data_1MVM
# 
_entry.id   1MVM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1MVM         
RCSB  PDV007       
WWPDB D_1000175178 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1MVM 
_pdbx_database_status.recvd_initial_deposition_date   1996-06-21 
_pdbx_database_status.deposit_site                    NDB 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Llamas-Saiz, A.L.'    1 
'Agbandje-McKenna, M.' 2 
'Rossmann, M.G.'       3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure determination of minute virus of mice.' 'Acta Crystallogr.,Sect.D' 53  93   102 1997 ABCRE6 DK 0907-4449 0766 ? 
15299974 10.1107/S0907444996010566 
1       'Functional Implications of the Structure of the Murine Parvovirus, Minute Virus of Mice' 'To be Published'          ?   ? 
?   ?    ?      ?  ?         0353 ? ?        ?                         
2       'Structure, Sequence, and Function Correlations Among Parvoviruses' Virology                   194 491  ?   1993 VIRLAX US 
0042-6822 0922 ? ?        ?                         
3       'Structure Determination of Feline Panleukopenia Virus Empty Particles' Proteins                   16  155  ?   1993 
PSFGEY US 0887-3585 0867 ? ?        ?                         
4       'Determination and Refinement of the Canine Parvovirus Empty-Capsid Structure' 'Acta Crystallogr.,Sect.D' 49  572  ?   
1993 ABCRE6 DK 0907-4449 0766 ? ?        ?                         
5       
;Two Amino Acid Substitutions within the Capsid are Coordinately Required for Acquisition of Fibrotropism by the Lymphotropic Strain of Minute Virus of Mice
;
J.Virol.                   66  3415 ?   1992 JOVIAM US 0022-538X 0825 ? ?        ?                         
6       'Structure Determination of Monoclinic Canine Parvovirus' 'Acta Crystallogr.,Sect.B' 48  75   ?   1992 ASBSDK DK 0108-7681 
0622 ? ?        ?                         
7       'The Three-Dimensional Structure of Canine Parvovirus and its Functional Implications' Science                    251 1456 
?   1991 SCIEAS US 0036-8075 0038 ? ?        ?                         
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Llamas-Saiz, A.L.'    1  
primary 'Agbandje-McKenna, M.' 2  
primary 'Wikoff, W.R.'         3  
primary 'Bratton, J.'          4  
primary 'Tattersall, P.'       5  
primary 'Rossmann, M.G.'       6  
1       'Agbandje-McKenna, M.' 7  
1       'Llamas-Saiz, A.L.'    8  
1       'Weng, F.'             9  
1       'Tattersall, P.J.'     10 
1       'Rossmann, M.G.'       11 
2       'Chapman, M.S.'        12 
2       'Rossmann, M.G.'       13 
3       'Agbandje, M.'         14 
3       'McKenna, R.'          15 
3       'Rossmann, M.G.'       16 
3       'Strassheim, M.L.'     17 
3       'Parrish, C.R.'        18 
4       'Wu, H.'               19 
4       'Keller, W.'           20 
4       'Rossmann, M.G.'       21 
5       'Ball-Goodrich, L.J.'  22 
5       'Tattersall, P.'       23 
6       'Tsao, J.'             24 
6       'Chapman, M.S.'        25 
6       'Wu, H.'               26 
6       'Agbandje, M.'         27 
6       'Keller, W.'           28 
6       'Rossmann, M.G.'       29 
7       'Tsao, J.'             30 
7       'Chapman, M.S.'        31 
7       'Agbandje, M.'         32 
7       'Keller, W.'           33 
7       'Smith, K.'            34 
7       'Wu, H.'               35 
7       'Luo, M.'              36 
7       'Smith, T.J.'          37 
7       'Rossmann, M.G.'       38 
7       'Compans, R.W.'        39 
7       'Parrish, C.R.'        40 
# 
_cell.entry_id           1MVM 
_cell.length_a           448.700 
_cell.length_b           416.700 
_cell.length_c           305.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.80 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1MVM 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'PROTEIN (MURINE MINUTE VIRUS COAT PROTEIN)'      64745.602 1 ? ? ? ? 
2 polymer syn 
;DNA (5'-D(*CP*CP*AP*CP*CP*CP*CP*AP*AP*CP*A)-3')
;
3232.142  1 ? ? ? ? 
3 polymer syn 
;DNA (5'-D(*CP*AP*AP*A)-3')
;
1183.845  1 ? ? ? ? 
4 polymer syn 
;DNA (5'-D(P*A)-3')
;
331.222   1 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MSDGTSQPDGGNAVHSAARVERAADGPGGSGGGGSGGGGVGVSTGSYDNQTHYRFLGDGWVEITALATRLVHLNMPKSEN
YCRIRVHNTTDTSVKGNMAKDDAHEQIWTPWSLVDANAWGVWLQPSDWQYICNTMSQLNLVSLDQEIFNVVLKTVTEQDS
GGQAIKIYNNDLTACMMVAVDSNNILPYTPAANSMETLGFYPWKPTIASPYRYYFCVDRDLSVTYENQEGTIEHNVMGTP
KGMNSQFFTIENTQQITLLRTGDEFATGTYYFDTNPVKLTHTWQTNRQLGQPPLLSTFPEADTDAGTLTAQGSRHGATQM
EVNWVSEAIRTRPAQVGFCQPHNDFEASRAGPFAAPKVPADVTQGMDREANGSVRYSYGKQHGENWAAHGPAPERYTWDE
TNFGSGRDTRDGFIQSAPLVVPPPLNGILTNANPIGTKNDIHFSNVFNSYGPLTTFSHPSPVYPQGQIWDKELDLEHKPR
LHITAPFVCKNNAPGQMLVRLGPNLTDQYDPNGATLSRIVTYGTFFWKGKLTMRAKLRANTTWNPVYQVSVEDNGNSYMS
VTKWLPTATGNMQSVPLITRPVARNTY
;
;MSDGTSQPDGGNAVHSAARVERAADGPGGSGGGGSGGGGVGVSTGSYDNQTHYRFLGDGWVEITALATRLVHLNMPKSEN
YCRIRVHNTTDTSVKGNMAKDDAHEQIWTPWSLVDANAWGVWLQPSDWQYICNTMSQLNLVSLDQEIFNVVLKTVTEQDS
GGQAIKIYNNDLTACMMVAVDSNNILPYTPAANSMETLGFYPWKPTIASPYRYYFCVDRDLSVTYENQEGTIEHNVMGTP
KGMNSQFFTIENTQQITLLRTGDEFATGTYYFDTNPVKLTHTWQTNRQLGQPPLLSTFPEADTDAGTLTAQGSRHGATQM
EVNWVSEAIRTRPAQVGFCQPHNDFEASRAGPFAAPKVPADVTQGMDREANGSVRYSYGKQHGENWAAHGPAPERYTWDE
TNFGSGRDTRDGFIQSAPLVVPPPLNGILTNANPIGTKNDIHFSNVFNSYGPLTTFSHPSPVYPQGQIWDKELDLEHKPR
LHITAPFVCKNNAPGQMLVRLGPNLTDQYDPNGATLSRIVTYGTFFWKGKLTMRAKLRANTTWNPVYQVSVEDNGNSYMS
VTKWLPTATGNMQSVPLITRPVARNTY
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DC)(DA)(DC)(DC)(DC)(DC)(DA)(DA)(DC)(DA)' CCACCCCAACA B ? 
3 polydeoxyribonucleotide no no '(DC)(DA)(DA)(DA)' CAAA C ? 
4 polydeoxyribonucleotide no no '(DA)' A D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ASP n 
1 4   GLY n 
1 5   THR n 
1 6   SER n 
1 7   GLN n 
1 8   PRO n 
1 9   ASP n 
1 10  GLY n 
1 11  GLY n 
1 12  ASN n 
1 13  ALA n 
1 14  VAL n 
1 15  HIS n 
1 16  SER n 
1 17  ALA n 
1 18  ALA n 
1 19  ARG n 
1 20  VAL n 
1 21  GLU n 
1 22  ARG n 
1 23  ALA n 
1 24  ALA n 
1 25  ASP n 
1 26  GLY n 
1 27  PRO n 
1 28  GLY n 
1 29  GLY n 
1 30  SER n 
1 31  GLY n 
1 32  GLY n 
1 33  GLY n 
1 34  GLY n 
1 35  SER n 
1 36  GLY n 
1 37  GLY n 
1 38  GLY n 
1 39  GLY n 
1 40  VAL n 
1 41  GLY n 
1 42  VAL n 
1 43  SER n 
1 44  THR n 
1 45  GLY n 
1 46  SER n 
1 47  TYR n 
1 48  ASP n 
1 49  ASN n 
1 50  GLN n 
1 51  THR n 
1 52  HIS n 
1 53  TYR n 
1 54  ARG n 
1 55  PHE n 
1 56  LEU n 
1 57  GLY n 
1 58  ASP n 
1 59  GLY n 
1 60  TRP n 
1 61  VAL n 
1 62  GLU n 
1 63  ILE n 
1 64  THR n 
1 65  ALA n 
1 66  LEU n 
1 67  ALA n 
1 68  THR n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  HIS n 
1 73  LEU n 
1 74  ASN n 
1 75  MET n 
1 76  PRO n 
1 77  LYS n 
1 78  SER n 
1 79  GLU n 
1 80  ASN n 
1 81  TYR n 
1 82  CYS n 
1 83  ARG n 
1 84  ILE n 
1 85  ARG n 
1 86  VAL n 
1 87  HIS n 
1 88  ASN n 
1 89  THR n 
1 90  THR n 
1 91  ASP n 
1 92  THR n 
1 93  SER n 
1 94  VAL n 
1 95  LYS n 
1 96  GLY n 
1 97  ASN n 
1 98  MET n 
1 99  ALA n 
1 100 LYS n 
1 101 ASP n 
1 102 ASP n 
1 103 ALA n 
1 104 HIS n 
1 105 GLU n 
1 106 GLN n 
1 107 ILE n 
1 108 TRP n 
1 109 THR n 
1 110 PRO n 
1 111 TRP n 
1 112 SER n 
1 113 LEU n 
1 114 VAL n 
1 115 ASP n 
1 116 ALA n 
1 117 ASN n 
1 118 ALA n 
1 119 TRP n 
1 120 GLY n 
1 121 VAL n 
1 122 TRP n 
1 123 LEU n 
1 124 GLN n 
1 125 PRO n 
1 126 SER n 
1 127 ASP n 
1 128 TRP n 
1 129 GLN n 
1 130 TYR n 
1 131 ILE n 
1 132 CYS n 
1 133 ASN n 
1 134 THR n 
1 135 MET n 
1 136 SER n 
1 137 GLN n 
1 138 LEU n 
1 139 ASN n 
1 140 LEU n 
1 141 VAL n 
1 142 SER n 
1 143 LEU n 
1 144 ASP n 
1 145 GLN n 
1 146 GLU n 
1 147 ILE n 
1 148 PHE n 
1 149 ASN n 
1 150 VAL n 
1 151 VAL n 
1 152 LEU n 
1 153 LYS n 
1 154 THR n 
1 155 VAL n 
1 156 THR n 
1 157 GLU n 
1 158 GLN n 
1 159 ASP n 
1 160 SER n 
1 161 GLY n 
1 162 GLY n 
1 163 GLN n 
1 164 ALA n 
1 165 ILE n 
1 166 LYS n 
1 167 ILE n 
1 168 TYR n 
1 169 ASN n 
1 170 ASN n 
1 171 ASP n 
1 172 LEU n 
1 173 THR n 
1 174 ALA n 
1 175 CYS n 
1 176 MET n 
1 177 MET n 
1 178 VAL n 
1 179 ALA n 
1 180 VAL n 
1 181 ASP n 
1 182 SER n 
1 183 ASN n 
1 184 ASN n 
1 185 ILE n 
1 186 LEU n 
1 187 PRO n 
1 188 TYR n 
1 189 THR n 
1 190 PRO n 
1 191 ALA n 
1 192 ALA n 
1 193 ASN n 
1 194 SER n 
1 195 MET n 
1 196 GLU n 
1 197 THR n 
1 198 LEU n 
1 199 GLY n 
1 200 PHE n 
1 201 TYR n 
1 202 PRO n 
1 203 TRP n 
1 204 LYS n 
1 205 PRO n 
1 206 THR n 
1 207 ILE n 
1 208 ALA n 
1 209 SER n 
1 210 PRO n 
1 211 TYR n 
1 212 ARG n 
1 213 TYR n 
1 214 TYR n 
1 215 PHE n 
1 216 CYS n 
1 217 VAL n 
1 218 ASP n 
1 219 ARG n 
1 220 ASP n 
1 221 LEU n 
1 222 SER n 
1 223 VAL n 
1 224 THR n 
1 225 TYR n 
1 226 GLU n 
1 227 ASN n 
1 228 GLN n 
1 229 GLU n 
1 230 GLY n 
1 231 THR n 
1 232 ILE n 
1 233 GLU n 
1 234 HIS n 
1 235 ASN n 
1 236 VAL n 
1 237 MET n 
1 238 GLY n 
1 239 THR n 
1 240 PRO n 
1 241 LYS n 
1 242 GLY n 
1 243 MET n 
1 244 ASN n 
1 245 SER n 
1 246 GLN n 
1 247 PHE n 
1 248 PHE n 
1 249 THR n 
1 250 ILE n 
1 251 GLU n 
1 252 ASN n 
1 253 THR n 
1 254 GLN n 
1 255 GLN n 
1 256 ILE n 
1 257 THR n 
1 258 LEU n 
1 259 LEU n 
1 260 ARG n 
1 261 THR n 
1 262 GLY n 
1 263 ASP n 
1 264 GLU n 
1 265 PHE n 
1 266 ALA n 
1 267 THR n 
1 268 GLY n 
1 269 THR n 
1 270 TYR n 
1 271 TYR n 
1 272 PHE n 
1 273 ASP n 
1 274 THR n 
1 275 ASN n 
1 276 PRO n 
1 277 VAL n 
1 278 LYS n 
1 279 LEU n 
1 280 THR n 
1 281 HIS n 
1 282 THR n 
1 283 TRP n 
1 284 GLN n 
1 285 THR n 
1 286 ASN n 
1 287 ARG n 
1 288 GLN n 
1 289 LEU n 
1 290 GLY n 
1 291 GLN n 
1 292 PRO n 
1 293 PRO n 
1 294 LEU n 
1 295 LEU n 
1 296 SER n 
1 297 THR n 
1 298 PHE n 
1 299 PRO n 
1 300 GLU n 
1 301 ALA n 
1 302 ASP n 
1 303 THR n 
1 304 ASP n 
1 305 ALA n 
1 306 GLY n 
1 307 THR n 
1 308 LEU n 
1 309 THR n 
1 310 ALA n 
1 311 GLN n 
1 312 GLY n 
1 313 SER n 
1 314 ARG n 
1 315 HIS n 
1 316 GLY n 
1 317 ALA n 
1 318 THR n 
1 319 GLN n 
1 320 MET n 
1 321 GLU n 
1 322 VAL n 
1 323 ASN n 
1 324 TRP n 
1 325 VAL n 
1 326 SER n 
1 327 GLU n 
1 328 ALA n 
1 329 ILE n 
1 330 ARG n 
1 331 THR n 
1 332 ARG n 
1 333 PRO n 
1 334 ALA n 
1 335 GLN n 
1 336 VAL n 
1 337 GLY n 
1 338 PHE n 
1 339 CYS n 
1 340 GLN n 
1 341 PRO n 
1 342 HIS n 
1 343 ASN n 
1 344 ASP n 
1 345 PHE n 
1 346 GLU n 
1 347 ALA n 
1 348 SER n 
1 349 ARG n 
1 350 ALA n 
1 351 GLY n 
1 352 PRO n 
1 353 PHE n 
1 354 ALA n 
1 355 ALA n 
1 356 PRO n 
1 357 LYS n 
1 358 VAL n 
1 359 PRO n 
1 360 ALA n 
1 361 ASP n 
1 362 VAL n 
1 363 THR n 
1 364 GLN n 
1 365 GLY n 
1 366 MET n 
1 367 ASP n 
1 368 ARG n 
1 369 GLU n 
1 370 ALA n 
1 371 ASN n 
1 372 GLY n 
1 373 SER n 
1 374 VAL n 
1 375 ARG n 
1 376 TYR n 
1 377 SER n 
1 378 TYR n 
1 379 GLY n 
1 380 LYS n 
1 381 GLN n 
1 382 HIS n 
1 383 GLY n 
1 384 GLU n 
1 385 ASN n 
1 386 TRP n 
1 387 ALA n 
1 388 ALA n 
1 389 HIS n 
1 390 GLY n 
1 391 PRO n 
1 392 ALA n 
1 393 PRO n 
1 394 GLU n 
1 395 ARG n 
1 396 TYR n 
1 397 THR n 
1 398 TRP n 
1 399 ASP n 
1 400 GLU n 
1 401 THR n 
1 402 ASN n 
1 403 PHE n 
1 404 GLY n 
1 405 SER n 
1 406 GLY n 
1 407 ARG n 
1 408 ASP n 
1 409 THR n 
1 410 ARG n 
1 411 ASP n 
1 412 GLY n 
1 413 PHE n 
1 414 ILE n 
1 415 GLN n 
1 416 SER n 
1 417 ALA n 
1 418 PRO n 
1 419 LEU n 
1 420 VAL n 
1 421 VAL n 
1 422 PRO n 
1 423 PRO n 
1 424 PRO n 
1 425 LEU n 
1 426 ASN n 
1 427 GLY n 
1 428 ILE n 
1 429 LEU n 
1 430 THR n 
1 431 ASN n 
1 432 ALA n 
1 433 ASN n 
1 434 PRO n 
1 435 ILE n 
1 436 GLY n 
1 437 THR n 
1 438 LYS n 
1 439 ASN n 
1 440 ASP n 
1 441 ILE n 
1 442 HIS n 
1 443 PHE n 
1 444 SER n 
1 445 ASN n 
1 446 VAL n 
1 447 PHE n 
1 448 ASN n 
1 449 SER n 
1 450 TYR n 
1 451 GLY n 
1 452 PRO n 
1 453 LEU n 
1 454 THR n 
1 455 THR n 
1 456 PHE n 
1 457 SER n 
1 458 HIS n 
1 459 PRO n 
1 460 SER n 
1 461 PRO n 
1 462 VAL n 
1 463 TYR n 
1 464 PRO n 
1 465 GLN n 
1 466 GLY n 
1 467 GLN n 
1 468 ILE n 
1 469 TRP n 
1 470 ASP n 
1 471 LYS n 
1 472 GLU n 
1 473 LEU n 
1 474 ASP n 
1 475 LEU n 
1 476 GLU n 
1 477 HIS n 
1 478 LYS n 
1 479 PRO n 
1 480 ARG n 
1 481 LEU n 
1 482 HIS n 
1 483 ILE n 
1 484 THR n 
1 485 ALA n 
1 486 PRO n 
1 487 PHE n 
1 488 VAL n 
1 489 CYS n 
1 490 LYS n 
1 491 ASN n 
1 492 ASN n 
1 493 ALA n 
1 494 PRO n 
1 495 GLY n 
1 496 GLN n 
1 497 MET n 
1 498 LEU n 
1 499 VAL n 
1 500 ARG n 
1 501 LEU n 
1 502 GLY n 
1 503 PRO n 
1 504 ASN n 
1 505 LEU n 
1 506 THR n 
1 507 ASP n 
1 508 GLN n 
1 509 TYR n 
1 510 ASP n 
1 511 PRO n 
1 512 ASN n 
1 513 GLY n 
1 514 ALA n 
1 515 THR n 
1 516 LEU n 
1 517 SER n 
1 518 ARG n 
1 519 ILE n 
1 520 VAL n 
1 521 THR n 
1 522 TYR n 
1 523 GLY n 
1 524 THR n 
1 525 PHE n 
1 526 PHE n 
1 527 TRP n 
1 528 LYS n 
1 529 GLY n 
1 530 LYS n 
1 531 LEU n 
1 532 THR n 
1 533 MET n 
1 534 ARG n 
1 535 ALA n 
1 536 LYS n 
1 537 LEU n 
1 538 ARG n 
1 539 ALA n 
1 540 ASN n 
1 541 THR n 
1 542 THR n 
1 543 TRP n 
1 544 ASN n 
1 545 PRO n 
1 546 VAL n 
1 547 TYR n 
1 548 GLN n 
1 549 VAL n 
1 550 SER n 
1 551 VAL n 
1 552 GLU n 
1 553 ASP n 
1 554 ASN n 
1 555 GLY n 
1 556 ASN n 
1 557 SER n 
1 558 TYR n 
1 559 MET n 
1 560 SER n 
1 561 VAL n 
1 562 THR n 
1 563 LYS n 
1 564 TRP n 
1 565 LEU n 
1 566 PRO n 
1 567 THR n 
1 568 ALA n 
1 569 THR n 
1 570 GLY n 
1 571 ASN n 
1 572 MET n 
1 573 GLN n 
1 574 SER n 
1 575 VAL n 
1 576 PRO n 
1 577 LEU n 
1 578 ILE n 
1 579 THR n 
1 580 ARG n 
1 581 PRO n 
1 582 VAL n 
1 583 ALA n 
1 584 ARG n 
1 585 ASN n 
1 586 THR n 
1 587 TYR n 
2 1   DC  n 
2 2   DC  n 
2 3   DA  n 
2 4   DC  n 
2 5   DC  n 
2 6   DC  n 
2 7   DC  n 
2 8   DA  n 
2 9   DA  n 
2 10  DC  n 
2 11  DA  n 
3 1   DC  n 
3 2   DA  n 
3 3   DA  n 
3 4   DA  n 
4 1   DA  n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Minute virus of mice' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      10794 
_entity_src_nat.genus                      Parvovirus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     'STRAIN I (IMMUNOSUPPRESSIVE)' 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             '549 MURINE LYMPHOMA CELLS' 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP COAT_MUMIM 1 ? ? P07302 ? 
2 PDB 1MVM       2 ? ? 1MVM   ? 
3 PDB 1MVM       3 ? ? 1MVM   ? 
4 PDB 1MVM       4 ? ? 1MVM   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1MVM A 1 ? 587 ? P07302 132 ? 718 ? 1  587 
2 2 1MVM B 1 ? 11  ? 1MVM   1   ? 11  ? 1  11  
3 3 1MVM C 1 ? 4   ? 1MVM   14  ? 17  ? 14 17  
4 4 1MVM D 1 ? 1   ? 1MVM   20  ? 20  ? 20 20  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1MVM MET A 366 ? UNP P07302 VAL 497 VARIANT 366 1 
1 1MVM THR A 455 ? UNP P07302 ALA 586 VARIANT 455 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1MVM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   35 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_details    'pH 7.50' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           277.00 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   FUJI 
_diffrn_detector.pdbx_collection_date   1993-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1MVM 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            3.500 
_reflns.number_obs                   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.155 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.700 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1MVM 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            3.500 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'CANINE PARVOVIRUS (MONOCLINIC FORM)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4328 
_refine_hist.pdbx_number_atoms_nucleic_acid   321 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4649 
_refine_hist.d_res_high                       3.500 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  1MVM 
_struct.title                     'MVM(STRAIN I), COMPLEX(VIRAL COAT/DNA), VP2, PH=7.5, T=4 DEGREES C' 
_struct.pdbx_descriptor           'MURINE MINUTE VIRUS COAT PROTEIN/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MVM 
_struct_keywords.pdbx_keywords   Virus/DNA 
_struct_keywords.text            
'COMPLEX (VIRAL COAT PROTEIN-DNA), VIRAL COAT PROTEIN/NUCLEIC ACID, Icosahedral virus, Virus-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 125 ? CYS A 132 ? PRO A 125 CYS A 132 1 ? 8 
HELX_P HELX_P2 2 ALA A 191 ? SER A 194 ? ALA A 191 SER A 194 5 ? 4 
HELX_P HELX_P3 3 ILE A 250 ? THR A 253 ? ILE A 250 THR A 253 1 ? 4 
HELX_P HELX_P4 4 GLN A 311 ? SER A 313 ? GLN A 311 SER A 313 5 ? 3 
HELX_P HELX_P5 5 PHE A 403 ? SER A 405 ? PHE A 403 SER A 405 5 ? 3 
HELX_P HELX_P6 6 VAL A 561 ? LYS A 563 ? VAL A 561 LYS A 563 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 51  ? PHE A 55  ? THR A 51  PHE A 55  
A 2 TRP A 60  ? LEU A 73  ? TRP A 60  LEU A 73  
A 3 GLY A 523 ? LYS A 536 ? GLY A 523 LYS A 536 
A 4 LEU A 143 ? ILE A 147 ? LEU A 143 ILE A 147 
B 1 CYS A 82  ? VAL A 86  ? CYS A 82  VAL A 86  
B 2 HIS A 104 ? TRP A 108 ? HIS A 104 TRP A 108 
B 3 ARG A 212 ? TYR A 214 ? ARG A 212 TYR A 214 
C 1 SER A 112 ? VAL A 114 ? SER A 112 VAL A 114 
C 2 GLN A 496 ? VAL A 499 ? GLN A 496 VAL A 499 
C 3 VAL A 178 ? ASP A 181 ? VAL A 178 ASP A 181 
D 1 THR A 521 ? PHE A 525 ? THR A 521 PHE A 525 
D 2 VAL A 150 ? GLN A 158 ? VAL A 150 GLN A 158 
D 3 ILE A 165 ? ASN A 170 ? ILE A 165 ASN A 170 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS A 52  ? O HIS A 52  N THR A 64  ? N THR A 64  
A 2 3 O VAL A 61  ? O VAL A 61  N ALA A 535 ? N ALA A 535 
A 3 4 O LYS A 528 ? O LYS A 528 N GLU A 146 ? N GLU A 146 
B 1 2 O CYS A 82  ? O CYS A 82  N TRP A 108 ? N TRP A 108 
B 2 3 O ILE A 107 ? O ILE A 107 N TYR A 213 ? N TYR A 213 
C 1 2 O SER A 112 ? O SER A 112 N VAL A 499 ? N VAL A 499 
C 2 3 O GLN A 496 ? O GLN A 496 N ASP A 181 ? N ASP A 181 
D 1 2 O TYR A 522 ? O TYR A 522 N LYS A 153 ? N LYS A 153 
D 2 3 O THR A 154 ? O THR A 154 N ASN A 169 ? N ASN A 169 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    1 
_struct_site.details              'BINDING SITE FOR RESIDUE DA D 20' 
# 
_struct_site_gen.id                   1 
_struct_site_gen.site_id              AC1 
_struct_site_gen.pdbx_num_res         1 
_struct_site_gen.label_comp_id        DA 
_struct_site_gen.label_asym_id        B 
_struct_site_gen.label_seq_id         9 
_struct_site_gen.pdbx_auth_ins_code   ? 
_struct_site_gen.auth_comp_id         DA 
_struct_site_gen.auth_asym_id         B 
_struct_site_gen.auth_seq_id          9 
_struct_site_gen.label_atom_id        . 
_struct_site_gen.label_alt_id         ? 
_struct_site_gen.symmetry             1_555 
_struct_site_gen.details              ? 
# 
_database_PDB_matrix.entry_id          1MVM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1MVM 
_atom_sites.fract_transf_matrix[1][1]   0.002229 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000226 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002400 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003292 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N     . GLY A 1 39  ? 46.428  -1.743  79.642  1.00 12.00 ? 39  GLY A N     1 
ATOM 2    C CA    . GLY A 1 39  ? 46.003  -2.851  80.554  1.00 12.00 ? 39  GLY A CA    1 
ATOM 3    C C     . GLY A 1 39  ? 45.211  -2.291  81.716  1.00 12.00 ? 39  GLY A C     1 
ATOM 4    O O     . GLY A 1 39  ? 43.983  -2.237  81.666  1.00 12.00 ? 39  GLY A O     1 
ATOM 5    N N     . VAL A 1 40  ? 45.943  -1.881  82.731  1.00 12.00 ? 40  VAL A N     1 
ATOM 6    C CA    . VAL A 1 40  ? 45.364  -1.299  83.921  1.00 12.00 ? 40  VAL A CA    1 
ATOM 7    C C     . VAL A 1 40  ? 45.132  0.189   83.731  1.00 12.00 ? 40  VAL A C     1 
ATOM 8    O O     . VAL A 1 40  ? 45.940  0.875   83.112  1.00 12.00 ? 40  VAL A O     1 
ATOM 9    C CB    . VAL A 1 40  ? 46.276  -1.530  85.133  1.00 12.00 ? 40  VAL A CB    1 
ATOM 10   C CG1   . VAL A 1 40  ? 47.690  -1.839  84.675  1.00 12.00 ? 40  VAL A CG1   1 
ATOM 11   C CG2   . VAL A 1 40  ? 46.263  -0.320  86.045  1.00 12.00 ? 40  VAL A CG2   1 
ATOM 12   N N     . GLY A 1 41  ? 44.029  0.694   84.261  1.00 12.00 ? 41  GLY A N     1 
ATOM 13   C CA    . GLY A 1 41  ? 43.719  2.101   84.150  1.00 12.00 ? 41  GLY A CA    1 
ATOM 14   C C     . GLY A 1 41  ? 42.221  2.346   84.130  1.00 12.00 ? 41  GLY A C     1 
ATOM 15   O O     . GLY A 1 41  ? 41.700  3.096   84.952  1.00 12.00 ? 41  GLY A O     1 
ATOM 16   N N     . VAL A 1 42  ? 41.545  1.703   83.192  1.00 12.00 ? 42  VAL A N     1 
ATOM 17   C CA    . VAL A 1 42  ? 40.109  1.859   83.045  1.00 12.00 ? 42  VAL A CA    1 
ATOM 18   C C     . VAL A 1 42  ? 39.338  0.833   83.857  1.00 12.00 ? 42  VAL A C     1 
ATOM 19   O O     . VAL A 1 42  ? 39.834  -0.259  84.121  1.00 12.00 ? 42  VAL A O     1 
ATOM 20   C CB    . VAL A 1 42  ? 39.682  1.751   81.577  1.00 12.00 ? 42  VAL A CB    1 
ATOM 21   C CG1   . VAL A 1 42  ? 40.485  2.706   80.719  1.00 12.00 ? 42  VAL A CG1   1 
ATOM 22   C CG2   . VAL A 1 42  ? 39.837  0.326   81.083  1.00 12.00 ? 42  VAL A CG2   1 
ATOM 23   N N     . SER A 1 43  ? 38.125  1.206   84.239  1.00 12.00 ? 43  SER A N     1 
ATOM 24   C CA    . SER A 1 43  ? 37.253  0.332   84.999  1.00 12.00 ? 43  SER A CA    1 
ATOM 25   C C     . SER A 1 43  ? 36.642  -0.726  84.099  1.00 12.00 ? 43  SER A C     1 
ATOM 26   O O     . SER A 1 43  ? 36.907  -0.759  82.901  1.00 12.00 ? 43  SER A O     1 
ATOM 27   C CB    . SER A 1 43  ? 36.161  1.138   85.695  1.00 12.00 ? 43  SER A CB    1 
ATOM 28   O OG    . SER A 1 43  ? 36.671  1.821   86.820  1.00 12.00 ? 43  SER A OG    1 
ATOM 29   N N     . THR A 1 44  ? 35.821  -1.582  84.680  1.00 12.00 ? 44  THR A N     1 
ATOM 30   C CA    . THR A 1 44  ? 35.189  -2.648  83.925  1.00 12.00 ? 44  THR A CA    1 
ATOM 31   C C     . THR A 1 44  ? 33.691  -2.684  84.153  1.00 12.00 ? 44  THR A C     1 
ATOM 32   O O     . THR A 1 44  ? 32.939  -3.174  83.317  1.00 12.00 ? 44  THR A O     1 
ATOM 33   C CB    . THR A 1 44  ? 35.758  -4.010  84.304  1.00 12.00 ? 44  THR A CB    1 
ATOM 34   O OG1   . THR A 1 44  ? 36.620  -3.869  85.434  1.00 12.00 ? 44  THR A OG1   1 
ATOM 35   C CG2   . THR A 1 44  ? 36.525  -4.608  83.145  1.00 12.00 ? 44  THR A CG2   1 
ATOM 36   N N     . GLY A 1 45  ? 33.251  -2.164  85.286  1.00 12.00 ? 45  GLY A N     1 
ATOM 37   C CA    . GLY A 1 45  ? 31.849  -2.190  85.604  1.00 12.00 ? 45  GLY A CA    1 
ATOM 38   C C     . GLY A 1 45  ? 31.367  -0.912  86.263  1.00 12.00 ? 45  GLY A C     1 
ATOM 39   O O     . GLY A 1 45  ? 32.141  0.021   86.469  1.00 12.00 ? 45  GLY A O     1 
ATOM 40   N N     . SER A 1 46  ? 30.081  -0.927  86.569  1.00 12.00 ? 46  SER A N     1 
ATOM 41   C CA    . SER A 1 46  ? 29.398  0.176   87.201  1.00 12.00 ? 46  SER A CA    1 
ATOM 42   C C     . SER A 1 46  ? 29.094  -0.144  88.652  1.00 12.00 ? 46  SER A C     1 
ATOM 43   O O     . SER A 1 46  ? 29.893  -0.779  89.333  1.00 12.00 ? 46  SER A O     1 
ATOM 44   C CB    . SER A 1 46  ? 28.100  0.470   86.455  1.00 12.00 ? 46  SER A CB    1 
ATOM 45   O OG    . SER A 1 46  ? 27.410  -0.731  86.157  1.00 20.00 ? 46  SER A OG    1 
ATOM 46   N N     . TYR A 1 47  ? 27.936  0.305   89.098  1.00 12.00 ? 47  TYR A N     1 
ATOM 47   C CA    . TYR A 1 47  ? 27.477  0.045   90.448  1.00 12.00 ? 47  TYR A CA    1 
ATOM 48   C C     . TYR A 1 47  ? 26.002  0.362   90.568  1.00 12.00 ? 47  TYR A C     1 
ATOM 49   O O     . TYR A 1 47  ? 25.618  1.525   90.670  1.00 12.00 ? 47  TYR A O     1 
ATOM 50   C CB    . TYR A 1 47  ? 28.280  0.830   91.475  1.00 12.00 ? 47  TYR A CB    1 
ATOM 51   C CG    . TYR A 1 47  ? 28.058  0.351   92.888  1.00 12.00 ? 47  TYR A CG    1 
ATOM 52   C CD1   . TYR A 1 47  ? 26.980  0.799   93.631  1.00 12.00 ? 47  TYR A CD1   1 
ATOM 53   C CD2   . TYR A 1 47  ? 28.923  -0.554  93.477  1.00 12.00 ? 47  TYR A CD2   1 
ATOM 54   C CE1   . TYR A 1 47  ? 26.770  0.362   94.920  1.00 12.00 ? 47  TYR A CE1   1 
ATOM 55   C CE2   . TYR A 1 47  ? 28.722  -0.997  94.765  1.00 12.00 ? 47  TYR A CE2   1 
ATOM 56   C CZ    . TYR A 1 47  ? 27.644  -0.537  95.482  1.00 12.00 ? 47  TYR A CZ    1 
ATOM 57   O OH    . TYR A 1 47  ? 27.439  -0.976  96.765  1.00 20.00 ? 47  TYR A OH    1 
ATOM 58   N N     . ASP A 1 48  ? 25.195  -0.685  90.552  1.00 12.00 ? 48  ASP A N     1 
ATOM 59   C CA    . ASP A 1 48  ? 23.757  -0.542  90.628  1.00 12.00 ? 48  ASP A CA    1 
ATOM 60   C C     . ASP A 1 48  ? 23.158  -1.350  91.769  1.00 12.00 ? 48  ASP A C     1 
ATOM 61   O O     . ASP A 1 48  ? 23.076  -2.572  91.695  1.00 12.00 ? 48  ASP A O     1 
ATOM 62   C CB    . ASP A 1 48  ? 23.105  -0.972  89.317  1.00 12.00 ? 48  ASP A CB    1 
ATOM 63   C CG    . ASP A 1 48  ? 22.954  0.161   88.327  1.00 12.00 ? 48  ASP A CG    1 
ATOM 64   O OD1   . ASP A 1 48  ? 23.945  0.495   87.652  1.00 12.00 ? 48  ASP A OD1   1 
ATOM 65   O OD2   . ASP A 1 48  ? 21.843  0.712   88.222  1.00 20.00 ? 48  ASP A OD2   1 
ATOM 66   N N     . ASN A 1 49  ? 22.751  -0.651  92.810  1.00 12.00 ? 49  ASN A N     1 
ATOM 67   C CA    . ASN A 1 49  ? 22.081  -1.252  93.951  1.00 12.00 ? 49  ASN A CA    1 
ATOM 68   C C     . ASN A 1 49  ? 20.716  -0.608  94.070  1.00 12.00 ? 49  ASN A C     1 
ATOM 69   O O     . ASN A 1 49  ? 20.215  -0.378  95.177  1.00 12.00 ? 49  ASN A O     1 
ATOM 70   C CB    . ASN A 1 49  ? 22.920  -1.066  95.213  1.00 12.00 ? 49  ASN A CB    1 
ATOM 71   C CG    . ASN A 1 49  ? 22.803  -2.229  96.169  1.00 12.00 ? 49  ASN A CG    1 
ATOM 72   O OD1   . ASN A 1 49  ? 21.981  -2.214  97.080  1.00 12.00 ? 49  ASN A OD1   1 
ATOM 73   N ND2   . ASN A 1 49  ? 23.629  -3.243  95.968  1.00 12.00 ? 49  ASN A ND2   1 
ATOM 74   N N     . GLN A 1 50  ? 20.204  -0.352  92.889  1.00 12.00 ? 50  GLN A N     1 
ATOM 75   C CA    . GLN A 1 50  ? 18.910  0.277   92.671  1.00 12.00 ? 50  GLN A CA    1 
ATOM 76   C C     . GLN A 1 50  ? 17.819  -0.774  92.566  1.00 12.00 ? 50  GLN A C     1 
ATOM 77   O O     . GLN A 1 50  ? 18.095  -1.960  92.361  1.00 12.00 ? 50  GLN A O     1 
ATOM 78   C CB    . GLN A 1 50  ? 18.923  1.036   91.348  1.00 12.00 ? 50  GLN A CB    1 
ATOM 79   C CG    . GLN A 1 50  ? 18.992  2.549   91.508  1.00 12.00 ? 50  GLN A CG    1 
ATOM 80   C CD    . GLN A 1 50  ? 19.236  3.264   90.184  1.00 12.00 ? 50  GLN A CD    1 
ATOM 81   O OE1   . GLN A 1 50  ? 18.785  4.388   89.999  1.00 12.00 ? 50  GLN A OE1   1 
ATOM 82   N NE2   . GLN A 1 50  ? 19.934  2.672   89.237  1.00 12.00 ? 50  GLN A NE2   1 
ATOM 83   N N     . THR A 1 51  ? 16.620  -0.276  92.715  1.00 12.00 ? 51  THR A N     1 
ATOM 84   C CA    . THR A 1 51  ? 15.398  -1.060  92.603  1.00 12.00 ? 51  THR A CA    1 
ATOM 85   C C     . THR A 1 51  ? 14.452  -0.308  91.688  1.00 12.00 ? 51  THR A C     1 
ATOM 86   O O     . THR A 1 51  ? 13.881  0.718   92.070  1.00 12.00 ? 51  THR A O     1 
ATOM 87   C CB    . THR A 1 51  ? 14.769  -1.249  93.976  1.00 12.00 ? 51  THR A CB    1 
ATOM 88   O OG1   . THR A 1 51  ? 15.718  -1.800  94.870  1.00 12.00 ? 51  THR A OG1   1 
ATOM 89   C CG2   . THR A 1 51  ? 13.566  -2.185  93.954  1.00 12.00 ? 51  THR A CG2   1 
ATOM 90   N N     . HIS A 1 52  ? 14.325  -0.839  90.501  1.00 12.00 ? 52  HIS A N     1 
ATOM 91   C CA    . HIS A 1 52  ? 13.508  -0.229  89.463  1.00 12.00 ? 52  HIS A CA    1 
ATOM 92   C C     . HIS A 1 52  ? 12.152  -0.894  89.367  1.00 12.00 ? 52  HIS A C     1 
ATOM 93   O O     . HIS A 1 52  ? 12.044  -2.125  89.394  1.00 12.00 ? 52  HIS A O     1 
ATOM 94   C CB    . HIS A 1 52  ? 14.218  -0.332  88.129  1.00 12.00 ? 52  HIS A CB    1 
ATOM 95   C CG    . HIS A 1 52  ? 15.333  0.690   88.015  1.00 12.00 ? 52  HIS A CG    1 
ATOM 96   N ND1   . HIS A 1 52  ? 16.655  0.316   87.847  1.00 20.00 ? 52  HIS A ND1   1 
ATOM 97   C CD2   . HIS A 1 52  ? 15.316  2.041   88.052  1.00 20.00 ? 52  HIS A CD2   1 
ATOM 98   C CE1   . HIS A 1 52  ? 17.382  1.411   87.789  1.00 20.00 ? 52  HIS A CE1   1 
ATOM 99   N NE2   . HIS A 1 52  ? 16.599  2.448   87.910  1.00 20.00 ? 52  HIS A NE2   1 
ATOM 100  N N     . TYR A 1 53  ? 11.184  -0.022  89.255  1.00 20.00 ? 53  TYR A N     1 
ATOM 101  C CA    . TYR A 1 53  ? 9.787   -0.390  89.129  1.00 20.00 ? 53  TYR A CA    1 
ATOM 102  C C     . TYR A 1 53  ? 9.272   0.041   87.772  1.00 20.00 ? 53  TYR A C     1 
ATOM 103  O O     . TYR A 1 53  ? 9.691   1.068   87.229  1.00 20.00 ? 53  TYR A O     1 
ATOM 104  C CB    . TYR A 1 53  ? 8.964   0.308   90.200  1.00 20.00 ? 53  TYR A CB    1 
ATOM 105  C CG    . TYR A 1 53  ? 9.008   -0.412  91.536  1.00 20.00 ? 53  TYR A CG    1 
ATOM 106  C CD1   . TYR A 1 53  ? 8.356   -1.634  91.686  1.00 20.00 ? 53  TYR A CD1   1 
ATOM 107  C CD2   . TYR A 1 53  ? 9.700   0.152   92.604  1.00 20.00 ? 53  TYR A CD2   1 
ATOM 108  C CE1   . TYR A 1 53  ? 8.398   -2.295  92.913  1.00 20.00 ? 53  TYR A CE1   1 
ATOM 109  C CE2   . TYR A 1 53  ? 9.742   -0.507  93.830  1.00 20.00 ? 53  TYR A CE2   1 
ATOM 110  C CZ    . TYR A 1 53  ? 9.091   -1.731  93.984  1.00 20.00 ? 53  TYR A CZ    1 
ATOM 111  O OH    . TYR A 1 53  ? 9.132   -2.372  95.176  1.00 20.00 ? 53  TYR A OH    1 
ATOM 112  N N     . ARG A 1 54  ? 8.384   -0.771  87.281  1.00 12.00 ? 54  ARG A N     1 
ATOM 113  C CA    . ARG A 1 54  ? 7.733   -0.548  86.004  1.00 12.00 ? 54  ARG A CA    1 
ATOM 114  C C     . ARG A 1 54  ? 6.283   -0.949  86.125  1.00 12.00 ? 54  ARG A C     1 
ATOM 115  O O     . ARG A 1 54  ? 5.965   -2.098  86.440  1.00 12.00 ? 54  ARG A O     1 
ATOM 116  C CB    . ARG A 1 54  ? 8.407   -1.376  84.925  1.00 12.00 ? 54  ARG A CB    1 
ATOM 117  C CG    . ARG A 1 54  ? 8.736   -0.561  83.683  1.00 12.00 ? 54  ARG A CG    1 
ATOM 118  C CD    . ARG A 1 54  ? 8.829   -1.408  82.424  1.00 12.00 ? 54  ARG A CD    1 
ATOM 119  N NE    . ARG A 1 54  ? 10.008  -1.094  81.616  1.00 20.00 ? 54  ARG A NE    1 
ATOM 120  C CZ    . ARG A 1 54  ? 10.342  -1.745  80.502  1.00 20.00 ? 54  ARG A CZ    1 
ATOM 121  N NH1   . ARG A 1 54  ? 9.595   -2.752  80.046  1.00 20.00 ? 54  ARG A NH1   1 
ATOM 122  N NH2   . ARG A 1 54  ? 11.417  -1.458  79.766  1.00 20.00 ? 54  ARG A NH2   1 
ATOM 123  N N     . PHE A 1 55  ? 5.446   0.019   85.879  1.00 12.00 ? 55  PHE A N     1 
ATOM 124  C CA    . PHE A 1 55  ? 4.013   -0.169  85.963  1.00 12.00 ? 55  PHE A CA    1 
ATOM 125  C C     . PHE A 1 55  ? 3.449   -0.392  84.579  1.00 12.00 ? 55  PHE A C     1 
ATOM 126  O O     . PHE A 1 55  ? 3.194   0.562   83.837  1.00 12.00 ? 55  PHE A O     1 
ATOM 127  C CB    . PHE A 1 55  ? 3.393   1.033   86.638  1.00 12.00 ? 55  PHE A CB    1 
ATOM 128  C CG    . PHE A 1 55  ? 3.683   1.018   88.126  1.00 12.00 ? 55  PHE A CG    1 
ATOM 129  C CD1   . PHE A 1 55  ? 3.232   -0.051  88.897  1.00 12.00 ? 55  PHE A CD1   1 
ATOM 130  C CD2   . PHE A 1 55  ? 4.407   2.055   88.710  1.00 12.00 ? 55  PHE A CD2   1 
ATOM 131  C CE1   . PHE A 1 55  ? 3.508   -0.084  90.263  1.00 12.00 ? 55  PHE A CE1   1 
ATOM 132  C CE2   . PHE A 1 55  ? 4.683   2.023   90.076  1.00 12.00 ? 55  PHE A CE2   1 
ATOM 133  C CZ    . PHE A 1 55  ? 4.234   0.954   90.853  1.00 12.00 ? 55  PHE A CZ    1 
ATOM 134  N N     . LEU A 1 56  ? 3.290   -1.663  84.303  1.00 12.00 ? 56  LEU A N     1 
ATOM 135  C CA    . LEU A 1 56  ? 2.748   -2.143  83.043  1.00 12.00 ? 56  LEU A CA    1 
ATOM 136  C C     . LEU A 1 56  ? 1.235   -1.987  83.045  1.00 12.00 ? 56  LEU A C     1 
ATOM 137  O O     . LEU A 1 56  ? 0.655   -1.417  83.975  1.00 12.00 ? 56  LEU A O     1 
ATOM 138  C CB    . LEU A 1 56  ? 3.133   -3.604  82.851  1.00 12.00 ? 56  LEU A CB    1 
ATOM 139  C CG    . LEU A 1 56  ? 4.591   -3.785  82.443  1.00 12.00 ? 56  LEU A CG    1 
ATOM 140  C CD1   . LEU A 1 56  ? 5.435   -4.450  83.525  1.00 12.00 ? 56  LEU A CD1   1 
ATOM 141  C CD2   . LEU A 1 56  ? 4.758   -4.649  81.198  1.00 12.00 ? 56  LEU A CD2   1 
ATOM 142  N N     . GLY A 1 57  ? 0.642   -2.498  81.992  1.00 12.00 ? 57  GLY A N     1 
ATOM 143  C CA    . GLY A 1 57  ? -0.806  -2.440  81.794  1.00 12.00 ? 57  GLY A CA    1 
ATOM 144  C C     . GLY A 1 57  ? -1.475  -3.661  82.412  1.00 12.00 ? 57  GLY A C     1 
ATOM 145  O O     . GLY A 1 57  ? -1.120  -4.805  82.110  1.00 12.00 ? 57  GLY A O     1 
ATOM 146  N N     . ASP A 1 58  ? -2.429  -3.376  83.269  1.00 12.00 ? 58  ASP A N     1 
ATOM 147  C CA    . ASP A 1 58  ? -3.212  -4.406  83.953  1.00 12.00 ? 58  ASP A CA    1 
ATOM 148  C C     . ASP A 1 58  ? -2.521  -4.877  85.219  1.00 12.00 ? 58  ASP A C     1 
ATOM 149  O O     . ASP A 1 58  ? -2.307  -6.076  85.412  1.00 12.00 ? 58  ASP A O     1 
ATOM 150  C CB    . ASP A 1 58  ? -3.368  -5.629  83.069  1.00 12.00 ? 58  ASP A CB    1 
ATOM 151  C CG    . ASP A 1 58  ? -4.266  -5.390  81.872  1.00 12.00 ? 58  ASP A CG    1 
ATOM 152  O OD1   . ASP A 1 58  ? -4.662  -4.201  81.596  1.00 12.00 ? 58  ASP A OD1   1 
ATOM 153  O OD2   . ASP A 1 58  ? -4.624  -6.380  81.138  1.00 20.00 ? 58  ASP A OD2   1 
ATOM 154  N N     . GLY A 1 59  ? -2.195  -3.920  86.040  1.00 12.00 ? 59  GLY A N     1 
ATOM 155  C CA    . GLY A 1 59  ? -1.545  -4.170  87.320  1.00 12.00 ? 59  GLY A CA    1 
ATOM 156  C C     . GLY A 1 59  ? -0.429  -5.205  87.186  1.00 12.00 ? 59  GLY A C     1 
ATOM 157  O O     . GLY A 1 59  ? -0.166  -5.996  88.092  1.00 12.00 ? 59  GLY A O     1 
ATOM 158  N N     . TRP A 1 60  ? 0.233   -5.207  86.055  1.00 12.00 ? 60  TRP A N     1 
ATOM 159  C CA    . TRP A 1 60  ? 1.359   -6.116  85.864  1.00 12.00 ? 60  TRP A CA    1 
ATOM 160  C C     . TRP A 1 60  ? 2.647   -5.320  85.949  1.00 12.00 ? 60  TRP A C     1 
ATOM 161  O O     . TRP A 1 60  ? 3.115   -4.758  84.952  1.00 12.00 ? 60  TRP A O     1 
ATOM 162  C CB    . TRP A 1 60  ? 1.218   -6.883  84.557  1.00 12.00 ? 60  TRP A CB    1 
ATOM 163  C CG    . TRP A 1 60  ? 0.090   -7.922  84.627  1.00 12.00 ? 60  TRP A CG    1 
ATOM 164  C CD1   . TRP A 1 60  ? -1.137  -7.810  84.114  1.00 12.00 ? 60  TRP A CD1   1 
ATOM 165  C CD2   . TRP A 1 60  ? 0.171   -9.190  85.267  1.00 12.00 ? 60  TRP A CD2   1 
ATOM 166  N NE1   . TRP A 1 60  ? -1.843  -9.007  84.433  1.00 12.00 ? 60  TRP A NE1   1 
ATOM 167  C CE2   . TRP A 1 60  ? -1.061  -9.801  85.112  1.00 12.00 ? 60  TRP A CE2   1 
ATOM 168  C CE3   . TRP A 1 60  ? 1.177   -9.867  85.963  1.00 12.00 ? 60  TRP A CE3   1 
ATOM 169  C CZ2   . TRP A 1 60  ? -1.363  -11.064 85.623  1.00 12.00 ? 60  TRP A CZ2   1 
ATOM 170  C CZ3   . TRP A 1 60  ? 0.866   -11.143 86.471  1.00 12.00 ? 60  TRP A CZ3   1 
ATOM 171  C CH2   . TRP A 1 60  ? -0.346  -11.711 86.309  1.00 12.00 ? 60  TRP A CH2   1 
ATOM 172  N N     . VAL A 1 61  ? 3.132   -5.313  87.170  1.00 12.00 ? 61  VAL A N     1 
ATOM 173  C CA    . VAL A 1 61  ? 4.359   -4.635  87.561  1.00 12.00 ? 61  VAL A CA    1 
ATOM 174  C C     . VAL A 1 61  ? 5.555   -5.505  87.242  1.00 12.00 ? 61  VAL A C     1 
ATOM 175  O O     . VAL A 1 61  ? 5.458   -6.735  87.207  1.00 12.00 ? 61  VAL A O     1 
ATOM 176  C CB    . VAL A 1 61  ? 4.369   -4.405  89.072  1.00 12.00 ? 61  VAL A CB    1 
ATOM 177  C CG1   . VAL A 1 61  ? 5.740   -3.998  89.604  1.00 12.00 ? 61  VAL A CG1   1 
ATOM 178  C CG2   . VAL A 1 61  ? 3.410   -3.313  89.521  1.00 12.00 ? 61  VAL A CG2   1 
ATOM 179  N N     . GLU A 1 62  ? 6.651   -4.837  87.012  1.00 12.00 ? 62  GLU A N     1 
ATOM 180  C CA    . GLU A 1 62  ? 7.921   -5.498  86.762  1.00 12.00 ? 62  GLU A CA    1 
ATOM 181  C C     . GLU A 1 62  ? 8.975   -4.869  87.642  1.00 12.00 ? 62  GLU A C     1 
ATOM 182  O O     . GLU A 1 62  ? 9.320   -3.692  87.474  1.00 12.00 ? 62  GLU A O     1 
ATOM 183  C CB    . GLU A 1 62  ? 8.337   -5.384  85.309  1.00 12.00 ? 62  GLU A CB    1 
ATOM 184  C CG    . GLU A 1 62  ? 9.601   -6.190  85.021  1.00 12.00 ? 62  GLU A CG    1 
ATOM 185  C CD    . GLU A 1 62  ? 9.704   -6.654  83.576  1.00 20.00 ? 62  GLU A CD    1 
ATOM 186  O OE1   . GLU A 1 62  ? 10.001  -5.810  82.656  1.00 20.00 ? 62  GLU A OE1   1 
ATOM 187  O OE2   . GLU A 1 62  ? 9.500   -7.888  83.280  1.00 20.00 ? 62  GLU A OE2   1 
ATOM 188  N N     . ILE A 1 63  ? 9.435   -5.690  88.543  1.00 12.00 ? 63  ILE A N     1 
ATOM 189  C CA    . ILE A 1 63  ? 10.421  -5.309  89.538  1.00 12.00 ? 63  ILE A CA    1 
ATOM 190  C C     . ILE A 1 63  ? 11.790  -5.878  89.175  1.00 12.00 ? 63  ILE A C     1 
ATOM 191  O O     . ILE A 1 63  ? 12.000  -7.096  89.202  1.00 12.00 ? 63  ILE A O     1 
ATOM 192  C CB    . ILE A 1 63  ? 9.963   -5.838  90.891  1.00 12.00 ? 63  ILE A CB    1 
ATOM 193  C CG1   . ILE A 1 63  ? 8.766   -5.072  91.448  1.00 12.00 ? 63  ILE A CG1   1 
ATOM 194  C CG2   . ILE A 1 63  ? 11.042  -5.762  91.959  1.00 12.00 ? 63  ILE A CG2   1 
ATOM 195  C CD1   . ILE A 1 63  ? 7.760   -5.968  92.162  1.00 12.00 ? 63  ILE A CD1   1 
ATOM 196  N N     . THR A 1 64  ? 12.671  -4.954  88.844  1.00 12.00 ? 64  THR A N     1 
ATOM 197  C CA    . THR A 1 64  ? 14.063  -5.251  88.484  1.00 12.00 ? 64  THR A CA    1 
ATOM 198  C C     . THR A 1 64  ? 14.984  -4.717  89.563  1.00 12.00 ? 64  THR A C     1 
ATOM 199  O O     . THR A 1 64  ? 15.205  -3.506  89.670  1.00 12.00 ? 64  THR A O     1 
ATOM 200  C CB    . THR A 1 64  ? 14.422  -4.586  87.161  1.00 12.00 ? 64  THR A CB    1 
ATOM 201  O OG1   . THR A 1 64  ? 13.532  -5.009  86.146  1.00 12.00 ? 64  THR A OG1   1 
ATOM 202  C CG2   . THR A 1 64  ? 15.836  -4.916  86.694  1.00 12.00 ? 64  THR A CG2   1 
ATOM 203  N N     . ALA A 1 65  ? 15.491  -5.646  90.332  1.00 12.00 ? 65  ALA A N     1 
ATOM 204  C CA    . ALA A 1 65  ? 16.388  -5.341  91.439  1.00 12.00 ? 65  ALA A CA    1 
ATOM 205  C C     . ALA A 1 65  ? 17.830  -5.584  91.030  1.00 12.00 ? 65  ALA A C     1 
ATOM 206  O O     . ALA A 1 65  ? 18.134  -6.533  90.298  1.00 12.00 ? 65  ALA A O     1 
ATOM 207  C CB    . ALA A 1 65  ? 16.058  -6.225  92.633  1.00 12.00 ? 65  ALA A CB    1 
ATOM 208  N N     . LEU A 1 66  ? 18.663  -4.705  91.528  1.00 12.00 ? 66  LEU A N     1 
ATOM 209  C CA    . LEU A 1 66  ? 20.098  -4.740  91.283  1.00 12.00 ? 66  LEU A CA    1 
ATOM 210  C C     . LEU A 1 66  ? 20.842  -4.579  92.593  1.00 12.00 ? 66  LEU A C     1 
ATOM 211  O O     . LEU A 1 66  ? 20.266  -4.169  93.606  1.00 12.00 ? 66  LEU A O     1 
ATOM 212  C CB    . LEU A 1 66  ? 20.498  -3.605  90.351  1.00 12.00 ? 66  LEU A CB    1 
ATOM 213  C CG    . LEU A 1 66  ? 19.671  -3.568  89.074  1.00 12.00 ? 66  LEU A CG    1 
ATOM 214  C CD1   . LEU A 1 66  ? 19.971  -2.350  88.209  1.00 20.00 ? 66  LEU A CD1   1 
ATOM 215  C CD2   . LEU A 1 66  ? 19.906  -4.780  88.180  1.00 20.00 ? 66  LEU A CD2   1 
ATOM 216  N N     . ALA A 1 67  ? 22.105  -4.908  92.523  1.00 12.00 ? 67  ALA A N     1 
ATOM 217  C CA    . ALA A 1 67  ? 23.000  -4.827  93.668  1.00 12.00 ? 67  ALA A CA    1 
ATOM 218  C C     . ALA A 1 67  ? 24.420  -5.139  93.239  1.00 12.00 ? 67  ALA A C     1 
ATOM 219  O O     . ALA A 1 67  ? 24.677  -6.145  92.570  1.00 12.00 ? 67  ALA A O     1 
ATOM 220  C CB    . ALA A 1 67  ? 22.575  -5.829  94.734  1.00 12.00 ? 67  ALA A CB    1 
ATOM 221  N N     . THR A 1 68  ? 25.297  -4.251  93.638  1.00 12.00 ? 68  THR A N     1 
ATOM 222  C CA    . THR A 1 68  ? 26.724  -4.378  93.368  1.00 12.00 ? 68  THR A CA    1 
ATOM 223  C C     . THR A 1 68  ? 27.493  -4.382  94.669  1.00 12.00 ? 68  THR A C     1 
ATOM 224  O O     . THR A 1 68  ? 27.908  -3.332  95.162  1.00 12.00 ? 68  THR A O     1 
ATOM 225  C CB    . THR A 1 68  ? 27.239  -3.214  92.538  1.00 12.00 ? 68  THR A CB    1 
ATOM 226  O OG1   . THR A 1 68  ? 27.044  -2.001  93.236  1.00 20.00 ? 68  THR A OG1   1 
ATOM 227  C CG2   . THR A 1 68  ? 26.554  -3.093  91.188  1.00 20.00 ? 68  THR A CG2   1 
ATOM 228  N N     . ARG A 1 69  ? 27.652  -5.569  95.181  1.00 12.00 ? 69  ARG A N     1 
ATOM 229  C CA    . ARG A 1 69  ? 28.389  -5.798  96.414  1.00 12.00 ? 69  ARG A CA    1 
ATOM 230  C C     . ARG A 1 69  ? 29.871  -5.999  96.098  1.00 12.00 ? 69  ARG A C     1 
ATOM 231  O O     . ARG A 1 69  ? 30.216  -6.720  95.159  1.00 12.00 ? 69  ARG A O     1 
ATOM 232  C CB    . ARG A 1 69  ? 27.880  -7.066  97.080  1.00 12.00 ? 69  ARG A CB    1 
ATOM 233  C CG    . ARG A 1 69  ? 27.480  -6.860  98.528  1.00 12.00 ? 69  ARG A CG    1 
ATOM 234  C CD    . ARG A 1 69  ? 25.999  -7.112  98.765  1.00 12.00 ? 69  ARG A CD    1 
ATOM 235  N NE    . ARG A 1 69  ? 25.248  -5.883  99.013  1.00 12.00 ? 69  ARG A NE    1 
ATOM 236  C CZ    . ARG A 1 69  ? 23.920  -5.800  98.942  1.00 12.00 ? 69  ARG A CZ    1 
ATOM 237  N NH1   . ARG A 1 69  ? 23.183  -6.865  98.622  1.00 12.00 ? 69  ARG A NH1   1 
ATOM 238  N NH2   . ARG A 1 69  ? 23.229  -4.684  99.181  1.00 12.00 ? 69  ARG A NH2   1 
ATOM 239  N N     . LEU A 1 70  ? 30.720  -5.356  96.900  1.00 12.00 ? 70  LEU A N     1 
ATOM 240  C CA    . LEU A 1 70  ? 32.199  -5.469  96.781  1.00 12.00 ? 70  LEU A CA    1 
ATOM 241  C C     . LEU A 1 70  ? 32.679  -6.537  97.709  1.00 12.00 ? 70  LEU A C     1 
ATOM 242  O O     . LEU A 1 70  ? 32.385  -6.515  98.906  1.00 12.00 ? 70  LEU A O     1 
ATOM 243  C CB    . LEU A 1 70  ? 32.866  -4.153  97.163  1.00 12.00 ? 70  LEU A CB    1 
ATOM 244  C CG    . LEU A 1 70  ? 34.280  -4.338  97.703  1.00 12.00 ? 70  LEU A CG    1 
ATOM 245  C CD1   . LEU A 1 70  ? 35.357  -3.899  96.717  1.00 12.00 ? 70  LEU A CD1   1 
ATOM 246  C CD2   . LEU A 1 70  ? 34.538  -3.544  98.978  1.00 12.00 ? 70  LEU A CD2   1 
ATOM 247  N N     . VAL A 1 71  ? 33.427  -7.422  97.139  1.00 12.00 ? 71  VAL A N     1 
ATOM 248  C CA    . VAL A 1 71  ? 33.820  -8.608  97.848  1.00 12.00 ? 71  VAL A CA    1 
ATOM 249  C C     . VAL A 1 71  ? 35.327  -8.755  98.002  1.00 12.00 ? 71  VAL A C     1 
ATOM 250  O O     . VAL A 1 71  ? 36.104  -8.369  97.116  1.00 12.00 ? 71  VAL A O     1 
ATOM 251  C CB    . VAL A 1 71  ? 33.227  -9.775  97.099  1.00 12.00 ? 71  VAL A CB    1 
ATOM 252  C CG1   . VAL A 1 71  ? 33.830  -11.103 97.493  1.00 12.00 ? 71  VAL A CG1   1 
ATOM 253  C CG2   . VAL A 1 71  ? 31.721  -9.896  97.325  1.00 12.00 ? 71  VAL A CG2   1 
ATOM 254  N N     . HIS A 1 72  ? 35.618  -9.332  99.152  1.00 12.00 ? 72  HIS A N     1 
ATOM 255  C CA    . HIS A 1 72  ? 36.963  -9.623  99.630  1.00 12.00 ? 72  HIS A CA    1 
ATOM 256  C C     . HIS A 1 72  ? 37.123  -11.123 99.691  1.00 12.00 ? 72  HIS A C     1 
ATOM 257  O O     . HIS A 1 72  ? 36.289  -11.828 100.268 1.00 12.00 ? 72  HIS A O     1 
ATOM 258  C CB    . HIS A 1 72  ? 37.149  -9.061  101.024 1.00 12.00 ? 72  HIS A CB    1 
ATOM 259  C CG    . HIS A 1 72  ? 38.594  -9.083  101.509 1.00 12.00 ? 72  HIS A CG    1 
ATOM 260  N ND1   . HIS A 1 72  ? 39.047  -10.026 102.420 1.00 12.00 ? 72  HIS A ND1   1 
ATOM 261  C CD2   . HIS A 1 72  ? 39.658  -8.295  101.221 1.00 12.00 ? 72  HIS A CD2   1 
ATOM 262  C CE1   . HIS A 1 72  ? 40.321  -9.794  102.650 1.00 12.00 ? 72  HIS A CE1   1 
ATOM 263  N NE2   . HIS A 1 72  ? 40.701  -8.766  101.944 1.00 12.00 ? 72  HIS A NE2   1 
ATOM 264  N N     . LEU A 1 73  ? 38.183  -11.568 99.091  1.00 12.00 ? 73  LEU A N     1 
ATOM 265  C CA    . LEU A 1 73  ? 38.495  -12.982 99.030  1.00 12.00 ? 73  LEU A CA    1 
ATOM 266  C C     . LEU A 1 73  ? 39.982  -13.173 99.264  1.00 12.00 ? 73  LEU A C     1 
ATOM 267  O O     . LEU A 1 73  ? 40.814  -12.637 98.526  1.00 12.00 ? 73  LEU A O     1 
ATOM 268  C CB    . LEU A 1 73  ? 38.083  -13.519 97.668  1.00 12.00 ? 73  LEU A CB    1 
ATOM 269  C CG    . LEU A 1 73  ? 39.019  -14.588 97.132  1.00 12.00 ? 73  LEU A CG    1 
ATOM 270  C CD1   . LEU A 1 73  ? 38.830  -15.936 97.814  1.00 12.00 ? 73  LEU A CD1   1 
ATOM 271  C CD2   . LEU A 1 73  ? 38.829  -14.845 95.641  1.00 12.00 ? 73  LEU A CD2   1 
ATOM 272  N N     . ASN A 1 74  ? 40.260  -13.931 100.297 1.00 12.00 ? 74  ASN A N     1 
ATOM 273  C CA    . ASN A 1 74  ? 41.627  -14.231 100.706 1.00 12.00 ? 74  ASN A CA    1 
ATOM 274  C C     . ASN A 1 74  ? 42.112  -15.506 100.029 1.00 12.00 ? 74  ASN A C     1 
ATOM 275  O O     . ASN A 1 74  ? 41.407  -16.093 99.199  1.00 12.00 ? 74  ASN A O     1 
ATOM 276  C CB    . ASN A 1 74  ? 41.690  -14.387 102.219 1.00 12.00 ? 74  ASN A CB    1 
ATOM 277  C CG    . ASN A 1 74  ? 41.784  -13.048 102.942 1.00 12.00 ? 74  ASN A CG    1 
ATOM 278  O OD1   . ASN A 1 74  ? 40.982  -12.769 103.825 1.00 12.00 ? 74  ASN A OD1   1 
ATOM 279  N ND2   . ASN A 1 74  ? 42.726  -12.189 102.614 1.00 12.00 ? 74  ASN A ND2   1 
ATOM 280  N N     . MET A 1 75  ? 43.308  -15.878 100.424 1.00 12.00 ? 75  MET A N     1 
ATOM 281  C CA    . MET A 1 75  ? 44.016  -17.046 99.894  1.00 12.00 ? 75  MET A CA    1 
ATOM 282  C C     . MET A 1 75  ? 43.628  -18.318 100.636 1.00 12.00 ? 75  MET A C     1 
ATOM 283  O O     . MET A 1 75  ? 43.658  -18.370 101.872 1.00 12.00 ? 75  MET A O     1 
ATOM 284  C CB    . MET A 1 75  ? 45.517  -16.851 100.074 1.00 12.00 ? 75  MET A CB    1 
ATOM 285  C CG    . MET A 1 75  ? 46.322  -17.191 98.830  1.00 12.00 ? 75  MET A CG    1 
ATOM 286  S SD    . MET A 1 75  ? 48.069  -16.990 99.067  1.00 12.00 ? 75  MET A SD    1 
ATOM 287  C CE    . MET A 1 75  ? 48.528  -17.538 100.691 1.00 12.00 ? 75  MET A CE    1 
ATOM 288  N N     . PRO A 1 76  ? 43.249  -19.392 99.934  1.00 12.00 ? 76  PRO A N     1 
ATOM 289  C CA    . PRO A 1 76  ? 42.916  -20.636 100.587 1.00 12.00 ? 76  PRO A CA    1 
ATOM 290  C C     . PRO A 1 76  ? 44.119  -21.144 101.322 1.00 12.00 ? 76  PRO A C     1 
ATOM 291  O O     . PRO A 1 76  ? 45.260  -21.030 100.788 1.00 12.00 ? 76  PRO A O     1 
ATOM 292  C CB    . PRO A 1 76  ? 42.535  -21.554 99.459  1.00 12.00 ? 76  PRO A CB    1 
ATOM 293  C CG    . PRO A 1 76  ? 42.678  -20.780 98.164  1.00 12.00 ? 76  PRO A CG    1 
ATOM 294  C CD    . PRO A 1 76  ? 43.140  -19.396 98.480  1.00 12.00 ? 76  PRO A CD    1 
ATOM 295  N N     . LYS A 1 77  ? 43.874  -21.677 102.499 1.00 12.00 ? 77  LYS A N     1 
ATOM 296  C CA    . LYS A 1 77  ? 44.940  -22.234 103.333 1.00 12.00 ? 77  LYS A CA    1 
ATOM 297  C C     . LYS A 1 77  ? 45.644  -23.346 102.570 1.00 12.00 ? 77  LYS A C     1 
ATOM 298  O O     . LYS A 1 77  ? 46.878  -23.424 102.548 1.00 12.00 ? 77  LYS A O     1 
ATOM 299  C CB    . LYS A 1 77  ? 44.364  -22.803 104.626 1.00 12.00 ? 77  LYS A CB    1 
ATOM 300  C CG    . LYS A 1 77  ? 42.862  -23.054 104.554 1.00 12.00 ? 77  LYS A CG    1 
ATOM 301  C CD    . LYS A 1 77  ? 42.415  -24.247 105.394 1.00 12.00 ? 77  LYS A CD    1 
ATOM 302  C CE    . LYS A 1 77  ? 41.365  -23.881 106.438 1.00 20.00 ? 77  LYS A CE    1 
ATOM 303  N NZ    . LYS A 1 77  ? 40.778  -25.053 107.094 1.00 20.00 ? 77  LYS A NZ    1 
ATOM 304  N N     . SER A 1 78  ? 44.819  -24.167 101.962 1.00 12.00 ? 78  SER A N     1 
ATOM 305  C CA    . SER A 1 78  ? 45.273  -25.314 101.182 1.00 12.00 ? 78  SER A CA    1 
ATOM 306  C C     . SER A 1 78  ? 44.845  -25.180 99.728  1.00 12.00 ? 78  SER A C     1 
ATOM 307  O O     . SER A 1 78  ? 43.782  -24.630 99.424  1.00 12.00 ? 78  SER A O     1 
ATOM 308  C CB    . SER A 1 78  ? 44.669  -26.597 101.742 1.00 12.00 ? 78  SER A CB    1 
ATOM 309  O OG    . SER A 1 78  ? 43.260  -26.563 101.616 1.00 12.00 ? 78  SER A OG    1 
ATOM 310  N N     . GLU A 1 79  ? 45.711  -25.695 98.895  1.00 12.00 ? 79  GLU A N     1 
ATOM 311  C CA    . GLU A 1 79  ? 45.527  -25.729 97.449  1.00 12.00 ? 79  GLU A CA    1 
ATOM 312  C C     . GLU A 1 79  ? 45.431  -27.182 97.060  1.00 12.00 ? 79  GLU A C     1 
ATOM 313  O O     . GLU A 1 79  ? 45.893  -27.586 95.985  1.00 12.00 ? 79  GLU A O     1 
ATOM 314  C CB    . GLU A 1 79  ? 46.687  -25.008 96.805  1.00 12.00 ? 79  GLU A CB    1 
ATOM 315  C CG    . GLU A 1 79  ? 47.039  -23.746 97.577  1.00 12.00 ? 79  GLU A CG    1 
ATOM 316  C CD    . GLU A 1 79  ? 48.015  -22.849 96.844  1.00 12.00 ? 79  GLU A CD    1 
ATOM 317  O OE1   . GLU A 1 79  ? 48.748  -23.335 95.911  1.00 12.00 ? 79  GLU A OE1   1 
ATOM 318  O OE2   . GLU A 1 79  ? 48.108  -21.610 97.166  1.00 12.00 ? 79  GLU A OE2   1 
ATOM 319  N N     . ASN A 1 80  ? 44.833  -27.846 98.006  1.00 12.00 ? 80  ASN A N     1 
ATOM 320  C CA    . ASN A 1 80  ? 44.552  -29.259 97.987  1.00 12.00 ? 80  ASN A CA    1 
ATOM 321  C C     . ASN A 1 80  ? 43.070  -29.458 98.180  1.00 12.00 ? 80  ASN A C     1 
ATOM 322  O O     . ASN A 1 80  ? 42.339  -28.522 98.522  1.00 12.00 ? 80  ASN A O     1 
ATOM 323  C CB    . ASN A 1 80  ? 45.237  -29.930 99.177  1.00 12.00 ? 80  ASN A CB    1 
ATOM 324  C CG    . ASN A 1 80  ? 46.581  -30.555 98.845  1.00 12.00 ? 80  ASN A CG    1 
ATOM 325  O OD1   . ASN A 1 80  ? 47.608  -29.902 98.971  1.00 12.00 ? 80  ASN A OD1   1 
ATOM 326  N ND2   . ASN A 1 80  ? 46.636  -31.802 98.431  1.00 12.00 ? 80  ASN A ND2   1 
ATOM 327  N N     . TYR A 1 81  ? 42.673  -30.667 97.950  1.00 12.00 ? 81  TYR A N     1 
ATOM 328  C CA    . TYR A 1 81  ? 41.312  -31.083 98.189  1.00 12.00 ? 81  TYR A CA    1 
ATOM 329  C C     . TYR A 1 81  ? 41.373  -31.997 99.377  1.00 12.00 ? 81  TYR A C     1 
ATOM 330  O O     . TYR A 1 81  ? 42.175  -32.931 99.424  1.00 12.00 ? 81  TYR A O     1 
ATOM 331  C CB    . TYR A 1 81  ? 40.776  -31.834 96.983  1.00 12.00 ? 81  TYR A CB    1 
ATOM 332  C CG    . TYR A 1 81  ? 40.187  -30.891 95.940  1.00 12.00 ? 81  TYR A CG    1 
ATOM 333  C CD1   . TYR A 1 81  ? 41.029  -30.227 95.049  1.00 12.00 ? 81  TYR A CD1   1 
ATOM 334  C CD2   . TYR A 1 81  ? 38.809  -30.689 95.883  1.00 12.00 ? 81  TYR A CD2   1 
ATOM 335  C CE1   . TYR A 1 81  ? 40.492  -29.358 94.100  1.00 12.00 ? 81  TYR A CE1   1 
ATOM 336  C CE2   . TYR A 1 81  ? 38.271  -29.819 94.934  1.00 12.00 ? 81  TYR A CE2   1 
ATOM 337  C CZ    . TYR A 1 81  ? 39.113  -29.155 94.042  1.00 12.00 ? 81  TYR A CZ    1 
ATOM 338  O OH    . TYR A 1 81  ? 38.591  -28.310 93.120  1.00 12.00 ? 81  TYR A OH    1 
ATOM 339  N N     . CYS A 1 82  ? 40.554  -31.727 100.336 1.00 12.00 ? 82  CYS A N     1 
ATOM 340  C CA    . CYS A 1 82  ? 40.577  -32.523 101.538 1.00 12.00 ? 82  CYS A CA    1 
ATOM 341  C C     . CYS A 1 82  ? 39.231  -33.156 101.808 1.00 12.00 ? 82  CYS A C     1 
ATOM 342  O O     . CYS A 1 82  ? 38.184  -32.534 101.605 1.00 12.00 ? 82  CYS A O     1 
ATOM 343  C CB    . CYS A 1 82  ? 40.939  -31.652 102.730 1.00 12.00 ? 82  CYS A CB    1 
ATOM 344  S SG    . CYS A 1 82  ? 42.535  -30.736 102.499 1.00 20.00 ? 82  CYS A SG    1 
ATOM 345  N N     . ARG A 1 83  ? 39.335  -34.382 102.244 1.00 12.00 ? 83  ARG A N     1 
ATOM 346  C CA    . ARG A 1 83  ? 38.197  -35.162 102.690 1.00 12.00 ? 83  ARG A CA    1 
ATOM 347  C C     . ARG A 1 83  ? 38.239  -35.203 104.203 1.00 12.00 ? 83  ARG A C     1 
ATOM 348  O O     . ARG A 1 83  ? 38.859  -36.088 104.798 1.00 12.00 ? 83  ARG A O     1 
ATOM 349  C CB    . ARG A 1 83  ? 38.289  -36.590 102.174 1.00 12.00 ? 83  ARG A CB    1 
ATOM 350  C CG    . ARG A 1 83  ? 37.141  -37.471 102.652 1.00 12.00 ? 83  ARG A CG    1 
ATOM 351  C CD    . ARG A 1 83  ? 37.604  -38.838 103.141 1.00 12.00 ? 83  ARG A CD    1 
ATOM 352  N NE    . ARG A 1 83  ? 38.844  -39.284 102.504 1.00 12.00 ? 83  ARG A NE    1 
ATOM 353  C CZ    . ARG A 1 83  ? 39.254  -40.555 102.475 1.00 12.00 ? 83  ARG A CZ    1 
ATOM 354  N NH1   . ARG A 1 83  ? 38.534  -41.523 103.046 1.00 12.00 ? 83  ARG A NH1   1 
ATOM 355  N NH2   . ARG A 1 83  ? 40.384  -40.961 101.893 1.00 12.00 ? 83  ARG A NH2   1 
ATOM 356  N N     . ILE A 1 84  ? 37.586  -34.233 104.781 1.00 12.00 ? 84  ILE A N     1 
ATOM 357  C CA    . ILE A 1 84  ? 37.574  -34.068 106.225 1.00 12.00 ? 84  ILE A CA    1 
ATOM 358  C C     . ILE A 1 84  ? 36.284  -34.587 106.828 1.00 12.00 ? 84  ILE A C     1 
ATOM 359  O O     . ILE A 1 84  ? 35.214  -34.492 106.218 1.00 12.00 ? 84  ILE A O     1 
ATOM 360  C CB    . ILE A 1 84  ? 37.750  -32.598 106.553 1.00 12.00 ? 84  ILE A CB    1 
ATOM 361  C CG1   . ILE A 1 84  ? 39.000  -32.004 105.912 1.00 12.00 ? 84  ILE A CG1   1 
ATOM 362  C CG2   . ILE A 1 84  ? 37.875  -32.332 108.049 1.00 12.00 ? 84  ILE A CG2   1 
ATOM 363  C CD1   . ILE A 1 84  ? 39.336  -30.613 106.432 1.00 20.00 ? 84  ILE A CD1   1 
ATOM 364  N N     . ARG A 1 85  ? 36.462  -35.116 108.017 1.00 12.00 ? 85  ARG A N     1 
ATOM 365  C CA    . ARG A 1 85  ? 35.386  -35.689 108.814 1.00 12.00 ? 85  ARG A CA    1 
ATOM 366  C C     . ARG A 1 85  ? 35.356  -35.028 110.185 1.00 12.00 ? 85  ARG A C     1 
ATOM 367  O O     . ARG A 1 85  ? 36.373  -34.514 110.666 1.00 12.00 ? 85  ARG A O     1 
ATOM 368  C CB    . ARG A 1 85  ? 35.608  -37.193 108.978 1.00 12.00 ? 85  ARG A CB    1 
ATOM 369  C CG    . ARG A 1 85  ? 35.471  -37.673 110.421 1.00 20.00 ? 85  ARG A CG    1 
ATOM 370  C CD    . ARG A 1 85  ? 36.231  -38.970 110.694 1.00 20.00 ? 85  ARG A CD    1 
ATOM 371  N NE    . ARG A 1 85  ? 35.402  -40.008 111.319 1.00 20.00 ? 85  ARG A NE    1 
ATOM 372  C CZ    . ARG A 1 85  ? 35.868  -41.192 111.730 1.00 20.00 ? 85  ARG A CZ    1 
ATOM 373  N NH1   . ARG A 1 85  ? 37.158  -41.512 111.591 1.00 20.00 ? 85  ARG A NH1   1 
ATOM 374  N NH2   . ARG A 1 85  ? 35.113  -42.137 112.298 1.00 20.00 ? 85  ARG A NH2   1 
ATOM 375  N N     . VAL A 1 86  ? 34.175  -35.069 110.749 1.00 12.00 ? 86  VAL A N     1 
ATOM 376  C CA    . VAL A 1 86  ? 33.887  -34.528 112.074 1.00 12.00 ? 86  VAL A CA    1 
ATOM 377  C C     . VAL A 1 86  ? 33.040  -35.542 112.833 1.00 12.00 ? 86  VAL A C     1 
ATOM 378  O O     . VAL A 1 86  ? 32.046  -36.055 112.309 1.00 12.00 ? 86  VAL A O     1 
ATOM 379  C CB    . VAL A 1 86  ? 33.131  -33.210 111.941 1.00 12.00 ? 86  VAL A CB    1 
ATOM 380  C CG1   . VAL A 1 86  ? 32.649  -32.661 113.279 1.00 12.00 ? 86  VAL A CG1   1 
ATOM 381  C CG2   . VAL A 1 86  ? 33.971  -32.100 111.318 1.00 12.00 ? 86  VAL A CG2   1 
ATOM 382  N N     . HIS A 1 87  ? 33.462  -35.806 114.045 1.00 12.00 ? 87  HIS A N     1 
ATOM 383  C CA    . HIS A 1 87  ? 32.803  -36.776 114.925 1.00 12.00 ? 87  HIS A CA    1 
ATOM 384  C C     . HIS A 1 87  ? 32.849  -36.297 116.362 1.00 12.00 ? 87  HIS A C     1 
ATOM 385  O O     . HIS A 1 87  ? 33.653  -36.770 117.161 1.00 12.00 ? 87  HIS A O     1 
ATOM 386  C CB    . HIS A 1 87  ? 33.554  -38.097 114.877 1.00 12.00 ? 87  HIS A CB    1 
ATOM 387  C CG    . HIS A 1 87  ? 32.720  -39.277 115.343 1.00 12.00 ? 87  HIS A CG    1 
ATOM 388  N ND1   . HIS A 1 87  ? 32.519  -39.558 116.688 1.00 20.00 ? 87  HIS A ND1   1 
ATOM 389  C CD2   . HIS A 1 87  ? 32.053  -40.225 114.650 1.00 20.00 ? 87  HIS A CD2   1 
ATOM 390  C CE1   . HIS A 1 87  ? 31.762  -40.633 116.768 1.00 20.00 ? 87  HIS A CE1   1 
ATOM 391  N NE2   . HIS A 1 87  ? 31.475  -41.042 115.562 1.00 20.00 ? 87  HIS A NE2   1 
ATOM 392  N N     . ASN A 1 88  ? 31.983  -35.370 116.682 1.00 12.00 ? 88  ASN A N     1 
ATOM 393  C CA    . ASN A 1 88  ? 31.958  -34.781 118.023 1.00 12.00 ? 88  ASN A CA    1 
ATOM 394  C C     . ASN A 1 88  ? 31.564  -35.814 119.085 1.00 12.00 ? 88  ASN A C     1 
ATOM 395  O O     . ASN A 1 88  ? 30.379  -36.016 119.367 1.00 12.00 ? 88  ASN A O     1 
ATOM 396  C CB    . ASN A 1 88  ? 30.973  -33.621 118.073 1.00 12.00 ? 88  ASN A CB    1 
ATOM 397  C CG    . ASN A 1 88  ? 29.518  -34.065 118.025 1.00 12.00 ? 88  ASN A CG    1 
ATOM 398  O OD1   . ASN A 1 88  ? 29.237  -35.207 117.683 1.00 12.00 ? 88  ASN A OD1   1 
ATOM 399  N ND2   . ASN A 1 88  ? 28.565  -33.220 118.350 1.00 12.00 ? 88  ASN A ND2   1 
ATOM 400  N N     . THR A 1 89  ? 32.588  -36.435 119.650 1.00 12.00 ? 89  THR A N     1 
ATOM 401  C CA    . THR A 1 89  ? 32.431  -37.417 120.737 1.00 12.00 ? 89  THR A CA    1 
ATOM 402  C C     . THR A 1 89  ? 32.614  -36.702 122.069 1.00 12.00 ? 89  THR A C     1 
ATOM 403  O O     . THR A 1 89  ? 33.486  -37.058 122.870 1.00 12.00 ? 89  THR A O     1 
ATOM 404  C CB    . THR A 1 89  ? 33.468  -38.530 120.622 1.00 12.00 ? 89  THR A CB    1 
ATOM 405  O OG1   . THR A 1 89  ? 34.695  -38.007 120.157 1.00 20.00 ? 89  THR A OG1   1 
ATOM 406  C CG2   . THR A 1 89  ? 33.049  -39.640 119.665 1.00 20.00 ? 89  THR A CG2   1 
ATOM 407  N N     . THR A 1 90  ? 31.776  -35.707 122.241 1.00 12.00 ? 90  THR A N     1 
ATOM 408  C CA    . THR A 1 90  ? 31.755  -34.861 123.434 1.00 12.00 ? 90  THR A CA    1 
ATOM 409  C C     . THR A 1 90  ? 30.336  -34.358 123.656 1.00 12.00 ? 90  THR A C     1 
ATOM 410  O O     . THR A 1 90  ? 30.056  -33.654 124.632 1.00 12.00 ? 90  THR A O     1 
ATOM 411  C CB    . THR A 1 90  ? 32.701  -33.683 123.236 1.00 12.00 ? 90  THR A CB    1 
ATOM 412  O OG1   . THR A 1 90  ? 34.042  -34.137 123.241 1.00 20.00 ? 90  THR A OG1   1 
ATOM 413  C CG2   . THR A 1 90  ? 32.570  -32.625 124.323 1.00 20.00 ? 90  THR A CG2   1 
ATOM 414  N N     . ASP A 1 91  ? 29.509  -34.754 122.717 1.00 12.00 ? 91  ASP A N     1 
ATOM 415  C CA    . ASP A 1 91  ? 28.083  -34.438 122.693 1.00 12.00 ? 91  ASP A CA    1 
ATOM 416  C C     . ASP A 1 91  ? 27.371  -35.646 122.110 1.00 12.00 ? 91  ASP A C     1 
ATOM 417  O O     . ASP A 1 91  ? 26.140  -35.666 121.999 1.00 12.00 ? 91  ASP A O     1 
ATOM 418  C CB    . ASP A 1 91  ? 27.841  -33.214 121.813 1.00 12.00 ? 91  ASP A CB    1 
ATOM 419  C CG    . ASP A 1 91  ? 28.560  -31.966 122.317 1.00 12.00 ? 91  ASP A CG    1 
ATOM 420  O OD1   . ASP A 1 91  ? 29.495  -32.073 123.190 1.00 20.00 ? 91  ASP A OD1   1 
ATOM 421  O OD2   . ASP A 1 91  ? 28.229  -30.809 121.866 1.00 20.00 ? 91  ASP A OD2   1 
ATOM 422  N N     . THR A 1 92  ? 28.216  -36.603 121.775 1.00 12.00 ? 92  THR A N     1 
ATOM 423  C CA    . THR A 1 92  ? 27.824  -37.866 121.154 1.00 12.00 ? 92  THR A CA    1 
ATOM 424  C C     . THR A 1 92  ? 27.940  -39.024 122.145 1.00 12.00 ? 92  THR A C     1 
ATOM 425  O O     . THR A 1 92  ? 27.291  -40.064 121.989 1.00 12.00 ? 92  THR A O     1 
ATOM 426  C CB    . THR A 1 92  ? 28.731  -38.141 119.959 1.00 12.00 ? 92  THR A CB    1 
ATOM 427  O OG1   . THR A 1 92  ? 28.571  -37.126 118.987 1.00 12.00 ? 92  THR A OG1   1 
ATOM 428  C CG2   . THR A 1 92  ? 28.435  -39.474 119.279 1.00 12.00 ? 92  THR A CG2   1 
ATOM 429  N N     . SER A 1 93  ? 28.770  -38.815 123.143 1.00 12.00 ? 93  SER A N     1 
ATOM 430  C CA    . SER A 1 93  ? 29.009  -39.806 124.198 1.00 12.00 ? 93  SER A CA    1 
ATOM 431  C C     . SER A 1 93  ? 28.374  -39.334 125.501 1.00 12.00 ? 93  SER A C     1 
ATOM 432  O O     . SER A 1 93  ? 29.066  -39.103 126.499 1.00 12.00 ? 93  SER A O     1 
ATOM 433  C CB    . SER A 1 93  ? 30.510  -39.989 124.411 1.00 12.00 ? 93  SER A CB    1 
ATOM 434  O OG    . SER A 1 93  ? 30.796  -41.338 124.728 1.00 20.00 ? 93  SER A OG    1 
ATOM 435  N N     . VAL A 1 94  ? 27.062  -39.207 125.452 1.00 12.00 ? 94  VAL A N     1 
ATOM 436  C CA    . VAL A 1 94  ? 26.267  -38.737 126.594 1.00 12.00 ? 94  VAL A CA    1 
ATOM 437  C C     . VAL A 1 94  ? 25.195  -39.768 126.966 1.00 12.00 ? 94  VAL A C     1 
