  O O   . ALA A 1 498  ? -2.821  59.323  19.024  1.00 30.46 ? 498  ALA A O   1 
ATOM   3920  C CB  . ALA A 1 498  ? -5.081  60.075  21.312  1.00 28.87 ? 498  ALA A CB  1 
ATOM   3921  N N   . ASN A 1 499  ? -4.812  58.370  18.703  1.00 30.49 ? 499  ASN A N   1 
ATOM   3922  C CA  . ASN A 1 499  ? -4.173  57.221  18.063  1.00 32.55 ? 499  ASN A CA  1 
ATOM   3923  C C   . ASN A 1 499  ? -4.382  57.081  16.560  1.00 32.50 ? 499  ASN A C   1 
ATOM   3924  O O   . ASN A 1 499  ? -4.600  55.978  16.054  1.00 33.83 ? 499  ASN A O   1 
ATOM   3925  C CB  . ASN A 1 499  ? -4.622  55.928  18.761  1.00 33.96 ? 499  ASN A CB  1 
ATOM   3926  C CG  . ASN A 1 499  ? -4.333  55.936  20.254  1.00 36.14 ? 499  ASN A CG  1 
ATOM   3927  O OD1 . ASN A 1 499  ? -3.172  55.863  20.679  1.00 37.05 ? 499  ASN A OD1 1 
ATOM   3928  N ND2 . ASN A 1 499  ? -5.392  56.031  21.062  1.00 34.27 ? 499  ASN A ND2 1 
ATOM   3929  N N   . LEU A 1 500  ? -4.304  58.189  15.841  1.00 31.20 ? 500  LEU A N   1 
ATOM   3930  C CA  . LEU A 1 500  ? -4.490  58.144  14.404  1.00 30.80 ? 500  LEU A CA  1 
ATOM   3931  C C   . LEU A 1 500  ? -3.287  58.764  13.722  1.00 31.75 ? 500  LEU A C   1 
ATOM   3932  O O   . LEU A 1 500  ? -2.748  59.774  14.185  1.00 33.20 ? 500  LEU A O   1 
ATOM   3933  C CB  . LEU A 1 500  ? -5.772  58.888  14.016  1.00 28.55 ? 500  LEU A CB  1 
ATOM   3934  C CG  . LEU A 1 500  ? -7.025  58.396  14.748  1.00 25.69 ? 500  LEU A CG  1 
ATOM   3935  C CD1 . LEU A 1 500  ? -8.252  59.158  14.270  1.00 26.55 ? 500  LEU A CD1 1 
ATOM   3936  C CD2 . LEU A 1 500  ? -7.196  56.917  14.505  1.00 24.56 ? 500  LEU A CD2 1 
ATOM   3937  N N   . PRO A 1 501  ? -2.810  58.138  12.641  1.00 31.55 ? 501  PRO A N   1 
ATOM   3938  C CA  . PRO A 1 501  ? -1.651  58.712  11.953  1.00 31.05 ? 501  PRO A CA  1 
ATOM   3939  C C   . PRO A 1 501  ? -2.050  60.018  11.284  1.00 31.21 ? 501  PRO A C   1 
ATOM   3940  O O   . PRO A 1 501  ? -3.223  60.222  10.965  1.00 30.62 ? 501  PRO A O   1 
ATOM   3941  C CB  . PRO A 1 501  ? -1.279  57.631  10.944  1.00 30.23 ? 501  PRO A CB  1 
ATOM   3942  C CG  . PRO A 1 501  ? -1.637  56.378  11.678  1.00 31.25 ? 501  PRO A CG  1 
ATOM   3943  C CD  . PRO A 1 501  ? -2.999  56.731  12.256  1.00 30.87 ? 501  PRO A CD  1 
ATOM   3944  N N   . PHE A 1 502  ? -1.073  60.898  11.096  1.00 31.14 ? 502  PHE A N   1 
ATOM   3945  C CA  . PHE A 1 502  ? -1.296  62.185  10.460  1.00 31.15 ? 502  PHE A CA  1 
ATOM   3946  C C   . PHE A 1 502  ? -2.133  62.022  9.203   1.00 32.84 ? 502  PHE A C   1 
ATOM   3947  O O   . PHE A 1 502  ? -2.997  62.844  8.917   1.00 33.86 ? 502  PHE A O   1 
ATOM   3948  C CB  . PHE A 1 502  ? 0.044   62.814  10.087  1.00 30.51 ? 502  PHE A CB  1 
ATOM   3949  C CG  . PHE A 1 502  ? -0.088  64.079  9.296   1.00 31.33 ? 502  PHE A CG  1 
ATOM   3950  C CD1 . PHE A 1 502  ? -0.614  65.226  9.882   1.00 28.53 ? 502  PHE A CD1 1 
ATOM   3951  C CD2 . PHE A 1 502  ? 0.286   64.117  7.947   1.00 31.30 ? 502  PHE A CD2 1 
ATOM   3952  C CE1 . PHE A 1 502  ? -0.774  66.394  9.143   1.00 28.74 ? 502  PHE A CE1 1 
ATOM   3953  C CE2 . PHE A 1 502  ? 0.128   65.287  7.193   1.00 30.51 ? 502  PHE A CE2 1 
ATOM   3954  C CZ  . PHE A 1 502  ? -0.403  66.428  7.797   1.00 29.47 ? 502  PHE A CZ  1 
ATOM   3955  N N   . SER A 1 503  ? -1.875  60.951  8.462   1.00 34.58 ? 503  SER A N   1 
ATOM   3956  C CA  . SER A 1 503  ? -2.575  60.675  7.206   1.00 36.75 ? 503  SER A CA  1 
ATOM   3957  C C   . SER A 1 503  ? -4.090  60.487  7.284   1.00 36.10 ? 503  SER A C   1 
ATOM   3958  O O   . SER A 1 503  ? -4.795  60.744  6.308   1.00 37.65 ? 503  SER A O   1 
ATOM   3959  C CB  . SER A 1 503  ? -1.949  59.450  6.518   1.00 38.81 ? 503  SER A CB  1 
ATOM   3960  O OG  . SER A 1 503  ? -1.947  58.311  7.371   1.00 40.71 ? 503  SER A OG  1 
ATOM   3961  N N   . HIS A 1 504  ? -4.594  60.040  8.425   1.00 35.40 ? 504  HIS A N   1 
ATOM   3962  C CA  . HIS A 1 504  ? -6.031  59.822  8.585   1.00 34.97 ? 504  HIS A CA  1 
ATOM   3963  C C   . HIS A 1 504  ? -6.801  61.088  8.914   1.00 34.11 ? 504  HIS A C   1 
ATOM   3964  O O   . HIS A 1 504  ? -7.992  61.183  8.655   1.00 34.76 ? 504  HIS A O   1 
ATOM   3965  C CB  . HIS A 1 504  ? -6.277  58.797  9.683   1.00 37.27 ? 504  HIS A CB  1 
ATOM   3966  C CG  . HIS A 1 504  ? -5.785  57.434  9.340   1.00 40.15 ? 504  HIS A CG  1 
ATOM   3967  N ND1 . HIS A 1 504  ? -6.587  56.483  8.746   1.00 42.33 ? 504  HIS A ND1 1 
ATOM   3968  C CD2 . HIS A 1 504  ? -4.556  56.878  9.448   1.00 41.49 ? 504  HIS A CD2 1 
ATOM   3969  C CE1 . HIS A 1 504  ? -5.873  55.399  8.505   1.00 43.08 ? 504  HIS A CE1 1 
ATOM   3970  N NE2 . HIS A 1 504  ? -4.636  55.613  8.921   1.00 43.39 ? 504  HIS A NE2 1 
ATOM   3971  N N   . THR A 1 505  ? -6.117  62.063  9.489   1.00 33.40 ? 505  THR A N   1 
ATOM   3972  C CA  . THR A 1 505  ? -6.762  63.303  9.868   1.00 32.52 ? 505  THR A CA  1 
ATOM   3973  C C   . THR A 1 505  ? -6.389  64.463  8.941   1.00 32.58 ? 505  THR A C   1 
ATOM   3974  O O   . THR A 1 505  ? -6.902  65.568  9.085   1.00 33.23 ? 505  THR A O   1 
ATOM   3975  C CB  . THR A 1 505  ? -6.384  63.657  11.312  1.00 32.38 ? 505  THR A CB  1 
ATOM   3976  O OG1 . THR A 1 505  ? -4.957  63.735  11.421  1.00 31.46 ? 505  THR A OG1 1 
ATOM   3977  C CG2 . THR A 1 505  ? -6.899  62.592  12.279  1.00 32.30 ? 505  THR A CG2 1 
ATOM   3978  N N   . SER A 1 506  ? -5.504  64.209  7.986   1.00 31.54 ? 506  SER A N   1 
ATOM   3979  C CA  . SER A 1 506  ? -5.068  65.244  7.054   1.00 31.56 ? 506  SER A CA  1 
ATOM   3980  C C   . SER A 1 506  ? -6.188  66.136  6.547   1.00 30.34 ? 506  SER A C   1 
ATOM   3981  O O   . SER A 1 506  ? -6.083  67.362  6.608   1.00 30.01 ? 506  SER A O   1 
ATOM   3982  C CB  . SER A 1 506  ? -4.375  64.619  5.842   1.00 32.98 ? 506  SER A CB  1 
ATOM   3983  O OG  . SER A 1 506  ? -3.157  64.002  6.208   1.00 39.39 ? 506  SER A OG  1 
ATOM   3984  N N   . VAL A 1 507  ? -7.258  65.526  6.039   1.00 27.91 ? 507  VAL A N   1 
ATOM   3985  C CA  . VAL A 1 507  ? -8.361  66.306  5.490   1.00 27.47 ? 507  VAL A CA  1 
ATOM   3986  C C   . VAL A 1 507  ? -8.987  67.276  6.480   1.00 25.24 ? 507  VAL A C   1 
ATOM   3987  O O   . VAL A 1 507  ? -9.570  68.277  6.084   1.00 24.85 ? 507  VAL A O   1 
ATOM   3988  C CB  . VAL A 1 507  ? -9.484  65.392  4.893   1.00 29.43 ? 507  VAL A CB  1 
ATOM   3989  C CG1 . VAL A 1 507  ? -8.876  64.433  3.863   1.00 30.07 ? 507  VAL A CG1 1 
ATOM   3990  C CG2 . VAL A 1 507  ? -10.199 64.626  5.989   1.00 27.33 ? 507  VAL A CG2 1 
ATOM   3991  N N   . ALA A 1 508  ? -8.859  66.987  7.767   1.00 24.01 ? 508  ALA A N   1 
ATOM   3992  C CA  . ALA A 1 508  ? -9.431  67.858  8.782   1.00 23.33 ? 508  ALA A CA  1 
ATOM   3993  C C   . ALA A 1 508  ? -8.793  69.238  8.726   1.00 22.10 ? 508  ALA A C   1 
ATOM   3994  O O   . ALA A 1 508  ? -9.345  70.203  9.250   1.00 22.54 ? 508  ALA A O   1 
ATOM   3995  C CB  . ALA A 1 508  ? -9.248  67.242  10.176  1.00 23.41 ? 508  ALA A CB  1 
ATOM   3996  N N   . ILE A 1 509  ? -7.635  69.332  8.079   1.00 21.13 ? 509  ILE A N   1 
ATOM   3997  C CA  . ILE A 1 509  ? -6.936  70.606  7.974   1.00 19.69 ? 509  ILE A CA  1 
ATOM   3998  C C   . ILE A 1 509  ? -7.720  71.594  7.128   1.00 20.08 ? 509  ILE A C   1 
ATOM   3999  O O   . ILE A 1 509  ? -7.569  72.806  7.274   1.00 21.50 ? 509  ILE A O   1 
ATOM   4000  C CB  . ILE A 1 509  ? -5.495  70.405  7.421   1.00 17.21 ? 509  ILE A CB  1 
ATOM   4001  C CG1 . ILE A 1 509  ? -4.688  69.578  8.432   1.00 15.95 ? 509  ILE A CG1 1 
ATOM   4002  C CG2 . ILE A 1 509  ? -4.806  71.736  7.231   1.00 15.96 ? 509  ILE A CG2 1 
ATOM   4003  C CD1 . ILE A 1 509  ? -3.302  69.188  7.996   1.00 13.20 ? 509  ILE A CD1 1 
ATOM   4004  N N   . LEU A 1 510  ? -8.592  71.075  6.275   1.00 21.41 ? 510  LEU A N   1 
ATOM   4005  C CA  . LEU A 1 510  ? -9.412  71.920  5.415   1.00 20.99 ? 510  LEU A CA  1 
ATOM   4006  C C   . LEU A 1 510  ? -10.862 72.059  5.892   1.00 20.78 ? 510  LEU A C   1 
ATOM   4007  O O   . LEU A 1 510  ? -11.682 72.665  5.208   1.00 19.44 ? 510  LEU A O   1 
ATOM   4008  C CB  . LEU A 1 510  ? -9.387  71.374  3.990   1.00 21.36 ? 510  LEU A CB  1 
ATOM   4009  C CG  . LEU A 1 510  ? -7.974  71.232  3.411   1.00 24.56 ? 510  LEU A CG  1 
ATOM   4010  C CD1 . LEU A 1 510  ? -8.014  70.615  2.025   1.00 24.95 ? 510  LEU A CD1 1 
ATOM   4011  C CD2 . LEU A 1 510  ? -7.331  72.599  3.338   1.00 26.77 ? 510  LEU A CD2 1 
ATOM   4012  N N   . ALA A 1 511  ? -11.186 71.515  7.063   1.00 20.31 ? 511  ALA A N   1 
ATOM   4013  C CA  . ALA A 1 511  ? -12.557 71.615  7.576   1.00 21.26 ? 511  ALA A CA  1 
ATOM   4014  C C   . ALA A 1 511  ? -12.977 73.044  7.969   1.00 23.09 ? 511  ALA A C   1 
ATOM   4015  O O   . ALA A 1 511  ? -12.132 73.892  8.273   1.00 22.40 ? 511  ALA A O   1 
ATOM   4016  C CB  . ALA A 1 511  ? -12.725 70.701  8.760   1.00 16.86 ? 511  ALA A CB  1 
ATOM   4017  N N   . ASP A 1 512  ? -14.289 73.296  7.966   1.00 24.46 ? 512  ASP A N   1 
ATOM   4018  C CA  . ASP A 1 512  ? -14.840 74.601  8.344   1.00 24.43 ? 512  ASP A CA  1 
ATOM   4019  C C   . ASP A 1 512  ? -14.371 75.035  9.738   1.00 24.99 ? 512  ASP A C   1 
ATOM   4020  O O   . ASP A 1 512  ? -13.954 74.217  10.567  1.00 23.58 ? 512  ASP A O   1 
ATOM   4021  C CB  . ASP A 1 512  ? -16.379 74.576  8.374   1.00 24.34 ? 512  ASP A CB  1 
ATOM   4022  C CG  . ASP A 1 512  ? -17.007 74.445  7.004   1.00 25.21 ? 512  ASP A CG  1 
ATOM   4023  O OD1 . ASP A 1 512  ? -16.362 74.808  6.001   1.00 27.93 ? 512  ASP A OD1 1 
ATOM   4024  O OD2 . ASP A 1 512  ? -18.170 73.995  6.933   1.00 27.01 ? 512  ASP A OD2 1 
ATOM   4025  N N   . THR A 1 513  ? -14.485 76.335  9.988   1.00 25.78 ? 513  THR A N   1 
ATOM   4026  C CA  . THR A 1 513  ? -14.106 76.944  11.259  1.00 25.87 ? 513  THR A CA  1 
ATOM   4027  C C   . THR A 1 513  ? -15.366 77.612  11.845  1.00 26.99 ? 513  THR A C   1 
ATOM   4028  O O   . THR A 1 513  ? -16.050 78.373  11.157  1.00 26.99 ? 513  THR A O   1 
ATOM   4029  C CB  . THR A 1 513  ? -12.995 78.003  11.027  1.00 24.72 ? 513  THR A CB  1 
ATOM   4030  O OG1 . THR A 1 513  ? -11.907 77.401  10.313  1.00 22.40 ? 513  THR A OG1 1 
ATOM   4031  C CG2 . THR A 1 513  ? -12.476 78.545  12.350  1.00 25.60 ? 513  THR A CG2 1 
ATOM   4032  N N   . SER A 1 514  ? -15.684 77.320  13.102  1.00 27.78 ? 514  SER A N   1 
ATOM   4033  C CA  . SER A 1 514  ? -16.875 77.895  13.726  1.00 29.88 ? 514  SER A CA  1 
ATOM   4034  C C   . SER A 1 514  ? -16.621 79.250  14.363  1.00 30.63 ? 514  SER A C   1 
ATOM   4035  O O   . SER A 1 514  ? -15.768 79.387  15.235  1.00 31.44 ? 514  SER A O   1 
ATOM   4036  C CB  . SER A 1 514  ? -17.433 76.944  14.779  1.00 31.39 ? 514  SER A CB  1 
ATOM   4037  O OG  . SER A 1 514  ? -17.962 75.781  14.165  1.00 37.14 ? 514  SER A OG  1 
ATOM   4038  N N   . MET A 1 515  ? -17.383 80.248  13.937  1.00 31.02 ? 515  MET A N   1 
ATOM   4039  C CA  . MET A 1 515  ? -17.215 81.586  14.461  1.00 32.01 ? 515  MET A CA  1 
ATOM   4040  C C   . MET A 1 515  ? -17.714 81.825  15.871  1.00 31.38 ? 515  MET A C   1 
ATOM   4041  O O   . MET A 1 515  ? -18.823 81.442  16.221  1.00 32.12 ? 515  MET A O   1 
ATOM   4042  C CB  . MET A 1 515  ? -17.877 82.610  13.558  1.00 33.51 ? 515  MET A CB  1 
ATOM   4043  C CG  . MET A 1 515  ? -17.924 83.956  14.229  1.00 37.88 ? 515  MET A CG  1 
ATOM   4044  S SD  . MET A 1 515  ? -18.860 85.159  13.345  1.00 44.08 ? 515  MET A SD  1 
ATOM   4045  C CE  . MET A 1 515  ? -17.487 85.964  12.495  1.00 43.70 ? 515  MET A CE  1 
ATOM   4046  N N   . GLY A 1 516  ? -16.874 82.485  16.664  1.00 31.21 ? 516  GLY A N   1 
ATOM   4047  C CA  . GLY A 1 516  ? -17.209 82.839  18.031  1.00 29.97 ? 516  GLY A CA  1 
ATOM   4048  C C   . GLY A 1 516  ? -17.320 84.354  18.048  1.00 30.10 ? 516  GLY A C   1 
ATOM   4049  O O   . GLY A 1 516  ? -17.018 85.014  17.047  1.00 29.10 ? 516  GLY A O   1 
ATOM   4050  N N   . LEU A 1 517  ? -17.738 84.924  19.168  1.00 28.70 ? 517  LEU A N   1 
ATOM   4051  C CA  . LEU A 1 517  ? -17.892 86.364  19.220  1.00 27.36 ? 517  LEU A CA  1 
ATOM   4052  C C   . LEU A 1 517  ? -17.626 86.908  20.599  1.00 27.57 ? 517  LEU A C   1 
ATOM   4053  O O   . LEU A 1 517  ? -17.816 86.207  21.593  1.00 29.14 ? 517  LEU A O   1 
ATOM   4054  C CB  . LEU A 1 517  ? -19.312 86.758  18.800  1.00 27.28 ? 517  LEU A CB  1 
ATOM   4055  C CG  . LEU A 1 517  ? -19.402 87.750  17.638  1.00 28.70 ? 517  LEU A CG  1 
ATOM   4056  C CD1 . LEU A 1 517  ? -19.164 87.007  16.339  1.00 28.55 ? 517  LEU A CD1 1 
ATOM   4057  C CD2 . LEU A 1 517  ? -20.777 88.434  17.612  1.00 31.99 ? 517  LEU A CD2 1 
ATOM   4058  N N   . ARG A 1 518  ? -17.186 88.162  20.654  1.00 26.07 ? 518  ARG A N   1 
ATOM   4059  C CA  . ARG A 1 518  ? -16.924 88.829  21.914  1.00 25.59 ? 518  ARG A CA  1 
ATOM   4060  C C   . ARG A 1 518  ? -17.135 90.318  21.709  1.00 23.85 ? 518  ARG A C   1 
ATOM   4061  O O   . ARG A 1 518  ? -16.533 90.926  20.819  1.00 22.84 ? 518  ARG A O   1 
ATOM   4062  C CB  . ARG A 1 518  ? -15.503 88.557  22.379  1.00 29.74 ? 518  ARG A CB  1 
ATOM   4063  C CG  . ARG A 1 518  ? -15.215 89.112  23.763  1.00 35.58 ? 518  ARG A CG  1 
ATOM   4064  C CD  . ARG A 1 518  ? -13.824 88.720  24.205  1.00 39.61 ? 518  ARG A CD  1 
ATOM   4065  N NE  . ARG A 1 518  ? -13.727 87.280  24.391  1.00 43.39 ? 518  ARG A NE  1 
ATOM   4066  C CZ  . ARG A 1 518  ? -12.585 86.605  24.391  1.00 44.65 ? 518  ARG A CZ  1 
ATOM   4067  N NH1 . ARG A 1 518  ? -11.437 87.250  24.205  1.00 45.49 ? 518  ARG A NH1 1 
ATOM   4068  N NH2 . ARG A 1 518  ? -12.592 85.293  24.592  1.00 43.97 ? 518  ARG A NH2 1 
ATOM   4069  N N   . ASN A 1 519  ? -18.007 90.904  22.521  1.00 20.38 ? 519  ASN A N   1 
ATOM   4070  C CA  . ASN A 1 519  ? -18.295 92.320  22.395  1.00 18.28 ? 519  ASN A CA  1 
ATOM   4071  C C   . ASN A 1 519  ? -17.242 93.203  23.079  1.00 18.00 ? 519  ASN A C   1 
ATOM   4072  O O   . ASN A 1 519  ? -16.510 92.765  23.976  1.00 15.45 ? 519  ASN A O   1 
ATOM   4073  C CB  . ASN A 1 519  ? -19.703 92.613  22.912  1.00 17.99 ? 519  ASN A CB  1 
ATOM   4074  C CG  . ASN A 1 519  ? -20.780 91.794  22.182  1.00 19.60 ? 519  ASN A CG  1 
ATOM   4075  O OD1 . ASN A 1 519  ? -20.733 91.626  20.956  1.00 17.72 ? 519  ASN A OD1 1 
ATOM   4076  N ND2 . ASN A 1 519  ? -21.762 91.294  22.937  1.00 18.36 ? 519  ASN A ND2 1 
ATOM   4077  N N   . GLN A 1 520  ? -17.161 94.452  22.638  1.00 17.40 ? 520  GLN A N   1 
ATOM   4078  C CA  . GLN A 1 520  ? -16.159 95.371  23.163  1.00 17.59 ? 520  GLN A CA  1 
ATOM   4079  C C   . GLN A 1 520  ? -16.708 96.741  23.523  1.00 15.58 ? 520  GLN A C   1 
ATOM   4080  O O   . GLN A 1 520  ? -17.739 97.178  23.013  1.00 14.14 ? 520  GLN A O   1 
ATOM   4081  C CB  . GLN A 1 520  ? -15.060 95.569  22.116  1.00 18.84 ? 520  GLN A CB  1 
ATOM   4082  C CG  . GLN A 1 520  ? -14.511 94.284  21.542  1.00 26.98 ? 520  GLN A CG  1 
ATOM   4083  C CD  . GLN A 1 520  ? -13.114 93.964  22.052  1.00 31.06 ? 520  GLN A CD  1 
ATOM   4084  O OE1 . GLN A 1 520  ? -12.129 94.626  21.684  1.00 33.32 ? 520  GLN A OE1 1 
ATOM   4085  N NE2 . GLN A 1 520  ? -13.018 92.947  22.907  1.00 33.49 ? 520  GLN A NE2 1 
ATOM   4086  N N   . VAL A 1 521  ? -16.002 97.431  24.397  1.00 13.83 ? 521  VAL A N   1 
ATOM   4087  C CA  . VAL A 1 521  ? -16.413 98.767  24.740  1.00 13.71 ? 521  VAL A CA  1 
ATOM   4088  C C   . VAL A 1 521  ? -15.876 99.683  23.634  1.00 15.32 ? 521  VAL A C   1 
ATOM   4089  O O   . VAL A 1 521  ? -14.774 99.473  23.119  1.00 14.43 ? 521  VAL A O   1 
ATOM   4090  C CB  . VAL A 1 521  ? -15.828 99.197  26.091  1.00 13.61 ? 521  VAL A CB  1 
ATOM   4091  C CG1 . VAL A 1 521  ? -16.092 100.689 26.314  1.00 14.63 ? 521  VAL A CG1 1 
ATOM   4092  C CG2 . VAL A 1 521  ? -16.434 98.350  27.216  1.00 7.72  ? 521  VAL A CG2 1 
ATOM   4093  N N   . GLN A 1 522  ? -16.668 100.675 23.244  1.00 16.33 ? 522  GLN A N   1 
ATOM   4094  C CA  . GLN A 1 522  ? -16.250 101.630 22.217  1.00 18.46 ? 522  GLN A CA  1 
ATOM   4095  C C   . GLN A 1 522  ? -15.679 101.027 20.946  1.00 20.08 ? 522  GLN A C   1 
ATOM   4096  O O   . GLN A 1 522  ? -14.844 101.660 20.289  1.00 20.03 ? 522  GLN A O   1 
ATOM   4097  C CB  . GLN A 1 522  ? -15.213 102.587 22.800  1.00 16.31 ? 522  GLN A CB  1 
ATOM   4098  C CG  . GLN A 1 522  ? -15.790 103.596 23.732  1.00 17.18 ? 522  GLN A CG  1 
ATOM   4099  C CD  . GLN A 1 522  ? -14.764 104.150 24.665  1.00 20.06 ? 522  GLN A CD  1 
ATOM   4100  O OE1 . GLN A 1 522  ? -13.671 104.541 24.248  1.00 21.91 ? 522  GLN A OE1 1 
ATOM   4101  N NE2 . GLN A 1 522  ? -15.103 104.199 25.948  1.00 20.94 ? 522  GLN A NE2 1 
ATOM   4102  N N   . ARG A 1 523  ? -16.135 99.830  20.583  1.00 21.16 ? 523  ARG A N   1 
ATOM   4103  C CA  . ARG A 1 523  ? -15.632 99.160  19.385  1.00 21.21 ? 523  ARG A CA  1 
ATOM   4104  C C   . ARG A 1 523  ? -16.601 98.104  18.854  1.00 20.18 ? 523  ARG A C   1 
ATOM   4105  O O   . ARG A 1 523  ? -17.470 97.636  19.580  1.00 21.04 ? 523  ARG A O   1 
ATOM   4106  C CB  . ARG A 1 523  ? -14.274 98.515  19.705  1.00 23.93 ? 523  ARG A CB  1 
ATOM   4107  C CG  . ARG A 1 523  ? -13.667 97.694  18.590  1.00 28.78 ? 523  ARG A CG  1 
ATOM   4108  C CD  . ARG A 1 523  ? -12.266 97.195  18.952  1.00 36.10 ? 523  ARG A CD  1 
ATOM   4109  N NE  . ARG A 1 523  ? -11.602 96.543  17.819  1.00 40.02 ? 523  ARG A NE  1 
ATOM   4110  C CZ  . ARG A 1 523  ? -11.951 95.355  17.329  1.00 42.08 ? 523  ARG A CZ  1 
ATOM   4111  N NH1 . ARG A 1 523  ? -12.954 94.676  17.876  1.00 43.28 ? 523  ARG A NH1 1 
ATOM   4112  N NH2 . ARG A 1 523  ? -11.310 94.856  16.280  1.00 42.68 ? 523  ARG A NH2 1 
ATOM   4113  N N   . ARG A 1 524  ? -16.451 97.741  17.584  1.00 19.68 ? 524  ARG A N   1 
ATOM   4114  C CA  . ARG A 1 524  ? -17.293 96.728  16.966  1.00 20.75 ? 524  ARG A CA  1 
ATOM   4115  C C   . ARG A 1 524  ? -16.921 95.380  17.584  1.00 20.79 ? 524  ARG A C   1 
ATOM   4116  O O   . ARG A 1 524  ? -15.869 95.251  18.203  1.00 20.80 ? 524  ARG A O   1 
ATOM   4117  C CB  . ARG A 1 524  ? -17.039 96.693  15.463  1.00 22.88 ? 524  ARG A CB  1 
ATOM   4118  C CG  . ARG A 1 524  ? -15.610 96.304  15.113  1.00 26.58 ? 524  ARG A CG  1 
ATOM   4119  C CD  . ARG A 1 524  ? -15.315 96.538  13.642  1.00 30.14 ? 524  ARG A CD  1 
ATOM   4120  N NE  . ARG A 1 524  ? -13.932 96.224  13.278  1.00 33.06 ? 524  ARG A NE  1 
ATOM   4121  C CZ  . ARG A 1 524  ? -12.852 96.809  13.799  1.00 34.78 ? 524  ARG A CZ  1 
ATOM   4122  N NH1 . ARG A 1 524  ? -12.965 97.756  14.726  1.00 34.36 ? 524  ARG A NH1 1 
ATOM   4123  N NH2 . ARG A 1 524  ? -11.648 96.443  13.385  1.00 35.66 ? 524  ARG A NH2 1 
ATOM   4124  N N   . PRO A 1 525  ? -17.779 94.360  17.434  1.00 20.85 ? 525  PRO A N   1 
ATOM   4125  C CA  . PRO A 1 525  ? -17.476 93.040  18.005  1.00 23.10 ? 525  PRO A CA  1 
ATOM   4126  C C   . PRO A 1 525  ? -16.251 92.354  17.395  1.00 25.76 ? 525  PRO A C   1 
ATOM   4127  O O   . PRO A 1 525  ? -15.967 92.491  16.208  1.00 25.20 ? 525  PRO A O   1 
ATOM   4128  C CB  . PRO A 1 525  ? -18.755 92.249  17.742  1.00 19.77 ? 525  PRO A CB  1 
ATOM   4129  C CG  . PRO A 1 525  ? -19.802 93.301  17.781  1.00 19.39 ? 525  PRO A CG  1 
ATOM   4130  C CD  . PRO A 1 525  ? -19.173 94.411  16.972  1.00 19.64 ? 525  PRO A CD  1 
ATOM   4131  N N   . ARG A 1 526  ? -15.538 91.606  18.228  1.00 30.08 ? 526  ARG A N   1 
ATOM   4132  C CA  . ARG A 1 526  ? -14.349 90.868  17.814  1.00 32.15 ? 526  ARG A CA  1 
ATOM   4133  C C   . ARG A 1 526  ? -14.778 89.437  17.468  1.00 32.51 ? 526  ARG A C   1 
ATOM   4134  O O   . ARG A 1 526  ? -15.431 88.761  18.269  1.00 30.92 ? 526  ARG A O   1 
ATOM   4135  C CB  . ARG A 1 526  ? -13.337 90.850  18.963  1.00 35.35 ? 526  ARG A CB  1 
ATOM   4136  C CG  . ARG A 1 526  ? -11.894 90.656  18.542  1.00 41.68 ? 526  ARG A CG  1 
ATOM   4137  C CD  . ARG A 1 526  ? -10.976 91.651  19.275  1.00 45.72 ? 526  ARG A CD  1 
ATOM   4138  N NE  . ARG A 1 526  ? -9.630  91.700  18.697  1.00 48.91 ? 526  ARG A NE  1 
ATOM   4139  C CZ  . ARG A 1 526  ? -8.711  92.613  19.006  1.00 49.88 ? 526  ARG A CZ  1 
ATOM   4140  N NH1 . ARG A 1 526  ? -8.984  93.564  19.893  1.00 50.38 ? 526  ARG A NH1 1 
ATOM   4141  N NH2 . ARG A 1 526  ? -7.518  92.575  18.427  1.00 50.15 ? 526  ARG A NH2 1 
ATOM   4142  N N   . SER A 1 527  ? -14.423 88.986  16.270  1.00 33.63 ? 527  SER A N   1 
ATOM   4143  C CA  . SER A 1 527  ? -14.776 87.642  15.828  1.00 34.88 ? 527  SER A CA  1 
ATOM   4144  C C   . SER A 1 527  ? -13.754 86.633  16.337  1.00 34.99 ? 527  SER A C   1 
ATOM   4145  O O   . SER A 1 527  ? -12.559 86.929  16.407  1.00 35.32 ? 527  SER A O   1 
ATOM   4146  C CB  . SER A 1 527  ? -14.828 87.594  14.308  1.00 35.75 ? 527  SER A CB  1 
ATOM   4147  O OG  . SER A 1 527  ? -15.531 88.710  13.795  1.00 39.81 ? 527  SER A OG  1 
ATOM   4148  N N   . ILE A 1 528  ? -14.224 85.442  16.692  1.00 34.76 ? 528  ILE A N   1 
ATOM   4149  C CA  . ILE A 1 528  ? -13.340 84.398  17.202  1.00 35.10 ? 528  ILE A CA  1 
ATOM   4150  C C   . ILE A 1 528  ? -13.332 83.163  16.300  1.00 34.92 ? 528  ILE A C   1 
ATOM   4151  O O   . ILE A 1 528  ? -14.248 82.351  16.349  1.00 33.51 ? 528  ILE A O   1 
ATOM   4152  C CB  . ILE A 1 528  ? -13.759 83.985  18.627  1.00 35.10 ? 528  ILE A CB  1 
ATOM   4153  C CG1 . ILE A 1 528  ? -13.709 85.212  19.540  1.00 35.48 ? 528  ILE A CG1 1 
ATOM   4154  C CG2 . ILE A 1 528  ? -12.837 82.885  19.150  1.00 33.52 ? 528  ILE A CG2 1 
ATOM   4155  C CD1 . ILE A 1 528  ? -14.135 84.953  20.967  1.00 37.80 ? 528  ILE A CD1 1 
ATOM   4156  N N   . MET A 1 529  ? -12.297 83.028  15.474  1.00 35.04 ? 529  MET A N   1 
ATOM   4157  C CA  . MET A 1 529  ? -12.202 81.884  14.574  1.00 34.99 ? 529  MET A CA  1 
ATOM   4158  C C   . MET A 1 529  ? -11.142 80.915  15.081  1.00 32.37 ? 529  MET A C   1 
ATOM   4159  O O   . MET A 1 529  ? -9.966  81.036  14.748  1.00 32.62 ? 529  MET A O   1 
ATOM   4160  C CB  . MET A 1 529  ? -11.855 82.352  13.157  1.00 39.10 ? 529  MET A CB  1 
ATOM   4161  C CG  . MET A 1 529  ? -12.763 83.453  12.605  1.00 44.26 ? 529  MET A CG  1 
ATOM   4162  S SD  . MET A 1 529  ? -14.572 83.108  12.611  1.00 50.76 ? 529  MET A SD  1 
ATOM   4163  C CE  . MET A 1 529  ? -14.615 81.297  12.703  1.00 49.76 ? 529  MET A CE  1 
ATOM   4164  N N   . PRO A 1 530  ? -11.553 79.931  15.893  1.00 29.65 ? 530  PRO A N   1 
ATOM   4165  C CA  . PRO A 1 530  ? -10.707 78.901  16.500  1.00 26.59 ? 530  PRO A CA  1 
ATOM   4166  C C   . PRO A 1 530  ? -10.476 77.664  15.633  1.00 25.54 ? 530  PRO A C   1 
ATOM   4167  O O   . PRO A 1 530  ? -11.399 76.882  15.376  1.00 25.39 ? 530  PRO A O   1 
ATOM   4168  C CB  . PRO A 1 530  ? -11.458 78.542  17.785  1.00 26.86 ? 530  PRO A CB  1 
ATOM   4169  C CG  . PRO A 1 530  ? -12.844 79.228  17.662  1.00 28.22 ? 530  PRO A CG  1 
ATOM   4170  C CD  . PRO A 1 530  ? -12.960 79.701  16.243  1.00 29.01 ? 530  PRO A CD  1 
ATOM   4171  N N   . LEU A 1 531  ? -9.234  77.480  15.204  1.00 23.02 ? 531  LEU A N   1 
ATOM   4172  C CA  . LEU A 1 531  ? -8.866  76.335  14.380  1.00 20.47 ? 531  LEU A CA  1 
ATOM   4173  C C   . LEU A 1 531  ? -8.960  75.020  15.159  1.00 18.58 ? 531  LEU A C   1 
ATOM   4174  O O   . LEU A 1 531  ? -9.032  75.023  16.393  1.00 17.62 ? 531  LEU A O   1 
ATOM   4175  C CB  . LEU A 1 531  ? -7.444  76.532  13.856  1.00 21.32 ? 531  LEU A CB  1 
ATOM   4176  C CG  . LEU A 1 531  ? -7.252  77.826  13.069  1.00 21.71 ? 531  LEU A CG  1 
ATOM   4177  C CD1 . LEU A 1 531  ? -5.838  77.897  12.524  1.00 22.20 ? 531  LEU A CD1 1 
ATOM   4178  C CD2 . LEU A 1 531  ? -8.267  77.864  11.939  1.00 21.74 ? 531  LEU A CD2 1 
ATOM   4179  N N   . ASN A 1 532  ? -8.974  73.896  14.445  1.00 16.85 ? 532  ASN A N   1 
ATOM   4180  C CA  . ASN A 1 532  ? -9.038  72.604  15.125  1.00 16.24 ? 532  ASN A CA  1 
ATOM   4181  C C   . ASN A 1 532  ? -7.633  72.064  15.410  1.00 15.45 ? 532  ASN A C   1 
ATOM   4182  O O   . ASN A 1 532  ? -6.632  72.573  14.889  1.00 12.60 ? 532  ASN A O   1 
ATOM   4183  C CB  . ASN A 1 532  ? -9.843  71.579  14.311  1.00 15.22 ? 532  ASN A CB  1 
ATOM   4184  C CG  . ASN A 1 532  ? -9.266  71.332  12.929  1.00 15.93 ? 532  ASN A CG  1 
ATOM   4185  O OD1 . ASN A 1 532  ? -8.071  71.047  12.771  1.00 16.51 ? 532  ASN A OD1 1 
ATOM   4186  N ND2 . ASN A 1 532  ? -10.121 71.420  11.914  1.00 15.13 ? 532  ASN A ND2 1 
ATOM   4187  N N   . VAL A 1 533  ? -7.566  71.024  16.233  1.00 15.03 ? 533  VAL A N   1 
ATOM   4188  C CA  . VAL A 1 533  ? -6.282  70.446  16.594  1.00 14.66 ? 533  VAL A CA  1 
ATOM   4189  C C   . VAL A 1 533  ? -5.383  70.126  15.388  1.00 15.46 ? 533  VAL A C   1 
ATOM   4190  O O   . VAL A 1 533  ? -4.219  70.536  15.361  1.00 15.76 ? 533  VAL A O   1 
ATOM   4191  C CB  . VAL A 1 533  ? -6.481  69.186  17.463  1.00 15.08 ? 533  VAL A CB  1 
ATOM   4192  C CG1 . VAL A 1 533  ? -5.125  68.627  17.899  1.00 14.75 ? 533  VAL A CG1 1 
ATOM   4193  C CG2 . VAL A 1 533  ? -7.331  69.530  18.691  1.00 15.18 ? 533  VAL A CG2 1 
ATOM   4194  N N   . PRO A 1 534  ? -5.896  69.390  14.377  1.00 14.85 ? 534  PRO A N   1 
ATOM   4195  C CA  . PRO A 1 534  ? -5.023  69.091  13.227  1.00 15.08 ? 534  PRO A CA  1 
ATOM   4196  C C   . PRO A 1 534  ? -4.528  70.362  12.530  1.00 16.72 ? 534  PRO A C   1 
ATOM   4197  O O   . PRO A 1 534  ? -3.400  70.406  12.043  1.00 19.65 ? 534  PRO A O   1 
ATOM   4198  C CB  . PRO A 1 534  ? -5.914  68.235  12.321  1.00 13.31 ? 534  PRO A CB  1 
ATOM   4199  C CG  . PRO A 1 534  ? -6.822  67.557  13.293  1.00 13.23 ? 534  PRO A CG  1 
ATOM   4200  C CD  . PRO A 1 534  ? -7.171  68.663  14.267  1.00 11.35 ? 534  PRO A CD  1 
ATOM   4201  N N   . GLN A 1 535  ? -5.370  71.390  12.475  1.00 17.09 ? 535  GLN A N   1 
ATOM   4202  C CA  . GLN A 1 535  ? -4.979  72.653  11.847  1.00 18.97 ? 535  GLN A CA  1 
ATOM   4203  C C   . GLN A 1 535  ? -3.885  73.345  12.668  1.00 19.03 ? 535  GLN A C   1 
ATOM   4204  O O   . GLN A 1 535  ? -2.880  73.811  12.128  1.00 21.14 ? 535  GLN A O   1 
ATOM   4205  C CB  . GLN A 1 535  ? -6.187  73.582  11.720  1.00 19.38 ? 535  GLN A CB  1 
ATOM   4206  C CG  . GLN A 1 535  ? -7.278  73.032  10.838  1.00 21.35 ? 535  GLN A CG  1 
ATOM   4207  C CD  . GLN A 1 535  ? -8.463  73.957  10.725  1.00 22.67 ? 535  GLN A CD  1 
ATOM   4208  O OE1 . GLN A 1 535  ? -9.021  74.397  11.731  1.00 26.31 ? 535  GLN A OE1 1 
ATOM   4209  N NE2 . GLN A 1 535  ? -8.863  74.257  9.496   1.00 23.08 ? 535  GLN A NE2 1 
ATOM   4210  N N   . GLN A 1 536  ? -4.078  73.410  13.978  1.00 17.92 ? 536  GLN A N   1 
ATOM   4211  C CA  . GLN A 1 536  ? -3.091  74.041  14.836  1.00 17.43 ? 536  GLN A CA  1 
ATOM   4212  C C   . GLN A 1 536  ? -1.764  73.308  14.724  1.00 17.34 ? 536  GLN A C   1 
ATOM   4213  O O   . GLN A 1 536  ? -0.708  73.930  14.604  1.00 17.55 ? 536  GLN A O   1 
ATOM   4214  C CB  . GLN A 1 536  ? -3.565  74.043  16.287  1.00 15.42 ? 536  GLN A CB  1 
ATOM   4215  C CG  . GLN A 1 536  ? -4.816  74.866  16.550  1.00 16.44 ? 536  GLN A CG  1 
ATOM   4216  C CD  . GLN A 1 536  ? -4.537  76.362  16.655  1.00 21.75 ? 536  GLN A CD  1 
ATOM   4217  O OE1 . GLN A 1 536  ? -5.163  77.062  17.468  1.00 22.95 ? 536  GLN A OE1 1 
ATOM   4218  N NE2 . GLN A 1 536  ? -3.611  76.867  15.827  1.00 18.85 ? 536  GLN A NE2 1 
ATOM   4219  N N   . GLN A 1 537  ? -1.823  71.982  14.747  1.00 17.24 ? 537  GLN A N   1 
ATOM   4220  C CA  . GLN A 1 537  ? -0.611  71.171  14.664  1.00 17.28 ? 537  GLN A CA  1 
ATOM   4221  C C   . GLN A 1 537  ? 0.216   71.585  13.453  1.00 16.86 ? 537  GLN A C   1 
ATOM   4222  O O   . GLN A 1 537  ? 1.418   71.875  13.552  1.00 15.59 ? 537  GLN A O   1 
ATOM   4223  C CB  . GLN A 1 537  ? -0.974  69.680  14.566  1.00 15.70 ? 537  GLN A CB  1 
ATOM   4224  C CG  . GLN A 1 537  ? 0.190   68.768  14.176  1.00 16.13 ? 537  GLN A CG  1 
ATOM   4225  C CD  . GLN A 1 537  ? -0.186  67.293  14.201  1.00 16.29 ? 537  GLN A CD  1 
ATOM   4226  O OE1 . GLN A 1 537  ? -1.265  66.909  13.761  1.00 17.98 ? 537  GLN A OE1 1 
ATOM   4227  N NE2 . GLN A 1 537  ? 0.712   66.460  14.709  1.00 16.13 ? 537  GLN A NE2 1 
ATOM   4228  N N   . VAL A 1 538  ? -0.459  71.631  12.314  1.00 16.25 ? 538  VAL A N   1 
ATOM   4229  C CA  . VAL A 1 538  ? 0.165   71.967  11.052  1.00 15.82 ? 538  VAL A CA  1 
ATOM   4230  C C   . VAL A 1 538  ? 0.649   73.423  10.985  1.00 16.85 ? 538  VAL A C   1 
ATOM   4231  O O   . VAL A 1 538  ? 1.511   73.755  10.169  1.00 15.66 ? 538  VAL A O   1 
ATOM   4232  C CB  . VAL A 1 538  ? -0.823  71.627  9.910   1.00 15.41 ? 538  VAL A CB  1 
ATOM   4233  C CG1 . VAL A 1 538  ? -1.124  72.831  9.091   1.00 15.04 ? 538  VAL A CG1 1 
ATOM   4234  C CG2 . VAL A 1 538  ? -0.264  70.492  9.072   1.00 16.83 ? 538  VAL A CG2 1 
ATOM   4235  N N   . SER A 1 539  ? 0.114   74.277  11.861  1.00 15.91 ? 539  SER A N   1 
ATOM   4236  C CA  . SER A 1 539  ? 0.497   75.692  11.907  1.00 15.64 ? 539  SER A CA  1 
ATOM   4237  C C   . SER A 1 539  ? 1.816   75.958  12.657  1.00 15.00 ? 539  SER A C   1 
ATOM   4238  O O   . SER A 1 539  ? 2.347   77.072  12.616  1.00 15.20 ? 539  SER A O   1 
ATOM   4239  C CB  . SER A 1 539  ? -0.614  76.512  12.583  1.00 16.82 ? 539  SER A CB  1 
ATOM   4240  O OG  . SER A 1 539  ? -1.864  76.366  11.919  1.00 21.28 ? 539  SER A OG  1 
ATOM   4241  N N   . ALA A 1 540  ? 2.345   74.941  13.329  1.00 12.14 ? 540  ALA A N   1 
ATOM   4242  C CA  . ALA A 1 540  ? 3.561   75.095  14.118  1.00 13.27 ? 540  ALA A CA  1 
ATOM   4243  C C   . ALA A 1 540  ? 4.742   75.810  13.461  1.00 14.28 ? 540  ALA A C   1 
ATOM   4244  O O   . ALA A 1 540  ? 5.359   76.693  14.072  1.00 13.70 ? 540  ALA A O   1 
ATOM   4245  C CB  . ALA A 1 540  ? 4.017   73.733  14.646  1.00 14.11 ? 540  ALA A CB  1 
ATOM   4246  N N   . PRO A 1 541  ? 5.084   75.433  12.220  1.00 13.38 ? 541  PRO A N   1 
ATOM   4247  C CA  . PRO A 1 541  ? 6.213   76.068  11.527  1.00 14.93 ? 541  PRO A CA  1 
ATOM   4248  C C   . PRO A 1 541  ? 6.050   77.581  11.379  1.00 14.04 ? 541  PRO A C   1 
ATOM   4249  O O   . PRO A 1 541  ? 6.982   78.346  11.575  1.00 14.64 ? 541  PRO A O   1 
ATOM   4250  C CB  . PRO A 1 541  ? 6.239   75.339  10.177  1.00 15.72 ? 541  PRO A CB  1 
ATOM   4251  C CG  . PRO A 1 541  ? 5.686   73.983  10.525  1.00 14.63 ? 541  PRO A CG  1 
ATOM   4252  C CD  . PRO A 1 541  ? 4.526   74.330  11.420  1.00 11.66 ? 541  PRO A CD  1 
ATOM   4253  N N   . HIS A 1 542  ? 4.844   77.987  11.028  1.00 14.22 ? 542  HIS A N   1 
ATOM   4254  C CA  . HIS A 1 542  ? 4.489   79.380  10.851  1.00 13.41 ? 542  HIS A CA  1 
ATOM   4255  C C   . HIS A 1 542  ? 4.700   80.088  12.199  1.00 12.83 ? 542  HIS A C   1 
ATOM   4256  O O   . HIS A 1 542  ? 5.408   81.102  12.302  1.00 12.32 ? 542  HIS A O   1 
ATOM   4257  C CB  . HIS A 1 542  ? 3.016   79.440  10.417  1.00 13.56 ? 542  HIS A CB  1 
ATOM   4258  C CG  . HIS A 1 542  ? 2.567   80.778  9.930   1.00 13.99 ? 542  HIS A CG  1 
ATOM   4259  N ND1 . HIS A 1 542  ? 1.332   80.973  9.342   1.00 16.08 ? 542  HIS A ND1 1 
ATOM   4260  C CD2 . HIS A 1 542  ? 3.195   81.976  9.887   1.00 13.49 ? 542  HIS A CD2 1 
ATOM   4261  C CE1 . HIS A 1 542  ? 1.226   82.230  8.952   1.00 15.54 ? 542  HIS A CE1 1 
ATOM   4262  N NE2 . HIS A 1 542  ? 2.345   82.860  9.269   1.00 14.15 ? 542  HIS A NE2 1 
ATOM   4263  N N   . THR A 1 543  ? 4.101   79.525  13.235  1.00 12.24 ? 543  THR A N   1 
ATOM   4264  C CA  . THR A 1 543  ? 4.195   80.083  14.572  1.00 13.12 ? 543  THR A CA  1 
ATOM   4265  C C   . THR A 1 543  ? 5.626   80.156  15.125  1.00 13.15 ? 543  THR A C   1 
ATOM   4266  O O   . THR A 1 543  ? 6.041   81.185  15.671  1.00 11.61 ? 543  THR A O   1 
ATOM   4267  C CB  . THR A 1 543  ? 3.332   79.258  15.541  1.00 14.85 ? 543  THR A CB  1 
ATOM   4268  O OG1 . THR A 1 543  ? 1.989   79.193  15.045  1.00 15.05 ? 543  THR A OG1 1 
ATOM   4269  C CG2 . THR A 1 543  ? 3.344   79.884  16.931  1.00 13.17 ? 543  THR A CG2 1 
ATOM   4270  N N   . LEU A 1 544  ? 6.368   79.062  14.984  1.00 12.25 ? 544  LEU A N   1 
ATOM   4271  C CA  . LEU A 1 544  ? 7.735   78.987  15.489  1.00 13.50 ? 544  LEU A CA  1 
ATOM   4272  C C   . LEU A 1 544  ? 8.648   80.007  14.846  1.00 13.80 ? 544  LEU A C   1 
ATOM   4273  O O   . LEU A 1 544  ? 9.413   80.679  15.538  1.00 14.10 ? 544  LEU A O   1 
ATOM   4274  C CB  . LEU A 1 544  ? 8.310   77.574  15.290  1.00 13.14 ? 544  LEU A CB  1 
ATOM   4275  C CG  . LEU A 1 544  ? 7.767   76.523  16.272  1.00 13.88 ? 544  LEU A CG  1 
ATOM   4276  C CD1 . LEU A 1 544  ? 8.210   75.133  15.837  1.00 12.31 ? 544  LEU A CD1 1 
ATOM   4277  C CD2 . LEU A 1 544  ? 8.242   76.841  17.693  1.00 9.16  ? 544  LEU A CD2 1 
ATOM   4278  N N   . THR A 1 545  ? 8.569   80.123  13.525  1.00 13.87 ? 545  THR A N   1 
ATOM   4279  C CA  . THR A 1 545  ? 9.401   81.081  12.817  1.00 14.85 ? 545  THR A CA  1 
ATOM   4280  C C   . THR A 1 545  ? 9.035   82.495  13.270  1.00 15.07 ? 545  THR A C   1 
ATOM   4281  O O   . THR A 1 545  ? 9.905   83.358  13.424  1.00 15.26 ? 545  THR A O   1 
ATOM   4282  C CB  . THR A 1 545  ? 9.230   80.964  11.283  1.00 14.17 ? 545  THR A CB  1 
ATOM   4283  O OG1 . THR A 1 545  ? 9.390   79.594  10.876  1.00 15.69 ? 545  THR A OG1 1 
ATOM   4284  C CG2 . THR A 1 545  ? 10.288  81.787  10.586  1.00 12.08 ? 545  THR A CG2 1 
ATOM   4285  N N   . ALA A 1 546  ? 7.746   82.725  13.498  1.00 15.43 ? 546  ALA A N   1 
ATOM   4286  C CA  . ALA A 1 546  ? 7.280   84.033  13.949  1.00 14.66 ? 546  ALA A CA  1 
ATOM   4287  C C   . ALA A 1 546  ? 7.875   84.352  15.326  1.00 13.82 ? 546  ALA A C   1 
ATOM   4288  O O   . ALA A 1 546  ? 8.376   85.446  15.549  1.00 14.35 ? 546  ALA A O   1 
ATOM   4289  C CB  . ALA A 1 546  ? 5.746   84.060  14.002  1.00 12.62 ? 546  ALA A CB  1 
ATOM   4290  N N   . ASP A 1 547  ? 7.831   83.394  16.245  1.00 14.27 ? 547  ASP A N   1 
ATOM   4291  C CA  . ASP A 1 547  ? 8.397   83.618  17.574  1.00 14.83 ? 547  ASP A CA  1 
ATOM   4292  C C   . ASP A 1 547  ? 9.885   83.939  17.490  1.00 14.41 ? 547  ASP A C   1 
ATOM   4293  O O   . ASP A 1 547  ? 10.389  84.822  18.196  1.00 14.73 ? 547  ASP A O   1 
ATOM   4294  C CB  . ASP A 1 547  ? 8.213   82.383  18.466  1.00 14.48 ? 547  ASP A CB  1 
ATOM   4295  C CG  . ASP A 1 547  ? 6.765   82.164  18.877  1.00 14.07 ? 547  ASP A CG  1 
ATOM   4296  O OD1 . ASP A 1 547  ? 5.939   83.100  18.739  1.00 13.92 ? 547  ASP A OD1 1 
ATOM   4297  O OD2 . ASP A 1 547  ? 6.461   81.049  19.351  1.00 15.37 ? 547  ASP A OD2 1 
ATOM   4298  N N   . TYR A 1 548  ? 10.586  83.210  16.629  1.00 14.62 ? 548  TYR A N   1 
ATOM   4299  C CA  . TYR A 1 548  ? 12.017  83.412  16.457  1.00 14.69 ? 548  TYR A CA  1 
ATOM   4300  C C   . TYR A 1 548  ? 12.309  84.860  16.054  1.00 15.22 ? 548  TYR A C   1 
ATOM   4301  O O   . TYR A 1 548  ? 13.233  85.495  16.583  1.00 14.90 ? 548  TYR A O   1 
ATOM   4302  C CB  . TYR A 1 548  ? 12.579  82.469  15.388  1.00 13.57 ? 548  TYR A CB  1 
ATOM   4303  C CG  . TYR A 1 548  ? 14.083  82.495  15.370  1.00 14.68 ? 548  TYR A CG  1 
ATOM   4304  C CD1 . TYR A 1 548  ? 14.816  81.633  16.179  1.00 14.46 ? 548  TYR A CD1 1 
ATOM   4305  C CD2 . TYR A 1 548  ? 14.778  83.461  14.634  1.00 15.38 ? 548  TYR A CD2 1 
ATOM   4306  C CE1 . TYR A 1 548  ? 16.202  81.730  16.266  1.00 15.48 ? 548  TYR A CE1 1 
ATOM   4307  C CE2 . TYR A 1 548  ? 16.168  83.571  14.716  1.00 16.35 ? 548  TYR A CE2 1 
ATOM   4308  C CZ  . TYR A 1 548  ? 16.870  82.699  15.536  1.00 16.36 ? 548  TYR A CZ  1 
ATOM   4309  O OH  . TYR A 1 548  ? 18.236  82.793  15.639  1.00 17.03 ? 548  TYR A OH  1 
ATOM   4310  N N   . ILE A 1 549  ? 11.516  85.367  15.113  1.00 12.20 ? 549  ILE A N   1 
ATOM   4311  C CA  . ILE A 1 549  ? 11.664  86.723  14.636  1.00 10.77 ? 549  ILE A CA  1 
ATOM   4312  C C   . ILE A 1 549  ? 11.407  87.700  15.774  1.00 13.51 ? 549  ILE A C   1 
ATOM   4313  O O   . ILE A 1 549  ? 12.178  88.647  15.968  1.00 13.88 ? 549  ILE A O   1 
ATOM   4314  C CB  . ILE A 1 549  ? 10.678  87.004  13.472  1.00 11.05 ? 549  ILE A CB  1 
ATOM   4315  C CG1 . ILE A 1 549  ? 11.091  86.193  12.240  1.00 11.75 ? 549  ILE A CG1 1 
ATOM   4316  C CG2 . ILE A 1 549  ? 10.660  88.482  13.139  1.00 7.35  ? 549  ILE A CG2 1 
ATOM   4317  C CD1 . ILE A 1 549  ? 10.136  86.286  11.087  1.00 12.12 ? 549  ILE A CD1 1 
ATOM   4318  N N   . ASN A 1 550  ? 10.335  87.467  16.533  1.00 13.46 ? 550  ASN A N   1 
ATOM   4319  C CA  . ASN A 1 550  ? 9.987   88.353  17.638  1.00 16.06 ? 550  ASN A CA  1 
ATOM   4320  C C   . ASN A 1 550  ? 10.946  88.244  18.807  1.00 18.20 ? 550  ASN A C   1 
ATOM   4321  O O   . ASN A 1 550  ? 11.021  89.150  19.650  1.00 18.68 ? 550  ASN A O   1 
ATOM   4322  C CB  . ASN A 1 550  ? 8.567   88.084  18.148  1.00 14.60 ? 550  ASN A CB  1 
ATOM   4323  C CG  . ASN A 1 550  ? 7.522   88.295  17.089  1.00 14.94 ? 550  ASN A CG  1 
ATOM   4324  O OD1 . ASN A 1 550  ? 7.580   89.266  16.325  1.00 14.46 ? 550  ASN A OD1 1 
ATOM   4325  N ND2 . ASN A 1 550  ? 6.545   87.387  17.035  1.00 12.44 ? 550  ASN A ND2 1 
ATOM   4326  N N   . TYR A 1 551  ? 11.671  87.137  18.879  1.00 20.30 ? 551  TYR A N   1 
ATOM   4327  C CA  . TYR A 1 551  ? 12.611  86.981  19.968  1.00 24.47 ? 551  TYR A CA  1 
ATOM   4328  C C   . TYR A 1 551  ? 14.004  87.506  19.620  1.00 23.99 ? 551  TYR A C   1 
ATOM   4329  O O   . TYR A 1 551  ? 14.661  88.111  20.455  1.00 23.54 ? 551  TYR A O   1 
ATOM   4330  C CB  . TYR A 1 551  ? 12.725  85.515  20.390  1.00 26.82 ? 551  TYR A CB  1 
ATOM   4331  C CG  . TYR A 1 551  ? 13.523  85.341  21.667  1.00 33.20 ? 551  TYR A CG  1 
ATOM   4332  C CD1 . TYR A 1 551  ? 12.900  85.410  22.920  1.00 36.82 ? 551  TYR A CD1 1 
ATOM   4333  C CD2 . TYR A 1 551  ? 14.909  85.157  21.633  1.00 34.68 ? 551  TYR A CD2 1 
ATOM   4334  C CE1 . TYR A 1 551  ? 13.643  85.296  24.111  1.00 37.57 ? 551  TYR A CE1 1 
ATOM   4335  C CE2 . TYR A 1 551  ? 15.655  85.043  22.814  1.00 35.87 ? 551  TYR A CE2 1 
ATOM   4336  C CZ  . TYR A 1 551  ? 15.016  85.109  24.047  1.00 36.75 ? 551  TYR A CZ  1 
ATOM   4337  O OH  . TYR A 1 551  ? 15.737  84.943  25.212  1.00 36.17 ? 551  TYR A OH  1 
ATOM   4338  N N   . HIS A 1 552  ? 14.442  87.294  18.386  1.00 25.13 ? 552  HIS A N   1 
ATOM   4339  C CA  . HIS A 1 552  ? 15.790  87.705  17.984  1.00 25.92 ? 552  HIS A CA  1 
ATOM   4340  C C   . HIS A 1 552  ? 15.905  88.879  17.021  1.00 25.91 ? 552  HIS A C   1 
ATOM   4341  O O   . HIS A 1 552  ? 16.923  89.571  17.006  1.00 25.73 ? 552  HIS A O   1 
ATOM   4342  C CB  . HIS A 1 552  ? 16.513  86.524  17.335  1.00 26.20 ? 552  HIS A CB  1 
ATOM   4343  C CG  . HIS A 1 552  ? 16.565  85.293  18.184  1.00 28.29 ? 552  HIS A CG  1 
ATOM   4344  N ND1 . HIS A 1 552  ? 17.640  84.993  18.994  1.00 27.65 ? 552  HIS A ND1 1 
ATOM   4345  C CD2 . HIS A 1 552  ? 15.678  84.283  18.346  1.00 28.32 ? 552  HIS A CD2 1 
ATOM   4346  C CE1 . HIS A 1 552  ? 17.412  83.851  19.617  1.00 28.87 ? 552  HIS A CE1 1 
ATOM   4347  N NE2 . HIS A 1 552  ? 16.228  83.400  19.242  1.00 30.25 ? 552  HIS A NE2 1 
ATOM   4348  N N   . MET A 1 553  ? 14.868  89.122  16.231  1.00 25.43 ? 553  MET A N   1 
ATOM   4349  C CA  . MET A 1 553  ? 14.964  90.164  15.224  1.00 24.07 ? 553  MET A CA  1 
ATOM   4350  C C   . MET A 1 553  ? 14.274  91.493  15.414  1.00 23.10 ? 553  MET A C   1 
ATOM   4351  O O   . MET A 1 553  ? 14.603  92.442  14.707  1.00 22.68 ? 553  MET A O   1 
ATOM   4352  C CB  . MET A 1 553  ? 14.570  89.564  13.872  1.00 22.67 ? 553  MET A CB  1 
ATOM   4353  C CG  . MET A 1 553  ? 15.473  88.406  13.491  1.00 22.35 ? 553  MET A CG  1 
ATOM   4354  S SD  . MET A 1 553  ? 14.934  87.521  12.019  1.00 26.11 ? 553  MET A SD  1 
ATOM   4355  C CE  . MET A 1 553  ? 16.066  86.110  12.046  1.00 24.75 ? 553  MET A CE  1 
ATOM   4356  N N   . ASN A 1 554  ? 13.322  91.585  16.339  1.00 23.33 ? 554  ASN A N   1 
ATOM   4357  C CA  . ASN A 1 554  ? 12.643  92.865  16.552  1.00 21.63 ? 554  ASN A CA  1 
ATOM   4358  C C   . ASN A 1 554  ? 12.420  93.237  18.001  1.00 20.85 ? 554  ASN A C   1 
ATOM   4359  O O   . ASN A 1 554  ? 12.745  92.494  18.926  1.00 22.21 ? 554  ASN A O   1 
ATOM   4360  C CB  . ASN A 1 554  ? 11.288  92.926  15.826  1.00 19.75 ? 554  ASN A CB  1 
ATOM   4361  C CG  . ASN A 1 554  ? 10.246  91.994  16.429  1.00 19.94 ? 554  ASN A CG  1 
ATOM   4362  O OD1 . ASN A 1 554  ? 10.195  91.800  17.640  1.00 19.11 ? 554  ASN A OD1 1 
ATOM   4363  N ND2 . ASN A 1 554  ? 9.393   91.429  15.577  1.00 19.35 ? 554  ASN A ND2 1 
ATOM   4364  N N   . LEU A 1 555  ? 11.838  94.411  18.168  1.00 20.06 ? 555  LEU A N   1 
ATOM   4365  C CA  . LEU A 1 555  ? 11.523  94.966  19.461  1.00 20.10 ? 555  LEU A CA  1 
ATOM   4366  C C   . LEU A 1 555  ? 10.007  94.809  19.642  1.00 19.94 ? 555  LEU A C   1 
ATOM   4367  O O   . LEU A 1 555  ? 9.240   95.676  19.230  1.00 22.93 ? 555  LEU A O   1 
ATOM   4368  C CB  . LEU A 1 555  ? 11.943  96.435  19.449  1.00 19.24 ? 555  LEU A CB  1 
ATOM   4369  C CG  . LEU A 1 555  ? 11.865  97.277  20.716  1.00 20.99 ? 555  LEU A CG  1 
ATOM   4370  C CD1 . LEU A 1 555  ? 12.480  96.513  21.881  1.00 19.78 ? 555  LEU A CD1 1 
ATOM   4371  C CD2 . LEU A 1 555  ? 12.594  98.604  20.473  1.00 17.58 ? 555  LEU A CD2 1 
ATOM   4372  N N   . SER A 1 556  ? 9.575   93.706  20.250  1.00 20.17 ? 556  SER A N   1 
ATOM   4373  C CA  . SER A 1 556  ? 8.140   93.443  20.442  1.00 22.02 ? 556  SER A CA  1 
ATOM   4374  C C   . SER A 1 556  ? 7.751   93.002  21.854  1.00 22.50 ? 556  SER A C   1 
ATOM   4375  O O   . SER A 1 556  ? 8.607   92.644  22.643  1.00 22.77 ? 556  SER A O   1 
ATOM   4376  C CB  . SER A 1 556  ? 7.690   92.360  19.450  1.00 20.94 ? 556  SER A CB  1 
ATOM   4377  O OG  . SER A 1 556  ? 8.286   91.109  19.764  1.00 18.93 ? 556  SER A OG  1 
ATOM   4378  N N   . PRO A 1 557  ? 6.449   93.071  22.199  1.00 25.94 ? 557  PRO A N   1 
ATOM   4379  C CA  . PRO A 1 557  ? 6.003   92.651  23.522  1.00 27.81 ? 557  PRO A CA  1 
ATOM   4380  C C   . PRO A 1 557  ? 4.970   91.529  23.335  1.00 30.13 ? 557  PRO A C   1 
ATOM   4381  O O   . PRO A 1 557  ? 4.525   91.243  22.212  1.00 29.80 ? 557  PRO A O   1 
ATOM   4382  C CB  . PRO A 1 557  ? 5.368   93.922  24.074  1.00 26.79 ? 557  PRO A CB  1 
ATOM   4383  C CG  . PRO A 1 557  ? 4.512   94.311  22.937  1.00 26.46 ? 557  PRO A CG  1 
ATOM   4384  C CD  . PRO A 1 557  ? 5.482   94.061  21.684  1.00 29.26 ? 557  PRO A CD  1 
ATOM   4385  N N   . THR A 1 558  ? 4.613   90.890  24.443  1.00 33.28 ? 558  THR A N   1 
ATOM   4386  C CA  . THR A 1 558  ? 3.630   89.822  24.446  1.00 35.93 ? 558  THR A CA  1 
ATOM   4387  C C   . THR A 1 558  ? 2.722   90.138  25.628  1.00 37.71 ? 558  THR A C   1 
ATOM   4388  O O   . THR A 1 558  ? 2.698   89.417  26.622  1.00 40.01 ? 558  THR A O   1 
ATOM   4389  C CB  . THR A 1 558  ? 4.287   88.447  24.651  1.00 34.47 ? 558  THR A CB  1 
ATOM   4390  O OG1 . THR A 1 558  ? 5.188   88.182  23.573  1.00 34.92 ? 558  THR A OG1 1 
ATOM   4391  C CG2 . THR A 1 558  ? 3.236   87.359  24.667  1.00 36.77 ? 558  THR A CG2 1 
ATOM   4392  N N   . SER A 1 559  ? 1.983   91.234  25.508  1.00 39.66 ? 559  SER A N   1 
ATOM   4393  C CA  . SER A 1 559  ? 1.088   91.704  26.558  1.00 40.82 ? 559  SER A CA  1 
ATOM   4394  C C   . SER A 1 559  ? -0.294  91.043  26.633  1.00 42.55 ? 559  SER A C   1 
ATOM   4395  O O   . SER A 1 559  ? -0.798  90.480  25.654  1.00 42.63 ? 559  SER A O   1 
ATOM   4396  C CB  . SER A 1 559  ? 0.916   93.216  26.421  1.00 40.26 ? 559  SER A CB  1 
ATOM   4397  O OG  . SER A 1 559  ? 0.150   93.734  27.487  1.00 43.03 ? 559  SER A OG  1 
ATOM   4398  N N   . GLY A 1 560  ? -0.892  91.121  27.819  1.00 43.65 ? 560  GLY A N   1 
ATOM   4399  C CA  . GLY A 1 560  ? -2.209  90.558  28.037  1.00 46.49 ? 560  GLY A CA  1 
ATOM   4400  C C   . GLY A 1 560  ? -3.281  91.636  27.986  1.00 48.47 ? 560  GLY A C   1 
ATOM   4401  O O   . GLY A 1 560  ? -3.345  92.409  27.030  1.00 50.14 ? 560  GLY A O   1 
ATOM   4402  N N   . SER A 1 561  ? -4.113  91.704  29.020  1.00 49.36 ? 561  SER A N   1 
ATOM   4403  C CA  . SER A 1 561  ? -5.186  92.692  29.070  1.00 49.48 ? 561  SER A CA  1 
ATOM   4404  C C   . SER A 1 561  ? -5.107  93.590  30.310  1.00 49.87 ? 561  SER A C   1 
ATOM   4405  O O   . SER A 1 561  ? -5.781  94.620  30.382  1.00 49.18 ? 561  SER A O   1 
ATOM   4406  C CB  . SER A 1 561  ? -6.543  91.975  29.028  1.00 49.17 ? 561  SER A CB  1 
ATOM   4407  O OG  . SER A 1 561  ? -7.615  92.886  28.854  1.00 47.41 ? 561  SER A OG  1 
ATOM   4408  N N   . ALA A 1 562  ? -4.280  93.201  31.278  1.00 50.01 ? 562  ALA A N   1 
ATOM   4409  C CA  . ALA A 1 562  ? -4.121  93.970  32.513  1.00 50.05 ? 562  ALA A CA  1 
ATOM   4410  C C   . ALA A 1 562  ? -3.091  95.090  32.367  1.00 49.85 ? 562  ALA A C   1 
ATOM   4411  O O   . ALA A 1 562  ? -2.083  94.930  31.681  1.00 48.92 ? 562  ALA A O   1 
ATOM   4412  C CB  . ALA A 1 562  ? -3.721  93.040  33.656  1.00 50.24 ? 562  ALA A CB  1 
ATOM   4413  N N   . VAL A 1 563  ? -3.352  96.220  33.018  1.00 50.07 ? 563  VAL A N   1 
ATOM   4414  C CA  . VAL A 1 563  ? -2.447  97.367  32.967  1.00 50.34 ? 563  VAL A CA  1 
ATOM   4415  C C   . VAL A 1 563  ? -1.053  96.950  33.438  1.00 50.11 ? 563  VAL A C   1 
ATOM   4416  O O   . VAL A 1 563  ? -0.042  97.399  32.900  1.00 49.56 ? 563  VAL A O   1 
ATOM   4417  C CB  . VAL A 1 563  ? -2.954  98.526  33.874  1.00 50.39 ? 563  VAL A CB  1 
ATOM   4418  C CG1 . VAL A 1 563  ? -2.016  99.710  33.784  1.00 49.02 ? 563  VAL A CG1 1 
ATOM   4419  C CG2 . VAL A 1 563  ? -4.354  98.942  33.464  1.00 50.66 ? 563  VAL A CG2 1 
ATOM   4420  N N   . ILE A 1 564  ? -1.021  96.078  34.442  1.00 50.18 ? 564  ILE A N   1 
ATOM   4421  C CA  . ILE A 1 564  ? 0.222   95.577  35.032  1.00 49.75 ? 564  ILE A CA  1 
ATOM   4422  C C   . ILE A 1 564  ? 1.201   94.932  34.045  1.00 48.31 ? 564  ILE A C   1 
ATOM   4423  O O   . ILE A 1 564  ? 2.412   94.911  34.281  1.00 47.71 ? 564  ILE A O   1 
ATOM   4424  C CB  . ILE A 1 564  ? -0.077  94.545  36.151  1.00 50.32 ? 564  ILE A CB  1 
ATOM   4425  C CG1 . ILE A 1 564  ? -0.787  93.323  35.563  1.00 50.32 ? 564  ILE A CG1 1 
ATOM   4426  C CG2 . ILE A 1 564  ? -0.942  95.179  37.222  1.00 50.63 ? 564  ILE A CG2 1 
ATOM   4427  C CD1 . ILE A 1 564  ? -1.137  92.262  36.582  1.00 51.38 ? 564  ILE A CD1 1 
ATOM   4428  N N   . GLU A 1 565  ? 0.680   94.408  32.943  1.00 45.91 ? 565  GLU A N   1 
ATOM   4429  C CA  . GLU A 1 565  ? 1.526   93.754  31.961  1.00 44.04 ? 565  GLU A CA  1 
ATOM   4430  C C   . GLU A 1 565  ? 1.650   94.479  30.634  1.00 41.07 ? 565  GLU A C   1 
ATOM   4431  O O   . GLU A 1 565  ? 2.120   93.904  29.663  1.00 40.70 ? 565  GLU A O   1 
ATOM   4432  C CB  . GLU A 1 565  ? 1.030   92.325  31.726  1.00 46.11 ? 565  GLU A CB  1 
ATOM   4433  C CG  . GLU A 1 565  ? -0.480  92.184  31.671  1.00 48.93 ? 565  GLU A CG  1 
ATOM   4434  C CD  . GLU A 1 565  ? -0.931  90.749  31.440  1.00 52.10 ? 565  GLU A CD  1 
ATOM   4435  O OE1 . GLU A 1 565  ? -2.149  90.493  31.527  1.00 54.43 ? 565  GLU A OE1 1 
ATOM   4436  O OE2 . GLU A 1 565  ? -0.081  89.875  31.164  1.00 52.57 ? 565  GLU A OE2 1 
ATOM   4437  N N   . LYS A 1 566  ? 1.248   95.743  30.588  1.00 39.60 ? 566  LYS A N   1 
ATOM   4438  C CA  . LYS A 1 566  ? 1.328   96.509  29.342  1.00 39.13 ? 566  LYS A CA  1 
ATOM   4439  C C   . LYS A 1 566  ? 2.479   97.509  29.271  1.00 36.62 ? 566  LYS A C   1 
ATOM   4440  O O   . LYS A 1 566  ? 2.332   98.597  28.722  1.00 36.56 ? 566  LYS A O   1 
ATOM   4441  C CB  . LYS A 1 566  ? 0.002   97.229  29.071  1.00 40.76 ? 566  LYS A CB  1 
ATOM   4442  C CG  . LYS A 1 566  ? -1.113  96.302  28.612  1.00 41.92 ? 566  LYS A CG  1 
ATOM   4443  C CD  . LYS A 1 566  ? -2.416  97.044  28.386  1.00 42.84 ? 566  LYS A CD  1 
ATOM   4444  C CE  . LYS A 1 566  ? -3.506  96.085  27.934  1.00 43.60 ? 566  LYS A CE  1 
ATOM   4445  N NZ  . LYS A 1 566  ? -4.793  96.779  27.681  1.00 44.48 ? 566  LYS A NZ  1 
ATOM   4446  N N   . VAL A 1 567  ? 3.617   97.123  29.839  1.00 34.96 ? 567  VAL A N   1 
ATOM   4447  C CA  . VAL A 1 567  ? 4.838   97.929  29.847  1.00 32.37 ? 567  VAL A CA  1 
ATOM   4448  C C   . VAL A 1 567  ? 4.660   99.441  30.044  1.00 30.32 ? 567  VAL A C   1 
ATOM   4449  O O   . VAL A 1 567  ? 5.119   100.243 29.226  1.00 30.26 ? 567  VAL A O   1 
ATOM   4450  C CB  . VAL A 1 567  ? 5.623   97.689  28.544  1.00 33.02 ? 567  VAL A CB  1 
ATOM   4451  C CG1 . VAL A 1 567  ? 7.039   98.223  28.675  1.00 32.53 ? 567  VAL A CG1 1 
ATOM   4452  C CG2 . VAL A 1 567  ? 5.622   96.205  28.214  1.00 31.14 ? 567  VAL A CG2 1 
ATOM   4453  N N   . ILE A 1 568  ? 4.012   99.828  31.139  1.00 27.20 ? 568  ILE A N   1 
ATOM   4454  C CA  . ILE A 1 568  ? 3.788   101.240 31.436  1.00 24.01 ? 568  ILE A CA  1 
ATOM   4455  C C   . ILE A 1 568  ? 5.029   102.133 31.204  1.00 22.88 ? 568  ILE A C   1 
ATOM   4456  O O   . ILE A 1 568  ? 4.920   103.201 30.598  1.00 22.69 ? 568  ILE A O   1 
ATOM   4457  C CB  . ILE A 1 568  ? 3.279   101.420 32.899  1.00 22.59 ? 568  ILE A CB  1 
ATOM   4458  C CG1 . ILE A 1 568  ? 1.922   100.724 33.060  1.00 23.92 ? 568  ILE A CG1 1 
ATOM   4459  C CG2 . ILE A 1 568  ? 3.136   102.903 33.245  1.00 21.40 ? 568  ILE A CG2 1 
ATOM   4460  C CD1 . ILE A 1 568  ? 1.298   100.853 34.455  1.00 20.25 ? 568  ILE A CD1 1 
ATOM   4461  N N   . PRO A 1 569  ? 6.217   101.710 31.678  1.00 20.99 ? 569  PRO A N   1 
ATOM   4462  C CA  . PRO A 1 569  ? 7.469   102.470 31.522  1.00 20.34 ? 569  PRO A CA  1 
ATOM   4463  C C   . PRO A 1 569  ? 7.792   102.940 30.103  1.00 18.57 ? 569  PRO A C   1 
ATOM   4464  O O   . PRO A 1 569  ? 8.261   104.058 29.906  1.00 17.08 ? 569  PRO A O   1 
ATOM   4465  C CB  . PRO A 1 569  ? 8.524   101.503 32.057  1.00 21.69 ? 569  PRO A CB  1 
ATOM   4466  C CG  . PRO A 1 569  ? 7.789   100.793 33.137  1.00 22.44 ? 569  PRO A CG  1 
ATOM   4467  C CD  . PRO A 1 569  ? 6.452   100.496 32.479  1.00 21.62 ? 569  PRO A CD  1 
ATOM   4468  N N   . LEU A 1 570  ? 7.553   102.079 29.120  1.00 17.93 ? 570  LEU A N   1 
ATOM   4469  C CA  . LEU A 1 570  ? 7.818   102.429 27.735  1.00 18.62 ? 570  LEU A CA  1 
ATOM   4470  C C   . LEU A 1 570  ? 7.032   103.695 27.356  1.00 17.93 ? 570  LEU A C   1 
ATOM   4471  O O   . LEU A 1 570  ? 7.589   104.659 26.831  1.00 16.49 ? 570  LEU A O   1 
ATOM   4472  C CB  . LEU A 1 570  ? 7.424   101.255 26.826  1.00 19.06 ? 570  LEU A CB  1 
ATOM   4473  C CG  . LEU A 1 570  ? 7.760   101.337 25.332  1.00 18.21 ? 570  LEU A CG  1 
ATOM   4474  C CD1 . LEU A 1 570  ? 9.229   101.660 25.160  1.00 17.49 ? 570  LEU A CD1 1 
ATOM   4475  C CD2 . LEU A 1 570  ? 7.426   100.017 24.660  1.00 17.18 ? 570  LEU A CD2 1 
ATOM   4476  N N   . GLY A 1 571  ? 5.733   103.677 27.637  1.00 18.51 ? 571  GLY A N   1 
ATOM   4477  C CA  . GLY A 1 571  ? 4.881   104.813 27.332  1.00 18.17 ? 571  GLY A CA  1 
ATOM   4478  C C   . GLY A 1 571  ? 5.386   106.087 27.973  1.00 17.85 ? 571  GLY A C   1 
ATOM   4479  O O   . GLY A 1 571  ? 5.382   107.145 27.347  1.00 19.95 ? 571  GLY A O   1 
ATOM   4480  N N   . VAL A 1 572  ? 5.821   105.985 29.225  1.00 16.96 ? 572  VAL A N   1 
ATOM   4481  C CA  . VAL A 1 572  ? 6.350   107.132 29.961  1.00 15.74 ? 572  VAL A CA  1 
ATOM   4482  C C   . VAL A 1 572  ? 7.518   107.752 29.200  1.00 15.95 ? 572  VAL A C   1 
ATOM   4483  O O   . VAL A 1 572  ? 7.579   108.967 29.018  1.00 15.16 ? 572  VAL A O   1 
ATOM   4484  C CB  . VAL A 1 572  ? 6.873   106.721 31.358  1.00 13.14 ? 572  VAL A CB  1 
ATOM   4485  C CG1 . VAL A 1 572  ? 7.232   107.969 32.151  1.00 12.15 ? 572  VAL A CG1 1 
ATOM   4486  C CG2 . VAL A 1 572  ? 5.824   105.891 32.092  1.00 11.81 ? 572  VAL A CG2 1 
ATOM   4487  N N   . TYR A 1 573  ? 8.441   106.890 28.777  1.00 15.95 ? 573  TYR A N   1 
ATOM   4488  C CA  . TYR A 1 573  ? 9.635   107.281 28.047  1.00 14.90 ? 573  TYR A CA  1 
ATOM   4489  C C   . TYR A 1 573  ? 9.312   107.914 26.707  1.00 15.14 ? 573  TYR A C   1 
ATOM   4490  O O   . TYR A 1 573  ? 9.814   108.996 26.371  1.00 13.44 ? 573  TYR A O   1 
ATOM   4491  C CB  . TYR A 1 573  ? 10.504  106.053 27.784  1.00 16.31 ? 573  TYR A CB  1 
ATOM   4492  C CG  . TYR A 1 573  ? 11.764  106.355 26.994  1.00 16.20 ? 573  TYR A CG  1 
ATOM   4493  C CD1 . TYR A 1 573  ? 12.928  106.777 27.639  1.00 16.12 ? 573  TYR A CD1 1 
ATOM   4494  C CD2 . TYR A 1 573  ? 11.792  106.217 25.606  1.00 13.88 ? 573  TYR A CD2 1 
ATOM   4495  C CE1 . TYR A 1 573  ? 14.088  107.044 26.920  1.00 15.03 ? 573  TYR A CE1 1 
ATOM   4496  C CE2 . TYR A 1 573  ? 12.940  106.484 24.886  1.00 15.07 ? 573  TYR A CE2 1 
ATOM   4497  C CZ  . TYR A 1 573  ? 14.084  106.895 25.552  1.00 16.04 ? 573  TYR A CZ  1 
ATOM   4498  O OH  . TYR A 1 573  ? 15.229  107.139 24.850  1.00 18.53 ? 573  TYR A OH  1 
ATOM   4499  N N   . ALA A 1 574  ? 8.491   107.201 25.943  1.00 13.53 ? 574  ALA A N   1 
ATOM   4500  C CA  . ALA A 1 574  ? 8.099   107.618 24.611  1.00 12.67 ? 574  ALA A CA  1 
ATOM   4501  C C   . ALA A 1 574  ? 7.299   108.910 24.600  1.00 13.07 ? 574  ALA A C   1 
ATOM   4502  O O   . ALA A 1 574  ? 7.333   109.659 23.623  1.00 12.70 ? 574  ALA A O   1 
ATOM   4503  C CB  . ALA A 1 574  ? 7.296   106.498 23.936  1.00 10.95 ? 574  ALA A CB  1 
ATOM   4504  N N   . SER A 1 575  ? 6.582   109.182 25.683  1.00 12.54 ? 575  SER A N   1 
ATOM   4505  C CA  . SER A 1 575  ? 5.775   110.385 25.710  1.00 13.09 ? 575  SER A CA  1 
ATOM   4506  C C   . SER A 1 575  ? 6.462   111.589 26.379  1.00 15.10 ? 575  SER A C   1 
ATOM   4507  O O   . SER A 1 575  ? 5.914   112.689 26.394  1.00 17.22 ? 575  SER A O   1 
ATOM   4508  C CB  . SER A 1 575  ? 4.427   110.098 26.388  1.00 12.03 ? 575  SER A CB  1 
ATOM   4509  O OG  . SER A 1 575  ? 4.546   109.922 27.792  1.00 12.30 ? 575  SER A OG  1 
ATOM   4510  N N   . SER A 1 576  ? 7.663   111.395 26.905  1.00 14.92 ? 576  SER A N   1 
ATOM   4511  C CA  . SER A 1 576  ? 8.349   112.495 27.569  1.00 16.90 ? 576  SER A CA  1 
ATOM   4512  C C   . SER A 1 576  ? 9.185   113.386 26.681  1.00 16.63 ? 576  SER A C   1 
ATOM   4513  O O   . SER A 1 576  ? 10.172  112.954 26.107  1.00 14.68 ? 576  SER A O   1 
ATOM   4514  C CB  . SER A 1 576  ? 9.261   111.994 28.688  1.00 15.63 ? 576  SER A CB  1 
ATOM   4515  O OG  . SER A 1 576  ? 8.516   111.405 29.715  1.00 16.50 ? 576  SER A OG  1 
ATOM   4516  N N   . PRO A 1 577  ? 8.831   114.667 26.609  1.00 16.58 ? 577  PRO A N   1 
ATOM   4517  C CA  . PRO A 1 577  ? 9.623   115.555 25.772  1.00 18.95 ? 577  PRO A CA  1 
ATOM   4518  C C   . PRO A 1 577  ? 11.028  115.529 26.398  1.00 19.33 ? 577  PRO A C   1 
ATOM   4519  O O   . PRO A 1 577  ? 11.193  115.434 27.605  1.00 19.91 ? 577  PRO A O   1 
ATOM   4520  C CB  . PRO A 1 577  ? 8.927   116.903 25.927  1.00 18.34 ? 577  PRO A CB  1 
ATOM   4521  C CG  . PRO A 1 577  ? 7.540   116.546 26.542  1.00 20.31 ? 577  PRO A CG  1 
ATOM   4522  C CD  . PRO A 1 577  ? 7.847   115.395 27.412  1.00 16.27 ? 577  PRO A CD  1 
ATOM   4523  N N   . PRO A 1 578  ? 12.081  115.617 25.573  1.00 19.70 ? 578  PRO A N   1 
ATOM   4524  C CA  . PRO A 1 578  ? 12.264  115.758 24.127  1.00 19.05 ? 578  PRO A CA  1 
ATOM   4525  C C   . PRO A 1 578  ? 11.860  114.582 23.254  1.00 18.89 ? 578  PRO A C   1 
ATOM   4526  O O   . PRO A 1 578  ? 11.804  114.743 22.038  1.00 18.08 ? 578  PRO A O   1 
ATOM   4527  C CB  . PRO A 1 578  ? 13.766  116.070 23.949  1.00 19.39 ? 578  PRO A CB  1 
ATOM   4528  C CG  . PRO A 1 578  ? 14.406  115.810 25.298  1.00 20.42 ? 578  PRO A CG  1 
ATOM   4529  C CD  . PRO A 1 578  ? 13.345  115.829 26.301  1.00 21.59 ? 578  PRO A CD  1 
ATOM   4530  N N   . ASN A 1 579  ? 11.583  113.398 23.800  1.00 17.00 ? 579  ASN A N   1 
ATOM   4531  C CA  . ASN A 1 579  ? 11.147  112.264 22.941  1.00 16.08 ? 579  ASN A CA  1 
ATOM   4532  C C   . ASN A 1 579  ? 9.755   112.455 22.332  1.00 17.38 ? 579  ASN A C   1 
ATOM   4533  O O   . ASN A 1 579  ? 8.970   113.245 22.839  1.00 15.00 ? 579  ASN A O   1 
ATOM   4534  C CB  . ASN A 1 579  ? 11.134  110.950 23.733  1.00 14.73 ? 579  ASN A CB  1 
ATOM   4535  C CG  . ASN A 1 579  ? 12.493  110.598 24.326  1.00 17.61 ? 579  ASN A CG  1 
ATOM   4536  O OD1 . ASN A 1 579  ? 13.538  110.755 23.683  1.00 18.30 ? 579  ASN A OD1 1 
ATOM   4537  N ND2 . ASN A 1 579  ? 12.477  110.093 25.565  1.00 15.73 ? 579  ASN A ND2 1 
ATOM   4538  N N   . GLN A 1 580  ? 9.477   111.753 21.234  1.00 17.55 ? 580  GLN A N   1 
ATOM   4539  C CA  . GLN A 1 580  ? 8.158   111.822 20.601  1.00 18.99 ? 580  GLN A CA  1 
ATOM   4540  C C   . GLN A 1 580  ? 7.764   110.431 20.101  1.00 19.73 ? 580  GLN A C   1 
ATOM   4541  O O   . GLN A 1 580  ? 8.630   109.595 19.825  1.00 21.35 ? 580  GLN A O   1 
ATOM   4542  C CB  . GLN A 1 580  ? 8.123   112.804 19.412  1.00 17.29 ? 580  GLN A CB  1 
ATOM   4543  C CG  . GLN A 1 580  ? 8.171   114.278 19.806  1.00 16.82 ? 580  GLN A CG  1 
ATOM   4544  C CD  . GLN A 1 580  ? 8.161   115.204 18.604  1.00 16.62 ? 580  GLN A CD  1 
ATOM   4545  O OE1 . GLN A 1 580  ? 9.191   115.418 17.964  1.00 16.33 ? 580  GLN A OE1 1 
ATOM   4546  N NE2 . GLN A 1 580  ? 6.990   115.744 18.282  1.00 13.27 ? 580  GLN A NE2 1 
ATOM   4547  N N   . SER A 1 581  ? 6.466   110.174 19.989  1.00 18.96 ? 581  SER A N   1 
ATOM   4548  C CA  . SER A 1 581  ? 6.016   108.876 19.519  1.00 19.86 ? 581  SER A CA  1 
ATOM   4549  C C   . SER A 1 581  ? 4.871   109.010 18.538  1.00 19.85 ? 581  SER A C   1 
ATOM   4550  O O   . SER A 1 581  ? 4.008   109.873 18.680  1.00 20.01 ? 581  SER A O   1 
ATOM   4551  C CB  . SER A 1 581  ? 5.577   108.004 20.693  1.00 21.22 ? 581  SER A CB  1 
ATOM   4552  O OG  . SER A 1 581  ? 4.532   108.629 21.408  1.00 27.31 ? 581  SER A OG  1 
ATOM   4553  N N   . ILE A 1 582  ? 4.900   108.160 17.523  1.00 19.46 ? 582  ILE A N   1 
ATOM   4554  C CA  . ILE A 1 582  ? 3.871   108.117 16.499  1.00 19.98 ? 582  ILE A CA  1 
ATOM   4555  C C   . ILE A 1 582  ? 3.152   106.800 16.774  1.00 21.07 ? 582  ILE A C   1 
ATOM   4556  O O   . ILE A 1 582  ? 3.790   105.763 16.918  1.00 21.57 ? 582  ILE A O   1 
ATOM   4557  C CB  . ILE A 1 582  ? 4.492   108.052 15.058  1.00 20.22 ? 582  ILE A CB  1 
ATOM   4558  C CG1 . ILE A 1 582  ? 5.571   109.128 14.891  1.00 21.59 ? 582  ILE A CG1 1 
ATOM   4559  C CG2 . ILE A 1 582  ? 3.397   108.204 14.002  1.00 16.10 ? 582  ILE A CG2 1 
ATOM   4560  C CD1 . ILE A 1 582  ? 5.058   110.562 15.016  1.00 25.71 ? 582  ILE A CD1 1 
ATOM   4561  N N   . ASN A 1 583  ? 1.834   106.829 16.864  1.00 22.53 ? 583  ASN A N   1 
ATOM   4562  C CA  . ASN A 1 583  ? 1.093   105.597 17.103  1.00 23.07 ? 583  ASN A CA  1 
ATOM   4563  C C   . ASN A 1 583  ? 0.700   105.077 15.725  1.00 23.78 ? 583  ASN A C   1 
ATOM   4564  O O   . ASN A 1 583  ? 0.038   105.770 14.947  1.00 23.22 ? 583  ASN A O   1 
ATOM   4565  C CB  . ASN A 1 583  ? -0.123  105.889 17.987  1.00 23.09 ? 583  ASN A CB  1 
ATOM   4566  C CG  . ASN A 1 583  ? 0.241   106.770 19.190  1.00 25.86 ? 583  ASN A CG  1 
ATOM   4567  O OD1 . ASN A 1 583  ? 1.179   106.469 19.938  1.00 24.54 ? 583  ASN A OD1 1 
ATOM   4568  N ND2 . ASN A 1 583  ? -0.487  107.871 19.366  1.00 27.46 ? 583  ASN A ND2 1 
ATOM   4569  N N   . ILE A 1 584  ? 1.163   103.872 15.407  1.00 25.03 ? 584  ILE A N   1 
ATOM   4570  C CA  . ILE A 1 584  ? 0.886   103.265 14.114  1.00 25.53 ? 584  ILE A CA  1 
ATOM   4571  C C   . ILE A 1 584  ? 0.096   101.993 14.281  1.00 25.52 ? 584  ILE A C   1 
ATOM   4572  O O   . ILE A 1 584  ? 0.387   101.184 15.154  1.00 28.10 ? 584  ILE A O   1 
ATOM   4573  C CB  . ILE A 1 584  ? 2.189   102.928 13.355  1.00 26.10 ? 584  ILE A CB  1 
ATOM   4574  C CG1 . ILE A 1 584  ? 3.024   104.193 13.162  1.00 25.95 ? 584  ILE A CG1 1 
ATOM   4575  C CG2 . ILE A 1 584  ? 1.859   102.315 12.013  1.00 24.71 ? 584  ILE A CG2 1 
ATOM   4576  C CD1 . ILE A 1 584  ? 4.320   103.956 12.421  1.00 27.05 ? 584  ILE A CD1 1 
ATOM   4577  N N   . ASP A 1 585  ? -0.915  101.822 13.443  1.00 25.56 ? 585  ASP A N   1 
ATOM   4578  C CA  . ASP A 1 585  ? -1.740  100.628 13.501  1.00 24.45 ? 585  ASP A CA  1 
ATOM   4579  C C   . ASP A 1 585  ? -2.013  100.091 12.100  1.00 22.28 ? 585  ASP A C   1 
ATOM   4580  O O   . ASP A 1 585  ? -2.111  100.847 11.127  1.00 19.73 ? 585  ASP A O   1 
ATOM   4581  C CB  . ASP A 1 585  ? -3.073  100.921 14.206  1.00 27.92 ? 585  ASP A CB  1 
ATOM   4582  C CG  . ASP A 1 585  ? -2.889  101.542 15.583  1.00 33.17 ? 585  ASP A CG  1 
ATOM   4583  O OD1 . ASP A 1 585  ? -1.992  101.101 16.340  1.00 33.74 ? 585  ASP A OD1 1 
ATOM   4584  O OD2 . ASP A 1 585  ? -3.654  102.474 15.916  1.00 37.38 ? 585  ASP A OD2 1 
ATOM   4585  N N   . ILE A 1 586  ? -2.104  98.773  12.002  1.00 19.22 ? 586  ILE A N   1 
ATOM   4586  C CA  . ILE A 1 586  ? -2.409  98.132  10.739  1.00 19.10 ? 586  ILE A CA  1 
ATOM   4587  C C   . ILE A 1 586  ? -3.910  97.858  10.834  1.00 19.57 ? 586  ILE A C   1 
ATOM   4588  O O   . ILE A 1 586  ? -4.336  96.972  11.581  1.00 20.11 ? 586  ILE A O   1 
ATOM   4589  C CB  . ILE A 1 586  ? -1.646  96.804  10.584  1.00 18.26 ? 586  ILE A CB  1 
ATOM   4590  C CG1 . ILE A 1 586  ? -0.145  97.043  10.736  1.00 18.30 ? 586  ILE A CG1 1 
ATOM   4591  C CG2 . ILE A 1 586  ? -1.910  96.216  9.225   1.00 18.41 ? 586  ILE A CG2 1 
ATOM   4592  C CD1 . ILE A 1 586  ? 0.670   95.783  10.811  1.00 14.89 ? 586  ILE A CD1 1 
ATOM   4593  N N   . SER A 1 587  ? -4.710  98.640  10.109  1.00 19.06 ? 587  SER A N   1 
ATOM   4594  C CA  . SER A 1 587  ? -6.161  98.472  10.125  1.00 19.99 ? 587  SER A CA  1 
ATOM   4595  C C   . SER A 1 587  ? -6.543  97.218  9.353   1.00 19.41 ? 587  SER A C   1 
ATOM   4596  O O   . SER A 1 587  ? -5.865  96.854  8.388   1.00 18.93 ? 587  SER A O   1 
ATOM   4597  C CB  . SER A 1 587  ? -6.853  99.693  9.506   1.00 21.62 ? 587  SER A CB  1 
ATOM   4598  O OG  . SER A 1 587  ? -6.576  99.788  8.123   1.00 22.88 ? 587  SER A OG  1 
ATOM   4599  N N   . ALA A 1 588  ? -7.630  96.570  9.779   1.00 18.97 ? 588  ALA A N   1 
ATOM   4600  C CA  . ALA A 1 588  ? -8.102  95.328  9.153   1.00 19.19 ? 588  ALA A CA  1 
ATOM   4601  C C   . ALA A 1 588  ? -6.903  94.405  8.901   1.00 19.80 ? 588  ALA A C   1 
ATOM   4602  O O   . ALA A 1 588  ? -6.698  93.911  7.787   1.00 20.07 ? 588  ALA A O   1 
ATOM   4603  C CB  . ALA A 1 588  ? -8.817  95.637  7.837   1.00 17.19 ? 588  ALA A CB  1 
ATOM   4604  N N   . CYS A 1 589  ? -6.109  94.190  9.945   1.00 19.67 ? 589  CYS A N   1 
ATOM   4605  C CA  . CYS A 1 589  ? -4.922  93.359  9.838   1.00 21.21 ? 589  CYS A CA  1 
ATOM   4606  C C   . CYS A 1 589  ? -5.177  91.945  9.310   1.00 21.34 ? 589  CYS A C   1 
ATOM   4607  O O   . CYS A 1 589  ? -4.515  91.515  8.363   1.00 21.81 ? 589  CYS A O   1 
ATOM   4608  C CB  . CYS A 1 589  ? -4.205  93.289  11.187  1.00 20.99 ? 589  CYS A CB  1 
ATOM   4609  S SG  . CYS A 1 589  ? -2.519  92.638  11.058  1.00 24.59 ? 589  CYS A SG  1 
ATOM   4610  N N   . ASP A 1 590  ? -6.119  91.219  9.910   1.00 21.61 ? 590  ASP A N   1 
ATOM   4611  C CA  . ASP A 1 590  ? -6.414  89.863  9.456   1.00 21.61 ? 590  ASP A CA  1 
ATOM   4612  C C   . ASP A 1 590  ? -6.852  89.830  8.004   1.00 22.20 ? 590  ASP A C   1 
ATOM   4613  O O   . ASP A 1 590  ? -6.508  88.911  7.266   1.00 24.09 ? 590  ASP A O   1 
ATOM   4614  C CB  . ASP A 1 590  ? -7.506  89.217  10.305  1.00 24.06 ? 590  ASP A CB  1 
ATOM   4615  C CG  . ASP A 1 590  ? -7.019  88.825  11.683  1.00 26.96 ? 590  ASP A CG  1 
ATOM   4616  O OD1 . ASP A 1 590  ? -5.868  88.363  11.788  1.00 28.71 ? 590  ASP A OD1 1 
ATOM   4617  O OD2 . ASP A 1 590  ? -7.790  88.963  12.660  1.00 29.61 ? 590  ASP A OD2 1 
ATOM   4618  N N   . ALA A 1 591  ? -7.621  90.829  7.591   1.00 22.66 ? 591  ALA A N   1 
ATOM   4619  C CA  . ALA A 1 591  ? -8.101  90.887  6.216   1.00 21.88 ? 591  ALA A CA  1 
ATOM   4620  C C   . ALA A 1 591  ? -7.010  91.358  5.258   1.00 21.17 ? 591  ALA A C   1 
ATOM   4621  O O   . ALA A 1 591  ? -7.202  91.351  4.042   1.00 22.92 ? 591  ALA A O   1 
ATOM   4622  C CB  . ALA A 1 591  ? -9.322  91.816  6.121   1.00 19.24 ? 591  ALA A CB  1 
ATOM   4623  N N   . SER A 1 592  ? -5.862  91.758  5.798   1.00 20.02 ? 592  SER A N   1 
ATOM   4624  C CA  . SER A 1 592  ? -4.776  92.260  4.954   1.00 18.95 ? 592  SER A CA  1 
ATOM   4625  C C   . SER A 1 592  ? -3.593  91.317  4.874   1.00 17.36 ? 592  SER A C   1 
ATOM   4626  O O   . SER A 1 592  ? -2.624  91.602  4.196   1.00 17.68 ? 592  SER A O   1 
ATOM   4627  C CB  . SER A 1 592  ? -4.310  93.636  5.449   1.00 19.59 ? 592  SER A CB  1 
ATOM   4628  O OG  . SER A 1 592  ? -5.405  94.535  5.567   1.00 19.83 ? 592  SER A OG  1 
ATOM   4629  N N   . ILE A 1 593  ? -3.667  90.206  5.594   1.00 19.08 ? 593  ILE A N   1 
ATOM   4630  C CA  . ILE A 1 593  ? -2.610  89.195  5.565   1.00 19.48 ? 593  ILE A CA  1 
ATOM   4631  C C   . ILE A 1 593  ? -3.232  88.010  4.815   1.00 19.26 ? 593  ILE A C   1 
ATOM   4632  O O   . ILE A 1 593  ? -3.786  87.083  5.415   1.00 19.46 ? 593  ILE A O   1 
ATOM   4633  C CB  . ILE A 1 593  ? -2.195  88.739  6.989   1.00 18.79 ? 593  ILE A CB  1 
ATOM   4634  C CG1 . ILE A 1 593  ? -1.716  89.933  7.817   1.00 18.72 ? 593  ILE A CG1 1 
ATOM   4635  C CG2 . ILE A 1 593  ? -1.085  87.704  6.899   1.00 17.89 ? 593  ILE A CG2 1 
ATOM   4636  C CD1 . ILE A 1 593  ? -0.394  90.450  7.406   1.00 17.09 ? 593  ILE A CD1 1 
ATOM   4637  N N   . THR A 1 594  ? -3.146  88.059  3.494   1.00 18.42 ? 594  THR A N   1 
ATOM   4638  C CA  . THR A 1 594  ? -3.724  87.017  2.666   1.00 16.73 ? 594  THR A CA  1 
ATOM   4639  C C   . THR A 1 594  ? -2.673  86.289  1.847   1.00 17.77 ? 594  THR A C   1 
ATOM   4640  O O   . THR A 1 594  ? -1.479  86.562  1.965   1.00 18.63 ? 594  THR A O   1 
ATOM   4641  C CB  . THR A 1 594  ? -4.792  87.616  1.743   1.00 14.90 ? 594  THR A CB  1 
ATOM   4642  O OG1 . THR A 1 594  ? -4.175  88.467  0.776   1.00 16.88 ? 594  THR A OG1 1 
ATOM   4643  C CG2 . THR A 1 594  ? -5.755  88.463  2.553   1.00 15.85 ? 594  THR A CG2 1 
ATOM   4644  N N   . TRP A 1 595  ? -3.119  85.364  1.010   1.00 18.92 ? 595  TRP A N   1 
ATOM   4645  C CA  . TRP A 1 595  ? -2.202  84.580  0.196   1.00 20.07 ? 595  TRP A CA  1 
ATOM   4646  C C   . TRP A 1 595  ? -1.508  85.348  -0.929  1.00 21.08 ? 595  TRP A C   1 
ATOM   4647  O O   . TRP A 1 595  ? -0.310  85.180  -1.147  1.00 21.25 ? 595  TRP A O   1 
ATOM   4648  C CB  . TRP A 1 595  ? -2.938  83.359  -0.379  1.00 18.23 ? 595  TRP A CB  1 
ATOM   4649  C CG  . TRP A 1 595  ? -2.083  82.501  -1.245  1.00 17.96 ? 595  TRP A CG  1 
ATOM   4650  C CD1 . TRP A 1 595  ? -1.968  82.568  -2.604  1.00 17.51 ? 595  TRP A CD1 1 
ATOM   4651  C CD2 . TRP A 1 595  ? -1.203  81.452  -0.817  1.00 17.44 ? 595  TRP A CD2 1 
ATOM   4652  N NE1 . TRP A 1 595  ? -1.071  81.624  -3.051  1.00 17.06 ? 595  TRP A NE1 1 
ATOM   4653  C CE2 . TRP A 1 595  ? -0.582  80.931  -1.978  1.00 16.30 ? 595  TRP A CE2 1 
ATOM   4654  C CE3 . TRP A 1 595  ? -0.867  80.914  0.432   1.00 17.23 ? 595  TRP A CE3 1 
ATOM   4655  C CZ2 . TRP A 1 595  ? 0.343   79.880  -1.928  1.00 17.21 ? 595  TRP A CZ2 1 
ATOM   4656  C CZ3 . TRP A 1 595  ? 0.060   79.866  0.482   1.00 18.21 ? 595  TRP A CZ3 1 
ATOM   4657  C CH2 . TRP A 1 595  ? 0.657   79.366  -0.693  1.00 16.98 ? 595  TRP A CH2 1 
ATOM   4658  N N   . ASP A 1 596  ? -2.261  86.190  -1.632  1.00 23.54 ? 596  ASP A N   1 
ATOM   4659  C CA  . ASP A 1 596  ? -1.732  86.962  -2.759  1.00 25.58 ? 596  ASP A CA  1 
ATOM   4660  C C   . ASP A 1 596  ? -0.397  87.659  -2.548  1.00 24.76 ? 596  ASP A C   1 
ATOM   4661  O O   . ASP A 1 596  ? 0.378   87.815  -3.487  1.00 24.49 ? 596  ASP A O   1 
ATOM   4662  C CB  . ASP A 1 596  ? -2.773  87.981  -3.222  1.00 28.80 ? 596  ASP A CB  1 
ATOM   4663  C CG  . ASP A 1 596  ? -3.799  87.373  -4.170  1.00 32.19 ? 596  ASP A CG  1 
ATOM   4664  O OD1 . ASP A 1 596  ? -4.058  86.151  -4.080  1.00 32.73 ? 596  ASP A OD1 1 
ATOM   4665  O OD2 . ASP A 1 596  ? -4.356  88.123  -5.000  1.00 34.62 ? 596  ASP A OD2 1 
ATOM   4666  N N   . PHE A 1 597  ? -0.118  88.077  -1.322  1.00 25.01 ? 597  PHE A N   1 
ATOM   4667  C CA  . PHE A 1 597  ? 1.138   88.748  -1.062  1.00 23.70 ? 597  PHE A CA  1 
ATOM   4668  C C   . PHE A 1 597  ? 1.906   88.112  0.086   1.00 22.10 ? 597  PHE A C   1 
ATOM   4669  O O   . PHE A 1 597  ? 2.946   87.498  -0.120  1.00 24.32 ? 597  PHE A O   1 
ATOM   4670  C CB  . PHE A 1 597  ? 0.909   90.237  -0.763  1.00 24.16 ? 597  PHE A CB  1 
ATOM   4671  C CG  . PHE A 1 597  ? 2.181   91.028  -0.659  1.00 23.71 ? 597  PHE A CG  1 
ATOM   4672  C CD1 . PHE A 1 597  ? 2.829   91.476  -1.808  1.00 24.16 ? 597  PHE A CD1 1 
ATOM   4673  C CD2 . PHE A 1 597  ? 2.768   91.271  0.585   1.00 24.44 ? 597  PHE A CD2 1 
ATOM   4674  C CE1 . PHE A 1 597  ? 4.053   92.157  -1.728  1.00 24.91 ? 597  PHE A CE1 1 
ATOM   4675  C CE2 . PHE A 1 597  ? 3.989   91.947  0.682   1.00 25.17 ? 597  PHE A CE2 1 
ATOM   4676  C CZ  . PHE A 1 597  ? 4.635   92.392  -0.482  1.00 24.32 ? 597  PHE A CZ  1 
ATOM   4677  N N   . PHE A 1 598  ? 1.389   88.255  1.295   1.00 19.62 ? 598  PHE A N   1 
ATOM   4678  C CA  . PHE A 1 598  ? 2.059   87.722  2.471   1.00 17.13 ? 598  PHE A CA  1 
ATOM   4679  C C   . PHE A 1 598  ? 2.199   86.211  2.596   1.00 15.59 ? 598  PHE A C   1 
ATOM   4680  O O   . PHE A 1 598  ? 3.305   85.682  2.558   1.00 14.38 ? 598  PHE A O   1 
ATOM   4681  C CB  . PHE A 1 598  ? 1.385   88.261  3.729   1.00 16.90 ? 598  PHE A CB  1 
ATOM   4682  C CG  . PHE A 1 598  ? 1.783   89.657  4.069   1.00 18.16 ? 598  PHE A CG  1 
ATOM   4683  C CD1 . PHE A 1 598  ? 3.040   89.916  4.632   1.00 17.58 ? 598  PHE A CD1 1 
ATOM   4684  C CD2 . PHE A 1 598  ? 0.933   90.726  3.785   1.00 18.69 ? 598  PHE A CD2 1 
ATOM   4685  C CE1 . PHE A 1 598  ? 3.455   91.220  4.912   1.00 16.91 ? 598  PHE A CE1 1 
ATOM   4686  C CE2 . PHE A 1 598  ? 1.332   92.040  4.056   1.00 21.11 ? 598  PHE A CE2 1 
ATOM   4687  C CZ  . PHE A 1 598  ? 2.608   92.290  4.623   1.00 19.39 ? 598  PHE A CZ  1 
ATOM   4688  N N   . LEU A 1 599  ? 1.081   85.516  2.751   1.00 15.33 ? 599  LEU A N   1 
ATOM   4689  C CA  . LEU A 1 599  ? 1.124   84.072  2.954   1.00 15.92 ? 599  LEU A CA  1 
ATOM   4690  C C   . LEU A 1 599  ? 1.837   83.230  1.904   1.00 15.57 ? 599  LEU A C   1 
ATOM   4691  O O   . LEU A 1 599  ? 2.519   82.274  2.258   1.00 17.66 ? 599  LEU A O   1 
ATOM   4692  C CB  . LEU A 1 599  ? -0.291  83.536  3.213   1.00 14.39 ? 599  LEU A CB  1 
ATOM   4693  C CG  . LEU A 1 599  ? -0.966  84.164  4.443   1.00 14.96 ? 599  LEU A CG  1 
ATOM   4694  C CD1 . LEU A 1 599  ? -2.334  83.555  4.628   1.00 15.23 ? 599  LEU A CD1 1 
ATOM   4695  C CD2 . LEU A 1 599  ? -0.114  83.957  5.695   1.00 14.05 ? 599  LEU A CD2 1 
ATOM   4696  N N   . SER A 1 600  ? 1.695   83.554  0.625   1.00 15.81 ? 600  SER A N   1 
ATOM   4697  C CA  . SER A 1 600  ? 2.392   82.766  -0.388  1.00 15.82 ? 600  SER A CA  1 
ATOM   4698  C C   . SER A 1 600  ? 3.904   82.963  -0.210  1.00 16.62 ? 600  SER A C   1 
ATOM   4699  O O   . SER A 1 600  ? 4.694   82.039  -0.423  1.00 16.83 ? 600  SER A O   1 
ATOM   4700  C CB  . SER A 1 600  ? 1.963   83.194  -1.789  1.00 16.38 ? 600  SER A CB  1 
ATOM   4701  O OG  . SER A 1 600  ? 2.157   84.584  -1.989  1.00 18.64 ? 600  SER A OG  1 
ATOM   4702  N N   . VAL A 1 601  ? 4.301   84.170  0.183   1.00 15.01 ? 601  VAL A N   1 
ATOM   4703  C CA  . VAL A 1 601  ? 5.710   84.473  0.408   1.00 15.76 ? 601  VAL A CA  1 
ATOM   4704  C C   . VAL A 1 601  ? 6.240   83.734  1.651   1.00 16.56 ? 601  VAL A C   1 
ATOM   4705  O O   . VAL A 1 601  ? 7.215   82.979  1.578   1.00 16.66 ? 601  VAL A O   1 
ATOM   4706  C CB  . VAL A 1 601  ? 5.929   86.007  0.591   1.00 15.40 ? 601  VAL A CB  1 
ATOM   4707  C CG1 . VAL A 1 601  ? 7.292   86.277  1.227   1.00 13.39 ? 601  VAL A CG1 1 
ATOM   4708  C CG2 . VAL A 1 601  ? 5.830   86.710  -0.761  1.00 14.28 ? 601  VAL A CG2 1 
ATOM   4709  N N   . ILE A 1 602  ? 5.576   83.945  2.780   1.00 14.88 ? 602  ILE A N   1 
ATOM   4710  C CA  . ILE A 1 602  ? 5.964   83.340  4.039   1.00 15.04 ? 602  ILE A CA  1 
ATOM   4711  C C   . ILE A 1 602  ? 6.017   81.806  4.004   1.00 15.86 ? 602  ILE A C   1 
ATOM   4712  O O   . ILE A 1 602  ? 6.992   81.194  4.472   1.00 14.69 ? 602  ILE A O   1 
ATOM   4713  C CB  . ILE A 1 602  ? 5.018   83.831  5.156   1.00 15.53 ? 602  ILE A CB  1 
ATOM   4714  C CG1 . ILE A 1 602  ? 5.153   85.354  5.288   1.00 13.59 ? 602  ILE A CG1 1 
ATOM   4715  C CG2 . ILE A 1 602  ? 5.355   83.160  6.477   1.00 15.21 ? 602  ILE A CG2 1 
ATOM   4716  C CD1 . ILE A 1 602  ? 4.168   85.991  6.255   1.00 13.92 ? 602  ILE A CD1 1 
ATOM   4717  N N   . MET A 1 603  ? 4.983   81.179  3.453   1.00 15.62 ? 603  MET A N   1 
ATOM   4718  C CA  . MET A 1 603  ? 4.967   79.725  3.371   1.00 16.50 ? 603  MET A CA  1 
ATOM   4719  C C   . MET A 1 603  ? 6.182   79.218  2.600   1.00 17.84 ? 603  MET A C   1 
ATOM   4720  O O   . MET A 1 603  ? 6.784   78.204  2.961   1.00 17.79 ? 603  MET A O   1 
ATOM   4721  C CB  . MET A 1 603  ? 3.685   79.234  2.691   1.00 17.66 ? 603  MET A CB  1 
ATOM   4722  C CG  . MET A 1 603  ? 2.414   79.419  3.529   1.00 19.31 ? 603  MET A CG  1 
ATOM   4723  S SD  . MET A 1 603  ? 2.600   78.802  5.232   1.00 20.23 ? 603  MET A SD  1 
ATOM   4724  C CE  . MET A 1 603  ? 2.196   77.144  5.030   1.00 22.53 ? 603  MET A CE  1 
ATOM   4725  N N   . ALA A 1 604  ? 6.548   79.937  1.543   1.00 17.05 ? 604  ALA A N   1 
ATOM   4726  C CA  . ALA A 1 604  ? 7.677   79.541  0.715   1.00 17.16 ? 604  ALA A CA  1 
ATOM   4727  C C   . ALA A 1 604  ? 9.015   79.737  1.417   1.00 16.56 ? 604  ALA A C   1 
ATOM   4728  O O   . ALA A 1 604  ? 9.902   78.889  1.345   1.00 15.20 ? 604  ALA A O   1 
ATOM   4729  C CB  . ALA A 1 604  ? 7.656   80.327  -0.612  1.00 17.36 ? 604  ALA A CB  1 
ATOM   4730  N N   . ALA A 1 605  ? 9.154   80.870  2.085   1.00 15.88 ? 605  ALA A N   1 
ATOM   4731  C CA  . ALA A 1 605  ? 10.385  81.179  2.773   1.00 16.52 ? 605  ALA A CA  1 
ATOM   4732  C C   . ALA A 1 605  ? 10.656  80.166  3.878   1.00 17.60 ? 605  ALA A C   1 
ATOM   4733  O O   . ALA A 1 605  ? 11.807  79.755  4.091   1.00 18.36 ? 605  ALA A O   1 
ATOM   4734  C CB  . ALA A 1 605  ? 10.316  82.598  3.341   1.00 16.88 ? 605  ALA A CB  1 
ATOM   4735  N N   . ILE A 1 606  ? 9.595   79.751  4.570   1.00 17.45 ? 606  ILE A N   1 
ATOM   4736  C CA  . ILE A 1 606  ? 9.730   78.787  5.659   1.00 16.20 ? 606  ILE A CA  1 
ATOM   4737  C C   . ILE A 1 606  ? 10.039  77.411  5.092   1.00 15.61 ? 606  ILE A C   1 
ATOM   4738  O O   . ILE A 1 606  ? 10.996  76.758  5.506   1.00 14.55 ? 606  ILE A O   1 
ATOM   4739  C CB  . ILE A 1 606  ? 8.436   78.715  6.520   1.00 15.77 ? 606  ILE A CB  1 
ATOM   4740  C CG1 . ILE A 1 606  ? 8.175   80.068  7.190   1.00 15.97 ? 606  ILE A CG1 1 
ATOM   4741  C CG2 . ILE A 1 606  ? 8.572   77.633  7.576   1.00 13.85 ? 606  ILE A CG2 1 
ATOM   4742  C CD1 . ILE A 1 606  ? 6.883   80.131  7.999   1.00 15.42 ? 606  ILE A CD1 1 
ATOM   4743  N N   . HIS A 1 607  ? 9.225   76.984  4.134   1.00 15.51 ? 607  HIS A N   1 
ATOM   4744  C CA  . HIS A 1 607  ? 9.406   75.690  3.496   1.00 16.61 ? 607  HIS A CA  1 
ATOM   4745  C C   . HIS A 1 607  ? 10.848  75.505  3.016   1.00 17.94 ? 607  HIS A C   1 
ATOM   4746  O O   . HIS A 1 607  ? 11.389  74.397  3.073   1.00 19.79 ? 607  HIS A O   1 
ATOM   4747  C CB  . HIS A 1 607  ? 8.437   75.538  2.310   1.00 15.95 ? 607  HIS A CB  1 
ATOM   4748  C CG  . HIS A 1 607  ? 8.466   74.180  1.678   1.00 14.33 ? 607  HIS A CG  1 
ATOM   4749  N ND1 . HIS A 1 607  ? 9.394   73.819  0.728   1.00 12.67 ? 607  HIS A ND1 1 
ATOM   4750  C CD2 . HIS A 1 607  ? 7.724   73.072  1.917   1.00 14.20 ? 607  HIS A CD2 1 
ATOM   4751  C CE1 . HIS A 1 607  ? 9.226   72.549  0.414   1.00 14.75 ? 607  HIS A CE1 1 
ATOM   4752  N NE2 . HIS A 1 607  ? 8.218   72.072  1.122   1.00 13.40 ? 607  HIS A NE2 1 
ATOM   4753  N N   . GLU A 1 608  ? 11.479  76.577  2.548   1.00 17.54 ? 608  GLU A N   1 
ATOM   4754  C CA  . GLU A 1 608  ? 12.851  76.455  2.071   1.00 18.70 ? 608  GLU A CA  1 
ATOM   4755  C C   . GLU A 1 608  ? 13.904  76.680  3.161   1.00 18.78 ? 608  GLU A C   1 
ATOM   4756  O O   . GLU A 1 608  ? 14.857  75.902  3.272   1.00 17.64 ? 608  GLU A O   1 
ATOM   4757  C CB  . GLU A 1 608  ? 13.088  77.410  0.895   1.00 19.45 ? 608  GLU A CB  1 
ATOM   4758  C CG  . GLU A 1 608  ? 12.206  77.115  -0.324  1.00 23.65 ? 608  GLU A CG  1 
ATOM   4759  C CD  . GLU A 1 608  ? 12.515  75.772  -0.994  1.00 25.10 ? 608  GLU A CD  1 
ATOM   4760  O OE1 . GLU A 1 608  ? 13.592  75.640  -1.628  1.00 26.38 ? 608  GLU A OE1 1 
ATOM   4761  O OE2 . GLU A 1 608  ? 11.677  74.848  -0.888  1.00 24.25 ? 608  GLU A OE2 1 
ATOM   4762  N N   . GLY A 1 609  ? 13.721  77.720  3.977   1.00 18.12 ? 609  GLY A N   1 
ATOM   4763  C CA  . GLY A 1 609  ? 14.693  78.013  5.019   1.00 16.55 ? 609  GLY A CA  1 
ATOM   4764  C C   . GLY A 1 609  ? 14.854  76.896  6.033   1.00 16.41 ? 609  GLY A C   1 
ATOM   4765  O O   . GLY A 1 609  ? 15.871  76.776  6.721   1.00 18.18 ? 609  GLY A O   1 
ATOM   4766  N N   . VAL A 1 610  ? 13.843  76.053  6.095   1.00 14.99 ? 610  VAL A N   1 
ATOM   4767  C CA  . VAL A 1 610  ? 13.787  74.953  7.030   1.00 15.35 ? 610  VAL A CA  1 
ATOM   4768  C C   . VAL A 1 610  ? 14.366  73.636  6.481   1.00 17.72 ? 610  VAL A C   1 
ATOM   4769  O O   . VAL A 1 610  ? 14.699  72.723  7.241   1.00 17.49 ? 610  VAL A O   1 
ATOM   4770  C CB  . VAL A 1 610  ? 12.301  74.816  7.455   1.00 14.81 ? 610  VAL A CB  1 
ATOM   4771  C CG1 . VAL A 1 610  ? 11.878  73.387  7.552   1.00 12.61 ? 610  VAL A CG1 1 
ATOM   4772  C CG2 . VAL A 1 610  ? 12.083  75.568  8.755   1.00 14.25 ? 610  VAL A CG2 1 
ATOM   4773  N N   . ALA A 1 611  ? 14.523  73.565  5.161   1.00 19.11 ? 611  ALA A N   1 
ATOM   4774  C CA  . ALA A 1 611  ? 15.017  72.364  4.481   1.00 20.50 ? 611  ALA A CA  1 
ATOM   4775  C C   . ALA A 1 611  ? 16.270  71.623  4.980   1.00 21.45 ? 611  ALA A C   1 
ATOM   4776  O O   . ALA A 1 611  ? 16.194  70.432  5.246   1.00 23.31 ? 611  ALA A O   1 
ATOM   4777  C CB  . ALA A 1 611  ? 15.168  72.653  2.986   1.00 15.82 ? 611  ALA A CB  1 
ATOM   4778  N N   . SER A 1 612  ? 17.409  72.295  5.112   1.00 22.56 ? 612  SER A N   1 
ATOM   4779  C CA  . SER A 1 612  ? 18.636  71.602  5.524   1.00 24.64 ? 612  SER A CA  1 
ATOM   4780  C C   . SER A 1 612  ? 18.723  71.113  6.967   1.00 25.28 ? 612  SER A C   1 
ATOM   4781  O O   . SER A 1 612  ? 19.319  70.067  7.234   1.00 25.53 ? 612  SER A O   1 
ATOM   4782  C CB  . SER A 1 612  ? 19.869  72.459  5.206   1.00 23.57 ? 612  SER A CB  1 
ATOM   4783  O OG  . SER A 1 612  ? 19.813  73.707  5.871   1.00 26.19 ? 612  SER A OG  1 
ATOM   4784  N N   . SER A 1 613  ? 18.134  71.852  7.897   1.00 25.54 ? 613  SER A N   1 
ATOM   4785  C CA  . SER A 1 613  ? 18.183  71.446  9.293   1.00 25.17 ? 613  SER A CA  1 
ATOM   4786  C C   . SER A 1 613  ? 17.128  70.418  9.690   1.00 26.98 ? 613  SER A C   1 
ATOM   4787  O O   . SER A 1 613  ? 17.319  69.669  10.651  1.00 27.63 ? 613  SER A O   1 
ATOM   4788  C CB  . SER A 1 613  ? 18.063  72.665  10.205  1.00 25.10 ? 613  SER A CB  1 
ATOM   4789  O OG  . SER A 1 613  ? 19.216  73.481  10.118  1.00 24.25 ? 613  SER A OG  1 
ATOM   4790  N N   . SER A 1 614  ? 16.015  70.376  8.964   1.00 26.18 ? 614  SER A N   1 
ATOM   4791  C CA  . SER A 1 614  ? 14.953  69.425  9.279   1.00 25.09 ? 614  SER A CA  1 
ATOM   4792  C C   . SER A 1 614  ? 14.997  68.217  8.352   1.00 25.77 ? 614  SER A C   1 
ATOM   4793  O O   . SER A 1 614  ? 14.177  67.308  8.466   1.00 25.05 ? 614  SER A O   1 