ATOM 438  O O     . VAL A 1 94  ? 25.383  -40.592 127.866 1.00 12.00 ? 94  VAL A O     1 
ATOM 439  C CB    . VAL A 1 94  ? 25.623  -37.402 126.248 1.00 12.00 ? 94  VAL A CB    1 
ATOM 440  C CG1   . VAL A 1 94  ? 25.632  -36.418 127.414 1.00 12.00 ? 94  VAL A CG1   1 
ATOM 441  C CG2   . VAL A 1 94  ? 26.330  -36.685 125.102 1.00 12.00 ? 94  VAL A CG2   1 
ATOM 442  N N     . LYS A 1 95  ? 24.070  -39.711 126.273 1.00 12.00 ? 95  LYS A N     1 
ATOM 443  C CA    . LYS A 1 95  ? 22.965  -40.652 126.519 1.00 12.00 ? 95  LYS A CA    1 
ATOM 444  C C     . LYS A 1 95  ? 21.616  -40.046 126.134 1.00 12.00 ? 95  LYS A C     1 
ATOM 445  O O     . LYS A 1 95  ? 20.645  -40.766 125.873 1.00 12.00 ? 95  LYS A O     1 
ATOM 446  C CB    . LYS A 1 95  ? 22.920  -41.025 127.995 1.00 12.00 ? 95  LYS A CB    1 
ATOM 447  C CG    . LYS A 1 95  ? 24.128  -41.846 128.436 1.00 12.00 ? 95  LYS A CG    1 
ATOM 448  C CD    . LYS A 1 95  ? 23.824  -43.336 128.549 1.00 20.00 ? 95  LYS A CD    1 
ATOM 449  C CE    . LYS A 1 95  ? 25.080  -44.199 128.592 1.00 20.00 ? 95  LYS A CE    1 
ATOM 450  N NZ    . LYS A 1 95  ? 24.993  -45.287 129.569 1.00 20.00 ? 95  LYS A NZ    1 
ATOM 451  N N     . GLY A 1 96  ? 21.585  -38.737 126.115 1.00 12.00 ? 96  GLY A N     1 
ATOM 452  C CA    . GLY A 1 96  ? 20.381  -37.983 125.761 1.00 12.00 ? 96  GLY A CA    1 
ATOM 453  C C     . GLY A 1 96  ? 20.670  -37.101 124.558 1.00 12.00 ? 96  GLY A C     1 
ATOM 454  O O     . GLY A 1 96  ? 19.768  -36.772 123.778 1.00 12.00 ? 96  GLY A O     1 
ATOM 455  N N     . ASN A 1 97  ? 21.933  -36.761 124.456 1.00 12.00 ? 97  ASN A N     1 
ATOM 456  C CA    . ASN A 1 97  ? 22.451  -35.904 123.393 1.00 12.00 ? 97  ASN A CA    1 
ATOM 457  C C     . ASN A 1 97  ? 22.554  -36.669 122.081 1.00 12.00 ? 97  ASN A C     1 
ATOM 458  O O     . ASN A 1 97  ? 23.633  -37.130 121.697 1.00 12.00 ? 97  ASN A O     1 
ATOM 459  C CB    . ASN A 1 97  ? 23.832  -35.384 123.768 1.00 12.00 ? 97  ASN A CB    1 
ATOM 460  C CG    . ASN A 1 97  ? 23.787  -34.282 124.822 1.00 12.00 ? 97  ASN A CG    1 
ATOM 461  O OD1   . ASN A 1 97  ? 22.754  -33.647 125.000 1.00 12.00 ? 97  ASN A OD1   1 
ATOM 462  N ND2   . ASN A 1 97  ? 24.857  -34.014 125.538 1.00 12.00 ? 97  ASN A ND2   1 
ATOM 463  N N     . MET A 1 98  ? 21.412  -36.768 121.443 1.00 12.00 ? 98  MET A N     1 
ATOM 464  C CA    . MET A 1 98  ? 21.275  -37.424 120.143 1.00 12.00 ? 98  MET A CA    1 
ATOM 465  C C     . MET A 1 98  ? 21.018  -36.359 119.092 1.00 12.00 ? 98  MET A C     1 
ATOM 466  O O     . MET A 1 98  ? 21.582  -36.399 117.993 1.00 12.00 ? 98  MET A O     1 
ATOM 467  C CB    . MET A 1 98  ? 20.112  -38.406 120.179 1.00 12.00 ? 98  MET A CB    1 
ATOM 468  C CG    . MET A 1 98  ? 20.079  -39.239 121.454 1.00 12.00 ? 98  MET A CG    1 
ATOM 469  S SD    . MET A 1 98  ? 18.676  -40.319 121.540 1.00 12.00 ? 98  MET A SD    1 
ATOM 470  C CE    . MET A 1 98  ? 19.201  -41.966 121.937 1.00 12.00 ? 98  MET A CE    1 
ATOM 471  N N     . ALA A 1 99  ? 20.167  -35.437 119.485 1.00 12.00 ? 99  ALA A N     1 
ATOM 472  C CA    . ALA A 1 99  ? 19.795  -34.293 118.660 1.00 12.00 ? 99  ALA A CA    1 
ATOM 473  C C     . ALA A 1 99  ? 20.934  -33.286 118.681 1.00 12.00 ? 99  ALA A C     1 
ATOM 474  O O     . ALA A 1 99  ? 20.713  -32.073 118.593 1.00 12.00 ? 99  ALA A O     1 
ATOM 475  C CB    . ALA A 1 99  ? 18.529  -33.644 119.211 1.00 12.00 ? 99  ALA A CB    1 
ATOM 476  N N     . LYS A 1 100 ? 22.124  -33.841 118.802 1.00 12.00 ? 100 LYS A N     1 
ATOM 477  C CA    . LYS A 1 100 ? 23.363  -33.065 118.862 1.00 12.00 ? 100 LYS A CA    1 
ATOM 478  C C     . LYS A 1 100 ? 24.454  -33.715 118.010 1.00 12.00 ? 100 LYS A C     1 
ATOM 479  O O     . LYS A 1 100 ? 25.619  -33.308 118.049 1.00 12.00 ? 100 LYS A O     1 
ATOM 480  C CB    . LYS A 1 100 ? 23.856  -32.983 120.302 1.00 12.00 ? 100 LYS A CB    1 
ATOM 481  C CG    . LYS A 1 100 ? 23.106  -31.944 121.129 1.00 12.00 ? 100 LYS A CG    1 
ATOM 482  C CD    . LYS A 1 100 ? 23.816  -31.593 122.432 1.00 20.00 ? 100 LYS A CD    1 
ATOM 483  C CE    . LYS A 1 100 ? 22.928  -30.827 123.405 1.00 20.00 ? 100 LYS A CE    1 
ATOM 484  N NZ    . LYS A 1 100 ? 23.585  -30.550 124.684 1.00 20.00 ? 100 LYS A NZ    1 
ATOM 485  N N     . ASP A 1 101 ? 24.054  -34.720 117.257 1.00 12.00 ? 101 ASP A N     1 
ATOM 486  C CA    . ASP A 1 101 ? 24.967  -35.440 116.360 1.00 12.00 ? 101 ASP A CA    1 
ATOM 487  C C     . ASP A 1 101 ? 25.369  -34.520 115.210 1.00 12.00 ? 101 ASP A C     1 
ATOM 488  O O     . ASP A 1 101 ? 24.529  -34.103 114.407 1.00 12.00 ? 101 ASP A O     1 
ATOM 489  C CB    . ASP A 1 101 ? 24.283  -36.684 115.799 1.00 12.00 ? 101 ASP A CB    1 
ATOM 490  C CG    . ASP A 1 101 ? 25.260  -37.657 115.147 1.00 12.00 ? 101 ASP A CG    1 
ATOM 491  O OD1   . ASP A 1 101 ? 26.527  -37.507 115.317 1.00 12.00 ? 101 ASP A OD1   1 
ATOM 492  O OD2   . ASP A 1 101 ? 24.820  -38.629 114.430 1.00 12.00 ? 101 ASP A OD2   1 
ATOM 493  N N     . ASP A 1 102 ? 26.654  -34.228 115.168 1.00 12.00 ? 102 ASP A N     1 
ATOM 494  C CA    . ASP A 1 102 ? 27.232  -33.330 114.160 1.00 12.00 ? 102 ASP A CA    1 
ATOM 495  C C     . ASP A 1 102 ? 28.379  -34.002 113.408 1.00 12.00 ? 102 ASP A C     1 
ATOM 496  O O     . ASP A 1 102 ? 29.303  -33.335 112.930 1.00 12.00 ? 102 ASP A O     1 
ATOM 497  C CB    . ASP A 1 102 ? 27.793  -32.083 114.836 1.00 12.00 ? 102 ASP A CB    1 
ATOM 498  C CG    . ASP A 1 102 ? 26.831  -30.902 114.819 1.00 12.00 ? 102 ASP A CG    1 
ATOM 499  O OD1   . ASP A 1 102 ? 25.686  -31.014 114.247 1.00 12.00 ? 102 ASP A OD1   1 
ATOM 500  O OD2   . ASP A 1 102 ? 27.165  -29.793 115.378 1.00 12.00 ? 102 ASP A OD2   1 
ATOM 501  N N     . ALA A 1 103 ? 28.294  -35.310 113.315 1.00 12.00 ? 103 ALA A N     1 
ATOM 502  C CA    . ALA A 1 103 ? 29.313  -36.121 112.636 1.00 12.00 ? 103 ALA A CA    1 
ATOM 503  C C     . ALA A 1 103 ? 28.932  -36.343 111.176 1.00 12.00 ? 103 ALA A C     1 
ATOM 504  O O     . ALA A 1 103 ? 27.969  -37.054 110.872 1.00 12.00 ? 103 ALA A O     1 
ATOM 505  C CB    . ALA A 1 103 ? 29.447  -37.474 113.321 1.00 12.00 ? 103 ALA A CB    1 
ATOM 506  N N     . HIS A 1 104 ? 29.718  -35.721 110.323 1.00 12.00 ? 104 HIS A N     1 
ATOM 507  C CA    . HIS A 1 104 ? 29.551  -35.789 108.868 1.00 12.00 ? 104 HIS A CA    1 
ATOM 508  C C     . HIS A 1 104 ? 30.919  -35.795 108.193 1.00 12.00 ? 104 HIS A C     1 
ATOM 509  O O     . HIS A 1 104 ? 31.869  -35.169 108.674 1.00 12.00 ? 104 HIS A O     1 
ATOM 510  C CB    . HIS A 1 104 ? 28.780  -34.568 108.378 1.00 12.00 ? 104 HIS A CB    1 
ATOM 511  C CG    . HIS A 1 104 ? 29.560  -33.270 108.560 1.00 12.00 ? 104 HIS A CG    1 
ATOM 512  N ND1   . HIS A 1 104 ? 29.543  -32.566 109.755 1.00 12.00 ? 104 HIS A ND1   1 
ATOM 513  C CD2   . HIS A 1 104 ? 30.362  -32.569 107.722 1.00 12.00 ? 104 HIS A CD2   1 
ATOM 514  C CE1   . HIS A 1 104 ? 30.305  -31.502 109.616 1.00 12.00 ? 104 HIS A CE1   1 
ATOM 515  N NE2   . HIS A 1 104 ? 30.802  -31.489 108.409 1.00 12.00 ? 104 HIS A NE2   1 
ATOM 516  N N     . GLU A 1 105 ? 30.988  -36.510 107.091 1.00 12.00 ? 105 GLU A N     1 
ATOM 517  C CA    . GLU A 1 105 ? 32.215  -36.611 106.290 1.00 12.00 ? 105 GLU A CA    1 
ATOM 518  C C     . GLU A 1 105 ? 32.127  -35.623 105.134 1.00 12.00 ? 105 GLU A C     1 
ATOM 519  O O     . GLU A 1 105 ? 31.472  -35.887 104.120 1.00 12.00 ? 105 GLU A O     1 
ATOM 520  C CB    . GLU A 1 105 ? 32.383  -38.030 105.763 1.00 12.00 ? 105 GLU A CB    1 
ATOM 521  C CG    . GLU A 1 105 ? 33.505  -38.791 106.463 1.00 20.00 ? 105 GLU A CG    1 
ATOM 522  C CD    . GLU A 1 105 ? 34.705  -39.052 105.559 1.00 20.00 ? 105 GLU A CD    1 
ATOM 523  O OE1   . GLU A 1 105 ? 34.720  -38.584 104.362 1.00 20.00 ? 105 GLU A OE1   1 
ATOM 524  O OE2   . GLU A 1 105 ? 35.698  -39.742 105.992 1.00 20.00 ? 105 GLU A OE2   1 
ATOM 525  N N     . GLN A 1 106 ? 32.801  -34.515 105.341 1.00 12.00 ? 106 GLN A N     1 
ATOM 526  C CA    . GLN A 1 106 ? 32.810  -33.390 104.406 1.00 12.00 ? 106 GLN A CA    1 
ATOM 527  C C     . GLN A 1 106 ? 34.086  -33.368 103.564 1.00 12.00 ? 106 GLN A C     1 
ATOM 528  O O     . GLN A 1 106 ? 35.075  -34.038 103.887 1.00 12.00 ? 106 GLN A O     1 
ATOM 529  C CB    . GLN A 1 106 ? 32.719  -32.092 105.197 1.00 12.00 ? 106 GLN A CB    1 
ATOM 530  C CG    . GLN A 1 106 ? 33.037  -30.851 104.377 1.00 12.00 ? 106 GLN A CG    1 
ATOM 531  C CD    . GLN A 1 106 ? 32.922  -29.570 105.196 1.00 12.00 ? 106 GLN A CD    1 
ATOM 532  O OE1   . GLN A 1 106 ? 32.705  -29.632 106.402 1.00 12.00 ? 106 GLN A OE1   1 
ATOM 533  N NE2   . GLN A 1 106 ? 33.054  -28.401 104.610 1.00 20.00 ? 106 GLN A NE2   1 
ATOM 534  N N     . ILE A 1 107 ? 33.982  -32.583 102.509 1.00 12.00 ? 107 ILE A N     1 
ATOM 535  C CA    . ILE A 1 107 ? 35.057  -32.357 101.537 1.00 12.00 ? 107 ILE A CA    1 
ATOM 536  C C     . ILE A 1 107 ? 35.191  -30.857 101.277 1.00 12.00 ? 107 ILE A C     1 
ATOM 537  O O     . ILE A 1 107 ? 34.226  -30.192 100.881 1.00 12.00 ? 107 ILE A O     1 
ATOM 538  C CB    . ILE A 1 107 ? 34.736  -33.069 100.227 1.00 12.00 ? 107 ILE A CB    1 
ATOM 539  C CG1   . ILE A 1 107 ? 34.955  -34.577 100.297 1.00 12.00 ? 107 ILE A CG1   1 
ATOM 540  C CG2   . ILE A 1 107 ? 35.587  -32.584 99.059  1.00 12.00 ? 107 ILE A CG2   1 
ATOM 541  C CD1   . ILE A 1 107 ? 35.221  -35.205 98.933  1.00 12.00 ? 107 ILE A CD1   1 
ATOM 542  N N     . TRP A 1 108 ? 36.393  -30.380 101.514 1.00 12.00 ? 108 TRP A N     1 
ATOM 543  C CA    . TRP A 1 108 ? 36.750  -28.964 101.363 1.00 12.00 ? 108 TRP A CA    1 
ATOM 544  C C     . TRP A 1 108 ? 37.359  -28.719 99.982  1.00 12.00 ? 108 TRP A C     1 
ATOM 545  O O     . TRP A 1 108 ? 38.154  -29.522 99.484  1.00 12.00 ? 108 TRP A O     1 
ATOM 546  C CB    . TRP A 1 108 ? 37.766  -28.597 102.442 1.00 12.00 ? 108 TRP A CB    1 
ATOM 547  C CG    . TRP A 1 108 ? 38.115  -27.113 102.492 1.00 20.00 ? 108 TRP A CG    1 
ATOM 548  C CD1   . TRP A 1 108 ? 39.144  -26.511 101.894 1.00 20.00 ? 108 TRP A CD1   1 
ATOM 549  C CD2   . TRP A 1 108 ? 37.388  -26.128 103.201 1.00 20.00 ? 108 TRP A CD2   1 
ATOM 550  N NE1   . TRP A 1 108 ? 39.077  -25.128 102.234 1.00 20.00 ? 108 TRP A NE1   1 
ATOM 551  C CE2   . TRP A 1 108 ? 38.043  -24.925 103.003 1.00 20.00 ? 108 TRP A CE2   1 
ATOM 552  C CE3   . TRP A 1 108 ? 36.240  -26.155 103.992 1.00 20.00 ? 108 TRP A CE3   1 
ATOM 553  C CZ2   . TRP A 1 108 ? 37.616  -23.722 103.566 1.00 20.00 ? 108 TRP A CZ2   1 
ATOM 554  C CZ3   . TRP A 1 108 ? 35.815  -24.938 104.551 1.00 20.00 ? 108 TRP A CZ3   1 
ATOM 555  C CH2   . TRP A 1 108 ? 36.472  -23.780 104.348 1.00 20.00 ? 108 TRP A CH2   1 
ATOM 556  N N     . THR A 1 109 ? 36.960  -27.603 99.402  1.00 12.00 ? 109 THR A N     1 
ATOM 557  C CA    . THR A 1 109 ? 37.430  -27.176 98.077  1.00 12.00 ? 109 THR A CA    1 
ATOM 558  C C     . THR A 1 109 ? 38.157  -25.840 98.187  1.00 12.00 ? 109 THR A C     1 
ATOM 559  O O     . THR A 1 109 ? 37.669  -24.900 98.824  1.00 12.00 ? 109 THR A O     1 
ATOM 560  C CB    . THR A 1 109 ? 36.251  -27.010 97.124  1.00 12.00 ? 109 THR A CB    1 
ATOM 561  O OG1   . THR A 1 109 ? 35.390  -25.989 97.589  1.00 12.00 ? 109 THR A OG1   1 
ATOM 562  C CG2   . THR A 1 109 ? 35.419  -28.279 96.979  1.00 12.00 ? 109 THR A CG2   1 
ATOM 563  N N     . PRO A 1 110 ? 39.340  -25.695 97.584  1.00 12.00 ? 110 PRO A N     1 
ATOM 564  C CA    . PRO A 1 110 ? 40.080  -24.454 97.660  1.00 12.00 ? 110 PRO A CA    1 
ATOM 565  C C     . PRO A 1 110 ? 39.289  -23.321 97.067  1.00 12.00 ? 110 PRO A C     1 
ATOM 566  O O     . PRO A 1 110 ? 39.711  -22.136 97.210  1.00 12.00 ? 110 PRO A O     1 
ATOM 567  C CB    . PRO A 1 110 ? 41.330  -24.725 96.866  1.00 12.00 ? 110 PRO A CB    1 
ATOM 568  C CG    . PRO A 1 110 ? 41.252  -26.147 96.350  1.00 12.00 ? 110 PRO A CG    1 
ATOM 569  C CD    . PRO A 1 110 ? 39.973  -26.759 96.814  1.00 12.00 ? 110 PRO A CD    1 
ATOM 570  N N     . TRP A 1 111 ? 38.192  -23.689 96.438  1.00 12.00 ? 111 TRP A N     1 
ATOM 571  C CA    . TRP A 1 111 ? 37.301  -22.740 95.755  1.00 12.00 ? 111 TRP A CA    1 
ATOM 572  C C     . TRP A 1 111 ? 36.319  -22.090 96.732  1.00 12.00 ? 111 TRP A C     1 
ATOM 573  O O     . TRP A 1 111 ? 35.692  -22.770 97.552  1.00 12.00 ? 111 TRP A O     1 
ATOM 574  C CB    . TRP A 1 111 ? 36.495  -23.466 94.682  1.00 12.00 ? 111 TRP A CB    1 
ATOM 575  C CG    . TRP A 1 111 ? 37.346  -23.904 93.494  1.00 12.00 ? 111 TRP A CG    1 
ATOM 576  C CD1   . TRP A 1 111 ? 37.870  -25.114 93.281  1.00 12.00 ? 111 TRP A CD1   1 
ATOM 577  C CD2   . TRP A 1 111 ? 37.716  -23.073 92.413  1.00 12.00 ? 111 TRP A CD2   1 
ATOM 578  N NE1   . TRP A 1 111 ? 38.586  -25.049 92.048  1.00 12.00 ? 111 TRP A NE1   1 
ATOM 579  C CE2   . TRP A 1 111 ? 38.483  -23.844 91.557  1.00 12.00 ? 111 TRP A CE2   1 
ATOM 580  C CE3   . TRP A 1 111 ? 37.468  -21.741 92.092  1.00 12.00 ? 111 TRP A CE3   1 
ATOM 581  C CZ2   . TRP A 1 111 ? 39.030  -23.350 90.373  1.00 12.00 ? 111 TRP A CZ2   1 
ATOM 582  C CZ3   . TRP A 1 111 ? 38.022  -21.252 90.897  1.00 12.00 ? 111 TRP A CZ3   1 
ATOM 583  C CH2   . TRP A 1 111 ? 38.767  -22.020 90.079  1.00 12.00 ? 111 TRP A CH2   1 
ATOM 584  N N     . SER A 1 112 ? 36.226  -20.779 96.595  1.00 12.00 ? 112 SER A N     1 
ATOM 585  C CA    . SER A 1 112 ? 35.324  -19.934 97.394  1.00 12.00 ? 112 SER A CA    1 
ATOM 586  C C     . SER A 1 112 ? 34.084  -19.605 96.557  1.00 12.00 ? 112 SER A C     1 
ATOM 587  O O     . SER A 1 112 ? 34.186  -19.064 95.451  1.00 12.00 ? 112 SER A O     1 
ATOM 588  C CB    . SER A 1 112 ? 36.033  -18.642 97.787  1.00 12.00 ? 112 SER A CB    1 
ATOM 589  O OG    . SER A 1 112 ? 37.065  -18.919 98.714  1.00 12.00 ? 112 SER A OG    1 
ATOM 590  N N     . LEU A 1 113 ? 32.936  -19.946 97.110  1.00 12.00 ? 113 LEU A N     1 
ATOM 591  C CA    . LEU A 1 113 ? 31.639  -19.760 96.439  1.00 12.00 ? 113 LEU A CA    1 
ATOM 592  C C     . LEU A 1 113 ? 31.067  -18.362 96.683  1.00 12.00 ? 113 LEU A C     1 
ATOM 593  O O     . LEU A 1 113 ? 31.535  -17.626 97.559  1.00 12.00 ? 113 LEU A O     1 
ATOM 594  C CB    . LEU A 1 113 ? 30.629  -20.776 96.960  1.00 12.00 ? 113 LEU A CB    1 
ATOM 595  C CG    . LEU A 1 113 ? 29.287  -20.701 96.242  1.00 12.00 ? 113 LEU A CG    1 
ATOM 596  C CD1   . LEU A 1 113 ? 28.470  -21.981 96.373  1.00 12.00 ? 113 LEU A CD1   1 
ATOM 597  C CD2   . LEU A 1 113 ? 28.393  -19.583 96.766  1.00 12.00 ? 113 LEU A CD2   1 
ATOM 598  N N     . VAL A 1 114 ? 30.059  -18.066 95.877  1.00 12.00 ? 114 VAL A N     1 
ATOM 599  C CA    . VAL A 1 114 ? 29.327  -16.792 95.906  1.00 12.00 ? 114 VAL A CA    1 
ATOM 600  C C     . VAL A 1 114 ? 27.829  -17.049 95.737  1.00 12.00 ? 114 VAL A C     1 
ATOM 601  O O     . VAL A 1 114 ? 27.374  -17.487 94.675  1.00 12.00 ? 114 VAL A O     1 
ATOM 602  C CB    . VAL A 1 114 ? 29.795  -15.889 94.767  1.00 12.00 ? 114 VAL A CB    1 
ATOM 603  C CG1   . VAL A 1 114 ? 28.979  -14.606 94.650  1.00 12.00 ? 114 VAL A CG1   1 
ATOM 604  C CG2   . VAL A 1 114 ? 31.245  -15.445 94.916  1.00 12.00 ? 114 VAL A CG2   1 
ATOM 605  N N     . ASP A 1 115 ? 27.109  -16.763 96.800  1.00 12.00 ? 115 ASP A N     1 
ATOM 606  C CA    . ASP A 1 115 ? 25.655  -16.947 96.856  1.00 12.00 ? 115 ASP A CA    1 
ATOM 607  C C     . ASP A 1 115 ? 24.965  -15.610 97.092  1.00 12.00 ? 115 ASP A C     1 
ATOM 608  O O     . ASP A 1 115 ? 25.434  -14.779 97.874  1.00 12.00 ? 115 ASP A O     1 
ATOM 609  C CB    . ASP A 1 115 ? 25.299  -17.889 98.002  1.00 12.00 ? 115 ASP A CB    1 
ATOM 610  C CG    . ASP A 1 115 ? 24.093  -18.774 97.706  1.00 12.00 ? 115 ASP A CG    1 
ATOM 611  O OD1   . ASP A 1 115 ? 23.796  -19.072 96.492  1.00 12.00 ? 115 ASP A OD1   1 
ATOM 612  O OD2   . ASP A 1 115 ? 23.373  -19.222 98.673  1.00 12.00 ? 115 ASP A OD2   1 
ATOM 613  N N     . ALA A 1 116 ? 23.861  -15.447 96.400  1.00 12.00 ? 116 ALA A N     1 
ATOM 614  C CA    . ALA A 1 116 ? 23.041  -14.240 96.487  1.00 12.00 ? 116 ALA A CA    1 
ATOM 615  C C     . ALA A 1 116 ? 21.567  -14.628 96.474  1.00 12.00 ? 116 ALA A C     1 
ATOM 616  O O     . ALA A 1 116 ? 20.696  -13.810 96.155  1.00 12.00 ? 116 ALA A O     1 
ATOM 617  C CB    . ALA A 1 116 ? 23.331  -13.327 95.301  1.00 12.00 ? 116 ALA A CB    1 
ATOM 618  N N     . ASN A 1 117 ? 21.341  -15.875 96.826  1.00 12.00 ? 117 ASN A N     1 
ATOM 619  C CA    . ASN A 1 117 ? 19.998  -16.460 96.883  1.00 12.00 ? 117 ASN A CA    1 
ATOM 620  C C     . ASN A 1 117 ? 19.350  -16.137 98.202  1.00 12.00 ? 117 ASN A C     1 
ATOM 621  O O     . ASN A 1 117 ? 19.075  -17.029 99.011  1.00 12.00 ? 117 ASN A O     1 
ATOM 622  C CB    . ASN A 1 117 ? 20.086  -17.977 96.746  1.00 12.00 ? 117 ASN A CB    1 
ATOM 623  C CG    . ASN A 1 117 ? 18.721  -18.644 96.626  1.00 12.00 ? 117 ASN A CG    1 
ATOM 624  O OD1   . ASN A 1 117 ? 17.700  -17.972 96.716  1.00 12.00 ? 117 ASN A OD1   1 
ATOM 625  N ND2   . ASN A 1 117 ? 18.638  -19.942 96.425  1.00 12.00 ? 117 ASN A ND2   1 
ATOM 626  N N     . ALA A 1 118 ? 19.136  -14.869 98.363  1.00 12.00 ? 118 ALA A N     1 
ATOM 627  C CA    . ALA A 1 118 ? 18.513  -14.328 99.549  1.00 12.00 ? 118 ALA A CA    1 
ATOM 628  C C     . ALA A 1 118 ? 17.647  -13.161 99.153  1.00 12.00 ? 118 ALA A C     1 
ATOM 629  O O     . ALA A 1 118 ? 17.736  -12.654 98.030  1.00 12.00 ? 118 ALA A O     1 
ATOM 630  C CB    . ALA A 1 118 ? 19.578  -13.871 100.533 1.00 12.00 ? 118 ALA A CB    1 
ATOM 631  N N     . TRP A 1 119 ? 16.845  -12.774 100.093 1.00 12.00 ? 119 TRP A N     1 
ATOM 632  C CA    . TRP A 1 119 ? 15.901  -11.692 99.916  1.00 12.00 ? 119 TRP A CA    1 
ATOM 633  C C     . TRP A 1 119 ? 16.525  -10.361 100.295 1.00 12.00 ? 119 TRP A C     1 
ATOM 634  O O     . TRP A 1 119 ? 16.393  -9.369  99.576  1.00 12.00 ? 119 TRP A O     1 
ATOM 635  C CB    . TRP A 1 119 ? 14.700  -11.937 100.809 1.00 12.00 ? 119 TRP A CB    1 
ATOM 636  C CG    . TRP A 1 119 ? 13.856  -13.111 100.340 1.00 12.00 ? 119 TRP A CG    1 
ATOM 637  C CD1   . TRP A 1 119 ? 13.826  -14.345 100.855 1.00 12.00 ? 119 TRP A CD1   1 
ATOM 638  C CD2   . TRP A 1 119 ? 12.960  -13.066 99.258  1.00 12.00 ? 119 TRP A CD2   1 
ATOM 639  N NE1   . TRP A 1 119 ? 12.875  -15.088 100.093 1.00 12.00 ? 119 TRP A NE1   1 
ATOM 640  C CE2   . TRP A 1 119 ? 12.373  -14.315 99.168  1.00 12.00 ? 119 TRP A CE2   1 
ATOM 641  C CE3   . TRP A 1 119 ? 12.589  -12.069 98.360  1.00 12.00 ? 119 TRP A CE3   1 
ATOM 642  C CZ2   . TRP A 1 119 ? 11.399  -14.629 98.220  1.00 12.00 ? 119 TRP A CZ2   1 
ATOM 643  C CZ3   . TRP A 1 119 ? 11.614  -12.396 97.405  1.00 12.00 ? 119 TRP A CZ3   1 
ATOM 644  C CH2   . TRP A 1 119 ? 11.046  -13.615 97.340  1.00 12.00 ? 119 TRP A CH2   1 
ATOM 645  N N     . GLY A 1 120 ? 17.189  -10.388 101.414 1.00 12.00 ? 120 GLY A N     1 
ATOM 646  C CA    . GLY A 1 120 ? 17.791  -9.200  102.004 1.00 12.00 ? 120 GLY A CA    1 
ATOM 647  C C     . GLY A 1 120 ? 18.791  -8.509  101.079 1.00 12.00 ? 120 GLY A C     1 
ATOM 648  O O     . GLY A 1 120 ? 19.003  -7.296  101.162 1.00 12.00 ? 120 GLY A O     1 
ATOM 649  N N     . VAL A 1 121 ? 19.392  -9.290  100.218 1.00 12.00 ? 121 VAL A N     1 
ATOM 650  C CA    . VAL A 1 121 ? 20.409  -8.791  99.286  1.00 12.00 ? 121 VAL A CA    1 
ATOM 651  C C     . VAL A 1 121 ? 19.779  -8.100  98.083  1.00 12.00 ? 121 VAL A C     1 
ATOM 652  O O     . VAL A 1 121 ? 20.416  -7.273  97.421  1.00 12.00 ? 121 VAL A O     1 
ATOM 653  C CB    . VAL A 1 121 ? 21.237  -9.949  98.740  1.00 12.00 ? 121 VAL A CB    1 
ATOM 654  C CG1   . VAL A 1 121 ? 22.232  -9.515  97.670  1.00 12.00 ? 121 VAL A CG1   1 
ATOM 655  C CG2   . VAL A 1 121 ? 22.059  -10.653 99.811  1.00 12.00 ? 121 VAL A CG2   1 
ATOM 656  N N     . TRP A 1 122 ? 18.543  -8.454  97.840  1.00 12.00 ? 122 TRP A N     1 
ATOM 657  C CA    . TRP A 1 122 ? 17.809  -7.981  96.669  1.00 12.00 ? 122 TRP A CA    1 
ATOM 658  C C     . TRP A 1 122 ? 16.810  -6.872  96.967  1.00 12.00 ? 122 TRP A C     1 
ATOM 659  O O     . TRP A 1 122 ? 16.318  -6.198  96.058  1.00 12.00 ? 122 TRP A O     1 
ATOM 660  C CB    . TRP A 1 122 ? 17.035  -9.140  96.072  1.00 12.00 ? 122 TRP A CB    1 
ATOM 661  C CG    . TRP A 1 122 ? 17.963  -10.230 95.553  1.00 12.00 ? 122 TRP A CG    1 
ATOM 662  C CD1   . TRP A 1 122 ? 18.031  -11.498 95.966  1.00 12.00 ? 122 TRP A CD1   1 
ATOM 663  C CD2   . TRP A 1 122 ? 18.919  -10.053 94.530  1.00 12.00 ? 122 TRP A CD2   1 
ATOM 664  N NE1   . TRP A 1 122 ? 19.052  -12.134 95.197  1.00 12.00 ? 122 TRP A NE1   1 
ATOM 665  C CE2   . TRP A 1 122 ? 19.561  -11.267 94.362  1.00 12.00 ? 122 TRP A CE2   1 
ATOM 666  C CE3   . TRP A 1 122 ? 19.295  -8.969  93.737  1.00 12.00 ? 122 TRP A CE3   1 
ATOM 667  C CZ2   . TRP A 1 122 ? 20.581  -11.467 93.433  1.00 12.00 ? 122 TRP A CZ2   1 
ATOM 668  C CZ3   . TRP A 1 122 ? 20.321  -9.181  92.801  1.00 12.00 ? 122 TRP A CZ3   1 
ATOM 669  C CH2   . TRP A 1 122 ? 20.933  -10.372 92.658  1.00 12.00 ? 122 TRP A CH2   1 
ATOM 670  N N     . LEU A 1 123 ? 16.503  -6.675  98.224  1.00 12.00 ? 123 LEU A N     1 
ATOM 671  C CA    . LEU A 1 123 ? 15.517  -5.658  98.588  1.00 12.00 ? 123 LEU A CA    1 
ATOM 672  C C     . LEU A 1 123 ? 15.876  -4.944  99.879  1.00 12.00 ? 123 LEU A C     1 
ATOM 673  O O     . LEU A 1 123 ? 16.735  -5.403  100.641 1.00 12.00 ? 123 LEU A O     1 
ATOM 674  C CB    . LEU A 1 123 ? 14.150  -6.298  98.773  1.00 12.00 ? 123 LEU A CB    1 
ATOM 675  C CG    . LEU A 1 123 ? 13.656  -7.008  97.519  1.00 12.00 ? 123 LEU A CG    1 
ATOM 676  C CD1   . LEU A 1 123 ? 12.383  -7.810  97.754  1.00 12.00 ? 123 LEU A CD1   1 
ATOM 677  C CD2   . LEU A 1 123 ? 13.337  -6.048  96.378  1.00 12.00 ? 123 LEU A CD2   1 
ATOM 678  N N     . GLN A 1 124 ? 15.175  -3.842  100.042 1.00 12.00 ? 124 GLN A N     1 
ATOM 679  C CA    . GLN A 1 124 ? 15.288  -2.965  101.202 1.00 12.00 ? 124 GLN A CA    1 
ATOM 680  C C     . GLN A 1 124 ? 14.046  -3.076  102.063 1.00 12.00 ? 124 GLN A C     1 
ATOM 681  O O     . GLN A 1 124 ? 13.041  -3.672  101.657 1.00 12.00 ? 124 GLN A O     1 
ATOM 682  C CB    . GLN A 1 124 ? 15.365  -1.507  100.779 1.00 12.00 ? 124 GLN A CB    1 
ATOM 683  C CG    . GLN A 1 124 ? 16.529  -1.186  99.860  1.00 12.00 ? 124 GLN A CG    1 
ATOM 684  C CD    . GLN A 1 124 ? 16.610  0.303   99.551  1.00 20.00 ? 124 GLN A CD    1 
ATOM 685  O OE1   . GLN A 1 124 ? 15.756  1.066   99.992  1.00 20.00 ? 124 GLN A OE1   1 
ATOM 686  N NE2   . GLN A 1 124 ? 17.594  0.771   98.818  1.00 20.00 ? 124 GLN A NE2   1 
ATOM 687  N N     . PRO A 1 125 ? 14.065  -2.513  103.267 1.00 12.00 ? 125 PRO A N     1 
ATOM 688  C CA    . PRO A 1 125 ? 12.913  -2.549  104.134 1.00 12.00 ? 125 PRO A CA    1 
ATOM 689  C C     . PRO A 1 125 ? 11.728  -1.876  103.483 1.00 12.00 ? 125 PRO A C     1 
ATOM 690  O O     . PRO A 1 125 ? 10.578  -2.388  103.617 1.00 12.00 ? 125 PRO A O     1 
ATOM 691  C CB    . PRO A 1 125 ? 13.369  -1.821  105.368 1.00 12.00 ? 125 PRO A CB    1 
ATOM 692  C CG    . PRO A 1 125 ? 14.805  -1.391  105.150 1.00 12.00 ? 125 PRO A CG    1 
ATOM 693  C CD    . PRO A 1 125 ? 15.240  -1.837  103.797 1.00 12.00 ? 125 PRO A CD    1 
ATOM 694  N N     . SER A 1 126 ? 12.001  -0.772  102.808 1.00 12.00 ? 126 SER A N     1 
ATOM 695  C CA    . SER A 1 126 ? 10.960  0.023   102.127 1.00 12.00 ? 126 SER A CA    1 
ATOM 696  C C     . SER A 1 126 ? 10.326  -0.784  100.993 1.00 12.00 ? 126 SER A C     1 
ATOM 697  O O     . SER A 1 126 ? 9.133   -1.103  101.028 1.00 12.00 ? 126 SER A O     1 
ATOM 698  C CB    . SER A 1 126 ? 11.553  1.301   101.545 1.00 20.00 ? 126 SER A CB    1 
ATOM 699  O OG    . SER A 1 126 ? 10.546  2.046   100.886 1.00 20.00 ? 126 SER A OG    1 
ATOM 700  N N     . ASP A 1 127 ? 11.152  -1.089  100.016 1.00 12.00 ? 127 ASP A N     1 
ATOM 701  C CA    . ASP A 1 127 ? 10.741  -1.843  98.825  1.00 12.00 ? 127 ASP A CA    1 
ATOM 702  C C     . ASP A 1 127 ? 9.765   -2.961  99.207  1.00 12.00 ? 127 ASP A C     1 
ATOM 703  O O     . ASP A 1 127 ? 8.612   -2.979  98.765  1.00 12.00 ? 127 ASP A O     1 
ATOM 704  C CB    . ASP A 1 127 ? 11.963  -2.444  98.140  1.00 12.00 ? 127 ASP A CB    1 
ATOM 705  C CG    . ASP A 1 127 ? 12.555  -1.529  97.070  1.00 12.00 ? 127 ASP A CG    1 
ATOM 706  O OD1   . ASP A 1 127 ? 12.051  -0.362  96.872  1.00 12.00 ? 127 ASP A OD1   1 
ATOM 707  O OD2   . ASP A 1 127 ? 13.556  -1.921  96.368  1.00 12.00 ? 127 ASP A OD2   1 
ATOM 708  N N     . TRP A 1 128 ? 10.256  -3.874  100.026 1.00 12.00 ? 128 TRP A N     1 
ATOM 709  C CA    . TRP A 1 128 ? 9.468   -5.022  100.508 1.00 12.00 ? 128 TRP A CA    1 
ATOM 710  C C     . TRP A 1 128 ? 8.087   -4.552  100.956 1.00 12.00 ? 128 TRP A C     1 
ATOM 711  O O     . TRP A 1 128 ? 7.063   -5.130  100.576 1.00 12.00 ? 128 TRP A O     1 
ATOM 712  C CB    . TRP A 1 128 ? 10.178  -5.689  101.691 1.00 12.00 ? 128 TRP A CB    1 
ATOM 713  C CG    . TRP A 1 128 ? 9.523   -6.997  102.155 1.00 12.00 ? 128 TRP A CG    1 
ATOM 714  C CD1   . TRP A 1 128 ? 8.772   -7.182  103.247 1.00 12.00 ? 128 TRP A CD1   1 
ATOM 715  C CD2   . TRP A 1 128 ? 9.618   -8.243  101.488 1.00 12.00 ? 128 TRP A CD2   1 
ATOM 716  N NE1   . TRP A 1 128 ? 8.392   -8.560  103.274 1.00 12.00 ? 128 TRP A NE1   1 
ATOM 717  C CE2   . TRP A 1 128 ? 8.900   -9.164  102.234 1.00 12.00 ? 128 TRP A CE2   1 
ATOM 718  C CE3   . TRP A 1 128 ? 10.251  -8.663  100.319 1.00 12.00 ? 128 TRP A CE3   1 
ATOM 719  C CZ2   . TRP A 1 128 ? 8.780   -10.508 101.877 1.00 12.00 ? 128 TRP A CZ2   1 
ATOM 720  C CZ3   . TRP A 1 128 ? 10.122  -10.017 99.966  1.00 12.00 ? 128 TRP A CZ3   1 
ATOM 721  C CH2   . TRP A 1 128 ? 9.421   -10.895 100.709 1.00 12.00 ? 128 TRP A CH2   1 
ATOM 722  N N     . GLN A 1 129 ? 8.111   -3.504  101.756 1.00 12.00 ? 129 GLN A N     1 
ATOM 723  C CA    . GLN A 1 129 ? 6.899   -2.892  102.312 1.00 12.00 ? 129 GLN A CA    1 
ATOM 724  C C     . GLN A 1 129 ? 5.950   -2.491  101.191 1.00 12.00 ? 129 GLN A C     1 
ATOM 725  O O     . GLN A 1 129 ? 4.745   -2.753  101.254 1.00 12.00 ? 129 GLN A O     1 
ATOM 726  C CB    . GLN A 1 129 ? 7.258   -1.647  103.116 1.00 12.00 ? 129 GLN A CB    1 
ATOM 727  C CG    . GLN A 1 129 ? 6.033   -0.935  103.682 1.00 12.00 ? 129 GLN A CG    1 
ATOM 728  C CD    . GLN A 1 129 ? 6.386   0.157   104.686 1.00 12.00 ? 129 GLN A CD    1 
ATOM 729  O OE1   . GLN A 1 129 ? 7.559   0.457   104.878 1.00 12.00 ? 129 GLN A OE1   1 
ATOM 730  N NE2   . GLN A 1 129 ? 5.432   0.777   105.344 1.00 12.00 ? 129 GLN A NE2   1 
ATOM 731  N N     . TYR A 1 130 ? 6.537   -1.865  100.200 1.00 12.00 ? 130 TYR A N     1 
ATOM 732  C CA    . TYR A 1 130 ? 5.820   -1.397  99.015  1.00 12.00 ? 130 TYR A CA    1 
ATOM 733  C C     . TYR A 1 130 ? 5.298   -2.592  98.225  1.00 12.00 ? 130 TYR A C     1 
ATOM 734  O O     . TYR A 1 130 ? 4.217   -2.537  97.628  1.00 12.00 ? 130 TYR A O     1 
ATOM 735  C CB    . TYR A 1 130 ? 6.770   -0.591  98.136  1.00 12.00 ? 130 TYR A CB    1 
ATOM 736  C CG    . TYR A 1 130 ? 6.093   0.026   96.920  1.00 12.00 ? 130 TYR A CG    1 
ATOM 737  C CD1   . TYR A 1 130 ? 4.776   -0.308  96.608  1.00 12.00 ? 130 TYR A CD1   1 
ATOM 738  C CD2   . TYR A 1 130 ? 6.795   0.925   96.116  1.00 12.00 ? 130 TYR A CD2   1 
ATOM 739  C CE1   . TYR A 1 130 ? 4.158   0.262   95.495  1.00 20.00 ? 130 TYR A CE1   1 
ATOM 740  C CE2   . TYR A 1 130 ? 6.178   1.493   95.003  1.00 20.00 ? 130 TYR A CE2   1 
ATOM 741  C CZ    . TYR A 1 130 ? 4.860   1.162   94.693  1.00 20.00 ? 130 TYR A CZ    1 
ATOM 742  O OH    . TYR A 1 130 ? 4.260   1.716   93.611  1.00 20.00 ? 130 TYR A OH    1 
ATOM 743  N N     . ILE A 1 131 ? 6.098   -3.635  98.263  1.00 12.00 ? 131 ILE A N     1 
ATOM 744  C CA    . ILE A 1 131 ? 5.826   -4.890  97.559  1.00 12.00 ? 131 ILE A CA    1 
ATOM 745  C C     . ILE A 1 131 ? 4.738   -5.696  98.269  1.00 12.00 ? 131 ILE A C     1 
ATOM 746  O O     . ILE A 1 131 ? 3.589   -5.746  97.818  1.00 12.00 ? 131 ILE A O     1 
ATOM 747  C CB    . ILE A 1 131 ? 7.092   -5.740  97.511  1.00 12.00 ? 131 ILE A CB    1 
ATOM 748  C CG1   . ILE A 1 131 ? 8.191   -5.127  96.653  1.00 12.00 ? 131 ILE A CG1   1 
ATOM 749  C CG2   . ILE A 1 131 ? 6.852   -7.133  96.943  1.00 12.00 ? 131 ILE A CG2   1 
ATOM 750  C CD1   . ILE A 1 131 ? 9.497   -5.911  96.707  1.00 12.00 ? 131 ILE A CD1   1 
ATOM 751  N N     . CYS A 1 132 ? 5.151   -6.301  99.359  1.00 12.00 ? 132 CYS A N     1 
ATOM 752  C CA    . CYS A 1 132 ? 4.294   -7.164  100.182 1.00 12.00 ? 132 CYS A CA    1 
ATOM 753  C C     . CYS A 1 132 ? 3.018   -6.445  100.618 1.00 12.00 ? 132 CYS A C     1 
ATOM 754  O O     . CYS A 1 132 ? 1.959   -7.064  100.767 1.00 12.00 ? 132 CYS A O     1 
ATOM 755  C CB    . CYS A 1 132 ? 5.040   -7.589  101.443 1.00 12.00 ? 132 CYS A CB    1 
ATOM 756  S SG    . CYS A 1 132 ? 6.630   -8.469  101.084 1.00 20.00 ? 132 CYS A SG    1 
ATOM 757  N N     . ASN A 1 133 ? 3.155   -5.157  100.809 1.00 12.00 ? 133 ASN A N     1 
ATOM 758  C CA    . ASN A 1 133 ? 2.065   -4.301  101.287 1.00 12.00 ? 133 ASN A CA    1 
ATOM 759  C C     . ASN A 1 133 ? 1.050   -3.941  100.195 1.00 12.00 ? 133 ASN A C     1 
ATOM 760  O O     . ASN A 1 133 ? -0.121  -3.668  100.479 1.00 12.00 ? 133 ASN A O     1 
ATOM 761  C CB    . ASN A 1 133 ? 2.629   -2.976  101.803 1.00 12.00 ? 133 ASN A CB    1 
ATOM 762  C CG    . ASN A 1 133 ? 2.512   -2.828  103.316 1.00 12.00 ? 133 ASN A CG    1 
ATOM 763  O OD1   . ASN A 1 133 ? 1.407   -2.811  103.847 1.00 12.00 ? 133 ASN A OD1   1 
ATOM 764  N ND2   . ASN A 1 133 ? 3.597   -2.718  104.051 1.00 12.00 ? 133 ASN A ND2   1 
ATOM 765  N N     . THR A 1 134 ? 1.503   -3.938  98.958  1.00 12.00 ? 134 THR A N     1 
ATOM 766  C CA    . THR A 1 134 ? 0.650   -3.540  97.825  1.00 12.00 ? 134 THR A CA    1 
ATOM 767  C C     . THR A 1 134 ? 0.278   -4.725  96.931  1.00 12.00 ? 134 THR A C     1 
ATOM 768  O O     . THR A 1 134 ? -0.901  -5.063  96.779  1.00 12.00 ? 134 THR A O     1 
ATOM 769  C CB    . THR A 1 134 ? 1.372   -2.506  96.969  1.00 12.00 ? 134 THR A CB    1 
ATOM 770  O OG1   . THR A 1 134 ? 2.084   -1.605  97.797  1.00 12.00 ? 134 THR A OG1   1 
ATOM 771  C CG2   . THR A 1 134 ? 0.423   -1.678  96.109  1.00 12.00 ? 134 THR A CG2   1 
ATOM 772  N N     . MET A 1 135 ? 1.297   -5.319  96.353  1.00 12.00 ? 135 MET A N     1 
ATOM 773  C CA    . MET A 1 135 ? 1.147   -6.447  95.420  1.00 12.00 ? 135 MET A CA    1 
ATOM 774  C C     . MET A 1 135 ? 0.490   -7.649  96.096  1.00 12.00 ? 135 MET A C     1 
ATOM 775  O O     . MET A 1 135 ? 0.694   -7.900  97.288  1.00 12.00 ? 135 MET A O     1 
ATOM 776  C CB    . MET A 1 135 ? 2.511   -6.879  94.900  1.00 12.00 ? 135 MET A CB    1 
ATOM 777  C CG    . MET A 1 135 ? 3.424   -5.703  94.577  1.00 12.00 ? 135 MET A CG    1 
ATOM 778  S SD    . MET A 1 135 ? 3.787   -5.560  92.847  1.00 12.00 ? 135 MET A SD    1 
ATOM 779  C CE    . MET A 1 135 ? 4.233   -3.888  92.457  1.00 12.00 ? 135 MET A CE    1 
ATOM 780  N N     . SER A 1 136 ? -0.279  -8.351  95.284  1.00 12.00 ? 136 SER A N     1 
ATOM 781  C CA    . SER A 1 136 ? -0.997  -9.562  95.696  1.00 12.00 ? 136 SER A CA    1 
ATOM 782  C C     . SER A 1 136 ? -0.025  -10.736 95.740  1.00 12.00 ? 136 SER A C     1 
ATOM 783  O O     . SER A 1 136 ? 0.392   -11.175 96.817  1.00 12.00 ? 136 SER A O     1 
ATOM 784  C CB    . SER A 1 136 ? -2.109  -9.872  94.699  1.00 12.00 ? 136 SER A CB    1 
ATOM 785  O OG    . SER A 1 136 ? -1.606  -9.806  93.376  1.00 12.00 ? 136 SER A OG    1 
ATOM 786  N N     . GLN A 1 137 ? 0.303   -11.201 94.553  1.00 12.00 ? 137 GLN A N     1 
ATOM 787  C CA    . GLN A 1 137 ? 1.246   -12.306 94.360  1.00 12.00 ? 137 GLN A CA    1 
ATOM 788  C C     . GLN A 1 137 ? 2.576   -11.751 93.852  1.00 12.00 ? 137 GLN A C     1 
ATOM 789  O O     . GLN A 1 137 ? 2.779   -10.533 93.801  1.00 12.00 ? 137 GLN A O     1 
ATOM 790  C CB    . GLN A 1 137 ? 0.680   -13.304 93.354  1.00 12.00 ? 137 GLN A CB    1 
ATOM 791  C CG    . GLN A 1 137 ? 1.193   -13.077 91.936  1.00 12.00 ? 137 GLN A CG    1 
ATOM 792  C CD    . GLN A 1 137 ? 0.204   -13.528 90.866  1.00 12.00 ? 137 GLN A CD    1 
ATOM 793  O OE1   . GLN A 1 137 ? -0.956  -13.134 90.900  1.00 12.00 ? 137 GLN A OE1   1 
ATOM 794  N NE2   . GLN A 1 137 ? 0.598   -14.337 89.908  1.00 20.00 ? 137 GLN A NE2   1 
ATOM 795  N N     . LEU A 1 138 ? 3.452   -12.664 93.487  1.00 12.00 ? 138 LEU A N     1 
ATOM 796  C CA    . LEU A 1 138 ? 4.789   -12.324 92.984  1.00 12.00 ? 138 LEU A CA    1 
ATOM 797  C C     . LEU A 1 138 ? 5.456   -13.563 92.394  1.00 12.00 ? 138 LEU A C     1 
ATOM 798  O O     . LEU A 1 138 ? 5.143   -14.696 92.772  1.00 12.00 ? 138 LEU A O     1 
ATOM 799  C CB    . LEU A 1 138 ? 5.644   -11.788 94.128  1.00 12.00 ? 138 LEU A CB    1 
ATOM 800  C CG    . LEU A 1 138 ? 7.108   -11.600 93.749  1.00 12.00 ? 138 LEU A CG    1 
ATOM 801  C CD1   . LEU A 1 138 ? 7.366   -10.304 92.990  1.00 12.00 ? 138 LEU A CD1   1 
ATOM 802  C CD2   . LEU A 1 138 ? 8.034   -11.560 94.960  1.00 12.00 ? 138 LEU A CD2   1 
ATOM 803  N N     . ASN A 1 139 ? 6.366   -13.308 91.474  1.00 12.00 ? 139 ASN A N     1 
ATOM 804  C CA    . ASN A 1 139 ? 7.115   -14.366 90.785  1.00 12.00 ? 139 ASN A CA    1 
ATOM 805  C C     . ASN A 1 139 ? 8.613   -14.060 90.794  1.00 12.00 ? 139 ASN A C     1 
ATOM 806  O O     . ASN A 1 139 ? 9.085   -13.219 91.566  1.00 12.00 ? 139 ASN A O     1 
ATOM 807  C CB    . ASN A 1 139 ? 6.650   -14.484 89.337  1.00 12.00 ? 139 ASN A CB    1 
ATOM 808  C CG    . ASN A 1 139 ? 6.697   -15.916 88.815  1.00 12.00 ? 139 ASN A CG    1 
ATOM 809  O OD1   . ASN A 1 139 ? 6.284   -16.173 87.690  1.00 20.00 ? 139 ASN A OD1   1 
ATOM 810  N ND2   . ASN A 1 139 ? 7.181   -16.878 89.572  1.00 20.00 ? 139 ASN A ND2   1 
ATOM 811  N N     . LEU A 1 140 ? 9.298   -14.769 89.920  1.00 12.00 ? 140 LEU A N     1 
ATOM 812  C CA    . LEU A 1 140 ? 10.751  -14.665 89.737  1.00 12.00 ? 140 LEU A CA    1 
ATOM 813  C C     . LEU A 1 140 ? 11.087  -14.900 88.267  1.00 12.00 ? 140 LEU A C     1 
ATOM 814  O O     . LEU A 1 140 ? 10.782  -15.956 87.704  1.00 12.00 ? 140 LEU A O     1 
ATOM 815  C CB    . LEU A 1 140 ? 11.445  -15.724 90.591  1.00 12.00 ? 140 LEU A CB    1 
ATOM 816  C CG    . LEU A 1 140 ? 12.871  -15.351 90.980  1.00 12.00 ? 140 LEU A CG    1 
ATOM 817  C CD1   . LEU A 1 140 ? 12.951  -14.070 91.801  1.00 12.00 ? 140 LEU A CD1   1 
ATOM 818  C CD2   . LEU A 1 140 ? 13.556  -16.423 91.821  1.00 12.00 ? 140 LEU A CD2   1 
ATOM 819  N N     . VAL A 1 141 ? 11.714  -13.904 87.671  1.00 12.00 ? 141 VAL A N     1 
ATOM 820  C CA    . VAL A 1 141 ? 12.068  -13.945 86.246  1.00 12.00 ? 141 VAL A CA    1 
ATOM 821  C C     . VAL A 1 141 ? 13.544  -14.277 86.032  1.00 12.00 ? 141 VAL A C     1 
ATOM 822  O O     . VAL A 1 141 ? 13.986  -15.406 86.271  1.00 12.00 ? 141 VAL A O     1 
ATOM 823  C CB    . VAL A 1 141 ? 11.787  -12.600 85.588  1.00 12.00 ? 141 VAL A CB    1 
ATOM 824  C CG1   . VAL A 1 141 ? 12.319  -12.514 84.160  1.00 12.00 ? 141 VAL A CG1   1 
ATOM 825  C CG2   . VAL A 1 141 ? 10.298  -12.284 85.491  1.00 12.00 ? 141 VAL A CG2   1 
ATOM 826  N N     . SER A 1 142 ? 14.257  -13.264 85.577  1.00 12.00 ? 142 SER A N     1 
ATOM 827  C CA    . SER A 1 142 ? 15.678  -13.369 85.224  1.00 12.00 ? 142 SER A CA    1 
ATOM 828  C C     . SER A 1 142 ? 16.595  -13.161 86.422  1.00 12.00 ? 142 SER A C     1 
ATOM 829  O O     . SER A 1 142 ? 16.139  -12.832 87.522  1.00 12.00 ? 142 SER A O     1 
ATOM 830  C CB    . SER A 1 142 ? 16.035  -12.312 84.185  1.00 12.00 ? 142 SER A CB    1 
ATOM 831  O OG    . SER A 1 142 ? 15.680  -11.027 84.662  1.00 12.00 ? 142 SER A OG    1 
ATOM 832  N N     . LEU A 1 143 ? 17.861  -13.372 86.120  1.00 12.00 ? 143 LEU A N     1 
ATOM 833  C CA    . LEU A 1 143 ? 18.976  -13.238 87.060  1.00 12.00 ? 143 LEU A CA    1 
ATOM 834  C C     . LEU A 1 143 ? 20.282  -13.178 86.272  1.00 12.00 ? 143 LEU A C     1 
ATOM 835  O O     . LEU A 1 143 ? 20.716  -14.173 85.682  1.00 12.00 ? 143 LEU A O     1 
ATOM 836  C CB    . LEU A 1 143 ? 19.017  -14.433 88.005  1.00 12.00 ? 143 LEU A CB    1 
ATOM 837  C CG    . LEU A 1 143 ? 20.360  -14.584 88.711  1.00 12.00 ? 143 LEU A CG    1 
ATOM 838  C CD1   . LEU A 1 143 ? 20.681  -13.414 89.635  1.00 12.00 ? 143 LEU A CD1   1 
ATOM 839  C CD2   . LEU A 1 143 ? 20.440  -15.832 89.582  1.00 12.00 ? 143 LEU A CD2   1 
ATOM 840  N N     . ASP A 1 144 ? 20.872  -12.002 86.284  1.00 12.00 ? 144 ASP A N     1 
ATOM 841  C CA    . ASP A 1 144 ? 22.121  -11.736 85.563  1.00 12.00 ? 144 ASP A CA    1 
ATOM 842  C C     . ASP A 1 144 ? 23.196  -11.222 86.517  1.00 12.00 ? 144 ASP A C     1 
ATOM 843  O O     . ASP A 1 144 ? 23.144  -10.075 86.974  1.00 12.00 ? 144 ASP A O     1 
ATOM 844  C CB    . ASP A 1 144 ? 21.881  -10.684 84.486  1.00 12.00 ? 144 ASP A CB    1 
ATOM 845  C CG    . ASP A 1 144 ? 23.055  -10.527 83.528  1.00 12.00 ? 144 ASP A CG    1 
ATOM 846  O OD1   . ASP A 1 144 ? 24.173  -11.108 83.781  1.00 20.00 ? 144 ASP A OD1   1 
ATOM 847  O OD2   . ASP A 1 144 ? 22.928  -9.812  82.466  1.00 20.00 ? 144 ASP A OD2   1 
ATOM 848  N N     . GLN A 1 145 ? 24.142  -12.099 86.781  1.00 12.00 ? 145 GLN A N     1 
ATOM 849  C CA    . GLN A 1 145 ? 25.284  -11.805 87.652  1.00 12.00 ? 145 GLN A CA    1 
ATOM 850  C C     . GLN A 1 145 ? 26.423  -11.238 86.810  1.00 12.00 ? 145 GLN A C     1 
ATOM 851  O O     . GLN A 1 145 ? 26.553  -11.552 85.621  1.00 12.00 ? 145 GLN A O     1 
ATOM 852  C CB    . GLN A 1 145 ? 25.749  -13.080 88.349  1.00 12.00 ? 145 GLN A CB    1 
ATOM 853  C CG    . GLN A 1 145 ? 24.769  -13.568 89.412  1.00 12.00 ? 145 GLN A CG    1 
ATOM 854  C CD    . GLN A 1 145 ? 25.358  -14.644 90.319  1.00 12.00 ? 145 GLN A CD    1 
ATOM 855  O OE1   . GLN A 1 145 ? 25.877  -14.331 91.383  1.00 12.00 ? 145 GLN A OE1   1 
ATOM 856  N NE2   . GLN A 1 145 ? 25.307  -15.908 89.960  1.00 12.00 ? 145 GLN A NE2   1 
ATOM 857  N N     . GLU A 1 146 ? 27.224  -10.412 87.450  1.00 12.00 ? 146 GLU A N     1 
ATOM 858  C CA    . GLU A 1 146 ? 28.359  -9.752  86.794  1.00 12.00 ? 146 GLU A CA    1 
ATOM 859  C C     . GLU A 1 146 ? 29.434  -9.394  87.819  1.00 12.00 ? 146 GLU A C     1 
ATOM 860  O O     . GLU A 1 146 ? 29.134  -9.118  88.986  1.00 12.00 ? 146 GLU A O     1 
ATOM 861  C CB    . GLU A 1 146 ? 27.880  -8.474  86.113  1.00 12.00 ? 146 GLU A CB    1 
ATOM 862  C CG    . GLU A 1 146 ? 28.996  -7.721  85.399  1.00 12.00 ? 146 GLU A CG    1 
ATOM 863  C CD    . GLU A 1 146 ? 28.508  -6.456  84.703  1.00 12.00 ? 146 GLU A CD    1 
ATOM 864  O OE1   . GLU A 1 146 ? 27.263  -6.136  84.750  1.00 12.00 ? 146 GLU A OE1   1 
ATOM 865  O OE2   . GLU A 1 146 ? 29.340  -5.708  84.071  1.00 12.00 ? 146 GLU A OE2   1 
ATOM 866  N N     . ILE A 1 147 ? 30.656  -9.414  87.332  1.00 12.00 ? 147 ILE A N     1 
ATOM 867  C CA    . ILE A 1 147 ? 31.850  -9.093  88.123  1.00 12.00 ? 147 ILE A CA    1 
ATOM 868  C C     . ILE A 1 147 ? 32.755  -8.168  87.317  1.00 12.00 ? 147 ILE A C     1 
ATOM 869  O O     . ILE A 1 147 ? 32.841  -8.272  86.089  1.00 12.00 ? 147 ILE A O     1 
ATOM 870  C CB    . ILE A 1 147 ? 32.612  -10.372 88.457  1.00 12.00 ? 147 ILE A CB    1 
ATOM 871  C CG1   . ILE A 1 147 ? 31.768  -11.390 89.214  1.00 12.00 ? 147 ILE A CG1   1 
ATOM 872  C CG2   . ILE A 1 147 ? 33.840  -10.125 89.327  1.00 12.00 ? 147 ILE A CG2   1 
ATOM 873  C CD1   . ILE A 1 147 ? 32.467  -12.734 89.385  1.00 12.00 ? 147 ILE A CD1   1 
ATOM 874  N N     . PHE A 1 148 ? 33.411  -7.275  88.027  1.00 12.00 ? 148 PHE A N     1 
ATOM 875  C CA    . PHE A 1 148 ? 34.310  -6.299  87.405  1.00 12.00 ? 148 PHE A CA    1 
ATOM 876  C C     . PHE A 1 148 ? 35.211  -5.634  88.439  1.00 12.00 ? 148 PHE A C     1 
ATOM 877  O O     . PHE A 1 148 ? 35.129  -5.928  89.638  1.00 12.00 ? 148 PHE A O     1 
ATOM 878  C CB    . PHE A 1 148 ? 33.498  -5.208  86.720  1.00 12.00 ? 148 PHE A CB    1 
ATOM 879  C CG    . PHE A 1 148 ? 32.400  -4.640  87.612  1.00 12.00 ? 148 PHE A CG    1 
ATOM 880  C CD1   . PHE A 1 148 ? 31.152  -5.262  87.662  1.00 12.00 ? 148 PHE A CD1   1 
ATOM 881  C CD2   . PHE A 1 148 ? 32.644  -3.501  88.379  1.00 12.00 ? 148 PHE A CD2   1 
ATOM 882  C CE1   . PHE A 1 148 ? 30.147  -4.743  88.477  1.00 12.00 ? 148 PHE A CE1   1 
ATOM 883  C CE2   . PHE A 1 148 ? 31.639  -2.982  89.195  1.00 12.00 ? 148 PHE A CE2   1 
ATOM 884  C CZ    . PHE A 1 148 ? 30.390  -3.603  89.244  1.00 12.00 ? 148 PHE A CZ    1 
ATOM 885  N N     . ASN A 1 149 ? 36.035  -4.756  87.907  1.00 12.00 ? 149 ASN A N     1 
ATOM 886  C CA    . ASN A 1 149 ? 37.003  -3.974  88.675  1.00 12.00 ? 149 ASN A CA    1 
ATOM 887  C C     . ASN A 1 149 ? 37.702  -4.857  89.694  1.00 12.00 ? 149 ASN A C     1 
ATOM 888  O O     . ASN A 1 149 ? 37.598  -4.634  90.905  1.00 12.00 ? 149 ASN A O     1 
ATOM 889  C CB    . ASN A 1 149 ? 36.302  -2.832  89.394  1.00 12.00 ? 149 ASN A CB    1 
ATOM 890  C CG    . ASN A 1 149 ? 36.313  -1.540  88.587  1.00 12.00 ? 149 ASN A CG    1 
ATOM 891  O OD1   . ASN A 1 149 ? 37.351  -0.899  88.472  1.00 12.00 ? 149 ASN A OD1   1 
ATOM 892  N ND2   . ASN A 1 149 ? 35.210  -1.117  88.012  1.00 12.00 ? 149 ASN A ND2   1 
ATOM 893  N N     . VAL A 1 150 ? 38.392  -5.832  89.156  1.00 12.00 ? 150 VAL A N     1 
ATOM 894  C CA    . VAL A 1 150 ? 39.153  -6.789  89.951  1.00 12.00 ? 150 VAL A CA    1 
ATOM 895  C C     . VAL A 1 150 ? 40.467  -6.174  90.399  1.00 12.00 ? 150 VAL A C     1 
ATOM 896  O O     . VAL A 1 150 ? 41.236  -5.652  89.585  1.00 12.00 ? 150 VAL A O     1 
ATOM 897  C CB    . VAL A 1 150 ? 39.474  -8.030  89.129  1.00 12.00 ? 150 VAL A CB    1 
ATOM 898  C CG1   . VAL A 1 150 ? 40.349  -9.029  89.877  1.00 12.00 ? 150 VAL A CG1   1 
ATOM 899  C CG2   . VAL A 1 150 ? 38.230  -8.804  88.709  1.00 12.00 ? 150 VAL A CG2   1 
ATOM 900  N N     . VAL A 1 151 ? 40.675  -6.263  91.689  1.00 12.00 ? 151 VAL A N     1 
ATOM 901  C CA    . VAL A 1 151 ? 41.883  -5.758  92.335  1.00 12.00 ? 151 VAL A CA    1 
ATOM 902  C C     . VAL A 1 151 ? 42.604  -6.911  93.020  1.00 12.00 ? 151 VAL A C     1 
ATOM 903  O O     . VAL A 1 151 ? 41.988  -7.719  93.720  1.00 12.00 ? 151 VAL A O     1 
ATOM 904  C CB    . VAL A 1 151 ? 41.521  -4.703  93.373  1.00 12.00 ? 151 VAL A CB    1 
ATOM 905  C CG1   . VAL A 1 151 ? 42.655  -4.420  94.353  1.00 12.00 ? 151 VAL A CG1   1 
ATOM 906  C CG2   . VAL A 1 151 ? 41.163  -3.357  92.756  1.00 12.00 ? 151 VAL A CG2   1 
ATOM 907  N N     . LEU A 1 152 ? 43.894  -6.950  92.785  1.00 12.00 ? 152 LEU A N     1 
ATOM 908  C CA    . LEU A 1 152 ? 44.773  -7.973  93.351  1.00 12.00 ? 152 LEU A CA    1 
ATOM 909  C C     . LEU A 1 152 ? 46.024  -7.303  93.925  1.00 12.00 ? 152 LEU A C     1 
ATOM 910  O O     . LEU A 1 152 ? 46.741  -6.584  93.221  1.00 12.00 ? 152 LEU A O     1 
ATOM 911  C CB    . LEU A 1 152 ? 45.179  -8.961  92.264  1.00 12.00 ? 152 LEU A CB    1 
ATOM 912  C CG    . LEU A 1 152 ? 44.029  -9.855  91.812  1.00 12.00 ? 152 LEU A CG    1 
ATOM 913  C CD1   . LEU A 1 152 ? 44.410  -10.776 90.659  1.00 12.00 ? 152 LEU A CD1   1 
ATOM 914  C CD2   . LEU A 1 152 ? 43.513  -10.767 92.919  1.00 12.00 ? 152 LEU A CD2   1 
ATOM 915  N N     . LYS A 1 153 ? 46.256  -7.555  95.202  1.00 12.00 ? 153 LYS A N     1 
ATOM 916  C CA    . LYS A 1 153 ? 47.398  -6.978  95.929  1.00 12.00 ? 153 LYS A CA    1 
ATOM 917  C C     . LYS A 1 153 ? 48.138  -8.050  96.735  1.00 12.00 ? 153 LYS A C     1 
ATOM 918  O O     . LYS A 1 153 ? 47.590  -9.118  97.025  1.00 12.00 ? 153 LYS A O     1 
ATOM 919  C CB    . LYS A 1 153 ? 46.912  -5.900  96.893  1.00 12.00 ? 153 LYS A CB    1 
ATOM 920  C CG    . LYS A 1 153 ? 46.039  -4.847  96.217  1.00 12.00 ? 153 LYS A CG    1 
ATOM 921  C CD    . LYS A 1 153 ? 46.061  -3.502  96.937  1.00 12.00 ? 153 LYS A CD    1 
ATOM 922  C CE    . LYS A 1 153 ? 45.397  -2.387  96.135  1.00 12.00 ? 153 LYS A CE    1 
ATOM 923  N NZ    . LYS A 1 153 ? 44.924  -1.283  96.974  1.00 12.00 ? 153 LYS A NZ    1 
ATOM 924  N N     . THR A 1 154 ? 49.372  -7.705  97.065  1.00 12.00 ? 154 THR A N     1 
ATOM 925  C CA    . THR A 1 154 ? 50.282  -8.563  97.841  1.00 12.00 ? 154 THR A CA    1 
ATOM 926  C C     . THR A 1 154 ? 50.787  -7.787  99.057  1.00 12.00 ? 154 THR A C     1 
ATOM 927  O O     . THR A 1 154 ? 50.874  -6.555  99.034  1.00 12.00 ? 154 THR A O     1 
ATOM 928  C CB    . THR A 1 154 ? 51.458  -8.992  96.968  1.00 12.00 ? 154 THR A CB    1 
ATOM 929  O OG1   . THR A 1 154 ? 51.010  -9.264  95.654  1.00 12.00 ? 154 THR A OG1   1 
ATOM 930  C CG2   . THR A 1 154 ? 52.154  -10.247 97.482  1.00 12.00 ? 154 THR A CG2   1 
ATOM 931  N N     . VAL A 1 155 ? 51.108  -8.532  100.095 1.00 12.00 ? 155 VAL A N     1 
ATOM 932  C CA    . VAL A 1 155 ? 51.580  -7.958  101.361 1.00 12.00 ? 155 VAL A CA    1 
ATOM 933  C C     . VAL A 1 155 ? 52.930  -8.528  101.754 1.00 12.00 ? 155 VAL A C     1 
ATOM 934  O O     . VAL A 1 155 ? 53.129  -9.738  101.744 1.00 12.00 ? 155 VAL A O     1 
ATOM 935  C CB    . VAL A 1 155 ? 50.557  -8.205  102.465 1.00 12.00 ? 155 VAL A CB    1 
ATOM 936  C CG1   . VAL A 1 155 ? 49.153  -8.215  101.895 1.00 12.00 ? 155 VAL A CG1   1 
ATOM 937  C CG2   . VAL A 1 155 ? 50.855  -9.505  103.184 1.00 12.00 ? 155 VAL A CG2   1 
ATOM 938  N N     . THR A 1 156 ? 53.854  -7.648  102.101 1.00 12.00 ? 156 THR A N     1 
ATOM 939  C CA    . THR A 1 156 ? 55.183  -8.073  102.498 1.00 12.00 ? 156 THR A CA    1 
ATOM 940  C C     . THR A 1 156 ? 55.473  -7.696  103.939 1.00 12.00 ? 156 THR A C     1 
ATOM 941  O O     . THR A 1 156 ? 55.862  -6.569  104.228 1.00 12.00 ? 156 THR A O     1 
ATOM 942  C CB    . THR A 1 156 ? 56.255  -7.464  101.602 1.00 12.00 ? 156 THR A CB    1 
ATOM 943  O OG1   . THR A 1 156 ? 55.881  -6.135  101.240 1.00 20.00 ? 156 THR A OG1   1 
ATOM 944  C CG2   . THR A 1 156 ? 56.441  -8.301  100.351 1.00 20.00 ? 156 THR A CG2   1 
ATOM 945  N N     . GLU A 1 157 ? 55.281  -8.644  104.845 1.00 12.00 ? 157 GLU A N     1 
ATOM 946  C CA    . GLU A 1 157 ? 55.538  -8.402  106.253 1.00 12.00 ? 157 GLU A CA    1 
ATOM 947  C C     . GLU A 1 157 ? 56.946  -7.871  106.448 1.00 12.00 ? 157 GLU A C     1 
ATOM 948  O O     . GLU A 1 157 ? 57.914  -8.621  106.381 1.00 12.00 ? 157 GLU A O     1 
ATOM 949  C CB    . GLU A 1 157 ? 55.303  -9.670  107.063 1.00 12.00 ? 157 GLU A CB    1 
ATOM 950  C CG    . GLU A 1 157 ? 53.879  -9.826  107.559 1.00 12.00 ? 157 GLU A CG    1 
ATOM 951  C CD    . GLU A 1 157 ? 53.417  -11.264 107.557 1.00 12.00 ? 157 GLU A CD    1 
ATOM 952  O OE1   . GLU A 1 157 ? 54.139  -12.118 108.103 1.00 12.00 ? 157 GLU A OE1   1 
ATOM 953  O OE2   . GLU A 1 157 ? 52.331  -11.536 107.012 1.00 12.00 ? 157 GLU A OE2   1 
ATOM 954  N N     . GLN A 1 158 ? 57.041  -6.575  106.688 1.00 20.00 ? 158 GLN A N     1 
ATOM 955  C CA    . GLN A 1 158 ? 58.319  -5.913  106.861 1.00 20.00 ? 158 GLN A CA    1 
ATOM 956  C C     . GLN A 1 158 ? 58.316  -5.023  108.091 1.00 20.00 ? 158 GLN A C     1 
ATOM 957  O O     . GLN A 1 158 ? 57.264  -4.688  108.623 1.00 20.00 ? 158 GLN A O     1 
ATOM 958  C CB    . GLN A 1 158 ? 58.637  -5.083  105.622 1.00 20.00 ? 158 GLN A CB    1 
ATOM 959  C CG    . GLN A 1 158 ? 60.073  -5.161  105.155 1.00 20.00 ? 158 GLN A CG    1 
ATOM 960  C CD    . GLN A 1 158 ? 60.370  -4.153  104.068 1.00 20.00 ? 158 GLN A CD    1 
ATOM 961  O OE1   . GLN A 1 158 ? 59.807  -3.063  104.053 1.00 20.00 ? 158 GLN A OE1   1 
ATOM 962  N NE2   . GLN A 1 158 ? 61.215  -4.308  103.063 1.00 20.00 ? 158 GLN A NE2   1 
ATOM 963  N N     . ASP A 1 159 ? 59.500  -4.641  108.544 1.00 20.00 ? 159 ASP A N     1 
ATOM 964  C CA    . ASP A 1 159 ? 59.620  -3.753  109.686 1.00 20.00 ? 159 ASP A CA    1 
ATOM 965  C C     . ASP A 1 159 ? 60.246  -4.427  110.895 1.00 20.00 ? 159 ASP A C     1 
ATOM 966  O O     . ASP A 1 159 ? 59.707  -4.368  111.995 1.00 20.00 ? 159 ASP A O     1 
ATOM 967  C CB    . ASP A 1 159 ? 58.265  -3.183  110.075 1.00 20.00 ? 159 ASP A CB    1 
ATOM 968  C CG    . ASP A 1 159 ? 58.308  -2.461  111.402 1.00 20.00 ? 159 ASP A CG    1 
ATOM 969  O OD1   . ASP A 1 159 ? 58.239  -3.138  112.444 1.00 20.00 ? 159 ASP A OD1   1 
ATOM 970  O OD2   . ASP A 1 159 ? 58.413  -1.222  111.399 1.00 20.00 ? 159 ASP A OD2   1 
ATOM 971  N N     . SER A 1 160 ? 61.384  -5.068  110.695 1.00 12.00 ? 160 SER A N     1 
ATOM 972  C CA    . SER A 1 160 ? 62.095  -5.689  111.796 1.00 12.00 ? 160 SER A CA    1 
ATOM 973  C C     . SER A 1 160 ? 63.070  -4.684  112.375 1.00 12.00 ? 160 SER A C     1 
ATOM 974  O O     . SER A 1 160 ? 63.517  -4.821  113.509 1.00 12.00 ? 160 SER A O     1 
ATOM 975  C CB    . SER A 1 160 ? 62.773  -6.971  111.337 1.00 12.00 ? 160 SER A CB    1 
ATOM 976  O OG    . SER A 1 160 ? 61.840  -8.030  111.254 1.00 20.00 ? 160 SER A OG    1 
ATOM 977  N N     . GLY A 1 161 ? 63.382  -3.685  111.565 1.00 12.00 ? 161 GLY A N     1 
ATOM 978  C CA    . GLY A 1 161 ? 64.231  -2.601  111.982 1.00 12.00 ? 161 GLY A CA    1 
ATOM 979  C C     . GLY A 1 161 ? 63.374  -1.543  112.646 1.00 12.00 ? 161 GLY A C     1 
ATOM 980  O O     . GLY A 1 161 ? 63.696  -0.359  112.599 1.00 12.00 ? 161 GLY A O     1 
ATOM 981  N N     . GLY A 1 162 ? 62.283  -2.020  113.247 1.00 12.00 ? 162 GLY A N     1 
ATOM 982  C CA    . GLY A 1 162 ? 61.325  -1.175  113.935 1.00 12.00 ? 162 GLY A CA    1 
ATOM 983  C C     . GLY A 1 162 ? 60.348  -2.005  114.777 1.00 12.00 ? 162 GLY A C     1 
ATOM 984  O O     . GLY A 1 162 ? 60.745  -2.956  115.446 1.00 12.00 ? 162 GLY A O     1 
ATOM 985  N N     . GLN A 1 163 ? 59.064  -1.638  114.732 1.00 12.00 ? 163 GLN A N     1 
ATOM 986  C CA    . GLN A 1 163 ? 58.023  -2.321  115.506 1.00 12.00 ? 163 GLN A CA    1 
ATOM 987  C C     . GLN A 1 163 ? 57.380  -3.471  114.737 1.00 12.00 ? 163 GLN A C     1 
ATOM 988  O O     . GLN A 1 163 ? 57.199  -4.562  115.274 1.00 12.00 ? 163 GLN A O     1 
ATOM 989  C CB    . GLN A 1 163 ? 56.930  -1.339  115.934 1.00 12.00 ? 163 GLN A CB    1 
ATOM 990  C CG    . GLN A 1 163 ? 57.316  0.121   115.806 1.00 12.00 ? 163 GLN A CG    1 
ATOM 991  C CD    . GLN A 1 163 ? 56.236  0.958   115.155 1.00 12.00 ? 163 GLN A CD    1 
ATOM 992  O OE1   . GLN A 1 163 ? 55.669  0.573   114.137 1.00 12.00 ? 163 GLN A OE1   1 
ATOM 993  N NE2   . GLN A 1 163 ? 55.796  2.135   115.570 1.00 12.00 ? 163 GLN A NE2   1 
ATOM 994  N N     . ALA A 1 164 ? 57.031  -3.219  113.483 1.00 12.00 ? 164 ALA A N     1 
ATOM 995  C CA    . ALA A 1 164 ? 56.401  -4.226  112.639 1.00 12.00 ? 164 ALA A CA    1 
ATOM 996  C C     . ALA A 1 164 ? 55.359  -3.597  111.726 1.00 12.00 ? 164 ALA A C     1 
ATOM 997  O O     . ALA A 1 164 ? 54.363  -3.051  112.188 1.00 12.00 ? 164 ALA A O     1 
ATOM 998  C CB    . ALA A 1 164 ? 55.772  -5.313  113.491 1.00 12.00 ? 164 ALA A CB    1 
ATOM 999  N N     . ILE A 1 165 ? 55.583  -3.670  110.419 1.00 12.00 ? 165 ILE A N     1 
ATOM 1000 C CA    . ILE A 1 165 ? 54.648  -3.092  109.466 1.00 12.00 ? 165 ILE A CA    1 
ATOM 1001 C C     . ILE A 1 165 ? 54.500  -3.945  108.216 1.00 12.00 ? 165 ILE A C     1 
ATOM 1002 O O     . ILE A 1 165 ? 55.483  -4.444  107.676 1.00 12.00 ? 165 ILE A O     1 
ATOM 1003 C CB    . ILE A 1 165 ? 55.066  -1.680  109.037 1.00 12.00 ? 165 ILE A CB    1 
ATOM 1004 C CG1   . ILE A 1 165 ? 55.485  -0.859  110.250 1.00 20.00 ? 165 ILE A CG1   1 
ATOM 1005 C CG2   . ILE A 1 165 ? 53.935  -0.999  108.290 1.00 12.00 ? 165 ILE A CG2   1 
ATOM 1006 C CD1   . ILE A 1 165 ? 54.351  -0.541  111.191 1.00 20.00 ? 165 ILE A CD1   1 
ATOM 1007 N N     . LYS A 1 166 ? 53.258  -4.093  107.777 1.00 12.00 ? 166 LYS A N     1 
ATOM 1008 C CA    . LYS A 1 166 ? 52.953  -4.869  106.589 1.00 12.00 ? 166 LYS A CA    1 
ATOM 1009 C C     . LYS A 1 166 ? 52.630  -3.962  105.413 1.00 12.00 ? 166 LYS A C     1 
ATOM 1010 O O     . LYS A 1 166 ? 51.549  -3.389  105.339 1.00 12.00 ? 166 LYS A O     1 
ATOM 1011 C CB    . LYS A 1 166 ? 51.783  -5.814  106.847 1.00 12.00 ? 166 LYS A CB    1 
ATOM 1012 C CG    . LYS A 1 166 ? 52.021  -6.812  107.962 1.00 12.00 ? 166 LYS A CG    1 
ATOM 1013 C CD    . LYS A 1 166 ? 50.712  -7.343  108.512 1.00 12.00 ? 166 LYS A CD    1 
ATOM 1014 C CE    . LYS A 1 166 ? 50.423  -8.739  107.998 1.00 12.00 ? 166 LYS A CE    1 
ATOM 1015 N NZ    . LYS A 1 166 ? 48.976  -9.063  108.059 1.00 12.00 ? 166 LYS A NZ    1 
ATOM 1016 N N     . ILE A 1 167 ? 53.573  -3.830  104.495 1.00 12.00 ? 167 ILE A N     1 
ATOM 1017 C CA    . ILE A 1 167 ? 53.377  -2.999  103.322 1.00 12.00 ? 167 ILE A CA    1 
ATOM 1018 C C     . ILE A 1 167 ? 52.464  -3.700  102.306 1.00 12.00 ? 167 ILE A C     1 
ATOM 1019 O O     . ILE A 1 167 ? 52.551  -4.915  102.104 1.00 12.00 ? 167 ILE A O     1 
ATOM 1020 C CB    . ILE A 1 167 ? 54.713  -2.651  102.651 1.00 12.00 ? 167 ILE A CB    1 
ATOM 1021 C CG1   . ILE A 1 167 ? 55.513  -1.694  103.526 1.00 12.00 ? 167 ILE A CG1   1 
ATOM 1022 C CG2   . ILE A 1 167 ? 54.478  -2.060  101.276 1.00 12.00 ? 167 ILE A CG2   1 
ATOM 1023 C CD1   . ILE A 1 167 ? 56.851  -1.312  102.945 1.00 20.00 ? 167 ILE A CD1   1 
ATOM 1024 N N     . TYR A 1 168 ? 51.603  -2.910  101.686 1.00 12.00 ? 168 TYR A N     1 
ATOM 1025 C CA    . TYR A 1 168 ? 50.643  -3.410  100.682 1.00 12.00 ? 168 TYR A CA    1 
ATOM 1026 C C     . TYR A 1 168 ? 50.880  -2.759  99.312  1.00 12.00 ? 168 TYR A C     1 
ATOM 1027 O O     . TYR A 1 168 ? 50.834  -1.533  99.174  1.00 12.00 ? 168 TYR A O     1 
ATOM 1028 C CB    . TYR A 1 168 ? 49.203  -3.069  101.079 1.00 12.00 ? 168 TYR A CB    1 
ATOM 1029 C CG    . TYR A 1 168 ? 48.784  -3.575  102.461 1.00 12.00 ? 168 TYR A CG    1 
ATOM 1030 C CD1   . TYR A 1 168 ? 48.255  -4.860  102.612 1.00 12.00 ? 168 TYR A CD1   1 
ATOM 1031 C CD2   . TYR A 1 168 ? 48.917  -2.746  103.576 1.00 12.00 ? 168 TYR A CD2   1 
ATOM 1032 C CE1   . TYR A 1 168 ? 47.861  -5.312  103.874 1.00 12.00 ? 168 TYR A CE1   1 
ATOM 1033 C CE2   . TYR A 1 168 ? 48.523  -3.199  104.837 1.00 12.00 ? 168 TYR A CE2   1 
ATOM 1034 C CZ    . TYR A 1 168 ? 47.995  -4.481  104.986 1.00 12.00 ? 168 TYR A CZ    1 
ATOM 1035 O OH    . TYR A 1 168 ? 47.612  -4.917  106.210 1.00 12.00 ? 168 TYR A OH    1 
ATOM 1036 N N     . ASN A 1 169 ? 51.123  -3.612  98.329  1.00 12.00 ? 169 ASN A N     1 
ATOM 1037 C CA    . ASN A 1 169 ? 51.319  -3.195  96.927  1.00 12.00 ? 169 ASN A CA    1 
ATOM 1038 C C     . ASN A 1 169 ? 50.573  -4.167  96.008  1.00 12.00 ? 169 ASN A C     1 
ATOM 1039 O O     . ASN A 1 169 ? 50.128  -5.235  96.438  1.00 12.00 ? 169 ASN A O     1 
ATOM 1040 C CB    . ASN A 1 169 ? 52.806  -3.145  96.572  1.00 12.00 ? 169 ASN A CB    1 
ATOM 1041 C CG    . ASN A 1 169 ? 53.578  -4.396  96.963  1.00 12.00 ? 169 ASN A CG    1 
ATOM 1042 O OD1   . ASN A 1 169 ? 52.987  -5.359  97.435  1.00 12.00 ? 169 ASN A OD1   1 
ATOM 1043 N ND2   . ASN A 1 169 ? 54.882  -4.440  96.795  1.00 12.00 ? 169 ASN A ND2   1 
ATOM 1044 N N     . ASN A 1 170 ? 50.455  -3.771  94.753  1.00 12.00 ? 170 ASN A N     1 
ATOM 1045 C CA    . ASN A 1 170 ? 49.702  -4.540  93.746  1.00 12.00 ? 170 ASN A CA    1 
ATOM 1046 C C     . ASN A 1 170 ? 50.599  -5.440  92.891  1.00 12.00 ? 170 ASN A C     1 
ATOM 1047 O O     . ASN A 1 170 ? 51.816  -5.238  92.815  1.00 12.00 ? 170 ASN A O     1 
ATOM 1048 C CB    . ASN A 1 170 ? 48.978  -3.595  92.794  1.00 12.00 ? 170 ASN A CB    1 
ATOM 1049 C CG    . ASN A 1 170 ? 48.164  -2.529  93.517  1.00 12.00 ? 170 ASN A CG    1 
ATOM 1050 O OD1   . ASN A 1 170 ? 47.059  -2.803  93.970  1.00 12.00 ? 170 ASN A OD1   1 
ATOM 1051 N ND2   . ASN A 1 170 ? 48.649  -1.314  93.653  1.00 12.00 ? 170 ASN A ND2   1 
ATOM 1052 N N     . ASP A 1 171 ? 49.907  -6.392  92.286  1.00 12.00 ? 171 ASP A N     1 
ATOM 1053 C CA    . ASP A 1 171 ? 50.469  -7.396  91.371  1.00 12.00 ? 171 ASP A CA    1 
ATOM 1054 C C     . ASP A 1 171 ? 49.584  -7.450  90.122  1.00 12.00 ? 171 ASP A C     1 
ATOM 1055 O O     . ASP A 1 171 ? 48.740  -8.341  89.978  1.00 12.00 ? 171 ASP A O     1 
ATOM 1056 C CB    . ASP A 1 171 ? 50.485  -8.763  92.057  1.00 12.00 ? 171 ASP A CB    1 
ATOM 1057 C CG    . ASP A 1 171 ? 51.225  -9.832  91.260  1.00 12.00 ? 171 ASP A CG    1 
ATOM 1058 O OD1   . ASP A 1 171 ? 52.038  -9.490  90.325  1.00 12.00 ? 171 ASP A OD1   1 
ATOM 1059 O OD2   . ASP A 1 171 ? 51.038  -11.076 91.524  1.00 12.00 ? 171 ASP A OD2   1 
ATOM 1060 N N     . LEU A 1 172 ? 49.822  -6.476  89.268  1.00 12.00 ? 172 LEU A N     1 
ATOM 1061 C CA    . LEU A 1 172 ? 49.062  -6.258  88.026  1.00 12.00 ? 172 LEU A CA    1 
ATOM 1062 C C     . LEU A 1 172 ? 49.225  -7.397  87.016  1.00 12.00 ? 172 LEU A C     1 
ATOM 1063 O O     . LEU A 1 172 ? 48.944  -7.236  85.824  1.00 12.00 ? 172 LEU A O     1 
ATOM 1064 C CB    . LEU A 1 172 ? 49.541  -4.986  87.334  1.00 12.00 ? 172 LEU A CB    1 
ATOM 1065 C CG    . LEU A 1 172 ? 49.608  -3.783  88.267  1.00 12.00 ? 172 LEU A CG    1 
ATOM 1066 C CD1   . LEU A 1 172 ? 50.124  -2.525  87.579  1.00 12.00 ? 172 LEU A CD1   1 
ATOM 1067 C CD2   . LEU A 1 172 ? 48.250  -3.410  88.850  1.00 12.00 ? 172 LEU A CD2   1 
ATOM 1068 N N     . THR A 1 173 ? 49.666  -8.538  87.490  1.00 12.00 ? 173 THR A N     1 
ATOM 1069 C CA    . THR A 1 173 ? 49.862  -9.708  86.621  1.00 12.00 ? 173 THR A CA    1 
ATOM 1070 C C     . THR A 1 173 ? 49.139  -10.919 87.180  1.00 12.00 ? 173 THR A C     1 
ATOM 1071 O O     . THR A 1 173 ? 49.055  -11.967 86.531  1.00 12.00 ? 173 THR A O     1 
ATOM 1072 C CB    . THR A 1 173 ? 51.340  -10.057 86.519  1.00 12.00 ? 173 THR A CB    1 
ATOM 1073 O OG1   . THR A 1 173 ? 52.006  -9.695  87.713  1.00 12.00 ? 173 THR A OG1   1 
ATOM 1074 C CG2   . THR A 1 173 ? 52.040  -9.346  85.368  1.00 12.00 ? 173 THR A CG2   1 
ATOM 1075 N N     . ALA A 1 174 ? 48.638  -10.731 88.368  1.00 12.00 ? 174 ALA A N     1 
ATOM 1076 C CA    . ALA A 1 174 ? 47.938  -11.776 89.098  1.00 12.00 ? 174 ALA A CA    1 
ATOM 1077 C C     . ALA A 1 174 ? 46.616  -12.115 88.445  1.00 12.00 ? 174 ALA A C     1 
ATOM 1078 O O     . ALA A 1 174 ? 46.196  -11.476 87.475  1.00 12.00 ? 174 ALA A O     1 
ATOM 1079 C CB    . ALA A 1 174 ? 47.661  -11.319 90.526  1.00 12.00 ? 174 ALA A CB    1 
ATOM 1080 N N     . CYS A 1 175 ? 46.150  -13.715 89.232  1.00 12.00 ? 175 CYS A N     1 
ATOM 1081 C CA    . CYS A 1 175 ? 44.853  -14.153 88.709  1.00 12.00 ? 175 CYS A CA    1 
ATOM 1082 C C     . CYS A 1 175 ? 43.886  -14.406 89.862  1.00 12.00 ? 175 CYS A C     1 
ATOM 1083 O O     . CYS A 1 175 ? 44.260  -14.557 91.017  1.00 12.00 ? 175 CYS A O     1 
ATOM 1084 C CB    . CYS A 1 175 ? 45.023  -15.442 87.912  1.00 12.00 ? 175 CYS A CB    1 
ATOM 1085 S SG    . CYS A 1 175 ? 46.153  -15.259 86.504  1.00 20.00 ? 175 CYS A SG    1 
ATOM 1086 N N     . MET A 1 176 ? 42.597  -14.780 89.250  1.00 12.00 ? 176 MET A N     1 
ATOM 1087 C CA    . MET A 1 176 ? 41.412  -14.972 90.083  1.00 12.00 ? 176 MET A CA    1 
ATOM 1088 C C     . MET A 1 176 ? 40.418  -15.849 89.352  1.00 12.00 ? 176 MET A C     1 
ATOM 1089 O O     . MET A 1 176 ? 39.434  -15.360 88.789  1.00 12.00 ? 176 MET A O     1 
ATOM 1090 C CB    . MET A 1 176 ? 40.718  -13.639 90.340  1.00 12.00 ? 176 MET A CB    1 
ATOM 1091 C CG    . MET A 1 176 ? 39.473  -13.774 91.208  1.00 12.00 ? 176 MET A CG    1 
ATOM 1092 S SD    . MET A 1 176 ? 38.661  -12.223 91.501  1.00 20.00 ? 176 MET A SD    1 
ATOM 1093 C CE    . MET A 1 176 ? 37.233  -12.469 92.521  1.00 20.00 ? 176 MET A CE    1 
ATOM 1094 N N     . MET A 1 177 ? 40.709  -17.118 89.381  1.00 12.00 ? 177 MET A N     1 
ATOM 1095 C CA    . MET A 1 177 ? 39.891  -18.119 88.715  1.00 12.00 ? 177 MET A CA    1 
ATOM 1096 C C     . MET A 1 177 ? 38.425  -18.006 89.071  1.00 12.00 ? 177 MET A C     1 
ATOM 1097 O O     . MET A 1 177 ? 38.062  -18.023 90.244  1.00 12.00 ? 177 MET A O     1 
ATOM 1098 C CB    . MET A 1 177 ? 40.385  -19.514 89.064  1.00 12.00 ? 177 MET A CB    1 
ATOM 1099 C CG    . MET A 1 177 ? 41.833  -19.564 89.507  1.00 12.00 ? 177 MET A CG    1 
ATOM 1100 S SD    . MET A 1 177 ? 42.568  -21.189 89.294  1.00 12.00 ? 177 MET A SD    1 
ATOM 1101 C CE    . MET A 1 177 ? 44.303  -20.771 89.250  1.00 12.00 ? 177 MET A CE    1 
ATOM 1102 N N     . VAL A 1 178 ? 37.608  -17.898 88.041  1.00 12.00 ? 178 VAL A N     1 
ATOM 1103 C CA    . VAL A 1 178 ? 36.173  -17.831 88.208  1.00 12.00 ? 178 VAL A CA    1 
ATOM 1104 C C     . VAL A 1 178 ? 35.522  -19.000 87.497  1.00 12.00 ? 178 VAL A C     1 
ATOM 1105 O O     . VAL A 1 178 ? 35.693  -19.178 86.297  1.00 12.00 ? 178 VAL A O     1 
ATOM 1106 C CB    . VAL A 1 178 ? 35.603  -16.505 87.687  1.00 12.00 ? 178 VAL A CB    1 
ATOM 1107 C CG1   . VAL A 1 178 ? 34.089  -16.517 87.752  1.00 12.00 ? 178 VAL A CG1   1 
ATOM 1108 C CG2   . VAL A 1 178 ? 36.167  -15.338 88.471  1.00 12.00 ? 178 VAL A CG2   1 
ATOM 1109 N N     . ALA A 1 179 ? 34.779  -19.805 88.236  1.00 12.00 ? 179 ALA A N     1 
ATOM 1110 C CA    . ALA A 1 179 ? 34.123  -20.961 87.656  1.00 12.00 ? 179 ALA A CA    1 
ATOM 1111 C C     . ALA A 1 179 ? 32.622  -20.913 87.873  1.00 12.00 ? 179 ALA A C     1 
ATOM 1112 O O     . ALA A 1 179 ? 32.154  -20.895 89.006  1.00 12.00 ? 179 ALA A O     1 
ATOM 1113 C CB    . ALA A 1 179 ? 34.700  -22.239 88.227  1.00 12.00 ? 179 ALA A CB    1 
ATOM 1114 N N     . VAL A 1 180 ? 31.880  -20.892 86.779  1.00 12.00 ? 180 VAL A N     1 
ATOM 1115 C CA    . VAL A 1 180 ? 30.432  -20.854 86.852  1.00 12.00 ? 180 VAL A CA    1 
ATOM 1116 C C     . VAL A 1 180 ? 29.837  -22.204 86.501  1.00 12.00 ? 180 VAL A C     1 
ATOM 1117 O O     . VAL A 1 180 ? 29.678  -22.536 85.331  1.00 12.00 ? 180 VAL A O     1 
ATOM 1118 C CB    . VAL A 1 180 ? 29.853  -19.775 85.928  1.00 12.00 ? 180 VAL A CB    1 
ATOM 1119 C CG1   . VAL A 1 180 ? 28.360  -19.970 85.755  1.00 20.00 ? 180 VAL A CG1   1 
ATOM 1120 C CG2   . VAL A 1 180 ? 30.157  -18.393 86.471  1.00 20.00 ? 180 VAL A CG2   1 
ATOM 1121 N N     . ASP A 1 181 ? 29.508  -22.988 87.515  1.00 12.00 ? 181 ASP A N     1 
ATOM 1122 C CA    . ASP A 1 181 ? 28.940  -24.302 87.287  1.00 12.00 ? 181 ASP A CA    1 
ATOM 1123 C C     . ASP A 1 181 ? 27.438  -24.257 87.120  1.00 12.00 ? 181 ASP A C     1 
ATOM 1124 O O     . ASP A 1 181 ? 26.696  -24.272 88.097  1.00 12.00 ? 181 ASP A O     1 
ATOM 1125 C CB    . ASP A 1 181 ? 29.268  -25.266 88.415  1.00 12.00 ? 181 ASP A CB    1 
ATOM 1126 C CG    . ASP A 1 181 ? 28.391  -26.499 88.370  1.00 12.00 ? 181 ASP A CG    1 
ATOM 1127 O OD1   . ASP A 1 181 ? 28.433  -27.220 87.355  1.00 12.00 ? 181 ASP A OD1   1 
ATOM 1128 O OD2   . ASP A 1 181 ? 27.657  -26.741 89.346  1.00 12.00 ? 181 ASP A OD2   1 
ATOM 1129 N N     . SER A 1 182 ? 26.997  -24.199 85.878  1.00 12.00 ? 182 SER A N     1 
ATOM 1130 C CA    . SER A 1 182 ? 25.583  -24.219 85.579  1.00 12.00 ? 182 SER A CA    1 
ATOM 1131 C C     . SER A 1 182 ? 25.168  -25.639 85.273  1.00 12.00 ? 182 SER A C     1 
ATOM 1132 O O     . SER A 1 182 ? 24.106  -26.088 85.689  1.00 12.00 ? 182 SER A O     1 
ATOM 1133 C CB    . SER A 1 182 ? 25.263  -23.271 84.434  1.00 12.00 ? 182 SER A CB    1 
ATOM 1134 O OG    . SER A 1 182 ? 26.141  -23.469 83.349  1.00 12.00 ? 182 SER A OG    1 
ATOM 1135 N N     . ASN A 1 183 ? 26.019  -26.342 84.539  1.00 12.00 ? 183 ASN A N     1 
ATOM 1136 C CA    . ASN A 1 183 ? 25.761  -27.728 84.238  1.00 12.00 ? 183 ASN A CA    1 
ATOM 1137 C C     . ASN A 1 183 ? 25.369  -28.431 85.516  1.00 12.00 ? 183 ASN A C     1 
ATOM 1138 O O     . ASN A 1 183 ? 25.208  -29.646 85.539  1.00 12.00 ? 183 ASN A O     1 
ATOM 1139 C CB    . ASN A 1 183 ? 26.986  -28.368 83.594  1.00 12.00 ? 183 ASN A CB    1 
ATOM 1140 C CG    . ASN A 1 183 ? 26.841  -28.538 82.102  1.00 12.00 ? 183 ASN A CG    1 
ATOM 1141 O OD1   . ASN A 1 183 ? 27.828  -28.638 81.380  1.00 12.00 ? 183 ASN A OD1   1 
ATOM 1142 N ND2   . ASN A 1 183 ? 25.604  -28.570 81.632  1.00 12.00 ? 183 ASN A ND2   1 
ATOM 1143 N N     . ASN A 1 184 ? 25.225  -27.628 86.563  1.00 12.00 ? 184 ASN A N     1 
ATOM 1144 C CA    . ASN A 1 184 ? 24.873  -28.122 87.876  1.00 12.00 ? 184 ASN A CA    1 
ATOM 1145 C C     . ASN A 1 184 ? 25.362  -29.544 88.058  1.00 12.00 ? 184 ASN A C     1 
ATOM 1146 O O     . ASN A 1 184 ? 24.584  -30.440 88.369  1.00 12.00 ? 184 ASN A O     1 
ATOM 1147 C CB    . ASN A 1 184 ? 23.372  -28.003 88.108  1.00 12.00 ? 184 ASN A CB    1 
ATOM 1148 C CG    . ASN A 1 184 ? 23.021  -26.821 88.986  1.00 12.00 ? 184 ASN A CG    1 
ATOM 1149 O OD1   . ASN A 1 184 ? 23.196  -26.865 90.200  1.00 12.00 ? 184 ASN A OD1   1 
ATOM 1150 N ND2   . ASN A 1 184 ? 22.526  -25.757 88.373  1.00 12.00 ? 184 ASN A ND2   1 
ATOM 1151 N N     . ILE A 1 185 ? 26.657  -29.723 87.852  1.00 12.00 ? 185 ILE A N     1 
ATOM 1152 C CA    . ILE A 1 185 ? 27.296  -31.017 88.009  1.00 12.00 ? 185 ILE A CA    1 
ATOM 1153 C C     . ILE A 1 185 ? 27.594  -31.278 89.470  1.00 12.00 ? 185 ILE A C     1 
ATOM 1154 O O     . ILE A 1 185 ? 27.339  -32.365 89.979  1.00 12.00 ? 185 ILE A O     1 
ATOM 1155 C CB    . ILE A 1 185 ? 28.598  -31.094 87.201  1.00 12.00 ? 185 ILE A CB    1 
ATOM 1156 C CG1   . ILE A 1 185 ? 28.350  -30.695 85.752  1.00 20.00 ? 185 ILE A CG1   1 
ATOM 1157 C CG2   . ILE A 1 185 ? 29.194  -32.484 87.286  1.00 12.00 ? 185 ILE A CG2   1 
ATOM 1158 C CD1   . ILE A 1 185 ? 29.612  -30.524 84.944  1.00 20.00 ? 185 ILE A CD1   1 
ATOM 1159 N N     . LEU A 1 186 ? 28.136  -30.264 90.124  1.00 12.00 ? 186 LEU A N     1 
ATOM 1160 C CA    . LEU A 1 186 ? 28.451  -30.350 91.534  1.00 12.00 ? 186 LEU A CA    1 
ATOM 1161 C C     . LEU A 1 186 ? 27.186  -30.268 92.360  1.00 12.00 ? 186 LEU A C     1 
ATOM 1162 O O     . LEU A 1 186 ? 26.116  -29.962 91.844  1.00 12.00 ? 186 LEU A O     1 
ATOM 1163 C CB    . LEU A 1 186 ? 29.420  -29.238 91.931  1.00 12.00 ? 186 LEU A CB    1 
ATOM 1164 C CG    . LEU A 1 186 ? 30.753  -29.206 91.194  1.00 12.00 ? 186 LEU A CG    1 
ATOM 1165 C CD1   . LEU A 1 186 ? 31.588  -28.026 91.648  1.00 20.00 ? 186 LEU A CD1   1 
ATOM 1166 C CD2   . LEU A 1 186 ? 31.507  -30.505 91.401  1.00 20.00 ? 186 LEU A CD2   1 
ATOM 1167 N N     . PRO A 1 187 ? 27.273  -30.536 93.661  1.00 12.00 ? 187 PRO A N     1 
ATOM 1168 C CA    . PRO A 1 187 ? 26.119  -30.457 94.538  1.00 12.00 ? 187 PRO A CA    1 
ATOM 1169 C C     . PRO A 1 187 ? 25.626  -29.036 94.562  1.00 12.00 ? 187 PRO A C     1 
ATOM 1170 O O     . PRO A 1 187 ? 26.282  -28.149 93.941  1.00 12.00 ? 187 PRO A O     1 
ATOM 1171 C CB    . PRO A 1 187 ? 26.686  -30.812 95.909  1.00 12.00 ? 187 PRO A CB    1 
ATOM 1172 C CG    . PRO A 1 187 ? 27.935  -31.550 95.612  1.00 12.00 ? 187 PRO A CG    1 
ATOM 1173 C CD    . PRO A 1 187 ? 28.486  -30.927 94.372  1.00 12.00 ? 187 PRO A CD    1 
ATOM 1174 N N     . TYR A 1 188 ? 24.516  -28.854 95.250  1.00 12.00 ? 188 TYR A N     1 
ATOM 1175 C CA    . TYR A 1 188 ? 23.870  -27.539 95.417  1.00 12.00 ? 188 TYR A CA    1 
ATOM 1176 C C     . TYR A 1 188 ? 23.899  -27.154 96.895  1.00 12.00 ? 188 TYR A C     1 
ATOM 1177 O O     . TYR A 1 188 ? 23.145  -27.697 97.708  1.00 12.00 ? 188 TYR A O     1 
ATOM 1178 C CB    . TYR A 1 188 ? 22.423  -27.611 94.935  1.00 12.00 ? 188 TYR A CB    1 
ATOM 1179 C CG    . TYR A 1 188 ? 21.834  -26.252 94.562  1.00 12.00 ? 188 TYR A CG    1 
ATOM 1180 C CD1   . TYR A 1 188 ? 22.049  -25.720 93.289  1.00 12.00 ? 188 TYR A CD1   1 
ATOM 1181 C CD2   . TYR A 1 188 ? 21.075  -25.540 95.493  1.00 12.00 ? 188 TYR A CD2   1 
ATOM 1182 C CE1   . TYR A 1 188 ? 21.507  -24.479 92.949  1.00 12.00 ? 188 TYR A CE1   1 
ATOM 1183 C CE2   . TYR A 1 188 ? 20.533  -24.300 95.152  1.00 12.00 ? 188 TYR A CE2   1 
ATOM 1184 C CZ    . TYR A 1 188 ? 20.749  -23.770 93.881  1.00 12.00 ? 188 TYR A CZ    1 
ATOM 1185 O OH    . TYR A 1 188 ? 20.221  -22.565 93.550  1.00 20.00 ? 188 TYR A OH    1 
ATOM 1186 N N     . THR A 1 189 ? 24.775  -26.219 97.205  1.00 12.00 ? 189 THR A N     1 
ATOM 1187 C CA    . THR A 1 189 ? 24.983  -25.759 98.584  1.00 12.00 ? 189 THR A CA    1 
ATOM 1188 C C     . THR A 1 189 ? 24.437  -24.353 98.806  1.00 12.00 ? 189 THR A C     1 
ATOM 1189 O O     . THR A 1 189 ? 25.190  -23.372 98.822  1.00 12.00 ? 189 THR A O     1 
ATOM 1190 C CB    . THR A 1 189 ? 26.472  -25.724 98.906  1.00 12.00 ? 189 THR A CB    1 
ATOM 1191 O OG1   . THR A 1 189 ? 27.159  -24.948 97.940  1.00 12.00 ? 189 THR A OG1   1 
ATOM 1192 C CG2   . THR A 1 189 ? 27.112  -27.107 98.917  1.00 12.00 ? 189 THR A CG2   1 
ATOM 1193 N N     . PRO A 1 190 ? 23.127  -24.170 98.990  1.00 12.00 ? 190 PRO A N     1 
ATOM 1194 C CA    . PRO A 1 190 ? 22.588  -22.856 99.251  1.00 12.00 ? 190 PRO A CA    1 
ATOM 1195 C C     . PRO A 1 190 ? 23.177  -22.339 100.536 1.00 12.00 ? 190 PRO A C     1 
ATOM 1196 O O     . PRO A 1 190 ? 22.692  -22.735 101.636 1.00 12.00 ? 190 PRO A O     1 
ATOM 1197 C CB    . PRO A 1 190 ? 21.108  -23.089 99.381  1.00 12.00 ? 190 PRO A CB    1 
ATOM 1198 C CG    . PRO A 1 190 ? 20.859  -24.576 99.184  1.00 12.00 ? 190 PRO A CG    1 
ATOM 1199 C CD    . PRO A 1 190 ? 22.165  -25.261 98.934  1.00 12.00 ? 190 PRO A CD    1 
ATOM 1200 N N     . ALA A 1 191 ? 24.180  -21.498 100.379 1.00 12.00 ? 191 ALA A N     1 
ATOM 1201 C CA    . ALA A 1 191 ? 24.925  -20.903 101.502 1.00 12.00 ? 191 ALA A CA    1 
ATOM 1202 C C     . ALA A 1 191 ? 23.985  -20.240 102.512 1.00 12.00 ? 191 ALA A C     1 
ATOM 1203 O O     . ALA A 1 191 ? 24.311  -20.110 103.697 1.00 12.00 ? 191 ALA A O     1 
ATOM 1204 C CB    . ALA A 1 191 ? 25.895  -19.848 100.988 1.00 12.00 ? 191 ALA A CB    1 
ATOM 1205 N N     . ALA A 1 192 ? 22.838  -19.825 102.018 1.00 12.00 ? 192 ALA A N     1 
ATOM 1206 C CA    . ALA A 1 192 ? 21.814  -19.184 102.852 1.00 12.00 ? 192 ALA A CA    1 
ATOM 1207 C C     . ALA A 1 192 ? 21.382  -20.160 103.938 1.00 12.00 ? 192 ALA A C     1 
ATOM 1208 O O     . ALA A 1 192 ? 20.685  -19.786 104.889 1.00 12.00 ? 192 ALA A O     1 
ATOM 1209 C CB    . ALA A 1 192 ? 20.610  -18.801 102.000 1.00 12.00 ? 192 ALA A CB    1 
ATOM 1210 N N     . ASN A 1 193 ? 21.832  -21.377 103.725 1.00 12.00 ? 193 ASN A N     1 
ATOM 1211 C CA    . ASN A 1 193 ? 21.586  -22.513 104.613 1.00 12.00 ? 193 ASN A CA    1 
ATOM 1212 C C     . ASN A 1 193 ? 22.223  -22.249 105.974 1.00 12.00 ? 193 ASN A C     1 
ATOM 1213 O O     . ASN A 1 193 ? 21.536  -22.201 107.000 1.00 12.00 ? 193 ASN A O     1 
ATOM 1214 C CB    . ASN A 1 193 ? 22.228  -23.762 104.016 1.00 12.00 ? 193 ASN A CB    1 
ATOM 1215 C CG    . ASN A 1 193 ? 21.359  -25.006 104.161 1.00 12.00 ? 193 ASN A CG    1 
ATOM 1216 O OD1   . ASN A 1 193 ? 21.465  -25.924 103.356 1.00 20.00 ? 193 ASN A OD1   1 
ATOM 1217 N ND2   . ASN A 1 193 ? 20.495  -25.093 105.147 1.00 20.00 ? 193 ASN A ND2   1 
ATOM 1218 N N     . SER A 1 194 ? 23.532  -22.088 105.922 1.00 12.00 ? 194 SER A N     1 
ATOM 1219 C CA    . SER A 1 194 ? 24.362  -21.833 107.104 1.00 12.00 ? 194 SER A CA    1 
ATOM 1220 C C     . SER A 1 194 ? 24.639  -20.338 107.247 1.00 12.00 ? 194 SER A C     1 
ATOM 1221 O O     . SER A 1 194 ? 25.712  -19.931 107.706 1.00 12.00 ? 194 SER A O     1 
ATOM 1222 C CB    . SER A 1 194 ? 25.692  -22.568 106.976 1.00 12.00 ? 194 SER A CB    1 
ATOM 1223 O OG    . SER A 1 194 ? 26.284  -22.283 105.723 1.00 20.00 ? 194 SER A OG    1 
ATOM 1224 N N     . MET A 1 195 ? 23.650  -19.571 106.844 1.00 12.00 ? 195 MET A N     1 
ATOM 1225 C CA    . MET A 1 195 ? 23.692  -18.105 106.903 1.00 12.00 ? 195 MET A CA    1 
ATOM 1226 C C     . MET A 1 195 ? 25.052  -17.584 106.441 1.00 12.00 ? 195 MET A C     1 
ATOM 1227 O O     . MET A 1 195 ? 25.704  -16.801 107.141 1.00 12.00 ? 195 MET A O     1 
ATOM 1228 C CB    . MET A 1 195 ? 23.447  -17.635 108.332 1.00 12.00 ? 195 MET A CB    1 
ATOM 1229 C CG    . MET A 1 195 ? 22.136  -18.153 108.913 1.00 20.00 ? 195 MET A CG    1 
ATOM 1230 S SD    . MET A 1 195 ? 20.786  -18.066 107.763 1.00 20.00 ? 195 MET A SD    1 
ATOM 1231 C CE    . MET A 1 195 ? 20.154  -16.411 107.694 1.00 20.00 ? 195 MET A CE    1 
ATOM 1232 N N     . GLU A 1 196 ? 25.433  -18.039 105.267 1.00 12.00 ? 196 GLU A N     1 
ATOM 1233 C CA    . GLU A 1 196 ? 26.696  -17.655 104.626 1.00 12.00 ? 196 GLU A CA    1 
ATOM 1234 C C     . GLU A 1 196 ? 26.420  -17.102 103.232 1.00 12.00 ? 196 GLU A C     1 
ATOM 1235 O O     . GLU A 1 196 ? 26.656  -17.773 102.224 1.00 12.00 ? 196 GLU A O     1 
ATOM 1236 C CB    . GLU A 1 196 ? 27.608  -18.870 104.480 1.00 12.00 ? 196 GLU A CB    1 
ATOM 1237 C CG    . GLU A 1 196 ? 28.031  -19.480 105.811 1.00 12.00 ? 196 GLU A CG    1 
ATOM 1238 C CD    . GLU A 1 196 ? 28.988  -20.655 105.641 1.00 12.00 ? 196 GLU A CD    1 
ATOM 1239 O OE1   . GLU A 1 196 ? 29.470  -20.929 104.481 1.00 12.00 ? 196 GLU A OE1   1 
ATOM 1240 O OE2   . GLU A 1 196 ? 29.315  -21.371 106.657 1.00 12.00 ? 196 GLU A OE2   1 
ATOM 1241 N N     . THR A 1 197 ? 25.925  -15.882 103.212 1.00 12.00 ? 197 THR A N     1 
ATOM 1242 C CA    . THR A 1 197 ? 25.575  -15.196 101.965 1.00 12.00 ? 197 THR A CA    1 
ATOM 1243 C C     . THR A 1 197 ? 26.384  -13.912 101.805 1.00 12.00 ? 197 THR A C     1 
ATOM 1244 O O     . THR A 1 197 ? 27.473  -13.770 102.373 1.00 12.00 ? 197 THR A O     1 
ATOM 1245 C CB    . THR A 1 197 ? 24.094  -14.843 101.961 1.00 12.00 ? 197 THR A CB    1 
ATOM 1246 O OG1   . THR A 1 197 ? 23.318  -16.014 102.135 1.00 12.00 ? 197 THR A OG1   1 
ATOM 1247 C CG2   . THR A 1 197 ? 23.642  -14.185 100.662 1.00 12.00 ? 197 THR A CG2   1 
ATOM 1248 N N     . LEU A 1 198 ? 25.809  -13.018 101.024 1.00 12.00 ? 198 LEU A N     1 
ATOM 1249 C CA    . LEU A 1 198 ? 26.409  -11.717 100.714 1.00 12.00 ? 198 LEU A CA    1 
ATOM 1250 C C     . LEU A 1 198 ? 25.722  -10.617 101.519 1.00 12.00 ? 198 LEU A C     1 
ATOM 1251 O O     . LEU A 1 198 ? 24.502  -10.638 101.713 1.00 12.00 ? 198 LEU A O     1 
ATOM 1252 C CB    . LEU A 1 198 ? 26.271  -11.423 99.224  1.00 12.00 ? 198 LEU A CB    1 
ATOM 1253 C CG    . LEU A 1 198 ? 27.350  -12.095 98.382  1.00 12.00 ? 198 LEU A CG    1 
ATOM 1254 C CD1   . LEU A 1 198 ? 26.853  -13.343 97.663  1.00 12.00 ? 198 LEU A CD1   1 
ATOM 1255 C CD2   . LEU A 1 198 ? 27.907  -11.185 97.293  1.00 12.00 ? 198 LEU A CD2   1 
ATOM 1256 N N     . GLY A 1 199 ? 26.548  -9.689  101.959 1.00 12.00 ? 199 GLY A N     1 
ATOM 1257 C CA    . GLY A 1 199 ? 26.120  -8.540  102.764 1.00 12.00 ? 199 GLY A CA    1 
ATOM 1258 C C     . GLY A 1 199 ? 24.776  -8.011  102.275 1.00 12.00 ? 199 GLY A C     1 
ATOM 1259 O O     . GLY A 1 199 ? 24.458  -8.084  101.084 1.00 12.00 ? 199 GLY A O     1 
ATOM 1260 N N     . PHE A 1 200 ? 24.033  -7.491  103.231 1.00 12.00 ? 200 PHE A N     1 
ATOM 1261 C CA    . PHE A 1 200 ? 22.706  -6.917  102.995 1.00 12.00 ? 200 PHE A CA    1 
ATOM 1262 C C     . PHE A 1 200 ? 22.818  -5.403  102.854 1.00 12.00 ? 200 PHE A C     1 
ATOM 1263 O O     . PHE A 1 200 ? 22.025  -4.767  102.153 1.00 12.00 ? 200 PHE A O     1 
ATOM 1264 C CB    . PHE A 1 200 ? 21.781  -7.253  104.159 1.00 12.00 ? 200 PHE A CB    1 
ATOM 1265 C CG    . PHE A 1 200 ? 21.293  -8.697  104.127 1.00 12.00 ? 200 PHE A CG    1 
ATOM 1266 C CD1   . PHE A 1 200 ? 21.990  -9.651  103.387 1.00 12.00 ? 200 PHE A CD1   1 
ATOM 1267 C CD2   . PHE A 1 200 ? 20.149  -9.064  104.835 1.00 12.00 ? 200 PHE A CD2   1 
ATOM 1268 C CE1   . PHE A 1 200 ? 21.544  -10.973 103.356 1.00 12.00 ? 200 PHE A CE1   1 
ATOM 1269 C CE2   . PHE A 1 200 ? 19.701  -10.385 104.804 1.00 12.00 ? 200 PHE A CE2   1 
ATOM 1270 C CZ    . PHE A 1 200 ? 20.399  -11.339 104.064 1.00 12.00 ? 200 PHE A CZ    1 
ATOM 1271 N N     . TYR A 1 201 ? 23.810  -4.880  103.539 1.00 12.00 ? 201 TYR A N     1 
ATOM 1272 C CA    . TYR A 1 201 ? 24.121  -3.450  103.530 1.00 12.00 ? 201 TYR A CA    1 
ATOM 1273 C C     . TYR A 1 201 ? 25.018  -3.178  102.324 1.00 12.00 ? 201 TYR A C     1 
ATOM 1274 O O     . TYR A 1 201 ? 26.227  -3.442  102.360 1.00 12.00 ? 201 TYR A O     1 
ATOM 1275 C CB    . TYR A 1 201 ? 24.751  -3.090  104.867 1.00 12.00 ? 201 TYR A CB    1 
ATOM 1276 C CG    . TYR A 1 201 ? 23.862  -3.522  106.033 1.00 12.00 ? 201 TYR A CG    1 
ATOM 1277 C CD1   . TYR A 1 201 ? 22.678  -2.832  106.299 1.00 12.00 ? 201 TYR A CD1   1 
ATOM 1278 C CD2   . TYR A 1 201 ? 24.220  -4.613  106.829 1.00 12.00 ? 201 TYR A CD2   1 
ATOM 1279 C CE1   . TYR A 1 201 ? 21.855  -3.231  107.352 1.00 12.00 ? 201 TYR A CE1   1 
ATOM 1280 C CE2   . TYR A 1 201 ? 23.395  -5.014  107.881 1.00 12.00 ? 201 TYR A CE2   1 
ATOM 1281 C CZ    . TYR A 1 201 ? 22.211  -4.323  108.143 1.00 12.00 ? 201 TYR A CZ    1 
ATOM 1282 O OH    . TYR A 1 201 ? 21.409  -4.712  109.164 1.00 12.00 ? 201 TYR A OH    1 
ATOM 1283 N N     . PRO A 1 202 ? 24.440  -2.649  101.240 1.00 12.00 ? 202 PRO A N     1 
ATOM 1284 C CA    . PRO A 1 202 ? 25.145  -2.442  99.982  1.00 12.00 ? 202 PRO A CA    1 
ATOM 1285 C C     . PRO A 1 202 ? 26.354  -1.540  100.075 1.00 12.00 ? 202 PRO A C     1 
ATOM 1286 O O     . PRO A 1 202 ? 27.104  -1.411  99.064  1.00 12.00 ? 202 PRO A O     1 
ATOM 1287 C CB    . PRO A 1 202 ? 24.112  -1.833  99.075  1.00 12.00 ? 202 PRO A CB    1 
ATOM 1288 C CG    . PRO A 1 202 ? 22.819  -1.715  99.854  1.00 12.00 ? 202 PRO A CG    1 
ATOM 1289 C CD    . PRO A 1 202 ? 23.038  -2.236  101.233 1.00 12.00 ? 202 PRO A CD    1 
ATOM 1290 N N     . TRP A 1 203 ? 26.573  -0.926  101.216 1.00 12.00 ? 203 TRP A N     1 
ATOM 1291 C CA    . TRP A 1 203 ? 27.724  -0.015  101.379 1.00 12.00 ? 203 TRP A CA    1 
ATOM 1292 C C     . TRP A 1 203 ? 28.684  -0.551  102.435 1.00 12.00 ? 203 TRP A C     1 
ATOM 1293 O O     . TRP A 1 203 ? 29.382  0.215   103.108 1.00 12.00 ? 203 TRP A O     1 
ATOM 1294 C CB    . TRP A 1 203 ? 27.255  1.368   101.816 1.00 12.00 ? 203 TRP A CB    1 
ATOM 1295 C CG    . TRP A 1 203 ? 26.679  1.378   103.229 1.00 12.00 ? 203 TRP A CG    1 
ATOM 1296 C CD1   . TRP A 1 203 ? 27.319  1.696   104.357 1.00 12.00 ? 203 TRP A CD1   1 
ATOM 1297 C CD2   . TRP A 1 203 ? 25.347  1.043   103.566 1.00 12.00 ? 203 TRP A CD2   1 
ATOM 1298 N NE1   . TRP A 1 203 ? 26.381  1.560   105.424 1.00 12.00 ? 203 TRP A NE1   1 
ATOM 1299 C CE2   . TRP A 1 203 ? 25.233  1.176   104.939 1.00 12.00 ? 203 TRP A CE2   1 
ATOM 1300 C CE3   . TRP A 1 203 ? 24.237  0.640   102.826 1.00 12.00 ? 203 TRP A CE3   1 
ATOM 1301 C CZ2   . TRP A 1 203 ? 24.049  0.924   105.632 1.00 12.00 ? 203 TRP A CZ2   1 
ATOM 1302 C CZ3   . TRP A 1 203 ? 23.048  0.390   103.533 1.00 12.00 ? 203 TRP A CZ3   1 
ATOM 1303 C CH2   . TRP A 1 203 ? 22.961  0.525   104.870 1.00 12.00 ? 203 TRP A CH2   1 
ATOM 1304 N N     . LYS A 1 204 ? 28.690  -1.860  102.546 1.00 12.00 ? 204 LYS A N     1 
ATOM 1305 C CA    . LYS A 1 204 ? 29.544  -2.574  103.499 1.00 12.00 ? 204 LYS A CA    1 
ATOM 1306 C C     . LYS A 1 204 ? 30.193  -3.772  102.817 1.00 12.00 ? 204 LYS A C     1 
ATOM 1307 O O     . LYS A 1 204 ? 29.508  -4.706  102.386 1.00 12.00 ? 204 LYS A O     1 
ATOM 1308 C CB    . LYS A 1 204 ? 28.713  -3.061  104.681 1.00 12.00 ? 204 LYS A CB    1 
ATOM 1309 C CG    . LYS A 1 204 ? 28.218  -1.925  105.570 1.00 12.00 ? 204 LYS A CG    1 
ATOM 1310 C CD    . LYS A 1 204 ? 29.323  -0.950  105.960 1.00 12.00 ? 204 LYS A CD    1 
ATOM 1311 C CE    . LYS A 1 204 ? 30.279  -1.519  107.001 1.00 12.00 ? 204 LYS A CE    1 
ATOM 1312 N NZ    . LYS A 1 204 ? 31.295  -0.555  107.433 1.00 12.00 ? 204 LYS A NZ    1 
ATOM 1313 N N     . PRO A 1 205 ? 31.523  -3.807  102.688 1.00 12.00 ? 205 PRO A N     1 
ATOM 1314 C CA    . PRO A 1 205 ? 32.192  -4.919  102.042 1.00 12.00 ? 205 PRO A CA    1 
ATOM 1315 C C     . PRO A 1 205 ? 31.887  -6.205  102.766 1.00 12.00 ? 205 PRO A C     1 
ATOM 1316 O O     . PRO A 1 205 ? 31.969  -6.233  104.027 1.00 12.00 ? 205 PRO A O     1 
ATOM 1317 C CB    . PRO A 1 205 ? 33.649  -4.556  102.116 1.00 12.00 ? 205 PRO A CB    1 
ATOM 1318 C CG    . PRO A 1 205 ? 33.762  -3.214  102.814 1.00 12.00 ? 205 PRO A CG    1 
ATOM 1319 C CD    . PRO A 1 205 ? 32.394  -2.743  103.175 1.00 12.00 ? 205 PRO A CD    1 
ATOM 1320 N N     . THR A 1 206 ? 31.550  -7.216  101.976 1.00 12.00 ? 206 THR A N     1 
ATOM 1321 C CA    . THR A 1 206 ? 31.216  -8.562  102.483 1.00 12.00 ? 206 THR A CA    1 
ATOM 1322 C C     . THR A 1 206 ? 32.237  -9.586  101.978 1.00 12.00 ? 206 THR A C     1 
ATOM 1323 O O     . THR A 1 206 ? 33.248  -9.227  101.364 1.00 12.00 ? 206 THR A O     1 
ATOM 1324 C CB    . THR A 1 206 ? 29.825  -8.976  102.009 1.00 12.00 ? 206 THR A CB    1 
ATOM 1325 O OG1   . THR A 1 206 ? 29.637  -10.364 102.214 1.00 12.00 ? 206 THR A OG1   1 
ATOM 1326 C CG2   . THR A 1 206 ? 29.591  -8.698  100.530 1.00 12.00 ? 206 THR A CG2   1 
ATOM 1327 N N     . ILE A 1 207 ? 31.944  -10.846 102.253 1.00 12.00 ? 207 ILE A N     1 
ATOM 1328 C CA    . ILE A 1 207 ? 32.814  -11.967 101.863 1.00 12.00 ? 207 ILE A CA    1 
ATOM 1329 C C     . ILE A 1 207 ? 31.995  -13.138 101.318 1.00 12.00 ? 207 ILE A C     1 
ATOM 1330 O O     . ILE A 1 207 ? 30.775  -13.204 101.502 1.00 12.00 ? 207 ILE A O     1 
ATOM 1331 C CB    . ILE A 1 207 ? 33.611  -12.456 103.069 1.00 12.00 ? 207 ILE A CB    1 
ATOM 1332 C CG1   . ILE A 1 207 ? 32.752  -12.647 104.314 1.00 12.00 ? 207 ILE A CG1   1 
ATOM 1333 C CG2   . ILE A 1 207 ? 34.722  -11.495 103.477 1.00 12.00 ? 207 ILE A CG2   1 
ATOM 1334 C CD1   . ILE A 1 207 ? 33.545  -12.514 105.609 1.00 12.00 ? 207 ILE A CD1   1 
ATOM 1335 N N     . ALA A 1 208 ? 32.718  -14.029 100.660 1.00 12.00 ? 208 ALA A N     1 
ATOM 1336 C CA    . ALA A 1 208 ? 32.153  -15.233 100.037 1.00 12.00 ? 208 ALA A CA    1 
ATOM 1337 C C     . ALA A 1 208 ? 32.076  -16.365 101.055 1.00 12.00 ? 208 ALA A C     1 
ATOM 1338 O O     . ALA A 1 208 ? 32.269  -16.156 102.256 1.00 12.00 ? 208 ALA A O     1 
ATOM 1339 C CB    . ALA A 1 208 ? 33.029  -15.677 98.871  1.00 12.00 ? 208 ALA A CB    1 
ATOM 1340 N N     . SER A 1 209 ? 31.795  -17.539 100.531 1.00 12.00 ? 209 SER A N     1 
ATOM 1341 C CA    . SER A 1 209 ? 31.667  -18.758 101.332 1.00 12.00 ? 209 SER A CA    1 
ATOM 1342 C C     . SER A 1 209 ? 32.485  -19.885 100.711 1.00 12.00 ? 209 SER A C     1 
ATOM 1343 O O     . SER A 1 209 ? 32.221  -20.315 99.582  1.00 12.00 ? 209 SER A O     1 
ATOM 1344 C CB    . SER A 1 209 ? 30.206  -19.188 101.394 1.00 12.00 ? 209 SER A CB    1 
ATOM 1345 O OG    . SER A 1 209 ? 30.097  -20.449 102.027 1.00 20.00 ? 209 SER A OG    1 
ATOM 1346 N N     . PRO A 1 210 ? 33.500  -20.414 101.405 1.00 12.00 ? 210 PRO A N     1 
ATOM 1347 C CA    . PRO A 1 210 ? 34.297  -21.492 100.862 1.00 12.00 ? 210 PRO A CA    1 
ATOM 1348 C C     . PRO A 1 210 ? 33.407  -22.660 100.557 1.00 12.00 ? 210 PRO A C     1 
ATOM 1349 O O     . PRO A 1 210 ? 32.635  -23.093 101.460 1.00 12.00 ? 210 PRO A O     1 
ATOM 1350 C CB    . PRO A 1 210 ? 35.296  -21.784 101.948 1.00 12.00 ? 210 PRO A CB    1 
ATOM 1351 C CG    . PRO A 1 210 ? 35.028  -20.830 103.095 1.00 12.00 ? 210 PRO A CG    1 
ATOM 1352 C CD    . PRO A 1 210 ? 33.876  -19.954 102.735 1.00 12.00 ? 210 PRO A CD    1 
ATOM 1353 N N     . TYR A 1 211 ? 33.523  -23.134 99.330  1.00 12.00 ? 211 TYR A N     1 
ATOM 1354 C CA    . TYR A 1 211 ? 32.710  -24.253 98.834  1.00 12.00 ? 211 TYR A CA    1 
ATOM 1355 C C     . TYR A 1 211 ? 33.160  -25.580 99.391  1.00 12.00 ? 211 TYR A C     1 
ATOM 1356 O O     . TYR A 1 211 ? 34.333  -25.936 99.286  1.00 12.00 ? 211 TYR A O     1 
ATOM 1357 C CB    . TYR A 1 211 ? 32.738  -24.320 97.310  1.00 12.00 ? 211 TYR A CB    1 
ATOM 1358 C CG    . TYR A 1 211 ? 31.829  -25.392 96.746  1.00 12.00 ? 211 TYR A CG    1 
ATOM 1359 C CD1   . TYR A 1 211 ? 30.461  -25.197 96.660  1.00 12.00 ? 211 TYR A CD1   1 
ATOM 1360 C CD2   . TYR A 1 211 ? 32.336  -26.605 96.304  1.00 12.00 ? 211 TYR A CD2   1 
ATOM 1361 C CE1   . TYR A 1 211 ? 29.628  -26.172 96.151  1.00 20.00 ? 211 TYR A CE1   1 
ATOM 1362 C CE2   . TYR A 1 211 ? 31.512  -27.585 95.795  1.00 12.00 ? 211 TYR A CE2   1 
ATOM 1363 C CZ    . TYR A 1 211 ? 30.159  -27.364 95.721  1.00 20.00 ? 211 TYR A CZ    1 
ATOM 1364 O OH    . TYR A 1 211 ? 29.335  -28.337 95.215  1.00 20.00 ? 211 TYR A OH    1 
ATOM 1365 N N     . ARG A 1 212 ? 32.199  -26.266 99.961  1.00 12.00 ? 212 ARG A N     1 
ATOM 1366 C CA    . ARG A 1 212 ? 32.384  -27.572 100.540 1.00 12.00 ? 212 ARG A CA    1 
ATOM 1367 C C     . ARG A 1 212 ? 31.158  -28.410 100.250 1.00 12.00 ? 212 ARG A C     1 
ATOM 1368 O O     . ARG A 1 212 ? 30.041  -27.904 100.252 1.00 12.00 ? 212 ARG A O     1 
ATOM 1369 C CB    . ARG A 1 212 ? 32.617  -27.448 102.040 1.00 12.00 ? 212 ARG A CB    1 
ATOM 1370 C CG    . ARG A 1 212 ? 31.406  -26.946 102.809 1.00 12.00 ? 212 ARG A CG    1 
ATOM 1371 C CD    . ARG A 1 212 ? 31.744  -25.722 103.638 1.00 12.00 ? 212 ARG A CD    1 
ATOM 1372 N NE    . ARG A 1 212 ? 30.555  -24.974 104.032 1.00 12.00 ? 212 ARG A NE    1 
ATOM 1373 C CZ    . ARG A 1 212 ? 30.585  -23.783 104.615 1.00 12.00 ? 212 ARG A CZ    1 
ATOM 1374 N NH1   . ARG A 1 212 ? 31.745  -23.201 104.871 1.00 12.00 ? 212 ARG A NH1   1 
ATOM 1375 N NH2   . ARG A 1 212 ? 29.458  -23.173 104.941 1.00 12.00 ? 212 ARG A NH2   1 
ATOM 1376 N N     . TYR A 1 213 ? 31.340  -29.691 99.991  1.00 12.00 ? 213 TYR A N     1 
ATOM 1377 C CA    . TYR A 1 213 ? 30.192  -30.532 99.707  1.00 12.00 ? 213 TYR A CA    1 
ATOM 1378 C C     . TYR A 1 213 ? 30.250  -31.848 100.460 1.00 12.00 ? 213 TYR A C     1 
ATOM 1379 O O     . TYR A 1 213 ? 31.313  -32.260 100.916 1.00 12.00 ? 213 TYR A O     1 
ATOM 1380 C CB    . TYR A 1 213 ? 30.040  -30.765 98.211  1.00 12.00 ? 213 TYR A CB    1 
ATOM 1381 C CG    . TYR A 1 213 ? 31.205  -31.465 97.574  1.00 12.00 ? 213 TYR A CG    1 
ATOM 1382 C CD1   . TYR A 1 213 ? 32.279  -30.748 97.085  1.00 12.00 ? 213 TYR A CD1   1 
ATOM 1383 C CD2   . TYR A 1 213 ? 31.227  -32.842 97.460  1.00 12.00 ? 213 TYR A CD2   1 
ATOM 1384 C CE1   . TYR A 1 213 ? 33.345  -31.384 96.492  1.00 12.00 ? 213 TYR A CE1   1 
ATOM 1385 C CE2   . TYR A 1 213 ? 32.288  -33.487 96.869  1.00 12.00 ? 213 TYR A CE2   1 
ATOM 1386 C CZ    . TYR A 1 213 ? 33.344  -32.753 96.386  1.00 12.00 ? 213 TYR A CZ    1 
ATOM 1387 O OH    . TYR A 1 213 ? 34.404  -33.388 95.793  1.00 12.00 ? 213 TYR A OH    1 
ATOM 1388 N N     . TYR A 1 214 ? 29.086  -32.471 100.554 1.00 12.00 ? 214 TYR A N     1 
ATOM 1389 C CA    . TYR A 1 214 ? 28.909  -33.715 101.283 1.00 12.00 ? 214 TYR A CA    1 
ATOM 1390 C C     . TYR A 1 214 ? 29.533  -34.920 100.588 1.00 12.00 ? 214 TYR A C     1 
ATOM 1391 O O     . TYR A 1 214 ? 29.594  -34.970 99.361  1.00 12.00 ? 214 TYR A O     1 
ATOM 1392 C CB    . TYR A 1 214 ? 27.428  -33.975 101.508 1.00 12.00 ? 214 TYR A CB    1 
ATOM 1393 C CG    . TYR A 1 214 ? 26.849  -33.194 102.655 1.00 12.00 ? 214 TYR A CG    1 
ATOM 1394 C CD1   . TYR A 1 214 ? 27.356  -33.341 103.929 1.00 12.00 ? 214 TYR A CD1   1 
ATOM 1395 C CD2   . TYR A 1 214 ? 25.800  -32.313 102.462 1.00 12.00 ? 214 TYR A CD2   1 
ATOM 1396 C CE1   . TYR A 1 214 ? 26.831  -32.637 104.989 1.00 12.00 ? 214 TYR A CE1   1 
ATOM 1397 C CE2   . TYR A 1 214 ? 25.267  -31.603 103.514 1.00 12.00 ? 214 TYR A CE2   1 
ATOM 1398 C CZ    . TYR A 1 214 ? 25.788  -31.770 104.775 1.00 12.00 ? 214 TYR A CZ    1 
ATOM 1399 O OH    . TYR A 1 214 ? 25.262  -31.070 105.831 1.00 12.00 ? 214 TYR A OH    1 
ATOM 1400 N N     . PHE A 1 215 ? 29.971  -35.869 101.421 1.00 12.00 ? 215 PHE A N     1 
ATOM 1401 C CA    . PHE A 1 215 ? 30.590  -37.113 100.965 1.00 12.00 ? 215 PHE A CA    1 
ATOM 1402 C C     . PHE A 1 215 ? 30.040  -38.323 101.747 1.00 12.00 ? 215 PHE A C     1 
ATOM 1403 O O     . PHE A 1 215 ? 29.755  -38.213 102.943 1.00 12.00 ? 215 PHE A O     1 
ATOM 1404 C CB    . PHE A 1 215 ? 32.108  -37.024 101.091 1.00 12.00 ? 215 PHE A CB    1 
ATOM 1405 C CG    . PHE A 1 215 ? 32.823  -38.200 100.511 1.00 12.00 ? 215 PHE A CG    1 
ATOM 1406 C CD1   . PHE A 1 215 ? 33.073  -39.314 101.283 1.00 12.00 ? 215 PHE A CD1   1 
ATOM 1407 C CD2   . PHE A 1 215 ? 33.241  -38.191 99.197  1.00 12.00 ? 215 PHE A CD2   1 
ATOM 1408 C CE1   . PHE A 1 215 ? 33.721  -40.405 100.753 1.00 12.00 ? 215 PHE A CE1   1 
ATOM 1409 C CE2   . PHE A 1 215 ? 33.888  -39.281 98.659  1.00 12.00 ? 215 PHE A CE2   1 
ATOM 1410 C CZ    . PHE A 1 215 ? 34.128  -40.390 99.439  1.00 12.00 ? 215 PHE A CZ    1 
ATOM 1411 N N     . CYS A 1 216 ? 29.908  -39.472 101.055 1.00 12.00 ? 216 CYS A N     1 
ATOM 1412 C CA    . CYS A 1 216 ? 29.339  -40.703 101.636 1.00 12.00 ? 216 CYS A CA    1 
ATOM 1413 C C     . CYS A 1 216 ? 30.263  -41.407 102.607 1.00 12.00 ? 216 CYS A C     1 
ATOM 1414 O O     . CYS A 1 216 ? 31.426  -41.670 102.278 1.00 12.00 ? 216 CYS A O     1 
ATOM 1415 C CB    . CYS A 1 216 ? 28.914  -41.710 100.576 1.00 12.00 ? 216 CYS A CB    1 
ATOM 1416 S SG    . CYS A 1 216 ? 28.173  -43.233 101.249 1.00 20.00 ? 216 CYS A SG    1 
ATOM 1417 N N     . VAL A 1 217 ? 29.637  -41.691 103.727 1.00 12.00 ? 217 VAL A N     1 
ATOM 1418 C CA    . VAL A 1 217 ? 30.242  -42.271 104.891 1.00 12.00 ? 217 VAL A CA    1 
ATOM 1419 C C     . VAL A 1 217 ? 29.449  -43.495 105.358 1.00 12.00 ? 217 VAL A C     1 
ATOM 1420 O O     . VAL A 1 217 ? 29.603  -44.586 104.813 1.00 12.00 ? 217 VAL A O     1 
ATOM 1421 C CB    . VAL A 1 217 ? 30.250  -41.197 105.980 1.00 12.00 ? 217 VAL A CB    1 
ATOM 1422 C CG1   . VAL A 1 217 ? 31.267  -40.120 105.655 1.00 20.00 ? 217 VAL A CG1   1 
ATOM 1423 C CG2   . VAL A 1 217 ? 28.859  -40.583 106.096 1.00 20.00 ? 217 VAL A CG2   1 
ATOM 1424 N N     . ASP A 1 218 ? 28.600  -43.271 106.370 1.00 12.00 ? 218 ASP A N     1 
ATOM 1425 C CA    . ASP A 1 218 ? 27.756  -44.310 106.970 1.00 12.00 ? 218 ASP A CA    1 
ATOM 1426 C C     . ASP A 1 218 ? 27.844  -44.259 108.498 1.00 12.00 ? 218 ASP A C     1 
ATOM 1427 O O     . ASP A 1 218 ? 28.937  -44.221 109.072 1.00 12.00 ? 218 ASP A O     1 
ATOM 1428 C CB    . ASP A 1 218 ? 28.163  -45.695 106.465 1.00 12.00 ? 218 ASP A CB    1 
ATOM 1429 C CG    . ASP A 1 218 ? 27.226  -46.246 105.410 1.00 12.00 ? 218 ASP A CG    1 
ATOM 1430 O OD1   . ASP A 1 218 ? 27.092  -45.613 104.348 1.00 12.00 ? 218 ASP A OD1   1 
ATOM 1431 O OD2   . ASP A 1 218 ? 26.632  -47.316 105.644 1.00 12.00 ? 218 ASP A OD2   1 
ATOM 1432 N N     . ARG A 1 219 ? 26.704  -44.253 109.161 1.00 12.00 ? 219 ARG A N     1 
ATOM 1433 C CA    . ARG A 1 219 ? 26.684  -44.166 110.629 1.00 12.00 ? 219 ARG A CA    1 
ATOM 1434 C C     . ARG A 1 219 ? 25.613  -45.060 111.248 1.00 12.00 ? 219 ARG A C     1 
ATOM 1435 O O     . ARG A 1 219 ? 24.729  -45.570 110.551 1.00 12.00 ? 219 ARG A O     1 
ATOM 1436 C CB    . ARG A 1 219 ? 26.407  -42.733 111.066 1.00 12.00 ? 219 ARG A CB    1 
ATOM 1437 C CG    . ARG A 1 219 ? 27.134  -42.353 112.351 1.00 12.00 ? 219 ARG A CG    1 
ATOM 1438 C CD    . ARG A 1 219 ? 26.338  -41.389 113.221 1.00 12.00 ? 219 ARG A CD    1 
ATOM 1439 N NE    . ARG A 1 219 ? 26.559  -41.593 114.654 1.00 12.00 ? 219 ARG A NE    1 
ATOM 1440 C CZ    . ARG A 1 219 ? 26.253  -40.692 115.592 1.00 12.00 ? 219 ARG A CZ    1 
ATOM 1441 N NH1   . ARG A 1 219 ? 25.712  -39.516 115.264 1.00 12.00 ? 219 ARG A NH1   1 
ATOM 1442 N NH2   . ARG A 1 219 ? 26.454  -40.877 116.898 1.00 12.00 ? 219 ARG A NH2   1 
ATOM 1443 N N     . ASP A 1 220 ? 25.759  -45.201 112.556 1.00 12.00 ? 220 ASP A N     1 
ATOM 1444 C CA    . ASP A 1 220 ? 24.866  -46.002 113.402 1.00 12.00 ? 220 ASP A CA    1 
ATOM 1445 C C     . ASP A 1 220 ? 24.951  -45.520 114.852 1.00 12.00 ? 220 ASP A C     1 
ATOM 1446 O O     . ASP A 1 220 ? 25.961  -45.724 115.534 1.00 12.00 ? 220 ASP A O     1 
ATOM 1447 C CB    . ASP A 1 220 ? 25.278  -47.471 113.361 1.00 12.00 ? 220 ASP A CB    1 
ATOM 1448 C CG    . ASP A 1 220 ? 25.184  -48.084 111.969 1.00 20.00 ? 220 ASP A CG    1 
ATOM 1449 O OD1   . ASP A 1 220 ? 24.895  -47.343 110.958 1.00 20.00 ? 220 ASP A OD1   1 
ATOM 1450 O OD2   . ASP A 1 220 ? 25.393  -49.342 111.805 1.00 20.00 ? 220 ASP A OD2   1 
ATOM 1451 N N     . LEU A 1 221 ? 23.874  -44.888 115.277 1.00 12.00 ? 221 LEU A N     1 
ATOM 1452 C CA    . LEU A 1 221 ? 23.740  -44.349 116.638 1.00 12.00 ? 221 LEU A CA    1 
ATOM 1453 C C     . LEU A 1 221 ? 22.409  -44.798 117.237 1.00 12.00 ? 221 LEU A C     1 
ATOM 1454 O O     . LEU A 1 221 ? 21.358  -44.707 116.593 1.00 12.00 ? 221 LEU A O     1 
ATOM 1455 C CB    . LEU A 1 221 ? 23.789  -42.825 116.598 1.00 12.00 ? 221 LEU A CB    1 
ATOM 1456 C CG    . LEU A 1 221 ? 23.530  -42.181 117.957 1.00 12.00 ? 221 LEU A CG    1 
ATOM 1457 C CD1   . LEU A 1 221 ? 24.609  -42.501 118.985 1.00 12.00 ? 221 LEU A CD1   1 
ATOM 1458 C CD2   . LEU A 1 221 ? 23.461  -40.658 117.891 1.00 12.00 ? 221 LEU A CD2   1 
ATOM 1459 N N     . SER A 1 222 ? 22.492  -45.275 118.463 1.00 12.00 ? 222 SER A N     1 
ATOM 1460 C CA    . SER A 1 222 ? 21.328  -45.782 119.201 1.00 12.00 ? 222 SER A CA    1 
ATOM 1461 C C     . SER A 1 222 ? 20.739  -44.743 120.132 1.00 12.00 ? 222 SER A C     1 
ATOM 1462 O O     . SER A 1 222 ? 21.432  -43.836 120.581 1.00 12.00 ? 222 SER A O     1 
ATOM 1463 C CB    . SER A 1 222 ? 21.707  -47.033 119.984 1.00 12.00 ? 222 SER A CB    1 
ATOM 1464 O OG    . SER A 1 222 ? 22.636  -46.733 121.004 1.00 20.00 ? 222 SER A OG    1 
ATOM 1465 N N     . VAL A 1 223 ? 19.454  -44.898 120.409 1.00 12.00 ? 223 VAL A N     1 
ATOM 1466 C CA    . VAL A 1 223 ? 18.754  -43.987 121.291 1.00 12.00 ? 223 VAL A CA    1 
ATOM 1467 C C     . VAL A 1 223 ? 19.160  -44.209 122.738 1.00 12.00 ? 223 VAL A C     1 
ATOM 1468 O O     . VAL A 1 223 ? 19.805  -45.200 123.064 1.00 12.00 ? 223 VAL A O     1 
ATOM 1469 C CB    . VAL A 1 223 ? 17.232  -44.131 121.144 1.00 12.00 ? 223 VAL A CB    1 
ATOM 1470 C CG1   . VAL A 1 223 ? 16.542  -42.818 121.451 1.00 20.00 ? 223 VAL A CG1   1 
ATOM 1471 C CG2   . VAL A 1 223 ? 16.877  -44.612 119.751 1.00 20.00 ? 223 VAL A CG2   1 
ATOM 1472 N N     . THR A 1 224 ? 18.778  -43.278 123.594 1.00 12.00 ? 224 THR A N     1 
ATOM 1473 C CA    . THR A 1 224 ? 19.099  -43.364 125.009 1.00 12.00 ? 224 THR A CA    1 
ATOM 1474 C C     . THR A 1 224 ? 18.581  -42.136 125.737 1.00 12.00 ? 224 THR A C     1 
ATOM 1475 O O     . THR A 1 224 ? 18.629  -41.029 125.211 1.00 12.00 ? 224 THR A O     1 
ATOM 1476 C CB    . THR A 1 224 ? 20.599  -43.511 125.232 1.00 12.00 ? 224 THR A CB    1 
ATOM 1477 O OG1   . THR A 1 224 ? 21.285  -42.418 124.621 1.00 20.00 ? 224 THR A OG1   1 
ATOM 1478 C CG2   . THR A 1 224 ? 21.097  -44.817 124.644 1.00 20.00 ? 224 THR A CG2   1 
ATOM 1479 N N     . TYR A 1 225 ? 18.084  -42.321 126.952 1.00 12.00 ? 225 TYR A N     1 
ATOM 1480 C CA    . TYR A 1 225 ? 17.532  -41.201 127.693 1.00 12.00 ? 225 TYR A CA    1 
ATOM 1481 C C     . TYR A 1 225 ? 18.387  -40.789 128.883 1.00 12.00 ? 225 TYR A C     1 
ATOM 1482 O O     . TYR A 1 225 ? 18.912  -41.634 129.601 1.00 12.00 ? 225 TYR A O     1 
ATOM 1483 C CB    . TYR A 1 225 ? 16.107  -41.498 128.149 1.00 12.00 ? 225 TYR A CB    1 
ATOM 1484 C CG    . TYR A 1 225 ? 15.953  -42.807 128.882 1.00 12.00 ? 225 TYR A CG    1 
ATOM 1485 C CD1   . TYR A 1 225 ? 15.680  -43.978 128.198 1.00 12.00 ? 225 TYR A CD1   1 
ATOM 1486 C CD2   . TYR A 1 225 ? 16.076  -42.869 130.258 1.00 20.00 ? 225 TYR A CD2   1 
ATOM 1487 C CE1   . TYR A 1 225 ? 15.534  -45.175 128.863 1.00 20.00 ? 225 TYR A CE1   1 
ATOM 1488 C CE2   . TYR A 1 225 ? 15.933  -44.062 130.933 1.00 12.00 ? 225 TYR A CE2   1 
ATOM 1489 C CZ    . TYR A 1 225 ? 15.662  -45.211 130.230 1.00 20.00 ? 225 TYR A CZ    1 
ATOM 1490 O OH    . TYR A 1 225 ? 15.518  -46.401 130.895 1.00 20.00 ? 225 TYR A OH    1 
ATOM 1491 N N     . GLU A 1 226 ? 18.492  -39.478 129.046 1.00 12.00 ? 226 GLU A N     1 
ATOM 1492 C CA    . GLU A 1 226 ? 19.237  -38.847 130.126 1.00 12.00 ? 226 GLU A CA    1 
ATOM 1493 C C     . GLU A 1 226 ? 20.359  -39.715 130.677 1.00 12.00 ? 226 GLU A C     1 
ATOM 1494 O O     . GLU A 1 226 ? 21.482  -39.679 130.184 1.00 12.00 ? 226 GLU A O     1 
ATOM 1495 C CB    . GLU A 1 226 ? 18.301  -38.438 131.258 1.00 12.00 ? 226 GLU A CB    1 
ATOM 1496 C CG    . GLU A 1 226 ? 17.853  -36.991 131.196 1.00 20.00 ? 226 GLU A CG    1 
ATOM 1497 C CD    . GLU A 1 226 ? 18.147  -36.236 132.471 1.00 20.00 ? 226 GLU A CD    1 
ATOM 1498 O OE1   . GLU A 1 226 ? 18.319  -36.887 133.518 1.00 20.00 ? 226 GLU A OE1   1 
ATOM 1499 O OE2   . GLU A 1 226 ? 18.205  -34.994 132.424 1.00 20.00 ? 226 GLU A OE2   1 
ATOM 1500 N N     . ASN A 1 227 ? 20.059  -40.494 131.707 1.00 12.00 ? 227 ASN A N     1 
ATOM 1501 C CA    . ASN A 1 227 ? 21.072  -41.311 132.359 1.00 12.00 ? 227 ASN A CA    1 
ATOM 1502 C C     . ASN A 1 227 ? 21.050  -42.766 131.910 1.00 12.00 ? 227 ASN A C     1 
ATOM 1503 O O     . ASN A 1 227 ? 22.084  -43.421 131.847 1.00 12.00 ? 227 ASN A O     1 
ATOM 1504 C CB    . ASN A 1 227 ? 20.922  -41.232 133.872 1.00 20.00 ? 227 ASN A CB    1 
ATOM 1505 C CG    . ASN A 1 227 ? 21.191  -39.844 134.403 1.00 20.00 ? 227 ASN A CG    1 
ATOM 1506 O OD1   . ASN A 1 227 ? 22.294  -39.323 134.269 1.00 20.00 ? 227 ASN A OD1   1 
ATOM 1507 N ND2   . ASN A 1 227 ? 20.182  -39.238 135.008 1.00 20.00 ? 227 ASN A ND2   1 
ATOM 1508 N N     . GLN A 1 228 ? 19.878  -43.295 131.598 1.00 12.00 ? 228 GLN A N     1 
ATOM 1509 C CA    . GLN A 1 228 ? 19.780  -44.683 131.175 1.00 12.00 ? 228 GLN A CA    1 
ATOM 1510 C C     . GLN A 1 228 ? 20.959  -45.491 131.704 1.00 12.00 ? 228 GLN A C     1 
ATOM 1511 O O     . GLN A 1 228 ? 21.955  -44.930 132.148 1.00 12.00 ? 228 GLN A O     1 
ATOM 1512 C CB    . GLN A 1 228 ? 19.703  -44.779 129.655 1.00 12.00 ? 228 GLN A CB    1 
ATOM 1513 C CG    . GLN A 1 228 ? 20.273  -46.063 129.087 1.00 20.00 ? 228 GLN A CG    1 
ATOM 1514 C CD    . GLN A 1 228 ? 19.408  -46.652 127.996 1.00 20.00 ? 228 GLN A CD    1 
ATOM 1515 O OE1   . GLN A 1 228 ? 18.787  -45.926 127.228 1.00 20.00 ? 228 GLN A OE1   1 
ATOM 1516 N NE2   . GLN A 1 228 ? 19.225  -47.938 127.748 1.00 20.00 ? 228 GLN A NE2   1 
ATOM 1517 N N     . GLU A 1 229 ? 20.844  -46.809 131.652 1.00 12.00 ? 229 GLU A N     1 
ATOM 1518 C CA    . GLU A 1 229 ? 21.899  -47.689 132.137 1.00 12.00 ? 229 GLU A CA    1 
ATOM 1519 C C     . GLU A 1 229 ? 22.704  -48.283 130.991 1.00 12.00 ? 229 GLU A C     1 
ATOM 1520 O O     . GLU A 1 229 ? 22.464  -47.974 129.830 1.00 12.00 ? 229 GLU A O     1 
ATOM 1521 C CB    . GLU A 1 229 ? 21.308  -48.805 132.992 1.00 12.00 ? 229 GLU A CB    1 
ATOM 1522 C CG    . GLU A 1 229 ? 21.744  -48.779 134.442 1.00 20.00 ? 229 GLU A CG    1 
ATOM 1523 C CD    . GLU A 1 229 ? 21.612  -50.127 135.112 1.00 20.00 ? 229 GLU A CD    1 
ATOM 1524 O OE1   . GLU A 1 229 ? 22.139  -51.113 134.565 1.00 20.00 ? 229 GLU A OE1   1 
ATOM 1525 O OE2   . GLU A 1 229 ? 20.981  -50.198 136.182 1.00 20.00 ? 229 GLU A OE2   1 
ATOM 1526 N N     . GLY A 1 230 ? 23.658  -49.137 131.333 1.00 12.00 ? 230 GLY A N     1 
ATOM 1527 C CA    . GLY A 1 230 ? 24.489  -49.791 130.346 1.00 12.00 ? 230 GLY A CA    1 
ATOM 1528 C C     . GLY A 1 230 ? 25.226  -48.787 129.474 1.00 12.00 ? 230 GLY A C     1 
ATOM 1529 O O     . GLY A 1 230 ? 25.535  -47.682 129.909 1.00 12.00 ? 230 GLY A O     1 
ATOM 1530 N N     . THR A 1 231 ? 25.500  -49.179 128.236 1.00 12.00 ? 231 THR A N     1 
ATOM 1531 C CA    . THR A 1 231 ? 26.210  -48.309 127.318 1.00 12.00 ? 231 THR A CA    1 
ATOM 1532 C C     . THR A 1 231 ? 25.446  -48.093 126.024 1.00 12.00 ? 231 THR A C     1 
ATOM 1533 O O     . THR A 1 231 ? 24.337  -48.593 125.858 1.00 12.00 ? 231 THR A O     1 
ATOM 1534 C CB    . THR A 1 231 ? 27.588  -48.854 126.968 1.00 12.00 ? 231 THR A CB    1 
ATOM 1535 O OG1   . THR A 1 231 ? 27.593  -50.273 127.107 1.00 12.00 ? 231 THR A OG1   1 
ATOM 1536 C CG2   . THR A 1 231 ? 28.642  -48.244 127.870 1.00 12.00 ? 231 THR A CG2   1 
ATOM 1537 N N     . ILE A 1 232 ? 26.073  -47.346 125.130 1.00 12.00 ? 232 ILE A N     1 
ATOM 1538 C CA    . ILE A 1 232 ? 25.497  -47.018 123.841 1.00 12.00 ? 232 ILE A CA    1 
ATOM 1539 C C     . ILE A 1 232 ? 25.754  -48.120 122.827 1.00 12.00 ? 232 ILE A C     1 
ATOM 1540 O O     . ILE A 1 232 ? 24.966  -48.330 121.912 1.00 12.00 ? 232 ILE A O     1 
ATOM 1541 C CB    . ILE A 1 232 ? 26.061  -45.690 123.325 1.00 12.00 ? 232 ILE A CB    1 
ATOM 1542 C CG1   . ILE A 1 232 ? 25.744  -44.571 124.312 1.00 20.00 ? 232 ILE A CG1   1 
ATOM 1543 C CG2   . ILE A 1 232 ? 25.516  -45.376 121.949 1.00 20.00 ? 232 ILE A CG2   1 
ATOM 1544 C CD1   . ILE A 1 232 ? 26.340  -43.239 123.938 1.00 20.00 ? 232 ILE A CD1   1 
ATOM 1545 N N     . GLU A 1 233 ? 26.863  -48.820 122.992 1.00 12.00 ? 233 GLU A N     1 
ATOM 1546 C CA    . GLU A 1 233 ? 27.214  -49.909 122.100 1.00 12.00 ? 233 GLU A CA    1 
ATOM 1547 C C     . GLU A 1 233 ? 28.163  -49.452 121.003 1.00 12.00 ? 233 GLU A C     1 
ATOM 1548 O O     . GLU A 1 233 ? 29.369  -49.657 121.088 1.00 12.00 ? 233 GLU A O     1 
ATOM 1549 C CB    . GLU A 1 233 ? 25.964  -50.540 121.504 1.00 12.00 ? 233 GLU A CB    1 
ATOM 1550 C CG    . GLU A 1 233 ? 25.523  -51.808 122.204 1.00 20.00 ? 233 GLU A CG    1 
ATOM 1551 C CD    . GLU A 1 233 ? 24.060  -52.113 121.988 1.00 20.00 ? 233 GLU A CD    1 
ATOM 1552 O OE1   . GLU A 1 233 ? 23.498  -51.635 120.985 1.00 20.00 ? 233 GLU A OE1   1 
ATOM 1553 O OE2   . GLU A 1 233 ? 23.475  -52.832 122.820 1.00 20.00 ? 233 GLU A OE2   1 
ATOM 1554 N N     . HIS A 1 234 ? 27.637  -48.823 119.957 1.00 12.00 ? 234 HIS A N     1 
ATOM 1555 C CA    . HIS A 1 234 ? 28.494  -48.381 118.871 1.00 12.00 ? 234 HIS A CA    1 
ATOM 1556 C C     . HIS A 1 234 ? 28.184  -46.975 118.378 1.00 12.00 ? 234 HIS A C     1 
ATOM 1557 O O     . HIS A 1 234 ? 27.023  -46.587 118.271 1.00 12.00 ? 234 HIS A O     1 
ATOM 1558 C CB    . HIS A 1 234 ? 28.447  -49.345 117.687 1.00 12.00 ? 234 HIS A CB    1 
ATOM 1559 C CG    . HIS A 1 234 ? 27.094  -50.063 117.487 1.00 12.00 ? 234 HIS A CG    1 
ATOM 1560 N ND1   . HIS A 1 234 ? 26.273  -50.408 118.531 1.00 20.00 ? 234 HIS A ND1   1 
ATOM 1561 C CD2   . HIS A 1 234 ? 26.470  -50.478 116.364 1.00 20.00 ? 234 HIS A CD2   1 
ATOM 1562 C CE1   . HIS A 1 234 ? 25.200  -51.009 118.060 1.00 20.00 ? 234 HIS A CE1   1 
ATOM 1563 N NE2   . HIS A 1 234 ? 25.295  -51.064 116.749 1.00 20.00 ? 234 HIS A NE2   1 
ATOM 1564 N N     . ASN A 1 235 ? 29.264  -46.265 118.093 1.00 12.00 ? 235 ASN A N     1 
ATOM 1565 C CA    . ASN A 1 235 ? 29.245  -44.919 117.549 1.00 12.00 ? 235 ASN A CA    1 
ATOM 1566 C C     . ASN A 1 235 ? 30.247  -44.869 116.409 1.00 12.00 ? 235 ASN A C     1 
ATOM 1567 O O     . ASN A 1 235 ? 31.299  -44.249 116.523 1.00 12.00 ? 235 ASN A O     1 
ATOM 1568 C CB    . ASN A 1 235 ? 29.580  -43.908 118.644 1.00 12.00 ? 235 ASN A CB    1 
ATOM 1569 C CG    . ASN A 1 235 ? 28.555  -42.804 118.762 1.00 20.00 ? 235 ASN A CG    1 
ATOM 1570 O OD1   . ASN A 1 235 ? 27.646  -42.700 117.947 1.00 20.00 ? 235 ASN A OD1   1 
ATOM 1571 N ND2   . ASN A 1 235 ? 28.702  -41.972 119.783 1.00 20.00 ? 235 ASN A ND2   1 
ATOM 1572 N N     . VAL A 1 236 ? 29.903  -45.535 115.315 1.00 12.00 ? 236 VAL A N     1 
ATOM 1573 C CA    . VAL A 1 236 ? 30.821  -45.671 114.199 1.00 12.00 ? 236 VAL A CA    1 
ATOM 1574 C C     . VAL A 1 236 ? 30.549  -44.735 113.026 1.00 12.00 ? 236 VAL A C     1 
ATOM 1575 O O     . VAL A 1 236 ? 29.396  -44.402 112.729 1.00 12.00 ? 236 VAL A O     1 
ATOM 1576 C CB    . VAL A 1 236 ? 30.829  -47.106 113.656 1.00 12.00 ? 236 VAL A CB    1 
ATOM 1577 C CG1   . VAL A 1 236 ? 32.228  -47.684 113.702 1.00 20.00 ? 236 VAL A CG1   1 
ATOM 1578 C CG2   . VAL A 1 236 ? 29.862  -47.974 114.438 1.00 20.00 ? 236 VAL A CG2   1 
ATOM 1579 N N     . MET A 1 237 ? 31.657  -44.365 112.408 1.00 12.00 ? 237 MET A N     1 
ATOM 1580 C CA    . MET A 1 237 ? 31.683  -43.505 111.225 1.00 12.00 ? 237 MET A CA    1 
ATOM 1581 C C     . MET A 1 237 ? 31.252  -44.322 110.015 1.00 12.00 ? 237 MET A C     1 
ATOM 1582 O O     . MET A 1 237 ? 30.145  -44.867 109.977 1.00 12.00 ? 237 MET A O     1 
ATOM 1583 C CB    . MET A 1 237 ? 33.097  -42.974 111.000 1.00 12.00 ? 237 MET A CB    1 
ATOM 1584 C CG    . MET A 1 237 ? 33.310  -41.573 111.564 1.00 12.00 ? 237 MET A CG    1 
ATOM 1585 S SD    . MET A 1 237 ? 31.802  -40.653 111.721 1.00 20.00 ? 237 MET A SD    1 
ATOM 1586 C CE    . MET A 1 237 ? 31.428  -39.834 110.192 1.00 20.00 ? 237 MET A CE    1 
ATOM 1587 N N     . GLY A 1 238 ? 32.147  -44.397 109.052 1.00 12.00 ? 238 GLY A N     1 
ATOM 1588 C CA    . GLY A 1 238 ? 31.905  -45.149 107.818 1.00 12.00 ? 238 GLY A CA    1 
ATOM 1589 C C     . GLY A 1 238 ? 33.023  -44.907 106.811 1.00 12.00 ? 238 GLY A C     1 
ATOM 1590 O O     . GLY A 1 238 ? 33.238  -43.778 106.358 1.00 12.00 ? 238 GLY A O     1 
ATOM 1591 N N     . THR A 1 239 ? 33.696  -45.992 106.492 1.00 12.00 ? 239 THR A N     1 
ATOM 1592 C CA    . THR A 1 239 ? 34.800  -45.990 105.531 1.00 12.00 ? 239 THR A CA    1 
ATOM 1593 C C     . THR A 1 239 ? 34.258  -45.714 104.135 1.00 12.00 ? 239 THR A C     1 
ATOM 1594 O O     . THR A 1 239 ? 33.043  -45.604 103.936 1.00 12.00 ? 239 THR A O     1 
ATOM 1595 C CB    . THR A 1 239 ? 35.501  -47.344 105.534 1.00 12.00 ? 239 THR A CB    1 
ATOM 1596 O OG1   . THR A 1 239 ? 35.388  -47.944 106.810 1.00 12.00 ? 239 THR A OG1   1 
ATOM 1597 C CG2   . THR A 1 239 ? 36.986  -47.248 105.205 1.00 12.00 ? 239 THR A CG2   1 
ATOM 1598 N N     . PRO A 1 240 ? 35.109  -45.590 103.114 1.00 12.00 ? 240 PRO A N     1 
ATOM 1599 C CA    . PRO A 1 240 ? 34.640  -45.321 101.773 1.00 12.00 ? 240 PRO A CA    1 
ATOM 1600 C C     . PRO A 1 240 ? 33.719  -46.414 101.309 1.00 12.00 ? 240 PRO A C     1 
ATOM 1601 O O     . PRO A 1 240 ? 34.156  -47.600 101.250 1.00 12.00 ? 240 PRO A O     1 
ATOM 1602 C CB    . PRO A 1 240 ? 35.899  -45.260 100.953 1.00 12.00 ? 240 PRO A CB    1 
ATOM 1603 C CG    . PRO A 1 240 ? 37.071  -45.502 101.884 1.00 12.00 ? 240 PRO A CG    1 
ATOM 1604 C CD    . PRO A 1 240 ? 36.553  -45.712 103.267 1.00 20.00 ? 240 PRO A CD    1 
ATOM 1605 N N     . LYS A 1 241 ? 32.500  -46.009 100.998 1.00 12.00 ? 241 LYS A N     1 
ATOM 1606 C CA    . LYS A 1 241 ? 31.452  -46.921 100.510 1.00 12.00 ? 241 LYS A CA    1 
ATOM 1607 C C     . LYS A 1 241 ? 31.540  -47.036 98.990  1.00 12.00 ? 241 LYS A C     1 
ATOM 1608 O O     . LYS A 1 241 ? 30.540  -46.881 98.281  1.00 12.00 ? 241 LYS A O     1 
ATOM 1609 C CB    . LYS A 1 241 ? 30.071  -46.392 100.890 1.00 12.00 ? 241 LYS A CB    1 
ATOM 1610 C CG    . LYS A 1 241 ? 29.316  -47.321 101.837 1.00 12.00 ? 241 LYS A CG    1 
ATOM 1611 C CD    . LYS A 1 241 ? 28.854  -48.613 101.169 1.00 12.00 ? 241 LYS A CD    1 
ATOM 1612 C CE    . LYS A 1 241 ? 28.058  -49.518 102.106 1.00 20.00 ? 241 LYS A CE    1 
ATOM 1613 N NZ    . LYS A 1 241 ? 27.585  -50.742 101.455 1.00 20.00 ? 241 LYS A NZ    1 
ATOM 1614 N N     . GLY A 1 242 ? 32.751  -47.308 98.554  1.00 12.00 ? 242 GLY A N     1 
ATOM 1615 C CA    . GLY A 1 242 ? 33.089  -47.458 97.135  1.00 12.00 ? 242 GLY A CA    1 
ATOM 1616 C C     . GLY A 1 242 ? 31.856  -47.839 96.325  1.00 12.00 ? 242 GLY A C     1 
ATOM 1617 O O     . GLY A 1 242 ? 31.891  -48.766 95.510  1.00 12.00 ? 242 GLY A O     1 
ATOM 1618 N N     . MET A 1 243 ? 30.797  -47.100 96.571  1.00 20.00 ? 243 MET A N     1 
ATOM 1619 C CA    . MET A 1 243 ? 29.516  -47.305 95.890  1.00 20.00 ? 243 MET A CA    1 
ATOM 1620 C C     . MET A 1 243 ? 28.752  -45.989 95.790  1.00 20.00 ? 243 MET A C     1 
ATOM 1621 O O     . MET A 1 243 ? 28.140  -45.686 94.761  1.00 20.00 ? 243 MET A O     1 
ATOM 1622 C CB    . MET A 1 243 ? 28.666  -48.310 96.663  1.00 20.00 ? 243 MET A CB    1 
ATOM 1623 C CG    . MET A 1 243 ? 28.400  -49.591 95.879  1.00 20.00 ? 243 MET A CG    1 
ATOM 1624 S SD    . MET A 1 243 ? 26.923  -50.426 96.395  1.00 20.00 ? 243 MET A SD    1 
ATOM 1625 C CE    . MET A 1 243 ? 27.019  -52.146 95.973  1.00 20.00 ? 243 MET A CE    1 
ATOM 1626 N N     . ASN A 1 244 ? 28.815  -45.244 96.872  1.00 12.00 ? 244 ASN A N     1 
ATOM 1627 C CA    . ASN A 1 244 ? 28.133  -43.951 96.982  1.00 12.00 ? 244 ASN A CA    1 
ATOM 1628 C C     . ASN A 1 244 ? 29.135  -42.802 96.865  1.00 12.00 ? 244 ASN A C     1 
ATOM 1629 O O     . ASN A 1 244 ? 28.757  -41.626 96.880  1.00 12.00 ? 244 ASN A O     1 
ATOM 1630 C CB    . ASN A 1 244 ? 27.428  -43.848 98.330  1.00 12.00 ? 244 ASN A CB    1 
ATOM 1631 C CG    . ASN A 1 244 ? 26.434  -44.979 98.569  1.00 20.00 ? 244 ASN A CG    1 
ATOM 1632 O OD1   . ASN A 1 244 ? 25.350  -44.974 97.998  1.00 20.00 ? 244 ASN A OD1   1 
ATOM 1633 N ND2   . ASN A 1 244 ? 26.741  -45.961 99.388  1.00 20.00 ? 244 ASN A ND2   1 
ATOM 1634 N N     . SER A 1 245 ? 30.393  -43.168 96.753  1.00 12.00 ? 245 SER A N     1 
ATOM 1635 C CA    . SER A 1 245 ? 31.486  -42.197 96.615  1.00 12.00 ? 245 SER A CA    1 
ATOM 1636 C C     . SER A 1 245 ? 31.210  -41.295 95.416  1.00 12.00 ? 245 SER A C     1 
ATOM 1637 O O     . SER A 1 245 ? 30.766  -41.757 94.360  1.00 12.00 ? 245 SER A O     1 
ATOM 1638 C CB    . SER A 1 245 ? 32.808  -42.926 96.405  1.00 12.00 ? 245 SER A CB    1 
ATOM 1639 O OG    . SER A 1 245 ? 33.239  -43.509 97.621  1.00 20.00 ? 245 SER A OG    1 
ATOM 1640 N N     . GLN A 1 246 ? 31.481  -40.017 95.603  1.00 12.00 ? 246 GLN A N     1 
ATOM 1641 C CA    . GLN A 1 246 ? 31.249  -39.015 94.556  1.00 12.00 ? 246 GLN A CA    1 
ATOM 1642 C C     . GLN A 1 246 ? 32.180  -37.800 94.710  1.00 12.00 ? 246 GLN A C     1 
ATOM 1643 O O     . GLN A 1 246 ? 31.756  -36.720 95.144  1.00 12.00 ? 246 GLN A O     1 
ATOM 1644 C CB    . GLN A 1 246 ? 29.809  -38.517 94.619  1.00 12.00 ? 246 GLN A CB    1 
ATOM 1645 C CG    . GLN A 1 246 ? 28.798  -39.559 94.155  1.00 12.00 ? 246 GLN A CG    1 
ATOM 1646 C CD    . GLN A 1 246 ? 27.633  -38.954 93.378  1.00 12.00 ? 246 GLN A CD    1 
ATOM 1647 O OE1   . GLN A 1 246 ? 27.826  -38.448 92.279  1.00 12.00 ? 246 GLN A OE1   1 
ATOM 1648 N NE2   . GLN A 1 246 ? 26.421  -38.976 93.888  1.00 12.00 ? 246 GLN A NE2   1 
ATOM 1649 N N     . PHE A 1 247 ? 33.429  -38.014 94.335  1.00 12.00 ? 247 PHE A N     1 
ATOM 1650 C CA    . PHE A 1 247 ? 34.491  -36.994 94.416  1.00 12.00 ? 247 PHE A CA    1 
ATOM 1651 C C     . PHE A 1 247 ? 34.583  -36.209 93.106  1.00 12.00 ? 247 PHE A C     1 
ATOM 1652 O O     . PHE A 1 247 ? 34.851  -36.775 92.041  1.00 12.00 ? 247 PHE A O     1 
ATOM 1653 C CB    . PHE A 1 247 ? 35.834  -37.675 94.680  1.00 12.00 ? 247 PHE A CB    1 
ATOM 1654 C CG    . PHE A 1 247 ? 37.009  -36.704 94.764  1.00 12.00 ? 247 PHE A CG    1 
ATOM 1655 C CD1   . PHE A 1 247 ? 36.785  -35.343 94.977  1.00 12.00 ? 247 PHE A CD1   1 
ATOM 1656 C CD2   . PHE A 1 247 ? 38.315  -37.181 94.630  1.00 12.00 ? 247 PHE A CD2   1 
ATOM 1657 C CE1   . PHE A 1 247 ? 37.863  -34.461 95.055  1.00 12.00 ? 247 PHE A CE1   1 
ATOM 1658 C CE2   . PHE A 1 247 ? 39.393  -36.299 94.709  1.00 12.00 ? 247 PHE A CE2   1 
ATOM 1659 C CZ    . PHE A 1 247 ? 39.167  -34.939 94.922  1.00 12.00 ? 247 PHE A CZ    1 
ATOM 1660 N N     . PHE A 1 248 ? 34.359  -34.915 93.233  1.00 12.00 ? 248 PHE A N     1 
ATOM 1661 C CA    . PHE A 1 248 ? 34.390  -33.983 92.099  1.00 12.00 ? 248 PHE A CA    1 
ATOM 1662 C C     . PHE A 1 248 ? 35.602  -33.063 92.198  1.00 12.00 ? 248 PHE A C     1 
ATOM 1663 O O     . PHE A 1 248 ? 36.283  -33.017 93.227  1.00 12.00 ? 248 PHE A O     1 
ATOM 1664 C CB    . PHE A 1 248 ? 33.127  -33.129 92.091  1.00 12.00 ? 248 PHE A CB    1 
ATOM 1665 C CG    . PHE A 1 248 ? 31.865  -33.947 91.861  1.00 12.00 ? 248 PHE A CG    1 
ATOM 1666 C CD1   . PHE A 1 248 ? 31.836  -34.910 90.852  1.00 12.00 ? 248 PHE A CD1   1 
ATOM 1667 C CD2   . PHE A 1 248 ? 30.741  -33.736 92.659  1.00 12.00 ? 248 PHE A CD2   1 
ATOM 1668 C CE1   . PHE A 1 248 ? 30.682  -35.664 90.642  1.00 12.00 ? 248 PHE A CE1   1 
ATOM 1669 C CE2   . PHE A 1 248 ? 29.586  -34.489 92.449  1.00 12.00 ? 248 PHE A CE2   1 
ATOM 1670 C CZ    . PHE A 1 248 ? 29.557  -35.454 91.440  1.00 12.00 ? 248 PHE A CZ    1 
ATOM 1671 N N     . THR A 1 249 ? 35.827  -32.360 91.106  1.00 12.00 ? 249 THR A N     1 
ATOM 1672 C CA    . THR A 1 249 ? 36.939  -31.415 90.976  1.00 12.00 ? 249 THR A CA    1 
ATOM 1673 C C     . THR A 1 249 ? 36.574  -30.313 89.985  1.00 12.00 ? 249 THR A C     1 
ATOM 1674 O O     . THR A 1 249 ? 36.422  -30.561 88.785  1.00 12.00 ? 249 THR A O     1 
ATOM 1675 C CB    . THR A 1 249 ? 38.181  -32.141 90.471  1.00 12.00 ? 249 THR A CB    1 
ATOM 1676 O OG1   . THR A 1 249 ? 38.225  -33.451 91.002  1.00 12.00 ? 249 THR A OG1   1 
ATOM 1677 C CG2   . THR A 1 249 ? 39.478  -31.445 90.865  1.00 12.00 ? 249 THR A CG2   1 
ATOM 1678 N N     . ILE A 1 250 ? 36.444  -29.123 90.532  1.00 12.00 ? 250 ILE A N     1 
ATOM 1679 C CA    . ILE A 1 250 ? 36.098  -27.926 89.760  1.00 12.00 ? 250 ILE A CA    1 
ATOM 1680 C C     . ILE A 1 250 ? 37.047  -27.772 88.579  1.00 12.00 ? 250 ILE A C     1 
ATOM 1681 O O     . ILE A 1 250 ? 36.632  -27.418 87.469  1.00 12.00 ? 250 ILE A O     1 
ATOM 1682 C CB    . ILE A 1 250 ? 36.204  -26.687 90.644  1.00 12.00 ? 250 ILE A CB    1 
ATOM 1683 C CG1   . ILE A 1 250 ? 35.291  -26.746 91.863  1.00 12.00 ? 250 ILE A CG1   1 
ATOM 1684 C CG2   . ILE A 1 250 ? 35.837  -25.401 89.913  1.00 12.00 ? 250 ILE A CG2   1 
ATOM 1685 C CD1   . ILE A 1 250 ? 35.330  -25.472 92.699  1.00 12.00 ? 250 ILE A CD1   1 
ATOM 1686 N N     . GLU A 1 251 ? 38.301  -28.048 88.861  1.00 12.00 ? 251 GLU A N     1 
ATOM 1687 C CA    . GLU A 1 251 ? 39.377  -27.967 87.872  1.00 12.00 ? 251 GLU A CA    1 
ATOM 1688 C C     . GLU A 1 251 ? 39.363  -29.202 86.980  1.00 12.00 ? 251 GLU A C     1 
ATOM 1689 O O     . GLU A 1 251 ? 40.406  -29.644 86.487  1.00 12.00 ? 251 GLU A O     1 
ATOM 1690 C CB    . GLU A 1 251 ? 40.729  -27.899 88.576  1.00 12.00 ? 251 GLU A CB    1 
ATOM 1691 C CG    . GLU A 1 251 ? 40.865  -26.694 89.498  1.00 12.00 ? 251 GLU A CG    1 
ATOM 1692 C CD    . GLU A 1 251 ? 40.335  -26.955 90.904  1.00 12.00 ? 251 GLU A CD    1 
ATOM 1693 O OE1   . GLU A 1 251 ? 40.251  -28.159 91.348  1.00 12.00 ? 251 GLU A OE1   1 
ATOM 1694 O OE2   . GLU A 1 251 ? 39.973  -25.971 91.648  1.00 12.00 ? 251 GLU A OE2   1 
ATOM 1695 N N     . ASN A 1 252 ? 38.171  -29.731 86.790  1.00 12.00 ? 252 ASN A N     1 
ATOM 1696 C CA    . ASN A 1 252 ? 37.977  -30.938 85.983  1.00 12.00 ? 252 ASN A CA    1 
ATOM 1697 C C     . ASN A 1 252 ? 36.624  -30.951 85.273  1.00 12.00 ? 252 ASN A C     1 
ATOM 1698 O O     . ASN A 1 252 ? 36.506  -31.422 84.136  1.00 12.00 ? 252 ASN A O     1 
ATOM 1699 C CB    . ASN A 1 252 ? 38.018  -32.176 86.875  1.00 12.00 ? 252 ASN A CB    1 
ATOM 1700 C CG    . ASN A 1 252 ? 39.426  -32.731 87.059  1.00 12.00 ? 252 ASN A CG    1 
ATOM 1701 O OD1   . ASN A 1 252 ? 40.070  -32.446 88.062  1.00 12.00 ? 252 ASN A OD1   1 
ATOM 1702 N ND2   . ASN A 1 252 ? 39.949  -33.516 86.142  1.00 12.00 ? 252 ASN A ND2   1 
ATOM 1703 N N     . THR A 1 253 ? 35.626  -30.435 85.958  1.00 12.00 ? 253 THR A N     1 
ATOM 1704 C CA    . THR A 1 253 ? 34.247  -30.443 85.455  1.00 12.00 ? 253 THR A CA    1 
ATOM 1705 C C     . THR A 1 253 ? 33.812  -29.088 84.898  1.00 12.00 ? 253 THR A C     1 
ATOM 1706 O O     . THR A 1 253 ? 33.070  -29.012 83.913  1.00 12.00 ? 253 THR A O     1 
ATOM 1707 C CB    . THR A 1 253 ? 33.283  -30.807 86.577  1.00 12.00 ? 253 THR A CB    1 
ATOM 1708 O OG1   . THR A 1 253 ? 33.399  -29.876 87.636  1.00 20.00 ? 253 THR A OG1   1 
ATOM 1709 C CG2   . THR A 1 253 ? 33.541  -32.193 87.157  1.00 20.00 ? 253 THR A CG2   1 
ATOM 1710 N N     . GLN A 1 254 ? 34.268  -28.031 85.529  1.00 12.00 ? 254 GLN A N     1 
ATOM 1711 C CA    . GLN A 1 254 ? 33.877  -26.673 85.132  1.00 12.00 ? 254 GLN A CA    1 
ATOM 1712 C C     . GLN A 1 254 ? 35.065  -25.866 84.634  1.00 12.00 ? 254 GLN A C     1 
ATOM 1713 O O     . GLN A 1 254 ? 36.185  -26.006 85.137  1.00 12.00 ? 254 GLN A O     1 
ATOM 1714 C CB    . GLN A 1 254 ? 33.254  -25.948 86.315  1.00 12.00 ? 254 GLN A CB    1 
ATOM 1715 C CG    . GLN A 1 254 ? 31.932  -26.567 86.757  1.00 20.00 ? 254 GLN A CG    1 
ATOM 1716 C CD    . GLN A 1 254 ? 31.388  -25.962 88.046  1.00 20.00 ? 254 GLN A CD    1 
ATOM 1717 O OE1   . GLN A 1 254 ? 31.920  -24.969 88.528  1.00 20.00 ? 254 GLN A OE1   1 
ATOM 1718 N NE2   . GLN A 1 254 ? 30.348  -26.505 88.640  1.00 20.00 ? 254 GLN A NE2   1 
ATOM 1719 N N     . GLN A 1 255 ? 34.750  -25.044 83.652  1.00 12.00 ? 255 GLN A N     1 
ATOM 1720 C CA    . GLN A 1 255 ? 35.709  -24.143 83.014  1.00 12.00 ? 255 GLN A CA    1 
ATOM 1721 C C     . GLN A 1 255 ? 36.071  -23.023 83.979  1.00 12.00 ? 255 GLN A C     1 
ATOM 1722 O O     . GLN A 1 255 ? 35.276  -22.650 84.847  1.00 12.00 ? 255 GLN A O     1 
ATOM 1723 C CB    . GLN A 1 255 ? 35.094  -23.524 81.762  1.00 12.00 ? 255 GLN A CB    1 
ATOM 1724 C CG    . GLN A 1 255 ? 34.956  -24.509 80.607  1.00 12.00 ? 255 GLN A CG    1 
ATOM 1725 C CD    . GLN A 1 255 ? 34.343  -23.877 79.361  1.00 12.00 ? 255 GLN A CD    1 
ATOM 1726 O OE1   . GLN A 1 255 ? 34.201  -22.661 79.296  1.00 20.00 ? 255 GLN A OE1   1 
ATOM 1727 N NE2   . GLN A 1 255 ? 33.966  -24.637 78.355  1.00 20.00 ? 255 GLN A NE2   1 