ATOM   4794  C CB  . SER A 1 614  ? 13.593  70.113  9.161   1.00 24.90 ? 614  SER A CB  1 
ATOM   4795  O OG  . SER A 1 614  ? 13.312  70.482  7.823   1.00 23.10 ? 614  SER A OG  1 
ATOM   4796  N N   . ILE A 1 615  ? 15.983  68.224  7.457   1.00 27.46 ? 615  ILE A N   1 
ATOM   4797  C CA  . ILE A 1 615  ? 16.213  67.201  6.434   1.00 29.95 ? 615  ILE A CA  1 
ATOM   4798  C C   . ILE A 1 615  ? 15.464  65.862  6.425   1.00 31.12 ? 615  ILE A C   1 
ATOM   4799  O O   . ILE A 1 615  ? 14.574  65.655  5.589   1.00 33.04 ? 615  ILE A O   1 
ATOM   4800  C CB  . ILE A 1 615  ? 17.714  66.888  6.306   1.00 31.39 ? 615  ILE A CB  1 
ATOM   4801  C CG1 . ILE A 1 615  ? 17.944  66.029  5.058   1.00 31.00 ? 615  ILE A CG1 1 
ATOM   4802  C CG2 . ILE A 1 615  ? 18.223  66.203  7.569   1.00 32.19 ? 615  ILE A CG2 1 
ATOM   4803  C CD1 . ILE A 1 615  ? 17.597  66.738  3.767   1.00 28.12 ? 615  ILE A CD1 1 
ATOM   4804  N N   . GLY A 1 616  ? 15.812  64.938  7.314   1.00 30.04 ? 616  GLY A N   1 
ATOM   4805  C CA  . GLY A 1 616  ? 15.126  63.653  7.276   1.00 30.57 ? 616  GLY A CA  1 
ATOM   4806  C C   . GLY A 1 616  ? 14.454  63.279  8.575   1.00 31.57 ? 616  GLY A C   1 
ATOM   4807  O O   . GLY A 1 616  ? 14.687  62.200  9.124   1.00 31.83 ? 616  GLY A O   1 
ATOM   4808  N N   . LYS A 1 617  ? 13.595  64.164  9.063   1.00 30.63 ? 617  LYS A N   1 
ATOM   4809  C CA  . LYS A 1 617  ? 12.932  63.918  10.322  1.00 28.41 ? 617  LYS A CA  1 
ATOM   4810  C C   . LYS A 1 617  ? 11.469  64.307  10.323  1.00 27.51 ? 617  LYS A C   1 
ATOM   4811  O O   . LYS A 1 617  ? 11.029  65.153  9.552   1.00 28.58 ? 617  LYS A O   1 
ATOM   4812  C CB  . LYS A 1 617  ? 13.649  64.697  11.423  1.00 27.56 ? 617  LYS A CB  1 
ATOM   4813  C CG  . LYS A 1 617  ? 15.157  64.513  11.427  1.00 27.73 ? 617  LYS A CG  1 
ATOM   4814  C CD  . LYS A 1 617  ? 15.830  65.332  12.521  1.00 26.19 ? 617  LYS A CD  1 
ATOM   4815  C CE  . LYS A 1 617  ? 15.844  66.809  12.184  1.00 24.84 ? 617  LYS A CE  1 
ATOM   4816  N NZ  . LYS A 1 617  ? 16.537  67.024  10.897  1.00 27.21 ? 617  LYS A NZ  1 
ATOM   4817  N N   . PRO A 1 618  ? 10.686  63.675  11.192  1.00 26.97 ? 618  PRO A N   1 
ATOM   4818  C CA  . PRO A 1 618  ? 9.268   63.998  11.277  1.00 25.64 ? 618  PRO A CA  1 
ATOM   4819  C C   . PRO A 1 618  ? 9.233   65.154  12.271  1.00 24.34 ? 618  PRO A C   1 
ATOM   4820  O O   . PRO A 1 618  ? 10.254  65.490  12.882  1.00 21.68 ? 618  PRO A O   1 
ATOM   4821  C CB  . PRO A 1 618  ? 8.680   62.733  11.867  1.00 26.03 ? 618  PRO A CB  1 
ATOM   4822  C CG  . PRO A 1 618  ? 9.720   62.376  12.886  1.00 25.96 ? 618  PRO A CG  1 
ATOM   4823  C CD  . PRO A 1 618  ? 11.025  62.576  12.116  1.00 27.21 ? 618  PRO A CD  1 
ATOM   4824  N N   . PHE A 1 619  ? 8.078   65.773  12.441  1.00 23.36 ? 619  PHE A N   1 
ATOM   4825  C CA  . PHE A 1 619  ? 8.001   66.864  13.399  1.00 20.38 ? 619  PHE A CA  1 
ATOM   4826  C C   . PHE A 1 619  ? 6.632   66.915  14.063  1.00 19.08 ? 619  PHE A C   1 
ATOM   4827  O O   . PHE A 1 619  ? 5.600   66.936  13.395  1.00 19.32 ? 619  PHE A O   1 
ATOM   4828  C CB  . PHE A 1 619  ? 8.313   68.196  12.720  1.00 18.09 ? 619  PHE A CB  1 
ATOM   4829  C CG  . PHE A 1 619  ? 8.490   69.343  13.689  1.00 19.54 ? 619  PHE A CG  1 
ATOM   4830  C CD1 . PHE A 1 619  ? 9.567   69.368  14.566  1.00 16.52 ? 619  PHE A CD1 1 
ATOM   4831  C CD2 . PHE A 1 619  ? 7.591   70.407  13.707  1.00 15.65 ? 619  PHE A CD2 1 
ATOM   4832  C CE1 . PHE A 1 619  ? 9.747   70.437  15.438  1.00 17.43 ? 619  PHE A CE1 1 
ATOM   4833  C CE2 . PHE A 1 619  ? 7.770   71.473  14.574  1.00 15.46 ? 619  PHE A CE2 1 
ATOM   4834  C CZ  . PHE A 1 619  ? 8.848   71.489  15.439  1.00 15.28 ? 619  PHE A CZ  1 
ATOM   4835  N N   . MET A 1 620  ? 6.638   66.923  15.389  1.00 18.73 ? 620  MET A N   1 
ATOM   4836  C CA  . MET A 1 620  ? 5.406   66.977  16.164  1.00 17.83 ? 620  MET A CA  1 
ATOM   4837  C C   . MET A 1 620  ? 4.352   65.979  15.714  1.00 18.07 ? 620  MET A C   1 
ATOM   4838  O O   . MET A 1 620  ? 3.162   66.237  15.835  1.00 19.15 ? 620  MET A O   1 
ATOM   4839  C CB  . MET A 1 620  ? 4.832   68.385  16.111  1.00 16.95 ? 620  MET A CB  1 
ATOM   4840  C CG  . MET A 1 620  ? 5.670   69.394  16.853  1.00 17.01 ? 620  MET A CG  1 
ATOM   4841  S SD  . MET A 1 620  ? 5.043   71.039  16.617  1.00 17.46 ? 620  MET A SD  1 
ATOM   4842  C CE  . MET A 1 620  ? 3.430   70.914  17.424  1.00 20.53 ? 620  MET A CE  1 
ATOM   4843  N N   . GLY A 1 621  ? 4.791   64.839  15.196  1.00 19.77 ? 621  GLY A N   1 
ATOM   4844  C CA  . GLY A 1 621  ? 3.852   63.826  14.752  1.00 20.41 ? 621  GLY A CA  1 
ATOM   4845  C C   . GLY A 1 621  ? 3.622   63.784  13.252  1.00 20.86 ? 621  GLY A C   1 
ATOM   4846  O O   . GLY A 1 621  ? 2.985   62.863  12.749  1.00 22.74 ? 621  GLY A O   1 
ATOM   4847  N N   . VAL A 1 622  ? 4.118   64.772  12.521  1.00 19.80 ? 622  VAL A N   1 
ATOM   4848  C CA  . VAL A 1 622  ? 3.918   64.759  11.083  1.00 18.72 ? 622  VAL A CA  1 
ATOM   4849  C C   . VAL A 1 622  ? 5.147   64.173  10.400  1.00 18.89 ? 622  VAL A C   1 
ATOM   4850  O O   . VAL A 1 622  ? 6.277   64.626  10.606  1.00 18.98 ? 622  VAL A O   1 
ATOM   4851  C CB  . VAL A 1 622  ? 3.627   66.157  10.553  1.00 17.66 ? 622  VAL A CB  1 
ATOM   4852  C CG1 . VAL A 1 622  ? 3.355   66.101  9.055   1.00 18.11 ? 622  VAL A CG1 1 
ATOM   4853  C CG2 . VAL A 1 622  ? 2.440   66.723  11.279  1.00 15.30 ? 622  VAL A CG2 1 
ATOM   4854  N N   . PRO A 1 623  ? 4.934   63.143  9.579   1.00 18.03 ? 623  PRO A N   1 
ATOM   4855  C CA  . PRO A 1 623  ? 5.979   62.437  8.841   1.00 19.62 ? 623  PRO A CA  1 
ATOM   4856  C C   . PRO A 1 623  ? 6.507   63.170  7.625   1.00 20.82 ? 623  PRO A C   1 
ATOM   4857  O O   . PRO A 1 623  ? 5.840   64.040  7.066   1.00 20.89 ? 623  PRO A O   1 
ATOM   4858  C CB  . PRO A 1 623  ? 5.280   61.155  8.431   1.00 17.23 ? 623  PRO A CB  1 
ATOM   4859  C CG  . PRO A 1 623  ? 3.922   61.680  8.064   1.00 16.77 ? 623  PRO A CG  1 
ATOM   4860  C CD  . PRO A 1 623  ? 3.606   62.606  9.231   1.00 18.35 ? 623  PRO A CD  1 
ATOM   4861  N N   . ALA A 1 624  ? 7.713   62.796  7.217   1.00 21.34 ? 624  ALA A N   1 
ATOM   4862  C CA  . ALA A 1 624  ? 8.314   63.363  6.023   1.00 22.24 ? 624  ALA A CA  1 
ATOM   4863  C C   . ALA A 1 624  ? 7.496   62.784  4.867   1.00 22.46 ? 624  ALA A C   1 
ATOM   4864  O O   . ALA A 1 624  ? 6.710   61.846  5.060   1.00 21.69 ? 624  ALA A O   1 
ATOM   4865  C CB  . ALA A 1 624  ? 9.772   62.925  5.912   1.00 19.62 ? 624  ALA A CB  1 
ATOM   4866  N N   . SER A 1 625  ? 7.642   63.357  3.677   1.00 23.59 ? 625  SER A N   1 
ATOM   4867  C CA  . SER A 1 625  ? 6.928   62.830  2.519   1.00 25.72 ? 625  SER A CA  1 
ATOM   4868  C C   . SER A 1 625  ? 7.600   63.156  1.194   1.00 27.06 ? 625  SER A C   1 
ATOM   4869  O O   . SER A 1 625  ? 8.791   63.485  1.146   1.00 27.38 ? 625  SER A O   1 
ATOM   4870  C CB  . SER A 1 625  ? 5.466   63.297  2.500   1.00 25.22 ? 625  SER A CB  1 
ATOM   4871  O OG  . SER A 1 625  ? 5.365   64.699  2.476   1.00 28.10 ? 625  SER A OG  1 
ATOM   4872  N N   . ILE A 1 626  ? 6.833   63.025  0.117   1.00 28.43 ? 626  ILE A N   1 
ATOM   4873  C CA  . ILE A 1 626  ? 7.339   63.284  -1.221  1.00 28.52 ? 626  ILE A CA  1 
ATOM   4874  C C   . ILE A 1 626  ? 6.383   64.226  -1.895  1.00 27.98 ? 626  ILE A C   1 
ATOM   4875  O O   . ILE A 1 626  ? 5.167   64.039  -1.839  1.00 27.02 ? 626  ILE A O   1 
ATOM   4876  C CB  . ILE A 1 626  ? 7.436   61.990  -2.078  1.00 28.37 ? 626  ILE A CB  1 
ATOM   4877  C CG1 . ILE A 1 626  ? 8.324   60.960  -1.378  1.00 29.68 ? 626  ILE A CG1 1 
ATOM   4878  C CG2 . ILE A 1 626  ? 8.035   62.315  -3.440  1.00 27.79 ? 626  ILE A CG2 1 
ATOM   4879  C CD1 . ILE A 1 626  ? 9.729   61.466  -1.088  1.00 31.00 ? 626  ILE A CD1 1 
ATOM   4880  N N   . VAL A 1 627  ? 6.947   65.227  -2.552  1.00 27.81 ? 627  VAL A N   1 
ATOM   4881  C CA  . VAL A 1 627  ? 6.154   66.231  -3.230  1.00 28.77 ? 627  VAL A CA  1 
ATOM   4882  C C   . VAL A 1 627  ? 6.590   66.401  -4.680  1.00 29.40 ? 627  VAL A C   1 
ATOM   4883  O O   . VAL A 1 627  ? 7.729   66.090  -5.042  1.00 28.97 ? 627  VAL A O   1 
ATOM   4884  C CB  . VAL A 1 627  ? 6.249   67.569  -2.437  1.00 28.85 ? 627  VAL A CB  1 
ATOM   4885  C CG1 . VAL A 1 627  ? 6.284   68.763  -3.365  1.00 30.24 ? 627  VAL A CG1 1 
ATOM   4886  C CG2 . VAL A 1 627  ? 5.081   67.661  -1.482  1.00 25.49 ? 627  VAL A CG2 1 
ATOM   4887  N N   . ASN A 1 628  ? 5.660   66.872  -5.505  1.00 31.61 ? 628  ASN A N   1 
ATOM   4888  C CA  . ASN A 1 628  ? 5.902   67.112  -6.925  1.00 33.35 ? 628  ASN A CA  1 
ATOM   4889  C C   . ASN A 1 628  ? 6.759   68.368  -7.066  1.00 34.22 ? 628  ASN A C   1 
ATOM   4890  O O   . ASN A 1 628  ? 6.412   69.427  -6.545  1.00 33.80 ? 628  ASN A O   1 
ATOM   4891  C CB  . ASN A 1 628  ? 4.556   67.272  -7.634  1.00 35.67 ? 628  ASN A CB  1 
ATOM   4892  C CG  . ASN A 1 628  ? 4.695   67.695  -9.071  1.00 38.77 ? 628  ASN A CG  1 
ATOM   4893  O OD1 . ASN A 1 628  ? 4.745   68.888  -9.378  1.00 40.78 ? 628  ASN A OD1 1 
ATOM   4894  N ND2 . ASN A 1 628  ? 4.761   66.716  -9.970  1.00 40.70 ? 628  ASN A ND2 1 
ATOM   4895  N N   . ASP A 1 629  ? 7.885   68.246  -7.762  1.00 34.95 ? 629  ASP A N   1 
ATOM   4896  C CA  . ASP A 1 629  ? 8.797   69.375  -7.920  1.00 36.88 ? 629  ASP A CA  1 
ATOM   4897  C C   . ASP A 1 629  ? 8.975   69.893  -9.344  1.00 38.47 ? 629  ASP A C   1 
ATOM   4898  O O   . ASP A 1 629  ? 9.721   69.321  -10.139 1.00 39.03 ? 629  ASP A O   1 
ATOM   4899  C CB  . ASP A 1 629  ? 10.171  69.007  -7.363  1.00 36.61 ? 629  ASP A CB  1 
ATOM   4900  C CG  . ASP A 1 629  ? 11.127  70.183  -7.343  1.00 36.96 ? 629  ASP A CG  1 
ATOM   4901  O OD1 . ASP A 1 629  ? 11.165  70.946  -8.328  1.00 36.40 ? 629  ASP A OD1 1 
ATOM   4902  O OD2 . ASP A 1 629  ? 11.849  70.335  -6.337  1.00 37.54 ? 629  ASP A OD2 1 
ATOM   4903  N N   . GLU A 1 630  ? 8.308   70.996  -9.650  1.00 40.03 ? 630  GLU A N   1 
ATOM   4904  C CA  . GLU A 1 630  ? 8.413   71.609  -10.962 1.00 42.20 ? 630  GLU A CA  1 
ATOM   4905  C C   . GLU A 1 630  ? 9.123   72.954  -10.792 1.00 43.05 ? 630  GLU A C   1 
ATOM   4906  O O   . GLU A 1 630  ? 8.905   73.899  -11.544 1.00 42.67 ? 630  GLU A O   1 
ATOM   4907  C CB  . GLU A 1 630  ? 7.013   71.766  -11.558 1.00 43.69 ? 630  GLU A CB  1 
ATOM   4908  C CG  . GLU A 1 630  ? 6.286   70.423  -11.656 1.00 47.33 ? 630  GLU A CG  1 
ATOM   4909  C CD  . GLU A 1 630  ? 4.898   70.513  -12.267 1.00 49.42 ? 630  GLU A CD  1 
ATOM   4910  O OE1 . GLU A 1 630  ? 4.039   71.241  -11.724 1.00 51.46 ? 630  GLU A OE1 1 
ATOM   4911  O OE2 . GLU A 1 630  ? 4.663   69.840  -13.292 1.00 51.45 ? 630  GLU A OE2 1 
ATOM   4912  N N   . SER A 1 631  ? 9.991   73.001  -9.783  1.00 45.45 ? 631  SER A N   1 
ATOM   4913  C CA  . SER A 1 631  ? 10.786  74.176  -9.430  1.00 47.68 ? 631  SER A CA  1 
ATOM   4914  C C   . SER A 1 631  ? 11.718  74.596  -10.565 1.00 49.34 ? 631  SER A C   1 
ATOM   4915  O O   . SER A 1 631  ? 11.642  75.719  -11.070 1.00 49.01 ? 631  SER A O   1 
ATOM   4916  C CB  . SER A 1 631  ? 11.610  73.862  -8.179  1.00 47.70 ? 631  SER A CB  1 
ATOM   4917  O OG  . SER A 1 631  ? 12.594  74.849  -7.940  1.00 51.80 ? 631  SER A OG  1 
ATOM   4918  N N   . VAL A 1 632  ? 12.608  73.686  -10.948 1.00 51.14 ? 632  VAL A N   1 
ATOM   4919  C CA  . VAL A 1 632  ? 13.553  73.939  -12.029 1.00 51.87 ? 632  VAL A CA  1 
ATOM   4920  C C   . VAL A 1 632  ? 12.775  73.823  -13.328 1.00 52.43 ? 632  VAL A C   1 
ATOM   4921  O O   . VAL A 1 632  ? 12.044  72.858  -13.534 1.00 52.19 ? 632  VAL A O   1 
ATOM   4922  C CB  . VAL A 1 632  ? 14.718  72.906  -12.016 1.00 51.96 ? 632  VAL A CB  1 
ATOM   4923  C CG1 . VAL A 1 632  ? 15.627  73.111  -13.221 1.00 51.73 ? 632  VAL A CG1 1 
ATOM   4924  C CG2 . VAL A 1 632  ? 15.521  73.046  -10.728 1.00 50.77 ? 632  VAL A CG2 1 
ATOM   4925  N N   . VAL A 1 633  ? 12.925  74.817  -14.195 1.00 53.73 ? 633  VAL A N   1 
ATOM   4926  C CA  . VAL A 1 633  ? 12.218  74.836  -15.471 1.00 54.88 ? 633  VAL A CA  1 
ATOM   4927  C C   . VAL A 1 633  ? 12.435  73.547  -16.279 1.00 55.48 ? 633  VAL A C   1 
ATOM   4928  O O   . VAL A 1 633  ? 13.561  73.052  -16.394 1.00 54.40 ? 633  VAL A O   1 
ATOM   4929  C CB  . VAL A 1 633  ? 12.659  76.059  -16.316 1.00 54.99 ? 633  VAL A CB  1 
ATOM   4930  C CG1 . VAL A 1 633  ? 11.720  76.241  -17.506 1.00 54.72 ? 633  VAL A CG1 1 
ATOM   4931  C CG2 . VAL A 1 633  ? 12.681  77.309  -15.445 1.00 53.41 ? 633  VAL A CG2 1 
ATOM   4932  N N   . GLY A 1 634  ? 11.345  73.009  -16.826 1.00 55.87 ? 634  GLY A N   1 
ATOM   4933  C CA  . GLY A 1 634  ? 11.419  71.790  -17.618 1.00 57.01 ? 634  GLY A CA  1 
ATOM   4934  C C   . GLY A 1 634  ? 11.433  70.517  -16.789 1.00 57.16 ? 634  GLY A C   1 
ATOM   4935  O O   . GLY A 1 634  ? 10.559  69.661  -16.921 1.00 56.81 ? 634  GLY A O   1 
ATOM   4936  N N   . VAL A 1 635  ? 12.444  70.398  -15.934 1.00 57.53 ? 635  VAL A N   1 
ATOM   4937  C CA  . VAL A 1 635  ? 12.605  69.247  -15.056 1.00 57.52 ? 635  VAL A CA  1 
ATOM   4938  C C   . VAL A 1 635  ? 11.387  69.068  -14.155 1.00 57.80 ? 635  VAL A C   1 
ATOM   4939  O O   . VAL A 1 635  ? 10.757  70.038  -13.731 1.00 58.24 ? 635  VAL A O   1 
ATOM   4940  C CB  . VAL A 1 635  ? 13.851  69.417  -14.152 1.00 57.42 ? 635  VAL A CB  1 
ATOM   4941  C CG1 . VAL A 1 635  ? 13.972  68.242  -13.191 1.00 58.24 ? 635  VAL A CG1 1 
ATOM   4942  C CG2 . VAL A 1 635  ? 15.098  69.537  -15.003 1.00 57.57 ? 635  VAL A CG2 1 
ATOM   4943  N N   . ARG A 1 636  ? 11.054  67.819  -13.867 1.00 57.49 ? 636  ARG A N   1 
ATOM   4944  C CA  . ARG A 1 636  ? 9.930   67.529  -13.000 1.00 56.83 ? 636  ARG A CA  1 
ATOM   4945  C C   . ARG A 1 636  ? 10.241  66.281  -12.211 1.00 55.46 ? 636  ARG A C   1 
ATOM   4946  O O   . ARG A 1 636  ? 10.164  65.178  -12.741 1.00 55.88 ? 636  ARG A O   1 
ATOM   4947  C CB  . ARG A 1 636  ? 8.658   67.314  -13.806 1.00 58.23 ? 636  ARG A CB  1 
ATOM   4948  C CG  . ARG A 1 636  ? 7.497   66.927  -12.923 1.00 61.20 ? 636  ARG A CG  1 
ATOM   4949  C CD  . ARG A 1 636  ? 6.213   66.725  -13.691 1.00 63.52 ? 636  ARG A CD  1 
ATOM   4950  N NE  . ARG A 1 636  ? 5.142   66.328  -12.785 1.00 65.41 ? 636  ARG A NE  1 
ATOM   4951  C CZ  . ARG A 1 636  ? 3.898   66.069  -13.164 1.00 66.79 ? 636  ARG A CZ  1 
ATOM   4952  N NH1 . ARG A 1 636  ? 3.561   66.161  -14.443 1.00 66.99 ? 636  ARG A NH1 1 
ATOM   4953  N NH2 . ARG A 1 636  ? 2.991   65.723  -12.258 1.00 67.63 ? 636  ARG A NH2 1 
ATOM   4954  N N   . ALA A 1 637  ? 10.589  66.458  -10.942 1.00 54.47 ? 637  ALA A N   1 
ATOM   4955  C CA  . ALA A 1 637  ? 10.929  65.330  -10.087 1.00 53.59 ? 637  ALA A CA  1 
ATOM   4956  C C   . ALA A 1 637  ? 10.050  65.228  -8.856  1.00 52.86 ? 637  ALA A C   1 
ATOM   4957  O O   . ALA A 1 637  ? 9.155   66.041  -8.638  1.00 52.97 ? 637  ALA A O   1 
ATOM   4958  C CB  . ALA A 1 637  ? 12.387  65.427  -9.661  1.00 53.48 ? 637  ALA A CB  1 
ATOM   4959  N N   . ALA A 1 638  ? 10.313  64.202  -8.059  1.00 51.35 ? 638  ALA A N   1 
ATOM   4960  C CA  . ALA A 1 638  ? 9.589   63.981  -6.824  1.00 50.36 ? 638  ALA A CA  1 
ATOM   4961  C C   . ALA A 1 638  ? 10.624  64.247  -5.745  1.00 49.62 ? 638  ALA A C   1 
ATOM   4962  O O   . ALA A 1 638  ? 11.518  63.429  -5.523  1.00 49.86 ? 638  ALA A O   1 
ATOM   4963  C CB  . ALA A 1 638  ? 9.103   62.552  -6.748  1.00 49.83 ? 638  ALA A CB  1 
ATOM   4964  N N   . ARG A 1 639  ? 10.512  65.395  -5.083  1.00 47.78 ? 639  ARG A N   1 
ATOM   4965  C CA  . ARG A 1 639  ? 11.469  65.764  -4.050  1.00 45.20 ? 639  ARG A CA  1 
ATOM   4966  C C   . ARG A 1 639  ? 11.069  65.393  -2.624  1.00 41.26 ? 639  ARG A C   1 
ATOM   4967  O O   . ARG A 1 639  ? 9.948   65.634  -2.190  1.00 41.62 ? 639  ARG A O   1 
ATOM   4968  C CB  . ARG A 1 639  ? 11.754  67.271  -4.121  1.00 47.28 ? 639  ARG A CB  1 
ATOM   4969  C CG  . ARG A 1 639  ? 12.743  67.784  -3.065  1.00 49.63 ? 639  ARG A CG  1 
ATOM   4970  C CD  . ARG A 1 639  ? 12.929  69.299  -3.145  1.00 51.96 ? 639  ARG A CD  1 
ATOM   4971  N NE  . ARG A 1 639  ? 13.605  69.710  -4.374  1.00 53.84 ? 639  ARG A NE  1 
ATOM   4972  C CZ  . ARG A 1 639  ? 13.806  70.972  -4.748  1.00 55.10 ? 639  ARG A CZ  1 
ATOM   4973  N NH1 . ARG A 1 639  ? 13.380  71.981  -3.990  1.00 54.27 ? 639  ARG A NH1 1 
ATOM   4974  N NH2 . ARG A 1 639  ? 14.438  71.225  -5.891  1.00 55.55 ? 639  ARG A NH2 1 
ATOM   4975  N N   . PRO A 1 640  ? 11.990  64.770  -1.884  1.00 38.15 ? 640  PRO A N   1 
ATOM   4976  C CA  . PRO A 1 640  ? 11.705  64.391  -0.499  1.00 35.93 ? 640  PRO A CA  1 
ATOM   4977  C C   . PRO A 1 640  ? 11.718  65.648  0.374   1.00 33.54 ? 640  PRO A C   1 
ATOM   4978  O O   . PRO A 1 640  ? 12.601  66.505  0.244   1.00 32.76 ? 640  PRO A O   1 
ATOM   4979  C CB  . PRO A 1 640  ? 12.861  63.450  -0.150  1.00 35.06 ? 640  PRO A CB  1 
ATOM   4980  C CG  . PRO A 1 640  ? 13.203  62.840  -1.461  1.00 36.88 ? 640  PRO A CG  1 
ATOM   4981  C CD  . PRO A 1 640  ? 13.161  64.036  -2.389  1.00 37.94 ? 640  PRO A CD  1 
ATOM   4982  N N   . ILE A 1 641  ? 10.733  65.759  1.256   1.00 30.57 ? 641  ILE A N   1 
ATOM   4983  C CA  . ILE A 1 641  ? 10.651  66.903  2.148   1.00 26.09 ? 641  ILE A CA  1 
ATOM   4984  C C   . ILE A 1 641  ? 10.491  66.373  3.561   1.00 24.78 ? 641  ILE A C   1 
ATOM   4985  O O   . ILE A 1 641  ? 10.063  65.237  3.751   1.00 23.45 ? 641  ILE A O   1 
ATOM   4986  C CB  . ILE A 1 641  ? 9.464   67.810  1.780   1.00 25.50 ? 641  ILE A CB  1 
ATOM   4987  C CG1 . ILE A 1 641  ? 8.175   66.988  1.723   1.00 24.73 ? 641  ILE A CG1 1 
ATOM   4988  C CG2 . ILE A 1 641  ? 9.720   68.471  0.445   1.00 22.49 ? 641  ILE A CG2 1 
ATOM   4989  C CD1 . ILE A 1 641  ? 6.924   67.822  1.572   1.00 24.59 ? 641  ILE A CD1 1 
ATOM   4990  N N   . SER A 1 642  ? 10.838  67.196  4.547   1.00 23.92 ? 642  SER A N   1 
ATOM   4991  C CA  . SER A 1 642  ? 10.765  66.807  5.952   1.00 22.81 ? 642  SER A CA  1 
ATOM   4992  C C   . SER A 1 642  ? 9.358   66.880  6.533   1.00 22.84 ? 642  SER A C   1 
ATOM   4993  O O   . SER A 1 642  ? 8.412   67.320  5.866   1.00 23.14 ? 642  SER A O   1 
ATOM   4994  C CB  . SER A 1 642  ? 11.682  67.704  6.782   1.00 23.02 ? 642  SER A CB  1 
ATOM   4995  O OG  . SER A 1 642  ? 11.215  69.042  6.776   1.00 23.11 ? 642  SER A OG  1 
ATOM   4996  N N   . GLY A 1 643  ? 9.227   66.441  7.783   1.00 21.49 ? 643  GLY A N   1 
ATOM   4997  C CA  . GLY A 1 643  ? 7.941   66.507  8.450   1.00 19.48 ? 643  GLY A CA  1 
ATOM   4998  C C   . GLY A 1 643  ? 7.535   67.968  8.580   1.00 18.73 ? 643  GLY A C   1 
ATOM   4999  O O   . GLY A 1 643  ? 6.398   68.351  8.289   1.00 17.45 ? 643  GLY A O   1 
ATOM   5000  N N   . MET A 1 644  ? 8.483   68.791  9.012   1.00 18.85 ? 644  MET A N   1 
ATOM   5001  C CA  . MET A 1 644  ? 8.242   70.217  9.171   1.00 19.25 ? 644  MET A CA  1 
ATOM   5002  C C   . MET A 1 644  ? 7.728   70.795  7.843   1.00 18.46 ? 644  MET A C   1 
ATOM   5003  O O   . MET A 1 644  ? 6.689   71.453  7.804   1.00 18.32 ? 644  MET A O   1 
ATOM   5004  C CB  . MET A 1 644  ? 9.536   70.904  9.618   1.00 17.76 ? 644  MET A CB  1 
ATOM   5005  C CG  . MET A 1 644  ? 9.345   72.326  10.078  1.00 19.84 ? 644  MET A CG  1 
ATOM   5006  S SD  . MET A 1 644  ? 10.767  73.038  10.930  1.00 21.65 ? 644  MET A SD  1 
ATOM   5007  C CE  . MET A 1 644  ? 10.636  72.253  12.526  1.00 20.30 ? 644  MET A CE  1 
ATOM   5008  N N   . GLN A 1 645  ? 8.443   70.514  6.758   1.00 18.34 ? 645  GLN A N   1 
ATOM   5009  C CA  . GLN A 1 645  ? 8.060   70.987  5.432   1.00 18.20 ? 645  GLN A CA  1 
ATOM   5010  C C   . GLN A 1 645  ? 6.694   70.436  5.061   1.00 19.37 ? 645  GLN A C   1 
ATOM   5011  O O   . GLN A 1 645  ? 5.862   71.135  4.458   1.00 20.16 ? 645  GLN A O   1 
ATOM   5012  C CB  . GLN A 1 645  ? 9.101   70.554  4.385   1.00 17.78 ? 645  GLN A CB  1 
ATOM   5013  C CG  . GLN A 1 645  ? 10.448  71.267  4.537   1.00 17.96 ? 645  GLN A CG  1 
ATOM   5014  C CD  . GLN A 1 645  ? 11.525  70.763  3.577   1.00 17.99 ? 645  GLN A CD  1 
ATOM   5015  O OE1 . GLN A 1 645  ? 11.817  69.566  3.522   1.00 17.55 ? 645  GLN A OE1 1 
ATOM   5016  N NE2 . GLN A 1 645  ? 12.130  71.682  2.829   1.00 14.26 ? 645  GLN A NE2 1 
ATOM   5017  N N   . ASN A 1 646  ? 6.458   69.181  5.429   1.00 19.61 ? 646  ASN A N   1 
ATOM   5018  C CA  . ASN A 1 646  ? 5.182   68.547  5.134   1.00 19.77 ? 646  ASN A CA  1 
ATOM   5019  C C   . ASN A 1 646  ? 4.063   69.367  5.768   1.00 19.68 ? 646  ASN A C   1 
ATOM   5020  O O   . ASN A 1 646  ? 3.002   69.550  5.158   1.00 20.96 ? 646  ASN A O   1 
ATOM   5021  C CB  . ASN A 1 646  ? 5.154   67.098  5.655   1.00 20.56 ? 646  ASN A CB  1 
ATOM   5022  C CG  . ASN A 1 646  ? 4.011   66.278  5.052   1.00 21.50 ? 646  ASN A CG  1 
ATOM   5023  O OD1 . ASN A 1 646  ? 3.281   66.750  4.181   1.00 24.03 ? 646  ASN A OD1 1 
ATOM   5024  N ND2 . ASN A 1 646  ? 3.861   65.045  5.512   1.00 21.58 ? 646  ASN A ND2 1 
ATOM   5025  N N   . MET A 1 647  ? 4.296   69.874  6.979   1.00 18.40 ? 647  MET A N   1 
ATOM   5026  C CA  . MET A 1 647  ? 3.272   70.679  7.644   1.00 18.45 ? 647  MET A CA  1 
ATOM   5027  C C   . MET A 1 647  ? 2.983   71.922  6.811   1.00 19.32 ? 647  MET A C   1 
ATOM   5028  O O   . MET A 1 647  ? 1.840   72.162  6.422   1.00 18.82 ? 647  MET A O   1 
ATOM   5029  C CB  . MET A 1 647  ? 3.718   71.130  9.032   1.00 17.14 ? 647  MET A CB  1 
ATOM   5030  C CG  . MET A 1 647  ? 3.834   70.053  10.085  1.00 16.41 ? 647  MET A CG  1 
ATOM   5031  S SD  . MET A 1 647  ? 4.623   70.830  11.510  1.00 19.88 ? 647  MET A SD  1 
ATOM   5032  C CE  . MET A 1 647  ? 4.033   69.848  12.887  1.00 20.73 ? 647  MET A CE  1 
ATOM   5033  N N   . ILE A 1 648  ? 4.026   72.707  6.547   1.00 18.90 ? 648  ILE A N   1 
ATOM   5034  C CA  . ILE A 1 648  ? 3.882   73.930  5.771   1.00 19.96 ? 648  ILE A CA  1 
ATOM   5035  C C   . ILE A 1 648  ? 3.135   73.625  4.487   1.00 21.36 ? 648  ILE A C   1 
ATOM   5036  O O   . ILE A 1 648  ? 2.265   74.390  4.054   1.00 19.71 ? 648  ILE A O   1 
ATOM   5037  C CB  . ILE A 1 648  ? 5.269   74.548  5.428   1.00 19.58 ? 648  ILE A CB  1 
ATOM   5038  C CG1 . ILE A 1 648  ? 5.887   75.156  6.685   1.00 19.47 ? 648  ILE A CG1 1 
ATOM   5039  C CG2 . ILE A 1 648  ? 5.126   75.637  4.368   1.00 17.53 ? 648  ILE A CG2 1 
ATOM   5040  C CD1 . ILE A 1 648  ? 5.093   76.332  7.255   1.00 18.46 ? 648  ILE A CD1 1 
ATOM   5041  N N   . GLN A 1 649  ? 3.481   72.484  3.895   1.00 23.37 ? 649  GLN A N   1 
ATOM   5042  C CA  . GLN A 1 649  ? 2.872   72.026  2.653   1.00 23.39 ? 649  GLN A CA  1 
ATOM   5043  C C   . GLN A 1 649  ? 1.344   71.915  2.823   1.00 23.23 ? 649  GLN A C   1 
ATOM   5044  O O   . GLN A 1 649  ? 0.585   72.471  2.027   1.00 23.64 ? 649  GLN A O   1 
ATOM   5045  C CB  . GLN A 1 649  ? 3.510   70.689  2.259   1.00 23.41 ? 649  GLN A CB  1 
ATOM   5046  C CG  . GLN A 1 649  ? 3.305   70.267  0.820   1.00 26.16 ? 649  GLN A CG  1 
ATOM   5047  C CD  . GLN A 1 649  ? 3.991   71.169  -0.213  1.00 28.03 ? 649  GLN A CD  1 
ATOM   5048  O OE1 . GLN A 1 649  ? 3.464   71.354  -1.298  1.00 28.25 ? 649  GLN A OE1 1 
ATOM   5049  N NE2 . GLN A 1 649  ? 5.165   71.706  0.112   1.00 27.20 ? 649  GLN A NE2 1 
ATOM   5050  N N   . HIS A 1 650  ? 0.886   71.229  3.866   1.00 23.03 ? 650  HIS A N   1 
ATOM   5051  C CA  . HIS A 1 650  ? -0.555  71.101  4.106   1.00 22.47 ? 650  HIS A CA  1 
ATOM   5052  C C   . HIS A 1 650  ? -1.211  72.412  4.529   1.00 22.39 ? 650  HIS A C   1 
ATOM   5053  O O   . HIS A 1 650  ? -2.372  72.660  4.207   1.00 22.87 ? 650  HIS A O   1 
ATOM   5054  C CB  . HIS A 1 650  ? -0.840  70.053  5.184   1.00 23.85 ? 650  HIS A CB  1 
ATOM   5055  C CG  . HIS A 1 650  ? -0.896  68.655  4.662   1.00 26.29 ? 650  HIS A CG  1 
ATOM   5056  N ND1 . HIS A 1 650  ? 0.237   67.928  4.355   1.00 26.92 ? 650  HIS A ND1 1 
ATOM   5057  C CD2 . HIS A 1 650  ? -1.950  67.860  4.362   1.00 24.42 ? 650  HIS A CD2 1 
ATOM   5058  C CE1 . HIS A 1 650  ? -0.120  66.745  3.889   1.00 27.73 ? 650  HIS A CE1 1 
ATOM   5059  N NE2 . HIS A 1 650  ? -1.441  66.679  3.882   1.00 27.35 ? 650  HIS A NE2 1 
ATOM   5060  N N   . LEU A 1 651  ? -0.468  73.239  5.263   1.00 21.15 ? 651  LEU A N   1 
ATOM   5061  C CA  . LEU A 1 651  ? -0.969  74.524  5.738   1.00 18.90 ? 651  LEU A CA  1 
ATOM   5062  C C   . LEU A 1 651  ? -1.228  75.480  4.573   1.00 19.36 ? 651  LEU A C   1 
ATOM   5063  O O   . LEU A 1 651  ? -2.212  76.230  4.575   1.00 17.77 ? 651  LEU A O   1 
ATOM   5064  C CB  . LEU A 1 651  ? 0.050   75.146  6.693   1.00 19.50 ? 651  LEU A CB  1 
ATOM   5065  C CG  . LEU A 1 651  ? -0.285  76.481  7.367   1.00 19.70 ? 651  LEU A CG  1 
ATOM   5066  C CD1 . LEU A 1 651  ? -1.427  76.310  8.364   1.00 20.90 ? 651  LEU A CD1 1 
ATOM   5067  C CD2 . LEU A 1 651  ? 0.932   76.972  8.090   1.00 19.16 ? 651  LEU A CD2 1 
ATOM   5068  N N   . SER A 1 652  ? -0.331  75.444  3.586   1.00 18.71 ? 652  SER A N   1 
ATOM   5069  C CA  . SER A 1 652  ? -0.415  76.299  2.403   1.00 18.19 ? 652  SER A CA  1 
ATOM   5070  C C   . SER A 1 652  ? -1.705  76.069  1.634   1.00 19.74 ? 652  SER A C   1 
ATOM   5071  O O   . SER A 1 652  ? -2.283  77.005  1.065   1.00 19.81 ? 652  SER A O   1 
ATOM   5072  C CB  . SER A 1 652  ? 0.772   76.035  1.475   1.00 17.84 ? 652  SER A CB  1 
ATOM   5073  O OG  . SER A 1 652  ? 2.004   76.373  2.093   1.00 16.02 ? 652  SER A OG  1 
ATOM   5074  N N   . LYS A 1 653  ? -2.156  74.818  1.624   1.00 19.64 ? 653  LYS A N   1 
ATOM   5075  C CA  . LYS A 1 653  ? -3.373  74.465  0.917   1.00 20.43 ? 653  LYS A CA  1 
ATOM   5076  C C   . LYS A 1 653  ? -4.548  75.195  1.549   1.00 18.87 ? 653  LYS A C   1 
ATOM   5077  O O   . LYS A 1 653  ? -5.401  75.731  0.849   1.00 17.62 ? 653  LYS A O   1 
ATOM   5078  C CB  . LYS A 1 653  ? -3.590  72.942  0.948   1.00 22.91 ? 653  LYS A CB  1 
ATOM   5079  C CG  . LYS A 1 653  ? -4.678  72.458  -0.006  1.00 26.10 ? 653  LYS A CG  1 
ATOM   5080  C CD  . LYS A 1 653  ? -4.574  70.961  -0.289  1.00 29.97 ? 653  LYS A CD  1 
ATOM   5081  C CE  . LYS A 1 653  ? -5.586  70.538  -1.358  1.00 31.99 ? 653  LYS A CE  1 
ATOM   5082  N NZ  . LYS A 1 653  ? -5.280  69.209  -1.992  1.00 34.80 ? 653  LYS A NZ  1 
ATOM   5083  N N   . LEU A 1 654  ? -4.580  75.225  2.876   1.00 18.70 ? 654  LEU A N   1 
ATOM   5084  C CA  . LEU A 1 654  ? -5.643  75.917  3.585   1.00 18.60 ? 654  LEU A CA  1 
ATOM   5085  C C   . LEU A 1 654  ? -5.511  77.423  3.374   1.00 19.97 ? 654  LEU A C   1 
ATOM   5086  O O   . LEU A 1 654  ? -6.481  78.092  2.998   1.00 19.26 ? 654  LEU A O   1 
ATOM   5087  C CB  . LEU A 1 654  ? -5.592  75.615  5.096   1.00 16.47 ? 654  LEU A CB  1 
ATOM   5088  C CG  . LEU A 1 654  ? -6.403  76.545  6.027   1.00 12.53 ? 654  LEU A CG  1 
ATOM   5089  C CD1 . LEU A 1 654  ? -7.885  76.439  5.718   1.00 9.80  ? 654  LEU A CD1 1 
ATOM   5090  C CD2 . LEU A 1 654  ? -6.150  76.193  7.478   1.00 9.46  ? 654  LEU A CD2 1 
ATOM   5091  N N   . TYR A 1 655  ? -4.314  77.956  3.627   1.00 21.22 ? 655  TYR A N   1 
ATOM   5092  C CA  . TYR A 1 655  ? -4.086  79.393  3.486   1.00 21.41 ? 655  TYR A CA  1 
ATOM   5093  C C   . TYR A 1 655  ? -4.439  79.852  2.095   1.00 22.64 ? 655  TYR A C   1 
ATOM   5094  O O   . TYR A 1 655  ? -5.033  80.907  1.916   1.00 22.83 ? 655  TYR A O   1 
ATOM   5095  C CB  . TYR A 1 655  ? -2.632  79.754  3.772   1.00 20.53 ? 655  TYR A CB  1 
ATOM   5096  C CG  . TYR A 1 655  ? -2.269  79.844  5.241   1.00 21.76 ? 655  TYR A CG  1 
ATOM   5097  C CD1 . TYR A 1 655  ? -3.212  79.568  6.243   1.00 20.00 ? 655  TYR A CD1 1 
ATOM   5098  C CD2 . TYR A 1 655  ? -0.971  80.208  5.631   1.00 20.61 ? 655  TYR A CD2 1 
ATOM   5099  C CE1 . TYR A 1 655  ? -2.870  79.651  7.596   1.00 20.68 ? 655  TYR A CE1 1 
ATOM   5100  C CE2 . TYR A 1 655  ? -0.615  80.292  6.978   1.00 21.04 ? 655  TYR A CE2 1 
ATOM   5101  C CZ  . TYR A 1 655  ? -1.566  80.014  7.954   1.00 22.17 ? 655  TYR A CZ  1 
ATOM   5102  O OH  . TYR A 1 655  ? -1.211  80.101  9.279   1.00 22.36 ? 655  TYR A OH  1 
ATOM   5103  N N   . LYS A 1 656  ? -4.076  79.035  1.112   1.00 24.92 ? 656  LYS A N   1 
ATOM   5104  C CA  . LYS A 1 656  ? -4.319  79.342  -0.287  1.00 25.14 ? 656  LYS A CA  1 
ATOM   5105  C C   . LYS A 1 656  ? -5.801  79.279  -0.667  1.00 25.45 ? 656  LYS A C   1 
ATOM   5106  O O   . LYS A 1 656  ? -6.302  80.148  -1.384  1.00 22.99 ? 656  LYS A O   1 
ATOM   5107  C CB  . LYS A 1 656  ? -3.493  78.384  -1.150  1.00 25.80 ? 656  LYS A CB  1 
ATOM   5108  C CG  . LYS A 1 656  ? -3.676  78.556  -2.642  1.00 25.80 ? 656  LYS A CG  1 
ATOM   5109  C CD  . LYS A 1 656  ? -2.530  77.916  -3.415  1.00 28.74 ? 656  LYS A CD  1 
ATOM   5110  C CE  . LYS A 1 656  ? -2.361  76.436  -3.104  1.00 27.95 ? 656  LYS A CE  1 
ATOM   5111  N NZ  . LYS A 1 656  ? -1.303  75.836  -3.975  1.00 28.53 ? 656  LYS A NZ  1 
ATOM   5112  N N   . ARG A 1 657  ? -6.492  78.254  -0.178  1.00 26.45 ? 657  ARG A N   1 
ATOM   5113  C CA  . ARG A 1 657  ? -7.911  78.064  -0.468  1.00 28.57 ? 657  ARG A CA  1 
ATOM   5114  C C   . ARG A 1 657  ? -8.772  79.166  0.123   1.00 28.55 ? 657  ARG A C   1 
ATOM   5115  O O   . ARG A 1 657  ? -9.641  79.737  -0.539  1.00 28.16 ? 657  ARG A O   1 
ATOM   5116  C CB  . ARG A 1 657  ? -8.395  76.717  0.083   1.00 30.15 ? 657  ARG A CB  1 
ATOM   5117  C CG  . ARG A 1 657  ? -9.893  76.482  -0.101  1.00 34.75 ? 657  ARG A CG  1 
ATOM   5118  C CD  . ARG A 1 657  ? -10.372 75.098  0.398   1.00 39.28 ? 657  ARG A CD  1 
ATOM   5119  N NE  . ARG A 1 657  ? -10.355 74.929  1.861   1.00 42.68 ? 657  ARG A NE  1 
ATOM   5120  C CZ  . ARG A 1 657  ? -10.930 75.760  2.732   1.00 44.19 ? 657  ARG A CZ  1 
ATOM   5121  N NH1 . ARG A 1 657  ? -11.575 76.842  2.308   1.00 46.81 ? 657  ARG A NH1 1 
ATOM   5122  N NH2 . ARG A 1 657  ? -10.869 75.510  4.033   1.00 42.30 ? 657  ARG A NH2 1 
ATOM   5123  N N   . GLY A 1 658  ? -8.517  79.465  1.384   1.00 29.56 ? 658  GLY A N   1 
ATOM   5124  C CA  . GLY A 1 658  ? -9.309  80.465  2.064   1.00 29.61 ? 658  GLY A CA  1 
ATOM   5125  C C   . GLY A 1 658  ? -9.985  79.756  3.217   1.00 28.91 ? 658  GLY A C   1 
ATOM   5126  O O   . GLY A 1 658  ? -9.891  78.534  3.344   1.00 29.71 ? 658  GLY A O   1 
ATOM   5127  N N   . PHE A 1 659  ? -10.676 80.505  4.053   1.00 26.93 ? 659  PHE A N   1 
ATOM   5128  C CA  . PHE A 1 659  ? -11.319 79.901  5.193   1.00 27.92 ? 659  PHE A CA  1 
ATOM   5129  C C   . PHE A 1 659  ? -12.821 79.837  5.050   1.00 29.05 ? 659  PHE A C   1 
ATOM   5130  O O   . PHE A 1 659  ? -13.417 80.649  4.343   1.00 30.41 ? 659  PHE A O   1 
ATOM   5131  C CB  . PHE A 1 659  ? -10.922 80.685  6.432   1.00 26.94 ? 659  PHE A CB  1 
ATOM   5132  C CG  . PHE A 1 659  ? -9.444  80.738  6.636   1.00 24.80 ? 659  PHE A CG  1 
ATOM   5133  C CD1 . PHE A 1 659  ? -8.778  79.673  7.229   1.00 22.37 ? 659  PHE A CD1 1 
ATOM   5134  C CD2 . PHE A 1 659  ? -8.706  81.820  6.161   1.00 25.29 ? 659  PHE A CD2 1 
ATOM   5135  C CE1 . PHE A 1 659  ? -7.404  79.674  7.348   1.00 21.45 ? 659  PHE A CE1 1 
ATOM   5136  C CE2 . PHE A 1 659  ? -7.328  81.835  6.273   1.00 24.63 ? 659  PHE A CE2 1 
ATOM   5137  C CZ  . PHE A 1 659  ? -6.672  80.752  6.870   1.00 24.10 ? 659  PHE A CZ  1 
ATOM   5138  N N   . SER A 1 660  ? -13.426 78.852  5.706   1.00 28.94 ? 660  SER A N   1 
ATOM   5139  C CA  . SER A 1 660  ? -14.873 78.694  5.670   1.00 28.92 ? 660  SER A CA  1 
ATOM   5140  C C   . SER A 1 660  ? -15.417 78.828  7.072   1.00 28.87 ? 660  SER A C   1 
ATOM   5141  O O   . SER A 1 660  ? -15.237 77.946  7.923   1.00 25.87 ? 660  SER A O   1 
ATOM   5142  C CB  . SER A 1 660  ? -15.263 77.345  5.078   1.00 28.91 ? 660  SER A CB  1 
ATOM   5143  O OG  . SER A 1 660  ? -15.107 77.380  3.676   1.00 32.62 ? 660  SER A OG  1 
ATOM   5144  N N   . TYR A 1 661  ? -16.075 79.958  7.301   1.00 29.36 ? 661  TYR A N   1 
ATOM   5145  C CA  . TYR A 1 661  ? -16.648 80.252  8.592   1.00 29.29 ? 661  TYR A CA  1 
ATOM   5146  C C   . TYR A 1 661  ? -18.103 79.853  8.681   1.00 28.65 ? 661  TYR A C   1 
ATOM   5147  O O   . TYR A 1 661  ? -18.935 80.322  7.908   1.00 28.54 ? 661  TYR A O   1 
ATOM   5148  C CB  . TYR A 1 661  ? -16.473 81.732  8.896   1.00 30.10 ? 661  TYR A CB  1 
ATOM   5149  C CG  . TYR A 1 661  ? -15.013 82.107  9.004   1.00 34.01 ? 661  TYR A CG  1 
ATOM   5150  C CD1 . TYR A 1 661  ? -14.114 81.274  9.673   1.00 34.18 ? 661  TYR A CD1 1 
ATOM   5151  C CD2 . TYR A 1 661  ? -14.522 83.291  8.453   1.00 34.46 ? 661  TYR A CD2 1 
ATOM   5152  C CE1 . TYR A 1 661  ? -12.769 81.605  9.794   1.00 34.80 ? 661  TYR A CE1 1 
ATOM   5153  C CE2 . TYR A 1 661  ? -13.170 83.630  8.568   1.00 35.43 ? 661  TYR A CE2 1 
ATOM   5154  C CZ  . TYR A 1 661  ? -12.302 82.779  9.240   1.00 35.30 ? 661  TYR A CZ  1 
ATOM   5155  O OH  . TYR A 1 661  ? -10.963 83.087  9.350   1.00 37.17 ? 661  TYR A OH  1 
ATOM   5156  N N   . ARG A 1 662  ? -18.388 78.951  9.615   1.00 28.44 ? 662  ARG A N   1 
ATOM   5157  C CA  . ARG A 1 662  ? -19.746 78.490  9.850   1.00 27.66 ? 662  ARG A CA  1 
ATOM   5158  C C   . ARG A 1 662  ? -20.378 79.471  10.824  1.00 27.40 ? 662  ARG A C   1 
ATOM   5159  O O   . ARG A 1 662  ? -19.979 79.564  11.984  1.00 26.43 ? 662  ARG A O   1 
ATOM   5160  C CB  . ARG A 1 662  ? -19.750 77.090  10.462  1.00 28.34 ? 662  ARG A CB  1 
ATOM   5161  C CG  . ARG A 1 662  ? -19.294 75.986  9.537   1.00 29.64 ? 662  ARG A CG  1 
ATOM   5162  C CD  . ARG A 1 662  ? -19.648 74.626  10.107  1.00 29.86 ? 662  ARG A CD  1 
ATOM   5163  N NE  . ARG A 1 662  ? -19.424 73.563  9.137   1.00 32.28 ? 662  ARG A NE  1 
ATOM   5164  C CZ  . ARG A 1 662  ? -19.811 72.303  9.307   1.00 35.85 ? 662  ARG A CZ  1 
ATOM   5165  N NH1 . ARG A 1 662  ? -20.447 71.945  10.416  1.00 36.47 ? 662  ARG A NH1 1 
ATOM   5166  N NH2 . ARG A 1 662  ? -19.563 71.399  8.366   1.00 38.49 ? 662  ARG A NH2 1 
ATOM   5167  N N   . VAL A 1 663  ? -21.366 80.206  10.340  1.00 27.41 ? 663  VAL A N   1 
ATOM   5168  C CA  . VAL A 1 663  ? -22.051 81.193  11.148  1.00 27.03 ? 663  VAL A CA  1 
ATOM   5169  C C   . VAL A 1 663  ? -23.385 80.671  11.652  1.00 27.20 ? 663  VAL A C   1 
ATOM   5170  O O   . VAL A 1 663  ? -24.247 80.328  10.858  1.00 27.99 ? 663  VAL A O   1 
ATOM   5171  C CB  . VAL A 1 663  ? -22.303 82.464  10.320  1.00 26.42 ? 663  VAL A CB  1 
ATOM   5172  C CG1 . VAL A 1 663  ? -22.992 83.510  11.162  1.00 24.06 ? 663  VAL A CG1 1 
ATOM   5173  C CG2 . VAL A 1 663  ? -20.984 82.989  9.780   1.00 26.37 ? 663  VAL A CG2 1 
ATOM   5174  N N   . ASN A 1 664  ? -23.546 80.606  12.970  1.00 28.92 ? 664  ASN A N   1 
ATOM   5175  C CA  . ASN A 1 664  ? -24.805 80.160  13.583  1.00 30.13 ? 664  ASN A CA  1 
ATOM   5176  C C   . ASN A 1 664  ? -25.417 81.312  14.382  1.00 28.87 ? 664  ASN A C   1 
ATOM   5177  O O   . ASN A 1 664  ? -25.305 81.362  15.611  1.00 27.25 ? 664  ASN A O   1 
ATOM   5178  C CB  . ASN A 1 664  ? -24.564 78.967  14.512  1.00 33.35 ? 664  ASN A CB  1 
ATOM   5179  C CG  . ASN A 1 664  ? -24.747 77.641  13.805  1.00 37.52 ? 664  ASN A CG  1 
ATOM   5180  O OD1 . ASN A 1 664  ? -25.853 77.315  13.357  1.00 38.74 ? 664  ASN A OD1 1 
ATOM   5181  N ND2 . ASN A 1 664  ? -23.665 76.867  13.692  1.00 37.60 ? 664  ASN A ND2 1 
ATOM   5182  N N   . ASP A 1 665  ? -26.070 82.234  13.679  1.00 26.58 ? 665  ASP A N   1 
ATOM   5183  C CA  . ASP A 1 665  ? -26.658 83.391  14.336  1.00 25.46 ? 665  ASP A CA  1 
ATOM   5184  C C   . ASP A 1 665  ? -27.842 83.030  15.243  1.00 25.27 ? 665  ASP A C   1 
ATOM   5185  O O   . ASP A 1 665  ? -28.962 82.816  14.797  1.00 26.98 ? 665  ASP A O   1 
ATOM   5186  C CB  . ASP A 1 665  ? -27.073 84.432  13.297  1.00 23.42 ? 665  ASP A CB  1 
ATOM   5187  C CG  . ASP A 1 665  ? -27.241 85.794  13.901  1.00 22.26 ? 665  ASP A CG  1 
ATOM   5188  O OD1 . ASP A 1 665  ? -27.675 85.853  15.068  1.00 24.56 ? 665  ASP A OD1 1 
ATOM   5189  O OD2 . ASP A 1 665  ? -26.952 86.799  13.225  1.00 21.43 ? 665  ASP A OD2 1 
ATOM   5190  N N   . SER A 1 666  ? -27.569 82.984  16.533  1.00 24.59 ? 666  SER A N   1 
ATOM   5191  C CA  . SER A 1 666  ? -28.555 82.643  17.532  1.00 23.79 ? 666  SER A CA  1 
ATOM   5192  C C   . SER A 1 666  ? -29.613 83.735  17.686  1.00 22.85 ? 666  SER A C   1 
ATOM   5193  O O   . SER A 1 666  ? -30.736 83.477  18.105  1.00 21.12 ? 666  SER A O   1 
ATOM   5194  C CB  . SER A 1 666  ? -27.841 82.425  18.865  1.00 24.98 ? 666  SER A CB  1 
ATOM   5195  O OG  . SER A 1 666  ? -28.631 81.646  19.734  1.00 30.28 ? 666  SER A OG  1 
ATOM   5196  N N   . PHE A 1 667  ? -29.256 84.961  17.345  1.00 21.88 ? 667  PHE A N   1 
ATOM   5197  C CA  . PHE A 1 667  ? -30.200 86.057  17.484  1.00 21.03 ? 667  PHE A CA  1 
ATOM   5198  C C   . PHE A 1 667  ? -31.096 86.254  16.257  1.00 20.44 ? 667  PHE A C   1 
ATOM   5199  O O   . PHE A 1 667  ? -32.135 86.891  16.350  1.00 19.35 ? 667  PHE A O   1 
ATOM   5200  C CB  . PHE A 1 667  ? -29.437 87.356  17.779  1.00 19.47 ? 667  PHE A CB  1 
ATOM   5201  C CG  . PHE A 1 667  ? -28.618 87.308  19.039  1.00 19.46 ? 667  PHE A CG  1 
ATOM   5202  C CD1 . PHE A 1 667  ? -29.231 87.339  20.288  1.00 18.52 ? 667  PHE A CD1 1 
ATOM   5203  C CD2 . PHE A 1 667  ? -27.226 87.189  18.977  1.00 20.29 ? 667  PHE A CD2 1 
ATOM   5204  C CE1 . PHE A 1 667  ? -28.467 87.247  21.467  1.00 19.46 ? 667  PHE A CE1 1 
ATOM   5205  C CE2 . PHE A 1 667  ? -26.456 87.096  20.140  1.00 19.07 ? 667  PHE A CE2 1 
ATOM   5206  C CZ  . PHE A 1 667  ? -27.078 87.123  21.394  1.00 17.86 ? 667  PHE A CZ  1 
ATOM   5207  N N   . SER A 1 668  ? -30.697 85.710  15.113  1.00 20.00 ? 668  SER A N   1 
ATOM   5208  C CA  . SER A 1 668  ? -31.465 85.894  13.884  1.00 20.74 ? 668  SER A CA  1 
ATOM   5209  C C   . SER A 1 668  ? -31.932 84.556  13.336  1.00 21.61 ? 668  SER A C   1 
ATOM   5210  O O   . SER A 1 668  ? -31.178 83.864  12.656  1.00 21.99 ? 668  SER A O   1 
ATOM   5211  C CB  . SER A 1 668  ? -30.601 86.599  12.833  1.00 20.01 ? 668  SER A CB  1 
ATOM   5212  O OG  . SER A 1 668  ? -29.993 87.770  13.356  1.00 21.34 ? 668  SER A OG  1 
ATOM   5213  N N   . PRO A 1 669  ? -33.197 84.190  13.600  1.00 22.18 ? 669  PRO A N   1 
ATOM   5214  C CA  . PRO A 1 669  ? -33.767 82.921  13.138  1.00 22.62 ? 669  PRO A CA  1 
ATOM   5215  C C   . PRO A 1 669  ? -33.588 82.738  11.636  1.00 24.10 ? 669  PRO A C   1 
ATOM   5216  O O   . PRO A 1 669  ? -33.879 83.653  10.854  1.00 24.54 ? 669  PRO A O   1 
ATOM   5217  C CB  . PRO A 1 669  ? -35.245 83.043  13.513  1.00 22.68 ? 669  PRO A CB  1 
ATOM   5218  C CG  . PRO A 1 669  ? -35.269 84.100  14.581  1.00 21.98 ? 669  PRO A CG  1 
ATOM   5219  C CD  . PRO A 1 669  ? -34.256 85.077  14.107  1.00 21.84 ? 669  PRO A CD  1 
ATOM   5220  N N   . GLY A 1 670  ? -33.114 81.563  11.235  1.00 23.00 ? 670  GLY A N   1 
ATOM   5221  C CA  . GLY A 1 670  ? -32.934 81.300  9.819   1.00 23.55 ? 670  GLY A CA  1 
ATOM   5222  C C   . GLY A 1 670  ? -31.618 81.789  9.255   1.00 24.97 ? 670  GLY A C   1 
ATOM   5223  O O   . GLY A 1 670  ? -31.384 81.689  8.056   1.00 25.90 ? 670  GLY A O   1 
ATOM   5224  N N   . ASN A 1 671  ? -30.753 82.327  10.108  1.00 27.13 ? 671  ASN A N   1 
ATOM   5225  C CA  . ASN A 1 671  ? -29.453 82.812  9.650   1.00 28.34 ? 671  ASN A CA  1 
ATOM   5226  C C   . ASN A 1 671  ? -28.323 81.838  9.990   1.00 29.38 ? 671  ASN A C   1 
ATOM   5227  O O   . ASN A 1 671  ? -27.528 82.065  10.904  1.00 30.03 ? 671  ASN A O   1 
ATOM   5228  C CB  . ASN A 1 671  ? -29.152 84.197  10.238  1.00 27.31 ? 671  ASN A CB  1 
ATOM   5229  C CG  . ASN A 1 671  ? -30.002 85.295  9.621   1.00 26.56 ? 671  ASN A CG  1 
ATOM   5230  O OD1 . ASN A 1 671  ? -29.640 86.468  9.676   1.00 27.84 ? 671  ASN A OD1 1 
ATOM   5231  N ND2 . ASN A 1 671  ? -31.132 84.922  9.035   1.00 23.87 ? 671  ASN A ND2 1 
ATOM   5232  N N   . ASP A 1 672  ? -28.282 80.736  9.253   1.00 30.68 ? 672  ASP A N   1 
ATOM   5233  C CA  . ASP A 1 672  ? -27.254 79.716  9.422   1.00 32.15 ? 672  ASP A CA  1 
ATOM   5234  C C   . ASP A 1 672  ? -26.590 79.614  8.062   1.00 30.51 ? 672  ASP A C   1 
ATOM   5235  O O   . ASP A 1 672  ? -27.245 79.296  7.074   1.00 32.33 ? 672  ASP A O   1 
ATOM   5236  C CB  . ASP A 1 672  ? -27.887 78.373  9.804   1.00 36.43 ? 672  ASP A CB  1 
ATOM   5237  C CG  . ASP A 1 672  ? -28.568 78.412  11.168  1.00 41.01 ? 672  ASP A CG  1 
ATOM   5238  O OD1 . ASP A 1 672  ? -27.844 78.437  12.195  1.00 39.68 ? 672  ASP A OD1 1 
ATOM   5239  O OD2 . ASP A 1 672  ? -29.826 78.431  11.205  1.00 42.02 ? 672  ASP A OD2 1 
ATOM   5240  N N   . PHE A 1 673  ? -25.302 79.902  7.991   1.00 27.40 ? 673  PHE A N   1 
ATOM   5241  C CA  . PHE A 1 673  ? -24.635 79.841  6.705   1.00 24.99 ? 673  PHE A CA  1 
ATOM   5242  C C   . PHE A 1 673  ? -23.133 79.731  6.830   1.00 25.89 ? 673  PHE A C   1 
ATOM   5243  O O   . PHE A 1 673  ? -22.554 80.073  7.861   1.00 25.58 ? 673  PHE A O   1 
ATOM   5244  C CB  . PHE A 1 673  ? -24.993 81.083  5.879   1.00 22.71 ? 673  PHE A CB  1 
ATOM   5245  C CG  . PHE A 1 673  ? -24.589 82.383  6.522   1.00 21.28 ? 673  PHE A CG  1 
ATOM   5246  C CD1 . PHE A 1 673  ? -23.399 83.011  6.169   1.00 20.97 ? 673  PHE A CD1 1 
ATOM   5247  C CD2 . PHE A 1 673  ? -25.378 82.962  7.513   1.00 20.06 ? 673  PHE A CD2 1 
ATOM   5248  C CE1 . PHE A 1 673  ? -22.997 84.202  6.800   1.00 19.66 ? 673  PHE A CE1 1 
ATOM   5249  C CE2 . PHE A 1 673  ? -24.982 84.147  8.146   1.00 19.06 ? 673  PHE A CE2 1 
ATOM   5250  C CZ  . PHE A 1 673  ? -23.792 84.765  7.789   1.00 16.46 ? 673  PHE A CZ  1 
ATOM   5251  N N   . THR A 1 674  ? -22.509 79.224  5.776   1.00 26.58 ? 674  THR A N   1 
ATOM   5252  C CA  . THR A 1 674  ? -21.066 79.102  5.745   1.00 27.84 ? 674  THR A CA  1 
ATOM   5253  C C   . THR A 1 674  ? -20.566 80.266  4.893   1.00 29.03 ? 674  THR A C   1 
ATOM   5254  O O   . THR A 1 674  ? -21.142 80.601  3.855   1.00 26.19 ? 674  THR A O   1 
ATOM   5255  C CB  . THR A 1 674  ? -20.629 77.754  5.142   1.00 28.62 ? 674  THR A CB  1 
ATOM   5256  O OG1 . THR A 1 674  ? -20.970 76.703  6.050   1.00 27.87 ? 674  THR A OG1 1 
ATOM   5257  C CG2 . THR A 1 674  ? -19.122 77.736  4.889   1.00 27.48 ? 674  THR A CG2 1 
ATOM   5258  N N   . HIS A 1 675  ? -19.498 80.897  5.353   1.00 31.80 ? 675  HIS A N   1 
ATOM   5259  C CA  . HIS A 1 675  ? -18.950 82.040  4.649   1.00 35.08 ? 675  HIS A CA  1 
ATOM   5260  C C   . HIS A 1 675  ? -17.481 81.799  4.323   1.00 35.80 ? 675  HIS A C   1 
ATOM   5261  O O   . HIS A 1 675  ? -16.682 81.465  5.200   1.00 36.30 ? 675  HIS A O   1 
ATOM   5262  C CB  . HIS A 1 675  ? -19.130 83.275  5.527   1.00 37.24 ? 675  HIS A CB  1 
ATOM   5263  C CG  . HIS A 1 675  ? -18.743 84.553  4.865   1.00 40.18 ? 675  HIS A CG  1 
ATOM   5264  N ND1 . HIS A 1 675  ? -17.463 85.058  4.917   1.00 41.37 ? 675  HIS A ND1 1 
ATOM   5265  C CD2 . HIS A 1 675  ? -19.471 85.434  4.137   1.00 41.95 ? 675  HIS A CD2 1 
ATOM   5266  C CE1 . HIS A 1 675  ? -17.417 86.198  4.250   1.00 42.57 ? 675  HIS A CE1 1 
ATOM   5267  N NE2 . HIS A 1 675  ? -18.621 86.448  3.767   1.00 42.09 ? 675  HIS A NE2 1 
ATOM   5268  N N   . MET A 1 676  ? -17.139 81.943  3.049   1.00 36.72 ? 676  MET A N   1 
ATOM   5269  C CA  . MET A 1 676  ? -15.768 81.742  2.600   1.00 36.62 ? 676  MET A CA  1 
ATOM   5270  C C   . MET A 1 676  ? -15.127 83.116  2.489   1.00 34.20 ? 676  MET A C   1 
ATOM   5271  O O   . MET A 1 676  ? -15.730 84.042  1.957   1.00 34.28 ? 676  MET A O   1 
ATOM   5272  C CB  . MET A 1 676  ? -15.761 81.023  1.241   1.00 40.28 ? 676  MET A CB  1 
ATOM   5273  C CG  . MET A 1 676  ? -14.375 80.615  0.723   1.00 46.34 ? 676  MET A CG  1 
ATOM   5274  S SD  . MET A 1 676  ? -13.479 79.402  1.767   1.00 55.39 ? 676  MET A SD  1 
ATOM   5275  C CE  . MET A 1 676  ? -13.947 77.824  0.987   1.00 51.63 ? 676  MET A CE  1 
ATOM   5276  N N   . THR A 1 677  ? -13.912 83.257  3.006   1.00 31.88 ? 677  THR A N   1 
ATOM   5277  C CA  . THR A 1 677  ? -13.223 84.539  2.949   1.00 29.74 ? 677  THR A CA  1 
ATOM   5278  C C   . THR A 1 677  ? -11.713 84.336  2.996   1.00 28.74 ? 677  THR A C   1 
ATOM   5279  O O   . THR A 1 677  ? -11.248 83.249  3.318   1.00 29.61 ? 677  THR A O   1 
ATOM   5280  C CB  . THR A 1 677  ? -13.662 85.448  4.134   1.00 28.87 ? 677  THR A CB  1 
ATOM   5281  O OG1 . THR A 1 677  ? -13.089 86.750  3.976   1.00 29.26 ? 677  THR A OG1 1 
ATOM   5282  C CG2 . THR A 1 677  ? -13.219 84.861  5.462   1.00 23.95 ? 677  THR A CG2 1 
ATOM   5283  N N   . THR A 1 678  ? -10.951 85.377  2.674   1.00 26.71 ? 678  THR A N   1 
ATOM   5284  C CA  . THR A 1 678  ? -9.495  85.286  2.710   1.00 26.33 ? 678  THR A CA  1 
ATOM   5285  C C   . THR A 1 678  ? -8.965  85.835  4.030   1.00 26.21 ? 678  THR A C   1 
ATOM   5286  O O   . THR A 1 678  ? -7.770  85.759  4.313   1.00 26.57 ? 678  THR A O   1 
ATOM   5287  C CB  . THR A 1 678  ? -8.853  86.088  1.577   1.00 25.63 ? 678  THR A CB  1 
ATOM   5288  O OG1 . THR A 1 678  ? -9.291  87.447  1.654   1.00 23.18 ? 678  THR A OG1 1 
ATOM   5289  C CG2 . THR A 1 678  ? -9.237  85.505  0.236   1.00 25.56 ? 678  THR A CG2 1 
ATOM   5290  N N   . THR A 1 679  ? -9.867  86.390  4.829   1.00 25.25 ? 679  THR A N   1 
ATOM   5291  C CA  . THR A 1 679  ? -9.520  86.966  6.117   1.00 24.24 ? 679  THR A CA  1 
ATOM   5292  C C   . THR A 1 679  ? -8.920  85.911  7.044   1.00 24.48 ? 679  THR A C   1 
ATOM   5293  O O   . THR A 1 679  ? -9.500  84.844  7.253   1.00 24.36 ? 679  THR A O   1 
ATOM   5294  C CB  . THR A 1 679  ? -10.765 87.590  6.760   1.00 25.08 ? 679  THR A CB  1 
ATOM   5295  O OG1 . THR A 1 679  ? -11.347 88.531  5.841   1.00 24.63 ? 679  THR A OG1 1 
ATOM   5296  C CG2 . THR A 1 679  ? -10.401 88.297  8.065   1.00 23.10 ? 679  THR A CG2 1 
ATOM   5297  N N   . PHE A 1 680  ? -7.761  86.230  7.612   1.00 24.16 ? 680  PHE A N   1 
ATOM   5298  C CA  . PHE A 1 680  ? -7.024  85.317  8.486   1.00 24.00 ? 680  PHE A CA  1 
ATOM   5299  C C   . PHE A 1 680  ? -7.715  84.873  9.788   1.00 24.50 ? 680  PHE A C   1 
ATOM   5300  O O   . PHE A 1 680  ? -8.443  85.640  10.408  1.00 26.66 ? 680  PHE A O   1 
ATOM   5301  C CB  . PHE A 1 680  ? -5.665  85.937  8.819   1.00 20.83 ? 680  PHE A CB  1 
ATOM   5302  C CG  . PHE A 1 680  ? -4.630  84.929  9.202   1.00 23.36 ? 680  PHE A CG  1 
ATOM   5303  C CD1 . PHE A 1 680  ? -3.946  84.216  8.225   1.00 22.50 ? 680  PHE A CD1 1 
ATOM   5304  C CD2 . PHE A 1 680  ? -4.376  84.645  10.544  1.00 23.03 ? 680  PHE A CD2 1 
ATOM   5305  C CE1 . PHE A 1 680  ? -3.025  83.228  8.572   1.00 24.73 ? 680  PHE A CE1 1 
ATOM   5306  C CE2 . PHE A 1 680  ? -3.456  83.658  10.903  1.00 23.81 ? 680  PHE A CE2 1 
ATOM   5307  C CZ  . PHE A 1 680  ? -2.778  82.948  9.913   1.00 24.45 ? 680  PHE A CZ  1 
ATOM   5308  N N   . PRO A 1 681  ? -7.486  83.620  10.222  1.00 24.03 ? 681  PRO A N   1 
ATOM   5309  C CA  . PRO A 1 681  ? -8.109  83.134  11.459  1.00 23.94 ? 681  PRO A CA  1 
ATOM   5310  C C   . PRO A 1 681  ? -7.520  83.871  12.654  1.00 24.19 ? 681  PRO A C   1 
ATOM   5311  O O   . PRO A 1 681  ? -6.312  84.107  12.701  1.00 24.04 ? 681  PRO A O   1 
ATOM   5312  C CB  . PRO A 1 681  ? -7.720  81.656  11.503  1.00 23.94 ? 681  PRO A CB  1 
ATOM   5313  C CG  . PRO A 1 681  ? -7.334  81.323  10.121  1.00 23.08 ? 681  PRO A CG  1 
ATOM   5314  C CD  . PRO A 1 681  ? -6.678  82.561  9.599   1.00 23.63 ? 681  PRO A CD  1 
ATOM   5315  N N   . SER A 1 682  ? -8.360  84.226  13.617  1.00 23.14 ? 682  SER A N   1 
ATOM   5316  C CA  . SER A 1 682  ? -7.885  84.923  14.804  1.00 22.84 ? 682  SER A CA  1 
ATOM   5317  C C   . SER A 1 682  ? -7.520  83.933  15.913  1.00 22.87 ? 682  SER A C   1 
ATOM   5318  O O   . SER A 1 682  ? -6.748  84.260  16.811  1.00 23.22 ? 682  SER A O   1 
ATOM   5319  C CB  . SER A 1 682  ? -8.955  85.884  15.312  1.00 24.06 ? 682  SER A CB  1 
ATOM   5320  O OG  . SER A 1 682  ? -10.141 85.184  15.662  1.00 30.67 ? 682  SER A OG  1 
ATOM   5321  N N   . GLY A 1 683  ? -8.070  82.721  15.835  1.00 21.44 ? 683  GLY A N   1 
ATOM   5322  C CA  . GLY A 1 683  ? -7.802  81.706  16.838  1.00 19.24 ? 683  GLY A CA  1 
ATOM   5323  C C   . GLY A 1 683  ? -6.761  80.661  16.467  1.00 20.34 ? 683  GLY A C   1 
ATOM   5324  O O   . GLY A 1 683  ? -6.908  79.468  16.779  1.00 20.49 ? 683  GLY A O   1 
ATOM   5325  N N   . SER A 1 684  ? -5.713  81.101  15.776  1.00 20.57 ? 684  SER A N   1 
ATOM   5326  C CA  . SER A 1 684  ? -4.617  80.218  15.394  1.00 19.96 ? 684  SER A CA  1 
ATOM   5327  C C   . SER A 1 684  ? -3.460  80.519  16.339  1.00 19.15 ? 684  SER A C   1 
ATOM   5328  O O   . SER A 1 684  ? -3.339  81.632  16.836  1.00 18.60 ? 684  SER A O   1 
ATOM   5329  C CB  . SER A 1 684  ? -4.181  80.479  13.944  1.00 19.55 ? 684  SER A CB  1 
ATOM   5330  O OG  . SER A 1 684  ? -2.883  79.950  13.689  1.00 18.13 ? 684  SER A OG  1 
ATOM   5331  N N   . THR A 1 685  ? -2.611  79.534  16.595  1.00 19.29 ? 685  THR A N   1 
ATOM   5332  C CA  . THR A 1 685  ? -1.471  79.764  17.469  1.00 19.90 ? 685  THR A CA  1 
ATOM   5333  C C   . THR A 1 685  ? -0.520  80.767  16.810  1.00 21.91 ? 685  THR A C   1 
ATOM   5334  O O   . THR A 1 685  ? 0.371   81.318  17.460  1.00 22.45 ? 685  THR A O   1 
ATOM   5335  C CB  . THR A 1 685  ? -0.689  78.468  17.725  1.00 18.87 ? 685  THR A CB  1 
ATOM   5336  O OG1 . THR A 1 685  ? -0.098  78.022  16.497  1.00 16.93 ? 685  THR A OG1 1 
ATOM   5337  C CG2 . THR A 1 685  ? -1.612  77.388  18.267  1.00 17.66 ? 685  THR A CG2 1 
ATOM   5338  N N   . ALA A 1 686  ? -0.720  81.013  15.519  1.00 22.27 ? 686  ALA A N   1 
ATOM   5339  C CA  . ALA A 1 686  ? 0.155   81.921  14.792  1.00 23.15 ? 686  ALA A CA  1 
ATOM   5340  C C   . ALA A 1 686  ? -0.360  83.338  14.667  1.00 22.92 ? 686  ALA A C   1 
ATOM   5341  O O   . ALA A 1 686  ? 0.425   84.274  14.592  1.00 23.06 ? 686  ALA A O   1 
ATOM   5342  C CB  . ALA A 1 686  ? 0.449   81.358  13.396  1.00 23.26 ? 686  ALA A CB  1 
ATOM   5343  N N   . THR A 1 687  ? -1.675  83.498  14.667  1.00 23.52 ? 687  THR A N   1 
ATOM   5344  C CA  . THR A 1 687  ? -2.276  84.813  14.494  1.00 22.77 ? 687  THR A CA  1 
ATOM   5345  C C   . THR A 1 687  ? -1.472  85.995  15.031  1.00 24.77 ? 687  THR A C   1 
ATOM   5346  O O   . THR A 1 687  ? -0.840  86.733  14.253  1.00 25.14 ? 687  THR A O   1 
ATOM   5347  C CB  . THR A 1 687  ? -3.689  84.881  15.100  1.00 22.19 ? 687  THR A CB  1 
ATOM   5348  O OG1 . THR A 1 687  ? -4.471  83.778  14.625  1.00 20.79 ? 687  THR A OG1 1 
ATOM   5349  C CG2 . THR A 1 687  ? -4.372  86.195  14.691  1.00 19.23 ? 687  THR A CG2 1 
ATOM   5350  N N   . SER A 1 688  ? -1.483  86.179  16.349  1.00 24.52 ? 688  SER A N   1 
ATOM   5351  C CA  . SER A 1 688  ? -0.785  87.317  16.934  1.00 24.54 ? 688  SER A CA  1 
ATOM   5352  C C   . SER A 1 688  ? 0.706   87.427  16.634  1.00 24.04 ? 688  SER A C   1 
ATOM   5353  O O   . SER A 1 688  ? 1.166   88.461  16.148  1.00 23.63 ? 688  SER A O   1 
ATOM   5354  C CB  . SER A 1 688  ? -0.981  87.349  18.444  1.00 24.54 ? 688  SER A CB  1 
ATOM   5355  O OG  . SER A 1 688  ? -0.312  88.482  18.981  1.00 27.60 ? 688  SER A OG  1 
ATOM   5356  N N   . THR A 1 689  ? 1.461   86.368  16.919  1.00 22.33 ? 689  THR A N   1 
ATOM   5357  C CA  . THR A 1 689  ? 2.904   86.400  16.703  1.00 21.36 ? 689  THR A CA  1 
ATOM   5358  C C   . THR A 1 689  ? 3.295   86.598  15.234  1.00 21.05 ? 689  THR A C   1 
ATOM   5359  O O   . THR A 1 689  ? 4.322   87.201  14.932  1.00 19.69 ? 689  THR A O   1 
ATOM   5360  C CB  . THR A 1 689  ? 3.568   85.120  17.241  1.00 19.86 ? 689  THR A CB  1 
ATOM   5361  O OG1 . THR A 1 689  ? 4.985   85.250  17.130  1.00 22.64 ? 689  THR A OG1 1 
ATOM   5362  C CG2 . THR A 1 689  ? 3.109   83.898  16.457  1.00 18.86 ? 689  THR A CG2 1 
ATOM   5363  N N   . GLU A 1 690  ? 2.446   86.091  14.341  1.00 21.18 ? 690  GLU A N   1 
ATOM   5364  C CA  . GLU A 1 690  ? 2.603   86.156  12.881  1.00 18.27 ? 690  GLU A CA  1 
ATOM   5365  C C   . GLU A 1 690  ? 2.474   87.601  12.422  1.00 19.31 ? 690  GLU A C   1 
ATOM   5366  O O   . GLU A 1 690  ? 3.287   88.103  11.637  1.00 18.82 ? 690  GLU A O   1 
ATOM   5367  C CB  . GLU A 1 690  ? 1.492   85.320  12.253  1.00 17.64 ? 690  GLU A CB  1 
ATOM   5368  C CG  . GLU A 1 690  ? 1.656   84.921  10.828  1.00 15.89 ? 690  GLU A CG  1 
ATOM   5369  C CD  . GLU A 1 690  ? 1.499   86.061  9.846   1.00 15.91 ? 690  GLU A CD  1 
ATOM   5370  O OE1 . GLU A 1 690  ? 0.768   87.035  10.132  1.00 14.53 ? 690  GLU A OE1 1 
ATOM   5371  O OE2 . GLU A 1 690  ? 2.108   85.961  8.769   1.00 14.36 ? 690  GLU A OE2 1 
ATOM   5372  N N   . HIS A 1 691  ? 1.433   88.264  12.919  1.00 19.52 ? 691  HIS A N   1 
ATOM   5373  C CA  . HIS A 1 691  ? 1.171   89.659  12.588  1.00 18.23 ? 691  HIS A CA  1 
ATOM   5374  C C   . HIS A 1 691  ? 2.256   90.554  13.167  1.00 17.75 ? 691  HIS A C   1 
ATOM   5375  O O   . HIS A 1 691  ? 2.634   91.552  12.558  1.00 18.57 ? 691  HIS A O   1 
ATOM   5376  C CB  . HIS A 1 691  ? -0.188  90.083  13.144  1.00 19.73 ? 691  HIS A CB  1 
ATOM   5377  C CG  . HIS A 1 691  ? -1.355  89.438  12.461  1.00 20.91 ? 691  HIS A CG  1 
ATOM   5378  N ND1 . HIS A 1 691  ? -1.219  88.377  11.590  1.00 21.88 ? 691  HIS A ND1 1 
ATOM   5379  C CD2 . HIS A 1 691  ? -2.684  89.692  12.542  1.00 19.25 ? 691  HIS A CD2 1 
ATOM   5380  C CE1 . HIS A 1 691  ? -2.414  88.005  11.166  1.00 23.26 ? 691  HIS A CE1 1 
ATOM   5381  N NE2 . HIS A 1 691  ? -3.320  88.787  11.730  1.00 22.64 ? 691  HIS A NE2 1 
ATOM   5382  N N   . THR A 1 692  ? 2.759   90.199  14.346  1.00 16.25 ? 692  THR A N   1 
ATOM   5383  C CA  . THR A 1 692  ? 3.797   90.996  14.970  1.00 15.76 ? 692  THR A CA  1 
ATOM   5384  C C   . THR A 1 692  ? 5.039   90.980  14.104  1.00 16.09 ? 692  THR A C   1 
ATOM   5385  O O   . THR A 1 692  ? 5.652   92.027  13.866  1.00 16.52 ? 692  THR A O   1 
ATOM   5386  C CB  . THR A 1 692  ? 4.214   90.454  16.348  1.00 16.01 ? 692  THR A CB  1 
ATOM   5387  O OG1 . THR A 1 692  ? 3.088   90.446  17.221  1.00 13.99 ? 692  THR A OG1 1 
ATOM   5388  C CG2 . THR A 1 692  ? 5.320   91.325  16.942  1.00 12.43 ? 692  THR A CG2 1 
ATOM   5389  N N   . ALA A 1 693  ? 5.399   89.789  13.632  1.00 13.71 ? 693  ALA A N   1 
ATOM   5390  C CA  . ALA A 1 693  ? 6.590   89.623  12.808  1.00 15.41 ? 693  ALA A CA  1 
ATOM   5391  C C   . ALA A 1 693  ? 6.506   90.327  11.457  1.00 16.20 ? 693  ALA A C   1 
ATOM   5392  O O   . ALA A 1 693  ? 7.505   90.882  10.989  1.00 15.16 ? 693  ALA A O   1 
ATOM   5393  C CB  . ALA A 1 693  ? 6.892   88.129  12.609  1.00 16.93 ? 693  ALA A CB  1 
ATOM   5394  N N   . ASN A 1 694  ? 5.330   90.291  10.821  1.00 16.44 ? 694  ASN A N   1 
ATOM   5395  C CA  . ASN A 1 694  ? 5.156   90.966  9.533   1.00 16.18 ? 694  ASN A CA  1 
ATOM   5396  C C   . ASN A 1 694  ? 5.137   92.465  9.754   1.00 16.71 ? 694  ASN A C   1 
ATOM   5397  O O   . ASN A 1 694  ? 5.660   93.222  8.936   1.00 17.35 ? 694  ASN A O   1 
ATOM   5398  C CB  . ASN A 1 694  ? 3.863   90.545  8.846   1.00 15.27 ? 694  ASN A CB  1 
ATOM   5399  C CG  . ASN A 1 694  ? 3.915   89.127  8.348   1.00 16.73 ? 694  ASN A CG  1 
ATOM   5400  O OD1 . ASN A 1 694  ? 4.848   88.738  7.644   1.00 14.39 ? 694  ASN A OD1 1 
ATOM   5401  N ND2 . ASN A 1 694  ? 2.908   88.338  8.710   1.00 16.84 ? 694  ASN A ND2 1 
ATOM   5402  N N   . ASN A 1 695  ? 4.525   92.892  10.857  1.00 15.32 ? 695  ASN A N   1 
ATOM   5403  C CA  . ASN A 1 695  ? 4.481   94.308  11.191  1.00 15.73 ? 695  ASN A CA  1 
ATOM   5404  C C   . ASN A 1 695  ? 5.929   94.883  11.164  1.00 16.32 ? 695  ASN A C   1 
ATOM   5405  O O   . ASN A 1 695  ? 6.231   95.788  10.386  1.00 16.80 ? 695  ASN A O   1 
ATOM   5406  C CB  . ASN A 1 695  ? 3.860   94.486  12.583  1.00 14.50 ? 695  ASN A CB  1 
ATOM   5407  C CG  . ASN A 1 695  ? 3.458   95.922  12.877  1.00 12.38 ? 695  ASN A CG  1 
ATOM   5408  O OD1 . ASN A 1 695  ? 4.152   96.868  12.507  1.00 11.54 ? 695  ASN A OD1 1 
ATOM   5409  N ND2 . ASN A 1 695  ? 2.340   96.086  13.572  1.00 11.51 ? 695  ASN A ND2 1 
ATOM   5410  N N   . SER A 1 696  ? 6.819   94.329  11.988  1.00 16.03 ? 696  SER A N   1 
ATOM   5411  C CA  . SER A 1 696  ? 8.207   94.794  12.065  1.00 15.70 ? 696  SER A CA  1 
ATOM   5412  C C   . SER A 1 696  ? 9.011   94.580  10.795  1.00 15.27 ? 696  SER A C   1 
ATOM   5413  O O   . SER A 1 696  ? 9.820   95.429  10.421  1.00 17.59 ? 696  SER A O   1 
ATOM   5414  C CB  . SER A 1 696  ? 8.940   94.106  13.217  1.00 13.37 ? 696  SER A CB  1 
ATOM   5415  O OG  . SER A 1 696  ? 9.153   92.739  12.912  1.00 16.87 ? 696  SER A OG  1 
ATOM   5416  N N   . THR A 1 697  ? 8.814   93.443  10.139  1.00 14.95 ? 697  THR A N   1 
ATOM   5417  C CA  . THR A 1 697  ? 9.557   93.156  8.917   1.00 14.78 ? 697  THR A CA  1 
ATOM   5418  C C   . THR A 1 697  ? 9.283   94.210  7.842   1.00 15.55 ? 697  THR A C   1 
ATOM   5419  O O   . THR A 1 697  ? 10.195  94.667  7.138   1.00 16.45 ? 697  THR A O   1 
ATOM   5420  C CB  . THR A 1 697  ? 9.202   91.769  8.376   1.00 16.17 ? 697  THR A CB  1 
ATOM   5421  O OG1 . THR A 1 697  ? 9.514   90.783  9.366   1.00 16.28 ? 697  THR A OG1 1 
ATOM   5422  C CG2 . THR A 1 697  ? 9.990   91.470  7.100   1.00 17.43 ? 697  THR A CG2 1 
ATOM   5423  N N   . MET A 1 698  ? 8.031   94.612  7.716   1.00 14.45 ? 698  MET A N   1 
ATOM   5424  C CA  . MET A 1 698  ? 7.702   95.621  6.734   1.00 16.94 ? 698  MET A CA  1 
ATOM   5425  C C   . MET A 1 698  ? 8.209   96.999  7.183   1.00 17.30 ? 698  MET A C   1 
ATOM   5426  O O   . MET A 1 698  ? 8.693   97.785  6.366   1.00 17.91 ? 698  MET A O   1 
ATOM   5427  C CB  . MET A 1 698  ? 6.192   95.632  6.498   1.00 17.19 ? 698  MET A CB  1 
ATOM   5428  C CG  . MET A 1 698  ? 5.669   94.281  6.050   1.00 19.70 ? 698  MET A CG  1 
ATOM   5429  S SD  . MET A 1 698  ? 6.293   93.732  4.436   1.00 23.26 ? 698  MET A SD  1 
ATOM   5430  C CE  . MET A 1 698  ? 7.777   92.945  4.854   1.00 25.23 ? 698  MET A CE  1 
ATOM   5431  N N   . MET A 1 699  ? 8.127   97.286  8.480   1.00 17.32 ? 699  MET A N   1 
ATOM   5432  C CA  . MET A 1 699  ? 8.579   98.588  8.982   1.00 18.88 ? 699  MET A CA  1 
ATOM   5433  C C   . MET A 1 699  ? 10.085  98.684  8.795   1.00 19.34 ? 699  MET A C   1 
ATOM   5434  O O   . MET A 1 699  ? 10.627  99.745  8.490   1.00 19.39 ? 699  MET A O   1 
ATOM   5435  C CB  . MET A 1 699  ? 8.216   98.767  10.466  1.00 15.61 ? 699  MET A CB  1 
ATOM   5436  C CG  . MET A 1 699  ? 8.508   100.154 11.014  1.00 15.44 ? 699  MET A CG  1 
ATOM   5437  S SD  . MET A 1 699  ? 7.748   101.506 10.055  1.00 17.83 ? 699  MET A SD  1 
ATOM   5438  C CE  . MET A 1 699  ? 5.970   101.147 10.281  1.00 14.58 ? 699  MET A CE  1 
ATOM   5439  N N   . GLU A 1 700  ? 10.760  97.559  8.970   1.00 19.86 ? 700  GLU A N   1 
ATOM   5440  C CA  . GLU A 1 700  ? 12.202  97.525  8.802   1.00 20.92 ? 700  GLU A CA  1 
ATOM   5441  C C   . GLU A 1 700  ? 12.553  97.807  7.331   1.00 18.74 ? 700  GLU A C   1 
ATOM   5442  O O   . GLU A 1 700  ? 13.438  98.605  7.042   1.00 18.80 ? 700  GLU A O   1 
ATOM   5443  C CB  . GLU A 1 700  ? 12.725  96.160  9.238   1.00 22.33 ? 700  GLU A CB  1 
ATOM   5444  C CG  . GLU A 1 700  ? 14.170  96.146  9.620   1.00 28.96 ? 700  GLU A CG  1 
ATOM   5445  C CD  . GLU A 1 700  ? 15.086  95.916  8.455   1.00 34.64 ? 700  GLU A CD  1 
ATOM   5446  O OE1 . GLU A 1 700  ? 16.316  95.846  8.689   1.00 38.17 ? 700  GLU A OE1 1 
ATOM   5447  O OE2 . GLU A 1 700  ? 14.584  95.799  7.312   1.00 38.36 ? 700  GLU A OE2 1 
ATOM   5448  N N   . THR A 1 701  ? 11.832  97.161  6.416   1.00 17.13 ? 701  THR A N   1 
ATOM   5449  C CA  . THR A 1 701  ? 12.043  97.321  4.983   1.00 15.89 ? 701  THR A CA  1 
ATOM   5450  C C   . THR A 1 701  ? 11.841  98.768  4.550   1.00 15.94 ? 701  THR A C   1 
ATOM   5451  O O   . THR A 1 701  ? 12.548  99.271  3.671   1.00 15.55 ? 701  THR A O   1 
ATOM   5452  C CB  . THR A 1 701  ? 11.069  96.430  4.190   1.00 16.77 ? 701  THR A CB  1 
ATOM   5453  O OG1 . THR A 1 701  ? 11.372  95.053  4.444   1.00 19.05 ? 701  THR A OG1 1 
ATOM   5454  C CG2 . THR A 1 701  ? 11.172  96.708  2.712   1.00 14.29 ? 701  THR A CG2 1 
ATOM   5455  N N   . PHE A 1 702  ? 10.864  99.429  5.159   1.00 15.58 ? 702  PHE A N   1 
ATOM   5456  C CA  . PHE A 1 702  ? 10.584  100.821 4.844   1.00 15.50 ? 702  PHE A CA  1 
ATOM   5457  C C   . PHE A 1 702  ? 11.728  101.732 5.302   1.00 15.55 ? 702  PHE A C   1 
ATOM   5458  O O   . PHE A 1 702  ? 12.159  102.620 4.569   1.00 15.87 ? 702  PHE A O   1 
ATOM   5459  C CB  . PHE A 1 702  ? 9.299   101.288 5.525   1.00 14.58 ? 702  PHE A CB  1 
ATOM   5460  C CG  . PHE A 1 702  ? 9.166   102.783 5.571   1.00 15.11 ? 702  PHE A CG  1 
ATOM   5461  C CD1 . PHE A 1 702  ? 8.657   103.481 4.481   1.00 15.78 ? 702  PHE A CD1 1 
ATOM   5462  C CD2 . PHE A 1 702  ? 9.652   103.500 6.663   1.00 14.36 ? 702  PHE A CD2 1 
ATOM   5463  C CE1 . PHE A 1 702  ? 8.636   104.872 4.471   1.00 15.71 ? 702  PHE A CE1 1 
ATOM   5464  C CE2 . PHE A 1 702  ? 9.639   104.886 6.667   1.00 13.91 ? 702  PHE A CE2 1 
ATOM   5465  C CZ  . PHE A 1 702  ? 9.131   105.577 5.564   1.00 15.56 ? 702  PHE A CZ  1 
ATOM   5466  N N   . LEU A 1 703  ? 12.204  101.520 6.522   1.00 16.12 ? 703  LEU A N   1 
ATOM   5467  C CA  . LEU A 1 703  ? 13.282  102.341 7.069   1.00 17.24 ? 703  LEU A CA  1 
ATOM   5468  C C   . LEU A 1 703  ? 14.623  102.090 6.400   1.00 17.76 ? 703  LEU A C   1 
ATOM   5469  O O   . LEU A 1 703  ? 15.459  102.983 6.326   1.00 19.18 ? 703  LEU A O   1 
ATOM   5470  C CB  . LEU A 1 703  ? 13.414  102.102 8.572   1.00 15.04 ? 703  LEU A CB  1 
ATOM   5471  C CG  . LEU A 1 703  ? 12.236  102.539 9.441   1.00 14.82 ? 703  LEU A CG  1 
ATOM   5472  C CD1 . LEU A 1 703  ? 12.449  102.104 10.883  1.00 12.94 ? 703  LEU A CD1 1 
ATOM   5473  C CD2 . LEU A 1 703  ? 12.094  104.046 9.340   1.00 14.57 ? 703  LEU A CD2 1 
ATOM   5474  N N   . THR A 1 704  ? 14.821  100.875 5.906   1.00 18.93 ? 704  THR A N   1 
ATOM   5475  C CA  . THR A 1 704  ? 16.071  100.507 5.268   1.00 19.68 ? 704  THR A CA  1 
ATOM   5476  C C   . THR A 1 704  ? 16.083  100.713 3.764   1.00 20.25 ? 704  THR A C   1 
ATOM   5477  O O   . THR A 1 704  ? 17.042  101.250 3.204   1.00 20.79 ? 704  THR A O   1 
ATOM   5478  C CB  . THR A 1 704  ? 16.407  99.013  5.522   1.00 21.86 ? 704  THR A CB  1 
ATOM   5479  O OG1 . THR A 1 704  ? 16.555  98.786  6.927   1.00 24.18 ? 704  THR A OG1 1 
ATOM   5480  C CG2 . THR A 1 704  ? 17.718  98.622  4.820   1.00 22.70 ? 704  THR A CG2 1 
ATOM   5481  N N   . VAL A 1 705  ? 15.007  100.301 3.111   1.00 20.43 ? 705  VAL A N   1 
ATOM   5482  C CA  . VAL A 1 705  ? 14.950  100.368 1.665   1.00 19.08 ? 705  VAL A CA  1 
ATOM   5483  C C   . VAL A 1 705  ? 14.001  101.360 1.015   1.00 19.49 ? 705  VAL A C   1 
ATOM   5484  O O   . VAL A 1 705  ? 14.424  102.379 0.470   1.00 18.97 ? 705  VAL A O   1 
ATOM   5485  C CB  . VAL A 1 705  ? 14.631  98.954  1.104   1.00 20.93 ? 705  VAL A CB  1 
ATOM   5486  C CG1 . VAL A 1 705  ? 14.718  98.951  -0.425  1.00 18.42 ? 705  VAL A CG1 1 
ATOM   5487  C CG2 . VAL A 1 705  ? 15.586  97.924  1.716   1.00 16.18 ? 705  VAL A CG2 1 
ATOM   5488  N N   . TRP A 1 706  ? 12.714  101.044 1.054   1.00 19.27 ? 706  TRP A N   1 
ATOM   5489  C CA  . TRP A 1 706  ? 11.703  101.868 0.405   1.00 19.33 ? 706  TRP A CA  1 
ATOM   5490  C C   . TRP A 1 706  ? 11.779  103.359 0.731   1.00 19.92 ? 706  TRP A C   1 
ATOM   5491  O O   . TRP A 1 706  ? 11.831  104.194 -0.173  1.00 20.09 ? 706  TRP A O   1 
ATOM   5492  C CB  . TRP A 1 706  ? 10.316  101.319 0.730   1.00 17.60 ? 706  TRP A CB  1 
ATOM   5493  C CG  . TRP A 1 706  ? 9.268   101.713 -0.243  1.00 18.15 ? 706  TRP A CG  1 
ATOM   5494  C CD1 . TRP A 1 706  ? 8.861   101.008 -1.335  1.00 19.35 ? 706  TRP A CD1 1 
ATOM   5495  C CD2 . TRP A 1 706  ? 8.451   102.891 -0.197  1.00 18.45 ? 706  TRP A CD2 1 
ATOM   5496  N NE1 . TRP A 1 706  ? 7.830   101.667 -1.973  1.00 19.04 ? 706  TRP A NE1 1 
ATOM   5497  C CE2 . TRP A 1 706  ? 7.562   102.829 -1.297  1.00 18.98 ? 706  TRP A CE2 1 
ATOM   5498  C CE3 . TRP A 1 706  ? 8.384   103.995 0.664   1.00 15.71 ? 706  TRP A CE3 1 
ATOM   5499  C CZ2 . TRP A 1 706  ? 6.613   103.828 -1.558  1.00 18.67 ? 706  TRP A CZ2 1 
ATOM   5500  C CZ3 . TRP A 1 706  ? 7.439   104.990 0.406   1.00 17.07 ? 706  TRP A CZ3 1 
ATOM   5501  C CH2 . TRP A 1 706  ? 6.567   104.898 -0.697  1.00 17.44 ? 706  TRP A CH2 1 
ATOM   5502  N N   . GLY A 1 707  ? 11.789  103.694 2.016   1.00 20.37 ? 707  GLY A N   1 
ATOM   5503  C CA  . GLY A 1 707  ? 11.854  105.091 2.400   1.00 20.22 ? 707  GLY A CA  1 
ATOM   5504  C C   . GLY A 1 707  ? 13.003  105.805 1.721   1.00 21.23 ? 707  GLY A C   1 
ATOM   5505  O O   . GLY A 1 707  ? 12.796  106.703 0.905   1.00 23.98 ? 707  GLY A O   1 
ATOM   5506  N N   . PRO A 1 708  ? 14.238  105.421 2.031   1.00 19.77 ? 708  PRO A N   1 
ATOM   5507  C CA  . PRO A 1 708  ? 15.410  106.052 1.427   1.00 21.06 ? 708  PRO A CA  1 
ATOM   5508  C C   . PRO A 1 708  ? 15.346  106.201 -0.105  1.00 21.56 ? 708  PRO A C   1 
ATOM   5509  O O   . PRO A 1 708  ? 15.834  107.191 -0.657  1.00 21.55 ? 708  PRO A O   1 
ATOM   5510  C CB  . PRO A 1 708  ? 16.555  105.138 1.875   1.00 20.85 ? 708  PRO A CB  1 
ATOM   5511  C CG  . PRO A 1 708  ? 16.095  104.665 3.211   1.00 19.81 ? 708  PRO A CG  1 
ATOM   5512  C CD  . PRO A 1 708  ? 14.629  104.365 2.980   1.00 19.87 ? 708  PRO A CD  1 
ATOM   5513  N N   . GLU A 1 709  ? 14.752  105.224 -0.785  1.00 21.79 ? 709  GLU A N   1 
ATOM   5514  C CA  . GLU A 1 709  ? 14.656  105.255 -2.242  1.00 22.38 ? 709  GLU A CA  1 
ATOM   5515  C C   . GLU A 1 709  ? 13.518  106.127 -2.748  1.00 23.61 ? 709  GLU A C   1 
ATOM   5516  O O   . GLU A 1 709  ? 13.346  106.291 -3.960  1.00 25.23 ? 709  GLU A O   1 
ATOM   5517  C CB  . GLU A 1 709  ? 14.467  103.842 -2.803  1.00 22.03 ? 709  GLU A CB  1 
ATOM   5518  C CG  . GLU A 1 709  ? 15.591  102.874 -2.487  1.00 26.67 ? 709  GLU A CG  1 
ATOM   5519  C CD  . GLU A 1 709  ? 15.368  101.486 -3.079  1.00 28.32 ? 709  GLU A CD  1 
ATOM   5520  O OE1 . GLU A 1 709  ? 14.190  101.094 -3.261  1.00 30.78 ? 709  GLU A OE1 1 
ATOM   5521  O OE2 . GLU A 1 709  ? 16.367  100.778 -3.345  1.00 27.42 ? 709  GLU A OE2 1 
ATOM   5522  N N   . HIS A 1 710  ? 12.740  106.694 -1.841  1.00 22.46 ? 710  HIS A N   1 
ATOM   5523  C CA  . HIS A 1 710  ? 11.624  107.504 -2.276  1.00 22.92 ? 710  HIS A CA  1 
ATOM   5524  C C   . HIS A 1 710  ? 11.694  108.961 -1.875  1.00 24.53 ? 710  HIS A C   1 
ATOM   5525  O O   . HIS A 1 710  ? 10.704  109.682 -1.953  1.00 26.49 ? 710  HIS A O   1 
ATOM   5526  C CB  . HIS A 1 710  ? 10.326  106.864 -1.791  1.00 23.50 ? 710  HIS A CB  1 
ATOM   5527  C CG  . HIS A 1 710  ? 9.918   105.685 -2.608  1.00 23.08 ? 710  HIS A CG  1 
ATOM   5528  N ND1 . HIS A 1 710  ? 9.239   105.811 -3.801  1.00 22.93 ? 710  HIS A ND1 1 
ATOM   5529  C CD2 . HIS A 1 710  ? 10.188  104.367 -2.467  1.00 24.77 ? 710  HIS A CD2 1 
ATOM   5530  C CE1 . HIS A 1 710  ? 9.110   104.623 -4.360  1.00 24.70 ? 710  HIS A CE1 1 
ATOM   5531  N NE2 . HIS A 1 710  ? 9.678   103.728 -3.571  1.00 25.81 ? 710  HIS A NE2 1 
ATOM   5532  N N   . THR A 1 711  ? 12.869  109.403 -1.461  1.00 24.61 ? 711  THR A N   1 
ATOM   5533  C CA  . THR A 1 711  ? 13.039  110.790 -1.074  1.00 25.21 ? 711  THR A CA  1 
ATOM   5534  C C   . THR A 1 711  ? 14.523  111.127 -1.078  1.00 25.58 ? 711  THR A C   1 
ATOM   5535  O O   . THR A 1 711  ? 15.363  110.245 -0.952  1.00 25.54 ? 711  THR A O   1 
ATOM   5536  C CB  . THR A 1 711  ? 12.453  111.049 0.340   1.00 24.03 ? 711  THR A CB  1 
ATOM   5537  O OG1 . THR A 1 711  ? 12.508  112.452 0.634   1.00 25.61 ? 711  THR A OG1 1 
ATOM   5538  C CG2 . THR A 1 711  ? 13.254  110.296 1.393   1.00 21.21 ? 711  THR A CG2 1 
ATOM   5539  N N   . ASP A 1 712  ? 14.840  112.403 -1.254  1.00 28.77 ? 712  ASP A N   1 
ATOM   5540  C CA  . ASP A 1 712  ? 16.226  112.859 -1.231  1.00 31.71 ? 712  ASP A CA  1 
ATOM   5541  C C   . ASP A 1 712  ? 16.327  113.973 -0.208  1.00 31.62 ? 712  ASP A C   1 
ATOM   5542  O O   . ASP A 1 712  ? 17.380  114.594 -0.041  1.00 31.92 ? 712  ASP A O   1 
ATOM   5543  C CB  . ASP A 1 712  ? 16.677  113.358 -2.604  1.00 35.77 ? 712  ASP A CB  1 
ATOM   5544  C CG  . ASP A 1 712  ? 17.400  112.274 -3.407  1.00 41.88 ? 712  ASP A CG  1 
ATOM   5545  O OD1 . ASP A 1 712  ? 17.937  111.323 -2.782  1.00 43.18 ? 712  ASP A OD1 1 
ATOM   5546  O OD2 . ASP A 1 712  ? 17.447  112.379 -4.657  1.00 44.39 ? 712  ASP A OD2 1 
ATOM   5547  N N   . ASP A 1 713  ? 15.204  114.206 0.470   1.00 31.28 ? 713  ASP A N   1 
ATOM   5548  C CA  . ASP A 1 713  ? 15.083  115.214 1.516   1.00 31.19 ? 713  ASP A CA  1 
ATOM   5549  C C   . ASP A 1 713  ? 16.083  114.844 2.613   1.00 30.81 ? 713  ASP A C   1 
ATOM   5550  O O   . ASP A 1 713  ? 15.918  113.837 3.300   1.00 30.18 ? 713  ASP A O   1 
ATOM   5551  C CB  . ASP A 1 713  ? 13.659  115.185 2.062   1.00 31.59 ? 713  ASP A CB  1 
ATOM   5552  C CG  . ASP A 1 713  ? 13.347  116.371 2.937   1.00 33.24 ? 713  ASP A CG  1 
ATOM   5553  O OD1 . ASP A 1 713  ? 14.091  116.600 3.927   1.00 33.58 ? 713  ASP A OD1 1 
ATOM   5554  O OD2 . ASP A 1 713  ? 12.350  117.068 2.632   1.00 31.55 ? 713  ASP A OD2 1 
ATOM   5555  N N   . PRO A 1 714  ? 17.138  115.652 2.787   1.00 30.61 ? 714  PRO A N   1 
ATOM   5556  C CA  . PRO A 1 714  ? 18.166  115.388 3.799   1.00 30.38 ? 714  PRO A CA  1 
ATOM   5557  C C   . PRO A 1 714  ? 17.625  115.095 5.196   1.00 30.64 ? 714  PRO A C   1 
ATOM   5558  O O   . PRO A 1 714  ? 18.073  114.158 5.862   1.00 31.46 ? 714  PRO A O   1 
ATOM   5559  C CB  . PRO A 1 714  ? 19.027  116.649 3.753   1.00 30.08 ? 714  PRO A CB  1 
ATOM   5560  C CG  . PRO A 1 714  ? 18.910  117.068 2.319   1.00 31.33 ? 714  PRO A CG  1 
ATOM   5561  C CD  . PRO A 1 714  ? 17.424  116.908 2.074   1.00 30.65 ? 714  PRO A CD  1 
ATOM   5562  N N   . ASP A 1 715  ? 16.665  115.893 5.642   1.00 29.65 ? 715  ASP A N   1 
ATOM   5563  C CA  . ASP A 1 715  ? 16.082  115.695 6.954   1.00 29.14 ? 715  ASP A CA  1 
ATOM   5564  C C   . ASP A 1 715  ? 15.323  114.369 7.086   1.00 26.47 ? 715  ASP A C   1 
ATOM   5565  O O   . ASP A 1 715  ? 15.514  113.630 8.054   1.00 24.59 ? 715  ASP A O   1 
ATOM   5566  C CB  . ASP A 1 715  ? 15.173  116.871 7.277   1.00 32.78 ? 715  ASP A CB  1 
ATOM   5567  C CG  . ASP A 1 715  ? 15.911  118.183 7.227   1.00 35.85 ? 715  ASP A CG  1 
ATOM   5568  O OD1 . ASP A 1 715  ? 16.972  118.273 7.880   1.00 38.00 ? 715  ASP A OD1 1 
ATOM   5569  O OD2 . ASP A 1 715  ? 15.437  119.116 6.538   1.00 39.50 ? 715  ASP A OD2 1 
ATOM   5570  N N   . VAL A 1 716  ? 14.468  114.062 6.116   1.00 23.12 ? 716  VAL A N   1 
ATOM   5571  C CA  . VAL A 1 716  ? 13.723  112.817 6.180   1.00 21.05 ? 716  VAL A CA  1 
ATOM   5572  C C   . VAL A 1 716  ? 14.695  111.647 6.120   1.00 21.26 ? 716  VAL A C   1 
ATOM   5573  O O   . VAL A 1 716  ? 14.493  110.621 6.775   1.00 20.77 ? 716  VAL A O   1 
ATOM   5574  C CB  . VAL A 1 716  ? 12.702  112.708 5.034   1.00 20.38 ? 716  VAL A CB  1 
ATOM   5575  C CG1 . VAL A 1 716  ? 11.944  111.376 5.129   1.00 16.46 ? 716  VAL A CG1 1 
ATOM   5576  C CG2 . VAL A 1 716  ? 11.731  113.887 5.099   1.00 17.08 ? 716  VAL A CG2 1 
ATOM   5577  N N   . LEU A 1 717  ? 15.766  111.804 5.350   1.00 21.04 ? 717  LEU A N   1 
ATOM   5578  C CA  . LEU A 1 717  ? 16.756  110.741 5.251   1.00 21.32 ? 717  LEU A CA  1 
ATOM   5579  C C   . LEU A 1 717  ? 17.482  110.593 6.579   1.00 21.90 ? 717  LEU A C   1 
ATOM   5580  O O   . LEU A 1 717  ? 17.826  109.487 6.968   1.00 22.86 ? 717  LEU A O   1 
ATOM   5581  C CB  . LEU A 1 717  ? 17.747  111.012 4.115   1.00 18.05 ? 717  LEU A CB  1 
ATOM   5582  C CG  . LEU A 1 717  ? 17.171  110.748 2.715   1.00 19.19 ? 717  LEU A CG  1 
ATOM   5583  C CD1 . LEU A 1 717  ? 18.116  111.297 1.645   1.00 18.20 ? 717  LEU A CD1 1 
ATOM   5584  C CD2 . LEU A 1 717  ? 16.943  109.259 2.518   1.00 11.57 ? 717  LEU A CD2 1 
ATOM   5585  N N   . ARG A 1 718  ? 17.701  111.699 7.285   1.00 23.77 ? 718  ARG A N   1 
ATOM   5586  C CA  . ARG A 1 718  ? 18.373  111.625 8.581   1.00 25.02 ? 718  ARG A CA  1 
ATOM   5587  C C   . ARG A 1 718  ? 17.483  110.937 9.603   1.00 24.11 ? 718  ARG A C   1 
ATOM   5588  O O   . ARG A 1 718  ? 17.919  110.011 10.284  1.00 25.07 ? 718  ARG A O   1 
ATOM   5589  C CB  . ARG A 1 718  ? 18.740  113.010 9.105   1.00 28.03 ? 718  ARG A CB  1 
ATOM   5590  C CG  . ARG A 1 718  ? 19.973  113.574 8.480   1.00 32.38 ? 718  ARG A CG  1 
ATOM   5591  C CD  . ARG A 1 718  ? 20.663  114.574 9.390   1.00 36.85 ? 718  ARG A CD  1 
ATOM   5592  N NE  . ARG A 1 718  ? 21.801  115.155 8.689   1.00 40.97 ? 718  ARG A NE  1 
ATOM   5593  C CZ  . ARG A 1 718  ? 21.688  116.054 7.713   1.00 43.58 ? 718  ARG A CZ  1 
ATOM   5594  N NH1 . ARG A 1 718  ? 20.484  116.485 7.335   1.00 42.19 ? 718  ARG A NH1 1 
ATOM   5595  N NH2 . ARG A 1 718  ? 22.778  116.499 7.094   1.00 45.08 ? 718  ARG A NH2 1 
ATOM   5596  N N   . LEU A 1 719  ? 16.243  111.399 9.713   1.00 20.85 ? 719  LEU A N   1 
ATOM   5597  C CA  . LEU A 1 719  ? 15.300  110.805 10.643  1.00 21.00 ? 719  LEU A CA  1 
ATOM   5598  C C   . LEU A 1 719  ? 15.259  109.292 10.424  1.00 23.16 ? 719  LEU A C   1 
ATOM   5599  O O   . LEU A 1 719  ? 15.520  108.509 11.340  1.00 24.80 ? 719  LEU A O   1 
ATOM   5600  C CB  . LEU A 1 719  ? 13.907  111.402 10.425  1.00 19.09 ? 719  LEU A CB  1 
ATOM   5601  C CG  . LEU A 1 719  ? 12.818  110.905 11.370  1.00 16.46 ? 719  LEU A CG  1 
ATOM   5602  C CD1 . LEU A 1 719  ? 13.301  111.056 12.829  1.00 12.92 ? 719  LEU A CD1 1 
ATOM   5603  C CD2 . LEU A 1 719  ? 11.526  111.676 11.118  1.00 10.70 ? 719  LEU A CD2 1 
ATOM   5604  N N   . MET A 1 720  ? 14.932  108.891 9.199   1.00 23.84 ? 720  MET A N   1 
ATOM   5605  C CA  . MET A 1 720  ? 14.863  107.482 8.828   1.00 23.51 ? 720  MET A CA  1 
ATOM   5606  C C   . MET A 1 720  ? 16.085  106.710 9.304   1.00 23.04 ? 720  MET A C   1 
ATOM   5607  O O   . MET A 1 720  ? 15.961  105.705 10.008  1.00 24.54 ? 720  MET A O   1 
ATOM   5608  C CB  . MET A 1 720  ? 14.752  107.361 7.313   1.00 23.72 ? 720  MET A CB  1 
ATOM   5609  C CG  . MET A 1 720  ? 13.505  106.694 6.817   1.00 24.08 ? 720  MET A CG  1 
ATOM   5610  S SD  . MET A 1 720  ? 13.069  107.274 5.158   1.00 25.44 ? 720  MET A SD  1 
ATOM   5611  C CE  . MET A 1 720  ? 11.640  108.206 5.594   1.00 27.41 ? 720  MET A CE  1 
ATOM   5612  N N   . LYS A 1 721  ? 17.266  107.186 8.935   1.00 21.79 ? 721  LYS A N   1 
ATOM   5613  C CA  . LYS A 1 721  ? 18.503  106.508 9.311   1.00 23.59 ? 721  LYS A CA  1 
ATOM   5614  C C   . LYS A 1 721  ? 18.695  106.331 10.827  1.00 22.72 ? 721  LYS A C   1 
ATOM   5615  O O   . LYS A 1 721  ? 19.286  105.335 11.265  1.00 22.83 ? 721  LYS A O   1 
ATOM   5616  C CB  . LYS A 1 721  ? 19.708  107.251 8.721   1.00 26.66 ? 721  LYS A CB  1 
ATOM   5617  C CG  . LYS A 1 721  ? 20.938  106.377 8.513   1.00 32.99 ? 721  LYS A CG  1 
ATOM   5618  C CD  . LYS A 1 721  ? 22.080  107.170 7.894   1.00 37.93 ? 721  LYS A CD  1 
ATOM   5619  C CE  . LYS A 1 721  ? 23.239  106.275 7.463   1.00 39.55 ? 721  LYS A CE  1 
ATOM   5620  N NZ  . LYS A 1 721  ? 24.278  107.034 6.691   1.00 39.65 ? 721  LYS A NZ  1 
ATOM   5621  N N   . SER A 1 722  ? 18.195  107.281 11.621  1.00 19.74 ? 722  SER A N   1 
ATOM   5622  C CA  . SER A 1 722  ? 18.331  107.209 13.077  1.00 17.98 ? 722  SER A CA  1 
ATOM   5623  C C   . SER A 1 722  ? 17.317  106.267 13.731  1.00 17.37 ? 722  SER A C   1 
ATOM   5624  O O   . SER A 1 722  ? 17.290  106.131 14.950  1.00 17.11 ? 722  SER A O   1 
ATOM   5625  C CB  . SER A 1 722  ? 18.184  108.603 13.707  1.00 16.84 ? 722  SER A CB  1 
ATOM   5626  O OG  . SER A 1 722  ? 16.845  109.089 13.632  1.00 14.90 ? 722  SER A OG  1 
ATOM   5627  N N   . LEU A 1 723  ? 16.471  105.634 12.930  1.00 17.03 ? 723  LEU A N   1 
ATOM   5628  C CA  . LEU A 1 723  ? 15.474  104.716 13.473  1.00 16.76 ? 723  LEU A CA  1 
ATOM   5629  C C   . LEU A 1 723  ? 15.827  103.305 13.078  1.00 16.34 ? 723  LEU A C   1 
ATOM   5630  O O   . LEU A 1 723  ? 16.355  103.071 12.003  1.00 20.20 ? 723  LEU A O   1 
ATOM   5631  C CB  . LEU A 1 723  ? 14.074  105.063 12.954  1.00 14.61 ? 723  LEU A CB  1 
ATOM   5632  C CG  . LEU A 1 723  ? 13.636  106.499 13.258  1.00 14.15 ? 723  LEU A CG  1 
ATOM   5633  C CD1 . LEU A 1 723  ? 12.386  106.863 12.437  1.00 9.93  ? 723  LEU A CD1 1 
ATOM   5634  C CD2 . LEU A 1 723  ? 13.394  106.643 14.771  1.00 10.57 ? 723  LEU A CD2 1 
ATOM   5635  N N   . THR A 1 724  ? 15.529  102.369 13.959  1.00 16.87 ? 724  THR A N   1 
ATOM   5636  C CA  . THR A 1 724  ? 15.807  100.969 13.733  1.00 17.95 ? 724  THR A CA  1 
ATOM   5637  C C   . THR A 1 724  ? 14.695  100.183 14.391  1.00 19.73 ? 724  THR A C   1 
ATOM   5638  O O   . THR A 1 724  ? 14.221  100.574 15.461  1.00 21.80 ? 724  THR A O   1 
ATOM   5639  C CB  . THR A 1 724  ? 17.143  100.617 14.355  1.00 18.84 ? 724  THR A CB  1 
ATOM   5640  O OG1 . THR A 1 724  ? 18.170  100.987 13.438  1.00 20.23 ? 724  THR A OG1 1 
ATOM   5641  C CG2 . THR A 1 724  ? 17.238  99.147  14.668  1.00 23.43 ? 724  THR A CG2 1 
ATOM   5642  N N   . ILE A 1 725  ? 14.265  99.087  13.767  1.00 19.68 ? 725  ILE A N   1 
ATOM   5643  C CA  . ILE A 1 725  ? 13.190  98.308  14.356  1.00 20.66 ? 725  ILE A CA  1 
ATOM   5644  C C   . ILE A 1 725  ? 13.652  97.621  15.624  1.00 20.84 ? 725  ILE A C   1 
ATOM   5645  O O   . ILE A 1 725  ? 12.855  97.047  16.342  1.00 23.21 ? 725  ILE A O   1 
ATOM   5646  C CB  . ILE A 1 725  ? 12.625  97.240  13.397  1.00 20.31 ? 725  ILE A CB  1 
ATOM   5647  C CG1 . ILE A 1 725  ? 13.723  96.259  12.998  1.00 20.64 ? 725  ILE A CG1 1 
ATOM   5648  C CG2 . ILE A 1 725  ? 11.992  97.901  12.205  1.00 19.62 ? 725  ILE A CG2 1 
ATOM   5649  C CD1 . ILE A 1 725  ? 13.184  94.937  12.523  1.00 21.56 ? 725  ILE A CD1 1 
ATOM   5650  N N   . GLN A 1 726  ? 14.943  97.673  15.906  1.00 22.15 ? 726  GLN A N   1 
ATOM   5651  C CA  . GLN A 1 726  ? 15.443  97.044  17.119  1.00 24.27 ? 726  GLN A CA  1 
ATOM   5652  C C   . GLN A 1 726  ? 15.544  98.015  18.283  1.00 23.31 ? 726  GLN A C   1 
ATOM   5653  O O   . GLN A 1 726  ? 15.738  97.599  19.423  1.00 21.40 ? 726  GLN A O   1 
ATOM   5654  C CB  . GLN A 1 726  ? 16.813  96.432  16.877  1.00 26.35 ? 726  GLN A CB  1 
ATOM   5655  C CG  . GLN A 1 726  ? 16.775  95.237  15.966  1.00 31.61 ? 726  GLN A CG  1 
ATOM   5656  C CD  . GLN A 1 726  ? 17.808  95.347  14.875  1.00 34.66 ? 726  GLN A CD  1 
ATOM   5657  O OE1 . GLN A 1 726  ? 17.736  96.237  14.019  1.00 34.49 ? 726  GLN A OE1 1 
ATOM   5658  N NE2 . GLN A 1 726  ? 18.788  94.452  14.902  1.00 35.86 ? 726  GLN A NE2 1 
ATOM   5659  N N   . ARG A 1 727  ? 15.408  99.305  17.992  1.00 21.86 ? 727  ARG A N   1 
ATOM   5660  C CA  . ARG A 1 727  ? 15.524  100.316 19.027  1.00 21.51 ? 727  ARG A CA  1 
ATOM   5661  C C   . ARG A 1 727  ? 14.367  101.300 19.113  1.00 21.12 ? 727  ARG A C   1 
ATOM   5662  O O   . ARG A 1 727  ? 13.976  101.704 20.205  1.00 22.15 ? 727  ARG A O   1 
ATOM   5663  C CB  . ARG A 1 727  ? 16.811  101.117 18.823  1.00 20.22 ? 727  ARG A CB  1 
ATOM   5664  C CG  . ARG A 1 727  ? 18.097  100.347 19.020  1.00 21.01 ? 727  ARG A CG  1 
ATOM   5665  C CD  . ARG A 1 727  ? 19.304  101.237 18.696  1.00 22.30 ? 727  ARG A CD  1 
ATOM   5666  N NE  . ARG A 1 727  ? 19.366  102.435 19.535  1.00 23.82 ? 727  ARG A NE  1 
ATOM   5667  C CZ  . ARG A 1 727  ? 19.715  102.434 20.824  1.00 26.19 ? 727  ARG A CZ  1 
ATOM   5668  N NH1 . ARG A 1 727  ? 20.039  101.299 21.445  1.00 24.30 ? 727  ARG A NH1 1 
ATOM   5669  N NH2 . ARG A 1 727  ? 19.755  103.576 21.495  1.00 25.47 ? 727  ARG A NH2 1 