ATOM 1728 N N     . ILE A 1 256 ? 37.267  -22.520 83.796  1.00 12.00 ? 256 ILE A N     1 
ATOM 1729 C CA    . ILE A 1 256 ? 37.799  -21.439 84.624  1.00 12.00 ? 256 ILE A CA    1 
ATOM 1730 C C     . ILE A 1 256 ? 38.270  -20.287 83.746  1.00 12.00 ? 256 ILE A C     1 
ATOM 1731 O O     . ILE A 1 256 ? 39.082  -20.474 82.832  1.00 12.00 ? 256 ILE A O     1 
ATOM 1732 C CB    . ILE A 1 256 ? 38.973  -21.945 85.450  1.00 12.00 ? 256 ILE A CB    1 
ATOM 1733 C CG1   . ILE A 1 256 ? 38.614  -23.141 86.325  1.00 12.00 ? 256 ILE A CG1   1 
ATOM 1734 C CG2   . ILE A 1 256 ? 39.532  -20.892 86.399  1.00 12.00 ? 256 ILE A CG2   1 
ATOM 1735 C CD1   . ILE A 1 256 ? 39.737  -23.544 87.274  1.00 20.00 ? 256 ILE A CD1   1 
ATOM 1736 N N     . THR A 1 257 ? 37.736  -19.128 84.061  1.00 12.00 ? 257 THR A N     1 
ATOM 1737 C CA    . THR A 1 257 ? 38.049  -17.887 83.354  1.00 12.00 ? 257 THR A CA    1 
ATOM 1738 C C     . THR A 1 257 ? 39.019  -17.053 84.181  1.00 12.00 ? 257 THR A C     1 
ATOM 1739 O O     . THR A 1 257 ? 38.610  -16.262 85.038  1.00 12.00 ? 257 THR A O     1 
ATOM 1740 C CB    . THR A 1 257 ? 36.773  -17.083 83.126  1.00 12.00 ? 257 THR A CB    1 
ATOM 1741 O OG1   . THR A 1 257 ? 35.799  -17.892 82.494  1.00 20.00 ? 257 THR A OG1   1 
ATOM 1742 C CG2   . THR A 1 257 ? 36.990  -15.858 82.244  1.00 20.00 ? 257 THR A CG2   1 
ATOM 1743 N N     . LEU A 1 258 ? 40.286  -17.263 83.894  1.00 12.00 ? 258 LEU A N     1 
ATOM 1744 C CA    . LEU A 1 258 ? 41.380  -16.566 84.571  1.00 12.00 ? 258 LEU A CA    1 
ATOM 1745 C C     . LEU A 1 258 ? 41.235  -15.063 84.371  1.00 12.00 ? 258 LEU A C     1 
ATOM 1746 O O     . LEU A 1 258 ? 41.607  -14.522 83.323  1.00 12.00 ? 258 LEU A O     1 
ATOM 1747 C CB    . LEU A 1 258 ? 42.718  -17.025 84.009  1.00 12.00 ? 258 LEU A CB    1 
ATOM 1748 C CG    . LEU A 1 258 ? 43.334  -18.174 84.800  1.00 12.00 ? 258 LEU A CG    1 
ATOM 1749 C CD1   . LEU A 1 258 ? 42.714  -19.526 84.466  1.00 12.00 ? 258 LEU A CD1   1 
ATOM 1750 C CD2   . LEU A 1 258 ? 44.830  -18.332 84.553  1.00 12.00 ? 258 LEU A CD2   1 
ATOM 1751 N N     . LEU A 1 259 ? 40.694  -14.442 85.395  1.00 12.00 ? 259 LEU A N     1 
ATOM 1752 C CA    . LEU A 1 259 ? 40.451  -12.999 85.418  1.00 12.00 ? 259 LEU A CA    1 
ATOM 1753 C C     . LEU A 1 259 ? 41.632  -12.246 85.994  1.00 12.00 ? 259 LEU A C     1 
ATOM 1754 O O     . LEU A 1 259 ? 42.153  -12.604 87.045  1.00 12.00 ? 259 LEU A O     1 
ATOM 1755 C CB    . LEU A 1 259 ? 39.210  -12.690 86.250  1.00 12.00 ? 259 LEU A CB    1 
ATOM 1756 C CG    . LEU A 1 259 ? 37.889  -13.208 85.693  1.00 12.00 ? 259 LEU A CG    1 
ATOM 1757 C CD1   . LEU A 1 259 ? 36.734  -12.805 86.586  1.00 12.00 ? 259 LEU A CD1   1 
ATOM 1758 C CD2   . LEU A 1 259 ? 37.671  -12.704 84.279  1.00 12.00 ? 259 LEU A CD2   1 
ATOM 1759 N N     . ARG A 1 260 ? 42.047  -11.203 85.304  1.00 12.00 ? 260 ARG A N     1 
ATOM 1760 C CA    . ARG A 1 260 ? 43.148  -10.382 85.764  1.00 12.00 ? 260 ARG A CA    1 
ATOM 1761 C C     . ARG A 1 260 ? 42.627  -9.137  86.452  1.00 12.00 ? 260 ARG A C     1 
ATOM 1762 O O     . ARG A 1 260 ? 41.845  -9.223  87.395  1.00 12.00 ? 260 ARG A O     1 
ATOM 1763 C CB    . ARG A 1 260 ? 44.054  -10.003 84.600  1.00 12.00 ? 260 ARG A CB    1 
ATOM 1764 C CG    . ARG A 1 260 ? 44.846  -11.158 84.030  1.00 12.00 ? 260 ARG A CG    1 
ATOM 1765 C CD    . ARG A 1 260 ? 46.335  -10.910 84.141  1.00 12.00 ? 260 ARG A CD    1 
ATOM 1766 N NE    . ARG A 1 260 ? 47.105  -12.124 83.931  1.00 12.00 ? 260 ARG A NE    1 
ATOM 1767 C CZ    . ARG A 1 260 ? 48.272  -12.165 83.307  1.00 12.00 ? 260 ARG A CZ    1 
ATOM 1768 N NH1   . ARG A 1 260 ? 48.806  -11.054 82.832  1.00 12.00 ? 260 ARG A NH1   1 
ATOM 1769 N NH2   . ARG A 1 260 ? 48.902  -13.317 83.162  1.00 12.00 ? 260 ARG A NH2   1 
ATOM 1770 N N     . THR A 1 261 ? 43.066  -7.990  85.970  1.00 12.00 ? 261 THR A N     1 
ATOM 1771 C CA    . THR A 1 261 ? 42.626  -6.726  86.520  1.00 12.00 ? 261 THR A CA    1 
ATOM 1772 C C     . THR A 1 261 ? 41.661  -6.044  85.570  1.00 12.00 ? 261 THR A C     1 
ATOM 1773 O O     . THR A 1 261 ? 40.602  -5.578  85.976  1.00 12.00 ? 261 THR A O     1 
ATOM 1774 C CB    . THR A 1 261 ? 43.802  -5.798  86.798  1.00 12.00 ? 261 THR A CB    1 
ATOM 1775 O OG1   . THR A 1 261 ? 44.575  -6.318  87.879  1.00 12.00 ? 261 THR A OG1   1 
ATOM 1776 C CG2   . THR A 1 261 ? 43.310  -4.407  87.143  1.00 12.00 ? 261 THR A CG2   1 
ATOM 1777 N N     . GLY A 1 262 ? 42.033  -5.993  84.303  1.00 12.00 ? 262 GLY A N     1 
ATOM 1778 C CA    . GLY A 1 262 ? 41.202  -5.380  83.297  1.00 12.00 ? 262 GLY A CA    1 
ATOM 1779 C C     . GLY A 1 262 ? 40.265  -6.397  82.678  1.00 12.00 ? 262 GLY A C     1 
ATOM 1780 O O     . GLY A 1 262 ? 39.838  -6.251  81.538  1.00 12.00 ? 262 GLY A O     1 
ATOM 1781 N N     . ASP A 1 263 ? 39.937  -7.432  83.434  1.00 12.00 ? 263 ASP A N     1 
ATOM 1782 C CA    . ASP A 1 263 ? 39.064  -8.473  82.933  1.00 12.00 ? 263 ASP A CA    1 
ATOM 1783 C C     . ASP A 1 263 ? 37.696  -8.428  83.579  1.00 12.00 ? 263 ASP A C     1 
ATOM 1784 O O     . ASP A 1 263 ? 37.577  -8.214  84.783  1.00 12.00 ? 263 ASP A O     1 
ATOM 1785 C CB    . ASP A 1 263 ? 39.698  -9.840  83.119  1.00 12.00 ? 263 ASP A CB    1 
ATOM 1786 C CG    . ASP A 1 263 ? 40.757  -10.110 82.082  1.00 12.00 ? 263 ASP A CG    1 
ATOM 1787 O OD1   . ASP A 1 263 ? 40.396  -10.487 80.953  1.00 12.00 ? 263 ASP A OD1   1 
ATOM 1788 O OD2   . ASP A 1 263 ? 41.948  -9.938  82.398  1.00 12.00 ? 263 ASP A OD2   1 
ATOM 1789 N N     . GLU A 1 264 ? 36.690  -8.635  82.749  1.00 12.00 ? 264 GLU A N     1 
ATOM 1790 C CA    . GLU A 1 264 ? 35.313  -8.630  83.184  1.00 12.00 ? 264 GLU A CA    1 
ATOM 1791 C C     . GLU A 1 264 ? 34.650  -9.969  82.948  1.00 12.00 ? 264 GLU A C     1 
ATOM 1792 O O     . GLU A 1 264 ? 34.604  -10.460 81.826  1.00 12.00 ? 264 GLU A O     1 
ATOM 1793 C CB    . GLU A 1 264 ? 34.514  -7.570  82.438  1.00 12.00 ? 264 GLU A CB    1 
ATOM 1794 C CG    . GLU A 1 264 ? 33.581  -8.147  81.389  1.00 12.00 ? 264 GLU A CG    1 
ATOM 1795 C CD    . GLU A 1 264 ? 32.339  -7.312  81.185  1.00 12.00 ? 264 GLU A CD    1 
ATOM 1796 O OE1   . GLU A 1 264 ? 31.485  -7.287  82.089  1.00 12.00 ? 264 GLU A OE1   1 
ATOM 1797 O OE2   . GLU A 1 264 ? 32.222  -6.684  80.117  1.00 12.00 ? 264 GLU A OE2   1 
ATOM 1798 N N     . PHE A 1 265 ? 34.138  -10.576 84.002  1.00 12.00 ? 265 PHE A N     1 
ATOM 1799 C CA    . PHE A 1 265 ? 33.415  -11.822 83.840  1.00 12.00 ? 265 PHE A CA    1 
ATOM 1800 C C     . PHE A 1 265 ? 31.932  -11.586 84.073  1.00 12.00 ? 265 PHE A C     1 
ATOM 1801 O O     . PHE A 1 265 ? 31.539  -10.973 85.059  1.00 12.00 ? 265 PHE A O     1 
ATOM 1802 C CB    . PHE A 1 265 ? 33.905  -12.903 84.790  1.00 12.00 ? 265 PHE A CB    1 
ATOM 1803 C CG    . PHE A 1 265 ? 33.059  -14.131 84.744  1.00 12.00 ? 265 PHE A CG    1 
ATOM 1804 C CD1   . PHE A 1 265 ? 32.971  -14.871 83.585  1.00 12.00 ? 265 PHE A CD1   1 
ATOM 1805 C CD2   . PHE A 1 265 ? 32.346  -14.539 85.852  1.00 12.00 ? 265 PHE A CD2   1 
ATOM 1806 C CE1   . PHE A 1 265 ? 32.186  -16.001 83.531  1.00 12.00 ? 265 PHE A CE1   1 
ATOM 1807 C CE2   . PHE A 1 265 ? 31.559  -15.668 85.805  1.00 12.00 ? 265 PHE A CE2   1 
ATOM 1808 C CZ    . PHE A 1 265 ? 31.478  -16.399 84.642  1.00 12.00 ? 265 PHE A CZ    1 
ATOM 1809 N N     . ALA A 1 266 ? 31.092  -12.065 83.171  1.00 12.00 ? 266 ALA A N     1 
ATOM 1810 C CA    . ALA A 1 266 ? 29.659  -11.868 83.313  1.00 12.00 ? 266 ALA A CA    1 
ATOM 1811 C C     . ALA A 1 266 ? 28.870  -13.025 82.730  1.00 12.00 ? 266 ALA A C     1 
ATOM 1812 O O     . ALA A 1 266 ? 29.234  -13.576 81.698  1.00 12.00 ? 266 ALA A O     1 
ATOM 1813 C CB    . ALA A 1 266 ? 29.236  -10.567 82.662  1.00 12.00 ? 266 ALA A CB    1 
ATOM 1814 N N     . THR A 1 267 ? 27.785  -13.385 83.399  1.00 12.00 ? 267 THR A N     1 
ATOM 1815 C CA    . THR A 1 267 ? 26.942  -14.468 82.932  1.00 12.00 ? 267 THR A CA    1 
ATOM 1816 C C     . THR A 1 267 ? 25.816  -13.953 82.060  1.00 12.00 ? 267 THR A C     1 
ATOM 1817 O O     . THR A 1 267 ? 25.665  -12.748 81.880  1.00 12.00 ? 267 THR A O     1 
ATOM 1818 C CB    . THR A 1 267 ? 26.323  -15.250 84.086  1.00 12.00 ? 267 THR A CB    1 
ATOM 1819 O OG1   . THR A 1 267 ? 27.182  -15.195 85.223  1.00 12.00 ? 267 THR A OG1   1 
ATOM 1820 C CG2   . THR A 1 267 ? 26.094  -16.694 83.684  1.00 12.00 ? 267 THR A CG2   1 
ATOM 1821 N N     . GLY A 1 268 ? 25.037  -14.876 81.526  1.00 12.00 ? 268 GLY A N     1 
ATOM 1822 C CA    . GLY A 1 268 ? 23.906  -14.529 80.703  1.00 12.00 ? 268 GLY A CA    1 
ATOM 1823 C C     . GLY A 1 268 ? 22.665  -14.383 81.562  1.00 12.00 ? 268 GLY A C     1 
ATOM 1824 O O     . GLY A 1 268 ? 22.692  -14.660 82.756  1.00 12.00 ? 268 GLY A O     1 
ATOM 1825 N N     . THR A 1 269 ? 21.573  -13.949 80.960  1.00 12.00 ? 269 THR A N     1 
ATOM 1826 C CA    . THR A 1 269 ? 20.335  -13.772 81.700  1.00 12.00 ? 269 THR A CA    1 
ATOM 1827 C C     . THR A 1 269 ? 19.618  -15.101 81.903  1.00 12.00 ? 269 THR A C     1 
ATOM 1828 O O     . THR A 1 269 ? 19.007  -15.632 80.982  1.00 12.00 ? 269 THR A O     1 
ATOM 1829 C CB    . THR A 1 269 ? 19.407  -12.789 80.994  1.00 12.00 ? 269 THR A CB    1 
ATOM 1830 O OG1   . THR A 1 269 ? 20.129  -11.599 80.668  1.00 12.00 ? 269 THR A OG1   1 
ATOM 1831 C CG2   . THR A 1 269 ? 18.228  -12.443 81.879  1.00 12.00 ? 269 THR A CG2   1 
ATOM 1832 N N     . TYR A 1 270 ? 19.698  -15.631 83.121  1.00 12.00 ? 270 TYR A N     1 
ATOM 1833 C CA    . TYR A 1 270 ? 19.060  -16.901 83.451  1.00 12.00 ? 270 TYR A CA    1 
ATOM 1834 C C     . TYR A 1 270 ? 17.559  -16.724 83.674  1.00 12.00 ? 270 TYR A C     1 
ATOM 1835 O O     . TYR A 1 270 ? 17.140  -16.078 84.630  1.00 12.00 ? 270 TYR A O     1 
ATOM 1836 C CB    . TYR A 1 270 ? 19.719  -17.516 84.683  1.00 12.00 ? 270 TYR A CB    1 
ATOM 1837 C CG    . TYR A 1 270 ? 19.086  -18.802 85.158  1.00 12.00 ? 270 TYR A CG    1 
ATOM 1838 C CD1   . TYR A 1 270 ? 18.397  -19.625 84.284  1.00 12.00 ? 270 TYR A CD1   1 
ATOM 1839 C CD2   . TYR A 1 270 ? 19.177  -19.192 86.483  1.00 12.00 ? 270 TYR A CD2   1 
ATOM 1840 C CE1   . TYR A 1 270 ? 17.820  -20.799 84.716  1.00 12.00 ? 270 TYR A CE1   1 
ATOM 1841 C CE2   . TYR A 1 270 ? 18.604  -20.364 86.924  1.00 12.00 ? 270 TYR A CE2   1 
ATOM 1842 C CZ    . TYR A 1 270 ? 17.928  -21.164 86.037  1.00 12.00 ? 270 TYR A CZ    1 
ATOM 1843 O OH    . TYR A 1 270 ? 17.356  -22.332 86.473  1.00 20.00 ? 270 TYR A OH    1 
ATOM 1844 N N     . TYR A 1 271 ? 16.759  -17.303 82.784  1.00 12.00 ? 271 TYR A N     1 
ATOM 1845 C CA    . TYR A 1 271 ? 15.304  -17.234 82.896  1.00 12.00 ? 271 TYR A CA    1 
ATOM 1846 C C     . TYR A 1 271 ? 14.795  -18.347 83.803  1.00 12.00 ? 271 TYR A C     1 
ATOM 1847 O O     . TYR A 1 271 ? 15.254  -19.491 83.725  1.00 12.00 ? 271 TYR A O     1 
ATOM 1848 C CB    . TYR A 1 271 ? 14.667  -17.323 81.514  1.00 12.00 ? 271 TYR A CB    1 
ATOM 1849 C CG    . TYR A 1 271 ? 15.034  -16.180 80.606  1.00 12.00 ? 271 TYR A CG    1 
ATOM 1850 C CD1   . TYR A 1 271 ? 14.905  -14.872 81.033  1.00 12.00 ? 271 TYR A CD1   1 
ATOM 1851 C CD2   . TYR A 1 271 ? 15.508  -16.408 79.327  1.00 12.00 ? 271 TYR A CD2   1 
ATOM 1852 C CE1   . TYR A 1 271 ? 15.232  -13.819 80.210  1.00 12.00 ? 271 TYR A CE1   1 
ATOM 1853 C CE2   . TYR A 1 271 ? 15.840  -15.361 78.495  1.00 12.00 ? 271 TYR A CE2   1 
ATOM 1854 C CZ    . TYR A 1 271 ? 15.699  -14.069 78.942  1.00 12.00 ? 271 TYR A CZ    1 
ATOM 1855 O OH    . TYR A 1 271 ? 16.025  -13.021 78.120  1.00 20.00 ? 271 TYR A OH    1 
ATOM 1856 N N     . PHE A 1 272 ? 13.856  -17.978 84.645  1.00 12.00 ? 272 PHE A N     1 
ATOM 1857 C CA    . PHE A 1 272 ? 13.274  -18.893 85.628  1.00 12.00 ? 272 PHE A CA    1 
ATOM 1858 C C     . PHE A 1 272 ? 11.948  -19.461 85.142  1.00 12.00 ? 272 PHE A C     1 
ATOM 1859 O O     . PHE A 1 272 ? 11.197  -18.797 84.419  1.00 12.00 ? 272 PHE A O     1 
ATOM 1860 C CB    . PHE A 1 272 ? 13.034  -18.160 86.938  1.00 12.00 ? 272 PHE A CB    1 
ATOM 1861 C CG    . PHE A 1 272 ? 14.295  -18.051 87.785  1.00 12.00 ? 272 PHE A CG    1 
ATOM 1862 C CD1   . PHE A 1 272 ? 14.708  -19.137 88.554  1.00 12.00 ? 272 PHE A CD1   1 
ATOM 1863 C CD2   . PHE A 1 272 ? 15.034  -16.870 87.786  1.00 12.00 ? 272 PHE A CD2   1 
ATOM 1864 C CE1   . PHE A 1 272 ? 15.864  -19.042 89.328  1.00 12.00 ? 272 PHE A CE1   1 
ATOM 1865 C CE2   . PHE A 1 272 ? 16.190  -16.773 88.561  1.00 12.00 ? 272 PHE A CE2   1 
ATOM 1866 C CZ    . PHE A 1 272 ? 16.605  -17.859 89.331  1.00 12.00 ? 272 PHE A CZ    1 
ATOM 1867 N N     . ASP A 1 273 ? 11.720  -20.684 85.573  1.00 12.00 ? 273 ASP A N     1 
ATOM 1868 C CA    . ASP A 1 273 ? 10.507  -21.438 85.258  1.00 12.00 ? 273 ASP A CA    1 
ATOM 1869 C C     . ASP A 1 273 ? 9.923   -22.024 86.537  1.00 12.00 ? 273 ASP A C     1 
ATOM 1870 O O     . ASP A 1 273 ? 9.842   -23.247 86.699  1.00 12.00 ? 273 ASP A O     1 
ATOM 1871 C CB    . ASP A 1 273 ? 10.825  -22.575 84.296  1.00 12.00 ? 273 ASP A CB    1 
ATOM 1872 C CG    . ASP A 1 273 ? 9.575   -23.274 83.775  1.00 12.00 ? 273 ASP A CG    1 
ATOM 1873 O OD1   . ASP A 1 273 ? 8.453   -23.121 84.385  1.00 12.00 ? 273 ASP A OD1   1 
ATOM 1874 O OD2   . ASP A 1 273 ? 9.641   -24.013 82.726  1.00 12.00 ? 273 ASP A OD2   1 
ATOM 1875 N N     . THR A 1 274 ? 9.540   -21.118 87.406  1.00 12.00 ? 274 THR A N     1 
ATOM 1876 C CA    . THR A 1 274 ? 8.949   -21.454 88.699  1.00 12.00 ? 274 THR A CA    1 
ATOM 1877 C C     . THR A 1 274 ? 7.530   -20.898 88.806  1.00 12.00 ? 274 THR A C     1 
ATOM 1878 O O     . THR A 1 274 ? 7.139   -20.002 88.049  1.00 12.00 ? 274 THR A O     1 
ATOM 1879 C CB    . THR A 1 274 ? 9.794   -20.879 89.830  1.00 12.00 ? 274 THR A CB    1 
ATOM 1880 O OG1   . THR A 1 274 ? 9.739   -19.465 89.804  1.00 20.00 ? 274 THR A OG1   1 
ATOM 1881 C CG2   . THR A 1 274 ? 11.262  -21.280 89.739  1.00 20.00 ? 274 THR A CG2   1 
ATOM 1882 N N     . ASN A 1 275 ? 6.811   -21.463 89.757  1.00 12.00 ? 275 ASN A N     1 
ATOM 1883 C CA    . ASN A 1 275 ? 5.414   -21.107 90.037  1.00 12.00 ? 275 ASN A CA    1 
ATOM 1884 C C     . ASN A 1 275 ? 5.337   -19.838 90.878  1.00 12.00 ? 275 ASN A C     1 
ATOM 1885 O O     . ASN A 1 275 ? 6.195   -19.588 91.733  1.00 12.00 ? 275 ASN A O     1 
ATOM 1886 C CB    . ASN A 1 275 ? 4.732   -22.233 90.806  1.00 12.00 ? 275 ASN A CB    1 
ATOM 1887 C CG    . ASN A 1 275 ? 4.479   -23.469 89.951  1.00 12.00 ? 275 ASN A CG    1 
ATOM 1888 O OD1   . ASN A 1 275 ? 3.824   -23.376 88.919  1.00 20.00 ? 275 ASN A OD1   1 
ATOM 1889 N ND2   . ASN A 1 275 ? 4.964   -24.634 90.320  1.00 20.00 ? 275 ASN A ND2   1 
ATOM 1890 N N     . PRO A 1 276 ? 4.320   -18.996 90.670  1.00 12.00 ? 276 PRO A N     1 
ATOM 1891 C CA    . PRO A 1 276 ? 4.173   -17.766 91.424  1.00 12.00 ? 276 PRO A CA    1 
ATOM 1892 C C     . PRO A 1 276 ? 4.026   -18.043 92.898  1.00 12.00 ? 276 PRO A C     1 
ATOM 1893 O O     . PRO A 1 276 ? 3.885   -19.241 93.288  1.00 12.00 ? 276 PRO A O     1 
ATOM 1894 C CB    . PRO A 1 276 ? 2.927   -17.140 90.862  1.00 12.00 ? 276 PRO A CB    1 
ATOM 1895 C CG    . PRO A 1 276 ? 2.389   -18.058 89.783  1.00 20.00 ? 276 PRO A CG    1 
ATOM 1896 C CD    . PRO A 1 276 ? 3.286   -19.244 89.671  1.00 20.00 ? 276 PRO A CD    1 
ATOM 1897 N N     . VAL A 1 277 ? 4.061   -16.953 93.648  1.00 12.00 ? 277 VAL A N     1 
ATOM 1898 C CA    . VAL A 1 277 ? 3.909   -16.951 95.114  1.00 12.00 ? 277 VAL A CA    1 
ATOM 1899 C C     . VAL A 1 277 ? 2.858   -15.912 95.508  1.00 12.00 ? 277 VAL A C     1 
ATOM 1900 O O     . VAL A 1 277 ? 2.900   -14.764 95.056  1.00 12.00 ? 277 VAL A O     1 
ATOM 1901 C CB    . VAL A 1 277 ? 5.234   -16.597 95.788  1.00 12.00 ? 277 VAL A CB    1 
ATOM 1902 C CG1   . VAL A 1 277 ? 5.109   -16.418 97.298  1.00 20.00 ? 277 VAL A CG1   1 
ATOM 1903 C CG2   . VAL A 1 277 ? 6.309   -17.659 95.588  1.00 20.00 ? 277 VAL A CG2   1 
ATOM 1904 N N     . LYS A 1 278 ? 1.937   -16.346 96.343  1.00 12.00 ? 278 LYS A N     1 
ATOM 1905 C CA    . LYS A 1 278 ? 0.825   -15.505 96.808  1.00 12.00 ? 278 LYS A CA    1 
ATOM 1906 C C     . LYS A 1 278 ? 1.215   -14.735 98.070  1.00 12.00 ? 278 LYS A C     1 
ATOM 1907 O O     . LYS A 1 278 ? 1.591   -15.328 99.087  1.00 12.00 ? 278 LYS A O     1 
ATOM 1908 C CB    . LYS A 1 278 ? -0.390  -16.375 97.113  1.00 12.00 ? 278 LYS A CB    1 
ATOM 1909 C CG    . LYS A 1 278 ? -0.720  -17.347 95.984  1.00 12.00 ? 278 LYS A CG    1 
ATOM 1910 C CD    . LYS A 1 278 ? -2.216  -17.604 95.836  1.00 12.00 ? 278 LYS A CD    1 
ATOM 1911 C CE    . LYS A 1 278 ? -2.578  -18.278 94.517  1.00 20.00 ? 278 LYS A CE    1 
ATOM 1912 N NZ    . LYS A 1 278 ? -3.829  -19.037 94.586  1.00 20.00 ? 278 LYS A NZ    1 
ATOM 1913 N N     . LEU A 1 279 ? 1.098   -13.426 97.951  1.00 12.00 ? 279 LEU A N     1 
ATOM 1914 C CA    . LEU A 1 279 ? 1.412   -12.484 99.031  1.00 12.00 ? 279 LEU A CA    1 
ATOM 1915 C C     . LEU A 1 279 ? 0.172   -12.224 99.883  1.00 12.00 ? 279 LEU A C     1 
ATOM 1916 O O     . LEU A 1 279 ? 0.011   -11.144 100.460 1.00 12.00 ? 279 LEU A O     1 
ATOM 1917 C CB    . LEU A 1 279 ? 1.881   -11.153 98.449  1.00 12.00 ? 279 LEU A CB    1 
ATOM 1918 C CG    . LEU A 1 279 ? 3.198   -11.262 97.686  1.00 12.00 ? 279 LEU A CG    1 
ATOM 1919 C CD1   . LEU A 1 279 ? 3.597   -9.958  97.001  1.00 12.00 ? 279 LEU A CD1   1 
ATOM 1920 C CD2   . LEU A 1 279 ? 4.375   -11.635 98.579  1.00 12.00 ? 279 LEU A CD2   1 
ATOM 1921 N N     . THR A 1 280 ? -0.669  -13.235 99.931  1.00 12.00 ? 280 THR A N     1 
ATOM 1922 C CA    . THR A 1 280 ? -1.923  -13.197 100.689 1.00 12.00 ? 280 THR A CA    1 
ATOM 1923 C C     . THR A 1 280 ? -1.979  -14.372 101.662 1.00 12.00 ? 280 THR A C     1 
ATOM 1924 O O     . THR A 1 280 ? -1.492  -15.468 101.364 1.00 12.00 ? 280 THR A O     1 
ATOM 1925 C CB    . THR A 1 280 ? -3.109  -13.285 99.734  1.00 12.00 ? 280 THR A CB    1 
ATOM 1926 O OG1   . THR A 1 280 ? -3.125  -12.159 98.876  1.00 12.00 ? 280 THR A OG1   1 
ATOM 1927 C CG2   . THR A 1 280 ? -4.452  -13.330 100.452 1.00 12.00 ? 280 THR A CG2   1 
ATOM 1928 N N     . HIS A 1 281 ? -2.577  -14.106 102.807 1.00 12.00 ? 281 HIS A N     1 
ATOM 1929 C CA    . HIS A 1 281 ? -2.734  -15.105 103.872 1.00 12.00 ? 281 HIS A CA    1 
ATOM 1930 C C     . HIS A 1 281 ? -4.214  -15.449 104.046 1.00 12.00 ? 281 HIS A C     1 
ATOM 1931 O O     . HIS A 1 281 ? -5.093  -14.611 103.818 1.00 12.00 ? 281 HIS A O     1 
ATOM 1932 C CB    . HIS A 1 281 ? -2.154  -14.570 105.180 1.00 12.00 ? 281 HIS A CB    1 
ATOM 1933 C CG    . HIS A 1 281 ? -3.058  -13.565 105.888 1.00 12.00 ? 281 HIS A CG    1 
ATOM 1934 N ND1   . HIS A 1 281 ? -3.109  -12.230 105.515 1.00 12.00 ? 281 HIS A ND1   1 
ATOM 1935 C CD2   . HIS A 1 281 ? -3.921  -13.700 106.924 1.00 12.00 ? 281 HIS A CD2   1 
ATOM 1936 C CE1   . HIS A 1 281 ? -3.966  -11.615 106.304 1.00 12.00 ? 281 HIS A CE1   1 
ATOM 1937 N NE2   . HIS A 1 281 ? -4.459  -12.478 107.149 1.00 12.00 ? 281 HIS A NE2   1 
ATOM 1938 N N     . THR A 1 282 ? -4.436  -16.687 104.448 1.00 12.00 ? 282 THR A N     1 
ATOM 1939 C CA    . THR A 1 282 ? -5.783  -17.243 104.651 1.00 12.00 ? 282 THR A CA    1 
ATOM 1940 C C     . THR A 1 282 ? -6.107  -17.355 106.140 1.00 12.00 ? 282 THR A C     1 
ATOM 1941 O O     . THR A 1 282 ? -5.309  -16.960 106.996 1.00 12.00 ? 282 THR A O     1 
ATOM 1942 C CB    . THR A 1 282 ? -5.865  -18.634 104.036 1.00 12.00 ? 282 THR A CB    1 
ATOM 1943 O OG1   . THR A 1 282 ? -4.684  -19.360 104.324 1.00 12.00 ? 282 THR A OG1   1 
ATOM 1944 C CG2   . THR A 1 282 ? -6.023  -18.606 102.521 1.00 12.00 ? 282 THR A CG2   1 
ATOM 1945 N N     . TRP A 1 283 ? -7.286  -17.898 106.402 1.00 12.00 ? 283 TRP A N     1 
ATOM 1946 C CA    . TRP A 1 283 ? -7.777  -18.088 107.772 1.00 12.00 ? 283 TRP A CA    1 
ATOM 1947 C C     . TRP A 1 283 ? -9.069  -18.897 107.808 1.00 12.00 ? 283 TRP A C     1 
ATOM 1948 O O     . TRP A 1 283 ? -9.735  -18.991 108.843 1.00 12.00 ? 283 TRP A O     1 
ATOM 1949 C CB    . TRP A 1 283 ? -8.073  -16.740 108.423 1.00 12.00 ? 283 TRP A CB    1 
ATOM 1950 C CG    . TRP A 1 283 ? -9.180  -15.944 107.724 1.00 12.00 ? 283 TRP A CG    1 
ATOM 1951 C CD1   . TRP A 1 283 ? -9.022  -14.928 106.872 1.00 12.00 ? 283 TRP A CD1   1 
ATOM 1952 C CD2   . TRP A 1 283 ? -10.575 -16.162 107.874 1.00 12.00 ? 283 TRP A CD2   1 
ATOM 1953 N NE1   . TRP A 1 283 ? -10.323 -14.485 106.491 1.00 12.00 ? 283 TRP A NE1   1 
ATOM 1954 C CE2   . TRP A 1 283 ? -11.220 -15.216 107.094 1.00 12.00 ? 283 TRP A CE2   1 
ATOM 1955 C CE3   . TRP A 1 283 ? -11.340 -17.069 108.609 1.00 12.00 ? 283 TRP A CE3   1 
ATOM 1956 C CZ2   . TRP A 1 283 ? -12.609 -15.109 107.012 1.00 12.00 ? 283 TRP A CZ2   1 
ATOM 1957 C CZ3   . TRP A 1 283 ? -12.739 -16.959 108.514 1.00 12.00 ? 283 TRP A CZ3   1 
ATOM 1958 C CH2   . TRP A 1 283 ? -13.342 -16.023 107.755 1.00 12.00 ? 283 TRP A CH2   1 
ATOM 1959 N N     . GLN A 1 284 ? -9.415  -19.479 106.684 1.00 12.00 ? 284 GLN A N     1 
ATOM 1960 C CA    . GLN A 1 284 ? -10.646 -20.264 106.588 1.00 12.00 ? 284 GLN A CA    1 
ATOM 1961 C C     . GLN A 1 284 ? -10.380 -21.718 106.957 1.00 12.00 ? 284 GLN A C     1 
ATOM 1962 O O     . GLN A 1 284 ? -9.942  -22.517 106.120 1.00 12.00 ? 284 GLN A O     1 
ATOM 1963 C CB    . GLN A 1 284 ? -11.236 -20.160 105.189 1.00 12.00 ? 284 GLN A CB    1 
ATOM 1964 C CG    . GLN A 1 284 ? -12.267 -19.039 105.092 1.00 12.00 ? 284 GLN A CG    1 
ATOM 1965 C CD    . GLN A 1 284 ? -13.184 -19.150 103.882 1.00 12.00 ? 284 GLN A CD    1 
ATOM 1966 O OE1   . GLN A 1 284 ? -12.781 -18.801 102.780 1.00 12.00 ? 284 GLN A OE1   1 
ATOM 1967 N NE2   . GLN A 1 284 ? -14.406 -19.615 104.021 1.00 12.00 ? 284 GLN A NE2   1 
ATOM 1968 N N     . THR A 1 285 ? -10.664 -21.975 108.214 1.00 12.00 ? 285 THR A N     1 
ATOM 1969 C CA    . THR A 1 285 ? -10.532 -23.294 108.827 1.00 12.00 ? 285 THR A CA    1 
ATOM 1970 C C     . THR A 1 285 ? -11.507 -24.244 108.146 1.00 12.00 ? 285 THR A C     1 
ATOM 1971 O O     . THR A 1 285 ? -11.778 -24.129 106.949 1.00 12.00 ? 285 THR A O     1 
ATOM 1972 C CB    . THR A 1 285 ? -10.856 -23.183 110.316 1.00 12.00 ? 285 THR A CB    1 
ATOM 1973 O OG1   . THR A 1 285 ? -10.460 -21.911 110.802 1.00 12.00 ? 285 THR A OG1   1 
ATOM 1974 C CG2   . THR A 1 285 ? -10.150 -24.233 111.164 1.00 12.00 ? 285 THR A CG2   1 
ATOM 1975 N N     . ASN A 1 286 ? -12.017 -25.167 108.924 1.00 12.00 ? 286 ASN A N     1 
ATOM 1976 C CA    . ASN A 1 286 ? -12.989 -26.143 108.433 1.00 12.00 ? 286 ASN A CA    1 
ATOM 1977 C C     . ASN A 1 286 ? -14.366 -25.772 108.947 1.00 12.00 ? 286 ASN A C     1 
ATOM 1978 O O     . ASN A 1 286 ? -15.386 -26.220 108.414 1.00 12.00 ? 286 ASN A O     1 
ATOM 1979 C CB    . ASN A 1 286 ? -12.621 -27.536 108.913 1.00 12.00 ? 286 ASN A CB    1 
ATOM 1980 C CG    . ASN A 1 286 ? -11.921 -28.350 107.835 1.00 12.00 ? 286 ASN A CG    1 
ATOM 1981 O OD1   . ASN A 1 286 ? -12.583 -28.986 107.024 1.00 12.00 ? 286 ASN A OD1   1 
ATOM 1982 N ND2   . ASN A 1 286 ? -10.609 -28.365 107.775 1.00 12.00 ? 286 ASN A ND2   1 
ATOM 1983 N N     . ARG A 1 287 ? -14.320 -24.957 109.966 1.00 12.00 ? 287 ARG A N     1 
ATOM 1984 C CA    . ARG A 1 287 ? -15.503 -24.441 110.633 1.00 12.00 ? 287 ARG A CA    1 
ATOM 1985 C C     . ARG A 1 287 ? -15.874 -23.099 110.039 1.00 12.00 ? 287 ARG A C     1 
ATOM 1986 O O     . ARG A 1 287 ? -16.729 -22.384 110.568 1.00 12.00 ? 287 ARG A O     1 
ATOM 1987 C CB    . ARG A 1 287 ? -15.207 -24.248 112.110 1.00 12.00 ? 287 ARG A CB    1 
ATOM 1988 C CG    . ARG A 1 287 ? -14.548 -25.464 112.741 1.00 12.00 ? 287 ARG A CG    1 
ATOM 1989 C CD    . ARG A 1 287 ? -15.308 -25.967 113.955 1.00 12.00 ? 287 ARG A CD    1 
ATOM 1990 N NE    . ARG A 1 287 ? -15.788 -24.881 114.807 1.00 12.00 ? 287 ARG A NE    1 
ATOM 1991 C CZ    . ARG A 1 287 ? -16.721 -25.025 115.747 1.00 12.00 ? 287 ARG A CZ    1 
ATOM 1992 N NH1   . ARG A 1 287 ? -17.293 -26.210 115.968 1.00 12.00 ? 287 ARG A NH1   1 
ATOM 1993 N NH2   . ARG A 1 287 ? -17.150 -24.033 116.529 1.00 12.00 ? 287 ARG A NH2   1 
ATOM 1994 N N     . GLN A 1 288 ? -15.215 -22.804 108.946 1.00 12.00 ? 288 GLN A N     1 
ATOM 1995 C CA    . GLN A 1 288 ? -15.392 -21.536 108.254 1.00 12.00 ? 288 GLN A CA    1 
ATOM 1996 C C     . GLN A 1 288 ? -15.263 -21.771 106.754 1.00 12.00 ? 288 GLN A C     1 
ATOM 1997 O O     . GLN A 1 288 ? -14.440 -21.141 106.081 1.00 12.00 ? 288 GLN A O     1 
ATOM 1998 C CB    . GLN A 1 288 ? -14.335 -20.576 108.790 1.00 12.00 ? 288 GLN A CB    1 
ATOM 1999 C CG    . GLN A 1 288 ? -14.282 -20.538 110.314 1.00 20.00 ? 288 GLN A CG    1 
ATOM 2000 C CD    . GLN A 1 288 ? -12.918 -20.120 110.852 1.00 20.00 ? 288 GLN A CD    1 
ATOM 2001 O OE1   . GLN A 1 288 ? -12.033 -19.774 110.077 1.00 20.00 ? 288 GLN A OE1   1 
ATOM 2002 N NE2   . GLN A 1 288 ? -12.692 -20.130 112.147 1.00 20.00 ? 288 GLN A NE2   1 
ATOM 2003 N N     . LEU A 1 289 ? -16.100 -22.685 106.303 1.00 12.00 ? 289 LEU A N     1 
ATOM 2004 C CA    . LEU A 1 289 ? -16.171 -23.098 104.900 1.00 12.00 ? 289 LEU A CA    1 
ATOM 2005 C C     . LEU A 1 289 ? -17.550 -23.671 104.583 1.00 12.00 ? 289 LEU A C     1 
ATOM 2006 O O     . LEU A 1 289 ? -17.820 -24.853 104.820 1.00 12.00 ? 289 LEU A O     1 
ATOM 2007 C CB    . LEU A 1 289 ? -15.147 -24.194 104.620 1.00 12.00 ? 289 LEU A CB    1 
ATOM 2008 C CG    . LEU A 1 289 ? -13.706 -23.703 104.678 1.00 12.00 ? 289 LEU A CG    1 
ATOM 2009 C CD1   . LEU A 1 289 ? -12.690 -24.824 104.490 1.00 12.00 ? 289 LEU A CD1   1 
ATOM 2010 C CD2   . LEU A 1 289 ? -13.386 -22.672 103.603 1.00 12.00 ? 289 LEU A CD2   1 
ATOM 2011 N N     . GLY A 1 290 ? -18.398 -22.815 104.052 1.00 12.00 ? 290 GLY A N     1 
ATOM 2012 C CA    . GLY A 1 290 ? -19.755 -23.205 103.659 1.00 12.00 ? 290 GLY A CA    1 
ATOM 2013 C C     . GLY A 1 290 ? -20.793 -22.245 104.233 1.00 12.00 ? 290 GLY A C     1 
ATOM 2014 O O     . GLY A 1 290 ? -20.460 -21.152 104.703 1.00 12.00 ? 290 GLY A O     1 
ATOM 2015 N N     . GLN A 1 291 ? -22.020 -22.717 104.164 1.00 12.00 ? 291 GLN A N     1 
ATOM 2016 C CA    . GLN A 1 291 ? -23.203 -21.989 104.628 1.00 12.00 ? 291 GLN A CA    1 
ATOM 2017 C C     . GLN A 1 291 ? -23.314 -22.060 106.146 1.00 12.00 ? 291 GLN A C     1 
ATOM 2018 O O     . GLN A 1 291 ? -23.553 -23.130 106.717 1.00 12.00 ? 291 GLN A O     1 
ATOM 2019 C CB    . GLN A 1 291 ? -24.455 -22.614 104.022 1.00 12.00 ? 291 GLN A CB    1 
ATOM 2020 C CG    . GLN A 1 291 ? -25.732 -21.866 104.383 1.00 12.00 ? 291 GLN A CG    1 
ATOM 2021 C CD    . GLN A 1 291 ? -26.249 -20.998 103.244 1.00 20.00 ? 291 GLN A CD    1 
ATOM 2022 O OE1   . GLN A 1 291 ? -25.529 -20.132 102.761 1.00 20.00 ? 291 GLN A OE1   1 
ATOM 2023 N NE2   . GLN A 1 291 ? -27.466 -21.178 102.779 1.00 20.00 ? 291 GLN A NE2   1 
ATOM 2024 N N     . PRO A 1 292 ? -23.155 -20.945 106.867 1.00 12.00 ? 292 PRO A N     1 
ATOM 2025 C CA    . PRO A 1 292 ? -23.272 -20.960 108.309 1.00 12.00 ? 292 PRO A CA    1 
ATOM 2026 C C     . PRO A 1 292 ? -24.640 -21.443 108.691 1.00 12.00 ? 292 PRO A C     1 
ATOM 2027 O O     . PRO A 1 292 ? -25.572 -21.381 107.837 1.00 12.00 ? 292 PRO A O     1 
ATOM 2028 C CB    . PRO A 1 292 ? -23.029 -19.530 108.705 1.00 12.00 ? 292 PRO A CB    1 
ATOM 2029 C CG    . PRO A 1 292 ? -22.774 -18.733 107.442 1.00 12.00 ? 292 PRO A CG    1 
ATOM 2030 C CD    . PRO A 1 292 ? -22.856 -19.650 106.268 1.00 12.00 ? 292 PRO A CD    1 
ATOM 2031 N N     . PRO A 1 293 ? -24.865 -21.931 109.921 1.00 12.00 ? 293 PRO A N     1 
ATOM 2032 C CA    . PRO A 1 293 ? -26.177 -22.409 110.313 1.00 12.00 ? 293 PRO A CA    1 
ATOM 2033 C C     . PRO A 1 293 ? -27.190 -21.306 110.178 1.00 12.00 ? 293 PRO A C     1 
ATOM 2034 O O     . PRO A 1 293 ? -26.795 -20.104 110.211 1.00 12.00 ? 293 PRO A O     1 
ATOM 2035 C CB    . PRO A 1 293 ? -25.996 -22.850 111.739 1.00 12.00 ? 293 PRO A CB    1 
ATOM 2036 C CG    . PRO A 1 293 ? -24.549 -22.609 112.119 1.00 12.00 ? 293 PRO A CG    1 
ATOM 2037 C CD    . PRO A 1 293 ? -23.833 -22.022 110.947 1.00 12.00 ? 293 PRO A CD    1 
ATOM 2038 N N     . LEU A 1 294 ? -28.436 -21.719 110.032 1.00 12.00 ? 294 LEU A N     1 
ATOM 2039 C CA    . LEU A 1 294 ? -29.576 -20.799 109.880 1.00 12.00 ? 294 LEU A CA    1 
ATOM 2040 C C     . LEU A 1 294 ? -29.980 -20.240 111.241 1.00 12.00 ? 294 LEU A C     1 
ATOM 2041 O O     . LEU A 1 294 ? -30.264 -20.993 112.179 1.00 12.00 ? 294 LEU A O     1 
ATOM 2042 C CB    . LEU A 1 294 ? -30.771 -21.535 109.277 1.00 12.00 ? 294 LEU A CB    1 
ATOM 2043 C CG    . LEU A 1 294 ? -31.430 -20.766 108.138 1.00 12.00 ? 294 LEU A CG    1 
ATOM 2044 C CD1   . LEU A 1 294 ? -32.947 -20.679 108.278 1.00 12.00 ? 294 LEU A CD1   1 
ATOM 2045 C CD2   . LEU A 1 294 ? -30.943 -19.326 108.031 1.00 12.00 ? 294 LEU A CD2   1 
ATOM 2046 N N     . LEU A 1 295 ? -29.989 -18.926 111.300 1.00 12.00 ? 295 LEU A N     1 
ATOM 2047 C CA    . LEU A 1 295 ? -30.346 -18.185 112.513 1.00 12.00 ? 295 LEU A CA    1 
ATOM 2048 C C     . LEU A 1 295 ? -31.856 -17.978 112.573 1.00 12.00 ? 295 LEU A C     1 
ATOM 2049 O O     . LEU A 1 295 ? -32.428 -17.229 111.771 1.00 12.00 ? 295 LEU A O     1 
ATOM 2050 C CB    . LEU A 1 295 ? -29.660 -16.823 112.512 1.00 12.00 ? 295 LEU A CB    1 
ATOM 2051 C CG    . LEU A 1 295 ? -28.182 -16.899 112.880 1.00 12.00 ? 295 LEU A CG    1 
ATOM 2052 C CD1   . LEU A 1 295 ? -27.591 -15.544 113.254 1.00 12.00 ? 295 LEU A CD1   1 
ATOM 2053 C CD2   . LEU A 1 295 ? -27.912 -17.810 114.073 1.00 12.00 ? 295 LEU A CD2   1 
ATOM 2054 N N     . SER A 1 296 ? -32.453 -18.655 113.529 1.00 12.00 ? 296 SER A N     1 
ATOM 2055 C CA    . SER A 1 296 ? -33.899 -18.601 113.764 1.00 12.00 ? 296 SER A CA    1 
ATOM 2056 C C     . SER A 1 296 ? -34.221 -17.509 114.779 1.00 12.00 ? 296 SER A C     1 
ATOM 2057 O O     . SER A 1 296 ? -35.369 -17.066 114.893 1.00 12.00 ? 296 SER A O     1 
ATOM 2058 C CB    . SER A 1 296 ? -34.391 -19.941 114.301 1.00 12.00 ? 296 SER A CB    1 
ATOM 2059 O OG    . SER A 1 296 ? -33.984 -20.101 115.646 1.00 20.00 ? 296 SER A OG    1 
ATOM 2060 N N     . THR A 1 297 ? -33.184 -17.115 115.485 1.00 12.00 ? 297 THR A N     1 
ATOM 2061 C CA    . THR A 1 297 ? -33.261 -16.071 116.511 1.00 12.00 ? 297 THR A CA    1 
ATOM 2062 C C     . THR A 1 297 ? -32.071 -15.129 116.368 1.00 12.00 ? 297 THR A C     1 
ATOM 2063 O O     . THR A 1 297 ? -30.917 -15.564 116.311 1.00 12.00 ? 297 THR A O     1 
ATOM 2064 C CB    . THR A 1 297 ? -33.239 -16.703 117.898 1.00 12.00 ? 297 THR A CB    1 
ATOM 2065 O OG1   . THR A 1 297 ? -34.335 -17.587 118.045 1.00 20.00 ? 297 THR A OG1   1 
ATOM 2066 C CG2   . THR A 1 297 ? -33.330 -15.677 119.022 1.00 20.00 ? 297 THR A CG2   1 
ATOM 2067 N N     . PHE A 1 298 ? -32.393 -13.854 116.313 1.00 12.00 ? 298 PHE A N     1 
ATOM 2068 C CA    . PHE A 1 298 ? -31.397 -12.792 116.156 1.00 12.00 ? 298 PHE A CA    1 
ATOM 2069 C C     . PHE A 1 298 ? -31.342 -11.915 117.398 1.00 12.00 ? 298 PHE A C     1 
ATOM 2070 O O     . PHE A 1 298 ? -32.349 -11.730 118.091 1.00 12.00 ? 298 PHE A O     1 
ATOM 2071 C CB    . PHE A 1 298 ? -31.762 -11.907 114.971 1.00 12.00 ? 298 PHE A CB    1 
ATOM 2072 C CG    . PHE A 1 298 ? -32.019 -12.700 113.698 1.00 12.00 ? 298 PHE A CG    1 
ATOM 2073 C CD1   . PHE A 1 298 ? -30.966 -12.976 112.830 1.00 12.00 ? 298 PHE A CD1   1 
ATOM 2074 C CD2   . PHE A 1 298 ? -33.307 -13.149 113.405 1.00 12.00 ? 298 PHE A CD2   1 
ATOM 2075 C CE1   . PHE A 1 298 ? -31.199 -13.705 111.663 1.00 20.00 ? 298 PHE A CE1   1 
ATOM 2076 C CE2   . PHE A 1 298 ? -33.541 -13.876 112.238 1.00 20.00 ? 298 PHE A CE2   1 
ATOM 2077 C CZ    . PHE A 1 298 ? -32.487 -14.154 111.367 1.00 20.00 ? 298 PHE A CZ    1 
ATOM 2078 N N     . PRO A 1 299 ? -30.181 -11.342 117.734 1.00 12.00 ? 299 PRO A N     1 
ATOM 2079 C CA    . PRO A 1 299 ? -30.077 -10.480 118.888 1.00 12.00 ? 299 PRO A CA    1 
ATOM 2080 C C     . PRO A 1 299 ? -31.028 -9.333  118.723 1.00 12.00 ? 299 PRO A C     1 
ATOM 2081 O O     . PRO A 1 299 ? -31.534 -9.114  117.585 1.00 12.00 ? 299 PRO A O     1 
ATOM 2082 C CB    . PRO A 1 299 ? -28.634 -10.056 118.893 1.00 12.00 ? 299 PRO A CB    1 
ATOM 2083 C CG    . PRO A 1 299 ? -27.951 -10.716 117.712 1.00 12.00 ? 299 PRO A CG    1 
ATOM 2084 C CD    . PRO A 1 299 ? -28.952 -11.541 116.977 1.00 12.00 ? 299 PRO A CD    1 
ATOM 2085 N N     . GLU A 1 300 ? -31.256 -8.631  119.816 1.00 12.00 ? 300 GLU A N     1 
ATOM 2086 C CA    . GLU A 1 300 ? -32.178 -7.488  119.835 1.00 12.00 ? 300 GLU A CA    1 
ATOM 2087 C C     . GLU A 1 300 ? -31.439 -6.193  120.154 1.00 12.00 ? 300 GLU A C     1 
ATOM 2088 O O     . GLU A 1 300 ? -32.044 -5.119  120.237 1.00 12.00 ? 300 GLU A O     1 
ATOM 2089 C CB    . GLU A 1 300 ? -33.256 -7.701  120.893 1.00 12.00 ? 300 GLU A CB    1 
ATOM 2090 C CG    . GLU A 1 300 ? -34.320 -8.705  120.464 1.00 12.00 ? 300 GLU A CG    1 
ATOM 2091 C CD    . GLU A 1 300 ? -35.604 -8.597  121.279 1.00 12.00 ? 300 GLU A CD    1 
ATOM 2092 O OE1   . GLU A 1 300 ? -35.688 -7.741  122.235 1.00 12.00 ? 300 GLU A OE1   1 
ATOM 2093 O OE2   . GLU A 1 300 ? -36.602 -9.361  121.011 1.00 20.00 ? 300 GLU A OE2   1 
ATOM 2094 N N     . ALA A 1 301 ? -30.144 -6.326  120.325 1.00 12.00 ? 301 ALA A N     1 
ATOM 2095 C CA    . ALA A 1 301 ? -29.272 -5.190  120.634 1.00 12.00 ? 301 ALA A CA    1 
ATOM 2096 C C     . ALA A 1 301 ? -27.971 -5.677  121.255 1.00 12.00 ? 301 ALA A C     1 
ATOM 2097 O O     . ALA A 1 301 ? -27.975 -6.468  122.204 1.00 12.00 ? 301 ALA A O     1 
ATOM 2098 C CB    . ALA A 1 301 ? -29.965 -4.254  121.617 1.00 12.00 ? 301 ALA A CB    1 
ATOM 2099 N N     . ASP A 1 302 ? -26.891 -5.179  120.691 1.00 12.00 ? 302 ASP A N     1 
ATOM 2100 C CA    . ASP A 1 302 ? -25.540 -5.512  121.141 1.00 12.00 ? 302 ASP A CA    1 
ATOM 2101 C C     . ASP A 1 302 ? -25.601 -6.057  122.561 1.00 12.00 ? 302 ASP A C     1 
ATOM 2102 O O     . ASP A 1 302 ? -25.997 -5.353  123.496 1.00 12.00 ? 302 ASP A O     1 
ATOM 2103 C CB    . ASP A 1 302 ? -24.663 -4.268  121.112 1.00 12.00 ? 302 ASP A CB    1 
ATOM 2104 C CG    . ASP A 1 302 ? -24.983 -3.344  119.942 1.00 12.00 ? 302 ASP A CG    1 
ATOM 2105 O OD1   . ASP A 1 302 ? -25.883 -3.679  119.087 1.00 20.00 ? 302 ASP A OD1   1 
ATOM 2106 O OD2   . ASP A 1 302 ? -24.356 -2.230  119.811 1.00 20.00 ? 302 ASP A OD2   1 
ATOM 2107 N N     . THR A 1 303 ? -25.206 -7.304  122.671 1.00 12.00 ? 303 THR A N     1 
ATOM 2108 C CA    . THR A 1 303 ? -25.204 -8.027  123.943 1.00 12.00 ? 303 THR A CA    1 
ATOM 2109 C C     . THR A 1 303 ? -26.416 -8.948  124.000 1.00 12.00 ? 303 THR A C     1 
ATOM 2110 O O     . THR A 1 303 ? -27.321 -8.758  124.821 1.00 12.00 ? 303 THR A O     1 
ATOM 2111 C CB    . THR A 1 303 ? -25.261 -7.039  125.102 1.00 20.00 ? 303 THR A CB    1 
ATOM 2112 O OG1   . THR A 1 303 ? -26.532 -7.094  125.722 1.00 20.00 ? 303 THR A OG1   1 
ATOM 2113 C CG2   . THR A 1 303 ? -25.029 -5.596  124.667 1.00 20.00 ? 303 THR A CG2   1 
ATOM 2114 N N     . ASP A 1 304 ? -26.384 -9.917  123.112 1.00 12.00 ? 304 ASP A N     1 
ATOM 2115 C CA    . ASP A 1 304 ? -27.448 -10.915 122.975 1.00 12.00 ? 304 ASP A CA    1 
ATOM 2116 C C     . ASP A 1 304 ? -27.355 -11.582 121.606 1.00 12.00 ? 304 ASP A C     1 
ATOM 2117 O O     . ASP A 1 304 ? -27.973 -11.131 120.636 1.00 12.00 ? 304 ASP A O     1 
ATOM 2118 C CB    . ASP A 1 304 ? -28.808 -10.241 123.108 1.00 12.00 ? 304 ASP A CB    1 
ATOM 2119 C CG    . ASP A 1 304 ? -28.816 -8.814  122.570 1.00 20.00 ? 304 ASP A CG    1 
ATOM 2120 O OD1   . ASP A 1 304 ? -27.738 -8.301  122.092 1.00 20.00 ? 304 ASP A OD1   1 
ATOM 2121 O OD2   . ASP A 1 304 ? -29.900 -8.124  122.593 1.00 20.00 ? 304 ASP A OD2   1 
ATOM 2122 N N     . ALA A 1 305 ? -26.577 -12.644 121.576 1.00 12.00 ? 305 ALA A N     1 
ATOM 2123 C CA    . ALA A 1 305 ? -26.341 -13.429 120.360 1.00 12.00 ? 305 ALA A CA    1 
ATOM 2124 C C     . ALA A 1 305 ? -27.577 -14.252 120.013 1.00 12.00 ? 305 ALA A C     1 
ATOM 2125 O O     . ALA A 1 305 ? -28.509 -14.369 120.816 1.00 12.00 ? 305 ALA A O     1 
ATOM 2126 C CB    . ALA A 1 305 ? -25.163 -14.373 120.570 1.00 12.00 ? 305 ALA A CB    1 
ATOM 2127 N N     . GLY A 1 306 ? -27.536 -14.798 118.814 1.00 12.00 ? 306 GLY A N     1 
ATOM 2128 C CA    . GLY A 1 306 ? -28.617 -15.628 118.273 1.00 12.00 ? 306 GLY A CA    1 
ATOM 2129 C C     . GLY A 1 306 ? -28.397 -17.090 118.649 1.00 12.00 ? 306 GLY A C     1 
ATOM 2130 O O     . GLY A 1 306 ? -27.371 -17.447 119.237 1.00 12.00 ? 306 GLY A O     1 
ATOM 2131 N N     . THR A 1 307 ? -29.380 -17.891 118.290 1.00 12.00 ? 307 THR A N     1 
ATOM 2132 C CA    . THR A 1 307 ? -29.373 -19.333 118.562 1.00 12.00 ? 307 THR A CA    1 
ATOM 2133 C C     . THR A 1 307 ? -29.984 -20.099 117.391 1.00 12.00 ? 307 THR A C     1 
ATOM 2134 O O     . THR A 1 307 ? -31.003 -19.689 116.825 1.00 12.00 ? 307 THR A O     1 
ATOM 2135 C CB    . THR A 1 307 ? -30.190 -19.629 119.816 1.00 12.00 ? 307 THR A CB    1 
ATOM 2136 O OG1   . THR A 1 307 ? -31.558 -19.356 119.578 1.00 20.00 ? 307 THR A OG1   1 
ATOM 2137 C CG2   . THR A 1 307 ? -29.761 -18.795 121.017 1.00 12.00 ? 307 THR A CG2   1 
ATOM 2138 N N     . LEU A 1 308 ? -29.329 -21.197 117.069 1.00 12.00 ? 308 LEU A N     1 
ATOM 2139 C CA    . LEU A 1 308 ? -29.747 -22.094 115.985 1.00 12.00 ? 308 LEU A CA    1 
ATOM 2140 C C     . LEU A 1 308 ? -30.871 -22.999 116.501 1.00 12.00 ? 308 LEU A C     1 
ATOM 2141 O O     . LEU A 1 308 ? -31.449 -22.751 117.563 1.00 12.00 ? 308 LEU A O     1 
ATOM 2142 C CB    . LEU A 1 308 ? -28.544 -22.895 115.508 1.00 20.00 ? 308 LEU A CB    1 
ATOM 2143 C CG    . LEU A 1 308 ? -27.343 -22.005 115.189 1.00 20.00 ? 308 LEU A CG    1 
ATOM 2144 C CD1   . LEU A 1 308 ? -26.241 -22.733 114.428 1.00 20.00 ? 308 LEU A CD1   1 
ATOM 2145 C CD2   . LEU A 1 308 ? -27.707 -20.796 114.330 1.00 20.00 ? 308 LEU A CD2   1 
ATOM 2146 N N     . THR A 1 309 ? -31.173 -24.046 115.750 1.00 12.00 ? 309 THR A N     1 
ATOM 2147 C CA    . THR A 1 309 ? -32.277 -24.958 116.108 1.00 12.00 ? 309 THR A CA    1 
ATOM 2148 C C     . THR A 1 309 ? -31.795 -26.394 116.365 1.00 12.00 ? 309 THR A C     1 
ATOM 2149 O O     . THR A 1 309 ? -30.830 -26.861 115.749 1.00 12.00 ? 309 THR A O     1 
ATOM 2150 C CB    . THR A 1 309 ? -33.317 -24.983 114.994 1.00 12.00 ? 309 THR A CB    1 
ATOM 2151 O OG1   . THR A 1 309 ? -32.680 -24.952 113.733 1.00 20.00 ? 309 THR A OG1   1 
ATOM 2152 C CG2   . THR A 1 309 ? -34.275 -23.797 115.050 1.00 12.00 ? 309 THR A CG2   1 
ATOM 2153 N N     . ALA A 1 310 ? -32.533 -27.013 117.278 1.00 12.00 ? 310 ALA A N     1 
ATOM 2154 C CA    . ALA A 1 310 ? -32.332 -28.396 117.758 1.00 12.00 ? 310 ALA A CA    1 
ATOM 2155 C C     . ALA A 1 310 ? -31.406 -29.188 116.838 1.00 12.00 ? 310 ALA A C     1 
ATOM 2156 O O     . ALA A 1 310 ? -31.774 -29.522 115.706 1.00 12.00 ? 310 ALA A O     1 
ATOM 2157 C CB    . ALA A 1 310 ? -33.671 -29.122 117.830 1.00 12.00 ? 310 ALA A CB    1 
ATOM 2158 N N     . GLN A 1 311 ? -30.246 -29.466 117.396 1.00 12.00 ? 311 GLN A N     1 
ATOM 2159 C CA    . GLN A 1 311 ? -29.154 -30.195 116.733 1.00 12.00 ? 311 GLN A CA    1 
ATOM 2160 C C     . GLN A 1 311 ? -29.681 -31.423 116.000 1.00 12.00 ? 311 GLN A C     1 
ATOM 2161 O O     . GLN A 1 311 ? -29.533 -31.542 114.787 1.00 12.00 ? 311 GLN A O     1 
ATOM 2162 C CB    . GLN A 1 311 ? -28.110 -30.608 117.763 1.00 12.00 ? 311 GLN A CB    1 
ATOM 2163 C CG    . GLN A 1 311 ? -27.508 -29.444 118.525 1.00 12.00 ? 311 GLN A CG    1 
ATOM 2164 C CD    . GLN A 1 311 ? -26.178 -29.782 119.156 1.00 12.00 ? 311 GLN A CD    1 
ATOM 2165 O OE1   . GLN A 1 311 ? -25.126 -29.514 118.586 1.00 12.00 ? 311 GLN A OE1   1 
ATOM 2166 N NE2   . GLN A 1 311 ? -25.992 -30.369 120.327 1.00 12.00 ? 311 GLN A NE2   1 
ATOM 2167 N N     . GLY A 1 312 ? -30.293 -32.332 116.754 1.00 12.00 ? 312 GLY A N     1 
ATOM 2168 C CA    . GLY A 1 312 ? -30.845 -33.554 116.199 1.00 12.00 ? 312 GLY A CA    1 
ATOM 2169 C C     . GLY A 1 312 ? -32.202 -33.304 115.556 1.00 12.00 ? 312 GLY A C     1 
ATOM 2170 O O     . GLY A 1 312 ? -33.070 -34.171 115.569 1.00 12.00 ? 312 GLY A O     1 
ATOM 2171 N N     . SER A 1 313 ? -32.356 -32.113 115.008 1.00 12.00 ? 313 SER A N     1 
ATOM 2172 C CA    . SER A 1 313 ? -33.577 -31.701 114.334 1.00 12.00 ? 313 SER A CA    1 
ATOM 2173 C C     . SER A 1 313 ? -33.222 -30.739 113.218 1.00 12.00 ? 313 SER A C     1 
ATOM 2174 O O     . SER A 1 313 ? -34.092 -30.309 112.463 1.00 12.00 ? 313 SER A O     1 
ATOM 2175 C CB    . SER A 1 313 ? -34.541 -31.074 115.338 1.00 12.00 ? 313 SER A CB    1 
ATOM 2176 O OG    . SER A 1 313 ? -35.879 -31.199 114.908 1.00 20.00 ? 313 SER A OG    1 
ATOM 2177 N N     . ARG A 1 314 ? -31.930 -30.443 113.168 1.00 12.00 ? 314 ARG A N     1 
ATOM 2178 C CA    . ARG A 1 314 ? -31.331 -29.542 112.198 1.00 12.00 ? 314 ARG A CA    1 
ATOM 2179 C C     . ARG A 1 314 ? -31.084 -30.235 110.869 1.00 12.00 ? 314 ARG A C     1 
ATOM 2180 O O     . ARG A 1 314 ? -30.577 -31.349 110.825 1.00 12.00 ? 314 ARG A O     1 
ATOM 2181 C CB    . ARG A 1 314 ? -29.987 -29.037 112.728 1.00 12.00 ? 314 ARG A CB    1 
ATOM 2182 C CG    . ARG A 1 314 ? -29.862 -27.533 112.859 1.00 12.00 ? 314 ARG A CG    1 
ATOM 2183 C CD    . ARG A 1 314 ? -28.965 -27.164 114.028 1.00 12.00 ? 314 ARG A CD    1 
ATOM 2184 N NE    . ARG A 1 314 ? -27.818 -26.359 113.625 1.00 12.00 ? 314 ARG A NE    1 
ATOM 2185 C CZ    . ARG A 1 314 ? -26.796 -26.067 114.421 1.00 12.00 ? 314 ARG A CZ    1 
ATOM 2186 N NH1   . ARG A 1 314 ? -26.775 -26.522 115.662 1.00 12.00 ? 314 ARG A NH1   1 
ATOM 2187 N NH2   . ARG A 1 314 ? -25.801 -25.319 113.977 1.00 12.00 ? 314 ARG A NH2   1 
ATOM 2188 N N     . HIS A 1 315 ? -31.432 -29.585 109.770 1.00 12.00 ? 315 HIS A N     1 
ATOM 2189 C CA    . HIS A 1 315 ? -31.180 -30.162 108.461 1.00 12.00 ? 315 HIS A CA    1 
ATOM 2190 C C     . HIS A 1 315 ? -29.706 -30.026 108.110 1.00 12.00 ? 315 HIS A C     1 
ATOM 2191 O O     . HIS A 1 315 ? -29.036 -29.105 108.564 1.00 12.00 ? 315 HIS A O     1 
ATOM 2192 C CB    . HIS A 1 315 ? -32.062 -29.513 107.399 1.00 12.00 ? 315 HIS A CB    1 
ATOM 2193 C CG    . HIS A 1 315 ? -33.577 -29.643 107.673 1.00 12.00 ? 315 HIS A CG    1 
ATOM 2194 N ND1   . HIS A 1 315 ? -34.312 -28.633 108.243 1.00 20.00 ? 315 HIS A ND1   1 
ATOM 2195 C CD2   . HIS A 1 315 ? -34.442 -30.655 107.446 1.00 20.00 ? 315 HIS A CD2   1 
ATOM 2196 C CE1   . HIS A 1 315 ? -35.566 -29.017 108.356 1.00 20.00 ? 315 HIS A CE1   1 
ATOM 2197 N NE2   . HIS A 1 315 ? -35.671 -30.240 107.880 1.00 20.00 ? 315 HIS A NE2   1 
ATOM 2198 N N     . GLY A 1 316 ? -29.198 -30.943 107.303 1.00 12.00 ? 316 GLY A N     1 
ATOM 2199 C CA    . GLY A 1 316 ? -27.802 -30.928 106.910 1.00 12.00 ? 316 GLY A CA    1 
ATOM 2200 C C     . GLY A 1 316 ? -27.265 -32.347 106.801 1.00 12.00 ? 316 GLY A C     1 
ATOM 2201 O O     . GLY A 1 316 ? -27.994 -33.322 107.018 1.00 12.00 ? 316 GLY A O     1 
ATOM 2202 N N     . ALA A 1 317 ? -25.997 -32.416 106.469 1.00 12.00 ? 317 ALA A N     1 
ATOM 2203 C CA    . ALA A 1 317 ? -25.291 -33.685 106.304 1.00 12.00 ? 317 ALA A CA    1 
ATOM 2204 C C     . ALA A 1 317 ? -24.211 -33.837 107.367 1.00 12.00 ? 317 ALA A C     1 
ATOM 2205 O O     . ALA A 1 317 ? -23.879 -32.881 108.078 1.00 12.00 ? 317 ALA A O     1 
ATOM 2206 C CB    . ALA A 1 317 ? -24.635 -33.741 104.930 1.00 12.00 ? 317 ALA A CB    1 
ATOM 2207 N N     . THR A 1 318 ? -23.710 -35.048 107.426 1.00 12.00 ? 318 THR A N     1 
ATOM 2208 C CA    . THR A 1 318 ? -22.654 -35.443 108.358 1.00 12.00 ? 318 THR A CA    1 
ATOM 2209 C C     . THR A 1 318 ? -22.118 -36.811 107.956 1.00 12.00 ? 318 THR A C     1 
ATOM 2210 O O     . THR A 1 318 ? -22.792 -37.580 107.264 1.00 12.00 ? 318 THR A O     1 
ATOM 2211 C CB    . THR A 1 318 ? -23.206 -35.514 109.778 1.00 12.00 ? 318 THR A CB    1 
ATOM 2212 O OG1   . THR A 1 318 ? -23.682 -34.241 110.175 1.00 12.00 ? 318 THR A OG1   1 
ATOM 2213 C CG2   . THR A 1 318 ? -22.163 -35.948 110.801 1.00 12.00 ? 318 THR A CG2   1 
ATOM 2214 N N     . GLN A 1 319 ? -20.913 -37.069 108.405 1.00 12.00 ? 319 GLN A N     1 
ATOM 2215 C CA    . GLN A 1 319 ? -20.214 -38.322 108.120 1.00 12.00 ? 319 GLN A CA    1 
ATOM 2216 C C     . GLN A 1 319 ? -20.119 -39.170 109.381 1.00 12.00 ? 319 GLN A C     1 
ATOM 2217 O O     . GLN A 1 319 ? -19.352 -40.137 109.442 1.00 12.00 ? 319 GLN A O     1 
ATOM 2218 C CB    . GLN A 1 319 ? -18.803 -38.022 107.628 1.00 12.00 ? 319 GLN A CB    1 
ATOM 2219 C CG    . GLN A 1 319 ? -18.273 -39.066 106.655 1.00 12.00 ? 319 GLN A CG    1 
ATOM 2220 C CD    . GLN A 1 319 ? -17.018 -38.606 105.920 1.00 12.00 ? 319 GLN A CD    1 
ATOM 2221 O OE1   . GLN A 1 319 ? -16.013 -38.305 106.553 1.00 12.00 ? 319 GLN A OE1   1 
ATOM 2222 N NE2   . GLN A 1 319 ? -17.017 -38.529 104.607 1.00 12.00 ? 319 GLN A NE2   1 
ATOM 2223 N N     . MET A 1 320 ? -20.909 -38.783 110.358 1.00 12.00 ? 320 MET A N     1 
ATOM 2224 C CA    . MET A 1 320 ? -20.936 -39.459 111.656 1.00 12.00 ? 320 MET A CA    1 
ATOM 2225 C C     . MET A 1 320 ? -22.350 -40.071 111.735 1.00 12.00 ? 320 MET A C     1 
ATOM 2226 O O     . MET A 1 320 ? -23.326 -39.483 111.255 1.00 12.00 ? 320 MET A O     1 
ATOM 2227 C CB    . MET A 1 320 ? -20.682 -38.456 112.776 1.00 12.00 ? 320 MET A CB    1 
ATOM 2228 C CG    . MET A 1 320 ? -19.481 -38.822 113.641 1.00 12.00 ? 320 MET A CG    1 
ATOM 2229 S SD    . MET A 1 320 ? -18.391 -37.452 113.928 1.00 12.00 ? 320 MET A SD    1 
ATOM 2230 C CE    . MET A 1 320 ? -16.711 -37.944 113.645 1.00 12.00 ? 320 MET A CE    1 
ATOM 2231 N N     . GLU A 1 321 ? -22.461 -41.241 112.323 1.00 12.00 ? 321 GLU A N     1 
ATOM 2232 C CA    . GLU A 1 321 ? -23.737 -41.994 112.351 1.00 12.00 ? 321 GLU A CA    1 
ATOM 2233 C C     . GLU A 1 321 ? -24.757 -41.484 113.385 1.00 12.00 ? 321 GLU A C     1 
ATOM 2234 O O     . GLU A 1 321 ? -25.745 -42.161 113.692 1.00 12.00 ? 321 GLU A O     1 
ATOM 2235 C CB    . GLU A 1 321 ? -23.483 -43.456 112.686 1.00 20.00 ? 321 GLU A CB    1 
ATOM 2236 C CG    . GLU A 1 321 ? -24.708 -44.335 112.468 1.00 20.00 ? 321 GLU A CG    1 
ATOM 2237 C CD    . GLU A 1 321 ? -24.369 -45.818 112.401 1.00 20.00 ? 321 GLU A CD    1 
ATOM 2238 O OE1   . GLU A 1 321 ? -23.604 -46.341 113.292 1.00 20.00 ? 321 GLU A OE1   1 
ATOM 2239 O OE2   . GLU A 1 321 ? -24.846 -46.544 111.455 1.00 20.00 ? 321 GLU A OE2   1 
ATOM 2240 N N     . VAL A 1 322 ? -24.542 -40.303 113.913 1.00 12.00 ? 322 VAL A N     1 
ATOM 2241 C CA    . VAL A 1 322 ? -25.456 -39.731 114.922 1.00 12.00 ? 322 VAL A CA    1 
ATOM 2242 C C     . VAL A 1 322 ? -26.614 -38.990 114.249 1.00 12.00 ? 322 VAL A C     1 
ATOM 2243 O O     . VAL A 1 322 ? -26.684 -38.903 113.020 1.00 12.00 ? 322 VAL A O     1 
ATOM 2244 C CB    . VAL A 1 322 ? -24.706 -38.744 115.811 1.00 12.00 ? 322 VAL A CB    1 
ATOM 2245 C CG1   . VAL A 1 322 ? -25.565 -38.192 116.943 1.00 20.00 ? 322 VAL A CG1   1 
ATOM 2246 C CG2   . VAL A 1 322 ? -23.483 -39.357 116.482 1.00 12.00 ? 322 VAL A CG2   1 
ATOM 2247 N N     . ASN A 1 323 ? -27.490 -38.479 115.103 1.00 12.00 ? 323 ASN A N     1 
ATOM 2248 C CA    . ASN A 1 323 ? -28.690 -37.733 114.688 1.00 12.00 ? 323 ASN A CA    1 
ATOM 2249 C C     . ASN A 1 323 ? -28.686 -36.317 115.262 1.00 12.00 ? 323 ASN A C     1 
ATOM 2250 O O     . ASN A 1 323 ? -29.468 -35.990 116.160 1.00 12.00 ? 323 ASN A O     1 
ATOM 2251 C CB    . ASN A 1 323 ? -29.957 -38.409 115.209 1.00 12.00 ? 323 ASN A CB    1 
ATOM 2252 C CG    . ASN A 1 323 ? -30.016 -39.904 114.922 1.00 12.00 ? 323 ASN A CG    1 
ATOM 2253 O OD1   . ASN A 1 323 ? -29.271 -40.672 115.518 1.00 12.00 ? 323 ASN A OD1   1 
ATOM 2254 N ND2   . ASN A 1 323 ? -30.872 -40.369 114.038 1.00 12.00 ? 323 ASN A ND2   1 
ATOM 2255 N N     . TRP A 1 324 ? -27.805 -35.503 114.726 1.00 12.00 ? 324 TRP A N     1 
ATOM 2256 C CA    . TRP A 1 324 ? -27.667 -34.106 115.149 1.00 12.00 ? 324 TRP A CA    1 
ATOM 2257 C C     . TRP A 1 324 ? -26.369 -33.525 114.602 1.00 12.00 ? 324 TRP A C     1 
ATOM 2258 O O     . TRP A 1 324 ? -25.273 -33.891 115.042 1.00 12.00 ? 324 TRP A O     1 
ATOM 2259 C CB    . TRP A 1 324 ? -27.660 -34.022 116.671 1.00 12.00 ? 324 TRP A CB    1 
ATOM 2260 C CG    . TRP A 1 324 ? -26.694 -35.009 117.312 1.00 12.00 ? 324 TRP A CG    1 
ATOM 2261 C CD1   . TRP A 1 324 ? -26.939 -36.280 117.636 1.00 12.00 ? 324 TRP A CD1   1 
ATOM 2262 C CD2   . TRP A 1 324 ? -25.361 -34.717 117.665 1.00 12.00 ? 324 TRP A CD2   1 
ATOM 2263 N NE1   . TRP A 1 324 ? -25.740 -36.805 118.201 1.00 20.00 ? 324 TRP A NE1   1 
ATOM 2264 C CE2   . TRP A 1 324 ? -24.826 -35.871 118.206 1.00 12.00 ? 324 TRP A CE2   1 
ATOM 2265 C CE3   . TRP A 1 324 ? -24.566 -33.577 117.571 1.00 20.00 ? 324 TRP A CE3   1 
ATOM 2266 C CZ2   . TRP A 1 324 ? -23.512 -35.960 118.664 1.00 20.00 ? 324 TRP A CZ2   1 
ATOM 2267 C CZ3   . TRP A 1 324 ? -23.245 -33.673 118.036 1.00 20.00 ? 324 TRP A CZ3   1 
ATOM 2268 C CH2   . TRP A 1 324 ? -22.743 -34.810 118.556 1.00 20.00 ? 324 TRP A CH2   1 
ATOM 2269 N N     . VAL A 1 325 ? -26.553 -32.632 113.656 1.00 12.00 ? 325 VAL A N     1 
ATOM 2270 C CA    . VAL A 1 325 ? -25.455 -31.958 112.962 1.00 12.00 ? 325 VAL A CA    1 
ATOM 2271 C C     . VAL A 1 325 ? -24.874 -30.841 113.821 1.00 12.00 ? 325 VAL A C     1 
ATOM 2272 O O     . VAL A 1 325 ? -25.610 -30.031 114.396 1.00 12.00 ? 325 VAL A O     1 
ATOM 2273 C CB    . VAL A 1 325 ? -25.958 -31.353 111.659 1.00 12.00 ? 325 VAL A CB    1 
ATOM 2274 C CG1   . VAL A 1 325 ? -24.832 -30.837 110.769 1.00 12.00 ? 325 VAL A CG1   1 
ATOM 2275 C CG2   . VAL A 1 325 ? -26.739 -32.345 110.805 1.00 12.00 ? 325 VAL A CG2   1 
ATOM 2276 N N     . SER A 1 326 ? -23.561 -30.850 113.863 1.00 12.00 ? 326 SER A N     1 
ATOM 2277 C CA    . SER A 1 326 ? -22.769 -29.867 114.600 1.00 12.00 ? 326 SER A CA    1 
ATOM 2278 C C     . SER A 1 326 ? -21.814 -29.172 113.639 1.00 12.00 ? 326 SER A C     1 
ATOM 2279 O O     . SER A 1 326 ? -21.678 -29.573 112.478 1.00 12.00 ? 326 SER A O     1 
ATOM 2280 C CB    . SER A 1 326 ? -21.968 -30.558 115.697 1.00 12.00 ? 326 SER A CB    1 
ATOM 2281 O OG    . SER A 1 326 ? -22.845 -31.139 116.645 1.00 20.00 ? 326 SER A OG    1 
ATOM 2282 N N     . GLU A 1 327 ? -21.178 -28.147 114.153 1.00 12.00 ? 327 GLU A N     1 
ATOM 2283 C CA    . GLU A 1 327 ? -20.225 -27.344 113.387 1.00 12.00 ? 327 GLU A CA    1 
ATOM 2284 C C     . GLU A 1 327 ? -18.866 -28.038 113.335 1.00 12.00 ? 327 GLU A C     1 
ATOM 2285 O O     . GLU A 1 327 ? -17.912 -27.524 112.742 1.00 12.00 ? 327 GLU A O     1 
ATOM 2286 C CB    . GLU A 1 327 ? -20.054 -25.977 114.038 1.00 12.00 ? 327 GLU A CB    1 
ATOM 2287 C CG    . GLU A 1 327 ? -21.146 -24.989 113.643 1.00 12.00 ? 327 GLU A CG    1 
ATOM 2288 C CD    . GLU A 1 327 ? -21.366 -24.919 112.136 1.00 12.00 ? 327 GLU A CD    1 
ATOM 2289 O OE1   . GLU A 1 327 ? -22.166 -25.747 111.563 1.00 12.00 ? 327 GLU A OE1   1 
ATOM 2290 O OE2   . GLU A 1 327 ? -20.751 -24.032 111.439 1.00 12.00 ? 327 GLU A OE2   1 
ATOM 2291 N N     . ALA A 1 328 ? -18.821 -29.196 113.959 1.00 12.00 ? 328 ALA A N     1 
ATOM 2292 C CA    . ALA A 1 328 ? -17.600 -30.007 114.033 1.00 12.00 ? 328 ALA A CA    1 
ATOM 2293 C C     . ALA A 1 328 ? -17.790 -31.338 113.307 1.00 12.00 ? 328 ALA A C     1 
ATOM 2294 O O     . ALA A 1 328 ? -16.840 -31.907 112.761 1.00 12.00 ? 328 ALA A O     1 
ATOM 2295 C CB    . ALA A 1 328 ? -17.252 -30.295 115.490 1.00 12.00 ? 328 ALA A CB    1 
ATOM 2296 N N     . ILE A 1 329 ? -19.023 -31.794 113.326 1.00 12.00 ? 329 ILE A N     1 
ATOM 2297 C CA    . ILE A 1 329 ? -19.419 -33.061 112.696 1.00 12.00 ? 329 ILE A CA    1 
ATOM 2298 C C     . ILE A 1 329 ? -19.636 -32.857 111.198 1.00 12.00 ? 329 ILE A C     1 
ATOM 2299 O O     . ILE A 1 329 ? -19.107 -33.607 110.371 1.00 12.00 ? 329 ILE A O     1 
ATOM 2300 C CB    . ILE A 1 329 ? -20.718 -33.557 113.321 1.00 12.00 ? 329 ILE A CB    1 
ATOM 2301 C CG1   . ILE A 1 329 ? -20.616 -33.743 114.830 1.00 20.00 ? 329 ILE A CG1   1 
ATOM 2302 C CG2   . ILE A 1 329 ? -21.172 -34.900 112.765 1.00 12.00 ? 329 ILE A CG2   1 
ATOM 2303 C CD1   . ILE A 1 329 ? -21.913 -34.236 115.459 1.00 20.00 ? 329 ILE A CD1   1 
ATOM 2304 N N     . ARG A 1 330 ? -20.415 -31.842 110.926 1.00 12.00 ? 330 ARG A N     1 
ATOM 2305 C CA    . ARG A 1 330 ? -20.788 -31.420 109.575 1.00 12.00 ? 330 ARG A CA    1 
ATOM 2306 C C     . ARG A 1 330 ? -19.648 -31.640 108.595 1.00 12.00 ? 330 ARG A C     1 
ATOM 2307 O O     . ARG A 1 330 ? -18.468 -31.545 108.931 1.00 12.00 ? 330 ARG A O     1 
ATOM 2308 C CB    . ARG A 1 330 ? -21.131 -29.934 109.618 1.00 12.00 ? 330 ARG A CB    1 
ATOM 2309 C CG    . ARG A 1 330 ? -21.588 -29.354 108.286 1.00 20.00 ? 330 ARG A CG    1 
ATOM 2310 C CD    . ARG A 1 330 ? -21.945 -27.875 108.402 1.00 20.00 ? 330 ARG A CD    1 
ATOM 2311 N NE    . ARG A 1 330 ? -22.345 -27.264 107.135 1.00 20.00 ? 330 ARG A NE    1 
ATOM 2312 C CZ    . ARG A 1 330 ? -22.680 -25.978 107.008 1.00 20.00 ? 330 ARG A CZ    1 
ATOM 2313 N NH1   . ARG A 1 330 ? -22.667 -25.157 108.062 1.00 20.00 ? 330 ARG A NH1   1 
ATOM 2314 N NH2   . ARG A 1 330 ? -23.047 -25.411 105.857 1.00 20.00 ? 330 ARG A NH2   1 
ATOM 2315 N N     . THR A 1 331 ? -20.069 -32.195 107.214 1.00 12.00 ? 331 THR A N     1 
ATOM 2316 C CA    . THR A 1 331 ? -19.200 -32.582 106.100 1.00 12.00 ? 331 THR A CA    1 
ATOM 2317 C C     . THR A 1 331 ? -18.752 -31.340 105.334 1.00 12.00 ? 331 THR A C     1 
ATOM 2318 O O     . THR A 1 331 ? -19.590 -30.574 104.868 1.00 12.00 ? 331 THR A O     1 
ATOM 2319 C CB    . THR A 1 331 ? -19.949 -33.516 105.157 1.00 12.00 ? 331 THR A CB    1 
ATOM 2320 O OG1   . THR A 1 331 ? -21.094 -32.866 104.641 1.00 20.00 ? 331 THR A OG1   1 
ATOM 2321 C CG2   . THR A 1 331 ? -20.418 -34.796 105.838 1.00 20.00 ? 331 THR A CG2   1 
ATOM 2322 N N     . ARG A 1 332 ? -17.506 -31.229 105.306 1.00 12.00 ? 332 ARG A N     1 
ATOM 2323 C CA    . ARG A 1 332 ? -16.871 -30.205 104.568 1.00 12.00 ? 332 ARG A CA    1 
ATOM 2324 C C     . ARG A 1 332 ? -16.141 -30.666 103.341 1.00 12.00 ? 332 ARG A C     1 
ATOM 2325 O O     . ARG A 1 332 ? -16.010 -31.870 103.096 1.00 12.00 ? 332 ARG A O     1 
ATOM 2326 C CB    . ARG A 1 332 ? -15.805 -29.532 105.426 1.00 12.00 ? 332 ARG A CB    1 
ATOM 2327 C CG    . ARG A 1 332 ? -16.260 -29.293 106.861 1.00 12.00 ? 332 ARG A CG    1 
ATOM 2328 C CD    . ARG A 1 332 ? -17.427 -28.317 106.962 1.00 12.00 ? 332 ARG A CD    1 
ATOM 2329 N NE    . ARG A 1 332 ? -17.373 -27.482 108.164 1.00 12.00 ? 332 ARG A NE    1 
ATOM 2330 C CZ    . ARG A 1 332 ? -18.358 -26.671 108.555 1.00 12.00 ? 332 ARG A CZ    1 
ATOM 2331 N NH1   . ARG A 1 332 ? -19.487 -26.572 107.848 1.00 12.00 ? 332 ARG A NH1   1 
ATOM 2332 N NH2   . ARG A 1 332 ? -18.309 -25.911 109.652 1.00 12.00 ? 332 ARG A NH2   1 
ATOM 2333 N N     . PRO A 1 333 ? -15.669 -29.683 102.583 1.00 12.00 ? 333 PRO A N     1 
ATOM 2334 C CA    . PRO A 1 333 ? -14.935 -29.920 101.369 1.00 12.00 ? 333 PRO A CA    1 
ATOM 2335 C C     . PRO A 1 333 ? -13.639 -30.691 101.576 1.00 12.00 ? 333 PRO A C     1 
ATOM 2336 O O     . PRO A 1 333 ? -13.355 -31.648 100.863 1.00 12.00 ? 333 PRO A O     1 
ATOM 2337 C CB    . PRO A 1 333 ? -14.615 -28.538 100.865 1.00 12.00 ? 333 PRO A CB    1 
ATOM 2338 C CG    . PRO A 1 333 ? -15.619 -27.663 101.505 1.00 12.00 ? 333 PRO A CG    1 
ATOM 2339 C CD    . PRO A 1 333 ? -15.862 -28.262 102.844 1.00 12.00 ? 333 PRO A CD    1 
ATOM 2340 N N     . ALA A 1 334 ? -12.823 -30.301 102.546 1.00 12.00 ? 334 ALA A N     1 
ATOM 2341 C CA    . ALA A 1 334 ? -11.562 -30.999 102.755 1.00 12.00 ? 334 ALA A CA    1 
ATOM 2342 C C     . ALA A 1 334 ? -11.049 -30.900 104.184 1.00 12.00 ? 334 ALA A C     1 
ATOM 2343 O O     . ALA A 1 334 ? -11.780 -30.508 105.088 1.00 12.00 ? 334 ALA A O     1 
ATOM 2344 C CB    . ALA A 1 334 ? -10.504 -30.476 101.805 1.00 12.00 ? 334 ALA A CB    1 
ATOM 2345 N N     . GLN A 1 335 ? -9.783  -31.268 104.342 1.00 12.00 ? 335 GLN A N     1 
ATOM 2346 C CA    . GLN A 1 335 ? -9.109  -31.263 105.630 1.00 12.00 ? 335 GLN A CA    1 
ATOM 2347 C C     . GLN A 1 335 ? -8.089  -30.137 105.715 1.00 12.00 ? 335 GLN A C     1 
ATOM 2348 O O     . GLN A 1 335 ? -6.951  -30.286 105.283 1.00 12.00 ? 335 GLN A O     1 
ATOM 2349 C CB    . GLN A 1 335 ? -8.421  -32.606 105.856 1.00 12.00 ? 335 GLN A CB    1 
ATOM 2350 C CG    . GLN A 1 335 ? -8.473  -33.115 107.279 1.00 12.00 ? 335 GLN A CG    1 
ATOM 2351 C CD    . GLN A 1 335 ? -7.827  -34.475 107.424 1.00 12.00 ? 335 GLN A CD    1 
ATOM 2352 O OE1   . GLN A 1 335 ? -6.610  -34.585 107.535 1.00 12.00 ? 335 GLN A OE1   1 
ATOM 2353 N NE2   . GLN A 1 335 ? -8.450  -35.643 107.443 1.00 20.00 ? 335 GLN A NE2   1 
ATOM 2354 N N     . VAL A 1 336 ? -8.492  -29.006 106.274 1.00 12.00 ? 336 VAL A N     1 
ATOM 2355 C CA    . VAL A 1 336 ? -7.587  -27.874 106.404 1.00 12.00 ? 336 VAL A CA    1 
ATOM 2356 C C     . VAL A 1 336 ? -6.396  -28.224 107.283 1.00 12.00 ? 336 VAL A C     1 
ATOM 2357 O O     . VAL A 1 336 ? -6.559  -28.597 108.441 1.00 12.00 ? 336 VAL A O     1 
ATOM 2358 C CB    . VAL A 1 336 ? -8.308  -26.638 106.958 1.00 12.00 ? 336 VAL A CB    1 
ATOM 2359 C CG1   . VAL A 1 336 ? -7.347  -25.474 107.082 1.00 12.00 ? 336 VAL A CG1   1 
ATOM 2360 C CG2   . VAL A 1 336 ? -9.485  -26.270 106.075 1.00 12.00 ? 336 VAL A CG2   1 
ATOM 2361 N N     . GLY A 1 337 ? -5.197  -28.101 106.729 1.00 12.00 ? 337 GLY A N     1 
ATOM 2362 C CA    . GLY A 1 337 ? -3.986  -28.415 107.458 1.00 12.00 ? 337 GLY A CA    1 
ATOM 2363 C C     . GLY A 1 337 ? -3.992  -29.864 107.916 1.00 12.00 ? 337 GLY A C     1 
ATOM 2364 O O     . GLY A 1 337 ? -5.034  -30.509 107.948 1.00 12.00 ? 337 GLY A O     1 
ATOM 2365 N N     . PHE A 1 338 ? -2.826  -30.387 108.273 1.00 12.00 ? 338 PHE A N     1 
ATOM 2366 C CA    . PHE A 1 338 ? -2.743  -31.768 108.725 1.00 12.00 ? 338 PHE A CA    1 
ATOM 2367 C C     . PHE A 1 338 ? -1.928  -31.886 110.005 1.00 12.00 ? 338 PHE A C     1 
ATOM 2368 O O     . PHE A 1 338 ? -1.058  -31.063 110.275 1.00 12.00 ? 338 PHE A O     1 
ATOM 2369 C CB    . PHE A 1 338 ? -2.196  -32.665 107.613 1.00 12.00 ? 338 PHE A CB    1 
ATOM 2370 C CG    . PHE A 1 338 ? -0.700  -32.685 107.489 1.00 12.00 ? 338 PHE A CG    1 
ATOM 2371 C CD1   . PHE A 1 338 ? -0.004  -31.535 107.176 1.00 12.00 ? 338 PHE A CD1   1 
ATOM 2372 C CD2   . PHE A 1 338 ? 0.006   -33.856 107.675 1.00 12.00 ? 338 PHE A CD2   1 