ATOM   5670  N N   . ASN A 1 728  ? 13.813  101.670 17.965  1.00 19.90 ? 728  ASN A N   1 
ATOM   5671  C CA  . ASN A 1 728  ? 12.767  102.681 17.925  1.00 18.66 ? 728  ASN A CA  1 
ATOM   5672  C C   . ASN A 1 728  ? 11.356  102.282 17.559  1.00 18.76 ? 728  ASN A C   1 
ATOM   5673  O O   . ASN A 1 728  ? 10.485  103.145 17.497  1.00 20.14 ? 728  ASN A O   1 
ATOM   5674  C CB  . ASN A 1 728  ? 13.220  103.787 16.983  1.00 18.13 ? 728  ASN A CB  1 
ATOM   5675  C CG  . ASN A 1 728  ? 14.535  104.387 17.409  1.00 17.02 ? 728  ASN A CG  1 
ATOM   5676  O OD1 . ASN A 1 728  ? 14.566  105.370 18.141  1.00 19.21 ? 728  ASN A OD1 1 
ATOM   5677  N ND2 . ASN A 1 728  ? 15.630  103.779 16.979  1.00 14.95 ? 728  ASN A ND2 1 
ATOM   5678  N N   . TYR A 1 729  ? 11.126  100.994 17.311  1.00 17.83 ? 729  TYR A N   1 
ATOM   5679  C CA  . TYR A 1 729  ? 9.804   100.522 16.936  1.00 15.66 ? 729  TYR A CA  1 
ATOM   5680  C C   . TYR A 1 729  ? 9.361   99.311  17.781  1.00 15.98 ? 729  TYR A C   1 
ATOM   5681  O O   . TYR A 1 729  ? 9.930   98.214  17.703  1.00 15.96 ? 729  TYR A O   1 
ATOM   5682  C CB  . TYR A 1 729  ? 9.791   100.181 15.442  1.00 15.03 ? 729  TYR A CB  1 
ATOM   5683  C CG  . TYR A 1 729  ? 8.410   99.917  14.907  1.00 17.22 ? 729  TYR A CG  1 
ATOM   5684  C CD1 . TYR A 1 729  ? 7.438   100.912 14.923  1.00 17.72 ? 729  TYR A CD1 1 
ATOM   5685  C CD2 . TYR A 1 729  ? 8.061   98.665  14.405  1.00 16.67 ? 729  TYR A CD2 1 
ATOM   5686  C CE1 . TYR A 1 729  ? 6.154   100.667 14.455  1.00 16.89 ? 729  TYR A CE1 1 
ATOM   5687  C CE2 . TYR A 1 729  ? 6.783   98.412  13.934  1.00 16.98 ? 729  TYR A CE2 1 
ATOM   5688  C CZ  . TYR A 1 729  ? 5.833   99.417  13.965  1.00 16.78 ? 729  TYR A CZ  1 
ATOM   5689  O OH  . TYR A 1 729  ? 4.550   99.169  13.538  1.00 16.29 ? 729  TYR A OH  1 
ATOM   5690  N N   . VAL A 1 730  ? 8.343   99.532  18.602  1.00 14.47 ? 730  VAL A N   1 
ATOM   5691  C CA  . VAL A 1 730  ? 7.812   98.489  19.466  1.00 14.20 ? 730  VAL A CA  1 
ATOM   5692  C C   . VAL A 1 730  ? 6.465   98.066  18.912  1.00 14.24 ? 730  VAL A C   1 
ATOM   5693  O O   . VAL A 1 730  ? 5.588   98.905  18.699  1.00 14.61 ? 730  VAL A O   1 
ATOM   5694  C CB  . VAL A 1 730  ? 7.601   99.019  20.893  1.00 14.53 ? 730  VAL A CB  1 
ATOM   5695  C CG1 . VAL A 1 730  ? 7.226   97.887  21.806  1.00 15.34 ? 730  VAL A CG1 1 
ATOM   5696  C CG2 . VAL A 1 730  ? 8.859   99.718  21.385  1.00 15.26 ? 730  VAL A CG2 1 
ATOM   5697  N N   . CYS A 1 731  ? 6.280   96.775  18.673  1.00 14.80 ? 731  CYS A N   1 
ATOM   5698  C CA  . CYS A 1 731  ? 4.999   96.335  18.134  1.00 16.28 ? 731  CYS A CA  1 
ATOM   5699  C C   . CYS A 1 731  ? 4.485   95.022  18.675  1.00 16.57 ? 731  CYS A C   1 
ATOM   5700  O O   . CYS A 1 731  ? 5.242   94.211  19.189  1.00 16.60 ? 731  CYS A O   1 
ATOM   5701  C CB  . CYS A 1 731  ? 5.067   96.250  16.608  1.00 15.84 ? 731  CYS A CB  1 
ATOM   5702  S SG  . CYS A 1 731  ? 6.266   95.059  15.974  1.00 18.83 ? 731  CYS A SG  1 
ATOM   5703  N N   . GLN A 1 732  ? 3.174   94.843  18.560  1.00 17.08 ? 732  GLN A N   1 
ATOM   5704  C CA  . GLN A 1 732  ? 2.488   93.627  18.975  1.00 16.69 ? 732  GLN A CA  1 
ATOM   5705  C C   . GLN A 1 732  ? 1.256   93.501  18.077  1.00 16.03 ? 732  GLN A C   1 
ATOM   5706  O O   . GLN A 1 732  ? 0.397   94.381  18.057  1.00 15.62 ? 732  GLN A O   1 
ATOM   5707  C CB  . GLN A 1 732  ? 2.057   93.704  20.441  1.00 15.81 ? 732  GLN A CB  1 
ATOM   5708  C CG  . GLN A 1 732  ? 1.438   92.387  20.982  1.00 17.14 ? 732  GLN A CG  1 
ATOM   5709  C CD  . GLN A 1 732  ? 0.907   92.510  22.423  1.00 19.24 ? 732  GLN A CD  1 
ATOM   5710  O OE1 . GLN A 1 732  ? 1.634   92.895  23.348  1.00 21.21 ? 732  GLN A OE1 1 
ATOM   5711  N NE2 . GLN A 1 732  ? -0.362  92.184  22.610  1.00 18.40 ? 732  GLN A NE2 1 
ATOM   5712  N N   . GLY A 1 733  ? 1.170   92.408  17.329  1.00 16.45 ? 733  GLY A N   1 
ATOM   5713  C CA  . GLY A 1 733  ? 0.032   92.225  16.446  1.00 17.33 ? 733  GLY A CA  1 
ATOM   5714  C C   . GLY A 1 733  ? -0.084  93.390  15.481  1.00 18.51 ? 733  GLY A C   1 
ATOM   5715  O O   . GLY A 1 733  ? 0.863   93.716  14.772  1.00 18.92 ? 733  GLY A O   1 
ATOM   5716  N N   . ASP A 1 734  ? -1.235  94.041  15.454  1.00 19.66 ? 734  ASP A N   1 
ATOM   5717  C CA  . ASP A 1 734  ? -1.410  95.152  14.533  1.00 21.26 ? 734  ASP A CA  1 
ATOM   5718  C C   . ASP A 1 734  ? -1.116  96.504  15.170  1.00 22.07 ? 734  ASP A C   1 
ATOM   5719  O O   . ASP A 1 734  ? -1.334  97.545  14.550  1.00 22.16 ? 734  ASP A O   1 
ATOM   5720  C CB  . ASP A 1 734  ? -2.830  95.141  13.930  1.00 20.16 ? 734  ASP A CB  1 
ATOM   5721  C CG  . ASP A 1 734  ? -3.935  95.221  14.986  1.00 21.99 ? 734  ASP A CG  1 
ATOM   5722  O OD1 . ASP A 1 734  ? -3.653  95.640  16.135  1.00 23.48 ? 734  ASP A OD1 1 
ATOM   5723  O OD2 . ASP A 1 734  ? -5.097  94.876  14.657  1.00 21.63 ? 734  ASP A OD2 1 
ATOM   5724  N N   . ASP A 1 735  ? -0.610  96.498  16.400  1.00 23.00 ? 735  ASP A N   1 
ATOM   5725  C CA  . ASP A 1 735  ? -0.311  97.762  17.066  1.00 24.24 ? 735  ASP A CA  1 
ATOM   5726  C C   . ASP A 1 735  ? 1.189   98.067  17.069  1.00 22.91 ? 735  ASP A C   1 
ATOM   5727  O O   . ASP A 1 735  ? 2.022   97.196  17.336  1.00 22.29 ? 735  ASP A O   1 
ATOM   5728  C CB  . ASP A 1 735  ? -0.873  97.756  18.497  1.00 27.79 ? 735  ASP A CB  1 
ATOM   5729  C CG  . ASP A 1 735  ? -0.906  99.153  19.130  1.00 33.73 ? 735  ASP A CG  1 
ATOM   5730  O OD1 . ASP A 1 735  ? -0.682  100.170 18.424  1.00 37.74 ? 735  ASP A OD1 1 
ATOM   5731  O OD2 . ASP A 1 735  ? -1.168  99.237  20.350  1.00 36.85 ? 735  ASP A OD2 1 
ATOM   5732  N N   . GLY A 1 736  ? 1.522   99.316  16.753  1.00 21.55 ? 736  GLY A N   1 
ATOM   5733  C CA  . GLY A 1 736  ? 2.911   99.732  16.709  1.00 18.83 ? 736  GLY A CA  1 
ATOM   5734  C C   . GLY A 1 736  ? 3.143   101.119 17.281  1.00 17.93 ? 736  GLY A C   1 
ATOM   5735  O O   . GLY A 1 736  ? 2.312   102.014 17.138  1.00 15.77 ? 736  GLY A O   1 
ATOM   5736  N N   . LEU A 1 737  ? 4.284   101.292 17.935  1.00 16.71 ? 737  LEU A N   1 
ATOM   5737  C CA  . LEU A 1 737  ? 4.641   102.561 18.530  1.00 17.10 ? 737  LEU A CA  1 
ATOM   5738  C C   . LEU A 1 737  ? 6.013   102.965 18.006  1.00 19.31 ? 737  LEU A C   1 
ATOM   5739  O O   . LEU A 1 737  ? 7.002   102.278 18.249  1.00 20.47 ? 737  LEU A O   1 
ATOM   5740  C CB  . LEU A 1 737  ? 4.665   102.431 20.057  1.00 16.29 ? 737  LEU A CB  1 
ATOM   5741  C CG  . LEU A 1 737  ? 5.109   103.652 20.879  1.00 16.86 ? 737  LEU A CG  1 
ATOM   5742  C CD1 . LEU A 1 737  ? 4.126   104.792 20.685  1.00 11.63 ? 737  LEU A CD1 1 
ATOM   5743  C CD2 . LEU A 1 737  ? 5.234   103.270 22.361  1.00 13.69 ? 737  LEU A CD2 1 
ATOM   5744  N N   . MET A 1 738  ? 6.056   104.068 17.260  1.00 22.55 ? 738  MET A N   1 
ATOM   5745  C CA  . MET A 1 738  ? 7.296   104.599 16.690  1.00 24.20 ? 738  MET A CA  1 
ATOM   5746  C C   . MET A 1 738  ? 7.856   105.598 17.699  1.00 24.13 ? 738  MET A C   1 
ATOM   5747  O O   . MET A 1 738  ? 7.279   106.665 17.909  1.00 24.77 ? 738  MET A O   1 
ATOM   5748  C CB  . MET A 1 738  ? 7.005   105.307 15.362  1.00 27.57 ? 738  MET A CB  1 
ATOM   5749  C CG  . MET A 1 738  ? 8.245   105.794 14.623  1.00 32.47 ? 738  MET A CG  1 
ATOM   5750  S SD  . MET A 1 738  ? 9.412   104.432 14.394  1.00 41.20 ? 738  MET A SD  1 
ATOM   5751  C CE  . MET A 1 738  ? 8.898   103.811 12.782  1.00 39.76 ? 738  MET A CE  1 
ATOM   5752  N N   . ILE A 1 739  ? 8.977   105.252 18.321  1.00 22.75 ? 739  ILE A N   1 
ATOM   5753  C CA  . ILE A 1 739  ? 9.585   106.107 19.332  1.00 22.18 ? 739  ILE A CA  1 
ATOM   5754  C C   . ILE A 1 739  ? 10.784  106.927 18.836  1.00 22.02 ? 739  ILE A C   1 
ATOM   5755  O O   . ILE A 1 739  ? 11.896  106.416 18.696  1.00 21.20 ? 739  ILE A O   1 
ATOM   5756  C CB  . ILE A 1 739  ? 10.011  105.260 20.558  1.00 22.58 ? 739  ILE A CB  1 
ATOM   5757  C CG1 . ILE A 1 739  ? 8.837   104.384 20.997  1.00 20.12 ? 739  ILE A CG1 1 
ATOM   5758  C CG2 . ILE A 1 739  ? 10.465  106.169 21.707  1.00 20.48 ? 739  ILE A CG2 1 
ATOM   5759  C CD1 . ILE A 1 739  ? 9.137   103.518 22.170  1.00 19.03 ? 739  ILE A CD1 1 
ATOM   5760  N N   . ILE A 1 740  ? 10.548  108.208 18.589  1.00 21.40 ? 740  ILE A N   1 
ATOM   5761  C CA  . ILE A 1 740  ? 11.595  109.098 18.125  1.00 22.65 ? 740  ILE A CA  1 
ATOM   5762  C C   . ILE A 1 740  ? 12.290  109.833 19.270  1.00 24.80 ? 740  ILE A C   1 
ATOM   5763  O O   . ILE A 1 740  ? 11.772  110.812 19.808  1.00 25.40 ? 740  ILE A O   1 
ATOM   5764  C CB  . ILE A 1 740  ? 11.015  110.125 17.143  1.00 22.19 ? 740  ILE A CB  1 
ATOM   5765  C CG1 . ILE A 1 740  ? 10.369  109.374 15.973  1.00 22.40 ? 740  ILE A CG1 1 
ATOM   5766  C CG2 . ILE A 1 740  ? 12.106  111.094 16.665  1.00 17.59 ? 740  ILE A CG2 1 
ATOM   5767  C CD1 . ILE A 1 740  ? 9.752   110.265 14.931  1.00 22.84 ? 740  ILE A CD1 1 
ATOM   5768  N N   . ASP A 1 741  ? 13.461  109.344 19.649  1.00 27.83 ? 741  ASP A N   1 
ATOM   5769  C CA  . ASP A 1 741  ? 14.243  109.972 20.712  1.00 32.83 ? 741  ASP A CA  1 
ATOM   5770  C C   . ASP A 1 741  ? 14.593  111.408 20.286  1.00 35.02 ? 741  ASP A C   1 
ATOM   5771  O O   . ASP A 1 741  ? 14.791  111.675 19.103  1.00 34.71 ? 741  ASP A O   1 
ATOM   5772  C CB  . ASP A 1 741  ? 15.547  109.178 20.959  1.00 32.53 ? 741  ASP A CB  1 
ATOM   5773  C CG  . ASP A 1 741  ? 15.310  107.832 21.661  1.00 32.59 ? 741  ASP A CG  1 
ATOM   5774  O OD1 . ASP A 1 741  ? 16.247  107.016 21.746  1.00 31.53 ? 741  ASP A OD1 1 
ATOM   5775  O OD2 . ASP A 1 741  ? 14.195  107.586 22.149  1.00 34.18 ? 741  ASP A OD2 1 
ATOM   5776  N N   . GLY A 1 742  ? 14.657  112.331 21.241  1.00 38.51 ? 742  GLY A N   1 
ATOM   5777  C CA  . GLY A 1 742  ? 15.014  113.701 20.907  1.00 42.35 ? 742  GLY A CA  1 
ATOM   5778  C C   . GLY A 1 742  ? 16.500  113.900 21.158  1.00 45.72 ? 742  GLY A C   1 
ATOM   5779  O O   . GLY A 1 742  ? 17.242  112.918 21.260  1.00 45.68 ? 742  GLY A O   1 
ATOM   5780  N N   . THR A 1 743  ? 16.942  115.156 21.244  1.00 48.40 ? 743  THR A N   1 
ATOM   5781  C CA  . THR A 1 743  ? 18.353  115.475 21.515  1.00 51.06 ? 743  THR A CA  1 
ATOM   5782  C C   . THR A 1 743  ? 18.433  116.627 22.518  1.00 51.63 ? 743  THR A C   1 
ATOM   5783  O O   . THR A 1 743  ? 17.417  117.031 23.093  1.00 51.96 ? 743  THR A O   1 
ATOM   5784  C CB  . THR A 1 743  ? 19.120  115.891 20.231  1.00 51.13 ? 743  THR A CB  1 
ATOM   5785  O OG1 . THR A 1 743  ? 18.477  117.027 19.628  1.00 53.42 ? 743  THR A OG1 1 
ATOM   5786  C CG2 . THR A 1 743  ? 19.168  114.736 19.239  1.00 49.90 ? 743  THR A CG2 1 
ATOM   5787  N N   . THR A 1 744  ? 19.634  117.155 22.736  1.00 52.81 ? 744  THR A N   1 
ATOM   5788  C CA  . THR A 1 744  ? 19.793  118.280 23.657  1.00 53.78 ? 744  THR A CA  1 
ATOM   5789  C C   . THR A 1 744  ? 19.214  119.514 22.959  1.00 54.14 ? 744  THR A C   1 
ATOM   5790  O O   . THR A 1 744  ? 18.769  120.469 23.612  1.00 55.07 ? 744  THR A O   1 
ATOM   5791  C CB  . THR A 1 744  ? 21.292  118.544 24.003  1.00 53.54 ? 744  THR A CB  1 
ATOM   5792  O OG1 . THR A 1 744  ? 21.852  117.386 24.635  1.00 53.31 ? 744  THR A OG1 1 
ATOM   5793  C CG2 . THR A 1 744  ? 21.428  119.734 24.955  1.00 53.84 ? 744  THR A CG2 1 
ATOM   5794  N N   . ALA A 1 745  ? 19.217  119.471 21.625  1.00 52.97 ? 745  ALA A N   1 
ATOM   5795  C CA  . ALA A 1 745  ? 18.699  120.563 20.802  1.00 52.00 ? 745  ALA A CA  1 
ATOM   5796  C C   . ALA A 1 745  ? 17.171  120.523 20.741  1.00 51.23 ? 745  ALA A C   1 
ATOM   5797  O O   . ALA A 1 745  ? 16.546  121.220 19.935  1.00 50.85 ? 745  ALA A O   1 
ATOM   5798  C CB  . ALA A 1 745  ? 19.279  120.474 19.392  1.00 51.86 ? 745  ALA A CB  1 
ATOM   5799  N N   . GLY A 1 746  ? 16.576  119.700 21.599  1.00 49.64 ? 746  GLY A N   1 
ATOM   5800  C CA  . GLY A 1 746  ? 15.133  119.585 21.624  1.00 46.80 ? 746  GLY A CA  1 
ATOM   5801  C C   . GLY A 1 746  ? 14.623  118.415 20.806  1.00 44.12 ? 746  GLY A C   1 
ATOM   5802  O O   . GLY A 1 746  ? 15.366  117.483 20.498  1.00 45.65 ? 746  GLY A O   1 
ATOM   5803  N N   . LYS A 1 747  ? 13.351  118.471 20.436  1.00 40.32 ? 747  LYS A N   1 
ATOM   5804  C CA  . LYS A 1 747  ? 12.748  117.400 19.675  1.00 36.67 ? 747  LYS A CA  1 
ATOM   5805  C C   . LYS A 1 747  ? 12.871  117.547 18.172  1.00 36.05 ? 747  LYS A C   1 
ATOM   5806  O O   . LYS A 1 747  ? 13.002  118.654 17.648  1.00 36.73 ? 747  LYS A O   1 
ATOM   5807  C CB  . LYS A 1 747  ? 11.276  117.245 20.071  1.00 35.07 ? 747  LYS A CB  1 
ATOM   5808  C CG  . LYS A 1 747  ? 10.463  118.517 20.086  1.00 29.88 ? 747  LYS A CG  1 
ATOM   5809  C CD  . LYS A 1 747  ? 9.050   118.221 20.589  1.00 28.33 ? 747  LYS A CD  1 
ATOM   5810  C CE  . LYS A 1 747  ? 8.126   119.407 20.398  1.00 26.90 ? 747  LYS A CE  1 
ATOM   5811  N NZ  . LYS A 1 747  ? 6.715   118.974 20.440  1.00 23.84 ? 747  LYS A NZ  1 
ATOM   5812  N N   . VAL A 1 748  ? 12.833  116.404 17.494  1.00 34.08 ? 748  VAL A N   1 
ATOM   5813  C CA  . VAL A 1 748  ? 12.924  116.328 16.040  1.00 31.43 ? 748  VAL A CA  1 
ATOM   5814  C C   . VAL A 1 748  ? 11.821  117.159 15.387  1.00 30.73 ? 748  VAL A C   1 
ATOM   5815  O O   . VAL A 1 748  ? 10.705  117.229 15.899  1.00 31.58 ? 748  VAL A O   1 
ATOM   5816  C CB  . VAL A 1 748  ? 12.808  114.852 15.577  1.00 29.35 ? 748  VAL A CB  1 
ATOM   5817  C CG1 . VAL A 1 748  ? 12.827  114.753 14.077  1.00 27.12 ? 748  VAL A CG1 1 
ATOM   5818  C CG2 . VAL A 1 748  ? 13.947  114.051 16.158  1.00 27.92 ? 748  VAL A CG2 1 
ATOM   5819  N N   . ASN A 1 749  ? 12.144  117.780 14.255  1.00 30.07 ? 749  ASN A N   1 
ATOM   5820  C CA  . ASN A 1 749  ? 11.204  118.615 13.510  1.00 28.39 ? 749  ASN A CA  1 
ATOM   5821  C C   . ASN A 1 749  ? 9.899   117.884 13.163  1.00 28.58 ? 749  ASN A C   1 
ATOM   5822  O O   . ASN A 1 749  ? 9.924   116.806 12.581  1.00 29.32 ? 749  ASN A O   1 
ATOM   5823  C CB  . ASN A 1 749  ? 11.866  119.107 12.220  1.00 26.63 ? 749  ASN A CB  1 
ATOM   5824  C CG  . ASN A 1 749  ? 11.029  120.143 11.496  1.00 27.88 ? 749  ASN A CG  1 
ATOM   5825  O OD1 . ASN A 1 749  ? 11.165  121.344 11.728  1.00 27.92 ? 749  ASN A OD1 1 
ATOM   5826  N ND2 . ASN A 1 749  ? 10.141  119.681 10.631  1.00 24.93 ? 749  ASN A ND2 1 
ATOM   5827  N N   . SER A 1 750  ? 8.769   118.492 13.512  1.00 28.33 ? 750  SER A N   1 
ATOM   5828  C CA  . SER A 1 750  ? 7.441   117.932 13.260  1.00 28.79 ? 750  SER A CA  1 
ATOM   5829  C C   . SER A 1 750  ? 7.135   117.759 11.768  1.00 30.01 ? 750  SER A C   1 
ATOM   5830  O O   . SER A 1 750  ? 6.547   116.765 11.331  1.00 28.63 ? 750  SER A O   1 
ATOM   5831  C CB  . SER A 1 750  ? 6.381   118.838 13.885  1.00 26.57 ? 750  SER A CB  1 
ATOM   5832  O OG  . SER A 1 750  ? 5.077   118.390 13.569  1.00 30.48 ? 750  SER A OG  1 
ATOM   5833  N N   . GLU A 1 751  ? 7.519   118.762 10.997  1.00 31.77 ? 751  GLU A N   1 
ATOM   5834  C CA  . GLU A 1 751  ? 7.318   118.765 9.561   1.00 31.89 ? 751  GLU A CA  1 
ATOM   5835  C C   . GLU A 1 751  ? 8.124   117.598 8.958   1.00 31.16 ? 751  GLU A C   1 
ATOM   5836  O O   . GLU A 1 751  ? 7.667   116.942 8.016   1.00 31.38 ? 751  GLU A O   1 
ATOM   5837  C CB  . GLU A 1 751  ? 7.795   120.118 9.038   1.00 34.83 ? 751  GLU A CB  1 
ATOM   5838  C CG  . GLU A 1 751  ? 7.534   120.447 7.599   1.00 41.48 ? 751  GLU A CG  1 
ATOM   5839  C CD  . GLU A 1 751  ? 8.168   121.783 7.232   1.00 46.12 ? 751  GLU A CD  1 
ATOM   5840  O OE1 . GLU A 1 751  ? 7.814   122.801 7.874   1.00 46.70 ? 751  GLU A OE1 1 
ATOM   5841  O OE2 . GLU A 1 751  ? 9.025   121.814 6.315   1.00 48.73 ? 751  GLU A OE2 1 
ATOM   5842  N N   . THR A 1 752  ? 9.310   117.332 9.512   1.00 28.12 ? 752  THR A N   1 
ATOM   5843  C CA  . THR A 1 752  ? 10.147  116.244 9.018   1.00 27.13 ? 752  THR A CA  1 
ATOM   5844  C C   . THR A 1 752  ? 9.478   114.911 9.319   1.00 28.16 ? 752  THR A C   1 
ATOM   5845  O O   . THR A 1 752  ? 9.551   113.976 8.520   1.00 29.39 ? 752  THR A O   1 
ATOM   5846  C CB  . THR A 1 752  ? 11.546  116.226 9.674   1.00 27.01 ? 752  THR A CB  1 
ATOM   5847  O OG1 . THR A 1 752  ? 12.233  117.449 9.399   1.00 26.17 ? 752  THR A OG1 1 
ATOM   5848  C CG2 . THR A 1 752  ? 12.372  115.073 9.118   1.00 25.84 ? 752  THR A CG2 1 
ATOM   5849  N N   . ILE A 1 753  ? 8.839   114.823 10.480  1.00 26.33 ? 753  ILE A N   1 
ATOM   5850  C CA  . ILE A 1 753  ? 8.143   113.613 10.880  1.00 24.22 ? 753  ILE A CA  1 
ATOM   5851  C C   . ILE A 1 753  ? 6.920   113.409 9.993   1.00 24.47 ? 753  ILE A C   1 
ATOM   5852  O O   . ILE A 1 753  ? 6.631   112.289 9.567   1.00 24.09 ? 753  ILE A O   1 
ATOM   5853  C CB  . ILE A 1 753  ? 7.714   113.708 12.347  1.00 23.85 ? 753  ILE A CB  1 
ATOM   5854  C CG1 . ILE A 1 753  ? 8.958   113.743 13.225  1.00 22.51 ? 753  ILE A CG1 1 
ATOM   5855  C CG2 . ILE A 1 753  ? 6.808   112.527 12.728  1.00 24.45 ? 753  ILE A CG2 1 
ATOM   5856  C CD1 . ILE A 1 753  ? 8.670   114.117 14.657  1.00 24.96 ? 753  ILE A CD1 1 
ATOM   5857  N N   . GLN A 1 754  ? 6.206   114.492 9.701   1.00 25.00 ? 754  GLN A N   1 
ATOM   5858  C CA  . GLN A 1 754  ? 5.025   114.400 8.851   1.00 27.29 ? 754  GLN A CA  1 
ATOM   5859  C C   . GLN A 1 754  ? 5.378   113.807 7.478   1.00 27.44 ? 754  GLN A C   1 
ATOM   5860  O O   . GLN A 1 754  ? 4.685   112.913 7.000   1.00 26.59 ? 754  GLN A O   1 
ATOM   5861  C CB  . GLN A 1 754  ? 4.382   115.776 8.693   1.00 29.18 ? 754  GLN A CB  1 
ATOM   5862  C CG  . GLN A 1 754  ? 2.996   115.913 9.320   1.00 33.05 ? 754  GLN A CG  1 
ATOM   5863  C CD  . GLN A 1 754  ? 2.550   117.377 9.423   1.00 35.60 ? 754  GLN A CD  1 
ATOM   5864  O OE1 . GLN A 1 754  ? 3.133   118.163 10.181  1.00 35.35 ? 754  GLN A OE1 1 
ATOM   5865  N NE2 . GLN A 1 754  ? 1.519   117.747 8.656   1.00 35.57 ? 754  GLN A NE2 1 
ATOM   5866  N N   . ASN A 1 755  ? 6.452   114.291 6.850   1.00 27.83 ? 755  ASN A N   1 
ATOM   5867  C CA  . ASN A 1 755  ? 6.862   113.761 5.549   1.00 28.51 ? 755  ASN A CA  1 
ATOM   5868  C C   . ASN A 1 755  ? 7.194   112.264 5.635   1.00 28.10 ? 755  ASN A C   1 
ATOM   5869  O O   . ASN A 1 755  ? 6.863   111.495 4.730   1.00 28.17 ? 755  ASN A O   1 
ATOM   5870  C CB  . ASN A 1 755  ? 8.089   114.511 4.990   1.00 32.17 ? 755  ASN A CB  1 
ATOM   5871  C CG  . ASN A 1 755  ? 7.795   115.982 4.668   1.00 38.39 ? 755  ASN A CG  1 
ATOM   5872  O OD1 . ASN A 1 755  ? 6.636   116.346 4.365   1.00 42.36 ? 755  ASN A OD1 1 
ATOM   5873  N ND2 . ASN A 1 755  ? 8.843   116.839 4.718   1.00 38.49 ? 755  ASN A ND2 1 
ATOM   5874  N N   . ASP A 1 756  ? 7.849   111.852 6.720   1.00 26.19 ? 756  ASP A N   1 
ATOM   5875  C CA  . ASP A 1 756  ? 8.229   110.448 6.906   1.00 23.69 ? 756  ASP A CA  1 
ATOM   5876  C C   . ASP A 1 756  ? 6.962   109.612 6.991   1.00 23.33 ? 756  ASP A C   1 
ATOM   5877  O O   . ASP A 1 756  ? 6.838   108.585 6.323   1.00 21.10 ? 756  ASP A O   1 
ATOM   5878  C CB  . ASP A 1 756  ? 9.099   110.290 8.182   1.00 23.16 ? 756  ASP A CB  1 
ATOM   5879  C CG  . ASP A 1 756  ? 9.483   108.830 8.483   1.00 24.19 ? 756  ASP A CG  1 
ATOM   5880  O OD1 . ASP A 1 756  ? 9.221   107.979 7.620   1.00 28.10 ? 756  ASP A OD1 1 
ATOM   5881  O OD2 . ASP A 1 756  ? 10.047  108.512 9.567   1.00 14.19 ? 756  ASP A OD2 1 
ATOM   5882  N N   . LEU A 1 757  ? 6.009   110.069 7.798   1.00 24.83 ? 757  LEU A N   1 
ATOM   5883  C CA  . LEU A 1 757  ? 4.751   109.351 7.976   1.00 25.16 ? 757  LEU A CA  1 
ATOM   5884  C C   . LEU A 1 757  ? 3.969   109.200 6.678   1.00 25.50 ? 757  LEU A C   1 
ATOM   5885  O O   . LEU A 1 757  ? 3.383   108.144 6.426   1.00 25.92 ? 757  LEU A O   1 
ATOM   5886  C CB  . LEU A 1 757  ? 3.886   110.058 9.018   1.00 25.88 ? 757  LEU A CB  1 
ATOM   5887  C CG  . LEU A 1 757  ? 4.506   110.142 10.415  1.00 25.86 ? 757  LEU A CG  1 
ATOM   5888  C CD1 . LEU A 1 757  ? 3.600   110.935 11.350  1.00 22.81 ? 757  LEU A CD1 1 
ATOM   5889  C CD2 . LEU A 1 757  ? 4.736   108.728 10.942  1.00 24.86 ? 757  LEU A CD2 1 
ATOM   5890  N N   . GLU A 1 758  ? 3.957   110.242 5.852   1.00 25.30 ? 758  GLU A N   1 
ATOM   5891  C CA  . GLU A 1 758  ? 3.227   110.177 4.583   1.00 27.95 ? 758  GLU A CA  1 
ATOM   5892  C C   . GLU A 1 758  ? 3.875   109.122 3.687   1.00 25.76 ? 758  GLU A C   1 
ATOM   5893  O O   . GLU A 1 758  ? 3.185   108.380 2.990   1.00 25.92 ? 758  GLU A O   1 
ATOM   5894  C CB  . GLU A 1 758  ? 3.223   111.546 3.884   1.00 32.64 ? 758  GLU A CB  1 
ATOM   5895  C CG  . GLU A 1 758  ? 2.679   112.672 4.754   1.00 39.54 ? 758  GLU A CG  1 
ATOM   5896  C CD  . GLU A 1 758  ? 2.878   114.057 4.141   1.00 44.78 ? 758  GLU A CD  1 
ATOM   5897  O OE1 . GLU A 1 758  ? 4.021   114.375 3.729   1.00 45.39 ? 758  GLU A OE1 1 
ATOM   5898  O OE2 . GLU A 1 758  ? 1.890   114.831 4.086   1.00 47.12 ? 758  GLU A OE2 1 
ATOM   5899  N N   . LEU A 1 759  ? 5.204   109.061 3.708   1.00 23.35 ? 759  LEU A N   1 
ATOM   5900  C CA  . LEU A 1 759  ? 5.931   108.062 2.927   1.00 22.40 ? 759  LEU A CA  1 
ATOM   5901  C C   . LEU A 1 759  ? 5.529   106.662 3.404   1.00 21.49 ? 759  LEU A C   1 
ATOM   5902  O O   . LEU A 1 759  ? 5.283   105.761 2.592   1.00 21.14 ? 759  LEU A O   1 
ATOM   5903  C CB  . LEU A 1 759  ? 7.443   108.243 3.094   1.00 20.67 ? 759  LEU A CB  1 
ATOM   5904  C CG  . LEU A 1 759  ? 8.032   109.524 2.501   1.00 20.83 ? 759  LEU A CG  1 
ATOM   5905  C CD1 . LEU A 1 759  ? 9.557   109.498 2.640   1.00 19.19 ? 759  LEU A CD1 1 
ATOM   5906  C CD2 . LEU A 1 759  ? 7.620   109.643 1.033   1.00 18.73 ? 759  LEU A CD2 1 
ATOM   5907  N N   . ILE A 1 760  ? 5.468   106.492 4.726   1.00 19.38 ? 760  ILE A N   1 
ATOM   5908  C CA  . ILE A 1 760  ? 5.076   105.215 5.321   1.00 18.33 ? 760  ILE A CA  1 
ATOM   5909  C C   . ILE A 1 760  ? 3.675   104.846 4.834   1.00 17.04 ? 760  ILE A C   1 
ATOM   5910  O O   . ILE A 1 760  ? 3.410   103.696 4.471   1.00 12.19 ? 760  ILE A O   1 
ATOM   5911  C CB  . ILE A 1 760  ? 5.057   105.300 6.877   1.00 17.28 ? 760  ILE A CB  1 
ATOM   5912  C CG1 . ILE A 1 760  ? 6.487   105.253 7.411   1.00 14.44 ? 760  ILE A CG1 1 
ATOM   5913  C CG2 . ILE A 1 760  ? 4.181   104.183 7.467   1.00 15.71 ? 760  ILE A CG2 1 
ATOM   5914  C CD1 . ILE A 1 760  ? 6.599   105.493 8.894   1.00 13.44 ? 760  ILE A CD1 1 
ATOM   5915  N N   . SER A 1 761  ? 2.793   105.843 4.820   1.00 17.02 ? 761  SER A N   1 
ATOM   5916  C CA  . SER A 1 761  ? 1.410   105.642 4.396   1.00 18.27 ? 761  SER A CA  1 
ATOM   5917  C C   . SER A 1 761  ? 1.312   105.125 2.965   1.00 18.56 ? 761  SER A C   1 
ATOM   5918  O O   . SER A 1 761  ? 0.677   104.095 2.713   1.00 19.37 ? 761  SER A O   1 
ATOM   5919  C CB  . SER A 1 761  ? 0.626   106.944 4.535   1.00 18.66 ? 761  SER A CB  1 
ATOM   5920  O OG  . SER A 1 761  ? -0.760  106.699 4.419   1.00 20.67 ? 761  SER A OG  1 
ATOM   5921  N N   . LYS A 1 762  ? 1.937   105.826 2.027   1.00 18.88 ? 762  LYS A N   1 
ATOM   5922  C CA  . LYS A 1 762  ? 1.906   105.392 0.631   1.00 21.81 ? 762  LYS A CA  1 
ATOM   5923  C C   . LYS A 1 762  ? 2.576   104.018 0.463   1.00 19.58 ? 762  LYS A C   1 
ATOM   5924  O O   . LYS A 1 762  ? 2.157   103.201 -0.360  1.00 17.40 ? 762  LYS A O   1 
ATOM   5925  C CB  . LYS A 1 762  ? 2.586   106.442 -0.266  1.00 24.13 ? 762  LYS A CB  1 
ATOM   5926  C CG  . LYS A 1 762  ? 1.729   107.683 -0.527  1.00 28.45 ? 762  LYS A CG  1 
ATOM   5927  C CD  . LYS A 1 762  ? 2.568   108.971 -0.595  1.00 32.96 ? 762  LYS A CD  1 
ATOM   5928  C CE  . LYS A 1 762  ? 3.559   108.965 -1.757  1.00 34.52 ? 762  LYS A CE  1 
ATOM   5929  N NZ  . LYS A 1 762  ? 4.535   110.100 -1.673  1.00 37.27 ? 762  LYS A NZ  1 
ATOM   5930  N N   . TYR A 1 763  ? 3.608   103.766 1.262   1.00 19.00 ? 763  TYR A N   1 
ATOM   5931  C CA  . TYR A 1 763  ? 4.331   102.501 1.209   1.00 17.76 ? 763  TYR A CA  1 
ATOM   5932  C C   . TYR A 1 763  ? 3.421   101.291 1.475   1.00 17.35 ? 763  TYR A C   1 
ATOM   5933  O O   . TYR A 1 763  ? 3.509   100.281 0.785   1.00 14.59 ? 763  TYR A O   1 
ATOM   5934  C CB  . TYR A 1 763  ? 5.477   102.557 2.216   1.00 18.08 ? 763  TYR A CB  1 
ATOM   5935  C CG  . TYR A 1 763  ? 6.078   101.225 2.613   1.00 17.69 ? 763  TYR A CG  1 
ATOM   5936  C CD1 . TYR A 1 763  ? 6.886   100.499 1.738   1.00 17.50 ? 763  TYR A CD1 1 
ATOM   5937  C CD2 . TYR A 1 763  ? 5.883   100.721 3.901   1.00 17.31 ? 763  TYR A CD2 1 
ATOM   5938  C CE1 . TYR A 1 763  ? 7.496   99.301  2.148   1.00 17.22 ? 763  TYR A CE1 1 
ATOM   5939  C CE2 . TYR A 1 763  ? 6.483   99.535  4.315   1.00 16.62 ? 763  TYR A CE2 1 
ATOM   5940  C CZ  . TYR A 1 763  ? 7.286   98.840  3.442   1.00 15.57 ? 763  TYR A CZ  1 
ATOM   5941  O OH  . TYR A 1 763  ? 7.903   97.710  3.892   1.00 17.39 ? 763  TYR A OH  1 
ATOM   5942  N N   . GLY A 1 764  ? 2.542   101.412 2.467   1.00 17.38 ? 764  GLY A N   1 
ATOM   5943  C CA  . GLY A 1 764  ? 1.636   100.328 2.812   1.00 19.30 ? 764  GLY A CA  1 
ATOM   5944  C C   . GLY A 1 764  ? 0.621   99.953  1.747   1.00 21.01 ? 764  GLY A C   1 
ATOM   5945  O O   . GLY A 1 764  ? 0.281   98.772  1.608   1.00 21.06 ? 764  GLY A O   1 
ATOM   5946  N N   . GLU A 1 765  ? 0.134   100.957 1.014   1.00 22.73 ? 765  GLU A N   1 
ATOM   5947  C CA  . GLU A 1 765  ? -0.837  100.776 -0.061  1.00 23.24 ? 765  GLU A CA  1 
ATOM   5948  C C   . GLU A 1 765  ? -0.256  99.867  -1.136  1.00 22.42 ? 765  GLU A C   1 
ATOM   5949  O O   . GLU A 1 765  ? -0.981  99.234  -1.887  1.00 22.74 ? 765  GLU A O   1 
ATOM   5950  C CB  . GLU A 1 765  ? -1.188  102.122 -0.690  1.00 27.86 ? 765  GLU A CB  1 
ATOM   5951  C CG  . GLU A 1 765  ? -2.233  102.963 0.038   1.00 33.99 ? 765  GLU A CG  1 
ATOM   5952  C CD  . GLU A 1 765  ? -2.131  104.448 -0.333  1.00 40.33 ? 765  GLU A CD  1 
ATOM   5953  O OE1 . GLU A 1 765  ? -1.943  104.769 -1.538  1.00 40.05 ? 765  GLU A OE1 1 
ATOM   5954  O OE2 . GLU A 1 765  ? -2.236  105.300 0.587   1.00 44.84 ? 765  GLU A OE2 1 
ATOM   5955  N N   . GLU A 1 766  ? 1.064   99.815  -1.202  1.00 21.92 ? 766  GLU A N   1 
ATOM   5956  C CA  . GLU A 1 766  ? 1.755   98.983  -2.169  1.00 21.40 ? 766  GLU A CA  1 
ATOM   5957  C C   . GLU A 1 766  ? 1.467   97.504  -1.952  1.00 21.72 ? 766  GLU A C   1 
ATOM   5958  O O   . GLU A 1 766  ? 1.318   96.744  -2.913  1.00 22.71 ? 766  GLU A O   1 
ATOM   5959  C CB  . GLU A 1 766  ? 3.252   99.229  -2.063  1.00 23.13 ? 766  GLU A CB  1 
ATOM   5960  C CG  . GLU A 1 766  ? 3.621   100.665 -2.307  1.00 27.03 ? 766  GLU A CG  1 
ATOM   5961  C CD  . GLU A 1 766  ? 4.222   100.883 -3.671  1.00 29.87 ? 766  GLU A CD  1 
ATOM   5962  O OE1 . GLU A 1 766  ? 5.433   100.594 -3.827  1.00 30.83 ? 766  GLU A OE1 1 
ATOM   5963  O OE2 . GLU A 1 766  ? 3.481   101.333 -4.581  1.00 30.54 ? 766  GLU A OE2 1 
ATOM   5964  N N   . PHE A 1 767  ? 1.388   97.084  -0.694  1.00 21.12 ? 767  PHE A N   1 
ATOM   5965  C CA  . PHE A 1 767  ? 1.122   95.682  -0.415  1.00 20.40 ? 767  PHE A CA  1 
ATOM   5966  C C   . PHE A 1 767  ? -0.169  95.432  0.363   1.00 20.32 ? 767  PHE A C   1 
ATOM   5967  O O   . PHE A 1 767  ? -0.265  94.496  1.161   1.00 21.01 ? 767  PHE A O   1 
ATOM   5968  C CB  . PHE A 1 767  ? 2.336   95.048  0.285   1.00 19.66 ? 767  PHE A CB  1 
ATOM   5969  C CG  . PHE A 1 767  ? 2.925   95.891  1.384   1.00 19.34 ? 767  PHE A CG  1 
ATOM   5970  C CD1 . PHE A 1 767  ? 2.449   95.795  2.692   1.00 20.79 ? 767  PHE A CD1 1 
ATOM   5971  C CD2 . PHE A 1 767  ? 3.960   96.782  1.113   1.00 18.96 ? 767  PHE A CD2 1 
ATOM   5972  C CE1 . PHE A 1 767  ? 2.993   96.574  3.714   1.00 20.07 ? 767  PHE A CE1 1 
ATOM   5973  C CE2 . PHE A 1 767  ? 4.515   97.569  2.130   1.00 18.29 ? 767  PHE A CE2 1 
ATOM   5974  C CZ  . PHE A 1 767  ? 4.031   97.464  3.428   1.00 19.57 ? 767  PHE A CZ  1 
ATOM   5975  N N   . GLY A 1 768  ? -1.159  96.286  0.133   1.00 19.78 ? 768  GLY A N   1 
ATOM   5976  C CA  . GLY A 1 768  ? -2.455  96.118  0.766   1.00 20.48 ? 768  GLY A CA  1 
ATOM   5977  C C   . GLY A 1 768  ? -2.657  96.432  2.238   1.00 21.15 ? 768  GLY A C   1 
ATOM   5978  O O   . GLY A 1 768  ? -3.639  95.979  2.832   1.00 20.18 ? 768  GLY A O   1 
ATOM   5979  N N   . TRP A 1 769  ? -1.743  97.180  2.842   1.00 21.03 ? 769  TRP A N   1 
ATOM   5980  C CA  . TRP A 1 769  ? -1.906  97.542  4.242   1.00 21.10 ? 769  TRP A CA  1 
ATOM   5981  C C   . TRP A 1 769  ? -2.263  99.014  4.326   1.00 22.79 ? 769  TRP A C   1 
ATOM   5982  O O   . TRP A 1 769  ? -1.595  99.876  3.731   1.00 22.85 ? 769  TRP A O   1 
ATOM   5983  C CB  . TRP A 1 769  ? -0.624  97.316  5.036   1.00 20.64 ? 769  TRP A CB  1 
ATOM   5984  C CG  . TRP A 1 769  ? -0.399  95.923  5.516   1.00 20.97 ? 769  TRP A CG  1 
ATOM   5985  C CD1 . TRP A 1 769  ? -1.082  94.797  5.149   1.00 20.45 ? 769  TRP A CD1 1 
ATOM   5986  C CD2 . TRP A 1 769  ? 0.613   95.497  6.435   1.00 19.78 ? 769  TRP A CD2 1 
ATOM   5987  N NE1 . TRP A 1 769  ? -0.554  93.695  5.783   1.00 18.91 ? 769  TRP A NE1 1 
ATOM   5988  C CE2 . TRP A 1 769  ? 0.491   94.097  6.576   1.00 19.34 ? 769  TRP A CE2 1 
ATOM   5989  C CE3 . TRP A 1 769  ? 1.621   96.162  7.145   1.00 17.11 ? 769  TRP A CE3 1 
ATOM   5990  C CZ2 . TRP A 1 769  ? 1.336   93.348  7.407   1.00 18.83 ? 769  TRP A CZ2 1 
ATOM   5991  C CZ3 . TRP A 1 769  ? 2.461   95.419  7.965   1.00 18.30 ? 769  TRP A CZ3 1 
ATOM   5992  C CH2 . TRP A 1 769  ? 2.314   94.023  8.087   1.00 17.86 ? 769  TRP A CH2 1 
ATOM   5993  N N   . LYS A 1 770  ? -3.329  99.293  5.062   1.00 23.82 ? 770  LYS A N   1 
ATOM   5994  C CA  . LYS A 1 770  ? -3.768  100.655 5.273   1.00 23.43 ? 770  LYS A CA  1 
ATOM   5995  C C   . LYS A 1 770  ? -3.298  101.010 6.674   1.00 22.08 ? 770  LYS A C   1 
ATOM   5996  O O   . LYS A 1 770  ? -3.894  100.591 7.659   1.00 21.23 ? 770  LYS A O   1 
ATOM   5997  C CB  . LYS A 1 770  ? -5.287  100.740 5.196   1.00 26.68 ? 770  LYS A CB  1 
ATOM   5998  C CG  . LYS A 1 770  ? -5.857  100.189 3.903   1.00 33.12 ? 770  LYS A CG  1 
ATOM   5999  C CD  . LYS A 1 770  ? -7.362  100.430 3.830   1.00 37.91 ? 770  LYS A CD  1 
ATOM   6000  C CE  . LYS A 1 770  ? -7.907  100.157 2.429   1.00 39.90 ? 770  LYS A CE  1 
ATOM   6001  N NZ  . LYS A 1 770  ? -9.388  100.348 2.386   1.00 41.56 ? 770  LYS A NZ  1 
ATOM   6002  N N   . TYR A 1 771  ? -2.205  101.754 6.766   1.00 21.92 ? 771  TYR A N   1 
ATOM   6003  C CA  . TYR A 1 771  ? -1.691  102.148 8.063   1.00 20.54 ? 771  TYR A CA  1 
ATOM   6004  C C   . TYR A 1 771  ? -2.596  103.193 8.663   1.00 20.71 ? 771  TYR A C   1 
ATOM   6005  O O   . TYR A 1 771  ? -3.109  104.054 7.971   1.00 22.22 ? 771  TYR A O   1 
ATOM   6006  C CB  . TYR A 1 771  ? -0.290  102.738 7.950   1.00 17.99 ? 771  TYR A CB  1 
ATOM   6007  C CG  . TYR A 1 771  ? 0.805   101.717 7.806   1.00 17.39 ? 771  TYR A CG  1 
ATOM   6008  C CD1 . TYR A 1 771  ? 1.046   100.774 8.808   1.00 13.95 ? 771  TYR A CD1 1 
ATOM   6009  C CD2 . TYR A 1 771  ? 1.620   101.701 6.668   1.00 15.35 ? 771  TYR A CD2 1 
ATOM   6010  C CE1 . TYR A 1 771  ? 2.064   99.844  8.676   1.00 11.63 ? 771  TYR A CE1 1 
ATOM   6011  C CE2 . TYR A 1 771  ? 2.638   100.777 6.530   1.00 12.30 ? 771  TYR A CE2 1 
ATOM   6012  C CZ  . TYR A 1 771  ? 2.851   99.853  7.533   1.00 13.24 ? 771  TYR A CZ  1 
ATOM   6013  O OH  . TYR A 1 771  ? 3.832   98.918  7.367   1.00 14.75 ? 771  TYR A OH  1 
ATOM   6014  N N   . ASP A 1 772  ? -2.782  103.106 9.963   1.00 22.15 ? 772  ASP A N   1 
ATOM   6015  C CA  . ASP A 1 772  ? -3.588  104.059 10.679  1.00 23.28 ? 772  ASP A CA  1 
ATOM   6016  C C   . ASP A 1 772  ? -2.561  104.749 11.551  1.00 22.78 ? 772  ASP A C   1 
ATOM   6017  O O   . ASP A 1 772  ? -2.169  104.234 12.602  1.00 21.95 ? 772  ASP A O   1 
ATOM   6018  C CB  . ASP A 1 772  ? -4.604  103.334 11.531  1.00 29.64 ? 772  ASP A CB  1 
ATOM   6019  C CG  . ASP A 1 772  ? -5.886  104.087 11.638  1.00 35.55 ? 772  ASP A CG  1 
ATOM   6020  O OD1 . ASP A 1 772  ? -5.868  105.192 12.230  1.00 38.78 ? 772  ASP A OD1 1 
ATOM   6021  O OD2 . ASP A 1 772  ? -6.907  103.575 11.118  1.00 40.53 ? 772  ASP A OD2 1 
ATOM   6022  N N   . ILE A 1 773  ? -2.118  105.910 11.085  1.00 21.43 ? 773  ILE A N   1 
ATOM   6023  C CA  . ILE A 1 773  ? -1.091  106.681 11.752  1.00 20.66 ? 773  ILE A CA  1 
ATOM   6024  C C   . ILE A 1 773  ? -1.669  107.830 12.549  1.00 22.03 ? 773  ILE A C   1 
ATOM   6025  O O   . ILE A 1 773  ? -2.591  108.521 12.107  1.00 23.13 ? 773  ILE A O   1 
ATOM   6026  C CB  . ILE A 1 773  ? -0.098  107.254 10.713  1.00 19.99 ? 773  ILE A CB  1 
ATOM   6027  C CG1 . ILE A 1 773  ? 0.434   106.126 9.823   1.00 23.02 ? 773  ILE A CG1 1 
ATOM   6028  C CG2 . ILE A 1 773  ? 1.044   107.953 11.408  1.00 19.54 ? 773  ILE A CG2 1 
ATOM   6029  C CD1 . ILE A 1 773  ? 1.488   106.571 8.823   1.00 22.18 ? 773  ILE A CD1 1 
ATOM   6030  N N   . ALA A 1 774  ? -1.123  108.038 13.734  1.00 20.50 ? 774  ALA A N   1 
ATOM   6031  C CA  . ALA A 1 774  ? -1.567  109.134 14.565  1.00 20.71 ? 774  ALA A CA  1 
ATOM   6032  C C   . ALA A 1 774  ? -0.342  109.792 15.175  1.00 21.20 ? 774  ALA A C   1 
ATOM   6033  O O   . ALA A 1 774  ? 0.440   109.145 15.883  1.00 22.17 ? 774  ALA A O   1 
ATOM   6034  C CB  . ALA A 1 774  ? -2.498  108.633 15.660  1.00 19.96 ? 774  ALA A CB  1 
ATOM   6035  N N   . TYR A 1 775  ? -0.164  111.068 14.862  1.00 19.93 ? 775  TYR A N   1 
ATOM   6036  C CA  . TYR A 1 775  ? 0.931   111.865 15.390  1.00 20.04 ? 775  TYR A CA  1 
ATOM   6037  C C   . TYR A 1 775  ? 0.170   113.033 16.018  1.00 20.13 ? 775  TYR A C   1 
ATOM   6038  O O   . TYR A 1 775  ? -0.278  113.954 15.326  1.00 20.56 ? 775  TYR A O   1 
ATOM   6039  C CB  . TYR A 1 775  ? 1.854   112.313 14.245  1.00 19.50 ? 775  TYR A CB  1 
ATOM   6040  C CG  . TYR A 1 775  ? 2.907   113.331 14.637  1.00 19.90 ? 775  TYR A CG  1 
ATOM   6041  C CD1 . TYR A 1 775  ? 3.472   113.331 15.914  1.00 21.61 ? 775  TYR A CD1 1 
ATOM   6042  C CD2 . TYR A 1 775  ? 3.352   114.282 13.725  1.00 18.79 ? 775  TYR A CD2 1 
ATOM   6043  C CE1 . TYR A 1 775  ? 4.454   114.259 16.272  1.00 21.56 ? 775  TYR A CE1 1 
ATOM   6044  C CE2 . TYR A 1 775  ? 4.330   115.210 14.064  1.00 19.60 ? 775  TYR A CE2 1 
ATOM   6045  C CZ  . TYR A 1 775  ? 4.876   115.200 15.339  1.00 22.59 ? 775  TYR A CZ  1 
ATOM   6046  O OH  . TYR A 1 775  ? 5.822   116.141 15.689  1.00 21.75 ? 775  TYR A OH  1 
ATOM   6047  N N   . ASP A 1 776  ? 0.003   112.975 17.333  1.00 19.96 ? 776  ASP A N   1 
ATOM   6048  C CA  . ASP A 1 776  ? -0.768  113.989 18.041  1.00 21.41 ? 776  ASP A CA  1 
ATOM   6049  C C   . ASP A 1 776  ? -0.192  114.517 19.343  1.00 19.93 ? 776  ASP A C   1 
ATOM   6050  O O   . ASP A 1 776  ? -0.933  115.066 20.151  1.00 22.68 ? 776  ASP A O   1 
ATOM   6051  C CB  . ASP A 1 776  ? -2.171  113.444 18.324  1.00 22.16 ? 776  ASP A CB  1 
ATOM   6052  C CG  . ASP A 1 776  ? -2.137  112.065 18.954  1.00 22.18 ? 776  ASP A CG  1 
ATOM   6053  O OD1 . ASP A 1 776  ? -1.339  111.861 19.891  1.00 21.63 ? 776  ASP A OD1 1 
ATOM   6054  O OD2 . ASP A 1 776  ? -2.910  111.186 18.515  1.00 24.30 ? 776  ASP A OD2 1 
ATOM   6055  N N   . GLY A 1 777  ? 1.109   114.358 19.549  1.00 19.10 ? 777  GLY A N   1 
ATOM   6056  C CA  . GLY A 1 777  ? 1.726   114.837 20.773  1.00 16.73 ? 777  GLY A CA  1 
ATOM   6057  C C   . GLY A 1 777  ? 1.518   113.846 21.897  1.00 17.41 ? 777  GLY A C   1 
ATOM   6058  O O   . GLY A 1 777  ? 2.007   114.033 23.002  1.00 17.90 ? 777  GLY A O   1 
ATOM   6059  N N   . THR A 1 778  ? 0.816   112.763 21.590  1.00 17.90 ? 778  THR A N   1 
ATOM   6060  C CA  . THR A 1 778  ? 0.493   111.723 22.563  1.00 19.37 ? 778  THR A CA  1 
ATOM   6061  C C   . THR A 1 778  ? 1.021   110.337 22.176  1.00 18.61 ? 778  THR A C   1 
ATOM   6062  O O   . THR A 1 778  ? 1.432   110.114 21.045  1.00 20.01 ? 778  THR A O   1 
ATOM   6063  C CB  . THR A 1 778  ? -1.049  111.680 22.735  1.00 20.31 ? 778  THR A CB  1 
ATOM   6064  O OG1 . THR A 1 778  ? -1.439  112.717 23.645  1.00 23.35 ? 778  THR A OG1 1 
ATOM   6065  C CG2 . THR A 1 778  ? -1.545  110.314 23.211  1.00 22.14 ? 778  THR A CG2 1 
ATOM   6066  N N   . ALA A 1 779  ? 1.025   109.419 23.134  1.00 18.22 ? 779  ALA A N   1 
ATOM   6067  C CA  . ALA A 1 779  ? 1.455   108.049 22.895  1.00 18.32 ? 779  ALA A CA  1 
ATOM   6068  C C   . ALA A 1 779  ? 0.319   107.121 23.292  1.00 18.19 ? 779  ALA A C   1 
ATOM   6069  O O   . ALA A 1 779  ? -0.311  107.314 24.325  1.00 19.61 ? 779  ALA A O   1 
ATOM   6070  C CB  . ALA A 1 779  ? 2.701   107.723 23.706  1.00 16.67 ? 779  ALA A CB  1 
ATOM   6071  N N   . GLU A 1 780  ? 0.035   106.138 22.451  1.00 19.07 ? 780  GLU A N   1 
ATOM   6072  C CA  . GLU A 1 780  ? -1.008  105.173 22.732  1.00 20.97 ? 780  GLU A CA  1 
ATOM   6073  C C   . GLU A 1 780  ? -0.502  103.820 22.272  1.00 21.03 ? 780  GLU A C   1 
ATOM   6074  O O   . GLU A 1 780  ? -0.322  103.564 21.084  1.00 23.79 ? 780  GLU A O   1 
ATOM   6075  C CB  . GLU A 1 780  ? -2.317  105.498 22.005  1.00 22.15 ? 780  GLU A CB  1 
ATOM   6076  C CG  . GLU A 1 780  ? -3.503  104.700 22.571  1.00 27.32 ? 780  GLU A CG  1 
ATOM   6077  C CD  . GLU A 1 780  ? -4.733  104.622 21.646  1.00 31.31 ? 780  GLU A CD  1 
ATOM   6078  O OE1 . GLU A 1 780  ? -5.229  105.686 21.191  1.00 32.87 ? 780  GLU A OE1 1 
ATOM   6079  O OE2 . GLU A 1 780  ? -5.216  103.490 21.391  1.00 29.37 ? 780  GLU A OE2 1 
ATOM   6080  N N   . TYR A 1 781  ? -0.274  102.946 23.228  1.00 20.99 ? 781  TYR A N   1 
ATOM   6081  C CA  . TYR A 1 781  ? 0.222   101.633 22.915  1.00 21.70 ? 781  TYR A CA  1 
ATOM   6082  C C   . TYR A 1 781  ? -0.463  100.630 23.839  1.00 21.85 ? 781  TYR A C   1 
ATOM   6083  O O   . TYR A 1 781  ? -0.532  100.832 25.064  1.00 22.32 ? 781  TYR A O   1 
ATOM   6084  C CB  . TYR A 1 781  ? 1.754   101.619 23.088  1.00 21.55 ? 781  TYR A CB  1 
ATOM   6085  C CG  . TYR A 1 781  ? 2.415   100.326 22.665  1.00 21.29 ? 781  TYR A CG  1 
ATOM   6086  C CD1 . TYR A 1 781  ? 2.135   99.748  21.421  1.00 20.27 ? 781  TYR A CD1 1 
ATOM   6087  C CD2 . TYR A 1 781  ? 3.305   99.669  23.515  1.00 21.22 ? 781  TYR A CD2 1 
ATOM   6088  C CE1 . TYR A 1 781  ? 2.720   98.544  21.040  1.00 21.52 ? 781  TYR A CE1 1 
ATOM   6089  C CE2 . TYR A 1 781  ? 3.896   98.460  23.145  1.00 22.14 ? 781  TYR A CE2 1 
ATOM   6090  C CZ  . TYR A 1 781  ? 3.595   97.904  21.909  1.00 22.44 ? 781  TYR A CZ  1 
ATOM   6091  O OH  . TYR A 1 781  ? 4.150   96.700  21.562  1.00 21.99 ? 781  TYR A OH  1 
ATOM   6092  N N   . LEU A 1 782  ? -0.977  99.559  23.244  1.00 20.38 ? 782  LEU A N   1 
ATOM   6093  C CA  . LEU A 1 782  ? -1.660  98.518  24.005  1.00 21.75 ? 782  LEU A CA  1 
ATOM   6094  C C   . LEU A 1 782  ? -2.770  99.088  24.900  1.00 22.52 ? 782  LEU A C   1 
ATOM   6095  O O   . LEU A 1 782  ? -2.906  98.702  26.055  1.00 24.05 ? 782  LEU A O   1 
ATOM   6096  C CB  . LEU A 1 782  ? -0.651  97.738  24.864  1.00 19.14 ? 782  LEU A CB  1 
ATOM   6097  C CG  . LEU A 1 782  ? 0.637   97.231  24.189  1.00 19.69 ? 782  LEU A CG  1 
ATOM   6098  C CD1 . LEU A 1 782  ? 1.600   96.736  25.274  1.00 13.93 ? 782  LEU A CD1 1 
ATOM   6099  C CD2 . LEU A 1 782  ? 0.326   96.128  23.146  1.00 14.27 ? 782  LEU A CD2 1 
ATOM   6100  N N   . LYS A 1 783  ? -3.550  100.019 24.368  1.00 23.85 ? 783  LYS A N   1 
ATOM   6101  C CA  . LYS A 1 783  ? -4.677  100.614 25.098  1.00 26.10 ? 783  LYS A CA  1 
ATOM   6102  C C   . LYS A 1 783  ? -4.395  101.474 26.338  1.00 24.78 ? 783  LYS A C   1 
ATOM   6103  O O   . LYS A 1 783  ? -5.303  101.746 27.127  1.00 22.92 ? 783  LYS A O   1 
ATOM   6104  C CB  . LYS A 1 783  ? -5.701  99.527  25.459  1.00 27.53 ? 783  LYS A CB  1 
ATOM   6105  C CG  . LYS A 1 783  ? -6.309  98.819  24.248  1.00 31.95 ? 783  LYS A CG  1 
ATOM   6106  C CD  . LYS A 1 783  ? -6.888  99.827  23.250  1.00 36.10 ? 783  LYS A CD  1 
ATOM   6107  C CE  . LYS A 1 783  ? -7.453  99.137  22.011  1.00 38.77 ? 783  LYS A CE  1 
ATOM   6108  N NZ  . LYS A 1 783  ? -7.849  100.109 20.947  1.00 38.28 ? 783  LYS A NZ  1 
ATOM   6109  N N   . LEU A 1 784  ? -3.144  101.884 26.523  1.00 23.53 ? 784  LEU A N   1 
ATOM   6110  C CA  . LEU A 1 784  ? -2.811  102.775 27.628  1.00 20.61 ? 784  LEU A CA  1 
ATOM   6111  C C   . LEU A 1 784  ? -2.517  104.118 26.972  1.00 18.70 ? 784  LEU A C   1 
ATOM   6112  O O   . LEU A 1 784  ? -1.955  104.164 25.879  1.00 17.44 ? 784  LEU A O   1 
ATOM   6113  C CB  . LEU A 1 784  ? -1.584  102.293 28.385  1.00 20.03 ? 784  LEU A CB  1 
ATOM   6114  C CG  . LEU A 1 784  ? -1.751  100.961 29.099  1.00 22.50 ? 784  LEU A CG  1 
ATOM   6115  C CD1 . LEU A 1 784  ? -0.546  100.758 30.015  1.00 24.07 ? 784  LEU A CD1 1 
ATOM   6116  C CD2 . LEU A 1 784  ? -3.061  100.934 29.888  1.00 19.86 ? 784  LEU A CD2 1 
ATOM   6117  N N   . TYR A 1 785  ? -2.909  105.207 27.621  1.00 17.29 ? 785  TYR A N   1 
ATOM   6118  C CA  . TYR A 1 785  ? -2.674  106.529 27.058  1.00 16.15 ? 785  TYR A CA  1 
ATOM   6119  C C   . TYR A 1 785  ? -1.612  107.265 27.863  1.00 15.22 ? 785  TYR A C   1 
ATOM   6120  O O   . TYR A 1 785  ? -1.568  107.150 29.097  1.00 13.02 ? 785  TYR A O   1 
ATOM   6121  C CB  . TYR A 1 785  ? -3.988  107.314 27.025  1.00 16.54 ? 785  TYR A CB  1 
ATOM   6122  C CG  . TYR A 1 785  ? -5.109  106.556 26.333  1.00 15.79 ? 785  TYR A CG  1 
ATOM   6123  C CD1 . TYR A 1 785  ? -5.524  106.896 25.043  1.00 14.69 ? 785  TYR A CD1 1 
ATOM   6124  C CD2 . TYR A 1 785  ? -5.720  105.464 26.957  1.00 15.40 ? 785  TYR A CD2 1 
ATOM   6125  C CE1 . TYR A 1 785  ? -6.516  106.164 24.397  1.00 16.41 ? 785  TYR A CE1 1 
ATOM   6126  C CE2 . TYR A 1 785  ? -6.709  104.727 26.321  1.00 15.75 ? 785  TYR A CE2 1 
ATOM   6127  C CZ  . TYR A 1 785  ? -7.101  105.078 25.047  1.00 18.35 ? 785  TYR A CZ  1 
ATOM   6128  O OH  . TYR A 1 785  ? -8.067  104.331 24.419  1.00 22.59 ? 785  TYR A OH  1 
ATOM   6129  N N   . PHE A 1 786  ? -0.753  108.005 27.152  1.00 14.75 ? 786  PHE A N   1 
ATOM   6130  C CA  . PHE A 1 786  ? 0.341   108.753 27.771  1.00 13.89 ? 786  PHE A CA  1 
ATOM   6131  C C   . PHE A 1 786  ? 0.579   110.121 27.179  1.00 13.56 ? 786  PHE A C   1 
ATOM   6132  O O   . PHE A 1 786  ? 0.629   110.263 25.965  1.00 15.34 ? 786  PHE A O   1 
ATOM   6133  C CB  . PHE A 1 786  ? 1.661   107.986 27.640  1.00 13.67 ? 786  PHE A CB  1 
ATOM   6134  C CG  . PHE A 1 786  ? 1.648   106.626 28.271  1.00 13.75 ? 786  PHE A CG  1 
ATOM   6135  C CD1 . PHE A 1 786  ? 1.966   106.466 29.609  1.00 11.09 ? 786  PHE A CD1 1 
ATOM   6136  C CD2 . PHE A 1 786  ? 1.324   105.497 27.513  1.00 14.99 ? 786  PHE A CD2 1 
ATOM   6137  C CE1 . PHE A 1 786  ? 1.967   105.195 30.203  1.00 13.62 ? 786  PHE A CE1 1 
ATOM   6138  C CE2 . PHE A 1 786  ? 1.320   104.217 28.093  1.00 16.02 ? 786  PHE A CE2 1 
ATOM   6139  C CZ  . PHE A 1 786  ? 1.644   104.071 29.447  1.00 14.52 ? 786  PHE A CZ  1 
ATOM   6140  N N   . ILE A 1 787  ? 0.740   111.125 28.040  1.00 13.32 ? 787  ILE A N   1 
ATOM   6141  C CA  . ILE A 1 787  ? 1.057   112.478 27.586  1.00 11.23 ? 787  ILE A CA  1 
ATOM   6142  C C   . ILE A 1 787  ? 2.165   113.079 28.483  1.00 11.89 ? 787  ILE A C   1 
ATOM   6143  O O   . ILE A 1 787  ? 2.075   113.075 29.709  1.00 8.74  ? 787  ILE A O   1 
ATOM   6144  C CB  . ILE A 1 787  ? -0.200  113.406 27.550  1.00 11.66 ? 787  ILE A CB  1 
ATOM   6145  C CG1 . ILE A 1 787  ? 0.198   114.773 26.975  1.00 11.87 ? 787  ILE A CG1 1 
ATOM   6146  C CG2 . ILE A 1 787  ? -0.817  113.554 28.939  1.00 7.06  ? 787  ILE A CG2 1 
ATOM   6147  C CD1 . ILE A 1 787  ? -0.984  115.651 26.550  1.00 9.93  ? 787  ILE A CD1 1 
ATOM   6148  N N   . PHE A 1 788  ? 3.226   113.569 27.853  1.00 11.91 ? 788  PHE A N   1 
ATOM   6149  C CA  . PHE A 1 788  ? 4.340   114.144 28.582  1.00 12.57 ? 788  PHE A CA  1 
ATOM   6150  C C   . PHE A 1 788  ? 4.843   113.236 29.700  1.00 13.27 ? 788  PHE A C   1 
ATOM   6151  O O   . PHE A 1 788  ? 5.194   113.687 30.776  1.00 15.07 ? 788  PHE A O   1 
ATOM   6152  C CB  . PHE A 1 788  ? 3.952   115.524 29.123  1.00 14.56 ? 788  PHE A CB  1 
ATOM   6153  C CG  . PHE A 1 788  ? 4.027   116.624 28.089  1.00 15.43 ? 788  PHE A CG  1 
ATOM   6154  C CD1 . PHE A 1 788  ? 3.866   116.338 26.731  1.00 15.45 ? 788  PHE A CD1 1 
ATOM   6155  C CD2 . PHE A 1 788  ? 4.216   117.952 28.475  1.00 16.74 ? 788  PHE A CD2 1 
ATOM   6156  C CE1 . PHE A 1 788  ? 3.881   117.350 25.771  1.00 12.89 ? 788  PHE A CE1 1 
ATOM   6157  C CE2 . PHE A 1 788  ? 4.235   118.978 27.529  1.00 14.64 ? 788  PHE A CE2 1 
ATOM   6158  C CZ  . PHE A 1 788  ? 4.066   118.674 26.169  1.00 16.21 ? 788  PHE A CZ  1 
ATOM   6159  N N   . GLY A 1 789  ? 4.878   111.937 29.436  1.00 14.95 ? 789  GLY A N   1 
ATOM   6160  C CA  . GLY A 1 789  ? 5.385   111.013 30.430  1.00 13.13 ? 789  GLY A CA  1 
ATOM   6161  C C   . GLY A 1 789  ? 4.417   110.637 31.524  1.00 12.64 ? 789  GLY A C   1 
ATOM   6162  O O   . GLY A 1 789  ? 4.795   109.916 32.457  1.00 13.15 ? 789  GLY A O   1 
ATOM   6163  N N   . CYS A 1 790  ? 3.180   111.119 31.413  1.00 10.22 ? 790  CYS A N   1 
ATOM   6164  C CA  . CYS A 1 790  ? 2.138   110.816 32.391  1.00 9.01  ? 790  CYS A CA  1 
ATOM   6165  C C   . CYS A 1 790  ? 1.058   109.881 31.826  1.00 9.36  ? 790  CYS A C   1 
ATOM   6166  O O   . CYS A 1 790  ? 0.486   110.118 30.754  1.00 9.30  ? 790  CYS A O   1 
ATOM   6167  C CB  . CYS A 1 790  ? 1.471   112.104 32.879  1.00 7.16  ? 790  CYS A CB  1 
ATOM   6168  S SG  . CYS A 1 790  ? 0.175   111.805 34.113  1.00 10.74 ? 790  CYS A SG  1 
ATOM   6169  N N   . ARG A 1 791  ? 0.772   108.814 32.556  1.00 9.63  ? 791  ARG A N   1 
ATOM   6170  C CA  . ARG A 1 791  ? -0.248  107.894 32.120  1.00 11.35 ? 791  ARG A CA  1 
ATOM   6171  C C   . ARG A 1 791  ? -1.604  108.500 32.428  1.00 12.25 ? 791  ARG A C   1 
ATOM   6172  O O   . ARG A 1 791  ? -1.821  109.059 33.506  1.00 11.47 ? 791  ARG A O   1 
ATOM   6173  C CB  . ARG A 1 791  ? -0.121  106.556 32.839  1.00 13.97 ? 791  ARG A CB  1 
ATOM   6174  C CG  . ARG A 1 791  ? -1.111  105.519 32.346  1.00 18.33 ? 791  ARG A CG  1 
ATOM   6175  C CD  . ARG A 1 791  ? -0.746  104.097 32.772  1.00 23.89 ? 791  ARG A CD  1 
ATOM   6176  N NE  . ARG A 1 791  ? -1.877  103.419 33.407  1.00 28.77 ? 791  ARG A NE  1 
ATOM   6177  C CZ  . ARG A 1 791  ? -2.152  103.504 34.705  1.00 30.44 ? 791  ARG A CZ  1 
ATOM   6178  N NH1 . ARG A 1 791  ? -1.369  104.231 35.492  1.00 33.28 ? 791  ARG A NH1 1 
ATOM   6179  N NH2 . ARG A 1 791  ? -3.204  102.875 35.215  1.00 29.95 ? 791  ARG A NH2 1 
ATOM   6180  N N   . ILE A 1 792  ? -2.508  108.396 31.465  1.00 10.71 ? 792  ILE A N   1 
ATOM   6181  C CA  . ILE A 1 792  ? -3.850  108.897 31.635  1.00 10.57 ? 792  ILE A CA  1 
ATOM   6182  C C   . ILE A 1 792  ? -4.744  107.675 31.643  1.00 11.40 ? 792  ILE A C   1 
ATOM   6183  O O   . ILE A 1 792  ? -5.015  107.104 30.594  1.00 12.32 ? 792  ILE A O   1 
ATOM   6184  C CB  . ILE A 1 792  ? -4.286  109.813 30.468  1.00 9.36  ? 792  ILE A CB  1 
ATOM   6185  C CG1 . ILE A 1 792  ? -3.373  111.038 30.384  1.00 9.37  ? 792  ILE A CG1 1 
ATOM   6186  C CG2 . ILE A 1 792  ? -5.719  110.264 30.675  1.00 7.56  ? 792  ILE A CG2 1 
ATOM   6187  C CD1 . ILE A 1 792  ? -3.349  111.887 31.624  1.00 8.65  ? 792  ILE A CD1 1 
ATOM   6188  N N   . PRO A 1 793  ? -5.202  107.242 32.832  1.00 12.07 ? 793  PRO A N   1 
ATOM   6189  C CA  . PRO A 1 793  ? -6.073  106.061 32.847  1.00 11.22 ? 793  PRO A CA  1 
ATOM   6190  C C   . PRO A 1 793  ? -7.357  106.427 32.104  1.00 12.84 ? 793  PRO A C   1 
ATOM   6191  O O   . PRO A 1 793  ? -7.815  107.576 32.183  1.00 13.01 ? 793  PRO A O   1 
ATOM   6192  C CB  . PRO A 1 793  ? -6.303  105.812 34.346  1.00 9.49  ? 793  PRO A CB  1 
ATOM   6193  C CG  . PRO A 1 793  ? -5.081  106.406 34.992  1.00 7.38  ? 793  PRO A CG  1 
ATOM   6194  C CD  . PRO A 1 793  ? -4.892  107.687 34.202  1.00 9.08  ? 793  PRO A CD  1 
ATOM   6195  N N   . ASN A 1 794  ? -7.922  105.468 31.370  1.00 12.56 ? 794  ASN A N   1 
ATOM   6196  C CA  . ASN A 1 794  ? -9.148  105.707 30.612  1.00 11.96 ? 794  ASN A CA  1 
ATOM   6197  C C   . ASN A 1 794  ? -10.300 104.945 31.273  1.00 12.51 ? 794  ASN A C   1 
ATOM   6198  O O   . ASN A 1 794  ? -10.566 103.792 30.947  1.00 13.75 ? 794  ASN A O   1 
ATOM   6199  C CB  . ASN A 1 794  ? -8.974  105.257 29.162  1.00 9.47  ? 794  ASN A CB  1 
ATOM   6200  C CG  . ASN A 1 794  ? -10.186 105.593 28.290  1.00 11.38 ? 794  ASN A CG  1 
ATOM   6201  O OD1 . ASN A 1 794  ? -11.267 105.936 28.789  1.00 9.45  ? 794  ASN A OD1 1 
ATOM   6202  N ND2 . ASN A 1 794  ? -10.015 105.471 26.982  1.00 12.23 ? 794  ASN A ND2 1 
ATOM   6203  N N   . LEU A 1 795  ? -10.997 105.617 32.181  1.00 12.00 ? 795  LEU A N   1 
ATOM   6204  C CA  . LEU A 1 795  ? -12.085 105.017 32.941  1.00 11.25 ? 795  LEU A CA  1 
ATOM   6205  C C   . LEU A 1 795  ? -13.281 104.511 32.144  1.00 11.46 ? 795  LEU A C   1 
ATOM   6206  O O   . LEU A 1 795  ? -13.965 103.585 32.572  1.00 11.48 ? 795  LEU A O   1 
ATOM   6207  C CB  . LEU A 1 795  ? -12.551 106.017 34.009  1.00 10.00 ? 795  LEU A CB  1 
ATOM   6208  C CG  . LEU A 1 795  ? -11.699 106.152 35.283  1.00 11.11 ? 795  LEU A CG  1 
ATOM   6209  C CD1 . LEU A 1 795  ? -10.227 106.167 34.972  1.00 8.58  ? 795  LEU A CD1 1 
ATOM   6210  C CD2 . LEU A 1 795  ? -12.093 107.441 36.006  1.00 10.75 ? 795  LEU A CD2 1 
ATOM   6211  N N   . SER A 1 796  ? -13.523 105.119 30.990  1.00 12.02 ? 796  SER A N   1 
ATOM   6212  C CA  . SER A 1 796  ? -14.645 104.758 30.138  1.00 11.09 ? 796  SER A CA  1 
ATOM   6213  C C   . SER A 1 796  ? -14.523 103.345 29.592  1.00 11.72 ? 796  SER A C   1 
ATOM   6214  O O   . SER A 1 796  ? -15.536 102.721 29.280  1.00 10.51 ? 796  SER A O   1 
ATOM   6215  C CB  . SER A 1 796  ? -14.774 105.754 28.964  1.00 12.13 ? 796  SER A CB  1 
ATOM   6216  O OG  . SER A 1 796  ? -13.720 105.599 28.023  1.00 10.14 ? 796  SER A OG  1 
ATOM   6217  N N   . ARG A 1 797  ? -13.290 102.854 29.460  1.00 12.79 ? 797  ARG A N   1 
ATOM   6218  C CA  . ARG A 1 797  ? -13.049 101.499 28.948  1.00 14.83 ? 797  ARG A CA  1 
ATOM   6219  C C   . ARG A 1 797  ? -13.272 100.404 29.981  1.00 14.20 ? 797  ARG A C   1 
ATOM   6220  O O   . ARG A 1 797  ? -13.199 99.225  29.649  1.00 12.61 ? 797  ARG A O   1 
ATOM   6221  C CB  . ARG A 1 797  ? -11.622 101.349 28.421  1.00 16.31 ? 797  ARG A CB  1 
ATOM   6222  C CG  . ARG A 1 797  ? -11.379 101.905 27.044  1.00 23.76 ? 797  ARG A CG  1 
ATOM   6223  C CD  . ARG A 1 797  ? -9.945  101.624 26.618  1.00 30.97 ? 797  ARG A CD  1 
ATOM   6224  N NE  . ARG A 1 797  ? -9.681  102.157 25.285  1.00 37.82 ? 797  ARG A NE  1 
ATOM   6225  C CZ  . ARG A 1 797  ? -10.261 101.706 24.178  1.00 40.03 ? 797  ARG A CZ  1 
ATOM   6226  N NH1 . ARG A 1 797  ? -11.131 100.707 24.250  1.00 41.13 ? 797  ARG A NH1 1 
ATOM   6227  N NH2 . ARG A 1 797  ? -9.985  102.263 23.007  1.00 41.69 ? 797  ARG A NH2 1 
ATOM   6228  N N   . HIS A 1 798  ? -13.531 100.790 31.227  1.00 14.11 ? 798  HIS A N   1 
ATOM   6229  C CA  . HIS A 1 798  ? -13.749 99.816  32.289  1.00 17.23 ? 798  HIS A CA  1 
ATOM   6230  C C   . HIS A 1 798  ? -15.087 100.008 33.007  1.00 15.30 ? 798  HIS A C   1 
ATOM   6231  O O   . HIS A 1 798  ? -15.144 100.221 34.212  1.00 13.84 ? 798  HIS A O   1 
ATOM   6232  C CB  . HIS A 1 798  ? -12.582 99.883  33.268  1.00 21.52 ? 798  HIS A CB  1 
ATOM   6233  C CG  . HIS A 1 798  ? -11.299 99.361  32.697  1.00 27.87 ? 798  HIS A CG  1 
ATOM   6234  N ND1 . HIS A 1 798  ? -10.164 100.132 32.586  1.00 30.56 ? 798  HIS A ND1 1 
ATOM   6235  C CD2 . HIS A 1 798  ? -10.982 98.142  32.195  1.00 28.88 ? 798  HIS A CD2 1 
ATOM   6236  C CE1 . HIS A 1 798  ? -9.197  99.410  32.041  1.00 31.08 ? 798  HIS A CE1 1 
ATOM   6237  N NE2 . HIS A 1 798  ? -9.668  98.201  31.796  1.00 31.92 ? 798  HIS A NE2 1 
ATOM   6238  N N   . PRO A 1 799  ? -16.190 99.869  32.264  1.00 15.61 ? 799  PRO A N   1 
ATOM   6239  C CA  . PRO A 1 799  ? -17.535 100.038 32.815  1.00 14.46 ? 799  PRO A CA  1 
ATOM   6240  C C   . PRO A 1 799  ? -17.728 99.282  34.127  1.00 14.91 ? 799  PRO A C   1 
ATOM   6241  O O   . PRO A 1 799  ? -17.548 98.060  34.187  1.00 14.34 ? 799  PRO A O   1 
ATOM   6242  C CB  . PRO A 1 799  ? -18.439 99.493  31.711  1.00 14.91 ? 799  PRO A CB  1 
ATOM   6243  C CG  . PRO A 1 799  ? -17.551 99.435  30.492  1.00 14.56 ? 799  PRO A CG  1 
ATOM   6244  C CD  . PRO A 1 799  ? -16.234 99.082  31.016  1.00 13.47 ? 799  PRO A CD  1 
ATOM   6245  N N   . ILE A 1 800  ? -18.107 100.009 35.173  1.00 14.10 ? 800  ILE A N   1 
ATOM   6246  C CA  . ILE A 1 800  ? -18.328 99.392  36.472  1.00 12.83 ? 800  ILE A CA  1 
ATOM   6247  C C   . ILE A 1 800  ? -19.493 98.418  36.430  1.00 12.15 ? 800  ILE A C   1 
ATOM   6248  O O   . ILE A 1 800  ? -19.435 97.364  37.054  1.00 12.86 ? 800  ILE A O   1 
ATOM   6249  C CB  . ILE A 1 800  ? -18.595 100.451 37.569  1.00 12.66 ? 800  ILE A CB  1 
ATOM   6250  C CG1 . ILE A 1 800  ? -17.307 101.233 37.851  1.00 13.20 ? 800  ILE A CG1 1 
ATOM   6251  C CG2 . ILE A 1 800  ? -19.076 99.773  38.836  1.00 10.27 ? 800  ILE A CG2 1 
ATOM   6252  C CD1 . ILE A 1 800  ? -17.450 102.340 38.874  1.00 16.67 ? 800  ILE A CD1 1 
ATOM   6253  N N   . VAL A 1 801  ? -20.541 98.755  35.688  1.00 9.49  ? 801  VAL A N   1 
ATOM   6254  C CA  . VAL A 1 801  ? -21.702 97.872  35.613  1.00 10.51 ? 801  VAL A CA  1 
ATOM   6255  C C   . VAL A 1 801  ? -21.667 96.980  34.381  1.00 12.30 ? 801  VAL A C   1 
ATOM   6256  O O   . VAL A 1 801  ? -22.374 95.972  34.309  1.00 13.72 ? 801  VAL A O   1 
ATOM   6257  C CB  . VAL A 1 801  ? -23.049 98.664  35.535  1.00 10.37 ? 801  VAL A CB  1 
ATOM   6258  C CG1 . VAL A 1 801  ? -23.157 99.610  36.681  1.00 3.85  ? 801  VAL A CG1 1 
ATOM   6259  C CG2 . VAL A 1 801  ? -23.164 99.416  34.171  1.00 9.07  ? 801  VAL A CG2 1 
ATOM   6260  N N   . GLY A 1 802  ? -20.849 97.358  33.408  1.00 12.41 ? 802  GLY A N   1 
ATOM   6261  C CA  . GLY A 1 802  ? -20.812 96.606  32.173  1.00 12.31 ? 802  GLY A CA  1 
ATOM   6262  C C   . GLY A 1 802  ? -20.190 95.237  32.196  1.00 14.32 ? 802  GLY A C   1 
ATOM   6263  O O   . GLY A 1 802  ? -19.359 94.922  33.044  1.00 14.91 ? 802  GLY A O   1 
ATOM   6264  N N   . LYS A 1 803  ? -20.621 94.410  31.255  1.00 15.43 ? 803  LYS A N   1 
ATOM   6265  C CA  . LYS A 1 803  ? -20.079 93.076  31.089  1.00 15.87 ? 803  LYS A CA  1 
ATOM   6266  C C   . LYS A 1 803  ? -20.400 92.573  29.698  1.00 17.66 ? 803  LYS A C   1 
ATOM   6267  O O   . LYS A 1 803  ? -21.487 92.798  29.169  1.00 18.41 ? 803  LYS A O   1 
ATOM   6268  C CB  . LYS A 1 803  ? -20.616 92.084  32.118  1.00 16.91 ? 803  LYS A CB  1 
ATOM   6269  C CG  . LYS A 1 803  ? -19.890 90.736  32.006  1.00 16.24 ? 803  LYS A CG  1 
ATOM   6270  C CD  . LYS A 1 803  ? -20.164 89.801  33.173  1.00 19.00 ? 803  LYS A CD  1 
ATOM   6271  C CE  . LYS A 1 803  ? -19.392 88.493  33.003  1.00 18.73 ? 803  LYS A CE  1 
ATOM   6272  N NZ  . LYS A 1 803  ? -17.949 88.724  32.664  1.00 20.91 ? 803  LYS A NZ  1 
ATOM   6273  N N   . GLU A 1 804  ? -19.427 91.885  29.125  1.00 17.58 ? 804  GLU A N   1 
ATOM   6274  C CA  . GLU A 1 804  ? -19.503 91.316  27.799  1.00 17.89 ? 804  GLU A CA  1 
ATOM   6275  C C   . GLU A 1 804  ? -20.289 90.002  27.791  1.00 16.13 ? 804  GLU A C   1 
ATOM   6276  O O   . GLU A 1 804  ? -19.928 89.074  28.494  1.00 16.25 ? 804  GLU A O   1 
ATOM   6277  C CB  . GLU A 1 804  ? -18.065 91.088  27.334  1.00 20.42 ? 804  GLU A CB  1 
ATOM   6278  C CG  . GLU A 1 804  ? -17.879 90.634  25.920  1.00 27.46 ? 804  GLU A CG  1 
ATOM   6279  C CD  . GLU A 1 804  ? -18.231 89.184  25.707  1.00 30.18 ? 804  GLU A CD  1 
ATOM   6280  O OE1 . GLU A 1 804  ? -17.878 88.347  26.574  1.00 32.07 ? 804  GLU A OE1 1 
ATOM   6281  O OE2 . GLU A 1 804  ? -18.844 88.887  24.657  1.00 31.61 ? 804  GLU A OE2 1 
ATOM   6282  N N   . ARG A 1 805  ? -21.373 89.936  27.024  1.00 15.93 ? 805  ARG A N   1 
ATOM   6283  C CA  . ARG A 1 805  ? -22.167 88.703  26.901  1.00 18.71 ? 805  ARG A CA  1 
ATOM   6284  C C   . ARG A 1 805  ? -22.480 88.520  25.415  1.00 19.51 ? 805  ARG A C   1 
ATOM   6285  O O   . ARG A 1 805  ? -23.544 88.908  24.948  1.00 19.25 ? 805  ARG A O   1 
ATOM   6286  C CB  . ARG A 1 805  ? -23.487 88.790  27.686  1.00 18.99 ? 805  ARG A CB  1 
ATOM   6287  C CG  . ARG A 1 805  ? -23.339 88.835  29.199  1.00 17.96 ? 805  ARG A CG  1 
ATOM   6288  C CD  . ARG A 1 805  ? -24.694 88.869  29.924  1.00 18.14 ? 805  ARG A CD  1 
ATOM   6289  N NE  . ARG A 1 805  ? -24.524 89.293  31.316  1.00 17.23 ? 805  ARG A NE  1 
ATOM   6290  C CZ  . ARG A 1 805  ? -23.935 88.554  32.249  1.00 17.68 ? 805  ARG A CZ  1 
ATOM   6291  N NH1 . ARG A 1 805  ? -23.480 87.340  31.944  1.00 17.48 ? 805  ARG A NH1 1 
ATOM   6292  N NH2 . ARG A 1 805  ? -23.746 89.047  33.467  1.00 17.83 ? 805  ARG A NH2 1 
ATOM   6293  N N   . ALA A 1 806  ? -21.555 87.923  24.673  1.00 22.23 ? 806  ALA A N   1 
ATOM   6294  C CA  . ALA A 1 806  ? -21.741 87.751  23.231  1.00 24.68 ? 806  ALA A CA  1 
ATOM   6295  C C   . ALA A 1 806  ? -22.837 86.782  22.824  1.00 25.76 ? 806  ALA A C   1 
ATOM   6296  O O   . ALA A 1 806  ? -23.533 87.022  21.848  1.00 25.45 ? 806  ALA A O   1 
ATOM   6297  C CB  . ALA A 1 806  ? -20.428 87.347  22.572  1.00 19.57 ? 806  ALA A CB  1 
ATOM   6298  N N   . ASN A 1 807  ? -22.982 85.687  23.558  1.00 29.35 ? 807  ASN A N   1 
ATOM   6299  C CA  . ASN A 1 807  ? -24.002 84.687  23.237  1.00 33.28 ? 807  ASN A CA  1 
ATOM   6300  C C   . ASN A 1 807  ? -25.269 84.918  24.053  1.00 33.83 ? 807  ASN A C   1 
ATOM   6301  O O   . ASN A 1 807  ? -25.398 85.914  24.761  1.00 36.10 ? 807  ASN A O   1 
ATOM   6302  C CB  . ASN A 1 807  ? -23.479 83.280  23.533  1.00 35.67 ? 807  ASN A CB  1 
ATOM   6303  C CG  . ASN A 1 807  ? -23.250 83.050  25.019  1.00 38.52 ? 807  ASN A CG  1 
ATOM   6304  O OD1 . ASN A 1 807  ? -23.090 81.918  25.461  1.00 41.09 ? 807  ASN A OD1 1 
ATOM   6305  N ND2 . ASN A 1 807  ? -23.229 84.133  25.796  1.00 38.74 ? 807  ASN A ND2 1 
ATOM   6306  N N   . SER A 1 808  ? -26.205 83.987  23.967  1.00 33.57 ? 808  SER A N   1 
ATOM   6307  C CA  . SER A 1 808  ? -27.437 84.134  24.719  1.00 34.04 ? 808  SER A CA  1 
ATOM   6308  C C   . SER A 1 808  ? -27.518 83.157  25.906  1.00 34.42 ? 808  SER A C   1 
ATOM   6309  O O   . SER A 1 808  ? -28.581 82.976  26.505  1.00 34.42 ? 808  SER A O   1 
ATOM   6310  C CB  . SER A 1 808  ? -28.636 83.959  23.784  1.00 34.62 ? 808  SER A CB  1 
ATOM   6311  O OG  . SER A 1 808  ? -28.566 82.731  23.093  1.00 34.18 ? 808  SER A OG  1 
ATOM   6312  N N   . SER A 1 809  ? -26.390 82.536  26.248  1.00 33.67 ? 809  SER A N   1 
ATOM   6313  C CA  . SER A 1 809  ? -26.363 81.608  27.372  1.00 32.22 ? 809  SER A CA  1 
ATOM   6314  C C   . SER A 1 809  ? -26.609 82.378  28.674  1.00 31.71 ? 809  SER A C   1 
ATOM   6315  O O   . SER A 1 809  ? -26.494 83.604  28.726  1.00 29.57 ? 809  SER A O   1 
ATOM   6316  C CB  . SER A 1 809  ? -25.022 80.869  27.430  1.00 31.85 ? 809  SER A CB  1 
ATOM   6317  O OG  . SER A 1 809  ? -23.950 81.737  27.770  1.00 33.02 ? 809  SER A OG  1 
ATOM   6318  N N   . ALA A 1 810  ? -26.946 81.647  29.727  1.00 32.15 ? 810  ALA A N   1 
ATOM   6319  C CA  . ALA A 1 810  ? -27.240 82.254  31.015  1.00 32.44 ? 810  ALA A CA  1 
ATOM   6320  C C   . ALA A 1 810  ? -25.997 82.708  31.771  1.00 32.53 ? 810  ALA A C   1 
ATOM   6321  O O   . ALA A 1 810  ? -24.962 82.048  31.731  1.00 33.24 ? 810  ALA A O   1 
ATOM   6322  C CB  . ALA A 1 810  ? -28.040 81.278  31.858  1.00 33.18 ? 810  ALA A CB  1 
ATOM   6323  N N   . GLU A 1 811  ? -26.108 83.843  32.454  1.00 31.97 ? 811  GLU A N   1 
ATOM   6324  C CA  . GLU A 1 811  ? -25.000 84.383  33.232  1.00 32.70 ? 811  GLU A CA  1 
ATOM   6325  C C   . GLU A 1 811  ? -24.516 83.314  34.203  1.00 33.07 ? 811  GLU A C   1 
ATOM   6326  O O   . GLU A 1 811  ? -25.259 82.386  34.535  1.00 33.34 ? 811  GLU A O   1 
ATOM   6327  C CB  . GLU A 1 811  ? -25.460 85.589  34.048  1.00 33.02 ? 811  GLU A CB  1 
ATOM   6328  C CG  . GLU A 1 811  ? -26.147 85.200  35.358  1.00 34.00 ? 811  GLU A CG  1 
ATOM   6329  C CD  . GLU A 1 811  ? -26.809 86.369  36.057  1.00 34.79 ? 811  GLU A CD  1 
ATOM   6330  O OE1 . GLU A 1 811  ? -26.140 87.390  36.326  1.00 37.01 ? 811  GLU A OE1 1 
ATOM   6331  O OE2 . GLU A 1 811  ? -28.014 86.260  36.342  1.00 36.13 ? 811  GLU A OE2 1 
ATOM   6332  N N   . GLU A 1 812  ? -23.277 83.456  34.667  1.00 33.28 ? 812  GLU A N   1 
ATOM   6333  C CA  . GLU A 1 812  ? -22.718 82.514  35.624  1.00 32.62 ? 812  GLU A CA  1 
ATOM   6334  C C   . GLU A 1 812  ? -23.470 82.684  36.933  1.00 30.94 ? 812  GLU A C   1 
ATOM   6335  O O   . GLU A 1 812  ? -23.763 83.798  37.346  1.00 30.78 ? 812  GLU A O   1 
ATOM   6336  C CB  . GLU A 1 812  ? -21.232 82.777  35.832  1.00 34.36 ? 812  GLU A CB  1 
ATOM   6337  C CG  . GLU A 1 812  ? -20.335 82.080  34.826  1.00 36.53 ? 812  GLU A CG  1 
ATOM   6338  C CD  . GLU A 1 812  ? -18.902 82.582  34.898  1.00 41.55 ? 812  GLU A CD  1 
ATOM   6339  O OE1 . GLU A 1 812  ? -18.260 82.461  35.973  1.00 42.48 ? 812  GLU A OE1 1 
ATOM   6340  O OE2 . GLU A 1 812  ? -18.414 83.109  33.871  1.00 45.07 ? 812  GLU A OE2 1 
ATOM   6341  N N   . PRO A 1 813  ? -23.795 81.568  37.599  1.00 30.10 ? 813  PRO A N   1 
ATOM   6342  C CA  . PRO A 1 813  ? -24.527 81.499  38.872  1.00 28.47 ? 813  PRO A CA  1 
ATOM   6343  C C   . PRO A 1 813  ? -23.813 82.171  40.038  1.00 27.91 ? 813  PRO A C   1 
ATOM   6344  O O   . PRO A 1 813  ? -22.579 82.175  40.106  1.00 26.78 ? 813  PRO A O   1 
ATOM   6345  C CB  . PRO A 1 813  ? -24.663 79.997  39.119  1.00 28.74 ? 813  PRO A CB  1 
ATOM   6346  C CG  . PRO A 1 813  ? -24.437 79.378  37.758  1.00 30.21 ? 813  PRO A CG  1 
ATOM   6347  C CD  . PRO A 1 813  ? -23.365 80.228  37.173  1.00 28.25 ? 813  PRO A CD  1 
ATOM   6348  N N   . TRP A 1 814  ? -24.593 82.729  40.959  1.00 26.58 ? 814  TRP A N   1 
ATOM   6349  C CA  . TRP A 1 814  ? -24.024 83.363  42.142  1.00 24.93 ? 814  TRP A CA  1 
ATOM   6350  C C   . TRP A 1 814  ? -23.176 82.273  42.799  1.00 24.90 ? 814  TRP A C   1 
ATOM   6351  O O   . TRP A 1 814  ? -23.543 81.094  42.774  1.00 24.68 ? 814  TRP A O   1 
ATOM   6352  C CB  . TRP A 1 814  ? -25.143 83.782  43.094  1.00 23.71 ? 814  TRP A CB  1 
ATOM   6353  C CG  . TRP A 1 814  ? -24.695 84.545  44.298  1.00 21.34 ? 814  TRP A CG  1 
ATOM   6354  C CD1 . TRP A 1 814  ? -24.632 85.907  44.435  1.00 19.46 ? 814  TRP A CD1 1 
ATOM   6355  C CD2 . TRP A 1 814  ? -24.283 83.994  45.554  1.00 21.01 ? 814  TRP A CD2 1 
ATOM   6356  N NE1 . TRP A 1 814  ? -24.212 86.236  45.707  1.00 18.53 ? 814  TRP A NE1 1 
ATOM   6357  C CE2 . TRP A 1 814  ? -23.991 85.083  46.413  1.00 19.98 ? 814  TRP A CE2 1 
ATOM   6358  C CE3 . TRP A 1 814  ? -24.134 82.685  46.040  1.00 21.70 ? 814  TRP A CE3 1 
ATOM   6359  C CZ2 . TRP A 1 814  ? -23.561 84.903  47.734  1.00 20.68 ? 814  TRP A CZ2 1 
ATOM   6360  C CZ3 . TRP A 1 814  ? -23.705 82.501  47.359  1.00 19.12 ? 814  TRP A CZ3 1 
ATOM   6361  C CH2 . TRP A 1 814  ? -23.424 83.609  48.188  1.00 22.83 ? 814  TRP A CH2 1 
ATOM   6362  N N   . PRO A 1 815  ? -22.050 82.647  43.417  1.00 23.92 ? 815  PRO A N   1 
ATOM   6363  C CA  . PRO A 1 815  ? -21.535 84.006  43.558  1.00 23.07 ? 815  PRO A CA  1 
ATOM   6364  C C   . PRO A 1 815  ? -20.425 84.444  42.595  1.00 21.74 ? 815  PRO A C   1 
ATOM   6365  O O   . PRO A 1 815  ? -19.535 85.196  43.002  1.00 23.57 ? 815  PRO A O   1 
ATOM   6366  C CB  . PRO A 1 815  ? -21.053 84.013  44.996  1.00 23.52 ? 815  PRO A CB  1 
ATOM   6367  C CG  . PRO A 1 815  ? -20.379 82.666  45.063  1.00 24.05 ? 815  PRO A CG  1 
ATOM   6368  C CD  . PRO A 1 815  ? -21.370 81.741  44.363  1.00 24.03 ? 815  PRO A CD  1 
ATOM   6369  N N   . ALA A 1 816  ? -20.441 83.999  41.344  1.00 19.06 ? 816  ALA A N   1 
ATOM   6370  C CA  . ALA A 1 816  ? -19.390 84.431  40.412  1.00 17.65 ? 816  ALA A CA  1 
ATOM   6371  C C   . ALA A 1 816  ? -19.328 85.963  40.388  1.00 17.74 ? 816  ALA A C   1 
ATOM   6372  O O   . ALA A 1 816  ? -18.267 86.560  40.182  1.00 18.51 ? 816  ALA A O   1 
ATOM   6373  C CB  . ALA A 1 816  ? -19.665 83.901  39.009  1.00 16.23 ? 816  ALA A CB  1 
ATOM   6374  N N   . ILE A 1 817  ? -20.477 86.592  40.613  1.00 16.26 ? 817  ILE A N   1 
ATOM   6375  C CA  . ILE A 1 817  ? -20.565 88.039  40.627  1.00 15.22 ? 817  ILE A CA  1 
ATOM   6376  C C   . ILE A 1 817  ? -19.587 88.622  41.653  1.00 15.83 ? 817  ILE A C   1 
ATOM   6377  O O   . ILE A 1 817  ? -19.051 89.726  41.459  1.00 14.14 ? 817  ILE A O   1 
ATOM   6378  C CB  . ILE A 1 817  ? -22.019 88.502  40.957  1.00 15.52 ? 817  ILE A CB  1 
ATOM   6379  C CG1 . ILE A 1 817  ? -22.116 90.033  40.931  1.00 16.23 ? 817  ILE A CG1 1 
ATOM   6380  C CG2 . ILE A 1 817  ? -22.439 87.984  42.318  1.00 12.84 ? 817  ILE A CG2 1 
ATOM   6381  C CD1 . ILE A 1 817  ? -21.835 90.638  39.596  1.00 14.53 ? 817  ILE A CD1 1 
ATOM   6382  N N   . LEU A 1 818  ? -19.352 87.889  42.742  1.00 15.20 ? 818  LEU A N   1 
ATOM   6383  C CA  . LEU A 1 818  ? -18.434 88.372  43.769  1.00 16.69 ? 818  LEU A CA  1 
ATOM   6384  C C   . LEU A 1 818  ? -17.033 88.482  43.182  1.00 17.51 ? 818  LEU A C   1 
ATOM   6385  O O   . LEU A 1 818  ? -16.295 89.403  43.509  1.00 16.40 ? 818  LEU A O   1 
ATOM   6386  C CB  . LEU A 1 818  ? -18.418 87.450  44.986  1.00 17.81 ? 818  LEU A CB  1 
ATOM   6387  C CG  . LEU A 1 818  ? -19.712 87.368  45.806  1.00 19.13 ? 818  LEU A CG  1 
ATOM   6388  C CD1 . LEU A 1 818  ? -19.461 86.532  47.072  1.00 18.41 ? 818  LEU A CD1 1 
ATOM   6389  C CD2 . LEU A 1 818  ? -20.189 88.755  46.164  1.00 19.46 ? 818  LEU A CD2 1 
ATOM   6390  N N   . ASP A 1 819  ? -16.666 87.553  42.304  1.00 17.17 ? 819  ASP A N   1 
ATOM   6391  C CA  . ASP A 1 819  ? -15.359 87.630  41.688  1.00 17.30 ? 819  ASP A CA  1 
ATOM   6392  C C   . ASP A 1 819  ? -15.296 88.857  40.789  1.00 17.51 ? 819  ASP A C   1 
ATOM   6393  O O   . ASP A 1 819  ? -14.283 89.545  40.734  1.00 17.03 ? 819  ASP A O   1 
ATOM   6394  C CB  . ASP A 1 819  ? -15.059 86.358  40.899  1.00 17.93 ? 819  ASP A CB  1 
ATOM   6395  C CG  . ASP A 1 819  ? -14.683 85.185  41.815  1.00 22.23 ? 819  ASP A CG  1 
ATOM   6396  O OD1 . ASP A 1 819  ? -14.467 85.426  43.032  1.00 20.70 ? 819  ASP A OD1 1 
ATOM   6397  O OD2 . ASP A 1 819  ? -14.594 84.027  41.328  1.00 25.46 ? 819  ASP A OD2 1 
ATOM   6398  N N   . GLN A 1 820  ? -16.392 89.149  40.101  1.00 17.39 ? 820  GLN A N   1 
ATOM   6399  C CA  . GLN A 1 820  ? -16.433 90.306  39.220  1.00 17.54 ? 820  GLN A CA  1 
ATOM   6400  C C   . GLN A 1 820  ? -16.425 91.624  39.995  1.00 18.15 ? 820  GLN A C   1 
ATOM   6401  O O   . GLN A 1 820  ? -15.772 92.585  39.595  1.00 16.99 ? 820  GLN A O   1 
ATOM   6402  C CB  . GLN A 1 820  ? -17.670 90.234  38.330  1.00 18.18 ? 820  GLN A CB  1 
ATOM   6403  C CG  . GLN A 1 820  ? -17.590 89.152  37.272  1.00 21.39 ? 820  GLN A CG  1 
ATOM   6404  C CD  . GLN A 1 820  ? -18.949 88.612  36.891  1.00 23.65 ? 820  GLN A CD  1 
ATOM   6405  O OE1 . GLN A 1 820  ? -19.856 89.368  36.531  1.00 24.60 ? 820  GLN A OE1 1 
ATOM   6406  N NE2 . GLN A 1 820  ? -19.102 87.292  36.970  1.00 24.15 ? 820  GLN A NE2 1 
ATOM   6407  N N   . ILE A 1 821  ? -17.152 91.672  41.105  1.00 17.76 ? 821  ILE A N   1 
ATOM   6408  C CA  . ILE A 1 821  ? -17.201 92.886  41.889  1.00 18.24 ? 821  ILE A CA  1 
ATOM   6409  C C   . ILE A 1 821  ? -15.807 93.177  42.441  1.00 18.80 ? 821  ILE A C   1 
ATOM   6410  O O   . ILE A 1 821  ? -15.383 94.339  42.492  1.00 19.18 ? 821  ILE A O   1 
ATOM   6411  C CB  . ILE A 1 821  ? -18.245 92.756  43.009  1.00 19.01 ? 821  ILE A CB  1 
ATOM   6412  C CG1 . ILE A 1 821  ? -19.620 92.502  42.386  1.00 19.92 ? 821  ILE A CG1 1 
ATOM   6413  C CG2 . ILE A 1 821  ? -18.312 94.030  43.827  1.00 21.80 ? 821  ILE A CG2 1 
ATOM   6414  C CD1 . ILE A 1 821  ? -20.011 93.519  41.333  1.00 17.03 ? 821  ILE A CD1 1 
ATOM   6415  N N   . MET A 1 822  ? -15.087 92.130  42.846  1.00 17.06 ? 822  MET A N   1 
ATOM   6416  C CA  . MET A 1 822  ? -13.720 92.317  43.335  1.00 15.91 ? 822  MET A CA  1 
ATOM   6417  C C   . MET A 1 822  ? -12.846 92.775  42.155  1.00 15.72 ? 822  MET A C   1 
ATOM   6418  O O   . MET A 1 822  ? -11.909 93.552  42.327  1.00 15.95 ? 822  MET A O   1 
ATOM   6419  C CB  . MET A 1 822  ? -13.165 91.020  43.938  1.00 10.96 ? 822  MET A CB  1 
ATOM   6420  C CG  . MET A 1 822  ? -13.697 90.730  45.341  1.00 11.97 ? 822  MET A CG  1 
ATOM   6421  S SD  . MET A 1 822  ? -13.532 92.136  46.538  1.00 12.48 ? 822  MET A SD  1 
ATOM   6422  C CE  . MET A 1 822  ? -11.725 92.401  46.507  1.00 9.21  ? 822  MET A CE  1 
ATOM   6423  N N   . GLY A 1 823  ? -13.180 92.298  40.958  1.00 15.42 ? 823  GLY A N   1 
ATOM   6424  C CA  . GLY A 1 823  ? -12.450 92.681  39.763  1.00 15.04 ? 823  GLY A CA  1 
ATOM   6425  C C   . GLY A 1 823  ? -12.705 94.150  39.461  1.00 16.78 ? 823  GLY A C   1 
ATOM   6426  O O   . GLY A 1 823  ? -11.833 94.845  38.929  1.00 17.17 ? 823  GLY A O   1 
ATOM   6427  N N   . VAL A 1 824  ? -13.907 94.626  39.797  1.00 16.11 ? 824  VAL A N   1 
ATOM   6428  C CA  . VAL A 1 824  ? -14.256 96.025  39.603  1.00 14.59 ? 824  VAL A CA  1 
ATOM   6429  C C   . VAL A 1 824  ? -13.370 96.831  40.562  1.00 15.76 ? 824  VAL A C   1 
ATOM   6430  O O   . VAL A 1 824  ? -12.698 97.776  40.156  1.00 18.24 ? 824  VAL A O   1 
ATOM   6431  C CB  . VAL A 1 824  ? -15.741 96.286  39.935  1.00 15.16 ? 824  VAL A CB  1 
ATOM   6432  C CG1 . VAL A 1 824  ? -15.968 97.765  40.129  1.00 12.85 ? 824  VAL A CG1 1 
ATOM   6433  C CG2 . VAL A 1 824  ? -16.638 95.757  38.819  1.00 11.41 ? 824  VAL A CG2 1 
ATOM   6434  N N   . PHE A 1 825  ? -13.352 96.441  41.831  1.00 14.20 ? 825  PHE A N   1 
ATOM   6435  C CA  . PHE A 1 825  ? -12.531 97.128  42.823  1.00 13.33 ? 825  PHE A CA  1 
ATOM   6436  C C   . PHE A 1 825  ? -11.067 97.238  42.401  1.00 14.39 ? 825  PHE A C   1 
ATOM   6437  O O   . PHE A 1 825  ? -10.481 98.326  42.454  1.00 13.93 ? 825  PHE A O   1 
ATOM   6438  C CB  . PHE A 1 825  ? -12.607 96.406  44.169  1.00 11.10 ? 825  PHE A CB  1 
ATOM   6439  C CG  . PHE A 1 825  ? -11.598 96.890  45.181  1.00 10.09 ? 825  PHE A CG  1 
ATOM   6440  C CD1 . PHE A 1 825  ? -11.712 98.149  45.754  1.00 9.65  ? 825  PHE A CD1 1 
ATOM   6441  C CD2 . PHE A 1 825  ? -10.528 96.079  45.560  1.00 11.03 ? 825  PHE A CD2 1 
ATOM   6442  C CE1 . PHE A 1 825  ? -10.787 98.600  46.685  1.00 8.05  ? 825  PHE A CE1 1 
ATOM   6443  C CE2 . PHE A 1 825  ? -9.589  96.518  46.497  1.00 11.81 ? 825  PHE A CE2 1 
ATOM   6444  C CZ  . PHE A 1 825  ? -9.719  97.788  47.065  1.00 9.88  ? 825  PHE A CZ  1 
ATOM   6445  N N   . PHE A 1 826  ? -10.465 96.127  41.979  1.00 13.99 ? 826  PHE A N   1 
ATOM   6446  C CA  . PHE A 1 826  ? -9.058  96.195  41.586  1.00 14.07 ? 826  PHE A CA  1 
ATOM   6447  C C   . PHE A 1 826  ? -8.858  97.138  40.406  1.00 14.57 ? 826  PHE A C   1 
ATOM   6448  O O   . PHE A 1 826  ? -7.812  97.774  40.306  1.00 15.12 ? 826  PHE A O   1 
ATOM   6449  C CB  . PHE A 1 826  ? -8.472  94.794  41.288  1.00 11.85 ? 826  PHE A CB  1 
ATOM   6450  C CG  . PHE A 1 826  ? -8.433  93.868  42.498  1.00 10.23 ? 826  PHE A CG  1 
ATOM   6451  C CD1 . PHE A 1 826  ? -7.909  94.297  43.715  1.00 11.16 ? 826  PHE A CD1 1 
ATOM   6452  C CD2 . PHE A 1 826  ? -8.956  92.579  42.425  1.00 10.41 ? 826  PHE A CD2 1 
ATOM   6453  C CE1 . PHE A 1 826  ? -7.909  93.455  44.849  1.00 8.47  ? 826  PHE A CE1 1 
ATOM   6454  C CE2 . PHE A 1 826  ? -8.962  91.732  43.550  1.00 8.94  ? 826  PHE A CE2 1 
ATOM   6455  C CZ  . PHE A 1 826  ? -8.437  92.183  44.766  1.00 8.27  ? 826  PHE A CZ  1 
ATOM   6456  N N   . ASN A 1 827  ? -9.843  97.256  39.515  1.00 15.37 ? 827  ASN A N   1 
ATOM   6457  C CA  . ASN A 1 827  ? -9.663  98.191  38.397  1.00 17.41 ? 827  ASN A CA  1 
ATOM   6458  C C   . ASN A 1 827  ? -9.566  99.602  38.970  1.00 16.34 ? 827  ASN A C   1 
ATOM   6459  O O   . ASN A 1 827  ? -8.771  100.415 38.499  1.00 18.77 ? 827  ASN A O   1 
ATOM   6460  C CB  . ASN A 1 827  ? -10.820 98.144  37.382  1.00 20.16 ? 827  ASN A CB  1 
ATOM   6461  C CG  . ASN A 1 827  ? -10.777 96.914  36.473  1.00 24.98 ? 827  ASN A CG  1 
ATOM   6462  O OD1 . ASN A 1 827  ? -9.698  96.415  36.103  1.00 26.56 ? 827  ASN A OD1 1 
ATOM   6463  N ND2 . ASN A 1 827  ? -11.959 96.432  36.087  1.00 24.19 ? 827  ASN A ND2 1 
ATOM   6464  N N   . GLY A 1 828  ? -10.373 99.891  39.989  1.00 13.44 ? 828  GLY A N   1 
ATOM   6465  C CA  . GLY A 1 828  ? -10.328 101.207 40.599  1.00 13.10 ? 828  GLY A CA  1 
ATOM   6466  C C   . GLY A 1 828  ? -8.964  101.504 41.213  1.00 13.73 ? 828  GLY A C   1 
ATOM   6467  O O   . GLY A 1 828  ? -8.477  102.636 41.134  1.00 12.78 ? 828  GLY A O   1 
ATOM   6468  N N   . VAL A 1 829  ? -8.351  100.488 41.827  1.00 13.20 ? 829  VAL A N   1 
ATOM   6469  C CA  . VAL A 1 829  ? -7.041  100.641 42.451  1.00 11.51 ? 829  VAL A CA  1 
ATOM   6470  C C   . VAL A 1 829  ? -6.018  100.961 41.359  1.00 11.42 ? 829  VAL A C   1 
ATOM   6471  O O   . VAL A 1 829  ? -5.219  101.889 41.490  1.00 10.22 ? 829  VAL A O   1 
ATOM   6472  C CB  . VAL A 1 829  ? -6.605  99.342  43.214  1.00 12.62 ? 829  VAL A CB  1 
ATOM   6473  C CG1 . VAL A 1 829  ? -5.220  99.542  43.833  1.00 11.94 ? 829  VAL A CG1 1 
ATOM   6474  C CG2 . VAL A 1 829  ? -7.610  98.994  44.320  1.00 9.74  ? 829  VAL A CG2 1 
ATOM   6475  N N   . HIS A 1 830  ? -6.060  100.211 40.268  1.00 11.58 ? 830  HIS A N   1 
ATOM   6476  C CA  . HIS A 1 830  ? -5.127  100.452 39.176  1.00 14.60 ? 830  HIS A CA  1 
ATOM   6477  C C   . HIS A 1 830  ? -5.396  101.784 38.498  1.00 13.98 ? 830  HIS A C   1 
ATOM   6478  O O   . HIS A 1 830  ? -4.459  102.518 38.242  1.00 17.46 ? 830  HIS A O   1 
ATOM   6479  C CB  . HIS A 1 830  ? -5.189  99.335  38.124  1.00 13.79 ? 830  HIS A CB  1 
ATOM   6480  C CG  . HIS A 1 830  ? -4.714  98.012  38.623  1.00 14.79 ? 830  HIS A CG  1 
ATOM   6481  N ND1 . HIS A 1 830  ? -3.471  97.836  39.189  1.00 16.62 ? 830  HIS A ND1 1 
ATOM   6482  C CD2 . HIS A 1 830  ? -5.309  96.794  38.634  1.00 16.39 ? 830  HIS A CD2 1 
ATOM   6483  C CE1 . HIS A 1 830  ? -3.319  96.566  39.524  1.00 14.48 ? 830  HIS A CE1 1 
ATOM   6484  N NE2 . HIS A 1 830  ? -4.418  95.911  39.197  1.00 12.80 ? 830  HIS A NE2 1 
ATOM   6485  N N   . ASP A 1 831  ? -6.657  102.097 38.210  1.00 14.02 ? 831  ASP A N   1 
ATOM   6486  C CA  . ASP A 1 831  ? -6.992  103.356 37.533  1.00 16.92 ? 831  ASP A CA  1 
ATOM   6487  C C   . ASP A 1 831  ? -6.895  104.592 38.409  1.00 16.83 ? 831  ASP A C   1 
ATOM   6488  O O   . ASP A 1 831  ? -7.172  105.703 37.949  1.00 16.63 ? 831  ASP A O   1 
ATOM   6489  C CB  . ASP A 1 831  ? -8.398  103.316 36.919  1.00 19.01 ? 831  ASP A CB  1 
ATOM   6490  C CG  . ASP A 1 831  ? -8.496  102.369 35.733  1.00 22.94 ? 831  ASP A CG  1 
ATOM   6491  O OD1 . ASP A 1 831  ? -7.483  102.221 35.002  1.00 24.47 ? 831  ASP A OD1 1 
ATOM   6492  O OD2 . ASP A 1 831  ? -9.593  101.785 35.532  1.00 24.29 ? 831  ASP A OD2 1 
ATOM   6493  N N   . GLY A 1 832  ? -6.523  104.391 39.673  1.00 17.24 ? 832  GLY A N   1 
ATOM   6494  C CA  . GLY A 1 832  ? -6.364  105.503 40.595  1.00 15.83 ? 832  GLY A CA  1 
ATOM   6495  C C   . GLY A 1 832  ? -7.556  106.337 41.017  1.00 14.61 ? 832  GLY A C   1 
ATOM   6496  O O   . GLY A 1 832  ? -7.476  107.560 41.049  1.00 16.82 ? 832  GLY A O   1 
ATOM   6497  N N   . LEU A 1 833  ? -8.662  105.696 41.351  1.00 14.13 ? 833  LEU A N   1 
ATOM   6498  C CA  . LEU A 1 833  ? -9.832  106.430 41.818  1.00 12.82 ? 833  LEU A CA  1 
ATOM   6499  C C   . LEU A 1 833  ? -9.507  107.046 43.194  1.00 11.73 ? 833  LEU A C   1 
ATOM   6500  O O   . LEU A 1 833  ? -8.440  106.777 43.757  1.00 10.12 ? 833  LEU A O   1 
ATOM   6501  C CB  . LEU A 1 833  ? -11.022 105.474 41.937  1.00 12.26 ? 833  LEU A CB  1 
ATOM   6502  C CG  . LEU A 1 833  ? -11.429 104.826 40.618  1.00 11.77 ? 833  LEU A CG  1 
ATOM   6503  C CD1 . LEU A 1 833  ? -12.743 104.093 40.764  1.00 7.90  ? 833  LEU A CD1 1 
ATOM   6504  C CD2 . LEU A 1 833  ? -11.540 105.910 39.576  1.00 10.50 ? 833  LEU A CD2 1 
ATOM   6505  N N   . GLN A 1 834  ? -10.406 107.871 43.733  1.00 10.57 ? 834  GLN A N   1 
ATOM   6506  C CA  . GLN A 1 834  ? -10.167 108.485 45.050  1.00 11.06 ? 834  GLN A CA  1 
ATOM   6507  C C   . GLN A 1 834  ? -10.271 107.350 46.073  1.00 10.80 ? 834  GLN A C   1 
ATOM   6508  O O   . GLN A 1 834  ? -11.372 106.863 46.365  1.00 11.86 ? 834  GLN A O   1 
ATOM   6509  C CB  . GLN A 1 834  ? -11.208 109.577 45.315  1.00 13.87 ? 834  GLN A CB  1 
ATOM   6510  C CG  . GLN A 1 834  ? -11.100 110.773 44.362  1.00 13.67 ? 834  GLN A CG  1 
ATOM   6511  C CD  . GLN A 1 834  ? -9.711  111.400 44.370  1.00 15.30 ? 834  GLN A CD  1 
ATOM   6512  O OE1 . GLN A 1 834  ? -9.207  111.807 45.419  1.00 18.28 ? 834  GLN A OE1 1 
ATOM   6513  N NE2 . GLN A 1 834  ? -9.089  111.487 43.198  1.00 17.11 ? 834  GLN A NE2 1 
ATOM   6514  N N   . TRP A 1 835  ? -9.129  106.935 46.621  1.00 8.97  ? 835  TRP A N   1 
ATOM   6515  C CA  . TRP A 1 835  ? -9.101  105.779 47.513  1.00 9.22  ? 835  TRP A CA  1 
ATOM   6516  C C   . TRP A 1 835  ? -10.183 105.615 48.575  1.00 10.02 ? 835  TRP A C   1 
ATOM   6517  O O   . TRP A 1 835  ? -10.775 104.532 48.687  1.00 9.93  ? 835  TRP A O   1 
ATOM   6518  C CB  . TRP A 1 835  ? -7.696  105.580 48.130  1.00 9.33  ? 835  TRP A CB  1 
ATOM   6519  C CG  . TRP A 1 835  ? -7.235  106.572 49.188  1.00 9.66  ? 835  TRP A CG  1 
ATOM   6520  C CD1 . TRP A 1 835  ? -6.785  107.850 48.991  1.00 8.92  ? 835  TRP A CD1 1 
ATOM   6521  C CD2 . TRP A 1 835  ? -7.118  106.325 50.591  1.00 10.28 ? 835  TRP A CD2 1 
ATOM   6522  N NE1 . TRP A 1 835  ? -6.391  108.406 50.178  1.00 6.64  ? 835  TRP A NE1 1 
ATOM   6523  C CE2 . TRP A 1 835  ? -6.585  107.491 51.179  1.00 10.45 ? 835  TRP A CE2 1 
ATOM   6524  C CE3 . TRP A 1 835  ? -7.403  105.223 51.410  1.00 10.00 ? 835  TRP A CE3 1 
ATOM   6525  C CZ2 . TRP A 1 835  ? -6.341  107.590 52.552  1.00 9.66  ? 835  TRP A CZ2 1 
ATOM   6526  C CZ3 . TRP A 1 835  ? -7.158  105.320 52.771  1.00 9.15  ? 835  TRP A CZ3 1 
ATOM   6527  C CH2 . TRP A 1 835  ? -6.631  106.495 53.329  1.00 9.66  ? 835  TRP A CH2 1 
ATOM   6528  N N   . GLN A 1 836  ? -10.466 106.649 49.353  1.00 9.69  ? 836  GLN A N   1 
ATOM   6529  C CA  . GLN A 1 836  ? -11.495 106.483 50.361  1.00 10.35 ? 836  GLN A CA  1 
ATOM   6530  C C   . GLN A 1 836  ? -12.865 106.292 49.737  1.00 11.34 ? 836  GLN A C   1 
ATOM   6531  O O   . GLN A 1 836  ? -13.570 105.341 50.070  1.00 11.96 ? 836  GLN A O   1 
ATOM   6532  C CB  . GLN A 1 836  ? -11.508 107.666 51.335  1.00 11.57 ? 836  GLN A CB  1 
ATOM   6533  C CG  . GLN A 1 836  ? -10.273 107.710 52.244  1.00 14.12 ? 836  GLN A CG  1 
ATOM   6534  C CD  . GLN A 1 836  ? -10.225 108.939 53.135  1.00 13.35 ? 836  GLN A CD  1 
ATOM   6535  O OE1 . GLN A 1 836  ? -9.917  110.045 52.679  1.00 14.89 ? 836  GLN A OE1 1 
ATOM   6536  N NE2 . GLN A 1 836  ? -10.538 108.754 54.412  1.00 12.08 ? 836  GLN A NE2 1 
ATOM   6537  N N   . ARG A 1 837  ? -13.256 107.175 48.827  1.00 11.79 ? 837  ARG A N   1 
ATOM   6538  C CA  . ARG A 1 837  ? -14.574 107.043 48.218  1.00 12.47 ? 837  ARG A CA  1 
ATOM   6539  C C   . ARG A 1 837  ? -14.704 105.682 47.550  1.00 13.28 ? 837  ARG A C   1 
ATOM   6540  O O   . ARG A 1 837  ? -15.764 105.059 47.603  1.00 14.48 ? 837  ARG A O   1 
ATOM   6541  C CB  . ARG A 1 837  ? -14.828 108.150 47.185  1.00 13.45 ? 837  ARG A CB  1 
ATOM   6542  C CG  . ARG A 1 837  ? -14.707 109.560 47.740  1.00 19.54 ? 837  ARG A CG  1 
ATOM   6543  C CD  . ARG A 1 837  ? -15.607 109.754 48.936  1.00 23.02 ? 837  ARG A CD  1 
ATOM   6544  N NE  . ARG A 1 837  ? -16.973 110.050 48.527  1.00 27.94 ? 837  ARG A NE  1 