ATOM 2373 C CE1   . PHE A 1 338 ? 1.368   -31.553 107.048 1.00 12.00 ? 338 PHE A CE1   1 
ATOM 2374 C CE2   . PHE A 1 338 ? 1.378   -33.881 107.550 1.00 12.00 ? 338 PHE A CE2   1 
ATOM 2375 C CZ    . PHE A 1 338 ? 2.060   -32.728 107.236 1.00 12.00 ? 338 PHE A CZ    1 
ATOM 2376 N N     . CYS A 1 339 ? -2.226  -32.917 110.787 1.00 12.00 ? 339 CYS A N     1 
ATOM 2377 C CA    . CYS A 1 339 ? -1.546  -33.153 112.051 1.00 12.00 ? 339 CYS A CA    1 
ATOM 2378 C C     . CYS A 1 339 ? -0.259  -33.930 111.861 1.00 12.00 ? 339 CYS A C     1 
ATOM 2379 O O     . CYS A 1 339 ? -0.269  -35.149 111.740 1.00 12.00 ? 339 CYS A O     1 
ATOM 2380 C CB    . CYS A 1 339 ? -2.456  -33.903 113.018 1.00 12.00 ? 339 CYS A CB    1 
ATOM 2381 S SG    . CYS A 1 339 ? -3.964  -33.007 113.480 1.00 20.00 ? 339 CYS A SG    1 
ATOM 2382 N N     . GLN A 1 340 ? 0.854   -33.223 111.838 1.00 12.00 ? 340 GLN A N     1 
ATOM 2383 C CA    . GLN A 1 340 ? 2.142   -33.859 111.667 1.00 12.00 ? 340 GLN A CA    1 
ATOM 2384 C C     . GLN A 1 340 ? 2.784   -34.191 113.002 1.00 12.00 ? 340 GLN A C     1 
ATOM 2385 O O     . GLN A 1 340 ? 2.682   -33.428 113.957 1.00 12.00 ? 340 GLN A O     1 
ATOM 2386 C CB    . GLN A 1 340 ? 3.093   -32.934 110.896 1.00 12.00 ? 340 GLN A CB    1 
ATOM 2387 C CG    . GLN A 1 340 ? 2.411   -31.748 110.246 1.00 20.00 ? 340 GLN A CG    1 
ATOM 2388 C CD    . GLN A 1 340 ? 3.395   -30.754 109.676 1.00 20.00 ? 340 GLN A CD    1 
ATOM 2389 O OE1   . GLN A 1 340 ? 4.469   -30.545 110.230 1.00 20.00 ? 340 GLN A OE1   1 
ATOM 2390 N NE2   . GLN A 1 340 ? 3.233   -30.028 108.581 1.00 20.00 ? 340 GLN A NE2   1 
ATOM 2391 N N     . PRO A 1 341 ? 3.459   -35.340 113.102 1.00 12.00 ? 341 PRO A N     1 
ATOM 2392 C CA    . PRO A 1 341 ? 4.162   -35.724 114.322 1.00 12.00 ? 341 PRO A CA    1 
ATOM 2393 C C     . PRO A 1 341 ? 5.263   -34.725 114.602 1.00 12.00 ? 341 PRO A C     1 
ATOM 2394 O O     . PRO A 1 341 ? 6.172   -34.550 113.797 1.00 12.00 ? 341 PRO A O     1 
ATOM 2395 C CB    . PRO A 1 341 ? 4.780   -37.074 113.965 1.00 12.00 ? 341 PRO A CB    1 
ATOM 2396 C CG    . PRO A 1 341 ? 3.969   -37.564 112.824 1.00 12.00 ? 341 PRO A CG    1 
ATOM 2397 C CD    . PRO A 1 341 ? 3.583   -36.347 112.050 1.00 12.00 ? 341 PRO A CD    1 
ATOM 2398 N N     . HIS A 1 342 ? 5.197   -34.053 115.736 1.00 12.00 ? 342 HIS A N     1 
ATOM 2399 C CA    . HIS A 1 342 ? 6.183   -33.035 116.045 1.00 12.00 ? 342 HIS A CA    1 
ATOM 2400 C C     . HIS A 1 342 ? 7.321   -33.550 116.912 1.00 12.00 ? 342 HIS A C     1 
ATOM 2401 O O     . HIS A 1 342 ? 7.093   -34.238 117.902 1.00 12.00 ? 342 HIS A O     1 
ATOM 2402 C CB    . HIS A 1 342 ? 5.528   -31.827 116.706 1.00 12.00 ? 342 HIS A CB    1 
ATOM 2403 C CG    . HIS A 1 342 ? 4.464   -32.178 117.766 1.00 12.00 ? 342 HIS A CG    1 
ATOM 2404 N ND1   . HIS A 1 342 ? 3.249   -32.735 117.446 1.00 20.00 ? 342 HIS A ND1   1 
ATOM 2405 C CD2   . HIS A 1 342 ? 4.470   -32.034 119.107 1.00 12.00 ? 342 HIS A CD2   1 
ATOM 2406 C CE1   . HIS A 1 342 ? 2.551   -32.917 118.547 1.00 12.00 ? 342 HIS A CE1   1 
ATOM 2407 N NE2   . HIS A 1 342 ? 3.268   -32.501 119.568 1.00 20.00 ? 342 HIS A NE2   1 
ATOM 2408 N N     . ASN A 1 343 ? 8.532   -33.190 116.506 1.00 12.00 ? 343 ASN A N     1 
ATOM 2409 C CA    . ASN A 1 343 ? 9.746   -33.548 117.221 1.00 12.00 ? 343 ASN A CA    1 
ATOM 2410 C C     . ASN A 1 343 ? 10.182  -34.977 116.936 1.00 12.00 ? 343 ASN A C     1 
ATOM 2411 O O     . ASN A 1 343 ? 10.812  -35.618 117.771 1.00 12.00 ? 343 ASN A O     1 
ATOM 2412 C CB    . ASN A 1 343 ? 9.572   -33.313 118.714 1.00 12.00 ? 343 ASN A CB    1 
ATOM 2413 C CG    . ASN A 1 343 ? 9.829   -31.873 119.094 1.00 12.00 ? 343 ASN A CG    1 
ATOM 2414 O OD1   . ASN A 1 343 ? 10.409  -31.114 118.323 1.00 20.00 ? 343 ASN A OD1   1 
ATOM 2415 N ND2   . ASN A 1 343 ? 9.397   -31.491 120.284 1.00 20.00 ? 343 ASN A ND2   1 
ATOM 2416 N N     . ASP A 1 344 ? 9.846   -35.473 115.755 1.00 12.00 ? 344 ASP A N     1 
ATOM 2417 C CA    . ASP A 1 344 ? 10.238  -36.813 115.351 1.00 12.00 ? 344 ASP A CA    1 
ATOM 2418 C C     . ASP A 1 344 ? 11.694  -36.984 115.517 1.00 12.00 ? 344 ASP A C     1 
ATOM 2419 O O     . ASP A 1 344 ? 12.344  -36.257 116.278 1.00 12.00 ? 344 ASP A O     1 
ATOM 2420 C CB    . ASP A 1 344 ? 9.824   -37.060 113.902 1.00 12.00 ? 344 ASP A CB    1 
ATOM 2421 C CG    . ASP A 1 344 ? 9.454   -38.497 113.628 1.00 20.00 ? 344 ASP A CG    1 
ATOM 2422 O OD1   . ASP A 1 344 ? 8.848   -39.132 114.510 1.00 20.00 ? 344 ASP A OD1   1 
ATOM 2423 O OD2   . ASP A 1 344 ? 9.771   -38.989 112.529 1.00 20.00 ? 344 ASP A OD2   1 
ATOM 2424 N N     . PHE A 1 345 ? 11.846  -37.505 115.013 1.00 12.00 ? 345 PHE A N     1 
ATOM 2425 C CA    . PHE A 1 345 ? 13.202  -37.819 115.001 1.00 12.00 ? 345 PHE A CA    1 
ATOM 2426 C C     . PHE A 1 345 ? 13.420  -39.169 114.305 1.00 12.00 ? 345 PHE A C     1 
ATOM 2427 O O     . PHE A 1 345 ? 13.296  -40.222 114.922 1.00 12.00 ? 345 PHE A O     1 
ATOM 2428 C CB    . PHE A 1 345 ? 13.770  -37.848 116.419 1.00 12.00 ? 345 PHE A CB    1 
ATOM 2429 C CG    . PHE A 1 345 ? 14.273  -36.521 116.885 1.00 12.00 ? 345 PHE A CG    1 
ATOM 2430 C CD1   . PHE A 1 345 ? 13.405  -35.584 117.407 1.00 12.00 ? 345 PHE A CD1   1 
ATOM 2431 C CD2   . PHE A 1 345 ? 15.612  -36.211 116.798 1.00 12.00 ? 345 PHE A CD2   1 
ATOM 2432 C CE1   . PHE A 1 345 ? 13.865  -34.360 117.836 1.00 12.00 ? 345 PHE A CE1   1 
ATOM 2433 C CE2   . PHE A 1 345 ? 16.080  -34.989 117.225 1.00 12.00 ? 345 PHE A CE2   1 
ATOM 2434 C CZ    . PHE A 1 345 ? 15.205  -34.061 117.744 1.00 12.00 ? 345 PHE A CZ    1 
ATOM 2435 N N     . GLU A 1 346 ? 13.743  -39.143 113.010 1.00 12.00 ? 346 GLU A N     1 
ATOM 2436 C CA    . GLU A 1 346 ? 13.939  -40.372 112.235 1.00 12.00 ? 346 GLU A CA    1 
ATOM 2437 C C     . GLU A 1 346 ? 15.415  -40.754 112.121 1.00 12.00 ? 346 GLU A C     1 
ATOM 2438 O O     . GLU A 1 346 ? 16.283  -40.074 112.657 1.00 12.00 ? 346 GLU A O     1 
ATOM 2439 C CB    . GLU A 1 346 ? 13.320  -40.231 110.847 1.00 12.00 ? 346 GLU A CB    1 
ATOM 2440 C CG    . GLU A 1 346 ? 11.816  -40.046 110.862 1.00 12.00 ? 346 GLU A CG    1 
ATOM 2441 C CD    . GLU A 1 346 ? 11.209  -40.070 109.478 1.00 12.00 ? 346 GLU A CD    1 
ATOM 2442 O OE1   . GLU A 1 346 ? 11.173  -39.009 108.829 1.00 12.00 ? 346 GLU A OE1   1 
ATOM 2443 O OE2   . GLU A 1 346 ? 10.768  -41.151 109.043 1.00 12.00 ? 346 GLU A OE2   1 
ATOM 2444 N N     . ALA A 1 347 ? 15.699  -41.853 111.416 1.00 12.00 ? 347 ALA A N     1 
ATOM 2445 C CA    . ALA A 1 347 ? 17.073  -42.328 111.260 1.00 12.00 ? 347 ALA A CA    1 
ATOM 2446 C C     . ALA A 1 347 ? 17.318  -42.991 109.904 1.00 12.00 ? 347 ALA A C     1 
ATOM 2447 O O     . ALA A 1 347 ? 16.391  -43.190 109.125 1.00 12.00 ? 347 ALA A O     1 
ATOM 2448 C CB    . ALA A 1 347 ? 17.426  -43.299 112.370 1.00 12.00 ? 347 ALA A CB    1 
ATOM 2449 N N     . SER A 1 348 ? 18.584  -43.325 109.647 1.00 12.00 ? 348 SER A N     1 
ATOM 2450 C CA    . SER A 1 348 ? 18.995  -43.965 108.399 1.00 12.00 ? 348 SER A CA    1 
ATOM 2451 C C     . SER A 1 348 ? 20.477  -44.344 108.439 1.00 12.00 ? 348 SER A C     1 
ATOM 2452 O O     . SER A 1 348 ? 20.948  -44.938 109.403 1.00 12.00 ? 348 SER A O     1 
ATOM 2453 C CB    . SER A 1 348 ? 18.706  -43.058 107.211 1.00 12.00 ? 348 SER A CB    1 
ATOM 2454 O OG    . SER A 1 348 ? 18.138  -43.785 106.142 1.00 12.00 ? 348 SER A OG    1 
ATOM 2455 N N     . ARG A 1 349 ? 21.216  -43.998 107.386 1.00 12.00 ? 349 ARG A N     1 
ATOM 2456 C CA    . ARG A 1 349 ? 22.646  -44.298 107.322 1.00 12.00 ? 349 ARG A CA    1 
ATOM 2457 C C     . ARG A 1 349 ? 23.474  -43.193 108.101 1.00 12.00 ? 349 ARG A C     1 
ATOM 2458 O O     . ARG A 1 349 ? 24.292  -43.484 108.956 1.00 12.00 ? 349 ARG A O     1 
ATOM 2459 C CB    . ARG A 1 349 ? 23.090  -44.457 105.871 1.00 12.00 ? 349 ARG A CB    1 
ATOM 2460 C CG    . ARG A 1 349 ? 22.441  -45.629 105.151 1.00 20.00 ? 349 ARG A CG    1 
ATOM 2461 C CD    . ARG A 1 349 ? 23.451  -46.713 104.815 1.00 20.00 ? 349 ARG A CD    1 
ATOM 2462 N NE    . ARG A 1 349 ? 22.838  -48.035 104.735 1.00 20.00 ? 349 ARG A NE    1 
ATOM 2463 C CZ    . ARG A 1 349 ? 23.187  -48.971 103.859 1.00 20.00 ? 349 ARG A CZ    1 
ATOM 2464 N NH1   . ARG A 1 349 ? 24.147  -48.733 102.982 1.00 20.00 ? 349 ARG A NH1   1 
ATOM 2465 N NH2   . ARG A 1 349 ? 22.576  -50.143 103.863 1.00 20.00 ? 349 ARG A NH2   1 
ATOM 2466 N N     . ALA A 1 350 ? 23.358  -41.867 107.885 1.00 12.00 ? 350 ALA A N     1 
ATOM 2467 C CA    . ALA A 1 350 ? 24.051  -40.895 108.850 1.00 12.00 ? 350 ALA A CA    1 
ATOM 2468 C C     . ALA A 1 350 ? 23.083  -40.825 109.998 1.00 12.00 ? 350 ALA A C     1 
ATOM 2469 O O     . ALA A 1 350 ? 23.229  -39.992 110.899 1.00 12.00 ? 350 ALA A O     1 
ATOM 2470 C CB    . ALA A 1 350 ? 24.265  -39.543 108.178 1.00 12.00 ? 350 ALA A CB    1 
ATOM 2471 N N     . GLY A 1 351 ? 22.133  -41.694 109.952 1.00 12.00 ? 351 GLY A N     1 
ATOM 2472 C CA    . GLY A 1 351 ? 21.132  -41.763 110.989 1.00 12.00 ? 351 GLY A CA    1 
ATOM 2473 C C     . GLY A 1 351 ? 20.378  -40.442 111.097 1.00 12.00 ? 351 GLY A C     1 
ATOM 2474 O O     . GLY A 1 351 ? 19.890  -39.909 110.097 1.00 12.00 ? 351 GLY A O     1 
ATOM 2475 N N     . PRO A 1 352 ? 20.266  -39.890 112.298 1.00 12.00 ? 352 PRO A N     1 
ATOM 2476 C CA    . PRO A 1 352 ? 19.459  -38.708 112.555 1.00 12.00 ? 352 PRO A CA    1 
ATOM 2477 C C     . PRO A 1 352 ? 19.795  -37.383 111.862 1.00 12.00 ? 352 PRO A C     1 
ATOM 2478 O O     . PRO A 1 352 ? 21.009  -37.029 111.770 1.00 12.00 ? 352 PRO A O     1 
ATOM 2479 C CB    . PRO A 1 352 ? 19.589  -38.484 114.039 1.00 12.00 ? 352 PRO A CB    1 
ATOM 2480 C CG    . PRO A 1 352 ? 20.490  -39.565 114.599 1.00 12.00 ? 352 PRO A CG    1 
ATOM 2481 C CD    . PRO A 1 352 ? 20.927  -40.449 113.479 1.00 12.00 ? 352 PRO A CD    1 
ATOM 2482 N N     . PHE A 1 353 ? 17.826  -37.727 112.226 1.00 12.00 ? 353 PHE A N     1 
ATOM 2483 C CA    . PHE A 1 353 ? 17.470  -36.368 111.726 1.00 12.00 ? 353 PHE A CA    1 
ATOM 2484 C C     . PHE A 1 353 ? 16.023  -36.041 111.925 1.00 12.00 ? 353 PHE A C     1 
ATOM 2485 O O     . PHE A 1 353 ? 15.139  -36.809 111.535 1.00 12.00 ? 353 PHE A O     1 
ATOM 2486 C CB    . PHE A 1 353 ? 17.809  -36.254 110.232 1.00 12.00 ? 353 PHE A CB    1 
ATOM 2487 C CG    . PHE A 1 353 ? 17.047  -37.263 109.381 1.00 12.00 ? 353 PHE A CG    1 
ATOM 2488 C CD1   . PHE A 1 353 ? 15.730  -37.003 109.003 1.00 12.00 ? 353 PHE A CD1   1 
ATOM 2489 C CD2   . PHE A 1 353 ? 17.665  -38.449 108.982 1.00 12.00 ? 353 PHE A CD2   1 
ATOM 2490 C CE1   . PHE A 1 353 ? 15.030  -37.928 108.228 1.00 12.00 ? 353 PHE A CE1   1 
ATOM 2491 C CE2   . PHE A 1 353 ? 16.966  -39.374 108.207 1.00 12.00 ? 353 PHE A CE2   1 
ATOM 2492 C CZ    . PHE A 1 353 ? 15.648  -39.114 107.830 1.00 12.00 ? 353 PHE A CZ    1 
ATOM 2493 N N     . ALA A 1 354 ? 15.846  -34.897 112.537 1.00 12.00 ? 354 ALA A N     1 
ATOM 2494 C CA    . ALA A 1 354 ? 14.529  -34.351 112.739 1.00 12.00 ? 354 ALA A CA    1 
ATOM 2495 C C     . ALA A 1 354 ? 13.821  -34.479 111.406 1.00 12.00 ? 354 ALA A C     1 
ATOM 2496 O O     . ALA A 1 354 ? 14.462  -34.603 110.359 1.00 12.00 ? 354 ALA A O     1 
ATOM 2497 C CB    . ALA A 1 354 ? 14.643  -32.885 113.163 1.00 12.00 ? 354 ALA A CB    1 
ATOM 2498 N N     . ALA A 1 355 ? 12.520  -34.475 111.448 1.00 12.00 ? 355 ALA A N     1 
ATOM 2499 C CA    . ALA A 1 355 ? 11.709  -34.559 110.227 1.00 12.00 ? 355 ALA A CA    1 
ATOM 2500 C C     . ALA A 1 355 ? 10.888  -33.285 110.130 1.00 12.00 ? 355 ALA A C     1 
ATOM 2501 O O     . ALA A 1 355 ? 10.095  -32.987 111.027 1.00 12.00 ? 355 ALA A O     1 
ATOM 2502 C CB    . ALA A 1 355 ? 10.831  -35.797 110.274 1.00 12.00 ? 355 ALA A CB    1 
ATOM 2503 N N     . PRO A 1 356 ? 11.032  -32.525 109.047 1.00 12.00 ? 356 PRO A N     1 
ATOM 2504 C CA    . PRO A 1 356 ? 10.426  -31.193 108.918 1.00 12.00 ? 356 PRO A CA    1 
ATOM 2505 C C     . PRO A 1 356 ? 8.996   -31.223 109.031 1.00 12.00 ? 356 PRO A C     1 
ATOM 2506 O O     . PRO A 1 356 ? 8.420   -32.334 109.213 1.00 12.00 ? 356 PRO A O     1 
ATOM 2507 C CB    . PRO A 1 356 ? 10.854  -30.744 107.543 1.00 12.00 ? 356 PRO A CB    1 
ATOM 2508 C CG    . PRO A 1 356 ? 11.705  -31.852 106.935 1.00 12.00 ? 356 PRO A CG    1 
ATOM 2509 C CD    . PRO A 1 356 ? 11.818  -32.984 107.908 1.00 12.00 ? 356 PRO A CD    1 
ATOM 2510 N N     . LYS A 1 357 ? 8.571   -30.032 108.915 1.00 12.00 ? 357 LYS A N     1 
ATOM 2511 C CA    . LYS A 1 357 ? 7.220   -29.670 108.991 1.00 12.00 ? 357 LYS A CA    1 
ATOM 2512 C C     . LYS A 1 357 ? 6.950   -28.665 107.928 1.00 12.00 ? 357 LYS A C     1 
ATOM 2513 O O     . LYS A 1 357 ? 7.825   -27.872 107.562 1.00 12.00 ? 357 LYS A O     1 
ATOM 2514 C CB    . LYS A 1 357 ? 6.977   -29.011 110.333 1.00 12.00 ? 357 LYS A CB    1 
ATOM 2515 C CG    . LYS A 1 357 ? 8.054   -27.977 110.664 1.00 20.00 ? 357 LYS A CG    1 
ATOM 2516 C CD    . LYS A 1 357 ? 9.238   -28.016 109.693 1.00 20.00 ? 357 LYS A CD    1 
ATOM 2517 C CE    . LYS A 1 357 ? 10.224  -26.867 109.894 1.00 20.00 ? 357 LYS A CE    1 
ATOM 2518 N NZ    . LYS A 1 357 ? 11.434  -26.998 109.074 1.00 20.00 ? 357 LYS A NZ    1 
ATOM 2519 N N     . VAL A 1 358 ? 5.765   -28.757 107.471 1.00 12.00 ? 358 VAL A N     1 
ATOM 2520 C CA    . VAL A 1 358 ? 5.242   -27.802 106.560 1.00 12.00 ? 358 VAL A CA    1 
ATOM 2521 C C     . VAL A 1 358 ? 4.566   -26.769 107.468 1.00 12.00 ? 358 VAL A C     1 
ATOM 2522 O O     . VAL A 1 358 ? 3.751   -27.119 108.317 1.00 12.00 ? 358 VAL A O     1 
ATOM 2523 C CB    . VAL A 1 358 ? 4.410   -28.506 105.501 1.00 12.00 ? 358 VAL A CB    1 
ATOM 2524 C CG1   . VAL A 1 358 ? 5.063   -29.812 105.094 1.00 20.00 ? 358 VAL A CG1   1 
ATOM 2525 C CG2   . VAL A 1 358 ? 3.000   -28.742 106.004 1.00 20.00 ? 358 VAL A CG2   1 
ATOM 2526 N N     . PRO A 1 359 ? 4.888   -25.477 107.322 1.00 12.00 ? 359 PRO A N     1 
ATOM 2527 C CA    . PRO A 1 359 ? 4.443   -24.429 108.254 1.00 12.00 ? 359 PRO A CA    1 
ATOM 2528 C C     . PRO A 1 359 ? 2.942   -24.316 108.416 1.00 12.00 ? 359 PRO A C     1 
ATOM 2529 O O     . PRO A 1 359 ? 2.192   -24.547 107.476 1.00 12.00 ? 359 PRO A O     1 
ATOM 2530 C CB    . PRO A 1 359 ? 4.974   -23.141 107.636 1.00 12.00 ? 359 PRO A CB    1 
ATOM 2531 C CG    . PRO A 1 359 ? 6.101   -23.580 106.778 1.00 20.00 ? 359 PRO A CG    1 
ATOM 2532 C CD    . PRO A 1 359 ? 5.700   -24.917 106.239 1.00 20.00 ? 359 PRO A CD    1 
ATOM 2533 N N     . ALA A 1 360 ? 2.569   -23.947 109.636 1.00 12.00 ? 360 ALA A N     1 
ATOM 2534 C CA    . ALA A 1 360 ? 1.186   -23.755 110.030 1.00 12.00 ? 360 ALA A CA    1 
ATOM 2535 C C     . ALA A 1 360 ? 1.125   -23.001 111.353 1.00 12.00 ? 360 ALA A C     1 
ATOM 2536 O O     . ALA A 1 360 ? 1.869   -23.301 112.282 1.00 12.00 ? 360 ALA A O     1 
ATOM 2537 C CB    . ALA A 1 360 ? 0.472   -25.088 110.123 1.00 20.00 ? 360 ALA A CB    1 
ATOM 2538 N N     . ASP A 1 361 ? 0.241   -22.020 111.438 1.00 12.00 ? 361 ASP A N     1 
ATOM 2539 C CA    . ASP A 1 361 ? 0.103   -21.207 112.639 1.00 12.00 ? 361 ASP A CA    1 
ATOM 2540 C C     . ASP A 1 361 ? 0.499   -21.963 113.902 1.00 12.00 ? 361 ASP A C     1 
ATOM 2541 O O     . ASP A 1 361 ? 0.806   -23.150 113.852 1.00 12.00 ? 361 ASP A O     1 
ATOM 2542 C CB    . ASP A 1 361 ? -1.320  -20.686 112.783 1.00 12.00 ? 361 ASP A CB    1 
ATOM 2543 C CG    . ASP A 1 361 ? -1.441  -19.644 113.869 1.00 12.00 ? 361 ASP A CG    1 
ATOM 2544 O OD1   . ASP A 1 361 ? -0.800  -19.812 114.923 1.00 20.00 ? 361 ASP A OD1   1 
ATOM 2545 O OD2   . ASP A 1 361 ? -2.172  -18.659 113.666 1.00 20.00 ? 361 ASP A OD2   1 
ATOM 2546 N N     . VAL A 1 362 ? 0.483   -21.253 115.027 1.00 12.00 ? 362 VAL A N     1 
ATOM 2547 C CA    . VAL A 1 362 ? 0.843   -21.838 116.311 1.00 12.00 ? 362 VAL A CA    1 
ATOM 2548 C C     . VAL A 1 362 ? -0.284  -21.656 117.346 1.00 12.00 ? 362 VAL A C     1 
ATOM 2549 O O     . VAL A 1 362 ? -0.054  -21.184 118.467 1.00 12.00 ? 362 VAL A O     1 
ATOM 2550 C CB    . VAL A 1 362 ? 2.145   -21.237 116.856 1.00 20.00 ? 362 VAL A CB    1 
ATOM 2551 C CG1   . VAL A 1 362 ? 1.892   -20.524 118.169 1.00 20.00 ? 362 VAL A CG1   1 
ATOM 2552 C CG2   . VAL A 1 362 ? 3.199   -22.314 117.024 1.00 20.00 ? 362 VAL A CG2   1 
ATOM 2553 N N     . THR A 1 363 ? -1.469  -22.046 116.928 1.00 12.00 ? 363 THR A N     1 
ATOM 2554 C CA    . THR A 1 363 ? -2.702  -21.975 117.734 1.00 12.00 ? 363 THR A CA    1 
ATOM 2555 C C     . THR A 1 363 ? -2.518  -21.142 119.006 1.00 12.00 ? 363 THR A C     1 
ATOM 2556 O O     . THR A 1 363 ? -1.391  -20.889 119.447 1.00 12.00 ? 363 THR A O     1 
ATOM 2557 C CB    . THR A 1 363 ? -3.144  -23.372 118.153 1.00 20.00 ? 363 THR A CB    1 
ATOM 2558 O OG1   . THR A 1 363 ? -3.222  -24.212 117.017 1.00 20.00 ? 363 THR A OG1   1 
ATOM 2559 C CG2   . THR A 1 363 ? -4.513  -23.385 118.824 1.00 20.00 ? 363 THR A CG2   1 
ATOM 2560 N N     . GLN A 1 364 ? -3.669  -20.765 119.538 1.00 12.00 ? 364 GLN A N     1 
ATOM 2561 C CA    . GLN A 1 364 ? -3.799  -19.945 120.750 1.00 12.00 ? 364 GLN A CA    1 
ATOM 2562 C C     . GLN A 1 364 ? -3.068  -20.586 121.928 1.00 12.00 ? 364 GLN A C     1 
ATOM 2563 O O     . GLN A 1 364 ? -3.150  -20.107 123.065 1.00 12.00 ? 364 GLN A O     1 
ATOM 2564 C CB    . GLN A 1 364 ? -5.276  -19.809 121.122 1.00 12.00 ? 364 GLN A CB    1 
ATOM 2565 C CG    . GLN A 1 364 ? -6.196  -19.747 119.903 1.00 20.00 ? 364 GLN A CG    1 
ATOM 2566 C CD    . GLN A 1 364 ? -7.259  -20.844 119.891 1.00 20.00 ? 364 GLN A CD    1 
ATOM 2567 O OE1   . GLN A 1 364 ? -7.063  -21.897 120.487 1.00 20.00 ? 364 GLN A OE1   1 
ATOM 2568 N NE2   . GLN A 1 364 ? -8.388  -20.660 119.239 1.00 20.00 ? 364 GLN A NE2   1 
ATOM 2569 N N     . GLY A 1 365 ? -2.368  -21.656 121.619 1.00 12.00 ? 365 GLY A N     1 
ATOM 2570 C CA    . GLY A 1 365 ? -1.603  -22.419 122.612 1.00 12.00 ? 365 GLY A CA    1 
ATOM 2571 C C     . GLY A 1 365 ? -0.114  -22.379 122.283 1.00 12.00 ? 365 GLY A C     1 
ATOM 2572 O O     . GLY A 1 365 ? 0.720   -22.884 123.041 1.00 12.00 ? 365 GLY A O     1 
ATOM 2573 N N     . MET A 1 366 ? 0.170   -21.777 121.151 1.00 12.00 ? 366 MET A N     1 
ATOM 2574 C CA    . MET A 1 366 ? 1.537   -21.625 120.648 1.00 12.00 ? 366 MET A CA    1 
ATOM 2575 C C     . MET A 1 366 ? 2.307   -22.943 120.763 1.00 12.00 ? 366 MET A C     1 
ATOM 2576 O O     . MET A 1 366 ? 3.220   -23.075 121.585 1.00 12.00 ? 366 MET A O     1 
ATOM 2577 C CB    . MET A 1 366 ? 2.284   -20.566 121.457 1.00 12.00 ? 366 MET A CB    1 
ATOM 2578 C CG    . MET A 1 366 ? 1.493   -19.274 121.628 1.00 20.00 ? 366 MET A CG    1 
ATOM 2579 S SD    . MET A 1 366 ? 2.515   -17.886 122.053 1.00 20.00 ? 366 MET A SD    1 
ATOM 2580 C CE    . MET A 1 366 ? 4.192   -18.197 121.564 1.00 20.00 ? 366 MET A CE    1 
ATOM 2581 N N     . ASP A 1 367 ? 1.913   -23.887 119.930 1.00 12.00 ? 367 ASP A N     1 
ATOM 2582 C CA    . ASP A 1 367 ? 2.556   -25.210 119.864 1.00 12.00 ? 367 ASP A CA    1 
ATOM 2583 C C     . ASP A 1 367 ? 3.927   -25.046 119.206 1.00 12.00 ? 367 ASP A C     1 
ATOM 2584 O O     . ASP A 1 367 ? 4.688   -26.011 119.078 1.00 12.00 ? 367 ASP A O     1 
ATOM 2585 C CB    . ASP A 1 367 ? 1.685   -26.167 119.055 1.00 12.00 ? 367 ASP A CB    1 
ATOM 2586 C CG    . ASP A 1 367 ? 0.594   -26.833 119.890 1.00 12.00 ? 367 ASP A CG    1 
ATOM 2587 O OD1   . ASP A 1 367 ? -0.356  -26.126 120.393 1.00 12.00 ? 367 ASP A OD1   1 
ATOM 2588 O OD2   . ASP A 1 367 ? 0.623   -28.103 120.091 1.00 12.00 ? 367 ASP A OD2   1 
ATOM 2589 N N     . ARG A 1 368 ? 4.128   -23.805 118.833 1.00 12.00 ? 368 ARG A N     1 
ATOM 2590 C CA    . ARG A 1 368 ? 5.333   -23.259 118.188 1.00 12.00 ? 368 ARG A CA    1 
ATOM 2591 C C     . ARG A 1 368 ? 6.343   -24.308 117.706 1.00 12.00 ? 368 ARG A C     1 
ATOM 2592 O O     . ARG A 1 368 ? 7.192   -24.029 116.854 1.00 12.00 ? 368 ARG A O     1 
ATOM 2593 C CB    . ARG A 1 368 ? 6.080   -22.357 119.159 1.00 12.00 ? 368 ARG A CB    1 
ATOM 2594 C CG    . ARG A 1 368 ? 6.033   -20.890 118.753 1.00 12.00 ? 368 ARG A CG    1 
ATOM 2595 C CD    . ARG A 1 368 ? 7.246   -20.103 119.232 1.00 12.00 ? 368 ARG A CD    1 
ATOM 2596 N NE    . ARG A 1 368 ? 7.032   -18.657 119.194 1.00 20.00 ? 368 ARG A NE    1 
ATOM 2597 C CZ    . ARG A 1 368 ? 7.840   -17.768 119.775 1.00 20.00 ? 368 ARG A CZ    1 
ATOM 2598 N NH1   . ARG A 1 368 ? 8.925   -18.161 120.445 1.00 20.00 ? 368 ARG A NH1   1 
ATOM 2599 N NH2   . ARG A 1 368 ? 7.644   -16.448 119.740 1.00 20.00 ? 368 ARG A NH2   1 
ATOM 2600 N N     . GLU A 1 369 ? 6.282   -25.509 118.231 1.00 12.00 ? 369 GLU A N     1 
ATOM 2601 C CA    . GLU A 1 369 ? 7.250   -26.545 117.834 1.00 12.00 ? 369 GLU A CA    1 
ATOM 2602 C C     . GLU A 1 369 ? 6.601   -27.564 116.900 1.00 12.00 ? 369 GLU A C     1 
ATOM 2603 O O     . GLU A 1 369 ? 7.282   -28.233 116.113 1.00 12.00 ? 369 GLU A O     1 
ATOM 2604 C CB    . GLU A 1 369 ? 7.832   -27.219 119.067 1.00 12.00 ? 369 GLU A CB    1 
ATOM 2605 C CG    . GLU A 1 369 ? 8.914   -26.365 119.727 1.00 12.00 ? 369 GLU A CG    1 
ATOM 2606 C CD    . GLU A 1 369 ? 9.876   -27.161 120.602 1.00 20.00 ? 369 GLU A CD    1 
ATOM 2607 O OE1   . GLU A 1 369 ? 9.767   -28.438 120.682 1.00 20.00 ? 369 GLU A OE1   1 
ATOM 2608 O OE2   . GLU A 1 369 ? 10.793  -26.550 121.265 1.00 20.00 ? 369 GLU A OE2   1 
ATOM 2609 N N     . ALA A 1 370 ? 5.296   -27.661 117.011 1.00 12.00 ? 370 ALA A N     1 
ATOM 2610 C CA    . ALA A 1 370 ? 4.502   -28.544 116.153 1.00 12.00 ? 370 ALA A CA    1 
ATOM 2611 C C     . ALA A 1 370 ? 4.331   -27.858 114.807 1.00 12.00 ? 370 ALA A C     1 
ATOM 2612 O O     . ALA A 1 370 ? 5.074   -28.125 113.855 1.00 12.00 ? 370 ALA A O     1 
ATOM 2613 C CB    . ALA A 1 370 ? 3.141   -28.803 116.784 1.00 12.00 ? 370 ALA A CB    1 
ATOM 2614 N N     . ASN A 1 371 ? 3.333   -26.992 114.782 1.00 12.00 ? 371 ASN A N     1 
ATOM 2615 C CA    . ASN A 1 371 ? 3.107   -26.174 113.589 1.00 12.00 ? 371 ASN A CA    1 
ATOM 2616 C C     . ASN A 1 371 ? 4.425   -25.572 113.112 1.00 12.00 ? 371 ASN A C     1 
ATOM 2617 O O     . ASN A 1 371 ? 4.527   -24.389 112.852 1.00 12.00 ? 371 ASN A O     1 
ATOM 2618 C CB    . ASN A 1 371 ? 2.127   -25.051 113.906 1.00 12.00 ? 371 ASN A CB    1 
ATOM 2619 C CG    . ASN A 1 371 ? 0.768   -25.559 114.368 1.00 12.00 ? 371 ASN A CG    1 
ATOM 2620 O OD1   . ASN A 1 371 ? 0.096   -26.268 113.629 1.00 12.00 ? 371 ASN A OD1   1 
ATOM 2621 N ND2   . ASN A 1 371 ? 0.318   -25.239 115.561 1.00 20.00 ? 371 ASN A ND2   1 
ATOM 2622 N N     . GLY A 1 372 ? 5.357   -26.514 113.127 1.00 12.00 ? 372 GLY A N     1 
ATOM 2623 C CA    . GLY A 1 372 ? 6.770   -26.334 112.768 1.00 12.00 ? 372 GLY A CA    1 
ATOM 2624 C C     . GLY A 1 372 ? 7.128   -24.906 112.362 1.00 12.00 ? 372 GLY A C     1 
ATOM 2625 O O     . GLY A 1 372 ? 7.470   -24.636 111.207 1.00 12.00 ? 372 GLY A O     1 
ATOM 2626 N N     . SER A 1 373 ? 7.066   -24.006 113.321 1.00 12.00 ? 373 SER A N     1 
ATOM 2627 C CA    . SER A 1 373 ? 7.475   -22.618 113.089 1.00 12.00 ? 373 SER A CA    1 
ATOM 2628 C C     . SER A 1 373 ? 9.000   -22.598 113.007 1.00 12.00 ? 373 SER A C     1 
ATOM 2629 O O     . SER A 1 373 ? 9.689   -22.856 113.998 1.00 12.00 ? 373 SER A O     1 
ATOM 2630 C CB    . SER A 1 373 ? 6.996   -21.721 114.225 1.00 12.00 ? 373 SER A CB    1 
ATOM 2631 O OG    . SER A 1 373 ? 7.268   -20.364 113.915 1.00 20.00 ? 373 SER A OG    1 
ATOM 2632 N N     . VAL A 1 374 ? 9.619   -22.321 112.638 1.00 12.00 ? 374 VAL A N     1 
ATOM 2633 C CA    . VAL A 1 374 ? 11.057  -22.303 112.321 1.00 12.00 ? 374 VAL A CA    1 
ATOM 2634 C C     . VAL A 1 374 ? 11.884  -21.669 113.431 1.00 12.00 ? 374 VAL A C     1 
ATOM 2635 O O     . VAL A 1 374 ? 11.382  -21.408 114.531 1.00 12.00 ? 374 VAL A O     1 
ATOM 2636 C CB    . VAL A 1 374 ? 11.324  -21.499 111.059 1.00 12.00 ? 374 VAL A CB    1 
ATOM 2637 C CG1   . VAL A 1 374 ? 12.774  -21.033 110.952 1.00 20.00 ? 374 VAL A CG1   1 
ATOM 2638 C CG2   . VAL A 1 374 ? 11.049  -22.287 109.785 1.00 20.00 ? 374 VAL A CG2   1 
ATOM 2639 N N     . ARG A 1 375 ? 13.001  -21.263 112.344 1.00 12.00 ? 375 ARG A N     1 
ATOM 2640 C CA    . ARG A 1 375 ? 13.847  -20.615 113.371 1.00 12.00 ? 375 ARG A CA    1 
ATOM 2641 C C     . ARG A 1 375 ? 15.178  -20.226 112.727 1.00 12.00 ? 375 ARG A C     1 
ATOM 2642 O O     . ARG A 1 375 ? 15.824  -21.041 112.061 1.00 12.00 ? 375 ARG A O     1 
ATOM 2643 C CB    . ARG A 1 375 ? 14.103  -21.569 114.540 1.00 12.00 ? 375 ARG A CB    1 
ATOM 2644 C CG    . ARG A 1 375 ? 15.139  -21.037 115.535 1.00 12.00 ? 375 ARG A CG    1 
ATOM 2645 C CD    . ARG A 1 375 ? 14.551  -20.058 116.551 1.00 12.00 ? 375 ARG A CD    1 
ATOM 2646 N NE    . ARG A 1 375 ? 15.370  -19.918 117.763 1.00 12.00 ? 375 ARG A NE    1 
ATOM 2647 C CZ    . ARG A 1 375 ? 14.962  -19.290 118.874 1.00 12.00 ? 375 ARG A CZ    1 
ATOM 2648 N NH1   . ARG A 1 375 ? 13.749  -18.737 118.947 1.00 12.00 ? 375 ARG A NH1   1 
ATOM 2649 N NH2   . ARG A 1 375 ? 15.706  -19.163 119.977 1.00 12.00 ? 375 ARG A NH2   1 
ATOM 2650 N N     . TYR A 1 376 ? 15.561  -18.981 112.937 1.00 12.00 ? 376 TYR A N     1 
ATOM 2651 C CA    . TYR A 1 376 ? 16.782  -18.427 112.333 1.00 12.00 ? 376 TYR A CA    1 
ATOM 2652 C C     . TYR A 1 376 ? 17.742  -17.858 113.389 1.00 12.00 ? 376 TYR A C     1 
ATOM 2653 O O     . TYR A 1 376 ? 17.333  -17.507 114.501 1.00 12.00 ? 376 TYR A O     1 
ATOM 2654 C CB    . TYR A 1 376 ? 16.412  -17.301 111.370 1.00 12.00 ? 376 TYR A CB    1 
ATOM 2655 C CG    . TYR A 1 376 ? 15.534  -17.758 110.202 1.00 12.00 ? 376 TYR A CG    1 
ATOM 2656 C CD1   . TYR A 1 376 ? 14.149  -17.875 110.360 1.00 12.00 ? 376 TYR A CD1   1 
ATOM 2657 C CD2   . TYR A 1 376 ? 16.113  -18.059 108.967 1.00 12.00 ? 376 TYR A CD2   1 
ATOM 2658 C CE1   . TYR A 1 376 ? 13.351  -18.285 109.290 1.00 12.00 ? 376 TYR A CE1   1 
ATOM 2659 C CE2   . TYR A 1 376 ? 15.315  -18.470 107.898 1.00 12.00 ? 376 TYR A CE2   1 
ATOM 2660 C CZ    . TYR A 1 376 ? 13.934  -18.582 108.059 1.00 12.00 ? 376 TYR A CZ    1 
ATOM 2661 O OH    . TYR A 1 376 ? 13.160  -18.979 107.017 1.00 12.00 ? 376 TYR A OH    1 
ATOM 2662 N N     . SER A 1 377 ? 18.996  -17.796 112.964 1.00 12.00 ? 377 SER A N     1 
ATOM 2663 C CA    . SER A 1 377 ? 20.128  -17.271 113.750 1.00 12.00 ? 377 SER A CA    1 
ATOM 2664 C C     . SER A 1 377 ? 21.164  -16.685 112.788 1.00 12.00 ? 377 SER A C     1 
ATOM 2665 O O     . SER A 1 377 ? 21.867  -17.419 112.084 1.00 12.00 ? 377 SER A O     1 
ATOM 2666 C CB    . SER A 1 377 ? 20.771  -18.393 114.561 1.00 12.00 ? 377 SER A CB    1 
ATOM 2667 O OG    . SER A 1 377 ? 19.794  -19.040 115.355 1.00 20.00 ? 377 SER A OG    1 
ATOM 2668 N N     . TYR A 1 378 ? 21.229  -15.369 112.785 1.00 12.00 ? 378 TYR A N     1 
ATOM 2669 C CA    . TYR A 1 378 ? 22.113  -14.613 111.884 1.00 12.00 ? 378 TYR A CA    1 
ATOM 2670 C C     . TYR A 1 378 ? 23.072  -13.720 112.657 1.00 12.00 ? 378 TYR A C     1 
ATOM 2671 O O     . TYR A 1 378 ? 22.850  -13.414 113.834 1.00 12.00 ? 378 TYR A O     1 
ATOM 2672 C CB    . TYR A 1 378 ? 21.256  -13.775 110.954 1.00 12.00 ? 378 TYR A CB    1 
ATOM 2673 C CG    . TYR A 1 378 ? 20.032  -13.193 111.655 1.00 12.00 ? 378 TYR A CG    1 
ATOM 2674 C CD1   . TYR A 1 378 ? 18.847  -13.927 111.714 1.00 12.00 ? 378 TYR A CD1   1 
ATOM 2675 C CD2   . TYR A 1 378 ? 20.100  -11.929 112.242 1.00 12.00 ? 378 TYR A CD2   1 
ATOM 2676 C CE1   . TYR A 1 378 ? 17.730  -13.398 112.358 1.00 12.00 ? 378 TYR A CE1   1 
ATOM 2677 C CE2   . TYR A 1 378 ? 18.982  -11.399 112.886 1.00 12.00 ? 378 TYR A CE2   1 
ATOM 2678 C CZ    . TYR A 1 378 ? 17.797  -12.134 112.945 1.00 12.00 ? 378 TYR A CZ    1 
ATOM 2679 O OH    . TYR A 1 378 ? 16.712  -11.619 113.573 1.00 20.00 ? 378 TYR A OH    1 
ATOM 2680 N N     . GLY A 1 379 ? 24.113  -13.338 111.940 1.00 12.00 ? 379 GLY A N     1 
ATOM 2681 C CA    . GLY A 1 379 ? 25.186  -12.490 112.460 1.00 12.00 ? 379 GLY A CA    1 
ATOM 2682 C C     . GLY A 1 379 ? 25.264  -11.180 111.678 1.00 12.00 ? 379 GLY A C     1 
ATOM 2683 O O     . GLY A 1 379 ? 24.997  -11.142 110.471 1.00 12.00 ? 379 GLY A O     1 
ATOM 2684 N N     . LYS A 1 380 ? 25.639  -10.166 112.422 1.00 12.00 ? 380 LYS A N     1 
ATOM 2685 C CA    . LYS A 1 380 ? 25.800  -8.788  111.942 1.00 12.00 ? 380 LYS A CA    1 
ATOM 2686 C C     . LYS A 1 380 ? 25.595  -8.677  110.427 1.00 12.00 ? 380 LYS A C     1 
ATOM 2687 O O     . LYS A 1 380 ? 24.691  -7.980  109.956 1.00 12.00 ? 380 LYS A O     1 
ATOM 2688 C CB    . LYS A 1 380 ? 27.200  -8.283  112.277 1.00 12.00 ? 380 LYS A CB    1 
ATOM 2689 C CG    . LYS A 1 380 ? 27.383  -7.976  113.760 1.00 12.00 ? 380 LYS A CG    1 
ATOM 2690 C CD    . LYS A 1 380 ? 28.721  -8.459  114.311 1.00 12.00 ? 380 LYS A CD    1 
ATOM 2691 C CE    . LYS A 1 380 ? 28.797  -8.400  115.834 1.00 20.00 ? 380 LYS A CE    1 
ATOM 2692 N NZ    . LYS A 1 380 ? 30.169  -8.292  116.336 1.00 20.00 ? 380 LYS A NZ    1 
ATOM 2693 N N     . GLN A 1 381 ? 26.450  -9.362  109.696 1.00 12.00 ? 381 GLN A N     1 
ATOM 2694 C CA    . GLN A 1 381 ? 26.438  -9.335  108.224 1.00 12.00 ? 381 GLN A CA    1 
ATOM 2695 C C     . GLN A 1 381 ? 25.151  -9.934  107.656 1.00 12.00 ? 381 GLN A C     1 
ATOM 2696 O O     . GLN A 1 381 ? 25.132  -10.460 106.538 1.00 12.00 ? 381 GLN A O     1 
ATOM 2697 C CB    . GLN A 1 381 ? 27.613  -10.128 107.662 1.00 12.00 ? 381 GLN A CB    1 
ATOM 2698 C CG    . GLN A 1 381 ? 27.897  -9.799  106.200 1.00 12.00 ? 381 GLN A CG    1 
ATOM 2699 C CD    . GLN A 1 381 ? 29.139  -10.497 105.656 1.00 12.00 ? 381 GLN A CD    1 
ATOM 2700 O OE1   . GLN A 1 381 ? 29.036  -11.586 105.104 1.00 12.00 ? 381 GLN A OE1   1 
ATOM 2701 N NE2   . GLN A 1 381 ? 30.318  -9.929  105.779 1.00 12.00 ? 381 GLN A NE2   1 
ATOM 2702 N N     . HIS A 1 382 ? 24.100  -9.837  108.438 1.00 12.00 ? 382 HIS A N     1 
ATOM 2703 C CA    . HIS A 1 382 ? 22.777  -10.343 108.051 1.00 12.00 ? 382 HIS A CA    1 
ATOM 2704 C C     . HIS A 1 382 ? 21.748  -10.006 109.122 1.00 12.00 ? 382 HIS A C     1 
ATOM 2705 O O     . HIS A 1 382 ? 20.696  -10.648 109.217 1.00 12.00 ? 382 HIS A O     1 
ATOM 2706 C CB    . HIS A 1 382 ? 22.819  -11.857 107.872 1.00 12.00 ? 382 HIS A CB    1 
ATOM 2707 C CG    . HIS A 1 382 ? 24.032  -12.337 107.083 1.00 12.00 ? 382 HIS A CG    1 
ATOM 2708 N ND1   . HIS A 1 382 ? 23.987  -12.529 105.710 1.00 12.00 ? 382 HIS A ND1   1 
ATOM 2709 C CD2   . HIS A 1 382 ? 25.290  -12.656 107.468 1.00 12.00 ? 382 HIS A CD2   1 
ATOM 2710 C CE1   . HIS A 1 382 ? 25.173  -12.943 105.315 1.00 12.00 ? 382 HIS A CE1   1 
ATOM 2711 N NE2   . HIS A 1 382 ? 25.962  -13.023 106.351 1.00 12.00 ? 382 HIS A NE2   1 
ATOM 2712 N N     . GLY A 1 383 ? 22.091  -9.003  109.899 1.00 12.00 ? 383 GLY A N     1 
ATOM 2713 C CA    . GLY A 1 383 ? 21.243  -8.517  110.990 1.00 12.00 ? 383 GLY A CA    1 
ATOM 2714 C C     . GLY A 1 383 ? 22.098  -8.172  112.204 1.00 12.00 ? 383 GLY A C     1 
ATOM 2715 O O     . GLY A 1 383 ? 23.190  -7.608  112.073 1.00 12.00 ? 383 GLY A O     1 
ATOM 2716 N N     . GLU A 1 384 ? 21.561  -8.528  113.352 1.00 12.00 ? 384 GLU A N     1 
ATOM 2717 C CA    . GLU A 1 384 ? 22.204  -8.286  114.646 1.00 12.00 ? 384 GLU A CA    1 
ATOM 2718 C C     . GLU A 1 384 ? 22.414  -6.791  114.840 1.00 12.00 ? 384 GLU A C     1 
ATOM 2719 O O     . GLU A 1 384 ? 22.590  -6.042  113.873 1.00 12.00 ? 384 GLU A O     1 
ATOM 2720 C CB    . GLU A 1 384 ? 23.550  -8.999  114.698 1.00 12.00 ? 384 GLU A CB    1 
ATOM 2721 C CG    . GLU A 1 384 ? 23.416  -10.499 114.931 1.00 12.00 ? 384 GLU A CG    1 
ATOM 2722 C CD    . GLU A 1 384 ? 24.339  -11.017 116.027 1.00 12.00 ? 384 GLU A CD    1 
ATOM 2723 O OE1   . GLU A 1 384 ? 25.224  -10.239 116.541 1.00 20.00 ? 384 GLU A OE1   1 
ATOM 2724 O OE2   . GLU A 1 384 ? 24.232  -12.230 116.437 1.00 20.00 ? 384 GLU A OE2   1 
ATOM 2725 N N     . ASN A 1 385 ? 22.387  -6.394  116.095 1.00 12.00 ? 385 ASN A N     1 
ATOM 2726 C CA    . ASN A 1 385 ? 22.546  -4.990  116.469 1.00 12.00 ? 385 ASN A CA    1 
ATOM 2727 C C     . ASN A 1 385 ? 23.956  -4.523  116.150 1.00 12.00 ? 385 ASN A C     1 
ATOM 2728 O O     . ASN A 1 385 ? 24.689  -4.062  117.034 1.00 12.00 ? 385 ASN A O     1 
ATOM 2729 C CB    . ASN A 1 385 ? 22.227  -4.789  117.935 1.00 12.00 ? 385 ASN A CB    1 
ATOM 2730 C CG    . ASN A 1 385 ? 20.882  -4.099  118.125 1.00 12.00 ? 385 ASN A CG    1 
ATOM 2731 O OD1   . ASN A 1 385 ? 20.676  -3.007  117.604 1.00 20.00 ? 385 ASN A OD1   1 
ATOM 2732 N ND2   . ASN A 1 385 ? 19.941  -4.678  118.834 1.00 20.00 ? 385 ASN A ND2   1 
ATOM 2733 N N     . TRP A 1 386 ? 24.231  -4.685  114.886 1.00 12.00 ? 386 TRP A N     1 
ATOM 2734 C CA    . TRP A 1 386 ? 25.466  -4.282  114.235 1.00 12.00 ? 386 TRP A CA    1 
ATOM 2735 C C     . TRP A 1 386 ? 26.392  -3.522  115.189 1.00 12.00 ? 386 TRP A C     1 
ATOM 2736 O O     . TRP A 1 386 ? 27.300  -2.804  114.758 1.00 12.00 ? 386 TRP A O     1 
ATOM 2737 C CB    . TRP A 1 386 ? 25.089  -3.357  113.093 1.00 12.00 ? 386 TRP A CB    1 
ATOM 2738 C CG    . TRP A 1 386 ? 25.948  -3.508  111.857 1.00 20.00 ? 386 TRP A CG    1 
ATOM 2739 C CD1   . TRP A 1 386 ? 26.441  -4.635  111.339 1.00 20.00 ? 386 TRP A CD1   1 
ATOM 2740 C CD2   . TRP A 1 386 ? 26.353  -2.433  111.054 1.00 20.00 ? 386 TRP A CD2   1 
ATOM 2741 N NE1   . TRP A 1 386 ? 27.187  -4.260  110.180 1.00 20.00 ? 386 TRP A NE1   1 
ATOM 2742 C CE2   . TRP A 1 386 ? 27.123  -2.960  110.036 1.00 20.00 ? 386 TRP A CE2   1 
ATOM 2743 C CE3   . TRP A 1 386 ? 26.135  -1.061  111.111 1.00 20.00 ? 386 TRP A CE3   1 
ATOM 2744 C CZ2   . TRP A 1 386 ? 27.712  -2.173  109.048 1.00 20.00 ? 386 TRP A CZ2   1 
ATOM 2745 C CZ3   . TRP A 1 386 ? 26.729  -0.276  110.112 1.00 20.00 ? 386 TRP A CZ3   1 
ATOM 2746 C CH2   . TRP A 1 386 ? 27.481  -0.807  109.131 1.00 20.00 ? 386 TRP A CH2   1 
ATOM 2747 N N     . ALA A 1 387 ? 26.152  -3.693  116.473 1.00 12.00 ? 387 ALA A N     1 
ATOM 2748 C CA    . ALA A 1 387 ? 26.949  -3.025  117.513 1.00 12.00 ? 387 ALA A CA    1 
ATOM 2749 C C     . ALA A 1 387 ? 26.860  -3.785  118.832 1.00 12.00 ? 387 ALA A C     1 
ATOM 2750 O O     . ALA A 1 387 ? 26.954  -3.196  119.914 1.00 12.00 ? 387 ALA A O     1 
ATOM 2751 C CB    . ALA A 1 387 ? 26.436  -1.606  117.735 1.00 12.00 ? 387 ALA A CB    1 
ATOM 2752 N N     . ALA A 1 388 ? 26.684  -5.081  118.697 1.00 12.00 ? 388 ALA A N     1 
ATOM 2753 C CA    . ALA A 1 388 ? 26.561  -5.992  119.838 1.00 12.00 ? 388 ALA A CA    1 
ATOM 2754 C C     . ALA A 1 388 ? 27.904  -6.657  120.124 1.00 12.00 ? 388 ALA A C     1 
ATOM 2755 O O     . ALA A 1 388 ? 28.900  -6.396  119.442 1.00 12.00 ? 388 ALA A O     1 
ATOM 2756 C CB    . ALA A 1 388 ? 25.523  -7.066  119.539 1.00 12.00 ? 388 ALA A CB    1 
ATOM 2757 N N     . HIS A 1 389 ? 27.882  -7.502  121.134 1.00 12.00 ? 389 HIS A N     1 
ATOM 2758 C CA    . HIS A 1 389 ? 29.068  -8.238  121.580 1.00 12.00 ? 389 HIS A CA    1 
ATOM 2759 C C     . HIS A 1 389 ? 28.712  -9.693  121.872 1.00 12.00 ? 389 HIS A C     1 
ATOM 2760 O O     . HIS A 1 389 ? 27.543  -10.089 121.805 1.00 12.00 ? 389 HIS A O     1 
ATOM 2761 C CB    . HIS A 1 389 ? 29.623  -7.611  122.854 1.00 12.00 ? 389 HIS A CB    1 
ATOM 2762 C CG    . HIS A 1 389 ? 28.821  -6.399  123.317 1.00 20.00 ? 389 HIS A CG    1 
ATOM 2763 N ND1   . HIS A 1 389 ? 27.754  -6.518  124.196 1.00 20.00 ? 389 HIS A ND1   1 
ATOM 2764 C CD2   . HIS A 1 389 ? 28.929  -5.080  123.031 1.00 20.00 ? 389 HIS A CD2   1 
ATOM 2765 C CE1   . HIS A 1 389 ? 27.263  -5.315  124.410 1.00 20.00 ? 389 HIS A CE1   1 
ATOM 2766 N NE2   . HIS A 1 389 ? 27.953  -4.447  123.723 1.00 20.00 ? 389 HIS A NE2   1 
ATOM 2767 N N     . GLY A 1 390 ? 29.750  -10.439 122.188 1.00 12.00 ? 390 GLY A N     1 
ATOM 2768 C CA    . GLY A 1 390 ? 29.649  -11.863 122.513 1.00 12.00 ? 390 GLY A CA    1 
ATOM 2769 C C     . GLY A 1 390 ? 29.326  -12.668 121.259 1.00 12.00 ? 390 GLY A C     1 
ATOM 2770 O O     . GLY A 1 390 ? 28.299  -12.445 120.608 1.00 12.00 ? 390 GLY A O     1 
ATOM 2771 N N     . PRO A 1 391 ? 30.170  -13.624 120.864 1.00 12.00 ? 391 PRO A N     1 
ATOM 2772 C CA    . PRO A 1 391 ? 29.907  -14.419 119.685 1.00 12.00 ? 391 PRO A CA    1 
ATOM 2773 C C     . PRO A 1 391 ? 28.611  -15.164 119.844 1.00 12.00 ? 391 PRO A C     1 
ATOM 2774 O O     . PRO A 1 391 ? 28.607  -16.423 119.722 1.00 12.00 ? 391 PRO A O     1 
ATOM 2775 C CB    . PRO A 1 391 ? 31.086  -15.352 119.606 1.00 12.00 ? 391 PRO A CB    1 
ATOM 2776 C CG    . PRO A 1 391 ? 32.000  -15.046 120.775 1.00 12.00 ? 391 PRO A CG    1 
ATOM 2777 C CD    . PRO A 1 391 ? 31.403  -13.937 121.575 1.00 12.00 ? 391 PRO A CD    1 
ATOM 2778 N N     . ALA A 1 392 ? 27.564  -14.400 120.103 1.00 12.00 ? 392 ALA A N     1 
ATOM 2779 C CA    . ALA A 1 392 ? 26.212  -14.942 120.320 1.00 12.00 ? 392 ALA A CA    1 
ATOM 2780 C C     . ALA A 1 392 ? 25.274  -14.558 119.175 1.00 12.00 ? 392 ALA A C     1 
ATOM 2781 O O     . ALA A 1 392 ? 24.928  -13.383 119.003 1.00 12.00 ? 392 ALA A O     1 
ATOM 2782 C CB    . ALA A 1 392 ? 25.631  -14.394 121.619 1.00 12.00 ? 392 ALA A CB    1 
ATOM 2783 N N     . PRO A 1 393 ? 24.828  -15.517 118.353 1.00 12.00 ? 393 PRO A N     1 
ATOM 2784 C CA    . PRO A 1 393 ? 23.926  -15.227 117.252 1.00 12.00 ? 393 PRO A CA    1 
ATOM 2785 C C     . PRO A 1 393 ? 22.633  -14.634 117.756 1.00 12.00 ? 393 PRO A C     1 
ATOM 2786 O O     . PRO A 1 393 ? 22.503  -14.406 118.994 1.00 12.00 ? 393 PRO A O     1 
ATOM 2787 C CB    . PRO A 1 393 ? 23.703  -16.566 116.602 1.00 12.00 ? 393 PRO A CB    1 
ATOM 2788 C CG    . PRO A 1 393 ? 24.501  -17.598 117.375 1.00 12.00 ? 393 PRO A CG    1 
ATOM 2789 C CD    . PRO A 1 393 ? 25.215  -16.917 118.494 1.00 12.00 ? 393 PRO A CD    1 
ATOM 2790 N N     . GLU A 1 394 ? 21.736  -14.401 116.805 1.00 12.00 ? 394 GLU A N     1 
ATOM 2791 C CA    . GLU A 1 394 ? 20.392  -13.839 117.056 1.00 12.00 ? 394 GLU A CA    1 
ATOM 2792 C C     . GLU A 1 394 ? 19.433  -14.291 115.948 1.00 12.00 ? 394 GLU A C     1 
ATOM 2793 O O     . GLU A 1 394 ? 19.789  -14.306 114.766 1.00 12.00 ? 394 GLU A O     1 
ATOM 2794 C CB    . GLU A 1 394 ? 20.450  -12.312 117.073 1.00 12.00 ? 394 GLU A CB    1 
ATOM 2795 C CG    . GLU A 1 394 ? 19.070  -11.662 117.158 1.00 12.00 ? 394 GLU A CG    1 
ATOM 2796 C CD    . GLU A 1 394 ? 19.114  -10.209 117.626 1.00 12.00 ? 394 GLU A CD    1 
ATOM 2797 O OE1   . GLU A 1 394 ? 19.225  -9.940  118.879 1.00 12.00 ? 394 GLU A OE1   1 
ATOM 2798 O OE2   . GLU A 1 394 ? 19.041  -9.254  116.769 1.00 12.00 ? 394 GLU A OE2   1 
ATOM 2799 N N     . ARG A 1 395 ? 18.229  -14.650 116.360 1.00 12.00 ? 395 ARG A N     1 
ATOM 2800 C CA    . ARG A 1 395 ? 17.192  -15.142 115.436 1.00 12.00 ? 395 ARG A CA    1 
ATOM 2801 C C     . ARG A 1 395 ? 15.840  -14.475 115.702 1.00 12.00 ? 395 ARG A C     1 
ATOM 2802 O O     . ARG A 1 395 ? 15.744  -13.520 116.480 1.00 12.00 ? 395 ARG A O     1 
ATOM 2803 C CB    . ARG A 1 395 ? 17.016  -16.647 115.602 1.00 12.00 ? 395 ARG A CB    1 
ATOM 2804 C CG    . ARG A 1 395 ? 17.217  -17.115 117.039 1.00 12.00 ? 395 ARG A CG    1 
ATOM 2805 C CD    . ARG A 1 395 ? 18.688  -17.223 117.428 1.00 12.00 ? 395 ARG A CD    1 
ATOM 2806 N NE    . ARG A 1 395 ? 18.886  -17.786 118.766 1.00 12.00 ? 395 ARG A NE    1 
ATOM 2807 C CZ    . ARG A 1 395 ? 20.056  -18.246 119.216 1.00 12.00 ? 395 ARG A CZ    1 
ATOM 2808 N NH1   . ARG A 1 395 ? 21.147  -18.218 118.447 1.00 12.00 ? 395 ARG A NH1   1 
ATOM 2809 N NH2   . ARG A 1 395 ? 20.237  -18.758 120.435 1.00 12.00 ? 395 ARG A NH2   1 
ATOM 2810 N N     . TYR A 1 396 ? 14.844  -15.023 115.027 1.00 12.00 ? 396 TYR A N     1 
ATOM 2811 C CA    . TYR A 1 396 ? 13.451  -14.561 115.103 1.00 12.00 ? 396 TYR A CA    1 
ATOM 2812 C C     . TYR A 1 396 ? 12.508  -15.663 114.615 1.00 12.00 ? 396 TYR A C     1 
ATOM 2813 O O     . TYR A 1 396 ? 12.259  -15.802 113.413 1.00 12.00 ? 396 TYR A O     1 
ATOM 2814 C CB    . TYR A 1 396 ? 13.266  -13.327 114.221 1.00 12.00 ? 396 TYR A CB    1 
ATOM 2815 C CG    . TYR A 1 396 ? 11.857  -12.742 114.278 1.00 12.00 ? 396 TYR A CG    1 
ATOM 2816 C CD1   . TYR A 1 396 ? 11.495  -11.896 115.328 1.00 12.00 ? 396 TYR A CD1   1 
ATOM 2817 C CD2   . TYR A 1 396 ? 10.929  -13.047 113.281 1.00 12.00 ? 396 TYR A CD2   1 
ATOM 2818 C CE1   . TYR A 1 396 ? 10.209  -11.357 115.379 1.00 12.00 ? 396 TYR A CE1   1 
ATOM 2819 C CE2   . TYR A 1 396 ? 9.643   -12.507 113.333 1.00 12.00 ? 396 TYR A CE2   1 
ATOM 2820 C CZ    . TYR A 1 396 ? 9.283   -11.662 114.382 1.00 12.00 ? 396 TYR A CZ    1 
ATOM 2821 O OH    . TYR A 1 396 ? 8.034   -11.137 114.433 1.00 20.00 ? 396 TYR A OH    1 
ATOM 2822 N N     . THR A 1 397 ? 12.013  -16.418 115.575 1.00 12.00 ? 397 THR A N     1 
ATOM 2823 C CA    . THR A 1 397 ? 11.092  -17.534 115.320 1.00 12.00 ? 397 THR A CA    1 
ATOM 2824 C C     . THR A 1 397 ? 9.926   -17.065 114.455 1.00 12.00 ? 397 THR A C     1 
ATOM 2825 O O     . THR A 1 397 ? 9.111   -16.239 114.879 1.00 12.00 ? 397 THR A O     1 
ATOM 2826 C CB    . THR A 1 397 ? 10.543  -18.072 116.637 1.00 12.00 ? 397 THR A CB    1 
ATOM 2827 O OG1   . THR A 1 397 ? 11.500  -18.911 117.255 1.00 12.00 ? 397 THR A OG1   1 
ATOM 2828 C CG2   . THR A 1 397 ? 9.267   -18.888 116.462 1.00 12.00 ? 397 THR A CG2   1 
ATOM 2829 N N     . TRP A 1 398 ? 9.887   -17.616 113.259 1.00 12.00 ? 398 TRP A N     1 
ATOM 2830 C CA    . TRP A 1 398 ? 8.853   -17.300 112.270 1.00 12.00 ? 398 TRP A CA    1 
ATOM 2831 C C     . TRP A 1 398 ? 7.608   -18.143 112.521 1.00 12.00 ? 398 TRP A C     1 
ATOM 2832 O O     . TRP A 1 398 ? 7.668   -19.377 112.536 1.00 12.00 ? 398 TRP A O     1 
ATOM 2833 C CB    . TRP A 1 398 ? 9.365   -17.588 110.862 1.00 12.00 ? 398 TRP A CB    1 
ATOM 2834 C CG    . TRP A 1 398 ? 8.450   -17.040 109.770 1.00 12.00 ? 398 TRP A CG    1 
ATOM 2835 C CD1   . TRP A 1 398 ? 7.666   -17.743 108.949 1.00 12.00 ? 398 TRP A CD1   1 
ATOM 2836 C CD2   . TRP A 1 398 ? 8.291   -15.671 109.453 1.00 12.00 ? 398 TRP A CD2   1 
ATOM 2837 N NE1   . TRP A 1 398 ? 7.000   -16.809 108.101 1.00 20.00 ? 398 TRP A NE1   1 
ATOM 2838 C CE2   . TRP A 1 398 ? 7.381   -15.600 108.413 1.00 12.00 ? 398 TRP A CE2   1 
ATOM 2839 C CE3   . TRP A 1 398 ? 8.839   -14.494 109.959 1.00 20.00 ? 398 TRP A CE3   1 
ATOM 2840 C CZ2   . TRP A 1 398 ? 6.976   -14.396 107.834 1.00 20.00 ? 398 TRP A CZ2   1 
ATOM 2841 C CZ3   . TRP A 1 398 ? 8.426   -13.286 109.371 1.00 20.00 ? 398 TRP A CZ3   1 
ATOM 2842 C CH2   . TRP A 1 398 ? 7.538   -13.242 108.359 1.00 20.00 ? 398 TRP A CH2   1 
ATOM 2843 N N     . ASP A 1 399 ? 6.516   -17.435 112.712 1.00 12.00 ? 399 ASP A N     1 
ATOM 2844 C CA    . ASP A 1 399 ? 5.206   -18.038 112.967 1.00 12.00 ? 399 ASP A CA    1 
ATOM 2845 C C     . ASP A 1 399 ? 4.238   -17.661 111.852 1.00 12.00 ? 399 ASP A C     1 
ATOM 2846 O O     . ASP A 1 399 ? 3.612   -16.596 111.887 1.00 12.00 ? 399 ASP A O     1 
ATOM 2847 C CB    . ASP A 1 399 ? 4.657   -17.546 114.300 1.00 12.00 ? 399 ASP A CB    1 
ATOM 2848 C CG    . ASP A 1 399 ? 5.399   -18.130 115.499 1.00 20.00 ? 399 ASP A CG    1 
ATOM 2849 O OD1   . ASP A 1 399 ? 6.451   -18.845 115.318 1.00 20.00 ? 399 ASP A OD1   1 
ATOM 2850 O OD2   . ASP A 1 399 ? 4.970   -17.907 116.690 1.00 20.00 ? 399 ASP A OD2   1 
ATOM 2851 N N     . GLU A 1 400 ? 4.127   -18.547 110.897 1.00 12.00 ? 400 GLU A N     1 
ATOM 2852 C CA    . GLU A 1 400 ? 3.299   -18.419 109.702 1.00 12.00 ? 400 GLU A CA    1 
ATOM 2853 C C     . GLU A 1 400 ? 2.042   -17.668 110.097 1.00 12.00 ? 400 GLU A C     1 
ATOM 2854 O O     . GLU A 1 400 ? 1.674   -17.517 111.257 1.00 12.00 ? 400 GLU A O     1 
ATOM 2855 C CB    . GLU A 1 400 ? 2.950   -19.805 109.171 1.00 12.00 ? 400 GLU A CB    1 
ATOM 2856 C CG    . GLU A 1 400 ? 3.937   -20.316 108.127 1.00 20.00 ? 400 GLU A CG    1 
ATOM 2857 C CD    . GLU A 1 400 ? 4.024   -19.411 106.903 1.00 20.00 ? 400 GLU A CD    1 
ATOM 2858 O OE1   . GLU A 1 400 ? 3.304   -18.348 106.836 1.00 20.00 ? 400 GLU A OE1   1 
ATOM 2859 O OE2   . GLU A 1 400 ? 4.818   -19.712 105.937 1.00 20.00 ? 400 GLU A OE2   1 
ATOM 2860 N N     . THR A 1 401 ? 1.363   -17.208 109.032 1.00 12.00 ? 401 THR A N     1 
ATOM 2861 C CA    . THR A 1 401 ? 0.103   -16.469 109.128 1.00 12.00 ? 401 THR A CA    1 
ATOM 2862 C C     . THR A 1 401 ? -1.046  -17.364 108.680 1.00 12.00 ? 401 THR A C     1 
ATOM 2863 O O     . THR A 1 401 ? -2.191  -17.194 109.115 1.00 12.00 ? 401 THR A O     1 
ATOM 2864 C CB    . THR A 1 401 ? 0.152   -15.237 108.231 1.00 12.00 ? 401 THR A CB    1 
ATOM 2865 O OG1   . THR A 1 401 ? 0.425   -15.621 106.897 1.00 20.00 ? 401 THR A OG1   1 
ATOM 2866 C CG2   . THR A 1 401 ? 1.227   -14.239 108.647 1.00 20.00 ? 401 THR A CG2   1 
ATOM 2867 N N     . ASN A 1 402 ? -0.686  -18.290 107.820 1.00 12.00 ? 402 ASN A N     1 
ATOM 2868 C CA    . ASN A 1 402 ? -1.616  -19.267 107.249 1.00 12.00 ? 402 ASN A CA    1 
ATOM 2869 C C     . ASN A 1 402 ? -2.429  -19.927 108.355 1.00 12.00 ? 402 ASN A C     1 
ATOM 2870 O O     . ASN A 1 402 ? -2.569  -21.153 108.396 1.00 12.00 ? 402 ASN A O     1 
ATOM 2871 C CB    . ASN A 1 402 ? -0.842  -20.348 106.506 1.00 12.00 ? 402 ASN A CB    1 
ATOM 2872 C CG    . ASN A 1 402 ? -0.083  -21.282 107.443 1.00 12.00 ? 402 ASN A CG    1 
ATOM 2873 O OD1   . ASN A 1 402 ? 0.087   -20.969 108.616 1.00 20.00 ? 402 ASN A OD1   1 
ATOM 2874 N ND2   . ASN A 1 402 ? 0.390   -22.424 106.993 1.00 20.00 ? 402 ASN A ND2   1 
ATOM 2875 N N     . PHE A 1 403 ? -2.943  -19.085 109.221 1.00 20.00 ? 403 PHE A N     1 
ATOM 2876 C CA    . PHE A 1 403 ? -3.759  -19.514 110.358 1.00 20.00 ? 403 PHE A CA    1 
ATOM 2877 C C     . PHE A 1 403 ? -4.701  -20.640 109.931 1.00 20.00 ? 403 PHE A C     1 
ATOM 2878 O O     . PHE A 1 403 ? -4.283  -21.612 109.292 1.00 20.00 ? 403 PHE A O     1 
ATOM 2879 C CB    . PHE A 1 403 ? -4.591  -18.343 110.876 1.00 20.00 ? 403 PHE A CB    1 
ATOM 2880 C CG    . PHE A 1 403 ? -3.755  -17.109 111.207 1.00 20.00 ? 403 PHE A CG    1 
ATOM 2881 C CD1   . PHE A 1 403 ? -2.764  -17.177 112.188 1.00 20.00 ? 403 PHE A CD1   1 
ATOM 2882 C CD2   . PHE A 1 403 ? -3.982  -15.909 110.532 1.00 20.00 ? 403 PHE A CD2   1 
ATOM 2883 C CE1   . PHE A 1 403 ? -2.003  -16.048 112.493 1.00 20.00 ? 403 PHE A CE1   1 
ATOM 2884 C CE2   . PHE A 1 403 ? -3.219  -14.780 110.836 1.00 20.00 ? 403 PHE A CE2   1 
ATOM 2885 C CZ    . PHE A 1 403 ? -2.230  -14.850 111.817 1.00 20.00 ? 403 PHE A CZ    1 
ATOM 2886 N N     . GLY A 1 404 ? -5.946  -20.453 110.312 1.00 12.00 ? 404 GLY A N     1 
ATOM 2887 C CA    . GLY A 1 404 ? -7.046  -21.382 110.024 1.00 12.00 ? 404 GLY A CA    1 
ATOM 2888 C C     . GLY A 1 404 ? -6.532  -22.706 109.458 1.00 12.00 ? 404 GLY A C     1 
ATOM 2889 O O     . GLY A 1 404 ? -7.312  -23.615 109.157 1.00 12.00 ? 404 GLY A O     1 
ATOM 2890 N N     . SER A 1 405 ? -5.226  -22.786 109.325 1.00 12.00 ? 405 SER A N     1 
ATOM 2891 C CA    . SER A 1 405 ? -4.564  -23.981 108.789 1.00 12.00 ? 405 SER A CA    1 
ATOM 2892 C C     . SER A 1 405 ? -3.930  -24.789 109.919 1.00 12.00 ? 405 SER A C     1 
ATOM 2893 O O     . SER A 1 405 ? -4.071  -26.016 109.981 1.00 12.00 ? 405 SER A O     1 
ATOM 2894 C CB    . SER A 1 405 ? -3.477  -23.576 107.801 1.00 12.00 ? 405 SER A CB    1 
ATOM 2895 O OG    . SER A 1 405 ? -2.200  -23.790 108.373 1.00 20.00 ? 405 SER A OG    1 
ATOM 2896 N N     . GLY A 1 406 ? -3.248  -24.063 110.779 1.00 12.00 ? 406 GLY A N     1 
ATOM 2897 C CA    . GLY A 1 406 ? -2.548  -24.631 111.937 1.00 12.00 ? 406 GLY A CA    1 
ATOM 2898 C C     . GLY A 1 406 ? -3.460  -25.592 112.694 1.00 12.00 ? 406 GLY A C     1 
ATOM 2899 O O     . GLY A 1 406 ? -4.660  -25.684 112.416 1.00 12.00 ? 406 GLY A O     1 
ATOM 2900 N N     . ARG A 1 407 ? -2.846  -26.278 113.638 1.00 12.00 ? 407 ARG A N     1 
ATOM 2901 C CA    . ARG A 1 407 ? -3.527  -27.261 114.486 1.00 12.00 ? 407 ARG A CA    1 
ATOM 2902 C C     . ARG A 1 407 ? -3.036  -27.172 115.927 1.00 12.00 ? 407 ARG A C     1 
ATOM 2903 O O     . ARG A 1 407 ? -1.830  -27.209 116.193 1.00 12.00 ? 407 ARG A O     1 
ATOM 2904 C CB    . ARG A 1 407 ? -3.260  -28.672 113.971 1.00 12.00 ? 407 ARG A CB    1 
ATOM 2905 C CG    . ARG A 1 407 ? -3.735  -28.884 112.539 1.00 12.00 ? 407 ARG A CG    1 
ATOM 2906 C CD    . ARG A 1 407 ? -5.250  -29.000 112.423 1.00 12.00 ? 407 ARG A CD    1 
ATOM 2907 N NE    . ARG A 1 407 ? -5.706  -29.200 111.046 1.00 12.00 ? 407 ARG A NE    1 
ATOM 2908 C CZ    . ARG A 1 407 ? -6.920  -29.650 110.719 1.00 12.00 ? 407 ARG A CZ    1 
ATOM 2909 N NH1   . ARG A 1 407 ? -7.818  -29.952 111.661 1.00 12.00 ? 407 ARG A NH1   1 
ATOM 2910 N NH2   . ARG A 1 407 ? -7.336  -29.832 109.464 1.00 12.00 ? 407 ARG A NH2   1 
ATOM 2911 N N     . ASP A 1 408 ? -4.006  -27.058 116.814 1.00 12.00 ? 408 ASP A N     1 
ATOM 2912 C CA    . ASP A 1 408 ? -3.767  -26.983 118.259 1.00 12.00 ? 408 ASP A CA    1 
ATOM 2913 C C     . ASP A 1 408 ? -3.662  -28.397 118.821 1.00 12.00 ? 408 ASP A C     1 
ATOM 2914 O O     . ASP A 1 408 ? -4.526  -29.245 118.575 1.00 12.00 ? 408 ASP A O     1 
ATOM 2915 C CB    . ASP A 1 408 ? -4.919  -26.249 118.940 1.00 12.00 ? 408 ASP A CB    1 
ATOM 2916 C CG    . ASP A 1 408 ? -4.672  -25.995 120.423 1.00 12.00 ? 408 ASP A CG    1 
ATOM 2917 O OD1   . ASP A 1 408 ? -3.690  -26.572 121.019 1.00 20.00 ? 408 ASP A OD1   1 
ATOM 2918 O OD2   . ASP A 1 408 ? -5.446  -25.206 121.079 1.00 20.00 ? 408 ASP A OD2   1 
ATOM 2919 N N     . THR A 1 409 ? -2.598  -28.607 119.564 1.00 12.00 ? 409 THR A N     1 
ATOM 2920 C CA    . THR A 1 409 ? -2.291  -29.910 120.167 1.00 12.00 ? 409 THR A CA    1 
ATOM 2921 C C     . THR A 1 409 ? -2.818  -29.998 121.594 1.00 12.00 ? 409 THR A C     1 
ATOM 2922 O O     . THR A 1 409 ? -2.521  -30.950 122.325 1.00 12.00 ? 409 THR A O     1 
ATOM 2923 C CB    . THR A 1 409 ? -0.781  -30.114 120.223 1.00 12.00 ? 409 THR A CB    1 
ATOM 2924 O OG1   . THR A 1 409 ? -0.216  -29.905 118.944 1.00 20.00 ? 409 THR A OG1   1 
ATOM 2925 C CG2   . THR A 1 409 ? -0.387  -31.517 120.671 1.00 20.00 ? 409 THR A CG2   1 
ATOM 2926 N N     . ARG A 1 410 ? -3.588  -29.002 121.962 1.00 12.00 ? 410 ARG A N     1 
ATOM 2927 C CA    . ARG A 1 410 ? -4.168  -28.916 123.303 1.00 12.00 ? 410 ARG A CA    1 
ATOM 2928 C C     . ARG A 1 410 ? -5.676  -29.058 123.241 1.00 12.00 ? 410 ARG A C     1 
ATOM 2929 O O     . ARG A 1 410 ? -6.406  -28.452 124.032 1.00 12.00 ? 410 ARG A O     1 
ATOM 2930 C CB    . ARG A 1 410 ? -3.837  -27.573 123.928 1.00 12.00 ? 410 ARG A CB    1 
ATOM 2931 C CG    . ARG A 1 410 ? -2.347  -27.385 124.146 1.00 12.00 ? 410 ARG A CG    1 
ATOM 2932 C CD    . ARG A 1 410 ? -2.026  -26.212 125.059 1.00 12.00 ? 410 ARG A CD    1 
ATOM 2933 N NE    . ARG A 1 410 ? -0.610  -25.853 125.037 1.00 20.00 ? 410 ARG A NE    1 
ATOM 2934 C CZ    . ARG A 1 410 ? -0.127  -24.705 125.510 1.00 20.00 ? 410 ARG A CZ    1 
ATOM 2935 N NH1   . ARG A 1 410 ? -0.936  -23.790 126.048 1.00 20.00 ? 410 ARG A NH1   1 
ATOM 2936 N NH2   . ARG A 1 410 ? 1.167   -24.378 125.491 1.00 20.00 ? 410 ARG A NH2   1 
ATOM 2937 N N     . ASP A 1 411 ? -6.099  -29.858 122.299 1.00 12.00 ? 411 ASP A N     1 
ATOM 2938 C CA    . ASP A 1 411 ? -7.513  -30.119 122.091 1.00 12.00 ? 411 ASP A CA    1 
ATOM 2939 C C     . ASP A 1 411 ? -7.693  -31.366 121.242 1.00 12.00 ? 411 ASP A C     1 
ATOM 2940 O O     . ASP A 1 411 ? -8.791  -31.642 120.744 1.00 12.00 ? 411 ASP A O     1 
ATOM 2941 C CB    . ASP A 1 411 ? -8.164  -28.916 121.426 1.00 20.00 ? 411 ASP A CB    1 
ATOM 2942 C CG    . ASP A 1 411 ? -8.256  -27.716 122.363 1.00 20.00 ? 411 ASP A CG    1 
ATOM 2943 O OD1   . ASP A 1 411 ? -7.611  -27.720 123.476 1.00 20.00 ? 411 ASP A OD1   1 
ATOM 2944 O OD2   . ASP A 1 411 ? -8.979  -26.702 122.045 1.00 20.00 ? 411 ASP A OD2   1 
ATOM 2945 N N     . GLY A 1 412 ? -6.605  -32.100 121.086 1.00 12.00 ? 412 GLY A N     1 
ATOM 2946 C CA    . GLY A 1 412 ? -6.653  -33.360 120.351 1.00 12.00 ? 412 GLY A CA    1 
ATOM 2947 C C     . GLY A 1 412 ? -8.051  -33.900 120.558 1.00 12.00 ? 412 GLY A C     1 
ATOM 2948 O O     . GLY A 1 412 ? -8.973  -33.161 120.914 1.00 12.00 ? 412 GLY A O     1 
ATOM 2949 N N     . PHE A 1 413 ? -8.252  -35.181 120.368 1.00 12.00 ? 413 PHE A N     1 
ATOM 2950 C CA    . PHE A 1 413 ? -9.598  -35.699 120.581 1.00 12.00 ? 413 PHE A CA    1 
ATOM 2951 C C     . PHE A 1 413 ? -9.963  -36.746 119.526 1.00 12.00 ? 413 PHE A C     1 
ATOM 2952 O O     . PHE A 1 413 ? -9.884  -36.488 118.319 1.00 12.00 ? 413 PHE A O     1 
ATOM 2953 C CB    . PHE A 1 413 ? -10.523 -34.487 120.511 1.00 12.00 ? 413 PHE A CB    1 
ATOM 2954 C CG    . PHE A 1 413 ? -11.989 -34.791 120.716 1.00 12.00 ? 413 PHE A CG    1 
ATOM 2955 C CD1   . PHE A 1 413 ? -12.409 -35.456 121.867 1.00 12.00 ? 413 PHE A CD1   1 
ATOM 2956 C CD2   . PHE A 1 413 ? -12.908 -34.386 119.757 1.00 12.00 ? 413 PHE A CD2   1 
ATOM 2957 C CE1   . PHE A 1 413 ? -13.763 -35.719 122.057 1.00 20.00 ? 413 PHE A CE1   1 
ATOM 2958 C CE2   . PHE A 1 413 ? -14.263 -34.647 119.945 1.00 12.00 ? 413 PHE A CE2   1 
ATOM 2959 C CZ    . PHE A 1 413 ? -14.690 -35.314 121.096 1.00 20.00 ? 413 PHE A CZ    1 
ATOM 2960 N N     . ILE A 1 414 ? -10.364 -37.904 120.039 1.00 12.00 ? 414 ILE A N     1 
ATOM 2961 C CA    . ILE A 1 414 ? -10.763 -39.065 119.223 1.00 12.00 ? 414 ILE A CA    1 
ATOM 2962 C C     . ILE A 1 414 ? -11.728 -39.965 119.999 1.00 12.00 ? 414 ILE A C     1 
ATOM 2963 O O     . ILE A 1 414 ? -11.416 -40.429 121.101 1.00 12.00 ? 414 ILE A O     1 
ATOM 2964 C CB    . ILE A 1 414 ? -9.524  -39.868 118.814 1.00 12.00 ? 414 ILE A CB    1 
ATOM 2965 C CG1   . ILE A 1 414 ? -8.454  -39.012 118.147 1.00 12.00 ? 414 ILE A CG1   1 
ATOM 2966 C CG2   . ILE A 1 414 ? -9.837  -40.984 117.824 1.00 12.00 ? 414 ILE A CG2   1 
ATOM 2967 C CD1   . ILE A 1 414 ? -7.101  -39.709 118.062 1.00 12.00 ? 414 ILE A CD1   1 
ATOM 2968 N N     . GLN A 1 415 ? -12.876 -40.174 119.378 1.00 12.00 ? 415 GLN A N     1 
ATOM 2969 C CA    . GLN A 1 415 ? -13.961 -41.004 119.925 1.00 12.00 ? 415 GLN A CA    1 
ATOM 2970 C C     . GLN A 1 415 ? -13.915 -42.398 119.293 1.00 12.00 ? 415 GLN A C     1 
ATOM 2971 O O     . GLN A 1 415 ? -13.055 -42.688 118.454 1.00 12.00 ? 415 GLN A O     1 
ATOM 2972 C CB    . GLN A 1 415 ? -15.307 -40.347 119.633 1.00 12.00 ? 415 GLN A CB    1 
ATOM 2973 C CG    . GLN A 1 415 ? -15.208 -38.830 119.488 1.00 12.00 ? 415 GLN A CG    1 
ATOM 2974 C CD    . GLN A 1 415 ? -16.400 -38.088 120.086 1.00 12.00 ? 415 GLN A CD    1 
ATOM 2975 O OE1   . GLN A 1 415 ? -17.508 -38.613 120.091 1.00 12.00 ? 415 GLN A OE1   1 
ATOM 2976 N NE2   . GLN A 1 415 ? -16.241 -36.886 120.594 1.00 12.00 ? 415 GLN A NE2   1 
ATOM 2977 N N     . SER A 1 416 ? -14.853 -43.231 119.714 1.00 12.00 ? 416 SER A N     1 
ATOM 2978 C CA    . SER A 1 416 ? -14.943 -44.627 119.251 1.00 12.00 ? 416 SER A CA    1 
ATOM 2979 C C     . SER A 1 416 ? -16.200 -44.865 118.407 1.00 12.00 ? 416 SER A C     1 
ATOM 2980 O O     . SER A 1 416 ? -16.943 -43.928 118.094 1.00 12.00 ? 416 SER A O     1 
ATOM 2981 C CB    . SER A 1 416 ? -14.993 -45.573 120.445 1.00 12.00 ? 416 SER A CB    1 
ATOM 2982 O OG    . SER A 1 416 ? -13.888 -45.336 121.297 1.00 20.00 ? 416 SER A OG    1 
ATOM 2983 N N     . ALA A 1 417 ? -16.368 -46.138 118.079 1.00 12.00 ? 417 ALA A N     1 
ATOM 2984 C CA    . ALA A 1 417 ? -17.483 -46.652 117.263 1.00 12.00 ? 417 ALA A CA    1 
ATOM 2985 C C     . ALA A 1 417 ? -18.712 -45.760 117.389 1.00 12.00 ? 417 ALA A C     1 
ATOM 2986 O O     . ALA A 1 417 ? -18.722 -44.620 116.909 1.00 12.00 ? 417 ALA A O     1 
ATOM 2987 C CB    . ALA A 1 417 ? -17.860 -48.057 117.721 1.00 12.00 ? 417 ALA A CB    1 
ATOM 2988 N N     . PRO A 1 418 ? -19.798 -46.219 118.029 1.00 12.00 ? 418 PRO A N     1 
ATOM 2989 C CA    . PRO A 1 418 ? -20.982 -45.400 118.172 1.00 12.00 ? 418 PRO A CA    1 
ATOM 2990 C C     . PRO A 1 418 ? -20.594 -44.128 118.862 1.00 12.00 ? 418 PRO A C     1 
ATOM 2991 O O     . PRO A 1 418 ? -20.605 -44.092 120.125 1.00 12.00 ? 418 PRO A O     1 
ATOM 2992 C CB    . PRO A 1 418 ? -21.925 -46.265 118.962 1.00 12.00 ? 418 PRO A CB    1 
ATOM 2993 C CG    . PRO A 1 418 ? -21.232 -47.585 119.231 1.00 12.00 ? 418 PRO A CG    1 
ATOM 2994 C CD    . PRO A 1 418 ? -19.871 -47.549 118.621 1.00 20.00 ? 418 PRO A CD    1 
ATOM 2995 N N     . LEU A 1 419 ? -20.277 -43.166 118.022 1.00 12.00 ? 419 LEU A N     1 
ATOM 2996 C CA    . LEU A 1 419 ? -19.775 -41.842 118.418 1.00 12.00 ? 419 LEU A CA    1 
ATOM 2997 C C     . LEU A 1 419 ? -20.522 -41.203 119.583 1.00 12.00 ? 419 LEU A C     1 
ATOM 2998 O O     . LEU A 1 419 ? -20.784 -39.997 119.588 1.00 12.00 ? 419 LEU A O     1 
ATOM 2999 C CB    . LEU A 1 419 ? -19.932 -40.829 117.294 1.00 12.00 ? 419 LEU A CB    1 
ATOM 3000 C CG    . LEU A 1 419 ? -19.818 -39.386 117.772 1.00 12.00 ? 419 LEU A CG    1 
ATOM 3001 C CD1   . LEU A 1 419 ? -18.418 -39.028 118.259 1.00 12.00 ? 419 LEU A CD1   1 
ATOM 3002 C CD2   . LEU A 1 419 ? -20.148 -38.369 116.684 1.00 12.00 ? 419 LEU A CD2   1 
ATOM 3003 N N     . VAL A 1 420 ? -20.861 -41.985 120.573 1.00 12.00 ? 420 VAL A N     1 
ATOM 3004 C CA    . VAL A 1 420 ? -21.545 -41.436 121.746 1.00 12.00 ? 420 VAL A CA    1 
ATOM 3005 C C     . VAL A 1 420 ? -20.875 -40.111 122.125 1.00 12.00 ? 420 VAL A C     1 
ATOM 3006 O O     . VAL A 1 420 ? -19.698 -40.078 122.500 1.00 12.00 ? 420 VAL A O     1 
ATOM 3007 C CB    . VAL A 1 420 ? -21.442 -42.411 122.912 1.00 12.00 ? 420 VAL A CB    1 
ATOM 3008 C CG1   . VAL A 1 420 ? -21.919 -43.815 122.561 1.00 20.00 ? 420 VAL A CG1   1 
ATOM 3009 C CG2   . VAL A 1 420 ? -20.016 -42.574 123.426 1.00 20.00 ? 420 VAL A CG2   1 
ATOM 3010 N N     . VAL A 1 421 ? -21.639 -39.038 122.012 1.00 12.00 ? 421 VAL A N     1 
ATOM 3011 C CA    . VAL A 1 421 ? -21.150 -37.685 122.326 1.00 12.00 ? 421 VAL A CA    1 
ATOM 3012 C C     . VAL A 1 421 ? -20.622 -37.645 123.754 1.00 12.00 ? 421 VAL A C     1 
ATOM 3013 O O     . VAL A 1 421 ? -19.415 -37.505 123.986 1.00 12.00 ? 421 VAL A O     1 
ATOM 3014 C CB    . VAL A 1 421 ? -22.261 -36.657 122.167 1.00 12.00 ? 421 VAL A CB    1 
ATOM 3015 C CG1   . VAL A 1 421 ? -21.808 -35.238 122.497 1.00 20.00 ? 421 VAL A CG1   1 
ATOM 3016 C CG2   . VAL A 1 421 ? -22.811 -36.592 120.747 1.00 20.00 ? 421 VAL A CG2   1 