ATOM   6545  C CZ  . ARG A 1 837  ? -17.503 111.266 48.510  1.00 26.18 ? 837  ARG A CZ  1 
ATOM   6546  N NH1 . ARG A 1 837  ? -16.790 112.314 48.885  1.00 24.30 ? 837  ARG A NH1 1 
ATOM   6547  N NH2 . ARG A 1 837  ? -18.749 111.426 48.107  1.00 27.70 ? 837  ARG A NH2 1 
ATOM   6548  N N   . TRP A 1 838  ? -13.624 105.213 46.931  1.00 12.80 ? 838  TRP A N   1 
ATOM   6549  C CA  . TRP A 1 838  ? -13.657 103.929 46.260  1.00 11.65 ? 838  TRP A CA  1 
ATOM   6550  C C   . TRP A 1 838  ? -13.792 102.766 47.245  1.00 12.62 ? 838  TRP A C   1 
ATOM   6551  O O   . TRP A 1 838  ? -14.628 101.873 47.047  1.00 13.50 ? 838  TRP A O   1 
ATOM   6552  C CB  . TRP A 1 838  ? -12.407 103.733 45.405  1.00 11.48 ? 838  TRP A CB  1 
ATOM   6553  C CG  . TRP A 1 838  ? -12.529 102.568 44.462  1.00 10.30 ? 838  TRP A CG  1 
ATOM   6554  C CD1 . TRP A 1 838  ? -11.617 101.570 44.268  1.00 11.56 ? 838  TRP A CD1 1 
ATOM   6555  C CD2 . TRP A 1 838  ? -13.604 102.310 43.552  1.00 9.25  ? 838  TRP A CD2 1 
ATOM   6556  N NE1 . TRP A 1 838  ? -12.051 100.712 43.288  1.00 12.22 ? 838  TRP A NE1 1 
ATOM   6557  C CE2 . TRP A 1 838  ? -13.265 101.146 42.826  1.00 11.44 ? 838  TRP A CE2 1 
ATOM   6558  C CE3 . TRP A 1 838  ? -14.814 102.959 43.265  1.00 9.30  ? 838  TRP A CE3 1 
ATOM   6559  C CZ2 . TRP A 1 838  ? -14.100 100.608 41.837  1.00 10.19 ? 838  TRP A CZ2 1 
ATOM   6560  C CZ3 . TRP A 1 838  ? -15.645 102.427 42.279  1.00 9.81  ? 838  TRP A CZ3 1 
ATOM   6561  C CH2 . TRP A 1 838  ? -15.277 101.264 41.572  1.00 10.10 ? 838  TRP A CH2 1 
ATOM   6562  N N   . ILE A 1 839  ? -12.981 102.768 48.299  1.00 10.42 ? 839  ILE A N   1 
ATOM   6563  C CA  . ILE A 1 839  ? -13.055 101.699 49.281  1.00 11.12 ? 839  ILE A CA  1 
ATOM   6564  C C   . ILE A 1 839  ? -14.464 101.622 49.875  1.00 11.68 ? 839  ILE A C   1 
ATOM   6565  O O   . ILE A 1 839  ? -15.057 100.529 49.952  1.00 10.51 ? 839  ILE A O   1 
ATOM   6566  C CB  . ILE A 1 839  ? -12.009 101.901 50.404  1.00 12.02 ? 839  ILE A CB  1 
ATOM   6567  C CG1 . ILE A 1 839  ? -10.622 101.543 49.867  1.00 13.32 ? 839  ILE A CG1 1 
ATOM   6568  C CG2 . ILE A 1 839  ? -12.340 101.033 51.631  1.00 8.89  ? 839  ILE A CG2 1 
ATOM   6569  C CD1 . ILE A 1 839  ? -9.483  101.996 50.773  1.00 14.95 ? 839  ILE A CD1 1 
ATOM   6570  N N   . ARG A 1 840  ? -15.000 102.777 50.278  1.00 11.73 ? 840  ARG A N   1 
ATOM   6571  C CA  . ARG A 1 840  ? -16.339 102.829 50.862  1.00 11.12 ? 840  ARG A CA  1 
ATOM   6572  C C   . ARG A 1 840  ? -17.355 102.304 49.872  1.00 10.53 ? 840  ARG A C   1 
ATOM   6573  O O   . ARG A 1 840  ? -18.180 101.458 50.217  1.00 12.78 ? 840  ARG A O   1 
ATOM   6574  C CB  . ARG A 1 840  ? -16.737 104.252 51.276  1.00 10.76 ? 840  ARG A CB  1 
ATOM   6575  C CG  . ARG A 1 840  ? -18.149 104.324 51.878  1.00 10.68 ? 840  ARG A CG  1 
ATOM   6576  C CD  . ARG A 1 840  ? -18.504 105.708 52.433  1.00 10.08 ? 840  ARG A CD  1 
ATOM   6577  N NE  . ARG A 1 840  ? -18.491 106.760 51.415  1.00 6.60  ? 840  ARG A NE  1 
ATOM   6578  C CZ  . ARG A 1 840  ? -18.813 108.032 51.648  1.00 7.66  ? 840  ARG A CZ  1 
ATOM   6579  N NH1 . ARG A 1 840  ? -19.175 108.414 52.875  1.00 5.15  ? 840  ARG A NH1 1 
ATOM   6580  N NH2 . ARG A 1 840  ? -18.785 108.928 50.655  1.00 6.56  ? 840  ARG A NH2 1 
ATOM   6581  N N   . TYR A 1 841  ? -17.309 102.789 48.640  1.00 8.77  ? 841  TYR A N   1 
ATOM   6582  C CA  . TYR A 1 841  ? -18.265 102.296 47.659  1.00 10.22 ? 841  TYR A CA  1 
ATOM   6583  C C   . TYR A 1 841  ? -18.181 100.764 47.511  1.00 11.85 ? 841  TYR A C   1 
ATOM   6584  O O   . TYR A 1 841  ? -19.198 100.079 47.607  1.00 14.80 ? 841  TYR A O   1 
ATOM   6585  C CB  . TYR A 1 841  ? -18.044 102.958 46.304  1.00 8.47  ? 841  TYR A CB  1 
ATOM   6586  C CG  . TYR A 1 841  ? -19.034 102.484 45.289  1.00 8.62  ? 841  TYR A CG  1 
ATOM   6587  C CD1 . TYR A 1 841  ? -20.385 102.788 45.424  1.00 8.48  ? 841  TYR A CD1 1 
ATOM   6588  C CD2 . TYR A 1 841  ? -18.645 101.657 44.240  1.00 7.39  ? 841  TYR A CD2 1 
ATOM   6589  C CE1 . TYR A 1 841  ? -21.319 102.283 44.551  1.00 7.07  ? 841  TYR A CE1 1 
ATOM   6590  C CE2 . TYR A 1 841  ? -19.573 101.141 43.366  1.00 7.24  ? 841  TYR A CE2 1 
ATOM   6591  C CZ  . TYR A 1 841  ? -20.909 101.458 43.527  1.00 8.90  ? 841  TYR A CZ  1 
ATOM   6592  O OH  . TYR A 1 841  ? -21.842 100.935 42.671  1.00 12.16 ? 841  TYR A OH  1 
ATOM   6593  N N   . SER A 1 842  ? -16.979 100.230 47.284  1.00 11.75 ? 842  SER A N   1 
ATOM   6594  C CA  . SER A 1 842  ? -16.788 98.782  47.129  1.00 11.33 ? 842  SER A CA  1 
ATOM   6595  C C   . SER A 1 842  ? -17.392 98.001  48.281  1.00 10.54 ? 842  SER A C   1 
ATOM   6596  O O   . SER A 1 842  ? -17.961 96.929  48.081  1.00 9.64  ? 842  SER A O   1 
ATOM   6597  C CB  . SER A 1 842  ? -15.300 98.426  47.031  1.00 9.89  ? 842  SER A CB  1 
ATOM   6598  O OG  . SER A 1 842  ? -14.688 99.068  45.926  1.00 13.24 ? 842  SER A OG  1 
ATOM   6599  N N   . TRP A 1 843  ? -17.256 98.536  49.486  1.00 9.63  ? 843  TRP A N   1 
ATOM   6600  C CA  . TRP A 1 843  ? -17.810 97.866  50.652  1.00 11.54 ? 843  TRP A CA  1 
ATOM   6601  C C   . TRP A 1 843  ? -19.327 97.801  50.567  1.00 11.12 ? 843  TRP A C   1 
ATOM   6602  O O   . TRP A 1 843  ? -19.932 96.802  50.959  1.00 11.87 ? 843  TRP A O   1 
ATOM   6603  C CB  . TRP A 1 843  ? -17.391 98.570  51.945  1.00 11.72 ? 843  TRP A CB  1 
ATOM   6604  C CG  . TRP A 1 843  ? -16.138 98.016  52.521  1.00 11.46 ? 843  TRP A CG  1 
ATOM   6605  C CD1 . TRP A 1 843  ? -14.917 98.627  52.588  1.00 14.89 ? 843  TRP A CD1 1 
ATOM   6606  C CD2 . TRP A 1 843  ? -15.965 96.715  53.077  1.00 12.76 ? 843  TRP A CD2 1 
ATOM   6607  N NE1 . TRP A 1 843  ? -13.986 97.777  53.151  1.00 13.21 ? 843  TRP A NE1 1 
ATOM   6608  C CE2 . TRP A 1 843  ? -14.606 96.593  53.458  1.00 14.30 ? 843  TRP A CE2 1 
ATOM   6609  C CE3 . TRP A 1 843  ? -16.824 95.629  53.289  1.00 13.81 ? 843  TRP A CE3 1 
ATOM   6610  C CZ2 . TRP A 1 843  ? -14.089 95.432  54.044  1.00 13.90 ? 843  TRP A CZ2 1 
ATOM   6611  C CZ3 . TRP A 1 843  ? -16.305 94.467  53.877  1.00 13.28 ? 843  TRP A CZ3 1 
ATOM   6612  C CH2 . TRP A 1 843  ? -14.952 94.383  54.243  1.00 13.45 ? 843  TRP A CH2 1 
ATOM   6613  N N   . ALA A 1 844  ? -19.939 98.866  50.060  1.00 10.41 ? 844  ALA A N   1 
ATOM   6614  C CA  . ALA A 1 844  ? -21.381 98.904  49.913  1.00 9.36  ? 844  ALA A CA  1 
ATOM   6615  C C   . ALA A 1 844  ? -21.754 97.900  48.833  1.00 12.84 ? 844  ALA A C   1 
ATOM   6616  O O   . ALA A 1 844  ? -22.705 97.120  48.996  1.00 13.28 ? 844  ALA A O   1 
ATOM   6617  C CB  . ALA A 1 844  ? -21.825 100.286 49.520  1.00 7.66  ? 844  ALA A CB  1 
ATOM   6618  N N   . LEU A 1 845  ? -20.990 97.911  47.741  1.00 14.29 ? 845  LEU A N   1 
ATOM   6619  C CA  . LEU A 1 845  ? -21.233 97.005  46.622  1.00 16.75 ? 845  LEU A CA  1 
ATOM   6620  C C   . LEU A 1 845  ? -21.077 95.550  47.034  1.00 17.90 ? 845  LEU A C   1 
ATOM   6621  O O   . LEU A 1 845  ? -21.964 94.738  46.761  1.00 19.10 ? 845  LEU A O   1 
ATOM   6622  C CB  . LEU A 1 845  ? -20.283 97.296  45.451  1.00 17.04 ? 845  LEU A CB  1 
ATOM   6623  C CG  . LEU A 1 845  ? -20.879 97.470  44.042  1.00 19.23 ? 845  LEU A CG  1 
ATOM   6624  C CD1 . LEU A 1 845  ? -19.866 97.017  42.987  1.00 15.46 ? 845  LEU A CD1 1 
ATOM   6625  C CD2 . LEU A 1 845  ? -22.165 96.665  43.899  1.00 19.11 ? 845  LEU A CD2 1 
ATOM   6626  N N   . CYS A 1 846  ? -19.955 95.212  47.676  1.00 17.95 ? 846  CYS A N   1 
ATOM   6627  C CA  . CYS A 1 846  ? -19.733 93.831  48.113  1.00 18.28 ? 846  CYS A CA  1 
ATOM   6628  C C   . CYS A 1 846  ? -20.846 93.386  49.054  1.00 19.85 ? 846  CYS A C   1 
ATOM   6629  O O   . CYS A 1 846  ? -21.385 92.279  48.930  1.00 21.65 ? 846  CYS A O   1 
ATOM   6630  C CB  . CYS A 1 846  ? -18.382 93.680  48.821  1.00 16.50 ? 846  CYS A CB  1 
ATOM   6631  S SG  . CYS A 1 846  ? -16.962 93.674  47.695  1.00 16.24 ? 846  CYS A SG  1 
ATOM   6632  N N   . CYS A 1 847  ? -21.195 94.252  49.999  1.00 19.06 ? 847  CYS A N   1 
ATOM   6633  C CA  . CYS A 1 847  ? -22.247 93.926  50.945  1.00 18.15 ? 847  CYS A CA  1 
ATOM   6634  C C   . CYS A 1 847  ? -23.575 93.646  50.219  1.00 17.96 ? 847  CYS A C   1 
ATOM   6635  O O   . CYS A 1 847  ? -24.301 92.733  50.594  1.00 18.72 ? 847  CYS A O   1 
ATOM   6636  C CB  . CYS A 1 847  ? -22.424 95.072  51.939  1.00 17.29 ? 847  CYS A CB  1 
ATOM   6637  S SG  . CYS A 1 847  ? -23.814 94.839  53.068  1.00 20.98 ? 847  CYS A SG  1 
ATOM   6638  N N   . ALA A 1 848  ? -23.875 94.418  49.176  1.00 15.58 ? 848  ALA A N   1 
ATOM   6639  C CA  . ALA A 1 848  ? -25.119 94.253  48.427  1.00 13.96 ? 848  ALA A CA  1 
ATOM   6640  C C   . ALA A 1 848  ? -25.208 92.965  47.617  1.00 13.22 ? 848  ALA A C   1 
ATOM   6641  O O   . ALA A 1 848  ? -26.274 92.637  47.096  1.00 13.18 ? 848  ALA A O   1 
ATOM   6642  C CB  . ALA A 1 848  ? -25.350 95.455  47.506  1.00 13.25 ? 848  ALA A CB  1 
ATOM   6643  N N   . PHE A 1 849  ? -24.096 92.245  47.499  1.00 13.74 ? 849  PHE A N   1 
ATOM   6644  C CA  . PHE A 1 849  ? -24.078 90.978  46.758  1.00 14.10 ? 849  PHE A CA  1 
ATOM   6645  C C   . PHE A 1 849  ? -23.640 89.797  47.633  1.00 15.10 ? 849  PHE A C   1 
ATOM   6646  O O   . PHE A 1 849  ? -23.561 88.664  47.152  1.00 17.26 ? 849  PHE A O   1 
ATOM   6647  C CB  . PHE A 1 849  ? -23.120 91.059  45.571  1.00 12.57 ? 849  PHE A CB  1 
ATOM   6648  C CG  . PHE A 1 849  ? -23.665 91.796  44.392  1.00 11.35 ? 849  PHE A CG  1 
ATOM   6649  C CD1 . PHE A 1 849  ? -24.627 91.210  43.579  1.00 9.97  ? 849  PHE A CD1 1 
ATOM   6650  C CD2 . PHE A 1 849  ? -23.210 93.075  44.089  1.00 10.25 ? 849  PHE A CD2 1 
ATOM   6651  C CE1 . PHE A 1 849  ? -25.132 91.878  42.482  1.00 7.41  ? 849  PHE A CE1 1 
ATOM   6652  C CE2 . PHE A 1 849  ? -23.708 93.757  42.992  1.00 11.08 ? 849  PHE A CE2 1 
ATOM   6653  C CZ  . PHE A 1 849  ? -24.678 93.153  42.185  1.00 11.93 ? 849  PHE A CZ  1 
ATOM   6654  N N   . SER A 1 850  ? -23.357 90.065  48.904  1.00 13.82 ? 850  SER A N   1 
ATOM   6655  C CA  . SER A 1 850  ? -22.885 89.033  49.823  1.00 16.17 ? 850  SER A CA  1 
ATOM   6656  C C   . SER A 1 850  ? -23.921 88.012  50.301  1.00 17.38 ? 850  SER A C   1 
ATOM   6657  O O   . SER A 1 850  ? -23.565 87.019  50.937  1.00 17.19 ? 850  SER A O   1 
ATOM   6658  C CB  . SER A 1 850  ? -22.248 89.694  51.048  1.00 13.67 ? 850  SER A CB  1 
ATOM   6659  O OG  . SER A 1 850  ? -23.214 90.447  51.760  1.00 12.81 ? 850  SER A OG  1 
ATOM   6660  N N   . ARG A 1 851  ? -25.191 88.253  49.996  1.00 18.59 ? 851  ARG A N   1 
ATOM   6661  C CA  . ARG A 1 851  ? -26.254 87.367  50.437  1.00 19.75 ? 851  ARG A CA  1 
ATOM   6662  C C   . ARG A 1 851  ? -27.004 86.747  49.266  1.00 20.66 ? 851  ARG A C   1 
ATOM   6663  O O   . ARG A 1 851  ? -27.299 87.417  48.287  1.00 18.76 ? 851  ARG A O   1 
ATOM   6664  C CB  . ARG A 1 851  ? -27.226 88.154  51.320  1.00 21.41 ? 851  ARG A CB  1 
ATOM   6665  C CG  . ARG A 1 851  ? -28.198 87.314  52.134  1.00 22.72 ? 851  ARG A CG  1 
ATOM   6666  C CD  . ARG A 1 851  ? -29.120 88.216  52.936  1.00 24.12 ? 851  ARG A CD  1 
ATOM   6667  N NE  . ARG A 1 851  ? -29.985 87.480  53.857  1.00 25.77 ? 851  ARG A NE  1 
ATOM   6668  C CZ  . ARG A 1 851  ? -29.571 86.926  54.992  1.00 27.73 ? 851  ARG A CZ  1 
ATOM   6669  N NH1 . ARG A 1 851  ? -28.299 87.019  55.360  1.00 28.45 ? 851  ARG A NH1 1 
ATOM   6670  N NH2 . ARG A 1 851  ? -30.428 86.279  55.764  1.00 28.90 ? 851  ARG A NH2 1 
ATOM   6671  N N   . GLN A 1 852  ? -27.307 85.459  49.369  1.00 23.01 ? 852  GLN A N   1 
ATOM   6672  C CA  . GLN A 1 852  ? -28.038 84.768  48.319  1.00 25.95 ? 852  GLN A CA  1 
ATOM   6673  C C   . GLN A 1 852  ? -29.114 83.874  48.919  1.00 29.75 ? 852  GLN A C   1 
ATOM   6674  O O   . GLN A 1 852  ? -28.853 83.133  49.870  1.00 30.17 ? 852  GLN A O   1 
ATOM   6675  C CB  . GLN A 1 852  ? -27.084 83.925  47.476  1.00 24.09 ? 852  GLN A CB  1 
ATOM   6676  C CG  . GLN A 1 852  ? -27.794 83.025  46.472  1.00 24.21 ? 852  GLN A CG  1 
ATOM   6677  C CD  . GLN A 1 852  ? -28.526 83.792  45.373  1.00 25.58 ? 852  GLN A CD  1 
ATOM   6678  O OE1 . GLN A 1 852  ? -29.386 83.235  44.687  1.00 26.58 ? 852  GLN A OE1 1 
ATOM   6679  N NE2 . GLN A 1 852  ? -28.181 85.064  45.194  1.00 22.76 ? 852  GLN A NE2 1 
ATOM   6680  N N   . ARG A 1 853  ? -30.317 83.937  48.355  1.00 33.72 ? 853  ARG A N   1 
ATOM   6681  C CA  . ARG A 1 853  ? -31.445 83.133  48.832  1.00 39.39 ? 853  ARG A CA  1 
ATOM   6682  C C   . ARG A 1 853  ? -31.445 81.693  48.300  1.00 42.12 ? 853  ARG A C   1 
ATOM   6683  O O   . ARG A 1 853  ? -31.328 81.473  47.093  1.00 41.96 ? 853  ARG A O   1 
ATOM   6684  C CB  . ARG A 1 853  ? -32.759 83.819  48.440  1.00 41.41 ? 853  ARG A CB  1 
ATOM   6685  C CG  . ARG A 1 853  ? -34.010 82.954  48.607  1.00 44.66 ? 853  ARG A CG  1 
ATOM   6686  C CD  . ARG A 1 853  ? -35.262 83.712  48.177  1.00 47.32 ? 853  ARG A CD  1 
ATOM   6687  N NE  . ARG A 1 853  ? -36.473 82.895  48.243  1.00 51.19 ? 853  ARG A NE  1 
ATOM   6688  C CZ  . ARG A 1 853  ? -36.723 81.848  47.460  1.00 51.97 ? 853  ARG A CZ  1 
ATOM   6689  N NH1 . ARG A 1 853  ? -35.844 81.473  46.535  1.00 52.13 ? 853  ARG A NH1 1 
ATOM   6690  N NH2 . ARG A 1 853  ? -37.858 81.173  47.603  1.00 52.09 ? 853  ARG A NH2 1 
ATOM   6691  N N   . THR A 1 854  ? -31.583 80.717  49.199  1.00 45.78 ? 854  THR A N   1 
ATOM   6692  C CA  . THR A 1 854  ? -31.614 79.304  48.803  1.00 51.09 ? 854  THR A CA  1 
ATOM   6693  C C   . THR A 1 854  ? -32.961 78.627  49.063  1.00 54.46 ? 854  THR A C   1 
ATOM   6694  O O   . THR A 1 854  ? -33.587 78.814  50.115  1.00 54.19 ? 854  THR A O   1 
ATOM   6695  C CB  . THR A 1 854  ? -30.546 78.450  49.528  1.00 50.36 ? 854  THR A CB  1 
ATOM   6696  O OG1 . THR A 1 854  ? -30.735 78.558  50.942  1.00 50.58 ? 854  THR A OG1 1 
ATOM   6697  C CG2 . THR A 1 854  ? -29.142 78.894  49.151  1.00 50.27 ? 854  THR A CG2 1 
ATOM   6698  N N   . MET A 1 855  ? -33.380 77.821  48.087  1.00 58.24 ? 855  MET A N   1 
ATOM   6699  C CA  . MET A 1 855  ? -34.644 77.072  48.140  1.00 59.69 ? 855  MET A CA  1 
ATOM   6700  C C   . MET A 1 855  ? -34.322 75.591  48.002  1.00 59.59 ? 855  MET A C   1 
ATOM   6701  O O   . MET A 1 855  ? -34.106 75.083  46.884  1.00 58.35 ? 855  MET A O   1 
ATOM   6702  C CB  . MET A 1 855  ? -35.568 77.501  46.992  1.00 60.88 ? 855  MET A CB  1 
ATOM   6703  C CG  . MET A 1 855  ? -36.750 78.357  47.428  1.00 63.75 ? 855  MET A CG  1 
ATOM   6704  S SD  . MET A 1 855  ? -37.962 77.379  48.405  1.00 65.91 ? 855  MET A SD  1 
ATOM   6705  C CE  . MET A 1 855  ? -38.838 76.401  47.033  1.00 66.84 ? 855  MET A CE  1 
ATOM   6706  N N   . ILE A 1 856  ? -34.270 74.916  49.149  1.00 60.40 ? 856  ILE A N   1 
ATOM   6707  C CA  . ILE A 1 856  ? -33.983 73.485  49.208  1.00 61.59 ? 856  ILE A CA  1 
ATOM   6708  C C   . ILE A 1 856  ? -35.323 72.739  49.352  1.00 63.03 ? 856  ILE A C   1 
ATOM   6709  O O   . ILE A 1 856  ? -35.682 72.252  50.447  1.00 63.24 ? 856  ILE A O   1 
ATOM   6710  C CB  . ILE A 1 856  ? -33.047 73.172  50.416  1.00 61.22 ? 856  ILE A CB  1 
ATOM   6711  C CG1 . ILE A 1 856  ? -31.708 73.903  50.225  1.00 60.41 ? 856  ILE A CG1 1 
ATOM   6712  C CG2 . ILE A 1 856  ? -32.820 71.650  50.541  1.00 61.21 ? 856  ILE A CG2 1 
ATOM   6713  C CD1 . ILE A 1 856  ? -30.735 73.730  51.369  1.00 60.49 ? 856  ILE A CD1 1 
ATOM   6714  N N   . GLY A 1 857  ? -36.069 72.674  48.248  1.00 62.68 ? 857  GLY A N   1 
ATOM   6715  C CA  . GLY A 1 857  ? -37.364 72.011  48.265  1.00 63.06 ? 857  GLY A CA  1 
ATOM   6716  C C   . GLY A 1 857  ? -38.282 72.523  49.375  1.00 62.59 ? 857  GLY A C   1 
ATOM   6717  O O   . GLY A 1 857  ? -38.423 71.862  50.418  1.00 63.57 ? 857  GLY A O   1 
ATOM   6718  N N   . GLU A 1 858  ? -38.897 73.691  49.162  1.00 62.16 ? 858  GLU A N   1 
ATOM   6719  C CA  . GLU A 1 858  ? -39.818 74.305  50.133  1.00 61.24 ? 858  GLU A CA  1 
ATOM   6720  C C   . GLU A 1 858  ? -39.148 74.922  51.363  1.00 60.21 ? 858  GLU A C   1 
ATOM   6721  O O   . GLU A 1 858  ? -39.732 75.789  52.022  1.00 58.80 ? 858  GLU A O   1 
ATOM   6722  C CB  . GLU A 1 858  ? -40.878 73.289  50.590  1.00 62.75 ? 858  GLU A CB  1 
ATOM   6723  C CG  . GLU A 1 858  ? -41.644 73.700  51.852  1.00 64.26 ? 858  GLU A CG  1 
ATOM   6724  C CD  . GLU A 1 858  ? -43.003 73.013  51.996  1.00 65.70 ? 858  GLU A CD  1 
ATOM   6725  O OE1 . GLU A 1 858  ? -43.646 73.187  53.060  1.00 65.39 ? 858  GLU A OE1 1 
ATOM   6726  O OE2 . GLU A 1 858  ? -43.430 72.313  51.047  1.00 65.38 ? 858  GLU A OE2 1 
ATOM   6727  N N   . SER A 1 859  ? -37.930 74.476  51.669  1.00 58.86 ? 859  SER A N   1 
ATOM   6728  C CA  . SER A 1 859  ? -37.185 74.993  52.820  1.00 57.09 ? 859  SER A CA  1 
ATOM   6729  C C   . SER A 1 859  ? -36.370 76.235  52.412  1.00 54.88 ? 859  SER A C   1 
ATOM   6730  O O   . SER A 1 859  ? -35.464 76.158  51.571  1.00 55.09 ? 859  SER A O   1 
ATOM   6731  C CB  . SER A 1 859  ? -36.263 73.897  53.368  1.00 57.35 ? 859  SER A CB  1 
ATOM   6732  O OG  . SER A 1 859  ? -35.823 74.199  54.680  1.00 58.29 ? 859  SER A OG  1 
ATOM   6733  N N   . VAL A 1 860  ? -36.706 77.379  53.004  1.00 52.01 ? 860  VAL A N   1 
ATOM   6734  C CA  . VAL A 1 860  ? -36.028 78.636  52.693  1.00 48.96 ? 860  VAL A CA  1 
ATOM   6735  C C   . VAL A 1 860  ? -34.810 78.922  53.583  1.00 46.84 ? 860  VAL A C   1 
ATOM   6736  O O   . VAL A 1 860  ? -34.905 78.918  54.811  1.00 47.25 ? 860  VAL A O   1 
ATOM   6737  C CB  . VAL A 1 860  ? -37.017 79.829  52.799  1.00 48.72 ? 860  VAL A CB  1 
ATOM   6738  C CG1 . VAL A 1 860  ? -36.316 81.124  52.439  1.00 48.01 ? 860  VAL A CG1 1 
ATOM   6739  C CG2 . VAL A 1 860  ? -38.206 79.605  51.875  1.00 48.38 ? 860  VAL A CG2 1 
ATOM   6740  N N   . GLY A 1 861  ? -33.670 79.169  52.946  1.00 44.84 ? 861  GLY A N   1 
ATOM   6741  C CA  . GLY A 1 861  ? -32.441 79.470  53.666  1.00 41.63 ? 861  GLY A CA  1 
ATOM   6742  C C   . GLY A 1 861  ? -31.632 80.573  52.985  1.00 39.79 ? 861  GLY A C   1 
ATOM   6743  O O   . GLY A 1 861  ? -32.024 81.099  51.941  1.00 38.33 ? 861  GLY A O   1 
ATOM   6744  N N   . TYR A 1 862  ? -30.493 80.928  53.563  1.00 37.57 ? 862  TYR A N   1 
ATOM   6745  C CA  . TYR A 1 862  ? -29.677 81.981  52.985  1.00 36.65 ? 862  TYR A CA  1 
ATOM   6746  C C   . TYR A 1 862  ? -28.171 81.770  53.131  1.00 34.27 ? 862  TYR A C   1 
ATOM   6747  O O   . TYR A 1 862  ? -27.682 81.420  54.206  1.00 34.58 ? 862  TYR A O   1 
ATOM   6748  C CB  . TYR A 1 862  ? -30.072 83.327  53.611  1.00 40.57 ? 862  TYR A CB  1 
ATOM   6749  C CG  . TYR A 1 862  ? -31.471 83.790  53.242  1.00 44.55 ? 862  TYR A CG  1 
ATOM   6750  C CD1 . TYR A 1 862  ? -31.681 84.655  52.162  1.00 46.61 ? 862  TYR A CD1 1 
ATOM   6751  C CD2 . TYR A 1 862  ? -32.591 83.336  53.951  1.00 45.33 ? 862  TYR A CD2 1 
ATOM   6752  C CE1 . TYR A 1 862  ? -32.973 85.057  51.797  1.00 48.12 ? 862  TYR A CE1 1 
ATOM   6753  C CE2 . TYR A 1 862  ? -33.880 83.726  53.594  1.00 46.58 ? 862  TYR A CE2 1 
ATOM   6754  C CZ  . TYR A 1 862  ? -34.066 84.586  52.517  1.00 48.31 ? 862  TYR A CZ  1 
ATOM   6755  O OH  . TYR A 1 862  ? -35.343 84.972  52.156  1.00 52.19 ? 862  TYR A OH  1 
ATOM   6756  N N   . LEU A 1 863  ? -27.449 81.977  52.030  1.00 30.77 ? 863  LEU A N   1 
ATOM   6757  C CA  . LEU A 1 863  ? -25.993 81.872  52.005  1.00 26.69 ? 863  LEU A CA  1 
ATOM   6758  C C   . LEU A 1 863  ? -25.526 83.301  52.279  1.00 25.27 ? 863  LEU A C   1 
ATOM   6759  O O   . LEU A 1 863  ? -26.047 84.256  51.699  1.00 28.03 ? 863  LEU A O   1 
ATOM   6760  C CB  . LEU A 1 863  ? -25.518 81.420  50.627  1.00 27.48 ? 863  LEU A CB  1 
ATOM   6761  C CG  . LEU A 1 863  ? -26.175 80.137  50.105  1.00 30.22 ? 863  LEU A CG  1 
ATOM   6762  C CD1 . LEU A 1 863  ? -25.818 79.936  48.641  1.00 27.17 ? 863  LEU A CD1 1 
ATOM   6763  C CD2 . LEU A 1 863  ? -25.745 78.948  50.952  1.00 27.14 ? 863  LEU A CD2 1 
ATOM   6764  N N   . GLN A 1 864  ? -24.554 83.460  53.162  1.00 21.73 ? 864  GLN A N   1 
ATOM   6765  C CA  . GLN A 1 864  ? -24.090 84.795  53.517  1.00 16.88 ? 864  GLN A CA  1 
ATOM   6766  C C   . GLN A 1 864  ? -22.594 84.804  53.776  1.00 16.02 ? 864  GLN A C   1 
ATOM   6767  O O   . GLN A 1 864  ? -22.121 84.126  54.700  1.00 15.38 ? 864  GLN A O   1 
ATOM   6768  C CB  . GLN A 1 864  ? -24.831 85.260  54.779  1.00 14.54 ? 864  GLN A CB  1 
ATOM   6769  C CG  . GLN A 1 864  ? -24.317 86.532  55.395  1.00 10.19 ? 864  GLN A CG  1 
ATOM   6770  C CD  . GLN A 1 864  ? -24.561 87.726  54.508  1.00 12.79 ? 864  GLN A CD  1 
ATOM   6771  O OE1 . GLN A 1 864  ? -25.715 88.093  54.244  1.00 12.56 ? 864  GLN A OE1 1 
ATOM   6772  N NE2 . GLN A 1 864  ? -23.477 88.341  54.027  1.00 10.28 ? 864  GLN A NE2 1 
ATOM   6773  N N   . TYR A 1 865  ? -21.855 85.553  52.955  1.00 13.33 ? 865  TYR A N   1 
ATOM   6774  C CA  . TYR A 1 865  ? -20.407 85.669  53.114  1.00 12.08 ? 865  TYR A CA  1 
ATOM   6775  C C   . TYR A 1 865  ? -20.143 86.774  54.140  1.00 12.19 ? 865  TYR A C   1 
ATOM   6776  O O   . TYR A 1 865  ? -20.643 87.897  53.995  1.00 13.15 ? 865  TYR A O   1 
ATOM   6777  C CB  . TYR A 1 865  ? -19.751 86.045  51.783  1.00 11.76 ? 865  TYR A CB  1 
ATOM   6778  C CG  . TYR A 1 865  ? -19.480 84.890  50.841  1.00 11.07 ? 865  TYR A CG  1 
ATOM   6779  C CD1 . TYR A 1 865  ? -18.252 84.232  50.859  1.00 11.99 ? 865  TYR A CD1 1 
ATOM   6780  C CD2 . TYR A 1 865  ? -20.430 84.484  49.900  1.00 11.48 ? 865  TYR A CD2 1 
ATOM   6781  C CE1 . TYR A 1 865  ? -17.959 83.202  49.953  1.00 11.20 ? 865  TYR A CE1 1 
ATOM   6782  C CE2 . TYR A 1 865  ? -20.151 83.451  48.988  1.00 12.87 ? 865  TYR A CE2 1 
ATOM   6783  C CZ  . TYR A 1 865  ? -18.907 82.822  49.017  1.00 13.15 ? 865  TYR A CZ  1 
ATOM   6784  O OH  . TYR A 1 865  ? -18.581 81.862  48.074  1.00 13.90 ? 865  TYR A OH  1 
ATOM   6785  N N   . PRO A 1 866  ? -19.380 86.466  55.206  1.00 10.62 ? 866  PRO A N   1 
ATOM   6786  C CA  . PRO A 1 866  ? -19.084 87.482  56.228  1.00 9.48  ? 866  PRO A CA  1 
ATOM   6787  C C   . PRO A 1 866  ? -18.202 88.564  55.616  1.00 9.76  ? 866  PRO A C   1 
ATOM   6788  O O   . PRO A 1 866  ? -17.481 88.305  54.653  1.00 11.04 ? 866  PRO A O   1 
ATOM   6789  C CB  . PRO A 1 866  ? -18.321 86.699  57.303  1.00 10.14 ? 866  PRO A CB  1 
ATOM   6790  C CG  . PRO A 1 866  ? -18.711 85.251  57.061  1.00 9.81  ? 866  PRO A CG  1 
ATOM   6791  C CD  . PRO A 1 866  ? -18.791 85.160  55.559  1.00 8.15  ? 866  PRO A CD  1 
ATOM   6792  N N   . MET A 1 867  ? -18.241 89.764  56.176  1.00 9.72  ? 867  MET A N   1 
ATOM   6793  C CA  . MET A 1 867  ? -17.418 90.865  55.673  1.00 11.32 ? 867  MET A CA  1 
ATOM   6794  C C   . MET A 1 867  ? -15.944 90.453  55.576  1.00 11.48 ? 867  MET A C   1 
ATOM   6795  O O   . MET A 1 867  ? -15.212 90.913  54.699  1.00 9.74  ? 867  MET A O   1 
ATOM   6796  C CB  . MET A 1 867  ? -17.504 92.062  56.614  1.00 13.43 ? 867  MET A CB  1 
ATOM   6797  C CG  . MET A 1 867  ? -16.843 91.788  57.964  1.00 16.55 ? 867  MET A CG  1 
ATOM   6798  S SD  . MET A 1 867  ? -16.841 93.195  59.068  1.00 20.70 ? 867  MET A SD  1 
ATOM   6799  C CE  . MET A 1 867  ? -15.237 93.866  58.705  1.00 21.80 ? 867  MET A CE  1 
ATOM   6800  N N   . TRP A 1 868  ? -15.513 89.597  56.496  1.00 10.26 ? 868  TRP A N   1 
ATOM   6801  C CA  . TRP A 1 868  ? -14.136 89.154  56.513  1.00 12.13 ? 868  TRP A CA  1 
ATOM   6802  C C   . TRP A 1 868  ? -13.696 88.392  55.259  1.00 14.12 ? 868  TRP A C   1 
ATOM   6803  O O   . TRP A 1 868  ? -12.505 88.319  54.972  1.00 16.04 ? 868  TRP A O   1 
ATOM   6804  C CB  . TRP A 1 868  ? -13.878 88.314  57.761  1.00 12.25 ? 868  TRP A CB  1 
ATOM   6805  C CG  . TRP A 1 868  ? -14.233 89.042  59.026  1.00 13.73 ? 868  TRP A CG  1 
ATOM   6806  C CD1 . TRP A 1 868  ? -15.303 88.799  59.845  1.00 11.68 ? 868  TRP A CD1 1 
ATOM   6807  C CD2 . TRP A 1 868  ? -13.525 90.145  59.607  1.00 13.08 ? 868  TRP A CD2 1 
ATOM   6808  N NE1 . TRP A 1 868  ? -15.299 89.678  60.897  1.00 12.03 ? 868  TRP A NE1 1 
ATOM   6809  C CE2 . TRP A 1 868  ? -14.216 90.515  60.777  1.00 12.90 ? 868  TRP A CE2 1 
ATOM   6810  C CE3 . TRP A 1 868  ? -12.370 90.855  59.253  1.00 12.32 ? 868  TRP A CE3 1 
ATOM   6811  C CZ2 . TRP A 1 868  ? -13.789 91.563  61.600  1.00 13.38 ? 868  TRP A CZ2 1 
ATOM   6812  C CZ3 . TRP A 1 868  ? -11.945 91.896  60.073  1.00 11.65 ? 868  TRP A CZ3 1 
ATOM   6813  C CH2 . TRP A 1 868  ? -12.651 92.237  61.230  1.00 10.32 ? 868  TRP A CH2 1 
ATOM   6814  N N   . SER A 1 869  ? -14.628 87.831  54.500  1.00 13.94 ? 869  SER A N   1 
ATOM   6815  C CA  . SER A 1 869  ? -14.226 87.116  53.295  1.00 15.57 ? 869  SER A CA  1 
ATOM   6816  C C   . SER A 1 869  ? -13.713 88.111  52.264  1.00 15.08 ? 869  SER A C   1 
ATOM   6817  O O   . SER A 1 869  ? -12.795 87.824  51.500  1.00 15.76 ? 869  SER A O   1 
ATOM   6818  C CB  . SER A 1 869  ? -15.397 86.332  52.706  1.00 17.00 ? 869  SER A CB  1 
ATOM   6819  O OG  . SER A 1 869  ? -15.742 85.240  53.537  1.00 19.39 ? 869  SER A OG  1 
ATOM   6820  N N   . PHE A 1 870  ? -14.319 89.287  52.240  1.00 14.66 ? 870  PHE A N   1 
ATOM   6821  C CA  . PHE A 1 870  ? -13.904 90.307  51.295  1.00 13.84 ? 870  PHE A CA  1 
ATOM   6822  C C   . PHE A 1 870  ? -12.528 90.842  51.655  1.00 12.57 ? 870  PHE A C   1 
ATOM   6823  O O   . PHE A 1 870  ? -11.761 91.252  50.778  1.00 11.20 ? 870  PHE A O   1 
ATOM   6824  C CB  . PHE A 1 870  ? -14.939 91.426  51.267  1.00 12.72 ? 870  PHE A CB  1 
ATOM   6825  C CG  . PHE A 1 870  ? -16.244 90.994  50.692  1.00 16.27 ? 870  PHE A CG  1 
ATOM   6826  C CD1 . PHE A 1 870  ? -16.397 90.867  49.314  1.00 13.90 ? 870  PHE A CD1 1 
ATOM   6827  C CD2 . PHE A 1 870  ? -17.295 90.626  51.523  1.00 16.26 ? 870  PHE A CD2 1 
ATOM   6828  C CE1 . PHE A 1 870  ? -17.567 90.372  48.765  1.00 15.86 ? 870  PHE A CE1 1 
ATOM   6829  C CE2 . PHE A 1 870  ? -18.476 90.127  50.978  1.00 19.57 ? 870  PHE A CE2 1 
ATOM   6830  C CZ  . PHE A 1 870  ? -18.607 90.001  49.593  1.00 18.33 ? 870  PHE A CZ  1 
ATOM   6831  N N   . VAL A 1 871  ? -12.208 90.828  52.945  1.00 9.96  ? 871  VAL A N   1 
ATOM   6832  C CA  . VAL A 1 871  ? -10.914 91.312  53.370  1.00 9.64  ? 871  VAL A CA  1 
ATOM   6833  C C   . VAL A 1 871  ? -9.889  90.358  52.802  1.00 10.48 ? 871  VAL A C   1 
ATOM   6834  O O   . VAL A 1 871  ? -8.938  90.773  52.137  1.00 9.22  ? 871  VAL A O   1 
ATOM   6835  C CB  . VAL A 1 871  ? -10.810 91.362  54.898  1.00 11.07 ? 871  VAL A CB  1 
ATOM   6836  C CG1 . VAL A 1 871  ? -9.385  91.781  55.319  1.00 9.86  ? 871  VAL A CG1 1 
ATOM   6837  C CG2 . VAL A 1 871  ? -11.869 92.354  55.449  1.00 9.01  ? 871  VAL A CG2 1 
ATOM   6838  N N   . TYR A 1 872  ? -10.111 89.069  53.044  1.00 11.01 ? 872  TYR A N   1 
ATOM   6839  C CA  . TYR A 1 872  ? -9.219  88.034  52.541  1.00 9.99  ? 872  TYR A CA  1 
ATOM   6840  C C   . TYR A 1 872  ? -9.009  88.181  51.042  1.00 10.02 ? 872  TYR A C   1 
ATOM   6841  O O   . TYR A 1 872  ? -7.909  87.933  50.550  1.00 12.18 ? 872  TYR A O   1 
ATOM   6842  C CB  . TYR A 1 872  ? -9.798  86.656  52.829  1.00 8.42  ? 872  TYR A CB  1 
ATOM   6843  C CG  . TYR A 1 872  ? -8.892  85.506  52.441  1.00 8.20  ? 872  TYR A CG  1 
ATOM   6844  C CD1 . TYR A 1 872  ? -7.939  85.019  53.328  1.00 7.61  ? 872  TYR A CD1 1 
ATOM   6845  C CD2 . TYR A 1 872  ? -9.015  84.882  51.194  1.00 9.81  ? 872  TYR A CD2 1 
ATOM   6846  C CE1 . TYR A 1 872  ? -7.129  83.937  52.992  1.00 9.30  ? 872  TYR A CE1 1 
ATOM   6847  C CE2 . TYR A 1 872  ? -8.218  83.795  50.845  1.00 9.97  ? 872  TYR A CE2 1 
ATOM   6848  C CZ  . TYR A 1 872  ? -7.277  83.327  51.750  1.00 10.06 ? 872  TYR A CZ  1 
ATOM   6849  O OH  . TYR A 1 872  ? -6.505  82.240  51.428  1.00 10.01 ? 872  TYR A OH  1 
ATOM   6850  N N   . TRP A 1 873  ? -10.062 88.572  50.325  1.00 8.95  ? 873  TRP A N   1 
ATOM   6851  C CA  . TRP A 1 873  ? -9.995  88.744  48.878  1.00 10.45 ? 873  TRP A CA  1 
ATOM   6852  C C   . TRP A 1 873  ? -9.235  89.993  48.443  1.00 11.77 ? 873  TRP A C   1 
ATOM   6853  O O   . TRP A 1 873  ? -8.935  90.165  47.263  1.00 12.84 ? 873  TRP A O   1 
ATOM   6854  C CB  . TRP A 1 873  ? -11.402 88.743  48.260  1.00 9.51  ? 873  TRP A CB  1 
ATOM   6855  C CG  . TRP A 1 873  ? -12.058 87.369  48.287  1.00 11.41 ? 873  TRP A CG  1 
ATOM   6856  C CD1 . TRP A 1 873  ? -11.423 86.166  48.173  1.00 8.80  ? 873  TRP A CD1 1 
ATOM   6857  C CD2 . TRP A 1 873  ? -13.466 87.069  48.350  1.00 9.84  ? 873  TRP A CD2 1 
ATOM   6858  N NE1 . TRP A 1 873  ? -12.331 85.147  48.155  1.00 8.96  ? 873  TRP A NE1 1 
ATOM   6859  C CE2 . TRP A 1 873  ? -13.595 85.660  48.260  1.00 9.34  ? 873  TRP A CE2 1 
ATOM   6860  C CE3 . TRP A 1 873  ? -14.628 87.849  48.470  1.00 8.55  ? 873  TRP A CE3 1 
ATOM   6861  C CZ2 . TRP A 1 873  ? -14.846 85.000  48.285  1.00 9.21  ? 873  TRP A CZ2 1 
ATOM   6862  C CZ3 . TRP A 1 873  ? -15.888 87.193  48.499  1.00 9.59  ? 873  TRP A CZ3 1 
ATOM   6863  C CH2 . TRP A 1 873  ? -15.979 85.780  48.408  1.00 8.36  ? 873  TRP A CH2 1 
ATOM   6864  N N   . GLY A 1 874  ? -8.922  90.861  49.398  1.00 13.55 ? 874  GLY A N   1 
ATOM   6865  C CA  . GLY A 1 874  ? -8.163  92.062  49.090  1.00 12.56 ? 874  GLY A CA  1 
ATOM   6866  C C   . GLY A 1 874  ? -8.793  93.391  49.452  1.00 11.81 ? 874  GLY A C   1 
ATOM   6867  O O   . GLY A 1 874  ? -8.172  94.432  49.268  1.00 12.70 ? 874  GLY A O   1 
ATOM   6868  N N   . LEU A 1 875  ? -10.019 93.372  49.957  1.00 12.14 ? 875  LEU A N   1 
ATOM   6869  C CA  . LEU A 1 875  ? -10.704 94.618  50.304  1.00 12.31 ? 875  LEU A CA  1 
ATOM   6870  C C   . LEU A 1 875  ? -10.270 95.101  51.694  1.00 11.60 ? 875  LEU A C   1 
ATOM   6871  O O   . LEU A 1 875  ? -10.574 94.470  52.707  1.00 13.29 ? 875  LEU A O   1 
ATOM   6872  C CB  . LEU A 1 875  ? -12.224 94.406  50.244  1.00 10.28 ? 875  LEU A CB  1 
ATOM   6873  C CG  . LEU A 1 875  ? -13.106 95.655  50.357  1.00 12.34 ? 875  LEU A CG  1 
ATOM   6874  C CD1 . LEU A 1 875  ? -12.769 96.647  49.221  1.00 9.82  ? 875  LEU A CD1 1 
ATOM   6875  C CD2 . LEU A 1 875  ? -14.558 95.250  50.303  1.00 7.80  ? 875  LEU A CD2 1 
ATOM   6876  N N   . PRO A 1 876  ? -9.548  96.228  51.761  1.00 10.06 ? 876  PRO A N   1 
ATOM   6877  C CA  . PRO A 1 876  ? -9.085  96.759  53.050  1.00 9.40  ? 876  PRO A CA  1 
ATOM   6878  C C   . PRO A 1 876  ? -10.190 97.253  53.973  1.00 10.68 ? 876  PRO A C   1 
ATOM   6879  O O   . PRO A 1 876  ? -11.201 97.788  53.525  1.00 11.86 ? 876  PRO A O   1 
ATOM   6880  C CB  . PRO A 1 876  ? -8.137  97.881  52.639  1.00 8.41  ? 876  PRO A CB  1 
ATOM   6881  C CG  . PRO A 1 876  ? -8.795  98.411  51.398  1.00 9.79  ? 876  PRO A CG  1 
ATOM   6882  C CD  . PRO A 1 876  ? -9.184  97.133  50.659  1.00 10.34 ? 876  PRO A CD  1 
ATOM   6883  N N   . LEU A 1 877  ? -9.977  97.069  55.271  1.00 13.49 ? 877  LEU A N   1 
ATOM   6884  C CA  . LEU A 1 877  ? -10.919 97.493  56.293  1.00 13.35 ? 877  LEU A CA  1 
ATOM   6885  C C   . LEU A 1 877  ? -10.880 99.003  56.403  1.00 14.20 ? 877  LEU A C   1 
ATOM   6886  O O   . LEU A 1 877  ? -9.857  99.615  56.120  1.00 14.53 ? 877  LEU A O   1 
ATOM   6887  C CB  . LEU A 1 877  ? -10.542 96.890  57.650  1.00 12.47 ? 877  LEU A CB  1 
ATOM   6888  C CG  . LEU A 1 877  ? -10.691 95.372  57.838  1.00 11.67 ? 877  LEU A CG  1 
ATOM   6889  C CD1 . LEU A 1 877  ? -9.885  94.930  59.070  1.00 9.70  ? 877  LEU A CD1 1 
ATOM   6890  C CD2 . LEU A 1 877  ? -12.163 94.994  57.968  1.00 8.76  ? 877  LEU A CD2 1 
ATOM   6891  N N   . VAL A 1 878  ? -12.001 99.588  56.817  1.00 14.18 ? 878  VAL A N   1 
ATOM   6892  C CA  . VAL A 1 878  ? -12.120 101.026 57.005  1.00 13.98 ? 878  VAL A CA  1 
ATOM   6893  C C   . VAL A 1 878  ? -11.744 101.364 58.451  1.00 15.37 ? 878  VAL A C   1 
ATOM   6894  O O   . VAL A 1 878  ? -10.973 102.295 58.707  1.00 15.13 ? 878  VAL A O   1 
ATOM   6895  C CB  . VAL A 1 878  ? -13.573 101.509 56.750  1.00 15.43 ? 878  VAL A CB  1 
ATOM   6896  C CG1 . VAL A 1 878  ? -13.687 103.009 57.008  1.00 12.27 ? 878  VAL A CG1 1 
ATOM   6897  C CG2 . VAL A 1 878  ? -13.991 101.178 55.313  1.00 15.59 ? 878  VAL A CG2 1 
ATOM   6898  N N   . LYS A 1 879  ? -12.289 100.601 59.395  1.00 14.74 ? 879  LYS A N   1 
ATOM   6899  C CA  . LYS A 1 879  ? -12.017 100.822 60.816  1.00 14.62 ? 879  LYS A CA  1 
ATOM   6900  C C   . LYS A 1 879  ? -12.483 99.587  61.589  1.00 15.73 ? 879  LYS A C   1 
ATOM   6901  O O   . LYS A 1 879  ? -13.591 99.088  61.372  1.00 15.88 ? 879  LYS A O   1 
ATOM   6902  C CB  . LYS A 1 879  ? -12.775 102.062 61.295  1.00 14.22 ? 879  LYS A CB  1 
ATOM   6903  C CG  . LYS A 1 879  ? -12.496 102.524 62.720  1.00 14.48 ? 879  LYS A CG  1 
ATOM   6904  C CD  . LYS A 1 879  ? -13.562 103.558 63.129  1.00 15.67 ? 879  LYS A CD  1 
ATOM   6905  C CE  . LYS A 1 879  ? -13.241 104.306 64.418  1.00 14.32 ? 879  LYS A CE  1 
ATOM   6906  N NZ  . LYS A 1 879  ? -13.012 103.433 65.609  1.00 14.21 ? 879  LYS A NZ  1 
ATOM   6907  N N   . ALA A 1 880  ? -11.630 99.089  62.481  1.00 16.26 ? 880  ALA A N   1 
ATOM   6908  C CA  . ALA A 1 880  ? -11.955 97.902  63.267  1.00 15.27 ? 880  ALA A CA  1 
ATOM   6909  C C   . ALA A 1 880  ? -11.211 97.853  64.588  1.00 14.64 ? 880  ALA A C   1 
ATOM   6910  O O   . ALA A 1 880  ? -10.165 98.482  64.745  1.00 14.05 ? 880  ALA A O   1 
ATOM   6911  C CB  . ALA A 1 880  ? -11.649 96.633  62.453  1.00 15.45 ? 880  ALA A CB  1 
ATOM   6912  N N   . PHE A 1 881  ? -11.776 97.102  65.533  1.00 16.61 ? 881  PHE A N   1 
ATOM   6913  C CA  . PHE A 1 881  ? -11.207 96.907  66.873  1.00 16.56 ? 881  PHE A CA  1 
ATOM   6914  C C   . PHE A 1 881  ? -10.788 98.197  67.578  1.00 17.88 ? 881  PHE A C   1 
ATOM   6915  O O   . PHE A 1 881  ? -9.757  98.233  68.241  1.00 20.61 ? 881  PHE A O   1 
ATOM   6916  C CB  . PHE A 1 881  ? -10.012 95.946  66.783  1.00 15.48 ? 881  PHE A CB  1 
ATOM   6917  C CG  . PHE A 1 881  ? -10.372 94.585  66.250  1.00 13.22 ? 881  PHE A CG  1 
ATOM   6918  C CD1 . PHE A 1 881  ? -11.139 93.705  67.017  1.00 10.07 ? 881  PHE A CD1 1 
ATOM   6919  C CD2 . PHE A 1 881  ? -10.016 94.213  64.953  1.00 12.24 ? 881  PHE A CD2 1 
ATOM   6920  C CE1 . PHE A 1 881  ? -11.565 92.475  66.498  1.00 10.46 ? 881  PHE A CE1 1 
ATOM   6921  C CE2 . PHE A 1 881  ? -10.436 92.981  64.419  1.00 11.55 ? 881  PHE A CE2 1 
ATOM   6922  C CZ  . PHE A 1 881  ? -11.212 92.111  65.195  1.00 10.61 ? 881  PHE A CZ  1 
ATOM   6923  N N   . GLY A 1 882  ? -11.588 99.252  67.426  1.00 18.63 ? 882  GLY A N   1 
ATOM   6924  C CA  . GLY A 1 882  ? -11.288 100.525 68.056  1.00 17.07 ? 882  GLY A CA  1 
ATOM   6925  C C   . GLY A 1 882  ? -10.133 101.313 67.448  1.00 17.88 ? 882  GLY A C   1 
ATOM   6926  O O   . GLY A 1 882  ? -9.571  102.189 68.110  1.00 20.56 ? 882  GLY A O   1 
ATOM   6927  N N   . SER A 1 883  ? -9.778  101.042 66.195  1.00 15.10 ? 883  SER A N   1 
ATOM   6928  C CA  . SER A 1 883  ? -8.654  101.742 65.556  1.00 12.99 ? 883  SER A CA  1 
ATOM   6929  C C   . SER A 1 883  ? -9.020  103.096 64.957  1.00 11.73 ? 883  SER A C   1 
ATOM   6930  O O   . SER A 1 883  ? -10.189 103.481 64.904  1.00 10.41 ? 883  SER A O   1 
ATOM   6931  C CB  . SER A 1 883  ? -8.076  100.892 64.422  1.00 12.13 ? 883  SER A CB  1 
ATOM   6932  O OG  . SER A 1 883  ? -8.920  100.983 63.284  1.00 11.81 ? 883  SER A OG  1 
ATOM   6933  N N   . ASP A 1 884  ? -8.004  103.813 64.492  1.00 11.05 ? 884  ASP A N   1 
ATOM   6934  C CA  . ASP A 1 884  ? -8.260  105.081 63.832  1.00 12.06 ? 884  ASP A CA  1 
ATOM   6935  C C   . ASP A 1 884  ? -8.852  104.683 62.481  1.00 12.28 ? 884  ASP A C   1 
ATOM   6936  O O   . ASP A 1 884  ? -8.632  103.564 61.987  1.00 12.19 ? 884  ASP A O   1 
ATOM   6937  C CB  . ASP A 1 884  ? -6.974  105.881 63.570  1.00 14.67 ? 884  ASP A CB  1 
ATOM   6938  C CG  . ASP A 1 884  ? -6.273  106.350 64.845  1.00 17.19 ? 884  ASP A CG  1 
ATOM   6939  O OD1 . ASP A 1 884  ? -6.940  106.522 65.901  1.00 16.50 ? 884  ASP A OD1 1 
ATOM   6940  O OD2 . ASP A 1 884  ? -5.033  106.558 64.764  1.00 20.01 ? 884  ASP A OD2 1 
ATOM   6941  N N   . PRO A 1 885  ? -9.621  105.584 61.863  1.00 12.53 ? 885  PRO A N   1 
ATOM   6942  C CA  . PRO A 1 885  ? -10.217 105.263 60.560  1.00 11.09 ? 885  PRO A CA  1 
ATOM   6943  C C   . PRO A 1 885  ? -9.241  105.448 59.398  1.00 10.16 ? 885  PRO A C   1 
ATOM   6944  O O   . PRO A 1 885  ? -8.320  106.269 59.463  1.00 9.39  ? 885  PRO A O   1 
ATOM   6945  C CB  . PRO A 1 885  ? -11.387 106.233 60.474  1.00 11.45 ? 885  PRO A CB  1 
ATOM   6946  C CG  . PRO A 1 885  ? -10.823 107.462 61.192  1.00 10.54 ? 885  PRO A CG  1 
ATOM   6947  C CD  . PRO A 1 885  ? -10.109 106.877 62.382  1.00 9.16  ? 885  PRO A CD  1 
ATOM   6948  N N   . TRP A 1 886  ? -9.455  104.660 58.349  1.00 10.62 ? 886  TRP A N   1 
ATOM   6949  C CA  . TRP A 1 886  ? -8.670  104.703 57.107  1.00 11.75 ? 886  TRP A CA  1 
ATOM   6950  C C   . TRP A 1 886  ? -7.163  104.502 57.192  1.00 12.91 ? 886  TRP A C   1 
ATOM   6951  O O   . TRP A 1 886  ? -6.399  105.119 56.435  1.00 13.93 ? 886  TRP A O   1 
ATOM   6952  C CB  . TRP A 1 886  ? -8.951  106.008 56.366  1.00 6.38  ? 886  TRP A CB  1 
ATOM   6953  C CG  . TRP A 1 886  ? -10.383 106.248 56.200  1.00 8.03  ? 886  TRP A CG  1 
ATOM   6954  C CD1 . TRP A 1 886  ? -11.146 107.104 56.919  1.00 9.23  ? 886  TRP A CD1 1 
ATOM   6955  C CD2 . TRP A 1 886  ? -11.257 105.620 55.255  1.00 10.04 ? 886  TRP A CD2 1 
ATOM   6956  N NE1 . TRP A 1 886  ? -12.443 107.061 56.487  1.00 10.16 ? 886  TRP A NE1 1 
ATOM   6957  C CE2 . TRP A 1 886  ? -12.544 106.155 55.464  1.00 11.44 ? 886  TRP A CE2 1 
ATOM   6958  C CE3 . TRP A 1 886  ? -11.080 104.652 54.253  1.00 10.39 ? 886  TRP A CE3 1 
ATOM   6959  C CZ2 . TRP A 1 886  ? -13.662 105.763 54.699  1.00 12.32 ? 886  TRP A CZ2 1 
ATOM   6960  C CZ3 . TRP A 1 886  ? -12.185 104.259 53.495  1.00 11.40 ? 886  TRP A CZ3 1 
ATOM   6961  C CH2 . TRP A 1 886  ? -13.462 104.815 53.725  1.00 11.86 ? 886  TRP A CH2 1 
ATOM   6962  N N   . ILE A 1 887  ? -6.730  103.627 58.087  1.00 11.81 ? 887  ILE A N   1 
ATOM   6963  C CA  . ILE A 1 887  ? -5.314  103.387 58.226  1.00 12.66 ? 887  ILE A CA  1 
ATOM   6964  C C   . ILE A 1 887  ? -4.856  102.301 57.287  1.00 13.15 ? 887  ILE A C   1 
ATOM   6965  O O   . ILE A 1 887  ? -3.667  102.034 57.178  1.00 16.88 ? 887  ILE A O   1 
ATOM   6966  C CB  . ILE A 1 887  ? -4.964  103.000 59.668  1.00 12.97 ? 887  ILE A CB  1 
ATOM   6967  C CG1 . ILE A 1 887  ? -5.849  101.836 60.128  1.00 10.36 ? 887  ILE A CG1 1 
ATOM   6968  C CG2 . ILE A 1 887  ? -5.148  104.224 60.584  1.00 9.79  ? 887  ILE A CG2 1 
ATOM   6969  C CD1 . ILE A 1 887  ? -5.483  101.318 61.500  1.00 8.47  ? 887  ILE A CD1 1 
ATOM   6970  N N   . PHE A 1 888  ? -5.794  101.686 56.585  1.00 14.09 ? 888  PHE A N   1 
ATOM   6971  C CA  . PHE A 1 888  ? -5.448  100.607 55.671  1.00 13.42 ? 888  PHE A CA  1 
ATOM   6972  C C   . PHE A 1 888  ? -5.549  101.044 54.223  1.00 13.05 ? 888  PHE A C   1 
ATOM   6973  O O   . PHE A 1 888  ? -6.541  101.651 53.806  1.00 15.18 ? 888  PHE A O   1 
ATOM   6974  C CB  . PHE A 1 888  ? -6.342  99.393  55.930  1.00 14.23 ? 888  PHE A CB  1 
ATOM   6975  C CG  . PHE A 1 888  ? -6.229  98.845  57.329  1.00 17.08 ? 888  PHE A CG  1 
ATOM   6976  C CD1 . PHE A 1 888  ? -5.015  98.379  57.812  1.00 19.60 ? 888  PHE A CD1 1 
ATOM   6977  C CD2 . PHE A 1 888  ? -7.341  98.793  58.163  1.00 21.06 ? 888  PHE A CD2 1 
ATOM   6978  C CE1 . PHE A 1 888  ? -4.906  97.866  59.110  1.00 22.50 ? 888  PHE A CE1 1 
ATOM   6979  C CE2 . PHE A 1 888  ? -7.245  98.282  59.465  1.00 21.97 ? 888  PHE A CE2 1 
ATOM   6980  C CZ  . PHE A 1 888  ? -6.030  97.817  59.939  1.00 22.27 ? 888  PHE A CZ  1 
ATOM   6981  N N   . SER A 1 889  ? -4.503  100.728 53.464  1.00 11.23 ? 889  SER A N   1 
ATOM   6982  C CA  . SER A 1 889  ? -4.396  101.084 52.057  1.00 8.97  ? 889  SER A CA  1 
ATOM   6983  C C   . SER A 1 889  ? -4.932  99.980  51.146  1.00 9.15  ? 889  SER A C   1 
ATOM   6984  O O   . SER A 1 889  ? -4.996  98.820  51.547  1.00 8.57  ? 889  SER A O   1 
ATOM   6985  C CB  . SER A 1 889  ? -2.923  101.379 51.745  1.00 7.96  ? 889  SER A CB  1 
ATOM   6986  O OG  . SER A 1 889  ? -2.641  101.287 50.361  1.00 6.96  ? 889  SER A OG  1 
ATOM   6987  N N   . TRP A 1 890  ? -5.339  100.330 49.927  1.00 9.50  ? 890  TRP A N   1 
ATOM   6988  C CA  . TRP A 1 890  ? -5.822  99.290  49.030  1.00 9.72  ? 890  TRP A CA  1 
ATOM   6989  C C   . TRP A 1 890  ? -4.660  98.440  48.485  1.00 9.70  ? 890  TRP A C   1 
ATOM   6990  O O   . TRP A 1 890  ? -4.872  97.523  47.711  1.00 9.98  ? 890  TRP A O   1 
ATOM   6991  C CB  . TRP A 1 890  ? -6.657  99.871  47.876  1.00 8.39  ? 890  TRP A CB  1 
ATOM   6992  C CG  . TRP A 1 890  ? -5.970  100.894 46.974  1.00 11.15 ? 890  TRP A CG  1 
ATOM   6993  C CD1 . TRP A 1 890  ? -4.616  101.036 46.737  1.00 10.64 ? 890  TRP A CD1 1 
ATOM   6994  C CD2 . TRP A 1 890  ? -6.620  101.868 46.148  1.00 9.48  ? 890  TRP A CD2 1 
ATOM   6995  N NE1 . TRP A 1 890  ? -4.398  102.036 45.812  1.00 8.81  ? 890  TRP A NE1 1 
ATOM   6996  C CE2 . TRP A 1 890  ? -5.604  102.563 45.434  1.00 10.41 ? 890  TRP A CE2 1 
ATOM   6997  C CE3 . TRP A 1 890  ? -7.962  102.223 45.940  1.00 9.48  ? 890  TRP A CE3 1 
ATOM   6998  C CZ2 . TRP A 1 890  ? -5.895  103.599 44.523  1.00 10.10 ? 890  TRP A CZ2 1 
ATOM   6999  C CZ3 . TRP A 1 890  ? -8.255  103.260 45.030  1.00 8.25  ? 890  TRP A CZ3 1 
ATOM   7000  C CH2 . TRP A 1 890  ? -7.220  103.932 44.335  1.00 8.88  ? 890  TRP A CH2 1 
ATOM   7001  N N   . TYR A 1 891  ? -3.433  98.757  48.879  1.00 9.80  ? 891  TYR A N   1 
ATOM   7002  C CA  . TYR A 1 891  ? -2.286  97.970  48.442  1.00 10.01 ? 891  TYR A CA  1 
ATOM   7003  C C   . TYR A 1 891  ? -2.075  96.836  49.444  1.00 9.49  ? 891  TYR A C   1 
ATOM   7004  O O   . TYR A 1 891  ? -1.054  96.155  49.432  1.00 7.83  ? 891  TYR A O   1 
ATOM   7005  C CB  . TYR A 1 891  ? -1.021  98.834  48.353  1.00 10.79 ? 891  TYR A CB  1 
ATOM   7006  C CG  . TYR A 1 891  ? -1.075  99.876  47.253  1.00 13.16 ? 891  TYR A CG  1 
ATOM   7007  C CD1 . TYR A 1 891  ? -1.126  99.500  45.907  1.00 12.18 ? 891  TYR A CD1 1 
ATOM   7008  C CD2 . TYR A 1 891  ? -1.103  101.237 47.558  1.00 11.84 ? 891  TYR A CD2 1 
ATOM   7009  C CE1 . TYR A 1 891  ? -1.204  100.459 44.896  1.00 14.31 ? 891  TYR A CE1 1 
ATOM   7010  C CE2 . TYR A 1 891  ? -1.184  102.198 46.562  1.00 12.92 ? 891  TYR A CE2 1 
ATOM   7011  C CZ  . TYR A 1 891  ? -1.234  101.809 45.236  1.00 14.60 ? 891  TYR A CZ  1 
ATOM   7012  O OH  . TYR A 1 891  ? -1.321  102.770 44.256  1.00 16.20 ? 891  TYR A OH  1 
ATOM   7013  N N   . MET A 1 892  ? -3.031  96.658  50.344  1.00 10.18 ? 892  MET A N   1 
ATOM   7014  C CA  . MET A 1 892  ? -2.930  95.563  51.301  1.00 12.50 ? 892  MET A CA  1 
ATOM   7015  C C   . MET A 1 892  ? -2.951  94.284  50.477  1.00 12.73 ? 892  MET A C   1 
ATOM   7016  O O   . MET A 1 892  ? -3.834  94.105  49.635  1.00 14.13 ? 892  MET A O   1 
ATOM   7017  C CB  . MET A 1 892  ? -4.130  95.533  52.249  1.00 13.12 ? 892  MET A CB  1 
ATOM   7018  C CG  . MET A 1 892  ? -4.237  94.216  53.024  1.00 14.25 ? 892  MET A CG  1 
ATOM   7019  S SD  . MET A 1 892  ? -5.828  93.966  53.823  1.00 12.79 ? 892  MET A SD  1 
ATOM   7020  C CE  . MET A 1 892  ? -6.893  93.785  52.354  1.00 14.69 ? 892  MET A CE  1 
ATOM   7021  N N   . PRO A 1 893  ? -1.992  93.377  50.706  1.00 12.44 ? 893  PRO A N   1 
ATOM   7022  C CA  . PRO A 1 893  ? -1.926  92.112  49.962  1.00 13.31 ? 893  PRO A CA  1 
ATOM   7023  C C   . PRO A 1 893  ? -3.220  91.300  50.057  1.00 13.93 ? 893  PRO A C   1 
ATOM   7024  O O   . PRO A 1 893  ? -4.133  91.617  50.822  1.00 13.25 ? 893  PRO A O   1 
ATOM   7025  C CB  . PRO A 1 893  ? -0.766  91.368  50.627  1.00 12.91 ? 893  PRO A CB  1 
ATOM   7026  C CG  . PRO A 1 893  ? 0.081   92.446  51.153  1.00 15.06 ? 893  PRO A CG  1 
ATOM   7027  C CD  . PRO A 1 893  ? -0.927  93.436  51.715  1.00 13.87 ? 893  PRO A CD  1 
ATOM   7028  N N   . THR A 1 894  ? -3.270  90.224  49.291  1.00 15.20 ? 894  THR A N   1 
ATOM   7029  C CA  . THR A 1 894  ? -4.426  89.341  49.277  1.00 13.88 ? 894  THR A CA  1 
ATOM   7030  C C   . THR A 1 894  ? -4.144  88.110  50.153  1.00 13.14 ? 894  THR A C   1 
ATOM   7031  O O   . THR A 1 894  ? -3.013  87.900  50.617  1.00 13.07 ? 894  THR A O   1 
ATOM   7032  C CB  . THR A 1 894  ? -4.725  88.941  47.808  1.00 14.40 ? 894  THR A CB  1 
ATOM   7033  O OG1 . THR A 1 894  ? -6.137  88.955  47.591  1.00 17.47 ? 894  THR A OG1 1 
ATOM   7034  C CG2 . THR A 1 894  ? -4.143  87.594  47.475  1.00 9.55  ? 894  THR A CG2 1 
ATOM   7035  N N   . GLY A 1 895  ? -5.176  87.319  50.412  1.00 13.07 ? 895  GLY A N   1 
ATOM   7036  C CA  . GLY A 1 895  ? -5.001  86.111  51.210  1.00 13.59 ? 895  GLY A CA  1 
ATOM   7037  C C   . GLY A 1 895  ? -4.210  86.199  52.511  1.00 14.23 ? 895  GLY A C   1 
ATOM   7038  O O   . GLY A 1 895  ? -4.253  87.199  53.228  1.00 16.74 ? 895  GLY A O   1 
ATOM   7039  N N   . ASP A 1 896  ? -3.477  85.144  52.833  1.00 14.08 ? 896  ASP A N   1 
ATOM   7040  C CA  . ASP A 1 896  ? -2.712  85.131  54.069  1.00 12.93 ? 896  ASP A CA  1 
ATOM   7041  C C   . ASP A 1 896  ? -1.764  86.308  54.284  1.00 11.45 ? 896  ASP A C   1 
ATOM   7042  O O   . ASP A 1 896  ? -1.663  86.823  55.403  1.00 8.67  ? 896  ASP A O   1 
ATOM   7043  C CB  . ASP A 1 896  ? -1.946  83.814  54.202  1.00 16.06 ? 896  ASP A CB  1 
ATOM   7044  C CG  . ASP A 1 896  ? -2.844  82.668  54.628  1.00 19.36 ? 896  ASP A CG  1 
ATOM   7045  O OD1 . ASP A 1 896  ? -3.958  82.943  55.124  1.00 18.00 ? 896  ASP A OD1 1 
ATOM   7046  O OD2 . ASP A 1 896  ? -2.433  81.496  54.475  1.00 23.15 ? 896  ASP A OD2 1 
ATOM   7047  N N   . LEU A 1 897  ? -1.079  86.742  53.226  1.00 9.79  ? 897  LEU A N   1 
ATOM   7048  C CA  . LEU A 1 897  ? -0.144  87.849  53.364  1.00 8.68  ? 897  LEU A CA  1 
ATOM   7049  C C   . LEU A 1 897  ? -0.847  89.156  53.761  1.00 9.99  ? 897  LEU A C   1 
ATOM   7050  O O   . LEU A 1 897  ? -0.311  89.952  54.531  1.00 9.50  ? 897  LEU A O   1 
ATOM   7051  C CB  . LEU A 1 897  ? 0.649   88.049  52.074  1.00 8.05  ? 897  LEU A CB  1 
ATOM   7052  C CG  . LEU A 1 897  ? 1.649   89.210  52.168  1.00 8.06  ? 897  LEU A CG  1 
ATOM   7053  C CD1 . LEU A 1 897  ? 2.606   88.964  53.347  1.00 5.99  ? 897  LEU A CD1 1 
ATOM   7054  C CD2 . LEU A 1 897  ? 2.396   89.364  50.849  1.00 2.75  ? 897  LEU A CD2 1 
ATOM   7055  N N   . GLY A 1 898  ? -2.046  89.368  53.238  1.00 8.06  ? 898  GLY A N   1 
ATOM   7056  C CA  . GLY A 1 898  ? -2.776  90.565  53.581  1.00 8.18  ? 898  GLY A CA  1 
ATOM   7057  C C   . GLY A 1 898  ? -3.376  90.449  54.977  1.00 9.59  ? 898  GLY A C   1 
ATOM   7058  O O   . GLY A 1 898  ? -3.410  91.445  55.731  1.00 7.75  ? 898  GLY A O   1 
ATOM   7059  N N   . MET A 1 899  ? -3.840  89.242  55.329  1.00 8.92  ? 899  MET A N   1 
ATOM   7060  C CA  . MET A 1 899  ? -4.435  89.000  56.646  1.00 8.10  ? 899  MET A CA  1 
ATOM   7061  C C   . MET A 1 899  ? -3.364  89.260  57.695  1.00 9.03  ? 899  MET A C   1 
ATOM   7062  O O   . MET A 1 899  ? -3.615  89.881  58.721  1.00 10.41 ? 899  MET A O   1 
ATOM   7063  C CB  . MET A 1 899  ? -4.944  87.560  56.767  1.00 6.96  ? 899  MET A CB  1 
ATOM   7064  C CG  . MET A 1 899  ? -6.201  87.244  55.959  1.00 9.41  ? 899  MET A CG  1 
ATOM   7065  S SD  . MET A 1 899  ? -7.698  88.150  56.515  1.00 12.15 ? 899  MET A SD  1 
ATOM   7066  C CE  . MET A 1 899  ? -8.024  87.270  58.075  1.00 10.91 ? 899  MET A CE  1 
ATOM   7067  N N   . TYR A 1 900  ? -2.158  88.795  57.422  1.00 10.28 ? 900  TYR A N   1 
ATOM   7068  C CA  . TYR A 1 900  ? -1.056  88.995  58.340  1.00 10.36 ? 900  TYR A CA  1 
ATOM   7069  C C   . TYR A 1 900  ? -0.719  90.467  58.458  1.00 11.26 ? 900  TYR A C   1 
ATOM   7070  O O   . TYR A 1 900  ? -0.346  90.944  59.535  1.00 13.59 ? 900  TYR A O   1 
ATOM   7071  C CB  . TYR A 1 900  ? 0.183   88.250  57.851  1.00 11.12 ? 900  TYR A CB  1 
ATOM   7072  C CG  . TYR A 1 900  ? 1.443   88.713  58.531  1.00 11.98 ? 900  TYR A CG  1 
ATOM   7073  C CD1 . TYR A 1 900  ? 1.785   88.255  59.811  1.00 11.93 ? 900  TYR A CD1 1 
ATOM   7074  C CD2 . TYR A 1 900  ? 2.263   89.667  57.923  1.00 11.14 ? 900  TYR A CD2 1 
ATOM   7075  C CE1 . TYR A 1 900  ? 2.919   88.743  60.465  1.00 12.59 ? 900  TYR A CE1 1 
ATOM   7076  C CE2 . TYR A 1 900  ? 3.384   90.164  58.561  1.00 12.06 ? 900  TYR A CE2 1 
ATOM   7077  C CZ  . TYR A 1 900  ? 3.713   89.703  59.832  1.00 13.03 ? 900  TYR A CZ  1 
ATOM   7078  O OH  . TYR A 1 900  ? 4.831   90.207  60.453  1.00 10.01 ? 900  TYR A OH  1 
ATOM   7079  N N   . SER A 1 901  ? -0.826  91.190  57.351  1.00 10.00 ? 901  SER A N   1 
ATOM   7080  C CA  . SER A 1 901  ? -0.494  92.607  57.372  1.00 9.69  ? 901  SER A CA  1 
ATOM   7081  C C   . SER A 1 901  ? -1.444  93.460  58.210  1.00 9.84  ? 901  SER A C   1 
ATOM   7082  O O   . SER A 1 901  ? -1.001  94.168  59.108  1.00 8.56  ? 901  SER A O   1 
ATOM   7083  C CB  . SER A 1 901  ? -0.429  93.162  55.947  1.00 10.95 ? 901  SER A CB  1 
ATOM   7084  O OG  . SER A 1 901  ? 0.716   92.680  55.263  1.00 10.03 ? 901  SER A OG  1 
ATOM   7085  N N   . TRP A 1 902  ? -2.748  93.394  57.951  1.00 9.36  ? 902  TRP A N   1 
ATOM   7086  C CA  . TRP A 1 902  ? -3.642  94.238  58.725  1.00 8.82  ? 902  TRP A CA  1 
ATOM   7087  C C   . TRP A 1 902  ? -3.714  93.814  60.183  1.00 10.79 ? 902  TRP A C   1 
ATOM   7088  O O   . TRP A 1 902  ? -3.916  94.656  61.061  1.00 9.86  ? 902  TRP A O   1 
ATOM   7089  C CB  . TRP A 1 902  ? -5.037  94.320  58.088  1.00 6.82  ? 902  TRP A CB  1 
ATOM   7090  C CG  . TRP A 1 902  ? -5.894  93.101  58.176  1.00 6.90  ? 902  TRP A CG  1 
ATOM   7091  C CD1 . TRP A 1 902  ? -6.107  92.174  57.192  1.00 5.94  ? 902  TRP A CD1 1 
ATOM   7092  C CD2 . TRP A 1 902  ? -6.736  92.722  59.275  1.00 7.44  ? 902  TRP A CD2 1 
ATOM   7093  N NE1 . TRP A 1 902  ? -7.035  91.248  57.607  1.00 8.87  ? 902  TRP A NE1 1 
ATOM   7094  C CE2 . TRP A 1 902  ? -7.438  91.556  58.881  1.00 6.70  ? 902  TRP A CE2 1 
ATOM   7095  C CE3 . TRP A 1 902  ? -6.962  93.250  60.555  1.00 5.87  ? 902  TRP A CE3 1 
ATOM   7096  C CZ2 . TRP A 1 902  ? -8.355  90.912  59.718  1.00 4.89  ? 902  TRP A CZ2 1 
ATOM   7097  C CZ3 . TRP A 1 902  ? -7.872  92.610  61.389  1.00 7.53  ? 902  TRP A CZ3 1 
ATOM   7098  C CH2 . TRP A 1 902  ? -8.557  91.448  60.965  1.00 8.12  ? 902  TRP A CH2 1 
ATOM   7099  N N   . ILE A 1 903  ? -3.522  92.525  60.457  1.00 10.98 ? 903  ILE A N   1 
ATOM   7100  C CA  . ILE A 1 903  ? -3.531  92.065  61.847  1.00 12.13 ? 903  ILE A CA  1 
ATOM   7101  C C   . ILE A 1 903  ? -2.302  92.612  62.599  1.00 13.48 ? 903  ILE A C   1 
ATOM   7102  O O   . ILE A 1 903  ? -2.440  93.225  63.664  1.00 15.99 ? 903  ILE A O   1 
ATOM   7103  C CB  . ILE A 1 903  ? -3.597  90.521  61.929  1.00 10.91 ? 903  ILE A CB  1 
ATOM   7104  C CG1 . ILE A 1 903  ? -5.019  90.060  61.581  1.00 9.33  ? 903  ILE A CG1 1 
ATOM   7105  C CG2 . ILE A 1 903  ? -3.223  90.040  63.316  1.00 8.71  ? 903  ILE A CG2 1 
ATOM   7106  C CD1 . ILE A 1 903  ? -5.129  88.582  61.342  1.00 8.98  ? 903  ILE A CD1 1 
ATOM   7107  N N   . SER A 1 904  ? -1.109  92.430  62.041  1.00 13.64 ? 904  SER A N   1 
ATOM   7108  C CA  . SER A 1 904  ? 0.103   92.947  62.676  1.00 14.61 ? 904  SER A CA  1 
ATOM   7109  C C   . SER A 1 904  ? 0.049   94.454  62.917  1.00 15.33 ? 904  SER A C   1 
ATOM   7110  O O   . SER A 1 904  ? 0.598   94.957  63.900  1.00 15.71 ? 904  SER A O   1 
ATOM   7111  C CB  . SER A 1 904  ? 1.330   92.648  61.817  1.00 14.21 ? 904  SER A CB  1 
ATOM   7112  O OG  . SER A 1 904  ? 1.616   91.268  61.840  1.00 18.16 ? 904  SER A OG  1 
ATOM   7113  N N   . LEU A 1 905  ? -0.592  95.176  62.006  1.00 14.67 ? 905  LEU A N   1 
ATOM   7114  C CA  . LEU A 1 905  ? -0.702  96.618  62.132  1.00 14.43 ? 905  LEU A CA  1 
ATOM   7115  C C   . LEU A 1 905  ? -1.479  97.048  63.374  1.00 16.20 ? 905  LEU A C   1 
ATOM   7116  O O   . LEU A 1 905  ? -1.150  98.059  64.000  1.00 15.19 ? 905  LEU A O   1 
ATOM   7117  C CB  . LEU A 1 905  ? -1.373  97.203  60.893  1.00 14.58 ? 905  LEU A CB  1 
ATOM   7118  C CG  . LEU A 1 905  ? -0.495  97.373  59.665  1.00 14.03 ? 905  LEU A CG  1 
ATOM   7119  C CD1 . LEU A 1 905  ? -1.326  97.797  58.475  1.00 14.38 ? 905  LEU A CD1 1 
ATOM   7120  C CD2 . LEU A 1 905  ? 0.558   98.408  59.984  1.00 15.10 ? 905  LEU A CD2 1 
ATOM   7121  N N   . ILE A 1 906  ? -2.520  96.302  63.734  1.00 15.75 ? 906  ILE A N   1 
ATOM   7122  C CA  . ILE A 1 906  ? -3.290  96.681  64.908  1.00 15.90 ? 906  ILE A CA  1 
ATOM   7123  C C   . ILE A 1 906  ? -3.352  95.582  65.971  1.00 17.53 ? 906  ILE A C   1 
ATOM   7124  O O   . ILE A 1 906  ? -4.256  95.571  66.810  1.00 16.55 ? 906  ILE A O   1 
ATOM   7125  C CB  . ILE A 1 906  ? -4.726  97.112  64.512  1.00 13.66 ? 906  ILE A CB  1 
ATOM   7126  C CG1 . ILE A 1 906  ? -5.429  95.986  63.753  1.00 13.07 ? 906  ILE A CG1 1 
ATOM   7127  C CG2 . ILE A 1 906  ? -4.666  98.379  63.688  1.00 11.92 ? 906  ILE A CG2 1 
ATOM   7128  C CD1 . ILE A 1 906  ? -6.851  96.306  63.360  1.00 12.79 ? 906  ILE A CD1 1 
ATOM   7129  N N   . ARG A 1 907  ? -2.377  94.674  65.944  1.00 18.20 ? 907  ARG A N   1 
ATOM   7130  C CA  . ARG A 1 907  ? -2.333  93.566  66.900  1.00 19.59 ? 907  ARG A CA  1 
ATOM   7131  C C   . ARG A 1 907  ? -2.577  93.998  68.364  1.00 19.57 ? 907  ARG A C   1 
ATOM   7132  O O   . ARG A 1 907  ? -3.476  93.475  69.030  1.00 18.22 ? 907  ARG A O   1 
ATOM   7133  C CB  . ARG A 1 907  ? -0.998  92.832  66.778  1.00 18.86 ? 907  ARG A CB  1 
ATOM   7134  C CG  . ARG A 1 907  ? -0.924  91.562  67.580  1.00 24.23 ? 907  ARG A CG  1 
ATOM   7135  C CD  . ARG A 1 907  ? 0.410   90.859  67.361  1.00 29.73 ? 907  ARG A CD  1 
ATOM   7136  N NE  . ARG A 1 907  ? 1.532   91.657  67.844  1.00 32.49 ? 907  ARG A NE  1 
ATOM   7137  C CZ  . ARG A 1 907  ? 1.719   91.992  69.118  1.00 36.10 ? 907  ARG A CZ  1 
ATOM   7138  N NH1 . ARG A 1 907  ? 0.853   91.594  70.058  1.00 35.90 ? 907  ARG A NH1 1 
ATOM   7139  N NH2 . ARG A 1 907  ? 2.769   92.736  69.449  1.00 34.82 ? 907  ARG A NH2 1 
ATOM   7140  N N   . PRO A 1 908  ? -1.790  94.965  68.875  1.00 18.95 ? 908  PRO A N   1 
ATOM   7141  C CA  . PRO A 1 908  ? -1.987  95.403  70.258  1.00 18.03 ? 908  PRO A CA  1 
ATOM   7142  C C   . PRO A 1 908  ? -3.435  95.823  70.461  1.00 19.41 ? 908  PRO A C   1 
ATOM   7143  O O   . PRO A 1 908  ? -4.051  95.488  71.470  1.00 19.57 ? 908  PRO A O   1 
ATOM   7144  C CB  . PRO A 1 908  ? -1.025  96.583  70.390  1.00 17.50 ? 908  PRO A CB  1 
ATOM   7145  C CG  . PRO A 1 908  ? 0.062   96.254  69.439  1.00 18.66 ? 908  PRO A CG  1 
ATOM   7146  C CD  . PRO A 1 908  ? -0.708  95.737  68.237  1.00 19.49 ? 908  PRO A CD  1 
ATOM   7147  N N   . LEU A 1 909  ? -3.967  96.557  69.484  1.00 19.01 ? 909  LEU A N   1 
ATOM   7148  C CA  . LEU A 1 909  ? -5.339  97.039  69.517  1.00 17.24 ? 909  LEU A CA  1 
ATOM   7149  C C   . LEU A 1 909  ? -6.330  95.897  69.635  1.00 17.42 ? 909  LEU A C   1 
ATOM   7150  O O   . LEU A 1 909  ? -7.250  95.939  70.450  1.00 18.33 ? 909  LEU A O   1 
ATOM   7151  C CB  . LEU A 1 909  ? -5.647  97.821  68.243  1.00 19.70 ? 909  LEU A CB  1 
ATOM   7152  C CG  . LEU A 1 909  ? -5.998  99.303  68.357  1.00 22.30 ? 909  LEU A CG  1 
ATOM   7153  C CD1 . LEU A 1 909  ? -7.174  99.473  69.318  1.00 22.79 ? 909  LEU A CD1 1 
ATOM   7154  C CD2 . LEU A 1 909  ? -4.785  100.073 68.852  1.00 22.57 ? 909  LEU A CD2 1 
ATOM   7155  N N   . MET A 1 910  ? -6.151  94.882  68.801  1.00 17.82 ? 910  MET A N   1 
ATOM   7156  C CA  . MET A 1 910  ? -7.043  93.735  68.798  1.00 18.56 ? 910  MET A CA  1 
ATOM   7157  C C   . MET A 1 910  ? -7.031  93.031  70.152  1.00 19.87 ? 910  MET A C   1 
ATOM   7158  O O   . MET A 1 910  ? -8.081  92.673  70.691  1.00 19.51 ? 910  MET A O   1 
ATOM   7159  C CB  . MET A 1 910  ? -6.632  92.760  67.698  1.00 17.26 ? 910  MET A CB  1 
ATOM   7160  C CG  . MET A 1 910  ? -6.882  93.275  66.301  1.00 17.94 ? 910  MET A CG  1 
ATOM   7161  S SD  . MET A 1 910  ? -6.146  92.226  65.031  1.00 17.65 ? 910  MET A SD  1 
ATOM   7162  C CE  . MET A 1 910  ? -7.450  91.016  64.808  1.00 14.51 ? 910  MET A CE  1 
ATOM   7163  N N   . THR A 1 911  ? -5.835  92.833  70.693  1.00 20.04 ? 911  THR A N   1 
ATOM   7164  C CA  . THR A 1 911  ? -5.691  92.185  71.981  1.00 21.44 ? 911  THR A CA  1 
ATOM   7165  C C   . THR A 1 911  ? -6.475  93.004  73.012  1.00 22.21 ? 911  THR A C   1 
ATOM   7166  O O   . THR A 1 911  ? -7.335  92.486  73.736  1.00 22.93 ? 911  THR A O   1 
ATOM   7167  C CB  . THR A 1 911  ? -4.180  92.098  72.381  1.00 21.93 ? 911  THR A CB  1 
ATOM   7168  O OG1 . THR A 1 911  ? -3.482  91.258  71.444  1.00 20.70 ? 911  THR A OG1 1 
ATOM   7169  C CG2 . THR A 1 911  ? -4.016  91.525  73.793  1.00 18.82 ? 911  THR A CG2 1 
ATOM   7170  N N   . ARG A 1 912  ? -6.193  94.297  73.047  1.00 22.50 ? 912  ARG A N   1 
ATOM   7171  C CA  . ARG A 1 912  ? -6.847  95.184  73.993  1.00 25.59 ? 912  ARG A CA  1 
ATOM   7172  C C   . ARG A 1 912  ? -8.362  95.138  73.848  1.00 24.01 ? 912  ARG A C   1 
ATOM   7173  O O   . ARG A 1 912  ? -9.090  95.075  74.838  1.00 23.48 ? 912  ARG A O   1 
ATOM   7174  C CB  . ARG A 1 912  ? -6.350  96.618  73.788  1.00 30.04 ? 912  ARG A CB  1 
ATOM   7175  C CG  . ARG A 1 912  ? -6.320  97.469  75.054  1.00 37.21 ? 912  ARG A CG  1 
ATOM   7176  C CD  . ARG A 1 912  ? -6.018  98.932  74.716  1.00 42.08 ? 912  ARG A CD  1 
ATOM   7177  N NE  . ARG A 1 912  ? -7.129  99.531  73.972  1.00 45.44 ? 912  ARG A NE  1 
ATOM   7178  C CZ  . ARG A 1 912  ? -7.055  100.660 73.273  1.00 44.92 ? 912  ARG A CZ  1 
ATOM   7179  N NH1 . ARG A 1 912  ? -5.913  101.337 73.208  1.00 43.26 ? 912  ARG A NH1 1 
ATOM   7180  N NH2 . ARG A 1 912  ? -8.128  101.101 72.629  1.00 45.92 ? 912  ARG A NH2 1 
ATOM   7181  N N   . TRP A 1 913  ? -8.835  95.162  72.609  1.00 22.09 ? 913  TRP A N   1 
ATOM   7182  C CA  . TRP A 1 913  ? -10.265 95.149  72.355  1.00 21.14 ? 913  TRP A CA  1 
ATOM   7183  C C   . TRP A 1 913  ? -10.926 93.847  72.778  1.00 21.79 ? 913  TRP A C   1 
ATOM   7184  O O   . TRP A 1 913  ? -12.001 93.855  73.388  1.00 22.93 ? 913  TRP A O   1 
ATOM   7185  C CB  . TRP A 1 913  ? -10.547 95.383  70.871  1.00 18.85 ? 913  TRP A CB  1 
ATOM   7186  C CG  . TRP A 1 913  ? -12.012 95.429  70.568  1.00 16.06 ? 913  TRP A CG  1 
ATOM   7187  C CD1 . TRP A 1 913  ? -12.809 96.538  70.524  1.00 15.22 ? 913  TRP A CD1 1 
ATOM   7188  C CD2 . TRP A 1 913  ? -12.873 94.309  70.325  1.00 12.90 ? 913  TRP A CD2 1 
ATOM   7189  N NE1 . TRP A 1 913  ? -14.112 96.180  70.263  1.00 13.21 ? 913  TRP A NE1 1 
ATOM   7190  C CE2 . TRP A 1 913  ? -14.176 94.817  70.127  1.00 13.99 ? 913  TRP A CE2 1 
ATOM   7191  C CE3 . TRP A 1 913  ? -12.666 92.927  70.238  1.00 11.48 ? 913  TRP A CE3 1 
ATOM   7192  C CZ2 . TRP A 1 913  ? -15.273 93.988  69.867  1.00 13.47 ? 913  TRP A CZ2 1 
ATOM   7193  C CZ3 . TRP A 1 913  ? -13.757 92.101  69.976  1.00 12.55 ? 913  TRP A CZ3 1 
ATOM   7194  C CH2 . TRP A 1 913  ? -15.039 92.636  69.783  1.00 13.44 ? 913  TRP A CH2 1 
ATOM   7195  N N   . MET A 1 914  ? -10.295 92.728  72.446  1.00 21.83 ? 914  MET A N   1 
ATOM   7196  C CA  . MET A 1 914  ? -10.860 91.432  72.786  1.00 23.10 ? 914  MET A CA  1 
ATOM   7197  C C   . MET A 1 914  ? -11.037 91.257  74.287  1.00 24.27 ? 914  MET A C   1 
ATOM   7198  O O   . MET A 1 914  ? -12.085 90.792  74.751  1.00 27.03 ? 914  MET A O   1 
ATOM   7199  C CB  . MET A 1 914  ? -9.997  90.306  72.213  1.00 21.10 ? 914  MET A CB  1 
ATOM   7200  C CG  . MET A 1 914  ? -10.076 90.200  70.697  1.00 19.01 ? 914  MET A CG  1 
ATOM   7201  S SD  . MET A 1 914  ? -9.301  88.714  70.042  1.00 18.36 ? 914  MET A SD  1 
ATOM   7202  C CE  . MET A 1 914  ? -7.618  89.269  69.809  1.00 18.77 ? 914  MET A CE  1 
ATOM   7203  N N   . VAL A 1 915  ? -10.022 91.637  75.048  1.00 24.00 ? 915  VAL A N   1 
ATOM   7204  C CA  . VAL A 1 915  ? -10.103 91.519  76.493  1.00 24.08 ? 915  VAL A CA  1 
ATOM   7205  C C   . VAL A 1 915  ? -11.211 92.435  77.004  1.00 24.78 ? 915  VAL A C   1 
ATOM   7206  O O   . VAL A 1 915  ? -12.122 91.998  77.725  1.00 23.36 ? 915  VAL A O   1 
ATOM   7207  C CB  . VAL A 1 915  ? -8.764  91.901  77.141  1.00 24.71 ? 915  VAL A CB  1 
ATOM   7208  C CG1 . VAL A 1 915  ? -8.915  91.973  78.650  1.00 22.66 ? 915  VAL A CG1 1 
ATOM   7209  C CG2 . VAL A 1 915  ? -7.701  90.878  76.749  1.00 22.99 ? 915  VAL A CG2 1 
ATOM   7210  N N   . ALA A 1 916  ? -11.135 93.704  76.611  1.00 24.85 ? 916  ALA A N   1 
ATOM   7211  C CA  . ALA A 1 916  ? -12.127 94.687  77.013  1.00 25.57 ? 916  ALA A CA  1 
ATOM   7212  C C   . ALA A 1 916  ? -13.533 94.165  76.781  1.00 27.92 ? 916  ALA A C   1 
ATOM   7213  O O   . ALA A 1 916  ? -14.447 94.536  77.505  1.00 29.56 ? 916  ALA A O   1 
ATOM   7214  C CB  . ALA A 1 916  ? -11.932 95.968  76.247  1.00 26.16 ? 916  ALA A CB  1 
ATOM   7215  N N   . ASN A 1 917  ? -13.715 93.305  75.779  1.00 29.24 ? 917  ASN A N   1 
ATOM   7216  C CA  . ASN A 1 917  ? -15.049 92.768  75.494  1.00 29.43 ? 917  ASN A CA  1 
ATOM   7217  C C   . ASN A 1 917  ? -15.319 91.361  76.004  1.00 28.66 ? 917  ASN A C   1 
ATOM   7218  O O   . ASN A 1 917  ? -16.122 90.639  75.420  1.00 27.81 ? 917  ASN A O   1 
ATOM   7219  C CB  . ASN A 1 917  ? -15.347 92.808  73.990  1.00 29.86 ? 917  ASN A CB  1 
ATOM   7220  C CG  . ASN A 1 917  ? -15.756 94.185  73.510  1.00 28.59 ? 917  ASN A CG  1 
ATOM   7221  O OD1 . ASN A 1 917  ? -14.909 95.031  73.228  1.00 29.25 ? 917  ASN A OD1 1 
ATOM   7222  N ND2 . ASN A 1 917  ? -17.064 94.420  73.426  1.00 26.62 ? 917  ASN A ND2 1 
ATOM   7223  N N   . GLY A 1 918  ? -14.650 90.971  77.083  1.00 29.29 ? 918  GLY A N   1 
ATOM   7224  C CA  . GLY A 1 918  ? -14.870 89.645  77.643  1.00 29.94 ? 918  GLY A CA  1 
ATOM   7225  C C   . GLY A 1 918  ? -14.109 88.474  77.031  1.00 30.20 ? 918  GLY A C   1 
ATOM   7226  O O   . GLY A 1 918  ? -14.202 87.347  77.528  1.00 30.07 ? 918  GLY A O   1 
ATOM   7227  N N   . TYR A 1 919  ? -13.361 88.721  75.959  1.00 28.41 ? 919  TYR A N   1 
ATOM   7228  C CA  . TYR A 1 919  ? -12.601 87.663  75.317  1.00 28.38 ? 919  TYR A CA  1 
ATOM   7229  C C   . TYR A 1 919  ? -11.220 87.538  75.951  1.00 30.29 ? 919  TYR A C   1 
ATOM   7230  O O   . TYR A 1 919  ? -10.207 87.921  75.358  1.00 30.17 ? 919  TYR A O   1 
ATOM   7231  C CB  . TYR A 1 919  ? -12.469 87.966  73.838  1.00 28.28 ? 919  TYR A CB  1 
ATOM   7232  C CG  . TYR A 1 919  ? -13.787 87.996  73.111  1.00 26.51 ? 919  TYR A CG  1 
ATOM   7233  C CD1 . TYR A 1 919  ? -14.531 86.830  72.925  1.00 26.08 ? 919  TYR A CD1 1 
ATOM   7234  C CD2 . TYR A 1 919  ? -14.279 89.182  72.580  1.00 25.46 ? 919  TYR A CD2 1 
ATOM   7235  C CE1 . TYR A 1 919  ? -15.731 86.847  72.222  1.00 23.47 ? 919  TYR A CE1 1 
ATOM   7236  C CE2 . TYR A 1 919  ? -15.478 89.209  71.872  1.00 24.69 ? 919  TYR A CE2 1 
ATOM   7237  C CZ  . TYR A 1 919  ? -16.192 88.038  71.694  1.00 23.84 ? 919  TYR A CZ  1 
ATOM   7238  O OH  . TYR A 1 919  ? -17.335 88.057  70.936  1.00 23.39 ? 919  TYR A OH  1 
ATOM   7239  N N   . VAL A 1 920  ? -11.188 86.980  77.157  1.00 31.25 ? 920  VAL A N   1 
ATOM   7240  C CA  . VAL A 1 920  ? -9.946  86.833  77.896  1.00 31.08 ? 920  VAL A CA  1 
ATOM   7241  C C   . VAL A 1 920  ? -9.748  85.395  78.363  1.00 31.73 ? 920  VAL A C   1 
ATOM   7242  O O   . VAL A 1 920  ? -10.713 84.651  78.544  1.00 31.43 ? 920  VAL A O   1 
ATOM   7243  C CB  . VAL A 1 920  ? -9.934  87.810  79.101  1.00 31.18 ? 920  VAL A CB  1 
ATOM   7244  C CG1 . VAL A 1 920  ? -11.085 87.493  80.031  1.00 29.29 ? 920  VAL A CG1 1 
ATOM   7245  C CG2 . VAL A 1 920  ? -8.590  87.748  79.827  1.00 32.01 ? 920  VAL A CG2 1 
ATOM   7246  N N   . THR A 1 921  ? -8.487  85.012  78.542  1.00 31.66 ? 921  THR A N   1 
ATOM   7247  C CA  . THR A 1 921  ? -8.131  83.660  78.962  1.00 32.39 ? 921  THR A CA  1 
ATOM   7248  C C   . THR A 1 921  ? -6.886  83.703  79.839  1.00 34.91 ? 921  THR A C   1 
ATOM   7249  O O   . THR A 1 921  ? -6.252  84.750  79.981  1.00 35.11 ? 921  THR A O   1 
ATOM   7250  C CB  . THR A 1 921  ? -7.807  82.754  77.750  1.00 30.96 ? 921  THR A CB  1 
ATOM   7251  O OG1 . THR A 1 921  ? -7.500  81.434  78.211  1.00 29.95 ? 921  THR A OG1 1 
ATOM   7252  C CG2 . THR A 1 921  ? -6.587  83.284  76.991  1.00 30.72 ? 921  THR A CG2 1 
ATOM   7253  N N   . ASP A 1 922  ? -6.525  82.553  80.397  1.00 36.86 ? 922  ASP A N   1 
ATOM   7254  C CA  . ASP A 1 922  ? -5.359  82.454  81.252  1.00 39.15 ? 922  ASP A CA  1 
ATOM   7255  C C   . ASP A 1 922  ? -4.136  81.969  80.501  1.00 39.52 ? 922  ASP A C   1 
ATOM   7256  O O   . ASP A 1 922  ? -3.002  82.190  80.938  1.00 38.40 ? 922  ASP A O   1 
ATOM   7257  C CB  . ASP A 1 922  ? -5.668  81.546  82.441  1.00 40.63 ? 922  ASP A CB  1 
ATOM   7258  C CG  . ASP A 1 922  ? -6.716  82.144  83.345  1.00 42.99 ? 922  ASP A CG  1 
ATOM   7259  O OD1 . ASP A 1 922  ? -6.448  83.233  83.898  1.00 42.15 ? 922  ASP A OD1 1 
ATOM   7260  O OD2 . ASP A 1 922  ? -7.808  81.542  83.483  1.00 44.53 ? 922  ASP A OD2 1 
ATOM   7261  N N   . ARG A 1 923  ? -4.363  81.304  79.373  1.00 40.97 ? 923  ARG A N   1 
ATOM   7262  C CA  . ARG A 1 923  ? -3.255  80.834  78.555  1.00 42.22 ? 923  ARG A CA  1 
ATOM   7263  C C   . ARG A 1 923  ? -2.732  82.096  77.863  1.00 41.91 ? 923  ARG A C   1 
ATOM   7264  O O   . ARG A 1 923  ? -3.502  82.944  77.467  1.00 40.98 ? 923  ARG A O   1 
ATOM   7265  C CB  . ARG A 1 923  ? -3.736  79.810  77.524  1.00 44.66 ? 923  ARG A CB  1 
ATOM   7266  C CG  . ARG A 1 923  ? -2.612  79.273  76.645  1.00 48.43 ? 923  ARG A CG  1 
ATOM   7267  C CD  . ARG A 1 923  ? -1.422  78.753  77.468  1.00 51.46 ? 923  ARG A CD  1 
ATOM   7268  N NE  . ARG A 1 923  ? -0.499  77.964  76.653  1.00 52.65 ? 923  ARG A NE  1 
ATOM   7269  C CZ  . ARG A 1 923  ? -0.750  76.731  76.213  1.00 54.30 ? 923  ARG A CZ  1 
ATOM   7270  N NH1 . ARG A 1 923  ? -1.897  76.127  76.512  1.00 53.81 ? 923  ARG A NH1 1 
ATOM   7271  N NH2 . ARG A 1 923  ? 0.140   76.108  75.452  1.00 54.32 ? 923  ARG A NH2 1 
ATOM   7272  N N   . CYS A 1 924  ? -1.420  82.215  77.721  1.00 42.72 ? 924  CYS A N   1 
ATOM   7273  C CA  . CYS A 1 924  ? -0.847  83.398  77.112  1.00 43.51 ? 924  CYS A CA  1 
ATOM   7274  C C   . CYS A 1 924  ? -0.559  83.178  75.653  1.00 42.99 ? 924  CYS A C   1 
ATOM   7275  O O   . CYS A 1 924  ? 0.327   82.398  75.290  1.00 43.06 ? 924  CYS A O   1 
ATOM   7276  C CB  . CYS A 1 924  ? 0.430   83.858  77.828  1.00 43.88 ? 924  CYS A CB  1 
ATOM   7277  S SG  . CYS A 1 924  ? 0.976   85.498  77.259  1.00 47.95 ? 924  CYS A SG  1 
ATOM   7278  N N   . SER A 1 925  ? -1.286  83.896  74.801  1.00 41.67 ? 925  SER A N   1 
ATOM   7279  C CA  . SER A 1 925  ? -1.057  83.709  73.378  1.00 40.80 ? 925  SER A CA  1 
ATOM   7280  C C   . SER A 1 925  ? 0.199   84.477  73.007  1.00 40.16 ? 925  SER A C   1 
ATOM   7281  O O   . SER A 1 925  ? 0.462   85.602  73.477  1.00 39.97 ? 925  SER A O   1 
ATOM   7282  C CB  . SER A 1 925  ? -2.194  84.234  72.523  1.00 40.86 ? 925  SER A CB  1 
ATOM   7283  O OG  . SER A 1 925  ? -1.730  84.393  71.188  1.00 40.36 ? 925  SER A OG  1 
ATOM   7284  N N   . THR A 1 926  ? 0.982   83.868  72.137  1.00 37.56 ? 926  THR A N   1 
ATOM   7285  C CA  . THR A 1 926  ? 2.201   84.477  71.661  1.00 34.60 ? 926  THR A CA  1 
ATOM   7286  C C   . THR A 1 926  ? 1.924   85.703  70.771  1.00 31.59 ? 926  THR A C   1 
ATOM   7287  O O   . THR A 1 926  ? 2.774   86.584  70.586  1.00 30.70 ? 926  THR A O   1 
ATOM   7288  C CB  . THR A 1 926  ? 2.951   83.495  70.816  1.00 35.78 ? 926  THR A CB  1 
ATOM   7289  O OG1 . THR A 1 926  ? 3.114   82.260  71.527  1.00 36.06 ? 926  THR A OG1 1 
ATOM   7290  C CG2 . THR A 1 926  ? 4.249   84.091  70.443  1.00 36.64 ? 926  THR A CG2 1 
ATOM   7291  N N   . VAL A 1 927  ? 0.735   85.733  70.187  1.00 28.69 ? 927  VAL A N   1 
ATOM   7292  C CA  . VAL A 1 927  ? 0.368   86.804  69.280  1.00 25.70 ? 927  VAL A CA  1 
ATOM   7293  C C   . VAL A 1 927  ? -0.634  87.747  69.894  1.00 25.31 ? 927  VAL A C   1 
ATOM   7294  O O   . VAL A 1 927  ? -0.459  88.962  69.838  1.00 26.03 ? 927  VAL A O   1 
ATOM   7295  C CB  . VAL A 1 927  ? -0.218  86.221  67.964  1.00 25.60 ? 927  VAL A CB  1 
ATOM   7296  C CG1 . VAL A 1 927  ? -0.771  87.339  67.079  1.00 24.86 ? 927  VAL A CG1 1 
ATOM   7297  C CG2 . VAL A 1 927  ? 0.860   85.409  67.232  1.00 24.15 ? 927  VAL A CG2 1 
ATOM   7298  N N   . PHE A 1 928  ? -1.667  87.186  70.504  1.00 22.99 ? 928  PHE A N   1 
ATOM   7299  C CA  . PHE A 1 928  ? -2.696  88.003  71.096  1.00 22.61 ? 928  PHE A CA  1 
ATOM   7300  C C   . PHE A 1 928  ? -2.675  88.036  72.628  1.00 23.69 ? 928  PHE A C   1 
ATOM   7301  O O   . PHE A 1 928  ? -3.664  88.399  73.259  1.00 24.72 ? 928  PHE A O   1 
ATOM   7302  C CB  . PHE A 1 928  ? -4.045  87.510  70.576  1.00 20.52 ? 928  PHE A CB  1 
ATOM   7303  C CG  . PHE A 1 928  ? -4.167  87.552  69.077  1.00 18.31 ? 928  PHE A CG  1 
ATOM   7304  C CD1 . PHE A 1 928  ? -4.390  88.752  68.419  1.00 19.31 ? 928  PHE A CD1 1 
ATOM   7305  C CD2 . PHE A 1 928  ? -4.051  86.396  68.324  1.00 17.16 ? 928  PHE A CD2 1 
ATOM   7306  C CE1 . PHE A 1 928  ? -4.501  88.806  67.031  1.00 18.43 ? 928  PHE A CE1 1 
ATOM   7307  C CE2 . PHE A 1 928  ? -4.161  86.443  66.944  1.00 18.60 ? 928  PHE A CE2 1 
ATOM   7308  C CZ  . PHE A 1 928  ? -4.388  87.654  66.293  1.00 16.78 ? 928  PHE A CZ  1 
ATOM   7309  N N   . GLY A 1 929  ? -1.548  87.660  73.221  1.00 25.58 ? 929  GLY A N   1 
ATOM   7310  C CA  . GLY A 1 929  ? -1.444  87.673  74.669  1.00 27.18 ? 929  GLY A CA  1 
ATOM   7311  C C   . GLY A 1 929  ? -2.542  86.927  75.418  1.00 28.89 ? 929  GLY A C   1 
ATOM   7312  O O   . GLY A 1 929  ? -2.779  85.742  75.171  1.00 29.93 ? 929  GLY A O   1 
ATOM   7313  N N   . ASN A 1 930  ? -3.219  87.628  76.325  1.00 28.40 ? 930  ASN A N   1 
ATOM   7314  C CA  . ASN A 1 930  ? -4.285  87.051  77.141  1.00 29.21 ? 930  ASN A CA  1 
ATOM   7315  C C   . ASN A 1 930  ? -5.666  87.146  76.491  1.00 27.52 ? 930  ASN A C   1 
ATOM   7316  O O   . ASN A 1 930  ? -6.690  86.973  77.154  1.00 25.87 ? 930  ASN A O   1 
ATOM   7317  C CB  . ASN A 1 930  ? -4.322  87.747  78.513  1.00 32.55 ? 930  ASN A CB  1 
ATOM   7318  C CG  . ASN A 1 930  ? -3.013  87.590  79.299  1.00 37.56 ? 930  ASN A CG  1 
ATOM   7319  O OD1 . ASN A 1 930  ? -2.808  88.265  80.314  1.00 40.18 ? 930  ASN A OD1 1 
ATOM   7320  N ND2 . ASN A 1 930  ? -2.128  86.697  78.839  1.00 36.41 ? 930  ASN A ND2 1 
ATOM   7321  N N   . ALA A 1 931  ? -5.708  87.419  75.196  1.00 26.70 ? 931  ALA A N   1 
ATOM   7322  C CA  . ALA A 1 931  ? -6.999  87.521  74.531  1.00 26.27 ? 931  ALA A CA  1 
ATOM   7323  C C   . ALA A 1 931  ? -7.467  86.153  74.075  1.00 25.92 ? 931  ALA A C   1 
ATOM   7324  O O   . ALA A 1 931  ? -6.687  85.367  73.550  1.00 25.42 ? 931  ALA A O   1 
ATOM   7325  C CB  . ALA A 1 931  ? -6.912  88.458  73.345  1.00 25.91 ? 931  ALA A CB  1 
ATOM   7326  N N   . ASP A 1 932  ? -8.744  85.867  74.297  1.00 25.75 ? 932  ASP A N   1 
ATOM   7327  C CA  . ASP A 1 932  ? -9.311  84.603  73.882  1.00 25.39 ? 932  ASP A CA  1 
ATOM   7328  C C   . ASP A 1 932  ? -9.691  84.757  72.406  1.00 25.47 ? 932  ASP A C   1 
ATOM   7329  O O   . ASP A 1 932  ? -10.867 84.755  72.035  1.00 22.04 ? 932  ASP A O   1 
ATOM   7330  C CB  . ASP A 1 932  ? -10.540 84.277  74.724  1.00 25.78 ? 932  ASP A CB  1 
ATOM   7331  C CG  . ASP A 1 932  ? -11.108 82.918  74.397  1.00 27.46 ? 932  ASP A CG  1 
ATOM   7332  O OD1 . ASP A 1 932  ? -10.416 82.153  73.690  1.00 29.30 ? 932  ASP A OD1 1 
ATOM   7333  O OD2 . ASP A 1 932  ? -12.232 82.610  74.847  1.00 29.87 ? 932  ASP A OD2 1 
ATOM   7334  N N   . TYR A 1 933  ? -8.670  84.884  71.567  1.00 25.82 ? 933  TYR A N   1 
ATOM   7335  C CA  . TYR A 1 933  ? -8.880  85.089  70.146  1.00 26.55 ? 933  TYR A CA  1 
ATOM   7336  C C   . TYR A 1 933  ? -9.698  83.999  69.463  1.00 27.19 ? 933  TYR A C   1 
ATOM   7337  O O   . TYR A 1 933  ? -10.544 84.294  68.610  1.00 26.17 ? 933  TYR A O   1 
ATOM   7338  C CB  . TYR A 1 933  ? -7.533  85.257  69.449  1.00 25.01 ? 933  TYR A CB  1 
ATOM   7339  C CG  . TYR A 1 933  ? -6.690  84.009  69.453  1.00 27.90 ? 933  TYR A CG  1 
ATOM   7340  C CD1 . TYR A 1 933  ? -6.795  83.071  68.424  1.00 25.88 ? 933  TYR A CD1 1 
ATOM   7341  C CD2 . TYR A 1 933  ? -5.811  83.742  70.508  1.00 27.06 ? 933  TYR A CD2 1 
ATOM   7342  C CE1 . TYR A 1 933  ? -6.045  81.896  68.448  1.00 26.94 ? 933  TYR A CE1 1 
ATOM   7343  C CE2 . TYR A 1 933  ? -5.057  82.561  70.540  1.00 25.96 ? 933  TYR A CE2 1 
ATOM   7344  C CZ  . TYR A 1 933  ? -5.181  81.642  69.510  1.00 26.44 ? 933  TYR A CZ  1 
ATOM   7345  O OH  . TYR A 1 933  ? -4.475  80.451  69.551  1.00 27.34 ? 933  TYR A OH  1 
ATOM   7346  N N   . ARG A 1 934  ? -9.469  82.746  69.841  1.00 28.07 ? 934  ARG A N   1 
ATOM   7347  C CA  . ARG A 1 934  ? -10.196 81.649  69.212  1.00 28.95 ? 934  ARG A CA  1 
ATOM   7348  C C   . ARG A 1 934  ? -11.704 81.830  69.285  1.00 26.44 ? 934  ARG A C   1 
ATOM   7349  O O   . ARG A 1 934  ? -12.414 81.671  68.296  1.00 26.13 ? 934  ARG A O   1 
ATOM   7350  C CB  . ARG A 1 934  ? -9.792  80.315  69.838  1.00 31.37 ? 934  ARG A CB  1 
ATOM   7351  C CG  . ARG A 1 934  ? -8.406  79.861  69.435  1.00 34.62 ? 934  ARG A CG  1 
ATOM   7352  C CD  . ARG A 1 934  ? -8.088  78.525  70.064  1.00 41.06 ? 934  ARG A CD  1 
ATOM   7353  N NE  . ARG A 1 934  ? -6.786  77.991  69.670  1.00 44.40 ? 934  ARG A NE  1 
ATOM   7354  C CZ  . ARG A 1 934  ? -6.377  76.762  69.976  1.00 46.77 ? 934  ARG A CZ  1 
ATOM   7355  N NH1 . ARG A 1 934  ? -7.172  75.955  70.678  1.00 47.98 ? 934  ARG A NH1 1 
ATOM   7356  N NH2 . ARG A 1 934  ? -5.186  76.332  69.580  1.00 45.72 ? 934  ARG A NH2 1 
ATOM   7357  N N   . ARG A 1 935  ? -12.195 82.172  70.461  1.00 24.80 ? 935  ARG A N   1 
ATOM   7358  C CA  . ARG A 1 935  ? -13.618 82.372  70.623  1.00 24.71 ? 935  ARG A CA  1 
ATOM   7359  C C   . ARG A 1 935  ? -14.059 83.681  69.955  1.00 24.83 ? 935  ARG A C   1 
ATOM   7360  O O   . ARG A 1 935  ? -15.176 83.779  69.440  1.00 25.92 ? 935  ARG A O   1 
ATOM   7361  C CB  . ARG A 1 935  ? -13.954 82.387  72.107  1.00 24.89 ? 935  ARG A CB  1 
ATOM   7362  C CG  . ARG A 1 935  ? -15.410 82.513  72.413  1.00 25.27 ? 935  ARG A CG  1 
ATOM   7363  C CD  . ARG A 1 935  ? -15.587 82.736  73.907  1.00 26.34 ? 935  ARG A CD  1 
ATOM   7364  N NE  . ARG A 1 935  ? -16.675 83.675  74.127  1.00 26.00 ? 935  ARG A NE  1 
ATOM   7365  C CZ  . ARG A 1 935  ? -16.606 84.713  74.944  1.00 26.08 ? 935  ARG A CZ  1 
ATOM   7366  N NH1 . ARG A 1 935  ? -15.497 84.949  75.636  1.00 25.82 ? 935  ARG A NH1 1 
ATOM   7367  N NH2 . ARG A 1 935  ? -17.644 85.526  75.047  1.00 30.09 ? 935  ARG A NH2 1 
ATOM   7368  N N   . CYS A 1 936  ? -13.181 84.684  69.953  1.00 22.64 ? 936  CYS A N   1 
ATOM   7369  C CA  . CYS A 1 936  ? -13.520 85.953  69.338  1.00 20.28 ? 936  CYS A CA  1 
ATOM   7370  C C   . CYS A 1 936  ? -13.682 85.781  67.838  1.00 19.81 ? 936  CYS A C   1 
ATOM   7371  O O   . CYS A 1 936  ? -14.721 86.126  67.265  1.00 21.31 ? 936  CYS A O   1 
ATOM   7372  C CB  . CYS A 1 936  ? -12.447 87.005  69.605  1.00 19.91 ? 936  CYS A CB  1 
ATOM   7373  S SG  . CYS A 1 936  ? -12.857 88.601  68.855  1.00 19.07 ? 936  CYS A SG  1 
ATOM   7374  N N   . PHE A 1 937  ? -12.663 85.234  67.194  1.00 17.93 ? 937  PHE A N   1 
ATOM   7375  C CA  . PHE A 1 937  ? -12.743 85.058  65.753  1.00 17.22 ? 937  PHE A CA  1 
ATOM   7376  C C   . PHE A 1 937  ? -13.908 84.155  65.309  1.00 17.78 ? 937  PHE A C   1 
ATOM   7377  O O   . PHE A 1 937  ? -14.429 84.318  64.210  1.00 19.42 ? 937  PHE A O   1 
ATOM   7378  C CB  . PHE A 1 937  ? -11.396 84.559  65.208  1.00 13.89 ? 937  PHE A CB  1 
ATOM   7379  C CG  . PHE A 1 937  ? -10.233 85.485  65.517  1.00 9.92  ? 937  PHE A CG  1 
ATOM   7380  C CD1 . PHE A 1 937  ? -10.461 86.786  65.983  1.00 5.13  ? 937  PHE A CD1 1 
ATOM   7381  C CD2 . PHE A 1 937  ? -8.914  85.054  65.348  1.00 7.90  ? 937  PHE A CD2 1 
ATOM   7382  C CE1 . PHE A 1 937  ? -9.404  87.635  66.280  1.00 4.08  ? 937  PHE A CE1 1 
ATOM   7383  C CE2 . PHE A 1 937  ? -7.833  85.906  65.642  1.00 6.10  ? 937  PHE A CE2 1 
ATOM   7384  C CZ  . PHE A 1 937  ? -8.086  87.199  66.111  1.00 6.98  ? 937  PHE A CZ  1 
ATOM   7385  N N   . ASN A 1 938  ? -14.337 83.215  66.143  1.00 18.04 ? 938  ASN A N   1 
ATOM   7386  C CA  . ASN A 1 938  ? -15.470 82.372  65.747  1.00 19.04 ? 938  ASN A CA  1 
ATOM   7387  C C   . ASN A 1 938  ? -16.758 83.161  65.879  1.00 19.96 ? 938  ASN A C   1 
ATOM   7388  O O   . ASN A 1 938  ? -17.575 83.164  64.962  1.00 20.50 ? 938  ASN A O   1 
ATOM   7389  C CB  . ASN A 1 938  ? -15.565 81.107  66.600  1.00 17.04 ? 938  ASN A CB  1 
ATOM   7390  C CG  . ASN A 1 938  ? -14.703 79.990  66.074  1.00 17.81 ? 938  ASN A CG  1 
ATOM   7391  O OD1 . ASN A 1 938  ? -14.963 79.446  65.003  1.00 18.57 ? 938  ASN A OD1 1 
ATOM   7392  N ND2 . ASN A 1 938  ? -13.663 79.640  66.821  1.00 17.15 ? 938  ASN A ND2 1 
ATOM   7393  N N   . GLU A 1 939  ? -16.935 83.841  67.016  1.00 22.85 ? 939  GLU A N   1 
ATOM   7394  C CA  . GLU A 1 939  ? -18.146 84.640  67.245  1.00 22.83 ? 939  GLU A CA  1 
ATOM   7395  C C   . GLU A 1 939  ? -18.281 85.750  66.208  1.00 21.84 ? 939  GLU A C   1 
ATOM   7396  O O   . GLU A 1 939  ? -19.370 85.979  65.706  1.00 23.98 ? 939  GLU A O   1 
ATOM   7397  C CB  . GLU A 1 939  ? -18.172 85.249  68.655  1.00 24.28 ? 939  GLU A CB  1 
ATOM   7398  C CG  . GLU A 1 939  ? -18.168 84.225  69.792  1.00 28.13 ? 939  GLU A CG  1 
ATOM   7399  C CD  . GLU A 1 939  ? -18.730 84.767  71.116  1.00 31.45 ? 939  GLU A CD  1 
ATOM   7400  O OE1 . GLU A 1 939  ? -18.578 85.975  71.421  1.00 31.75 ? 939  GLU A OE1 1 
ATOM   7401  O OE2 . GLU A 1 939  ? -19.317 83.965  71.870  1.00 32.32 ? 939  GLU A OE2 1 
ATOM   7402  N N   . LEU A 1 940  ? -17.189 86.430  65.870  1.00 18.31 ? 940  LEU A N   1 
ATOM   7403  C CA  . LEU A 1 940  ? -17.271 87.486  64.865  1.00 17.56 ? 940  LEU A CA  1 
ATOM   7404  C C   . LEU A 1 940  ? -17.285 86.971  63.414  1.00 17.99 ? 940  LEU A C   1 
ATOM   7405  O O   . LEU A 1 940  ? -17.345 87.770  62.472  1.00 17.51 ? 940  LEU A O   1 
ATOM   7406  C CB  . LEU A 1 940  ? -16.119 88.486  65.036  1.00 16.05 ? 940  LEU A CB  1 
ATOM   7407  C CG  . LEU A 1 940  ? -16.103 89.284  66.337  1.00 14.66 ? 940  LEU A CG  1 
ATOM   7408  C CD1 . LEU A 1 940  ? -15.013 90.316  66.271  1.00 14.75 ? 940  LEU A CD1 1 
ATOM   7409  C CD2 . LEU A 1 940  ? -17.452 89.947  66.555  1.00 16.62 ? 940  LEU A CD2 1 
ATOM   7410  N N   . LYS A 1 941  ? -17.242 85.649  63.242  1.00 16.22 ? 941  LYS A N   1 
ATOM   7411  C CA  . LYS A 1 941  ? -17.230 85.029  61.917  1.00 15.61 ? 941  LYS A CA  1 
ATOM   7412  C C   . LYS A 1 941  ? -15.962 85.353  61.124  1.00 14.39 ? 941  LYS A C   1 
ATOM   7413  O O   . LYS A 1 941  ? -15.937 85.227  59.901  1.00 11.01 ? 941  LYS A O   1 
ATOM   7414  C CB  . LYS A 1 941  ? -18.448 85.456  61.098  1.00 17.39 ? 941  LYS A CB  1 
ATOM   7415  C CG  . LYS A 1 941  ? -19.769 85.108  61.716  1.00 20.38 ? 941  LYS A CG  1 
ATOM   7416  C CD  . LYS A 1 941  ? -20.005 83.615  61.749  1.00 25.62 ? 941  LYS A CD  1 
ATOM   7417  C CE  . LYS A 1 941  ? -21.370 83.307  62.396  1.00 27.93 ? 941  LYS A CE  1 
ATOM   7418  N NZ  . LYS A 1 941  ? -21.560 81.844  62.631  1.00 30.25 ? 941  LYS A NZ  1 
ATOM   7419  N N   . LEU A 1 942  ? -14.910 85.767  61.824  1.00 14.28 ? 942  LEU A N   1 
ATOM   7420  C CA  . LEU A 1 942  ? -13.646 86.087  61.172  1.00 15.29 ? 942  LEU A CA  1 
ATOM   7421  C C   . LEU A 1 942  ? -13.012 84.813  60.620  1.00 15.35 ? 942  LEU A C   1 
ATOM   7422  O O   . LEU A 1 942  ? -12.468 84.817  59.518  1.00 16.95 ? 942  LEU A O   1 
ATOM   7423  C CB  . LEU A 1 942  ? -12.699 86.775  62.156  1.00 15.13 ? 942  LEU A CB  1 
ATOM   7424  C CG  . LEU A 1 942  ? -11.427 87.398  61.579  1.00 15.82 ? 942  LEU A CG  1 
ATOM   7425  C CD1 . LEU A 1 942  ? -10.784 88.350  62.580  1.00 14.57 ? 942  LEU A CD1 1 
ATOM   7426  C CD2 . LEU A 1 942  ? -10.472 86.298  61.216  1.00 19.04 ? 942  LEU A CD2 1 
ATOM   7427  N N   . TYR A 1 943  ? -13.078 83.722  61.379  1.00 14.62 ? 943  TYR A N   1 
ATOM   7428  C CA  . TYR A 1 943  ? -12.524 82.459  60.910  1.00 14.07 ? 943  TYR A CA  1 
ATOM   7429  C C   . TYR A 1 943  ? -13.400 81.964  59.765  1.00 14.00 ? 943  TYR A C   1 
ATOM   7430  O O   . TYR A 1 943  ? -12.911 81.603  58.694  1.00 15.46 ? 943  TYR A O   1 
ATOM   7431  C CB  . TYR A 1 943  ? -12.509 81.408  62.020  1.00 12.54 ? 943  TYR A CB  1 
ATOM   7432  C CG  . TYR A 1 943  ? -11.323 81.462  62.964  1.00 11.77 ? 943  TYR A CG  1 
ATOM   7433  C CD1 . TYR A 1 943  ? -10.063 81.867  62.526  1.00 13.50 ? 943  TYR A CD1 1 
ATOM   7434  C CD2 . TYR A 1 943  ? -11.449 81.024  64.282  1.00 13.11 ? 943  TYR A CD2 1 
ATOM   7435  C CE1 . TYR A 1 943  ? -8.953  81.832  63.386  1.00 12.62 ? 943  TYR A CE1 1 
ATOM   7436  C CE2 . TYR A 1 943  ? -10.359 80.980  65.141  1.00 12.94 ? 943  TYR A CE2 1 
ATOM   7437  C CZ  . TYR A 1 943  ? -9.116  81.385  64.692  1.00 13.51 ? 943  TYR A CZ  1 
ATOM   7438  O OH  . TYR A 1 943  ? -8.047  81.337  65.556  1.00 14.22 ? 943  TYR A OH  1 
ATOM   7439  N N   . GLN A 1 944  ? -14.700 81.956  60.001  1.00 13.48 ? 944  GLN A N   1 
ATOM   7440  C CA  . GLN A 1 944  ? -15.665 81.525  58.998  1.00 14.76 ? 944  GLN A CA  1 
ATOM   7441  C C   . GLN A 1 944  ? -15.434 82.238  57.647  1.00 14.56 ? 944  GLN A C   1 
ATOM   7442  O O   . GLN A 1 944  ? -15.311 81.597  56.587  1.00 13.87 ? 944  GLN A O   1 
ATOM   7443  C CB  . GLN A 1 944  ? -17.078 81.808  59.511  1.00 14.49 ? 944  GLN A CB  1 
ATOM   7444  C CG  . GLN A 1 944  ? -17.526 80.945  60.704  1.00 15.31 ? 944  GLN A CG  1 
ATOM   7445  C CD  . GLN A 1 944  ? -16.589 81.012  61.905  1.00 13.87 ? 944  GLN A CD  1 
ATOM   7446  O OE1 . GLN A 1 944  ? -16.181 82.081  62.335  1.00 14.56 ? 944  GLN A OE1 1 
ATOM   7447  N NE2 . GLN A 1 944  ? -16.261 79.857  62.458  1.00 16.31 ? 944  GLN A NE2 1 
ATOM   7448  N N   . GLY A 1 945  ? -15.364 83.564  57.691  1.00 14.60 ? 945  GLY A N   1 
ATOM   7449  C CA  . GLY A 1 945  ? -15.147 84.324  56.473  1.00 13.58 ? 945  GLY A CA  1 
ATOM   7450  C C   . GLY A 1 945  ? -13.828 83.977  55.804  1.00 13.06 ? 945  GLY A C   1 
ATOM   7451  O O   . GLY A 1 945  ? -13.737 83.927  54.575  1.00 9.61  ? 945  GLY A O   1 
ATOM   7452  N N   . TYR A 1 946  ? -12.814 83.740  56.634  1.00 12.54 ? 946  TYR A N   1 
ATOM   7453  C CA  . TYR A 1 946  ? -11.467 83.399  56.189  1.00 13.23 ? 946  TYR A CA  1 
ATOM   7454  C C   . TYR A 1 946  ? -11.478 82.094  55.378  1.00 14.05 ? 946  TYR A C   1 
ATOM   7455  O O   . TYR A 1 946  ? -10.989 82.040  54.250  1.00 13.90 ? 946  TYR A O   1 
ATOM   7456  C CB  . TYR A 1 946  ? -10.568 83.257  57.421  1.00 12.03 ? 946  TYR A CB  1 
ATOM   7457  C CG  . TYR A 1 946  ? -9.156  82.787  57.147  1.00 10.74 ? 946  TYR A CG  1 
ATOM   7458  C CD1 . TYR A 1 946  ? -8.193  83.656  56.641  1.00 10.28 ? 946  TYR A CD1 1 
ATOM   7459  C CD2 . TYR A 1 946  ? -8.776  81.469  57.437  1.00 11.94 ? 946  TYR A CD2 1 
ATOM   7460  C CE1 . TYR A 1 946  ? -6.873  83.225  56.432  1.00 11.97 ? 946  TYR A CE1 1 
ATOM   7461  C CE2 . TYR A 1 946  ? -7.470  81.026  57.240  1.00 11.30 ? 946  TYR A CE2 1 
ATOM   7462  C CZ  . TYR A 1 946  ? -6.522  81.908  56.740  1.00 12.96 ? 946  TYR A CZ  1 
ATOM   7463  O OH  . TYR A 1 946  ? -5.228  81.476  56.576  1.00 13.01 ? 946  TYR A OH  1 
ATOM   7464  N N   . TYR A 1 947  ? -12.047 81.049  55.963  1.00 14.74 ? 947  TYR A N   1 
ATOM   7465  C CA  . TYR A 1 947  ? -12.138 79.757  55.305  1.00 15.80 ? 947  TYR A CA  1 
ATOM   7466  C C   . TYR A 1 947  ? -13.179 79.720  54.183  1.00 16.58 ? 947  TYR A C   1 
ATOM   7467  O O   . TYR A 1 947  ? -13.005 79.007  53.195  1.00 17.64 ? 947  TYR A O   1 
ATOM   7468  C CB  . TYR A 1 947  ? -12.412 78.673  56.355  1.00 14.54 ? 947  TYR A CB  1 
ATOM   7469  C CG  . TYR A 1 947  ? -11.183 78.387  57.187  1.00 14.95 ? 947  TYR A CG  1 
ATOM   7470  C CD1 . TYR A 1 947  ? -10.053 77.842  56.592  1.00 13.66 ? 947  TYR A CD1 1 
ATOM   7471  C CD2 . TYR A 1 947  ? -11.126 78.709  58.547  1.00 14.09 ? 947  TYR A CD2 1 
ATOM   7472  C CE1 . TYR A 1 947  ? -8.897  77.627  57.307  1.00 14.32 ? 947  TYR A CE1 1 
ATOM   7473  C CE2 . TYR A 1 947  ? -9.966  78.492  59.283  1.00 13.83 ? 947  TYR A CE2 1 
ATOM   7474  C CZ  . TYR A 1 947  ? -8.848  77.950  58.647  1.00 16.37 ? 947  TYR A CZ  1 
ATOM   7475  O OH  . TYR A 1 947  ? -7.659  77.739  59.312  1.00 16.46 ? 947  TYR A OH  1 
ATOM   7476  N N   . MET A 1 948  ? -14.260 80.480  54.321  1.00 17.00 ? 948  MET A N   1 
ATOM   7477  C CA  . MET A 1 948  ? -15.268 80.493  53.268  1.00 18.01 ? 948  MET A CA  1 
ATOM   7478  C C   . MET A 1 948  ? -14.687 81.094  51.996  1.00 19.06 ? 948  MET A C   1 
ATOM   7479  O O   . MET A 1 948  ? -14.926 80.590  50.899  1.00 19.28 ? 948  MET A O   1 
ATOM   7480  C CB  . MET A 1 948  ? -16.490 81.295  53.695  1.00 18.82 ? 948  MET A CB  1 
ATOM   7481  C CG  . MET A 1 948  ? -17.391 80.569  54.658  1.00 21.98 ? 948  MET A CG  1 
ATOM   7482  S SD  . MET A 1 948  ? -18.910 81.497  54.912  1.00 29.47 ? 948  MET A SD  1 
ATOM   7483  C CE  . MET A 1 948  ? -18.675 81.936  56.563  1.00 26.75 ? 948  MET A CE  1 
ATOM   7484  N N   . ALA A 1 949  ? -13.920 82.172  52.151  1.00 19.16 ? 949  ALA A N   1 
ATOM   7485  C CA  . ALA A 1 949  ? -13.300 82.855  51.020  1.00 20.42 ? 949  ALA A CA  1 
ATOM   7486  C C   . ALA A 1 949  ? -12.403 81.932  50.203  1.00 21.68 ? 949  ALA A C   1 
ATOM   7487  O O   . ALA A 1 949  ? -12.233 82.128  48.996  1.00 20.70 ? 949  ALA A O   1 
ATOM   7488  C CB  . ALA A 1 949  ? -12.479 84.057  51.517  1.00 20.63 ? 949  ALA A CB  1 
ATOM   7489  N N   . GLN A 1 950  ? -11.843 80.921  50.864  1.00 22.33 ? 950  GLN A N   1 
ATOM   7490  C CA  . GLN A 1 950  ? -10.927 79.996  50.215  1.00 23.49 ? 950  GLN A CA  1 
ATOM   7491  C C   . GLN A 1 950  ? -11.575 78.823  49.518  1.00 25.25 ? 950  GLN A C   1 
ATOM   7492  O O   . GLN A 1 950  ? -10.883 77.911  49.080  1.00 26.96 ? 950  GLN A O   1 
ATOM   7493  C CB  . GLN A 1 950  ? -9.922  79.470  51.225  1.00 22.34 ? 950  GLN A CB  1 
ATOM   7494  C CG  . GLN A 1 950  ? -9.075  80.550  51.842  1.00 26.55 ? 950  GLN A CG  1 
ATOM   7495  C CD  . GLN A 1 950  ? -8.254  80.033  53.003  1.00 27.26 ? 950  GLN A CD  1 
ATOM   7496  O OE1 . GLN A 1 950  ? -7.528  79.043  52.868  1.00 30.42 ? 950  GLN A OE1 1 
ATOM   7497  N NE2 . GLN A 1 950  ? -8.362  80.697  54.153  1.00 26.25 ? 950  GLN A NE2 1 
ATOM   7498  N N   . LEU A 1 951  ? -12.894 78.827  49.428  1.00 26.26 ? 951  LEU A N   1 
ATOM   7499  C CA  . LEU A 1 951  ? -13.592 77.752  48.745  1.00 29.63 ? 951  LEU A CA  1 
ATOM   7500  C C   . LEU A 1 951  ? -13.826 78.182  47.303  1.00 33.09 ? 951  LEU A C   1 
ATOM   7501  O O   . LEU A 1 951  ? -14.124 79.354  47.032  1.00 34.57 ? 951  LEU A O   1 
ATOM   7502  C CB  . LEU A 1 951  ? -14.937 77.461  49.415  1.00 27.21 ? 951  LEU A CB  1 
ATOM   7503  C CG  . LEU A 1 951  ? -14.882 76.893  50.837  1.00 27.27 ? 951  LEU A CG  1 
ATOM   7504  C CD1 . LEU A 1 951  ? -16.277 76.865  51.418  1.00 25.32 ? 951  LEU A CD1 1 
ATOM   7505  C CD2 . LEU A 1 951  ? -14.261 75.498  50.823  1.00 25.44 ? 951  LEU A CD2 1 
ATOM   7506  N N   . PRO A 1 952  ? -13.667 77.248  46.352  1.00 36.59 ? 952  PRO A N   1 
ATOM   7507  C CA  . PRO A 1 952  ? -13.881 77.575  44.937  1.00 37.86 ? 952  PRO A CA  1 
ATOM   7508  C C   . PRO A 1 952  ? -15.328 77.985  44.710  1.00 38.75 ? 952  PRO A C   1 
ATOM   7509  O O   . PRO A 1 952  ? -16.235 77.335  45.221  1.00 38.34 ? 952  PRO A O   1 
ATOM   7510  C CB  . PRO A 1 952  ? -13.520 76.276  44.220  1.00 38.74 ? 952  PRO A CB  1 
ATOM   7511  C CG  . PRO A 1 952  ? -13.735 75.202  45.275  1.00 37.93 ? 952  PRO A CG  1 
ATOM   7512  C CD  . PRO A 1 952  ? -13.197 75.859  46.513  1.00 36.84 ? 952  PRO A CD  1 
ATOM   7513  N N   . ARG A 1 953  ? -15.533 79.066  43.958  1.00 39.77 ? 953  ARG A N   1 
ATOM   7514  C CA  . ARG A 1 953  ? -16.871 79.577  43.675  1.00 40.36 ? 953  ARG A CA  1 
ATOM   7515  C C   . ARG A 1 953  ? -17.507 78.962  42.422  1.00 41.23 ? 953  ARG A C   1 
ATOM   7516  O O   . ARG A 1 953  ? -18.284 79.629  41.732  1.00 39.93 ? 953  ARG A O   1 
ATOM   7517  C CB  . ARG A 1 953  ? -16.818 81.107  43.541  1.00 41.17 ? 953  ARG A CB  1 
ATOM   7518  C CG  . ARG A 1 953  ? -16.559 81.856  44.856  1.00 40.38 ? 953  ARG A CG  1 
ATOM   7519  C CD  . ARG A 1 953  ? -15.547 82.981  44.671  1.00 40.88 ? 953  ARG A CD  1 
ATOM   7520  N NE  . ARG A 1 953  ? -14.392 82.799  45.545  1.00 43.70 ? 953  ARG A NE  1 
ATOM   7521  C CZ  . ARG A 1 953  ? -13.170 83.264  45.295  1.00 44.87 ? 953  ARG A CZ  1 
ATOM   7522  N NH1 . ARG A 1 953  ? -12.926 83.950  44.186  1.00 43.28 ? 953  ARG A NH1 1 
ATOM   7523  N NH2 . ARG A 1 953  ? -12.183 83.030  46.156  1.00 45.71 ? 953  ARG A NH2 1 
ATOM   7524  N N   . ASN A 1 954  ? -17.188 77.691  42.152  1.00 42.73 ? 954  ASN A N   1 
ATOM   7525  C CA  . ASN A 1 954  ? -17.706 76.958  40.990  1.00 45.41 ? 954  ASN A CA  1 
ATOM   7526  C C   . ASN A 1 954  ? -18.056 75.488  41.272  1.00 45.65 ? 954  ASN A C   1 
ATOM   7527  O O   . ASN A 1 954  ? -17.166 74.652  41.441  1.00 46.22 ? 954  ASN A O   1 
ATOM   7528  C CB  . ASN A 1 954  ? -16.677 76.997  39.860  1.00 47.22 ? 954  ASN A CB  1 
ATOM   7529  C CG  . ASN A 1 954  ? -16.640 78.333  39.144  1.00 49.32 ? 954  ASN A CG  1 
ATOM   7530  O OD1 . ASN A 1 954  ? -16.576 79.388  39.773  1.00 50.41 ? 954  ASN A OD1 1 
ATOM   7531  N ND2 . ASN A 1 954  ? -16.663 78.293  37.814  1.00 50.03 ? 954  ASN A ND2 1 
ATOM   7532  N N   . PRO A 1 955  ? -19.351 75.147  41.284  0.00 45.86 ? 955  PRO A N   1 
ATOM   7533  C CA  . PRO A 1 955  ? -19.772 73.766  41.547  0.00 46.13 ? 955  PRO A CA  1 
ATOM   7534  C C   . PRO A 1 955  ? -18.879 72.734  40.859  0.00 46.56 ? 955  PRO A C   1 
ATOM   7535  O O   . PRO A 1 955  ? -18.607 72.835  39.664  0.00 46.66 ? 955  PRO A O   1 
ATOM   7536  C CB  . PRO A 1 955  ? -21.198 73.740  41.014  0.00 45.94 ? 955  PRO A CB  1 
ATOM   7537  C CG  . PRO A 1 955  ? -21.667 75.125  41.298  0.00 45.74 ? 955  PRO A CG  1 
ATOM   7538  C CD  . PRO A 1 955  ? -20.497 75.965  40.851  0.00 45.75 ? 955  PRO A CD  1 
ATOM   7539  N N   . LYS A 1 956  ? -18.424 71.747  41.623  0.00 47.20 ? 956  LYS A N   1 
ATOM   7540  C CA  . LYS A 1 956  ? -17.564 70.699  41.086  0.00 47.96 ? 956  LYS A CA  1 
ATOM   7541  C C   . LYS A 1 956  ? -18.388 69.445  40.820  0.00 47.89 ? 956  LYS A C   1 
ATOM   7542  O O   . LYS A 1 956  ? -17.992 68.580  40.038  0.00 47.93 ? 956  LYS A O   1 
ATOM   7543  C CB  . LYS A 1 956  ? -16.448 70.375  42.078  0.00 48.84 ? 956  LYS A CB  1 
ATOM   7544  C CG  . LYS A 1 956  ? -16.951 69.673  43.314  1.00 49.82 ? 956  LYS A CG  1 
ATOM   7545  C CD  . LYS A 1 956  ? -15.848 69.418  44.339  1.00 50.16 ? 956  LYS A CD  1 
ATOM   7546  C CE  . LYS A 1 956  ? -16.380 68.554  45.506  1.00 49.47 ? 956  LYS A CE  1 
ATOM   7547  N NZ  . LYS A 1 956  ? -15.341 68.193  46.531  1.00 47.53 ? 956  LYS A NZ  1 
ATOM   7548  N N   . GLU A 1 965  ? -15.412 53.082  33.129  1.00 58.91 ? 965  GLU A N   1 
ATOM   7549  C CA  . GLU A 1 965  ? -14.360 52.530  32.276  1.00 60.09 ? 965  GLU A CA  1 
ATOM   7550  C C   . GLU A 1 965  ? -14.022 53.476  31.115  1.00 59.38 ? 965  GLU A C   1 
ATOM   7551  O O   . GLU A 1 965  ? -12.913 53.434  30.577  1.00 59.41 ? 965  GLU A O   1 
ATOM   7552  C CB  . GLU A 1 965  ? -14.780 51.168  31.696  1.00 61.62 ? 965  GLU A CB  1 
ATOM   7553  C CG  . GLU A 1 965  ? -13.753 50.577  30.715  1.00 63.93 ? 965  GLU A CG  1 
ATOM   7554  C CD  . GLU A 1 965  ? -14.262 49.353  29.958  1.00 65.95 ? 965  GLU A CD  1 
ATOM   7555  O OE1 . GLU A 1 965  ? -14.459 48.289  30.591  1.00 66.83 ? 965  GLU A OE1 1 
ATOM   7556  O OE2 . GLU A 1 965  ? -14.460 49.453  28.722  1.00 66.33 ? 965  GLU A OE2 1 
ATOM   7557  N N   . VAL A 1 966  ? -14.969 54.319  30.713  1.00 57.33 ? 966  VAL A N   1 
ATOM   7558  C CA  . VAL A 1 966  ? -14.690 55.234  29.616  1.00 55.63 ? 966  VAL A CA  1 
ATOM   7559  C C   . VAL A 1 966  ? -13.725 56.307  30.111  1.00 55.50 ? 966  VAL A C   1 
ATOM   7560  O O   . VAL A 1 966  ? -13.057 56.970  29.320  1.00 55.12 ? 966  VAL A O   1 
ATOM   7561  C CB  . VAL A 1 966  ? -15.979 55.912  29.066  1.00 54.20 ? 966  VAL A CB  1 
ATOM   7562  C CG1 . VAL A 1 966  ? -16.506 56.939  30.053  1.00 53.75 ? 966  VAL A CG1 1 
ATOM   7563  C CG2 . VAL A 1 966  ? -15.683 56.567  27.737  1.00 53.72 ? 966  VAL A CG2 1 
ATOM   7564  N N   . ARG A 1 967  ? -13.634 56.463  31.427  1.00 54.71 ? 967  ARG A N   1 
ATOM   7565  C CA  . ARG A 1 967  ? -12.747 57.472  31.985  1.00 54.37 ? 967  ARG A CA  1 
ATOM   7566  C C   . ARG A 1 967  ? -11.298 57.076  31.767  1.00 52.41 ? 967  ARG A C   1 
ATOM   7567  O O   . ARG A 1 967  ? -10.468 57.902  31.407  1.00 52.55 ? 967  ARG A O   1 
ATOM   7568  C CB  . ARG A 1 967  ? -13.009 57.655  33.481  1.00 56.22 ? 967  ARG A CB  1 
ATOM   7569  C CG  . ARG A 1 967  ? -12.427 58.949  34.041  1.00 58.46 ? 967  ARG A CG  1 
ATOM   7570  C CD  . ARG A 1 967  ? -12.715 59.117  35.518  1.00 60.37 ? 967  ARG A CD  1 
ATOM   7571  N NE  . ARG A 1 967  ? -11.941 58.190  36.337  1.00 62.71 ? 967  ARG A NE  1 
ATOM   7572  C CZ  . ARG A 1 967  ? -12.021 58.126  37.662  1.00 63.97 ? 967  ARG A CZ  1 
ATOM   7573  N NH1 . ARG A 1 967  ? -12.846 58.936  38.314  1.00 64.32 ? 967  ARG A NH1 1 
ATOM   7574  N NH2 . ARG A 1 967  ? -11.272 57.263  38.337  1.00 64.14 ? 967  ARG A NH2 1 
ATOM   7575  N N   . GLU A 1 968  ? -11.001 55.803  31.978  1.00 50.80 ? 968  GLU A N   1 
ATOM   7576  C CA  . GLU A 1 968  ? -9.647  55.308  31.814  1.00 50.04 ? 968  GLU A CA  1 
ATOM   7577  C C   . GLU A 1 968  ? -9.219  55.420  30.348  1.00 49.05 ? 968  GLU A C   1 
ATOM   7578  O O   . GLU A 1 968  ? -8.060  55.720  30.060  1.00 48.49 ? 968  GLU A O   1 
ATOM   7579  C CB  . GLU A 1 968  ? -9.572  53.851  32.294  1.00 51.71 ? 968  GLU A CB  1 
ATOM   7580  C CG  . GLU A 1 968  ? -8.162  53.293  32.537  1.00 54.60 ? 968  GLU A CG  1 
ATOM   7581  C CD  . GLU A 1 968  ? -7.336  53.133  31.260  1.00 56.83 ? 968  GLU A CD  1 
ATOM   7582  O OE1 . GLU A 1 968  ? -7.889  52.659  30.239  1.00 56.80 ? 968  GLU A OE1 1 
ATOM   7583  O OE2 . GLU A 1 968  ? -6.128  53.466  31.282  1.00 57.77 ? 968  GLU A OE2 1 
ATOM   7584  N N   . GLN A 1 969  ? -10.160 55.189  29.431  1.00 47.29 ? 969  GLN A N   1 
ATOM   7585  C CA  . GLN A 1 969  ? -9.888  55.252  27.992  1.00 45.39 ? 969  GLN A CA  1 
ATOM   7586  C C   . GLN A 1 969  ? -9.538  56.668  27.571  1.00 42.81 ? 969  GLN A C   1 
ATOM   7587  O O   . GLN A 1 969  ? -8.580  56.893  26.835  1.00 41.22 ? 969  GLN A O   1 
ATOM   7588  C CB  . GLN A 1 969  ? -11.110 54.809  27.188  1.00 47.98 ? 969  GLN A CB  1 
ATOM   7589  C CG  . GLN A 1 969  ? -11.721 53.493  27.618  1.00 51.90 ? 969  GLN A CG  1 
ATOM   7590  C CD  . GLN A 1 969  ? -12.890 53.097  26.734  1.00 53.59 ? 969  GLN A CD  1 
ATOM   7591  O OE1 . GLN A 1 969  ? -13.744 53.927  26.403  1.00 54.04 ? 969  GLN A OE1 1 
ATOM   7592  N NE2 . GLN A 1 969  ? -12.941 51.822  26.354  1.00 53.81 ? 969  GLN A NE2 1 
ATOM   7593  N N   . PHE A 1 970  ? -10.349 57.611  28.035  1.00 40.28 ? 970  PHE A N   1 
ATOM   7594  C CA  . PHE A 1 970  ? -10.163 59.019  27.740  1.00 37.98 ? 970  PHE A CA  1 
ATOM   7595  C C   . PHE A 1 970  ? -8.768  59.439  28.189  1.00 38.29 ? 970  PHE A C   1 
ATOM   7596  O O   . PHE A 1 970  ? -7.914  59.804  27.368  1.00 38.35 ? 970  PHE A O   1 
ATOM   7597  C CB  . PHE A 1 970  ? -11.205 59.837  28.489  1.00 35.45 ? 970  PHE A CB  1 
ATOM   7598  C CG  . PHE A 1 970  ? -11.390 61.220  27.952  1.00 33.64 ? 970  PHE A CG  1 
ATOM   7599  C CD1 . PHE A 1 970  ? -11.940 61.419  26.689  1.00 33.01 ? 970  PHE A CD1 1 
ATOM   7600  C CD2 . PHE A 1 970  ? -11.032 62.330  28.712  1.00 32.40 ? 970  PHE A CD2 1 
ATOM   7601  C CE1 . PHE A 1 970  ? -12.128 62.712  26.190  1.00 32.57 ? 970  PHE A CE1 1 
ATOM   7602  C CE2 . PHE A 1 970  ? -11.215 63.626  28.224  1.00 31.66 ? 970  PHE A CE2 1 
ATOM   7603  C CZ  . PHE A 1 970  ? -11.765 63.818  26.962  1.00 30.77 ? 970  PHE A CZ  1 
ATOM   7604  N N   . THR A 1 971  ? -8.548  59.373  29.498  1.00 36.95 ? 971  THR A N   1 
ATOM   7605  C CA  . THR A 1 971  ? -7.271  59.742  30.091  1.00 35.44 ? 971  THR A CA  1 
ATOM   7606  C C   . THR A 1 971  ? -6.114  59.052  29.376  1.00 33.66 ? 971  THR A C   1 
ATOM   7607  O O   . THR A 1 971  ? -5.087  59.673  29.098  1.00 34.34 ? 971  THR A O   1 
ATOM   7608  C CB  . THR A 1 971  ? -7.247  59.385  31.584  1.00 36.48 ? 971  THR A CB  1 
ATOM   7609  O OG1 . THR A 1 971  ? -8.367  60.000  32.233  1.00 37.34 ? 971  THR A OG1 1 
ATOM   7610  C CG2 . THR A 1 971  ? -5.967  59.898  32.241  1.00 38.82 ? 971  THR A CG2 1 
ATOM   7611  N N   . GLN A 1 972  ? -6.280  57.775  29.061  1.00 31.60 ? 972  GLN A N   1 
ATOM   7612  C CA  . GLN A 1 972  ? -5.232  57.045  28.358  1.00 30.93 ? 972  GLN A CA  1 
ATOM   7613  C C   . GLN A 1 972  ? -5.020  57.638  26.959  1.00 29.98 ? 972  GLN A C   1 
ATOM   7614  O O   . GLN A 1 972  ? -3.898  57.670  26.450  1.00 27.93 ? 972  GLN A O   1 
ATOM   7615  C CB  . GLN A 1 972  ? -5.597  55.563  28.246  1.00 32.46 ? 972  GLN A CB  1 
ATOM   7616  C CG  . GLN A 1 972  ? -4.560  54.718  27.517  1.00 34.59 ? 972  GLN A CG  1 
ATOM   7617  C CD  . GLN A 1 972  ? -3.175  54.907  28.090  1.00 36.18 ? 972  GLN A CD  1 
ATOM   7618  O OE1 . GLN A 1 972  ? -2.975  54.764  29.292  1.00 38.02 ? 972  GLN A OE1 1 
ATOM   7619  N NE2 . GLN A 1 972  ? -2.209  55.235  27.232  1.00 35.91 ? 972  GLN A NE2 1 
ATOM   7620  N N   . ALA A 1 973  ? -6.104  58.100  26.342  1.00 28.70 ? 973  ALA A N   1 
ATOM   7621  C CA  . ALA A 1 973  ? -6.025  58.700  25.017  1.00 28.75 ? 973  ALA A CA  1 
ATOM   7622  C C   . ALA A 1 973  ? -5.178  59.964  25.130  1.00 27.97 ? 973  ALA A C   1 
ATOM   7623  O O   . ALA A 1 973  ? -4.203  60.144  24.399  1.00 26.33 ? 973  ALA A O   1 
ATOM   7624  C CB  . ALA A 1 973  ? -7.423  59.039  24.501  1.00 26.60 ? 973  ALA A CB  1 
ATOM   7625  N N   . LEU A 1 974  ? -5.548  60.835  26.061  1.00 28.56 ? 974  LEU A N   1 
ATOM   7626  C CA  . LEU A 1 974  ? -4.799  62.066  26.266  1.00 28.19 ? 974  LEU A CA  1 
ATOM   7627  C C   . LEU A 1 974  ? -3.343  61.697  26.484  1.00 28.75 ? 974  LEU A C   1 
ATOM   7628  O O   . LEU A 1 974  ? -2.440  62.315  25.918  1.00 30.31 ? 974  LEU A O   1 
ATOM   7629  C CB  . LEU A 1 974  ? -5.355  62.824  27.466  1.00 26.07 ? 974  LEU A CB  1 
ATOM   7630  C CG  . LEU A 1 974  ? -6.778  63.318  27.200  1.00 26.86 ? 974  LEU A CG  1 
ATOM   7631  C CD1 . LEU A 1 974  ? -7.500  63.568  28.505  1.00 27.85 ? 974  LEU A CD1 1 
ATOM   7632  C CD2 . LEU A 1 974  ? -6.728  64.580  26.345  1.00 28.76 ? 974  LEU A CD2 1 
ATOM   7633  N N   . SER A 1 975  ? -3.112  60.665  27.282  1.00 28.90 ? 975  SER A N   1 
ATOM   7634  C CA  . SER A 1 975  ? -1.747  60.232  27.546  1.00 30.16 ? 975  SER A CA  1 
ATOM   7635  C C   . SER A 1 975  ? -0.973  59.838  26.275  1.00 29.00 ? 975  SER A C   1 
ATOM   7636  O O   . SER A 1 975  ? 0.198   60.173  26.139  1.00 28.12 ? 975  SER A O   1 
ATOM   7637  C CB  . SER A 1 975  ? -1.749  59.066  28.540  1.00 30.23 ? 975  SER A CB  1 
ATOM   7638  O OG  . SER A 1 975  ? -0.423  58.694  28.866  1.00 32.33 ? 975  SER A OG  1 
ATOM   7639  N N   . ASP A 1 976  ? -1.612  59.131  25.349  1.00 29.86 ? 976  ASP A N   1 
ATOM   7640  C CA  . ASP A 1 976  ? -0.920  58.731  24.124  1.00 32.10 ? 976  ASP A CA  1 
ATOM   7641  C C   . ASP A 1 976  ? -0.596  59.967  23.291  1.00 33.22 ? 976  ASP A C   1 
ATOM   7642  O O   . ASP A 1 976  ? 0.433   60.029  22.608  1.00 32.21 ? 976  ASP A O   1 
ATOM   7643  C CB  . ASP A 1 976  ? -1.773  57.779  23.276  1.00 34.71 ? 976  ASP A CB  1 
ATOM   7644  C CG  . ASP A 1 976  ? -2.009  56.438  23.944  1.00 37.73 ? 976  ASP A CG  1 
ATOM   7645  O OD1 . ASP A 1 976  ? -1.137  55.985  24.718  1.00 37.93 ? 976  ASP A OD1 1 
ATOM   7646  O OD2 . ASP A 1 976  ? -3.070  55.828  23.675  1.00 40.32 ? 976  ASP A OD2 1 
ATOM   7647  N N   . TYR A 1 977  ? -1.492  60.947  23.347  1.00 32.91 ? 977  TYR A N   1 
ATOM   7648  C CA  . TYR A 1 977  ? -1.313  62.179  22.604  1.00 33.24 ? 977  TYR A CA  1 
ATOM   7649  C C   . TYR A 1 977  ? -0.030  62.870  23.049  1.00 34.92 ? 977  TYR A C   1 
ATOM   7650  O O   . TYR A 1 977  ? 0.804   63.248  22.226  1.00 34.11 ? 977  TYR A O   1 
ATOM   7651  C CB  . TYR A 1 977  ? -2.502  63.110  22.837  1.00 32.46 ? 977  TYR A CB  1 
ATOM   7652  C CG  . TYR A 1 977  ? -2.406  64.411  22.077  1.00 32.33 ? 977  TYR A CG  1 
ATOM   7653  C CD1 . TYR A 1 977  ? -2.834  64.500  20.750  1.00 32.01 ? 977  TYR A CD1 1 
ATOM   7654  C CD2 . TYR A 1 977  ? -1.840  65.543  22.666  1.00 32.73 ? 977  TYR A CD2 1 
ATOM   7655  C CE1 . TYR A 1 977  ? -2.697  65.684  20.022  1.00 31.75 ? 977  TYR A CE1 1 
ATOM   7656  C CE2 . TYR A 1 977  ? -1.698  66.734  21.946  1.00 33.62 ? 977  TYR A CE2 1 
ATOM   7657  C CZ  . TYR A 1 977  ? -2.125  66.793  20.626  1.00 31.70 ? 977  TYR A CZ  1 
ATOM   7658  O OH  . TYR A 1 977  ? -1.939  67.940  19.903  1.00 29.85 ? 977  TYR A OH  1 
ATOM   7659  N N   . LEU A 1 978  ? 0.119   63.029  24.361  1.00 36.44 ? 978  LEU A N   1 
ATOM   7660  C CA  . LEU A 1 978  ? 1.286   63.691  24.932  1.00 38.47 ? 978  LEU A CA  1 
ATOM   7661  C C   . LEU A 1 978  ? 2.547   62.825  24.841  1.00 40.38 ? 978  LEU A C   1 
ATOM   7662  O O   . LEU A 1 978  ? 3.581   63.274  24.340  1.00 41.19 ? 978  LEU A O   1 
ATOM   7663  C CB  . LEU A 1 978  ? 1.008   64.053  26.395  1.00 36.93 ? 978  LEU A CB  1 
ATOM   7664  C CG  . LEU A 1 978  ? 2.041   64.917  27.114  1.00 35.91 ? 978  LEU A CG  1 
ATOM   7665  C CD1 . LEU A 1 978  ? 1.988   66.322  26.553  1.00 36.70 ? 978  LEU A CD1 1 
ATOM   7666  C CD2 . LEU A 1 978  ? 1.747   64.948  28.604  1.00 36.62 ? 978  LEU A CD2 1 
ATOM   7667  N N   . MET A 1 979  ? 2.451   61.584  25.318  1.00 42.27 ? 979  MET A N   1 
ATOM   7668  C CA  . MET A 1 979  ? 3.580   60.652  25.311  1.00 43.74 ? 979  MET A CA  1 
ATOM   7669  C C   . MET A 1 979  ? 3.799   60.004  23.955  1.00 44.04 ? 979  MET A C   1 
ATOM   7670  O O   . MET A 1 979  ? 4.428   58.949  23.851  1.00 43.11 ? 979  MET A O   1 
ATOM   7671  C CB  . MET A 1 979  ? 3.368   59.555  26.351  1.00 44.72 ? 979  MET A CB  1 
ATOM   7672  C CG  . MET A 1 979  ? 3.331   60.048  27.773  1.00 46.03 ? 979  MET A CG  1 
ATOM   7673  S SD  . MET A 1 979  ? 4.823   60.934  28.162  1.00 49.38 ? 979  MET A SD  1 
ATOM   7674  C CE  . MET A 1 979  ? 4.167   62.545  28.506  1.00 49.35 ? 979  MET A CE  1 
ATOM   7675  N N   . GLN A 1 980  ? 3.277   60.641  22.916  1.00 44.69 ? 980  GLN A N   1 
ATOM   7676  C CA  . GLN A 1 980  ? 3.413   60.130  21.561  1.00 44.75 ? 980  GLN A CA  1 
ATOM   7677  C C   . GLN A 1 980  ? 4.846   59.666  21.301  1.00 43.43 ? 980  GLN A C   1 
ATOM   7678  O O   . GLN A 1 980  ? 5.077   58.529  20.885  1.00 44.99 ? 980  GLN A O   1 
ATOM   7679  C CB  . GLN A 1 980  ? 3.039   61.217  20.562  1.00 46.00 ? 980  GLN A CB  1 
ATOM   7680  C CG  . GLN A 1 980  ? 2.590   60.694  19.223  1.00 48.12 ? 980  GLN A CG  1 
ATOM   7681  C CD  . GLN A 1 980  ? 2.528   61.787  18.183  1.00 49.66 ? 980  GLN A CD  1 
ATOM   7682  O OE1 . GLN A 1 980  ? 1.976   61.596  17.102  1.00 51.53 ? 980  GLN A OE1 1 
ATOM   7683  N NE2 . GLN A 1 980  ? 3.104   62.944  18.500  1.00 50.00 ? 980  GLN A NE2 1 
ATOM   7684  N N   . ASN A 1 981  ? 5.807   60.544  21.564  1.00 40.62 ? 981  ASN A N   1 
ATOM   7685  C CA  . ASN A 1 981  ? 7.205   60.212  21.342  1.00 38.15 ? 981  ASN A CA  1 
ATOM   7686  C C   . ASN A 1 981  ? 7.754   59.322  22.455  1.00 36.53 ? 981  ASN A C   1 
ATOM   7687  O O   . ASN A 1 981  ? 7.699   59.680  23.621  1.00 35.95 ? 981  ASN A O   1 
ATOM   7688  C CB  . ASN A 1 981  ? 8.034   61.491  21.233  1.00 36.93 ? 981  ASN A CB  1 
ATOM   7689  C CG  . ASN A 1 981  ? 9.390   61.243  20.622  1.00 36.57 ? 981  ASN A CG  1 
ATOM   7690  O OD1 . ASN A 1 981  ? 10.222  60.526  21.183  1.00 35.50 ? 981  ASN A OD1 1 
ATOM   7691  N ND2 . ASN A 1 981  ? 9.617   61.824  19.453  1.00 37.19 ? 981  ASN A ND2 1 
ATOM   7692  N N   . PRO A 1 982  ? 8.287   58.143  22.099  1.00 36.15 ? 982  PRO A N   1 
ATOM   7693  C CA  . PRO A 1 982  ? 8.854   57.179  23.049  1.00 35.58 ? 982  PRO A CA  1 
ATOM   7694  C C   . PRO A 1 982  ? 9.993   57.733  23.915  1.00 35.95 ? 982  PRO A C   1 
ATOM   7695  O O   . PRO A 1 982  ? 10.087  57.412  25.104  1.00 35.25 ? 982  PRO A O   1 
ATOM   7696  C CB  . PRO A 1 982  ? 9.330   56.039  22.141  1.00 34.86 ? 982  PRO A CB  1 
ATOM   7697  C CG  . PRO A 1 982  ? 8.383   56.099  21.002  1.00 34.57 ? 982  PRO A CG  1 
ATOM   7698  C CD  . PRO A 1 982  ? 8.291   57.582  20.736  1.00 35.73 ? 982  PRO A CD  1 
ATOM   7699  N N   . GLU A 1 983  ? 10.855  58.555  23.319  1.00 35.68 ? 983  GLU A N   1 
ATOM   7700  C CA  . GLU A 1 983  ? 11.988  59.130  24.042  1.00 36.49 ? 983  GLU A CA  1 
ATOM   7701  C C   . GLU A 1 983  ? 11.539  59.992  25.222  1.00 35.62 ? 983  GLU A C   1 
ATOM   7702  O O   . GLU A 1 983  ? 12.167  59.982  26.281  1.00 35.11 ? 983  GLU A O   1 
ATOM   7703  C CB  . GLU A 1 983  ? 12.848  59.975  23.098  1.00 37.88 ? 983  GLU A CB  1 
ATOM   7704  C CG  . GLU A 1 983  ? 14.228  60.311  23.644  1.00 40.47 ? 983  GLU A CG  1 
ATOM   7705  C CD  . GLU A 1 983  ? 14.999  61.282  22.752  1.00 43.37 ? 983  GLU A CD  1 
ATOM   7706  O OE1 . GLU A 1 983  ? 14.924  61.144  21.507  1.00 42.91 ? 983  GLU A OE1 1 
ATOM   7707  O OE2 . GLU A 1 983  ? 15.688  62.176  23.299  1.00 42.61 ? 983  GLU A OE2 1 
ATOM   7708  N N   . LEU A 1 984  ? 10.457  60.742  25.034  1.00 34.76 ? 984  LEU A N   1 
ATOM   7709  C CA  . LEU A 1 984  ? 9.939   61.611  26.086  1.00 34.18 ? 984  LEU A CA  1 
ATOM   7710  C C   . LEU A 1 984  ? 9.446   60.739  27.251  1.00 34.59 ? 984  LEU A C   1 
ATOM   7711  O O   . LEU A 1 984  ? 9.753   61.007  28.418  1.00 33.81 ? 984  LEU A O   1 
ATOM   7712  C CB  . LEU A 1 984  ? 8.809   62.499  25.517  1.00 32.81 ? 984  LEU A CB  1 
ATOM   7713  C CG  . LEU A 1 984  ? 8.133   63.653  26.286  1.00 30.16 ? 984  LEU A CG  1 
ATOM   7714  C CD1 . LEU A 1 984  ? 7.211   63.096  27.320  1.00 32.58 ? 984  LEU A CD1 1 
ATOM   7715  C CD2 . LEU A 1 984  ? 9.157   64.539  26.937  1.00 29.19 ? 984  LEU A CD2 1 
ATOM   7716  N N   . LYS A 1 985  ? 8.717   59.674  26.926  1.00 34.55 ? 985  LYS A N   1 
ATOM   7717  C CA  . LYS A 1 985  ? 8.188   58.770  27.942  1.00 34.58 ? 985  LYS A CA  1 
ATOM   7718  C C   . LYS A 1 985  ? 9.317   58.151  28.757  1.00 33.43 ? 985  LYS A C   1 
ATOM   7719  O O   . LYS A 1 985  ? 9.238   58.059  29.984  1.00 32.93 ? 985  LYS A O   1 
ATOM   7720  C CB  . LYS A 1 985  ? 7.354   57.664  27.287  1.00 35.78 ? 985  LYS A CB  1 
ATOM   7721  C CG  . LYS A 1 985  ? 6.567   56.817  28.275  1.00 38.35 ? 985  LYS A CG  1 
ATOM   7722  C CD  . LYS A 1 985  ? 5.549   55.917  27.585  1.00 40.12 ? 985  LYS A CD  1 
ATOM   7723  C CE  . LYS A 1 985  ? 4.730   55.135  28.609  1.00 41.98 ? 985  LYS A CE  1 
ATOM   7724  N NZ  . LYS A 1 985  ? 3.690   54.281  27.949  1.00 44.23 ? 985  LYS A NZ  1 
ATOM   7725  N N   . SER A 1 986  ? 10.370  57.735  28.063  1.00 32.51 ? 986  SER A N   1 
ATOM   7726  C CA  . SER A 1 986  ? 11.526  57.126  28.707  1.00 31.44 ? 986  SER A CA  1 
ATOM   7727  C C   . SER A 1 986  ? 12.128  58.075  29.725  1.00 30.07 ? 986  SER A C   1 
ATOM   7728  O O   . SER A 1 986  ? 12.609  57.652  30.775  1.00 30.71 ? 986  SER A O   1 
ATOM   7729  C CB  . SER A 1 986  ? 12.580  56.763  27.668  1.00 31.42 ? 986  SER A CB  1 
ATOM   7730  O OG  . SER A 1 986  ? 12.025  55.908  26.692  1.00 36.23 ? 986  SER A OG  1 
ATOM   7731  N N   . ARG A 1 987  ? 12.111  59.360  29.409  1.00 28.47 ? 987  ARG A N   1 
ATOM   7732  C CA  . ARG A 1 987  ? 12.649  60.346  30.326  1.00 28.42 ? 987  ARG A CA  1 
ATOM   7733  C C   . ARG A 1 987  ? 11.834  60.384  31.616  1.00 28.29 ? 987  ARG A C   1 
ATOM   7734  O O   . ARG A 1 987  ? 12.388  60.287  32.718  1.00 25.87 ? 987  ARG A O   1 
ATOM   7735  C CB  . ARG A 1 987  ? 12.640  61.728  29.678  1.00 27.41 ? 987  ARG A CB  1 
ATOM   7736  C CG  . ARG A 1 987  ? 13.628  61.879  28.554  1.00 24.94 ? 987  ARG A CG  1 
ATOM   7737  C CD  . ARG A 1 987  ? 13.673  63.309  28.093  1.00 22.76 ? 987  ARG A CD  1 
ATOM   7738  N NE  . ARG A 1 987  ? 14.532  63.482  26.932  1.00 22.54 ? 987  ARG A NE  1 
ATOM   7739  C CZ  . ARG A 1 987  ? 14.595  64.606  26.233  1.00 22.18 ? 987  ARG A CZ  1 
ATOM   7740  N NH1 . ARG A 1 987  ? 13.846  65.634  26.600  1.00 20.81 ? 987  ARG A NH1 1 
ATOM   7741  N NH2 . ARG A 1 987  ? 15.382  64.698  25.166  1.00 22.03 ? 987  ARG A NH2 1 
ATOM   7742  N N   . VAL A 1 988  ? 10.517  60.517  31.463  1.00 28.29 ? 988  VAL A N   1 
ATOM   7743  C CA  . VAL A 1 988  ? 9.607   60.586  32.599  1.00 29.39 ? 988  VAL A CA  1 
ATOM   7744  C C   . VAL A 1 988  ? 9.670   59.347  33.488  1.00 30.28 ? 988  VAL A C   1 
ATOM   7745  O O   . VAL A 1 988  ? 9.595   59.454  34.715  1.00 30.78 ? 988  VAL A O   1 
ATOM   7746  C CB  . VAL A 1 988  ? 8.163   60.820  32.130  1.00 28.75 ? 988  VAL A CB  1 
ATOM   7747  C CG1 . VAL A 1 988  ? 7.214   60.778  33.314  1.00 29.17 ? 988  VAL A CG1 1 
ATOM   7748  C CG2 . VAL A 1 988  ? 8.072   62.162  31.435  1.00 28.68 ? 988  VAL A CG2 1 
ATOM   7749  N N   . LEU A 1 989  ? 9.807   58.177  32.871  1.00 30.58 ? 989  LEU A N   1 
ATOM   7750  C CA  . LEU A 1 989  ? 9.908   56.928  33.618  1.00 29.35 ? 989  LEU A CA  1 
ATOM   7751  C C   . LEU A 1 989  ? 11.216  56.916  34.403  1.00 28.74 ? 989  LEU A C   1 
ATOM   7752  O O   . LEU A 1 989  ? 11.245  56.528  35.567  1.00 29.29 ? 989  LEU A O   1 
ATOM   7753  C CB  . LEU A 1 989  ? 9.845   55.733  32.662  1.00 28.82 ? 989  LEU A CB  1 
ATOM   7754  C CG  . LEU A 1 989  ? 8.419   55.432  32.194  1.00 29.53 ? 989  LEU A CG  1 
ATOM   7755  C CD1 . LEU A 1 989  ? 8.409   54.526  30.966  1.00 27.16 ? 989  LEU A CD1 1 
ATOM   7756  C CD2 . LEU A 1 989  ? 7.671   54.795  33.353  1.00 28.42 ? 989  LEU A CD2 1 
ATOM   7757  N N   . ARG A 1 990  ? 12.298  57.355  33.770  1.00 28.67 ? 990  ARG A N   1 
ATOM   7758  C CA  . ARG A 1 990  ? 13.590  57.396  34.446  1.00 30.56 ? 990  ARG A CA  1 
ATOM   7759  C C   . ARG A 1 990  ? 13.435  58.300  35.663  1.00 30.24 ? 990  ARG A C   1 
ATOM   7760  O O   . ARG A 1 990  ? 13.834  57.948  36.777  1.00 30.28 ? 990  ARG A O   1 
ATOM   7761  C CB  . ARG A 1 990  ? 14.661  57.963  33.515  1.00 31.04 ? 990  ARG A CB  1 
ATOM   7762  C CG  . ARG A 1 990  ? 15.976  57.217  33.565  1.00 36.25 ? 990  ARG A CG  1 
ATOM   7763  C CD  . ARG A 1 990  ? 16.876  57.676  34.690  1.00 39.37 ? 990  ARG A CD  1 
ATOM   7764  N NE  . ARG A 1 990  ? 18.067  56.834  34.803  1.00 42.69 ? 990  ARG A NE  1 
ATOM   7765  C CZ  . ARG A 1 990  ? 19.117  57.129  35.565  1.00 45.74 ? 990  ARG A CZ  1 
ATOM   7766  N NH1 . ARG A 1 990  ? 19.124  58.250  36.276  1.00 48.15 ? 990  ARG A NH1 1 
ATOM   7767  N NH2 . ARG A 1 990  ? 20.160  56.306  35.627  1.00 46.41 ? 990  ARG A NH2 1 
ATOM   7768  N N   . GLY A 1 991  ? 12.840  59.465  35.440  1.00 29.07 ? 991  GLY A N   1 
ATOM   7769  C CA  . GLY A 1 991  ? 12.632  60.388  36.531  1.00 29.58 ? 991  GLY A CA  1 
ATOM   7770  C C   . GLY A 1 991  ? 11.911  59.685  37.664  1.00 30.77 ? 991  GLY A C   1 
ATOM   7771  O O   . GLY A 1 991  ? 12.291  59.826  38.827  1.00 30.90 ? 991  GLY A O   1 
ATOM   7772  N N   . ARG A 1 992  ? 10.885  58.908  37.330  1.00 30.17 ? 992  ARG A N   1 
ATOM   7773  C CA  . ARG A 1 992  ? 10.118  58.204  38.348  1.00 32.10 ? 992  ARG A CA  1 
ATOM   7774  C C   . ARG A 1 992  ? 10.910  57.187  39.166  1.00 31.84 ? 992  ARG A C   1 
ATOM   7775  O O   . ARG A 1 992  ? 10.835  57.186  40.400  1.00 30.38 ? 992  ARG A O   1 
ATOM   7776  C CB  . ARG A 1 992  ? 8.887   57.553  37.723  1.00 33.73 ? 992  ARG A CB  1 
ATOM   7777  C CG  . ARG A 1 992  ? 7.724   58.506  37.654  1.00 37.42 ? 992  ARG A CG  1 
ATOM   7778  C CD  . ARG A 1 992  ? 6.515   57.923  36.960  1.00 41.65 ? 992  ARG A CD  1 
ATOM   7779  N NE  . ARG A 1 992  ? 6.148   56.608  37.469  1.00 45.60 ? 992  ARG A NE  1 
ATOM   7780  C CZ  . ARG A 1 992  ? 4.916   56.107  37.408  1.00 48.22 ? 992  ARG A CZ  1 
ATOM   7781  N NH1 . ARG A 1 992  ? 3.931   56.817  36.868  1.00 47.80 ? 992  ARG A NH1 1 
ATOM   7782  N NH2 . ARG A 1 992  ? 4.670   54.887  37.874  1.00 48.82 ? 992  ARG A NH2 1 
ATOM   7783  N N   . SER A 1 993  ? 11.669  56.324  38.499  1.00 31.49 ? 993  SER A N   1 
ATOM   7784  C CA  . SER A 1 993  ? 12.461  55.348  39.235  1.00 31.78 ? 993  SER A CA  1 
ATOM   7785  C C   . SER A 1 993  ? 13.519  56.106  40.044  1.00 31.90 ? 993  SER A C   1 
ATOM   7786  O O   . SER A 1 993  ? 13.814  55.751  41.185  1.00 32.82 ? 993  SER A O   1 
ATOM   7787  C CB  . SER A 1 993  ? 13.127  54.341  38.281  1.00 31.73 ? 993  SER A CB  1 
ATOM   7788  O OG  . SER A 1 993  ? 14.322  54.844  37.702  1.00 36.23 ? 993  SER A OG  1 
ATOM   7789  N N   . GLU A 1 994  ? 14.081  57.160  39.461  1.00 31.61 ? 994  GLU A N   1 
ATOM   7790  C CA  . GLU A 1 994  ? 15.084  57.943  40.164  1.00 32.60 ? 994  GLU A CA  1 
ATOM   7791  C C   . GLU A 1 994  ? 14.454  58.637  41.363  1.00 32.80 ? 994  GLU A C   1 
ATOM   7792  O O   . GLU A 1 994  ? 15.074  58.782  42.416  1.00 32.34 ? 994  GLU A O   1 
ATOM   7793  C CB  . GLU A 1 994  ? 15.691  58.982  39.222  1.00 33.68 ? 994  GLU A CB  1 
ATOM   7794  C CG  . GLU A 1 994  ? 16.808  58.424  38.358  1.00 36.20 ? 994  GLU A CG  1 
ATOM   7795  C CD  . GLU A 1 994  ? 18.062  58.120  39.158  1.00 36.69 ? 994  GLU A CD  1 
ATOM   7796  O OE1 . GLU A 1 994  ? 18.679  59.068  39.682  1.00 38.77 ? 994  GLU A OE1 1 
ATOM   7797  O OE2 . GLU A 1 994  ? 18.432  56.937  39.268  1.00 38.80 ? 994  GLU A OE2 1 
ATOM   7798  N N   . TRP A 1 995  ? 13.201  59.044  41.197  1.00 32.75 ? 995  TRP A N   1 
ATOM   7799  C CA  . TRP A 1 995  ? 12.474  59.740  42.244  1.00 32.40 ? 995  TRP A CA  1 
ATOM   7800  C C   . TRP A 1 995  ? 12.266  58.896  43.491  1.00 31.61 ? 995  TRP A C   1 
ATOM   7801  O O   . TRP A 1 995  ? 12.368  59.405  44.607  1.00 31.75 ? 995  TRP A O   1 
ATOM   7802  C CB  . TRP A 1 995  ? 11.119  60.226  41.710  1.00 31.64 ? 995  TRP A CB  1 
ATOM   7803  C CG  . TRP A 1 995  ? 10.316  60.995  42.714  1.00 30.66 ? 995  TRP A CG  1 
ATOM   7804  C CD1 . TRP A 1 995  ? 9.203   60.564  43.379  1.00 31.90 ? 995  TRP A CD1 1 
ATOM   7805  C CD2 . TRP A 1 995  ? 10.560  62.336  43.165  1.00 30.48 ? 995  TRP A CD2 1 
ATOM   7806  N NE1 . TRP A 1 995  ? 8.735   61.555  44.216  1.00 31.66 ? 995  TRP A NE1 1 
ATOM   7807  C CE2 . TRP A 1 995  ? 9.552   62.650  44.109  1.00 31.99 ? 995  TRP A CE2 1 
ATOM   7808  C CE3 . TRP A 1 995  ? 11.534  63.298  42.869  1.00 29.34 ? 995  TRP A CE3 1 
ATOM   7809  C CZ2 . TRP A 1 995  ? 9.488   63.901  44.758  1.00 30.77 ? 995  TRP A CZ2 1 
ATOM   7810  C CZ3 . TRP A 1 995  ? 11.470  64.541  43.514  1.00 30.30 ? 995  TRP A CZ3 1 
ATOM   7811  C CH2 . TRP A 1 995  ? 10.454  64.826  44.450  1.00 30.80 ? 995  TRP A CH2 1 
ATOM   7812  N N   . GLU A 1 996  ? 11.961  57.616  43.301  1.00 31.27 ? 996  GLU A N   1 
ATOM   7813  C CA  . GLU A 1 996  ? 11.741  56.712  44.426  1.00 31.47 ? 996  GLU A CA  1 
ATOM   7814  C C   . GLU A 1 996  ? 13.009  56.577  45.256  1.00 32.37 ? 996  GLU A C   1 
ATOM   7815  O O   . GLU A 1 996  ? 12.958  56.406  46.477  1.00 32.04 ? 996  GLU A O   1 
ATOM   7816  C CB  . GLU A 1 996  ? 11.318  55.324  43.937  1.00 30.71 ? 996  GLU A CB  1 
ATOM   7817  C CG  . GLU A 1 996  ? 9.894   55.240  43.467  1.00 28.94 ? 996  GLU A CG  1 
ATOM   7818  C CD  . GLU A 1 996  ? 8.949   55.860  44.463  1.00 31.67 ? 996  GLU A CD  1 
ATOM   7819  O OE1 . GLU A 1 996  ? 8.975   55.451  45.649  1.00 32.70 ? 996  GLU A OE1 1 
ATOM   7820  O OE2 . GLU A 1 996  ? 8.184   56.762  44.059  1.00 32.93 ? 996  GLU A OE2 1 
ATOM   7821  N N   . LYS A 1 997  ? 14.147  56.673  44.583  1.00 32.05 ? 997  LYS A N   1 
ATOM   7822  C CA  . LYS A 1 997  ? 15.430  56.545  45.242  1.00 33.22 ? 997  LYS A CA  1 
ATOM   7823  C C   . LYS A 1 997  ? 15.903  57.792  45.984  1.00 33.61 ? 997  LYS A C   1 
ATOM   7824  O O   . LYS A 1 997  ? 16.366  57.687  47.115  1.00 35.28 ? 997  LYS A O   1 
ATOM   7825  C CB  . LYS A 1 997  ? 16.486  56.124  44.217  1.00 34.91 ? 997  LYS A CB  1 
ATOM   7826  C CG  . LYS A 1 997  ? 16.178  54.799  43.539  1.00 35.91 ? 997  LYS A CG  1 
ATOM   7827  C CD  . LYS A 1 997  ? 17.163  54.487  42.417  1.00 38.16 ? 997  LYS A CD  1 
ATOM   7828  C CE  . LYS A 1 997  ? 16.761  53.191  41.702  1.00 40.50 ? 997  LYS A CE  1 
ATOM   7829  N NZ  . LYS A 1 997  ? 17.665  52.798  40.580  1.00 40.20 ? 997  LYS A NZ  1 
ATOM   7830  N N   . TYR A 1 998  ? 15.768  58.967  45.373  1.00 33.56 ? 998  TYR A N   1 
ATOM   7831  C CA  . TYR A 1 998  ? 16.254  60.187  46.010  1.00 32.86 ? 998  TYR A CA  1 
ATOM   7832  C C   . TYR A 1 998  ? 15.276  61.270  46.461  1.00 31.40 ? 998  TYR A C   1 
ATOM   7833  O O   . TYR A 1 998  ? 15.639  62.113  47.289  1.00 30.90 ? 998  TYR A O   1 
ATOM   7834  C CB  . TYR A 1 998  ? 17.298  60.861  45.116  1.00 35.98 ? 998  TYR A CB  1 
ATOM   7835  C CG  . TYR A 1 998  ? 18.366  59.934  44.593  1.00 40.54 ? 998  TYR A CG  1 
ATOM   7836  C CD1 . TYR A 1 998  ? 18.159  59.182  43.438  1.00 42.35 ? 998  TYR A CD1 1 
ATOM   7837  C CD2 . TYR A 1 998  ? 19.588  59.809  45.253  1.00 42.24 ? 998  TYR A CD2 1 
ATOM   7838  C CE1 . TYR A 1 998  ? 19.150  58.326  42.950  1.00 44.53 ? 998  TYR A CE1 1 
ATOM   7839  C CE2 . TYR A 1 998  ? 20.586  58.958  44.777  1.00 43.85 ? 998  TYR A CE2 1 
ATOM   7840  C CZ  . TYR A 1 998  ? 20.363  58.220  43.626  1.00 44.76 ? 998  TYR A CZ  1 
ATOM   7841  O OH  . TYR A 1 998  ? 21.350  57.387  43.151  1.00 46.11 ? 998  TYR A OH  1 
ATOM   7842  N N   . GLY A 1 999  ? 14.056  61.271  45.933  1.00 28.40 ? 999  GLY A N   1 
ATOM   7843  C CA  . GLY A 1 999  ? 13.123  62.319  46.303  1.00 27.21 ? 999  GLY A CA  1 
ATOM   7844  C C   . GLY A 1 999  ? 11.816  61.997  47.000  1.00 27.43 ? 999  GLY A C   1 
ATOM   7845  O O   . GLY A 1 999  ? 11.235  62.863  47.651  1.00 28.02 ? 999  GLY A O   1 
ATOM   7846  N N   . ALA A 1 1000 ? 11.338  60.771  46.862  1.00 26.47 ? 1000 ALA A N   1 
ATOM   7847  C CA  . ALA A 1 1000 ? 10.091  60.384  47.496  1.00 25.74 ? 1000 ALA A CA  1 
ATOM   7848  C C   . ALA A 1 1000 ? 10.102  60.707  48.997  1.00 25.98 ? 1000 ALA A C   1 
ATOM   7849  O O   . ALA A 1 1000 ? 11.114  60.532  49.677  1.00 26.98 ? 1000 ALA A O   1 
ATOM   7850  C CB  . ALA A 1 1000 ? 9.837   58.886  47.271  1.00 27.09 ? 1000 ALA A CB  1 
ATOM   7851  N N   . GLY A 1 1001 ? 8.974   61.168  49.524  1.00 24.73 ? 1001 GLY A N   1 
ATOM   7852  C CA  . GLY A 1 1001 ? 8.931   61.491  50.937  1.00 22.69 ? 1001 GLY A CA  1 
ATOM   7853  C C   . GLY A 1 1001 ? 9.344   62.912  51.265  1.00 21.37 ? 1001 GLY A C   1 
ATOM   7854  O O   . GLY A 1 1001 ? 8.758   63.535  52.143  1.00 22.24 ? 1001 GLY A O   1 
ATOM   7855  N N   . ILE A 1 1002 ? 10.351  63.434  50.579  1.00 20.42 ? 1002 ILE A N   1 
ATOM   7856  C CA  . ILE A 1 1002 ? 10.786  64.795  50.848  1.00 20.28 ? 1002 ILE A CA  1 
ATOM   7857  C C   . ILE A 1 1002 ? 9.649   65.783  50.583  1.00 21.00 ? 1002 ILE A C   1 
ATOM   7858  O O   . ILE A 1 1002 ? 9.338   66.613  51.435  1.00 22.50 ? 1002 ILE A O   1 
ATOM   7859  C CB  . ILE A 1 1002 ? 12.019  65.138  50.030  1.00 20.38 ? 1002 ILE A CB  1 
ATOM   7860  C CG1 . ILE A 1 1002 ? 13.150  64.190  50.435  1.00 18.83 ? 1002 ILE A CG1 1 
ATOM   7861  C CG2 . ILE A 1 1002 ? 12.424  66.574  50.287  1.00 19.53 ? 1002 ILE A CG2 1 
ATOM   7862  C CD1 . ILE A 1 1002 ? 14.356  64.214  49.534  1.00 18.81 ? 1002 ILE A CD1 1 
ATOM   7863  N N   . ILE A 1 1003 ? 9.035   65.716  49.408  1.00 20.74 ? 1003 ILE A N   1 
ATOM   7864  C CA  . ILE A 1 1003 ? 7.882   66.566  49.128  1.00 20.71 ? 1003 ILE A CA  1 
ATOM   7865  C C   . ILE A 1 1003 ? 6.838   65.617  48.578  1.00 20.76 ? 1003 ILE A C   1 
ATOM   7866  O O   . ILE A 1 1003 ? 7.172   64.500  48.206  1.00 21.84 ? 1003 ILE A O   1 
ATOM   7867  C CB  . ILE A 1 1003 ? 8.159   67.684  48.099  1.00 19.45 ? 1003 ILE A CB  1 
ATOM   7868  C CG1 . ILE A 1 1003 ? 8.660   67.096  46.782  1.00 20.30 ? 1003 ILE A CG1 1 
ATOM   7869  C CG2 . ILE A 1 1003 ? 9.113   68.678  48.689  1.00 18.70 ? 1003 ILE A CG2 1 
ATOM   7870  C CD1 . ILE A 1 1003 ? 8.606   68.076  45.624  1.00 19.93 ? 1003 ILE A CD1 1 
ATOM   7871  N N   . HIS A 1 1004 ? 5.584   66.047  48.538  1.00 21.64 ? 1004 HIS A N   1 
ATOM   7872  C CA  . HIS A 1 1004 ? 4.508   65.200  48.047  1.00 23.65 ? 1004 HIS A CA  1 
ATOM   7873  C C   . HIS A 1 1004 ? 3.777   65.841  46.873  1.00 24.36 ? 1004 HIS A C   1 
ATOM   7874  O O   . HIS A 1 1004 ? 2.788   65.308  46.389  1.00 25.42 ? 1004 HIS A O   1 
ATOM   7875  C CB  . HIS A 1 1004 ? 3.538   64.907  49.199  1.00 25.28 ? 1004 HIS A CB  1 
ATOM   7876  C CG  . HIS A 1 1004 ? 4.112   64.002  50.248  1.00 28.10 ? 1004 HIS A CG  1 
ATOM   7877  N ND1 . HIS A 1 1004 ? 3.885   62.640  50.264  1.00 27.86 ? 1004 HIS A ND1 1 
ATOM   7878  C CD2 . HIS A 1 1004 ? 4.963   64.251  51.275  1.00 27.74 ? 1004 HIS A CD2 1 
ATOM   7879  C CE1 . HIS A 1 1004 ? 4.571   62.093  51.252  1.00 27.24 ? 1004 HIS A CE1 1 
ATOM   7880  N NE2 . HIS A 1 1004 ? 5.234   63.049  51.881  1.00 26.98 ? 1004 HIS A NE2 1 
ATOM   7881  N N   . ASN A 1 1005 ? 4.312   66.971  46.412  1.00 26.44 ? 1005 ASN A N   1 
ATOM   7882  C CA  . ASN A 1 1005 ? 3.785   67.777  45.298  1.00 27.11 ? 1005 ASN A CA  1 
ATOM   7883  C C   . ASN A 1 1005 ? 4.503   67.592  43.949  1.00 26.94 ? 1005 ASN A C   1 
ATOM   7884  O O   . ASN A 1 1005 ? 4.314   68.407  43.044  1.00 28.47 ? 1005 ASN A O   1 
ATOM   7885  C CB  . ASN A 1 1005 ? 3.951   69.259  45.632  1.00 28.04 ? 1005 ASN A CB  1 
ATOM   7886  C CG  . ASN A 1 1005 ? 2.729   69.869  46.203  1.00 29.61 ? 1005 ASN A CG  1 
ATOM   7887  O OD1 . ASN A 1 1005 ? 1.609   69.525  45.825  1.00 33.72 ? 1005 ASN A OD1 1 
ATOM   7888  N ND2 . ASN A 1 1005 ? 2.923   70.818  47.101  1.00 30.83 ? 1005 ASN A ND2 1 
ATOM   7889  N N   . PRO A 1 1006 ? 5.310   66.533  43.784  1.00 25.86 ? 1006 PRO A N   1 
ATOM   7890  C CA  . PRO A 1 1006 ? 6.024   66.357  42.510  1.00 24.54 ? 1006 PRO A CA  1 
ATOM   7891  C C   . PRO A 1 1006 ? 5.220   66.554  41.235  1.00 21.49 ? 1006 PRO A C   1 
ATOM   7892  O O   . PRO A 1 1006 ? 4.315   65.768  40.937  1.00 19.05 ? 1006 PRO A O   1 
ATOM   7893  C CB  . PRO A 1 1006 ? 6.573   64.928  42.592  1.00 25.85 ? 1006 PRO A CB  1 
ATOM   7894  C CG  . PRO A 1 1006 ? 6.433   64.544  44.034  1.00 28.36 ? 1006 PRO A CG  1 
ATOM   7895  C CD  . PRO A 1 1006 ? 5.188   65.238  44.469  1.00 27.49 ? 1006 PRO A CD  1 
ATOM   7896  N N   . PRO A 1 1007 ? 5.525   67.624  40.481  1.00 20.77 ? 1007 PRO A N   1 
ATOM   7897  C CA  . PRO A 1 1007 ? 4.827   67.906  39.217  1.00 19.94 ? 1007 PRO A CA  1 
ATOM   7898  C C   . PRO A 1 1007 ? 5.318   66.843  38.224  1.00 20.35 ? 1007 PRO A C   1 
ATOM   7899  O O   . PRO A 1 1007 ? 6.488   66.438  38.267  1.00 20.88 ? 1007 PRO A O   1 
ATOM   7900  C CB  . PRO A 1 1007 ? 5.317   69.305  38.857  1.00 18.67 ? 1007 PRO A CB  1 
ATOM   7901  C CG  . PRO A 1 1007 ? 5.613   69.911  40.212  1.00 21.51 ? 1007 PRO A CG  1 
ATOM   7902  C CD  . PRO A 1 1007 ? 6.320   68.787  40.910  1.00 20.01 ? 1007 PRO A CD  1 
ATOM   7903  N N   . SER A 1 1008 ? 4.444   66.361  37.353  1.00 19.30 ? 1008 SER A N   1 
ATOM   7904  C CA  . SER A 1 1008 ? 4.874   65.333  36.413  1.00 21.34 ? 1008 SER A CA  1 
ATOM   7905  C C   . SER A 1 1008 ? 4.063   65.299  35.122  1.00 21.98 ? 1008 SER A C   1 
ATOM   7906  O O   . SER A 1 1008 ? 2.855   65.531  35.138  1.00 22.80 ? 1008 SER A O   1 
ATOM   7907  C CB  . SER A 1 1008 ? 4.800   63.961  37.085  1.00 19.88 ? 1008 SER A CB  1 
ATOM   7908  O OG  . SER A 1 1008 ? 4.994   62.919  36.140  1.00 21.91 ? 1008 SER A OG  1 
ATOM   7909  N N   . LEU A 1 1009 ? 4.722   65.009  34.004  1.00 22.00 ? 1009 LEU A N   1 
ATOM   7910  C CA  . LEU A 1 1009 ? 4.001   64.925  32.746  1.00 24.28 ? 1009 LEU A CA  1 
ATOM   7911  C C   . LEU A 1 1009 ? 2.877   63.900  32.859  1.00 24.72 ? 1009 LEU A C   1 
ATOM   7912  O O   . LEU A 1 1009 ? 1.826   64.099  32.264  1.00 26.09 ? 1009 LEU A O   1 
ATOM   7913  C CB  . LEU A 1 1009 ? 4.931   64.566  31.580  1.00 23.63 ? 1009 LEU A CB  1 
ATOM   7914  C CG  . LEU A 1 1009 ? 5.982   65.621  31.188  1.00 24.95 ? 1009 LEU A CG  1 
ATOM   7915  C CD1 . LEU A 1 1009 ? 6.599   65.223  29.864  1.00 23.34 ? 1009 LEU A CD1 1 
ATOM   7916  C CD2 . LEU A 1 1009 ? 5.360   67.014  31.074  1.00 21.94 ? 1009 LEU A CD2 1 
ATOM   7917  N N   . PHE A 1 1010 ? 3.077   62.820  33.619  1.00 25.91 ? 1010 PHE A N   1 
ATOM   7918  C CA  . PHE A 1 1010 ? 2.013   61.821  33.779  1.00 27.67 ? 1010 PHE A CA  1 
ATOM   7919  C C   . PHE A 1 1010 ? 0.768   62.417  34.443  1.00 28.51 ? 1010 PHE A C   1 
ATOM   7920  O O   . PHE A 1 1010 ? -0.308  61.814  34.414  1.00 29.49 ? 1010 PHE A O   1 
ATOM   7921  C CB  . PHE A 1 1010 ? 2.482   60.619  34.604  1.00 30.14 ? 1010 PHE A CB  1 
ATOM   7922  C CG  . PHE A 1 1010 ? 3.467   59.731  33.895  1.00 34.43 ? 1010 PHE A CG  1 
ATOM   7923  C CD1 . PHE A 1 1010 ? 3.661   59.827  32.522  1.00 35.66 ? 1010 PHE A CD1 1 
ATOM   7924  C CD2 . PHE A 1 1010 ? 4.194   58.780  34.605  1.00 36.87 ? 1010 PHE A CD2 1 
ATOM   7925  C CE1 . PHE A 1 1010 ? 4.571   58.992  31.862  1.00 37.02 ? 1010 PHE A CE1 1 
ATOM   7926  C CE2 . PHE A 1 1010 ? 5.109   57.938  33.956  1.00 37.55 ? 1010 PHE A CE2 1 
ATOM   7927  C CZ  . PHE A 1 1010 ? 5.295   58.045  32.582  1.00 37.39 ? 1010 PHE A CZ  1 
ATOM   7928  N N   . ASP A 1 1011 ? 0.915   63.595  35.047  1.00 28.88 ? 1011 ASP A N   1 
ATOM   7929  C CA  . ASP A 1 1011 ? -0.215  64.265  35.692  1.00 29.90 ? 1011 ASP A CA  1 
ATOM   7930  C C   . ASP A 1 1011 ? -1.042  65.045  34.680  1.00 29.19 ? 1011 ASP A C   1 
ATOM   7931  O O   . ASP A 1 1011 ? -2.220  65.313  34.906  1.00 30.62 ? 1011 ASP A O   1 
ATOM   7932  C CB  . ASP A 1 1011 ? 0.244   65.264  36.765  1.00 31.03 ? 1011 ASP A CB  1 
ATOM   7933  C CG  . ASP A 1 1011 ? 0.797   64.597  38.001  1.00 34.37 ? 1011 ASP A CG  1 
ATOM   7934  O OD1 . ASP A 1 1011 ? 0.406   63.441  38.297  1.00 34.22 ? 1011 ASP A OD1 1 
ATOM   7935  O OD2 . ASP A 1 1011 ? 1.617   65.252  38.691  1.00 36.82 ? 1011 ASP A OD2 1 
ATOM   7936  N N   . VAL A 1 1012 ? -0.422  65.411  33.567  1.00 27.00 ? 1012 VAL A N   1 
ATOM   7937  C CA  . VAL A 1 1012 ? -1.098  66.204  32.559  1.00 25.03 ? 1012 VAL A CA  1 
ATOM   7938  C C   . VAL A 1 1012 ? -2.384  65.599  32.014  1.00 23.75 ? 1012 VAL A C   1 
ATOM   7939  O O   . VAL A 1 1012 ? -3.394  66.295  31.860  1.00 22.38 ? 1012 VAL A O   1 
ATOM   7940  C CB  . VAL A 1 1012 ? -0.127  66.541  31.405  1.00 24.88 ? 1012 VAL A CB  1 
ATOM   7941  C CG1 . VAL A 1 1012 ? -0.847  67.308  30.300  1.00 21.89 ? 1012 VAL A CG1 1 
ATOM   7942  C CG2 . VAL A 1 1012 ? 1.031   67.370  31.960  1.00 22.87 ? 1012 VAL A CG2 1 
ATOM   7943  N N   . PRO A 1 1013 ? -2.381  64.294  31.730  1.00 23.90 ? 1013 PRO A N   1 
ATOM   7944  C CA  . PRO A 1 1013 ? -3.636  63.740  31.202  1.00 24.66 ? 1013 PRO A CA  1 
ATOM   7945  C C   . PRO A 1 1013 ? -4.824  63.971  32.160  1.00 25.60 ? 1013 PRO A C   1 
ATOM   7946  O O   . PRO A 1 1013 ? -5.947  64.265  31.728  1.00 23.76 ? 1013 PRO A O   1 
ATOM   7947  C CB  . PRO A 1 1013 ? -3.300  62.259  31.000  1.00 23.00 ? 1013 PRO A CB  1 
ATOM   7948  C CG  . PRO A 1 1013 ? -1.813  62.269  30.750  1.00 20.63 ? 1013 PRO A CG  1 
ATOM   7949  C CD  . PRO A 1 1013 ? -1.315  63.279  31.765  1.00 22.16 ? 1013 PRO A CD  1 
ATOM   7950  N N   . HIS A 1 1014 ? -4.575  63.851  33.462  1.00 26.81 ? 1014 HIS A N   1 
ATOM   7951  C CA  . HIS A 1 1014 ? -5.646  64.061  34.428  1.00 28.41 ? 1014 HIS A CA  1 
ATOM   7952  C C   . HIS A 1 1014 ? -5.954  65.542  34.564  1.00 27.72 ? 1014 HIS A C   1 
ATOM   7953  O O   . HIS A 1 1014 ? -7.097  65.929  34.808  1.00 26.89 ? 1014 HIS A O   1 
ATOM   7954  C CB  . HIS A 1 1014 ? -5.279  63.457  35.782  1.00 31.20 ? 1014 HIS A CB  1 
ATOM   7955  C CG  . HIS A 1 1014 ? -5.059  61.978  35.733  1.00 35.07 ? 1014 HIS A CG  1 
ATOM   7956  N ND1 . HIS A 1 1014 ? -3.874  61.414  35.304  1.00 38.35 ? 1014 HIS A ND1 1 
ATOM   7957  C CD2 . HIS A 1 1014 ? -5.892  60.943  35.998  1.00 36.48 ? 1014 HIS A CD2 1 
ATOM   7958  C CE1 . HIS A 1 1014 ? -3.988  60.097  35.304  1.00 39.38 ? 1014 HIS A CE1 1 
ATOM   7959  N NE2 . HIS A 1 1014 ? -5.204  59.786  35.721  1.00 40.10 ? 1014 HIS A NE2 1 
ATOM   7960  N N   . LYS A 1 1015 ? -4.933  66.370  34.399  1.00 27.95 ? 1015 LYS A N   1 
ATOM   7961  C CA  . LYS A 1 1015 ? -5.118  67.807  34.485  1.00 30.17 ? 1015 LYS A CA  1 
ATOM   7962  C C   . LYS A 1 1015 ? -6.049  68.234  33.351  1.00 30.07 ? 1015 LYS A C   1 
ATOM   7963  O O   . LYS A 1 1015 ? -6.949  69.054  33.556  1.00 28.42 ? 1015 LYS A O   1 
ATOM   7964  C CB  . LYS A 1 1015 ? -3.769  68.530  34.362  1.00 33.82 ? 1015 LYS A CB  1 
ATOM   7965  C CG  . LYS A 1 1015 ? -2.836  68.377  35.577  1.00 38.53 ? 1015 LYS A CG  1 
ATOM   7966  C CD  . LYS A 1 1015 ? -3.098  69.448  36.644  1.00 42.43 ? 1015 LYS A CD  1 
ATOM   7967  C CE  . LYS A 1 1015 ? -2.123  69.347  37.820  1.00 42.88 ? 1015 LYS A CE  1 
ATOM   7968  N NZ  . LYS A 1 1015 ? -2.389  68.149  38.669  1.00 43.73 ? 1015 LYS A NZ  1 
ATOM   7969  N N   . TRP A 1 1016 ? -5.835  67.671  32.161  1.00 28.90 ? 1016 TRP A N   1 
ATOM   7970  C CA  . TRP A 1 1016 ? -6.664  68.004  31.005  1.00 29.98 ? 1016 TRP A CA  1 
ATOM   7971  C C   . TRP A 1 1016 ? -8.101  67.507  31.185  1.00 32.20 ? 1016 TRP A C   1 
ATOM   7972  O O   . TRP A 1 1016 ? -9.059  68.236  30.910  1.00 31.31 ? 1016 TRP A O   1 
ATOM   7973  C CB  . TRP A 1 1016 ? -6.073  67.415  29.714  1.00 27.92 ? 1016 TRP A CB  1 
ATOM   7974  C CG  . TRP A 1 1016 ? -4.809  68.098  29.232  1.00 26.00 ? 1016 TRP A CG  1 
ATOM   7975  C CD1 . TRP A 1 1016 ? -4.341  69.332  29.603  1.00 24.85 ? 1016 TRP A CD1 1 
ATOM   7976  C CD2 . TRP A 1 1016 ? -3.886  67.601  28.256  1.00 24.97 ? 1016 TRP A CD2 1 
ATOM   7977  N NE1 . TRP A 1 1016 ? -3.187  69.629  28.922  1.00 24.33 ? 1016 TRP A NE1 1 
ATOM   7978  C CE2 . TRP A 1 1016 ? -2.881  68.583  28.090  1.00 25.86 ? 1016 TRP A CE2 1 
ATOM   7979  C CE3 . TRP A 1 1016 ? -3.804  66.416  27.511  1.00 25.21 ? 1016 TRP A CE3 1 
ATOM   7980  C CZ2 . TRP A 1 1016 ? -1.811  68.422  27.195  1.00 26.01 ? 1016 TRP A CZ2 1 
ATOM   7981  C CZ3 . TRP A 1 1016 ? -2.739  66.255  26.621  1.00 26.57 ? 1016 TRP A CZ3 1 
ATOM   7982  C CH2 . TRP A 1 1016 ? -1.753  67.253  26.477  1.00 25.30 ? 1016 TRP A CH2 1 
ATOM   7983  N N   . TYR A 1 1017 ? -8.249  66.268  31.649  1.00 34.00 ? 1017 TYR A N   1 
ATOM   7984  C CA  . TYR A 1 1017 ? -9.570  65.689  31.873  1.00 36.40 ? 1017 TYR A CA  1 
ATOM   7985  C C   . TYR A 1 1017 ? -10.398 66.547  32.813  1.00 37.81 ? 1017 TYR A C   1 
ATOM   7986  O O   . TYR A 1 1017 ? -11.580 66.788  32.578  1.00 38.60 ? 1017 TYR A O   1 
ATOM   7987  C CB  . TYR A 1 1017 ? -9.433  64.294  32.465  1.00 38.01 ? 1017 TYR A CB  1 
ATOM   7988  C CG  . TYR A 1 1017 ? -10.728 63.732  32.985  1.00 40.84 ? 1017 TYR A CG  1 
ATOM   7989  C CD1 . TYR A 1 1017 ? -11.225 64.104  34.232  1.00 42.75 ? 1017 TYR A CD1 1 
ATOM   7990  C CD2 . TYR A 1 1017 ? -11.464 62.829  32.229  1.00 42.18 ? 1017 TYR A CD2 1 
ATOM   7991  C CE1 . TYR A 1 1017 ? -12.425 63.582  34.710  1.00 44.16 ? 1017 TYR A CE1 1 
ATOM   7992  C CE2 . TYR A 1 1017 ? -12.660 62.304  32.697  1.00 42.93 ? 1017 TYR A CE2 1 
ATOM   7993  C CZ  . TYR A 1 1017 ? -13.135 62.683  33.934  1.00 43.70 ? 1017 TYR A CZ  1 
ATOM   7994  O OH  . TYR A 1 1017 ? -14.323 62.163  34.395  1.00 44.80 ? 1017 TYR A OH  1 
ATOM   7995  N N   . GLN A 1 1018 ? -9.756  66.984  33.890  1.00 39.17 ? 1018 GLN A N   1 
ATOM   7996  C CA  . GLN A 1 1018 ? -10.373 67.813  34.910  1.00 40.66 ? 1018 GLN A CA  1 
ATOM   7997  C C   . GLN A 1 1018 ? -10.872 69.093  34.249  1.00 39.13 ? 1018 GLN A C   1 
ATOM   7998  O O   . GLN A 1 1018 ? -12.017 69.509  34.438  1.00 39.03 ? 1018 GLN A O   1 
ATOM   7999  C CB  . GLN A 1 1018 ? -9.322  68.130  35.989  1.00 44.82 ? 1018 GLN A CB  1 
ATOM   8000  C CG  . GLN A 1 1018 ? -9.830  68.744  37.294  1.00 51.68 ? 1018 GLN A CG  1 
ATOM   8001  C CD  . GLN A 1 1018 ? -9.304  67.993  38.532  1.00 56.07 ? 1018 GLN A CD  1 
ATOM   8002  O OE1 . GLN A 1 1018 ? -8.392  67.126  38.419  1.00 57.92 ? 1018 GLN A OE1 1 
ATOM   8003  N NE2 . GLN A 1 1018 ? -9.871  68.319  39.724  1.00 56.64 ? 1018 GLN A NE2 1 
ATOM   8004  N N   . GLY A 1 1019 ? -9.999  69.719  33.471  1.00 37.98 ? 1019 GLY A N   1 
ATOM   8005  C CA  . GLY A 1 1019 ? -10.367 70.945  32.791  1.00 35.72 ? 1019 GLY A CA  1 
ATOM   8006  C C   . GLY A 1 1019 ? -11.524 70.755  31.831  1.00 34.96 ? 1019 GLY A C   1 
ATOM   8007  O O   . GLY A 1 1019 ? -12.342 71.646  31.675  1.00 35.90 ? 1019 GLY A O   1 
ATOM   8008  N N   . ALA A 1 1020 ? -11.593 69.599  31.179  1.00 34.54 ? 1020 ALA A N   1 
ATOM   8009  C CA  . ALA A 1 1020 ? -12.672 69.332  30.241  1.00 34.37 ? 1020 ALA A CA  1 
ATOM   8010  C C   . ALA A 1 1020 ? -13.950 69.133  31.032  1.00 35.04 ? 1020 ALA A C   1 
ATOM   8011  O O   . ALA A 1 1020 ? -15.051 69.363  30.523  1.00 34.60 ? 1020 ALA A O   1 
ATOM   8012  C CB  . ALA A 1 1020 ? -12.367 68.096  29.419  1.00 33.19 ? 1020 ALA A CB  1 
ATOM   8013  N N   . GLN A 1 1021 ? -13.807 68.696  32.280  1.00 35.07 ? 1021 GLN A N   1 
ATOM   8014  C CA  . GLN A 1 1021 ? -14.973 68.495  33.128  1.00 36.02 ? 1021 GLN A CA  1 
ATOM   8015  C C   . GLN A 1 1021 ? -15.486 69.831  33.630  1.00 35.94 ? 1021 GLN A C   1 
ATOM   8016  O O   . GLN A 1 1021 ? -16.674 70.132  33.496  1.00 36.36 ? 1021 GLN A O   1 
ATOM   8017  C CB  . GLN A 1 1021 ? -14.651 67.606  34.324  1.00 36.49 ? 1021 GLN A CB  1 
ATOM   8018  C CG  . GLN A 1 1021 ? -14.921 66.142  34.090  1.00 40.99 ? 1021 GLN A CG  1 
ATOM   8019  C CD  . GLN A 1 1021 ? -15.154 65.391  35.387  1.00 45.36 ? 1021 GLN A CD  1 
ATOM   8020  O OE1 . GLN A 1 1021 ? -14.255 65.283  36.226  1.00 47.01 ? 1021 GLN A OE1 1 
ATOM   8021  N NE2 . GLN A 1 1021 ? -16.374 64.875  35.566  1.00 46.75 ? 1021 GLN A NE2 1 
ATOM   8022  N N   . GLU A 1 1022 ? -14.587 70.634  34.193  1.00 35.31 ? 1022 GLU A N   1 
ATOM   8023  C CA  . GLU A 1 1022 ? -14.956 71.943  34.725  1.00 36.06 ? 1022 GLU A CA  1 
ATOM   8024  C C   . GLU A 1 1022 ? -15.515 72.878  33.666  1.00 35.75 ? 1022 GLU A C   1 
ATOM   8025  O O   . GLU A 1 1022 ? -16.145 73.883  33.987  1.00 36.20 ? 1022 GLU A O   1 
ATOM   8026  C CB  . GLU A 1 1022 ? -13.748 72.588  35.402  1.00 36.18 ? 1022 GLU A CB  1 
ATOM   8027  C CG  . GLU A 1 1022 ? -13.024 71.607  36.303  1.00 40.85 ? 1022 GLU A CG  1 
ATOM   8028  C CD  . GLU A 1 1022 ? -12.060 72.260  37.274  1.00 43.75 ? 1022 GLU A CD  1 
ATOM   8029  O OE1 . GLU A 1 1022 ? -11.265 73.139  36.851  1.00 44.25 ? 1022 GLU A OE1 1 
ATOM   8030  O OE2 . GLU A 1 1022 ? -12.094 71.870  38.467  1.00 44.23 ? 1022 GLU A OE2 1 
ATOM   8031  N N   . ALA A 1 1023 ? -15.304 72.539  32.400  1.00 37.13 ? 1023 ALA A N   1 
ATOM   8032  C CA  . ALA A 1 1023 ? -15.781 73.375  31.302  1.00 37.66 ? 1023 ALA A CA  1 
ATOM   8033  C C   . ALA A 1 1023 ? -17.254 73.121  31.004  1.00 38.17 ? 1023 ALA A C   1 
ATOM   8034  O O   . ALA A 1 1023 ? -17.937 73.957  30.408  1.00 37.16 ? 1023 ALA A O   1 
ATOM   8035  C CB  . ALA A 1 1023 ? -14.932 73.125  30.054  1.00 36.26 ? 1023 ALA A CB  1 
ATOM   8036  N N   . ALA A 1 1024 ? -17.734 71.956  31.419  1.00 39.79 ? 1024 ALA A N   1 
ATOM   8037  C CA  . ALA A 1 1024 ? -19.122 71.591  31.200  1.00 41.85 ? 1024 ALA A CA  1 
ATOM   8038  C C   . ALA A 1 1024 ? -20.002 72.460  32.098  1.00 43.22 ? 1024 ALA A C   1 
ATOM   8039  O O   . ALA A 1 1024 ? -19.505 73.094  33.035  1.00 42.95 ? 1024 ALA A O   1 
ATOM   8040  C CB  . ALA A 1 1024 ? -19.326 70.114  31.515  1.00 40.57 ? 1024 ALA A CB  1 
ATOM   8041  N N   . ILE A 1 1025 ? -21.300 72.509  31.799  1.00 43.81 ? 1025 ILE A N   1 
ATOM   8042  C CA  . ILE A 1 1025 ? -22.231 73.302  32.596  1.00 44.14 ? 1025 ILE A CA  1 
ATOM   8043  C C   . ILE A 1 1025 ? -22.659 72.482  33.813  1.00 43.65 ? 1025 ILE A C   1 
ATOM   8044  O O   . ILE A 1 1025 ? -23.044 71.308  33.688  1.00 43.09 ? 1025 ILE A O   1 
ATOM   8045  C CB  . ILE A 1 1025 ? -23.483 73.689  31.786  1.00 45.24 ? 1025 ILE A CB  1 
ATOM   8046  C CG1 . ILE A 1 1025 ? -23.085 74.490  30.535  1.00 46.02 ? 1025 ILE A CG1 1 
ATOM   8047  C CG2 . ILE A 1 1025 ? -24.421 74.512  32.655  1.00 45.30 ? 1025 ILE A CG2 1 
ATOM   8048  C CD1 . ILE A 1 1025 ? -22.600 75.940  30.815  1.00 49.23 ? 1025 ILE A CD1 1 
ATOM   8049  N N   . ALA A 1 1026 ? -22.575 73.107  34.985  1.00 42.12 ? 1026 ALA A N   1 
ATOM   8050  C CA  . ALA A 1 1026 ? -22.928 72.462  36.244  1.00 41.78 ? 1026 ALA A CA  1 
ATOM   8051  C C   . ALA A 1 1026 ? -24.355 71.931  36.263  1.00 41.70 ? 1026 ALA A C   1 
ATOM   8052  O O   . ALA A 1 1026 ? -25.246 72.480  35.618  1.00 40.31 ? 1026 ALA A O   1 
ATOM   8053  C CB  . ALA A 1 1026 ? -22.729 73.438  37.400  1.00 41.11 ? 1026 ALA A CB  1 
ATOM   8054  N N   . THR A 1 1027 ? -24.557 70.853  37.011  1.00 42.75 ? 1027 THR A N   1 
ATOM   8055  C CA  . THR A 1 1027 ? -25.872 70.254  37.151  1.00 44.54 ? 1027 THR A CA  1 
ATOM   8056  C C   . THR A 1 1027 ? -26.540 70.825  38.411  1.00 45.61 ? 1027 THR A C   1 
ATOM   8057  O O   . THR A 1 1027 ? -25.854 71.318  39.311  1.00 46.35 ? 1027 THR A O   1 
ATOM   8058  C CB  . THR A 1 1027 ? -25.762 68.731  37.269  1.00 44.95 ? 1027 THR A CB  1 
ATOM   8059  O OG1 . THR A 1 1027 ? -27.077 68.162  37.302  1.00 47.62 ? 1027 THR A OG1 1 
ATOM   8060  C CG2 . THR A 1 1027 ? -25.011 68.347  38.528  1.00 44.77 ? 1027 THR A CG2 1 
ATOM   8061  N N   . ARG A 1 1028 ? -27.870 70.764  38.463  1.00 46.04 ? 1028 ARG A N   1 
ATOM   8062  C CA  . ARG A 1 1028 ? -28.646 71.281  39.590  1.00 45.61 ? 1028 ARG A CA  1 
ATOM   8063  C C   . ARG A 1 1028 ? -28.117 70.786  40.930  1.00 43.69 ? 1028 ARG A C   1 
ATOM   8064  O O   . ARG A 1 1028 ? -28.031 71.553  41.890  1.00 41.60 ? 1028 ARG A O   1 
ATOM   8065  C CB  . ARG A 1 1028 ? -30.117 70.881  39.430  1.00 50.10 ? 1028 ARG A CB  1 
ATOM   8066  C CG  . ARG A 1 1028 ? -31.071 71.481  40.465  1.00 55.52 ? 1028 ARG A CG  1 
ATOM   8067  C CD  . ARG A 1 1028 ? -32.533 71.323  40.021  1.00 60.46 ? 1028 ARG A CD  1 
ATOM   8068  N NE  . ARG A 1 1028 ? -33.494 71.878  40.981  1.00 64.77 ? 1028 ARG A NE  1 
ATOM   8069  C CZ  . ARG A 1 1028 ? -34.808 71.962  40.764  1.00 66.41 ? 1028 ARG A CZ  1 
ATOM   8070  N NH1 . ARG A 1 1028 ? -35.319 71.529  39.614  1.00 66.75 ? 1028 ARG A NH1 1 
ATOM   8071  N NH2 . ARG A 1 1028 ? -35.615 72.470  41.696  1.00 66.09 ? 1028 ARG A NH2 1 
ATOM   8072  N N   . GLU A 1 1029 ? -27.767 69.502  40.983  1.00 41.95 ? 1029 GLU A N   1 
ATOM   8073  C CA  . GLU A 1 1029 ? -27.236 68.888  42.198  1.00 40.90 ? 1029 GLU A CA  1 
ATOM   8074  C C   . GLU A 1 1029 ? -25.894 69.497  42.539  1.00 38.35 ? 1029 GLU A C   1 
ATOM   8075  O O   . GLU A 1 1029 ? -25.619 69.809  43.689  1.00 39.64 ? 1029 GLU A O   1 
ATOM   8076  C CB  . GLU A 1 1029 ? -27.041 67.379  42.018  1.00 44.07 ? 1029 GLU A CB  1 
ATOM   8077  C CG  . GLU A 1 1029 ? -28.267 66.630  41.533  1.00 49.71 ? 1029 GLU A CG  1 
ATOM   8078  C CD  . GLU A 1 1029 ? -28.575 66.903  40.071  1.00 53.25 ? 1029 GLU A CD  1 
ATOM   8079  O OE1 . GLU A 1 1029 ? -27.771 66.470  39.209  1.00 54.35 ? 1029 GLU A OE1 1 
ATOM   8080  O OE2 . GLU A 1 1029 ? -29.614 67.552  39.787  1.00 55.15 ? 1029 GLU A OE2 1 
ATOM   8081  N N   . GLU A 1 1030 ? -25.049 69.651  41.531  1.00 35.73 ? 1030 GLU A N   1 
ATOM   8082  C CA  . GLU A 1 1030 ? -23.736 70.217  41.741  1.00 32.83 ? 1030 GLU A CA  1 
ATOM   8083  C C   . GLU A 1 1030 ? -23.799 71.605  42.340  1.00 30.99 ? 1030 GLU A C   1 
ATOM   8084  O O   . GLU A 1 1030 ? -23.015 71.934  43.225  1.00 28.67 ? 1030 GLU A O   1 
ATOM   8085  C CB  . GLU A 1 1030 ? -22.960 70.230  40.429  1.00 34.27 ? 1030 GLU A CB  1 
ATOM   8086  C CG  . GLU A 1 1030 ? -22.204 68.931  40.198  1.00 35.65 ? 1030 GLU A CG  1 
ATOM   8087  C CD  . GLU A 1 1030 ? -21.743 68.745  38.763  1.00 38.63 ? 1030 GLU A CD  1 
ATOM   8088  O OE1 . GLU A 1 1030 ? -21.104 67.702  38.494  1.00 40.09 ? 1030 GLU A OE1 1 
ATOM   8089  O OE2 . GLU A 1 1030 ? -22.019 69.624  37.907  1.00 38.21 ? 1030 GLU A OE2 1 
ATOM   8090  N N   . LEU A 1 1031 ? -24.735 72.415  41.863  1.00 30.49 ? 1031 LEU A N   1 
ATOM   8091  C CA  . LEU A 1 1031 ? -24.895 73.773  42.370  1.00 30.42 ? 1031 LEU A CA  1 
ATOM   8092  C C   . LEU A 1 1031 ? -25.339 73.726  43.818  1.00 31.09 ? 1031 LEU A C   1 
ATOM   8093  O O   . LEU A 1 1031 ? -24.900 74.532  44.638  1.00 29.92 ? 1031 LEU A O   1 
ATOM   8094  C CB  . LEU A 1 1031 ? -25.927 74.538  41.546  1.00 30.00 ? 1031 LEU A CB  1 
ATOM   8095  C CG  . LEU A 1 1031 ? -25.507 74.899  40.120  1.00 31.41 ? 1031 LEU A CG  1 
ATOM   8096  C CD1 . LEU A 1 1031 ? -26.721 75.349  39.341  1.00 31.33 ? 1031 LEU A CD1 1 
ATOM   8097  C CD2 . LEU A 1 1031 ? -24.452 75.988  40.140  1.00 31.26 ? 1031 LEU A CD2 1 
ATOM   8098  N N   . ALA A 1 1032 ? -26.211 72.771  44.126  1.00 31.90 ? 1032 ALA A N   1 
ATOM   8099  C CA  . ALA A 1 1032 ? -26.722 72.605  45.477  1.00 31.78 ? 1032 ALA A CA  1 
ATOM   8100  C C   . ALA A 1 1032 ? -25.618 72.143  46.419  1.00 32.41 ? 1032 ALA A C   1 
ATOM   8101  O O   . ALA A 1 1032 ? -25.609 72.512  47.593  1.00 33.92 ? 1032 ALA A O   1 
ATOM   8102  C CB  . ALA A 1 1032 ? -27.864 71.603  45.484  1.00 31.09 ? 1032 ALA A CB  1 
ATOM   8103  N N   . GLU A 1 1033 ? -24.689 71.340  45.910  1.00 32.15 ? 1033 GLU A N   1 
ATOM   8104  C CA  . GLU A 1 1033 ? -23.602 70.849  46.740  1.00 33.90 ? 1033 GLU A CA  1 
ATOM   8105  C C   . GLU A 1 1033 ? -22.640 71.967  47.073  1.00 33.18 ? 1033 GLU A C   1 
ATOM   8106  O O   . GLU A 1 1033 ? -22.068 71.999  48.158  1.00 32.36 ? 1033 GLU A O   1 
ATOM   8107  C CB  . GLU A 1 1033 ? -22.844 69.719  46.047  1.00 37.16 ? 1033 GLU A CB  1 
ATOM   8108  C CG  . GLU A 1 1033 ? -22.781 68.448  46.888  1.00 42.45 ? 1033 GLU A CG  1 
ATOM   8109  C CD  . GLU A 1 1033 ? -22.219 68.688  48.287  1.00 45.79 ? 1033 GLU A CD  1 
ATOM   8110  O OE1 . GLU A 1 1033 ? -20.980 68.612  48.457  1.00 47.03 ? 1033 GLU A OE1 1 
ATOM   8111  O OE2 . GLU A 1 1033 ? -23.017 68.958  49.218  1.00 46.88 ? 1033 GLU A OE2 1 
ATOM   8112  N N   . MET A 1 1034 ? -22.461 72.883  46.132  1.00 33.74 ? 1034 MET A N   1 
ATOM   8113  C CA  . MET A 1 1034 ? -21.568 74.015  46.343  1.00 34.61 ? 1034 MET A CA  1 
ATOM   8114  C C   . MET A 1 1034 ? -22.107 74.869  47.496  1.00 32.90 ? 1034 MET A C   1 
ATOM   8115  O O   . MET A 1 1034 ? -21.342 75.347  48.339  1.00 32.55 ? 1034 MET A O   1 
ATOM   8116  C CB  . MET A 1 1034 ? -21.467 74.860  45.067  1.00 36.16 ? 1034 MET A CB  1 
ATOM   8117  C CG  . MET A 1 1034 ? -20.607 76.094  45.231  1.00 40.10 ? 1034 MET A CG  1 
ATOM   8118  S SD  . MET A 1 1034 ? -20.695 77.216  43.823  1.00 46.15 ? 1034 MET A SD  1 
ATOM   8119  C CE  . MET A 1 1034 ? -22.158 78.226  44.289  1.00 42.12 ? 1034 MET A CE  1 
ATOM   8120  N N   . ASP A 1 1035 ? -23.427 75.045  47.527  1.00 30.15 ? 1035 ASP A N   1 
ATOM   8121  C CA  . ASP A 1 1035 ? -24.064 75.830  48.574  1.00 28.95 ? 1035 ASP A CA  1 
ATOM   8122  C C   . ASP A 1 1035 ? -23.907 75.131  49.910  1.00 27.67 ? 1035 ASP A C   1 
ATOM   8123  O O   . ASP A 1 1035 ? -23.557 75.755  50.903  1.00 25.82 ? 1035 ASP A O   1 
ATOM   8124  C CB  . ASP A 1 1035 ? -25.552 76.048  48.272  1.00 28.12 ? 1035 ASP A CB  1 
ATOM   8125  C CG  . ASP A 1 1035 ? -25.781 76.972  47.083  1.00 30.12 ? 1035 ASP A CG  1 
ATOM   8126  O OD1 . ASP A 1 1035 ? -24.842 77.688  46.677  1.00 32.15 ? 1035 ASP A OD1 1 
ATOM   8127  O OD2 . ASP A 1 1035 ? -26.908 77.003  46.551  1.00 32.85 ? 1035 ASP A OD2 1 
ATOM   8128  N N   . GLU A 1 1036 ? -24.161 73.829  49.932  1.00 29.30 ? 1036 GLU A N   1 
ATOM   8129  C CA  . GLU A 1 1036 ? -24.027 73.066  51.164  1.00 30.55 ? 1036 GLU A CA  1 
ATOM   8130  C C   . GLU A 1 1036 ? -22.592 73.166  51.690  1.00 29.16 ? 1036 GLU A C   1 
ATOM   8131  O O   . GLU A 1 1036 ? -22.378 73.249  52.895  1.00 28.97 ? 1036 GLU A O   1 
ATOM   8132  C CB  . GLU A 1 1036 ? -24.416 71.602  50.930  1.00 32.83 ? 1036 GLU A CB  1 
ATOM   8133  C CG  . GLU A 1 1036 ? -24.411 70.748  52.198  1.00 39.59 ? 1036 GLU A CG  1 
ATOM   8134  C CD  . GLU A 1 1036 ? -25.048 71.462  53.397  1.00 44.41 ? 1036 GLU A CD  1 
ATOM   8135  O OE1 . GLU A 1 1036 ? -26.167 72.018  53.245  1.00 45.95 ? 1036 GLU A OE1 1 
ATOM   8136  O OE2 . GLU A 1 1036 ? -24.427 71.462  54.491  1.00 44.49 ? 1036 GLU A OE2 1 
ATOM   8137  N N   . THR A 1 1037 ? -21.615 73.169  50.783  1.00 27.91 ? 1037 THR A N   1 
ATOM   8138  C CA  . THR A 1 1037 ? -20.217 73.285  51.172  1.00 27.33 ? 1037 THR A CA  1 
ATOM   8139  C C   . THR A 1 1037 ? -19.999 74.646  51.823  1.00 27.46 ? 1037 THR A C   1 
ATOM   8140  O O   . THR A 1 1037 ? -19.256 74.761  52.795  1.00 26.37 ? 1037 THR A O   1 
ATOM   8141  C CB  . THR A 1 1037 ? -19.266 73.157  49.954  1.00 28.54 ? 1037 THR A CB  1 
ATOM   8142  O OG1 . THR A 1 1037 ? -19.306 71.814  49.447  1.00 28.46 ? 1037 THR A OG1 1 
ATOM   8143  C CG2 . THR A 1 1037 ? -17.821 73.497  50.360  1.00 27.19 ? 1037 THR A CG2 1 
ATOM   8144  N N   . LEU A 1 1038 ? -20.645 75.672  51.274  1.00 28.39 ? 1038 LEU A N   1 
ATOM   8145  C CA  . LEU A 1 1038 ? -20.547 77.032  51.807  1.00 28.89 ? 1038 LEU A CA  1 
ATOM   8146  C C   . LEU A 1 1038 ? -21.155 77.105  53.207  1.00 29.38 ? 1038 LEU A C   1 
ATOM   8147  O O   . LEU A 1 1038 ? -20.515 77.608  54.130  1.00 29.40 ? 1038 LEU A O   1 
ATOM   8148  C CB  . LEU A 1 1038 ? -21.276 78.027  50.901  1.00 28.97 ? 1038 LEU A CB  1 
ATOM   8149  C CG  . LEU A 1 1038 ? -20.477 79.165  50.258  1.00 30.15 ? 1038 LEU A CG  1 
ATOM   8150  C CD1 . LEU A 1 1038 ? -21.467 80.161  49.698  1.00 30.33 ? 1038 LEU A CD1 1 
ATOM   8151  C CD2 . LEU A 1 1038 ? -19.561 79.861  51.262  1.00 30.31 ? 1038 LEU A CD2 1 
ATOM   8152  N N   . MET A 1 1039 ? -22.388 76.612  53.359  1.00 28.37 ? 1039 MET A N   1 
ATOM   8153  C CA  . MET A 1 1039 ? -23.059 76.615  54.659  1.00 29.40 ? 1039 MET A CA  1 
ATOM   8154  C C   . MET A 1 1039 ? -22.305 75.781  55.695  1.00 28.11 ? 1039 MET A C   1 
ATOM   8155  O O   . MET A 1 1039 ? -22.335 76.070  56.888  1.00 27.34 ? 1039 MET A O   1 
ATOM   8156  C CB  . MET A 1 1039 ? -24.493 76.087  54.538  1.00 33.12 ? 1039 MET A CB  1 
ATOM   8157  C CG  . MET A 1 1039 ? -25.449 77.036  53.837  1.00 39.28 ? 1039 MET A CG  1 
ATOM   8158  S SD  . MET A 1 1039 ? -25.402 78.727  54.536  1.00 48.99 ? 1039 MET A SD  1 
ATOM   8159  C CE  . MET A 1 1039 ? -26.642 78.600  55.893  1.00 47.77 ? 1039 MET A CE  1 
ATOM   8160  N N   . ARG A 1 1040 ? -21.620 74.744  55.244  1.00 26.68 ? 1040 ARG A N   1 
ATOM   8161  C CA  . ARG A 1 1040 ? -20.891 73.916  56.173  1.00 26.30 ? 1040 ARG A CA  1 
ATOM   8162  C C   . ARG A 1 1040 ? -19.739 74.718  56.752  1.00 25.52 ? 1040 ARG A C   1 
ATOM   8163  O O   . ARG A 1 1040 ? -19.489 74.677  57.959  1.00 24.64 ? 1040 ARG A O   1 
ATOM   8164  C CB  . ARG A 1 1040 ? -20.365 72.665  55.473  1.00 29.30 ? 1040 ARG A CB  1 
ATOM   8165  C CG  . ARG A 1 1040 ? -19.941 71.532  56.420  1.00 33.44 ? 1040 ARG A CG  1 
ATOM   8166  C CD  . ARG A 1 1040 ? -19.541 70.308  55.617  1.00 37.63 ? 1040 ARG A CD  1 
ATOM   8167  N NE  . ARG A 1 1040 ? -20.439 70.145  54.471  1.00 41.14 ? 1040 ARG A NE  1 
ATOM   8168  C CZ  . ARG A 1 1040 ? -20.199 69.354  53.429  1.00 42.38 ? 1040 ARG A CZ  1 
ATOM   8169  N NH1 . ARG A 1 1040 ? -19.083 68.636  53.382  1.00 43.58 ? 1040 ARG A NH1 1 
ATOM   8170  N NH2 . ARG A 1 1040 ? -21.062 69.304  52.419  1.00 42.25 ? 1040 ARG A NH2 1 
ATOM   8171  N N   . ALA A 1 1041 ? -19.051 75.462  55.892  1.00 23.61 ? 1041 ALA A N   1 
ATOM   8172  C CA  . ALA A 1 1041 ? -17.916 76.256  56.328  1.00 23.97 ? 1041 ALA A CA  1 
ATOM   8173  C C   . ALA A 1 1041 ? -18.314 77.389  57.261  1.00 23.54 ? 1041 ALA A C   1 
ATOM   8174  O O   . ALA A 1 1041 ? -17.525 77.796  58.104  1.00 23.86 ? 1041 ALA A O   1 
ATOM   8175  C CB  . ALA A 1 1041 ? -17.161 76.808  55.123  1.00 25.50 ? 1041 ALA A CB  1 
ATOM   8176  N N   . ARG A 1 1042 ? -19.532 77.894  57.115  1.00 23.54 ? 1042 ARG A N   1 
ATOM   8177  C CA  . ARG A 1 1042 ? -20.005 78.975  57.970  1.00 26.04 ? 1042 ARG A CA  1 
ATOM   8178  C C   . ARG A 1 1042 ? -20.486 78.434  59.319  1.00 28.61 ? 1042 ARG A C   1 
ATOM   8179  O O   . ARG A 1 1042 ? -20.471 79.153  60.330  1.00 30.49 ? 1042 ARG A O   1 
ATOM   8180  C CB  . ARG A 1 1042 ? -21.150 79.744  57.289  1.00 24.45 ? 1042 ARG A CB  1 
ATOM   8181  C CG  . ARG A 1 1042 ? -21.680 80.921  58.087  1.00 19.31 ? 1042 ARG A CG  1 
ATOM   8182  C CD  . ARG A 1 1042 ? -22.998 81.395  57.513  1.00 20.06 ? 1042 ARG A CD  1 
ATOM   8183  N NE  . ARG A 1 1042 ? -23.687 82.322  58.414  1.00 21.90 ? 1042 ARG A NE  1 
ATOM   8184  C CZ  . ARG A 1 1042 ? -23.440 83.630  58.501  1.00 22.17 ? 1042 ARG A CZ  1 
ATOM   8185  N NH1 . ARG A 1 1042 ? -22.513 84.200  57.731  1.00 19.90 ? 1042 ARG A NH1 1 
ATOM   8186  N NH2 . ARG A 1 1042 ? -24.115 84.371  59.374  1.00 21.54 ? 1042 ARG A NH2 1 
ATOM   8187  N N   . ARG A 1 1043 ? -20.911 77.172  59.336  1.00 29.14 ? 1043 ARG A N   1 
ATOM   8188  C CA  . ARG A 1 1043 ? -21.396 76.562  60.567  1.00 29.92 ? 1043 ARG A CA  1 
ATOM   8189  C C   . ARG A 1 1043 ? -20.292 75.949  61.421  1.00 28.09 ? 1043 ARG A C   1 
ATOM   8190  O O   . ARG A 1 1043 ? -20.397 75.935  62.640  1.00 27.69 ? 1043 ARG A O   1 
ATOM   8191  C CB  . ARG A 1 1043 ? -22.464 75.508  60.255  1.00 32.54 ? 1043 ARG A CB  1 
ATOM   8192  C CG  . ARG A 1 1043 ? -23.804 76.103  59.832  1.00 38.92 ? 1043 ARG A CG  1 
ATOM   8193  C CD  . ARG A 1 1043 ? -24.844 75.028  59.557  1.00 42.49 ? 1043 ARG A CD  1 
ATOM   8194  N NE  . ARG A 1 1043 ? -24.435 74.177  58.444  1.00 48.36 ? 1043 ARG A NE  1 
ATOM   8195  C CZ  . ARG A 1 1043 ? -25.170 73.192  57.939  1.00 50.06 ? 1043 ARG A CZ  1 
ATOM   8196  N NH1 . ARG A 1 1043 ? -26.370 72.924  58.448  1.00 50.51 ? 1043 ARG A NH1 1 
ATOM   8197  N NH2 . ARG A 1 1043 ? -24.701 72.474  56.927  1.00 50.53 ? 1043 ARG A NH2 1 
ATOM   8198  N N   . HIS A 1 1044 ? -19.241 75.455  60.777  1.00 26.87 ? 1044 HIS A N   1 
ATOM   8199  C CA  . HIS A 1 1044 ? -18.107 74.834  61.466  1.00 27.58 ? 1044 HIS A CA  1 
ATOM   8200  C C   . HIS A 1 1044 ? -17.407 75.851  62.372  1.00 26.27 ? 1044 HIS A C   1 
ATOM   8201  O O   . HIS A 1 1044 ? -17.438 77.047  62.110  1.00 26.61 ? 1044 HIS A O   1 
ATOM   8202  C CB  . HIS A 1 1044 ? -17.124 74.274  60.413  1.00 31.21 ? 1044 HIS A CB  1 
ATOM   8203  C CG  . HIS A 1 1044 ? -15.968 73.497  60.982  1.00 35.67 ? 1044 HIS A CG  1 
ATOM   8204  N ND1 . HIS A 1 1044 ? -14.766 74.085  61.322  1.00 36.50 ? 1044 HIS A ND1 1 
ATOM   8205  C CD2 . HIS A 1 1044 ? -15.820 72.170  61.227  1.00 36.39 ? 1044 HIS A CD2 1 
ATOM   8206  C CE1 . HIS A 1 1044 ? -13.926 73.153  61.746  1.00 37.32 ? 1044 HIS A CE1 1 
ATOM   8207  N NE2 . HIS A 1 1044 ? -14.540 71.984  61.698  1.00 36.06 ? 1044 HIS A NE2 1 
ATOM   8208  N N   . SER A 1 1045 ? -16.788 75.373  63.444  1.00 23.63 ? 1045 SER A N   1 
ATOM   8209  C CA  . SER A 1 1045 ? -16.078 76.244  64.372  1.00 22.36 ? 1045 SER A CA  1 
ATOM   8210  C C   . SER A 1 1045 ? -14.582 75.961  64.255  1.00 21.11 ? 1045 SER A C   1 
ATOM   8211  O O   . SER A 1 1045 ? -14.179 74.815  64.313  1.00 24.42 ? 1045 SER A O   1 
ATOM   8212  C CB  . SER A 1 1045 ? -16.557 75.965  65.792  1.00 21.63 ? 1045 SER A CB  1 
ATOM   8213  O OG  . SER A 1 1045 ? -15.740 76.614  66.740  1.00 25.00 ? 1045 SER A OG  1 
ATOM   8214  N N   . TYR A 1 1046 ? -13.755 76.991  64.104  1.00 20.07 ? 1046 TYR A N   1 
ATOM   8215  C CA  . TYR A 1 1046 ? -12.305 76.790  63.951  1.00 18.89 ? 1046 TYR A CA  1 
ATOM   8216  C C   . TYR A 1 1046 ? -11.477 77.187  65.175  1.00 18.90 ? 1046 TYR A C   1 
ATOM   8217  O O   . TYR A 1 1046 ? -11.971 77.818  66.108  1.00 20.63 ? 1046 TYR A O   1 
ATOM   8218  C CB  . TYR A 1 1046 ? -11.800 77.591  62.748  1.00 16.71 ? 1046 TYR A CB  1 
ATOM   8219  C CG  . TYR A 1 1046 ? -12.576 77.338  61.489  1.00 15.64 ? 1046 TYR A CG  1 
ATOM   8220  C CD1 . TYR A 1 1046 ? -12.211 76.309  60.615  1.00 16.23 ? 1046 TYR A CD1 1 
ATOM   8221  C CD2 . TYR A 1 1046 ? -13.717 78.092  61.191  1.00 15.73 ? 1046 TYR A CD2 1 
ATOM   8222  C CE1 . TYR A 1 1046 ? -12.967 76.033  59.475  1.00 15.43 ? 1046 TYR A CE1 1 
ATOM   8223  C CE2 . TYR A 1 1046 ? -14.485 77.825  60.059  1.00 13.92 ? 1046 TYR A CE2 1 
ATOM   8224  C CZ  . TYR A 1 1046 ? -14.106 76.794  59.212  1.00 15.14 ? 1046 TYR A CZ  1 
ATOM   8225  O OH  . TYR A 1 1046 ? -14.893 76.481  58.135  1.00 17.79 ? 1046 TYR A OH  1 
ATOM   8226  N N   . SER A 1 1047 ? -10.198 76.844  65.153  1.00 18.21 ? 1047 SER A N   1 
ATOM   8227  C CA  . SER A 1 1047 ? -9.326  77.193  66.263  1.00 18.14 ? 1047 SER A CA  1 
ATOM   8228  C C   . SER A 1 1047 ? -7.999  77.836  65.798  1.00 18.12 ? 1047 SER A C   1 
ATOM   8229  O O   . SER A 1 1047 ? -7.090  78.072  66.601  1.00 19.96 ? 1047 SER A O   1 
ATOM   8230  C CB  . SER A 1 1047 ? -9.051  75.944  67.086  1.00 17.49 ? 1047 SER A CB  1 
ATOM   8231  O OG  . SER A 1 1047 ? -8.463  74.955  66.265  1.00 20.67 ? 1047 SER A OG  1 
ATOM   8232  N N   . SER A 1 1048 ? -7.890  78.134  64.507  1.00 15.90 ? 1048 SER A N   1 
ATOM   8233  C CA  . SER A 1 1048 ? -6.671  78.745  63.993  1.00 15.11 ? 1048 SER A CA  1 
ATOM   8234  C C   . SER A 1 1048 ? -6.769  79.044  62.500  1.00 15.28 ? 1048 SER A C   1 
ATOM   8235  O O   . SER A 1 1048 ? -7.663  78.549  61.815  1.00 16.83 ? 1048 SER A O   1 
ATOM   8236  C CB  . SER A 1 1048 ? -5.476  77.811  64.230  1.00 13.27 ? 1048 SER A CB  1 
ATOM   8237  O OG  . SER A 1 1048 ? -5.546  76.679  63.376  1.00 10.25 ? 1048 SER A OG  1 
ATOM   8238  N N   . PHE A 1 1049 ? -5.847  79.859  62.003  1.00 14.66 ? 1049 PHE A N   1 
ATOM   8239  C CA  . PHE A 1 1049 ? -5.788  80.176  60.580  1.00 15.78 ? 1049 PHE A CA  1 
ATOM   8240  C C   . PHE A 1 1049 ? -4.967  79.071  59.892  1.00 16.52 ? 1049 PHE A C   1 
ATOM   8241  O O   . PHE A 1 1049 ? -4.671  78.028  60.500  1.00 15.34 ? 1049 PHE A O   1 
ATOM   8242  C CB  . PHE A 1 1049 ? -5.079  81.511  60.373  1.00 16.04 ? 1049 PHE A CB  1 
ATOM   8243  C CG  . PHE A 1 1049 ? -5.845  82.692  60.882  1.00 15.72 ? 1049 PHE A CG  1 
ATOM   8244  C CD1 . PHE A 1 1049 ? -6.976  83.134  60.218  1.00 13.55 ? 1049 PHE A CD1 1 
ATOM   8245  C CD2 . PHE A 1 1049 ? -5.436  83.355  62.036  1.00 13.59 ? 1049 PHE A CD2 1 
ATOM   8246  C CE1 . PHE A 1 1049 ? -7.686  84.217  60.692  1.00 15.61 ? 1049 PHE A CE1 1 
ATOM   8247  C CE2 . PHE A 1 1049 ? -6.138  84.436  62.520  1.00 12.27 ? 1049 PHE A CE2 1 
ATOM   8248  C CZ  . PHE A 1 1049 ? -7.265  84.873  61.854  1.00 15.08 ? 1049 PHE A CZ  1 
ATOM   8249  N N   . SER A 1 1050 ? -4.591  79.309  58.634  1.00 16.30 ? 1050 SER A N   1 
ATOM   8250  C CA  . SER A 1 1050 ? -3.775  78.357  57.876  1.00 16.62 ? 1050 SER A CA  1 
ATOM   8251  C C   . SER A 1 1050 ? -2.441  78.155  58.602  1.00 18.31 ? 1050 SER A C   1 
ATOM   8252  O O   . SER A 1 1050 ? -2.035  78.989  59.413  1.00 19.63 ? 1050 SER A O   1 
ATOM   8253  C CB  . SER A 1 1050 ? -3.479  78.895  56.475  1.00 13.96 ? 1050 SER A CB  1 
ATOM   8254  O OG  . SER A 1 1050 ? -2.516  79.938  56.519  1.00 12.96 ? 1050 SER A OG  1 
ATOM   8255  N N   . LYS A 1 1051 ? -1.747  77.065  58.311  1.00 18.58 ? 1051 LYS A N   1 
ATOM   8256  C CA  . LYS A 1 1051 ? -0.475  76.838  58.970  1.00 19.59 ? 1051 LYS A CA  1 
ATOM   8257  C C   . LYS A 1 1051 ? 0.527   77.919  58.612  1.00 18.12 ? 1051 LYS A C   1 
ATOM   8258  O O   . LYS A 1 1051 ? 1.312   78.328  59.457  1.00 19.27 ? 1051 LYS A O   1 
ATOM   8259  C CB  . LYS A 1 1051 ? 0.065   75.449  58.630  1.00 21.27 ? 1051 LYS A CB  1 
ATOM   8260  C CG  . LYS A 1 1051 ? -0.706  74.345  59.338  1.00 25.42 ? 1051 LYS A CG  1 
ATOM   8261  C CD  . LYS A 1 1051 ? -0.220  72.968  58.940  1.00 30.76 ? 1051 LYS A CD  1 
ATOM   8262  C CE  . LYS A 1 1051 ? -0.839  71.891  59.818  1.00 33.13 ? 1051 LYS A CE  1 
ATOM   8263  N NZ  . LYS A 1 1051 ? -0.398  70.531  59.391  1.00 34.43 ? 1051 LYS A NZ  1 
ATOM   8264  N N   . LEU A 1 1052 ? 0.493   78.404  57.376  1.00 17.59 ? 1052 LEU A N   1 
ATOM   8265  C CA  . LEU A 1 1052 ? 1.423   79.460  56.966  1.00 17.15 ? 1052 LEU A CA  1 
ATOM   8266  C C   . LEU A 1 1052 ? 1.161   80.770  57.708  1.00 15.95 ? 1052 LEU A C   1 
ATOM   8267  O O   . LEU A 1 1052 ? 2.094   81.408  58.184  1.00 15.16 ? 1052 LEU A O   1 
ATOM   8268  C CB  . LEU A 1 1052 ? 1.342   79.701  55.450  1.00 17.19 ? 1052 LEU A CB  1 
ATOM   8269  C CG  . LEU A 1 1052 ? 2.461   79.154  54.541  1.00 17.74 ? 1052 LEU A CG  1 
ATOM   8270  C CD1 . LEU A 1 1052 ? 3.373   78.182  55.285  1.00 15.96 ? 1052 LEU A CD1 1 
ATOM   8271  C CD2 . LEU A 1 1052 ? 1.828   78.494  53.339  1.00 13.61 ? 1052 LEU A CD2 1 
ATOM   8272  N N   . LEU A 1 1053 ? -0.105  81.170  57.818  1.00 14.99 ? 1053 LEU A N   1 
ATOM   8273  C CA  . LEU A 1 1053 ? -0.428  82.404  58.522  1.00 14.44 ? 1053 LEU A CA  1 
ATOM   8274  C C   . LEU A 1 1053 ? -0.081  82.296  60.022  1.00 14.71 ? 1053 LEU A C   1 
ATOM   8275  O O   . LEU A 1 1053 ? 0.412   83.264  60.626  1.00 14.56 ? 1053 LEU A O   1 
ATOM   8276  C CB  . LEU A 1 1053 ? -1.905  82.771  58.313  1.00 14.56 ? 1053 LEU A CB  1 
ATOM   8277  C CG  . LEU A 1 1053 ? -2.447  84.072  58.950  1.00 16.08 ? 1053 LEU A CG  1 
ATOM   8278  C CD1 . LEU A 1 1053 ? -1.498  85.272  58.732  1.00 13.05 ? 1053 LEU A CD1 1 
ATOM   8279  C CD2 . LEU A 1 1053 ? -3.825  84.364  58.353  1.00 15.60 ? 1053 LEU A CD2 1 
ATOM   8280  N N   . GLU A 1 1054 ? -0.314  81.133  60.627  1.00 13.32 ? 1054 GLU A N   1 
ATOM   8281  C CA  . GLU A 1 1054 ? 0.043   80.970  62.033  1.00 14.96 ? 1054 GLU A CA  1 
ATOM   8282  C C   . GLU A 1 1054 ? 1.559   81.167  62.217  1.00 15.80 ? 1054 GLU A C   1 
ATOM   8283  O O   . GLU A 1 1054 ? 2.018   81.620  63.271  1.00 14.97 ? 1054 GLU A O   1 
ATOM   8284  C CB  . GLU A 1 1054 ? -0.362  79.590  62.553  1.00 14.35 ? 1054 GLU A CB  1 
ATOM   8285  C CG  . GLU A 1 1054 ? -1.873  79.386  62.732  1.00 14.83 ? 1054 GLU A CG  1 
ATOM   8286  C CD  . GLU A 1 1054 ? -2.523  80.430  63.616  1.00 16.59 ? 1054 GLU A CD  1 
ATOM   8287  O OE1 . GLU A 1 1054 ? -1.797  81.107  64.378  1.00 18.71 ? 1054 GLU A OE1 1 
ATOM   8288  O OE2 . GLU A 1 1054 ? -3.767  80.567  63.558  1.00 17.96 ? 1054 GLU A OE2 1 
ATOM   8289  N N   . ALA A 1 1055 ? 2.332   80.840  61.185  1.00 14.91 ? 1055 ALA A N   1 
ATOM   8290  C CA  . ALA A 1 1055 ? 3.773   81.014  61.255  1.00 14.03 ? 1055 ALA A CA  1 
ATOM   8291  C C   . ALA A 1 1055 ? 4.203   82.466  61.010  1.00 14.52 ? 1055 ALA A C   1 
ATOM   8292  O O   . ALA A 1 1055 ? 5.129   82.955  61.659  1.00 13.07 ? 1055 ALA A O   1 
ATOM   8293  C CB  . ALA A 1 1055 ? 4.458   80.096  60.265  1.00 14.40 ? 1055 ALA A CB  1 
ATOM   8294  N N   . TYR A 1 1056 ? 3.551   83.166  60.083  1.00 15.27 ? 1056 TYR A N   1 