ATOM 3017 N N     . PRO A 1 422 ? -21.466 -37.766 124.789 1.00 12.00 ? 422 PRO A N     1 
ATOM 3018 C CA    . PRO A 1 422 ? -20.966 -37.778 126.142 1.00 12.00 ? 422 PRO A CA    1 
ATOM 3019 C C     . PRO A 1 422 ? -19.997 -38.909 126.229 1.00 12.00 ? 422 PRO A C     1 
ATOM 3020 O O     . PRO A 1 422 ? -20.311 -39.930 126.907 1.00 12.00 ? 422 PRO A O     1 
ATOM 3021 C CB    . PRO A 1 422 ? -22.202 -37.951 126.981 1.00 12.00 ? 422 PRO A CB    1 
ATOM 3022 C CG    . PRO A 1 422 ? -23.391 -38.024 126.043 1.00 12.00 ? 422 PRO A CG    1 
ATOM 3023 C CD    . PRO A 1 422 ? -22.908 -37.895 124.637 1.00 12.00 ? 422 PRO A CD    1 
ATOM 3024 N N     . PRO A 1 423 ? -18.839 -38.777 125.576 1.00 12.00 ? 423 PRO A N     1 
ATOM 3025 C CA    . PRO A 1 423 ? -17.868 -39.851 125.481 1.00 12.00 ? 423 PRO A CA    1 
ATOM 3026 C C     . PRO A 1 423 ? -17.355 -40.314 126.810 1.00 12.00 ? 423 PRO A C     1 
ATOM 3027 O O     . PRO A 1 423 ? -16.764 -39.485 127.566 1.00 12.00 ? 423 PRO A O     1 
ATOM 3028 C CB    . PRO A 1 423 ? -16.742 -39.261 124.675 1.00 12.00 ? 423 PRO A CB    1 
ATOM 3029 C CG    . PRO A 1 423 ? -17.117 -37.836 124.325 1.00 20.00 ? 423 PRO A CG    1 
ATOM 3030 C CD    . PRO A 1 423 ? -18.456 -37.535 124.907 1.00 20.00 ? 423 PRO A CD    1 
ATOM 3031 N N     . PRO A 1 424 ? -17.526 -41.601 127.173 1.00 12.00 ? 424 PRO A N     1 
ATOM 3032 C CA    . PRO A 1 424 ? -16.951 -42.106 128.396 1.00 12.00 ? 424 PRO A CA    1 
ATOM 3033 C C     . PRO A 1 424 ? -15.476 -41.868 128.311 1.00 12.00 ? 424 PRO A C     1 
ATOM 3034 O O     . PRO A 1 424 ? -15.026 -41.120 127.394 1.00 12.00 ? 424 PRO A O     1 
ATOM 3035 C CB    . PRO A 1 424 ? -17.364 -43.554 128.422 1.00 12.00 ? 424 PRO A CB    1 
ATOM 3036 C CG    . PRO A 1 424 ? -18.189 -43.816 127.171 1.00 20.00 ? 424 PRO A CG    1 
ATOM 3037 C CD    . PRO A 1 424 ? -18.291 -42.551 126.380 1.00 20.00 ? 424 PRO A CD    1 
ATOM 3038 N N     . LEU A 1 425 ? -14.740 -42.466 129.213 1.00 12.00 ? 425 LEU A N     1 
ATOM 3039 C CA    . LEU A 1 425 ? -13.284 -42.291 129.254 1.00 12.00 ? 425 LEU A CA    1 
ATOM 3040 C C     . LEU A 1 425 ? -12.591 -43.374 128.431 1.00 12.00 ? 425 LEU A C     1 
ATOM 3041 O O     . LEU A 1 425 ? -11.698 -43.088 127.626 1.00 12.00 ? 425 LEU A O     1 
ATOM 3042 C CB    . LEU A 1 425 ? -12.795 -42.343 130.692 1.00 12.00 ? 425 LEU A CB    1 
ATOM 3043 C CG    . LEU A 1 425 ? -13.042 -41.037 131.439 1.00 12.00 ? 425 LEU A CG    1 
ATOM 3044 C CD1   . LEU A 1 425 ? -12.072 -40.815 132.592 1.00 20.00 ? 425 LEU A CD1   1 
ATOM 3045 C CD2   . LEU A 1 425 ? -12.911 -39.806 130.546 1.00 20.00 ? 425 LEU A CD2   1 
ATOM 3046 N N     . ASN A 1 426 ? -13.021 -44.592 128.658 1.00 12.00 ? 426 ASN A N     1 
ATOM 3047 C CA    . ASN A 1 426 ? -12.477 -45.764 127.967 1.00 12.00 ? 426 ASN A CA    1 
ATOM 3048 C C     . ASN A 1 426 ? -12.922 -45.768 126.510 1.00 12.00 ? 426 ASN A C     1 
ATOM 3049 O O     . ASN A 1 426 ? -12.743 -46.757 125.792 1.00 12.00 ? 426 ASN A O     1 
ATOM 3050 C CB    . ASN A 1 426 ? -12.974 -47.042 128.631 1.00 12.00 ? 426 ASN A CB    1 
ATOM 3051 C CG    . ASN A 1 426 ? -12.308 -47.315 129.974 1.00 12.00 ? 426 ASN A CG    1 
ATOM 3052 O OD1   . ASN A 1 426 ? -11.095 -47.478 130.034 1.00 12.00 ? 426 ASN A OD1   1 
ATOM 3053 N ND2   . ASN A 1 426 ? -13.036 -47.378 131.067 1.00 20.00 ? 426 ASN A ND2   1 
ATOM 3054 N N     . GLY A 1 427 ? -13.492 -44.651 126.112 1.00 12.00 ? 427 GLY A N     1 
ATOM 3055 C CA    . GLY A 1 427 ? -13.999 -44.467 124.751 1.00 12.00 ? 427 GLY A CA    1 
ATOM 3056 C C     . GLY A 1 427 ? -13.449 -43.182 124.138 1.00 12.00 ? 427 GLY A C     1 
ATOM 3057 O O     . GLY A 1 427 ? -14.083 -42.567 123.274 1.00 12.00 ? 427 GLY A O     1 
ATOM 3058 N N     . ILE A 1 428 ? -12.274 -42.807 124.599 1.00 12.00 ? 428 ILE A N     1 
ATOM 3059 C CA    . ILE A 1 428 ? -11.597 -41.600 124.117 1.00 12.00 ? 428 ILE A CA    1 
ATOM 3060 C C     . ILE A 1 428 ? -10.091 -41.696 124.323 1.00 12.00 ? 428 ILE A C     1 
ATOM 3061 O O     . ILE A 1 428 ? -9.603  -42.555 125.065 1.00 12.00 ? 428 ILE A O     1 
ATOM 3062 C CB    . ILE A 1 428 ? -12.101 -40.371 124.865 1.00 12.00 ? 428 ILE A CB    1 
ATOM 3063 C CG1   . ILE A 1 428 ? -13.389 -39.803 124.282 1.00 12.00 ? 428 ILE A CG1   1 
ATOM 3064 C CG2   . ILE A 1 428 ? -11.100 -39.218 124.854 1.00 12.00 ? 428 ILE A CG2   1 
ATOM 3065 C CD1   . ILE A 1 428 ? -13.680 -38.382 124.751 1.00 20.00 ? 428 ILE A CD1   1 
ATOM 3066 N N     . LEU A 1 429 ? -9.426  -40.788 123.642 1.00 12.00 ? 429 LEU A N     1 
ATOM 3067 C CA    . LEU A 1 429 ? -7.969  -40.647 123.664 1.00 12.00 ? 429 LEU A CA    1 
ATOM 3068 C C     . LEU A 1 429 ? -7.615  -39.174 123.485 1.00 12.00 ? 429 LEU A C     1 
ATOM 3069 O O     . LEU A 1 429 ? -7.543  -38.668 122.360 1.00 12.00 ? 429 LEU A O     1 
ATOM 3070 C CB    . LEU A 1 429 ? -7.358  -41.461 122.528 1.00 12.00 ? 429 LEU A CB    1 
ATOM 3071 C CG    . LEU A 1 429 ? -5.837  -41.547 122.601 1.00 12.00 ? 429 LEU A CG    1 
ATOM 3072 C CD1   . LEU A 1 429 ? -5.328  -41.927 123.986 1.00 12.00 ? 429 LEU A CD1   1 
ATOM 3073 C CD2   . LEU A 1 429 ? -5.252  -42.582 121.647 1.00 12.00 ? 429 LEU A CD2   1 
ATOM 3074 N N     . THR A 1 430 ? -7.406  -38.527 124.613 1.00 12.00 ? 430 THR A N     1 
ATOM 3075 C CA    . THR A 1 430 ? -7.085  -37.097 124.661 1.00 12.00 ? 430 THR A CA    1 
ATOM 3076 C C     . THR A 1 430 ? -5.570  -36.883 124.633 1.00 12.00 ? 430 THR A C     1 
ATOM 3077 O O     . THR A 1 430 ? -4.799  -37.814 124.380 1.00 12.00 ? 430 THR A O     1 
ATOM 3078 C CB    . THR A 1 430 ? -7.672  -36.472 125.921 1.00 12.00 ? 430 THR A CB    1 
ATOM 3079 O OG1   . THR A 1 430 ? -7.134  -37.098 127.068 1.00 20.00 ? 430 THR A OG1   1 
ATOM 3080 C CG2   . THR A 1 430 ? -9.190  -36.607 125.995 1.00 20.00 ? 430 THR A CG2   1 
ATOM 3081 N N     . ASN A 1 431 ? -5.203  -35.646 124.905 1.00 12.00 ? 431 ASN A N     1 
ATOM 3082 C CA    . ASN A 1 431 ? -3.810  -35.181 124.871 1.00 12.00 ? 431 ASN A CA    1 
ATOM 3083 C C     . ASN A 1 431 ? -3.008  -35.621 126.101 1.00 12.00 ? 431 ASN A C     1 
ATOM 3084 O O     . ASN A 1 431 ? -1.776  -35.554 126.114 1.00 12.00 ? 431 ASN A O     1 
ATOM 3085 C CB    . ASN A 1 431 ? -3.776  -33.654 124.831 1.00 12.00 ? 431 ASN A CB    1 
ATOM 3086 C CG    . ASN A 1 431 ? -2.365  -33.082 124.904 1.00 12.00 ? 431 ASN A CG    1 
ATOM 3087 O OD1   . ASN A 1 431 ? -2.181  -31.880 124.757 1.00 20.00 ? 431 ASN A OD1   1 
ATOM 3088 N ND2   . ASN A 1 431 ? -1.342  -33.881 125.125 1.00 20.00 ? 431 ASN A ND2   1 
ATOM 3089 N N     . ALA A 1 432 ? -3.707  -36.074 127.118 1.00 12.00 ? 432 ALA A N     1 
ATOM 3090 C CA    . ALA A 1 432 ? -3.066  -36.472 128.382 1.00 12.00 ? 432 ALA A CA    1 
ATOM 3091 C C     . ALA A 1 432 ? -2.889  -37.992 128.492 1.00 12.00 ? 432 ALA A C     1 
ATOM 3092 O O     . ALA A 1 432 ? -2.153  -38.484 129.354 1.00 12.00 ? 432 ALA A O     1 
ATOM 3093 C CB    . ALA A 1 432 ? -3.913  -36.019 129.566 1.00 12.00 ? 432 ALA A CB    1 
ATOM 3094 N N     . ASN A 1 433 ? -3.559  -38.712 127.620 1.00 12.00 ? 433 ASN A N     1 
ATOM 3095 C CA    . ASN A 1 433 ? -3.543  -40.188 127.632 1.00 12.00 ? 433 ASN A CA    1 
ATOM 3096 C C     . ASN A 1 433 ? -2.204  -40.690 127.127 1.00 12.00 ? 433 ASN A C     1 
ATOM 3097 O O     . ASN A 1 433 ? -1.865  -40.520 125.950 1.00 12.00 ? 433 ASN A O     1 
ATOM 3098 C CB    . ASN A 1 433 ? -4.750  -40.721 126.877 1.00 12.00 ? 433 ASN A CB    1 
ATOM 3099 C CG    . ASN A 1 433 ? -6.039  -40.643 127.686 1.00 12.00 ? 433 ASN A CG    1 
ATOM 3100 O OD1   . ASN A 1 433 ? -6.024  -40.882 128.888 1.00 12.00 ? 433 ASN A OD1   1 
ATOM 3101 N ND2   . ASN A 1 433 ? -7.168  -40.320 127.093 1.00 20.00 ? 433 ASN A ND2   1 
ATOM 3102 N N     . PRO A 1 434 ? -1.433  -41.317 128.024 1.00 12.00 ? 434 PRO A N     1 
ATOM 3103 C CA    . PRO A 1 434 ? -0.109  -41.806 127.708 1.00 12.00 ? 434 PRO A CA    1 
ATOM 3104 C C     . PRO A 1 434 ? -0.149  -42.795 126.585 1.00 12.00 ? 434 PRO A C     1 
ATOM 3105 O O     . PRO A 1 434 ? -1.247  -43.362 126.307 1.00 12.00 ? 434 PRO A O     1 
ATOM 3106 C CB    . PRO A 1 434 ? 0.366   -42.438 128.991 1.00 12.00 ? 434 PRO A CB    1 
ATOM 3107 C CG    . PRO A 1 434 ? -0.730  -42.276 130.022 1.00 12.00 ? 434 PRO A CG    1 
ATOM 3108 C CD    . PRO A 1 434 ? -1.874  -41.557 129.395 1.00 12.00 ? 434 PRO A CD    1 
ATOM 3109 N N     . ILE A 1 435 ? 1.017   -42.962 125.994 1.00 12.00 ? 435 ILE A N     1 
ATOM 3110 C CA    . ILE A 1 435 ? 1.236   -43.882 124.872 1.00 12.00 ? 435 ILE A CA    1 
ATOM 3111 C C     . ILE A 1 435 ? 2.681   -44.370 124.874 1.00 12.00 ? 435 ILE A C     1 
ATOM 3112 O O     . ILE A 1 435 ? 3.622   -43.576 124.768 1.00 12.00 ? 435 ILE A O     1 
ATOM 3113 C CB    . ILE A 1 435 ? 0.963   -43.173 123.550 1.00 12.00 ? 435 ILE A CB    1 
ATOM 3114 C CG1   . ILE A 1 435 ? -0.427  -42.551 123.481 1.00 12.00 ? 435 ILE A CG1   1 
ATOM 3115 C CG2   . ILE A 1 435 ? 1.060   -44.103 122.345 1.00 12.00 ? 435 ILE A CG2   1 
ATOM 3116 C CD1   . ILE A 1 435 ? -1.540  -43.550 123.774 1.00 12.00 ? 435 ILE A CD1   1 
ATOM 3117 N N     . GLY A 1 436 ? 2.810   -45.674 124.998 1.00 12.00 ? 436 GLY A N     1 
ATOM 3118 C CA    . GLY A 1 436 ? 4.110   -46.350 125.021 1.00 12.00 ? 436 GLY A CA    1 
ATOM 3119 C C     . GLY A 1 436 ? 4.540   -46.607 126.462 1.00 12.00 ? 436 GLY A C     1 
ATOM 3120 O O     . GLY A 1 436 ? 5.534   -47.295 126.717 1.00 12.00 ? 436 GLY A O     1 
ATOM 3121 N N     . THR A 1 437 ? 3.765   -46.039 127.359 1.00 12.00 ? 437 THR A N     1 
ATOM 3122 C CA    . THR A 1 437 ? 3.993   -46.156 128.800 1.00 12.00 ? 437 THR A CA    1 
ATOM 3123 C C     . THR A 1 437 ? 4.737   -44.926 129.312 1.00 12.00 ? 437 THR A C     1 
ATOM 3124 O O     . THR A 1 437 ? 5.084   -44.838 130.494 1.00 12.00 ? 437 THR A O     1 
ATOM 3125 C CB    . THR A 1 437 ? 4.814   -47.404 129.101 1.00 20.00 ? 437 THR A CB    1 
ATOM 3126 O OG1   . THR A 1 437 ? 6.062   -47.334 128.440 1.00 20.00 ? 437 THR A OG1   1 
ATOM 3127 C CG2   . THR A 1 437 ? 4.129   -48.690 128.648 1.00 20.00 ? 437 THR A CG2   1 
ATOM 3128 N N     . LYS A 1 438 ? 4.959   -44.013 128.389 1.00 12.00 ? 438 LYS A N     1 
ATOM 3129 C CA    . LYS A 1 438 ? 5.637   -42.744 128.668 1.00 12.00 ? 438 LYS A CA    1 
ATOM 3130 C C     . LYS A 1 438 ? 4.589   -41.673 128.956 1.00 12.00 ? 438 LYS A C     1 
ATOM 3131 O O     . LYS A 1 438 ? 3.628   -41.504 128.198 1.00 12.00 ? 438 LYS A O     1 
ATOM 3132 C CB    . LYS A 1 438 ? 6.493   -42.337 127.474 1.00 12.00 ? 438 LYS A CB    1 
ATOM 3133 C CG    . LYS A 1 438 ? 7.622   -43.325 127.186 1.00 12.00 ? 438 LYS A CG    1 
ATOM 3134 C CD    . LYS A 1 438 ? 8.952   -42.916 127.814 1.00 12.00 ? 438 LYS A CD    1 
ATOM 3135 C CE    . LYS A 1 438 ? 10.000  -44.024 127.766 1.00 12.00 ? 438 LYS A CE    1 
ATOM 3136 N NZ    . LYS A 1 438 ? 11.365  -43.515 127.616 1.00 12.00 ? 438 LYS A NZ    1 
ATOM 3137 N N     . ASN A 1 439 ? 4.818   -40.986 130.052 1.00 12.00 ? 439 ASN A N     1 
ATOM 3138 C CA    . ASN A 1 439 ? 3.919   -39.945 130.559 1.00 12.00 ? 439 ASN A CA    1 
ATOM 3139 C C     . ASN A 1 439 ? 3.724   -38.809 129.551 1.00 12.00 ? 439 ASN A C     1 
ATOM 3140 O O     . ASN A 1 439 ? 2.708   -38.747 128.850 1.00 12.00 ? 439 ASN A O     1 
ATOM 3141 C CB    . ASN A 1 439 ? 4.485   -39.355 131.845 1.00 12.00 ? 439 ASN A CB    1 
ATOM 3142 C CG    . ASN A 1 439 ? 4.575   -40.376 132.974 1.00 20.00 ? 439 ASN A CG    1 
ATOM 3143 O OD1   . ASN A 1 439 ? 3.551   -40.850 133.456 1.00 20.00 ? 439 ASN A OD1   1 
ATOM 3144 N ND2   . ASN A 1 439 ? 5.750   -40.752 133.431 1.00 20.00 ? 439 ASN A ND2   1 
ATOM 3145 N N     . ASP A 1 440 ? 4.708   -37.935 129.510 1.00 12.00 ? 440 ASP A N     1 
ATOM 3146 C CA    . ASP A 1 440 ? 4.680   -36.733 128.662 1.00 12.00 ? 440 ASP A CA    1 
ATOM 3147 C C     . ASP A 1 440 ? 4.774   -37.073 127.171 1.00 12.00 ? 440 ASP A C     1 
ATOM 3148 O O     . ASP A 1 440 ? 4.955   -36.189 126.327 1.00 12.00 ? 440 ASP A O     1 
ATOM 3149 C CB    . ASP A 1 440 ? 5.830   -35.807 129.029 1.00 20.00 ? 440 ASP A CB    1 
ATOM 3150 C CG    . ASP A 1 440 ? 5.432   -34.768 130.072 1.00 20.00 ? 440 ASP A CG    1 
ATOM 3151 O OD1   . ASP A 1 440 ? 4.410   -34.107 129.918 1.00 20.00 ? 440 ASP A OD1   1 
ATOM 3152 O OD2   . ASP A 1 440 ? 6.180   -34.585 131.137 1.00 20.00 ? 440 ASP A OD2   1 
ATOM 3153 N N     . ILE A 1 441 ? 4.648   -38.347 126.874 1.00 12.00 ? 441 ILE A N     1 
ATOM 3154 C CA    . ILE A 1 441 ? 4.664   -38.839 125.489 1.00 12.00 ? 441 ILE A CA    1 
ATOM 3155 C C     . ILE A 1 441 ? 3.232   -39.176 125.082 1.00 12.00 ? 441 ILE A C     1 
ATOM 3156 O O     . ILE A 1 441 ? 2.665   -40.179 125.523 1.00 12.00 ? 441 ILE A O     1 
ATOM 3157 C CB    . ILE A 1 441 ? 5.546   -40.078 125.381 1.00 12.00 ? 441 ILE A CB    1 
ATOM 3158 C CG1   . ILE A 1 441 ? 7.029   -39.746 125.235 1.00 12.00 ? 441 ILE A CG1   1 
ATOM 3159 C CG2   . ILE A 1 441 ? 5.201   -40.951 124.179 1.00 12.00 ? 441 ILE A CG2   1 
ATOM 3160 C CD1   . ILE A 1 441 ? 7.280   -38.491 124.406 1.00 12.00 ? 441 ILE A CD1   1 
ATOM 3161 N N     . HIS A 1 442 ? 2.681   -38.317 124.247 1.00 12.00 ? 442 HIS A N     1 
ATOM 3162 C CA    . HIS A 1 442 ? 1.287   -38.434 123.796 1.00 12.00 ? 442 HIS A CA    1 
ATOM 3163 C C     . HIS A 1 442 ? 1.193   -39.060 122.404 1.00 12.00 ? 442 HIS A C     1 
ATOM 3164 O O     . HIS A 1 442 ? 2.195   -39.507 121.838 1.00 12.00 ? 442 HIS A O     1 
ATOM 3165 C CB    . HIS A 1 442 ? 0.640   -37.060 123.791 1.00 12.00 ? 442 HIS A CB    1 
ATOM 3166 C CG    . HIS A 1 442 ? 0.333   -36.574 125.201 1.00 12.00 ? 442 HIS A CG    1 
ATOM 3167 N ND1   . HIS A 1 442 ? 1.275   -35.908 125.971 1.00 20.00 ? 442 HIS A ND1   1 
ATOM 3168 C CD2   . HIS A 1 442 ? -0.783  -36.663 125.963 1.00 20.00 ? 442 HIS A CD2   1 
ATOM 3169 C CE1   . HIS A 1 442 ? 0.727   -35.623 127.133 1.00 20.00 ? 442 HIS A CE1   1 
ATOM 3170 N NE2   . HIS A 1 442 ? -0.500  -36.066 127.143 1.00 20.00 ? 442 HIS A NE2   1 
ATOM 3171 N N     . PHE A 1 443 ? -0.037  -39.062 121.910 1.00 12.00 ? 443 PHE A N     1 
ATOM 3172 C CA    . PHE A 1 443 ? -0.393  -39.665 120.617 1.00 12.00 ? 443 PHE A CA    1 
ATOM 3173 C C     . PHE A 1 443 ? -0.332  -38.642 119.480 1.00 12.00 ? 443 PHE A C     1 
ATOM 3174 O O     . PHE A 1 443 ? -0.289  -39.004 118.299 1.00 12.00 ? 443 PHE A O     1 
ATOM 3175 C CB    . PHE A 1 443 ? -1.800  -40.264 120.689 1.00 12.00 ? 443 PHE A CB    1 
ATOM 3176 C CG    . PHE A 1 443 ? -2.926  -39.279 120.362 1.00 12.00 ? 443 PHE A CG    1 
ATOM 3177 C CD1   . PHE A 1 443 ? -3.486  -38.489 121.369 1.00 12.00 ? 443 PHE A CD1   1 
ATOM 3178 C CD2   . PHE A 1 443 ? -3.408  -39.178 119.055 1.00 12.00 ? 443 PHE A CD2   1 
ATOM 3179 C CE1   . PHE A 1 443 ? -4.522  -37.602 121.071 1.00 12.00 ? 443 PHE A CE1   1 
ATOM 3180 C CE2   . PHE A 1 443 ? -4.443  -38.290 118.757 1.00 12.00 ? 443 PHE A CE2   1 
ATOM 3181 C CZ    . PHE A 1 443 ? -5.000  -37.503 119.766 1.00 12.00 ? 443 PHE A CZ    1 
ATOM 3182 N N     . SER A 1 444 ? -0.329  -37.383 119.851 1.00 12.00 ? 444 SER A N     1 
ATOM 3183 C CA    . SER A 1 444 ? -0.253  -36.286 118.880 1.00 12.00 ? 444 SER A CA    1 
ATOM 3184 C C     . SER A 1 444 ? 1.155   -36.219 118.302 1.00 12.00 ? 444 SER A C     1 
ATOM 3185 O O     . SER A 1 444 ? 1.388   -35.594 117.262 1.00 12.00 ? 444 SER A O     1 
ATOM 3186 C CB    . SER A 1 444 ? -0.575  -34.961 119.558 1.00 12.00 ? 444 SER A CB    1 
ATOM 3187 O OG    . SER A 1 444 ? -1.939  -34.924 119.929 1.00 20.00 ? 444 SER A OG    1 
ATOM 3188 N N     . ASN A 1 445 ? 2.040   -36.881 119.014 1.00 12.00 ? 445 ASN A N     1 
ATOM 3189 C CA    . ASN A 1 445 ? 3.460   -36.949 118.675 1.00 12.00 ? 445 ASN A CA    1 
ATOM 3190 C C     . ASN A 1 445 ? 3.710   -37.983 117.579 1.00 12.00 ? 445 ASN A C     1 
ATOM 3191 O O     . ASN A 1 445 ? 4.786   -38.022 116.974 1.00 12.00 ? 445 ASN A O     1 
ATOM 3192 C CB    . ASN A 1 445 ? 4.271   -37.353 119.904 1.00 12.00 ? 445 ASN A CB    1 
ATOM 3193 C CG    . ASN A 1 445 ? 4.330   -36.265 120.972 1.00 12.00 ? 445 ASN A CG    1 
ATOM 3194 O OD1   . ASN A 1 445 ? 3.335   -36.000 121.636 1.00 12.00 ? 445 ASN A OD1   1 
ATOM 3195 N ND2   . ASN A 1 445 ? 5.453   -35.612 121.184 1.00 12.00 ? 445 ASN A ND2   1 
ATOM 3196 N N     . VAL A 1 446 ? 2.704   -38.804 117.339 1.00 12.00 ? 446 VAL A N     1 
ATOM 3197 C CA    . VAL A 1 446 ? 2.793   -39.874 116.336 1.00 12.00 ? 446 VAL A CA    1 
ATOM 3198 C C     . VAL A 1 446 ? 1.755   -39.698 115.226 1.00 12.00 ? 446 VAL A C     1 
ATOM 3199 O O     . VAL A 1 446 ? 1.975   -40.102 114.079 1.00 12.00 ? 446 VAL A O     1 
ATOM 3200 C CB    . VAL A 1 446 ? 2.564   -41.235 116.984 1.00 12.00 ? 446 VAL A CB    1 
ATOM 3201 C CG1   . VAL A 1 446 ? 3.467   -41.483 118.186 1.00 12.00 ? 446 VAL A CG1   1 
ATOM 3202 C CG2   . VAL A 1 446 ? 1.139   -41.425 117.489 1.00 12.00 ? 446 VAL A CG2   1 
ATOM 3203 N N     . PHE A 1 447 ? 0.635   -39.101 115.580 1.00 12.00 ? 447 PHE A N     1 
ATOM 3204 C CA    . PHE A 1 447 ? -0.462  -38.882 114.626 1.00 12.00 ? 447 PHE A CA    1 
ATOM 3205 C C     . PHE A 1 447 ? 0.092   -38.383 113.294 1.00 12.00 ? 447 PHE A C     1 
ATOM 3206 O O     . PHE A 1 447 ? 1.197   -37.834 113.230 1.00 12.00 ? 447 PHE A O     1 
ATOM 3207 C CB    . PHE A 1 447 ? -1.460  -37.862 115.162 1.00 12.00 ? 447 PHE A CB    1 
ATOM 3208 C CG    . PHE A 1 447 ? -2.881  -38.131 114.673 1.00 12.00 ? 447 PHE A CG    1 
ATOM 3209 C CD1   . PHE A 1 447 ? -3.256  -39.425 114.305 1.00 12.00 ? 447 PHE A CD1   1 
ATOM 3210 C CD2   . PHE A 1 447 ? -3.806  -37.090 114.589 1.00 12.00 ? 447 PHE A CD2   1 
ATOM 3211 C CE1   . PHE A 1 447 ? -4.553  -39.676 113.856 1.00 12.00 ? 447 PHE A CE1   1 
ATOM 3212 C CE2   . PHE A 1 447 ? -5.104  -37.342 114.141 1.00 12.00 ? 447 PHE A CE2   1 
ATOM 3213 C CZ    . PHE A 1 447 ? -5.476  -38.635 113.773 1.00 12.00 ? 447 PHE A CZ    1 
ATOM 3214 N N     . ASN A 1 448 ? -0.714  -38.601 112.276 1.00 12.00 ? 448 ASN A N     1 
ATOM 3215 C CA    . ASN A 1 448 ? -0.405  -38.207 110.898 1.00 12.00 ? 448 ASN A CA    1 
ATOM 3216 C C     . ASN A 1 448 ? -1.671  -38.277 110.049 1.00 12.00 ? 448 ASN A C     1 
ATOM 3217 O O     . ASN A 1 448 ? -2.047  -39.345 109.552 1.00 12.00 ? 448 ASN A O     1 
ATOM 3218 C CB    . ASN A 1 448 ? 0.643   -39.145 110.308 1.00 12.00 ? 448 ASN A CB    1 
ATOM 3219 C CG    . ASN A 1 448 ? 0.878   -38.915 108.818 1.00 12.00 ? 448 ASN A CG    1 
ATOM 3220 O OD1   . ASN A 1 448 ? 1.640   -39.647 108.197 1.00 12.00 ? 448 ASN A OD1   1 
ATOM 3221 N ND2   . ASN A 1 448 ? 0.263   -37.930 108.200 1.00 12.00 ? 448 ASN A ND2   1 
ATOM 3222 N N     . SER A 1 449 ? -2.291  -37.124 109.910 1.00 12.00 ? 449 SER A N     1 
ATOM 3223 C CA    . SER A 1 449 ? -3.533  -36.973 109.148 1.00 12.00 ? 449 SER A CA    1 
ATOM 3224 C C     . SER A 1 449 ? -3.275  -36.221 107.844 1.00 12.00 ? 449 SER A C     1 
ATOM 3225 O O     . SER A 1 449 ? -3.504  -35.011 107.754 1.00 12.00 ? 449 SER A O     1 
ATOM 3226 C CB    . SER A 1 449 ? -4.558  -36.195 109.966 1.00 12.00 ? 449 SER A CB    1 
ATOM 3227 O OG    . SER A 1 449 ? -5.803  -36.180 109.295 1.00 20.00 ? 449 SER A OG    1 
ATOM 3228 N N     . TYR A 1 450 ? -2.806  -36.977 106.877 1.00 12.00 ? 450 TYR A N     1 
ATOM 3229 C CA    . TYR A 1 450 ? -2.502  -36.472 105.535 1.00 12.00 ? 450 TYR A CA    1 
ATOM 3230 C C     . TYR A 1 450 ? -3.255  -37.306 104.502 1.00 12.00 ? 450 TYR A C     1 
ATOM 3231 O O     . TYR A 1 450 ? -2.649  -38.017 103.694 1.00 12.00 ? 450 TYR A O     1 
ATOM 3232 C CB    . TYR A 1 450 ? -1.001  -36.567 105.274 1.00 12.00 ? 450 TYR A CB    1 
ATOM 3233 C CG    . TYR A 1 450 ? -0.575  -35.914 103.961 1.00 12.00 ? 450 TYR A CG    1 
ATOM 3234 C CD1   . TYR A 1 450 ? -0.992  -34.618 103.656 1.00 12.00 ? 450 TYR A CD1   1 
ATOM 3235 C CD2   . TYR A 1 450 ? 0.234   -36.614 103.066 1.00 12.00 ? 450 TYR A CD2   1 
ATOM 3236 C CE1   . TYR A 1 450 ? -0.602  -34.023 102.456 1.00 12.00 ? 450 TYR A CE1   1 
ATOM 3237 C CE2   . TYR A 1 450 ? 0.624   -36.019 101.866 1.00 12.00 ? 450 TYR A CE2   1 
ATOM 3238 C CZ    . TYR A 1 450 ? 0.206   -34.724 101.561 1.00 12.00 ? 450 TYR A CZ    1 
ATOM 3239 O OH    . TYR A 1 450 ? 0.584   -34.147 100.394 1.00 12.00 ? 450 TYR A OH    1 
ATOM 3240 N N     . GLY A 1 451 ? -4.566  -37.185 104.577 1.00 12.00 ? 451 GLY A N     1 
ATOM 3241 C CA    . GLY A 1 451 ? -5.495  -37.913 103.708 1.00 12.00 ? 451 GLY A CA    1 
ATOM 3242 C C     . GLY A 1 451 ? -5.621  -37.230 102.350 1.00 12.00 ? 451 GLY A C     1 
ATOM 3243 O O     . GLY A 1 451 ? -5.301  -36.044 102.201 1.00 12.00 ? 451 GLY A O     1 
ATOM 3244 N N     . PRO A 1 452 ? -6.087  -37.946 101.319 1.00 12.00 ? 452 PRO A N     1 
ATOM 3245 C CA    . PRO A 1 452 ? -6.236  -37.376 99.997  1.00 12.00 ? 452 PRO A CA    1 
ATOM 3246 C C     . PRO A 1 452 ? -7.185  -36.209 100.017 1.00 12.00 ? 452 PRO A C     1 
ATOM 3247 O O     . PRO A 1 452 ? -7.586  -35.723 98.917  1.00 12.00 ? 452 PRO A O     1 
ATOM 3248 C CB    . PRO A 1 452 ? -6.772  -38.512 99.168  1.00 12.00 ? 452 PRO A CB    1 
ATOM 3249 C CG    . PRO A 1 452 ? -6.912  -39.720 100.070 1.00 12.00 ? 452 PRO A CG    1 
ATOM 3250 C CD    . PRO A 1 452 ? -6.474  -39.346 101.445 1.00 12.00 ? 452 PRO A CD    1 
ATOM 3251 N N     . LEU A 1 453 ? -7.520  -35.788 101.219 1.00 12.00 ? 453 LEU A N     1 
ATOM 3252 C CA    . LEU A 1 453 ? -8.439  -34.662 101.445 1.00 12.00 ? 453 LEU A CA    1 
ATOM 3253 C C     . LEU A 1 453 ? -7.747  -33.560 102.238 1.00 12.00 ? 453 LEU A C     1 
ATOM 3254 O O     . LEU A 1 453 ? -8.350  -32.928 103.111 1.00 12.00 ? 453 LEU A O     1 
ATOM 3255 C CB    . LEU A 1 453 ? -9.647  -35.115 102.261 1.00 12.00 ? 453 LEU A CB    1 
ATOM 3256 C CG    . LEU A 1 453 ? -10.461 -36.208 101.583 1.00 12.00 ? 453 LEU A CG    1 
ATOM 3257 C CD1   . LEU A 1 453 ? -11.654 -36.664 102.417 1.00 12.00 ? 453 LEU A CD1   1 
ATOM 3258 C CD2   . LEU A 1 453 ? -11.036 -35.776 100.240 1.00 12.00 ? 453 LEU A CD2   1 
ATOM 3259 N N     . THR A 1 454 ? -6.493  -33.349 101.910 1.00 12.00 ? 454 THR A N     1 
ATOM 3260 C CA    . THR A 1 454 ? -5.670  -32.358 102.600 1.00 12.00 ? 454 THR A CA    1 
ATOM 3261 C C     . THR A 1 454 ? -5.199  -31.260 101.664 1.00 12.00 ? 454 THR A C     1 
ATOM 3262 O O     . THR A 1 454 ? -4.888  -31.512 100.494 1.00 12.00 ? 454 THR A O     1 
ATOM 3263 C CB    . THR A 1 454 ? -4.445  -33.022 103.214 1.00 12.00 ? 454 THR A CB    1 
ATOM 3264 O OG1   . THR A 1 454 ? -4.844  -34.071 104.076 1.00 12.00 ? 454 THR A OG1   1 
ATOM 3265 C CG2   . THR A 1 454 ? -3.593  -32.058 104.033 1.00 12.00 ? 454 THR A CG2   1 
ATOM 3266 N N     . THR A 1 455 ? -5.173  -30.088 102.252 1.00 12.00 ? 455 THR A N     1 
ATOM 3267 C CA    . THR A 1 455 ? -4.739  -28.855 101.608 1.00 12.00 ? 455 THR A CA    1 
ATOM 3268 C C     . THR A 1 455 ? -3.870  -28.078 102.589 1.00 12.00 ? 455 THR A C     1 
ATOM 3269 O O     . THR A 1 455 ? -3.711  -28.475 103.748 1.00 12.00 ? 455 THR A O     1 
ATOM 3270 C CB    . THR A 1 455 ? -5.953  -28.013 101.226 1.00 12.00 ? 455 THR A CB    1 
ATOM 3271 O OG1   . THR A 1 455 ? -6.497  -27.397 102.378 1.00 20.00 ? 455 THR A OG1   1 
ATOM 3272 C CG2   . THR A 1 455 ? -7.066  -28.830 100.579 1.00 20.00 ? 455 THR A CG2   1 
ATOM 3273 N N     . PHE A 1 456 ? -3.326  -26.991 102.102 1.00 12.00 ? 456 PHE A N     1 
ATOM 3274 C CA    . PHE A 1 456 ? -2.469  -26.116 102.903 1.00 12.00 ? 456 PHE A CA    1 
ATOM 3275 C C     . PHE A 1 456 ? -1.697  -25.172 101.993 1.00 12.00 ? 456 PHE A C     1 
ATOM 3276 O O     . PHE A 1 456 ? -1.480  -25.463 100.813 1.00 12.00 ? 456 PHE A O     1 
ATOM 3277 C CB    . PHE A 1 456 ? -1.493  -26.949 103.729 1.00 12.00 ? 456 PHE A CB    1 
ATOM 3278 C CG    . PHE A 1 456 ? -0.691  -27.948 102.900 1.00 12.00 ? 456 PHE A CG    1 
ATOM 3279 C CD1   . PHE A 1 456 ? -1.211  -29.216 102.637 1.00 12.00 ? 456 PHE A CD1   1 
ATOM 3280 C CD2   . PHE A 1 456 ? 0.566   -27.595 102.409 1.00 12.00 ? 456 PHE A CD2   1 
ATOM 3281 C CE1   . PHE A 1 456 ? -0.474  -30.130 101.883 1.00 20.00 ? 456 PHE A CE1   1 
ATOM 3282 C CE2   . PHE A 1 456 ? 1.302   -28.509 101.656 1.00 20.00 ? 456 PHE A CE2   1 
ATOM 3283 C CZ    . PHE A 1 456 ? 0.782   -29.776 101.393 1.00 20.00 ? 456 PHE A CZ    1 
ATOM 3284 N N     . SER A 1 457 ? -1.308  -24.065 102.587 1.00 12.00 ? 457 SER A N     1 
ATOM 3285 C CA    . SER A 1 457 ? -0.575  -23.005 101.896 1.00 12.00 ? 457 SER A CA    1 
ATOM 3286 C C     . SER A 1 457 ? 0.921   -23.303 101.868 1.00 12.00 ? 457 SER A C     1 
ATOM 3287 O O     . SER A 1 457 ? 1.447   -23.998 102.745 1.00 12.00 ? 457 SER A O     1 
ATOM 3288 C CB    . SER A 1 457 ? -0.790  -21.671 102.601 1.00 12.00 ? 457 SER A CB    1 
ATOM 3289 O OG    . SER A 1 457 ? -1.121  -20.672 101.655 1.00 20.00 ? 457 SER A OG    1 
ATOM 3290 N N     . HIS A 1 458 ? 1.530   -22.748 100.843 1.00 12.00 ? 458 HIS A N     1 
ATOM 3291 C CA    . HIS A 1 458 ? 2.963   -22.868 100.566 1.00 12.00 ? 458 HIS A CA    1 
ATOM 3292 C C     . HIS A 1 458 ? 3.759   -22.037 101.568 1.00 12.00 ? 458 HIS A C     1 
ATOM 3293 O O     . HIS A 1 458 ? 3.336   -20.947 101.970 1.00 12.00 ? 458 HIS A O     1 
ATOM 3294 C CB    . HIS A 1 458 ? 3.232   -22.339 99.158  1.00 12.00 ? 458 HIS A CB    1 
ATOM 3295 C CG    . HIS A 1 458 ? 4.603   -22.708 98.608  1.00 12.00 ? 458 HIS A CG    1 
ATOM 3296 N ND1   . HIS A 1 458 ? 5.592   -21.755 98.408  1.00 20.00 ? 458 HIS A ND1   1 
ATOM 3297 C CD2   . HIS A 1 458 ? 5.135   -23.890 98.219  1.00 20.00 ? 458 HIS A CD2   1 
ATOM 3298 C CE1   . HIS A 1 458 ? 6.654   -22.362 97.923  1.00 20.00 ? 458 HIS A CE1   1 
ATOM 3299 N NE2   . HIS A 1 458 ? 6.398   -23.635 97.804  1.00 20.00 ? 458 HIS A NE2   1 
ATOM 3300 N N     . PRO A 1 459 ? 4.934   -22.489 102.024 1.00 12.00 ? 459 PRO A N     1 
ATOM 3301 C CA    . PRO A 1 459 ? 5.721   -21.711 102.956 1.00 12.00 ? 459 PRO A CA    1 
ATOM 3302 C C     . PRO A 1 459 ? 6.044   -20.381 102.336 1.00 12.00 ? 459 PRO A C     1 
ATOM 3303 O O     . PRO A 1 459 ? 6.752   -20.349 101.287 1.00 12.00 ? 459 PRO A O     1 
ATOM 3304 C CB    . PRO A 1 459 ? 6.940   -22.560 103.197 1.00 12.00 ? 459 PRO A CB    1 
ATOM 3305 C CG    . PRO A 1 459 ? 6.794   -23.827 102.377 1.00 20.00 ? 459 PRO A CG    1 
ATOM 3306 C CD    . PRO A 1 459 ? 5.502   -23.773 101.631 1.00 20.00 ? 459 PRO A CD    1 
ATOM 3307 N N     . SER A 1 460 ? 5.535   -19.342 102.974 1.00 12.00 ? 460 SER A N     1 
ATOM 3308 C CA    . SER A 1 460 ? 5.690   -17.950 102.515 1.00 12.00 ? 460 SER A CA    1 
ATOM 3309 C C     . SER A 1 460 ? 7.125   -17.455 102.690 1.00 12.00 ? 460 SER A C     1 
ATOM 3310 O O     . SER A 1 460 ? 7.873   -17.956 103.538 1.00 12.00 ? 460 SER A O     1 
ATOM 3311 C CB    . SER A 1 460 ? 4.776   -17.030 103.316 1.00 12.00 ? 460 SER A CB    1 
ATOM 3312 O OG    . SER A 1 460 ? 5.112   -17.087 104.689 1.00 20.00 ? 460 SER A OG    1 
ATOM 3313 N N     . PRO A 1 461 ? 7.560   -16.461 101.900 1.00 12.00 ? 461 PRO A N     1 
ATOM 3314 C CA    . PRO A 1 461 ? 8.902   -15.927 102.008 1.00 12.00 ? 461 PRO A CA    1 
ATOM 3315 C C     . PRO A 1 461 ? 9.132   -15.354 103.379 1.00 12.00 ? 461 PRO A C     1 
ATOM 3316 O O     . PRO A 1 461 ? 8.174   -15.333 104.206 1.00 12.00 ? 461 PRO A O     1 
ATOM 3317 C CB    . PRO A 1 461 ? 8.960   -14.861 100.946 1.00 12.00 ? 461 PRO A CB    1 
ATOM 3318 C CG    . PRO A 1 461 ? 7.612   -14.821 100.255 1.00 12.00 ? 461 PRO A CG    1 
ATOM 3319 C CD    . PRO A 1 461 ? 6.723   -15.847 100.872 1.00 12.00 ? 461 PRO A CD    1 
ATOM 3320 N N     . VAL A 1 462 ? 10.363  -14.921 103.582 1.00 12.00 ? 462 VAL A N     1 
ATOM 3321 C CA    . VAL A 1 462 ? 10.818  -14.303 104.837 1.00 12.00 ? 462 VAL A CA    1 
ATOM 3322 C C     . VAL A 1 462 ? 11.813  -13.193 104.513 1.00 12.00 ? 462 VAL A C     1 
ATOM 3323 O O     . VAL A 1 462 ? 13.023  -13.427 104.425 1.00 12.00 ? 462 VAL A O     1 
ATOM 3324 C CB    . VAL A 1 462 ? 11.502  -15.346 105.718 1.00 12.00 ? 462 VAL A CB    1 
ATOM 3325 C CG1   . VAL A 1 462 ? 11.750  -14.858 107.141 1.00 12.00 ? 462 VAL A CG1   1 
ATOM 3326 C CG2   . VAL A 1 462 ? 10.693  -16.630 105.858 1.00 12.00 ? 462 VAL A CG2   1 
ATOM 3327 N N     . TYR A 1 463 ? 11.267  -12.006 104.347 1.00 12.00 ? 463 TYR A N     1 
ATOM 3328 C CA    . TYR A 1 463 ? 12.049  -10.828 103.970 1.00 12.00 ? 463 TYR A CA    1 
ATOM 3329 C C     . TYR A 1 463 ? 13.535  -11.067 104.179 1.00 12.00 ? 463 TYR A C     1 
ATOM 3330 O O     . TYR A 1 463 ? 14.168  -11.820 103.430 1.00 12.00 ? 463 TYR A O     1 
ATOM 3331 C CB    . TYR A 1 463 ? 11.696  -9.603  104.789 1.00 12.00 ? 463 TYR A CB    1 
ATOM 3332 C CG    . TYR A 1 463 ? 12.528  -8.424  104.324 1.00 12.00 ? 463 TYR A CG    1 
ATOM 3333 C CD1   . TYR A 1 463 ? 13.218  -8.529  103.117 1.00 12.00 ? 463 TYR A CD1   1 
ATOM 3334 C CD2   . TYR A 1 463 ? 12.608  -7.259  105.085 1.00 12.00 ? 463 TYR A CD2   1 
ATOM 3335 C CE1   . TYR A 1 463 ? 13.992  -7.463  102.664 1.00 12.00 ? 463 TYR A CE1   1 
ATOM 3336 C CE2   . TYR A 1 463 ? 13.385  -6.190  104.631 1.00 12.00 ? 463 TYR A CE2   1 
ATOM 3337 C CZ    . TYR A 1 463 ? 14.077  -6.293  103.420 1.00 12.00 ? 463 TYR A CZ    1 
ATOM 3338 O OH    . TYR A 1 463 ? 14.829  -5.257  102.976 1.00 12.00 ? 463 TYR A OH    1 
ATOM 3339 N N     . PRO A 1 464 ? 14.165  -10.450 105.187 1.00 12.00 ? 464 PRO A N     1 
ATOM 3340 C CA    . PRO A 1 464 ? 15.575  -10.651 105.415 1.00 12.00 ? 464 PRO A CA    1 
ATOM 3341 C C     . PRO A 1 464 ? 15.825  -12.108 105.651 1.00 12.00 ? 464 PRO A C     1 
ATOM 3342 O O     . PRO A 1 464 ? 14.839  -12.874 105.857 1.00 12.00 ? 464 PRO A O     1 
ATOM 3343 C CB    . PRO A 1 464 ? 15.873  -9.812  106.627 1.00 12.00 ? 464 PRO A CB    1 
ATOM 3344 C CG    . PRO A 1 464 ? 14.576  -9.140  107.048 1.00 12.00 ? 464 PRO A CG    1 
ATOM 3345 C CD    . PRO A 1 464 ? 13.486  -9.553  106.111 1.00 12.00 ? 464 PRO A CD    1 
ATOM 3346 N N     . GLN A 1 465 ? 17.090  -12.460 105.618 1.00 12.00 ? 465 GLN A N     1 
ATOM 3347 C CA    . GLN A 1 465 ? 17.529  -13.844 105.818 1.00 12.00 ? 465 GLN A CA    1 
ATOM 3348 C C     . GLN A 1 465 ? 16.896  -14.749 104.764 1.00 12.00 ? 465 GLN A C     1 
ATOM 3349 O O     . GLN A 1 465 ? 17.452  -14.944 103.677 1.00 12.00 ? 465 GLN A O     1 
ATOM 3350 C CB    . GLN A 1 465 ? 17.104  -14.343 107.196 1.00 12.00 ? 465 GLN A CB    1 
ATOM 3351 C CG    . GLN A 1 465 ? 17.317  -13.314 108.301 1.00 12.00 ? 465 GLN A CG    1 
ATOM 3352 C CD    . GLN A 1 465 ? 16.876  -13.818 109.672 1.00 20.00 ? 465 GLN A CD    1 
ATOM 3353 O OE1   . GLN A 1 465 ? 16.201  -14.839 109.762 1.00 20.00 ? 465 GLN A OE1   1 
ATOM 3354 N NE2   . GLN A 1 465 ? 17.218  -13.161 110.757 1.00 20.00 ? 465 GLN A NE2   1 
ATOM 3355 N N     . GLY A 1 466 ? 15.745  -15.270 105.131 1.00 12.00 ? 466 GLY A N     1 
ATOM 3356 C CA    . GLY A 1 466 ? 14.959  -16.169 104.278 1.00 12.00 ? 466 GLY A CA    1 
ATOM 3357 C C     . GLY A 1 466 ? 15.639  -16.344 102.924 1.00 12.00 ? 466 GLY A C     1 
ATOM 3358 O O     . GLY A 1 466 ? 16.382  -15.470 102.469 1.00 12.00 ? 466 GLY A O     1 
ATOM 3359 N N     . GLN A 1 467 ? 15.355  -17.483 102.325 1.00 12.00 ? 467 GLN A N     1 
ATOM 3360 C CA    . GLN A 1 467 ? 15.901  -17.857 101.016 1.00 12.00 ? 467 GLN A CA    1 
ATOM 3361 C C     . GLN A 1 467 ? 14.994  -17.340 99.903  1.00 12.00 ? 467 GLN A C     1 
ATOM 3362 O O     . GLN A 1 467 ? 14.039  -16.599 100.154 1.00 12.00 ? 467 GLN A O     1 
ATOM 3363 C CB    . GLN A 1 467 ? 16.007  -19.374 100.905 1.00 12.00 ? 467 GLN A CB    1 
ATOM 3364 C CG    . GLN A 1 467 ? 17.125  -19.822 99.972  1.00 12.00 ? 467 GLN A CG    1 
ATOM 3365 C CD    . GLN A 1 467 ? 17.377  -21.325 100.021 1.00 12.00 ? 467 GLN A CD    1 
ATOM 3366 O OE1   . GLN A 1 467 ? 16.677  -22.085 99.363  1.00 12.00 ? 467 GLN A OE1   1 
ATOM 3367 N NE2   . GLN A 1 467 ? 18.346  -21.805 100.770 1.00 12.00 ? 467 GLN A NE2   1 
ATOM 3368 N N     . ILE A 1 468 ? 15.326  -17.754 98.695  1.00 12.00 ? 468 ILE A N     1 
ATOM 3369 C CA    . ILE A 1 468 ? 14.591  -17.358 97.489  1.00 12.00 ? 468 ILE A CA    1 
ATOM 3370 C C     . ILE A 1 468 ? 14.216  -18.586 96.657  1.00 12.00 ? 468 ILE A C     1 
ATOM 3371 O O     . ILE A 1 468 ? 13.095  -19.100 96.748  1.00 12.00 ? 468 ILE A O     1 
ATOM 3372 C CB    . ILE A 1 468 ? 15.448  -16.422 96.644  1.00 12.00 ? 468 ILE A CB    1 
ATOM 3373 C CG1   . ILE A 1 468 ? 15.598  -15.035 97.262  1.00 12.00 ? 468 ILE A CG1   1 
ATOM 3374 C CG2   . ILE A 1 468 ? 14.883  -16.194 95.248  1.00 12.00 ? 468 ILE A CG2   1 
ATOM 3375 C CD1   . ILE A 1 468 ? 16.233  -14.025 96.314  1.00 12.00 ? 468 ILE A CD1   1 
ATOM 3376 N N     . TRP A 1 469 ? 15.171  -19.026 95.858  1.00 12.00 ? 469 TRP A N     1 
ATOM 3377 C CA    . TRP A 1 469 ? 14.999  -20.190 94.974  1.00 12.00 ? 469 TRP A CA    1 
ATOM 3378 C C     . TRP A 1 469 ? 15.880  -21.330 95.470  1.00 12.00 ? 469 TRP A C     1 
ATOM 3379 O O     . TRP A 1 469 ? 16.832  -21.115 96.227  1.00 12.00 ? 469 TRP A O     1 
ATOM 3380 C CB    . TRP A 1 469 ? 15.403  -19.826 93.547  1.00 12.00 ? 469 TRP A CB    1 
ATOM 3381 C CG    . TRP A 1 469 ? 16.909  -19.650 93.375  1.00 12.00 ? 469 TRP A CG    1 
ATOM 3382 C CD1   . TRP A 1 469 ? 17.822  -20.613 93.233  1.00 12.00 ? 469 TRP A CD1   1 
ATOM 3383 C CD2   . TRP A 1 469 ? 17.583  -18.407 93.340  1.00 12.00 ? 469 TRP A CD2   1 
ATOM 3384 N NE1   . TRP A 1 469 ? 19.092  -19.974 93.104  1.00 12.00 ? 469 TRP A NE1   1 
ATOM 3385 C CE2   . TRP A 1 469 ? 18.928  -18.681 93.170  1.00 12.00 ? 469 TRP A CE2   1 
ATOM 3386 C CE3   . TRP A 1 469 ? 17.166  -17.080 93.437  1.00 12.00 ? 469 TRP A CE3   1 
ATOM 3387 C CZ2   . TRP A 1 469 ? 19.905  -17.688 93.088  1.00 12.00 ? 469 TRP A CZ2   1 
ATOM 3388 C CZ3   . TRP A 1 469 ? 18.157  -16.086 93.354  1.00 12.00 ? 469 TRP A CZ3   1 
ATOM 3389 C CH2   . TRP A 1 469 ? 19.461  -16.377 93.188  1.00 12.00 ? 469 TRP A CH2   1 
ATOM 3390 N N     . ASP A 1 470 ? 15.537  -22.517 95.026  1.00 12.00 ? 470 ASP A N     1 
ATOM 3391 C CA    . ASP A 1 470 ? 16.262  -23.733 95.399  1.00 12.00 ? 470 ASP A CA    1 
ATOM 3392 C C     . ASP A 1 470 ? 15.985  -24.843 94.396  1.00 12.00 ? 470 ASP A C     1 
ATOM 3393 O O     . ASP A 1 470 ? 14.830  -25.121 94.056  1.00 12.00 ? 470 ASP A O     1 
ATOM 3394 C CB    . ASP A 1 470 ? 15.817  -24.199 96.781  1.00 12.00 ? 470 ASP A CB    1 
ATOM 3395 C CG    . ASP A 1 470 ? 16.480  -25.504 97.211  1.00 12.00 ? 470 ASP A CG    1 
ATOM 3396 O OD1   . ASP A 1 470 ? 15.938  -26.630 96.910  1.00 12.00 ? 470 ASP A OD1   1 
ATOM 3397 O OD2   . ASP A 1 470 ? 17.580  -25.478 97.874  1.00 12.00 ? 470 ASP A OD2   1 
ATOM 3398 N N     . LYS A 1 471 ? 17.068  -25.443 93.953  1.00 12.00 ? 471 LYS A N     1 
ATOM 3399 C CA    . LYS A 1 471 ? 17.030  -26.544 92.992  1.00 12.00 ? 471 LYS A CA    1 
ATOM 3400 C C     . LYS A 1 471 ? 15.821  -27.427 93.278  1.00 12.00 ? 471 LYS A C     1 
ATOM 3401 O O     . LYS A 1 471 ? 14.784  -26.952 93.752  1.00 12.00 ? 471 LYS A O     1 
ATOM 3402 C CB    . LYS A 1 471 ? 18.299  -27.380 93.110  1.00 12.00 ? 471 LYS A CB    1 
ATOM 3403 C CG    . LYS A 1 471 ? 18.689  -28.066 91.806  1.00 12.00 ? 471 LYS A CG    1 
ATOM 3404 C CD    . LYS A 1 471 ? 20.150  -28.504 91.775  1.00 12.00 ? 471 LYS A CD    1 
ATOM 3405 C CE    . LYS A 1 471 ? 20.318  -30.014 91.652  1.00 12.00 ? 471 LYS A CE    1 
ATOM 3406 N NZ    . LYS A 1 471 ? 21.708  -30.450 91.802  1.00 12.00 ? 471 LYS A NZ    1 
ATOM 3407 N N     . GLU A 1 472 ? 16.001  -28.693 92.978  1.00 12.00 ? 472 GLU A N     1 
ATOM 3408 C CA    . GLU A 1 472 ? 14.969  -29.711 93.181  1.00 12.00 ? 472 GLU A CA    1 
ATOM 3409 C C     . GLU A 1 472 ? 15.599  -31.097 93.163  1.00 12.00 ? 472 GLU A C     1 
ATOM 3410 O O     . GLU A 1 472 ? 16.338  -31.447 92.237  1.00 12.00 ? 472 GLU A O     1 
ATOM 3411 C CB    . GLU A 1 472 ? 13.923  -29.627 92.076  1.00 12.00 ? 472 GLU A CB    1 
ATOM 3412 C CG    . GLU A 1 472 ? 12.750  -30.576 92.294  1.00 12.00 ? 472 GLU A CG    1 
ATOM 3413 C CD    . GLU A 1 472 ? 12.160  -30.483 93.697  1.00 12.00 ? 472 GLU A CD    1 
ATOM 3414 O OE1   . GLU A 1 472 ? 12.693  -31.140 94.665  1.00 12.00 ? 472 GLU A OE1   1 
ATOM 3415 O OE2   . GLU A 1 472 ? 11.129  -29.745 93.913  1.00 12.00 ? 472 GLU A OE2   1 
ATOM 3416 N N     . LEU A 1 473 ? 15.279  -31.841 94.197  1.00 12.00 ? 473 LEU A N     1 
ATOM 3417 C CA    . LEU A 1 473 ? 15.774  -33.206 94.377  1.00 12.00 ? 473 LEU A CA    1 
ATOM 3418 C C     . LEU A 1 473 ? 15.442  -34.038 93.141  1.00 12.00 ? 473 LEU A C     1 
ATOM 3419 O O     . LEU A 1 473 ? 14.271  -34.203 92.782  1.00 12.00 ? 473 LEU A O     1 
ATOM 3420 C CB    . LEU A 1 473 ? 15.137  -33.823 95.614  1.00 12.00 ? 473 LEU A CB    1 
ATOM 3421 C CG    . LEU A 1 473 ? 15.392  -33.003 96.876  1.00 12.00 ? 473 LEU A CG    1 
ATOM 3422 C CD1   . LEU A 1 473 ? 14.993  -33.732 98.153  1.00 12.00 ? 473 LEU A CD1   1 
ATOM 3423 C CD2   . LEU A 1 473 ? 16.860  -32.627 97.055  1.00 12.00 ? 473 LEU A CD2   1 
ATOM 3424 N N     . ASP A 1 474 ? 16.504  -34.529 92.540  1.00 12.00 ? 474 ASP A N     1 
ATOM 3425 C CA    . ASP A 1 474 ? 16.450  -35.340 91.319  1.00 12.00 ? 474 ASP A CA    1 
ATOM 3426 C C     . ASP A 1 474 ? 15.860  -36.718 91.605  1.00 12.00 ? 474 ASP A C     1 
ATOM 3427 O O     . ASP A 1 474 ? 16.422  -37.746 91.211  1.00 12.00 ? 474 ASP A O     1 
ATOM 3428 C CB    . ASP A 1 474 ? 17.861  -35.527 90.772  1.00 12.00 ? 474 ASP A CB    1 
ATOM 3429 C CG    . ASP A 1 474 ? 17.889  -36.107 89.364  1.00 12.00 ? 474 ASP A CG    1 
ATOM 3430 O OD1   . ASP A 1 474 ? 17.886  -37.380 89.192  1.00 12.00 ? 474 ASP A OD1   1 
ATOM 3431 O OD2   . ASP A 1 474 ? 17.918  -35.320 88.347  1.00 12.00 ? 474 ASP A OD2   1 
ATOM 3432 N N     . LEU A 1 475 ? 14.733  -36.709 92.280  1.00 12.00 ? 475 LEU A N     1 
ATOM 3433 C CA    . LEU A 1 475 ? 14.031  -37.942 92.652  1.00 12.00 ? 475 LEU A CA    1 
ATOM 3434 C C     . LEU A 1 475 ? 12.802  -38.145 91.765  1.00 12.00 ? 475 LEU A C     1 
ATOM 3435 O O     . LEU A 1 475 ? 11.983  -37.235 91.598  1.00 12.00 ? 475 LEU A O     1 
ATOM 3436 C CB    . LEU A 1 475 ? 13.596  -37.874 94.111  1.00 12.00 ? 475 LEU A CB    1 
ATOM 3437 C CG    . LEU A 1 475 ? 14.759  -38.058 95.082  1.00 20.00 ? 475 LEU A CG    1 
ATOM 3438 C CD1   . LEU A 1 475 ? 14.309  -38.432 96.489  1.00 20.00 ? 475 LEU A CD1   1 
ATOM 3439 C CD2   . LEU A 1 475 ? 15.728  -39.155 94.653  1.00 20.00 ? 475 LEU A CD2   1 
ATOM 3440 N N     . GLU A 1 476 ? 12.732  -39.349 91.230  1.00 12.00 ? 476 GLU A N     1 
ATOM 3441 C CA    . GLU A 1 476 ? 11.640  -39.788 90.351  1.00 12.00 ? 476 GLU A CA    1 
ATOM 3442 C C     . GLU A 1 476 ? 10.339  -39.117 90.787  1.00 12.00 ? 476 GLU A C     1 
ATOM 3443 O O     . GLU A 1 476 ? 9.610   -38.550 89.967  1.00 12.00 ? 476 GLU A O     1 
ATOM 3444 C CB    . GLU A 1 476 ? 11.513  -41.306 90.432  1.00 12.00 ? 476 GLU A CB    1 
ATOM 3445 C CG    . GLU A 1 476 ? 12.626  -41.949 91.261  1.00 12.00 ? 476 GLU A CG    1 
ATOM 3446 C CD    . GLU A 1 476 ? 13.640  -42.722 90.419  1.00 20.00 ? 476 GLU A CD    1 
ATOM 3447 O OE1   . GLU A 1 476 ? 13.235  -43.573 89.545  1.00 20.00 ? 476 GLU A OE1   1 
ATOM 3448 O OE2   . GLU A 1 476 ? 14.901  -42.525 90.584  1.00 20.00 ? 476 GLU A OE2   1 
ATOM 3449 N N     . HIS A 1 477 ? 10.102  -39.218 92.075  1.00 12.00 ? 477 HIS A N     1 
ATOM 3450 C CA    . HIS A 1 477 ? 8.958   -38.591 92.746  1.00 12.00 ? 477 HIS A CA    1 
ATOM 3451 C C     . HIS A 1 477 ? 9.517   -37.437 93.563  1.00 12.00 ? 477 HIS A C     1 
ATOM 3452 O O     . HIS A 1 477 ? 10.673  -37.461 93.991  1.00 12.00 ? 477 HIS A O     1 
ATOM 3453 C CB    . HIS A 1 477 ? 8.258   -39.619 93.627  1.00 12.00 ? 477 HIS A CB    1 
ATOM 3454 C CG    . HIS A 1 477 ? 7.918   -40.903 92.878  1.00 12.00 ? 477 HIS A CG    1 
ATOM 3455 N ND1   . HIS A 1 477 ? 8.879   -41.861 92.589  1.00 20.00 ? 477 HIS A ND1   1 
ATOM 3456 C CD2   . HIS A 1 477 ? 6.753   -41.375 92.371  1.00 12.00 ? 477 HIS A CD2   1 
ATOM 3457 C CE1   . HIS A 1 477 ? 8.294   -42.846 91.939  1.00 20.00 ? 477 HIS A CE1   1 
ATOM 3458 N NE2   . HIS A 1 477 ? 7.027   -42.571 91.802  1.00 20.00 ? 477 HIS A NE2   1 
ATOM 3459 N N     . LYS A 1 478 ? 8.723   -36.413 93.791  1.00 12.00 ? 478 LYS A N     1 
ATOM 3460 C CA    . LYS A 1 478 ? 9.248   -35.243 94.496  1.00 12.00 ? 478 LYS A CA    1 
ATOM 3461 C C     . LYS A 1 478 ? 8.261   -34.593 95.452  1.00 12.00 ? 478 LYS A C     1 
ATOM 3462 O O     . LYS A 1 478 ? 7.044   -34.778 95.334  1.00 12.00 ? 478 LYS A O     1 
ATOM 3463 C CB    . LYS A 1 478 ? 9.649   -34.172 93.500  1.00 12.00 ? 478 LYS A CB    1 
ATOM 3464 C CG    . LYS A 1 478 ? 9.855   -34.720 92.095  1.00 12.00 ? 478 LYS A CG    1 
ATOM 3465 C CD    . LYS A 1 478 ? 10.926  -33.966 91.320  1.00 12.00 ? 478 LYS A CD    1 
ATOM 3466 C CE    . LYS A 1 478 ? 11.573  -34.806 90.227  1.00 12.00 ? 478 LYS A CE    1 
ATOM 3467 N NZ    . LYS A 1 478 ? 12.189  -33.995 89.175  1.00 12.00 ? 478 LYS A NZ    1 
ATOM 3468 N N     . PRO A 1 479 ? 8.801   -33.823 96.404  1.00 12.00 ? 479 PRO A N     1 
ATOM 3469 C CA    . PRO A 1 479 ? 8.003   -33.094 97.367  1.00 12.00 ? 479 PRO A CA    1 
ATOM 3470 C C     . PRO A 1 479 ? 7.105   -32.119 96.656  1.00 12.00 ? 479 PRO A C     1 
ATOM 3471 O O     . PRO A 1 479 ? 7.478   -31.637 95.547  1.00 12.00 ? 479 PRO A O     1 
ATOM 3472 C CB    . PRO A 1 479 ? 9.027   -32.398 98.228  1.00 12.00 ? 479 PRO A CB    1 
ATOM 3473 C CG    . PRO A 1 479 ? 10.404  -32.763 97.708  1.00 12.00 ? 479 PRO A CG    1 
ATOM 3474 C CD    . PRO A 1 479 ? 10.246  -33.671 96.541  1.00 12.00 ? 479 PRO A CD    1 
ATOM 3475 N N     . ARG A 1 480 ? 5.974   -31.851 97.286  1.00 12.00 ? 480 ARG A N     1 
ATOM 3476 C CA    . ARG A 1 480 ? 4.940   -30.941 96.756  1.00 12.00 ? 480 ARG A CA    1 
ATOM 3477 C C     . ARG A 1 480 ? 5.544   -29.551 96.805  1.00 12.00 ? 480 ARG A C     1 
ATOM 3478 O O     . ARG A 1 480 ? 5.201   -28.680 95.997  1.00 12.00 ? 480 ARG A O     1 
ATOM 3479 C CB    . ARG A 1 480 ? 3.718   -30.952 97.673  1.00 12.00 ? 480 ARG A CB    1 
ATOM 3480 C CG    . ARG A 1 480 ? 2.929   -32.254 97.597  1.00 12.00 ? 480 ARG A CG    1 
ATOM 3481 C CD    . ARG A 1 480 ? 1.529   -32.137 98.189  1.00 12.00 ? 480 ARG A CD    1 
ATOM 3482 N NE    . ARG A 1 480 ? 0.627   -31.322 97.371  1.00 12.00 ? 480 ARG A NE    1 
ATOM 3483 C CZ    . ARG A 1 480 ? -0.677  -31.172 97.619  1.00 12.00 ? 480 ARG A CZ    1 
ATOM 3484 N NH1   . ARG A 1 480 ? -1.252  -31.776 98.661  1.00 12.00 ? 480 ARG A NH1   1 
ATOM 3485 N NH2   . ARG A 1 480 ? -1.498  -30.429 96.873  1.00 12.00 ? 480 ARG A NH2   1 
ATOM 3486 N N     . LEU A 1 481 ? 6.441   -29.444 97.778  1.00 12.00 ? 481 LEU A N     1 
ATOM 3487 C CA    . LEU A 1 481 ? 7.148   -28.209 98.101  1.00 12.00 ? 481 LEU A CA    1 
ATOM 3488 C C     . LEU A 1 481 ? 8.441   -28.465 98.886  1.00 12.00 ? 481 LEU A C     1 
ATOM 3489 O O     . LEU A 1 481 ? 8.697   -29.587 99.341  1.00 12.00 ? 481 LEU A O     1 
ATOM 3490 C CB    . LEU A 1 481 ? 6.287   -27.358 99.026  1.00 12.00 ? 481 LEU A CB    1 
ATOM 3491 C CG    . LEU A 1 481 ? 6.234   -27.925 100.447 1.00 12.00 ? 481 LEU A CG    1 
ATOM 3492 C CD1   . LEU A 1 481 ? 5.514   -27.014 101.434 1.00 12.00 ? 481 LEU A CD1   1 
ATOM 3493 C CD2   . LEU A 1 481 ? 5.513   -29.269 100.529 1.00 12.00 ? 481 LEU A CD2   1 
ATOM 3494 N N     . HIS A 1 482 ? 9.173   -27.373 98.983  1.00 12.00 ? 482 HIS A N     1 
ATOM 3495 C CA    . HIS A 1 482 ? 10.410  -27.227 99.769  1.00 12.00 ? 482 HIS A CA    1 
ATOM 3496 C C     . HIS A 1 482 ? 10.069  -26.099 100.818 1.00 12.00 ? 482 HIS A C     1 
ATOM 3497 O O     . HIS A 1 482 ? 9.491   -25.065 100.469 1.00 12.00 ? 482 HIS A O     1 
ATOM 3498 C CB    . HIS A 1 482 ? 11.584  -26.857 98.810  1.00 12.00 ? 482 HIS A CB    1 
ATOM 3499 C CG    . HIS A 1 482 ? 12.227  -28.028 97.983  1.00 12.00 ? 482 HIS A CG    1 
ATOM 3500 N ND1   . HIS A 1 482 ? 13.609  -28.116 97.772  1.00 12.00 ? 482 HIS A ND1   1 
ATOM 3501 C CD2   . HIS A 1 482 ? 11.719  -29.117 97.322  1.00 12.00 ? 482 HIS A CD2   1 
ATOM 3502 C CE1   . HIS A 1 482 ? 13.870  -29.187 97.039  1.00 12.00 ? 482 HIS A CE1   1 
ATOM 3503 N NE2   . HIS A 1 482 ? 12.755  -29.792 96.765  1.00 12.00 ? 482 HIS A NE2   1 
ATOM 3504 N N     . ILE A 1 483 ? 10.408  -26.321 102.103 1.00 12.00 ? 483 ILE A N     1 
ATOM 3505 C CA    . ILE A 1 483 ? 10.079  -25.398 103.275 1.00 12.00 ? 483 ILE A CA    1 
ATOM 3506 C C     . ILE A 1 483 ? 11.093  -24.279 103.434 1.00 12.00 ? 483 ILE A C     1 
ATOM 3507 O O     . ILE A 1 483 ? 11.002  -23.488 104.424 1.00 12.00 ? 483 ILE A O     1 
ATOM 3508 C CB    . ILE A 1 483 ? 10.123  -26.231 104.547 1.00 12.00 ? 483 ILE A CB    1 
ATOM 3509 C CG1   . ILE A 1 483 ? 11.511  -26.822 104.799 1.00 12.00 ? 483 ILE A CG1   1 
ATOM 3510 C CG2   . ILE A 1 483 ? 9.164   -27.420 104.509 1.00 12.00 ? 483 ILE A CG2   1 
ATOM 3511 C CD1   . ILE A 1 483 ? 11.488  -28.055 105.691 1.00 20.00 ? 483 ILE A CD1   1 
ATOM 3512 N N     . THR A 1 484 ? 12.333  -25.203 102.442 1.00 12.00 ? 484 THR A N     1 
ATOM 3513 C CA    . THR A 1 484 ? 13.437  -24.249 102.573 1.00 12.00 ? 484 THR A CA    1 
ATOM 3514 C C     . THR A 1 484 ? 13.338  -22.998 101.662 1.00 12.00 ? 484 THR A C     1 
ATOM 3515 O O     . THR A 1 484 ? 14.133  -22.059 101.776 1.00 12.00 ? 484 THR A O     1 
ATOM 3516 C CB    . THR A 1 484 ? 14.762  -24.949 102.299 1.00 12.00 ? 484 THR A CB    1 
ATOM 3517 O OG1   . THR A 1 484 ? 14.767  -25.480 100.988 1.00 20.00 ? 484 THR A OG1   1 
ATOM 3518 C CG2   . THR A 1 484 ? 15.037  -26.101 103.259 1.00 20.00 ? 484 THR A CG2   1 
ATOM 3519 N N     . ALA A 1 485 ? 12.376  -22.922 100.746 1.00 12.00 ? 485 ALA A N     1 
ATOM 3520 C CA    . ALA A 1 485 ? 12.283  -21.723 99.866  1.00 12.00 ? 485 ALA A CA    1 
ATOM 3521 C C     . ALA A 1 485 ? 10.947  -21.617 99.120  1.00 12.00 ? 485 ALA A C     1 
ATOM 3522 O O     . ALA A 1 485 ? 10.420  -22.612 98.612  1.00 12.00 ? 485 ALA A O     1 
ATOM 3523 C CB    . ALA A 1 485 ? 13.384  -21.752 98.814  1.00 12.00 ? 485 ALA A CB    1 
ATOM 3524 N N     . PRO A 1 486 ? 10.357  -20.408 99.022  1.00 12.00 ? 486 PRO A N     1 
ATOM 3525 C CA    . PRO A 1 486 ? 9.095   -20.211 98.328  1.00 12.00 ? 486 PRO A CA    1 
ATOM 3526 C C     . PRO A 1 486 ? 9.140   -20.591 96.852  1.00 12.00 ? 486 PRO A C     1 
ATOM 3527 O O     . PRO A 1 486 ? 8.151   -21.049 96.290  1.00 12.00 ? 486 PRO A O     1 
ATOM 3528 C CB    . PRO A 1 486 ? 8.812   -18.739 98.476  1.00 12.00 ? 486 PRO A CB    1 
ATOM 3529 C CG    . PRO A 1 486 ? 9.604   -18.326 99.656  1.00 12.00 ? 486 PRO A CG    1 
ATOM 3530 C CD    . PRO A 1 486 ? 10.837  -19.163 99.619  1.00 12.00 ? 486 PRO A CD    1 
ATOM 3531 N N     . PHE A 1 487 ? 10.275  -20.422 96.190  1.00 12.00 ? 487 PHE A N     1 
ATOM 3532 C CA    . PHE A 1 487 ? 10.346  -20.775 94.778  1.00 12.00 ? 487 PHE A CA    1 
ATOM 3533 C C     . PHE A 1 487 ? 11.316  -21.902 94.508  1.00 12.00 ? 487 PHE A C     1 
ATOM 3534 O O     . PHE A 1 487 ? 12.439  -21.897 95.001  1.00 12.00 ? 487 PHE A O     1 
ATOM 3535 C CB    . PHE A 1 487 ? 10.734  -19.584 93.918  1.00 12.00 ? 487 PHE A CB    1 
ATOM 3536 C CG    . PHE A 1 487 ? 9.890   -18.380 94.148  1.00 12.00 ? 487 PHE A CG    1 
ATOM 3537 C CD1   . PHE A 1 487 ? 8.631   -18.285 93.591  1.00 12.00 ? 487 PHE A CD1   1 
ATOM 3538 C CD2   . PHE A 1 487 ? 10.362  -17.349 94.922  1.00 12.00 ? 487 PHE A CD2   1 
ATOM 3539 C CE1   . PHE A 1 487 ? 7.853   -17.170 93.807  1.00 12.00 ? 487 PHE A CE1   1 
ATOM 3540 C CE2   . PHE A 1 487 ? 9.591   -16.231 95.143  1.00 12.00 ? 487 PHE A CE2   1 
ATOM 3541 C CZ    . PHE A 1 487 ? 8.334   -16.141 94.585  1.00 12.00 ? 487 PHE A CZ    1 
ATOM 3542 N N     . VAL A 1 488 ? 10.857  -22.853 93.718  1.00 12.00 ? 488 VAL A N     1 
ATOM 3543 C CA    . VAL A 1 488 ? 11.671  -23.985 93.340  1.00 12.00 ? 488 VAL A CA    1 
ATOM 3544 C C     . VAL A 1 488 ? 11.705  -24.139 91.838  1.00 12.00 ? 488 VAL A C     1 
ATOM 3545 O O     . VAL A 1 488 ? 10.737  -24.572 91.227  1.00 12.00 ? 488 VAL A O     1 
ATOM 3546 C CB    . VAL A 1 488 ? 11.159  -25.291 93.957  1.00 12.00 ? 488 VAL A CB    1 
ATOM 3547 C CG1   . VAL A 1 488 ? 11.850  -26.483 93.321  1.00 12.00 ? 488 VAL A CG1   1 
ATOM 3548 C CG2   . VAL A 1 488 ? 11.361  -25.289 95.457  1.00 12.00 ? 488 VAL A CG2   1 
ATOM 3549 N N     . CYS A 1 489 ? 12.811  -23.781 91.220  1.00 12.00 ? 489 CYS A N     1 
ATOM 3550 C CA    . CYS A 1 489 ? 12.921  -23.941 89.788  1.00 12.00 ? 489 CYS A CA    1 
ATOM 3551 C C     . CYS A 1 489 ? 12.417  -25.328 89.400  1.00 12.00 ? 489 CYS A C     1 
ATOM 3552 O O     . CYS A 1 489 ? 12.760  -26.319 90.036  1.00 12.00 ? 489 CYS A O     1 
ATOM 3553 C CB    . CYS A 1 489 ? 14.360  -23.703 89.345  1.00 12.00 ? 489 CYS A CB    1 
ATOM 3554 S SG    . CYS A 1 489 ? 15.330  -22.659 90.473  1.00 12.00 ? 489 CYS A SG    1 
ATOM 3555 N N     . LYS A 1 490 ? 11.593  -25.403 88.359  1.00 12.00 ? 490 LYS A N     1 
ATOM 3556 C CA    . LYS A 1 490 ? 11.040  -26.684 87.918  1.00 12.00 ? 490 LYS A CA    1 
ATOM 3557 C C     . LYS A 1 490 ? 12.038  -27.467 87.068  1.00 12.00 ? 490 LYS A C     1 
ATOM 3558 O O     . LYS A 1 490 ? 11.992  -28.692 87.013  1.00 12.00 ? 490 LYS A O     1 
ATOM 3559 C CB    . LYS A 1 490 ? 9.746   -26.471 87.134  1.00 12.00 ? 490 LYS A CB    1 
ATOM 3560 C CG    . LYS A 1 490 ? 8.594   -25.922 87.956  1.00 12.00 ? 490 LYS A CG    1 
ATOM 3561 C CD    . LYS A 1 490 ? 7.357   -25.716 87.101  1.00 12.00 ? 490 LYS A CD    1 
ATOM 3562 C CE    . LYS A 1 490 ? 6.225   -25.102 87.901  1.00 20.00 ? 490 LYS A CE    1 
ATOM 3563 N NZ    . LYS A 1 490 ? 5.011   -24.890 87.072  1.00 20.00 ? 490 LYS A NZ    1 
ATOM 3564 N N     . ASN A 1 491 ? 12.924  -26.737 86.413  1.00 12.00 ? 491 ASN A N     1 
ATOM 3565 C CA    . ASN A 1 491 ? 13.949  -27.314 85.557  1.00 12.00 ? 491 ASN A CA    1 
ATOM 3566 C C     . ASN A 1 491 ? 15.315  -27.132 86.186  1.00 12.00 ? 491 ASN A C     1 
ATOM 3567 O O     . ASN A 1 491 ? 15.430  -26.882 87.381  1.00 12.00 ? 491 ASN A O     1 
ATOM 3568 C CB    . ASN A 1 491 ? 13.914  -26.634 84.199  1.00 12.00 ? 491 ASN A CB    1 
ATOM 3569 C CG    . ASN A 1 491 ? 13.855  -25.129 84.338  1.00 12.00 ? 491 ASN A CG    1 
ATOM 3570 O OD1   . ASN A 1 491 ? 13.926  -24.599 85.445  1.00 12.00 ? 491 ASN A OD1   1 
ATOM 3571 N ND2   . ASN A 1 491 ? 13.727  -24.436 83.220  1.00 12.00 ? 491 ASN A ND2   1 
ATOM 3572 N N     . ASN A 1 492 ? 16.374  -27.253 85.400  1.00 12.00 ? 492 ASN A N     1 
ATOM 3573 C CA    . ASN A 1 492 ? 17.693  -27.010 85.943  1.00 12.00 ? 492 ASN A CA    1 
ATOM 3574 C C     . ASN A 1 492 ? 17.614  -25.771 86.808  1.00 12.00 ? 492 ASN A C     1 
ATOM 3575 O O     . ASN A 1 492 ? 16.546  -25.195 86.983  1.00 12.00 ? 492 ASN A O     1 
ATOM 3576 C CB    . ASN A 1 492 ? 18.720  -26.862 84.817  1.00 12.00 ? 492 ASN A CB    1 
ATOM 3577 C CG    . ASN A 1 492 ? 20.148  -27.087 85.275  1.00 12.00 ? 492 ASN A CG    1 
ATOM 3578 O OD1   . ASN A 1 492 ? 20.628  -28.217 85.308  1.00 12.00 ? 492 ASN A OD1   1 
ATOM 3579 N ND2   . ASN A 1 492 ? 20.835  -26.011 85.626  1.00 12.00 ? 492 ASN A ND2   1 
ATOM 3580 N N     . ALA A 1 493 ? 18.720  -25.345 87.359  1.00 12.00 ? 493 ALA A N     1 
ATOM 3581 C CA    . ALA A 1 493 ? 18.727  -24.149 88.173  1.00 12.00 ? 493 ALA A CA    1 
ATOM 3582 C C     . ALA A 1 493 ? 19.948  -23.332 87.855  1.00 12.00 ? 493 ALA A C     1 
ATOM 3583 O O     . ALA A 1 493 ? 20.785  -23.742 87.058  1.00 12.00 ? 493 ALA A O     1 
ATOM 3584 C CB    . ALA A 1 493 ? 18.663  -24.511 89.642  1.00 12.00 ? 493 ALA A CB    1 
ATOM 3585 N N     . PRO A 1 494 ? 20.101  -22.165 88.469  1.00 12.00 ? 494 PRO A N     1 
ATOM 3586 C CA    . PRO A 1 494 ? 21.241  -21.334 88.211  1.00 12.00 ? 494 PRO A CA    1 
ATOM 3587 C C     . PRO A 1 494 ? 22.474  -22.050 88.582  1.00 12.00 ? 494 PRO A C     1 
ATOM 3588 O O     . PRO A 1 494 ? 22.470  -22.885 89.484  1.00 12.00 ? 494 PRO A O     1 
ATOM 3589 C CB    . PRO A 1 494 ? 21.064  -20.145 89.139  1.00 12.00 ? 494 PRO A CB    1 
ATOM 3590 C CG    . PRO A 1 494 ? 19.619  -20.127 89.423  1.00 12.00 ? 494 PRO A CG    1 
ATOM 3591 C CD    . PRO A 1 494 ? 19.199  -21.566 89.443  1.00 12.00 ? 494 PRO A CD    1 
ATOM 3592 N N     . GLY A 1 495 ? 23.499  -21.725 87.886  1.00 12.00 ? 495 GLY A N     1 
ATOM 3593 C CA    . GLY A 1 495 ? 24.723  -22.329 88.142  1.00 12.00 ? 495 GLY A CA    1 
ATOM 3594 C C     . GLY A 1 495 ? 25.497  -21.558 89.121  1.00 12.00 ? 495 GLY A C     1 
ATOM 3595 O O     . GLY A 1 495 ? 25.555  -20.319 89.064  1.00 12.00 ? 495 GLY A O     1 
ATOM 3596 N N     . GLN A 1 496 ? 26.052  -22.233 89.941  1.00 12.00 ? 496 GLN A N     1 
ATOM 3597 C CA    . GLN A 1 496 ? 26.737  -21.679 90.977  1.00 12.00 ? 496 GLN A CA    1 
ATOM 3598 C C     . GLN A 1 496 ? 27.999  -21.078 90.464  1.00 12.00 ? 496 GLN A C     1 
ATOM 3599 O O     . GLN A 1 496 ? 28.584  -21.551 89.484  1.00 12.00 ? 496 GLN A O     1 
ATOM 3600 C CB    . GLN A 1 496 ? 27.004  -22.714 91.999  1.00 12.00 ? 496 GLN A CB    1 
ATOM 3601 C CG    . GLN A 1 496 ? 25.732  -23.385 92.498  1.00 12.00 ? 496 GLN A CG    1 
ATOM 3602 C CD    . GLN A 1 496 ? 25.976  -24.314 93.677  1.00 12.00 ? 496 GLN A CD    1 
ATOM 3603 O OE1   . GLN A 1 496 ? 25.864  -23.891 94.821  1.00 12.00 ? 496 GLN A OE1   1 
ATOM 3604 N NE2   . GLN A 1 496 ? 26.308  -25.567 93.465  1.00 12.00 ? 496 GLN A NE2   1 
ATOM 3605 N N     . MET A 1 497 ? 28.340  -20.075 91.167  1.00 12.00 ? 497 MET A N     1 
ATOM 3606 C CA    . MET A 1 497 ? 29.445  -19.238 90.854  1.00 12.00 ? 497 MET A CA    1 
ATOM 3607 C C     . MET A 1 497 ? 30.449  -19.317 91.969  1.00 12.00 ? 497 MET A C     1 
ATOM 3608 O O     . MET A 1 497 ? 30.173  -18.803 93.070  1.00 12.00 ? 497 MET A O     1 
ATOM 3609 C CB    . MET A 1 497 ? 28.881  -17.853 90.690  1.00 12.00 ? 497 MET A CB    1 
ATOM 3610 C CG    . MET A 1 497 ? 29.893  -16.828 90.254  1.00 12.00 ? 497 MET A CG    1 
ATOM 3611 S SD    . MET A 1 497 ? 29.141  -15.254 89.962  1.00 20.00 ? 497 MET A SD    1 
ATOM 3612 C CE    . MET A 1 497 ? 30.385  -14.042 89.641  1.00 20.00 ? 497 MET A CE    1 
ATOM 3613 N N     . LEU A 1 498 ? 31.521  -19.958 91.563  1.00 12.00 ? 498 LEU A N     1 
ATOM 3614 C CA    . LEU A 1 498 ? 32.707  -20.260 92.372  1.00 12.00 ? 498 LEU A CA    1 
ATOM 3615 C C     . LEU A 1 498 ? 33.892  -19.343 91.963  1.00 12.00 ? 498 LEU A C     1 
ATOM 3616 O O     . LEU A 1 498 ? 34.197  -19.190 90.781  1.00 12.00 ? 498 LEU A O     1 
ATOM 3617 C CB    . LEU A 1 498 ? 33.111  -21.720 92.126  1.00 12.00 ? 498 LEU A CB    1 
ATOM 3618 C CG    . LEU A 1 498 ? 31.981  -22.729 92.355  1.00 12.00 ? 498 LEU A CG    1 
ATOM 3619 C CD1   . LEU A 1 498 ? 32.403  -24.168 92.067  1.00 12.00 ? 498 LEU A CD1   1 
ATOM 3620 C CD2   . LEU A 1 498 ? 31.477  -22.730 93.793  1.00 12.00 ? 498 LEU A CD2   1 
ATOM 3621 N N     . VAL A 1 499 ? 34.560  -18.769 92.982  1.00 12.00 ? 499 VAL A N     1 
ATOM 3622 C CA    . VAL A 1 499 ? 35.702  -17.788 92.832  1.00 12.00 ? 499 VAL A CA    1 
ATOM 3623 C C     . VAL A 1 499 ? 36.893  -18.208 93.688  1.00 12.00 ? 499 VAL A C     1 
ATOM 3624 O O     . VAL A 1 499 ? 36.747  -18.589 94.851  1.00 12.00 ? 499 VAL A O     1 
ATOM 3625 C CB    . VAL A 1 499 ? 35.221  -16.436 93.351  1.00 12.00 ? 499 VAL A CB    1 
ATOM 3626 C CG1   . VAL A 1 499 ? 36.264  -15.339 93.243  1.00 12.00 ? 499 VAL A CG1   1 
ATOM 3627 C CG2   . VAL A 1 499 ? 33.985  -15.922 92.622  1.00 12.00 ? 499 VAL A CG2   1 
ATOM 3628 N N     . ARG A 1 500 ? 38.065  -18.125 93.103  1.00 12.00 ? 500 ARG A N     1 
ATOM 3629 C CA    . ARG A 1 500 ? 39.296  -18.484 93.805  1.00 12.00 ? 500 ARG A CA    1 
ATOM 3630 C C     . ARG A 1 500 ? 40.435  -17.624 93.346  1.00 12.00 ? 500 ARG A C     1 
ATOM 3631 O O     . ARG A 1 500 ? 40.462  -17.137 92.212  1.00 12.00 ? 500 ARG A O     1 
ATOM 3632 C CB    . ARG A 1 500 ? 39.694  -19.944 93.514  1.00 12.00 ? 500 ARG A CB    1 
ATOM 3633 C CG    . ARG A 1 500 ? 41.130  -20.315 93.955  1.00 12.00 ? 500 ARG A CG    1 
ATOM 3634 C CD    . ARG A 1 500 ? 41.562  -21.712 93.469  1.00 12.00 ? 500 ARG A CD    1 
ATOM 3635 N NE    . ARG A 1 500 ? 42.814  -22.217 94.073  1.00 20.00 ? 500 ARG A NE    1 
ATOM 3636 C CZ    . ARG A 1 500 ? 43.309  -23.451 93.848  1.00 20.00 ? 500 ARG A CZ    1 
ATOM 3637 N NH1   . ARG A 1 500 ? 42.675  -24.313 93.043  1.00 20.00 ? 500 ARG A NH1   1 
ATOM 3638 N NH2   . ARG A 1 500 ? 44.441  -23.923 94.384  1.00 20.00 ? 500 ARG A NH2   1 
ATOM 3639 N N     . LEU A 1 501 ? 41.336  -17.444 94.251  1.00 12.00 ? 501 LEU A N     1 
ATOM 3640 C CA    . LEU A 1 501 ? 42.556  -16.790 93.923  1.00 12.00 ? 501 LEU A CA    1 
ATOM 3641 C C     . LEU A 1 501 ? 43.341  -17.805 93.136  1.00 12.00 ? 501 LEU A C     1 
ATOM 3642 O O     . LEU A 1 501 ? 43.172  -19.019 93.334  1.00 12.00 ? 501 LEU A O     1 
ATOM 3643 C CB    . LEU A 1 501 ? 43.317  -16.422 95.186  1.00 12.00 ? 501 LEU A CB    1 
ATOM 3644 C CG    . LEU A 1 501 ? 43.011  -15.023 95.698  1.00 20.00 ? 501 LEU A CG    1 
ATOM 3645 C CD1   . LEU A 1 501 ? 44.100  -14.478 96.616  1.00 20.00 ? 501 LEU A CD1   1 
ATOM 3646 C CD2   . LEU A 1 501 ? 42.854  -13.995 94.585  1.00 20.00 ? 501 LEU A CD2   1 
ATOM 3647 N N     . GLY A 1 502 ? 44.139  -17.299 92.259  1.00 12.00 ? 502 GLY A N     1 
ATOM 3648 C CA    . GLY A 1 502 ? 45.036  -18.125 91.482  1.00 12.00 ? 502 GLY A CA    1 
ATOM 3649 C C     . GLY A 1 502 ? 46.337  -18.201 92.269  1.00 12.00 ? 502 GLY A C     1 
ATOM 3650 O O     . GLY A 1 502 ? 46.791  -17.206 92.846  1.00 12.00 ? 502 GLY A O     1 
ATOM 3651 N N     . PRO A 1 503 ? 46.983  -19.368 92.324  1.00 12.00 ? 503 PRO A N     1 
ATOM 3652 C CA    . PRO A 1 503 ? 48.215  -19.523 93.071  1.00 12.00 ? 503 PRO A CA    1 
ATOM 3653 C C     . PRO A 1 503 ? 49.315  -18.618 92.521  1.00 12.00 ? 503 PRO A C     1 
ATOM 3654 O O     . PRO A 1 503 ? 49.661  -18.740 91.311  1.00 12.00 ? 503 PRO A O     1 
ATOM 3655 C CB    . PRO A 1 503 ? 48.573  -20.990 92.884  1.00 12.00 ? 503 PRO A CB    1 
ATOM 3656 C CG    . PRO A 1 503 ? 47.483  -21.625 91.993  1.00 12.00 ? 503 PRO A CG    1 
ATOM 3657 C CD    . PRO A 1 503 ? 46.490  -20.583 91.643  1.00 12.00 ? 503 PRO A CD    1 
ATOM 3658 N N     . ASN A 1 504 ? 49.816  -17.754 93.411  1.00 12.00 ? 504 ASN A N     1 
ATOM 3659 C CA    . ASN A 1 504 ? 50.965  -16.883 93.142  1.00 12.00 ? 504 ASN A CA    1 
ATOM 3660 C C     . ASN A 1 504 ? 52.203  -17.526 93.766  1.00 12.00 ? 504 ASN A C     1 
ATOM 3661 O O     . ASN A 1 504 ? 52.277  -17.727 94.982  1.00 12.00 ? 504 ASN A O     1 