ATOM   8295  C CA  . TYR A 1 1056 ? 3.937   84.565  59.831  1.00 16.05 ? 1056 TYR A CA  1 
ATOM   8296  C C   . TYR A 1 1056 ? 3.670   85.418  61.073  1.00 16.61 ? 1056 TYR A C   1 
ATOM   8297  O O   . TYR A 1 1056 ? 4.443   86.323  61.391  1.00 14.55 ? 1056 TYR A O   1 
ATOM   8298  C CB  . TYR A 1 1056 ? 3.155   85.183  58.664  1.00 12.80 ? 1056 TYR A CB  1 
ATOM   8299  C CG  . TYR A 1 1056 ? 3.258   84.458  57.344  1.00 13.13 ? 1056 TYR A CG  1 
ATOM   8300  C CD1 . TYR A 1 1056 ? 4.420   83.779  56.977  1.00 13.36 ? 1056 TYR A CD1 1 
ATOM   8301  C CD2 . TYR A 1 1056 ? 2.205   84.504  56.427  1.00 12.88 ? 1056 TYR A CD2 1 
ATOM   8302  C CE1 . TYR A 1 1056 ? 4.532   83.165  55.732  1.00 12.44 ? 1056 TYR A CE1 1 
ATOM   8303  C CE2 . TYR A 1 1056 ? 2.307   83.905  55.183  1.00 14.21 ? 1056 TYR A CE2 1 
ATOM   8304  C CZ  . TYR A 1 1056 ? 3.477   83.235  54.840  1.00 15.18 ? 1056 TYR A CZ  1 
ATOM   8305  O OH  . TYR A 1 1056 ? 3.586   82.653  53.598  1.00 17.32 ? 1056 TYR A OH  1 
ATOM   8306  N N   . LEU A 1 1057 ? 2.565   85.117  61.756  1.00 17.16 ? 1057 LEU A N   1 
ATOM   8307  C CA  . LEU A 1 1057 ? 2.156   85.844  62.954  1.00 19.19 ? 1057 LEU A CA  1 
ATOM   8308  C C   . LEU A 1 1057 ? 3.143   85.793  64.120  1.00 19.55 ? 1057 LEU A C   1 
ATOM   8309  O O   . LEU A 1 1057 ? 3.001   86.543  65.087  1.00 19.84 ? 1057 LEU A O   1 
ATOM   8310  C CB  . LEU A 1 1057 ? 0.785   85.352  63.416  1.00 19.50 ? 1057 LEU A CB  1 
ATOM   8311  C CG  . LEU A 1 1057 ? -0.357  85.916  62.579  1.00 20.28 ? 1057 LEU A CG  1 
ATOM   8312  C CD1 . LEU A 1 1057 ? -1.643  85.173  62.870  1.00 20.66 ? 1057 LEU A CD1 1 
ATOM   8313  C CD2 . LEU A 1 1057 ? -0.496  87.401  62.881  1.00 19.85 ? 1057 LEU A CD2 1 
ATOM   8314  N N   . LEU A 1 1058 ? 4.129   84.904  64.042  1.00 19.34 ? 1058 LEU A N   1 
ATOM   8315  C CA  . LEU A 1 1058 ? 5.144   84.814  65.089  1.00 18.11 ? 1058 LEU A CA  1 
ATOM   8316  C C   . LEU A 1 1058 ? 6.175   85.921  64.873  1.00 17.61 ? 1058 LEU A C   1 
ATOM   8317  O O   . LEU A 1 1058 ? 6.996   86.198  65.743  1.00 17.65 ? 1058 LEU A O   1 
ATOM   8318  C CB  . LEU A 1 1058 ? 5.857   83.466  65.030  1.00 17.28 ? 1058 LEU A CB  1 
ATOM   8319  C CG  . LEU A 1 1058 ? 5.002   82.216  65.216  1.00 16.72 ? 1058 LEU A CG  1 
ATOM   8320  C CD1 . LEU A 1 1058 ? 5.890   80.988  65.085  1.00 11.22 ? 1058 LEU A CD1 1 
ATOM   8321  C CD2 . LEU A 1 1058 ? 4.314   82.258  66.574  1.00 15.47 ? 1058 LEU A CD2 1 
ATOM   8322  N N   . VAL A 1 1059 ? 6.121   86.540  63.698  1.00 18.12 ? 1059 VAL A N   1 
ATOM   8323  C CA  . VAL A 1 1059 ? 7.042   87.599  63.307  1.00 18.00 ? 1059 VAL A CA  1 
ATOM   8324  C C   . VAL A 1 1059 ? 6.483   88.993  63.572  1.00 20.30 ? 1059 VAL A C   1 
ATOM   8325  O O   . VAL A 1 1059 ? 5.416   89.345  63.077  1.00 20.76 ? 1059 VAL A O   1 
ATOM   8326  C CB  . VAL A 1 1059 ? 7.371   87.476  61.822  1.00 15.15 ? 1059 VAL A CB  1 
ATOM   8327  C CG1 . VAL A 1 1059 ? 8.453   88.470  61.426  1.00 10.62 ? 1059 VAL A CG1 1 
ATOM   8328  C CG2 . VAL A 1 1059 ? 7.785   86.062  61.535  1.00 14.23 ? 1059 VAL A CG2 1 
ATOM   8329  N N   . LYS A 1 1060 ? 7.227   89.779  64.348  1.00 22.59 ? 1060 LYS A N   1 
ATOM   8330  C CA  . LYS A 1 1060 ? 6.839   91.137  64.712  1.00 24.44 ? 1060 LYS A CA  1 
ATOM   8331  C C   . LYS A 1 1060 ? 7.834   92.159  64.133  1.00 23.64 ? 1060 LYS A C   1 
ATOM   8332  O O   . LYS A 1 1060 ? 9.021   91.860  63.952  1.00 23.55 ? 1060 LYS A O   1 
ATOM   8333  C CB  . LYS A 1 1060 ? 6.786   91.244  66.237  1.00 27.54 ? 1060 LYS A CB  1 
ATOM   8334  C CG  . LYS A 1 1060 ? 6.132   90.032  66.904  1.00 33.92 ? 1060 LYS A CG  1 
ATOM   8335  C CD  . LYS A 1 1060 ? 6.256   90.087  68.431  1.00 38.09 ? 1060 LYS A CD  1 
ATOM   8336  C CE  . LYS A 1 1060 ? 5.842   88.761  69.088  1.00 40.14 ? 1060 LYS A CE  1 
ATOM   8337  N NZ  . LYS A 1 1060 ? 4.385   88.474  68.943  1.00 42.09 ? 1060 LYS A NZ  1 
ATOM   8338  N N   . TRP A 1 1061 ? 7.351   93.366  63.852  1.00 21.77 ? 1061 TRP A N   1 
ATOM   8339  C CA  . TRP A 1 1061 ? 8.195   94.410  63.276  1.00 18.46 ? 1061 TRP A CA  1 
ATOM   8340  C C   . TRP A 1 1061 ? 8.062   95.752  63.965  1.00 19.89 ? 1061 TRP A C   1 
ATOM   8341  O O   . TRP A 1 1061 ? 7.216   95.943  64.834  1.00 19.90 ? 1061 TRP A O   1 
ATOM   8342  C CB  . TRP A 1 1061 ? 7.847   94.631  61.807  1.00 15.75 ? 1061 TRP A CB  1 
ATOM   8343  C CG  . TRP A 1 1061 ? 7.883   93.404  60.983  1.00 13.38 ? 1061 TRP A CG  1 
ATOM   8344  C CD1 . TRP A 1 1061 ? 6.952   92.405  60.959  1.00 11.23 ? 1061 TRP A CD1 1 
ATOM   8345  C CD2 . TRP A 1 1061 ? 8.926   93.014  60.077  1.00 10.42 ? 1061 TRP A CD2 1 
ATOM   8346  N NE1 . TRP A 1 1061 ? 7.350   91.414  60.088  1.00 13.21 ? 1061 TRP A NE1 1 
ATOM   8347  C CE2 . TRP A 1 1061 ? 8.555   91.764  59.532  1.00 11.46 ? 1061 TRP A CE2 1 
ATOM   8348  C CE3 . TRP A 1 1061 ? 10.130  93.602  59.673  1.00 8.52  ? 1061 TRP A CE3 1 
ATOM   8349  C CZ2 . TRP A 1 1061 ? 9.355   91.084  58.606  1.00 10.51 ? 1061 TRP A CZ2 1 
ATOM   8350  C CZ3 . TRP A 1 1061 ? 10.927  92.932  58.758  1.00 9.44  ? 1061 TRP A CZ3 1 
ATOM   8351  C CH2 . TRP A 1 1061 ? 10.534  91.685  58.230  1.00 12.54 ? 1061 TRP A CH2 1 
ATOM   8352  N N   . ARG A 1 1062 ? 8.931   96.676  63.565  1.00 20.99 ? 1062 ARG A N   1 
ATOM   8353  C CA  . ARG A 1 1062 ? 8.918   98.038  64.066  1.00 22.32 ? 1062 ARG A CA  1 
ATOM   8354  C C   . ARG A 1 1062 ? 8.992   98.956  62.858  1.00 22.53 ? 1062 ARG A C   1 
ATOM   8355  O O   . ARG A 1 1062 ? 9.933   98.885  62.066  1.00 21.33 ? 1062 ARG A O   1 
ATOM   8356  C CB  . ARG A 1 1062 ? 10.105  98.315  64.979  1.00 24.22 ? 1062 ARG A CB  1 
ATOM   8357  C CG  . ARG A 1 1062 ? 9.943   97.805  66.395  1.00 27.94 ? 1062 ARG A CG  1 
ATOM   8358  C CD  . ARG A 1 1062 ? 11.186  98.127  67.210  1.00 30.21 ? 1062 ARG A CD  1 
ATOM   8359  N NE  . ARG A 1 1062 ? 11.436  99.565  67.309  1.00 32.36 ? 1062 ARG A NE  1 
ATOM   8360  C CZ  . ARG A 1 1062 ? 12.549  100.094 67.806  1.00 33.26 ? 1062 ARG A CZ  1 
ATOM   8361  N NH1 . ARG A 1 1062 ? 13.524  99.303  68.247  1.00 33.83 ? 1062 ARG A NH1 1 
ATOM   8362  N NH2 . ARG A 1 1062 ? 12.683  101.411 67.872  1.00 32.60 ? 1062 ARG A NH2 1 
ATOM   8363  N N   . MET A 1 1063 ? 7.982   99.802  62.715  1.00 23.00 ? 1063 MET A N   1 
ATOM   8364  C CA  . MET A 1 1063 ? 7.934   100.741 61.614  1.00 25.34 ? 1063 MET A CA  1 
ATOM   8365  C C   . MET A 1 1063 ? 8.610   102.031 62.046  1.00 26.34 ? 1063 MET A C   1 
ATOM   8366  O O   . MET A 1 1063 ? 8.310   102.567 63.111  1.00 28.06 ? 1063 MET A O   1 
ATOM   8367  C CB  . MET A 1 1063 ? 6.483   100.942 61.205  1.00 24.73 ? 1063 MET A CB  1 
ATOM   8368  C CG  . MET A 1 1063 ? 5.889   99.602  60.826  1.00 28.26 ? 1063 MET A CG  1 
ATOM   8369  S SD  . MET A 1 1063 ? 4.428   99.643  59.818  1.00 31.11 ? 1063 MET A SD  1 
ATOM   8370  C CE  . MET A 1 1063 ? 3.266   99.155  61.032  1.00 32.67 ? 1063 MET A CE  1 
ATOM   8371  N N   . CYS A 1 1064 ? 9.538   102.515 61.227  1.00 26.37 ? 1064 CYS A N   1 
ATOM   8372  C CA  . CYS A 1 1064 ? 10.284  103.710 61.572  1.00 28.47 ? 1064 CYS A CA  1 
ATOM   8373  C C   . CYS A 1 1064 ? 10.179  104.876 60.597  1.00 29.58 ? 1064 CYS A C   1 
ATOM   8374  O O   . CYS A 1 1064 ? 9.104   105.174 60.094  1.00 29.69 ? 1064 CYS A O   1 
ATOM   8375  C CB  . CYS A 1 1064 ? 11.752  103.337 61.798  1.00 29.00 ? 1064 CYS A CB  1 
ATOM   8376  S SG  . CYS A 1 1064 ? 11.973  102.078 63.090  1.00 35.15 ? 1064 CYS A SG  1 
ATOM   8377  N N   . GLU A 1 1065 ? 11.305  105.535 60.340  1.00 31.39 ? 1065 GLU A N   1 
ATOM   8378  C CA  . GLU A 1 1065 ? 11.335  106.706 59.473  1.00 34.20 ? 1065 GLU A CA  1 
ATOM   8379  C C   . GLU A 1 1065 ? 10.658  106.511 58.120  1.00 33.50 ? 1065 GLU A C   1 
ATOM   8380  O O   . GLU A 1 1065 ? 10.730  105.438 57.520  1.00 33.38 ? 1065 GLU A O   1 
ATOM   8381  C CB  . GLU A 1 1065 ? 12.781  107.166 59.222  1.00 38.78 ? 1065 GLU A CB  1 
ATOM   8382  C CG  . GLU A 1 1065 ? 13.766  107.010 60.390  1.00 45.47 ? 1065 GLU A CG  1 
ATOM   8383  C CD  . GLU A 1 1065 ? 14.188  105.558 60.620  1.00 48.93 ? 1065 GLU A CD  1 
ATOM   8384  O OE1 . GLU A 1 1065 ? 14.547  104.868 59.628  1.00 49.68 ? 1065 GLU A OE1 1 
ATOM   8385  O OE2 . GLU A 1 1065 ? 14.167  105.117 61.795  1.00 51.71 ? 1065 GLU A OE2 1 
ATOM   8386  N N   . ALA A 1 1066 ? 10.001  107.564 57.645  1.00 31.54 ? 1066 ALA A N   1 
ATOM   8387  C CA  . ALA A 1 1066 ? 9.354   107.525 56.344  1.00 30.03 ? 1066 ALA A CA  1 
ATOM   8388  C C   . ALA A 1 1066 ? 10.488  107.599 55.330  1.00 28.60 ? 1066 ALA A C   1 
ATOM   8389  O O   . ALA A 1 1066 ? 11.500  108.252 55.579  1.00 26.62 ? 1066 ALA A O   1 
ATOM   8390  C CB  . ALA A 1 1066 ? 8.422   108.719 56.179  1.00 27.50 ? 1066 ALA A CB  1 
ATOM   8391  N N   . ARG A 1 1067 ? 10.329  106.918 54.202  1.00 28.47 ? 1067 ARG A N   1 
ATOM   8392  C CA  . ARG A 1 1067 ? 11.355  106.938 53.166  1.00 29.24 ? 1067 ARG A CA  1 
ATOM   8393  C C   . ARG A 1 1067 ? 11.369  108.295 52.461  1.00 29.52 ? 1067 ARG A C   1 
ATOM   8394  O O   . ARG A 1 1067 ? 10.370  109.003 52.441  1.00 29.33 ? 1067 ARG A O   1 
ATOM   8395  C CB  . ARG A 1 1067 ? 11.087  105.853 52.118  1.00 29.01 ? 1067 ARG A CB  1 
ATOM   8396  C CG  . ARG A 1 1067 ? 11.190  104.422 52.601  1.00 27.42 ? 1067 ARG A CG  1 
ATOM   8397  C CD  . ARG A 1 1067 ? 10.766  103.442 51.497  1.00 27.29 ? 1067 ARG A CD  1 
ATOM   8398  N NE  . ARG A 1 1067 ? 11.493  103.657 50.242  1.00 26.35 ? 1067 ARG A NE  1 
ATOM   8399  C CZ  . ARG A 1 1067 ? 11.499  102.799 49.222  1.00 25.23 ? 1067 ARG A CZ  1 
ATOM   8400  N NH1 . ARG A 1 1067 ? 10.812  101.665 49.315  1.00 25.68 ? 1067 ARG A NH1 1 
ATOM   8401  N NH2 . ARG A 1 1067 ? 12.195  103.062 48.120  1.00 22.43 ? 1067 ARG A NH2 1 
ATOM   8402  N N   . GLU A 1 1068 ? 12.517  108.652 51.893  1.00 30.61 ? 1068 GLU A N   1 
ATOM   8403  C CA  . GLU A 1 1068 ? 12.661  109.898 51.155  1.00 30.80 ? 1068 GLU A CA  1 
ATOM   8404  C C   . GLU A 1 1068 ? 11.995  109.662 49.812  1.00 29.61 ? 1068 GLU A C   1 
ATOM   8405  O O   . GLU A 1 1068 ? 11.838  108.519 49.386  1.00 31.89 ? 1068 GLU A O   1 
ATOM   8406  C CB  . GLU A 1 1068 ? 14.138  110.220 50.938  1.00 33.73 ? 1068 GLU A CB  1 
ATOM   8407  C CG  . GLU A 1 1068 ? 14.807  110.867 52.123  1.00 37.17 ? 1068 GLU A CG  1 
ATOM   8408  C CD  . GLU A 1 1068 ? 14.192  112.215 52.436  1.00 40.34 ? 1068 GLU A CD  1 
ATOM   8409  O OE1 . GLU A 1 1068 ? 14.170  113.079 51.524  1.00 39.47 ? 1068 GLU A OE1 1 
ATOM   8410  O OE2 . GLU A 1 1068 ? 13.729  112.405 53.587  1.00 42.56 ? 1068 GLU A OE2 1 
ATOM   8411  N N   . PRO A 1 1069 ? 11.593  110.729 49.122  1.00 27.55 ? 1069 PRO A N   1 
ATOM   8412  C CA  . PRO A 1 1069 ? 10.946  110.517 47.822  1.00 27.05 ? 1069 PRO A CA  1 
ATOM   8413  C C   . PRO A 1 1069 ? 11.866  109.808 46.823  1.00 25.07 ? 1069 PRO A C   1 
ATOM   8414  O O   . PRO A 1 1069 ? 13.051  110.129 46.737  1.00 24.47 ? 1069 PRO A O   1 
ATOM   8415  C CB  . PRO A 1 1069 ? 10.597  111.939 47.367  1.00 27.76 ? 1069 PRO A CB  1 
ATOM   8416  C CG  . PRO A 1 1069 ? 10.434  112.692 48.670  1.00 28.93 ? 1069 PRO A CG  1 
ATOM   8417  C CD  . PRO A 1 1069 ? 11.576  112.148 49.508  1.00 26.95 ? 1069 PRO A CD  1 
ATOM   8418  N N   . SER A 1 1070 ? 11.317  108.848 46.081  1.00 22.45 ? 1070 SER A N   1 
ATOM   8419  C CA  . SER A 1 1070 ? 12.077  108.127 45.069  1.00 21.30 ? 1070 SER A CA  1 
ATOM   8420  C C   . SER A 1 1070 ? 11.929  108.909 43.780  1.00 20.36 ? 1070 SER A C   1 
ATOM   8421  O O   . SER A 1 1070 ? 12.744  108.778 42.864  1.00 20.94 ? 1070 SER A O   1 
ATOM   8422  C CB  . SER A 1 1070 ? 11.525  106.716 44.858  1.00 22.02 ? 1070 SER A CB  1 
ATOM   8423  O OG  . SER A 1 1070 ? 11.520  105.974 46.067  1.00 27.15 ? 1070 SER A OG  1 
ATOM   8424  N N   . VAL A 1 1071 ? 10.867  109.707 43.712  1.00 19.58 ? 1071 VAL A N   1 
ATOM   8425  C CA  . VAL A 1 1071 ? 10.587  110.548 42.550  1.00 19.24 ? 1071 VAL A CA  1 
ATOM   8426  C C   . VAL A 1 1071 ? 10.018  111.914 42.975  1.00 19.78 ? 1071 VAL A C   1 
ATOM   8427  O O   . VAL A 1 1071 ? 9.320   112.041 43.983  1.00 19.37 ? 1071 VAL A O   1 
ATOM   8428  C CB  . VAL A 1 1071 ? 9.588   109.874 41.567  1.00 20.14 ? 1071 VAL A CB  1 
ATOM   8429  C CG1 . VAL A 1 1071 ? 10.198  108.630 40.961  1.00 18.22 ? 1071 VAL A CG1 1 
ATOM   8430  C CG2 . VAL A 1 1071 ? 8.302   109.533 42.283  1.00 20.11 ? 1071 VAL A CG2 1 
ATOM   8431  N N   . ASP A 1 1072 ? 10.326  112.932 42.183  1.00 19.43 ? 1072 ASP A N   1 
ATOM   8432  C CA  . ASP A 1 1072 ? 9.889   114.296 42.437  1.00 19.60 ? 1072 ASP A CA  1 
ATOM   8433  C C   . ASP A 1 1072 ? 8.376   114.421 42.700  1.00 19.32 ? 1072 ASP A C   1 
ATOM   8434  O O   . ASP A 1 1072 ? 7.555   113.871 41.962  1.00 17.05 ? 1072 ASP A O   1 
ATOM   8435  C CB  . ASP A 1 1072 ? 10.300  115.160 41.240  1.00 19.61 ? 1072 ASP A CB  1 
ATOM   8436  C CG  . ASP A 1 1072 ? 10.311  116.636 41.560  1.00 22.06 ? 1072 ASP A CG  1 
ATOM   8437  O OD1 . ASP A 1 1072 ? 9.231   117.195 41.868  1.00 22.47 ? 1072 ASP A OD1 1 
ATOM   8438  O OD2 . ASP A 1 1072 ? 11.407  117.234 41.503  1.00 23.05 ? 1072 ASP A OD2 1 
ATOM   8439  N N   . LEU A 1 1073 ? 8.020   115.166 43.745  1.00 20.36 ? 1073 LEU A N   1 
ATOM   8440  C CA  . LEU A 1 1073 ? 6.618   115.365 44.123  1.00 22.11 ? 1073 LEU A CA  1 
ATOM   8441  C C   . LEU A 1 1073 ? 5.780   116.245 43.199  1.00 22.90 ? 1073 LEU A C   1 
ATOM   8442  O O   . LEU A 1 1073 ? 4.550   116.262 43.324  1.00 23.82 ? 1073 LEU A O   1 
ATOM   8443  C CB  . LEU A 1 1073 ? 6.530   115.933 45.533  1.00 24.42 ? 1073 LEU A CB  1 
ATOM   8444  C CG  . LEU A 1 1073 ? 6.813   115.000 46.713  1.00 28.19 ? 1073 LEU A CG  1 
ATOM   8445  C CD1 . LEU A 1 1073 ? 8.148   114.286 46.539  1.00 29.55 ? 1073 LEU A CD1 1 
ATOM   8446  C CD2 . LEU A 1 1073 ? 6.815   115.834 47.987  1.00 27.18 ? 1073 LEU A CD2 1 
ATOM   8447  N N   . ARG A 1 1074 ? 6.420   116.986 42.294  1.00 20.95 ? 1074 ARG A N   1 
ATOM   8448  C CA  . ARG A 1 1074 ? 5.674   117.839 41.361  1.00 21.04 ? 1074 ARG A CA  1 
ATOM   8449  C C   . ARG A 1 1074 ? 5.446   117.075 40.058  1.00 21.13 ? 1074 ARG A C   1 
ATOM   8450  O O   . ARG A 1 1074 ? 4.902   117.609 39.089  1.00 23.15 ? 1074 ARG A O   1 
ATOM   8451  C CB  . ARG A 1 1074 ? 6.462   119.118 41.009  1.00 22.28 ? 1074 ARG A CB  1 
ATOM   8452  C CG  . ARG A 1 1074 ? 6.970   119.955 42.178  1.00 22.14 ? 1074 ARG A CG  1 
ATOM   8453  C CD  . ARG A 1 1074 ? 8.489   119.865 42.290  1.00 22.49 ? 1074 ARG A CD  1 
ATOM   8454  N NE  . ARG A 1 1074 ? 9.196   120.580 41.229  1.00 23.19 ? 1074 ARG A NE  1 
ATOM   8455  C CZ  . ARG A 1 1074 ? 10.515  120.530 41.044  1.00 23.14 ? 1074 ARG A CZ  1 
ATOM   8456  N NH1 . ARG A 1 1074 ? 11.277  119.795 41.833  1.00 23.93 ? 1074 ARG A NH1 1 
ATOM   8457  N NH2 . ARG A 1 1074 ? 11.082  121.237 40.087  1.00 24.71 ? 1074 ARG A NH2 1 
ATOM   8458  N N   . LEU A 1 1075 ? 5.852   115.817 40.043  1.00 19.75 ? 1075 LEU A N   1 
ATOM   8459  C CA  . LEU A 1 1075 ? 5.783   115.011 38.841  1.00 18.09 ? 1075 LEU A CA  1 
ATOM   8460  C C   . LEU A 1 1075 ? 4.586   114.108 38.626  1.00 19.01 ? 1075 LEU A C   1 
ATOM   8461  O O   . LEU A 1 1075 ? 4.379   113.149 39.368  1.00 20.69 ? 1075 LEU A O   1 
ATOM   8462  C CB  . LEU A 1 1075 ? 7.049   114.177 38.770  1.00 16.70 ? 1075 LEU A CB  1 
ATOM   8463  C CG  . LEU A 1 1075 ? 7.330   113.364 37.530  1.00 16.18 ? 1075 LEU A CG  1 
ATOM   8464  C CD1 . LEU A 1 1075 ? 7.217   114.223 36.268  1.00 18.28 ? 1075 LEU A CD1 1 
ATOM   8465  C CD2 . LEU A 1 1075 ? 8.729   112.809 37.680  1.00 19.01 ? 1075 LEU A CD2 1 
ATOM   8466  N N   . PRO A 1 1076 ? 3.787   114.395 37.591  1.00 18.38 ? 1076 PRO A N   1 
ATOM   8467  C CA  . PRO A 1 1076 ? 2.601   113.587 37.271  1.00 19.23 ? 1076 PRO A CA  1 
ATOM   8468  C C   . PRO A 1 1076 ? 3.007   112.248 36.615  1.00 20.20 ? 1076 PRO A C   1 
ATOM   8469  O O   . PRO A 1 1076 ? 3.675   112.226 35.578  1.00 20.49 ? 1076 PRO A O   1 
ATOM   8470  C CB  . PRO A 1 1076 ? 1.817   114.473 36.283  1.00 18.70 ? 1076 PRO A CB  1 
ATOM   8471  C CG  . PRO A 1 1076 ? 2.387   115.863 36.471  1.00 17.43 ? 1076 PRO A CG  1 
ATOM   8472  C CD  . PRO A 1 1076 ? 3.847   115.602 36.748  1.00 17.19 ? 1076 PRO A CD  1 
ATOM   8473  N N   . LEU A 1 1077 ? 2.625   111.131 37.218  1.00 21.36 ? 1077 LEU A N   1 
ATOM   8474  C CA  . LEU A 1 1077 ? 2.947   109.834 36.622  1.00 20.49 ? 1077 LEU A CA  1 
ATOM   8475  C C   . LEU A 1 1077 ? 1.654   109.142 36.197  1.00 18.49 ? 1077 LEU A C   1 
ATOM   8476  O O   . LEU A 1 1077 ? 1.611   108.428 35.189  1.00 15.46 ? 1077 LEU A O   1 
ATOM   8477  C CB  . LEU A 1 1077 ? 3.723   108.947 37.607  1.00 20.74 ? 1077 LEU A CB  1 
ATOM   8478  C CG  . LEU A 1 1077 ? 5.221   109.232 37.788  1.00 22.94 ? 1077 LEU A CG  1 
ATOM   8479  C CD1 . LEU A 1 1077 ? 5.901   109.276 36.423  1.00 22.48 ? 1077 LEU A CD1 1 
ATOM   8480  C CD2 . LEU A 1 1077 ? 5.422   110.542 38.517  1.00 23.26 ? 1077 LEU A CD2 1 
ATOM   8481  N N   . CYS A 1 1078 ? 0.600   109.370 36.972  1.00 16.77 ? 1078 CYS A N   1 
ATOM   8482  C CA  . CYS A 1 1078 ? -0.697  108.781 36.671  1.00 18.10 ? 1078 CYS A CA  1 
ATOM   8483  C C   . CYS A 1 1078 ? -1.809  109.757 37.017  1.00 15.82 ? 1078 CYS A C   1 
ATOM   8484  O O   . CYS A 1 1078 ? -2.059  110.018 38.192  1.00 17.51 ? 1078 CYS A O   1 
ATOM   8485  C CB  . CYS A 1 1078 ? -0.887  107.484 37.458  1.00 18.47 ? 1078 CYS A CB  1 
ATOM   8486  S SG  . CYS A 1 1078 ? -2.322  106.560 36.926  1.00 16.67 ? 1078 CYS A SG  1 
ATOM   8487  N N   . ALA A 1 1079 ? -2.470  110.295 35.997  1.00 13.98 ? 1079 ALA A N   1 
ATOM   8488  C CA  . ALA A 1 1079 ? -3.534  111.261 36.230  1.00 12.61 ? 1079 ALA A CA  1 
ATOM   8489  C C   . ALA A 1 1079 ? -4.513  110.667 37.235  1.00 13.07 ? 1079 ALA A C   1 
ATOM   8490  O O   . ALA A 1 1079 ? -4.872  109.485 37.147  1.00 13.18 ? 1079 ALA A O   1 
ATOM   8491  C CB  . ALA A 1 1079 ? -4.229  111.610 34.933  1.00 8.85  ? 1079 ALA A CB  1 
ATOM   8492  N N   . GLY A 1 1080 ? -4.923  111.492 38.199  1.00 13.57 ? 1080 GLY A N   1 
ATOM   8493  C CA  . GLY A 1 1080 ? -5.830  111.044 39.236  1.00 12.91 ? 1080 GLY A CA  1 
ATOM   8494  C C   . GLY A 1 1080 ? -5.013  110.674 40.461  1.00 14.56 ? 1080 GLY A C   1 
ATOM   8495  O O   . GLY A 1 1080 ? -5.529  110.666 41.586  1.00 15.67 ? 1080 GLY A O   1 
ATOM   8496  N N   . ILE A 1 1081 ? -3.738  110.349 40.252  1.00 12.62 ? 1081 ILE A N   1 
ATOM   8497  C CA  . ILE A 1 1081 ? -2.876  110.007 41.366  1.00 13.46 ? 1081 ILE A CA  1 
ATOM   8498  C C   . ILE A 1 1081 ? -1.998  111.217 41.620  1.00 15.02 ? 1081 ILE A C   1 
ATOM   8499  O O   . ILE A 1 1081 ? -0.881  111.317 41.125  1.00 13.78 ? 1081 ILE A O   1 
ATOM   8500  C CB  . ILE A 1 1081 ? -2.007  108.770 41.073  1.00 13.63 ? 1081 ILE A CB  1 
ATOM   8501  C CG1 . ILE A 1 1081 ? -2.897  107.543 40.900  1.00 16.06 ? 1081 ILE A CG1 1 
ATOM   8502  C CG2 . ILE A 1 1081 ? -1.062  108.506 42.232  1.00 11.92 ? 1081 ILE A CG2 1 
ATOM   8503  C CD1 . ILE A 1 1081 ? -2.134  106.266 40.563  1.00 14.64 ? 1081 ILE A CD1 1 
ATOM   8504  N N   . ASP A 1 1082 ? -2.532  112.135 42.413  1.00 16.79 ? 1082 ASP A N   1 
ATOM   8505  C CA  . ASP A 1 1082 ? -1.859  113.382 42.751  1.00 18.44 ? 1082 ASP A CA  1 
ATOM   8506  C C   . ASP A 1 1082 ? -2.093  113.716 44.232  1.00 17.62 ? 1082 ASP A C   1 
ATOM   8507  O O   . ASP A 1 1082 ? -2.730  112.951 44.954  1.00 16.11 ? 1082 ASP A O   1 
ATOM   8508  C CB  . ASP A 1 1082 ? -2.435  114.500 41.878  1.00 20.30 ? 1082 ASP A CB  1 
ATOM   8509  C CG  . ASP A 1 1082 ? -3.946  114.488 41.860  1.00 19.84 ? 1082 ASP A CG  1 
ATOM   8510  O OD1 . ASP A 1 1082 ? -4.548  114.396 42.952  1.00 20.69 ? 1082 ASP A OD1 1 
ATOM   8511  O OD2 . ASP A 1 1082 ? -4.528  114.566 40.758  1.00 23.96 ? 1082 ASP A OD2 1 
ATOM   8512  N N   . PRO A 1 1083 ? -1.604  114.882 44.688  1.00 16.63 ? 1083 PRO A N   1 
ATOM   8513  C CA  . PRO A 1 1083 ? -1.776  115.283 46.087  1.00 16.33 ? 1083 PRO A CA  1 
ATOM   8514  C C   . PRO A 1 1083 ? -3.219  115.255 46.592  1.00 16.97 ? 1083 PRO A C   1 
ATOM   8515  O O   . PRO A 1 1083 ? -3.461  115.377 47.792  1.00 15.68 ? 1083 PRO A O   1 
ATOM   8516  C CB  . PRO A 1 1083 ? -1.168  116.680 46.117  1.00 17.17 ? 1083 PRO A CB  1 
ATOM   8517  C CG  . PRO A 1 1083 ? -0.083  116.587 45.072  1.00 18.54 ? 1083 PRO A CG  1 
ATOM   8518  C CD  . PRO A 1 1083 ? -0.772  115.859 43.958  1.00 15.78 ? 1083 PRO A CD  1 
ATOM   8519  N N   . LEU A 1 1084 ? -4.175  115.103 45.678  1.00 18.40 ? 1084 LEU A N   1 
ATOM   8520  C CA  . LEU A 1 1084 ? -5.590  115.037 46.055  1.00 17.29 ? 1084 LEU A CA  1 
ATOM   8521  C C   . LEU A 1 1084 ? -6.027  113.592 46.382  1.00 17.08 ? 1084 LEU A C   1 
ATOM   8522  O O   . LEU A 1 1084 ? -7.103  113.375 46.937  1.00 17.12 ? 1084 LEU A O   1 
ATOM   8523  C CB  . LEU A 1 1084 ? -6.460  115.604 44.935  1.00 16.90 ? 1084 LEU A CB  1 
ATOM   8524  C CG  . LEU A 1 1084 ? -6.241  117.090 44.624  1.00 18.69 ? 1084 LEU A CG  1 
ATOM   8525  C CD1 . LEU A 1 1084 ? -7.040  117.507 43.376  1.00 12.38 ? 1084 LEU A CD1 1 
ATOM   8526  C CD2 . LEU A 1 1084 ? -6.672  117.916 45.838  1.00 16.43 ? 1084 LEU A CD2 1 
ATOM   8527  N N   . ASN A 1 1085 ? -5.198  112.611 46.022  1.00 15.17 ? 1085 ASN A N   1 
ATOM   8528  C CA  . ASN A 1 1085 ? -5.480  111.198 46.299  1.00 14.63 ? 1085 ASN A CA  1 
ATOM   8529  C C   . ASN A 1 1085 ? -4.309  110.691 47.170  1.00 14.50 ? 1085 ASN A C   1 
ATOM   8530  O O   . ASN A 1 1085 ? -3.508  109.865 46.742  1.00 16.90 ? 1085 ASN A O   1 
ATOM   8531  C CB  . ASN A 1 1085 ? -5.569  110.420 44.978  1.00 11.28 ? 1085 ASN A CB  1 
ATOM   8532  C CG  . ASN A 1 1085 ? -6.425  109.157 45.093  1.00 10.76 ? 1085 ASN A CG  1 
ATOM   8533  O OD1 . ASN A 1 1085 ? -6.893  108.800 46.179  1.00 7.62  ? 1085 ASN A OD1 1 
ATOM   8534  N ND2 . ASN A 1 1085 ? -6.632  108.480 43.968  1.00 6.61  ? 1085 ASN A ND2 1 
ATOM   8535  N N   . SER A 1 1086 ? -4.240  111.204 48.396  1.00 15.15 ? 1086 SER A N   1 
ATOM   8536  C CA  . SER A 1 1086 ? -3.165  110.936 49.356  1.00 14.90 ? 1086 SER A CA  1 
ATOM   8537  C C   . SER A 1 1086 ? -2.462  109.581 49.410  1.00 15.65 ? 1086 SER A C   1 
ATOM   8538  O O   . SER A 1 1086 ? -1.253  109.504 49.145  1.00 14.76 ? 1086 SER A O   1 
ATOM   8539  C CB  . SER A 1 1086 ? -3.630  111.307 50.764  1.00 14.62 ? 1086 SER A CB  1 
ATOM   8540  O OG  . SER A 1 1086 ? -4.630  110.424 51.228  1.00 18.90 ? 1086 SER A OG  1 
ATOM   8541  N N   . ASP A 1 1087 ? -3.188  108.518 49.757  1.00 14.47 ? 1087 ASP A N   1 
ATOM   8542  C CA  . ASP A 1 1087 ? -2.547  107.210 49.857  1.00 14.21 ? 1087 ASP A CA  1 
ATOM   8543  C C   . ASP A 1 1087 ? -1.837  106.761 48.571  1.00 12.32 ? 1087 ASP A C   1 
ATOM   8544  O O   . ASP A 1 1087 ? -0.642  106.488 48.597  1.00 13.27 ? 1087 ASP A O   1 
ATOM   8545  C CB  . ASP A 1 1087 ? -3.543  106.135 50.320  1.00 13.10 ? 1087 ASP A CB  1 
ATOM   8546  C CG  . ASP A 1 1087 ? -2.917  104.739 50.370  1.00 14.55 ? 1087 ASP A CG  1 
ATOM   8547  O OD1 . ASP A 1 1087 ? -1.901  104.544 51.089  1.00 12.43 ? 1087 ASP A OD1 1 
ATOM   8548  O OD2 . ASP A 1 1087 ? -3.448  103.838 49.679  1.00 15.19 ? 1087 ASP A OD2 1 
ATOM   8549  N N   . PRO A 1 1088 ? -2.556  106.680 47.439  1.00 10.28 ? 1088 PRO A N   1 
ATOM   8550  C CA  . PRO A 1 1088 ? -1.912  106.252 46.189  1.00 9.37  ? 1088 PRO A CA  1 
ATOM   8551  C C   . PRO A 1 1088 ? -0.742  107.148 45.784  1.00 9.25  ? 1088 PRO A C   1 
ATOM   8552  O O   . PRO A 1 1088 ? 0.277   106.659 45.318  1.00 8.94  ? 1088 PRO A O   1 
ATOM   8553  C CB  . PRO A 1 1088 ? -3.044  106.319 45.165  1.00 7.30  ? 1088 PRO A CB  1 
ATOM   8554  C CG  . PRO A 1 1088 ? -4.266  106.130 45.985  1.00 9.85  ? 1088 PRO A CG  1 
ATOM   8555  C CD  . PRO A 1 1088 ? -3.990  106.925 47.229  1.00 9.27  ? 1088 PRO A CD  1 
ATOM   8556  N N   . PHE A 1 1089 ? -0.902  108.459 45.960  1.00 9.05  ? 1089 PHE A N   1 
ATOM   8557  C CA  . PHE A 1 1089 ? 0.134   109.430 45.590  1.00 10.07 ? 1089 PHE A CA  1 
ATOM   8558  C C   . PHE A 1 1089 ? 1.417   109.298 46.418  1.00 10.98 ? 1089 PHE A C   1 
ATOM   8559  O O   . PHE A 1 1089 ? 2.530   109.372 45.880  1.00 9.30  ? 1089 PHE A O   1 
ATOM   8560  C CB  . PHE A 1 1089 ? -0.391  110.861 45.744  1.00 8.59  ? 1089 PHE A CB  1 
ATOM   8561  C CG  . PHE A 1 1089 ? 0.632   111.914 45.426  1.00 8.27  ? 1089 PHE A CG  1 
ATOM   8562  C CD1 . PHE A 1 1089 ? 1.047   112.122 44.113  1.00 7.62  ? 1089 PHE A CD1 1 
ATOM   8563  C CD2 . PHE A 1 1089 ? 1.205   112.683 46.443  1.00 9.78  ? 1089 PHE A CD2 1 
ATOM   8564  C CE1 . PHE A 1 1089 ? 2.014   113.077 43.807  1.00 7.18  ? 1089 PHE A CE1 1 
ATOM   8565  C CE2 . PHE A 1 1089 ? 2.182   113.650 46.152  1.00 10.48 ? 1089 PHE A CE2 1 
ATOM   8566  C CZ  . PHE A 1 1089 ? 2.586   113.845 44.827  1.00 11.00 ? 1089 PHE A CZ  1 
ATOM   8567  N N   . LEU A 1 1090 ? 1.248   109.131 47.727  1.00 11.03 ? 1090 LEU A N   1 
ATOM   8568  C CA  . LEU A 1 1090 ? 2.380   108.997 48.623  1.00 12.86 ? 1090 LEU A CA  1 
ATOM   8569  C C   . LEU A 1 1090 ? 3.080   107.653 48.366  1.00 14.68 ? 1090 LEU A C   1 
ATOM   8570  O O   . LEU A 1 1090 ? 4.318   107.582 48.331  1.00 14.94 ? 1090 LEU A O   1 
ATOM   8571  C CB  . LEU A 1 1090 ? 1.915   109.138 50.081  1.00 10.17 ? 1090 LEU A CB  1 
ATOM   8572  C CG  . LEU A 1 1090 ? 1.241   110.492 50.389  1.00 10.66 ? 1090 LEU A CG  1 
ATOM   8573  C CD1 . LEU A 1 1090 ? 0.789   110.551 51.858  1.00 4.82  ? 1090 LEU A CD1 1 
ATOM   8574  C CD2 . LEU A 1 1090 ? 2.209   111.638 50.077  1.00 6.82  ? 1090 LEU A CD2 1 
ATOM   8575  N N   . LYS A 1 1091 ? 2.299   106.601 48.140  1.00 13.51 ? 1091 LYS A N   1 
ATOM   8576  C CA  . LYS A 1 1091 ? 2.883   105.296 47.868  1.00 14.03 ? 1091 LYS A CA  1 
ATOM   8577  C C   . LYS A 1 1091 ? 3.691   105.388 46.585  1.00 15.41 ? 1091 LYS A C   1 
ATOM   8578  O O   . LYS A 1 1091 ? 4.811   104.880 46.505  1.00 18.03 ? 1091 LYS A O   1 
ATOM   8579  C CB  . LYS A 1 1091 ? 1.796   104.231 47.719  1.00 14.47 ? 1091 LYS A CB  1 
ATOM   8580  C CG  . LYS A 1 1091 ? 1.185   103.740 49.031  1.00 15.05 ? 1091 LYS A CG  1 
ATOM   8581  C CD  . LYS A 1 1091 ? 2.246   103.152 49.951  1.00 17.20 ? 1091 LYS A CD  1 
ATOM   8582  C CE  . LYS A 1 1091 ? 1.626   102.393 51.124  1.00 17.44 ? 1091 LYS A CE  1 
ATOM   8583  N NZ  . LYS A 1 1091 ? 0.576   103.165 51.848  1.00 18.11 ? 1091 LYS A NZ  1 
ATOM   8584  N N   . MET A 1 1092 ? 3.120   106.042 45.581  1.00 15.26 ? 1092 MET A N   1 
ATOM   8585  C CA  . MET A 1 1092 ? 3.790   106.220 44.298  1.00 16.19 ? 1092 MET A CA  1 
ATOM   8586  C C   . MET A 1 1092 ? 5.105   106.974 44.485  1.00 16.69 ? 1092 MET A C   1 
ATOM   8587  O O   . MET A 1 1092 ? 6.153   106.593 43.949  1.00 14.51 ? 1092 MET A O   1 
ATOM   8588  C CB  . MET A 1 1092 ? 2.888   107.012 43.344  1.00 17.91 ? 1092 MET A CB  1 
ATOM   8589  C CG  . MET A 1 1092 ? 3.553   107.446 42.040  1.00 20.30 ? 1092 MET A CG  1 
ATOM   8590  S SD  . MET A 1 1092 ? 4.194   106.030 41.142  1.00 27.43 ? 1092 MET A SD  1 
ATOM   8591  C CE  . MET A 1 1092 ? 2.646   105.399 40.449  1.00 27.67 ? 1092 MET A CE  1 
ATOM   8592  N N   . VAL A 1 1093 ? 5.025   108.045 45.265  1.00 15.72 ? 1093 VAL A N   1 
ATOM   8593  C CA  . VAL A 1 1093 ? 6.158   108.905 45.534  1.00 16.33 ? 1093 VAL A CA  1 
ATOM   8594  C C   . VAL A 1 1093 ? 7.221   108.284 46.411  1.00 16.29 ? 1093 VAL A C   1 
ATOM   8595  O O   . VAL A 1 1093 ? 8.403   108.419 46.130  1.00 17.19 ? 1093 VAL A O   1 
ATOM   8596  C CB  . VAL A 1 1093 ? 5.677   110.208 46.171  1.00 18.01 ? 1093 VAL A CB  1 
ATOM   8597  C CG1 . VAL A 1 1093 ? 6.845   111.012 46.652  1.00 20.45 ? 1093 VAL A CG1 1 
ATOM   8598  C CG2 . VAL A 1 1093 ? 4.876   110.999 45.147  1.00 16.82 ? 1093 VAL A CG2 1 
ATOM   8599  N N   . SER A 1 1094 ? 6.805   107.600 47.471  1.00 17.19 ? 1094 SER A N   1 
ATOM   8600  C CA  . SER A 1 1094 ? 7.757   106.975 48.386  1.00 15.10 ? 1094 SER A CA  1 
ATOM   8601  C C   . SER A 1 1094 ? 8.374   105.693 47.836  1.00 16.10 ? 1094 SER A C   1 
ATOM   8602  O O   . SER A 1 1094 ? 9.592   105.527 47.846  1.00 16.92 ? 1094 SER A O   1 
ATOM   8603  C CB  . SER A 1 1094 ? 7.090   106.684 49.739  1.00 12.47 ? 1094 SER A CB  1 
ATOM   8604  O OG  . SER A 1 1094 ? 5.906   105.940 49.594  1.00 8.92  ? 1094 SER A OG  1 
ATOM   8605  N N   . VAL A 1 1095 ? 7.529   104.790 47.357  1.00 15.81 ? 1095 VAL A N   1 
ATOM   8606  C CA  . VAL A 1 1095 ? 7.992   103.517 46.825  1.00 16.31 ? 1095 VAL A CA  1 
ATOM   8607  C C   . VAL A 1 1095 ? 8.606   103.672 45.447  1.00 14.54 ? 1095 VAL A C   1 
ATOM   8608  O O   . VAL A 1 1095 ? 9.589   103.015 45.125  1.00 15.65 ? 1095 VAL A O   1 
ATOM   8609  C CB  . VAL A 1 1095 ? 6.832   102.502 46.744  1.00 17.28 ? 1095 VAL A CB  1 
ATOM   8610  C CG1 . VAL A 1 1095 ? 7.283   101.259 46.030  1.00 15.53 ? 1095 VAL A CG1 1 
ATOM   8611  C CG2 . VAL A 1 1095 ? 6.338   102.171 48.140  1.00 17.19 ? 1095 VAL A CG2 1 
ATOM   8612  N N   . GLY A 1 1096 ? 8.019   104.548 44.640  1.00 14.94 ? 1096 GLY A N   1 
ATOM   8613  C CA  . GLY A 1 1096 ? 8.516   104.770 43.297  1.00 13.56 ? 1096 GLY A CA  1 
ATOM   8614  C C   . GLY A 1 1096 ? 7.856   103.849 42.279  1.00 14.28 ? 1096 GLY A C   1 
ATOM   8615  O O   . GLY A 1 1096 ? 7.500   102.717 42.601  1.00 13.85 ? 1096 GLY A O   1 
ATOM   8616  N N   . PRO A 1 1097 ? 7.689   104.301 41.027  1.00 14.42 ? 1097 PRO A N   1 
ATOM   8617  C CA  . PRO A 1 1097 ? 7.056   103.447 40.015  1.00 14.14 ? 1097 PRO A CA  1 
ATOM   8618  C C   . PRO A 1 1097 ? 7.929   102.259 39.602  1.00 14.72 ? 1097 PRO A C   1 
ATOM   8619  O O   . PRO A 1 1097 ? 9.156   102.309 39.709  1.00 12.49 ? 1097 PRO A O   1 
ATOM   8620  C CB  . PRO A 1 1097 ? 6.848   104.406 38.852  1.00 14.50 ? 1097 PRO A CB  1 
ATOM   8621  C CG  . PRO A 1 1097 ? 8.117   105.265 38.944  1.00 15.10 ? 1097 PRO A CG  1 
ATOM   8622  C CD  . PRO A 1 1097 ? 8.179   105.562 40.432  1.00 12.23 ? 1097 PRO A CD  1 
ATOM   8623  N N   . MET A 1 1098 ? 7.279   101.189 39.153  1.00 14.57 ? 1098 MET A N   1 
ATOM   8624  C CA  . MET A 1 1098 ? 7.971   100.008 38.653  1.00 15.70 ? 1098 MET A CA  1 
ATOM   8625  C C   . MET A 1 1098 ? 8.456   100.435 37.256  1.00 16.27 ? 1098 MET A C   1 
ATOM   8626  O O   . MET A 1 1098 ? 7.643   100.724 36.376  1.00 17.88 ? 1098 MET A O   1 
ATOM   8627  C CB  . MET A 1 1098 ? 6.983   98.834  38.536  1.00 17.09 ? 1098 MET A CB  1 
ATOM   8628  C CG  . MET A 1 1098 ? 7.450   97.703  37.622  1.00 16.58 ? 1098 MET A CG  1 
ATOM   8629  S SD  . MET A 1 1098 ? 8.941   96.888  38.210  1.00 18.78 ? 1098 MET A SD  1 
ATOM   8630  C CE  . MET A 1 1098 ? 8.663   95.206  37.625  1.00 16.75 ? 1098 MET A CE  1 
ATOM   8631  N N   . LEU A 1 1099 ? 9.765   100.469 37.038  1.00 14.83 ? 1099 LEU A N   1 
ATOM   8632  C CA  . LEU A 1 1099 ? 10.265  100.917 35.749  1.00 12.64 ? 1099 LEU A CA  1 
ATOM   8633  C C   . LEU A 1 1099 ? 10.716  99.846  34.761  1.00 11.71 ? 1099 LEU A C   1 
ATOM   8634  O O   . LEU A 1 1099 ? 11.514  100.109 33.857  1.00 11.21 ? 1099 LEU A O   1 
ATOM   8635  C CB  . LEU A 1 1099 ? 11.364  101.957 35.965  1.00 12.20 ? 1099 LEU A CB  1 
ATOM   8636  C CG  . LEU A 1 1099 ? 10.880  103.252 36.635  1.00 12.45 ? 1099 LEU A CG  1 
ATOM   8637  C CD1 . LEU A 1 1099 ? 12.086  104.065 37.035  1.00 13.77 ? 1099 LEU A CD1 1 
ATOM   8638  C CD2 . LEU A 1 1099 ? 9.988   104.058 35.696  1.00 7.40  ? 1099 LEU A CD2 1 
ATOM   8639  N N   . GLN A 1 1100 ? 10.191  98.640  34.918  1.00 11.14 ? 1100 GLN A N   1 
ATOM   8640  C CA  . GLN A 1 1100 ? 10.514  97.570  33.988  1.00 11.08 ? 1100 GLN A CA  1 
ATOM   8641  C C   . GLN A 1 1100 ? 9.299   96.724  33.648  1.00 9.31  ? 1100 GLN A C   1 
ATOM   8642  O O   . GLN A 1 1100 ? 8.389   96.561  34.454  1.00 9.55  ? 1100 GLN A O   1 
ATOM   8643  C CB  . GLN A 1 1100 ? 11.615  96.667  34.554  1.00 14.20 ? 1100 GLN A CB  1 
ATOM   8644  C CG  . GLN A 1 1100 ? 11.804  95.362  33.752  1.00 17.25 ? 1100 GLN A CG  1 
ATOM   8645  C CD  . GLN A 1 1100 ? 12.995  94.516  34.213  1.00 18.98 ? 1100 GLN A CD  1 
ATOM   8646  O OE1 . GLN A 1 1100 ? 13.249  94.352  35.415  1.00 19.38 ? 1100 GLN A OE1 1 
ATOM   8647  N NE2 . GLN A 1 1100 ? 13.717  93.957  33.250  1.00 19.96 ? 1100 GLN A NE2 1 
ATOM   8648  N N   . SER A 1 1101 ? 9.271   96.198  32.437  1.00 11.15 ? 1101 SER A N   1 
ATOM   8649  C CA  . SER A 1 1101 ? 8.184   95.319  32.040  1.00 10.70 ? 1101 SER A CA  1 
ATOM   8650  C C   . SER A 1 1101 ? 8.100   94.206  33.077  1.00 11.65 ? 1101 SER A C   1 
ATOM   8651  O O   . SER A 1 1101 ? 9.101   93.552  33.381  1.00 12.30 ? 1101 SER A O   1 
ATOM   8652  C CB  . SER A 1 1101 ? 8.474   94.701  30.681  1.00 11.67 ? 1101 SER A CB  1 
ATOM   8653  O OG  . SER A 1 1101 ? 7.827   93.449  30.552  1.00 14.99 ? 1101 SER A OG  1 
ATOM   8654  N N   . THR A 1 1102 ? 6.907   93.990  33.619  1.00 13.33 ? 1102 THR A N   1 
ATOM   8655  C CA  . THR A 1 1102 ? 6.702   92.956  34.617  1.00 13.75 ? 1102 THR A CA  1 
ATOM   8656  C C   . THR A 1 1102 ? 6.886   91.542  34.068  1.00 16.63 ? 1102 THR A C   1 
ATOM   8657  O O   . THR A 1 1102 ? 7.185   90.608  34.813  1.00 16.91 ? 1102 THR A O   1 
ATOM   8658  C CB  . THR A 1 1102 ? 5.321   93.093  35.240  1.00 15.27 ? 1102 THR A CB  1 
ATOM   8659  O OG1 . THR A 1 1102 ? 4.311   92.901  34.240  1.00 14.72 ? 1102 THR A OG1 1 
ATOM   8660  C CG2 . THR A 1 1102 ? 5.174   94.479  35.853  1.00 15.37 ? 1102 THR A CG2 1 
ATOM   8661  N N   . ARG A 1 1103 ? 6.725   91.382  32.760  1.00 20.14 ? 1103 ARG A N   1 
ATOM   8662  C CA  . ARG A 1 1103 ? 6.894   90.074  32.147  1.00 22.92 ? 1103 ARG A CA  1 
ATOM   8663  C C   . ARG A 1 1103 ? 8.380   89.722  32.123  1.00 22.85 ? 1103 ARG A C   1 
ATOM   8664  O O   . ARG A 1 1103 ? 8.769   88.580  32.383  1.00 22.24 ? 1103 ARG A O   1 
ATOM   8665  C CB  . ARG A 1 1103 ? 6.338   90.080  30.719  1.00 26.42 ? 1103 ARG A CB  1 
ATOM   8666  C CG  . ARG A 1 1103 ? 6.219   88.696  30.098  1.00 33.15 ? 1103 ARG A CG  1 
ATOM   8667  C CD  . ARG A 1 1103 ? 5.745   88.770  28.637  1.00 40.40 ? 1103 ARG A CD  1 
ATOM   8668  N NE  . ARG A 1 1103 ? 5.580   87.450  28.021  1.00 44.11 ? 1103 ARG A NE  1 
ATOM   8669  C CZ  . ARG A 1 1103 ? 4.585   86.610  28.301  1.00 46.27 ? 1103 ARG A CZ  1 
ATOM   8670  N NH1 . ARG A 1 1103 ? 3.659   86.952  29.190  1.00 46.12 ? 1103 ARG A NH1 1 
ATOM   8671  N NH2 . ARG A 1 1103 ? 4.511   85.431  27.690  1.00 46.46 ? 1103 ARG A NH2 1 
ATOM   8672  N N   . LYS A 1 1104 ? 9.209   90.714  31.817  1.00 22.45 ? 1104 LYS A N   1 
ATOM   8673  C CA  . LYS A 1 1104 ? 10.644  90.504  31.753  1.00 23.65 ? 1104 LYS A CA  1 
ATOM   8674  C C   . LYS A 1 1104 ? 11.244  90.425  33.146  1.00 22.96 ? 1104 LYS A C   1 
ATOM   8675  O O   . LYS A 1 1104 ? 12.284  89.792  33.349  1.00 24.45 ? 1104 LYS A O   1 
ATOM   8676  C CB  . LYS A 1 1104 ? 11.316  91.632  30.965  1.00 26.12 ? 1104 LYS A CB  1 
ATOM   8677  C CG  . LYS A 1 1104 ? 11.156  91.535  29.457  1.00 28.11 ? 1104 LYS A CG  1 
ATOM   8678  C CD  . LYS A 1 1104 ? 12.129  90.555  28.826  1.00 30.69 ? 1104 LYS A CD  1 
ATOM   8679  C CE  . LYS A 1 1104 ? 11.955  90.572  27.304  1.00 34.43 ? 1104 LYS A CE  1 
ATOM   8680  N NZ  . LYS A 1 1104 ? 13.057  89.866  26.587  1.00 37.44 ? 1104 LYS A NZ  1 
ATOM   8681  N N   . TYR A 1 1105 ? 10.604  91.077  34.107  1.00 19.86 ? 1105 TYR A N   1 
ATOM   8682  C CA  . TYR A 1 1105 ? 11.104  91.031  35.466  1.00 17.69 ? 1105 TYR A CA  1 
ATOM   8683  C C   . TYR A 1 1105 ? 10.878  89.637  36.045  1.00 18.89 ? 1105 TYR A C   1 
ATOM   8684  O O   . TYR A 1 1105 ? 11.804  89.002  36.556  1.00 18.62 ? 1105 TYR A O   1 
ATOM   8685  C CB  . TYR A 1 1105 ? 10.380  92.044  36.337  1.00 16.29 ? 1105 TYR A CB  1 
ATOM   8686  C CG  . TYR A 1 1105 ? 10.776  91.946  37.784  1.00 13.87 ? 1105 TYR A CG  1 
ATOM   8687  C CD1 . TYR A 1 1105 ? 11.911  92.606  38.257  1.00 13.33 ? 1105 TYR A CD1 1 
ATOM   8688  C CD2 . TYR A 1 1105 ? 10.062  91.141  38.664  1.00 11.44 ? 1105 TYR A CD2 1 
ATOM   8689  C CE1 . TYR A 1 1105 ? 12.328  92.467  39.558  1.00 12.50 ? 1105 TYR A CE1 1 
ATOM   8690  C CE2 . TYR A 1 1105 ? 10.475  90.991  39.977  1.00 12.50 ? 1105 TYR A CE2 1 
ATOM   8691  C CZ  . TYR A 1 1105 ? 11.609  91.657  40.417  1.00 15.60 ? 1105 TYR A CZ  1 
ATOM   8692  O OH  . TYR A 1 1105 ? 12.032  91.521  41.725  1.00 19.19 ? 1105 TYR A OH  1 
ATOM   8693  N N   . PHE A 1 1106 ? 9.638   89.165  35.967  1.00 19.05 ? 1106 PHE A N   1 
ATOM   8694  C CA  . PHE A 1 1106 ? 9.304   87.859  36.504  1.00 19.86 ? 1106 PHE A CA  1 
ATOM   8695  C C   . PHE A 1 1106 ? 9.895   86.693  35.735  1.00 20.67 ? 1106 PHE A C   1 
ATOM   8696  O O   . PHE A 1 1106 ? 10.046  85.607  36.291  1.00 20.57 ? 1106 PHE A O   1 
ATOM   8697  C CB  . PHE A 1 1106 ? 7.790   87.713  36.631  1.00 19.19 ? 1106 PHE A CB  1 
ATOM   8698  C CG  . PHE A 1 1106 ? 7.212   88.491  37.779  1.00 19.92 ? 1106 PHE A CG  1 
ATOM   8699  C CD1 . PHE A 1 1106 ? 7.560   88.179  39.088  1.00 18.45 ? 1106 PHE A CD1 1 
ATOM   8700  C CD2 . PHE A 1 1106 ? 6.356   89.568  37.554  1.00 19.34 ? 1106 PHE A CD2 1 
ATOM   8701  C CE1 . PHE A 1 1106 ? 7.064   88.936  40.153  1.00 18.97 ? 1106 PHE A CE1 1 
ATOM   8702  C CE2 . PHE A 1 1106 ? 5.859   90.321  38.611  1.00 16.90 ? 1106 PHE A CE2 1 
ATOM   8703  C CZ  . PHE A 1 1106 ? 6.213   90.006  39.910  1.00 17.49 ? 1106 PHE A CZ  1 
ATOM   8704  N N   . ALA A 1 1107 ? 10.247  86.903  34.470  1.00 20.98 ? 1107 ALA A N   1 
ATOM   8705  C CA  . ALA A 1 1107 ? 10.852  85.819  33.705  1.00 22.68 ? 1107 ALA A CA  1 
ATOM   8706  C C   . ALA A 1 1107 ? 12.216  85.487  34.334  1.00 23.78 ? 1107 ALA A C   1 
ATOM   8707  O O   . ALA A 1 1107 ? 12.790  84.414  34.090  1.00 23.83 ? 1107 ALA A O   1 
ATOM   8708  C CB  . ALA A 1 1107 ? 11.027  86.219  32.249  1.00 21.55 ? 1107 ALA A CB  1 
ATOM   8709  N N   . GLN A 1 1108 ? 12.729  86.406  35.150  1.00 22.88 ? 1108 GLN A N   1 
ATOM   8710  C CA  . GLN A 1 1108 ? 14.010  86.190  35.808  1.00 23.22 ? 1108 GLN A CA  1 
ATOM   8711  C C   . GLN A 1 1108 ? 13.841  85.467  37.132  1.00 21.61 ? 1108 GLN A C   1 
ATOM   8712  O O   . GLN A 1 1108 ? 14.817  85.193  37.813  1.00 23.01 ? 1108 GLN A O   1 
ATOM   8713  C CB  . GLN A 1 1108 ? 14.736  87.521  36.040  1.00 25.88 ? 1108 GLN A CB  1 
ATOM   8714  C CG  . GLN A 1 1108 ? 15.253  88.185  34.758  1.00 30.25 ? 1108 GLN A CG  1 
ATOM   8715  C CD  . GLN A 1 1108 ? 16.243  87.305  33.993  1.00 33.60 ? 1108 GLN A CD  1 
ATOM   8716  O OE1 . GLN A 1 1108 ? 17.322  86.974  34.498  1.00 36.32 ? 1108 GLN A OE1 1 
ATOM   8717  N NE2 . GLN A 1 1108 ? 15.879  86.921  32.774  1.00 32.70 ? 1108 GLN A NE2 1 
ATOM   8718  N N   . THR A 1 1109 ? 12.606  85.146  37.500  1.00 20.57 ? 1109 THR A N   1 
ATOM   8719  C CA  . THR A 1 1109 ? 12.356  84.448  38.766  1.00 19.22 ? 1109 THR A CA  1 
ATOM   8720  C C   . THR A 1 1109 ? 12.005  82.964  38.602  1.00 20.34 ? 1109 THR A C   1 
ATOM   8721  O O   . THR A 1 1109 ? 11.444  82.340  39.503  1.00 22.05 ? 1109 THR A O   1 
ATOM   8722  C CB  . THR A 1 1109 ? 11.211  85.109  39.539  1.00 17.38 ? 1109 THR A CB  1 
ATOM   8723  O OG1 . THR A 1 1109 ? 10.020  85.068  38.743  1.00 13.99 ? 1109 THR A OG1 1 
ATOM   8724  C CG2 . THR A 1 1109 ? 11.556  86.547  39.881  1.00 14.61 ? 1109 THR A CG2 1 
ATOM   8725  N N   . LEU A 1 1110 ? 12.342  82.395  37.457  1.00 20.59 ? 1110 LEU A N   1 
ATOM   8726  C CA  . LEU A 1 1110 ? 12.036  81.000  37.191  1.00 23.06 ? 1110 LEU A CA  1 
ATOM   8727  C C   . LEU A 1 1110 ? 13.250  80.271  36.648  1.00 23.72 ? 1110 LEU A C   1 
ATOM   8728  O O   . LEU A 1 1110 ? 14.055  80.850  35.916  1.00 25.98 ? 1110 LEU A O   1 
ATOM   8729  C CB  . LEU A 1 1110 ? 10.906  80.907  36.161  1.00 23.74 ? 1110 LEU A CB  1 
ATOM   8730  C CG  . LEU A 1 1110 ? 9.546   81.448  36.601  1.00 25.05 ? 1110 LEU A CG  1 
ATOM   8731  C CD1 . LEU A 1 1110 ? 8.665   81.651  35.384  1.00 23.38 ? 1110 LEU A CD1 1 
ATOM   8732  C CD2 . LEU A 1 1110 ? 8.912   80.476  37.609  1.00 23.57 ? 1110 LEU A CD2 1 
ATOM   8733  N N   . PHE A 1 1111 ? 13.389  78.999  36.986  1.00 22.88 ? 1111 PHE A N   1 
ATOM   8734  C CA  . PHE A 1 1111 ? 14.512  78.263  36.447  1.00 23.37 ? 1111 PHE A CA  1 
ATOM   8735  C C   . PHE A 1 1111 ? 14.204  77.847  35.026  1.00 23.97 ? 1111 PHE A C   1 
ATOM   8736  O O   . PHE A 1 1111 ? 15.110  77.748  34.217  1.00 24.17 ? 1111 PHE A O   1 
ATOM   8737  C CB  . PHE A 1 1111 ? 14.830  77.055  37.309  1.00 20.96 ? 1111 PHE A CB  1 
ATOM   8738  C CG  . PHE A 1 1111 ? 15.447  77.418  38.615  1.00 20.28 ? 1111 PHE A CG  1 
ATOM   8739  C CD1 . PHE A 1 1111 ? 16.579  78.216  38.652  1.00 19.73 ? 1111 PHE A CD1 1 
ATOM   8740  C CD2 . PHE A 1 1111 ? 14.899  76.976  39.808  1.00 19.29 ? 1111 PHE A CD2 1 
ATOM   8741  C CE1 . PHE A 1 1111 ? 17.156  78.570  39.863  1.00 22.63 ? 1111 PHE A CE1 1 
ATOM   8742  C CE2 . PHE A 1 1111 ? 15.468  77.324  41.021  1.00 20.76 ? 1111 PHE A CE2 1 
ATOM   8743  C CZ  . PHE A 1 1111 ? 16.597  78.121  41.052  1.00 20.79 ? 1111 PHE A CZ  1 
ATOM   8744  N N   . MET A 1 1112 ? 12.921  77.630  34.732  1.00 26.59 ? 1112 MET A N   1 
ATOM   8745  C CA  . MET A 1 1112 ? 12.452  77.226  33.396  1.00 29.73 ? 1112 MET A CA  1 
ATOM   8746  C C   . MET A 1 1112 ? 11.277  78.073  32.910  1.00 29.97 ? 1112 MET A C   1 
ATOM   8747  O O   . MET A 1 1112 ? 10.186  78.026  33.476  1.00 30.39 ? 1112 MET A O   1 
ATOM   8748  C CB  . MET A 1 1112 ? 12.000  75.766  33.388  1.00 32.36 ? 1112 MET A CB  1 
ATOM   8749  C CG  . MET A 1 1112 ? 13.101  74.737  33.518  1.00 37.99 ? 1112 MET A CG  1 
ATOM   8750  S SD  . MET A 1 1112 ? 12.359  73.095  33.727  1.00 43.37 ? 1112 MET A SD  1 
ATOM   8751  C CE  . MET A 1 1112 ? 11.634  72.827  32.066  1.00 43.46 ? 1112 MET A CE  1 
ATOM   8752  N N   . ALA A 1 1113 ? 11.508  78.822  31.840  1.00 30.60 ? 1113 ALA A N   1 
ATOM   8753  C CA  . ALA A 1 1113 ? 10.505  79.693  31.239  1.00 30.23 ? 1113 ALA A CA  1 
ATOM   8754  C C   . ALA A 1 1113 ? 9.150   79.038  30.992  1.00 30.20 ? 1113 ALA A C   1 
ATOM   8755  O O   . ALA A 1 1113 ? 8.107   79.552  31.413  1.00 29.44 ? 1113 ALA A O   1 
ATOM   8756  C CB  . ALA A 1 1113 ? 11.042  80.235  29.926  1.00 32.00 ? 1113 ALA A CB  1 
ATOM   8757  N N   . LYS A 1 1114 ? 9.151   77.911  30.292  1.00 29.26 ? 1114 LYS A N   1 
ATOM   8758  C CA  . LYS A 1 1114 ? 7.886   77.260  30.006  1.00 28.96 ? 1114 LYS A CA  1 
ATOM   8759  C C   . LYS A 1 1114 ? 7.916   75.749  30.121  1.00 25.09 ? 1114 LYS A C   1 
ATOM   8760  O O   . LYS A 1 1114 ? 8.975   75.143  30.205  1.00 25.35 ? 1114 LYS A O   1 
ATOM   8761  C CB  . LYS A 1 1114 ? 7.362   77.701  28.615  1.00 33.20 ? 1114 LYS A CB  1 
ATOM   8762  C CG  . LYS A 1 1114 ? 8.285   77.457  27.406  1.00 35.68 ? 1114 LYS A CG  1 
ATOM   8763  C CD  . LYS A 1 1114 ? 7.629   77.939  26.096  1.00 38.75 ? 1114 LYS A CD  1 
ATOM   8764  C CE  . LYS A 1 1114 ? 8.465   77.545  24.850  1.00 42.83 ? 1114 LYS A CE  1 
ATOM   8765  N NZ  . LYS A 1 1114 ? 7.845   77.889  23.500  1.00 41.75 ? 1114 LYS A NZ  1 
ATOM   8766  N N   . THR A 1 1115 ? 6.731   75.150  30.167  1.00 22.73 ? 1115 THR A N   1 
ATOM   8767  C CA  . THR A 1 1115 ? 6.602   73.705  30.262  1.00 19.37 ? 1115 THR A CA  1 
ATOM   8768  C C   . THR A 1 1115 ? 5.344   73.304  29.507  1.00 19.74 ? 1115 THR A C   1 
ATOM   8769  O O   . THR A 1 1115 ? 4.716   74.121  28.857  1.00 18.33 ? 1115 THR A O   1 
ATOM   8770  C CB  . THR A 1 1115 ? 6.474   73.242  31.723  1.00 17.66 ? 1115 THR A CB  1 
ATOM   8771  O OG1 . THR A 1 1115 ? 6.478   71.807  31.771  1.00 15.73 ? 1115 THR A OG1 1 
ATOM   8772  C CG2 . THR A 1 1115 ? 5.169   73.766  32.337  1.00 15.38 ? 1115 THR A CG2 1 
ATOM   8773  N N   . VAL A 1 1116 ? 4.976   72.038  29.587  1.00 22.01 ? 1116 VAL A N   1 
ATOM   8774  C CA  . VAL A 1 1116 ? 3.779   71.571  28.913  1.00 23.15 ? 1116 VAL A CA  1 
ATOM   8775  C C   . VAL A 1 1116 ? 2.551   72.306  29.434  1.00 23.16 ? 1116 VAL A C   1 
ATOM   8776  O O   . VAL A 1 1116 ? 2.454   72.608  30.621  1.00 22.02 ? 1116 VAL A O   1 
ATOM   8777  C CB  . VAL A 1 1116 ? 3.591   70.063  29.143  1.00 24.05 ? 1116 VAL A CB  1 
ATOM   8778  C CG1 . VAL A 1 1116 ? 2.223   69.622  28.654  1.00 26.30 ? 1116 VAL A CG1 1 
ATOM   8779  C CG2 . VAL A 1 1116 ? 4.682   69.302  28.417  1.00 24.57 ? 1116 VAL A CG2 1 
ATOM   8780  N N   . SER A 1 1117 ? 1.619   72.605  28.539  1.00 25.38 ? 1117 SER A N   1 
ATOM   8781  C CA  . SER A 1 1117 ? 0.384   73.265  28.939  1.00 26.35 ? 1117 SER A CA  1 
ATOM   8782  C C   . SER A 1 1117 ? -0.300  72.226  29.801  1.00 26.29 ? 1117 SER A C   1 
ATOM   8783  O O   . SER A 1 1117 ? -0.558  71.113  29.336  1.00 28.07 ? 1117 SER A O   1 
ATOM   8784  C CB  . SER A 1 1117 ? -0.485  73.565  27.722  1.00 27.91 ? 1117 SER A CB  1 
ATOM   8785  O OG  . SER A 1 1117 ? -1.679  74.226  28.107  1.00 28.71 ? 1117 SER A OG  1 
ATOM   8786  N N   . GLY A 1 1118 ? -0.583  72.574  31.049  1.00 25.60 ? 1118 GLY A N   1 
ATOM   8787  C CA  . GLY A 1 1118 ? -1.199  71.617  31.949  1.00 26.01 ? 1118 GLY A CA  1 
ATOM   8788  C C   . GLY A 1 1118 ? -0.423  71.549  33.257  1.00 26.63 ? 1118 GLY A C   1 
ATOM   8789  O O   . GLY A 1 1118 ? -0.941  71.079  34.280  1.00 28.25 ? 1118 GLY A O   1 
ATOM   8790  N N   . LEU A 1 1119 ? 0.837   71.981  33.220  1.00 24.99 ? 1119 LEU A N   1 
ATOM   8791  C CA  . LEU A 1 1119 ? 1.659   72.031  34.425  1.00 22.91 ? 1119 LEU A CA  1 
ATOM   8792  C C   . LEU A 1 1119 ? 1.963   73.506  34.673  1.00 22.07 ? 1119 LEU A C   1 
ATOM   8793  O O   . LEU A 1 1119 ? 1.959   74.315  33.756  1.00 21.12 ? 1119 LEU A O   1 
ATOM   8794  C CB  . LEU A 1 1119 ? 2.955   71.243  34.264  1.00 19.81 ? 1119 LEU A CB  1 
ATOM   8795  C CG  . LEU A 1 1119 ? 2.815   69.729  34.089  1.00 20.33 ? 1119 LEU A CG  1 
ATOM   8796  C CD1 . LEU A 1 1119 ? 4.186   69.088  34.059  1.00 18.39 ? 1119 LEU A CD1 1 
ATOM   8797  C CD2 . LEU A 1 1119 ? 1.995   69.142  35.216  1.00 19.64 ? 1119 LEU A CD2 1 
ATOM   8798  N N   . ASP A 1 1120 ? 2.214   73.850  35.921  1.00 23.14 ? 1120 ASP A N   1 
ATOM   8799  C CA  . ASP A 1 1120 ? 2.485   75.228  36.285  1.00 23.41 ? 1120 ASP A CA  1 
ATOM   8800  C C   . ASP A 1 1120 ? 3.980   75.472  36.489  1.00 23.73 ? 1120 ASP A C   1 
ATOM   8801  O O   . ASP A 1 1120 ? 4.598   74.932  37.421  1.00 22.58 ? 1120 ASP A O   1 
ATOM   8802  C CB  . ASP A 1 1120 ? 1.721   75.567  37.570  1.00 25.20 ? 1120 ASP A CB  1 
ATOM   8803  C CG  . ASP A 1 1120 ? 1.717   77.051  37.879  1.00 29.81 ? 1120 ASP A CG  1 
ATOM   8804  O OD1 . ASP A 1 1120 ? 2.528   77.807  37.290  1.00 31.42 ? 1120 ASP A OD1 1 
ATOM   8805  O OD2 . ASP A 1 1120 ? 0.900   77.462  38.730  1.00 32.87 ? 1120 ASP A OD2 1 
ATOM   8806  N N   . VAL A 1 1121 ? 4.556   76.288  35.613  1.00 22.59 ? 1121 VAL A N   1 
ATOM   8807  C CA  . VAL A 1 1121 ? 5.972   76.622  35.701  1.00 22.10 ? 1121 VAL A CA  1 
ATOM   8808  C C   . VAL A 1 1121 ? 6.325   77.098  37.115  1.00 20.82 ? 1121 VAL A C   1 
ATOM   8809  O O   . VAL A 1 1121 ? 7.422   76.824  37.603  1.00 19.45 ? 1121 VAL A O   1 
ATOM   8810  C CB  . VAL A 1 1121 ? 6.347   77.717  34.659  1.00 22.74 ? 1121 VAL A CB  1 
ATOM   8811  C CG1 . VAL A 1 1121 ? 7.698   78.308  34.979  1.00 24.28 ? 1121 VAL A CG1 1 
ATOM   8812  C CG2 . VAL A 1 1121 ? 6.392   77.109  33.265  1.00 22.18 ? 1121 VAL A CG2 1 
ATOM   8813  N N   . ASN A 1 1122 ? 5.398   77.805  37.770  1.00 20.10 ? 1122 ASN A N   1 
ATOM   8814  C CA  . ASN A 1 1122 ? 5.633   78.288  39.127  1.00 18.56 ? 1122 ASN A CA  1 
ATOM   8815  C C   . ASN A 1 1122 ? 5.623   77.129  40.111  1.00 19.91 ? 1122 ASN A C   1 
ATOM   8816  O O   . ASN A 1 1122 ? 6.288   77.177  41.149  1.00 20.30 ? 1122 ASN A O   1 
ATOM   8817  C CB  . ASN A 1 1122 ? 4.569   79.292  39.564  1.00 20.61 ? 1122 ASN A CB  1 
ATOM   8818  C CG  . ASN A 1 1122 ? 4.687   80.628  38.865  1.00 22.57 ? 1122 ASN A CG  1 
ATOM   8819  O OD1 . ASN A 1 1122 ? 5.784   81.098  38.557  1.00 25.34 ? 1122 ASN A OD1 1 
ATOM   8820  N ND2 . ASN A 1 1122 ? 3.550   81.261  38.629  1.00 22.11 ? 1122 ASN A ND2 1 
ATOM   8821  N N   . ALA A 1 1123 ? 4.858   76.088  39.796  1.00 18.68 ? 1123 ALA A N   1 
ATOM   8822  C CA  . ALA A 1 1123 ? 4.787   74.936  40.683  1.00 17.23 ? 1123 ALA A CA  1 
ATOM   8823  C C   . ALA A 1 1123 ? 6.090   74.152  40.584  1.00 17.48 ? 1123 ALA A C   1 
ATOM   8824  O O   . ALA A 1 1123 ? 6.657   73.733  41.596  1.00 17.60 ? 1123 ALA A O   1 
ATOM   8825  C CB  . ALA A 1 1123 ? 3.598   74.053  40.313  1.00 16.30 ? 1123 ALA A CB  1 
ATOM   8826  N N   . ILE A 1 1124 ? 6.566   73.964  39.357  1.00 17.03 ? 1124 ILE A N   1 
ATOM   8827  C CA  . ILE A 1 1124 ? 7.803   73.241  39.137  1.00 15.92 ? 1124 ILE A CA  1 
ATOM   8828  C C   . ILE A 1 1124 ? 8.926   73.968  39.854  1.00 16.17 ? 1124 ILE A C   1 
ATOM   8829  O O   . ILE A 1 1124 ? 9.771   73.353  40.509  1.00 16.79 ? 1124 ILE A O   1 
ATOM   8830  C CB  . ILE A 1 1124 ? 8.126   73.137  37.633  1.00 15.88 ? 1124 ILE A CB  1 
ATOM   8831  C CG1 . ILE A 1 1124 ? 7.005   72.364  36.932  1.00 18.05 ? 1124 ILE A CG1 1 
ATOM   8832  C CG2 . ILE A 1 1124 ? 9.463   72.423  37.426  1.00 13.62 ? 1124 ILE A CG2 1 
ATOM   8833  C CD1 . ILE A 1 1124 ? 7.133   72.286  35.429  1.00 16.28 ? 1124 ILE A CD1 1 
ATOM   8834  N N   . ASP A 1 1125 ? 8.919   75.289  39.750  1.00 17.05 ? 1125 ASP A N   1 
ATOM   8835  C CA  . ASP A 1 1125 ? 9.951   76.072  40.398  1.00 18.54 ? 1125 ASP A CA  1 
ATOM   8836  C C   . ASP A 1 1125 ? 9.815   75.933  41.915  1.00 18.80 ? 1125 ASP A C   1 
ATOM   8837  O O   . ASP A 1 1125 ? 10.804  75.993  42.639  1.00 18.89 ? 1125 ASP A O   1 
ATOM   8838  C CB  . ASP A 1 1125 ? 9.851   77.540  39.983  1.00 18.58 ? 1125 ASP A CB  1 
ATOM   8839  C CG  . ASP A 1 1125 ? 11.190  78.268  40.090  1.00 22.56 ? 1125 ASP A CG  1 
ATOM   8840  O OD1 . ASP A 1 1125 ? 12.081  78.035  39.235  1.00 21.09 ? 1125 ASP A OD1 1 
ATOM   8841  O OD2 . ASP A 1 1125 ? 11.353  79.067  41.039  1.00 25.77 ? 1125 ASP A OD2 1 
ATOM   8842  N N   . SER A 1 1126 ? 8.588   75.733  42.392  1.00 18.69 ? 1126 SER A N   1 
ATOM   8843  C CA  . SER A 1 1126 ? 8.352   75.577  43.825  1.00 18.86 ? 1126 SER A CA  1 
ATOM   8844  C C   . SER A 1 1126 ? 8.827   74.200  44.305  1.00 17.26 ? 1126 SER A C   1 
ATOM   8845  O O   . SER A 1 1126 ? 9.404   74.066  45.388  1.00 16.11 ? 1126 SER A O   1 
ATOM   8846  C CB  . SER A 1 1126 ? 6.857   75.747  44.152  1.00 19.54 ? 1126 SER A CB  1 
ATOM   8847  O OG  . SER A 1 1126 ? 6.635   75.705  45.557  1.00 18.75 ? 1126 SER A OG  1 
ATOM   8848  N N   . ALA A 1 1127 ? 8.581   73.176  43.498  1.00 16.28 ? 1127 ALA A N   1 
ATOM   8849  C CA  . ALA A 1 1127 ? 8.991   71.831  43.868  1.00 16.55 ? 1127 ALA A CA  1 
ATOM   8850  C C   . ALA A 1 1127 ? 10.515  71.725  43.987  1.00 17.03 ? 1127 ALA A C   1 
ATOM   8851  O O   . ALA A 1 1127 ? 11.038  71.124  44.930  1.00 16.33 ? 1127 ALA A O   1 
ATOM   8852  C CB  . ALA A 1 1127 ? 8.474   70.840  42.848  1.00 18.52 ? 1127 ALA A CB  1 
ATOM   8853  N N   . LEU A 1 1128 ? 11.218  72.320  43.027  1.00 16.32 ? 1128 LEU A N   1 
ATOM   8854  C CA  . LEU A 1 1128 ? 12.671  72.298  43.002  1.00 15.44 ? 1128 LEU A CA  1 
ATOM   8855  C C   . LEU A 1 1128 ? 13.262  73.053  44.180  1.00 16.54 ? 1128 LEU A C   1 
ATOM   8856  O O   . LEU A 1 1128 ? 14.153  72.556  44.881  1.00 16.34 ? 1128 LEU A O   1 
ATOM   8857  C CB  . LEU A 1 1128 ? 13.170  72.932  41.705  1.00 16.94 ? 1128 LEU A CB  1 
ATOM   8858  C CG  . LEU A 1 1128 ? 12.896  72.153  40.424  1.00 18.34 ? 1128 LEU A CG  1 
ATOM   8859  C CD1 . LEU A 1 1128 ? 12.987  73.073  39.209  1.00 15.95 ? 1128 LEU A CD1 1 
ATOM   8860  C CD2 . LEU A 1 1128 ? 13.900  70.991  40.344  1.00 18.30 ? 1128 LEU A CD2 1 
ATOM   8861  N N   . LEU A 1 1129 ? 12.779  74.273  44.394  1.00 15.27 ? 1129 LEU A N   1 
ATOM   8862  C CA  . LEU A 1 1129 ? 13.306  75.054  45.483  1.00 13.92 ? 1129 LEU A CA  1 
ATOM   8863  C C   . LEU A 1 1129 ? 12.965  74.417  46.828  1.00 12.94 ? 1129 LEU A C   1 
ATOM   8864  O O   . LEU A 1 1129 ? 13.775  74.445  47.753  1.00 9.51  ? 1129 LEU A O   1 
ATOM   8865  C CB  . LEU A 1 1129 ? 12.800  76.495  45.387  1.00 14.23 ? 1129 LEU A CB  1 
ATOM   8866  C CG  . LEU A 1 1129 ? 13.633  77.300  44.390  1.00 15.38 ? 1129 LEU A CG  1 
ATOM   8867  C CD1 . LEU A 1 1129 ? 12.886  78.534  43.943  1.00 15.57 ? 1129 LEU A CD1 1 
ATOM   8868  C CD2 . LEU A 1 1129 ? 14.973  77.662  45.038  1.00 16.16 ? 1129 LEU A CD2 1 
ATOM   8869  N N   . ARG A 1 1130 ? 11.785  73.815  46.935  1.00 11.49 ? 1130 ARG A N   1 
ATOM   8870  C CA  . ARG A 1 1130 ? 11.418  73.198  48.196  1.00 13.69 ? 1130 ARG A CA  1 
ATOM   8871  C C   . ARG A 1 1130 ? 12.296  71.983  48.485  1.00 14.75 ? 1130 ARG A C   1 
ATOM   8872  O O   . ARG A 1 1130 ? 12.739  71.798  49.624  1.00 13.84 ? 1130 ARG A O   1 
ATOM   8873  C CB  . ARG A 1 1130 ? 9.927   72.837  48.208  1.00 14.40 ? 1130 ARG A CB  1 
ATOM   8874  C CG  . ARG A 1 1130 ? 9.032   74.048  48.497  1.00 14.30 ? 1130 ARG A CG  1 
ATOM   8875  C CD  . ARG A 1 1130 ? 7.562   73.693  48.552  1.00 14.01 ? 1130 ARG A CD  1 
ATOM   8876  N NE  . ARG A 1 1130 ? 7.083   73.181  47.271  1.00 16.50 ? 1130 ARG A NE  1 
ATOM   8877  C CZ  . ARG A 1 1130 ? 6.426   72.037  47.120  1.00 12.90 ? 1130 ARG A CZ  1 
ATOM   8878  N NH1 . ARG A 1 1130 ? 6.162   71.278  48.171  1.00 13.37 ? 1130 ARG A NH1 1 
ATOM   8879  N NH2 . ARG A 1 1130 ? 6.051   71.645  45.916  1.00 12.96 ? 1130 ARG A NH2 1 
ATOM   8880  N N   . LEU A 1 1131 ? 12.576  71.171  47.465  1.00 14.23 ? 1131 LEU A N   1 
ATOM   8881  C CA  . LEU A 1 1131 ? 13.433  70.011  47.681  1.00 16.32 ? 1131 LEU A CA  1 
ATOM   8882  C C   . LEU A 1 1131 ? 14.778  70.503  48.180  1.00 17.74 ? 1131 LEU A C   1 
ATOM   8883  O O   . LEU A 1 1131 ? 15.361  69.913  49.093  1.00 17.42 ? 1131 LEU A O   1 
ATOM   8884  C CB  . LEU A 1 1131 ? 13.632  69.214  46.391  1.00 15.63 ? 1131 LEU A CB  1 
ATOM   8885  C CG  . LEU A 1 1131 ? 12.460  68.340  45.933  1.00 16.45 ? 1131 LEU A CG  1 
ATOM   8886  C CD1 . LEU A 1 1131 ? 12.564  68.057  44.438  1.00 16.32 ? 1131 LEU A CD1 1 
ATOM   8887  C CD2 . LEU A 1 1131 ? 12.441  67.061  46.745  1.00 15.42 ? 1131 LEU A CD2 1 
ATOM   8888  N N   . ARG A 1 1132 ? 15.266  71.593  47.585  1.00 18.77 ? 1132 ARG A N   1 
ATOM   8889  C CA  . ARG A 1 1132 ? 16.554  72.148  47.987  1.00 19.57 ? 1132 ARG A CA  1 
ATOM   8890  C C   . ARG A 1 1132 ? 16.546  72.618  49.440  1.00 20.69 ? 1132 ARG A C   1 
ATOM   8891  O O   . ARG A 1 1132 ? 17.497  72.381  50.189  1.00 20.75 ? 1132 ARG A O   1 
ATOM   8892  C CB  . ARG A 1 1132 ? 16.959  73.322  47.101  1.00 18.00 ? 1132 ARG A CB  1 
ATOM   8893  C CG  . ARG A 1 1132 ? 18.391  73.734  47.375  1.00 18.61 ? 1132 ARG A CG  1 
ATOM   8894  C CD  . ARG A 1 1132 ? 18.836  74.923  46.575  1.00 17.99 ? 1132 ARG A CD  1 
ATOM   8895  N NE  . ARG A 1 1132 ? 18.414  76.169  47.196  1.00 17.13 ? 1132 ARG A NE  1 
ATOM   8896  C CZ  . ARG A 1 1132 ? 18.786  77.366  46.766  1.00 16.60 ? 1132 ARG A CZ  1 
ATOM   8897  N NH1 . ARG A 1 1132 ? 19.582  77.460  45.706  1.00 15.03 ? 1132 ARG A NH1 1 
ATOM   8898  N NH2 . ARG A 1 1132 ? 18.383  78.463  47.403  1.00 16.38 ? 1132 ARG A NH2 1 
ATOM   8899  N N   . THR A 1 1133 ? 15.469  73.285  49.837  1.00 20.97 ? 1133 THR A N   1 
ATOM   8900  C CA  . THR A 1 1133 ? 15.345  73.782  51.200  1.00 20.38 ? 1133 THR A CA  1 
ATOM   8901  C C   . THR A 1 1133 ? 15.233  72.615  52.179  1.00 21.60 ? 1133 THR A C   1 
ATOM   8902  O O   . THR A 1 1133 ? 15.817  72.639  53.273  1.00 20.64 ? 1133 THR A O   1 
ATOM   8903  C CB  . THR A 1 1133 ? 14.110  74.688  51.324  1.00 19.94 ? 1133 THR A CB  1 
ATOM   8904  O OG1 . THR A 1 1133 ? 14.244  75.779  50.403  1.00 20.01 ? 1133 THR A OG1 1 
ATOM   8905  C CG2 . THR A 1 1133 ? 13.976  75.234  52.726  1.00 15.27 ? 1133 THR A CG2 1 
ATOM   8906  N N   . LEU A 1 1134 ? 14.504  71.585  51.761  1.00 20.95 ? 1134 LEU A N   1 
ATOM   8907  C CA  . LEU A 1 1134 ? 14.303  70.414  52.593  1.00 20.47 ? 1134 LEU A CA  1 
ATOM   8908  C C   . LEU A 1 1134 ? 15.523  69.496  52.671  1.00 21.27 ? 1134 LEU A C   1 
ATOM   8909  O O   . LEU A 1 1134 ? 15.427  68.370  53.168  1.00 22.92 ? 1134 LEU A O   1 
ATOM   8910  C CB  . LEU A 1 1134 ? 13.066  69.648  52.116  1.00 18.61 ? 1134 LEU A CB  1 
ATOM   8911  C CG  . LEU A 1 1134 ? 11.764  70.439  52.340  1.00 19.51 ? 1134 LEU A CG  1 
ATOM   8912  C CD1 . LEU A 1 1134 ? 10.585  69.754  51.669  1.00 17.78 ? 1134 LEU A CD1 1 
ATOM   8913  C CD2 . LEU A 1 1134 ? 11.504  70.579  53.841  1.00 21.27 ? 1134 LEU A CD2 1 
ATOM   8914  N N   . GLY A 1 1135 ? 16.668  69.982  52.192  1.00 20.00 ? 1135 GLY A N   1 
ATOM   8915  C CA  . GLY A 1 1135 ? 17.891  69.202  52.262  1.00 18.51 ? 1135 GLY A CA  1 
ATOM   8916  C C   . GLY A 1 1135 ? 18.028  68.033  51.302  1.00 20.27 ? 1135 GLY A C   1 
ATOM   8917  O O   . GLY A 1 1135 ? 18.942  67.222  51.442  1.00 19.72 ? 1135 GLY A O   1 
ATOM   8918  N N   . ALA A 1 1136 ? 17.142  67.932  50.318  1.00 20.73 ? 1136 ALA A N   1 
ATOM   8919  C CA  . ALA A 1 1136 ? 17.234  66.834  49.374  1.00 21.25 ? 1136 ALA A CA  1 
ATOM   8920  C C   . ALA A 1 1136 ? 18.534  66.928  48.598  1.00 22.98 ? 1136 ALA A C   1 
ATOM   8921  O O   . ALA A 1 1136 ? 19.174  67.984  48.528  1.00 21.68 ? 1136 ALA A O   1 
ATOM   8922  C CB  . ALA A 1 1136 ? 16.053  66.841  48.421  1.00 20.15 ? 1136 ALA A CB  1 
ATOM   8923  N N   . ASP A 1 1137 ? 18.920  65.802  48.015  1.00 26.29 ? 1137 ASP A N   1 
ATOM   8924  C CA  . ASP A 1 1137 ? 20.138  65.721  47.237  1.00 27.40 ? 1137 ASP A CA  1 
ATOM   8925  C C   . ASP A 1 1137 ? 19.951  66.177  45.791  1.00 27.41 ? 1137 ASP A C   1 
ATOM   8926  O O   . ASP A 1 1137 ? 18.863  66.066  45.221  1.00 26.28 ? 1137 ASP A O   1 
ATOM   8927  C CB  . ASP A 1 1137 ? 20.652  64.289  47.238  1.00 30.49 ? 1137 ASP A CB  1 
ATOM   8928  C CG  . ASP A 1 1137 ? 21.929  64.146  46.450  1.00 34.10 ? 1137 ASP A CG  1 
ATOM   8929  O OD1 . ASP A 1 1137 ? 22.953  64.720  46.887  1.00 36.88 ? 1137 ASP A OD1 1 
ATOM   8930  O OD2 . ASP A 1 1137 ? 21.906  63.479  45.392  1.00 34.18 ? 1137 ASP A OD2 1 
ATOM   8931  N N   . LYS A 1 1138 ? 21.030  66.683  45.204  1.00 27.01 ? 1138 LYS A N   1 
ATOM   8932  C CA  . LYS A 1 1138 ? 21.023  67.139  43.819  1.00 26.94 ? 1138 LYS A CA  1 
ATOM   8933  C C   . LYS A 1 1138 ? 20.265  66.160  42.916  1.00 26.45 ? 1138 LYS A C   1 
ATOM   8934  O O   . LYS A 1 1138 ? 19.441  66.562  42.095  1.00 25.99 ? 1138 LYS A O   1 
ATOM   8935  C CB  . LYS A 1 1138 ? 22.470  67.288  43.334  1.00 28.03 ? 1138 LYS A CB  1 
ATOM   8936  C CG  . LYS A 1 1138 ? 22.654  67.609  41.856  1.00 28.93 ? 1138 LYS A CG  1 
ATOM   8937  C CD  . LYS A 1 1138 ? 24.141  67.705  41.542  1.00 30.36 ? 1138 LYS A CD  1 
ATOM   8938  C CE  . LYS A 1 1138 ? 24.421  67.610  40.052  1.00 32.20 ? 1138 LYS A CE  1 
ATOM   8939  N NZ  . LYS A 1 1138 ? 25.880  67.393  39.785  1.00 33.99 ? 1138 LYS A NZ  1 
ATOM   8940  N N   . LYS A 1 1139 ? 20.536  64.871  43.083  1.00 25.93 ? 1139 LYS A N   1 
ATOM   8941  C CA  . LYS A 1 1139 ? 19.890  63.863  42.263  1.00 25.51 ? 1139 LYS A CA  1 
ATOM   8942  C C   . LYS A 1 1139 ? 18.370  63.896  42.340  1.00 24.52 ? 1139 LYS A C   1 
ATOM   8943  O O   . LYS A 1 1139 ? 17.684  63.467  41.406  1.00 22.89 ? 1139 LYS A O   1 
ATOM   8944  C CB  . LYS A 1 1139 ? 20.430  62.476  42.620  1.00 28.78 ? 1139 LYS A CB  1 
ATOM   8945  C CG  . LYS A 1 1139 ? 21.699  62.128  41.848  1.00 30.86 ? 1139 LYS A CG  1 
ATOM   8946  C CD  . LYS A 1 1139 ? 22.350  60.831  42.323  1.00 34.55 ? 1139 LYS A CD  1 
ATOM   8947  C CE  . LYS A 1 1139 ? 23.081  61.033  43.648  1.00 36.63 ? 1139 LYS A CE  1 
ATOM   8948  N NZ  . LYS A 1 1139 ? 23.860  59.822  44.063  1.00 40.11 ? 1139 LYS A NZ  1 
ATOM   8949  N N   . ALA A 1 1140 ? 17.843  64.410  43.448  1.00 24.16 ? 1140 ALA A N   1 
ATOM   8950  C CA  . ALA A 1 1140 ? 16.399  64.519  43.622  1.00 21.05 ? 1140 ALA A CA  1 
ATOM   8951  C C   . ALA A 1 1140 ? 15.881  65.623  42.684  1.00 21.14 ? 1140 ALA A C   1 
ATOM   8952  O O   . ALA A 1 1140 ? 14.857  65.452  42.024  1.00 19.53 ? 1140 ALA A O   1 
ATOM   8953  C CB  . ALA A 1 1140 ? 16.074  64.846  45.064  1.00 20.56 ? 1140 ALA A CB  1 
ATOM   8954  N N   . LEU A 1 1141 ? 16.585  66.756  42.622  1.00 19.98 ? 1141 LEU A N   1 
ATOM   8955  C CA  . LEU A 1 1141 ? 16.167  67.831  41.719  1.00 19.17 ? 1141 LEU A CA  1 
ATOM   8956  C C   . LEU A 1 1141 ? 16.303  67.322  40.296  1.00 18.81 ? 1141 LEU A C   1 
ATOM   8957  O O   . LEU A 1 1141 ? 15.529  67.688  39.416  1.00 19.52 ? 1141 LEU A O   1 
ATOM   8958  C CB  . LEU A 1 1141 ? 17.013  69.089  41.905  1.00 17.78 ? 1141 LEU A CB  1 
ATOM   8959  C CG  . LEU A 1 1141 ? 16.532  69.998  43.045  1.00 18.62 ? 1141 LEU A CG  1 
ATOM   8960  C CD1 . LEU A 1 1141 ? 16.745  69.310  44.382  1.00 17.67 ? 1141 LEU A CD1 1 
ATOM   8961  C CD2 . LEU A 1 1141 ? 17.286  71.313  43.003  1.00 16.89 ? 1141 LEU A CD2 1 
ATOM   8962  N N   . THR A 1 1142 ? 17.283  66.456  40.074  1.00 18.11 ? 1142 THR A N   1 
ATOM   8963  C CA  . THR A 1 1142 ? 17.478  65.888  38.757  1.00 17.20 ? 1142 THR A CA  1 
ATOM   8964  C C   . THR A 1 1142 ? 16.299  64.990  38.441  1.00 17.01 ? 1142 THR A C   1 
ATOM   8965  O O   . THR A 1 1142 ? 15.797  64.987  37.322  1.00 17.29 ? 1142 THR A O   1 
ATOM   8966  C CB  . THR A 1 1142 ? 18.754  65.073  38.696  1.00 19.33 ? 1142 THR A CB  1 
ATOM   8967  O OG1 . THR A 1 1142 ? 19.873  65.942  38.939  1.00 21.79 ? 1142 THR A OG1 1 
ATOM   8968  C CG2 . THR A 1 1142 ? 18.889  64.393  37.322  1.00 16.10 ? 1142 THR A CG2 1 
ATOM   8969  N N   . ALA A 1 1143 ? 15.848  64.220  39.425  1.00 15.65 ? 1143 ALA A N   1 
ATOM   8970  C CA  . ALA A 1 1143 ? 14.697  63.362  39.199  1.00 15.46 ? 1143 ALA A CA  1 
ATOM   8971  C C   . ALA A 1 1143 ? 13.463  64.213  38.851  1.00 15.69 ? 1143 ALA A C   1 
ATOM   8972  O O   . ALA A 1 1143 ? 12.709  63.892  37.925  1.00 15.51 ? 1143 ALA A O   1 
ATOM   8973  C CB  . ALA A 1 1143 ? 14.412  62.526  40.435  1.00 14.75 ? 1143 ALA A CB  1 
ATOM   8974  N N   . GLN A 1 1144 ? 13.268  65.301  39.591  1.00 14.72 ? 1144 GLN A N   1 
ATOM   8975  C CA  . GLN A 1 1144 ? 12.122  66.163  39.372  1.00 14.99 ? 1144 GLN A CA  1 
ATOM   8976  C C   . GLN A 1 1144 ? 12.109  66.752  37.970  1.00 15.13 ? 1144 GLN A C   1 
ATOM   8977  O O   . GLN A 1 1144 ? 11.045  66.889  37.367  1.00 14.45 ? 1144 GLN A O   1 
ATOM   8978  C CB  . GLN A 1 1144 ? 12.095  67.275  40.423  1.00 14.58 ? 1144 GLN A CB  1 
ATOM   8979  C CG  . GLN A 1 1144 ? 11.031  68.349  40.193  1.00 19.36 ? 1144 GLN A CG  1 
ATOM   8980  C CD  . GLN A 1 1144 ? 9.596   67.842  40.326  1.00 22.51 ? 1144 GLN A CD  1 
ATOM   8981  O OE1 . GLN A 1 1144 ? 9.091   67.634  41.434  1.00 27.05 ? 1144 GLN A OE1 1 
ATOM   8982  N NE2 . GLN A 1 1144 ? 8.934   67.644  39.195  1.00 21.83 ? 1144 GLN A NE2 1 
ATOM   8983  N N   . LEU A 1 1145 ? 13.287  67.090  37.451  1.00 15.64 ? 1145 LEU A N   1 
ATOM   8984  C CA  . LEU A 1 1145 ? 13.402  67.671  36.115  1.00 16.83 ? 1145 LEU A CA  1 
ATOM   8985  C C   . LEU A 1 1145 ? 13.223  66.625  34.999  1.00 19.19 ? 1145 LEU A C   1 
ATOM   8986  O O   . LEU A 1 1145 ? 12.851  66.961  33.862  1.00 19.66 ? 1145 LEU A O   1 
ATOM   8987  C CB  . LEU A 1 1145 ? 14.754  68.384  35.968  1.00 15.65 ? 1145 LEU A CB  1 
ATOM   8988  C CG  . LEU A 1 1145 ? 14.959  69.655  36.806  1.00 15.81 ? 1145 LEU A CG  1 
ATOM   8989  C CD1 . LEU A 1 1145 ? 16.375  70.161  36.657  1.00 12.54 ? 1145 LEU A CD1 1 
ATOM   8990  C CD2 . LEU A 1 1145 ? 13.960  70.728  36.362  1.00 15.89 ? 1145 LEU A CD2 1 
ATOM   8991  N N   . LEU A 1 1146 ? 13.486  65.360  35.323  1.00 20.16 ? 1146 LEU A N   1 
ATOM   8992  C CA  . LEU A 1 1146 ? 13.332  64.287  34.353  1.00 20.21 ? 1146 LEU A CA  1 
ATOM   8993  C C   . LEU A 1 1146 ? 11.856  63.985  34.261  1.00 21.40 ? 1146 LEU A C   1 
ATOM   8994  O O   . LEU A 1 1146 ? 11.354  63.615  33.202  1.00 21.64 ? 1146 LEU A O   1 
ATOM   8995  C CB  . LEU A 1 1146 ? 14.074  63.032  34.797  1.00 20.78 ? 1146 LEU A CB  1 
ATOM   8996  C CG  . LEU A 1 1146 ? 15.589  62.997  34.657  1.00 21.13 ? 1146 LEU A CG  1 
ATOM   8997  C CD1 . LEU A 1 1146 ? 16.125  61.760  35.353  1.00 22.40 ? 1146 LEU A CD1 1 
ATOM   8998  C CD2 . LEU A 1 1146 ? 15.958  62.990  33.180  1.00 23.29 ? 1146 LEU A CD2 1 
ATOM   8999  N N   . MET A 1 1147 ? 11.154  64.149  35.377  1.00 21.86 ? 1147 MET A N   1 
ATOM   9000  C CA  . MET A 1 1147 ? 9.727   63.895  35.386  1.00 22.88 ? 1147 MET A CA  1 
ATOM   9001  C C   . MET A 1 1147 ? 8.933   64.957  34.618  1.00 24.05 ? 1147 MET A C   1 
ATOM   9002  O O   . MET A 1 1147 ? 7.763   64.738  34.299  1.00 24.90 ? 1147 MET A O   1 
ATOM   9003  C CB  . MET A 1 1147 ? 9.211   63.763  36.824  1.00 22.37 ? 1147 MET A CB  1 
ATOM   9004  C CG  . MET A 1 1147 ? 9.557   62.429  37.471  1.00 19.88 ? 1147 MET A CG  1 
ATOM   9005  S SD  . MET A 1 1147 ? 8.955   62.284  39.160  1.00 23.60 ? 1147 MET A SD  1 
ATOM   9006  C CE  . MET A 1 1147 ? 7.344   61.513  38.867  1.00 25.91 ? 1147 MET A CE  1 
ATOM   9007  N N   . VAL A 1 1148 ? 9.545   66.104  34.319  1.00 24.12 ? 1148 VAL A N   1 
ATOM   9008  C CA  . VAL A 1 1148 ? 8.824   67.108  33.551  1.00 23.52 ? 1148 VAL A CA  1 
ATOM   9009  C C   . VAL A 1 1148 ? 9.288   67.164  32.089  1.00 24.57 ? 1148 VAL A C   1 
ATOM   9010  O O   . VAL A 1 1148 ? 8.939   68.082  31.347  1.00 23.64 ? 1148 VAL A O   1 
ATOM   9011  C CB  . VAL A 1 1148 ? 8.879   68.519  34.217  1.00 24.45 ? 1148 VAL A CB  1 
ATOM   9012  C CG1 . VAL A 1 1148 ? 8.114   68.479  35.544  1.00 21.17 ? 1148 VAL A CG1 1 
ATOM   9013  C CG2 . VAL A 1 1148 ? 10.322  68.975  34.434  1.00 22.79 ? 1148 VAL A CG2 1 
ATOM   9014  N N   . GLY A 1 1149 ? 10.074  66.170  31.676  1.00 24.89 ? 1149 GLY A N   1 
ATOM   9015  C CA  . GLY A 1 1149 ? 10.501  66.112  30.289  1.00 24.34 ? 1149 GLY A CA  1 
ATOM   9016  C C   . GLY A 1 1149 ? 11.949  66.329  29.914  1.00 23.67 ? 1149 GLY A C   1 
ATOM   9017  O O   . GLY A 1 1149 ? 12.354  65.929  28.835  1.00 24.80 ? 1149 GLY A O   1 
ATOM   9018  N N   . LEU A 1 1150 ? 12.733  66.957  30.776  1.00 24.83 ? 1150 LEU A N   1 
ATOM   9019  C CA  . LEU A 1 1150 ? 14.134  67.209  30.461  1.00 26.12 ? 1150 LEU A CA  1 
ATOM   9020  C C   . LEU A 1 1150 ? 14.996  65.984  30.258  1.00 26.72 ? 1150 LEU A C   1 
ATOM   9021  O O   . LEU A 1 1150 ? 14.774  64.927  30.847  1.00 27.18 ? 1150 LEU A O   1 
ATOM   9022  C CB  . LEU A 1 1150 ? 14.793  68.056  31.540  1.00 26.40 ? 1150 LEU A CB  1 
ATOM   9023  C CG  . LEU A 1 1150 ? 14.534  69.546  31.448  1.00 27.78 ? 1150 LEU A CG  1 
ATOM   9024  C CD1 . LEU A 1 1150 ? 13.028  69.801  31.549  1.00 28.26 ? 1150 LEU A CD1 1 
ATOM   9025  C CD2 . LEU A 1 1150 ? 15.304  70.247  32.562  1.00 26.86 ? 1150 LEU A CD2 1 
ATOM   9026  N N   . GLN A 1 1151 ? 16.003  66.164  29.420  1.00 28.17 ? 1151 GLN A N   1 
ATOM   9027  C CA  . GLN A 1 1151 ? 16.971  65.135  29.101  1.00 29.75 ? 1151 GLN A CA  1 
ATOM   9028  C C   . GLN A 1 1151 ? 17.972  65.106  30.257  1.00 30.45 ? 1151 GLN A C   1 
ATOM   9029  O O   . GLN A 1 1151 ? 18.400  66.161  30.717  1.00 30.28 ? 1151 GLN A O   1 
ATOM   9030  C CB  . GLN A 1 1151 ? 17.642  65.520  27.788  1.00 30.10 ? 1151 GLN A CB  1 
ATOM   9031  C CG  . GLN A 1 1151 ? 18.955  64.864  27.485  1.00 35.81 ? 1151 GLN A CG  1 
ATOM   9032  C CD  . GLN A 1 1151 ? 19.519  65.383  26.184  1.00 39.15 ? 1151 GLN A CD  1 
ATOM   9033  O OE1 . GLN A 1 1151 ? 19.777  66.583  26.042  1.00 41.51 ? 1151 GLN A OE1 1 
ATOM   9034  N NE2 . GLN A 1 1151 ? 19.699  64.491  25.216  1.00 40.06 ? 1151 GLN A NE2 1 
ATOM   9035  N N   . GLU A 1 1152 ? 18.334  63.909  30.727  1.00 31.18 ? 1152 GLU A N   1 
ATOM   9036  C CA  . GLU A 1 1152 ? 19.272  63.765  31.840  1.00 32.20 ? 1152 GLU A CA  1 
ATOM   9037  C C   . GLU A 1 1152 ? 20.414  64.768  31.830  1.00 30.76 ? 1152 GLU A C   1 
ATOM   9038  O O   . GLU A 1 1152 ? 20.764  65.304  32.875  1.00 31.11 ? 1152 GLU A O   1 
ATOM   9039  C CB  . GLU A 1 1152 ? 19.833  62.337  31.904  1.00 36.97 ? 1152 GLU A CB  1 
ATOM   9040  C CG  . GLU A 1 1152 ? 18.957  61.380  32.719  1.00 44.85 ? 1152 GLU A CG  1 
ATOM   9041  C CD  . GLU A 1 1152 ? 19.410  59.919  32.658  1.00 49.30 ? 1152 GLU A CD  1 
ATOM   9042  O OE1 . GLU A 1 1152 ? 19.510  59.362  31.541  1.00 51.32 ? 1152 GLU A OE1 1 
ATOM   9043  O OE2 . GLU A 1 1152 ? 19.652  59.323  33.731  1.00 50.60 ? 1152 GLU A OE2 1 
ATOM   9044  N N   . SER A 1 1153 ? 20.991  65.030  30.664  1.00 29.13 ? 1153 SER A N   1 
ATOM   9045  C CA  . SER A 1 1153 ? 22.085  65.994  30.566  1.00 28.81 ? 1153 SER A CA  1 
ATOM   9046  C C   . SER A 1 1153 ? 21.664  67.345  31.140  1.00 26.95 ? 1153 SER A C   1 
ATOM   9047  O O   . SER A 1 1153 ? 22.301  67.865  32.052  1.00 25.40 ? 1153 SER A O   1 
ATOM   9048  C CB  . SER A 1 1153 ? 22.504  66.211  29.107  1.00 29.99 ? 1153 SER A CB  1 
ATOM   9049  O OG  . SER A 1 1153 ? 22.693  64.990  28.419  1.00 35.91 ? 1153 SER A OG  1 
ATOM   9050  N N   . GLU A 1 1154 ? 20.598  67.914  30.585  1.00 26.11 ? 1154 GLU A N   1 
ATOM   9051  C CA  . GLU A 1 1154 ? 20.107  69.215  31.032  1.00 27.05 ? 1154 GLU A CA  1 
ATOM   9052  C C   . GLU A 1 1154 ? 19.605  69.130  32.458  1.00 25.67 ? 1154 GLU A C   1 
ATOM   9053  O O   . GLU A 1 1154 ? 19.806  70.052  33.250  1.00 25.50 ? 1154 GLU A O   1 
ATOM   9054  C CB  . GLU A 1 1154 ? 18.964  69.705  30.147  1.00 29.06 ? 1154 GLU A CB  1 
ATOM   9055  C CG  . GLU A 1 1154 ? 19.254  69.710  28.666  1.00 33.99 ? 1154 GLU A CG  1 
ATOM   9056  C CD  . GLU A 1 1154 ? 18.115  70.336  27.889  1.00 37.91 ? 1154 GLU A CD  1 
ATOM   9057  O OE1 . GLU A 1 1154 ? 17.865  71.546  28.094  1.00 38.57 ? 1154 GLU A OE1 1 
ATOM   9058  O OE2 . GLU A 1 1154 ? 17.461  69.621  27.090  1.00 41.45 ? 1154 GLU A OE2 1 
ATOM   9059  N N   . ALA A 1 1155 ? 18.944  68.017  32.769  1.00 23.78 ? 1155 ALA A N   1 
ATOM   9060  C CA  . ALA A 1 1155 ? 18.407  67.783  34.098  1.00 22.28 ? 1155 ALA A CA  1 
ATOM   9061  C C   . ALA A 1 1155 ? 19.502  67.932  35.138  1.00 21.50 ? 1155 ALA A C   1 
ATOM   9062  O O   . ALA A 1 1155 ? 19.420  68.787  36.013  1.00 19.72 ? 1155 ALA A O   1 
ATOM   9063  C CB  . ALA A 1 1155 ? 17.814  66.401  34.179  1.00 23.61 ? 1155 ALA A CB  1 
ATOM   9064  N N   . ASP A 1 1156 ? 20.527  67.094  35.021  1.00 21.66 ? 1156 ASP A N   1 
ATOM   9065  C CA  . ASP A 1 1156 ? 21.656  67.091  35.944  1.00 21.44 ? 1156 ASP A CA  1 
ATOM   9066  C C   . ASP A 1 1156 ? 22.322  68.457  36.032  1.00 21.34 ? 1156 ASP A C   1 
ATOM   9067  O O   . ASP A 1 1156 ? 22.735  68.893  37.119  1.00 22.58 ? 1156 ASP A O   1 
ATOM   9068  C CB  . ASP A 1 1156 ? 22.684  66.037  35.512  1.00 21.80 ? 1156 ASP A CB  1 
ATOM   9069  C CG  . ASP A 1 1156 ? 23.954  66.072  36.352  1.00 22.73 ? 1156 ASP A CG  1 
ATOM   9070  O OD1 . ASP A 1 1156 ? 24.103  65.228  37.267  1.00 21.07 ? 1156 ASP A OD1 1 
ATOM   9071  O OD2 . ASP A 1 1156 ? 24.800  66.957  36.093  1.00 22.55 ? 1156 ASP A OD2 1 
ATOM   9072  N N   . ALA A 1 1157 ? 22.424  69.143  34.901  1.00 19.79 ? 1157 ALA A N   1 
ATOM   9073  C CA  . ALA A 1 1157 ? 23.059  70.450  34.911  1.00 19.01 ? 1157 ALA A CA  1 
ATOM   9074  C C   . ALA A 1 1157 ? 22.167  71.490  35.591  1.00 18.47 ? 1157 ALA A C   1 
ATOM   9075  O O   . ALA A 1 1157 ? 22.606  72.175  36.516  1.00 20.94 ? 1157 ALA A O   1 
ATOM   9076  C CB  . ALA A 1 1157 ? 23.408  70.885  33.489  1.00 17.86 ? 1157 ALA A CB  1 
ATOM   9077  N N   . LEU A 1 1158 ? 20.920  71.618  35.151  1.00 16.70 ? 1158 LEU A N   1 
ATOM   9078  C CA  . LEU A 1 1158 ? 20.044  72.597  35.786  1.00 17.18 ? 1158 LEU A CA  1 
ATOM   9079  C C   . LEU A 1 1158 ? 19.990  72.335  37.293  1.00 17.48 ? 1158 LEU A C   1 
ATOM   9080  O O   . LEU A 1 1158 ? 20.065  73.277  38.092  1.00 16.93 ? 1158 LEU A O   1 
ATOM   9081  C CB  . LEU A 1 1158 ? 18.627  72.563  35.192  1.00 15.09 ? 1158 LEU A CB  1 
ATOM   9082  C CG  . LEU A 1 1158 ? 17.662  73.548  35.867  1.00 15.64 ? 1158 LEU A CG  1 
ATOM   9083  C CD1 . LEU A 1 1158 ? 18.255  74.935  35.819  1.00 12.67 ? 1158 LEU A CD1 1 
ATOM   9084  C CD2 . LEU A 1 1158 ? 16.292  73.526  35.199  1.00 12.79 ? 1158 LEU A CD2 1 
ATOM   9085  N N   . ALA A 1 1159 ? 19.898  71.061  37.680  1.00 16.55 ? 1159 ALA A N   1 
ATOM   9086  C CA  . ALA A 1 1159 ? 19.837  70.708  39.098  1.00 19.18 ? 1159 ALA A CA  1 
ATOM   9087  C C   . ALA A 1 1159 ? 21.056  71.233  39.860  1.00 20.86 ? 1159 ALA A C   1 
ATOM   9088  O O   . ALA A 1 1159 ? 20.917  71.935  40.881  1.00 20.87 ? 1159 ALA A O   1 
ATOM   9089  C CB  . ALA A 1 1159 ? 19.722  69.195  39.271  1.00 16.44 ? 1159 ALA A CB  1 
ATOM   9090  N N   . GLY A 1 1160 ? 22.244  70.899  39.354  1.00 21.98 ? 1160 GLY A N   1 
ATOM   9091  C CA  . GLY A 1 1160 ? 23.471  71.335  39.991  1.00 20.03 ? 1160 GLY A CA  1 
ATOM   9092  C C   . GLY A 1 1160 ? 23.548  72.837  40.029  1.00 19.49 ? 1160 GLY A C   1 
ATOM   9093  O O   . GLY A 1 1160 ? 24.162  73.426  40.906  1.00 22.29 ? 1160 GLY A O   1 
ATOM   9094  N N   . LYS A 1 1161 ? 22.918  73.475  39.061  1.00 20.47 ? 1161 LYS A N   1 
ATOM   9095  C CA  . LYS A 1 1161 ? 22.923  74.926  39.009  1.00 19.67 ? 1161 LYS A CA  1 
ATOM   9096  C C   . LYS A 1 1161 ? 22.027  75.445  40.126  1.00 19.72 ? 1161 LYS A C   1 
ATOM   9097  O O   . LYS A 1 1161 ? 22.381  76.378  40.853  1.00 19.86 ? 1161 LYS A O   1 
ATOM   9098  C CB  . LYS A 1 1161 ? 22.405  75.384  37.648  1.00 19.79 ? 1161 LYS A CB  1 
ATOM   9099  C CG  . LYS A 1 1161 ? 22.325  76.876  37.480  1.00 22.45 ? 1161 LYS A CG  1 
ATOM   9100  C CD  . LYS A 1 1161 ? 21.618  77.217  36.181  1.00 25.02 ? 1161 LYS A CD  1 
ATOM   9101  C CE  . LYS A 1 1161 ? 21.365  78.706  36.067  1.00 27.72 ? 1161 LYS A CE  1 
ATOM   9102  N NZ  . LYS A 1 1161 ? 20.666  79.000  34.790  1.00 32.64 ? 1161 LYS A NZ  1 
ATOM   9103  N N   . ILE A 1 1162 ? 20.860  74.823  40.256  1.00 19.98 ? 1162 ILE A N   1 
ATOM   9104  C CA  . ILE A 1 1162 ? 19.904  75.208  41.275  1.00 20.41 ? 1162 ILE A CA  1 
ATOM   9105  C C   . ILE A 1 1162 ? 20.495  75.016  42.672  1.00 21.83 ? 1162 ILE A C   1 
ATOM   9106  O O   . ILE A 1 1162 ? 20.276  75.841  43.561  1.00 22.92 ? 1162 ILE A O   1 
ATOM   9107  C CB  . ILE A 1 1162 ? 18.599  74.395  41.130  1.00 19.30 ? 1162 ILE A CB  1 
ATOM   9108  C CG1 . ILE A 1 1162 ? 17.922  74.765  39.809  1.00 16.85 ? 1162 ILE A CG1 1 
ATOM   9109  C CG2 . ILE A 1 1162 ? 17.681  74.655  42.304  1.00 15.73 ? 1162 ILE A CG2 1 
ATOM   9110  C CD1 . ILE A 1 1162 ? 16.689  73.974  39.502  1.00 16.02 ? 1162 ILE A CD1 1 
ATOM   9111  N N   . MET A 1 1163 ? 21.259  73.945  42.863  1.00 20.84 ? 1163 MET A N   1 
ATOM   9112  C CA  . MET A 1 1163 ? 21.863  73.683  44.165  1.00 20.56 ? 1163 MET A CA  1 
ATOM   9113  C C   . MET A 1 1163 ? 22.815  74.783  44.626  1.00 22.19 ? 1163 MET A C   1 
ATOM   9114  O O   . MET A 1 1163 ? 22.939  75.045  45.818  1.00 22.91 ? 1163 MET A O   1 
ATOM   9115  C CB  . MET A 1 1163 ? 22.632  72.367  44.143  1.00 19.78 ? 1163 MET A CB  1 
ATOM   9116  C CG  . MET A 1 1163 ? 21.793  71.144  43.886  1.00 20.92 ? 1163 MET A CG  1 
ATOM   9117  S SD  . MET A 1 1163 ? 20.569  70.895  45.168  1.00 24.01 ? 1163 MET A SD  1 
ATOM   9118  C CE  . MET A 1 1163 ? 21.606  70.388  46.567  1.00 20.07 ? 1163 MET A CE  1 
ATOM   9119  N N   . LEU A 1 1164 ? 23.496  75.429  43.688  1.00 23.51 ? 1164 LEU A N   1 
ATOM   9120  C CA  . LEU A 1 1164 ? 24.456  76.458  44.056  1.00 23.76 ? 1164 LEU A CA  1 
ATOM   9121  C C   . LEU A 1 1164 ? 23.992  77.877  43.837  1.00 23.57 ? 1164 LEU A C   1 
ATOM   9122  O O   . LEU A 1 1164 ? 24.702  78.817  44.167  1.00 24.07 ? 1164 LEU A O   1 
ATOM   9123  C CB  . LEU A 1 1164 ? 25.748  76.247  43.274  1.00 24.47 ? 1164 LEU A CB  1 
ATOM   9124  C CG  . LEU A 1 1164 ? 26.352  74.843  43.358  1.00 26.54 ? 1164 LEU A CG  1 
ATOM   9125  C CD1 . LEU A 1 1164 ? 27.653  74.804  42.546  1.00 24.69 ? 1164 LEU A CD1 1 
ATOM   9126  C CD2 . LEU A 1 1164 ? 26.605  74.477  44.832  1.00 23.85 ? 1164 LEU A CD2 1 
ATOM   9127  N N   . GLN A 1 1165 ? 22.799  78.054  43.293  1.00 25.15 ? 1165 GLN A N   1 
ATOM   9128  C CA  . GLN A 1 1165 ? 22.324  79.405  43.010  1.00 24.85 ? 1165 GLN A CA  1 
ATOM   9129  C C   . GLN A 1 1165 ? 21.798  80.251  44.153  1.00 23.95 ? 1165 GLN A C   1 
ATOM   9130  O O   . GLN A 1 1165 ? 21.131  79.767  45.071  1.00 24.27 ? 1165 GLN A O   1 
ATOM   9131  C CB  . GLN A 1 1165 ? 21.278  79.354  41.901  1.00 25.39 ? 1165 GLN A CB  1 
ATOM   9132  C CG  . GLN A 1 1165 ? 20.675  80.696  41.525  1.00 27.83 ? 1165 GLN A CG  1 
ATOM   9133  C CD  . GLN A 1 1165 ? 20.043  80.669  40.141  1.00 28.52 ? 1165 GLN A CD  1 
ATOM   9134  O OE1 . GLN A 1 1165 ? 19.032  81.323  39.895  1.00 30.87 ? 1165 GLN A OE1 1 
ATOM   9135  N NE2 . GLN A 1 1165 ? 20.648  79.916  39.227  1.00 28.50 ? 1165 GLN A NE2 1 
ATOM   9136  N N   . ASP A 1 1166 ? 22.132  81.532  44.074  1.00 23.10 ? 1166 ASP A N   1 
ATOM   9137  C CA  . ASP A 1 1166 ? 21.688  82.536  45.025  1.00 23.06 ? 1166 ASP A CA  1 
ATOM   9138  C C   . ASP A 1 1166 ? 20.346  83.000  44.490  1.00 22.43 ? 1166 ASP A C   1 
ATOM   9139  O O   . ASP A 1 1166 ? 20.280  83.850  43.602  1.00 21.26 ? 1166 ASP A O   1 
ATOM   9140  C CB  . ASP A 1 1166 ? 22.632  83.725  45.016  1.00 26.79 ? 1166 ASP A CB  1 
ATOM   9141  C CG  . ASP A 1 1166 ? 23.342  83.901  46.317  1.00 31.58 ? 1166 ASP A CG  1 
ATOM   9142  O OD1 . ASP A 1 1166 ? 22.644  84.063  47.344  1.00 35.30 ? 1166 ASP A OD1 1 
ATOM   9143  O OD2 . ASP A 1 1166 ? 24.595  83.879  46.308  1.00 33.40 ? 1166 ASP A OD2 1 
ATOM   9144  N N   . VAL A 1 1167 ? 19.280  82.434  45.028  1.00 22.36 ? 1167 VAL A N   1 
ATOM   9145  C CA  . VAL A 1 1167 ? 17.934  82.766  44.602  1.00 21.66 ? 1167 VAL A CA  1 
ATOM   9146  C C   . VAL A 1 1167 ? 17.474  84.099  45.211  1.00 22.03 ? 1167 VAL A C   1 
ATOM   9147  O O   . VAL A 1 1167 ? 17.595  84.321  46.420  1.00 21.97 ? 1167 VAL A O   1 
ATOM   9148  C CB  . VAL A 1 1167 ? 16.988  81.630  45.001  1.00 20.56 ? 1167 VAL A CB  1 
ATOM   9149  C CG1 . VAL A 1 1167 ? 15.644  81.816  44.339  1.00 22.44 ? 1167 VAL A CG1 1 
ATOM   9150  C CG2 . VAL A 1 1167 ? 17.612  80.297  44.610  1.00 17.92 ? 1167 VAL A CG2 1 
ATOM   9151  N N   . ASN A 1 1168 ? 16.974  85.000  44.370  1.00 21.59 ? 1168 ASN A N   1 
ATOM   9152  C CA  . ASN A 1 1168 ? 16.526  86.295  44.864  1.00 20.49 ? 1168 ASN A CA  1 
ATOM   9153  C C   . ASN A 1 1168 ? 15.175  86.195  45.554  1.00 17.60 ? 1168 ASN A C   1 
ATOM   9154  O O   . ASN A 1 1168 ? 14.470  85.198  45.429  1.00 17.87 ? 1168 ASN A O   1 
ATOM   9155  C CB  . ASN A 1 1168 ? 16.504  87.338  43.737  1.00 24.51 ? 1168 ASN A CB  1 
ATOM   9156  C CG  . ASN A 1 1168 ? 17.923  87.872  43.395  1.00 30.19 ? 1168 ASN A CG  1 
ATOM   9157  O OD1 . ASN A 1 1168 ? 18.779  88.052  44.297  1.00 32.88 ? 1168 ASN A OD1 1 
ATOM   9158  N ND2 . ASN A 1 1168 ? 18.172  88.137  42.101  1.00 28.11 ? 1168 ASN A ND2 1 
ATOM   9159  N N   . THR A 1 1169 ? 14.834  87.236  46.293  1.00 14.21 ? 1169 THR A N   1 
ATOM   9160  C CA  . THR A 1 1169 ? 13.615  87.279  47.080  1.00 14.72 ? 1169 THR A CA  1 
ATOM   9161  C C   . THR A 1 1169 ? 12.307  86.759  46.506  1.00 15.43 ? 1169 THR A C   1 
ATOM   9162  O O   . THR A 1 1169 ? 11.656  85.902  47.115  1.00 16.50 ? 1169 THR A O   1 
ATOM   9163  C CB  . THR A 1 1169 ? 13.386  88.685  47.597  1.00 13.20 ? 1169 THR A CB  1 
ATOM   9164  O OG1 . THR A 1 1169 ? 14.524  89.074  48.372  1.00 11.29 ? 1169 THR A OG1 1 
ATOM   9165  C CG2 . THR A 1 1169 ? 12.142  88.728  48.458  1.00 10.68 ? 1169 THR A CG2 1 
ATOM   9166  N N   . VAL A 1 1170 ? 11.911  87.278  45.353  1.00 14.73 ? 1170 VAL A N   1 
ATOM   9167  C CA  . VAL A 1 1170 ? 10.672  86.855  44.724  1.00 13.42 ? 1170 VAL A CA  1 
ATOM   9168  C C   . VAL A 1 1170 ? 10.621  85.371  44.368  1.00 13.03 ? 1170 VAL A C   1 
ATOM   9169  O O   . VAL A 1 1170 ? 9.674   84.669  44.708  1.00 12.88 ? 1170 VAL A O   1 
ATOM   9170  C CB  . VAL A 1 1170 ? 10.410  87.683  43.457  1.00 13.38 ? 1170 VAL A CB  1 
ATOM   9171  C CG1 . VAL A 1 1170 ? 9.311   87.049  42.612  1.00 12.09 ? 1170 VAL A CG1 1 
ATOM   9172  C CG2 . VAL A 1 1170 ? 10.012  89.085  43.862  1.00 14.70 ? 1170 VAL A CG2 1 
ATOM   9173  N N   . GLN A 1 1171 ? 11.637  84.881  43.686  1.00 13.96 ? 1171 GLN A N   1 
ATOM   9174  C CA  . GLN A 1 1171 ? 11.609  83.489  43.293  1.00 15.70 ? 1171 GLN A CA  1 
ATOM   9175  C C   . GLN A 1 1171 ? 11.598  82.517  44.465  1.00 17.08 ? 1171 GLN A C   1 
ATOM   9176  O O   . GLN A 1 1171 ? 10.847  81.534  44.455  1.00 15.84 ? 1171 GLN A O   1 
ATOM   9177  C CB  . GLN A 1 1171 ? 12.780  83.181  42.361  1.00 14.56 ? 1171 GLN A CB  1 
ATOM   9178  C CG  . GLN A 1 1171 ? 13.004  81.705  42.123  1.00 15.50 ? 1171 GLN A CG  1 
ATOM   9179  C CD  . GLN A 1 1171 ? 13.937  81.446  40.972  1.00 14.58 ? 1171 GLN A CD  1 
ATOM   9180  O OE1 . GLN A 1 1171 ? 14.807  82.262  40.674  1.00 17.68 ? 1171 GLN A OE1 1 
ATOM   9181  N NE2 . GLN A 1 1171 ? 13.777  80.303  40.327  1.00 14.65 ? 1171 GLN A NE2 1 
ATOM   9182  N N   . LEU A 1 1172 ? 12.414  82.798  45.476  1.00 16.18 ? 1172 LEU A N   1 
ATOM   9183  C CA  . LEU A 1 1172 ? 12.504  81.908  46.622  1.00 15.42 ? 1172 LEU A CA  1 
ATOM   9184  C C   . LEU A 1 1172 ? 11.231  81.931  47.442  1.00 16.56 ? 1172 LEU A C   1 
ATOM   9185  O O   . LEU A 1 1172 ? 10.811  80.900  47.982  1.00 17.63 ? 1172 LEU A O   1 
ATOM   9186  C CB  . LEU A 1 1172 ? 13.704  82.299  47.478  1.00 13.63 ? 1172 LEU A CB  1 
ATOM   9187  C CG  . LEU A 1 1172 ? 14.164  81.359  48.596  1.00 13.58 ? 1172 LEU A CG  1 
ATOM   9188  C CD1 . LEU A 1 1172 ? 14.217  79.899  48.115  1.00 8.34  ? 1172 LEU A CD1 1 
ATOM   9189  C CD2 . LEU A 1 1172 ? 15.544  81.828  49.061  1.00 9.15  ? 1172 LEU A CD2 1 
ATOM   9190  N N   . ALA A 1 1173 ? 10.606  83.103  47.525  1.00 16.10 ? 1173 ALA A N   1 
ATOM   9191  C CA  . ALA A 1 1173 ? 9.370   83.248  48.290  1.00 15.40 ? 1173 ALA A CA  1 
ATOM   9192  C C   . ALA A 1 1173 ? 8.294   82.256  47.861  1.00 13.79 ? 1173 ALA A C   1 
ATOM   9193  O O   . ALA A 1 1173 ? 7.363   81.996  48.618  1.00 14.86 ? 1173 ALA A O   1 
ATOM   9194  C CB  . ALA A 1 1173 ? 8.836   84.674  48.175  1.00 15.19 ? 1173 ALA A CB  1 
ATOM   9195  N N   . ARG A 1 1174 ? 8.400   81.713  46.655  1.00 11.79 ? 1174 ARG A N   1 
ATOM   9196  C CA  . ARG A 1 1174 ? 7.406   80.748  46.202  1.00 12.69 ? 1174 ARG A CA  1 
ATOM   9197  C C   . ARG A 1 1174 ? 7.418   79.438  47.000  1.00 13.87 ? 1174 ARG A C   1 
ATOM   9198  O O   . ARG A 1 1174 ? 6.429   78.705  46.991  1.00 11.63 ? 1174 ARG A O   1 
ATOM   9199  C CB  . ARG A 1 1174 ? 7.591   80.397  44.721  1.00 12.33 ? 1174 ARG A CB  1 
ATOM   9200  C CG  . ARG A 1 1174 ? 7.444   81.559  43.777  1.00 12.71 ? 1174 ARG A CG  1 
ATOM   9201  C CD  . ARG A 1 1174 ? 6.725   81.168  42.499  1.00 10.79 ? 1174 ARG A CD  1 
ATOM   9202  N NE  . ARG A 1 1174 ? 6.641   82.326  41.617  1.00 10.38 ? 1174 ARG A NE  1 
ATOM   9203  C CZ  . ARG A 1 1174 ? 7.650   82.772  40.878  1.00 11.76 ? 1174 ARG A CZ  1 
ATOM   9204  N NH1 . ARG A 1 1174 ? 8.824   82.149  40.895  1.00 11.95 ? 1174 ARG A NH1 1 
ATOM   9205  N NH2 . ARG A 1 1174 ? 7.499   83.872  40.154  1.00 12.70 ? 1174 ARG A NH2 1 
ATOM   9206  N N   . VAL A 1 1175 ? 8.521   79.128  47.684  1.00 14.50 ? 1175 VAL A N   1 
ATOM   9207  C CA  . VAL A 1 1175 ? 8.564   77.874  48.444  1.00 15.16 ? 1175 VAL A CA  1 
ATOM   9208  C C   . VAL A 1 1175 ? 7.455   77.835  49.473  1.00 15.35 ? 1175 VAL A C   1 
ATOM   9209  O O   . VAL A 1 1175 ? 7.149   76.782  50.026  1.00 16.81 ? 1175 VAL A O   1 
ATOM   9210  C CB  . VAL A 1 1175 ? 9.890   77.662  49.221  1.00 15.62 ? 1175 VAL A CB  1 
ATOM   9211  C CG1 . VAL A 1 1175 ? 11.077  77.668  48.263  1.00 16.41 ? 1175 VAL A CG1 1 
ATOM   9212  C CG2 . VAL A 1 1175 ? 10.023  78.704  50.307  1.00 14.21 ? 1175 VAL A CG2 1 
ATOM   9213  N N   . VAL A 1 1176 ? 6.857   78.986  49.739  1.00 14.74 ? 1176 VAL A N   1 
ATOM   9214  C CA  . VAL A 1 1176 ? 5.801   79.038  50.719  1.00 14.51 ? 1176 VAL A CA  1 
ATOM   9215  C C   . VAL A 1 1176 ? 4.581   79.752  50.126  1.00 15.30 ? 1176 VAL A C   1 
ATOM   9216  O O   . VAL A 1 1176 ? 3.761   80.348  50.824  1.00 13.52 ? 1176 VAL A O   1 
ATOM   9217  C CB  . VAL A 1 1176 ? 6.342   79.710  52.003  1.00 14.15 ? 1176 VAL A CB  1 
ATOM   9218  C CG1 . VAL A 1 1176 ? 6.292   81.211  51.898  1.00 13.09 ? 1176 VAL A CG1 1 
ATOM   9219  C CG2 . VAL A 1 1176 ? 5.593   79.204  53.184  1.00 17.63 ? 1176 VAL A CG2 1 
ATOM   9220  N N   . ASN A 1 1177 ? 4.483   79.675  48.803  1.00 16.24 ? 1177 ASN A N   1 
ATOM   9221  C CA  . ASN A 1 1177 ? 3.379   80.267  48.063  1.00 16.42 ? 1177 ASN A CA  1 
ATOM   9222  C C   . ASN A 1 1177 ? 3.155   81.773  48.200  1.00 16.01 ? 1177 ASN A C   1 
ATOM   9223  O O   . ASN A 1 1177 ? 2.017   82.231  48.114  1.00 17.46 ? 1177 ASN A O   1 
ATOM   9224  C CB  . ASN A 1 1177 ? 2.070   79.534  48.394  1.00 16.94 ? 1177 ASN A CB  1 
ATOM   9225  C CG  . ASN A 1 1177 ? 2.032   78.118  47.825  1.00 17.44 ? 1177 ASN A CG  1 
ATOM   9226  O OD1 . ASN A 1 1177 ? 2.705   77.808  46.838  1.00 17.73 ? 1177 ASN A OD1 1 
ATOM   9227  N ND2 . ASN A 1 1177 ? 1.226   77.259  48.437  1.00 17.77 ? 1177 ASN A ND2 1 
ATOM   9228  N N   . LEU A 1 1178 ? 4.211   82.548  48.421  1.00 13.30 ? 1178 LEU A N   1 
ATOM   9229  C CA  . LEU A 1 1178 ? 4.034   83.991  48.500  1.00 13.20 ? 1178 LEU A CA  1 
ATOM   9230  C C   . LEU A 1 1178 ? 4.248   84.582  47.105  1.00 11.94 ? 1178 LEU A C   1 
ATOM   9231  O O   . LEU A 1 1178 ? 5.206   84.256  46.422  1.00 11.43 ? 1178 LEU A O   1 
ATOM   9232  C CB  . LEU A 1 1178 ? 5.008   84.621  49.504  1.00 12.49 ? 1178 LEU A CB  1 
ATOM   9233  C CG  . LEU A 1 1178 ? 4.609   84.493  50.980  1.00 11.25 ? 1178 LEU A CG  1 
ATOM   9234  C CD1 . LEU A 1 1178 ? 5.777   84.855  51.883  1.00 10.66 ? 1178 LEU A CD1 1 
ATOM   9235  C CD2 . LEU A 1 1178 ? 3.430   85.400  51.267  1.00 13.16 ? 1178 LEU A CD2 1 
ATOM   9236  N N   . ALA A 1 1179 ? 3.328   85.440  46.682  1.00 11.12 ? 1179 ALA A N   1 
ATOM   9237  C CA  . ALA A 1 1179 ? 3.411   86.069  45.370  1.00 10.04 ? 1179 ALA A CA  1 
ATOM   9238  C C   . ALA A 1 1179 ? 3.359   87.591  45.477  1.00 9.36  ? 1179 ALA A C   1 
ATOM   9239  O O   . ALA A 1 1179 ? 2.763   88.136  46.410  1.00 8.62  ? 1179 ALA A O   1 
ATOM   9240  C CB  . ALA A 1 1179 ? 2.265   85.566  44.495  1.00 7.68  ? 1179 ALA A CB  1 
ATOM   9241  N N   . VAL A 1 1180 ? 4.005   88.284  44.543  1.00 9.17  ? 1180 VAL A N   1 
ATOM   9242  C CA  . VAL A 1 1180 ? 3.951   89.747  44.562  1.00 9.75  ? 1180 VAL A CA  1 
ATOM   9243  C C   . VAL A 1 1180 ? 2.504   90.080  44.230  1.00 10.20 ? 1180 VAL A C   1 
ATOM   9244  O O   . VAL A 1 1180 ? 1.967   89.582  43.246  1.00 11.62 ? 1180 VAL A O   1 
ATOM   9245  C CB  . VAL A 1 1180 ? 4.862   90.381  43.494  1.00 8.97  ? 1180 VAL A CB  1 
ATOM   9246  C CG1 . VAL A 1 1180 ? 4.597   91.886  43.420  1.00 7.96  ? 1180 VAL A CG1 1 
ATOM   9247  C CG2 . VAL A 1 1180 ? 6.309   90.129  43.834  1.00 4.09  ? 1180 VAL A CG2 1 
ATOM   9248  N N   . PRO A 1 1181 ? 1.841   90.895  45.063  1.00 11.64 ? 1181 PRO A N   1 
ATOM   9249  C CA  . PRO A 1 1181 ? 0.438   91.273  44.835  1.00 11.83 ? 1181 PRO A CA  1 
ATOM   9250  C C   . PRO A 1 1181 ? 0.209   92.044  43.532  1.00 14.18 ? 1181 PRO A C   1 
ATOM   9251  O O   . PRO A 1 1181 ? 0.974   92.959  43.190  1.00 16.03 ? 1181 PRO A O   1 
ATOM   9252  C CB  . PRO A 1 1181 ? 0.099   92.135  46.062  1.00 11.85 ? 1181 PRO A CB  1 
ATOM   9253  C CG  . PRO A 1 1181 ? 1.036   91.648  47.119  1.00 10.93 ? 1181 PRO A CG  1 
ATOM   9254  C CD  . PRO A 1 1181 ? 2.330   91.447  46.340  1.00 12.90 ? 1181 PRO A CD  1 
ATOM   9255  N N   . ASP A 1 1182 ? -0.846  91.690  42.808  1.00 15.26 ? 1182 ASP A N   1 
ATOM   9256  C CA  . ASP A 1 1182 ? -1.147  92.383  41.560  1.00 16.31 ? 1182 ASP A CA  1 
ATOM   9257  C C   . ASP A 1 1182 ? -1.144  93.887  41.738  1.00 15.20 ? 1182 ASP A C   1 
ATOM   9258  O O   . ASP A 1 1182 ? -0.526  94.605  40.952  1.00 13.72 ? 1182 ASP A O   1 
ATOM   9259  C CB  . ASP A 1 1182 ? -2.498  91.933  41.003  1.00 19.48 ? 1182 ASP A CB  1 
ATOM   9260  C CG  . ASP A 1 1182 ? -2.353  90.855  39.945  1.00 24.66 ? 1182 ASP A CG  1 
ATOM   9261  O OD1 . ASP A 1 1182 ? -1.556  89.909  40.155  1.00 24.71 ? 1182 ASP A OD1 1 
ATOM   9262  O OD2 . ASP A 1 1182 ? -3.034  90.955  38.899  1.00 30.43 ? 1182 ASP A OD2 1 
ATOM   9263  N N   . THR A 1 1183 ? -1.807  94.364  42.788  1.00 12.70 ? 1183 THR A N   1 
ATOM   9264  C CA  . THR A 1 1183 ? -1.868  95.794  43.026  1.00 11.63 ? 1183 THR A CA  1 
ATOM   9265  C C   . THR A 1 1183 ? -0.502  96.499  43.150  1.00 11.34 ? 1183 THR A C   1 
ATOM   9266  O O   . THR A 1 1183 ? -0.406  97.706  42.932  1.00 12.20 ? 1183 THR A O   1 
ATOM   9267  C CB  . THR A 1 1183 ? -2.761  96.123  44.273  1.00 10.79 ? 1183 THR A CB  1 
ATOM   9268  O OG1 . THR A 1 1183 ? -2.270  95.454  45.438  1.00 10.57 ? 1183 THR A OG1 1 
ATOM   9269  C CG2 . THR A 1 1183 ? -4.200  95.709  44.016  1.00 10.22 ? 1183 THR A CG2 1 
ATOM   9270  N N   . TRP A 1 1184 ? 0.552   95.752  43.456  1.00 10.64 ? 1184 TRP A N   1 
ATOM   9271  C CA  . TRP A 1 1184 ? 1.886   96.333  43.621  1.00 12.76 ? 1184 TRP A CA  1 
ATOM   9272  C C   . TRP A 1 1184 ? 2.675   96.440  42.312  1.00 14.79 ? 1184 TRP A C   1 
ATOM   9273  O O   . TRP A 1 1184 ? 3.681   97.154  42.247  1.00 16.29 ? 1184 TRP A O   1 
ATOM   9274  C CB  . TRP A 1 1184 ? 2.736   95.478  44.579  1.00 11.11 ? 1184 TRP A CB  1 
ATOM   9275  C CG  . TRP A 1 1184 ? 2.321   95.405  46.018  1.00 9.95  ? 1184 TRP A CG  1 
ATOM   9276  C CD1 . TRP A 1 1184 ? 1.124   95.776  46.557  1.00 9.24  ? 1184 TRP A CD1 1 
ATOM   9277  C CD2 . TRP A 1 1184 ? 3.089   94.836  47.096  1.00 8.85  ? 1184 TRP A CD2 1 
ATOM   9278  N NE1 . TRP A 1 1184 ? 1.095   95.463  47.905  1.00 9.79  ? 1184 TRP A NE1 1 
ATOM   9279  C CE2 . TRP A 1 1184 ? 2.287   94.886  48.257  1.00 8.60  ? 1184 TRP A CE2 1 
ATOM   9280  C CE3 . TRP A 1 1184 ? 4.375   94.285  47.187  1.00 5.89  ? 1184 TRP A CE3 1 
ATOM   9281  C CZ2 . TRP A 1 1184 ? 2.730   94.406  49.496  1.00 7.66  ? 1184 TRP A CZ2 1 
ATOM   9282  C CZ3 . TRP A 1 1184 ? 4.816   93.812  48.416  1.00 5.27  ? 1184 TRP A CZ3 1 
ATOM   9283  C CH2 . TRP A 1 1184 ? 3.993   93.874  49.555  1.00 7.13  ? 1184 TRP A CH2 1 
ATOM   9284  N N   . MET A 1 1185 ? 2.248   95.694  41.298  1.00 14.37 ? 1185 MET A N   1 
ATOM   9285  C CA  . MET A 1 1185 ? 2.928   95.657  40.003  1.00 15.52 ? 1185 MET A CA  1 
ATOM   9286  C C   . MET A 1 1185 ? 3.264   97.016  39.370  1.00 16.54 ? 1185 MET A C   1 
ATOM   9287  O O   . MET A 1 1185 ? 4.090   97.092  38.455  1.00 17.15 ? 1185 MET A O   1 
ATOM   9288  C CB  . MET A 1 1185 ? 2.092   94.846  38.998  1.00 17.90 ? 1185 MET A CB  1 
ATOM   9289  C CG  . MET A 1 1185 ? 1.693   93.444  39.455  1.00 18.61 ? 1185 MET A CG  1 
ATOM   9290  S SD  . MET A 1 1185 ? 2.973   92.219  39.177  1.00 23.50 ? 1185 MET A SD  1 
ATOM   9291  C CE  . MET A 1 1185 ? 2.177   90.675  39.790  1.00 19.04 ? 1185 MET A CE  1 
ATOM   9292  N N   . SER A 1 1186 ? 2.630   98.092  39.819  1.00 15.48 ? 1186 SER A N   1 
ATOM   9293  C CA  . SER A 1 1186 ? 2.934   99.384  39.214  1.00 15.49 ? 1186 SER A CA  1 
ATOM   9294  C C   . SER A 1 1186 ? 3.976   100.159 40.017  1.00 15.07 ? 1186 SER A C   1 
ATOM   9295  O O   . SER A 1 1186 ? 4.397   101.242 39.625  1.00 15.76 ? 1186 SER A O   1 
ATOM   9296  C CB  . SER A 1 1186 ? 1.649   100.215 39.049  1.00 16.66 ? 1186 SER A CB  1 
ATOM   9297  O OG  . SER A 1 1186 ? 1.008   100.480 40.293  1.00 19.53 ? 1186 SER A OG  1 
ATOM   9298  N N   . LEU A 1 1187 ? 4.403   99.594  41.138  1.00 14.09 ? 1187 LEU A N   1 
ATOM   9299  C CA  . LEU A 1 1187 ? 5.397   100.251 41.984  1.00 13.86 ? 1187 LEU A CA  1 
ATOM   9300  C C   . LEU A 1 1187 ? 6.695   99.445  42.035  1.00 13.99 ? 1187 LEU A C   1 
ATOM   9301  O O   . LEU A 1 1187 ? 6.723   98.279  41.639  1.00 13.66 ? 1187 LEU A O   1 
ATOM   9302  C CB  . LEU A 1 1187 ? 4.830   100.416 43.394  1.00 11.17 ? 1187 LEU A CB  1 
ATOM   9303  C CG  . LEU A 1 1187 ? 3.460   101.096 43.393  1.00 8.65  ? 1187 LEU A CG  1 
ATOM   9304  C CD1 . LEU A 1 1187 ? 2.659   100.690 44.614  1.00 11.32 ? 1187 LEU A CD1 1 
ATOM   9305  C CD2 . LEU A 1 1187 ? 3.657   102.589 43.343  1.00 6.45  ? 1187 LEU A CD2 1 
ATOM   9306  N N   . ASP A 1 1188 ? 7.759   100.062 42.542  1.00 13.82 ? 1188 ASP A N   1 
ATOM   9307  C CA  . ASP A 1 1188 ? 9.054   99.398  42.637  1.00 15.11 ? 1188 ASP A CA  1 
ATOM   9308  C C   . ASP A 1 1188 ? 9.150   98.481  43.869  1.00 15.34 ? 1188 ASP A C   1 
ATOM   9309  O O   . ASP A 1 1188 ? 9.798   98.826  44.871  1.00 12.61 ? 1188 ASP A O   1 
ATOM   9310  C CB  . ASP A 1 1188 ? 10.162  100.455 42.660  1.00 16.41 ? 1188 ASP A CB  1 
ATOM   9311  C CG  . ASP A 1 1188 ? 11.569  99.851  42.626  1.00 17.87 ? 1188 ASP A CG  1 
ATOM   9312  O OD1 . ASP A 1 1188 ? 11.701  98.624  42.424  1.00 17.47 ? 1188 ASP A OD1 1 
ATOM   9313  O OD2 . ASP A 1 1188 ? 12.546  100.622 42.796  1.00 16.86 ? 1188 ASP A OD2 1 
ATOM   9314  N N   . PHE A 1 1189 ? 8.521   97.305  43.777  1.00 14.46 ? 1189 PHE A N   1 
ATOM   9315  C CA  . PHE A 1 1189 ? 8.533   96.351  44.890  1.00 15.31 ? 1189 PHE A CA  1 
ATOM   9316  C C   . PHE A 1 1189 ? 9.893   95.682  45.091  1.00 16.39 ? 1189 PHE A C   1 
ATOM   9317  O O   . PHE A 1 1189 ? 10.206  95.231  46.191  1.00 18.22 ? 1189 PHE A O   1 
ATOM   9318  C CB  . PHE A 1 1189 ? 7.437   95.293  44.707  1.00 10.50 ? 1189 PHE A CB  1 
ATOM   9319  C CG  . PHE A 1 1189 ? 7.505   94.559  43.397  1.00 9.85  ? 1189 PHE A CG  1 
ATOM   9320  C CD1 . PHE A 1 1189 ? 8.304   93.430  43.256  1.00 8.60  ? 1189 PHE A CD1 1 
ATOM   9321  C CD2 . PHE A 1 1189 ? 6.771   95.002  42.298  1.00 7.30  ? 1189 PHE A CD2 1 
ATOM   9322  C CE1 . PHE A 1 1189 ? 8.376   92.747  42.029  1.00 9.80  ? 1189 PHE A CE1 1 
ATOM   9323  C CE2 . PHE A 1 1189 ? 6.830   94.334  41.071  1.00 7.06  ? 1189 PHE A CE2 1 
ATOM   9324  C CZ  . PHE A 1 1189 ? 7.638   93.199  40.936  1.00 8.13  ? 1189 PHE A CZ  1 
ATOM   9325  N N   . ASP A 1 1190 ? 10.702  95.638  44.036  1.00 17.38 ? 1190 ASP A N   1 
ATOM   9326  C CA  . ASP A 1 1190 ? 12.026  95.039  44.110  1.00 18.66 ? 1190 ASP A CA  1 
ATOM   9327  C C   . ASP A 1 1190 ? 12.855  95.864  45.078  1.00 20.58 ? 1190 ASP A C   1 
ATOM   9328  O O   . ASP A 1 1190 ? 13.570  95.316  45.921  1.00 21.05 ? 1190 ASP A O   1 
ATOM   9329  C CB  . ASP A 1 1190 ? 12.687  95.050  42.728  1.00 21.36 ? 1190 ASP A CB  1 
ATOM   9330  C CG  . ASP A 1 1190 ? 13.983  94.259  42.683  1.00 22.71 ? 1190 ASP A CG  1 
ATOM   9331  O OD1 . ASP A 1 1190 ? 13.928  93.006  42.712  1.00 25.56 ? 1190 ASP A OD1 1 
ATOM   9332  O OD2 . ASP A 1 1190 ? 15.059  94.890  42.620  1.00 21.23 ? 1190 ASP A OD2 1 
ATOM   9333  N N   . SER A 1 1191 ? 12.754  97.188  44.960  1.00 21.82 ? 1191 SER A N   1 
ATOM   9334  C CA  . SER A 1 1191 ? 13.507  98.082  45.843  1.00 21.31 ? 1191 SER A CA  1 
ATOM   9335  C C   . SER A 1 1191 ? 13.006  98.014  47.266  1.00 20.17 ? 1191 SER A C   1 
ATOM   9336  O O   . SER A 1 1191 ? 13.793  98.044  48.211  1.00 21.04 ? 1191 SER A O   1 
ATOM   9337  C CB  . SER A 1 1191 ? 13.435  99.527  45.354  1.00 21.56 ? 1191 SER A CB  1 
ATOM   9338  O OG  . SER A 1 1191 ? 14.226  99.693  44.185  1.00 24.54 ? 1191 SER A OG  1 
ATOM   9339  N N   . MET A 1 1192 ? 11.696  97.936  47.433  1.00 18.90 ? 1192 MET A N   1 
ATOM   9340  C CA  . MET A 1 1192 ? 11.172  97.847  48.772  1.00 21.07 ? 1192 MET A CA  1 
ATOM   9341  C C   . MET A 1 1192 ? 11.735  96.616  49.491  1.00 23.59 ? 1192 MET A C   1 
ATOM   9342  O O   . MET A 1 1192 ? 12.174  96.720  50.634  1.00 25.47 ? 1192 MET A O   1 
ATOM   9343  C CB  . MET A 1 1192 ? 9.659   97.770  48.754  1.00 19.96 ? 1192 MET A CB  1 
ATOM   9344  C CG  . MET A 1 1192 ? 9.102   97.331  50.084  1.00 17.71 ? 1192 MET A CG  1 
ATOM   9345  S SD  . MET A 1 1192 ? 7.407   97.755  50.188  1.00 21.52 ? 1192 MET A SD  1 
ATOM   9346  C CE  . MET A 1 1192 ? 6.743   96.882  48.695  1.00 21.55 ? 1192 MET A CE  1 
ATOM   9347  N N   . PHE A 1 1193 ? 11.716  95.455  48.834  1.00 23.63 ? 1193 PHE A N   1 
ATOM   9348  C CA  . PHE A 1 1193 ? 12.250  94.242  49.453  1.00 22.94 ? 1193 PHE A CA  1 
ATOM   9349  C C   . PHE A 1 1193 ? 13.738  94.392  49.775  1.00 23.96 ? 1193 PHE A C   1 
ATOM   9350  O O   . PHE A 1 1193 ? 14.175  93.975  50.837  1.00 26.17 ? 1193 PHE A O   1 
ATOM   9351  C CB  . PHE A 1 1193 ? 12.104  93.005  48.544  1.00 20.22 ? 1193 PHE A CB  1 
ATOM   9352  C CG  . PHE A 1 1193 ? 10.684  92.534  48.322  1.00 18.79 ? 1193 PHE A CG  1 
ATOM   9353  C CD1 . PHE A 1 1193 ? 9.757   92.499  49.364  1.00 18.84 ? 1193 PHE A CD1 1 
ATOM   9354  C CD2 . PHE A 1 1193 ? 10.303  92.034  47.080  1.00 16.44 ? 1193 PHE A CD2 1 
ATOM   9355  C CE1 . PHE A 1 1193 ? 8.480   91.968  49.171  1.00 15.39 ? 1193 PHE A CE1 1 
ATOM   9356  C CE2 . PHE A 1 1193 ? 9.037   91.504  46.881  1.00 17.10 ? 1193 PHE A CE2 1 
ATOM   9357  C CZ  . PHE A 1 1193 ? 8.121   91.469  47.932  1.00 16.80 ? 1193 PHE A CZ  1 
ATOM   9358  N N   . LYS A 1 1194 ? 14.514  94.985  48.871  1.00 24.20 ? 1194 LYS A N   1 
ATOM   9359  C CA  . LYS A 1 1194 ? 15.964  95.110  49.077  1.00 27.50 ? 1194 LYS A CA  1 
ATOM   9360  C C   . LYS A 1 1194 ? 16.524  96.158  50.040  1.00 28.93 ? 1194 LYS A C   1 
ATOM   9361  O O   . LYS A 1 1194 ? 17.364  95.846  50.888  1.00 29.14 ? 1194 LYS A O   1 
ATOM   9362  C CB  . LYS A 1 1194 ? 16.684  95.317  47.738  1.00 27.64 ? 1194 LYS A CB  1 
ATOM   9363  C CG  . LYS A 1 1194 ? 16.714  94.119  46.818  1.00 31.43 ? 1194 LYS A CG  1 
ATOM   9364  C CD  . LYS A 1 1194 ? 17.477  94.443  45.528  1.00 34.45 ? 1194 LYS A CD  1 
ATOM   9365  C CE  . LYS A 1 1194 ? 17.374  93.304  44.508  1.00 35.57 ? 1194 LYS A CE  1 
ATOM   9366  N NZ  . LYS A 1 1194 ? 17.895  93.707  43.169  1.00 36.16 ? 1194 LYS A NZ  1 
ATOM   9367  N N   . HIS A 1 1195 ? 16.076  97.400  49.909  1.00 28.58 ? 1195 HIS A N   1 
ATOM   9368  C CA  . HIS A 1 1195 ? 16.631  98.464  50.732  1.00 28.14 ? 1195 HIS A CA  1 
ATOM   9369  C C   . HIS A 1 1195 ? 15.733  99.015  51.826  1.00 27.23 ? 1195 HIS A C   1 
ATOM   9370  O O   . HIS A 1 1195 ? 16.178  99.813  52.649  1.00 27.73 ? 1195 HIS A O   1 
ATOM   9371  C CB  . HIS A 1 1195 ? 17.067  99.621  49.826  1.00 28.41 ? 1195 HIS A CB  1 
ATOM   9372  C CG  . HIS A 1 1195 ? 17.924  99.199  48.670  1.00 28.33 ? 1195 HIS A CG  1 
ATOM   9373  N ND1 . HIS A 1 1195 ? 19.178  98.654  48.832  1.00 27.35 ? 1195 HIS A ND1 1 
ATOM   9374  C CD2 . HIS A 1 1195 ? 17.703  99.248  47.334  1.00 27.60 ? 1195 HIS A CD2 1 
ATOM   9375  C CE1 . HIS A 1 1195 ? 19.696  98.386  47.645  1.00 27.06 ? 1195 HIS A CE1 1 
ATOM   9376  N NE2 . HIS A 1 1195 ? 18.822  98.737  46.721  1.00 26.21 ? 1195 HIS A NE2 1 
ATOM   9377  N N   . HIS A 1 1196 ? 14.486  98.585  51.879  1.00 25.00 ? 1196 HIS A N   1 
ATOM   9378  C CA  . HIS A 1 1196 ? 13.631  99.171  52.876  1.00 24.25 ? 1196 HIS A CA  1 
ATOM   9379  C C   . HIS A 1 1196 ? 12.900  98.264  53.868  1.00 23.31 ? 1196 HIS A C   1 
ATOM   9380  O O   . HIS A 1 1196 ? 12.004  98.694  54.593  1.00 21.90 ? 1196 HIS A O   1 
ATOM   9381  C CB  . HIS A 1 1196 ? 12.729  100.152 52.139  1.00 24.54 ? 1196 HIS A CB  1 
ATOM   9382  C CG  . HIS A 1 1196 ? 13.513  101.205 51.409  1.00 26.69 ? 1196 HIS A CG  1 
ATOM   9383  N ND1 . HIS A 1 1196 ? 14.034  102.319 52.040  1.00 24.65 ? 1196 HIS A ND1 1 
ATOM   9384  C CD2 . HIS A 1 1196 ? 13.975  101.252 50.132  1.00 26.90 ? 1196 HIS A CD2 1 
ATOM   9385  C CE1 . HIS A 1 1196 ? 14.780  103.000 51.187  1.00 23.64 ? 1196 HIS A CE1 1 
ATOM   9386  N NE2 . HIS A 1 1196 ? 14.762  102.375 50.021  1.00 24.78 ? 1196 HIS A NE2 1 
ATOM   9387  N N   . VAL A 1 1197 ? 13.337  97.014  53.927  1.00 22.82 ? 1197 VAL A N   1 
ATOM   9388  C CA  . VAL A 1 1197 ? 12.807  96.046  54.880  1.00 23.21 ? 1197 VAL A CA  1 
ATOM   9389  C C   . VAL A 1 1197 ? 14.065  95.505  55.545  1.00 23.03 ? 1197 VAL A C   1 
ATOM   9390  O O   . VAL A 1 1197 ? 14.687  94.582  55.029  1.00 24.56 ? 1197 VAL A O   1 
ATOM   9391  C CB  . VAL A 1 1197 ? 12.061  94.877  54.187  1.00 23.79 ? 1197 VAL A CB  1 
ATOM   9392  C CG1 . VAL A 1 1197 ? 11.732  93.782  55.216  1.00 19.41 ? 1197 VAL A CG1 1 
ATOM   9393  C CG2 . VAL A 1 1197 ? 10.774  95.396  53.522  1.00 22.12 ? 1197 VAL A CG2 1 
ATOM   9394  N N   . LYS A 1 1198 ? 14.451  96.102  56.667  1.00 22.69 ? 1198 LYS A N   1 
ATOM   9395  C CA  . LYS A 1 1198 ? 15.656  95.690  57.378  1.00 22.38 ? 1198 LYS A CA  1 
ATOM   9396  C C   . LYS A 1 1198 ? 15.424  94.490  58.284  1.00 22.17 ? 1198 LYS A C   1 
ATOM   9397  O O   . LYS A 1 1198 ? 14.545  94.508  59.138  1.00 23.20 ? 1198 LYS A O   1 
ATOM   9398  C CB  . LYS A 1 1198 ? 16.206  96.851  58.220  1.00 24.03 ? 1198 LYS A CB  1 
ATOM   9399  C CG  . LYS A 1 1198 ? 16.822  98.004  57.424  1.00 22.78 ? 1198 LYS A CG  1 
ATOM   9400  C CD  . LYS A 1 1198 ? 15.754  98.821  56.705  1.00 23.58 ? 1198 LYS A CD  1 
ATOM   9401  C CE  . LYS A 1 1198 ? 16.323  100.127 56.171  1.00 22.97 ? 1198 LYS A CE  1 
ATOM   9402  N NZ  . LYS A 1 1198 ? 17.445  99.913  55.221  1.00 23.60 ? 1198 LYS A NZ  1 
ATOM   9403  N N   . LEU A 1 1199 ? 16.227  93.449  58.099  1.00 22.97 ? 1199 LEU A N   1 
ATOM   9404  C CA  . LEU A 1 1199 ? 16.119  92.240  58.904  1.00 22.50 ? 1199 LEU A CA  1 
ATOM   9405  C C   . LEU A 1 1199 ? 17.113  92.240  60.073  1.00 23.95 ? 1199 LEU A C   1 
ATOM   9406  O O   . LEU A 1 1199 ? 17.241  91.249  60.790  1.00 24.84 ? 1199 LEU A O   1 
ATOM   9407  C CB  . LEU A 1 1199 ? 16.335  91.026  58.014  1.00 20.06 ? 1199 LEU A CB  1 
ATOM   9408  C CG  . LEU A 1 1199 ? 15.468  91.055  56.745  1.00 20.08 ? 1199 LEU A CG  1 
ATOM   9409  C CD1 . LEU A 1 1199 ? 15.796  89.841  55.874  1.00 18.26 ? 1199 LEU A CD1 1 
ATOM   9410  C CD2 . LEU A 1 1199 ? 13.996  91.078  57.112  1.00 17.51 ? 1199 LEU A CD2 1 
ATOM   9411  N N   . LEU A 1 1200 ? 17.824  93.355  60.251  1.00 26.52 ? 1200 LEU A N   1 
ATOM   9412  C CA  . LEU A 1 1200 ? 18.775  93.517  61.359  1.00 28.07 ? 1200 LEU A CA  1 
ATOM   9413  C C   . LEU A 1 1200 ? 18.045  94.478  62.278  1.00 28.42 ? 1200 LEU A C   1 
ATOM   9414  O O   . LEU A 1 1200 ? 17.993  95.668  61.998  1.00 28.30 ? 1200 LEU A O   1 
ATOM   9415  C CB  . LEU A 1 1200 ? 20.079  94.158  60.875  1.00 26.51 ? 1200 LEU A CB  1 
ATOM   9416  C CG  . LEU A 1 1200 ? 21.180  94.496  61.897  1.00 27.96 ? 1200 LEU A CG  1 
ATOM   9417  C CD1 . LEU A 1 1200 ? 22.435  94.934  61.145  1.00 23.41 ? 1200 LEU A CD1 1 
ATOM   9418  C CD2 . LEU A 1 1200 ? 20.728  95.606  62.858  1.00 26.84 ? 1200 LEU A CD2 1 
ATOM   9419  N N   . PRO A 1 1201 ? 17.478  93.974  63.388  1.00 30.74 ? 1201 PRO A N   1 
ATOM   9420  C CA  . PRO A 1 1201 ? 16.732  94.801  64.348  1.00 32.61 ? 1201 PRO A CA  1 
ATOM   9421  C C   . PRO A 1 1201 ? 17.222  96.235  64.480  1.00 33.59 ? 1201 PRO A C   1 
ATOM   9422  O O   . PRO A 1 1201 ? 18.414  96.519  64.318  1.00 34.94 ? 1201 PRO A O   1 
ATOM   9423  C CB  . PRO A 1 1201 ? 16.838  94.004  65.643  1.00 31.45 ? 1201 PRO A CB  1 
ATOM   9424  C CG  . PRO A 1 1201 ? 16.770  92.598  65.142  1.00 31.44 ? 1201 PRO A CG  1 
ATOM   9425  C CD  . PRO A 1 1201 ? 17.722  92.632  63.948  1.00 30.69 ? 1201 PRO A CD  1 
ATOM   9426  N N   . LYS A 1 1202 ? 16.290  97.137  64.759  1.00 34.05 ? 1202 LYS A N   1 
ATOM   9427  C CA  . LYS A 1 1202 ? 16.614  98.549  64.891  1.00 37.30 ? 1202 LYS A CA  1 
ATOM   9428  C C   . LYS A 1 1202 ? 17.798  98.796  65.834  1.00 38.61 ? 1202 LYS A C   1 
ATOM   9429  O O   . LYS A 1 1202 ? 18.660  99.634  65.556  1.00 37.52 ? 1202 LYS A O   1 
ATOM   9430  C CB  . LYS A 1 1202 ? 15.379  99.314  65.379  1.00 39.37 ? 1202 LYS A CB  1 
ATOM   9431  C CG  . LYS A 1 1202 ? 15.507  100.828 65.317  1.00 43.25 ? 1202 LYS A CG  1 
ATOM   9432  C CD  . LYS A 1 1202 ? 15.857  101.309 63.913  1.00 44.02 ? 1202 LYS A CD  1 
ATOM   9433  C CE  . LYS A 1 1202 ? 15.927  102.833 63.837  1.00 44.92 ? 1202 LYS A CE  1 
ATOM   9434  N NZ  . LYS A 1 1202 ? 16.443  103.275 62.503  1.00 45.30 ? 1202 LYS A NZ  1 
ATOM   9435  N N   . ASP A 1 1203 ? 17.849  98.046  66.934  1.00 39.39 ? 1203 ASP A N   1 
ATOM   9436  C CA  . ASP A 1 1203 ? 18.909  98.195  67.926  1.00 40.02 ? 1203 ASP A CA  1 
ATOM   9437  C C   . ASP A 1 1203 ? 19.886  97.027  68.032  1.00 40.31 ? 1203 ASP A C   1 
ATOM   9438  O O   . ASP A 1 1203 ? 20.264  96.634  69.132  1.00 40.21 ? 1203 ASP A O   1 
ATOM   9439  C CB  . ASP A 1 1203 ? 18.285  98.430  69.295  1.00 41.60 ? 1203 ASP A CB  1 
ATOM   9440  C CG  . ASP A 1 1203 ? 17.204  97.421  69.610  1.00 44.41 ? 1203 ASP A CG  1 
ATOM   9441  O OD1 . ASP A 1 1203 ? 17.449  96.211  69.419  1.00 45.65 ? 1203 ASP A OD1 1 
ATOM   9442  O OD2 . ASP A 1 1203 ? 16.110  97.831  70.047  1.00 46.67 ? 1203 ASP A OD2 1 
ATOM   9443  N N   . GLY A 1 1204 ? 20.294  96.463  66.903  1.00 40.64 ? 1204 GLY A N   1 
ATOM   9444  C CA  . GLY A 1 1204 ? 21.244  95.369  66.958  1.00 41.49 ? 1204 GLY A CA  1 
ATOM   9445  C C   . GLY A 1 1204 ? 20.703  93.968  66.739  1.00 42.07 ? 1204 GLY A C   1 
ATOM   9446  O O   . GLY A 1 1204 ? 19.631  93.776  66.170  1.00 41.65 ? 1204 GLY A O   1 
ATOM   9447  N N   . ARG A 1 1205 ? 21.465  92.979  67.198  1.00 42.42 ? 1205 ARG A N   1 
ATOM   9448  C CA  . ARG A 1 1205 ? 21.093  91.583  67.037  1.00 42.32 ? 1205 ARG A CA  1 
ATOM   9449  C C   . ARG A 1 1205 ? 20.395  90.958  68.236  1.00 42.32 ? 1205 ARG A C   1 
ATOM   9450  O O   . ARG A 1 1205 ? 20.769  91.188  69.387  1.00 43.48 ? 1205 ARG A O   1 
ATOM   9451  C CB  . ARG A 1 1205 ? 22.329  90.762  66.676  1.00 41.56 ? 1205 ARG A CB  1 
ATOM   9452  C CG  . ARG A 1 1205 ? 22.804  90.978  65.251  1.00 43.19 ? 1205 ARG A CG  1 
ATOM   9453  C CD  . ARG A 1 1205 ? 24.069  90.191  64.974  1.00 44.85 ? 1205 ARG A CD  1 
ATOM   9454  N NE  . ARG A 1 1205 ? 23.978  88.828  65.491  1.00 46.59 ? 1205 ARG A NE  1 
ATOM   9455  C CZ  . ARG A 1 1205 ? 24.956  87.931  65.410  1.00 46.60 ? 1205 ARG A CZ  1 
ATOM   9456  N NH1 . ARG A 1 1205 ? 26.106  88.254  64.827  1.00 46.70 ? 1205 ARG A NH1 1 
ATOM   9457  N NH2 . ARG A 1 1205 ? 24.786  86.714  65.913  1.00 44.58 ? 1205 ARG A NH2 1 
ATOM   9458  N N   . HIS A 1 1206 ? 19.372  90.165  67.947  1.00 41.04 ? 1206 HIS A N   1 
ATOM   9459  C CA  . HIS A 1 1206 ? 18.608  89.472  68.970  1.00 40.70 ? 1206 HIS A CA  1 
ATOM   9460  C C   . HIS A 1 1206 ? 18.764  87.992  68.681  1.00 39.60 ? 1206 HIS A C   1 
ATOM   9461  O O   . HIS A 1 1206 ? 18.916  87.604  67.524  1.00 40.09 ? 1206 HIS A O   1 
ATOM   9462  C CB  . HIS A 1 1206 ? 17.128  89.842  68.877  1.00 43.36 ? 1206 HIS A CB  1 
ATOM   9463  C CG  . HIS A 1 1206 ? 16.856  91.309  69.001  1.00 45.23 ? 1206 HIS A CG  1 
ATOM   9464  N ND1 . HIS A 1 1206 ? 15.598  91.848  68.830  1.00 46.00 ? 1206 HIS A ND1 1 
ATOM   9465  C CD2 . HIS A 1 1206 ? 17.674  92.349  69.289  1.00 45.94 ? 1206 HIS A CD2 1 
ATOM   9466  C CE1 . HIS A 1 1206 ? 15.652  93.156  69.008  1.00 45.03 ? 1206 HIS A CE1 1 
ATOM   9467  N NE2 . HIS A 1 1206 ? 16.900  93.485  69.287  1.00 47.08 ? 1206 HIS A NE2 1 
ATOM   9468  N N   . LEU A 1 1207 ? 18.728  87.166  69.719  1.00 37.72 ? 1207 LEU A N   1 
ATOM   9469  C CA  . LEU A 1 1207 ? 18.854  85.731  69.530  1.00 36.83 ? 1207 LEU A CA  1 
ATOM   9470  C C   . LEU A 1 1207 ? 17.767  85.223  68.590  1.00 36.49 ? 1207 LEU A C   1 
ATOM   9471  O O   . LEU A 1 1207 ? 18.015  84.357  67.741  1.00 36.30 ? 1207 LEU A O   1 
ATOM   9472  C CB  . LEU A 1 1207 ? 18.739  85.011  70.872  1.00 38.73 ? 1207 LEU A CB  1 
ATOM   9473  C CG  . LEU A 1 1207 ? 19.888  85.253  71.855  1.00 41.02 ? 1207 LEU A CG  1 
ATOM   9474  C CD1 . LEU A 1 1207 ? 19.594  84.586  73.197  1.00 40.31 ? 1207 LEU A CD1 1 
ATOM   9475  C CD2 . LEU A 1 1207 ? 21.176  84.705  71.250  1.00 42.51 ? 1207 LEU A CD2 1 
ATOM   9476  N N   . ASN A 1 1208 ? 16.566  85.779  68.737  1.00 34.77 ? 1208 ASN A N   1 
ATOM   9477  C CA  . ASN A 1 1208 ? 15.423  85.382  67.927  1.00 33.47 ? 1208 ASN A CA  1 
ATOM   9478  C C   . ASN A 1 1208 ? 15.429  85.864  66.487  1.00 33.51 ? 1208 ASN A C   1 
ATOM   9479  O O   . ASN A 1 1208 ? 14.855  85.209  65.616  1.00 34.40 ? 1208 ASN A O   1 
ATOM   9480  C CB  . ASN A 1 1208 ? 14.133  85.852  68.580  1.00 33.43 ? 1208 ASN A CB  1 
ATOM   9481  C CG  . ASN A 1 1208 ? 13.959  85.299  69.970  1.00 31.98 ? 1208 ASN A CG  1 
ATOM   9482  O OD1 . ASN A 1 1208 ? 14.439  84.214  70.271  1.00 31.36 ? 1208 ASN A OD1 1 
ATOM   9483  N ND2 . ASN A 1 1208 ? 13.250  86.035  70.823  1.00 32.28 ? 1208 ASN A ND2 1 
ATOM   9484  N N   . THR A 1 1209 ? 16.071  87.000  66.229  1.00 31.45 ? 1209 THR A N   1 
ATOM   9485  C CA  . THR A 1 1209 ? 16.099  87.553  64.881  1.00 29.33 ? 1209 THR A CA  1 
ATOM   9486  C C   . THR A 1 1209 ? 17.215  87.004  64.005  1.00 27.96 ? 1209 THR A C   1 
ATOM   9487  O O   . THR A 1 1209 ? 17.195  87.194  62.794  1.00 28.27 ? 1209 THR A O   1 
ATOM   9488  C CB  . THR A 1 1209 ? 16.239  89.079  64.915  1.00 28.62 ? 1209 THR A CB  1 
ATOM   9489  O OG1 . THR A 1 1209 ? 17.561  89.433  65.340  1.00 31.89 ? 1209 THR A OG1 1 
ATOM   9490  C CG2 . THR A 1 1209 ? 15.254  89.667  65.876  1.00 29.74 ? 1209 THR A CG2 1 
ATOM   9491  N N   . ASP A 1 1210 ? 18.195  86.333  64.595  1.00 26.56 ? 1210 ASP A N   1 
ATOM   9492  C CA  . ASP A 1 1210 ? 19.279  85.809  63.779  1.00 27.55 ? 1210 ASP A CA  1 
ATOM   9493  C C   . ASP A 1 1210 ? 18.776  84.771  62.798  1.00 26.51 ? 1210 ASP A C   1 
ATOM   9494  O O   . ASP A 1 1210 ? 17.792  84.095  63.040  1.00 28.10 ? 1210 ASP A O   1 
ATOM   9495  C CB  . ASP A 1 1210 ? 20.379  85.182  64.637  1.00 30.38 ? 1210 ASP A CB  1 
ATOM   9496  C CG  . ASP A 1 1210 ? 21.115  86.197  65.486  1.00 32.33 ? 1210 ASP A CG  1 
ATOM   9497  O OD1 . ASP A 1 1210 ? 21.402  87.308  64.991  1.00 34.29 ? 1210 ASP A OD1 1 
ATOM   9498  O OD2 . ASP A 1 1210 ? 21.423  85.871  66.649  1.00 35.07 ? 1210 ASP A OD2 1 
ATOM   9499  N N   . ILE A 1 1211 ? 19.468  84.647  61.681  1.00 26.24 ? 1211 ILE A N   1 
ATOM   9500  C CA  . ILE A 1 1211 ? 19.101  83.679  60.668  1.00 24.93 ? 1211 ILE A CA  1 
ATOM   9501  C C   . ILE A 1 1211 ? 20.065  82.514  60.789  1.00 24.59 ? 1211 ILE A C   1 
ATOM   9502  O O   . ILE A 1 1211 ? 21.277  82.707  60.713  1.00 23.38 ? 1211 ILE A O   1 
ATOM   9503  C CB  . ILE A 1 1211 ? 19.227  84.294  59.269  1.00 24.78 ? 1211 ILE A CB  1 
ATOM   9504  C CG1 . ILE A 1 1211 ? 18.348  85.546  59.175  1.00 25.84 ? 1211 ILE A CG1 1 
ATOM   9505  C CG2 . ILE A 1 1211 ? 18.877  83.274  58.218  1.00 26.32 ? 1211 ILE A CG2 1 
ATOM   9506  C CD1 . ILE A 1 1211 ? 16.951  85.395  59.762  1.00 22.09 ? 1211 ILE A CD1 1 
ATOM   9507  N N   . PRO A 1 1212 ? 19.545  81.296  61.024  1.00 24.84 ? 1212 PRO A N   1 
ATOM   9508  C CA  . PRO A 1 1212 ? 20.430  80.138  61.143  1.00 26.11 ? 1212 PRO A CA  1 
ATOM   9509  C C   . PRO A 1 1212 ? 21.184  79.947  59.830  1.00 28.21 ? 1212 PRO A C   1 
ATOM   9510  O O   . PRO A 1 1212 ? 20.647  80.197  58.749  1.00 27.12 ? 1212 PRO A O   1 
ATOM   9511  C CB  . PRO A 1 1212 ? 19.464  78.993  61.441  1.00 25.91 ? 1212 PRO A CB  1 
ATOM   9512  C CG  . PRO A 1 1212 ? 18.393  79.667  62.236  1.00 25.26 ? 1212 PRO A CG  1 
ATOM   9513  C CD  . PRO A 1 1212 ? 18.176  80.944  61.446  1.00 26.78 ? 1212 PRO A CD  1 
ATOM   9514  N N   . PRO A 1 1213 ? 22.438  79.488  59.914  1.00 29.98 ? 1213 PRO A N   1 
ATOM   9515  C CA  . PRO A 1 1213 ? 23.318  79.250  58.768  1.00 30.90 ? 1213 PRO A CA  1 
ATOM   9516  C C   . PRO A 1 1213 ? 22.671  78.582  57.551  1.00 31.12 ? 1213 PRO A C   1 
ATOM   9517  O O   . PRO A 1 1213 ? 22.903  79.011  56.419  1.00 32.42 ? 1213 PRO A O   1 
ATOM   9518  C CB  . PRO A 1 1213 ? 24.436  78.397  59.368  1.00 31.64 ? 1213 PRO A CB  1 
ATOM   9519  C CG  . PRO A 1 1213 ? 24.501  78.875  60.784  1.00 31.41 ? 1213 PRO A CG  1 
ATOM   9520  C CD  . PRO A 1 1213 ? 23.042  78.963  61.152  1.00 30.94 ? 1213 PRO A CD  1 
ATOM   9521  N N   . ARG A 1 1214 ? 21.866  77.545  57.761  1.00 28.90 ? 1214 ARG A N   1 
ATOM   9522  C CA  . ARG A 1 1214 ? 21.260  76.877  56.616  1.00 28.24 ? 1214 ARG A CA  1 
ATOM   9523  C C   . ARG A 1 1214 ? 19.841  77.309  56.299  1.00 25.81 ? 1214 ARG A C   1 
ATOM   9524  O O   . ARG A 1 1214 ? 19.153  76.666  55.499  1.00 23.38 ? 1214 ARG A O   1 
ATOM   9525  C CB  . ARG A 1 1214 ? 21.284  75.362  56.801  1.00 32.58 ? 1214 ARG A CB  1 
ATOM   9526  C CG  . ARG A 1 1214 ? 22.671  74.754  56.847  1.00 38.59 ? 1214 ARG A CG  1 
ATOM   9527  C CD  . ARG A 1 1214 ? 22.713  73.448  56.055  1.00 43.11 ? 1214 ARG A CD  1 
ATOM   9528  N NE  . ARG A 1 1214 ? 23.796  72.579  56.505  1.00 48.13 ? 1214 ARG A NE  1 
ATOM   9529  C CZ  . ARG A 1 1214 ? 23.902  72.116  57.751  1.00 51.08 ? 1214 ARG A CZ  1 
ATOM   9530  N NH1 . ARG A 1 1214 ? 22.988  72.445  58.659  1.00 51.98 ? 1214 ARG A NH1 1 
ATOM   9531  N NH2 . ARG A 1 1214 ? 24.915  71.324  58.093  1.00 50.67 ? 1214 ARG A NH2 1 
ATOM   9532  N N   . MET A 1 1215 ? 19.393  78.392  56.920  1.00 23.40 ? 1215 MET A N   1 
ATOM   9533  C CA  . MET A 1 1215 ? 18.038  78.874  56.670  1.00 22.44 ? 1215 MET A CA  1 
ATOM   9534  C C   . MET A 1 1215 ? 18.028  80.310  56.125  1.00 21.71 ? 1215 MET A C   1 
ATOM   9535  O O   . MET A 1 1215 ? 17.157  81.113  56.466  1.00 20.88 ? 1215 MET A O   1 
ATOM   9536  C CB  . MET A 1 1215 ? 17.209  78.792  57.955  1.00 22.15 ? 1215 MET A CB  1 
ATOM   9537  C CG  . MET A 1 1215 ? 17.146  77.403  58.574  1.00 21.45 ? 1215 MET A CG  1 
ATOM   9538  S SD  . MET A 1 1215 ? 16.070  77.348  60.035  1.00 23.92 ? 1215 MET A SD  1 
ATOM   9539  C CE  . MET A 1 1215 ? 15.982  75.557  60.356  1.00 21.70 ? 1215 MET A CE  1 
ATOM   9540  N N   . GLY A 1 1216 ? 19.009  80.623  55.281  1.00 20.58 ? 1216 GLY A N   1 
ATOM   9541  C CA  . GLY A 1 1216 ? 19.086  81.948  54.699  1.00 18.97 ? 1216 GLY A CA  1 
ATOM   9542  C C   . GLY A 1 1216 ? 17.872  82.232  53.834  1.00 17.96 ? 1216 GLY A C   1 
ATOM   9543  O O   . GLY A 1 1216 ? 17.576  83.386  53.528  1.00 16.90 ? 1216 GLY A O   1 
ATOM   9544  N N   . TRP A 1 1217 ? 17.166  81.174  53.441  1.00 17.67 ? 1217 TRP A N   1 
ATOM   9545  C CA  . TRP A 1 1217 ? 15.978  81.312  52.617  1.00 15.22 ? 1217 TRP A CA  1 
ATOM   9546  C C   . TRP A 1 1217 ? 14.887  82.022  53.386  1.00 16.25 ? 1217 TRP A C   1 
ATOM   9547  O O   . TRP A 1 1217 ? 13.904  82.463  52.793  1.00 17.50 ? 1217 TRP A O   1 
ATOM   9548  C CB  . TRP A 1 1217 ? 15.471  79.944  52.140  1.00 15.03 ? 1217 TRP A CB  1 
ATOM   9549  C CG  . TRP A 1 1217 ? 15.401  78.895  53.185  1.00 15.69 ? 1217 TRP A CG  1 
ATOM   9550  C CD1 . TRP A 1 1217 ? 16.404  78.045  53.560  1.00 18.39 ? 1217 TRP A CD1 1 
ATOM   9551  C CD2 . TRP A 1 1217 ? 14.277  78.580  54.016  1.00 18.86 ? 1217 TRP A CD2 1 
ATOM   9552  N NE1 . TRP A 1 1217 ? 15.978  77.215  54.572  1.00 19.71 ? 1217 TRP A NE1 1 
ATOM   9553  C CE2 . TRP A 1 1217 ? 14.676  77.522  54.875  1.00 20.16 ? 1217 TRP A CE2 1 
ATOM   9554  C CE3 . TRP A 1 1217 ? 12.972  79.085  54.124  1.00 17.48 ? 1217 TRP A CE3 1 
ATOM   9555  C CZ2 . TRP A 1 1217 ? 13.810  76.960  55.831  1.00 18.31 ? 1217 TRP A CZ2 1 
ATOM   9556  C CZ3 . TRP A 1 1217 ? 12.111  78.523  55.074  1.00 18.58 ? 1217 TRP A CZ3 1 
ATOM   9557  C CH2 . TRP A 1 1217 ? 12.537  77.472  55.913  1.00 17.29 ? 1217 TRP A CH2 1 
ATOM   9558  N N   . LEU A 1 1218 ? 15.051  82.126  54.705  1.00 15.92 ? 1218 LEU A N   1 
ATOM   9559  C CA  . LEU A 1 1218 ? 14.064  82.810  55.540  1.00 16.10 ? 1218 LEU A CA  1 
ATOM   9560  C C   . LEU A 1 1218 ? 13.935  84.269  55.128  1.00 16.62 ? 1218 LEU A C   1 
ATOM   9561  O O   . LEU A 1 1218 ? 12.832  84.815  55.062  1.00 17.80 ? 1218 LEU A O   1 
ATOM   9562  C CB  . LEU A 1 1218 ? 14.460  82.774  57.017  1.00 14.48 ? 1218 LEU A CB  1 
ATOM   9563  C CG  . LEU A 1 1218 ? 14.082  81.554  57.847  1.00 16.90 ? 1218 LEU A CG  1 
ATOM   9564  C CD1 . LEU A 1 1218 ? 14.562  81.766  59.268  1.00 16.02 ? 1218 LEU A CD1 1 
ATOM   9565  C CD2 . LEU A 1 1218 ? 12.569  81.331  57.813  1.00 16.26 ? 1218 LEU A CD2 1 
ATOM   9566  N N   . ARG A 1 1219 ? 15.080  84.891  54.869  1.00 17.62 ? 1219 ARG A N   1 
ATOM   9567  C CA  . ARG A 1 1219 ? 15.145  86.300  54.488  1.00 17.79 ? 1219 ARG A CA  1 
ATOM   9568  C C   . ARG A 1 1219 ? 14.127  86.686  53.430  1.00 16.22 ? 1219 ARG A C   1 
ATOM   9569  O O   . ARG A 1 1219 ? 13.534  87.770  53.498  1.00 13.09 ? 1219 ARG A O   1 
ATOM   9570  C CB  . ARG A 1 1219 ? 16.542  86.647  53.979  1.00 19.00 ? 1219 ARG A CB  1 
ATOM   9571  C CG  . ARG A 1 1219 ? 17.628  86.380  54.995  1.00 24.13 ? 1219 ARG A CG  1 
ATOM   9572  C CD  . ARG A 1 1219 ? 18.785  87.342  54.835  1.00 26.92 ? 1219 ARG A CD  1 
ATOM   9573  N NE  . ARG A 1 1219 ? 19.712  87.197  55.946  1.00 32.21 ? 1219 ARG A NE  1 
ATOM   9574  C CZ  . ARG A 1 1219 ? 20.510  86.146  56.103  1.00 35.18 ? 1219 ARG A CZ  1 
ATOM   9575  N NH1 . ARG A 1 1219 ? 20.490  85.156  55.209  1.00 34.66 ? 1219 ARG A NH1 1 
ATOM   9576  N NH2 . ARG A 1 1219 ? 21.322  86.082  57.151  1.00 34.71 ? 1219 ARG A NH2 1 
ATOM   9577  N N   . ALA A 1 1220 ? 13.936  85.795  52.458  1.00 13.88 ? 1220 ALA A N   1 
ATOM   9578  C CA  . ALA A 1 1220 ? 13.002  86.038  51.367  1.00 13.02 ? 1220 ALA A CA  1 
ATOM   9579  C C   . ALA A 1 1220 ? 11.597  86.172  51.929  1.00 12.86 ? 1220 ALA A C   1 
ATOM   9580  O O   . ALA A 1 1220 ? 10.884  87.150  51.664  1.00 11.70 ? 1220 ALA A O   1 
ATOM   9581  C CB  . ALA A 1 1220 ? 13.053  84.881  50.361  1.00 11.83 ? 1220 ALA A CB  1 
ATOM   9582  N N   . ILE A 1 1221 ? 11.217  85.178  52.719  1.00 10.61 ? 1221 ILE A N   1 
ATOM   9583  C CA  . ILE A 1 1221 ? 9.906   85.151  53.311  1.00 9.14  ? 1221 ILE A CA  1 
ATOM   9584  C C   . ILE A 1 1221 ? 9.722   86.382  54.181  1.00 12.83 ? 1221 ILE A C   1 
ATOM   9585  O O   . ILE A 1 1221 ? 8.714   87.100  54.065  1.00 15.74 ? 1221 ILE A O   1 
ATOM   9586  C CB  . ILE A 1 1221 ? 9.736   83.859  54.143  1.00 8.26  ? 1221 ILE A CB  1 
ATOM   9587  C CG1 . ILE A 1 1221 ? 9.828   82.649  53.210  1.00 5.99  ? 1221 ILE A CG1 1 
ATOM   9588  C CG2 . ILE A 1 1221 ? 8.417   83.894  54.929  1.00 5.00  ? 1221 ILE A CG2 1 
ATOM   9589  C CD1 . ILE A 1 1221 ? 9.688   81.322  53.900  1.00 7.37  ? 1221 ILE A CD1 1 
ATOM   9590  N N   . LEU A 1 1222 ? 10.705  86.634  55.042  1.00 11.66 ? 1222 LEU A N   1 
ATOM   9591  C CA  . LEU A 1 1222 ? 10.642  87.759  55.943  1.00 12.18 ? 1222 LEU A CA  1 
ATOM   9592  C C   . LEU A 1 1222 ? 10.488  89.079  55.190  1.00 14.80 ? 1222 LEU A C   1 
ATOM   9593  O O   . LEU A 1 1222 ? 9.795   89.995  55.648  1.00 15.89 ? 1222 LEU A O   1 
ATOM   9594  C CB  . LEU A 1 1222 ? 11.891  87.788  56.829  1.00 11.71 ? 1222 LEU A CB  1 
ATOM   9595  C CG  . LEU A 1 1222 ? 11.935  86.696  57.907  1.00 11.64 ? 1222 LEU A CG  1 
ATOM   9596  C CD1 . LEU A 1 1222 ? 13.278  86.685  58.616  1.00 7.77  ? 1222 LEU A CD1 1 
ATOM   9597  C CD2 . LEU A 1 1222 ? 10.808  86.937  58.898  1.00 10.38 ? 1222 LEU A CD2 1 
ATOM   9598  N N   . ARG A 1 1223 ? 11.116  89.188  54.028  1.00 15.01 ? 1223 ARG A N   1 
ATOM   9599  C CA  . ARG A 1 1223 ? 11.007  90.429  53.291  1.00 14.51 ? 1223 ARG A CA  1 
ATOM   9600  C C   . ARG A 1 1223 ? 9.570   90.674  52.895  1.00 14.06 ? 1223 ARG A C   1 
ATOM   9601  O O   . ARG A 1 1223 ? 9.076   91.797  53.029  1.00 12.58 ? 1223 ARG A O   1 
ATOM   9602  C CB  . ARG A 1 1223 ? 11.922  90.412  52.078  1.00 14.28 ? 1223 ARG A CB  1 
ATOM   9603  C CG  . ARG A 1 1223 ? 13.338  90.763  52.458  1.00 15.43 ? 1223 ARG A CG  1 
ATOM   9604  C CD  . ARG A 1 1223 ? 14.327  90.381  51.389  1.00 15.38 ? 1223 ARG A CD  1 
ATOM   9605  N NE  . ARG A 1 1223 ? 15.682  90.461  51.910  1.00 19.41 ? 1223 ARG A NE  1 
ATOM   9606  C CZ  . ARG A 1 1223 ? 16.686  89.699  51.490  1.00 22.59 ? 1223 ARG A CZ  1 
ATOM   9607  N NH1 . ARG A 1 1223 ? 16.483  88.794  50.535  1.00 21.99 ? 1223 ARG A NH1 1 
ATOM   9608  N NH2 . ARG A 1 1223 ? 17.891  89.835  52.034  1.00 23.95 ? 1223 ARG A NH2 1 
ATOM   9609  N N   . PHE A 1 1224 ? 8.887   89.627  52.439  1.00 13.52 ? 1224 PHE A N   1 
ATOM   9610  C CA  . PHE A 1 1224 ? 7.487   89.779  52.055  1.00 15.06 ? 1224 PHE A CA  1 
ATOM   9611  C C   . PHE A 1 1224 ? 6.624   90.245  53.235  1.00 15.75 ? 1224 PHE A C   1 
ATOM   9612  O O   . PHE A 1 1224 ? 5.809   91.157  53.097  1.00 16.85 ? 1224 PHE A O   1 
ATOM   9613  C CB  . PHE A 1 1224 ? 6.915   88.468  51.494  1.00 13.69 ? 1224 PHE A CB  1 
ATOM   9614  C CG  . PHE A 1 1224 ? 6.993   88.353  49.992  1.00 12.61 ? 1224 PHE A CG  1 
ATOM   9615  C CD1 . PHE A 1 1224 ? 8.176   87.970  49.361  1.00 12.69 ? 1224 PHE A CD1 1 
ATOM   9616  C CD2 . PHE A 1 1224 ? 5.875   88.605  49.209  1.00 9.65  ? 1224 PHE A CD2 1 
ATOM   9617  C CE1 . PHE A 1 1224 ? 8.239   87.836  47.971  1.00 11.15 ? 1224 PHE A CE1 1 
ATOM   9618  C CE2 . PHE A 1 1224 ? 5.928   88.473  47.821  1.00 11.90 ? 1224 PHE A CE2 1 
ATOM   9619  C CZ  . PHE A 1 1224 ? 7.113   88.086  47.199  1.00 10.12 ? 1224 PHE A CZ  1 
ATOM   9620  N N   . LEU A 1 1225 ? 6.804   89.627  54.396  1.00 16.38 ? 1225 LEU A N   1 
ATOM   9621  C CA  . LEU A 1 1225 ? 6.014   90.003  55.564  1.00 16.80 ? 1225 LEU A CA  1 
ATOM   9622  C C   . LEU A 1 1225 ? 6.177   91.477  55.917  1.00 16.99 ? 1225 LEU A C   1 
ATOM   9623  O O   . LEU A 1 1225 ? 5.193   92.185  56.141  1.00 16.07 ? 1225 LEU A O   1 
ATOM   9624  C CB  . LEU A 1 1225 ? 6.392   89.131  56.766  1.00 16.11 ? 1225 LEU A CB  1 
ATOM   9625  C CG  . LEU A 1 1225 ? 6.107   87.632  56.640  1.00 16.18 ? 1225 LEU A CG  1 
ATOM   9626  C CD1 . LEU A 1 1225 ? 6.346   86.976  57.979  1.00 16.57 ? 1225 LEU A CD1 1 
ATOM   9627  C CD2 . LEU A 1 1225 ? 4.672   87.397  56.191  1.00 13.58 ? 1225 LEU A CD2 1 
ATOM   9628  N N   . GLY A 1 1226 ? 7.423   91.936  55.962  1.00 17.10 ? 1226 GLY A N   1 
ATOM   9629  C CA  . GLY A 1 1226 ? 7.676   93.328  56.281  1.00 17.07 ? 1226 GLY A CA  1 
ATOM   9630  C C   . GLY A 1 1226 ? 7.066   94.254  55.239  1.00 15.97 ? 1226 GLY A C   1 
ATOM   9631  O O   . GLY A 1 1226 ? 6.466   95.280  55.571  1.00 13.96 ? 1226 GLY A O   1 
ATOM   9632  N N   . ALA A 1 1227 ? 7.219   93.888  53.972  1.00 13.78 ? 1227 ALA A N   1 
ATOM   9633  C CA  . ALA A 1 1227 ? 6.683   94.698  52.891  1.00 13.85 ? 1227 ALA A CA  1 
ATOM   9634  C C   . ALA A 1 1227 ? 5.164   94.726  52.995  1.00 15.39 ? 1227 ALA A C   1 
ATOM   9635  O O   . ALA A 1 1227 ? 4.527   95.750  52.715  1.00 15.94 ? 1227 ALA A O   1 
ATOM   9636  C CB  . ALA A 1 1227 ? 7.106   94.127  51.554  1.00 10.55 ? 1227 ALA A CB  1 
ATOM   9637  N N   . GLY A 1 1228 ? 4.591   93.597  53.410  1.00 15.29 ? 1228 GLY A N   1 
ATOM   9638  C CA  . GLY A 1 1228 ? 3.148   93.508  53.535  1.00 14.65 ? 1228 GLY A CA  1 
ATOM   9639  C C   . GLY A 1 1228 ? 2.628   94.612  54.431  1.00 14.46 ? 1228 GLY A C   1 
ATOM   9640  O O   . GLY A 1 1228 ? 1.726   95.349  54.046  1.00 13.78 ? 1228 GLY A O   1 
ATOM   9641  N N   . MET A 1 1229 ? 3.205   94.727  55.626  1.00 14.17 ? 1229 MET A N   1 
ATOM   9642  C CA  . MET A 1 1229 ? 2.793   95.751  56.574  1.00 14.76 ? 1229 MET A CA  1 
ATOM   9643  C C   . MET A 1 1229 ? 3.050   97.164  56.057  1.00 15.56 ? 1229 MET A C   1 
ATOM   9644  O O   . MET A 1 1229 ? 2.219   98.063  56.227  1.00 16.14 ? 1229 MET A O   1 
ATOM   9645  C CB  . MET A 1 1229 ? 3.533   95.591  57.892  1.00 16.40 ? 1229 MET A CB  1 
ATOM   9646  C CG  . MET A 1 1229 ? 3.204   94.337  58.669  1.00 16.64 ? 1229 MET A CG  1 
ATOM   9647  S SD  . MET A 1 1229 ? 4.013   94.466  60.273  1.00 22.94 ? 1229 MET A SD  1 
ATOM   9648  C CE  . MET A 1 1229 ? 2.900   95.651  61.128  1.00 12.90 ? 1229 MET A CE  1 
ATOM   9649  N N   . VAL A 1 1230 ? 4.200   97.366  55.430  1.00 13.28 ? 1230 VAL A N   1 
ATOM   9650  C CA  . VAL A 1 1230 ? 4.527   98.688  54.943  1.00 12.94 ? 1230 VAL A CA  1 
ATOM   9651  C C   . VAL A 1 1230 ? 3.516   99.170  53.920  1.00 12.92 ? 1230 VAL A C   1 
ATOM   9652  O O   . VAL A 1 1230 ? 3.052   100.302 53.985  1.00 13.09 ? 1230 VAL A O   1 
ATOM   9653  C CB  . VAL A 1 1230 ? 5.964   98.734  54.339  1.00 11.92 ? 1230 VAL A CB  1 
ATOM   9654  C CG1 . VAL A 1 1230 ? 6.170   100.029 53.526  1.00 11.08 ? 1230 VAL A CG1 1 
ATOM   9655  C CG2 . VAL A 1 1230 ? 6.984   98.696  55.457  1.00 9.17  ? 1230 VAL A CG2 1 
ATOM   9656  N N   . MET A 1 1231 ? 3.165   98.298  52.989  1.00 13.23 ? 1231 MET A N   1 
ATOM   9657  C CA  . MET A 1 1231 ? 2.230   98.642  51.929  1.00 11.88 ? 1231 MET A CA  1 
ATOM   9658  C C   . MET A 1 1231 ? 0.784   98.713  52.370  1.00 11.30 ? 1231 MET A C   1 
ATOM   9659  O O   . MET A 1 1231 ? -0.028  99.388  51.733  1.00 10.04 ? 1231 MET A O   1 
ATOM   9660  C CB  . MET A 1 1231 ? 2.367   97.634  50.786  1.00 13.82 ? 1231 MET A CB  1 
ATOM   9661  C CG  . MET A 1 1231 ? 3.712   97.708  50.085  1.00 14.45 ? 1231 MET A CG  1 
ATOM   9662  S SD  . MET A 1 1231 ? 4.005   99.364  49.449  1.00 16.87 ? 1231 MET A SD  1 
ATOM   9663  C CE  . MET A 1 1231 ? 2.747   99.426  48.189  1.00 19.46 ? 1231 MET A CE  1 
ATOM   9664  N N   . THR A 1 1232 ? 0.455   98.004  53.449  1.00 11.75 ? 1232 THR A N   1 
ATOM   9665  C CA  . THR A 1 1232 ? -0.910  97.991  53.969  1.00 11.01 ? 1232 THR A CA  1 
ATOM   9666  C C   . THR A 1 1232 ? -1.221  99.245  54.797  1.00 11.15 ? 1232 THR A C   1 
ATOM   9667  O O   . THR A 1 1232 ? -2.372  99.655  54.900  1.00 8.65  ? 1232 THR A O   1 
ATOM   9668  C CB  . THR A 1 1232 ? -1.144  96.734  54.814  1.00 10.94 ? 1232 THR A CB  1 
ATOM   9669  O OG1 . THR A 1 1232 ? -0.964  95.583  53.987  1.00 12.27 ? 1232 THR A OG1 1 
ATOM   9670  C CG2 . THR A 1 1232 ? -2.556  96.715  55.398  1.00 11.17 ? 1232 THR A CG2 1 
ATOM   9671  N N   . ALA A 1 1233 ? -0.184  99.853  55.368  1.00 12.20 ? 1233 ALA A N   1 
ATOM   9672  C CA  . ALA A 1 1233 ? -0.346  101.061 56.177  1.00 14.99 ? 1233 ALA A CA  1 
ATOM   9673  C C   . ALA A 1 1233 ? -0.549  102.309 55.311  1.00 15.88 ? 1233 ALA A C   1 
ATOM   9674  O O   . ALA A 1 1233 ? 0.330   102.690 54.518  1.00 16.05 ? 1233 ALA A O   1 
ATOM   9675  C CB  . ALA A 1 1233 ? 0.868   101.252 57.082  1.00 13.37 ? 1233 ALA A CB  1 
ATOM   9676  N N   . THR A 1 1234 ? -1.712  102.938 55.461  1.00 13.41 ? 1234 THR A N   1 
ATOM   9677  C CA  . THR A 1 1234 ? -2.034  104.149 54.709  1.00 14.42 ? 1234 THR A CA  1 
ATOM   9678  C C   . THR A 1 1234 ? -0.929  105.207 54.785  1.00 13.21 ? 1234 THR A C   1 
ATOM   9679  O O   . THR A 1 1234 ? -0.334  105.413 55.847  1.00 13.76 ? 1234 THR A O   1 
ATOM   9680  C CB  . THR A 1 1234 ? -3.338  104.774 55.237  1.00 13.52 ? 1234 THR A CB  1 
ATOM   9681  O OG1 . THR A 1 1234 ? -4.451  104.036 54.721  1.00 18.41 ? 1234 THR A OG1 1 
ATOM   9682  C CG2 . THR A 1 1234 ? -3.455  106.227 54.820  1.00 13.84 ? 1234 THR A CG2 1 
ATOM   9683  N N   . GLY A 1 1235 ? -0.651  105.865 53.664  1.00 11.63 ? 1235 GLY A N   1 
ATOM   9684  C CA  . GLY A 1 1235 ? 0.353   106.920 53.663  1.00 11.10 ? 1235 GLY A CA  1 
ATOM   9685  C C   . GLY A 1 1235 ? 1.667   106.617 52.980  1.00 11.71 ? 1235 GLY A C   1 
ATOM   9686  O O   . GLY A 1 1235 ? 1.727   105.754 52.116  1.00 11.63 ? 1235 GLY A O   1 
ATOM   9687  N N   . VAL A 1 1236 ? 2.728   107.325 53.358  1.00 12.68 ? 1236 VAL A N   1 
ATOM   9688  C CA  . VAL A 1 1236 ? 4.034   107.092 52.744  1.00 14.73 ? 1236 VAL A CA  1 
ATOM   9689  C C   . VAL A 1 1236 ? 4.613   105.733 53.114  1.00 15.25 ? 1236 VAL A C   1 
ATOM   9690  O O   . VAL A 1 1236 ? 4.471   105.280 54.246  1.00 16.11 ? 1236 VAL A O   1 
ATOM   9691  C CB  . VAL A 1 1236 ? 5.070   108.159 53.179  1.00 16.47 ? 1236 VAL A CB  1 
ATOM   9692  C CG1 . VAL A 1 1236 ? 4.664   109.518 52.650  1.00 20.07 ? 1236 VAL A CG1 1 
ATOM   9693  C CG2 . VAL A 1 1236 ? 5.188   108.189 54.713  1.00 14.77 ? 1236 VAL A CG2 1 
ATOM   9694  N N   . ALA A 1 1237 ? 5.262   105.083 52.157  1.00 15.97 ? 1237 ALA A N   1 
ATOM   9695  C CA  . ALA A 1 1237 ? 5.903   103.804 52.420  1.00 15.65 ? 1237 ALA A CA  1 
ATOM   9696  C C   . ALA A 1 1237 ? 6.915   104.181 53.472  1.00 16.48 ? 1237 ALA A C   1 
ATOM   9697  O O   . ALA A 1 1237 ? 7.540   105.244 53.401  1.00 18.73 ? 1237 ALA A O   1 
ATOM   9698  C CB  . ALA A 1 1237 ? 6.613   103.291 51.189  1.00 17.20 ? 1237 ALA A CB  1 
ATOM   9699  N N   . VAL A 1 1238 ? 7.094   103.301 54.437  1.00 14.63 ? 1238 VAL A N   1 
ATOM   9700  C CA  . VAL A 1 1238 ? 7.979   103.568 55.536  1.00 12.53 ? 1238 VAL A CA  1 
ATOM   9701  C C   . VAL A 1 1238 ? 9.045   102.482 55.605  1.00 14.27 ? 1238 VAL A C   1 
ATOM   9702  O O   . VAL A 1 1238 ? 8.910   101.435 54.973  1.00 15.47 ? 1238 VAL A O   1 
ATOM   9703  C CB  . VAL A 1 1238 ? 7.097   103.611 56.823  1.00 12.59 ? 1238 VAL A CB  1 
ATOM   9704  C CG1 . VAL A 1 1238 ? 7.585   102.627 57.868  1.00 13.20 ? 1238 VAL A CG1 1 
ATOM   9705  C CG2 . VAL A 1 1238 ? 7.015   105.026 57.352  1.00 9.14  ? 1238 VAL A CG2 1 
ATOM   9706  N N   . ASP A 1 1239 ? 10.121  102.745 56.338  1.00 13.94 ? 1239 ASP A N   1 
ATOM   9707  C CA  . ASP A 1 1239 ? 11.165  101.748 56.522  1.00 14.22 ? 1239 ASP A CA  1 
ATOM   9708  C C   . ASP A 1 1239 ? 10.667  100.840 57.643  1.00 14.81 ? 1239 ASP A C   1 
ATOM   9709  O O   . ASP A 1 1239 ? 10.132  101.329 58.648  1.00 14.42 ? 1239 ASP A O   1 
ATOM   9710  C CB  . ASP A 1 1239 ? 12.474  102.386 56.982  1.00 15.56 ? 1239 ASP A CB  1 
ATOM   9711  C CG  . ASP A 1 1239 ? 13.377  102.762 55.839  1.00 17.33 ? 1239 ASP A CG  1 
ATOM   9712  O OD1 . ASP A 1 1239 ? 13.312  102.103 54.781  1.00 16.24 ? 1239 ASP A OD1 1 
ATOM   9713  O OD2 . ASP A 1 1239 ? 14.177  103.704 56.015  1.00 21.19 ? 1239 ASP A OD2 1 
ATOM   9714  N N   . ILE A 1 1240 ? 10.827  99.528  57.491  1.00 13.10 ? 1240 ILE A N   1 
ATOM   9715  C CA  . ILE A 1 1240 ? 10.384  98.642  58.551  1.00 12.19 ? 1240 ILE A CA  1 
ATOM   9716  C C   . ILE A 1 1240 ? 11.541  97.752  59.041  1.00 13.26 ? 1240 ILE A C   1 
ATOM   9717  O O   . ILE A 1 1240 ? 12.349  97.251  58.242  1.00 13.80 ? 1240 ILE A O   1 
ATOM   9718  C CB  . ILE A 1 1240 ? 9.146   97.816  58.096  1.00 9.56  ? 1240 ILE A CB  1 
ATOM   9719  C CG1 . ILE A 1 1240 ? 8.529   97.103  59.309  1.00 7.84  ? 1240 ILE A CG1 1 
ATOM   9720  C CG2 . ILE A 1 1240 ? 9.525   96.854  56.987  1.00 7.90  ? 1240 ILE A CG2 1 
ATOM   9721  C CD1 . ILE A 1 1240 ? 7.266   96.343  59.006  1.00 6.85  ? 1240 ILE A CD1 1 
ATOM   9722  N N   . TYR A 1 1241 ? 11.639  97.587  60.360  1.00 13.13 ? 1241 TYR A N   1 
ATOM   9723  C CA  . TYR A 1 1241 ? 12.717  96.783  60.956  1.00 14.92 ? 1241 TYR A CA  1 
ATOM   9724  C C   . TYR A 1 1241 ? 12.240  95.537  61.718  1.00 13.85 ? 1241 TYR A C   1 
ATOM   9725  O O   . TYR A 1 1241 ? 11.360  95.623  62.591  1.00 11.32 ? 1241 TYR A O   1 
ATOM   9726  C CB  . TYR A 1 1241 ? 13.550  97.654  61.902  1.00 16.25 ? 1241 TYR A CB  1 
ATOM   9727  C CG  . TYR A 1 1241 ? 14.336  98.758  61.226  1.00 19.41 ? 1241 TYR A CG  1 
ATOM   9728  C CD1 . TYR A 1 1241 ? 15.721  98.664  61.074  1.00 20.31 ? 1241 TYR A CD1 1 
ATOM   9729  C CD2 . TYR A 1 1241 ? 13.701  99.918  60.763  1.00 20.96 ? 1241 TYR A CD2 1 
ATOM   9730  C CE1 . TYR A 1 1241 ? 16.459  99.699  60.483  1.00 20.78 ? 1241 TYR A CE1 1 
ATOM   9731  C CE2 . TYR A 1 1241 ? 14.429  100.958 60.170  1.00 20.55 ? 1241 TYR A CE2 1 
ATOM   9732  C CZ  . TYR A 1 1241 ? 15.806  100.838 60.034  1.00 21.14 ? 1241 TYR A CZ  1 
ATOM   9733  O OH  . TYR A 1 1241 ? 16.521  101.841 59.426  1.00 22.45 ? 1241 TYR A OH  1 
ATOM   9734  N N   . LEU A 1 1242 ? 12.821  94.386  61.385  1.00 12.93 ? 1242 LEU A N   1 
ATOM   9735  C CA  . LEU A 1 1242 ? 12.457  93.146  62.059  1.00 14.80 ? 1242 LEU A CA  1 
ATOM   9736  C C   . LEU A 1 1242 ? 12.733  93.377  63.534  1.00 17.03 ? 1242 LEU A C   1 
ATOM   9737  O O   . LEU A 1 1242 ? 13.819  93.832  63.914  1.00 17.71 ? 1242 LEU A O   1 
ATOM   9738  C CB  . LEU A 1 1242 ? 13.293  91.964  61.545  1.00 15.28 ? 1242 LEU A CB  1 
ATOM   9739  C CG  . LEU A 1 1242 ? 13.072  90.601  62.232  1.00 16.60 ? 1242 LEU A CG  1 
ATOM   9740  C CD1 . LEU A 1 1242 ? 11.621  90.160  62.073  1.00 13.47 ? 1242 LEU A CD1 1 
ATOM   9741  C CD2 . LEU A 1 1242 ? 14.006  89.550  61.623  1.00 17.15 ? 1242 LEU A CD2 1 
ATOM   9742  N N   . GLU A 1 1243 ? 11.746  93.084  64.366  1.00 18.49 ? 1243 GLU A N   1 
ATOM   9743  C CA  . GLU A 1 1243 ? 11.900  93.293  65.790  1.00 21.72 ? 1243 GLU A CA  1 
ATOM   9744  C C   . GLU A 1 1243 ? 11.937  91.957  66.539  1.00 22.54 ? 1243 GLU A C   1 
ATOM   9745  O O   . GLU A 1 1243 ? 12.698  91.797  67.502  1.00 18.79 ? 1243 GLU A O   1 
ATOM   9746  C CB  . GLU A 1 1243 ? 10.760  94.198  66.286  1.00 23.97 ? 1243 GLU A CB  1 
ATOM   9747  C CG  . GLU A 1 1243 ? 10.734  94.521  67.786  1.00 30.34 ? 1243 GLU A CG  1 
ATOM   9748  C CD  . GLU A 1 1243 ? 12.085  94.959  68.354  1.00 34.75 ? 1243 GLU A CD  1 
ATOM   9749  O OE1 . GLU A 1 1243 ? 12.834  95.715  67.687  1.00 37.84 ? 1243 GLU A OE1 1 
ATOM   9750  O OE2 . GLU A 1 1243 ? 12.392  94.547  69.495  1.00 38.16 ? 1243 GLU A OE2 1 
ATOM   9751  N N   . ASP A 1 1244 ? 11.152  90.982  66.078  1.00 21.91 ? 1244 ASP A N   1 
ATOM   9752  C CA  . ASP A 1 1244 ? 11.138  89.711  66.778  1.00 22.12 ? 1244 ASP A CA  1 
ATOM   9753  C C   . ASP A 1 1244 ? 10.478  88.531  66.081  1.00 20.04 ? 1244 ASP A C   1 
ATOM   9754  O O   . ASP A 1 1244 ? 9.614   88.691  65.222  1.00 20.71 ? 1244 ASP A O   1 
ATOM   9755  C CB  . ASP A 1 1244 ? 10.476  89.915  68.143  1.00 24.10 ? 1244 ASP A CB  1 
ATOM   9756  C CG  . ASP A 1 1244 ? 10.690  88.747  69.085  1.00 26.47 ? 1244 ASP A CG  1 
ATOM   9757  O OD1 . ASP A 1 1244 ? 9.716   88.370  69.769  1.00 29.17 ? 1244 ASP A OD1 1 
ATOM   9758  O OD2 . ASP A 1 1244 ? 11.826  88.220  69.158  1.00 27.14 ? 1244 ASP A OD2 1 
ATOM   9759  N N   . ILE A 1 1245 ? 10.918  87.341  66.472  1.00 18.26 ? 1245 ILE A N   1 
ATOM   9760  C CA  . ILE A 1 1245 ? 10.377  86.079  65.977  1.00 17.93 ? 1245 ILE A CA  1 
ATOM   9761  C C   . ILE A 1 1245 ? 10.182  85.276  67.259  1.00 19.98 ? 1245 ILE A C   1 
ATOM   9762  O O   . ILE A 1 1245 ? 11.158  84.813  67.849  1.00 19.40 ? 1245 ILE A O   1 
ATOM   9763  C CB  . ILE A 1 1245 ? 11.367  85.319  65.076  1.00 15.50 ? 1245 ILE A CB  1 
ATOM   9764  C CG1 . ILE A 1 1245 ? 11.855  86.219  63.936  1.00 14.98 ? 1245 ILE A CG1 1 
ATOM   9765  C CG2 . ILE A 1 1245 ? 10.700  84.090  64.523  1.00 10.81 ? 1245 ILE A CG2 1 
ATOM   9766  C CD1 . ILE A 1 1245 ? 12.729  85.511  62.926  1.00 13.80 ? 1245 ILE A CD1 1 
ATOM   9767  N N   . HIS A 1 1246 ? 8.934   85.119  67.690  1.00 21.48 ? 1246 HIS A N   1 
ATOM   9768  C CA  . HIS A 1 1246 ? 8.654   84.414  68.931  1.00 24.81 ? 1246 HIS A CA  1 
ATOM   9769  C C   . HIS A 1 1246 ? 9.529   83.222  69.312  1.00 24.75 ? 1246 HIS A C   1 
ATOM   9770  O O   . HIS A 1 1246 ? 10.202  83.260  70.353  1.00 29.38 ? 1246 HIS A O   1 
ATOM   9771  C CB  . HIS A 1 1246 ? 7.203   83.964  69.014  1.00 26.21 ? 1246 HIS A CB  1 
ATOM   9772  C CG  . HIS A 1 1246 ? 6.914   83.166  70.247  1.00 29.41 ? 1246 HIS A CG  1 
ATOM   9773  N ND1 . HIS A 1 1246 ? 6.530   81.841  70.208  1.00 31.50 ? 1246 HIS A ND1 1 
ATOM   9774  C CD2 . HIS A 1 1246 ? 6.985   83.497  71.559  1.00 30.25 ? 1246 HIS A CD2 1 
ATOM   9775  C CE1 . HIS A 1 1246 ? 6.379   81.391  71.441  1.00 31.03 ? 1246 HIS A CE1 1 
ATOM   9776  N NE2 . HIS A 1 1246 ? 6.648   82.377  72.278  1.00 31.18 ? 1246 HIS A NE2 1 
ATOM   9777  N N   . GLY A 1 1247 ? 9.525   82.163  68.517  1.00 21.77 ? 1247 GLY A N   1 
ATOM   9778  C CA  . GLY A 1 1247 ? 10.343  81.018  68.891  1.00 19.06 ? 1247 GLY A CA  1 
ATOM   9779  C C   . GLY A 1 1247 ? 11.708  80.978  68.231  1.00 18.26 ? 1247 GLY A C   1 
ATOM   9780  O O   . GLY A 1 1247 ? 12.341  79.921  68.146  1.00 18.15 ? 1247 GLY A O   1 
ATOM   9781  N N   . GLY A 1 1248 ? 12.166  82.128  67.753  1.00 17.14 ? 1248 GLY A N   1 
ATOM   9782  C CA  . GLY A 1 1248 ? 13.462  82.187  67.105  1.00 16.59 ? 1248 GLY A CA  1 
ATOM   9783  C C   . GLY A 1 1248 ? 13.426  81.738  65.655  1.00 17.13 ? 1248 GLY A C   1 
ATOM   9784  O O   . GLY A 1 1248 ? 12.518  81.015  65.228  1.00 16.69 ? 1248 GLY A O   1 
ATOM   9785  N N   . GLY A 1 1249 ? 14.435  82.166  64.900  1.00 17.41 ? 1249 GLY A N   1 
ATOM   9786  C CA  . GLY A 1 1249 ? 14.527  81.821  63.497  1.00 15.95 ? 1249 GLY A CA  1 
ATOM   9787  C C   . GLY A 1 1249 ? 14.635  80.337  63.211  1.00 15.67 ? 1249 GLY A C   1 
ATOM   9788  O O   . GLY A 1 1249 ? 14.140  79.858  62.189  1.00 15.05 ? 1249 GLY A O   1 
ATOM   9789  N N   . ARG A 1 1250 ? 15.272  79.596  64.105  1.00 15.87 ? 1250 ARG A N   1 
ATOM   9790  C CA  . ARG A 1 1250 ? 15.433  78.172  63.871  1.00 16.95 ? 1250 ARG A CA  1 
ATOM   9791  C C   . ARG A 1 1250 ? 14.086  77.473  63.921  1.00 17.28 ? 1250 ARG A C   1 
ATOM   9792  O O   . ARG A 1 1250 ? 13.764  76.672  63.033  1.00 16.84 ? 1250 ARG A O   1 
ATOM   9793  C CB  . ARG A 1 1250 ? 16.394  77.540  64.889  1.00 16.44 ? 1250 ARG A CB  1 
ATOM   9794  C CG  . ARG A 1 1250 ? 16.874  76.179  64.436  1.00 16.90 ? 1250 ARG A CG  1 
ATOM   9795  C CD  . ARG A 1 1250 ? 17.778  75.493  65.436  1.00 21.00 ? 1250 ARG A CD  1 
ATOM   9796  N NE  . ARG A 1 1250 ? 18.005  74.101  65.044  1.00 21.86 ? 1250 ARG A NE  1 
ATOM   9797  C CZ  . ARG A 1 1250 ? 18.662  73.204  65.776  1.00 22.25 ? 1250 ARG A CZ  1 
ATOM   9798  N NH1 . ARG A 1 1250 ? 19.171  73.553  66.950  1.00 21.05 ? 1250 ARG A NH1 1 
ATOM   9799  N NH2 . ARG A 1 1250 ? 18.791  71.951  65.342  1.00 21.54 ? 1250 ARG A NH2 1 
ATOM   9800  N N   . SER A 1 1251 ? 13.302  77.785  64.952  1.00 16.69 ? 1251 SER A N   1 
ATOM   9801  C CA  . SER A 1 1251 ? 11.978  77.193  65.119  1.00 16.65 ? 1251 SER A CA  1 
ATOM   9802  C C   . SER A 1 1251 ? 11.086  77.600  63.961  1.00 15.19 ? 1251 SER A C   1 
ATOM   9803  O O   . SER A 1 1251 ? 10.305  76.787  63.436  1.00 15.19 ? 1251 SER A O   1 
ATOM   9804  C CB  . SER A 1 1251 ? 11.321  77.663  66.428  1.00 18.71 ? 1251 SER A CB  1 
ATOM   9805  O OG  . SER A 1 1251 ? 12.078  77.299  67.576  1.00 23.24 ? 1251 SER A OG  1 
ATOM   9806  N N   . LEU A 1 1252 ? 11.201  78.860  63.557  1.00 13.36 ? 1252 LEU A N   1 
ATOM   9807  C CA  . LEU A 1 1252 ? 10.369  79.355  62.477  1.00 13.66 ? 1252 LEU A CA  1 
ATOM   9808  C C   . LEU A 1 1252 ? 10.640  78.579  61.189  1.00 14.31 ? 1252 LEU A C   1 
ATOM   9809  O O   . LEU A 1 1252 ? 9.705   78.168  60.488  1.00 15.48 ? 1252 LEU A O   1 
ATOM   9810  C CB  . LEU A 1 1252 ? 10.593  80.857  62.268  1.00 13.10 ? 1252 LEU A CB  1 
ATOM   9811  C CG  . LEU A 1 1252 ? 9.700   81.458  61.173  1.00 11.66 ? 1252 LEU A CG  1 
ATOM   9812  C CD1 . LEU A 1 1252 ? 8.228   81.253  61.521  1.00 11.50 ? 1252 LEU A CD1 1 
ATOM   9813  C CD2 . LEU A 1 1252 ? 10.005  82.918  61.020  1.00 10.22 ? 1252 LEU A CD2 1 
ATOM   9814  N N   . GLY A 1 1253 ? 11.913  78.359  60.889  1.00 12.15 ? 1253 GLY A N   1 
ATOM   9815  C CA  . GLY A 1 1253 ? 12.258  77.622  59.687  1.00 12.29 ? 1253 GLY A CA  1 
ATOM   9816  C C   . GLY A 1 1253 ? 11.645  76.232  59.635  1.00 12.73 ? 1253 GLY A C   1 
ATOM   9817  O O   . GLY A 1 1253 ? 11.082  75.833  58.604  1.00 11.56 ? 1253 GLY A O   1 
ATOM   9818  N N   . GLN A 1 1254 ? 11.752  75.489  60.738  1.00 12.84 ? 1254 GLN A N   1 
ATOM   9819  C CA  . GLN A 1 1254 ? 11.195  74.139  60.783  1.00 14.86 ? 1254 GLN A CA  1 
ATOM   9820  C C   . GLN A 1 1254 ? 9.692   74.225  60.538  1.00 15.51 ? 1254 GLN A C   1 
ATOM   9821  O O   . GLN A 1 1254 ? 9.114   73.399  59.821  1.00 16.34 ? 1254 GLN A O   1 
ATOM   9822  C CB  . GLN A 1 1254 ? 11.439  73.458  62.141  1.00 14.44 ? 1254 GLN A CB  1 
ATOM   9823  C CG  . GLN A 1 1254 ? 12.866  73.046  62.440  1.00 15.81 ? 1254 GLN A CG  1 
ATOM   9824  C CD  . GLN A 1 1254 ? 13.465  72.150  61.372  1.00 18.66 ? 1254 GLN A CD  1 
ATOM   9825  O OE1 . GLN A 1 1254 ? 12.754  71.393  60.696  1.00 20.11 ? 1254 GLN A OE1 1 
ATOM   9826  N NE2 . GLN A 1 1254 ? 14.790  72.214  61.224  1.00 18.35 ? 1254 GLN A NE2 1 
ATOM   9827  N N   . ARG A 1 1255 ? 9.064   75.233  61.131  1.00 14.40 ? 1255 ARG A N   1 
ATOM   9828  C CA  . ARG A 1 1255 ? 7.626   75.406  60.967  1.00 15.19 ? 1255 ARG A CA  1 
ATOM   9829  C C   . ARG A 1 1255 ? 7.261   75.489  59.481  1.00 13.96 ? 1255 ARG A C   1 
ATOM   9830  O O   . ARG A 1 1255 ? 6.317   74.836  59.042  1.00 15.80 ? 1255 ARG A O   1 
ATOM   9831  C CB  . ARG A 1 1255 ? 7.160   76.656  61.729  1.00 15.70 ? 1255 ARG A CB  1 
ATOM   9832  C CG  . ARG A 1 1255 ? 5.783   76.540  62.289  1.00 14.61 ? 1255 ARG A CG  1 
ATOM   9833  C CD  . ARG A 1 1255 ? 5.593   77.401  63.520  1.00 17.55 ? 1255 ARG A CD  1 
ATOM   9834  N NE  . ARG A 1 1255 ? 4.172   77.633  63.738  1.00 19.74 ? 1255 ARG A NE  1 
ATOM   9835  C CZ  . ARG A 1 1255 ? 3.598   77.813  64.920  1.00 21.93 ? 1255 ARG A CZ  1 
ATOM   9836  N NH1 . ARG A 1 1255 ? 4.324   77.788  66.030  1.00 22.99 ? 1255 ARG A NH1 1 
ATOM   9837  N NH2 . ARG A 1 1255 ? 2.283   78.015  64.987  1.00 24.74 ? 1255 ARG A NH2 1 
ATOM   9838  N N   . PHE A 1 1256 ? 8.009   76.269  58.705  1.00 13.38 ? 1256 PHE A N   1 
ATOM   9839  C CA  . PHE A 1 1256 ? 7.744   76.374  57.260  1.00 13.44 ? 1256 PHE A CA  1 
ATOM   9840  C C   . PHE A 1 1256 ? 8.169   75.075  56.540  1.00 13.51 ? 1256 PHE A C   1 
ATOM   9841  O O   . PHE A 1 1256 ? 7.598   74.699  55.507  1.00 11.14 ? 1256 PHE A O   1 
ATOM   9842  C CB  . PHE A 1 1256 ? 8.512   77.540  56.626  1.00 11.51 ? 1256 PHE A CB  1 
ATOM   9843  C CG  . PHE A 1 1256 ? 8.106   78.896  57.116  1.00 9.27  ? 1256 PHE A CG  1 
ATOM   9844  C CD1 . PHE A 1 1256 ? 6.790   79.317  57.039  1.00 9.83  ? 1256 PHE A CD1 1 
ATOM   9845  C CD2 . PHE A 1 1256 ? 9.064   79.784  57.583  1.00 9.08  ? 1256 PHE A CD2 1 
ATOM   9846  C CE1 . PHE A 1 1256 ? 6.435   80.606  57.414  1.00 10.73 ? 1256 PHE A CE1 1 
ATOM   9847  C CE2 . PHE A 1 1256 ? 8.724   81.079  57.962  1.00 9.40  ? 1256 PHE A CE2 1 
ATOM   9848  C CZ  . PHE A 1 1256 ? 7.407   81.490  57.876  1.00 10.80 ? 1256 PHE A CZ  1 
ATOM   9849  N N   . MET A 1 1257 ? 9.182   74.394  57.067  1.00 13.74 ? 1257 MET A N   1 
ATOM   9850  C CA  . MET A 1 1257 ? 9.598   73.151  56.424  1.00 15.19 ? 1257 MET A CA  1 
ATOM   9851  C C   . MET A 1 1257 ? 8.519   72.083  56.588  1.00 14.52 ? 1257 MET A C   1 
ATOM   9852  O O   . MET A 1 1257 ? 8.284   71.273  55.674  1.00 14.31 ? 1257 MET A O   1 
ATOM   9853  C CB  . MET A 1 1257 ? 10.949  72.679  56.968  1.00 13.69 ? 1257 MET A CB  1 
ATOM   9854  C CG  . MET A 1 1257 ? 12.076  73.507  56.398  1.00 19.25 ? 1257 MET A CG  1 
ATOM   9855  S SD  . MET A 1 1257 ? 13.734  73.045  56.897  1.00 24.35 ? 1257 MET A SD  1 
ATOM   9856  C CE  . MET A 1 1257 ? 14.201  72.111  55.496  1.00 25.50 ? 1257 MET A CE  1 
ATOM   9857  N N   . THR A 1 1258 ? 7.850   72.090  57.738  1.00 11.81 ? 1258 THR A N   1 
ATOM   9858  C CA  . THR A 1 1258 ? 6.785   71.128  57.970  1.00 11.45 ? 1258 THR A CA  1 
ATOM   9859  C C   . THR A 1 1258 ? 5.706   71.409  56.916  1.00 12.73 ? 1258 THR A C   1 
ATOM   9860  O O   . THR A 1 1258 ? 5.150   70.484  56.310  1.00 11.48 ? 1258 THR A O   1 
ATOM   9861  C CB  . THR A 1 1258 ? 6.214   71.262  59.418  1.00 11.47 ? 1258 THR A CB  1 
ATOM   9862  O OG1 . THR A 1 1258 ? 7.080   70.574  60.337  1.00 8.20  ? 1258 THR A OG1 1 
ATOM   9863  C CG2 . THR A 1 1258 ? 4.781   70.694  59.510  1.00 5.37  ? 1258 THR A CG2 1 
ATOM   9864  N N   . TRP A 1 1259 ? 5.434   72.691  56.672  1.00 12.89 ? 1259 TRP A N   1 
ATOM   9865  C CA  . TRP A 1 1259 ? 4.438   73.038  55.670  1.00 15.49 ? 1259 TRP A CA  1 
ATOM   9866  C C   . TRP A 1 1259 ? 4.890   72.624  54.273  1.00 16.02 ? 1259 TRP A C   1 
ATOM   9867  O O   . TRP A 1 1259 ? 4.089   72.147  53.484  1.00 15.69 ? 1259 TRP A O   1 
ATOM   9868  C CB  . TRP A 1 1259 ? 4.147   74.535  55.639  1.00 14.88 ? 1259 TRP A CB  1 
ATOM   9869  C CG  . TRP A 1 1259 ? 3.013   74.845  54.692  1.00 15.62 ? 1259 TRP A CG  1 
ATOM   9870  C CD1 . TRP A 1 1259 ? 1.677   74.778  54.966  1.00 15.06 ? 1259 TRP A CD1 1 
ATOM   9871  C CD2 . TRP A 1 1259 ? 3.117   75.188  53.304  1.00 15.33 ? 1259 TRP A CD2 1 
ATOM   9872  N NE1 . TRP A 1 1259 ? 0.945   75.052  53.841  1.00 14.22 ? 1259 TRP A NE1 1 
ATOM   9873  C CE2 . TRP A 1 1259 ? 1.800   75.308  52.804  1.00 14.50 ? 1259 TRP A CE2 1 
ATOM   9874  C CE3 . TRP A 1 1259 ? 4.195   75.401  52.434  1.00 16.01 ? 1259 TRP A CE3 1 
ATOM   9875  C CZ2 . TRP A 1 1259 ? 1.526   75.631  51.472  1.00 16.40 ? 1259 TRP A CZ2 1 
ATOM   9876  C CZ3 . TRP A 1 1259 ? 3.926   75.723  51.100  1.00 18.32 ? 1259 TRP A CZ3 1 
ATOM   9877  C CH2 . TRP A 1 1259 ? 2.597   75.834  50.634  1.00 19.03 ? 1259 TRP A CH2 1 
ATOM   9878  N N   . MET A 1 1260 ? 6.169   72.824  53.968  1.00 17.47 ? 1260 MET A N   1 
ATOM   9879  C CA  . MET A 1 1260 ? 6.686   72.479  52.657  1.00 18.48 ? 1260 MET A CA  1 
ATOM   9880  C C   . MET A 1 1260 ? 6.560   71.000  52.357  1.00 21.88 ? 1260 MET A C   1 
ATOM   9881  O O   . MET A 1 1260 ? 6.194   70.624  51.240  1.00 24.28 ? 1260 MET A O   1 
ATOM   9882  C CB  . MET A 1 1260 ? 8.142   72.899  52.528  1.00 16.21 ? 1260 MET A CB  1 
ATOM   9883  C CG  . MET A 1 1260 ? 8.341   74.399  52.414  1.00 17.13 ? 1260 MET A CG  1 
ATOM   9884  S SD  . MET A 1 1260 ? 10.094  74.799  52.357  1.00 19.73 ? 1260 MET A SD  1 
ATOM   9885  C CE  . MET A 1 1260 ? 10.216  76.184  53.458  1.00 12.43 ? 1260 MET A CE  1 
ATOM   9886  N N   . ARG A 1 1261 ? 6.835   70.152  53.346  1.00 21.49 ? 1261 ARG A N   1 
ATOM   9887  C CA  . ARG A 1 1261 ? 6.761   68.733  53.092  1.00 20.84 ? 1261 ARG A CA  1 
ATOM   9888  C C   . ARG A 1 1261 ? 5.369   68.139  53.227  1.00 23.06 ? 1261 ARG A C   1 
ATOM   9889  O O   . ARG A 1 1261 ? 5.140   67.006  52.817  1.00 25.41 ? 1261 ARG A O   1 
ATOM   9890  C CB  . ARG A 1 1261 ? 7.738   67.971  53.982  1.00 18.82 ? 1261 ARG A CB  1 
ATOM   9891  C CG  . ARG A 1 1261 ? 7.322   67.809  55.423  1.00 17.67 ? 1261 ARG A CG  1 
ATOM   9892  C CD  . ARG A 1 1261 ? 8.267   66.861  56.134  1.00 13.91 ? 1261 ARG A CD  1 
ATOM   9893  N NE  . ARG A 1 1261 ? 9.648   67.337  56.078  1.00 14.19 ? 1261 ARG A NE  1 
ATOM   9894  C CZ  . ARG A 1 1261 ? 10.162  68.292  56.858  1.00 12.40 ? 1261 ARG A CZ  1 
ATOM   9895  N NH1 . ARG A 1 1261 ? 9.418   68.892  57.783  1.00 10.59 ? 1261 ARG A NH1 1 
ATOM   9896  N NH2 . ARG A 1 1261 ? 11.425  68.662  56.697  1.00 11.06 ? 1261 ARG A NH2 1 
ATOM   9897  N N   . GLN A 1 1262 ? 4.422   68.886  53.769  1.00 24.65 ? 1262 GLN A N   1 
ATOM   9898  C CA  . GLN A 1 1262 ? 3.092   68.318  53.912  1.00 25.86 ? 1262 GLN A CA  1 
ATOM   9899  C C   . GLN A 1 1262 ? 2.091   68.548  52.784  1.00 26.14 ? 1262 GLN A C   1 
ATOM   9900  O O   . GLN A 1 1262 ? 1.035   67.907  52.770  1.00 27.57 ? 1262 GLN A O   1 
ATOM   9901  C CB  . GLN A 1 1262 ? 2.473   68.759  55.242  1.00 26.45 ? 1262 GLN A CB  1 
ATOM   9902  C CG  . GLN A 1 1262 ? 2.744   67.797  56.402  1.00 29.63 ? 1262 GLN A CG  1 
ATOM   9903  C CD  . GLN A 1 1262 ? 2.377   68.391  57.758  1.00 30.38 ? 1262 GLN A CD  1 
ATOM   9904  O OE1 . GLN A 1 1262 ? 1.338   69.037  57.907  1.00 31.25 ? 1262 GLN A OE1 1 
ATOM   9905  N NE2 . GLN A 1 1262 ? 3.228   68.167  58.751  1.00 29.36 ? 1262 GLN A NE2 1 
ATOM   9906  N N   . GLU A 1 1263 ? 2.406   69.431  51.836  1.00 24.80 ? 1263 GLU A N   1 
ATOM   9907  C CA  . GLU A 1 1263 ? 1.474   69.738  50.742  1.00 26.48 ? 1263 GLU A CA  1 
ATOM   9908  C C   . GLU A 1 1263 ? 0.846   68.577  49.957  1.00 28.11 ? 1263 GLU A C   1 
ATOM   9909  O O   . GLU A 1 1263 ? 1.484   67.932  49.129  1.00 29.42 ? 1263 GLU A O   1 
ATOM   9910  C CB  . GLU A 1 1263 ? 2.126   70.737  49.795  1.00 26.41 ? 1263 GLU A CB  1 
ATOM   9911  C CG  . GLU A 1 1263 ? 1.922   72.141  50.265  1.00 27.95 ? 1263 GLU A CG  1 
ATOM   9912  C CD  . GLU A 1 1263 ? 0.462   72.511  50.232  1.00 30.92 ? 1263 GLU A CD  1 
ATOM   9913  O OE1 . GLU A 1 1263 ? -0.006  72.903  49.148  1.00 33.27 ? 1263 GLU A OE1 1 
ATOM   9914  O OE2 . GLU A 1 1263 ? -0.222  72.411  51.275  1.00 32.32 ? 1263 GLU A OE2 1 
ATOM   9915  N N   . GLY A 1 1264 ? -0.428  68.342  50.239  0.00 28.56 ? 1264 GLY A N   1 
ATOM   9916  C CA  . GLY A 1 1264 ? -1.148  67.278  49.584  0.00 29.19 ? 1264 GLY A CA  1 
ATOM   9917  C C   . GLY A 1 1264 ? -0.715  65.895  50.021  0.00 29.67 ? 1264 GLY A C   1 
ATOM   9918  O O   . GLY A 1 1264 ? -0.022  65.209  49.268  0.00 29.64 ? 1264 GLY A O   1 
ATOM   9919  N N   . ARG A 1 1265 ? -1.100  65.474  51.223  0.00 30.13 ? 1265 ARG A N   1 
ATOM   9920  C CA  . ARG A 1 1265 ? -0.721  64.137  51.656  0.00 30.74 ? 1265 ARG A CA  1 
ATOM   9921  C C   . ARG A 1 1265 ? -1.884  63.138  51.581  0.00 31.29 ? 1265 ARG A C   1 
ATOM   9922  O O   . ARG A 1 1265 ? -1.876  62.353  50.611  0.00 31.60 ? 1265 ARG A O   1 
ATOM   9923  C CB  . ARG A 1 1265 ? -0.108  64.157  53.067  0.00 30.25 ? 1265 ARG A CB  1 
ATOM   9924  C CG  . ARG A 1 1265 ? 1.286   64.825  53.158  0.00 29.63 ? 1265 ARG A CG  1 
ATOM   9925  C CD  . ARG A 1 1265 ? 2.003   64.419  54.442  0.00 29.07 ? 1265 ARG A CD  1 
ATOM   9926  N NE  . ARG A 1 1265 ? 3.347   64.977  54.600  0.00 28.73 ? 1265 ARG A NE  1 
ATOM   9927  C CZ  . ARG A 1 1265 ? 4.120   64.710  55.648  0.00 28.55 ? 1265 ARG A CZ  1 
ATOM   9928  N NH1 . ARG A 1 1265 ? 3.666   63.903  56.595  0.00 28.51 ? 1265 ARG A NH1 1 
ATOM   9929  N NH2 . ARG A 1 1265 ? 5.329   65.248  55.767  0.00 28.51 ? 1265 ARG A NH2 1 
HETATM 9930  O O   . HOH B 2 .    ? -22.572 101.517 30.004  1.00 7.45  ? 1268 HOH A O   1 
HETATM 9931  O O   . HOH B 2 .    ? -7.382  108.015 37.283  1.00 13.13 ? 1269 HOH A O   1 
HETATM 9932  O O   . HOH B 2 .    ? -9.126  109.499 41.458  1.00 18.10 ? 1270 HOH A O   1 
HETATM 9933  O O   . HOH B 2 .    ? -26.998 100.753 13.602  1.00 21.56 ? 1271 HOH A O   1 
HETATM 9934  O O   . HOH B 2 .    ? -15.302 109.577 16.967  1.00 21.21 ? 1272 HOH A O   1 
HETATM 9935  O O   . HOH B 2 .    ? -26.599 98.029  18.996  1.00 20.96 ? 1273 HOH A O   1 
HETATM 9936  O O   . HOH B 2 .    ? -14.313 71.945  19.717  1.00 18.37 ? 1274 HOH A O   1 
HETATM 9937  O O   . HOH B 2 .    ? -3.423  92.284  44.484  1.00 13.94 ? 1275 HOH A O   1 
HETATM 9938  O O   . HOH B 2 .    ? -20.416 110.516 26.716  1.00 15.68 ? 1276 HOH A O   1 
HETATM 9939  O O   . HOH B 2 .    ? 9.853   96.172  41.656  1.00 16.95 ? 1277 HOH A O   1 
HETATM 9940  O O   . HOH B 2 .    ? -1.336  89.190  0.944   1.00 27.15 ? 1278 HOH A O   1 
HETATM 9941  O O   . HOH B 2 .    ? -17.865 106.194 30.721  1.00 18.76 ? 1279 HOH A O   1 
HETATM 9942  O O   . HOH B 2 .    ? -6.937  111.609 49.255  1.00 16.69 ? 1280 HOH A O   1 
HETATM 9943  O O   . HOH B 2 .    ? 9.837   80.747  42.510  1.00 26.96 ? 1281 HOH A O   1 
HETATM 9944  O O   . HOH B 2 .    ? -23.090 85.547  39.838  1.00 18.24 ? 1282 HOH A O   1 
HETATM 9945  O O   . HOH B 2 .    ? -7.520  95.694  56.066  1.00 17.51 ? 1283 HOH A O   1 
HETATM 9946  O O   . HOH B 2 .    ? -6.403  114.616 61.811  1.00 19.08 ? 1284 HOH A O   1 
HETATM 9947  O O   . HOH B 2 .    ? -8.590  102.327 55.582  1.00 20.52 ? 1285 HOH A O   1 
HETATM 9948  O O   . HOH B 2 .    ? 16.645  102.882 9.394   1.00 17.97 ? 1286 HOH A O   1 
HETATM 9949  O O   . HOH B 2 .    ? -18.614 95.215  20.529  1.00 13.55 ? 1287 HOH A O   1 
HETATM 9950  O O   . HOH B 2 .    ? -3.713  122.433 27.204  1.00 15.40 ? 1288 HOH A O   1 
HETATM 9951  O O   . HOH B 2 .    ? 4.732   114.223 33.476  1.00 21.58 ? 1289 HOH A O   1 
HETATM 9952  O O   . HOH B 2 .    ? -0.708  105.310 58.402  1.00 22.69 ? 1290 HOH A O   1 
HETATM 9953  O O   . HOH B 2 .    ? 2.773   105.813 55.913  1.00 19.51 ? 1291 HOH A O   1 
HETATM 9954  O O   . HOH B 2 .    ? -14.580 102.741 35.379  1.00 15.65 ? 1292 HOH A O   1 
HETATM 9955  O O   . HOH B 2 .    ? -17.318 93.107  14.378  1.00 33.95 ? 1293 HOH A O   1 
HETATM 9956  O O   . HOH B 2 .    ? 19.541  80.767  47.492  1.00 22.01 ? 1294 HOH A O   1 
HETATM 9957  O O   . HOH B 2 .    ? -11.084 115.181 39.155  1.00 21.68 ? 1295 HOH A O   1 
HETATM 9958  O O   . HOH B 2 .    ? -12.010 105.969 25.051  1.00 20.55 ? 1296 HOH A O   1 
HETATM 9959  O O   . HOH B 2 .    ? -39.772 104.859 37.424  1.00 17.83 ? 1297 HOH A O   1 
HETATM 9960  O O   . HOH B 2 .    ? 20.426  85.235  52.804  1.00 24.66 ? 1298 HOH A O   1 
HETATM 9961  O O   . HOH B 2 .    ? -1.676  116.640 22.254  1.00 16.68 ? 1299 HOH A O   1 
HETATM 9962  O O   . HOH B 2 .    ? -3.802  114.409 38.471  1.00 15.79 ? 1300 HOH A O   1 
HETATM 9963  O O   . HOH B 2 .    ? -8.056  76.800  18.555  1.00 20.69 ? 1301 HOH A O   1 
HETATM 9964  O O   . HOH B 2 .    ? -10.151 109.620 58.764  1.00 18.41 ? 1302 HOH A O   1 
HETATM 9965  O O   . HOH B 2 .    ? 4.373   97.591  9.777   1.00 15.77 ? 1303 HOH A O   1 
HETATM 9966  O O   . HOH B 2 .    ? -15.334 110.480 23.639  1.00 13.10 ? 1304 HOH A O   1 
HETATM 9967  O O   . HOH B 2 .    ? -9.339  109.822 49.812  1.00 14.79 ? 1305 HOH A O   1 
HETATM 9968  O O   . HOH B 2 .    ? -10.105 108.427 32.217  1.00 22.97 ? 1306 HOH A O   1 
HETATM 9969  O O   . HOH B 2 .    ? 15.879  92.741  53.328  1.00 18.45 ? 1307 HOH A O   1 
HETATM 9970  O O   . HOH B 2 .    ? 19.689  89.194  64.994  1.00 23.51 ? 1308 HOH A O   1 
HETATM 9971  O O   . HOH B 2 .    ? -3.139  75.154  56.491  1.00 23.08 ? 1309 HOH A O   1 
HETATM 9972  O O   . HOH B 2 .    ? 5.196   66.745  59.772  1.00 21.04 ? 1310 HOH A O   1 
HETATM 9973  O O   . HOH B 2 .    ? -25.138 98.506  28.276  1.00 14.45 ? 1311 HOH A O   1 
HETATM 9974  O O   . HOH B 2 .    ? 2.441   118.713 38.955  1.00 19.88 ? 1312 HOH A O   1 
HETATM 9975  O O   . HOH B 2 .    ? -24.202 90.087  21.448  1.00 20.67 ? 1313 HOH A O   1 
HETATM 9976  O O   . HOH B 2 .    ? -8.030  119.192 36.826  1.00 21.33 ? 1314 HOH A O   1 
HETATM 9977  O O   . HOH B 2 .    ? -5.678  103.001 49.204  1.00 22.55 ? 1315 HOH A O   1 
HETATM 9978  O O   . HOH B 2 .    ? -20.558 104.278 31.021  1.00 20.00 ? 1316 HOH A O   1 
HETATM 9979  O O   . HOH B 2 .    ? 7.250   85.685  44.884  1.00 26.21 ? 1317 HOH A O   1 
HETATM 9980  O O   . HOH B 2 .    ? 10.202  62.052  2.475   1.00 24.35 ? 1318 HOH A O   1 
HETATM 9981  O O   . HOH B 2 .    ? -27.987 101.004 19.811  1.00 18.42 ? 1319 HOH A O   1 
HETATM 9982  O O   . HOH B 2 .    ? 11.725  91.557  20.667  1.00 26.77 ? 1320 HOH A O   1 
HETATM 9983  O O   . HOH B 2 .    ? 16.037  97.881  28.312  1.00 21.86 ? 1321 HOH A O   1 
HETATM 9984  O O   . HOH B 2 .    ? 9.526   80.256  65.957  1.00 21.12 ? 1322 HOH A O   1 
HETATM 9985  O O   . HOH B 2 .    ? -20.191 97.494  59.494  1.00 23.15 ? 1323 HOH A O   1 
HETATM 9986  O O   . HOH B 2 .    ? -23.170 115.965 37.278  1.00 21.43 ? 1324 HOH A O   1 
HETATM 9987  O O   . HOH B 2 .    ? -18.165 106.471 48.524  1.00 18.83 ? 1325 HOH A O   1 
HETATM 9988  O O   . HOH B 2 .    ? -29.729 95.251  15.015  1.00 23.09 ? 1326 HOH A O   1 
HETATM 9989  O O   . HOH B 2 .    ? -1.702  92.628  1.831   1.00 20.69 ? 1327 HOH A O   1 
HETATM 9990  O O   . HOH B 2 .    ? 3.837   97.997  35.968  1.00 19.08 ? 1328 HOH A O   1 
HETATM 9991  O O   . HOH B 2 .    ? 1.467   123.490 38.344  1.00 29.80 ? 1329 HOH A O   1 
HETATM 9992  O O   . HOH B 2 .    ? 1.780   109.446 55.525  1.00 24.90 ? 1330 HOH A O   1 
HETATM 9993  O O   . HOH B 2 .    ? -12.382 108.531 26.764  1.00 14.26 ? 1331 HOH A O   1 
HETATM 9994  O O   . HOH B 2 .    ? 3.224   113.151 25.329  1.00 30.20 ? 1332 HOH A O   1 
HETATM 9995  O O   . HOH B 2 .    ? 1.721   63.400  3.960   1.00 20.62 ? 1333 HOH A O   1 
HETATM 9996  O O   . HOH B 2 .    ? -29.459 89.717  11.745  1.00 16.85 ? 1334 HOH A O   1 
HETATM 9997  O O   . HOH B 2 .    ? 5.242   93.354  30.798  1.00 18.57 ? 1335 HOH A O   1 
HETATM 9998  O O   . HOH B 2 .    ? -10.279 126.019 18.403  1.00 30.58 ? 1336 HOH A O   1 
HETATM 9999  O O   . HOH B 2 .    ? 1.669   75.059  19.503  1.00 33.53 ? 1337 HOH A O   1 
HETATM 10000 O O   . HOH B 2 .    ? -38.386 84.150  6.073   1.00 24.10 ? 1338 HOH A O   1 
HETATM 10001 O O   . HOH B 2 .    ? 20.865  63.543  28.366  1.00 30.76 ? 1339 HOH A O   1 
HETATM 10002 O O   . HOH B 2 .    ? -21.379 104.562 8.830   1.00 26.88 ? 1340 HOH A O   1 
HETATM 10003 O O   . HOH B 2 .    ? -31.611 88.115  23.149  1.00 22.07 ? 1341 HOH A O   1 
HETATM 10004 O O   . HOH B 2 .    ? -7.823  75.007  29.365  1.00 28.43 ? 1342 HOH A O   1 
HETATM 10005 O O   . HOH B 2 .    ? -8.535  88.283  45.448  1.00 22.05 ? 1343 HOH A O   1 
HETATM 10006 O O   . HOH B 2 .    ? -2.217  116.775 57.965  1.00 38.37 ? 1344 HOH A O   1 
HETATM 10007 O O   . HOH B 2 .    ? -44.563 105.402 37.499  1.00 22.94 ? 1345 HOH A O   1 
HETATM 10008 O O   . HOH B 2 .    ? -16.885 109.197 13.067  1.00 20.12 ? 1346 HOH A O   1 
HETATM 10009 O O   . HOH B 2 .    ? -26.049 88.768  38.063  1.00 25.51 ? 1347 HOH A O   1 
HETATM 10010 O O   . HOH B 2 .    ? 11.865  61.548  9.097   1.00 34.06 ? 1348 HOH A O   1 
HETATM 10011 O O   . HOH B 2 .    ? -28.999 92.541  11.878  1.00 13.25 ? 1349 HOH A O   1 
HETATM 10012 O O   . HOH B 2 .    ? -0.844  81.280  51.974  1.00 27.72 ? 1350 HOH A O   1 
HETATM 10013 O O   . HOH B 2 .    ? 0.794   90.331  -4.850  1.00 21.14 ? 1351 HOH A O   1 
HETATM 10014 O O   . HOH B 2 .    ? -1.682  93.855  19.680  1.00 20.45 ? 1352 HOH A O   1 
HETATM 10015 O O   . HOH B 2 .    ? -28.873 96.667  30.090  1.00 38.90 ? 1353 HOH A O   1 
HETATM 10016 O O   . HOH B 2 .    ? -2.387  67.825  11.258  1.00 25.75 ? 1354 HOH A O   1 
HETATM 10017 O O   . HOH B 2 .    ? 9.851   73.071  30.710  1.00 41.29 ? 1355 HOH A O   1 
HETATM 10018 O O   . HOH B 2 .    ? 1.554   110.576 39.306  1.00 19.01 ? 1356 HOH A O   1 
HETATM 10019 O O   . HOH B 2 .    ? -5.970  102.835 64.806  1.00 23.62 ? 1357 HOH A O   1 
HETATM 10020 O O   . HOH B 2 .    ? -5.037  97.304  6.214   1.00 23.04 ? 1358 HOH A O   1 
HETATM 10021 O O   . HOH B 2 .    ? -24.746 97.233  21.930  1.00 23.42 ? 1359 HOH A O   1 
HETATM 10022 O O   . HOH B 2 .    ? 0.044   104.559 43.659  1.00 28.37 ? 1360 HOH A O   1 
HETATM 10023 O O   . HOH B 2 .    ? 14.618  78.813  66.982  1.00 16.59 ? 1361 HOH A O   1 
HETATM 10024 O O   . HOH B 2 .    ? -30.430 106.272 3.533   1.00 18.07 ? 1362 HOH A O   1 
HETATM 10025 O O   . HOH B 2 .    ? 1.357   81.056  19.976  1.00 21.60 ? 1363 HOH A O   1 
HETATM 10026 O O   . HOH B 2 .    ? -13.480 126.356 21.296  1.00 25.46 ? 1364 HOH A O   1 
HETATM 10027 O O   . HOH B 2 .    ? -33.388 95.169  44.464  1.00 38.05 ? 1365 HOH A O   1 
HETATM 10028 O O   . HOH B 2 .    ? -41.072 105.156 21.494  1.00 32.52 ? 1366 HOH A O   1 
HETATM 10029 O O   . HOH B 2 .    ? -5.001  117.658 40.425  1.00 21.69 ? 1367 HOH A O   1 
HETATM 10030 O O   . HOH B 2 .    ? -37.651 107.053 38.538  1.00 20.20 ? 1368 HOH A O   1 
HETATM 10031 O O   . HOH B 2 .    ? -1.018  102.333 4.153   1.00 37.73 ? 1369 HOH A O   1 
HETATM 10032 O O   . HOH B 2 .    ? -40.186 102.329 11.220  1.00 29.26 ? 1370 HOH A O   1 
HETATM 10033 O O   . HOH B 2 .    ? 15.789  91.165  26.289  1.00 21.05 ? 1371 HOH A O   1 
HETATM 10034 O O   . HOH B 2 .    ? 13.369  69.353  58.695  1.00 33.61 ? 1372 HOH A O   1 
HETATM 10035 O O   . HOH B 2 .    ? 16.300  61.210  25.847  1.00 24.48 ? 1373 HOH A O   1 
HETATM 10036 O O   . HOH B 2 .    ? 17.502  93.094  16.775  1.00 34.16 ? 1374 HOH A O   1 
HETATM 10037 O O   . HOH B 2 .    ? 7.542   68.401  59.525  1.00 22.24 ? 1375 HOH A O   1 
HETATM 10038 O O   . HOH B 2 .    ? -23.005 94.304  8.111   1.00 25.96 ? 1376 HOH A O   1 
HETATM 10039 O O   . HOH B 2 .    ? -21.779 85.904  33.817  1.00 18.84 ? 1377 HOH A O   1 
HETATM 10040 O O   . HOH B 2 .    ? -19.467 80.271  64.391  1.00 33.11 ? 1378 HOH A O   1 
HETATM 10041 O O   . HOH B 2 .    ? -26.683 88.387  24.826  1.00 22.54 ? 1379 HOH A O   1 
HETATM 10042 O O   . HOH B 2 .    ? -22.762 97.302  28.345  1.00 26.81 ? 1380 HOH A O   1 
HETATM 10043 O O   . HOH B 2 .    ? -8.696  81.751  71.962  1.00 40.42 ? 1381 HOH A O   1 
HETATM 10044 O O   . HOH B 2 .    ? -13.869 53.673  34.489  1.00 44.07 ? 1382 HOH A O   1 
HETATM 10045 O O   . HOH B 2 .    ? 8.645   70.975  31.651  1.00 24.05 ? 1383 HOH A O   1 