ATOM 3662 C CB    . ASN A 1 504 ? 50.731  -15.501 93.739  1.00 12.00 ? 504 ASN A CB    1 
ATOM 3663 C CG    . ASN A 1 504 ? 51.889  -14.542 93.490  1.00 12.00 ? 504 ASN A CG    1 
ATOM 3664 O OD1   . ASN A 1 504 ? 52.876  -14.921 92.869  1.00 12.00 ? 504 ASN A OD1   1 
ATOM 3665 N ND2   . ASN A 1 504 ? 51.829  -13.307 93.939  1.00 12.00 ? 504 ASN A ND2   1 
ATOM 3666 N N     . LEU A 1 505 ? 53.162  -17.835 92.921  1.00 12.00 ? 505 LEU A N     1 
ATOM 3667 C CA    . LEU A 1 505 ? 54.362  -18.559 93.347  1.00 12.00 ? 505 LEU A CA    1 
ATOM 3668 C C     . LEU A 1 505 ? 55.564  -17.685 93.591  1.00 12.00 ? 505 LEU A C     1 
ATOM 3669 O O     . LEU A 1 505 ? 55.622  -16.532 93.151  1.00 12.00 ? 505 LEU A O     1 
ATOM 3670 C CB    . LEU A 1 505 ? 54.809  -19.540 92.283  1.00 12.00 ? 505 LEU A CB    1 
ATOM 3671 C CG    . LEU A 1 505 ? 53.885  -20.734 92.166  1.00 12.00 ? 505 LEU A CG    1 
ATOM 3672 C CD1   . LEU A 1 505 ? 54.528  -21.910 91.445  1.00 12.00 ? 505 LEU A CD1   1 
ATOM 3673 C CD2   . LEU A 1 505 ? 53.427  -21.269 93.517  1.00 12.00 ? 505 LEU A CD2   1 
ATOM 3674 N N     . THR A 1 506 ? 56.465  -18.325 94.281  1.00 12.00 ? 506 THR A N     1 
ATOM 3675 C CA    . THR A 1 506 ? 57.741  -17.770 94.614  1.00 12.00 ? 506 THR A CA    1 
ATOM 3676 C C     . THR A 1 506 ? 58.895  -18.372 93.758  1.00 12.00 ? 506 THR A C     1 
ATOM 3677 O O     . THR A 1 506 ? 58.658  -19.045 92.748  1.00 12.00 ? 506 THR A O     1 
ATOM 3678 C CB    . THR A 1 506 ? 58.063  -18.006 96.086  1.00 12.00 ? 506 THR A CB    1 
ATOM 3679 O OG1   . THR A 1 506 ? 58.358  -19.374 96.303  1.00 12.00 ? 506 THR A OG1   1 
ATOM 3680 C CG2   . THR A 1 506 ? 56.912  -17.636 97.014  1.00 12.00 ? 506 THR A CG2   1 
ATOM 3681 N N     . ASP A 1 507 ? 60.140  -18.103 94.206  1.00 12.00 ? 507 ASP A N     1 
ATOM 3682 C CA    . ASP A 1 507 ? 61.394  -18.517 93.498  1.00 12.00 ? 507 ASP A CA    1 
ATOM 3683 C C     . ASP A 1 507 ? 61.620  -20.002 93.659  1.00 12.00 ? 507 ASP A C     1 
ATOM 3684 O O     . ASP A 1 507 ? 62.230  -20.638 92.807  1.00 12.00 ? 507 ASP A O     1 
ATOM 3685 C CB    . ASP A 1 507 ? 62.599  -17.692 93.968  1.00 12.00 ? 507 ASP A CB    1 
ATOM 3686 C CG    . ASP A 1 507 ? 62.947  -17.901 95.425  1.00 12.00 ? 507 ASP A CG    1 
ATOM 3687 O OD1   . ASP A 1 507 ? 62.277  -18.710 96.089  1.00 12.00 ? 507 ASP A OD1   1 
ATOM 3688 O OD2   . ASP A 1 507 ? 63.897  -17.250 95.904  1.00 20.00 ? 507 ASP A OD2   1 
ATOM 3689 N N     . GLN A 1 508 ? 61.117  -20.546 94.755  1.00 12.00 ? 508 GLN A N     1 
ATOM 3690 C CA    . GLN A 1 508 ? 61.231  -21.968 95.009  1.00 12.00 ? 508 GLN A CA    1 
ATOM 3691 C C     . GLN A 1 508 ? 59.858  -22.659 94.945  1.00 12.00 ? 508 GLN A C     1 
ATOM 3692 O O     . GLN A 1 508 ? 58.849  -22.053 95.338  1.00 12.00 ? 508 GLN A O     1 
ATOM 3693 C CB    . GLN A 1 508 ? 61.904  -22.238 96.361  1.00 12.00 ? 508 GLN A CB    1 
ATOM 3694 C CG    . GLN A 1 508 ? 63.355  -21.784 96.449  1.00 12.00 ? 508 GLN A CG    1 
ATOM 3695 C CD    . GLN A 1 508 ? 64.352  -22.925 96.352  1.00 12.00 ? 508 GLN A CD    1 
ATOM 3696 O OE1   . GLN A 1 508 ? 64.083  -24.043 96.780  1.00 12.00 ? 508 GLN A OE1   1 
ATOM 3697 N NE2   . GLN A 1 508 ? 65.568  -22.864 95.824  1.00 12.00 ? 508 GLN A NE2   1 
ATOM 3698 N N     . TYR A 1 509 ? 59.899  -23.909 94.425  1.00 12.00 ? 509 TYR A N     1 
ATOM 3699 C CA    . TYR A 1 509 ? 58.731  -24.817 94.310  1.00 12.00 ? 509 TYR A CA    1 
ATOM 3700 C C     . TYR A 1 509 ? 59.063  -26.227 93.702  1.00 12.00 ? 509 TYR A C     1 
ATOM 3701 O O     . TYR A 1 509 ? 58.889  -26.456 92.509  1.00 12.00 ? 509 TYR A O     1 
ATOM 3702 C CB    . TYR A 1 509 ? 57.589  -24.247 93.455  1.00 12.00 ? 509 TYR A CB    1 
ATOM 3703 C CG    . TYR A 1 509 ? 56.451  -25.240 93.299  1.00 12.00 ? 509 TYR A CG    1 
ATOM 3704 C CD1   . TYR A 1 509 ? 55.469  -25.358 94.268  1.00 12.00 ? 509 TYR A CD1   1 
ATOM 3705 C CD2   . TYR A 1 509 ? 56.365  -26.076 92.193  1.00 12.00 ? 509 TYR A CD2   1 
ATOM 3706 C CE1   . TYR A 1 509 ? 54.457  -26.288 94.157  1.00 12.00 ? 509 TYR A CE1   1 
ATOM 3707 C CE2   . TYR A 1 509 ? 55.361  -27.014 92.077  1.00 12.00 ? 509 TYR A CE2   1 
ATOM 3708 C CZ    . TYR A 1 509 ? 54.412  -27.119 93.063  1.00 12.00 ? 509 TYR A CZ    1 
ATOM 3709 O OH    . TYR A 1 509 ? 53.420  -28.060 92.961  1.00 12.00 ? 509 TYR A OH    1 
ATOM 3710 N N     . ASP A 1 510 ? 59.560  -27.197 94.526  1.00 0.00  ? 510 ASP A N     1 
ATOM 3711 C CA    . ASP A 1 510 ? 59.787  -28.627 94.099  1.00 0.00  ? 510 ASP A CA    1 
ATOM 3712 C C     . ASP A 1 510 ? 58.656  -29.446 94.737  1.00 0.00  ? 510 ASP A C     1 
ATOM 3713 O O     . ASP A 1 510 ? 58.688  -29.725 95.938  1.00 0.00  ? 510 ASP A O     1 
ATOM 3714 C CB    . ASP A 1 510 ? 61.222  -29.102 94.479  1.00 0.00  ? 510 ASP A CB    1 
ATOM 3715 C CG    . ASP A 1 510 ? 61.753  -30.319 93.700  1.00 0.00  ? 510 ASP A CG    1 
ATOM 3716 O OD1   . ASP A 1 510 ? 62.219  -30.160 92.550  1.00 0.00  ? 510 ASP A OD1   1 
ATOM 3717 O OD2   . ASP A 1 510 ? 61.724  -31.444 94.249  1.00 0.00  ? 510 ASP A OD2   1 
ATOM 3718 N N     . PRO A 1 511 ? 57.666  -29.858 93.922  1.00 0.00  ? 511 PRO A N     1 
ATOM 3719 C CA    . PRO A 1 511 ? 56.386  -30.417 94.399  1.00 0.00  ? 511 PRO A CA    1 
ATOM 3720 C C     . PRO A 1 511 ? 56.573  -31.625 95.227  1.00 0.00  ? 511 PRO A C     1 
ATOM 3721 O O     . PRO A 1 511 ? 55.767  -31.904 96.113  1.00 0.00  ? 511 PRO A O     1 
ATOM 3722 C CB    . PRO A 1 511 ? 55.662  -30.813 93.119  1.00 0.00  ? 511 PRO A CB    1 
ATOM 3723 C CG    . PRO A 1 511 ? 56.297  -29.987 92.065  1.00 0.00  ? 511 PRO A CG    1 
ATOM 3724 C CD    . PRO A 1 511 ? 57.727  -29.849 92.462  1.00 0.00  ? 511 PRO A CD    1 
ATOM 3725 N N     . ASN A 1 512 ? 57.791  -32.176 94.921  1.00 0.00  ? 512 ASN A N     1 
ATOM 3726 C CA    . ASN A 1 512 ? 58.227  -33.134 95.928  1.00 0.00  ? 512 ASN A CA    1 
ATOM 3727 C C     . ASN A 1 512 ? 58.601  -32.427 97.215  1.00 0.00  ? 512 ASN A C     1 
ATOM 3728 O O     . ASN A 1 512 ? 59.551  -32.812 97.889  1.00 0.00  ? 512 ASN A O     1 
ATOM 3729 C CB    . ASN A 1 512 ? 59.345  -34.062 95.486  1.00 0.00  ? 512 ASN A CB    1 
ATOM 3730 C CG    . ASN A 1 512 ? 59.093  -34.666 94.124  1.00 0.00  ? 512 ASN A CG    1 
ATOM 3731 O OD1   . ASN A 1 512 ? 58.402  -35.671 94.000  1.00 0.00  ? 512 ASN A OD1   1 
ATOM 3732 N ND2   . ASN A 1 512 ? 59.656  -34.052 93.095  1.00 20.00 ? 512 ASN A ND2   1 
ATOM 3733 N N     . GLY A 1 513 ? 57.834  -31.396 97.527  1.00 0.00  ? 513 GLY A N     1 
ATOM 3734 C CA    . GLY A 1 513 ? 58.024  -30.630 98.734  1.00 0.00  ? 513 GLY A CA    1 
ATOM 3735 C C     . GLY A 1 513 ? 56.812  -30.773 99.641  1.00 0.00  ? 513 GLY A C     1 
ATOM 3736 O O     . GLY A 1 513 ? 55.695  -30.445 99.253  1.00 0.00  ? 513 GLY A O     1 
ATOM 3737 N N     . ALA A 1 514 ? 57.038  -31.271 100.848 1.00 0.00  ? 514 ALA A N     1 
ATOM 3738 C CA    . ALA A 1 514 ? 55.961  -31.468 101.807 1.00 0.00  ? 514 ALA A CA    1 
ATOM 3739 C C     . ALA A 1 514 ? 55.022  -30.273 101.837 1.00 0.00  ? 514 ALA A C     1 
ATOM 3740 O O     . ALA A 1 514 ? 53.833  -30.402 101.565 1.00 0.00  ? 514 ALA A O     1 
ATOM 3741 C CB    . ALA A 1 514 ? 56.529  -31.732 103.187 1.00 0.00  ? 514 ALA A CB    1 
ATOM 3742 N N     . THR A 1 515 ? 55.568  -29.119 102.176 1.00 0.00  ? 515 THR A N     1 
ATOM 3743 C CA    . THR A 1 515 ? 54.791  -27.892 102.222 1.00 0.00  ? 515 THR A CA    1 
ATOM 3744 C C     . THR A 1 515 ? 55.365  -26.891 101.239 1.00 0.00  ? 515 THR A C     1 
ATOM 3745 O O     . THR A 1 515 ? 56.554  -26.600 101.261 1.00 0.00  ? 515 THR A O     1 
ATOM 3746 C CB    . THR A 1 515 ? 54.777  -27.305 103.628 1.00 0.00  ? 515 THR A CB    1 
ATOM 3747 O OG1   . THR A 1 515 ? 54.274  -28.278 104.545 1.00 20.00 ? 515 THR A OG1   1 
ATOM 3748 C CG2   . THR A 1 515 ? 53.913  -26.062 103.677 1.00 20.00 ? 515 THR A CG2   1 
ATOM 3749 N N     . LEU A 1 516 ? 54.537  -26.349 100.363 1.00 0.00  ? 516 LEU A N     1 
ATOM 3750 C CA    . LEU A 1 516 ? 55.058  -25.436 99.367  1.00 0.00  ? 516 LEU A CA    1 
ATOM 3751 C C     . LEU A 1 516 ? 54.812  -23.982 99.702  1.00 0.00  ? 516 LEU A C     1 
ATOM 3752 O O     . LEU A 1 516 ? 53.751  -23.625 100.213 1.00 0.00  ? 516 LEU A O     1 
ATOM 3753 C CB    . LEU A 1 516 ? 54.521  -25.767 97.990  1.00 0.00  ? 516 LEU A CB    1 
ATOM 3754 C CG    . LEU A 1 516 ? 55.539  -26.371 97.033  1.00 0.00  ? 516 LEU A CG    1 
ATOM 3755 C CD1   . LEU A 1 516 ? 56.209  -25.290 96.209  1.00 20.00 ? 516 LEU A CD1   1 
ATOM 3756 C CD2   . LEU A 1 516 ? 56.577  -27.171 97.800  1.00 20.00 ? 516 LEU A CD2   1 
ATOM 3757 N N     . SER A 1 517 ? 55.821  -23.194 99.382  1.00 12.00 ? 517 SER A N     1 
ATOM 3758 C CA    . SER A 1 517 ? 55.823  -21.775 99.626  1.00 12.00 ? 517 SER A CA    1 
ATOM 3759 C C     . SER A 1 517 ? 55.075  -21.009 98.558  1.00 12.00 ? 517 SER A C     1 
ATOM 3760 O O     . SER A 1 517 ? 55.281  -21.224 97.369  1.00 12.00 ? 517 SER A O     1 
ATOM 3761 C CB    . SER A 1 517 ? 57.252  -21.253 99.704  1.00 12.00 ? 517 SER A CB    1 
ATOM 3762 O OG    . SER A 1 517 ? 57.872  -21.288 98.432  1.00 12.00 ? 517 SER A OG    1 
ATOM 3763 N N     . ARG A 1 518 ? 54.219  -20.131 99.019  1.00 12.00 ? 518 ARG A N     1 
ATOM 3764 C CA    . ARG A 1 518 ? 53.454  -19.256 98.165  1.00 12.00 ? 518 ARG A CA    1 
ATOM 3765 C C     . ARG A 1 518 ? 53.392  -17.895 98.839  1.00 12.00 ? 518 ARG A C     1 
ATOM 3766 O O     . ARG A 1 518 ? 53.458  -17.798 100.064 1.00 12.00 ? 518 ARG A O     1 
ATOM 3767 C CB    . ARG A 1 518 ? 52.071  -19.841 97.903  1.00 12.00 ? 518 ARG A CB    1 
ATOM 3768 C CG    . ARG A 1 518 ? 51.245  -20.063 99.153  1.00 12.00 ? 518 ARG A CG    1 
ATOM 3769 C CD    . ARG A 1 518 ? 49.811  -20.407 98.809  1.00 12.00 ? 518 ARG A CD    1 
ATOM 3770 N NE    . ARG A 1 518 ? 49.028  -20.725 99.993  1.00 12.00 ? 518 ARG A NE    1 
ATOM 3771 C CZ    . ARG A 1 518 ? 47.792  -21.199 99.963  1.00 12.00 ? 518 ARG A CZ    1 
ATOM 3772 N NH1   . ARG A 1 518 ? 47.195  -21.412 98.803  1.00 12.00 ? 518 ARG A NH1   1 
ATOM 3773 N NH2   . ARG A 1 518 ? 47.156  -21.459 101.091 1.00 12.00 ? 518 ARG A NH2   1 
ATOM 3774 N N     . ILE A 1 519 ? 53.275  -16.882 97.992  1.00 12.00 ? 519 ILE A N     1 
ATOM 3775 C CA    . ILE A 1 519 ? 53.209  -15.491 98.398  1.00 12.00 ? 519 ILE A CA    1 
ATOM 3776 C C     . ILE A 1 519 ? 51.827  -15.129 98.917  1.00 12.00 ? 519 ILE A C     1 
ATOM 3777 O O     . ILE A 1 519 ? 50.818  -15.547 98.359  1.00 12.00 ? 519 ILE A O     1 
ATOM 3778 C CB    . ILE A 1 519 ? 53.543  -14.567 97.216  1.00 12.00 ? 519 ILE A CB    1 
ATOM 3779 C CG1   . ILE A 1 519 ? 54.929  -14.880 96.660  1.00 12.00 ? 519 ILE A CG1   1 
ATOM 3780 C CG2   . ILE A 1 519 ? 53.444  -13.114 97.627  1.00 12.00 ? 519 ILE A CG2   1 
ATOM 3781 C CD1   . ILE A 1 519 ? 55.249  -14.150 95.378  1.00 12.00 ? 519 ILE A CD1   1 
ATOM 3782 N N     . VAL A 1 520 ? 51.783  -14.347 99.989  1.00 12.00 ? 520 VAL A N     1 
ATOM 3783 C CA    . VAL A 1 520 ? 50.511  -13.926 100.558 1.00 12.00 ? 520 VAL A CA    1 
ATOM 3784 C C     . VAL A 1 520 ? 49.760  -13.037 99.588  1.00 12.00 ? 520 VAL A C     1 
ATOM 3785 O O     . VAL A 1 520 ? 50.073  -11.860 99.443  1.00 12.00 ? 520 VAL A O     1 
ATOM 3786 C CB    . VAL A 1 520 ? 50.698  -13.202 101.894 1.00 12.00 ? 520 VAL A CB    1 
ATOM 3787 C CG1   . VAL A 1 520 ? 49.356  -12.956 102.553 1.00 12.00 ? 520 VAL A CG1   1 
ATOM 3788 C CG2   . VAL A 1 520 ? 51.610  -13.999 102.805 1.00 12.00 ? 520 VAL A CG2   1 
ATOM 3789 N N     . THR A 1 521 ? 48.764  -13.604 98.933  1.00 12.00 ? 521 THR A N     1 
ATOM 3790 C CA    . THR A 1 521 ? 48.010  -12.862 97.948  1.00 12.00 ? 521 THR A CA    1 
ATOM 3791 C C     . THR A 1 521 ? 46.518  -12.851 98.265  1.00 12.00 ? 521 THR A C     1 
ATOM 3792 O O     . THR A 1 521 ? 45.937  -13.883 98.587  1.00 12.00 ? 521 THR A O     1 
ATOM 3793 C CB    . THR A 1 521 ? 48.247  -13.437 96.557  1.00 12.00 ? 521 THR A CB    1 
ATOM 3794 O OG1   . THR A 1 521 ? 49.654  -13.523 96.310  1.00 12.00 ? 521 THR A OG1   1 
ATOM 3795 C CG2   . THR A 1 521 ? 47.596  -12.569 95.503  1.00 12.00 ? 521 THR A CG2   1 
ATOM 3796 N N     . TYR A 1 522 ? 45.925  -11.665 98.168  1.00 12.00 ? 522 TYR A N     1 
ATOM 3797 C CA    . TYR A 1 522 ? 44.498  -11.475 98.406  1.00 12.00 ? 522 TYR A CA    1 
ATOM 3798 C C     . TYR A 1 522 ? 43.917  -10.463 97.357  1.00 12.00 ? 522 TYR A C     1 
ATOM 3799 O O     . TYR A 1 522 ? 44.673  -9.827  96.612  1.00 12.00 ? 522 TYR A O     1 
ATOM 3800 C CB    . TYR A 1 522 ? 44.250  -10.992 99.837  1.00 12.00 ? 522 TYR A CB    1 
ATOM 3801 C CG    . TYR A 1 522 ? 44.548  -9.526  100.069 1.00 12.00 ? 522 TYR A CG    1 
ATOM 3802 C CD1   . TYR A 1 522 ? 43.717  -8.535  99.569  1.00 12.00 ? 522 TYR A CD1   1 
ATOM 3803 C CD2   . TYR A 1 522 ? 45.660  -9.129  100.796 1.00 12.00 ? 522 TYR A CD2   1 
ATOM 3804 C CE1   . TYR A 1 522 ? 43.986  -7.199  99.785  1.00 12.00 ? 522 TYR A CE1   1 
ATOM 3805 C CE2   . TYR A 1 522 ? 45.937  -7.798  101.016 1.00 12.00 ? 522 TYR A CE2   1 
ATOM 3806 C CZ    . TYR A 1 522 ? 45.097  -6.836  100.510 1.00 12.00 ? 522 TYR A CZ    1 
ATOM 3807 O OH    . TYR A 1 522 ? 45.369  -5.510  100.728 1.00 12.00 ? 522 TYR A OH    1 
ATOM 3808 N N     . GLY A 1 523 ? 42.546  -10.307 97.300  1.00 12.00 ? 523 GLY A N     1 
ATOM 3809 C CA    . GLY A 1 523 ? 41.907  -9.392  96.290  1.00 12.00 ? 523 GLY A CA    1 
ATOM 3810 C C     . GLY A 1 523 ? 40.408  -8.993  96.513  1.00 12.00 ? 523 GLY A C     1 
ATOM 3811 O O     . GLY A 1 523 ? 39.647  -9.701  97.214  1.00 12.00 ? 523 GLY A O     1 
ATOM 3812 N N     . THR A 1 524 ? 40.132  -7.839  95.831  1.00 12.00 ? 524 THR A N     1 
ATOM 3813 C CA    . THR A 1 524 ? 38.815  -7.151  95.733  1.00 12.00 ? 524 THR A CA    1 
ATOM 3814 C C     . THR A 1 524 ? 38.270  -7.238  94.310  1.00 12.00 ? 524 THR A C     1 
ATOM 3815 O O     . THR A 1 524 ? 38.949  -6.848  93.354  1.00 12.00 ? 524 THR A O     1 
ATOM 3816 C CB    . THR A 1 524 ? 38.881  -5.690  96.163  1.00 12.00 ? 524 THR A CB    1 
ATOM 3817 O OG1   . THR A 1 524 ? 39.724  -4.959  95.305  1.00 20.00 ? 524 THR A OG1   1 
ATOM 3818 C CG2   . THR A 1 524 ? 39.391  -5.510  97.588  1.00 20.00 ? 524 THR A CG2   1 
ATOM 3819 N N     . PHE A 1 525 ? 36.982  -7.646  94.457  1.00 12.00 ? 525 PHE A N     1 
ATOM 3820 C CA    . PHE A 1 525 ? 36.269  -7.365  93.209  1.00 12.00 ? 525 PHE A CA    1 
ATOM 3821 C C     . PHE A 1 525 ? 34.819  -6.991  93.492  1.00 12.00 ? 525 PHE A C     1 
ATOM 3822 O O     . PHE A 1 525 ? 34.237  -7.415  94.496  1.00 12.00 ? 525 PHE A O     1 
ATOM 3823 C CB    . PHE A 1 525 ? 36.315  -8.586  92.289  1.00 12.00 ? 525 PHE A CB    1 
ATOM 3824 C CG    . PHE A 1 525 ? 35.688  -9.837  92.905  1.00 12.00 ? 525 PHE A CG    1 
ATOM 3825 C CD1   . PHE A 1 525 ? 36.469  -10.708 93.666  1.00 12.00 ? 525 PHE A CD1   1 
ATOM 3826 C CD2   . PHE A 1 525 ? 34.336  -10.112 92.701  1.00 12.00 ? 525 PHE A CD2   1 
ATOM 3827 C CE1   . PHE A 1 525 ? 35.897  -11.854 94.221  1.00 12.00 ? 525 PHE A CE1   1 
ATOM 3828 C CE2   . PHE A 1 525 ? 33.765  -11.258 93.256  1.00 12.00 ? 525 PHE A CE2   1 
ATOM 3829 C CZ    . PHE A 1 525 ? 34.546  -12.129 94.015  1.00 12.00 ? 525 PHE A CZ    1 
ATOM 3830 N N     . PHE A 1 526 ? 34.510  -6.180  93.441  1.00 12.00 ? 526 PHE A N     1 
ATOM 3831 C CA    . PHE A 1 526 ? 33.104  -6.035  93.054  1.00 12.00 ? 526 PHE A CA    1 
ATOM 3832 C C     . PHE A 1 526 ? 32.650  -7.257  92.261  1.00 12.00 ? 526 PHE A C     1 
ATOM 3833 O O     . PHE A 1 526 ? 33.307  -7.684  91.306  1.00 12.00 ? 526 PHE A O     1 
ATOM 3834 C CB    . PHE A 1 526 ? 32.928  -4.802  92.186  1.00 12.00 ? 526 PHE A CB    1 
ATOM 3835 C CG    . PHE A 1 526 ? 33.347  -3.538  92.909  1.00 12.00 ? 526 PHE A CG    1 
ATOM 3836 C CD1   . PHE A 1 526 ? 34.671  -3.110  92.829  1.00 12.00 ? 526 PHE A CD1   1 
ATOM 3837 C CD2   . PHE A 1 526 ? 32.417  -2.819  93.651  1.00 12.00 ? 526 PHE A CD2   1 
ATOM 3838 C CE1   . PHE A 1 526 ? 35.068  -1.961  93.503  1.00 20.00 ? 526 PHE A CE1   1 
ATOM 3839 C CE2   . PHE A 1 526 ? 32.815  -1.669  94.330  1.00 12.00 ? 526 PHE A CE2   1 
ATOM 3840 C CZ    . PHE A 1 526 ? 34.142  -1.241  94.257  1.00 20.00 ? 526 PHE A CZ    1 
ATOM 3841 N N     . TRP A 1 527 ? 30.919  -7.036  92.593  1.00 12.00 ? 527 TRP A N     1 
ATOM 3842 C CA    . TRP A 1 527 ? 29.865  -7.935  92.090  1.00 12.00 ? 527 TRP A CA    1 
ATOM 3843 C C     . TRP A 1 527 ? 28.566  -7.152  91.978  1.00 12.00 ? 527 TRP A C     1 
ATOM 3844 O O     . TRP A 1 527 ? 28.227  -6.353  92.856  1.00 12.00 ? 527 TRP A O     1 
ATOM 3845 C CB    . TRP A 1 527 ? 29.665  -9.108  93.073  1.00 12.00 ? 527 TRP A CB    1 
ATOM 3846 C CG    . TRP A 1 527 ? 28.497  -10.032 92.697  1.00 12.00 ? 527 TRP A CG    1 
ATOM 3847 C CD1   . TRP A 1 527 ? 28.545  -11.116 91.916  1.00 12.00 ? 527 TRP A CD1   1 
ATOM 3848 C CD2   . TRP A 1 527 ? 27.153  -9.882  93.132  1.00 12.00 ? 527 TRP A CD2   1 
ATOM 3849 N NE1   . TRP A 1 527 ? 27.223  -11.653 91.849  1.00 12.00 ? 527 TRP A NE1   1 
ATOM 3850 C CE2   . TRP A 1 527 ? 26.422  -10.914 92.566  1.00 12.00 ? 527 TRP A CE2   1 
ATOM 3851 C CE3   . TRP A 1 527 ? 26.500  -8.959  93.949  1.00 12.00 ? 527 TRP A CE3   1 
ATOM 3852 C CZ2   . TRP A 1 527 ? 25.050  -11.080 92.767  1.00 12.00 ? 527 TRP A CZ2   1 
ATOM 3853 C CZ3   . TRP A 1 527 ? 25.119  -9.135  94.148  1.00 12.00 ? 527 TRP A CZ3   1 
ATOM 3854 C CH2   . TRP A 1 527 ? 24.429  -10.146 93.584  1.00 12.00 ? 527 TRP A CH2   1 
ATOM 3855 N N     . LYS A 1 528 ? 27.878  -7.404  90.897  1.00 12.00 ? 528 LYS A N     1 
ATOM 3856 C CA    . LYS A 1 528 ? 26.605  -6.754  90.604  1.00 12.00 ? 528 LYS A CA    1 
ATOM 3857 C C     . LYS A 1 528 ? 25.574  -7.798  90.280  1.00 12.00 ? 528 LYS A C     1 
ATOM 3858 O O     . LYS A 1 528 ? 25.895  -8.868  89.755  1.00 12.00 ? 528 LYS A O     1 
ATOM 3859 C CB    . LYS A 1 528 ? 26.771  -5.824  89.411  1.00 12.00 ? 528 LYS A CB    1 
ATOM 3860 C CG    . LYS A 1 528 ? 25.578  -4.905  89.198  1.00 12.00 ? 528 LYS A CG    1 
ATOM 3861 C CD    . LYS A 1 528 ? 25.809  -3.890  88.087  1.00 12.00 ? 528 LYS A CD    1 
ATOM 3862 C CE    . LYS A 1 528 ? 24.560  -3.093  87.741  1.00 12.00 ? 528 LYS A CE    1 
ATOM 3863 N NZ    . LYS A 1 528 ? 24.777  -2.134  86.654  1.00 12.00 ? 528 LYS A NZ    1 
ATOM 3864 N N     . GLY A 1 529 ? 24.350  -7.481  90.587  1.00 12.00 ? 529 GLY A N     1 
ATOM 3865 C CA    . GLY A 1 529 ? 23.261  -8.408  90.385  1.00 12.00 ? 529 GLY A CA    1 
ATOM 3866 C C     . GLY A 1 529 ? 22.014  -7.716  89.905  1.00 12.00 ? 529 GLY A C     1 
ATOM 3867 O O     . GLY A 1 529 ? 21.687  -6.611  90.350  1.00 12.00 ? 529 GLY A O     1 
ATOM 3868 N N     . LYS A 1 530 ? 21.507  -8.486  88.822  1.00 12.00 ? 530 LYS A N     1 
ATOM 3869 C CA    . LYS A 1 530 ? 20.199  -8.409  88.224  1.00 12.00 ? 530 LYS A CA    1 
ATOM 3870 C C     . LYS A 1 530 ? 19.310  -9.607  88.516  1.00 12.00 ? 530 LYS A C     1 
ATOM 3871 O O     . LYS A 1 530 ? 19.585  -10.724 88.060  1.00 12.00 ? 530 LYS A O     1 
ATOM 3872 C CB    . LYS A 1 530 ? 20.297  -8.203  86.712  1.00 12.00 ? 530 LYS A CB    1 
ATOM 3873 C CG    . LYS A 1 530 ? 18.925  -8.147  86.046  1.00 12.00 ? 530 LYS A CG    1 
ATOM 3874 C CD    . LYS A 1 530 ? 18.991  -7.946  84.536  1.00 12.00 ? 530 LYS A CD    1 
ATOM 3875 C CE    . LYS A 1 530 ? 17.612  -7.888  83.886  1.00 12.00 ? 530 LYS A CE    1 
ATOM 3876 N NZ    . LYS A 1 530 ? 17.668  -7.697  82.436  1.00 12.00 ? 530 LYS A NZ    1 
ATOM 3877 N N     . LEU A 1 531 ? 18.279  -9.252  89.266  1.00 12.00 ? 531 LEU A N     1 
ATOM 3878 C CA    . LEU A 1 531 ? 17.169  -10.126 89.660  1.00 12.00 ? 531 LEU A CA    1 
ATOM 3879 C C     . LEU A 1 531 ? 15.870  -9.437  89.230  1.00 12.00 ? 531 LEU A C     1 
ATOM 3880 O O     . LEU A 1 531 ? 15.584  -8.303  89.634  1.00 12.00 ? 531 LEU A O     1 
ATOM 3881 C CB    . LEU A 1 531 ? 17.159  -10.351 91.171  1.00 12.00 ? 531 LEU A CB    1 
ATOM 3882 C CG    . LEU A 1 531 ? 16.181  -11.448 91.588  1.00 12.00 ? 531 LEU A CG    1 
ATOM 3883 C CD1   . LEU A 1 531 ? 16.455  -12.781 90.897  1.00 12.00 ? 531 LEU A CD1   1 
ATOM 3884 C CD2   . LEU A 1 531 ? 16.207  -11.745 93.082  1.00 12.00 ? 531 LEU A CD2   1 
ATOM 3885 N N     . THR A 1 532 ? 15.121  -10.142 88.407  1.00 12.00 ? 532 THR A N     1 
ATOM 3886 C CA    . THR A 1 532 ? 13.869  -9.629  87.824  1.00 12.00 ? 532 THR A CA    1 
ATOM 3887 C C     . THR A 1 532 ? 12.663  -10.428 88.313  1.00 12.00 ? 532 THR A C     1 
ATOM 3888 O O     . THR A 1 532 ? 12.691  -11.655 88.389  1.00 12.00 ? 532 THR A O     1 
ATOM 3889 C CB    . THR A 1 532 ? 13.941  -9.752  86.307  1.00 12.00 ? 532 THR A CB    1 
ATOM 3890 O OG1   . THR A 1 532 ? 14.079  -11.114 85.943  1.00 20.00 ? 532 THR A OG1   1 
ATOM 3891 C CG2   . THR A 1 532 ? 15.127  -9.003  85.707  1.00 12.00 ? 532 THR A CG2   1 
ATOM 3892 N N     . MET A 1 533 ? 11.614  -9.702  88.630  1.00 12.00 ? 533 MET A N     1 
ATOM 3893 C CA    . MET A 1 533 ? 10.368  -10.297 89.112  1.00 12.00 ? 533 MET A CA    1 
ATOM 3894 C C     . MET A 1 533 ? 9.198   -9.581  88.504  1.00 12.00 ? 533 MET A C     1 
ATOM 3895 O O     . MET A 1 533 ? 9.246   -8.400  88.189  1.00 12.00 ? 533 MET A O     1 
ATOM 3896 C CB    . MET A 1 533 ? 10.262  -10.158 90.626  1.00 12.00 ? 533 MET A CB    1 
ATOM 3897 C CG    . MET A 1 533 ? 11.597  -10.331 91.330  1.00 12.00 ? 533 MET A CG    1 
ATOM 3898 S SD    . MET A 1 533 ? 11.522  -9.980  93.064  1.00 20.00 ? 533 MET A SD    1 
ATOM 3899 C CE    . MET A 1 533 ? 13.075  -10.370 93.826  1.00 20.00 ? 533 MET A CE    1 
ATOM 3900 N N     . ARG A 1 534 ? 8.142   -10.279 88.327  1.00 12.00 ? 534 ARG A N     1 
ATOM 3901 C CA    . ARG A 1 534 ? 6.978   -9.649  87.785  1.00 12.00 ? 534 ARG A CA    1 
ATOM 3902 C C     . ARG A 1 534 ? 5.775   -10.048 88.637  1.00 12.00 ? 534 ARG A C     1 
ATOM 3903 O O     . ARG A 1 534 ? 5.539   -11.240 88.872  1.00 12.00 ? 534 ARG A O     1 
ATOM 3904 C CB    . ARG A 1 534 ? 6.759   -10.105 86.348  1.00 12.00 ? 534 ARG A CB    1 
ATOM 3905 C CG    . ARG A 1 534 ? 7.978   -9.882  85.462  1.00 12.00 ? 534 ARG A CG    1 
ATOM 3906 C CD    . ARG A 1 534 ? 7.810   -10.459 84.062  1.00 12.00 ? 534 ARG A CD    1 
ATOM 3907 N NE    . ARG A 1 534 ? 8.918   -10.117 83.168  1.00 20.00 ? 534 ARG A NE    1 
ATOM 3908 C CZ    . ARG A 1 534 ? 9.002   -10.511 81.896  1.00 20.00 ? 534 ARG A CZ    1 
ATOM 3909 N NH1   . ARG A 1 534 ? 8.049   -11.267 81.346  1.00 20.00 ? 534 ARG A NH1   1 
ATOM 3910 N NH2   . ARG A 1 534 ? 10.014  -10.198 81.083  1.00 20.00 ? 534 ARG A NH2   1 
ATOM 3911 N N     . ALA A 1 535 ? 5.049   -9.027  89.101  1.00 12.00 ? 535 ALA A N     1 
ATOM 3912 C CA    . ALA A 1 535 ? 3.905   -9.232  90.005  1.00 12.00 ? 535 ALA A CA    1 
ATOM 3913 C C     . ALA A 1 535 ? 2.716   -8.320  89.662  1.00 12.00 ? 535 ALA A C     1 
ATOM 3914 O O     . ALA A 1 535 ? 2.845   -7.378  88.870  1.00 12.00 ? 535 ALA A O     1 
ATOM 3915 C CB    . ALA A 1 535 ? 4.318   -8.943  91.441  1.00 12.00 ? 535 ALA A CB    1 
ATOM 3916 N N     . LYS A 1 536 ? 1.615   -8.680  90.319  1.00 12.00 ? 536 LYS A N     1 
ATOM 3917 C CA    . LYS A 1 536 ? 0.295   -8.078  90.137  1.00 12.00 ? 536 LYS A CA    1 
ATOM 3918 C C     . LYS A 1 536 ? -0.062  -7.146  91.316  1.00 12.00 ? 536 LYS A C     1 
ATOM 3919 O O     . LYS A 1 536 ? 0.429   -7.320  92.436  1.00 12.00 ? 536 LYS A O     1 
ATOM 3920 C CB    . LYS A 1 536 ? -0.743  -9.196  90.092  1.00 12.00 ? 536 LYS A CB    1 
ATOM 3921 C CG    . LYS A 1 536 ? -2.137  -8.695  89.856  1.00 12.00 ? 536 LYS A CG    1 
ATOM 3922 C CD    . LYS A 1 536 ? -2.498  -8.645  88.391  1.00 12.00 ? 536 LYS A CD    1 
ATOM 3923 C CE    . LYS A 1 536 ? -3.950  -8.286  88.152  1.00 12.00 ? 536 LYS A CE    1 
ATOM 3924 N NZ    . LYS A 1 536 ? -4.252  -8.045  86.741  1.00 12.00 ? 536 LYS A NZ    1 
ATOM 3925 N N     . LEU A 1 537 ? -0.925  -6.183  90.997  1.00 12.00 ? 537 LEU A N     1 
ATOM 3926 C CA    . LEU A 1 537 ? -1.420  -5.184  91.963  1.00 12.00 ? 537 LEU A CA    1 
ATOM 3927 C C     . LEU A 1 537 ? -2.736  -5.650  92.554  1.00 12.00 ? 537 LEU A C     1 
ATOM 3928 O O     . LEU A 1 537 ? -3.579  -6.225  91.857  1.00 12.00 ? 537 LEU A O     1 
ATOM 3929 C CB    . LEU A 1 537 ? -1.655  -3.843  91.265  1.00 12.00 ? 537 LEU A CB    1 
ATOM 3930 C CG    . LEU A 1 537 ? -0.386  -3.255  90.660  1.00 12.00 ? 537 LEU A CG    1 
ATOM 3931 C CD1   . LEU A 1 537 ? -0.614  -1.904  89.993  1.00 12.00 ? 537 LEU A CD1   1 
ATOM 3932 C CD2   . LEU A 1 537 ? 0.714   -3.026  91.690  1.00 12.00 ? 537 LEU A CD2   1 
ATOM 3933 N N     . ARG A 1 538 ? -2.873  -5.790  93.852  1.00 12.00 ? 538 ARG A N     1 
ATOM 3934 C CA    . ARG A 1 538 ? -4.047  -6.161  94.622  1.00 12.00 ? 538 ARG A CA    1 
ATOM 3935 C C     . ARG A 1 538 ? -5.207  -5.202  94.502  1.00 12.00 ? 538 ARG A C     1 
ATOM 3936 O O     . ARG A 1 538 ? -5.012  -3.996  94.294  1.00 12.00 ? 538 ARG A O     1 
ATOM 3937 C CB    . ARG A 1 538 ? -3.687  -6.262  96.101  1.00 12.00 ? 538 ARG A CB    1 
ATOM 3938 C CG    . ARG A 1 538 ? -3.471  -4.896  96.747  1.00 12.00 ? 538 ARG A CG    1 
ATOM 3939 C CD    . ARG A 1 538 ? -3.254  -4.973  98.254  1.00 12.00 ? 538 ARG A CD    1 
ATOM 3940 N NE    . ARG A 1 538 ? -3.433  -3.683  98.924  1.00 12.00 ? 538 ARG A NE    1 
ATOM 3941 C CZ    . ARG A 1 538 ? -4.602  -3.242  99.396  1.00 12.00 ? 538 ARG A CZ    1 
ATOM 3942 N NH1   . ARG A 1 538 ? -5.711  -3.977  99.279  1.00 12.00 ? 538 ARG A NH1   1 
ATOM 3943 N NH2   . ARG A 1 538 ? -4.766  -2.066  100.007 1.00 12.00 ? 538 ARG A NH2   1 
ATOM 3944 N N     . ALA A 1 539 ? -6.322  -5.868  94.685  1.00 12.00 ? 539 ALA A N     1 
ATOM 3945 C CA    . ALA A 1 539 ? -7.672  -5.339  94.596  1.00 12.00 ? 539 ALA A CA    1 
ATOM 3946 C C     . ALA A 1 539 ? -8.259  -5.020  95.966  1.00 12.00 ? 539 ALA A C     1 
ATOM 3947 O O     . ALA A 1 539 ? -7.927  -5.633  96.977  1.00 12.00 ? 539 ALA A O     1 
ATOM 3948 C CB    . ALA A 1 539 ? -8.578  -6.433  94.010  1.00 12.00 ? 539 ALA A CB    1 
ATOM 3949 N N     . ASN A 1 540 ? -9.646  -4.454  95.652  1.00 12.00 ? 540 ASN A N     1 
ATOM 3950 C CA    . ASN A 1 540 ? -9.853  -4.118  97.063  1.00 12.00 ? 540 ASN A CA    1 
ATOM 3951 C C     . ASN A 1 540 ? -11.316 -4.472  97.208  1.00 12.00 ? 540 ASN A C     1 
ATOM 3952 O O     . ASN A 1 540 ? -12.197 -3.660  96.905  1.00 12.00 ? 540 ASN A O     1 
ATOM 3953 C CB    . ASN A 1 540 ? -9.746  -2.638  97.395  1.00 12.00 ? 540 ASN A CB    1 
ATOM 3954 C CG    . ASN A 1 540 ? -9.830  -2.366  98.893  1.00 0.00  ? 540 ASN A CG    1 
ATOM 3955 O OD1   . ASN A 1 540 ? -9.671  -1.229  99.319  1.00 0.00  ? 540 ASN A OD1   1 
ATOM 3956 N ND2   . ASN A 1 540 ? -10.073 -3.354  99.728  1.00 0.00  ? 540 ASN A ND2   1 
ATOM 3957 N N     . THR A 1 541 ? -11.520 -5.671  97.619  1.00 12.00 ? 541 THR A N     1 
ATOM 3958 C CA    . THR A 1 541 ? -12.821 -6.306  97.557  1.00 12.00 ? 541 THR A CA    1 
ATOM 3959 C C     . THR A 1 541 ? -13.656 -6.198  98.832  1.00 12.00 ? 541 THR A C     1 
ATOM 3960 O O     . THR A 1 541 ? -14.886 -6.321  98.799  1.00 12.00 ? 541 THR A O     1 
ATOM 3961 C CB    . THR A 1 541 ? -12.541 -7.751  97.222  1.00 12.00 ? 541 THR A CB    1 
ATOM 3962 O OG1   . THR A 1 541 ? -13.656 -8.552  97.559  1.00 0.00  ? 541 THR A OG1   1 
ATOM 3963 C CG2   . THR A 1 541 ? -11.332 -8.310  97.964  1.00 0.00  ? 541 THR A CG2   1 
ATOM 3964 N N     . THR A 1 542 ? -13.015 -5.977  99.944  1.00 12.00 ? 542 THR A N     1 
ATOM 3965 C CA    . THR A 1 542 ? -13.733 -5.872  101.217 1.00 12.00 ? 542 THR A CA    1 
ATOM 3966 C C     . THR A 1 542 ? -14.379 -4.505  101.356 1.00 12.00 ? 542 THR A C     1 
ATOM 3967 O O     . THR A 1 542 ? -14.685 -3.838  100.359 1.00 12.00 ? 542 THR A O     1 
ATOM 3968 C CB    . THR A 1 542 ? -12.773 -6.052  102.384 1.00 12.00 ? 542 THR A CB    1 
ATOM 3969 O OG1   . THR A 1 542 ? -11.883 -4.954  102.450 1.00 12.00 ? 542 THR A OG1   1 
ATOM 3970 C CG2   . THR A 1 542 ? -11.934 -7.318  102.275 1.00 12.00 ? 542 THR A CG2   1 
ATOM 3971 N N     . TRP A 1 543 ? -14.566 -4.160  102.601 1.00 12.00 ? 543 TRP A N     1 
ATOM 3972 C CA    . TRP A 1 543 ? -15.105 -2.873  103.012 1.00 12.00 ? 543 TRP A CA    1 
ATOM 3973 C C     . TRP A 1 543 ? -14.227 -2.322  104.108 1.00 12.00 ? 543 TRP A C     1 
ATOM 3974 O O     . TRP A 1 543 ? -13.927 -1.125  104.142 1.00 12.00 ? 543 TRP A O     1 
ATOM 3975 C CB    . TRP A 1 543 ? -16.506 -3.009  103.570 1.00 12.00 ? 543 TRP A CB    1 
ATOM 3976 C CG    . TRP A 1 543 ? -16.929 -1.749  104.306 1.00 12.00 ? 543 TRP A CG    1 
ATOM 3977 C CD1   . TRP A 1 543 ? -16.466 -1.304  105.478 1.00 12.00 ? 543 TRP A CD1   1 
ATOM 3978 C CD2   . TRP A 1 543 ? -17.893 -0.833  103.844 1.00 12.00 ? 543 TRP A CD2   1 
ATOM 3979 N NE1   . TRP A 1 543 ? -17.146 -0.083  105.759 1.00 12.00 ? 543 TRP A NE1   1 
ATOM 3980 C CE2   . TRP A 1 543 ? -17.979 0.175   104.786 1.00 12.00 ? 543 TRP A CE2   1 
ATOM 3981 C CE3   . TRP A 1 543 ? -18.697 -0.777  102.709 1.00 12.00 ? 543 TRP A CE3   1 
ATOM 3982 C CZ2   . TRP A 1 543 ? -18.837 1.264   104.657 1.00 12.00 ? 543 TRP A CZ2   1 
ATOM 3983 C CZ3   . TRP A 1 543 ? -19.562 0.321   102.587 1.00 12.00 ? 543 TRP A CZ3   1 
ATOM 3984 C CH2   . TRP A 1 543 ? -19.628 1.294   103.517 1.00 12.00 ? 543 TRP A CH2   1 
ATOM 3985 N N     . ASN A 1 544 ? -13.856 -3.239  104.969 1.00 12.00 ? 544 ASN A N     1 
ATOM 3986 C CA    . ASN A 1 544 ? -12.974 -2.951  106.084 1.00 12.00 ? 544 ASN A CA    1 
ATOM 3987 C C     . ASN A 1 544 ? -11.558 -2.844  105.631 1.00 12.00 ? 544 ASN A C     1 
ATOM 3988 O O     . ASN A 1 544 ? -11.075 -3.676  104.853 1.00 12.00 ? 544 ASN A O     1 
ATOM 3989 C CB    . ASN A 1 544 ? -13.210 -3.955  107.211 1.00 12.00 ? 544 ASN A CB    1 
ATOM 3990 C CG    . ASN A 1 544 ? -12.886 -5.391  106.811 1.00 12.00 ? 544 ASN A CG    1 
ATOM 3991 O OD1   . ASN A 1 544 ? -11.746 -5.820  106.942 1.00 12.00 ? 544 ASN A OD1   1 
ATOM 3992 N ND2   . ASN A 1 544 ? -13.830 -6.167  106.327 1.00 12.00 ? 544 ASN A ND2   1 
ATOM 3993 N N     . PRO A 1 545 ? -10.858 -1.817  106.112 1.00 12.00 ? 545 PRO A N     1 
ATOM 3994 C CA    . PRO A 1 545 ? -9.499  -1.644  105.746 1.00 12.00 ? 545 PRO A CA    1 
ATOM 3995 C C     . PRO A 1 545 ? -8.887  -2.921  106.135 1.00 12.00 ? 545 PRO A C     1 
ATOM 3996 O O     . PRO A 1 545 ? -9.620  -3.835  106.609 1.00 12.00 ? 545 PRO A O     1 
ATOM 3997 C CB    . PRO A 1 545 ? -9.065  -0.441  106.540 1.00 12.00 ? 545 PRO A CB    1 
ATOM 3998 C CG    . PRO A 1 545 ? -10.262 0.036   107.339 1.00 12.00 ? 545 PRO A CG    1 
ATOM 3999 C CD    . PRO A 1 545 ? -11.423 -0.851  107.037 1.00 12.00 ? 545 PRO A CD    1 
ATOM 4000 N N     . VAL A 1 546 ? -7.632  -3.047  105.958 1.00 12.00 ? 546 VAL A N     1 
ATOM 4001 C CA    . VAL A 1 546 ? -7.001  -4.272  106.365 1.00 12.00 ? 546 VAL A CA    1 
ATOM 4002 C C     . VAL A 1 546 ? -5.606  -3.933  106.811 1.00 12.00 ? 546 VAL A C     1 
ATOM 4003 O O     . VAL A 1 546 ? -5.112  -2.824  106.575 1.00 12.00 ? 546 VAL A O     1 
ATOM 4004 C CB    . VAL A 1 546 ? -7.140  -5.299  105.248 1.00 12.00 ? 546 VAL A CB    1 
ATOM 4005 C CG1   . VAL A 1 546 ? -7.894  -4.762  104.036 1.00 12.00 ? 546 VAL A CG1   1 
ATOM 4006 C CG2   . VAL A 1 546 ? -5.799  -5.792  104.718 1.00 12.00 ? 546 VAL A CG2   1 
ATOM 4007 N N     . TYR A 1 547 ? -5.062  -4.899  107.453 1.00 12.00 ? 547 TYR A N     1 
ATOM 4008 C CA    . TYR A 1 547 ? -3.778  -4.811  108.090 1.00 12.00 ? 547 TYR A CA    1 
ATOM 4009 C C     . TYR A 1 547 ? -2.677  -4.632  107.145 1.00 12.00 ? 547 TYR A C     1 
ATOM 4010 O O     . TYR A 1 547 ? -2.698  -5.139  106.025 1.00 12.00 ? 547 TYR A O     1 
ATOM 4011 C CB    . TYR A 1 547 ? -3.477  -6.101  108.751 1.00 12.00 ? 547 TYR A CB    1 
ATOM 4012 C CG    . TYR A 1 547 ? -2.215  -6.058  109.572 1.00 12.00 ? 547 TYR A CG    1 
ATOM 4013 C CD1   . TYR A 1 547 ? -1.586  -4.840  109.809 1.00 0.00  ? 547 TYR A CD1   1 
ATOM 4014 C CD2   . TYR A 1 547 ? -1.699  -7.242  110.075 1.00 0.00  ? 547 TYR A CD2   1 
ATOM 4015 C CE1   . TYR A 1 547 ? -0.431  -4.804  110.581 1.00 0.00  ? 547 TYR A CE1   1 
ATOM 4016 C CE2   . TYR A 1 547 ? -0.547  -7.207  110.853 1.00 0.00  ? 547 TYR A CE2   1 
ATOM 4017 C CZ    . TYR A 1 547 ? 0.085   -5.989  111.108 1.00 0.00  ? 547 TYR A CZ    1 
ATOM 4018 O OH    . TYR A 1 547 ? 1.197   -5.961  111.876 1.00 0.00  ? 547 TYR A OH    1 
ATOM 4019 N N     . GLN A 1 548 ? -1.742  -3.953  107.659 1.00 12.00 ? 548 GLN A N     1 
ATOM 4020 C CA    . GLN A 1 548 ? -0.595  -3.672  106.919 1.00 12.00 ? 548 GLN A CA    1 
ATOM 4021 C C     . GLN A 1 548 ? 0.561   -3.502  107.758 1.00 12.00 ? 548 GLN A C     1 
ATOM 4022 O O     . GLN A 1 548 ? 0.458   -3.514  108.983 1.00 12.00 ? 548 GLN A O     1 
ATOM 4023 C CB    . GLN A 1 548 ? -0.732  -2.351  106.278 1.00 12.00 ? 548 GLN A CB    1 
ATOM 4024 C CG    . GLN A 1 548 ? -2.158  -2.078  105.948 1.00 12.00 ? 548 GLN A CG    1 
ATOM 4025 C CD    . GLN A 1 548 ? -2.522  -2.737  104.652 1.00 12.00 ? 548 GLN A CD    1 
ATOM 4026 O OE1   . GLN A 1 548 ? -3.028  -3.849  104.650 1.00 12.00 ? 548 GLN A OE1   1 
ATOM 4027 N NE2   . GLN A 1 548 ? -2.267  -2.106  103.535 1.00 12.00 ? 548 GLN A NE2   1 
ATOM 4028 N N     . VAL A 1 549 ? 1.574   -3.322  107.024 1.00 12.00 ? 549 VAL A N     1 
ATOM 4029 C CA    . VAL A 1 549 ? 2.816   -3.095  107.587 1.00 12.00 ? 549 VAL A CA    1 
ATOM 4030 C C     . VAL A 1 549 ? 3.051   -1.602  107.688 1.00 12.00 ? 549 VAL A C     1 
ATOM 4031 O O     . VAL A 1 549 ? 2.823   -0.856  106.729 1.00 12.00 ? 549 VAL A O     1 
ATOM 4032 C CB    . VAL A 1 549 ? 3.907   -3.751  106.750 1.00 12.00 ? 549 VAL A CB    1 
ATOM 4033 C CG1   . VAL A 1 549 ? 5.300   -3.576  107.349 1.00 20.00 ? 549 VAL A CG1   1 
ATOM 4034 C CG2   . VAL A 1 549 ? 3.714   -5.256  106.597 1.00 20.00 ? 549 VAL A CG2   1 
ATOM 4035 N N     . SER A 1 550 ? 3.494   -1.204  108.850 1.00 12.00 ? 550 SER A N     1 
ATOM 4036 C CA    . SER A 1 550 ? 3.775   0.198   109.135 1.00 12.00 ? 550 SER A CA    1 
ATOM 4037 C C     . SER A 1 550 ? 4.938   0.299   110.090 1.00 12.00 ? 550 SER A C     1 
ATOM 4038 O O     . SER A 1 550 ? 5.425   -0.709  110.611 1.00 12.00 ? 550 SER A O     1 
ATOM 4039 C CB    . SER A 1 550 ? 2.551   0.859   109.755 1.00 12.00 ? 550 SER A CB    1 
ATOM 4040 O OG    . SER A 1 550 ? 2.331   2.124   109.161 1.00 12.00 ? 550 SER A OG    1 
ATOM 4041 N N     . VAL A 1 551 ? 5.336   1.508   110.270 1.00 12.00 ? 551 VAL A N     1 
ATOM 4042 C CA    . VAL A 1 551 ? 6.452   1.838   111.159 1.00 12.00 ? 551 VAL A CA    1 
ATOM 4043 C C     . VAL A 1 551 ? 6.018   2.917   112.153 1.00 12.00 ? 551 VAL A C     1 
ATOM 4044 O O     . VAL A 1 551 ? 5.811   4.061   111.765 1.00 12.00 ? 551 VAL A O     1 
ATOM 4045 C CB    . VAL A 1 551 ? 7.639   2.331   110.333 1.00 12.00 ? 551 VAL A CB    1 
ATOM 4046 C CG1   . VAL A 1 551 ? 8.851   2.688   111.183 1.00 20.00 ? 551 VAL A CG1   1 
ATOM 4047 C CG2   . VAL A 1 551 ? 8.132   1.303   109.320 1.00 20.00 ? 551 VAL A CG2   1 
ATOM 4048 N N     . GLU A 1 552 ? 5.898   2.459   113.334 1.00 12.00 ? 552 GLU A N     1 
ATOM 4049 C CA    . GLU A 1 552 ? 5.441   3.290   114.401 1.00 12.00 ? 552 GLU A CA    1 
ATOM 4050 C C     . GLU A 1 552 ? 6.511   4.188   114.921 1.00 12.00 ? 552 GLU A C     1 
ATOM 4051 O O     . GLU A 1 552 ? 7.694   4.042   114.581 1.00 12.00 ? 552 GLU A O     1 
ATOM 4052 C CB    . GLU A 1 552 ? 5.011   2.451   115.568 1.00 12.00 ? 552 GLU A CB    1 
ATOM 4053 C CG    . GLU A 1 552 ? 3.675   2.892   116.120 1.00 12.00 ? 552 GLU A CG    1 
ATOM 4054 C CD    . GLU A 1 552 ? 3.443   4.396   116.022 1.00 20.00 ? 552 GLU A CD    1 
ATOM 4055 O OE1   . GLU A 1 552 ? 4.441   5.204   115.954 1.00 20.00 ? 552 GLU A OE1   1 
ATOM 4056 O OE2   . GLU A 1 552 ? 2.243   4.857   116.017 1.00 20.00 ? 552 GLU A OE2   1 
ATOM 4057 N N     . ASP A 1 553 ? 6.005   5.061   115.731 1.00 12.00 ? 553 ASP A N     1 
ATOM 4058 C CA    . ASP A 1 553 ? 6.811   6.002   116.416 1.00 12.00 ? 553 ASP A CA    1 
ATOM 4059 C C     . ASP A 1 553 ? 7.977   5.252   116.993 1.00 12.00 ? 553 ASP A C     1 
ATOM 4060 O O     . ASP A 1 553 ? 8.560   4.380   116.336 1.00 12.00 ? 553 ASP A O     1 
ATOM 4061 C CB    . ASP A 1 553 ? 5.992   6.705   117.485 1.00 12.00 ? 553 ASP A CB    1 
ATOM 4062 C CG    . ASP A 1 553 ? 5.305   7.954   116.947 1.00 20.00 ? 553 ASP A CG    1 
ATOM 4063 O OD1   . ASP A 1 553 ? 4.881   7.980   115.732 1.00 20.00 ? 553 ASP A OD1   1 
ATOM 4064 O OD2   . ASP A 1 553 ? 5.156   8.983   117.701 1.00 20.00 ? 553 ASP A OD2   1 
ATOM 4065 N N     . ASN A 1 554 ? 8.444   5.201   117.922 1.00 12.00 ? 554 ASN A N     1 
ATOM 4066 C CA    . ASN A 1 554 ? 9.612   4.727   118.621 1.00 12.00 ? 554 ASN A CA    1 
ATOM 4067 C C     . ASN A 1 554 ? 9.265   4.401   120.064 1.00 12.00 ? 554 ASN A C     1 
ATOM 4068 O O     . ASN A 1 554 ? 9.331   5.265   120.944 1.00 12.00 ? 554 ASN A O     1 
ATOM 4069 C CB    . ASN A 1 554 ? 10.666  5.818   118.579 1.00 12.00 ? 554 ASN A CB    1 
ATOM 4070 C CG    . ASN A 1 554 ? 11.821  5.561   119.525 1.00 12.00 ? 554 ASN A CG    1 
ATOM 4071 O OD1   . ASN A 1 554 ? 12.084  6.374   120.400 1.00 12.00 ? 554 ASN A OD1   1 
ATOM 4072 N ND2   . ASN A 1 554 ? 12.534  4.467   119.396 1.00 20.00 ? 554 ASN A ND2   1 
ATOM 4073 N N     . GLY A 1 555 ? 8.906   3.155   120.254 1.00 20.00 ? 555 GLY A N     1 
ATOM 4074 C CA    . GLY A 1 555 ? 8.562   2.623   121.569 1.00 20.00 ? 555 GLY A CA    1 
ATOM 4075 C C     . GLY A 1 555 ? 9.124   1.890   122.217 1.00 20.00 ? 555 GLY A C     1 
ATOM 4076 O O     . GLY A 1 555 ? 10.110  2.175   122.904 1.00 20.00 ? 555 GLY A O     1 
ATOM 4077 N N     . ASN A 1 556 ? 8.820   0.693   121.784 1.00 20.00 ? 556 ASN A N     1 
ATOM 4078 C CA    . ASN A 1 556 ? 9.627   -0.495  122.056 1.00 20.00 ? 556 ASN A CA    1 
ATOM 4079 C C     . ASN A 1 556 ? 9.117   -1.633  121.196 1.00 20.00 ? 556 ASN A C     1 
ATOM 4080 O O     . ASN A 1 556 ? 9.690   -2.728  121.184 1.00 20.00 ? 556 ASN A O     1 
ATOM 4081 C CB    . ASN A 1 556 ? 9.512   -0.887  123.523 1.00 20.00 ? 556 ASN A CB    1 
ATOM 4082 C CG    . ASN A 1 556 ? 9.663   0.296   124.469 1.00 20.00 ? 556 ASN A CG    1 
ATOM 4083 O OD1   . ASN A 1 556 ? 10.685  0.420   125.134 1.00 20.00 ? 556 ASN A OD1   1 
ATOM 4084 N ND2   . ASN A 1 556 ? 8.698   1.183   124.572 1.00 20.00 ? 556 ASN A ND2   1 
ATOM 4085 N N     . SER A 1 557 ? 8.048   -1.308  120.508 1.00 20.00 ? 557 SER A N     1 
ATOM 4086 C CA    . SER A 1 557 ? 7.366   -2.233  119.618 1.00 20.00 ? 557 SER A CA    1 
ATOM 4087 C C     . SER A 1 557 ? 8.277   -2.639  118.477 1.00 20.00 ? 557 SER A C     1 
ATOM 4088 O O     . SER A 1 557 ? 9.028   -1.815  117.938 1.00 20.00 ? 557 SER A O     1 
ATOM 4089 C CB    . SER A 1 557 ? 6.120   -1.588  119.027 1.00 20.00 ? 557 SER A CB    1 
ATOM 4090 O OG    . SER A 1 557 ? 5.587   -2.416  118.009 1.00 20.00 ? 557 SER A OG    1 
ATOM 4091 N N     . TYR A 1 558 ? 8.154   -3.899  118.176 1.00 20.00 ? 558 TYR A N     1 
ATOM 4092 C CA    . TYR A 1 558 ? 8.882   -4.560  117.109 1.00 20.00 ? 558 TYR A CA    1 
ATOM 4093 C C     . TYR A 1 558 ? 8.989   -3.638  115.898 1.00 20.00 ? 558 TYR A C     1 
ATOM 4094 O O     . TYR A 1 558 ? 10.069  -3.465  115.321 1.00 20.00 ? 558 TYR A O     1 
ATOM 4095 C CB    . TYR A 1 558 ? 8.118   -5.816  116.732 1.00 20.00 ? 558 TYR A CB    1 
ATOM 4096 C CG    . TYR A 1 558 ? 8.867   -6.719  115.776 1.00 20.00 ? 558 TYR A CG    1 
ATOM 4097 C CD1   . TYR A 1 558 ? 9.830   -7.599  116.264 1.00 20.00 ? 558 TYR A CD1   1 
ATOM 4098 C CD2   . TYR A 1 558 ? 8.581   -6.662  114.418 1.00 20.00 ? 558 TYR A CD2   1 
ATOM 4099 C CE1   . TYR A 1 558 ? 10.511  -8.434  115.383 1.00 20.00 ? 558 TYR A CE1   1 
ATOM 4100 C CE2   . TYR A 1 558 ? 9.261   -7.498  113.535 1.00 20.00 ? 558 TYR A CE2   1 
ATOM 4101 C CZ    . TYR A 1 558 ? 10.225  -8.384  114.018 1.00 20.00 ? 558 TYR A CZ    1 
ATOM 4102 O OH    . TYR A 1 558 ? 10.883  -9.197  113.159 1.00 20.00 ? 558 TYR A OH    1 
ATOM 4103 N N     . MET A 1 559 ? 7.849   -3.074  115.554 1.00 20.00 ? 559 MET A N     1 
ATOM 4104 C CA    . MET A 1 559 ? 7.714   -2.169  114.408 1.00 20.00 ? 559 MET A CA    1 
ATOM 4105 C C     . MET A 1 559 ? 7.816   -0.713  114.855 1.00 20.00 ? 559 MET A C     1 
ATOM 4106 O O     . MET A 1 559 ? 6.803   -0.059  115.126 1.00 20.00 ? 559 MET A O     1 
ATOM 4107 C CB    . MET A 1 559 ? 6.362   -2.381  113.736 1.00 20.00 ? 559 MET A CB    1 
ATOM 4108 C CG    . MET A 1 559 ? 5.984   -3.854  113.613 1.00 20.00 ? 559 MET A CG    1 
ATOM 4109 S SD    . MET A 1 559 ? 6.196   -4.489  111.971 1.00 20.00 ? 559 MET A SD    1 
ATOM 4110 C CE    . MET A 1 559 ? 6.932   -3.252  110.933 1.00 20.00 ? 559 MET A CE    1 
ATOM 4111 N N     . SER A 1 560 ? 9.051   -0.259  114.912 1.00 12.00 ? 560 SER A N     1 
ATOM 4112 C CA    . SER A 1 560 ? 9.388   1.114   115.303 1.00 12.00 ? 560 SER A CA    1 
ATOM 4113 C C     . SER A 1 560 ? 10.733  1.506   114.688 1.00 12.00 ? 560 SER A C     1 
ATOM 4114 O O     . SER A 1 560 ? 11.770  0.913   114.999 1.00 12.00 ? 560 SER A O     1 
ATOM 4115 C CB    . SER A 1 560 ? 9.469   1.222   116.822 1.00 12.00 ? 560 SER A CB    1 
ATOM 4116 O OG    . SER A 1 560 ? 10.679  0.656   117.285 1.00 20.00 ? 560 SER A OG    1 
ATOM 4117 N N     . VAL A 1 561 ? 10.648  2.498   113.829 1.00 12.00 ? 561 VAL A N     1 
ATOM 4118 C CA    . VAL A 1 561 ? 11.793  3.046   113.087 1.00 12.00 ? 561 VAL A CA    1 
ATOM 4119 C C     . VAL A 1 561 ? 13.127  2.654   113.734 1.00 12.00 ? 561 VAL A C     1 
ATOM 4120 O O     . VAL A 1 561 ? 13.631  1.544   113.531 1.00 12.00 ? 561 VAL A O     1 
ATOM 4121 C CB    . VAL A 1 561 ? 11.698  4.568   113.037 1.00 12.00 ? 561 VAL A CB    1 
ATOM 4122 C CG1   . VAL A 1 561 ? 12.863  5.212   112.295 1.00 20.00 ? 561 VAL A CG1   1 
ATOM 4123 C CG2   . VAL A 1 561 ? 10.438  5.062   112.334 1.00 20.00 ? 561 VAL A CG2   1 
ATOM 4124 N N     . THR A 1 562 ? 13.663  3.594   114.493 1.00 12.00 ? 562 THR A N     1 
ATOM 4125 C CA    . THR A 1 562 ? 14.959  3.445   115.182 1.00 12.00 ? 562 THR A CA    1 
ATOM 4126 C C     . THR A 1 562 ? 15.570  2.074   114.910 1.00 12.00 ? 562 THR A C     1 
ATOM 4127 O O     . THR A 1 562 ? 16.787  1.937   114.748 1.00 12.00 ? 562 THR A O     1 
ATOM 4128 C CB    . THR A 1 562 ? 14.797  3.601   116.693 1.00 12.00 ? 562 THR A CB    1 
ATOM 4129 O OG1   . THR A 1 562 ? 13.954  2.587   117.200 1.00 20.00 ? 562 THR A OG1   1 
ATOM 4130 C CG2   . THR A 1 562 ? 14.195  4.942   117.092 1.00 20.00 ? 562 THR A CG2   1 
ATOM 4131 N N     . LYS A 1 563 ? 14.701  1.093   114.872 1.00 12.00 ? 563 LYS A N     1 
ATOM 4132 C CA    . LYS A 1 563 ? 15.085  -0.299  114.632 1.00 12.00 ? 563 LYS A CA    1 
ATOM 4133 C C     . LYS A 1 563 ? 15.864  -0.429  113.323 1.00 12.00 ? 563 LYS A C     1 
ATOM 4134 O O     . LYS A 1 563 ? 16.769  -1.262  113.202 1.00 12.00 ? 563 LYS A O     1 
ATOM 4135 C CB    . LYS A 1 563 ? 13.835  -1.169  114.516 1.00 12.00 ? 563 LYS A CB    1 
ATOM 4136 C CG    . LYS A 1 563 ? 13.548  -1.997  115.765 1.00 12.00 ? 563 LYS A CG    1 
ATOM 4137 C CD    . LYS A 1 563 ? 12.492  -3.076  115.531 1.00 20.00 ? 563 LYS A CD    1 
ATOM 4138 C CE    . LYS A 1 563 ? 11.753  -3.480  116.802 1.00 20.00 ? 563 LYS A CE    1 
ATOM 4139 N NZ    . LYS A 1 563 ? 10.676  -4.444  116.557 1.00 20.00 ? 563 LYS A NZ    1 
ATOM 4140 N N     . TRP A 1 564 ? 15.489  0.412   112.376 1.00 12.00 ? 564 TRP A N     1 
ATOM 4141 C CA    . TRP A 1 564 ? 16.056  0.384   111.021 1.00 12.00 ? 564 TRP A CA    1 
ATOM 4142 C C     . TRP A 1 564 ? 17.129  1.496   110.821 1.00 12.00 ? 564 TRP A C     1 
ATOM 4143 O O     . TRP A 1 564 ? 18.319  1.215   110.649 1.00 12.00 ? 564 TRP A O     1 
ATOM 4144 C CB    . TRP A 1 564 ? 14.907  0.486   110.011 1.00 12.00 ? 564 TRP A CB    1 
ATOM 4145 C CG    . TRP A 1 564 ? 14.190  -0.864  109.767 1.00 12.00 ? 564 TRP A CG    1 
ATOM 4146 C CD1   . TRP A 1 564 ? 14.621  -1.878  109.007 1.00 12.00 ? 564 TRP A CD1   1 
ATOM 4147 C CD2   . TRP A 1 564 ? 12.932  -1.262  110.317 1.00 12.00 ? 564 TRP A CD2   1 
ATOM 4148 N NE1   . TRP A 1 564 ? 13.635  -2.913  109.066 1.00 20.00 ? 564 TRP A NE1   1 
ATOM 4149 C CE2   . TRP A 1 564 ? 12.654  -2.531  109.832 1.00 12.00 ? 564 TRP A CE2   1 
ATOM 4150 C CE3   . TRP A 1 564 ? 12.012  -0.653  111.174 1.00 20.00 ? 564 TRP A CE3   1 
ATOM 4151 C CZ2   . TRP A 1 564 ? 11.487  -3.237  110.147 1.00 20.00 ? 564 TRP A CZ2   1 
ATOM 4152 C CZ3   . TRP A 1 564 ? 10.842  -1.373  111.488 1.00 20.00 ? 564 TRP A CZ3   1 
ATOM 4153 C CH2   . TRP A 1 564 ? 10.594  -2.603  110.998 1.00 20.00 ? 564 TRP A CH2   1 
ATOM 4154 N N     . LEU A 1 565 ? 16.719  2.763   110.835 1.00 12.00 ? 565 LEU A N     1 
ATOM 4155 C CA    . LEU A 1 565 ? 17.661  3.908   110.640 1.00 12.00 ? 565 LEU A CA    1 
ATOM 4156 C C     . LEU A 1 565 ? 18.938  3.704   111.478 1.00 12.00 ? 565 LEU A C     1 
ATOM 4157 O O     . LEU A 1 565 ? 18.888  3.158   112.584 1.00 12.00 ? 565 LEU A O     1 
ATOM 4158 C CB    . LEU A 1 565 ? 17.013  5.223   111.072 1.00 12.00 ? 565 LEU A CB    1 
ATOM 4159 C CG    . LEU A 1 565 ? 15.695  5.517   110.360 1.00 20.00 ? 565 LEU A CG    1 
ATOM 4160 C CD1   . LEU A 1 565 ? 15.000  6.769   110.892 1.00 20.00 ? 565 LEU A CD1   1 
ATOM 4161 C CD2   . LEU A 1 565 ? 15.853  5.742   108.861 1.00 20.00 ? 565 LEU A CD2   1 
ATOM 4162 N N     . PRO A 1 566 ? 20.139  4.124   111.015 1.00 12.00 ? 566 PRO A N     1 
ATOM 4163 C CA    . PRO A 1 566 ? 21.379  3.908   111.756 1.00 12.00 ? 566 PRO A CA    1 
ATOM 4164 C C     . PRO A 1 566 ? 21.378  4.558   113.107 1.00 12.00 ? 566 PRO A C     1 
ATOM 4165 O O     . PRO A 1 566 ? 20.287  4.991   113.579 1.00 12.00 ? 566 PRO A O     1 
ATOM 4166 C CB    . PRO A 1 566 ? 22.453  4.500   110.890 1.00 12.00 ? 566 PRO A CB    1 
ATOM 4167 C CG    . PRO A 1 566 ? 21.773  5.057   109.645 1.00 12.00 ? 566 PRO A CG    1 
ATOM 4168 C CD    . PRO A 1 566 ? 20.294  4.817   109.739 1.00 12.00 ? 566 PRO A CD    1 
ATOM 4169 N N     . THR A 1 567 ? 22.585  4.598   113.661 1.00 12.00 ? 567 THR A N     1 
ATOM 4170 C CA    . THR A 1 567 ? 22.859  5.140   115.002 1.00 12.00 ? 567 THR A CA    1 
ATOM 4171 C C     . THR A 1 567 ? 24.025  6.130   114.978 1.00 12.00 ? 567 THR A C     1 
ATOM 4172 O O     . THR A 1 567 ? 24.777  6.207   113.997 1.00 12.00 ? 567 THR A O     1 
ATOM 4173 C CB    . THR A 1 567 ? 23.259  4.007   115.940 1.00 12.00 ? 567 THR A CB    1 
ATOM 4174 O OG1   . THR A 1 567 ? 22.402  2.898   115.751 1.00 20.00 ? 567 THR A OG1   1 
ATOM 4175 C CG2   . THR A 1 567 ? 23.188  4.397   117.410 1.00 20.00 ? 567 THR A CG2   1 
ATOM 4176 N N     . ALA A 1 568 ? 24.132  6.860   116.083 1.00 12.00 ? 568 ALA A N     1 
ATOM 4177 C CA    . ALA A 1 568 ? 25.199  7.848   116.277 1.00 12.00 ? 568 ALA A CA    1 
ATOM 4178 C C     . ALA A 1 568 ? 26.365  7.430   115.415 1.00 12.00 ? 568 ALA A C     1 
ATOM 4179 O O     . ALA A 1 568 ? 26.706  8.090   114.431 1.00 12.00 ? 568 ALA A O     1 
ATOM 4180 C CB    . ALA A 1 568 ? 25.609  7.897   117.742 1.00 12.00 ? 568 ALA A CB    1 
ATOM 4181 N N     . THR A 1 569 ? 26.971  6.328   115.798 1.00 12.00 ? 569 THR A N     1 
ATOM 4182 C CA    . THR A 1 569 ? 28.009  5.765   114.964 1.00 12.00 ? 569 THR A CA    1 
ATOM 4183 C C     . THR A 1 569 ? 27.325  5.455   113.657 1.00 12.00 ? 569 THR A C     1 
ATOM 4184 O O     . THR A 1 569 ? 26.950  6.357   112.902 1.00 12.00 ? 569 THR A O     1 
ATOM 4185 C CB    . THR A 1 569 ? 28.612  4.509   115.585 1.00 12.00 ? 569 THR A CB    1 
ATOM 4186 O OG1   . THR A 1 569 ? 27.697  3.436   115.512 1.00 20.00 ? 569 THR A OG1   1 
ATOM 4187 C CG2   . THR A 1 569 ? 29.000  4.688   117.045 1.00 12.00 ? 569 THR A CG2   1 
ATOM 4188 N N     . GLY A 1 570 ? 27.131  4.195   113.419 1.00 12.00 ? 570 GLY A N     1 
ATOM 4189 C CA    . GLY A 1 570 ? 26.456  3.774   112.214 1.00 12.00 ? 570 GLY A CA    1 
ATOM 4190 C C     . GLY A 1 570 ? 26.335  2.297   112.154 1.00 12.00 ? 570 GLY A C     1 
ATOM 4191 O O     . GLY A 1 570 ? 26.936  1.644   111.307 1.00 12.00 ? 570 GLY A O     1 
ATOM 4192 N N     . ASN A 1 571 ? 25.558  1.788   113.028 1.00 12.00 ? 571 ASN A N     1 
ATOM 4193 C CA    . ASN A 1 571 ? 25.276  0.384   112.993 1.00 12.00 ? 571 ASN A CA    1 
ATOM 4194 C C     . ASN A 1 571 ? 23.926  0.239   112.275 1.00 12.00 ? 571 ASN A C     1 
ATOM 4195 O O     . ASN A 1 571 ? 23.295  1.241   111.912 1.00 12.00 ? 571 ASN A O     1 
ATOM 4196 C CB    . ASN A 1 571 ? 25.315  -0.144  114.412 1.00 20.00 ? 571 ASN A CB    1 
ATOM 4197 C CG    . ASN A 1 571 ? 26.705  -0.041  115.035 1.00 20.00 ? 571 ASN A CG    1 
ATOM 4198 O OD1   . ASN A 1 571 ? 27.594  -0.809  114.682 1.00 20.00 ? 571 ASN A OD1   1 
ATOM 4199 N ND2   . ASN A 1 571 ? 26.953  0.875   115.946 1.00 20.00 ? 571 ASN A ND2   1 
ATOM 4200 N N     . MET A 1 572 ? 23.491  -0.990  112.054 1.00 12.00 ? 572 MET A N     1 
ATOM 4201 C CA    . MET A 1 572 ? 22.225  -1.232  111.330 1.00 12.00 ? 572 MET A CA    1 
ATOM 4202 C C     . MET A 1 572 ? 21.683  -2.654  111.509 1.00 12.00 ? 572 MET A C     1 
ATOM 4203 O O     . MET A 1 572 ? 22.409  -3.638  111.342 1.00 12.00 ? 572 MET A O     1 
ATOM 4204 C CB    . MET A 1 572 ? 22.434  -1.059  109.826 1.00 12.00 ? 572 MET A CB    1 
ATOM 4205 C CG    . MET A 1 572 ? 22.931  0.325   109.439 1.00 12.00 ? 572 MET A CG    1 
ATOM 4206 S SD    . MET A 1 572 ? 21.613  1.475   109.148 1.00 12.00 ? 572 MET A SD    1 
ATOM 4207 C CE    . MET A 1 572 ? 20.365  0.727   108.132 1.00 12.00 ? 572 MET A CE    1 
ATOM 4208 N N     . GLN A 1 573 ? 20.401  -2.696  111.837 1.00 12.00 ? 573 GLN A N     1 
ATOM 4209 C CA    . GLN A 1 573 ? 19.621  -3.943  111.971 1.00 12.00 ? 573 GLN A CA    1 
ATOM 4210 C C     . GLN A 1 573 ? 18.754  -4.067  110.792 1.00 12.00 ? 573 GLN A C     1 
ATOM 4211 O O     . GLN A 1 573 ? 18.513  -3.085  110.081 1.00 12.00 ? 573 GLN A O     1 
ATOM 4212 C CB    . GLN A 1 573 ? 18.669  -3.880  113.165 1.00 12.00 ? 573 GLN A CB    1 
ATOM 4213 C CG    . GLN A 1 573 ? 19.345  -3.752  114.522 1.00 12.00 ? 573 GLN A CG    1 
ATOM 4214 C CD    . GLN A 1 573 ? 18.324  -3.651  115.655 1.00 12.00 ? 573 GLN A CD    1 
ATOM 4215 O OE1   . GLN A 1 573 ? 17.123  -3.632  115.399 1.00 20.00 ? 573 GLN A OE1   1 
ATOM 4216 N NE2   . GLN A 1 573 ? 18.727  -3.583  116.904 1.00 20.00 ? 573 GLN A NE2   1 
ATOM 4217 N N     . SER A 1 574 ? 18.362  -5.248  110.701 1.00 12.00 ? 574 SER A N     1 
ATOM 4218 C CA    . SER A 1 574 ? 17.431  -5.707  109.757 1.00 12.00 ? 574 SER A CA    1 
ATOM 4219 C C     . SER A 1 574 ? 16.592  -6.640  110.542 1.00 12.00 ? 574 SER A C     1 
ATOM 4220 O O     . SER A 1 574 ? 17.103  -7.530  111.219 1.00 12.00 ? 574 SER A O     1 
ATOM 4221 C CB    . SER A 1 574 ? 18.162  -6.417  108.639 1.00 12.00 ? 574 SER A CB    1 
ATOM 4222 O OG    . SER A 1 574 ? 18.702  -7.632  109.129 1.00 20.00 ? 574 SER A OG    1 
ATOM 4223 N N     . VAL A 1 575 ? 15.336  -6.427  110.497 1.00 12.00 ? 575 VAL A N     1 
ATOM 4224 C CA    . VAL A 1 575 ? 14.455  -7.304  111.212 1.00 12.00 ? 575 VAL A CA    1 
ATOM 4225 C C     . VAL A 1 575 ? 13.536  -7.968  110.223 1.00 12.00 ? 575 VAL A C     1 
ATOM 4226 O O     . VAL A 1 575 ? 12.918  -7.300  109.390 1.00 12.00 ? 575 VAL A O     1 
ATOM 4227 C CB    . VAL A 1 575 ? 13.679  -6.525  112.256 1.00 12.00 ? 575 VAL A CB    1 
ATOM 4228 C CG1   . VAL A 1 575 ? 12.757  -7.411  113.084 1.00 12.00 ? 575 VAL A CG1   1 
ATOM 4229 C CG2   . VAL A 1 575 ? 14.581  -5.814  113.261 1.00 12.00 ? 575 VAL A CG2   1 
ATOM 4230 N N     . PRO A 1 576 ? 13.422  -9.291  110.252 1.00 12.00 ? 576 PRO A N     1 
ATOM 4231 C CA    . PRO A 1 576 ? 12.523  -9.977  109.358 1.00 12.00 ? 576 PRO A CA    1 
ATOM 4232 C C     . PRO A 1 576 ? 11.120  -9.491  109.587 1.00 12.00 ? 576 PRO A C     1 
ATOM 4233 O O     . PRO A 1 576 ? 10.678  -9.432  110.774 1.00 12.00 ? 576 PRO A O     1 
ATOM 4234 C CB    . PRO A 1 576 ? 12.697  -11.426 109.715 1.00 12.00 ? 576 PRO A CB    1 
ATOM 4235 C CG    . PRO A 1 576 ? 13.722  -11.510 110.828 1.00 12.00 ? 576 PRO A CG    1 
ATOM 4236 C CD    . PRO A 1 576 ? 14.179  -10.133 111.167 1.00 20.00 ? 576 PRO A CD    1 
ATOM 4237 N N     . LEU A 1 577 ? 10.472  -9.166  108.483 1.00 12.00 ? 577 LEU A N     1 
ATOM 4238 C CA    . LEU A 1 577 ? 9.098   -8.644  108.477 1.00 12.00 ? 577 LEU A CA    1 
ATOM 4239 C C     . LEU A 1 577 ? 8.130   -9.643  107.844 1.00 12.00 ? 577 LEU A C     1 
ATOM 4240 O O     . LEU A 1 577 ? 8.548   -10.637 107.239 1.00 12.00 ? 577 LEU A O     1 
ATOM 4241 C CB    . LEU A 1 577 ? 9.035   -7.351  107.674 1.00 12.00 ? 577 LEU A CB    1 
ATOM 4242 C CG    . LEU A 1 577 ? 10.058  -6.318  108.129 1.00 12.00 ? 577 LEU A CG    1 
ATOM 4243 C CD1   . LEU A 1 577 ? 10.056  -5.058  107.273 1.00 20.00 ? 577 LEU A CD1   1 
ATOM 4244 C CD2   . LEU A 1 577 ? 9.828   -5.846  109.560 1.00 20.00 ? 577 LEU A CD2   1 
ATOM 4245 N N     . ILE A 1 578 ? 6.863   -9.318  108.021 1.00 12.00 ? 578 ILE A N     1 
ATOM 4246 C CA    . ILE A 1 578 ? 5.731   -10.108 107.520 1.00 12.00 ? 578 ILE A CA    1 
ATOM 4247 C C     . ILE A 1 578 ? 5.407   -9.749  106.080 1.00 12.00 ? 578 ILE A C     1 
ATOM 4248 O O     . ILE A 1 578 ? 5.293   -8.574  105.726 1.00 12.00 ? 578 ILE A O     1 
ATOM 4249 C CB    . ILE A 1 578 ? 4.460   -9.780  108.303 1.00 12.00 ? 578 ILE A CB    1 
ATOM 4250 C CG1   . ILE A 1 578 ? 4.520   -10.160 109.776 1.00 20.00 ? 578 ILE A CG1   1 
ATOM 4251 C CG2   . ILE A 1 578 ? 3.223   -10.485 107.756 1.00 20.00 ? 578 ILE A CG2   1 
ATOM 4252 C CD1   . ILE A 1 578 ? 3.282   -9.710  110.550 1.00 20.00 ? 578 ILE A CD1   1 
ATOM 4253 N N     . THR A 1 579 ? 5.251   -10.765 105.269 1.00 12.00 ? 579 THR A N     1 
ATOM 4254 C CA    . THR A 1 579 ? 4.827   -10.576 103.881 1.00 12.00 ? 579 THR A CA    1 
ATOM 4255 C C     . THR A 1 579 ? 3.684   -11.521 103.585 1.00 12.00 ? 579 THR A C     1 
ATOM 4256 O O     . THR A 1 579 ? 3.893   -12.716 103.348 1.00 12.00 ? 579 THR A O     1 
ATOM 4257 C CB    . THR A 1 579 ? 5.953   -10.827 102.890 1.00 12.00 ? 579 THR A CB    1 
ATOM 4258 O OG1   . THR A 1 579 ? 6.874   -9.755  102.925 1.00 20.00 ? 579 THR A OG1   1 
ATOM 4259 C CG2   . THR A 1 579 ? 5.448   -10.937 101.449 1.00 20.00 ? 579 THR A CG2   1 
ATOM 4260 N N     . ARG A 1 580 ? 2.517   -10.934 103.624 1.00 12.00 ? 580 ARG A N     1 
ATOM 4261 C CA    . ARG A 1 580 ? 1.270   -11.636 103.379 1.00 12.00 ? 580 ARG A CA    1 
ATOM 4262 C C     . ARG A 1 580 ? 0.154   -11.023 104.208 1.00 12.00 ? 580 ARG A C     1 
ATOM 4263 O O     . ARG A 1 580 ? -0.945  -11.578 104.304 1.00 12.00 ? 580 ARG A O     1 
ATOM 4264 C CB    . ARG A 1 580 ? 1.413   -13.103 103.766 1.00 12.00 ? 580 ARG A CB    1 
ATOM 4265 C CG    . ARG A 1 580 ? 2.241   -13.904 102.770 1.00 12.00 ? 580 ARG A CG    1 
ATOM 4266 C CD    . ARG A 1 580 ? 1.559   -15.197 102.335 1.00 12.00 ? 580 ARG A CD    1 
ATOM 4267 N NE    . ARG A 1 580 ? 2.395   -16.017 101.457 1.00 20.00 ? 580 ARG A NE    1 
ATOM 4268 C CZ    . ARG A 1 580 ? 2.183   -17.313 101.224 1.00 20.00 ? 580 ARG A CZ    1 
ATOM 4269 N NH1   . ARG A 1 580 ? 1.164   -17.957 101.798 1.00 20.00 ? 580 ARG A NH1   1 
ATOM 4270 N NH2   . ARG A 1 580 ? 2.944   -18.062 100.423 1.00 20.00 ? 580 ARG A NH2   1 
ATOM 4271 N N     . PRO A 1 581 ? 0.371   -9.874  104.843 1.00 12.00 ? 581 PRO A N     1 
ATOM 4272 C CA    . PRO A 1 581 ? -0.661  -9.256  105.642 1.00 12.00 ? 581 PRO A CA    1 
ATOM 4273 C C     . PRO A 1 581 ? -1.863  -8.915  104.800 1.00 12.00 ? 581 PRO A C     1 
ATOM 4274 O O     . PRO A 1 581 ? -1.927  -7.777  104.252 1.00 12.00 ? 581 PRO A O     1 
ATOM 4275 C CB    . PRO A 1 581 ? -0.006  -8.011  106.179 1.00 12.00 ? 581 PRO A CB    1 
ATOM 4276 C CG    . PRO A 1 581 ? 1.411   -7.962  105.644 1.00 12.00 ? 581 PRO A CG    1 
ATOM 4277 C CD    . PRO A 1 581 ? 1.642   -9.161  104.786 1.00 20.00 ? 581 PRO A CD    1 
ATOM 4278 N N     . VAL A 1 582 ? -2.791  -9.863  104.696 1.00 12.00 ? 582 VAL A N     1 
ATOM 4279 C CA    . VAL A 1 582 ? -4.039  -9.645  103.934 1.00 12.00 ? 582 VAL A CA    1 
ATOM 4280 C C     . VAL A 1 582 ? -4.730  -10.973 103.564 1.00 12.00 ? 582 VAL A C     1 
ATOM 4281 O O     . VAL A 1 582 ? -4.106  -11.872 102.983 1.00 12.00 ? 582 VAL A O     1 
ATOM 4282 C CB    . VAL A 1 582 ? -3.739  -8.848  102.672 1.00 12.00 ? 582 VAL A CB    1 
ATOM 4283 C CG1   . VAL A 1 582 ? -4.966  -8.136  102.115 1.00 20.00 ? 582 VAL A CG1   1 
ATOM 4284 C CG2   . VAL A 1 582 ? -2.698  -7.753  102.899 1.00 20.00 ? 582 VAL A CG2   1 
ATOM 4285 N N     . ALA A 1 583 ? -6.011  -10.989 103.927 1.00 12.00 ? 583 ALA A N     1 
ATOM 4286 C CA    . ALA A 1 583 ? -6.958  -12.117 103.751 1.00 12.00 ? 583 ALA A CA    1 
ATOM 4287 C C     . ALA A 1 583 ? -6.932  -12.676 102.329 1.00 12.00 ? 583 ALA A C     1 
ATOM 4288 O O     . ALA A 1 583 ? -6.115  -12.267 101.498 1.00 12.00 ? 583 ALA A O     1 
ATOM 4289 C CB    . ALA A 1 583 ? -8.381  -11.647 104.040 1.00 12.00 ? 583 ALA A CB    1 
ATOM 4290 N N     . ARG A 1 584 ? -7.850  -13.612 102.080 1.00 12.00 ? 584 ARG A N     1 
ATOM 4291 C CA    . ARG A 1 584 ? -7.934  -14.284 100.775 1.00 12.00 ? 584 ARG A CA    1 
ATOM 4292 C C     . ARG A 1 584 ? -9.142  -15.231 100.646 1.00 12.00 ? 584 ARG A C     1 
ATOM 4293 O O     . ARG A 1 584 ? -9.179  -16.106 99.774  1.00 12.00 ? 584 ARG A O     1 
ATOM 4294 C CB    . ARG A 1 584 ? -6.688  -15.135 100.571 1.00 12.00 ? 584 ARG A CB    1 
ATOM 4295 C CG    . ARG A 1 584 ? -6.273  -15.259 99.114  1.00 12.00 ? 584 ARG A CG    1 
ATOM 4296 C CD    . ARG A 1 584 ? -5.016  -16.103 98.929  1.00 12.00 ? 584 ARG A CD    1 
ATOM 4297 N NE    . ARG A 1 584 ? -5.232  -17.522 99.218  1.00 12.00 ? 584 ARG A NE    1 
ATOM 4298 C CZ    . ARG A 1 584 ? -4.290  -18.460 99.100  1.00 12.00 ? 584 ARG A CZ    1 
ATOM 4299 N NH1   . ARG A 1 584 ? -3.054  -18.146 98.702  1.00 12.00 ? 584 ARG A NH1   1 
ATOM 4300 N NH2   . ARG A 1 584 ? -4.487  -19.755 99.357  1.00 12.00 ? 584 ARG A NH2   1 
ATOM 4301 N N     . ASN A 1 585 ? -10.133 -15.063 101.499 1.00 12.00 ? 585 ASN A N     1 
ATOM 4302 C CA    . ASN A 1 585 ? -11.334 -15.922 101.467 1.00 12.00 ? 585 ASN A CA    1 
ATOM 4303 C C     . ASN A 1 585 ? -10.997 -17.255 100.790 1.00 12.00 ? 585 ASN A C     1 
ATOM 4304 O O     . ASN A 1 585 ? -11.094 -17.391 99.564  1.00 12.00 ? 585 ASN A O     1 
ATOM 4305 C CB    . ASN A 1 585 ? -12.452 -15.239 100.678 1.00 12.00 ? 585 ASN A CB    1 
ATOM 4306 C CG    . ASN A 1 585 ? -13.799 -15.955 100.794 1.00 12.00 ? 585 ASN A CG    1 