HETATM 10046 O O   . HOH B 2 .    ? -18.444 95.616  57.528  1.00 25.40 ? 1384 HOH A O   1 
HETATM 10047 O O   . HOH B 2 .    ? -31.323 97.098  24.547  1.00 10.78 ? 1385 HOH A O   1 
HETATM 10048 O O   . HOH B 2 .    ? -2.168  93.722  25.349  1.00 21.61 ? 1386 HOH A O   1 
HETATM 10049 O O   . HOH B 2 .    ? 17.066  80.146  66.338  1.00 19.26 ? 1387 HOH A O   1 
HETATM 10050 O O   . HOH B 2 .    ? -18.497 102.079 24.319  1.00 16.93 ? 1388 HOH A O   1 
HETATM 10051 O O   . HOH B 2 .    ? 15.114  91.736  4.635   1.00 26.50 ? 1389 HOH A O   1 
HETATM 10052 O O   . HOH B 2 .    ? -19.130 99.167  12.689  1.00 26.17 ? 1390 HOH A O   1 
HETATM 10053 O O   . HOH B 2 .    ? 11.516  99.599  38.650  1.00 19.17 ? 1391 HOH A O   1 
HETATM 10054 O O   . HOH B 2 .    ? 3.410   65.017  22.510  1.00 32.67 ? 1392 HOH A O   1 
HETATM 10055 O O   . HOH B 2 .    ? 5.595   86.529  42.774  1.00 22.09 ? 1393 HOH A O   1 
HETATM 10056 O O   . HOH B 2 .    ? -13.022 101.572 15.746  1.00 36.69 ? 1394 HOH A O   1 
HETATM 10057 O O   . HOH B 2 .    ? 5.373   75.699  47.611  1.00 29.65 ? 1395 HOH A O   1 
HETATM 10058 O O   . HOH B 2 .    ? -16.939 103.442 32.309  1.00 19.21 ? 1396 HOH A O   1 
HETATM 10059 O O   . HOH B 2 .    ? -42.025 100.392 23.078  1.00 23.16 ? 1397 HOH A O   1 
HETATM 10060 O O   . HOH B 2 .    ? 14.907  81.132  20.439  1.00 30.77 ? 1398 HOH A O   1 
HETATM 10061 O O   . HOH B 2 .    ? -3.566  106.375 63.174  1.00 23.54 ? 1399 HOH A O   1 
HETATM 10062 O O   . HOH B 2 .    ? -43.271 96.809  15.374  1.00 17.01 ? 1400 HOH A O   1 
HETATM 10063 O O   . HOH B 2 .    ? 4.371   91.214  69.258  1.00 58.58 ? 1401 HOH A O   1 
HETATM 10064 O O   . HOH B 2 .    ? 4.719   80.155  -2.550  1.00 26.30 ? 1402 HOH A O   1 
HETATM 10065 O O   . HOH B 2 .    ? 0.545   103.886 36.719  1.00 38.11 ? 1403 HOH A O   1 
HETATM 10066 O O   . HOH B 2 .    ? -11.027 112.651 47.302  1.00 14.86 ? 1404 HOH A O   1 
HETATM 10067 O O   . HOH B 2 .    ? -22.898 87.384  1.231   1.00 26.91 ? 1405 HOH A O   1 
HETATM 10068 O O   . HOH B 2 .    ? -2.383  101.743 42.172  1.00 25.73 ? 1406 HOH A O   1 
HETATM 10069 O O   . HOH B 2 .    ? 4.821   111.773 21.923  1.00 33.01 ? 1407 HOH A O   1 
HETATM 10070 O O   . HOH B 2 .    ? -21.025 99.064  30.214  1.00 26.75 ? 1408 HOH A O   1 
HETATM 10071 O O   . HOH B 2 .    ? -13.911 96.213  25.290  1.00 18.56 ? 1409 HOH A O   1 
HETATM 10072 O O   . HOH B 2 .    ? -24.314 120.922 16.461  1.00 23.14 ? 1410 HOH A O   1 
HETATM 10073 O O   . HOH B 2 .    ? -17.645 102.824 34.778  1.00 22.45 ? 1411 HOH A O   1 
HETATM 10074 O O   . HOH B 2 .    ? 6.174   79.159  30.746  1.00 38.96 ? 1412 HOH A O   1 
HETATM 10075 O O   . HOH B 2 .    ? -36.657 91.242  24.072  1.00 25.97 ? 1413 HOH A O   1 
HETATM 10076 O O   . HOH B 2 .    ? 22.627  114.367 6.225   1.00 37.96 ? 1414 HOH A O   1 
HETATM 10077 O O   . HOH B 2 .    ? 20.113  103.238 10.025  1.00 26.45 ? 1415 HOH A O   1 
HETATM 10078 O O   . HOH B 2 .    ? -5.406  77.642  21.145  1.00 41.40 ? 1416 HOH A O   1 
HETATM 10079 O O   . HOH B 2 .    ? -6.032  56.327  32.320  1.00 33.03 ? 1417 HOH A O   1 
HETATM 10080 O O   . HOH B 2 .    ? -4.484  84.545  74.168  1.00 29.96 ? 1418 HOH A O   1 
HETATM 10081 O O   . HOH B 2 .    ? -6.799  102.574 31.625  1.00 30.92 ? 1419 HOH A O   1 
HETATM 10082 O O   . HOH B 2 .    ? 18.317  76.076  68.390  1.00 31.65 ? 1420 HOH A O   1 
HETATM 10083 O O   . HOH B 2 .    ? 16.634  76.913  49.668  1.00 28.43 ? 1421 HOH A O   1 
HETATM 10084 O O   . HOH B 2 .    ? 19.108  75.639  9.548   1.00 24.33 ? 1422 HOH A O   1 
HETATM 10085 O O   . HOH B 2 .    ? 17.091  83.264  65.721  1.00 33.60 ? 1423 HOH A O   1 
HETATM 10086 O O   . HOH B 2 .    ? -17.339 107.349 8.999   1.00 23.82 ? 1424 HOH A O   1 
HETATM 10087 O O   . HOH B 2 .    ? 1.933   71.936  37.691  1.00 29.11 ? 1425 HOH A O   1 
HETATM 10088 O O   . HOH B 2 .    ? -2.818  79.027  11.143  1.00 24.21 ? 1426 HOH A O   1 
HETATM 10089 O O   . HOH B 2 .    ? -23.258 71.887  58.689  1.00 23.87 ? 1427 HOH A O   1 
HETATM 10090 O O   . HOH B 2 .    ? 5.295   118.805 22.996  1.00 21.57 ? 1428 HOH A O   1 
HETATM 10091 O O   . HOH B 2 .    ? 15.359  103.770 57.907  1.00 37.12 ? 1429 HOH A O   1 
HETATM 10092 O O   . HOH B 2 .    ? -27.155 94.501  6.913   1.00 22.27 ? 1430 HOH A O   1 
HETATM 10093 O O   . HOH B 2 .    ? 18.763  97.598  22.611  1.00 29.65 ? 1431 HOH A O   1 
HETATM 10094 O O   . HOH B 2 .    ? -17.250 115.389 41.373  1.00 22.58 ? 1432 HOH A O   1 
HETATM 10095 O O   . HOH B 2 .    ? -20.240 107.987 21.428  1.00 43.96 ? 1433 HOH A O   1 
HETATM 10096 O O   . HOH B 2 .    ? -35.196 105.213 15.115  1.00 27.92 ? 1434 HOH A O   1 
HETATM 10097 O O   . HOH B 2 .    ? -17.079 123.887 16.455  1.00 31.78 ? 1435 HOH A O   1 
HETATM 10098 O O   . HOH B 2 .    ? 13.391  122.906 40.663  1.00 31.71 ? 1436 HOH A O   1 
HETATM 10099 O O   . HOH B 2 .    ? -18.665 120.687 15.951  1.00 39.52 ? 1437 HOH A O   1 
HETATM 10100 O O   . HOH B 2 .    ? -31.743 79.326  12.993  1.00 30.42 ? 1438 HOH A O   1 
HETATM 10101 O O   . HOH B 2 .    ? 11.167  79.968  17.935  1.00 31.87 ? 1439 HOH A O   1 
HETATM 10102 O O   . HOH B 2 .    ? -2.897  82.483  66.599  1.00 25.46 ? 1440 HOH A O   1 
HETATM 10103 O O   . HOH B 2 .    ? -30.926 104.133 10.816  1.00 23.15 ? 1441 HOH A O   1 
HETATM 10104 O O   . HOH B 2 .    ? -2.623  93.729  28.816  1.00 76.88 ? 1442 HOH A O   1 
HETATM 10105 O O   . HOH B 2 .    ? -14.266 115.669 18.179  1.00 25.77 ? 1443 HOH A O   1 
HETATM 10106 O O   . HOH B 2 .    ? -20.453 97.547  62.534  1.00 22.32 ? 1444 HOH A O   1 
HETATM 10107 O O   . HOH B 2 .    ? 10.748  91.949  11.695  1.00 27.15 ? 1445 HOH A O   1 
HETATM 10108 O O   . HOH B 2 .    ? 14.861  104.755 38.801  1.00 26.12 ? 1446 HOH A O   1 
HETATM 10109 O O   . HOH B 2 .    ? -6.855  58.354  18.180  1.00 42.52 ? 1447 HOH A O   1 
HETATM 10110 O O   . HOH B 2 .    ? -27.794 108.702 49.613  1.00 23.89 ? 1448 HOH A O   1 
HETATM 10111 O O   . HOH B 2 .    ? -15.611 80.932  48.357  1.00 28.16 ? 1449 HOH A O   1 
HETATM 10112 O O   . HOH B 2 .    ? 12.974  86.487  -3.237  1.00 32.31 ? 1450 HOH A O   1 
HETATM 10113 O O   . HOH B 2 .    ? -44.919 84.366  32.850  1.00 34.79 ? 1451 HOH A O   1 
HETATM 10114 O O   . HOH B 2 .    ? -1.846  107.126 1.737   1.00 20.24 ? 1452 HOH A O   1 
HETATM 10115 O O   . HOH B 2 .    ? -40.474 97.623  16.864  1.00 25.59 ? 1453 HOH A O   1 
HETATM 10116 O O   . HOH B 2 .    ? -23.934 121.621 11.231  1.00 25.25 ? 1454 HOH A O   1 
HETATM 10117 O O   . HOH B 2 .    ? 12.164  71.130  -11.055 1.00 37.78 ? 1455 HOH A O   1 
HETATM 10118 O O   . HOH B 2 .    ? 14.092  68.811  4.294   1.00 26.40 ? 1456 HOH A O   1 
HETATM 10119 O O   . HOH B 2 .    ? -37.892 93.948  44.074  1.00 33.63 ? 1457 HOH A O   1 
HETATM 10120 O O   . HOH B 2 .    ? 0.855   85.402  48.432  1.00 27.97 ? 1458 HOH A O   1 
HETATM 10121 O O   . HOH B 2 .    ? 18.595  57.629  32.664  1.00 54.90 ? 1459 HOH A O   1 
HETATM 10122 O O   . HOH B 2 .    ? 18.972  61.271  39.518  1.00 28.06 ? 1460 HOH A O   1 
HETATM 10123 O O   . HOH B 2 .    ? 11.011  103.964 41.149  1.00 26.34 ? 1461 HOH A O   1 
HETATM 10124 O O   . HOH B 2 .    ? -14.055 110.011 56.704  1.00 31.30 ? 1462 HOH A O   1 
HETATM 10125 O O   . HOH B 2 .    ? 4.858   93.645  64.341  1.00 21.33 ? 1463 HOH A O   1 
HETATM 10126 O O   . HOH B 2 .    ? 10.060  96.510  16.455  1.00 22.50 ? 1464 HOH A O   1 
HETATM 10127 O O   . HOH B 2 .    ? -6.202  89.326  53.438  1.00 25.43 ? 1465 HOH A O   1 
HETATM 10128 O O   . HOH B 2 .    ? -27.632 93.757  13.836  1.00 18.93 ? 1466 HOH A O   1 
HETATM 10129 O O   . HOH B 2 .    ? -22.543 92.063  19.370  1.00 34.83 ? 1467 HOH A O   1 
HETATM 10130 O O   . HOH B 2 .    ? -9.553  99.402  73.456  1.00 48.18 ? 1468 HOH A O   1 
HETATM 10131 O O   . HOH B 2 .    ? -27.318 91.094  48.191  1.00 31.50 ? 1469 HOH A O   1 
HETATM 10132 O O   . HOH B 2 .    ? -10.189 87.042  12.331  1.00 27.92 ? 1470 HOH A O   1 
HETATM 10133 O O   . HOH B 2 .    ? -43.511 110.999 26.373  1.00 29.39 ? 1471 HOH A O   1 
HETATM 10134 O O   . HOH B 2 .    ? -5.294  93.648  -4.877  1.00 27.06 ? 1472 HOH A O   1 
HETATM 10135 O O   . HOH B 2 .    ? 4.348   119.914 36.528  1.00 34.06 ? 1473 HOH A O   1 
HETATM 10136 O O   . HOH B 2 .    ? -30.219 95.152  46.393  1.00 23.93 ? 1474 HOH A O   1 
HETATM 10137 O O   . HOH B 2 .    ? -2.400  76.003  26.532  1.00 33.25 ? 1475 HOH A O   1 
HETATM 10138 O O   . HOH B 2 .    ? -27.857 88.057  31.924  1.00 22.66 ? 1476 HOH A O   1 
HETATM 10139 O O   . HOH B 2 .    ? -39.743 86.778  3.246   1.00 52.59 ? 1477 HOH A O   1 
HETATM 10140 O O   . HOH B 2 .    ? 0.351   88.322  41.707  1.00 27.27 ? 1478 HOH A O   1 
HETATM 10141 O O   . HOH B 2 .    ? 8.446   118.977 16.915  1.00 34.63 ? 1479 HOH A O   1 
HETATM 10142 O O   . HOH B 2 .    ? 1.227   71.631  53.480  1.00 27.31 ? 1480 HOH A O   1 
HETATM 10143 O O   . HOH B 2 .    ? 0.539   117.741 23.495  1.00 34.95 ? 1481 HOH A O   1 
HETATM 10144 O O   . HOH B 2 .    ? -37.611 113.592 30.271  1.00 25.97 ? 1482 HOH A O   1 
HETATM 10145 O O   . HOH B 2 .    ? -47.503 106.802 28.497  1.00 37.51 ? 1483 HOH A O   1 
HETATM 10146 O O   . HOH B 2 .    ? -1.845  102.598 59.275  1.00 26.28 ? 1484 HOH A O   1 
HETATM 10147 O O   . HOH B 2 .    ? 9.415   101.103 50.997  1.00 40.99 ? 1485 HOH A O   1 
HETATM 10148 O O   . HOH B 2 .    ? 2.058   88.998  65.936  1.00 35.00 ? 1486 HOH A O   1 
HETATM 10149 O O   . HOH B 2 .    ? 17.405  106.597 26.792  1.00 20.08 ? 1487 HOH A O   1 
HETATM 10150 O O   . HOH B 2 .    ? 0.953   75.781  16.296  1.00 26.30 ? 1488 HOH A O   1 
HETATM 10151 O O   . HOH B 2 .    ? -23.114 85.589  29.945  1.00 37.73 ? 1489 HOH A O   1 
HETATM 10152 O O   . HOH B 2 .    ? 11.617  114.132 19.362  1.00 26.03 ? 1490 HOH A O   1 
HETATM 10153 O O   . HOH B 2 .    ? -24.478 85.444  26.975  1.00 57.63 ? 1491 HOH A O   1 
HETATM 10154 O O   . HOH B 2 .    ? -18.422 124.040 13.447  1.00 33.11 ? 1492 HOH A O   1 
HETATM 10155 O O   . HOH B 2 .    ? -9.681  74.934  63.096  1.00 30.06 ? 1493 HOH A O   1 
HETATM 10156 O O   . HOH B 2 .    ? 1.778   111.155 18.834  1.00 24.89 ? 1494 HOH A O   1 
HETATM 10157 O O   . HOH B 2 .    ? 12.292  71.893  -1.620  1.00 33.95 ? 1495 HOH A O   1 
HETATM 10158 O O   . HOH B 2 .    ? 3.013   76.763  61.232  1.00 17.13 ? 1496 HOH A O   1 
HETATM 10159 O O   . HOH B 2 .    ? 15.193  90.270  -5.356  1.00 57.42 ? 1497 HOH A O   1 
HETATM 10160 O O   . HOH B 2 .    ? -3.663  94.059  46.662  1.00 41.84 ? 1498 HOH A O   1 
HETATM 10161 O O   . HOH B 2 .    ? -37.856 92.955  40.277  1.00 38.62 ? 1499 HOH A O   1 
HETATM 10162 O O   . HOH B 2 .    ? -24.854 120.999 48.311  1.00 39.82 ? 1500 HOH A O   1 
HETATM 10163 O O   . HOH B 2 .    ? -43.755 102.895 13.623  1.00 34.64 ? 1501 HOH A O   1 
HETATM 10164 O O   . HOH B 2 .    ? -43.558 102.682 21.743  1.00 32.05 ? 1502 HOH A O   1 
HETATM 10165 O O   . HOH B 2 .    ? -29.321 117.234 26.908  1.00 27.77 ? 1503 HOH A O   1 
HETATM 10166 O O   . HOH B 2 .    ? -12.728 111.759 49.782  1.00 17.14 ? 1504 HOH A O   1 
HETATM 10167 O O   . HOH B 2 .    ? -12.504 54.428  24.172  1.00 29.91 ? 1505 HOH A O   1 
HETATM 10168 O O   . HOH B 2 .    ? -17.462 115.323 62.033  1.00 22.91 ? 1506 HOH A O   1 
HETATM 10169 O O   . HOH B 2 .    ? 16.005  66.776  23.611  1.00 34.46 ? 1507 HOH A O   1 
HETATM 10170 O O   . HOH B 2 .    ? -17.060 91.397  63.679  1.00 31.52 ? 1508 HOH A O   1 
HETATM 10171 O O   . HOH B 2 .    ? -47.399 81.026  16.278  1.00 27.89 ? 1509 HOH A O   1 
HETATM 10172 O O   . HOH B 2 .    ? 10.808  67.748  9.780   1.00 31.66 ? 1510 HOH A O   1 
HETATM 10173 O O   . HOH B 2 .    ? -9.231  88.916  3.342   1.00 30.49 ? 1511 HOH A O   1 
HETATM 10174 O O   . HOH B 2 .    ? -14.805 92.570  36.930  1.00 29.35 ? 1512 HOH A O   1 
HETATM 10175 O O   . HOH B 2 .    ? -32.374 87.638  52.771  1.00 33.91 ? 1513 HOH A O   1 
HETATM 10176 O O   . HOH B 2 .    ? -21.363 121.460 31.804  1.00 28.67 ? 1514 HOH A O   1 
HETATM 10177 O O   . HOH B 2 .    ? 2.773   73.497  47.313  1.00 40.05 ? 1515 HOH A O   1 
HETATM 10178 O O   . HOH B 2 .    ? -5.439  81.856  64.971  1.00 24.90 ? 1516 HOH A O   1 
HETATM 10179 O O   . HOH B 2 .    ? 3.767   117.671 19.188  1.00 31.41 ? 1517 HOH A O   1 
HETATM 10180 O O   . HOH B 2 .    ? 13.479  82.917  72.941  1.00 39.91 ? 1518 HOH A O   1 
HETATM 10181 O O   . HOH B 2 .    ? 23.083  83.745  62.985  1.00 32.09 ? 1519 HOH A O   1 
HETATM 10182 O O   . HOH B 2 .    ? -22.282 89.073  35.975  1.00 29.31 ? 1520 HOH A O   1 
HETATM 10183 O O   . HOH B 2 .    ? 11.576  127.156 25.532  1.00 34.52 ? 1521 HOH A O   1 
HETATM 10184 O O   . HOH B 2 .    ? -7.469  102.106 22.597  1.00 58.15 ? 1522 HOH A O   1 
HETATM 10185 O O   . HOH B 2 .    ? -6.763  89.545  15.192  1.00 41.47 ? 1523 HOH A O   1 
HETATM 10186 O O   . HOH B 2 .    ? -14.064 99.559  38.240  1.00 30.84 ? 1524 HOH A O   1 
HETATM 10187 O O   . HOH B 2 .    ? 2.311   81.652  -8.706  1.00 37.21 ? 1525 HOH A O   1 
HETATM 10188 O O   . HOH B 2 .    ? 13.928  96.345  64.825  1.00 34.99 ? 1526 HOH A O   1 
HETATM 10189 O O   . HOH B 2 .    ? -6.729  96.708  0.893   1.00 63.81 ? 1527 HOH A O   1 
HETATM 10190 O O   . HOH B 2 .    ? -4.871  53.441  14.866  1.00 48.04 ? 1528 HOH A O   1 
HETATM 10191 O O   . HOH B 2 .    ? -20.263 76.020  14.292  1.00 34.93 ? 1529 HOH A O   1 
HETATM 10192 O O   . HOH B 2 .    ? -11.754 120.319 34.923  1.00 17.26 ? 1530 HOH A O   1 
HETATM 10193 O O   . HOH B 2 .    ? 3.764   74.540  59.987  1.00 27.96 ? 1531 HOH A O   1 
HETATM 10194 O O   . HOH B 2 .    ? -22.686 114.581 42.635  1.00 29.88 ? 1532 HOH A O   1 
HETATM 10195 O O   . HOH B 2 .    ? 14.149  82.596  -3.889  1.00 39.70 ? 1533 HOH A O   1 
HETATM 10196 O O   . HOH B 2 .    ? -3.432  66.589  15.120  1.00 45.12 ? 1534 HOH A O   1 
HETATM 10197 O O   . HOH B 2 .    ? -7.224  107.687 61.199  1.00 31.32 ? 1535 HOH A O   1 
HETATM 10198 O O   . HOH B 2 .    ? -24.137 121.292 20.048  1.00 33.56 ? 1536 HOH A O   1 
HETATM 10199 O O   . HOH B 2 .    ? 22.536  103.390 30.308  1.00 27.07 ? 1537 HOH A O   1 
HETATM 10200 O O   . HOH B 2 .    ? 21.727  79.264  54.180  1.00 30.99 ? 1538 HOH A O   1 
HETATM 10201 O O   . HOH B 2 .    ? -27.075 96.906  62.676  1.00 28.19 ? 1539 HOH A O   1 
HETATM 10202 O O   . HOH B 2 .    ? -7.028  121.629 11.892  1.00 34.18 ? 1540 HOH A O   1 
HETATM 10203 O O   . HOH B 2 .    ? -9.504  106.261 22.526  1.00 43.60 ? 1541 HOH A O   1 
HETATM 10204 O O   . HOH B 2 .    ? 17.996  75.696  4.338   1.00 36.80 ? 1542 HOH A O   1 
HETATM 10205 O O   . HOH B 2 .    ? 2.903   66.792  -4.634  1.00 26.86 ? 1543 HOH A O   1 
HETATM 10206 O O   . HOH B 2 .    ? -4.805  123.374 23.138  1.00 34.68 ? 1544 HOH A O   1 
HETATM 10207 O O   . HOH B 2 .    ? 1.816   87.140  -7.939  1.00 26.21 ? 1545 HOH A O   1 
HETATM 10208 O O   . HOH B 2 .    ? 17.369  74.486  7.266   1.00 28.06 ? 1546 HOH A O   1 
HETATM 10209 O O   . HOH B 2 .    ? 11.363  65.489  15.349  1.00 36.80 ? 1547 HOH A O   1 
HETATM 10210 O O   . HOH B 2 .    ? 19.584  80.903  17.344  1.00 32.21 ? 1548 HOH A O   1 
HETATM 10211 O O   . HOH B 2 .    ? -2.320  89.836  46.678  1.00 28.64 ? 1549 HOH A O   1 
HETATM 10212 O O   . HOH B 2 .    ? -15.269 103.551 59.573  1.00 51.30 ? 1550 HOH A O   1 
HETATM 10213 O O   . HOH B 2 .    ? -3.251  96.361  35.943  1.00 51.92 ? 1551 HOH A O   1 
HETATM 10214 O O   . HOH B 2 .    ? 4.694   100.922 35.923  1.00 30.85 ? 1552 HOH A O   1 
HETATM 10215 O O   . HOH B 2 .    ? -1.373  67.899  17.611  1.00 31.12 ? 1553 HOH A O   1 
HETATM 10216 O O   . HOH B 2 .    ? -37.656 88.485  25.661  1.00 44.55 ? 1554 HOH A O   1 
HETATM 10217 O O   . HOH B 2 .    ? -20.483 115.800 53.597  1.00 40.22 ? 1555 HOH A O   1 
HETATM 10218 O O   . HOH B 2 .    ? -9.228  92.441  9.506   1.00 26.08 ? 1556 HOH A O   1 
HETATM 10219 O O   . HOH B 2 .    ? -3.922  104.815 29.940  1.00 26.77 ? 1557 HOH A O   1 
HETATM 10220 O O   . HOH B 2 .    ? -11.240 112.357 52.153  1.00 25.95 ? 1558 HOH A O   1 
HETATM 10221 O O   . HOH B 2 .    ? 1.650   124.799 19.876  1.00 34.76 ? 1559 HOH A O   1 
HETATM 10222 O O   . HOH B 2 .    ? 0.414   81.061  65.167  1.00 40.29 ? 1560 HOH A O   1 
HETATM 10223 O O   . HOH B 2 .    ? 7.154   64.439  21.730  1.00 41.50 ? 1561 HOH A O   1 
HETATM 10224 O O   . HOH B 2 .    ? 10.175  70.848  59.880  1.00 27.02 ? 1562 HOH A O   1 
HETATM 10225 O O   . HOH B 2 .    ? -14.487 98.692  36.312  1.00 28.36 ? 1563 HOH A O   1 
HETATM 10226 O O   . HOH B 2 .    ? -13.610 81.334  46.994  1.00 44.52 ? 1564 HOH A O   1 
HETATM 10227 O O   . HOH B 2 .    ? -48.939 100.461 30.228  1.00 44.42 ? 1565 HOH A O   1 
HETATM 10228 O O   . HOH B 2 .    ? -42.023 98.271  50.439  1.00 30.13 ? 1566 HOH A O   1 
HETATM 10229 O O   . HOH B 2 .    ? -20.389 114.516 49.114  1.00 35.07 ? 1567 HOH A O   1 
HETATM 10230 O O   . HOH B 2 .    ? -22.283 101.971 62.884  1.00 36.81 ? 1568 HOH A O   1 
HETATM 10231 O O   . HOH B 2 .    ? 7.890   89.612  21.163  1.00 30.96 ? 1569 HOH A O   1 
HETATM 10232 O O   . HOH B 2 .    ? -35.153 107.979 15.699  1.00 31.85 ? 1570 HOH A O   1 
HETATM 10233 O O   . HOH B 2 .    ? 3.532   102.891 38.243  1.00 34.28 ? 1571 HOH A O   1 
HETATM 10234 O O   . HOH B 2 .    ? 7.312   61.877  47.282  1.00 29.61 ? 1572 HOH A O   1 
HETATM 10235 O O   . HOH B 2 .    ? -9.172  102.654 70.836  1.00 36.39 ? 1573 HOH A O   1 
HETATM 10236 O O   . HOH B 2 .    ? 15.512  86.345  -2.188  1.00 41.04 ? 1574 HOH A O   1 
HETATM 10237 O O   . HOH B 2 .    ? 15.799  109.331 17.261  1.00 32.31 ? 1575 HOH A O   1 
HETATM 10238 O O   . HOH B 2 .    ? -11.976 84.923  14.343  1.00 57.24 ? 1576 HOH A O   1 
HETATM 10239 O O   . HOH B 2 .    ? 3.506   78.065  44.030  1.00 37.64 ? 1577 HOH A O   1 
HETATM 10240 O O   . HOH B 2 .    ? 20.762  103.168 27.691  1.00 34.72 ? 1578 HOH A O   1 
HETATM 10241 O O   . HOH B 2 .    ? -11.492 126.894 14.830  1.00 39.08 ? 1579 HOH A O   1 
HETATM 10242 O O   . HOH B 2 .    ? 8.334   111.749 -1.547  1.00 30.71 ? 1580 HOH A O   1 
HETATM 10243 O O   . HOH B 2 .    ? 20.263  79.030  15.001  1.00 32.40 ? 1581 HOH A O   1 
HETATM 10244 O O   . HOH B 2 .    ? -13.586 92.684  25.591  1.00 35.22 ? 1582 HOH A O   1 
HETATM 10245 O O   . HOH B 2 .    ? 13.232  113.553 25.446  1.00 67.03 ? 1583 HOH A O   1 
HETATM 10246 O O   . HOH B 2 .    ? -1.526  113.697 49.191  1.00 23.83 ? 1584 HOH A O   1 
HETATM 10247 O O   . HOH B 2 .    ? 6.832   65.299  52.388  1.00 47.68 ? 1585 HOH A O   1 
HETATM 10248 O O   . HOH B 2 .    ? -19.417 87.590  73.974  1.00 31.78 ? 1586 HOH A O   1 
HETATM 10249 O O   . HOH B 2 .    ? 3.829   61.097  55.613  1.00 33.00 ? 1587 HOH A O   1 
HETATM 10250 O O   . HOH B 2 .    ? -24.328 109.764 57.944  1.00 42.97 ? 1588 HOH A O   1 
HETATM 10251 O O   . HOH B 2 .    ? 17.495  77.464  0.084   1.00 31.47 ? 1589 HOH A O   1 
HETATM 10252 O O   . HOH B 2 .    ? -8.257  79.715  19.617  1.00 41.19 ? 1590 HOH A O   1 
HETATM 10253 O O   . HOH B 2 .    ? -10.962 123.318 32.957  1.00 36.18 ? 1591 HOH A O   1 
HETATM 10254 O O   . HOH B 2 .    ? -17.675 116.978 49.888  1.00 38.95 ? 1592 HOH A O   1 
HETATM 10255 O O   . HOH B 2 .    ? -47.049 108.579 26.540  1.00 27.52 ? 1593 HOH A O   1 
HETATM 10256 O O   . HOH B 2 .    ? -20.261 86.543  29.797  1.00 30.52 ? 1594 HOH A O   1 
HETATM 10257 O O   . HOH B 2 .    ? -25.607 106.093 58.940  1.00 45.29 ? 1595 HOH A O   1 
HETATM 10258 O O   . HOH B 2 .    ? -9.395  82.241  46.721  1.00 39.05 ? 1596 HOH A O   1 
HETATM 10259 O O   . HOH B 2 .    ? 15.528  68.726  27.353  1.00 39.02 ? 1597 HOH A O   1 
HETATM 10260 O O   . HOH B 2 .    ? -4.654  103.877 17.822  1.00 37.19 ? 1598 HOH A O   1 
HETATM 10261 O O   . HOH B 2 .    ? -20.827 80.071  39.804  1.00 37.56 ? 1599 HOH A O   1 
HETATM 10262 O O   . HOH B 2 .    ? -18.233 109.793 11.159  1.00 42.76 ? 1600 HOH A O   1 
HETATM 10263 O O   . HOH B 2 .    ? -27.264 90.194  61.506  1.00 39.58 ? 1601 HOH A O   1 
HETATM 10264 O O   . HOH B 2 .    ? -39.452 84.968  25.108  1.00 39.52 ? 1602 HOH A O   1 
HETATM 10265 O O   . HOH B 2 .    ? -0.311  102.106 19.307  1.00 45.99 ? 1603 HOH A O   1 
HETATM 10266 O O   . HOH B 2 .    ? 3.204   90.482  63.499  1.00 40.95 ? 1604 HOH A O   1 
HETATM 10267 O O   . HOH B 2 .    ? 16.322  92.597  32.818  1.00 28.09 ? 1605 HOH A O   1 
HETATM 10268 O O   . HOH B 2 .    ? 19.712  113.623 31.818  1.00 43.01 ? 1606 HOH A O   1 
HETATM 10269 O O   . HOH B 2 .    ? 4.056   84.016  20.969  1.00 47.01 ? 1607 HOH A O   1 
HETATM 10270 O O   . HOH B 2 .    ? -15.732 112.220 59.922  1.00 36.98 ? 1608 HOH A O   1 
HETATM 10271 O O   . HOH B 2 .    ? -1.867  123.241 33.936  1.00 29.77 ? 1609 HOH A O   1 
HETATM 10272 O O   . HOH B 2 .    ? -1.939  120.533 39.155  1.00 29.56 ? 1610 HOH A O   1 
HETATM 10273 O O   . HOH B 2 .    ? -7.123  120.729 58.141  1.00 34.96 ? 1611 HOH A O   1 
HETATM 10274 O O   . HOH B 2 .    ? -31.390 100.562 20.640  1.00 21.09 ? 1612 HOH A O   1 
HETATM 10275 O O   . HOH B 2 .    ? 6.675   85.836  19.583  1.00 32.90 ? 1613 HOH A O   1 
HETATM 10276 O O   . HOH B 2 .    ? -15.560 96.534  32.839  1.00 32.75 ? 1614 HOH A O   1 
HETATM 10277 O O   . HOH B 2 .    ? -5.402  111.776 60.673  1.00 40.16 ? 1615 HOH A O   1 
HETATM 10278 O O   . HOH B 2 .    ? -48.072 95.354  23.478  1.00 27.99 ? 1616 HOH A O   1 
HETATM 10279 O O   . HOH B 2 .    ? -19.234 86.497  25.995  1.00 32.27 ? 1617 HOH A O   1 
HETATM 10280 O O   . HOH B 2 .    ? 19.344  84.762  40.800  1.00 32.11 ? 1618 HOH A O   1 
HETATM 10281 O O   . HOH B 2 .    ? -14.411 115.098 11.404  1.00 34.07 ? 1619 HOH A O   1 
HETATM 10282 O O   . HOH B 2 .    ? -15.117 90.212  12.192  1.00 73.78 ? 1620 HOH A O   1 
HETATM 10283 O O   . HOH B 2 .    ? -10.599 129.118 26.271  1.00 32.18 ? 1621 HOH A O   1 
HETATM 10284 O O   . HOH B 2 .    ? -41.318 92.478  11.446  1.00 37.22 ? 1622 HOH A O   1 
HETATM 10285 O O   . HOH B 2 .    ? -33.922 113.892 17.979  1.00 34.67 ? 1623 HOH A O   1 
HETATM 10286 O O   . HOH B 2 .    ? -19.734 125.504 23.033  1.00 34.27 ? 1624 HOH A O   1 
HETATM 10287 O O   . HOH B 2 .    ? -11.873 109.944 48.508  1.00 23.05 ? 1625 HOH A O   1 
HETATM 10288 O O   . HOH B 2 .    ? -5.325  93.632  39.695  1.00 35.08 ? 1626 HOH A O   1 
HETATM 10289 O O   . HOH B 2 .    ? -50.611 86.803  16.919  1.00 39.64 ? 1627 HOH A O   1 
HETATM 10290 O O   . HOH B 2 .    ? -13.238 84.258  76.704  1.00 37.38 ? 1628 HOH A O   1 
HETATM 10291 O O   . HOH B 2 .    ? 21.183  93.132  14.306  1.00 35.48 ? 1629 HOH A O   1 
HETATM 10292 O O   . HOH B 2 .    ? -7.504  91.769  12.328  1.00 35.71 ? 1630 HOH A O   1 
HETATM 10293 O O   . HOH B 2 .    ? 24.136  78.189  40.219  1.00 35.24 ? 1631 HOH A O   1 
HETATM 10294 O O   . HOH B 2 .    ? -46.669 80.139  11.314  1.00 37.74 ? 1632 HOH A O   1 
HETATM 10295 O O   . HOH B 2 .    ? 16.696  114.858 35.240  1.00 31.96 ? 1633 HOH A O   1 
HETATM 10296 O O   . HOH B 2 .    ? -11.454 118.047 47.855  1.00 53.42 ? 1634 HOH A O   1 
HETATM 10297 O O   . HOH B 2 .    ? 13.774  90.036  37.961  1.00 37.04 ? 1635 HOH A O   1 
HETATM 10298 O O   . HOH B 2 .    ? 3.943   102.225 55.283  1.00 33.34 ? 1636 HOH A O   1 
HETATM 10299 O O   . HOH B 2 .    ? 13.034  113.760 29.240  1.00 26.16 ? 1637 HOH A O   1 
HETATM 10300 O O   . HOH B 2 .    ? -9.838  119.259 20.076  1.00 46.92 ? 1638 HOH A O   1 
HETATM 10301 O O   . HOH B 2 .    ? 17.524  96.890  53.296  1.00 28.58 ? 1639 HOH A O   1 
HETATM 10302 O O   . HOH B 2 .    ? 4.290   95.281  32.566  1.00 33.22 ? 1640 HOH A O   1 
HETATM 10303 O O   . HOH B 2 .    ? 16.250  71.453  25.501  1.00 36.43 ? 1641 HOH A O   1 
HETATM 10304 O O   . HOH B 2 .    ? 3.928   83.422  41.821  1.00 36.90 ? 1642 HOH A O   1 
HETATM 10305 O O   . HOH B 2 .    ? -2.798  126.143 32.753  1.00 33.26 ? 1643 HOH A O   1 
HETATM 10306 O O   . HOH B 2 .    ? -24.091 80.480  62.138  1.00 37.75 ? 1644 HOH A O   1 
HETATM 10307 O O   . HOH B 2 .    ? -31.058 85.811  46.538  1.00 32.09 ? 1645 HOH A O   1 
HETATM 10308 O O   . HOH B 2 .    ? -25.614 95.593  5.428   1.00 40.54 ? 1646 HOH A O   1 
HETATM 10309 O O   . HOH B 2 .    ? 13.002  89.342  43.277  1.00 31.99 ? 1647 HOH A O   1 
HETATM 10310 O O   . HOH B 2 .    ? -16.558 87.408  28.030  1.00 37.74 ? 1648 HOH A O   1 
HETATM 10311 O O   . HOH B 2 .    ? -42.993 112.719 32.973  1.00 37.67 ? 1649 HOH A O   1 
HETATM 10312 O O   . HOH B 2 .    ? -5.215  111.293 17.221  1.00 31.47 ? 1650 HOH A O   1 
HETATM 10313 O O   . HOH B 2 .    ? -29.000 112.434 17.791  1.00 37.71 ? 1651 HOH A O   1 
HETATM 10314 O O   . HOH B 2 .    ? -5.173  129.549 31.062  1.00 34.62 ? 1652 HOH A O   1 
HETATM 10315 O O   . HOH B 2 .    ? -27.197 120.035 27.591  1.00 33.71 ? 1653 HOH A O   1 
HETATM 10316 O O   . HOH B 2 .    ? -15.645 96.856  67.197  1.00 52.88 ? 1654 HOH A O   1 
HETATM 10317 O O   . HOH B 2 .    ? -4.729  79.191  67.255  1.00 37.28 ? 1655 HOH A O   1 
HETATM 10318 O O   . HOH B 2 .    ? 9.955   74.370  -14.204 1.00 50.81 ? 1656 HOH A O   1 
HETATM 10319 O O   . HOH B 2 .    ? -0.536  83.037  46.377  1.00 34.14 ? 1657 HOH A O   1 
HETATM 10320 O O   . HOH B 2 .    ? -28.831 90.226  -0.949  1.00 35.72 ? 1658 HOH A O   1 
HETATM 10321 O O   . HOH B 2 .    ? 12.887  78.057  70.492  1.00 36.21 ? 1659 HOH A O   1 
HETATM 10322 O O   . HOH B 2 .    ? 6.423   113.845 23.967  1.00 29.77 ? 1660 HOH A O   1 
HETATM 10323 O O   . HOH B 2 .    ? 10.088  80.422  -14.217 1.00 59.43 ? 1661 HOH A O   1 
HETATM 10324 O O   . HOH B 2 .    ? -21.466 62.676  17.229  1.00 44.23 ? 1662 HOH A O   1 
HETATM 10325 O O   . HOH B 2 .    ? 13.406  89.747  22.553  1.00 32.96 ? 1663 HOH A O   1 
HETATM 10326 O O   . HOH B 2 .    ? 6.241   61.039  53.304  1.00 43.02 ? 1664 HOH A O   1 
HETATM 10327 O O   . HOH B 2 .    ? -38.258 115.547 28.100  1.00 29.92 ? 1665 HOH A O   1 
HETATM 10328 O O   . HOH B 2 .    ? 14.462  107.106 42.437  1.00 31.97 ? 1666 HOH A O   1 
HETATM 10329 O O   . HOH B 2 .    ? -1.135  76.822  55.233  1.00 34.46 ? 1667 HOH A O   1 
HETATM 10330 O O   . HOH B 2 .    ? -29.559 108.834 13.843  1.00 32.69 ? 1668 HOH A O   1 
HETATM 10331 O O   . HOH B 2 .    ? -33.695 107.317 51.004  1.00 39.67 ? 1669 HOH A O   1 
HETATM 10332 O O   . HOH B 2 .    ? -25.517 116.582 51.814  1.00 31.83 ? 1670 HOH A O   1 
HETATM 10333 O O   . HOH B 2 .    ? 13.694  91.080  71.003  1.00 36.70 ? 1671 HOH A O   1 
HETATM 10334 O O   . HOH B 2 .    ? -21.525 60.670  27.723  1.00 48.09 ? 1672 HOH A O   1 
HETATM 10335 O O   . HOH B 2 .    ? -6.846  124.406 18.633  1.00 27.77 ? 1673 HOH A O   1 
HETATM 10336 O O   . HOH B 2 .    ? 9.108   84.840  20.914  1.00 29.33 ? 1674 HOH A O   1 
HETATM 10337 O O   . HOH B 2 .    ? -17.734 110.736 22.779  1.00 25.54 ? 1675 HOH A O   1 
HETATM 10338 O O   . HOH B 2 .    ? -19.589 118.468 9.402   1.00 23.21 ? 1676 HOH A O   1 
HETATM 10339 O O   . HOH B 2 .    ? -31.246 96.842  35.082  1.00 28.59 ? 1677 HOH A O   1 
HETATM 10340 O O   . HOH B 2 .    ? -23.019 121.268 25.321  1.00 33.70 ? 1678 HOH A O   1 
HETATM 10341 O O   . HOH B 2 .    ? 3.518   89.354  47.908  1.00 75.21 ? 1679 HOH A O   1 
HETATM 10342 O O   . HOH B 2 .    ? -16.128 131.060 24.981  1.00 34.15 ? 1680 HOH A O   1 
HETATM 10343 O O   . HOH B 2 .    ? 15.516  116.493 38.723  1.00 33.81 ? 1681 HOH A O   1 
HETATM 10344 O O   . HOH B 2 .    ? -15.285 47.653  27.852  1.00 58.55 ? 1682 HOH A O   1 
HETATM 10345 O O   . HOH B 2 .    ? -4.351  127.243 21.177  1.00 46.58 ? 1683 HOH A O   1 
HETATM 10346 O O   . HOH B 2 .    ? -23.514 121.741 29.698  1.00 35.75 ? 1684 HOH A O   1 
HETATM 10347 O O   . HOH B 2 .    ? -36.908 115.526 46.635  1.00 44.34 ? 1685 HOH A O   1 
HETATM 10348 O O   . HOH B 2 .    ? 2.185   82.493  51.752  1.00 38.86 ? 1686 HOH A O   1 
HETATM 10349 O O   . HOH B 2 .    ? 15.633  104.694 53.831  1.00 30.26 ? 1687 HOH A O   1 
HETATM 10350 O O   . HOH B 2 .    ? 16.473  63.492  20.191  1.00 33.96 ? 1688 HOH A O   1 
HETATM 10351 O O   . HOH B 2 .    ? -19.315 109.111 24.624  1.00 19.68 ? 1689 HOH A O   1 
HETATM 10352 O O   . HOH B 2 .    ? -27.079 73.464  48.850  1.00 42.64 ? 1690 HOH A O   1 
HETATM 10353 O O   . HOH B 2 .    ? 15.163  97.583  41.751  1.00 43.71 ? 1691 HOH A O   1 
HETATM 10354 O O   . HOH B 2 .    ? -28.754 81.007  5.679   1.00 36.22 ? 1692 HOH A O   1 
HETATM 10355 O O   . HOH B 2 .    ? 16.996  102.756 54.344  1.00 35.75 ? 1693 HOH A O   1 
HETATM 10356 O O   . HOH B 2 .    ? -44.213 102.460 42.912  1.00 40.73 ? 1694 HOH A O   1 
HETATM 10357 O O   . HOH B 2 .    ? -33.613 95.226  37.112  1.00 34.84 ? 1695 HOH A O   1 
HETATM 10358 O O   . HOH B 2 .    ? -17.603 72.788  14.834  1.00 40.39 ? 1696 HOH A O   1 
HETATM 10359 O O   . HOH B 2 .    ? 17.278  105.983 39.615  1.00 38.89 ? 1697 HOH A O   1 
HETATM 10360 O O   . HOH B 2 .    ? 1.834   69.304  -1.113  1.00 37.21 ? 1698 HOH A O   1 
HETATM 10361 O O   . HOH B 2 .    ? 10.643  101.069 46.290  1.00 40.29 ? 1699 HOH A O   1 
HETATM 10362 O O   . HOH B 2 .    ? 10.199  77.081  -12.136 1.00 48.93 ? 1700 HOH A O   1 
HETATM 10363 O O   . HOH B 2 .    ? 16.418  94.169  36.321  1.00 43.01 ? 1701 HOH A O   1 
HETATM 10364 O O   . HOH B 2 .    ? -5.030  84.739  4.575   1.00 39.28 ? 1702 HOH A O   1 
HETATM 10365 O O   . HOH B 2 .    ? -45.020 110.036 31.402  1.00 31.02 ? 1703 HOH A O   1 
HETATM 10366 O O   . HOH B 2 .    ? -10.696 84.688  43.869  1.00 53.88 ? 1704 HOH A O   1 
HETATM 10367 O O   . HOH B 2 .    ? -3.015  90.435  77.481  1.00 44.93 ? 1705 HOH A O   1 
HETATM 10368 O O   . HOH B 2 .    ? -28.919 79.472  21.224  1.00 34.85 ? 1706 HOH A O   1 
HETATM 10369 O O   . HOH B 2 .    ? -26.971 95.534  3.654   1.00 38.47 ? 1707 HOH A O   1 
HETATM 10370 O O   . HOH B 2 .    ? 18.117  88.822  60.708  1.00 31.00 ? 1708 HOH A O   1 
HETATM 10371 O O   . HOH B 2 .    ? -16.916 102.020 12.169  1.00 34.75 ? 1709 HOH A O   1 
HETATM 10372 O O   . HOH B 2 .    ? 13.346  101.714 40.039  1.00 32.92 ? 1710 HOH A O   1 
HETATM 10373 O O   . HOH B 2 .    ? -0.371  70.188  45.764  1.00 41.07 ? 1711 HOH A O   1 
HETATM 10374 O O   . HOH B 2 .    ? -15.303 120.650 44.423  1.00 38.17 ? 1712 HOH A O   1 
HETATM 10375 O O   . HOH B 2 .    ? -16.746 55.065  19.417  1.00 39.28 ? 1713 HOH A O   1 
HETATM 10376 O O   . HOH B 2 .    ? -8.046  57.343  21.169  1.00 36.99 ? 1714 HOH A O   1 
HETATM 10377 O O   . HOH B 2 .    ? 14.223  98.532  -4.350  1.00 42.94 ? 1715 HOH A O   1 
HETATM 10378 O O   . HOH B 2 .    ? -9.492  99.322  23.762  1.00 47.26 ? 1716 HOH A O   1 
HETATM 10379 O O   . HOH B 2 .    ? 0.369   86.515  -5.828  1.00 31.18 ? 1717 HOH A O   1 
HETATM 10380 O O   . HOH B 2 .    ? -3.877  57.662  6.496   1.00 43.29 ? 1718 HOH A O   1 
HETATM 10381 O O   . HOH B 2 .    ? -36.988 97.896  52.283  1.00 45.26 ? 1719 HOH A O   1 
HETATM 10382 O O   . HOH B 2 .    ? -9.469  114.464 48.108  1.00 37.69 ? 1720 HOH A O   1 
HETATM 10383 O O   . HOH B 2 .    ? 4.794   88.825  20.277  1.00 40.03 ? 1721 HOH A O   1 
HETATM 10384 O O   . HOH B 2 .    ? 15.227  122.179 26.865  1.00 47.56 ? 1722 HOH A O   1 
HETATM 10385 O O   . HOH B 2 .    ? -2.794  127.853 24.156  1.00 45.96 ? 1723 HOH A O   1 
HETATM 10386 O O   . HOH B 2 .    ? 1.100   99.832  26.015  1.00 47.68 ? 1724 HOH A O   1 
HETATM 10387 O O   . HOH B 2 .    ? -29.975 79.732  56.434  1.00 48.98 ? 1725 HOH A O   1 
HETATM 10388 O O   . HOH B 2 .    ? -3.395  62.411  13.493  1.00 29.57 ? 1726 HOH A O   1 
HETATM 10389 O O   . HOH B 2 .    ? -33.155 87.018  55.324  1.00 23.58 ? 1727 HOH A O   1 
HETATM 10390 O O   . HOH B 2 .    ? 18.841  116.523 8.738   1.00 50.40 ? 1728 HOH A O   1 
HETATM 10391 O O   . HOH B 2 .    ? 2.979   106.625 34.887  1.00 38.78 ? 1729 HOH A O   1 
HETATM 10392 O O   . HOH B 2 .    ? -27.969 92.948  0.415   1.00 35.62 ? 1730 HOH A O   1 
HETATM 10393 O O   . HOH B 2 .    ? -34.267 92.177  38.238  1.00 33.05 ? 1731 HOH A O   1 
HETATM 10394 O O   . HOH B 2 .    ? -7.589  67.798  -1.843  1.00 33.19 ? 1732 HOH A O   1 
HETATM 10395 O O   . HOH B 2 .    ? 18.156  102.941 15.847  1.00 36.83 ? 1733 HOH A O   1 
HETATM 10396 O O   . HOH B 2 .    ? -2.234  74.128  52.813  1.00 42.47 ? 1734 HOH A O   1 
HETATM 10397 O O   . HOH B 2 .    ? 17.226  81.995  38.081  1.00 37.75 ? 1735 HOH A O   1 
HETATM 10398 O O   . HOH B 2 .    ? 11.742  102.750 43.376  1.00 30.56 ? 1736 HOH A O   1 
HETATM 10399 O O   . HOH B 2 .    ? -15.294 99.012  15.316  1.00 45.74 ? 1737 HOH A O   1 
HETATM 10400 O O   . HOH B 2 .    ? 13.424  105.756 48.962  1.00 39.07 ? 1738 HOH A O   1 
HETATM 10401 O O   . HOH B 2 .    ? -4.539  80.322  53.539  1.00 45.32 ? 1739 HOH A O   1 
HETATM 10402 O O   . HOH B 2 .    ? -6.046  95.523  12.446  1.00 45.05 ? 1740 HOH A O   1 
HETATM 10403 O O   . HOH B 2 .    ? 14.628  80.114  -1.721  1.00 35.64 ? 1741 HOH A O   1 
HETATM 10404 O O   . HOH B 2 .    ? 1.943   87.401  20.458  1.00 31.86 ? 1742 HOH A O   1 
HETATM 10405 O O   . HOH B 2 .    ? -43.913 76.773  13.325  1.00 44.77 ? 1743 HOH A O   1 
HETATM 10406 O O   . HOH B 2 .    ? 4.507   64.066  -11.860 1.00 39.13 ? 1744 HOH A O   1 
HETATM 10407 O O   . HOH B 2 .    ? -3.552  119.567 10.032  1.00 43.30 ? 1745 HOH A O   1 
HETATM 10408 O O   . HOH B 2 .    ? -39.824 98.069  39.768  1.00 33.64 ? 1746 HOH A O   1 
HETATM 10409 O O   . HOH B 2 .    ? -7.005  106.660 19.543  1.00 48.08 ? 1747 HOH A O   1 
HETATM 10410 O O   . HOH B 2 .    ? 18.723  107.715 22.241  1.00 39.43 ? 1748 HOH A O   1 
HETATM 10411 O O   . HOH B 2 .    ? -5.024  85.902  -1.159  1.00 35.76 ? 1749 HOH A O   1 
HETATM 10412 O O   . HOH B 2 .    ? 17.753  104.463 6.400   1.00 30.43 ? 1750 HOH A O   1 
HETATM 10413 O O   . HOH B 2 .    ? -41.934 108.247 45.950  1.00 27.88 ? 1751 HOH A O   1 
HETATM 10414 O O   . HOH B 2 .    ? 7.909   78.493  21.472  1.00 48.88 ? 1752 HOH A O   1 
HETATM 10415 O O   . HOH B 2 .    ? -5.176  90.295  80.835  1.00 33.27 ? 1753 HOH A O   1 
HETATM 10416 O O   . HOH B 2 .    ? 3.764   118.030 44.777  1.00 50.23 ? 1754 HOH A O   1 
HETATM 10417 O O   . HOH B 2 .    ? -4.834  52.991  29.585  1.00 38.04 ? 1755 HOH A O   1 
HETATM 10418 O O   . HOH B 2 .    ? 10.676  66.301  54.036  1.00 34.26 ? 1756 HOH A O   1 
HETATM 10419 O O   . HOH B 2 .    ? 17.465  109.788 28.838  1.00 46.14 ? 1757 HOH A O   1 
HETATM 10420 O O   . HOH B 2 .    ? 3.944   112.847 19.504  1.00 25.03 ? 1758 HOH A O   1 
HETATM 10421 O O   . HOH B 2 .    ? -34.674 84.184  34.140  1.00 43.01 ? 1759 HOH A O   1 
HETATM 10422 O O   . HOH B 2 .    ? -31.130 124.345 42.842  1.00 31.36 ? 1760 HOH A O   1 
HETATM 10423 O O   . HOH B 2 .    ? 0.749   78.436  -4.353  1.00 48.22 ? 1761 HOH A O   1 
HETATM 10424 O O   . HOH B 2 .    ? -27.070 82.080  36.157  1.00 43.11 ? 1762 HOH A O   1 
HETATM 10425 O O   . HOH B 2 .    ? 14.192  60.312  49.362  1.00 41.85 ? 1763 HOH A O   1 
HETATM 10426 O O   . HOH B 2 .    ? -48.325 92.230  38.051  1.00 43.56 ? 1764 HOH A O   1 
HETATM 10427 O O   . HOH B 2 .    ? 17.268  107.416 5.537   1.00 25.99 ? 1765 HOH A O   1 
HETATM 10428 O O   . HOH B 2 .    ? 0.694   59.439  7.066   1.00 50.20 ? 1766 HOH A O   1 
HETATM 10429 O O   . HOH B 2 .    ? -30.877 84.067  25.476  1.00 39.17 ? 1767 HOH A O   1 
HETATM 10430 O O   . HOH B 2 .    ? 4.691   76.736  30.112  1.00 23.13 ? 1768 HOH A O   1 
HETATM 10431 O O   . HOH B 2 .    ? -7.921  123.629 21.948  1.00 35.78 ? 1769 HOH A O   1 
HETATM 10432 O O   . HOH B 2 .    ? -9.830  98.848  20.281  1.00 54.32 ? 1770 HOH A O   1 
HETATM 10433 O O   . HOH B 2 .    ? -26.066 82.155  59.699  1.00 49.17 ? 1771 HOH A O   1 
HETATM 10434 O O   . HOH B 2 .    ? 11.212  93.161  70.797  1.00 36.47 ? 1772 HOH A O   1 
HETATM 10435 O O   . HOH B 2 .    ? -3.590  67.693  -2.922  1.00 45.09 ? 1773 HOH A O   1 
HETATM 10436 O O   . HOH B 2 .    ? 17.089  120.424 25.072  1.00 56.97 ? 1774 HOH A O   1 
HETATM 10437 O O   . HOH B 2 .    ? -49.485 97.369  33.139  1.00 45.10 ? 1775 HOH A O   1 
HETATM 10438 O O   . HOH B 2 .    ? -20.971 125.833 15.356  1.00 41.70 ? 1776 HOH A O   1 
HETATM 10439 O O   . HOH B 2 .    ? 18.024  78.801  34.839  1.00 37.21 ? 1777 HOH A O   1 
HETATM 10440 O O   . HOH B 2 .    ? -40.693 108.247 50.943  1.00 31.11 ? 1778 HOH A O   1 
HETATM 10441 O O   . HOH B 2 .    ? 2.963   77.019  33.606  1.00 31.27 ? 1779 HOH A O   1 
HETATM 10442 O O   . HOH B 2 .    ? -40.034 94.385  7.996   1.00 42.53 ? 1780 HOH A O   1 
HETATM 10443 O O   . HOH B 2 .    ? -5.687  90.084  45.818  1.00 60.94 ? 1781 HOH A O   1 
HETATM 10444 O O   . HOH B 2 .    ? -11.204 75.457  12.039  1.00 35.68 ? 1782 HOH A O   1 
HETATM 10445 O O   . HOH B 2 .    ? 4.161   116.295 4.742   1.00 33.04 ? 1783 HOH A O   1 
HETATM 10446 O O   . HOH B 2 .    ? 8.281   54.523  47.390  1.00 48.61 ? 1784 HOH A O   1 
HETATM 10447 O O   . HOH B 2 .    ? 11.116  121.462 7.361   1.00 51.46 ? 1785 HOH A O   1 
HETATM 10448 O O   . HOH B 2 .    ? 18.970  98.532  43.561  1.00 38.09 ? 1786 HOH A O   1 
HETATM 10449 O O   . HOH B 2 .    ? 3.009   76.082  76.005  1.00 41.29 ? 1787 HOH A O   1 
HETATM 10450 O O   . HOH B 2 .    ? -3.773  72.610  28.365  1.00 35.55 ? 1788 HOH A O   1 
HETATM 10451 O O   . HOH B 2 .    ? 8.493   90.744  70.689  1.00 44.07 ? 1789 HOH A O   1 
HETATM 10452 O O   . HOH B 2 .    ? 23.816  94.045  65.949  1.00 42.27 ? 1790 HOH A O   1 
HETATM 10453 O O   . HOH B 2 .    ? 9.113   72.102  -17.941 1.00 36.32 ? 1791 HOH A O   1 
HETATM 10454 O O   . HOH B 2 .    ? -44.465 96.075  10.188  1.00 41.64 ? 1792 HOH A O   1 
HETATM 10455 O O   . HOH B 2 .    ? -0.549  84.974  18.075  1.00 46.09 ? 1793 HOH A O   1 
HETATM 10456 O O   . HOH B 2 .    ? -3.883  65.295  10.324  1.00 47.62 ? 1794 HOH A O   1 
HETATM 10457 O O   . HOH B 2 .    ? -15.417 105.022 15.867  1.00 52.58 ? 1795 HOH A O   1 
HETATM 10458 O O   . HOH B 2 .    ? -9.470  93.484  37.852  1.00 54.10 ? 1796 HOH A O   1 
HETATM 10459 O O   . HOH B 2 .    ? -27.368 111.141 50.451  1.00 27.16 ? 1797 HOH A O   1 
HETATM 10460 O O   . HOH B 2 .    ? 22.214  83.768  67.138  1.00 37.15 ? 1798 HOH A O   1 
HETATM 10461 O O   . HOH B 2 .    ? 7.874   129.126 28.306  1.00 33.04 ? 1799 HOH A O   1 
HETATM 10462 O O   . HOH B 2 .    ? 4.526   80.069  20.911  1.00 32.91 ? 1800 HOH A O   1 
HETATM 10463 O O   . HOH B 2 .    ? 15.956  95.662  5.266   1.00 38.66 ? 1801 HOH A O   1 
HETATM 10464 O O   . HOH B 2 .    ? -7.135  79.335  25.795  1.00 41.40 ? 1802 HOH A O   1 
HETATM 10465 O O   . HOH B 2 .    ? -16.874 123.035 30.415  1.00 50.69 ? 1803 HOH A O   1 
HETATM 10466 O O   . HOH B 2 .    ? 15.108  91.375  48.645  1.00 26.30 ? 1804 HOH A O   1 
HETATM 10467 O O   . HOH B 2 .    ? -13.609 81.803  42.225  1.00 32.51 ? 1805 HOH A O   1 
HETATM 10468 O O   . HOH B 2 .    ? -34.251 80.872  44.762  1.00 39.52 ? 1806 HOH A O   1 
HETATM 10469 O O   . HOH B 2 .    ? -31.576 81.770  20.145  1.00 42.99 ? 1807 HOH A O   1 
HETATM 10470 O O   . HOH B 2 .    ? -2.211  69.657  51.549  1.00 37.51 ? 1808 HOH A O   1 
HETATM 10471 O O   . HOH B 2 .    ? 15.867  99.242  67.750  1.00 57.21 ? 1809 HOH A O   1 
HETATM 10472 O O   . HOH B 2 .    ? 4.189   128.199 24.526  1.00 33.22 ? 1810 HOH A O   1 
HETATM 10473 O O   . HOH B 2 .    ? 7.974   63.470  54.575  1.00 32.62 ? 1811 HOH A O   1 
HETATM 10474 O O   . HOH B 2 .    ? 15.174  77.633  -2.265  1.00 38.98 ? 1812 HOH A O   1 
HETATM 10475 O O   . HOH B 2 .    ? 18.354  61.566  28.555  1.00 39.58 ? 1813 HOH A O   1 
HETATM 10476 O O   . HOH B 2 .    ? 6.847   104.831 60.809  1.00 45.52 ? 1814 HOH A O   1 
HETATM 10477 O O   . HOH B 2 .    ? -11.756 88.771  41.079  1.00 31.44 ? 1815 HOH A O   1 
HETATM 10478 O O   . HOH B 2 .    ? 21.384  105.265 23.442  1.00 40.34 ? 1816 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1    MET 1    1    ?    ?   ?   A . n 
A 1 2    SER 2    2    2    SER SER A . n 
A 1 3    SER 3    3    3    SER SER A . n 
A 1 4    MET 4    4    4    MET MET A . n 
A 1 5    ILE 5    5    5    ILE ILE A . n 
A 1 6    LEU 6    6    6    LEU LEU A . n 
A 1 7    THR 7    7    7    THR THR A . n 
A 1 8    GLN 8    8    8    GLN GLN A . n 
A 1 9    PHE 9    9    9    PHE PHE A . n 
A 1 10   GLY 10   10   10   GLY GLY A . n 
A 1 11   PRO 11   11   11   PRO PRO A . n 
A 1 12   PHE 12   12   12   PHE PHE A . n 
A 1 13   ILE 13   13   13   ILE ILE A . n 
A 1 14   GLU 14   14   14   GLU GLU A . n 
A 1 15   SER 15   15   15   SER SER A . n 
A 1 16   ILE 16   16   16   ILE ILE A . n 
A 1 17   SER 17   17   17   SER SER A . n 
A 1 18   GLY 18   18   18   GLY GLY A . n 
A 1 19   ILE 19   19   19   ILE ILE A . n 
A 1 20   THR 20   20   20   THR THR A . n 
A 1 21   ASP 21   21   21   ASP ASP A . n 
A 1 22   GLN 22   22   22   GLN GLN A . n 
A 1 23   SER 23   23   23   SER SER A . n 
A 1 24   ASN 24   24   24   ASN ASN A . n 
A 1 25   ASP 25   25   25   ASP ASP A . n 
A 1 26   VAL 26   26   26   VAL VAL A . n 
A 1 27   PHE 27   27   27   PHE PHE A . n 
A 1 28   GLU 28   28   28   GLU GLU A . n 
A 1 29   ASP 29   29   29   ASP ASP A . n 
A 1 30   ALA 30   30   30   ALA ALA A . n 
A 1 31   ALA 31   31   31   ALA ALA A . n 
A 1 32   LYS 32   32   32   LYS LYS A . n 
A 1 33   ALA 33   33   33   ALA ALA A . n 
A 1 34   PHE 34   34   34   PHE PHE A . n 
A 1 35   SER 35   35   35   SER SER A . n 
A 1 36   MET 36   36   36   MET MET A . n 
A 1 37   PHE 37   37   37   PHE PHE A . n 
A 1 38   THR 38   38   38   THR THR A . n 
A 1 39   ARG 39   39   39   ARG ARG A . n 
A 1 40   SER 40   40   40   SER SER A . n 
A 1 41   ASP 41   41   41   ASP ASP A . n 
A 1 42   VAL 42   42   42   VAL VAL A . n 
A 1 43   TYR 43   43   43   TYR TYR A . n 
A 1 44   LYS 44   44   44   LYS LYS A . n 
A 1 45   ALA 45   45   45   ALA ALA A . n 
A 1 46   LEU 46   46   46   LEU LEU A . n 
A 1 47   ASP 47   47   47   ASP ASP A . n 
A 1 48   GLU 48   48   48   GLU GLU A . n 
A 1 49   ILE 49   49   49   ILE ILE A . n 
A 1 50   PRO 50   50   50   PRO PRO A . n 
A 1 51   PHE 51   51   51   PHE PHE A . n 
A 1 52   SER 52   52   52   SER SER A . n 
A 1 53   ASP 53   53   53   ASP ASP A . n 
A 1 54   ASP 54   54   54   ASP ASP A . n 
A 1 55   ALA 55   55   55   ALA ALA A . n 
A 1 56   MET 56   56   56   MET MET A . n 
A 1 57   LEU 57   57   57   LEU LEU A . n 
A 1 58   PRO 58   58   58   PRO PRO A . n 
A 1 59   ILE 59   59   59   ILE ILE A . n 
A 1 60   PRO 60   60   60   PRO PRO A . n 
A 1 61   PRO 61   61   61   PRO PRO A . n 
A 1 62   THR 62   62   62   THR THR A . n 
A 1 63   ILE 63   63   63   ILE ILE A . n 
A 1 64   TYR 64   64   64   TYR TYR A . n 
A 1 65   THR 65   65   65   THR THR A . n 
A 1 66   LYS 66   66   66   LYS LYS A . n 
A 1 67   PRO 67   67   67   PRO PRO A . n 
A 1 68   SER 68   68   68   SER SER A . n 
A 1 69   HIS 69   69   69   HIS HIS A . n 
A 1 70   ASP 70   70   70   ASP ASP A . n 
A 1 71   SER 71   71   71   SER SER A . n 
A 1 72   TYR 72   72   72   TYR TYR A . n 
A 1 73   TYR 73   73   73   TYR TYR A . n 
A 1 74   TYR 74   74   74   TYR TYR A . n 
A 1 75   ILE 75   75   75   ILE ILE A . n 
A 1 76   ASP 76   76   76   ASP ASP A . n 
A 1 77   ALA 77   77   77   ALA ALA A . n 
A 1 78   LEU 78   78   78   LEU LEU A . n 
A 1 79   ASN 79   79   79   ASN ASN A . n 
A 1 80   ARG 80   80   80   ARG ARG A . n 
A 1 81   VAL 81   81   81   VAL VAL A . n 
A 1 82   ARG 82   82   82   ARG ARG A . n 
A 1 83   ARG 83   83   83   ARG ARG A . n 
A 1 84   LYS 84   84   84   LYS LYS A . n 
A 1 85   THR 85   85   85   THR THR A . n 
A 1 86   TYR 86   86   86   TYR TYR A . n 
A 1 87   GLN 87   87   87   GLN GLN A . n 
A 1 88   GLY 88   88   88   GLY GLY A . n 
A 1 89   PRO 89   89   89   PRO PRO A . n 
A 1 90   ASP 90   90   90   ASP ASP A . n 
A 1 91   ASP 91   91   91   ASP ASP A . n 
A 1 92   VAL 92   92   92   VAL VAL A . n 
A 1 93   TYR 93   93   93   TYR TYR A . n 
A 1 94   VAL 94   94   94   VAL VAL A . n 
A 1 95   PRO 95   95   95   PRO PRO A . n 
A 1 96   ASN 96   96   96   ASN ASN A . n 
A 1 97   CYS 97   97   97   CYS CYS A . n 
A 1 98   SER 98   98   98   SER SER A . n 
A 1 99   ILE 99   99   99   ILE ILE A . n 
A 1 100  VAL 100  100  100  VAL VAL A . n 
A 1 101  GLU 101  101  101  GLU GLU A . n 
A 1 102  LEU 102  102  102  LEU LEU A . n 
A 1 103  LEU 103  103  103  LEU LEU A . n 
A 1 104  GLU 104  104  104  GLU GLU A . n 
A 1 105  PRO 105  105  105  PRO PRO A . n 
A 1 106  HIS 106  106  106  HIS HIS A . n 
A 1 107  GLU 107  107  107  GLU GLU A . n 
A 1 108  THR 108  108  108  THR THR A . n 
A 1 109  LEU 109  109  109  LEU LEU A . n 
A 1 110  THR 110  110  110  THR THR A . n 
A 1 111  SER 111  111  111  SER SER A . n 
A 1 112  TYR 112  112  112  TYR TYR A . n 
A 1 113  GLY 113  113  113  GLY GLY A . n 
A 1 114  ARG 114  114  114  ARG ARG A . n 
A 1 115  LEU 115  115  115  LEU LEU A . n 
A 1 116  SER 116  116  116  SER SER A . n 
A 1 117  GLU 117  117  117  GLU GLU A . n 
A 1 118  ALA 118  118  118  ALA ALA A . n 
A 1 119  ILE 119  119  119  ILE ILE A . n 
A 1 120  GLU 120  120  120  GLU GLU A . n 
A 1 121  ASN 121  121  121  ASN ASN A . n 
A 1 122  ARG 122  122  122  ARG ARG A . n 
A 1 123  ALA 123  123  123  ALA ALA A . n 
A 1 124  LYS 124  124  124  LYS LYS A . n 
A 1 125  ASP 125  125  125  ASP ASP A . n 
A 1 126  GLY 126  126  126  GLY GLY A . n 
A 1 127  ASP 127  127  127  ASP ASP A . n 
A 1 128  SER 128  128  128  SER SER A . n 
A 1 129  GLN 129  129  129  GLN GLN A . n 
A 1 130  ALA 130  130  130  ALA ALA A . n 
A 1 131  ARG 131  131  131  ARG ARG A . n 
A 1 132  ILE 132  132  132  ILE ILE A . n 
A 1 133  ALA 133  133  133  ALA ALA A . n 
A 1 134  THR 134  134  134  THR THR A . n 
A 1 135  THR 135  135  135  THR THR A . n 
A 1 136  TYR 136  136  136  TYR TYR A . n 
A 1 137  GLY 137  137  137  GLY GLY A . n 
A 1 138  ARG 138  138  138  ARG ARG A . n 
A 1 139  ILE 139  139  139  ILE ILE A . n 
A 1 140  ALA 140  140  140  ALA ALA A . n 
A 1 141  GLU 141  141  141  GLU GLU A . n 
A 1 142  SER 142  142  142  SER SER A . n 
A 1 143  GLN 143  143  143  GLN GLN A . n 
A 1 144  ALA 144  144  144  ALA ALA A . n 
A 1 145  ARG 145  145  145  ARG ARG A . n 
A 1 146  GLN 146  146  146  GLN GLN A . n 
A 1 147  ILE 147  147  147  ILE ILE A . n 
A 1 148  LYS 148  148  148  LYS LYS A . n 
A 1 149  ALA 149  149  149  ALA ALA A . n 
A 1 150  PRO 150  150  150  PRO PRO A . n 
A 1 151  LEU 151  151  151  LEU LEU A . n 
A 1 152  GLU 152  152  152  GLU GLU A . n 
A 1 153  LYS 153  153  153  LYS LYS A . n 
A 1 154  PHE 154  154  154  PHE PHE A . n 
A 1 155  VAL 155  155  155  VAL VAL A . n 
A 1 156  LEU 156  156  156  LEU LEU A . n 
A 1 157  ALA 157  157  157  ALA ALA A . n 
A 1 158  LEU 158  158  158  LEU LEU A . n 
A 1 159  LEU 159  159  159  LEU LEU A . n 
A 1 160  VAL 160  160  160  VAL VAL A . n 
A 1 161  ALA 161  161  161  ALA ALA A . n 
A 1 162  GLU 162  162  162  GLU GLU A . n 
A 1 163  ALA 163  163  163  ALA ALA A . n 
A 1 164  GLY 164  164  164  GLY GLY A . n 
A 1 165  GLY 165  165  165  GLY GLY A . n 
A 1 166  SER 166  166  166  SER SER A . n 
A 1 167  LEU 167  167  167  LEU LEU A . n 
A 1 168  TYR 168  168  168  TYR TYR A . n 
A 1 169  ASP 169  169  169  ASP ASP A . n 
A 1 170  PRO 170  170  170  PRO PRO A . n 
A 1 171  VAL 171  171  171  VAL VAL A . n 
A 1 172  LEU 172  172  172  LEU LEU A . n 
A 1 173  GLN 173  173  173  GLN GLN A . n 
A 1 174  LYS 174  174  174  LYS LYS A . n 
A 1 175  TYR 175  175  175  TYR TYR A . n 
A 1 176  ASP 176  176  176  ASP ASP A . n 
A 1 177  GLU 177  177  177  GLU GLU A . n 
A 1 178  ILE 178  178  178  ILE ILE A . n 
A 1 179  PRO 179  179  179  PRO PRO A . n 
A 1 180  ASP 180  180  180  ASP ASP A . n 
A 1 181  LEU 181  181  181  LEU LEU A . n 
A 1 182  SER 182  182  182  SER SER A . n 
A 1 183  HIS 183  183  183  HIS HIS A . n 
A 1 184  ASN 184  184  184  ASN ASN A . n 
A 1 185  CYS 185  185  185  CYS CYS A . n 
A 1 186  PRO 186  186  186  PRO PRO A . n 
A 1 187  LEU 187  187  187  LEU LEU A . n 
A 1 188  TRP 188  188  188  TRP TRP A . n 
A 1 189  CYS 189  189  189  CYS CYS A . n 
A 1 190  PHE 190  190  190  PHE PHE A . n 
A 1 191  ARG 191  191  191  ARG ARG A . n 
A 1 192  GLU 192  192  192  GLU GLU A . n 
A 1 193  ILE 193  193  193  ILE ILE A . n 
A 1 194  CYS 194  194  194  CYS CYS A . n 
A 1 195  ARG 195  195  195  ARG ARG A . n 
A 1 196  HIS 196  196  196  HIS HIS A . n 
A 1 197  ILE 197  197  197  ILE ILE A . n 
A 1 198  SER 198  198  198  SER SER A . n 
A 1 199  GLY 199  199  199  GLY GLY A . n 
A 1 200  PRO 200  200  200  PRO PRO A . n 
A 1 201  LEU 201  201  201  LEU LEU A . n 
A 1 202  PRO 202  202  202  PRO PRO A . n 
A 1 203  ASP 203  203  203  ASP ASP A . n 
A 1 204  ARG 204  204  204  ARG ARG A . n 
A 1 205  ALA 205  205  205  ALA ALA A . n 
A 1 206  PRO 206  206  206  PRO PRO A . n 
A 1 207  TYR 207  207  207  TYR TYR A . n 
A 1 208  LEU 208  208  208  LEU LEU A . n 
A 1 209  TYR 209  209  209  TYR TYR A . n 
A 1 210  LEU 210  210  210  LEU LEU A . n 
A 1 211  SER 211  211  211  SER SER A . n 
A 1 212  ALA 212  212  212  ALA ALA A . n 
A 1 213  GLY 213  213  213  GLY GLY A . n 
A 1 214  VAL 214  214  214  VAL VAL A . n 
A 1 215  PHE 215  215  215  PHE PHE A . n 
A 1 216  TRP 216  216  216  TRP TRP A . n 
A 1 217  LEU 217  217  217  LEU LEU A . n 
A 1 218  MET 218  218  218  MET MET A . n 
A 1 219  SER 219  219  219  SER SER A . n 
A 1 220  PRO 220  220  220  PRO PRO A . n 
A 1 221  ARG 221  221  221  ARG ARG A . n 
A 1 222  MET 222  222  222  MET MET A . n 
A 1 223  THR 223  223  223  THR THR A . n 
A 1 224  SER 224  224  224  SER SER A . n 
A 1 225  ALA 225  225  225  ALA ALA A . n 
A 1 226  ILE 226  226  226  ILE ILE A . n 
A 1 227  PRO 227  227  227  PRO PRO A . n 
A 1 228  PRO 228  228  228  PRO PRO A . n 
A 1 229  LEU 229  229  229  LEU LEU A . n 
A 1 230  LEU 230  230  230  LEU LEU A . n 
A 1 231  SER 231  231  231  SER SER A . n 
A 1 232  ASP 232  232  232  ASP ASP A . n 
A 1 233  LEU 233  233  233  LEU LEU A . n 
A 1 234  VAL 234  234  234  VAL VAL A . n 
A 1 235  ASN 235  235  235  ASN ASN A . n 
A 1 236  LEU 236  236  236  LEU LEU A . n 
A 1 237  ALA 237  237  237  ALA ALA A . n 
A 1 238  ILE 238  238  238  ILE ILE A . n 
A 1 239  LEU 239  239  239  LEU LEU A . n 
A 1 240  GLN 240  240  240  GLN GLN A . n 
A 1 241  GLN 241  241  241  GLN GLN A . n 
A 1 242  THR 242  242  242  THR THR A . n 
A 1 243  ALA 243  243  243  ALA ALA A . n 
A 1 244  GLY 244  244  244  GLY GLY A . n 
A 1 245  LEU 245  245  245  LEU LEU A . n 
A 1 246  ASP 246  246  246  ASP ASP A . n 
A 1 247  PRO 247  247  247  PRO PRO A . n 
A 1 248  SER 248  248  248  SER SER A . n 
A 1 249  LEU 249  249  249  LEU LEU A . n 
A 1 250  VAL 250  250  250  VAL VAL A . n 
A 1 251  LYS 251  251  251  LYS LYS A . n 
A 1 252  LEU 252  252  252  LEU LEU A . n 
A 1 253  GLY 253  253  253  GLY GLY A . n 
A 1 254  VAL 254  254  254  VAL VAL A . n 
A 1 255  GLN 255  255  255  GLN GLN A . n 
A 1 256  ILE 256  256  256  ILE ILE A . n 
A 1 257  CYS 257  257  257  CYS CYS A . n 
A 1 258  LEU 258  258  258  LEU LEU A . n 
A 1 259  HIS 259  259  259  HIS HIS A . n 
A 1 260  ALA 260  260  260  ALA ALA A . n 
A 1 261  ALA 261  261  261  ALA ALA A . n 
A 1 262  ALA 262  262  262  ALA ALA A . n 
A 1 263  SER 263  263  263  SER SER A . n 
A 1 264  SER 264  264  264  SER SER A . n 
A 1 265  SER 265  265  265  SER SER A . n 
A 1 266  TYR 266  266  266  TYR TYR A . n 
A 1 267  SER 267  267  267  SER SER A . n 
A 1 268  TRP 268  268  268  TRP TRP A . n 
A 1 269  PHE 269  269  269  PHE PHE A . n 
A 1 270  ILE 270  270  270  ILE ILE A . n 
A 1 271  LEU 271  271  271  LEU LEU A . n 
A 1 272  LYS 272  272  272  LYS LYS A . n 
A 1 273  THR 273  273  273  THR THR A . n 
A 1 274  LYS 274  274  274  LYS LYS A . n 
A 1 275  SER 275  275  275  SER SER A . n 
A 1 276  ILE 276  276  276  ILE ILE A . n 
A 1 277  PHE 277  277  277  PHE PHE A . n 
A 1 278  PRO 278  278  278  PRO PRO A . n 
A 1 279  GLN 279  279  279  GLN GLN A . n 
A 1 280  ASN 280  280  280  ASN ASN A . n 
A 1 281  THR 281  281  281  THR THR A . n 
A 1 282  LEU 282  282  282  LEU LEU A . n 
A 1 283  HIS 283  283  283  HIS HIS A . n 
A 1 284  SER 284  284  284  SER SER A . n 
A 1 285  MET 285  285  285  MET MET A . n 
A 1 286  TYR 286  286  286  TYR TYR A . n 
A 1 287  GLU 287  287  287  GLU GLU A . n 
A 1 288  SER 288  288  288  SER SER A . n 
A 1 289  LEU 289  289  289  LEU LEU A . n 
A 1 290  GLU 290  290  290  GLU GLU A . n 
A 1 291  GLY 291  291  291  GLY GLY A . n 
A 1 292  GLY 292  292  292  GLY GLY A . n 
A 1 293  TYR 293  293  293  TYR TYR A . n 
A 1 294  CYS 294  294  294  CYS CYS A . n 
A 1 295  PRO 295  295  295  PRO PRO A . n 
A 1 296  ASN 296  296  296  ASN ASN A . n 
A 1 297  LEU 297  297  297  LEU LEU A . n 
A 1 298  GLU 298  298  298  GLU GLU A . n 
A 1 299  TRP 299  299  299  TRP TRP A . n 
A 1 300  LEU 300  300  300  LEU LEU A . n 
A 1 301  GLU 301  301  301  GLU GLU A . n 
A 1 302  PRO 302  302  302  PRO PRO A . n 
A 1 303  ARG 303  303  303  ARG ARG A . n 
A 1 304  SER 304  304  304  SER SER A . n 
A 1 305  ASP 305  305  305  ASP ASP A . n 
A 1 306  TYR 306  306  306  TYR TYR A . n 
A 1 307  LYS 307  307  307  LYS LYS A . n 
A 1 308  PHE 308  308  308  PHE PHE A . n 
A 1 309  MET 309  309  309  MET MET A . n 
A 1 310  TYR 310  310  310  TYR TYR A . n 
A 1 311  MET 311  311  311  MET MET A . n 
A 1 312  GLY 312  312  312  GLY GLY A . n 
A 1 313  VAL 313  313  313  VAL VAL A . n 
A 1 314  MET 314  314  314  MET MET A . n 
A 1 315  PRO 315  315  315  PRO PRO A . n 
A 1 316  LEU 316  316  316  LEU LEU A . n 
A 1 317  SER 317  317  317  SER SER A . n 
A 1 318  ALA 318  318  318  ALA ALA A . n 
A 1 319  LYS 319  319  319  LYS LYS A . n 
A 1 320  TYR 320  320  320  TYR TYR A . n 
A 1 321  ALA 321  321  321  ALA ALA A . n 
A 1 322  ARG 322  322  322  ARG ARG A . n 
A 1 323  SER 323  323  323  SER SER A . n 
A 1 324  ALA 324  324  324  ALA ALA A . n 
A 1 325  PRO 325  325  325  PRO PRO A . n 
A 1 326  SER 326  326  326  SER SER A . n 
A 1 327  ASN 327  327  327  ASN ASN A . n 
A 1 328  ASP 328  328  328  ASP ASP A . n 
A 1 329  LYS 329  329  329  LYS LYS A . n 
A 1 330  LYS 330  330  330  LYS LYS A . n 
A 1 331  ALA 331  331  331  ALA ALA A . n 
A 1 332  ARG 332  332  332  ARG ARG A . n 
A 1 333  GLU 333  333  333  GLU GLU A . n 
A 1 334  LEU 334  334  334  LEU LEU A . n 
A 1 335  GLY 335  335  335  GLY GLY A . n 
A 1 336  GLU 336  336  336  GLU GLU A . n 
A 1 337  LYS 337  337  337  LYS LYS A . n 
A 1 338  TYR 338  338  338  TYR TYR A . n 
A 1 339  GLY 339  339  339  GLY GLY A . n 
A 1 340  LEU 340  340  340  LEU LEU A . n 
A 1 341  SER 341  341  341  SER SER A . n 
A 1 342  SER 342  342  342  SER SER A . n 
A 1 343  VAL 343  343  343  VAL VAL A . n 
A 1 344  VAL 344  344  344  VAL VAL A . n 
A 1 345  GLY 345  345  345  GLY GLY A . n 
A 1 346  GLU 346  346  346  GLU GLU A . n 
A 1 347  LEU 347  347  347  LEU LEU A . n 
A 1 348  ARG 348  348  348  ARG ARG A . n 
A 1 349  LYS 349  349  349  LYS LYS A . n 
A 1 350  ARG 350  350  350  ARG ARG A . n 
A 1 351  THR 351  351  351  THR THR A . n 
A 1 352  LYS 352  352  352  LYS LYS A . n 
A 1 353  THR 353  353  353  THR THR A . n 
A 1 354  TYR 354  354  354  TYR TYR A . n 
A 1 355  VAL 355  355  355  VAL VAL A . n 
A 1 356  LYS 356  356  356  LYS LYS A . n 
A 1 357  HIS 357  357  357  HIS HIS A . n 
A 1 358  ASP 358  358  358  ASP ASP A . n 
A 1 359  PHE 359  359  359  PHE PHE A . n 
A 1 360  ALA 360  360  360  ALA ALA A . n 
A 1 361  SER 361  361  361  SER SER A . n 
A 1 362  VAL 362  362  362  VAL VAL A . n 
A 1 363  ARG 363  363  363  ARG ARG A . n 
A 1 364  TYR 364  364  364  TYR TYR A . n 
A 1 365  ILE 365  365  365  ILE ILE A . n 
A 1 366  ARG 366  366  366  ARG ARG A . n 
A 1 367  ASP 367  367  367  ASP ASP A . n 
A 1 368  ALA 368  368  368  ALA ALA A . n 
A 1 369  MET 369  369  369  MET MET A . n 
A 1 370  ALA 370  370  370  ALA ALA A . n 
A 1 371  CYS 371  371  371  CYS CYS A . n 
A 1 372  THR 372  372  372  THR THR A . n 
A 1 373  SER 373  373  373  SER SER A . n 
A 1 374  GLY 374  374  374  GLY GLY A . n 
A 1 375  ILE 375  375  375  ILE ILE A . n 
A 1 376  PHE 376  376  376  PHE PHE A . n 
A 1 377  LEU 377  377  377  LEU LEU A . n 
A 1 378  VAL 378  378  378  VAL VAL A . n 
A 1 379  ARG 379  379  379  ARG ARG A . n 
A 1 380  THR 380  380  380  THR THR A . n 
A 1 381  PRO 381  381  381  PRO PRO A . n 
A 1 382  THR 382  382  382  THR THR A . n 
A 1 383  GLU 383  383  383  GLU GLU A . n 
A 1 384  THR 384  384  384  THR THR A . n 
A 1 385  VAL 385  385  385  VAL VAL A . n 
A 1 386  LEU 386  386  386  LEU LEU A . n 
A 1 387  GLN 387  387  387  GLN GLN A . n 
A 1 388  GLU 388  388  388  GLU GLU A . n 
A 1 389  TYR 389  389  389  TYR TYR A . n 
A 1 390  THR 390  390  390  THR THR A . n 
A 1 391  GLN 391  391  391  GLN GLN A . n 
A 1 392  SER 392  392  392  SER SER A . n 
A 1 393  PRO 393  393  393  PRO PRO A . n 
A 1 394  GLU 394  394  394  GLU GLU A . n 
A 1 395  ILE 395  395  395  ILE ILE A . n 
A 1 396  LYS 396  396  396  LYS LYS A . n 
A 1 397  VAL 397  397  397  VAL VAL A . n 
A 1 398  PRO 398  398  398  PRO PRO A . n 
A 1 399  ILE 399  399  399  ILE ILE A . n 
A 1 400  PRO 400  400  400  PRO PRO A . n 
A 1 401  GLN 401  401  401  GLN GLN A . n 
A 1 402  LYS 402  402  402  LYS LYS A . n 
A 1 403  ASP 403  403  403  ASP ASP A . n 
A 1 404  TRP 404  404  404  TRP TRP A . n 
A 1 405  THR 405  405  405  THR THR A . n 
A 1 406  GLY 406  406  406  GLY GLY A . n 
A 1 407  PRO 407  407  407  PRO PRO A . n 
A 1 408  ILE 408  408  408  ILE ILE A . n 
A 1 409  GLY 409  409  409  GLY GLY A . n 
A 1 410  GLU 410  410  410  GLU GLU A . n 
A 1 411  ILE 411  411  411  ILE ILE A . n 
A 1 412  ARG 412  412  412  ARG ARG A . n 
A 1 413  ILE 413  413  413  ILE ILE A . n 
A 1 414  LEU 414  414  414  LEU LEU A . n 
A 1 415  LYS 415  415  415  LYS LYS A . n 
A 1 416  ASP 416  416  416  ASP ASP A . n 
A 1 417  THR 417  417  417  THR THR A . n 
A 1 418  THR 418  418  418  THR THR A . n 
A 1 419  SER 419  419  419  SER SER A . n 
A 1 420  SER 420  420  420  SER SER A . n 
A 1 421  ILE 421  421  421  ILE ILE A . n 
A 1 422  ALA 422  422  422  ALA ALA A . n 
A 1 423  ARG 423  423  423  ARG ARG A . n 
A 1 424  TYR 424  424  424  TYR TYR A . n 
A 1 425  LEU 425  425  425  LEU LEU A . n 
A 1 426  TYR 426  426  426  TYR TYR A . n 
A 1 427  ARG 427  427  427  ARG ARG A . n 
A 1 428  THR 428  428  428  THR THR A . n 
A 1 429  TRP 429  429  429  TRP TRP A . n 
A 1 430  TYR 430  430  430  TYR TYR A . n 
A 1 431  LEU 431  431  431  LEU LEU A . n 
A 1 432  ALA 432  432  432  ALA ALA A . n 
A 1 433  ALA 433  433  433  ALA ALA A . n 
A 1 434  ALA 434  434  434  ALA ALA A . n 
A 1 435  ARG 435  435  435  ARG ARG A . n 
A 1 436  MET 436  436  436  MET MET A . n 
A 1 437  ALA 437  437  437  ALA ALA A . n 
A 1 438  ALA 438  438  438  ALA ALA A . n 
A 1 439  GLN 439  439  439  GLN GLN A . n 
A 1 440  PRO 440  440  440  PRO PRO A . n 
A 1 441  ARG 441  441  441  ARG ARG A . n 
A 1 442  THR 442  442  442  THR THR A . n 
A 1 443  TRP 443  443  443  TRP TRP A . n 
A 1 444  ASP 444  444  444  ASP ASP A . n 
A 1 445  PRO 445  445  445  PRO PRO A . n 
A 1 446  LEU 446  446  446  LEU LEU A . n 
A 1 447  PHE 447  447  447  PHE PHE A . n 
A 1 448  GLN 448  448  448  GLN GLN A . n 
A 1 449  ALA 449  449  449  ALA ALA A . n 
A 1 450  ILE 450  450  450  ILE ILE A . n 
A 1 451  MET 451  451  451  MET MET A . n 
A 1 452  ARG 452  452  452  ARG ARG A . n 
A 1 453  SER 453  453  453  SER SER A . n 
A 1 454  GLN 454  454  454  GLN GLN A . n 
A 1 455  TYR 455  455  455  TYR TYR A . n 
A 1 456  VAL 456  456  456  VAL VAL A . n 
A 1 457  THR 457  457  457  THR THR A . n 
A 1 458  ALA 458  458  458  ALA ALA A . n 
A 1 459  ARG 459  459  459  ARG ARG A . n 
A 1 460  GLY 460  460  460  GLY GLY A . n 
A 1 461  GLY 461  461  461  GLY GLY A . n 
A 1 462  SER 462  462  462  SER SER A . n 
A 1 463  GLY 463  463  463  GLY GLY A . n 
A 1 464  ALA 464  464  464  ALA ALA A . n 
A 1 465  ALA 465  465  465  ALA ALA A . n 
A 1 466  LEU 466  466  466  LEU LEU A . n 
A 1 467  ARG 467  467  467  ARG ARG A . n 
A 1 468  GLU 468  468  468  GLU GLU A . n 
A 1 469  SER 469  469  469  SER SER A . n 
A 1 470  LEU 470  470  470  LEU LEU A . n 
A 1 471  TYR 471  471  471  TYR TYR A . n 
A 1 472  ALA 472  472  472  ALA ALA A . n 
A 1 473  ILE 473  473  473  ILE ILE A . n 
A 1 474  ASN 474  474  474  ASN ASN A . n 
A 1 475  VAL 475  475  475  VAL VAL A . n 
A 1 476  SER 476  476  476  SER SER A . n 
A 1 477  LEU 477  477  477  LEU LEU A . n 
A 1 478  PRO 478  478  478  PRO PRO A . n 
A 1 479  ASP 479  479  479  ASP ASP A . n 
A 1 480  PHE 480  480  480  PHE PHE A . n 
A 1 481  LYS 481  481  481  LYS LYS A . n 
A 1 482  GLY 482  482  482  GLY GLY A . n 
A 1 483  LEU 483  483  483  LEU LEU A . n 
A 1 484  PRO 484  484  484  PRO PRO A . n 
A 1 485  VAL 485  485  485  VAL VAL A . n 
A 1 486  LYS 486  486  486  LYS LYS A . n 
A 1 487  ALA 487  487  487  ALA ALA A . n 
A 1 488  ALA 488  488  488  ALA ALA A . n 
A 1 489  THR 489  489  489  THR THR A . n 
A 1 490  LYS 490  490  490  LYS LYS A . n 
A 1 491  ILE 491  491  491  ILE ILE A . n 
A 1 492  PHE 492  492  492  PHE PHE A . n 
A 1 493  GLN 493  493  493  GLN GLN A . n 
A 1 494  ALA 494  494  494  ALA ALA A . n 
A 1 495  ALA 495  495  495  ALA ALA A . n 
A 1 496  GLN 496  496  496  GLN GLN A . n 
A 1 497  LEU 497  497  497  LEU LEU A . n 
A 1 498  ALA 498  498  498  ALA ALA A . n 
A 1 499  ASN 499  499  499  ASN ASN A . n 
A 1 500  LEU 500  500  500  LEU LEU A . n 
A 1 501  PRO 501  501  501  PRO PRO A . n 
A 1 502  PHE 502  502  502  PHE PHE A . n 
A 1 503  SER 503  503  503  SER SER A . n 
A 1 504  HIS 504  504  504  HIS HIS A . n 
A 1 505  THR 505  505  505  THR THR A . n 
A 1 506  SER 506  506  506  SER SER A . n 
A 1 507  VAL 507  507  507  VAL VAL A . n 
A 1 508  ALA 508  508  508  ALA ALA A . n 
A 1 509  ILE 509  509  509  ILE ILE A . n 
A 1 510  LEU 510  510  510  LEU LEU A . n 
A 1 511  ALA 511  511  511  ALA ALA A . n 
A 1 512  ASP 512  512  512  ASP ASP A . n 
A 1 513  THR 513  513  513  THR THR A . n 
A 1 514  SER 514  514  514  SER SER A . n 
A 1 515  MET 515  515  515  MET MET A . n 
A 1 516  GLY 516  516  516  GLY GLY A . n 
A 1 517  LEU 517  517  517  LEU LEU A . n 
A 1 518  ARG 518  518  518  ARG ARG A . n 
A 1 519  ASN 519  519  519  ASN ASN A . n 
A 1 520  GLN 520  520  520  GLN GLN A . n 
A 1 521  VAL 521  521  521  VAL VAL A . n 
A 1 522  GLN 522  522  522  GLN GLN A . n 
A 1 523  ARG 523  523  523  ARG ARG A . n 
A 1 524  ARG 524  524  524  ARG ARG A . n 
A 1 525  PRO 525  525  525  PRO PRO A . n 
A 1 526  ARG 526  526  526  ARG ARG A . n 
A 1 527  SER 527  527  527  SER SER A . n 
A 1 528  ILE 528  528  528  ILE ILE A . n 
A 1 529  MET 529  529  529  MET MET A . n 
A 1 530  PRO 530  530  530  PRO PRO A . n 
A 1 531  LEU 531  531  531  LEU LEU A . n 
A 1 532  ASN 532  532  532  ASN ASN A . n 
A 1 533  VAL 533  533  533  VAL VAL A . n 
A 1 534  PRO 534  534  534  PRO PRO A . n 
A 1 535  GLN 535  535  535  GLN GLN A . n 
A 1 536  GLN 536  536  536  GLN GLN A . n 
A 1 537  GLN 537  537  537  GLN GLN A . n 
A 1 538  VAL 538  538  538  VAL VAL A . n 
A 1 539  SER 539  539  539  SER SER A . n 
A 1 540  ALA 540  540  540  ALA ALA A . n 
A 1 541  PRO 541  541  541  PRO PRO A . n 
A 1 542  HIS 542  542  542  HIS HIS A . n 
A 1 543  THR 543  543  543  THR THR A . n 
A 1 544  LEU 544  544  544  LEU LEU A . n 
A 1 545  THR 545  545  545  THR THR A . n 
A 1 546  ALA 546  546  546  ALA ALA A . n 
A 1 547  ASP 547  547  547  ASP ASP A . n 
A 1 548  TYR 548  548  548  TYR TYR A . n 
A 1 549  ILE 549  549  549  ILE ILE A . n 
A 1 550  ASN 550  550  550  ASN ASN A . n 
A 1 551  TYR 551  551  551  TYR TYR A . n 
A 1 552  HIS 552  552  552  HIS HIS A . n 
A 1 553  MET 553  553  553  MET MET A . n 
A 1 554  ASN 554  554  554  ASN ASN A . n 
A 1 555  LEU 555  555  555  LEU LEU A . n 
A 1 556  SER 556  556  556  SER SER A . n 
A 1 557  PRO 557  557  557  PRO PRO A . n 
A 1 558  THR 558  558  558  THR THR A . n 
A 1 559  SER 559  559  559  SER SER A . n 
A 1 560  GLY 560  560  560  GLY GLY A . n 
A 1 561  SER 561  561  561  SER SER A . n 
A 1 562  ALA 562  562  562  ALA ALA A . n 
A 1 563  VAL 563  563  563  VAL VAL A . n 
A 1 564  ILE 564  564  564  ILE ILE A . n 
A 1 565  GLU 565  565  565  GLU GLU A . n 
A 1 566  LYS 566  566  566  LYS LYS A . n 
A 1 567  VAL 567  567  567  VAL VAL A . n 
A 1 568  ILE 568  568  568  ILE ILE A . n 
A 1 569  PRO 569  569  569  PRO PRO A . n 
A 1 570  LEU 570  570  570  LEU LEU A . n 
A 1 571  GLY 571  571  571  GLY GLY A . n 
A 1 572  VAL 572  572  572  VAL VAL A . n 
A 1 573  TYR 573  573  573  TYR TYR A . n 
A 1 574  ALA 574  574  574  ALA ALA A . n 
A 1 575  SER 575  575  575  SER SER A . n 
A 1 576  SER 576  576  576  SER SER A . n 
A 1 577  PRO 577  577  577  PRO PRO A . n 
A 1 578  PRO 578  578  578  PRO PRO A . n 
A 1 579  ASN 579  579  579  ASN ASN A . n 
A 1 580  GLN 580  580  580  GLN GLN A . n 
A 1 581  SER 581  581  581  SER SER A . n 
A 1 582  ILE 582  582  582  ILE ILE A . n 
A 1 583  ASN 583  583  583  ASN ASN A . n 
A 1 584  ILE 584  584  584  ILE ILE A . n 
A 1 585  ASP 585  585  585  ASP ASP A . n 
A 1 586  ILE 586  586  586  ILE ILE A . n 
A 1 587  SER 587  587  587  SER SER A . n 
A 1 588  ALA 588  588  588  ALA ALA A . n 
A 1 589  CYS 589  589  589  CYS CYS A . n 
A 1 590  ASP 590  590  590  ASP ASP A . n 
A 1 591  ALA 591  591  591  ALA ALA A . n 
A 1 592  SER 592  592  592  SER SER A . n 
A 1 593  ILE 593  593  593  ILE ILE A . n 
A 1 594  THR 594  594  594  THR THR A . n 
A 1 595  TRP 595  595  595  TRP TRP A . n 
A 1 596  ASP 596  596  596  ASP ASP A . n 
A 1 597  PHE 597  597  597  PHE PHE A . n 
A 1 598  PHE 598  598  598  PHE PHE A . n 
A 1 599  LEU 599  599  599  LEU LEU A . n 
A 1 600  SER 600  600  600  SER SER A . n 
A 1 601  VAL 601  601  601  VAL VAL A . n 
A 1 602  ILE 602  602  602  ILE ILE A . n 
A 1 603  MET 603  603  603  MET MET A . n 
A 1 604  ALA 604  604  604  ALA ALA A . n 
A 1 605  ALA 605  605  605  ALA ALA A . n 
A 1 606  ILE 606  606  606  ILE ILE A . n 
A 1 607  HIS 607  607  607  HIS HIS A . n 
A 1 608  GLU 608  608  608  GLU GLU A . n 
A 1 609  GLY 609  609  609  GLY GLY A . n 
A 1 610  VAL 610  610  610  VAL VAL A . n 
A 1 611  ALA 611  611  611  ALA ALA A . n 
A 1 612  SER 612  612  612  SER SER A . n 
A 1 613  SER 613  613  613  SER SER A . n 
A 1 614  SER 614  614  614  SER SER A . n 
A 1 615  ILE 615  615  615  ILE ILE A . n 
A 1 616  GLY 616  616  616  GLY GLY A . n 
A 1 617  LYS 617  617  617  LYS LYS A . n 
A 1 618  PRO 618  618  618  PRO PRO A . n 
A 1 619  PHE 619  619  619  PHE PHE A . n 
A 1 620  MET 620  620  620  MET MET A . n 
A 1 621  GLY 621  621  621  GLY GLY A . n 
A 1 622  VAL 622  622  622  VAL VAL A . n 
A 1 623  PRO 623  623  623  PRO PRO A . n 
A 1 624  ALA 624  624  624  ALA ALA A . n 
A 1 625  SER 625  625  625  SER SER A . n 
A 1 626  ILE 626  626  626  ILE ILE A . n 
A 1 627  VAL 627  627  627  VAL VAL A . n 
A 1 628  ASN 628  628  628  ASN ASN A . n 
A 1 629  ASP 629  629  629  ASP ASP A . n 
A 1 630  GLU 630  630  630  GLU GLU A . n 
A 1 631  SER 631  631  631  SER SER A . n 
A 1 632  VAL 632  632  632  VAL VAL A . n 
A 1 633  VAL 633  633  633  VAL VAL A . n 
A 1 634  GLY 634  634  634  GLY GLY A . n 
A 1 635  VAL 635  635  635  VAL VAL A . n 
A 1 636  ARG 636  636  636  ARG ARG A . n 
A 1 637  ALA 637  637  637  ALA ALA A . n 
A 1 638  ALA 638  638  638  ALA ALA A . n 
A 1 639  ARG 639  639  639  ARG ARG A . n 
A 1 640  PRO 640  640  640  PRO PRO A . n 
A 1 641  ILE 641  641  641  ILE ILE A . n 
A 1 642  SER 642  642  642  SER SER A . n 
A 1 643  GLY 643  643  643  GLY GLY A . n 
A 1 644  MET 644  644  644  MET MET A . n 
A 1 645  GLN 645  645  645  GLN GLN A . n 
A 1 646  ASN 646  646  646  ASN ASN A . n 
A 1 647  MET 647  647  647  MET MET A . n 
A 1 648  ILE 648  648  648  ILE ILE A . n 
A 1 649  GLN 649  649  649  GLN GLN A . n 
A 1 650  HIS 650  650  650  HIS HIS A . n 
A 1 651  LEU 651  651  651  LEU LEU A . n 
A 1 652  SER 652  652  652  SER SER A . n 
A 1 653  LYS 653  653  653  LYS LYS A . n 
A 1 654  LEU 654  654  654  LEU LEU A . n 
A 1 655  TYR 655  655  655  TYR TYR A . n 
A 1 656  LYS 656  656  656  LYS LYS A . n 
A 1 657  ARG 657  657  657  ARG ARG A . n 
A 1 658  GLY 658  658  658  GLY GLY A . n 
A 1 659  PHE 659  659  659  PHE PHE A . n 
A 1 660  SER 660  660  660  SER SER A . n 
A 1 661  TYR 661  661  661  TYR TYR A . n 
A 1 662  ARG 662  662  662  ARG ARG A . n 
A 1 663  VAL 663  663  663  VAL VAL A . n 
A 1 664  ASN 664  664  664  ASN ASN A . n 
A 1 665  ASP 665  665  665  ASP ASP A . n 
A 1 666  SER 666  666  666  SER SER A . n 
A 1 667  PHE 667  667  667  PHE PHE A . n 
A 1 668  SER 668  668  668  SER SER A . n 
A 1 669  PRO 669  669  669  PRO PRO A . n 
A 1 670  GLY 670  670  670  GLY GLY A . n 
A 1 671  ASN 671  671  671  ASN ASN A . n 
A 1 672  ASP 672  672  672  ASP ASP A . n 
A 1 673  PHE 673  673  673  PHE PHE A . n 
A 1 674  THR 674  674  674  THR THR A . n 
A 1 675  HIS 675  675  675  HIS HIS A . n 
A 1 676  MET 676  676  676  MET MET A . n 
A 1 677  THR 677  677  677  THR THR A . n 
A 1 678  THR 678  678  678  THR THR A . n 
A 1 679  THR 679  679  679  THR THR A . n 
A 1 680  PHE 680  680  680  PHE PHE A . n 
A 1 681  PRO 681  681  681  PRO PRO A . n 
A 1 682  SER 682  682  682  SER SER A . n 
A 1 683  GLY 683  683  683  GLY GLY A . n 
A 1 684  SER 684  684  684  SER SER A . n 
A 1 685  THR 685  685  685  THR THR A . n 
A 1 686  ALA 686  686  686  ALA ALA A . n 
A 1 687  THR 687  687  687  THR THR A . n 
A 1 688  SER 688  688  688  SER SER A . n 
A 1 689  THR 689  689  689  THR THR A . n 
A 1 690  GLU 690  690  690  GLU GLU A . n 
A 1 691  HIS 691  691  691  HIS HIS A . n 
A 1 692  THR 692  692  692  THR THR A . n 
A 1 693  ALA 693  693  693  ALA ALA A . n 
A 1 694  ASN 694  694  694  ASN ASN A . n 
A 1 695  ASN 695  695  695  ASN ASN A . n 
A 1 696  SER 696  696  696  SER SER A . n 
A 1 697  THR 697  697  697  THR THR A . n 
A 1 698  MET 698  698  698  MET MET A . n 
A 1 699  MET 699  699  699  MET MET A . n 
A 1 700  GLU 700  700  700  GLU GLU A . n 
A 1 701  THR 701  701  701  THR THR A . n 
A 1 702  PHE 702  702  702  PHE PHE A . n 
A 1 703  LEU 703  703  703  LEU LEU A . n 
A 1 704  THR 704  704  704  THR THR A . n 
A 1 705  VAL 705  705  705  VAL VAL A . n 
A 1 706  TRP 706  706  706  TRP TRP A . n 
A 1 707  GLY 707  707  707  GLY GLY A . n 
A 1 708  PRO 708  708  708  PRO PRO A . n 
A 1 709  GLU 709  709  709  GLU GLU A . n 
A 1 710  HIS 710  710  710  HIS HIS A . n 
A 1 711  THR 711  711  711  THR THR A . n 
A 1 712  ASP 712  712  712  ASP ASP A . n 
A 1 713  ASP 713  713  713  ASP ASP A . n 
A 1 714  PRO 714  714  714  PRO PRO A . n 
A 1 715  ASP 715  715  715  ASP ASP A . n 
A 1 716  VAL 716  716  716  VAL VAL A . n 
A 1 717  LEU 717  717  717  LEU LEU A . n 
A 1 718  ARG 718  718  718  ARG ARG A . n 
A 1 719  LEU 719  719  719  LEU LEU A . n 
A 1 720  MET 720  720  720  MET MET A . n 
A 1 721  LYS 721  721  721  LYS LYS A . n 
A 1 722  SER 722  722  722  SER SER A . n 
A 1 723  LEU 723  723  723  LEU LEU A . n 
A 1 724  THR 724  724  724  THR THR A . n 
A 1 725  ILE 725  725  725  ILE ILE A . n 
A 1 726  GLN 726  726  726  GLN GLN A . n 
A 1 727  ARG 727  727  727  ARG ARG A . n 
A 1 728  ASN 728  728  728  ASN ASN A . n 
A 1 729  TYR 729  729  729  TYR TYR A . n 
A 1 730  VAL 730  730  730  VAL VAL A . n 
A 1 731  CYS 731  731  731  CYS CYS A . n 
A 1 732  GLN 732  732  732  GLN GLN A . n 
A 1 733  GLY 733  733  733  GLY GLY A . n 
A 1 734  ASP 734  734  734  ASP ASP A . n 
A 1 735  ASP 735  735  735  ASP ASP A . n 
A 1 736  GLY 736  736  736  GLY GLY A . n 
A 1 737  LEU 737  737  737  LEU LEU A . n 
A 1 738  MET 738  738  738  MET MET A . n 
A 1 739  ILE 739  739  739  ILE ILE A . n 
A 1 740  ILE 740  740  740  ILE ILE A . n 
A 1 741  ASP 741  741  741  ASP ASP A . n 
A 1 742  GLY 742  742  742  GLY GLY A . n 
A 1 743  THR 743  743  743  THR THR A . n 
A 1 744  THR 744  744  744  THR THR A . n 
A 1 745  ALA 745  745  745  ALA ALA A . n 
A 1 746  GLY 746  746  746  GLY GLY A . n 
A 1 747  LYS 747  747  747  LYS LYS A . n 
A 1 748  VAL 748  748  748  VAL VAL A . n 
A 1 749  ASN 749  749  749  ASN ASN A . n 
A 1 750  SER 750  750  750  SER SER A . n 
A 1 751  GLU 751  751  751  GLU GLU A . n 
A 1 752  THR 752  752  752  THR THR A . n 
A 1 753  ILE 753  753  753  ILE ILE A . n 
A 1 754  GLN 754  754  754  GLN GLN A . n 
A 1 755  ASN 755  755  755  ASN ASN A . n 
A 1 756  ASP 756  756  756  ASP ASP A . n 
A 1 757  LEU 757  757  757  LEU LEU A . n 
A 1 758  GLU 758  758  758  GLU GLU A . n 
A 1 759  LEU 759  759  759  LEU LEU A . n 
A 1 760  ILE 760  760  760  ILE ILE A . n 
A 1 761  SER 761  761  761  SER SER A . n 
A 1 762  LYS 762  762  762  LYS LYS A . n 
A 1 763  TYR 763  763  763  TYR TYR A . n 
A 1 764  GLY 764  764  764  GLY GLY A . n 
A 1 765  GLU 765  765  765  GLU GLU A . n 
A 1 766  GLU 766  766  766  GLU GLU A . n 
A 1 767  PHE 767  767  767  PHE PHE A . n 
A 1 768  GLY 768  768  768  GLY GLY A . n 
A 1 769  TRP 769  769  769  TRP TRP A . n 
A 1 770  LYS 770  770  770  LYS LYS A . n 
A 1 771  TYR 771  771  771  TYR TYR A . n 
A 1 772  ASP 772  772  772  ASP ASP A . n 
A 1 773  ILE 773  773  773  ILE ILE A . n 
A 1 774  ALA 774  774  774  ALA ALA A . n 
A 1 775  TYR 775  775  775  TYR TYR A . n 
A 1 776  ASP 776  776  776  ASP ASP A . n 
A 1 777  GLY 777  777  777  GLY GLY A . n 
A 1 778  THR 778  778  778  THR THR A . n 
A 1 779  ALA 779  779  779  ALA ALA A . n 
A 1 780  GLU 780  780  780  GLU GLU A . n 
A 1 781  TYR 781  781  781  TYR TYR A . n 
A 1 782  LEU 782  782  782  LEU LEU A . n 
A 1 783  LYS 783  783  783  LYS LYS A . n 
A 1 784  LEU 784  784  784  LEU LEU A . n 
A 1 785  TYR 785  785  785  TYR TYR A . n 
A 1 786  PHE 786  786  786  PHE PHE A . n 
A 1 787  ILE 787  787  787  ILE ILE A . n 
A 1 788  PHE 788  788  788  PHE PHE A . n 
A 1 789  GLY 789  789  789  GLY GLY A . n 
A 1 790  CYS 790  790  790  CYS CYS A . n 
A 1 791  ARG 791  791  791  ARG ARG A . n 
A 1 792  ILE 792  792  792  ILE ILE A . n 
A 1 793  PRO 793  793  793  PRO PRO A . n 
A 1 794  ASN 794  794  794  ASN ASN A . n 
A 1 795  LEU 795  795  795  LEU LEU A . n 
A 1 796  SER 796  796  796  SER SER A . n 
A 1 797  ARG 797  797  797  ARG ARG A . n 
A 1 798  HIS 798  798  798  HIS HIS A . n 
A 1 799  PRO 799  799  799  PRO PRO A . n 
A 1 800  ILE 800  800  800  ILE ILE A . n 
A 1 801  VAL 801  801  801  VAL VAL A . n 
A 1 802  GLY 802  802  802  GLY GLY A . n 
A 1 803  LYS 803  803  803  LYS LYS A . n 
A 1 804  GLU 804  804  804  GLU GLU A . n 
A 1 805  ARG 805  805  805  ARG ARG A . n 
A 1 806  ALA 806  806  806  ALA ALA A . n 
A 1 807  ASN 807  807  807  ASN ASN A . n 
A 1 808  SER 808  808  808  SER SER A . n 
A 1 809  SER 809  809  809  SER SER A . n 
A 1 810  ALA 810  810  810  ALA ALA A . n 
A 1 811  GLU 811  811  811  GLU GLU A . n 
A 1 812  GLU 812  812  812  GLU GLU A . n 
A 1 813  PRO 813  813  813  PRO PRO A . n 
A 1 814  TRP 814  814  814  TRP TRP A . n 
A 1 815  PRO 815  815  815  PRO PRO A . n 
A 1 816  ALA 816  816  816  ALA ALA A . n 
A 1 817  ILE 817  817  817  ILE ILE A . n 
A 1 818  LEU 818  818  818  LEU LEU A . n 
A 1 819  ASP 819  819  819  ASP ASP A . n 
A 1 820  GLN 820  820  820  GLN GLN A . n 
A 1 821  ILE 821  821  821  ILE ILE A . n 
A 1 822  MET 822  822  822  MET MET A . n 
A 1 823  GLY 823  823  823  GLY GLY A . n 
A 1 824  VAL 824  824  824  VAL VAL A . n 
A 1 825  PHE 825  825  825  PHE PHE A . n 
A 1 826  PHE 826  826  826  PHE PHE A . n 
A 1 827  ASN 827  827  827  ASN ASN A . n 
A 1 828  GLY 828  828  828  GLY GLY A . n 
A 1 829  VAL 829  829  829  VAL VAL A . n 
A 1 830  HIS 830  830  830  HIS HIS A . n 
A 1 831  ASP 831  831  831  ASP ASP A . n 
A 1 832  GLY 832  832  832  GLY GLY A . n 
A 1 833  LEU 833  833  833  LEU LEU A . n 
A 1 834  GLN 834  834  834  GLN GLN A . n 
A 1 835  TRP 835  835  835  TRP TRP A . n 
A 1 836  GLN 836  836  836  GLN GLN A . n 
A 1 837  ARG 837  837  837  ARG ARG A . n 
A 1 838  TRP 838  838  838  TRP TRP A . n 
A 1 839  ILE 839  839  839  ILE ILE A . n 
A 1 840  ARG 840  840  840  ARG ARG A . n 
A 1 841  TYR 841  841  841  TYR TYR A . n 
A 1 842  SER 842  842  842  SER SER A . n 
A 1 843  TRP 843  843  843  TRP TRP A . n 
A 1 844  ALA 844  844  844  ALA ALA A . n 
A 1 845  LEU 845  845  845  LEU LEU A . n 
A 1 846  CYS 846  846  846  CYS CYS A . n 
A 1 847  CYS 847  847  847  CYS CYS A . n 
A 1 848  ALA 848  848  848  ALA ALA A . n 
A 1 849  PHE 849  849  849  PHE PHE A . n 
A 1 850  SER 850  850  850  SER SER A . n 
A 1 851  ARG 851  851  851  ARG ARG A . n 
A 1 852  GLN 852  852  852  GLN GLN A . n 
A 1 853  ARG 853  853  853  ARG ARG A . n 
A 1 854  THR 854  854  854  THR THR A . n 
A 1 855  MET 855  855  855  MET MET A . n 
A 1 856  ILE 856  856  856  ILE ILE A . n 
A 1 857  GLY 857  857  857  GLY GLY A . n 
A 1 858  GLU 858  858  858  GLU GLU A . n 
A 1 859  SER 859  859  859  SER SER A . n 
A 1 860  VAL 860  860  860  VAL VAL A . n 
A 1 861  GLY 861  861  861  GLY GLY A . n 
A 1 862  TYR 862  862  862  TYR TYR A . n 
A 1 863  LEU 863  863  863  LEU LEU A . n 
A 1 864  GLN 864  864  864  GLN GLN A . n 
A 1 865  TYR 865  865  865  TYR TYR A . n 
A 1 866  PRO 866  866  866  PRO PRO A . n 
A 1 867  MET 867  867  867  MET MET A . n 
A 1 868  TRP 868  868  868  TRP TRP A . n 
A 1 869  SER 869  869  869  SER SER A . n 
A 1 870  PHE 870  870  870  PHE PHE A . n 
A 1 871  VAL 871  871  871  VAL VAL A . n 
A 1 872  TYR 872  872  872  TYR TYR A . n 
A 1 873  TRP 873  873  873  TRP TRP A . n 
A 1 874  GLY 874  874  874  GLY GLY A . n 
A 1 875  LEU 875  875  875  LEU LEU A . n 
A 1 876  PRO 876  876  876  PRO PRO A . n 
A 1 877  LEU 877  877  877  LEU LEU A . n 
A 1 878  VAL 878  878  878  VAL VAL A . n 
A 1 879  LYS 879  879  879  LYS LYS A . n 
A 1 880  ALA 880  880  880  ALA ALA A . n 
A 1 881  PHE 881  881  881  PHE PHE A . n 
A 1 882  GLY 882  882  882  GLY GLY A . n 
A 1 883  SER 883  883  883  SER SER A . n 
A 1 884  ASP 884  884  884  ASP ASP A . n 
A 1 885  PRO 885  885  885  PRO PRO A . n 
A 1 886  TRP 886  886  886  TRP TRP A . n 
A 1 887  ILE 887  887  887  ILE ILE A . n 
A 1 888  PHE 888  888  888  PHE PHE A . n 
A 1 889  SER 889  889  889  SER SER A . n 
A 1 890  TRP 890  890  890  TRP TRP A . n 
A 1 891  TYR 891  891  891  TYR TYR A . n 
A 1 892  MET 892  892  892  MET MET A . n 
A 1 893  PRO 893  893  893  PRO PRO A . n 
A 1 894  THR 894  894  894  THR THR A . n 
A 1 895  GLY 895  895  895  GLY GLY A . n 
A 1 896  ASP 896  896  896  ASP ASP A . n 
A 1 897  LEU 897  897  897  LEU LEU A . n 
A 1 898  GLY 898  898  898  GLY GLY A . n 
A 1 899  MET 899  899  899  MET MET A . n 
A 1 900  TYR 900  900  900  TYR TYR A . n 
A 1 901  SER 901  901  901  SER SER A . n 
A 1 902  TRP 902  902  902  TRP TRP A . n 
A 1 903  ILE 903  903  903  ILE ILE A . n 
A 1 904  SER 904  904  904  SER SER A . n 
A 1 905  LEU 905  905  905  LEU LEU A . n 
A 1 906  ILE 906  906  906  ILE ILE A . n 
A 1 907  ARG 907  907  907  ARG ARG A . n 
A 1 908  PRO 908  908  908  PRO PRO A . n 
A 1 909  LEU 909  909  909  LEU LEU A . n 
A 1 910  MET 910  910  910  MET MET A . n 
A 1 911  THR 911  911  911  THR THR A . n 
A 1 912  ARG 912  912  912  ARG ARG A . n 
A 1 913  TRP 913  913  913  TRP TRP A . n 
A 1 914  MET 914  914  914  MET MET A . n 
A 1 915  VAL 915  915  915  VAL VAL A . n 
A 1 916  ALA 916  916  916  ALA ALA A . n 
A 1 917  ASN 917  917  917  ASN ASN A . n 
A 1 918  GLY 918  918  918  GLY GLY A . n 
A 1 919  TYR 919  919  919  TYR TYR A . n 
A 1 920  VAL 920  920  920  VAL VAL A . n 
A 1 921  THR 921  921  921  THR THR A . n 
A 1 922  ASP 922  922  922  ASP ASP A . n 
A 1 923  ARG 923  923  923  ARG ARG A . n 
A 1 924  CYS 924  924  924  CYS CYS A . n 
A 1 925  SER 925  925  925  SER SER A . n 
A 1 926  THR 926  926  926  THR THR A . n 
A 1 927  VAL 927  927  927  VAL VAL A . n 
A 1 928  PHE 928  928  928  PHE PHE A . n 
A 1 929  GLY 929  929  929  GLY GLY A . n 
A 1 930  ASN 930  930  930  ASN ASN A . n 
A 1 931  ALA 931  931  931  ALA ALA A . n 
A 1 932  ASP 932  932  932  ASP ASP A . n 
A 1 933  TYR 933  933  933  TYR TYR A . n 
A 1 934  ARG 934  934  934  ARG ARG A . n 
A 1 935  ARG 935