ATOM 4307 O OD1   . ASN A 1 585 ? -14.325 -16.097 101.892 1.00 20.00 ? 585 ASN A OD1   1 
ATOM 4308 N ND2   . ASN A 1 585 ? -14.396 -16.418 99.717  1.00 20.00 ? 585 ASN A ND2   1 
ATOM 4309 N N     . THR A 1 586 ? -10.604 -18.202 101.623 1.00 12.00 ? 586 THR A N     1 
ATOM 4310 C CA    . THR A 1 586 ? -10.205 -19.548 101.183 1.00 12.00 ? 586 THR A CA    1 
ATOM 4311 C C     . THR A 1 586 ? -11.396 -20.277 100.554 1.00 12.00 ? 586 THR A C     1 
ATOM 4312 O O     . THR A 1 586 ? -11.352 -20.681 99.387  1.00 12.00 ? 586 THR A O     1 
ATOM 4313 C CB    . THR A 1 586 ? -9.663  -20.339 102.366 1.00 12.00 ? 586 THR A CB    1 
ATOM 4314 O OG1   . THR A 1 586 ? -8.658  -19.590 103.026 1.00 20.00 ? 586 THR A OG1   1 
ATOM 4315 C CG2   . THR A 1 586 ? -9.040  -21.669 101.958 1.00 20.00 ? 586 THR A CG2   1 
ATOM 4316 N N     . TYR A 1 587 ? -12.450 -20.449 101.336 1.00 12.00 ? 587 TYR A N     1 
ATOM 4317 C CA    . TYR A 1 587 ? -13.677 -21.091 100.837 1.00 12.00 ? 587 TYR A CA    1 
ATOM 4318 C C     . TYR A 1 587 ? -14.884 -20.166 101.001 1.00 12.00 ? 587 TYR A C     1 
ATOM 4319 O O     . TYR A 1 587 ? -15.516 -19.763 100.018 1.00 12.00 ? 587 TYR A O     1 
ATOM 4320 C CB    . TYR A 1 587 ? -13.985 -22.402 101.541 1.00 12.00 ? 587 TYR A CB    1 
ATOM 4321 C CG    . TYR A 1 587 ? -15.015 -23.221 100.759 1.00 12.00 ? 587 TYR A CG    1 
ATOM 4322 C CD1   . TYR A 1 587 ? -14.609 -24.029 99.694  1.00 12.00 ? 587 TYR A CD1   1 
ATOM 4323 C CD2   . TYR A 1 587 ? -16.369 -23.153 101.097 1.00 12.00 ? 587 TYR A CD2   1 
ATOM 4324 C CE1   . TYR A 1 587 ? -15.549 -24.764 98.970  1.00 12.00 ? 587 TYR A CE1   1 
ATOM 4325 C CE2   . TYR A 1 587 ? -17.310 -23.890 100.373 1.00 12.00 ? 587 TYR A CE2   1 
ATOM 4326 C CZ    . TYR A 1 587 ? -16.900 -24.694 99.310  1.00 12.00 ? 587 TYR A CZ    1 
ATOM 4327 O OH    . TYR A 1 587 ? -17.815 -25.408 98.608  1.00 12.00 ? 587 TYR A OH    1 
ATOM 4328 O OXT   . TYR A 1 587 ? -15.082 -20.039 100.809 1.00 12.00 ? 587 TYR A OXT   1 
ATOM 4329 O OP3   . DC  B 2 1   ? 27.467  6.761   78.383  1.00 12.00 ? 1   DC  B OP3   1 
ATOM 4330 P P     . DC  B 2 1   ? 26.201  7.313   77.606  1.00 12.00 ? 1   DC  B P     1 
ATOM 4331 O OP1   . DC  B 2 1   ? 26.532  7.514   76.183  1.00 12.00 ? 1   DC  B OP1   1 
ATOM 4332 O OP2   . DC  B 2 1   ? 25.040  6.436   77.845  1.00 12.00 ? 1   DC  B OP2   1 
ATOM 4333 O "O5'" . DC  B 2 1   ? 25.977  8.730   78.302  1.00 12.00 ? 1   DC  B "O5'" 1 
ATOM 4334 C "C5'" . DC  B 2 1   ? 25.720  8.754   79.713  1.00 12.00 ? 1   DC  B "C5'" 1 
ATOM 4335 C "C4'" . DC  B 2 1   ? 25.534  10.190  80.186  1.00 12.00 ? 1   DC  B "C4'" 1 
ATOM 4336 O "O4'" . DC  B 2 1   ? 26.728  10.940  79.826  1.00 12.00 ? 1   DC  B "O4'" 1 
ATOM 4337 C "C3'" . DC  B 2 1   ? 24.395  10.958  79.547  1.00 12.00 ? 1   DC  B "C3'" 1 
ATOM 4338 O "O3'" . DC  B 2 1   ? 23.737  11.800  80.474  1.00 12.00 ? 1   DC  B "O3'" 1 
ATOM 4339 C "C2'" . DC  B 2 1   ? 25.111  11.747  78.470  1.00 12.00 ? 1   DC  B "C2'" 1 
ATOM 4340 C "C1'" . DC  B 2 1   ? 26.370  12.095  79.073  1.00 12.00 ? 1   DC  B "C1'" 1 
ATOM 4341 N N1    . DC  B 2 1   ? 27.520  12.458  78.223  1.00 12.00 ? 1   DC  B N1    1 
ATOM 4342 C C2    . DC  B 2 1   ? 27.397  13.569  77.391  1.00 12.00 ? 1   DC  B C2    1 
ATOM 4343 O O2    . DC  B 2 1   ? 26.337  14.203  77.396  1.00 12.00 ? 1   DC  B O2    1 
ATOM 4344 N N3    . DC  B 2 1   ? 28.441  13.921  76.601  1.00 12.00 ? 1   DC  B N3    1 
ATOM 4345 C C4    . DC  B 2 1   ? 29.569  13.207  76.627  1.00 12.00 ? 1   DC  B C4    1 
ATOM 4346 N N4    . DC  B 2 1   ? 30.556  13.583  75.846  1.00 12.00 ? 1   DC  B N4    1 
ATOM 4347 C C5    . DC  B 2 1   ? 29.721  12.059  77.475  1.00 12.00 ? 1   DC  B C5    1 
ATOM 4348 C C6    . DC  B 2 1   ? 28.673  11.728  78.250  1.00 12.00 ? 1   DC  B C6    1 
ATOM 4349 P P     . DC  B 2 2   ? 22.606  11.191  81.393  1.00 12.00 ? 2   DC  B P     1 
ATOM 4350 O OP1   . DC  B 2 2   ? 23.211  10.419  82.494  1.00 12.00 ? 2   DC  B OP1   1 
ATOM 4351 O OP2   . DC  B 2 2   ? 21.640  10.439  80.571  1.00 12.00 ? 2   DC  B OP2   1 
ATOM 4352 O "O5'" . DC  B 2 2   ? 21.904  12.492  81.960  1.00 12.00 ? 2   DC  B "O5'" 1 
ATOM 4353 C "C5'" . DC  B 2 2   ? 22.442  13.101  83.145  1.00 12.00 ? 2   DC  B "C5'" 1 
ATOM 4354 C "C4'" . DC  B 2 2   ? 21.328  13.826  83.857  1.00 12.00 ? 2   DC  B "C4'" 1 
ATOM 4355 O "O4'" . DC  B 2 2   ? 21.901  14.644  84.925  1.00 12.00 ? 2   DC  B "O4'" 1 
ATOM 4356 C "C3'" . DC  B 2 2   ? 20.532  14.778  82.985  1.00 12.00 ? 2   DC  B "C3'" 1 
ATOM 4357 O "O3'" . DC  B 2 2   ? 19.180  14.704  83.271  1.00 12.00 ? 2   DC  B "O3'" 1 
ATOM 4358 C "C2'" . DC  B 2 2   ? 21.161  16.109  83.300  1.00 12.00 ? 2   DC  B "C2'" 1 
ATOM 4359 C "C1'" . DC  B 2 2   ? 21.444  15.968  84.775  1.00 12.00 ? 2   DC  B "C1'" 1 
ATOM 4360 N N1    . DC  B 2 2   ? 22.452  16.879  85.385  1.00 12.00 ? 2   DC  B N1    1 
ATOM 4361 C C2    . DC  B 2 2   ? 23.272  17.626  84.539  1.00 12.00 ? 2   DC  B C2    1 
ATOM 4362 O O2    . DC  B 2 2   ? 23.131  17.512  83.317  1.00 12.00 ? 2   DC  B O2    1 
ATOM 4363 N N3    . DC  B 2 2   ? 24.200  18.457  85.082  1.00 12.00 ? 2   DC  B N3    1 
ATOM 4364 C C4    . DC  B 2 2   ? 24.316  18.556  86.407  1.00 12.00 ? 2   DC  B C4    1 
ATOM 4365 N N4    . DC  B 2 2   ? 25.231  19.368  86.892  1.00 12.00 ? 2   DC  B N4    1 
ATOM 4366 C C5    . DC  B 2 2   ? 23.477  17.810  87.298  1.00 12.00 ? 2   DC  B C5    1 
ATOM 4367 C C6    . DC  B 2 2   ? 22.566  16.991  86.741  1.00 12.00 ? 2   DC  B C6    1 
ATOM 4368 P P     . DA  B 2 3   ? 18.475  13.322  83.044  1.00 12.00 ? 3   DA  B P     1 
ATOM 4369 O OP1   . DA  B 2 3   ? 19.279  12.239  83.637  1.00 12.00 ? 3   DA  B OP1   1 
ATOM 4370 O OP2   . DA  B 2 3   ? 18.130  13.160  81.620  1.00 12.00 ? 3   DA  B OP2   1 
ATOM 4371 O "O5'" . DA  B 2 3   ? 17.178  13.481  83.862  1.00 12.00 ? 3   DA  B "O5'" 1 
ATOM 4372 C "C5'" . DA  B 2 3   ? 16.191  14.271  83.300  1.00 12.00 ? 3   DA  B "C5'" 1 
ATOM 4373 C "C4'" . DA  B 2 3   ? 15.543  15.055  84.362  1.00 12.00 ? 3   DA  B "C4'" 1 
ATOM 4374 O "O4'" . DA  B 2 3   ? 16.052  16.416  84.269  1.00 12.00 ? 3   DA  B "O4'" 1 
ATOM 4375 C "C3'" . DA  B 2 3   ? 14.060  15.119  84.256  1.00 12.00 ? 3   DA  B "C3'" 1 
ATOM 4376 O "O3'" . DA  B 2 3   ? 13.453  15.023  85.505  1.00 12.00 ? 3   DA  B "O3'" 1 
ATOM 4377 C "C2'" . DA  B 2 3   ? 13.854  16.439  83.546  1.00 12.00 ? 3   DA  B "C2'" 1 
ATOM 4378 C "C1'" . DA  B 2 3   ? 14.971  17.290  84.131  1.00 12.00 ? 3   DA  B "C1'" 1 
ATOM 4379 N N9    . DA  B 2 3   ? 15.447  18.497  83.384  1.00 12.00 ? 3   DA  B N9    1 
ATOM 4380 C C8    . DA  B 2 3   ? 15.012  19.781  83.493  1.00 12.00 ? 3   DA  B C8    1 
ATOM 4381 N N7    . DA  B 2 3   ? 15.630  20.620  82.712  1.00 12.00 ? 3   DA  B N7    1 
ATOM 4382 C C5    . DA  B 2 3   ? 16.536  19.838  82.037  1.00 12.00 ? 3   DA  B C5    1 
ATOM 4383 C C6    . DA  B 2 3   ? 17.507  20.117  81.056  1.00 12.00 ? 3   DA  B C6    1 
ATOM 4384 N N6    . DA  B 2 3   ? 17.726  21.353  80.573  1.00 12.00 ? 3   DA  B N6    1 
ATOM 4385 N N1    . DA  B 2 3   ? 18.237  19.101  80.595  1.00 12.00 ? 3   DA  B N1    1 
ATOM 4386 C C2    . DA  B 2 3   ? 18.016  17.876  81.079  1.00 12.00 ? 3   DA  B C2    1 
ATOM 4387 N N3    . DA  B 2 3   ? 17.148  17.488  81.993  1.00 12.00 ? 3   DA  B N3    1 
ATOM 4388 C C4    . DA  B 2 3   ? 16.437  18.535  82.432  1.00 12.00 ? 3   DA  B C4    1 
ATOM 4389 P P     . DC  B 2 4   ? 12.094  14.243  85.623  1.00 12.00 ? 4   DC  B P     1 
ATOM 4390 O OP1   . DC  B 2 4   ? 12.344  12.789  85.641  1.00 12.00 ? 4   DC  B OP1   1 
ATOM 4391 O OP2   . DC  B 2 4   ? 11.167  14.686  84.565  1.00 12.00 ? 4   DC  B OP2   1 
ATOM 4392 O "O5'" . DC  B 2 4   ? 11.592  14.721  87.043  1.00 12.00 ? 4   DC  B "O5'" 1 
ATOM 4393 C "C5'" . DC  B 2 4   ? 12.597  14.999  88.028  1.00 12.00 ? 4   DC  B "C5'" 1 
ATOM 4394 C "C4'" . DC  B 2 4   ? 12.127  16.102  88.947  1.00 12.00 ? 4   DC  B "C4'" 1 
ATOM 4395 O "O4'" . DC  B 2 4   ? 11.746  17.244  88.119  1.00 12.00 ? 4   DC  B "O4'" 1 
ATOM 4396 C "C3'" . DC  B 2 4   ? 10.901  15.766  89.787  1.00 12.00 ? 4   DC  B "C3'" 1 
ATOM 4397 O "O3'" . DC  B 2 4   ? 10.978  16.325  91.085  1.00 12.00 ? 4   DC  B "O3'" 1 
ATOM 4398 C "C2'" . DC  B 2 4   ? 9.786   16.351  88.965  1.00 12.00 ? 4   DC  B "C2'" 1 
ATOM 4399 C "C1'" . DC  B 2 4   ? 10.432  17.616  88.442  1.00 12.00 ? 4   DC  B "C1'" 1 
ATOM 4400 N N1    . DC  B 2 4   ? 9.818   18.249  87.247  1.00 12.00 ? 4   DC  B N1    1 
ATOM 4401 C C2    . DC  B 2 4   ? 8.980   19.342  87.442  1.00 12.00 ? 4   DC  B C2    1 
ATOM 4402 O O2    . DC  B 2 4   ? 8.780   19.742  88.593  1.00 12.00 ? 4   DC  B O2    1 
ATOM 4403 N N3    . DC  B 2 4   ? 8.406   19.937  86.363  1.00 12.00 ? 4   DC  B N3    1 
ATOM 4404 C C4    . DC  B 2 4   ? 8.649   19.472  85.136  1.00 12.00 ? 4   DC  B C4    1 
ATOM 4405 N N4    . DC  B 2 4   ? 8.073   20.077  84.119  1.00 12.00 ? 4   DC  B N4    1 
ATOM 4406 C C5    . DC  B 2 4   ? 9.508   18.346  84.907  1.00 12.00 ? 4   DC  B C5    1 
ATOM 4407 C C6    . DC  B 2 4   ? 10.066  17.773  85.991  1.00 12.00 ? 4   DC  B C6    1 
ATOM 4408 P P     . DC  B 2 5   ? 9.932   15.775  92.168  1.00 12.00 ? 5   DC  B P     1 
ATOM 4409 O OP1   . DC  B 2 5   ? 8.763   15.141  91.534  1.00 12.00 ? 5   DC  B OP1   1 
ATOM 4410 O OP2   . DC  B 2 5   ? 9.604   16.847  93.127  1.00 12.00 ? 5   DC  B OP2   1 
ATOM 4411 O "O5'" . DC  B 2 5   ? 10.827  14.675  92.886  1.00 12.00 ? 5   DC  B "O5'" 1 
ATOM 4412 C "C5'" . DC  B 2 5   ? 11.299  13.577  92.098  1.00 12.00 ? 5   DC  B "C5'" 1 
ATOM 4413 C "C4'" . DC  B 2 5   ? 12.268  12.738  92.913  1.00 12.00 ? 5   DC  B "C4'" 1 
ATOM 4414 O "O4'" . DC  B 2 5   ? 12.016  13.003  94.319  1.00 12.00 ? 5   DC  B "O4'" 1 
ATOM 4415 C "C3'" . DC  B 2 5   ? 12.119  11.237  92.783  1.00 12.00 ? 5   DC  B "C3'" 1 
ATOM 4416 O "O3'" . DC  B 2 5   ? 12.786  10.735  91.642  1.00 12.00 ? 5   DC  B "O3'" 1 
ATOM 4417 C "C2'" . DC  B 2 5   ? 12.694  10.750  94.096  1.00 12.00 ? 5   DC  B "C2'" 1 
ATOM 4418 C "C1'" . DC  B 2 5   ? 12.197  11.812  95.071  1.00 12.00 ? 5   DC  B "C1'" 1 
ATOM 4419 N N1    . DC  B 2 5   ? 10.915  11.492  95.730  1.00 12.00 ? 5   DC  B N1    1 
ATOM 4420 C C2    . DC  B 2 5   ? 10.823  11.672  97.102  1.00 12.00 ? 5   DC  B C2    1 
ATOM 4421 O O2    . DC  B 2 5   ? 11.812  12.089  97.717  1.00 12.00 ? 5   DC  B O2    1 
ATOM 4422 N N3    . DC  B 2 5   ? 9.654   11.388  97.729  1.00 12.00 ? 5   DC  B N3    1 
ATOM 4423 C C4    . DC  B 2 5   ? 8.611   10.940  97.026  1.00 12.00 ? 5   DC  B C4    1 
ATOM 4424 N N4    . DC  B 2 5   ? 7.496   10.677  97.673  1.00 12.00 ? 5   DC  B N4    1 
ATOM 4425 C C5    . DC  B 2 5   ? 8.680   10.743  95.607  1.00 12.00 ? 5   DC  B C5    1 
ATOM 4426 C C6    . DC  B 2 5   ? 9.850   11.033  95.008  1.00 12.00 ? 5   DC  B C6    1 
ATOM 4427 P P     . DC  B 2 6   ? 11.995  10.184  90.408  1.00 12.00 ? 6   DC  B P     1 
ATOM 4428 O OP1   . DC  B 2 6   ? 12.373  10.985  89.229  1.00 12.00 ? 6   DC  B OP1   1 
ATOM 4429 O OP2   . DC  B 2 6   ? 10.553  10.193  90.719  1.00 12.00 ? 6   DC  B OP2   1 
ATOM 4430 O "O5'" . DC  B 2 6   ? 12.488  8.678   90.233  1.00 12.00 ? 6   DC  B "O5'" 1 
ATOM 4431 C "C5'" . DC  B 2 6   ? 13.610  8.243   91.013  1.00 12.00 ? 6   DC  B "C5'" 1 
ATOM 4432 C "C4'" . DC  B 2 6   ? 13.909  6.779   90.725  1.00 12.00 ? 6   DC  B "C4'" 1 
ATOM 4433 O "O4'" . DC  B 2 6   ? 12.900  5.973   91.393  1.00 12.00 ? 6   DC  B "O4'" 1 
ATOM 4434 C "C3'" . DC  B 2 6   ? 13.827  6.357   89.273  1.00 12.00 ? 6   DC  B "C3'" 1 
ATOM 4435 O "O3'" . DC  B 2 6   ? 15.022  6.651   88.571  1.00 12.00 ? 6   DC  B "O3'" 1 
ATOM 4436 C "C2'" . DC  B 2 6   ? 13.530  4.877   89.395  1.00 12.00 ? 6   DC  B "C2'" 1 
ATOM 4437 C "C1'" . DC  B 2 6   ? 12.583  4.840   90.594  1.00 12.00 ? 6   DC  B "C1'" 1 
ATOM 4438 N N1    . DC  B 2 6   ? 11.142  4.909   90.262  1.00 12.00 ? 6   DC  B N1    1 
ATOM 4439 C C2    . DC  B 2 6   ? 10.507  3.745   89.855  1.00 12.00 ? 6   DC  B C2    1 
ATOM 4440 O O2    . DC  B 2 6   ? 11.164  2.700   89.780  1.00 12.00 ? 6   DC  B O2    1 
ATOM 4441 N N3    . DC  B 2 6   ? 9.185   3.785   89.550  1.00 12.00 ? 6   DC  B N3    1 
ATOM 4442 C C4    . DC  B 2 6   ? 8.512   4.935   89.644  1.00 12.00 ? 6   DC  B C4    1 
ATOM 4443 N N4    . DC  B 2 6   ? 7.233   4.930   89.339  1.00 12.00 ? 6   DC  B N4    1 
ATOM 4444 C C5    . DC  B 2 6   ? 9.144   6.151   90.062  1.00 12.00 ? 6   DC  B C5    1 
ATOM 4445 C C6    . DC  B 2 6   ? 10.455  6.086   90.359  1.00 12.00 ? 6   DC  B C6    1 
ATOM 4446 P P     . DC  B 2 7   ? 14.940  7.072   87.044  1.00 12.00 ? 7   DC  B P     1 
ATOM 4447 O OP1   . DC  B 2 7   ? 16.255  7.551   86.580  1.00 12.00 ? 7   DC  B OP1   1 
ATOM 4448 O OP2   . DC  B 2 7   ? 13.823  8.016   86.841  1.00 12.00 ? 7   DC  B OP2   1 
ATOM 4449 O "O5'" . DC  B 2 7   ? 14.591  5.697   86.340  1.00 12.00 ? 7   DC  B "O5'" 1 
ATOM 4450 C "C5'" . DC  B 2 7   ? 15.661  4.782   86.091  1.00 12.00 ? 7   DC  B "C5'" 1 
ATOM 4451 C "C4'" . DC  B 2 7   ? 15.094  3.446   85.664  1.00 12.00 ? 7   DC  B "C4'" 1 
ATOM 4452 O "O4'" . DC  B 2 7   ? 13.987  3.112   86.555  1.00 12.00 ? 7   DC  B "O4'" 1 
ATOM 4453 C "C3'" . DC  B 2 7   ? 14.516  3.391   84.265  1.00 12.00 ? 7   DC  B "C3'" 1 
ATOM 4454 O "O3'" . DC  B 2 7   ? 15.512  3.079   83.274  1.00 12.00 ? 7   DC  B "O3'" 1 
ATOM 4455 C "C2'" . DC  B 2 7   ? 13.499  2.256   84.393  1.00 12.00 ? 7   DC  B "C2'" 1 
ATOM 4456 C "C1'" . DC  B 2 7   ? 12.970  2.430   85.826  1.00 12.00 ? 7   DC  B "C1'" 1 
ATOM 4457 N N1    . DC  B 2 7   ? 11.706  3.204   85.963  1.00 12.00 ? 7   DC  B N1    1 
ATOM 4458 C C2    . DC  B 2 7   ? 10.509  2.498   86.007  1.00 12.00 ? 7   DC  B C2    1 
ATOM 4459 O O2    . DC  B 2 7   ? 10.543  1.265   85.922  1.00 12.00 ? 7   DC  B O2    1 
ATOM 4460 N N3    . DC  B 2 7   ? 9.341   3.179   86.142  1.00 12.00 ? 7   DC  B N3    1 
ATOM 4461 C C4    . DC  B 2 7   ? 9.346   4.509   86.231  1.00 12.00 ? 7   DC  B C4    1 
ATOM 4462 N N4    . DC  B 2 7   ? 8.193   5.128   86.359  1.00 12.00 ? 7   DC  B N4    1 
ATOM 4463 C C5    . DC  B 2 7   ? 10.566  5.266   86.191  1.00 12.00 ? 7   DC  B C5    1 
ATOM 4464 C C6    . DC  B 2 7   ? 11.715  4.570   86.058  1.00 12.00 ? 7   DC  B C6    1 
ATOM 4465 P P     . DA  B 2 8   ? 16.466  4.252   82.533  1.00 12.00 ? 8   DA  B P     1 
ATOM 4466 O OP1   . DA  B 2 8   ? 16.944  3.717   81.247  1.00 12.00 ? 8   DA  B OP1   1 
ATOM 4467 O OP2   . DA  B 2 8   ? 17.447  4.725   83.525  1.00 12.00 ? 8   DA  B OP2   1 
ATOM 4468 O "O5'" . DA  B 2 8   ? 15.354  5.320   82.133  1.00 12.00 ? 8   DA  B "O5'" 1 
ATOM 4469 C "C5'" . DA  B 2 8   ? 15.710  6.355   81.201  1.00 12.00 ? 8   DA  B "C5'" 1 
ATOM 4470 C "C4'" . DA  B 2 8   ? 14.614  7.412   81.178  1.00 12.00 ? 8   DA  B "C4'" 1 
ATOM 4471 O "O4'" . DA  B 2 8   ? 13.356  6.716   80.917  1.00 12.00 ? 8   DA  B "O4'" 1 
ATOM 4472 C "C3'" . DA  B 2 8   ? 14.420  8.163   82.491  1.00 12.00 ? 8   DA  B "C3'" 1 
ATOM 4473 O "O3'" . DA  B 2 8   ? 14.111  9.541   82.321  1.00 12.00 ? 8   DA  B "O3'" 1 
ATOM 4474 C "C2'" . DA  B 2 8   ? 13.289  7.393   83.134  1.00 12.00 ? 8   DA  B "C2'" 1 
ATOM 4475 C "C1'" . DA  B 2 8   ? 12.431  7.047   81.932  1.00 12.00 ? 8   DA  B "C1'" 1 
ATOM 4476 N N9    . DA  B 2 8   ? 11.482  5.913   82.077  1.00 12.00 ? 8   DA  B N9    1 
ATOM 4477 C C8    . DA  B 2 8   ? 11.715  4.592   81.865  1.00 12.00 ? 8   DA  B C8    1 
ATOM 4478 N N7    . DA  B 2 8   ? 10.684  3.831   82.071  1.00 12.00 ? 8   DA  B N7    1 
ATOM 4479 C C5    . DA  B 2 8   ? 9.696   4.708   82.447  1.00 12.00 ? 8   DA  B C5    1 
ATOM 4480 C C6    . DA  B 2 8   ? 8.347   4.540   82.806  1.00 12.00 ? 8   DA  B C6    1 
ATOM 4481 N N6    . DA  B 2 8   ? 7.740   3.339   82.835  1.00 12.00 ? 8   DA  B N6    1 
ATOM 4482 N N1    . DA  B 2 8   ? 7.649   5.630   83.130  1.00 12.00 ? 8   DA  B N1    1 
ATOM 4483 C C2    . DA  B 2 8   ? 8.257   6.818   83.099  1.00 12.00 ? 8   DA  B C2    1 
ATOM 4484 N N3    . DA  B 2 8   ? 9.503   7.105   82.781  1.00 12.00 ? 8   DA  B N3    1 
ATOM 4485 C C4    . DA  B 2 8   ? 10.167  5.989   82.461  1.00 12.00 ? 8   DA  B C4    1 
ATOM 4486 P P     . DA  B 2 9   ? 14.427  10.527  83.530  1.00 12.00 ? 9   DA  B P     1 
ATOM 4487 O OP1   . DA  B 2 9   ? 15.882  10.622  83.737  1.00 12.00 ? 9   DA  B OP1   1 
ATOM 4488 O OP2   . DA  B 2 9   ? 13.652  10.138  84.718  1.00 12.00 ? 9   DA  B OP2   1 
ATOM 4489 O "O5'" . DA  B 2 9   ? 13.880  11.929  83.019  1.00 12.00 ? 9   DA  B "O5'" 1 
ATOM 4490 C "C5'" . DA  B 2 9   ? 14.489  12.500  81.871  1.00 12.00 ? 9   DA  B "C5'" 1 
ATOM 4491 C "C4'" . DA  B 2 9   ? 13.526  12.403  80.717  1.00 12.00 ? 9   DA  B "C4'" 1 
ATOM 4492 O "O4'" . DA  B 2 9   ? 12.623  13.541  80.810  1.00 12.00 ? 9   DA  B "O4'" 1 
ATOM 4493 C "C3'" . DA  B 2 9   ? 14.166  12.469  79.354  1.00 12.00 ? 9   DA  B "C3'" 1 
ATOM 4494 O "O3'" . DA  B 2 9   ? 13.531  11.598  78.470  1.00 12.00 ? 9   DA  B "O3'" 1 
ATOM 4495 C "C2'" . DA  B 2 9   ? 13.998  13.929  78.995  1.00 12.00 ? 9   DA  B "C2'" 1 
ATOM 4496 C "C1'" . DA  B 2 9   ? 12.637  14.232  79.585  1.00 12.00 ? 9   DA  B "C1'" 1 
ATOM 4497 N N9    . DA  B 2 9   ? 12.336  15.648  79.866  1.00 12.00 ? 9   DA  B N9    1 
ATOM 4498 C C8    . DA  B 2 9   ? 11.246  16.177  80.478  1.00 12.00 ? 9   DA  B C8    1 
ATOM 4499 N N7    . DA  B 2 9   ? 11.289  17.468  80.600  1.00 12.00 ? 9   DA  B N7    1 
ATOM 4500 C C5    . DA  B 2 9   ? 12.489  17.812  80.025  1.00 12.00 ? 9   DA  B C5    1 
ATOM 4501 C C6    . DA  B 2 9   ? 13.155  19.036  79.841  1.00 12.00 ? 9   DA  B C6    1 
ATOM 4502 N N6    . DA  B 2 9   ? 12.666  20.212  80.273  1.00 12.00 ? 9   DA  B N6    1 
ATOM 4503 N N1    . DA  B 2 9   ? 14.332  19.018  79.209  1.00 12.00 ? 9   DA  B N1    1 
ATOM 4504 C C2    . DA  B 2 9   ? 14.818  17.849  78.784  1.00 12.00 ? 9   DA  B C2    1 
ATOM 4505 N N3    . DA  B 2 9   ? 14.301  16.645  78.902  1.00 12.00 ? 9   DA  B N3    1 
ATOM 4506 C C4    . DA  B 2 9   ? 13.134  16.707  79.550  1.00 12.00 ? 9   DA  B C4    1 
ATOM 4507 P P     . DC  B 2 10  ? 14.038  11.479  76.990  1.00 12.00 ? 10  DC  B P     1 
ATOM 4508 O OP1   . DC  B 2 10  ? 14.949  10.319  76.878  1.00 12.00 ? 10  DC  B OP1   1 
ATOM 4509 O OP2   . DC  B 2 10  ? 14.633  12.753  76.555  1.00 12.00 ? 10  DC  B OP2   1 
ATOM 4510 O "O5'" . DC  B 2 10  ? 12.644  11.213  76.298  1.00 12.00 ? 10  DC  B "O5'" 1 
ATOM 4511 C "C5'" . DC  B 2 10  ? 11.694  10.509  77.107  1.00 12.00 ? 10  DC  B "C5'" 1 
ATOM 4512 C "C4'" . DC  B 2 10  ? 12.453  9.424   77.850  1.00 12.00 ? 10  DC  B "C4'" 1 
ATOM 4513 O "O4'" . DC  B 2 10  ? 11.568  8.777   78.805  1.00 12.00 ? 10  DC  B "O4'" 1 
ATOM 4514 C "C3'" . DC  B 2 10  ? 12.963  8.311   76.976  1.00 12.00 ? 10  DC  B "C3'" 1 
ATOM 4515 O "O3'" . DC  B 2 10  ? 14.182  8.659   76.344  1.00 12.00 ? 10  DC  B "O3'" 1 
ATOM 4516 C "C2'" . DC  B 2 10  ? 13.085  7.170   77.961  1.00 12.00 ? 10  DC  B "C2'" 1 
ATOM 4517 C "C1'" . DC  B 2 10  ? 11.865  7.379   78.867  1.00 12.00 ? 10  DC  B "C1'" 1 
ATOM 4518 N N1    . DC  B 2 10  ? 10.612  6.641   78.517  1.00 12.00 ? 10  DC  B N1    1 
ATOM 4519 C C2    . DC  B 2 10  ? 10.688  5.403   77.874  1.00 12.00 ? 10  DC  B C2    1 
ATOM 4520 O O2    . DC  B 2 10  ? 11.800  4.967   77.554  1.00 12.00 ? 10  DC  B O2    1 
ATOM 4521 N N3    . DC  B 2 10  ? 9.546   4.713   77.613  1.00 12.00 ? 10  DC  B N3    1 
ATOM 4522 C C4    . DC  B 2 10  ? 8.361   5.227   77.943  1.00 12.00 ? 10  DC  B C4    1 
ATOM 4523 N N4    . DC  B 2 10  ? 7.278   4.522   77.687  1.00 12.00 ? 10  DC  B N4    1 
ATOM 4524 C C5    . DC  B 2 10  ? 8.245   6.509   78.568  1.00 12.00 ? 10  DC  B C5    1 
ATOM 4525 C C6    . DC  B 2 10  ? 9.389   7.168   78.832  1.00 12.00 ? 10  DC  B C6    1 
ATOM 4526 P P     . DA  B 2 11  ? 14.381  9.739   73.579  1.00 12.00 ? 11  DA  B P     1 
ATOM 4527 O OP1   . DA  B 2 11  ? 15.659  10.439  73.816  1.00 12.00 ? 11  DA  B OP1   1 
ATOM 4528 O OP2   . DA  B 2 11  ? 13.618  10.238  72.421  1.00 12.00 ? 11  DA  B OP2   1 
ATOM 4529 O "O5'" . DA  B 2 11  ? 14.636  8.175   73.416  1.00 12.00 ? 11  DA  B "O5'" 1 
ATOM 4530 C "C5'" . DA  B 2 11  ? 15.480  7.524   74.378  1.00 12.00 ? 11  DA  B "C5'" 1 
ATOM 4531 C "C4'" . DA  B 2 11  ? 15.244  6.021   74.340  1.00 12.00 ? 11  DA  B "C4'" 1 
ATOM 4532 O "O4'" . DA  B 2 11  ? 13.879  5.769   74.801  1.00 12.00 ? 11  DA  B "O4'" 1 
ATOM 4533 C "C3'" . DA  B 2 11  ? 15.346  5.376   72.960  1.00 12.00 ? 11  DA  B "C3'" 1 
ATOM 4534 O "O3'" . DA  B 2 11  ? 15.938  4.088   73.014  1.00 12.00 ? 11  DA  B "O3'" 1 
ATOM 4535 C "C2'" . DA  B 2 11  ? 13.904  5.336   72.523  1.00 12.00 ? 11  DA  B "C2'" 1 
ATOM 4536 C "C1'" . DA  B 2 11  ? 13.199  5.013   73.826  1.00 12.00 ? 11  DA  B "C1'" 1 
ATOM 4537 N N9    . DA  B 2 11  ? 11.741  5.323   73.936  1.00 12.00 ? 11  DA  B N9    1 
ATOM 4538 C C8    . DA  B 2 11  ? 11.156  6.496   74.286  1.00 12.00 ? 11  DA  B C8    1 
ATOM 4539 N N7    . DA  B 2 11  ? 9.858   6.457   74.300  1.00 12.00 ? 11  DA  B N7    1 
ATOM 4540 C C5    . DA  B 2 11  ? 9.560   5.167   73.933  1.00 12.00 ? 11  DA  B C5    1 
ATOM 4541 C C6    . DA  B 2 11  ? 8.348   4.472   73.763  1.00 12.00 ? 11  DA  B C6    1 
ATOM 4542 N N6    . DA  B 2 11  ? 7.144   5.038   73.965  1.00 12.00 ? 11  DA  B N6    1 
ATOM 4543 N N1    . DA  B 2 11  ? 8.411   3.195   73.382  1.00 12.00 ? 11  DA  B N1    1 
ATOM 4544 C C2    . DA  B 2 11  ? 9.609   2.640   73.184  1.00 12.00 ? 11  DA  B C2    1 
ATOM 4545 N N3    . DA  B 2 11  ? 10.806  3.179   73.312  1.00 12.00 ? 11  DA  B N3    1 
ATOM 4546 C C4    . DA  B 2 11  ? 10.699  4.457   73.698  1.00 12.00 ? 11  DA  B C4    1 
ATOM 4547 P P     . DC  C 3 1   ? 1.577   23.153  83.712  1.00 12.00 ? 14  DC  C P     1 
ATOM 4548 O OP1   . DC  C 3 1   ? 2.470   23.824  82.749  1.00 12.00 ? 14  DC  C OP1   1 
ATOM 4549 O OP2   . DC  C 3 1   ? 0.889   24.435  83.950  1.00 12.00 ? 14  DC  C OP2   1 
ATOM 4550 O "O5'" . DC  C 3 1   ? 2.471   22.697  84.951  1.00 12.00 ? 14  DC  C "O5'" 1 
ATOM 4551 C "C5'" . DC  C 3 1   ? 3.339   21.569  84.772  1.00 12.00 ? 14  DC  C "C5'" 1 
ATOM 4552 C "C4'" . DC  C 3 1   ? 2.785   20.355  85.515  1.00 12.00 ? 14  DC  C "C4'" 1 
ATOM 4553 O "O4'" . DC  C 3 1   ? 3.592   19.170  85.234  1.00 12.00 ? 14  DC  C "O4'" 1 
ATOM 4554 C "C3'" . DC  C 3 1   ? 2.769   20.452  87.050  1.00 12.00 ? 14  DC  C "C3'" 1 
ATOM 4555 O "O3'" . DC  C 3 1   ? 1.704   19.707  87.596  1.00 12.00 ? 14  DC  C "O3'" 1 
ATOM 4556 C "C2'" . DC  C 3 1   ? 4.030   19.751  87.430  1.00 12.00 ? 14  DC  C "C2'" 1 
ATOM 4557 C "C1'" . DC  C 3 1   ? 3.944   18.588  86.470  1.00 12.00 ? 14  DC  C "C1'" 1 
ATOM 4558 N N1    . DC  C 3 1   ? 5.172   17.777  86.316  1.00 12.00 ? 14  DC  C N1    1 
ATOM 4559 C C2    . DC  C 3 1   ? 5.721   17.219  87.463  1.00 12.00 ? 14  DC  C C2    1 
ATOM 4560 O O2    . DC  C 3 1   ? 5.195   17.465  88.553  1.00 12.00 ? 14  DC  C O2    1 
ATOM 4561 N N3    . DC  C 3 1   ? 6.819   16.426  87.357  1.00 12.00 ? 14  DC  C N3    1 
ATOM 4562 C C4    . DC  C 3 1   ? 7.371   16.205  86.162  1.00 12.00 ? 14  DC  C C4    1 
ATOM 4563 N N4    . DC  C 3 1   ? 8.426   15.420  86.103  1.00 12.00 ? 14  DC  C N4    1 
ATOM 4564 C C5    . DC  C 3 1   ? 6.840   16.791  84.962  1.00 12.00 ? 14  DC  C C5    1 
ATOM 4565 C C6    . DC  C 3 1   ? 5.743   17.565  85.092  1.00 12.00 ? 14  DC  C C6    1 
ATOM 4566 P P     . DA  C 3 2   ? 0.455   20.330  88.320  1.00 12.00 ? 15  DA  C P     1 
ATOM 4567 O OP1   . DA  C 3 2   ? 0.079   21.607  87.685  1.00 12.00 ? 15  DA  C OP1   1 
ATOM 4568 O OP2   . DA  C 3 2   ? 0.717   20.435  89.773  1.00 12.00 ? 15  DA  C OP2   1 
ATOM 4569 O "O5'" . DA  C 3 2   ? -0.564  19.143  87.986  1.00 12.00 ? 15  DA  C "O5'" 1 
ATOM 4570 C "C5'" . DA  C 3 2   ? -0.311  18.461  86.731  1.00 12.00 ? 15  DA  C "C5'" 1 
ATOM 4571 C "C4'" . DA  C 3 2   ? -0.676  16.962  86.742  1.00 12.00 ? 15  DA  C "C4'" 1 
ATOM 4572 O "O4'" . DA  C 3 2   ? 0.130   16.298  85.710  1.00 12.00 ? 15  DA  C "O4'" 1 
ATOM 4573 C "C3'" . DA  C 3 2   ? -0.415  16.168  88.017  1.00 12.00 ? 15  DA  C "C3'" 1 
ATOM 4574 O "O3'" . DA  C 3 2   ? -1.430  15.198  88.238  1.00 12.00 ? 15  DA  C "O3'" 1 
ATOM 4575 C "C2'" . DA  C 3 2   ? 0.936   15.530  87.743  1.00 12.00 ? 15  DA  C "C2'" 1 
ATOM 4576 C "C1'" . DA  C 3 2   ? 0.824   15.192  86.267  1.00 12.00 ? 15  DA  C "C1'" 1 
ATOM 4577 N N9    . DA  C 3 2   ? 2.067   14.993  85.447  1.00 12.00 ? 15  DA  C N9    1 
ATOM 4578 C C8    . DA  C 3 2   ? 2.434   15.657  84.320  1.00 12.00 ? 15  DA  C C8    1 
ATOM 4579 N N7    . DA  C 3 2   ? 3.564   15.268  83.810  1.00 12.00 ? 15  DA  C N7    1 
ATOM 4580 C C5    . DA  C 3 2   ? 3.988   14.274  84.655  1.00 12.00 ? 15  DA  C C5    1 
ATOM 4581 C C6    . DA  C 3 2   ? 5.124   13.445  84.666  1.00 12.00 ? 15  DA  C C6    1 
ATOM 4582 N N6    . DA  C 3 2   ? 6.083   13.504  83.723  1.00 12.00 ? 15  DA  C N6    1 
ATOM 4583 N N1    . DA  C 3 2   ? 5.240   12.564  85.660  1.00 12.00 ? 15  DA  C N1    1 
ATOM 4584 C C2    . DA  C 3 2   ? 4.282   12.512  86.589  1.00 12.00 ? 15  DA  C C2    1 
ATOM 4585 N N3    . DA  C 3 2   ? 3.176   13.227  86.685  1.00 12.00 ? 15  DA  C N3    1 
ATOM 4586 C C4    . DA  C 3 2   ? 3.093   14.094  85.668  1.00 12.00 ? 15  DA  C C4    1 
ATOM 4587 P P     . DA  C 3 3   ? -2.710  15.185  87.286  1.00 12.00 ? 16  DA  C P     1 
ATOM 4588 O OP1   . DA  C 3 3   ? -3.244  16.552  87.149  1.00 12.00 ? 16  DA  C OP1   1 
ATOM 4589 O OP2   . DA  C 3 3   ? -3.690  14.194  87.774  1.00 12.00 ? 16  DA  C OP2   1 
ATOM 4590 O "O5'" . DA  C 3 3   ? -2.103  14.682  85.888  1.00 12.00 ? 16  DA  C "O5'" 1 
ATOM 4591 C "C5'" . DA  C 3 3   ? -2.815  14.989  84.663  1.00 12.00 ? 16  DA  C "C5'" 1 
ATOM 4592 C "C4'" . DA  C 3 3   ? -1.832  15.528  83.616  1.00 12.00 ? 16  DA  C "C4'" 1 
ATOM 4593 O "O4'" . DA  C 3 3   ? -0.807  14.507  83.359  1.00 12.00 ? 16  DA  C "O4'" 1 
ATOM 4594 C "C3'" . DA  C 3 3   ? -2.411  15.874  82.236  1.00 12.00 ? 16  DA  C "C3'" 1 
ATOM 4595 O "O3'" . DA  C 3 3   ? -1.788  17.029  81.683  1.00 12.00 ? 16  DA  C "O3'" 1 
ATOM 4596 C "C2'" . DA  C 3 3   ? -2.104  14.631  81.435  1.00 12.00 ? 16  DA  C "C2'" 1 
ATOM 4597 C "C1'" . DA  C 3 3   ? -0.722  14.264  81.959  1.00 12.00 ? 16  DA  C "C1'" 1 
ATOM 4598 N N9    . DA  C 3 3   ? -0.140  12.875  81.730  1.00 12.00 ? 16  DA  C N9    1 
ATOM 4599 C C8    . DA  C 3 3   ? 1.155   12.569  81.450  1.00 12.00 ? 16  DA  C C8    1 
ATOM 4600 N N7    . DA  C 3 3   ? 1.405   11.306  81.292  1.00 12.00 ? 16  DA  C N7    1 
ATOM 4601 C C5    . DA  C 3 3   ? 0.197   10.696  81.476  1.00 12.00 ? 16  DA  C C5    1 
ATOM 4602 C C6    . DA  C 3 3   ? -0.201  9.348   81.434  1.00 12.00 ? 16  DA  C C6    1 
ATOM 4603 N N6    . DA  C 3 3   ? 0.654   8.340   81.168  1.00 12.00 ? 16  DA  C N6    1 
ATOM 4604 N N1    . DA  C 3 3   ? -1.483  9.077   81.669  1.00 12.00 ? 16  DA  C N1    1 
ATOM 4605 C C2    . DA  C 3 3   ? -2.316  10.090  81.929  1.00 12.00 ? 16  DA  C C2    1 
ATOM 4606 N N3    . DA  C 3 3   ? -2.063  11.390  81.993  1.00 12.00 ? 16  DA  C N3    1 
ATOM 4607 C C4    . DA  C 3 3   ? -0.763  11.623  81.749  1.00 12.00 ? 16  DA  C C4    1 
ATOM 4608 P P     . DA  C 3 4   ? -2.117  17.494  80.194  1.00 12.00 ? 17  DA  C P     1 
ATOM 4609 O OP1   . DA  C 3 4   ? -1.465  18.792  79.915  1.00 12.00 ? 17  DA  C OP1   1 
ATOM 4610 O OP2   . DA  C 3 4   ? -3.574  17.488  79.967  1.00 12.00 ? 17  DA  C OP2   1 
ATOM 4611 O "O5'" . DA  C 3 4   ? -1.451  16.348  79.294  1.00 12.00 ? 17  DA  C "O5'" 1 
ATOM 4612 C "C5'" . DA  C 3 4   ? -0.259  15.698  79.766  1.00 12.00 ? 17  DA  C "C5'" 1 
ATOM 4613 C "C4'" . DA  C 3 4   ? 0.339   14.830  78.655  1.00 12.00 ? 17  DA  C "C4'" 1 
ATOM 4614 O "O4'" . DA  C 3 4   ? -0.205  13.476  78.790  1.00 12.00 ? 17  DA  C "O4'" 1 
ATOM 4615 C "C3'" . DA  C 3 4   ? -0.001  15.269  77.232  1.00 12.00 ? 17  DA  C "C3'" 1 
ATOM 4616 O "O3'" . DA  C 3 4   ? 1.081   15.087  76.339  1.00 12.00 ? 17  DA  C "O3'" 1 
ATOM 4617 C "C2'" . DA  C 3 4   ? -1.174  14.379  76.890  1.00 12.00 ? 17  DA  C "C2'" 1 
ATOM 4618 C "C1'" . DA  C 3 4   ? -0.760  13.081  77.549  1.00 12.00 ? 17  DA  C "C1'" 1 
ATOM 4619 N N9    . DA  C 3 4   ? -1.840  12.084  77.793  1.00 12.00 ? 17  DA  C N9    1 
ATOM 4620 C C8    . DA  C 3 4   ? -3.115  12.307  78.206  1.00 12.00 ? 17  DA  C C8    1 
ATOM 4621 N N7    . DA  C 3 4   ? -3.833  11.231  78.317  1.00 12.00 ? 17  DA  C N7    1 
ATOM 4622 C C5    . DA  C 3 4   ? -2.976  10.220  77.955  1.00 12.00 ? 17  DA  C C5    1 
ATOM 4623 C C6    . DA  C 3 4   ? -3.124  8.825   77.852  1.00 12.00 ? 17  DA  C C6    1 
ATOM 4624 N N6    . DA  C 3 4   ? -4.279  8.188   78.117  1.00 12.00 ? 17  DA  C N6    1 
ATOM 4625 N N1    . DA  C 3 4   ? -2.062  8.114   77.470  1.00 12.00 ? 17  DA  C N1    1 
ATOM 4626 C C2    . DA  C 3 4   ? -0.920  8.753   77.205  1.00 12.00 ? 17  DA  C C2    1 
ATOM 4627 N N3    . DA  C 3 4   ? -0.658  10.044  77.259  1.00 12.00 ? 17  DA  C N3    1 
ATOM 4628 C C4    . DA  C 3 4   ? -1.748  10.722  77.640  1.00 12.00 ? 17  DA  C C4    1 
ATOM 4629 P P     . DA  D 4 1   ? 13.436  24.181  81.144  1.00 12.00 ? 20  DA  D P     1 
ATOM 4630 O OP1   . DA  D 4 1   ? 14.912  24.212  81.136  1.00 12.00 ? 20  DA  D OP1   1 
ATOM 4631 O OP2   . DA  D 4 1   ? 12.830  24.111  82.485  1.00 12.00 ? 20  DA  D OP2   1 
ATOM 4632 O "O5'" . DA  D 4 1   ? 12.934  22.972  80.246  1.00 12.00 ? 20  DA  D "O5'" 1 
ATOM 4633 C "C5'" . DA  D 4 1   ? 11.536  22.888  79.968  1.00 12.00 ? 20  DA  D "C5'" 1 
ATOM 4634 C "C4'" . DA  D 4 1   ? 11.290  23.063  78.479  1.00 12.00 ? 20  DA  D "C4'" 1 
ATOM 4635 O "O4'" . DA  D 4 1   ? 11.730  21.843  77.804  1.00 12.00 ? 20  DA  D "O4'" 1 
ATOM 4636 C "C3'" . DA  D 4 1   ? 9.832   23.264  78.073  1.00 12.00 ? 20  DA  D "C3'" 1 
ATOM 4637 O "O3'" . DA  D 4 1   ? 9.693   24.176  76.999  1.00 12.00 ? 20  DA  D "O3'" 1 
ATOM 4638 C "C2'" . DA  D 4 1   ? 9.414   21.865  77.701  1.00 12.00 ? 20  DA  D "C2'" 1 
ATOM 4639 C "C1'" . DA  D 4 1   ? 10.668  21.342  77.029  1.00 12.00 ? 20  DA  D "C1'" 1 
ATOM 4640 N N9    . DA  D 4 1   ? 10.847  19.863  76.893  1.00 12.00 ? 20  DA  D N9    1 
ATOM 4641 C C8    . DA  D 4 1   ? 11.883  19.192  76.327  1.00 12.00 ? 20  DA  D C8    1 
ATOM 4642 N N7    . DA  D 4 1   ? 11.759  17.900  76.357  1.00 12.00 ? 20  DA  D N7    1 
ATOM 4643 C C5    . DA  D 4 1   ? 10.556  17.699  76.989  1.00 12.00 ? 20  DA  D C5    1 
ATOM 4644 C C6    . DA  D 4 1   ? 9.840   16.541  77.341  1.00 12.00 ? 20  DA  D C6    1 
ATOM 4645 N N6    . DA  D 4 1   ? 10.282  15.297  77.082  1.00 12.00 ? 20  DA  D N6    1 
ATOM 4646 N N1    . DA  D 4 1   ? 8.669   16.697  77.961  1.00 12.00 ? 20  DA  D N1    1 
ATOM 4647 C C2    . DA  D 4 1   ? 8.234   17.935  78.214  1.00 12.00 ? 20  DA  D C2    1 
ATOM 4648 N N3    . DA  D 4 1   ? 8.808   19.090  77.938  1.00 12.00 ? 20  DA  D N3    1 
ATOM 4649 C C4    . DA  D 4 1   ? 9.979   18.888  77.321  1.00 12.00 ? 20  DA  D C4    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   THR 5   5   ?   ?   ?   A . n 
A 1 6   SER 6   6   ?   ?   ?   A . n 
A 1 7   GLN 7   7   ?   ?   ?   A . n 
A 1 8   PRO 8   8   ?   ?   ?   A . n 
A 1 9   ASP 9   9   ?   ?   ?   A . n 
A 1 10  GLY 10  10  ?   ?   ?   A . n 
A 1 11  GLY 11  11  ?   ?   ?   A . n 
A 1 12  ASN 12  12  ?   ?   ?   A . n 
A 1 13  ALA 13  13  ?   ?   ?   A . n 
A 1 14  VAL 14  14  ?   ?   ?   A . n 
A 1 15  HIS 15  15  ?   ?   ?   A . n 
A 1 16  SER 16  16  ?   ?   ?   A . n 
A 1 17  ALA 17  17  ?   ?   ?   A . n 
A 1 18  ALA 18  18  ?   ?   ?   A . n 
A 1 19  ARG 19  19  ?   ?   ?   A . n 
A 1 20  VAL 20  20  ?   ?   ?   A . n 
A 1 21  GLU 21  21  ?   ?   ?   A . n 
A 1 22  ARG 22  22  ?   ?   ?   A . n 
A 1 23  ALA 23  23  ?   ?   ?   A . n 
A 1 24  ALA 24  24  ?   ?   ?   A . n 
A 1 25  ASP 25  25  ?   ?   ?   A . n 
A 1 26  GLY 26  26  ?   ?   ?   A . n 
A 1 27  PRO 27  27  ?   ?   ?   A . n 
A 1 28  GLY 28  28  ?   ?   ?   A . n 
A 1 29  GLY 29  29  ?   ?   ?   A . n 
A 1 30  SER 30  30  ?   ?   ?   A . n 
A 1 31  GLY 31  31  ?   ?   ?   A . n 
A 1 32  GLY 32  32  ?   ?   ?   A . n 
A 1 33  GLY 33  33  ?   ?   ?   A . n 
A 1 34  GLY 34  34  ?   ?   ?   A . n 
A 1 35  SER 35  35  ?   ?   ?   A . n 
A 1 36  GLY 36  36  ?   ?   ?   A . n 
A 1 37  GLY 37  37  ?   ?   ?   A . n 
A 1 38  GLY 38  38  ?   ?   ?   A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  THR 44  44  44  THR THR A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  TYR 47  47  47  TYR TYR A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  ASN 49  49  49  ASN ASN A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  HIS 52  52  52  HIS HIS A . n 
A 1 53  TYR 53  53  53  TYR TYR A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  TRP 60  60  60  TRP TRP A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  HIS 72  72  72  HIS HIS A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  MET 75  75  75  MET MET A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  TYR 81  81  81  TYR TYR A . n 
A 1 82  CYS 82  82  82  CYS CYS A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  HIS 87  87  87  HIS HIS A . n 
A 1 88  ASN 88  88  88  ASN ASN A . n 
A 1 89  THR 89  89  89  THR THR A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  MET 98  98  98  MET MET A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 HIS 104 104 104 HIS HIS A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 TRP 108 108 108 TRP TRP A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 TRP 111 111 111 TRP TRP A . n 
A 1 112 SER 112 112 112 SER SER A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 ASP 115 115 115 ASP ASP A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 ALA 118 118 118 ALA ALA A . n 
A 1 119 TRP 119 119 119 TRP TRP A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 TRP 122 122 122 TRP TRP A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 GLN 124 124 124 GLN GLN A . n 
A 1 125 PRO 125 125 125 PRO PRO A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 ASP 127 127 127 ASP ASP A . n 
A 1 128 TRP 128 128 128 TRP TRP A . n 
A 1 129 GLN 129 129 129 GLN GLN A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 CYS 132 132 132 CYS CYS A . n 
A 1 133 ASN 133 133 133 ASN ASN A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 MET 135 135 135 MET MET A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ASN 139 139 139 ASN ASN A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 GLU 146 146 146 GLU GLU A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 GLU 157 157 157 GLU GLU A . n 
A 1 158 GLN 158 158 158 GLN GLN A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 SER 160 160 160 SER SER A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ILE 165 165 165 ILE ILE A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 TYR 168 168 168 TYR TYR A . n 
A 1 169 ASN 169 169 169 ASN ASN A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 ASP 171 171 171 ASP ASP A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 THR 173 173 173 THR THR A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 CYS 175 175 175 CYS CYS A . n 
A 1 176 MET 176 176 176 MET MET A . n 
A 1 177 MET 177 177 177 MET MET A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ASN 184 184 184 ASN ASN A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 PRO 190 190 190 PRO PRO A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 ASN 193 193 193 ASN ASN A . n 
A 1 194 SER 194 194 194 SER SER A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 THR 197 197 197 THR THR A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 TYR 201 201 201 TYR TYR A . n 
A 1 202 PRO 202 202 202 PRO PRO A . n 
A 1 203 TRP 203 203 203 TRP TRP A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 PRO 205 205 205 PRO PRO A . n 
A 1 206 THR 206 206 206 THR THR A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 SER 209 209 209 SER SER A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 TYR 211 211 211 TYR TYR A . n 
A 1 212 ARG 212 212 212 ARG ARG A . n 
A 1 213 TYR 213 213 213 TYR TYR A . n 
A 1 214 TYR 214 214 214 TYR TYR A . n 
A 1 215 PHE 215 215 215 PHE PHE A . n 
A 1 216 CYS 216 216 216 CYS CYS A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 SER 222 222 222 SER SER A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 THR 224 224 224 THR THR A . n 
A 1 225 TYR 225 225 225 TYR TYR A . n 
A 1 226 GLU 226 226 226 GLU GLU A . n 
A 1 227 ASN 227 227 227 ASN ASN A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 ILE 232 232 232 ILE ILE A . n 
A 1 233 GLU 233 233 233 GLU GLU A . n 
A 1 234 HIS 234 234 234 HIS HIS A . n 
A 1 235 ASN 235 235 235 ASN ASN A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 MET 237 237 237 MET MET A . n 
A 1 238 GLY 238 238 238 GLY GLY A . n 
A 1 239 THR 239 239 239 THR THR A . n 
A 1 240 PRO 240 240 240 PRO PRO A . n 
A 1 241 LYS 241 241 241 LYS LYS A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 MET 243 243 243 MET MET A . n 
A 1 244 ASN 244 244 244 ASN ASN A . n 
A 1 245 SER 245 245 245 SER SER A . n 
A 1 246 GLN 246 246 246 GLN GLN A . n 
A 1 247 PHE 247 247 247 PHE PHE A . n 
A 1 248 PHE 248 248 248 PHE PHE A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 GLU 251 251 251 GLU GLU A . n 
A 1 252 ASN 252 252 252 ASN ASN A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 GLN 254 254 254 GLN GLN A . n 
A 1 255 GLN 255 255 255 GLN GLN A . n 
A 1 256 ILE 256 256 256 ILE ILE A . n 
A 1 257 THR 257 257 257 THR THR A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 ARG 260 260 260 ARG ARG A . n 
A 1 261 THR 261 261 261 THR THR A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 ASP 263 263 263 ASP ASP A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 PHE 265 265 265 PHE PHE A . n 
A 1 266 ALA 266 266 266 ALA ALA A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 THR 269 269 269 THR THR A . n 
A 1 270 TYR 270 270 270 TYR TYR A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 PHE 272 272 272 PHE PHE A . n 
A 1 273 ASP 273 273 273 ASP ASP A . n 
A 1 274 THR 274 274 274 THR THR A . n 
A 1 275 ASN 275 275 275 ASN ASN A . n 
A 1 276 PRO 276 276 276 PRO PRO A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 LYS 278 278 278 LYS LYS A . n 
A 1 279 LEU 279 279 279 LEU LEU A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 HIS 281 281 281 HIS HIS A . n 
A 1 282 THR 282 282 282 THR THR A . n 
A 1 283 TRP 283 283 283 TRP TRP A . n 
A 1 284 GLN 284 284 284 GLN GLN A . n 
A 1 285 THR 285 285 285 THR THR A . n 
A 1 286 ASN 286 286 286 ASN ASN A . n 
A 1 287 ARG 287 287 287 ARG ARG A . n 
A 1 288 GLN 288 288 288 GLN GLN A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 GLY 290 290 290 GLY GLY A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 PRO 292 292 292 PRO PRO A . n 
A 1 293 PRO 293 293 293 PRO PRO A . n 
A 1 294 LEU 294 294 294 LEU LEU A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 SER 296 296 296 SER SER A . n 
A 1 297 THR 297 297 297 THR THR A . n 
A 1 298 PHE 298 298 298 PHE PHE A . n 
A 1 299 PRO 299 299 299 PRO PRO A . n 
A 1 300 GLU 300 300 300 GLU GLU A . n 
A 1 301 ALA 301 301 301 ALA ALA A . n 
A 1 302 ASP 302 302 302 ASP ASP A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 ALA 305 305 305 ALA ALA A . n 
A 1 306 GLY 306 306 306 GLY GLY A . n 
A 1 307 THR 307 307 307 THR THR A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 THR 309 309 309 THR THR A . n 
A 1 310 ALA 310 310 310 ALA ALA A . n 
A 1 311 GLN 311 311 311 GLN GLN A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 SER 313 313 313 SER SER A . n 
A 1 314 ARG 314 314 314 ARG ARG A . n 
A 1 315 HIS 315 315 315 HIS HIS A . n 
A 1 316 GLY 316 316 316 GLY GLY A . n 
A 1 317 ALA 317 317 317 ALA ALA A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLN 319 319 319 GLN GLN A . n 
A 1 320 MET 320 320 320 MET MET A . n 
A 1 321 GLU 321 321 321 GLU GLU A . n 
A 1 322 VAL 322 322 322 VAL VAL A . n 
A 1 323 ASN 323 323 323 ASN ASN A . n 
A 1 324 TRP 324 324 324 TRP TRP A . n 
A 1 325 VAL 325 325 325 VAL VAL A . n 
A 1 326 SER 326 326 326 SER SER A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 ALA 328 328 328 ALA ALA A . n 
A 1 329 ILE 329 329 329 ILE ILE A . n 
A 1 330 ARG 330 330 330 ARG ARG A . n 
A 1 331 THR 331 331 331 THR THR A . n 
A 1 332 ARG 332 332 332 ARG ARG A . n 
A 1 333 PRO 333 333 333 PRO PRO A . n 
A 1 334 ALA 334 334 334 ALA ALA A . n 
A 1 335 GLN 335 335 335 GLN GLN A . n 
A 1 336 VAL 336 336 336 VAL VAL A . n 
A 1 337 GLY 337 337 337 GLY GLY A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 CYS 339 339 339 CYS CYS A . n 
A 1 340 GLN 340 340 340 GLN GLN A . n 
A 1 341 PRO 341 341 341 PRO PRO A . n 
A 1 342 HIS 342 342 342 HIS HIS A . n 
A 1 343 ASN 343 343 343 ASN ASN A . n 
A 1 344 ASP 344 344 344 ASP ASP A . n 
A 1 345 PHE 345 345 345 PHE PHE A . n 
A 1 346 GLU 346 346 346 GLU GLU A . n 
A 1 347 ALA 347 347 347 ALA ALA A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 ALA 350 350 350 ALA ALA A . n 
A 1 351 GLY 351 351 351 GLY GLY A . n 
A 1 352 PRO 352 352 352 PRO PRO A . n 
A 1 353 PHE 353 353 353 PHE PHE A . n 
A 1 354 ALA 354 354 354 ALA ALA A . n 
A 1 355 ALA 355 355 355 ALA ALA A . n 
A 1 356 PRO 356 356 356 PRO PRO A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 VAL 358 358 358 VAL VAL A . n 
A 1 359 PRO 359 359 359 PRO PRO A . n 
A 1 360 ALA 360 360 360 ALA ALA A . n 
A 1 361 ASP 361 361 361 ASP ASP A . n 
A 1 362 VAL 362 362 362 VAL VAL A . n 
A 1 363 THR 363 363 363 THR THR A . n 
A 1 364 GLN 364 364 364 GLN GLN A . n 
A 1 365 GLY 365 365 365 GLY GLY A . n 
A 1 366 MET 366 366 366 MET MET A . n 
A 1 367 ASP 367 367 367 ASP ASP A . n 
A 1 368 ARG 368 368 368 ARG ARG A . n 
A 1 369 GLU 369 369 369 GLU GLU A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 ASN 371 371 371 ASN ASN A . n 
A 1 372 GLY 372 372 372 GLY GLY A . n 
A 1 373 SER 373 373 373 SER SER A . n 
A 1 374 VAL 374 374 374 VAL VAL A . n 
A 1 375 ARG 375 375 375 ARG ARG A . n 
A 1 376 TYR 376 376 376 TYR TYR A . n 
A 1 377 SER 377 377 377 SER SER A . n 
A 1 378 TYR 378 378 378 TYR TYR A . n 
A 1 379 GLY 379 379 379 GLY GLY A . n 
A 1 380 LYS 380 380 380 LYS LYS A . n 
A 1 381 GLN 381 381 381 GLN GLN A . n 
A 1 382 HIS 382 382 382 HIS HIS A . n 
A 1 383 GLY 383 383 383 GLY GLY A . n 
A 1 384 GLU 384 384 384 GLU GLU A . n 
A 1 385 ASN 385 385 385 ASN ASN A . n 
A 1 386 TRP 386 386 386 TRP TRP A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 ALA 388 388 388 ALA ALA A . n 
A 1 389 HIS 389 389 389 HIS HIS A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 ALA 392 392 392 ALA ALA A . n 
A 1 393 PRO 393 393 393 PRO PRO A . n 
A 1 394 GLU 394 394 394 GLU GLU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 TYR 396 396 396 TYR TYR A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 TRP 398 398 398 TRP TRP A . n 
A 1 399 ASP 399 399 399 ASP ASP A . n 
A 1 400 GLU 400 400 400 GLU GLU A . n 
A 1 401 THR 401 401 401 THR THR A . n 
A 1 402 ASN 402 402 402 ASN ASN A . n 
A 1 403 PHE 403 403 403 PHE PHE A . n 
A 1 404 GLY 404 404 404 GLY GLY A . n 
A 1 405 SER 405 405 405 SER SER A . n 
A 1 406 GLY 406 406 406 GLY GLY A . n 
A 1 407 ARG 407 407 407 ARG ARG A . n 
A 1 408 ASP 408 408 408 ASP ASP A . n 
A 1 409 THR 409 409 409 THR THR A . n 
A 1 410 ARG 410 410 410 ARG ARG A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 GLY 412 412 412 GLY GLY A . n 
A 1 413 PHE 413 413 413 PHE PHE A . n 
A 1 414 ILE 414 414 414 ILE ILE A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 SER 416 416 416 SER SER A . n 
A 1 417 ALA 417 417 417 ALA ALA A . n 
A 1 418 PRO 418 418 418 PRO PRO A . n 
A 1 419 LEU 419 419 419 LEU LEU A . n 
A 1 420 VAL 420 420 420 VAL VAL A . n 
A 1 421 VAL 421 421 421 VAL VAL A . n 
A 1 422 PRO 422 422 422 PRO PRO A . n 
A 1 423 PRO 423 423 423 PRO PRO A . n 
A 1 424 PRO 424 424 424 PRO PRO A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 ASN 426 426 426 ASN ASN A . n 
A 1 427 GLY 427 427 427 GLY GLY A . n 
A 1 428 ILE 428 428 428 ILE ILE A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 THR 430 430 430 THR THR A . n 
A 1 431 ASN 431 431 431 ASN ASN A . n 
A 1 432 ALA 432 432 432 ALA ALA A . n 
A 1 433 ASN 433 433 433 ASN ASN A . n 
A 1 434 PRO 434 434 434 PRO PRO A . n 
A 1 435 ILE 435 435 435 ILE ILE A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 THR 437 437 437 THR THR A . n 
A 1 438 LYS 438 438 438 LYS LYS A . n 
A 1 439 ASN 439 439 439 ASN ASN A . n 
A 1 440 ASP 440 440 440 ASP ASP A . n 
A 1 441 ILE 441 441 441 ILE ILE A . n 
A 1 442 HIS 442 442 442 HIS HIS A . n 
A 1 443 PHE 443 443 443 PHE PHE A . n 
A 1 444 SER 444 444 444 SER SER A . n 
A 1 445 ASN 445 445 445 ASN ASN A . n 
A 1 446 VAL 446 446 446 VAL VAL A . n 
A 1 447 PHE 447 447 447 PHE PHE A . n 
A 1 448 ASN 448 448 448 ASN ASN A . n 
A 1 449 SER 449 449 449 SER SER A . n 
A 1 450 TYR 450 450 450 TYR TYR A . n 
A 1 451 GLY 451 451 451 GLY GLY A . n 
A 1 452 PRO 452 452 452 PRO PRO A . n 
A 1 453 LEU 453 453 453 LEU LEU A . n 
A 1 454 THR 454 454 454 THR THR A . n 
A 1 455 THR 455 455 455 THR THR A . n 
A 1 456 PHE 456 456 456 PHE PHE A . n 
A 1 457 SER 457 457 457 SER SER A . n 
A 1 458 HIS 458 458 458 HIS HIS A . n 
A 1 459 PRO 459 459 459 PRO PRO A . n 
A 1 460 SER 460 460 460 SER SER A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 VAL 462 462 462 VAL VAL A . n 
A 1 463 TYR 463 463 463 TYR TYR A . n 
A 1 464 PRO 464 464 464 PRO PRO A . n 
A 1 465 GLN 465 465 465 GLN GLN A . n 
A 1 466 GLY 466 466 466 GLY GLY A . n 
A 1 467 GLN 467 467 467 GLN GLN A . n 
A 1 468 ILE 468 468 468 ILE ILE A . n 
A 1 469 TRP 469 469 469 TRP TRP A . n 
A 1 470 ASP 470 470 470 ASP ASP A . n 
A 1 471 LYS 471 471 471 LYS LYS A . n 
A 1 472 GLU 472 472 472 GLU GLU A . n 
A 1 473 LEU 473 473 473 LEU LEU A . n 
A 1 474 ASP 474 474 474 ASP ASP A . n 
A 1 475 LEU 475 475 475 LEU LEU A . n 
A 1 476 GLU 476 476 476 GLU GLU A . n 
A 1 477 HIS 477 477 477 HIS HIS A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 PRO 479 479 479 PRO PRO A . n 
A 1 480 ARG 480 480 480 ARG ARG A . n 
A 1 481 LEU 481 481 481 LEU LEU A . n 
A 1 482 HIS 482 482 482 HIS HIS A . n 
A 1 483 ILE 483 483 483 ILE ILE A . n 
A 1 484 THR 484 484 484 THR THR A . n 
A 1 485 ALA 485 485 485 ALA ALA A . n 
A 1 486 PRO 486 486 486 PRO PRO A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 VAL 488 488 488 VAL VAL A . n 
A 1 489 CYS 489 489 489 CYS CYS A . n 
A 1 490 LYS 490 490 490 LYS LYS A . n 
A 1 491 ASN 491 491 491 ASN ASN A . n 
A 1 492 ASN 492 492 492 ASN ASN A . n 
A 1 493 ALA 493 493 493 ALA ALA A . n 
A 1 494 PRO 494 494 494 PRO PRO A . n 
A 1 495 GLY 495 495 495 GLY GLY A . n 
A 1 496 GLN 496 496 496 GLN GLN A . n 
A 1 497 MET 497 497 497 MET MET A . n 
A 1 498 LEU 498 498 498 LEU LEU A . n 
A 1 499 VAL 499 499 499 VAL VAL A . n 
A 1 500 ARG 500 500 500 ARG ARG A . n 
A 1 501 LEU 501 501 501 LEU LEU A . n 
A 1 502 GLY 502 502 502 GLY GLY A . n 
A 1 503 PRO 503 503 503 PRO PRO A . n 
A 1 504 ASN 504 504 504 ASN ASN A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 THR 506 506 506 THR THR A . n 
A 1 507 ASP 507 507 507 ASP ASP A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 TYR 509 509 509 TYR TYR A . n 
A 1 510 ASP 510 510 510 ASP ASP A . n 
A 1 511 PRO 511 511 511 PRO PRO A . n 
A 1 512 ASN 512 512 512 ASN ASN A . n 
A 1 513 GLY 513 513 513 GLY GLY A . n 
A 1 514 ALA 514 514 514 ALA ALA A . n 
A 1 515 THR 515 515 515 THR THR A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 SER 517 517 517 SER SER A . n 
A 1 518 ARG 518 518 518 ARG ARG A . n 
A 1 519 ILE 519 519 519 ILE ILE A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 THR 521 521 521 THR THR A . n 
A 1 522 TYR 522 522 522 TYR TYR A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 THR 524 524 524 THR THR A . n 
A 1 525 PHE 525 525 525 PHE PHE A . n 
A 1 526 PHE 526 526 526 PHE PHE A . n 
A 1 527 TRP 527 527 527 TRP TRP A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 GLY 529 529 529 GLY GLY A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 THR 532 532 532 THR THR A . n 
A 1 533 MET 533 533 533 MET MET A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 ALA 535 535 535 ALA ALA A . n 
A 1 536 LYS 536 536 536 LYS LYS A . n 
A 1 537 LEU 537 537 537 LEU LEU A . n 
A 1 538 ARG 538 538 538 ARG ARG A . n 
A 1 539 ALA 539 539 539 ALA ALA A . n 
A 1 540 ASN 540 540 540 ASN ASN A . n 
A 1 541 THR 541 541 541 THR THR A . n 
A 1 542 THR 542 542 542 THR THR A . n 
A 1 543 TRP 543 543 543 TRP TRP A . n 
A 1 544 ASN 544 544 544 ASN ASN A . n 
A 1 545 PRO 545 545 545 PRO PRO A . n 
A 1 546 VAL 546 546 546 VAL VAL A . n 
A 1 547 TYR 547 547 547 TYR TYR A . n 
A 1 548 GLN 548 548 548 GLN GLN A . n 
A 1 549 VAL 549 549 549 VAL VAL A . n 
A 1 550 SER 550 550 550 SER SER A . n 
A 1 551 VAL 551 551 551 VAL VAL A . n 
A 1 552 GLU 552 552 552 GLU GLU A . n 
A 1 553 ASP 553 553 553 ASP ASP A . n 
A 1 554 ASN 554 554 554 ASN ASN A . n 
A 1 555 GLY 555 555 555 GLY GLY A . n 
A 1 556 ASN 556 556 556 ASN ASN A . n 
A 1 557 SER 557 557 557 SER SER A . n 
A 1 558 TYR 558 558 558 TYR TYR A . n 
A 1 559 MET 559 559 559 MET MET A . n 
A 1 560 SER 560 560 560 SER SER A . n 
A 1 561 VAL 561 561 561 VAL VAL A . n 
A 1 562 THR 562 562 562 THR THR A . n 
A 1 563 LYS 563 563 563 LYS LYS A . n 
A 1 564 TRP 564 564 564 TRP TRP A . n 
A 1 565 LEU 565 565 565 LEU LEU A . n 
A 1 566 PRO 566 566 566 PRO PRO A . n 
A 1 567 THR 567 567 567 THR THR A . n 
A 1 568 ALA 568 568 568 ALA ALA A . n 
A 1 569 THR 569 569 569 THR THR A . n 
A 1 570 GLY 570 570 570 GLY GLY A . n 
A 1 571 ASN 571 571 571 ASN ASN A . n 
A 1 572 MET 572 572 572 MET MET A . n 
A 1 573 GLN 573 573 573 GLN GLN A . n 
A 1 574 SER 574 574 574 SER SER A . n 
A 1 575 VAL 575 575 575 VAL VAL A . n 
A 1 576 PRO 576 576 576 PRO PRO A . n 
A 1 577 LEU 577 577 577 LEU LEU A . n 
A 1 578 ILE 578 578 578 ILE ILE A . n 
A 1 579 THR 579 579 579 THR THR A . n 
A 1 580 ARG 580 580 580 ARG ARG A . n 
A 1 581 PRO 581 581 581 PRO PRO A . n 
A 1 582 VAL 582 582 582 VAL VAL A . n 
A 1 583 ALA 583 583 583 ALA ALA A . n 
A 1 584 ARG 584 584 584 ARG ARG A . n 
A 1 585 ASN 585 585 585 ASN ASN A . n 
A 1 586 THR 586 586 586 THR THR A . n 
A 1 587 TYR 587 587 587 TYR TYR A . n 
B 2 1   DC  1   1   1   DC  C   B . n 
B 2 2   DC  2   2   2   DC  C   B . n 
B 2 3   DA  3   3   3   DA  A   B . n 
B 2 4   DC  4   4   4   DC  C   B . n 
B 2 5   DC  5   5   5   DC  C   B . n 
B 2 6   DC  6   6   6   DC  C   B . n 
B 2 7   DC  7   7   7   DC  C   B . n 
B 2 8   DA  8   8   8   DA  A   B . n 
B 2 9   DA  9   9   9   DA  A   B . n 
B 2 10  DC  10  10  10  DC  C   B . n 
B 2 11  DA  11  11  11  DA  A   B . n 
C 3 1   DC  1   14  14  DC  C   C . n 
C 3 2   DA  2   15  15  DA  A   C . n 
C 3 3   DA  3   16  16  DA  A   C . n 
C 3 4   DA  4   17  17  DA  A   C . n 
D 4 1   DA  1   20  20  DA  A   D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 'complete icosahedral assembly'                ? 240-MERIC   240 
2 'icosahedral asymmetric unit'                  ? tetrameric  4   
3 'icosahedral pentamer'                         ? eicosameric 20  
4 'icosahedral 23 hexamer'                       ? 24-meric    24  
5 'icosahedral asymmetric unit, std point frame' ? tetrameric  4   
6 'crystal asymmetric unit, crystal frame'       ? 120-meric   120 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 '(1-60)'                       A,B,C,D 
2 1                              A,B,C,D 
3 '(1-5)'                        A,B,C,D 
4 '(1,2,6,10,23,24)'             A,B,C,D 
5 P                              A,B,C,D 
6 '(X0)(1-10,21-25,31-35,41-50)' A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
P  'transform to point frame'   ? ? 0.00000000  -1.00000000 0.00000000  0.00000 1.00000000  0.00000000  0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  -0.00000 
X0 'transform to crystal frame' ? ? 0.86853755  0.00000000  0.49561512  0.00000 0.00000000  1.00000000  0.00000000  0.00000 
-0.49544346 0.00000000  0.86846894  0.00000  
1  'point symmetry operation'   ? ? 1.00000000  0.00000000  0.00000000  0.00000 0.00000000  1.00000000  0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  0.00000  
2  'point symmetry operation'   ? ? 0.50000000  -0.80901699 0.30901699  0.00000 0.80901699  0.30901699  -0.50000000 0.00000 
0.30901699  0.50000000  0.80901699  0.00000  
3  'point symmetry operation'   ? ? -0.30901699 -0.50000000 0.80901699  0.00000 0.50000000  -0.80901699 -0.30901699 0.00000 
0.80901699  0.30901699  0.50000000  0.00000  
4  'point symmetry operation'   ? ? -0.30901699 0.50000000  0.80901699  0.00000 -0.50000000 -0.80901699 0.30901699  0.00000 
0.80901699  -0.30901699 0.50000000  0.00000  
5  'point symmetry operation'   ? ? 0.50000000  0.80901699  0.30901699  0.00000 -0.80901699 0.30901699  0.50000000  0.00000 
0.30901699  -0.50000000 0.80901699  0.00000  
6  'point symmetry operation'   ? ? -1.00000000 0.00000000  0.00000000  0.00000 0.00000000  -1.00000000 0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  0.00000  
7  'point symmetry operation'   ? ? -0.50000000 0.80901699  -0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000  0.00000 
0.30901699  0.50000000  0.80901699  0.00000  
8  'point symmetry operation'   ? ? 0.30901699  0.50000000  -0.80901699 0.00000 -0.50000000 0.80901699  0.30901699  0.00000 
0.80901699  0.30901699  0.50000000  0.00000  
9  'point symmetry operation'   ? ? 0.30901699  -0.50000000 -0.80901699 0.00000 0.50000000  0.80901699  -0.30901699 0.00000 
0.80901699  -0.30901699 0.50000000  0.00000  
10 'point symmetry operation'   ? ? -0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699  -0.30901699 -0.50000000 0.00000 
0.30901699  -0.50000000 0.80901699  0.00000  
11 'point symmetry operation'   ? ? 1.00000000  0.00000000  0.00000000  0.00000 0.00000000  -1.00000000 0.00000000  0.00000 
0.00000000  0.00000000  -1.00000000 0.00000  
12 'point symmetry operation'   ? ? 0.50000000  -0.80901699 0.30901699  0.00000 -0.80901699 -0.30901699 0.50000000  0.00000 
-0.30901699 -0.50000000 -0.80901699 0.00000  
13 'point symmetry operation'   ? ? -0.30901699 -0.50000000 0.80901699  0.00000 -0.50000000 0.80901699  0.30901699  0.00000 
-0.80901699 -0.30901699 -0.50000000 0.00000  
14 'point symmetry operation'   ? ? -0.30901699 0.50000000  0.80901699  0.00000 0.50000000  0.80901699  -0.30901699 0.00000 
-0.80901699 0.30901699  -0.50000000 0.00000  
15 'point symmetry operation'   ? ? 0.50000000  0.80901699  0.30901699  0.00000 0.80901699  -0.30901699 -0.50000000 0.00000 
-0.30901699 0.50000000  -0.80901699 0.00000  
16 'point symmetry operation'   ? ? -1.00000000 0.00000000  0.00000000  0.00000 0.00000000  1.00000000  0.00000000  0.00000 
0.00000000  0.00000000  -1.00000000 0.00000  
17 'point symmetry operation'   ? ? -0.50000000 0.80901699  -0.30901699 0.00000 0.80901699  0.30901699  -0.50000000 0.00000 
-0.30901699 -0.50000000 -0.80901699 0.00000  
18 'point symmetry operation'   ? ? 0.30901699  0.50000000  -0.80901699 0.00000 0.50000000  -0.80901699 -0.30901699 0.00000 
-0.80901699 -0.30901699 -0.50000000 0.00000  
19 'point symmetry operation'   ? ? 0.30901699  -0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699  0.00000 
-0.80901699 0.30901699  -0.50000000 0.00000  
20 'point symmetry operation'   ? ? -0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699  0.50000000  0.00000 
-0.30901699 0.50000000  -0.80901699 0.00000  
21 'point symmetry operation'   ? ? 0.00000000  -1.00000000 0.00000000  0.00000 0.00000000  0.00000000  -1.00000000 0.00000 
1.00000000  0.00000000  0.00000000  0.00000  
22 'point symmetry operation'   ? ? -0.80901699 -0.30901699 0.50000000  0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 
0.50000000  -0.80901699 0.30901699  0.00000  
23 'point symmetry operation'   ? ? -0.50000000 0.80901699  0.30901699  0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 
-0.30901699 -0.50000000 0.80901699  0.00000  
24 'point symmetry operation'   ? ? 0.50000000  0.80901699  -0.30901699 0.00000 -0.80901699 0.30901699  -0.50000000 0.00000 
-0.30901699 0.50000000  0.80901699  0.00000  
25 'point symmetry operation'   ? ? 0.80901699  -0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000  -0.80901699 0.00000 
0.50000000  0.80901699  0.30901699  0.00000  
26 'point symmetry operation'   ? ? 0.00000000  1.00000000  0.00000000  0.00000 0.00000000  0.00000000  -1.00000000 0.00000 
-1.00000000 0.00000000  0.00000000  0.00000  
27 'point symmetry operation'   ? ? 0.80901699  0.30901699  -0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 
-0.50000000 0.80901699  -0.30901699 0.00000  
28 'point symmetry operation'   ? ? 0.50000000  -0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 
0.30901699  0.50000000  -0.80901699 0.00000  
29 'point symmetry operation'   ? ? -0.50000000 -0.80901699 0.30901699  0.00000 -0.80901699 0.30901699  -0.50000000 0.00000 
0.30901699  -0.50000000 -0.80901699 0.00000  
30 'point symmetry operation'   ? ? -0.80901699 0.30901699  0.50000000  0.00000 -0.30901699 0.50000000  -0.80901699 0.00000 
-0.50000000 -0.80901699 -0.30901699 0.00000  
31 'point symmetry operation'   ? ? 0.00000000  1.00000000  0.00000000  0.00000 0.00000000  0.00000000  1.00000000  0.00000 
1.00000000  0.00000000  0.00000000  0.00000  
32 'point symmetry operation'   ? ? 0.80901699  0.30901699  -0.50000000 0.00000 0.30901699  0.50000000  0.80901699  0.00000 
0.50000000  -0.80901699 0.30901699  0.00000  
33 'point symmetry operation'   ? ? 0.50000000  -0.80901699 -0.30901699 0.00000 0.80901699  0.30901699  0.50000000  0.00000 
-0.30901699 -0.50000000 0.80901699  0.00000  
34 'point symmetry operation'   ? ? -0.50000000 -0.80901699 0.30901699  0.00000 0.80901699  -0.30901699 0.50000000  0.00000 
-0.30901699 0.50000000  0.80901699  0.00000  
35 'point symmetry operation'   ? ? -0.80901699 0.30901699  0.50000000  0.00000 0.30901699  -0.50000000 0.80901699  0.00000 
0.50000000  0.80901699  0.30901699  0.00000  
36 'point symmetry operation'   ? ? 0.00000000  -1.00000000 0.00000000  0.00000 0.00000000  0.00000000  1.00000000  0.00000 
-1.00000000 0.00000000  0.00000000  0.00000  
37 'point symmetry operation'   ? ? -0.80901699 -0.30901699 0.50000000  0.00000 0.30901699  0.50000000  0.80901699  0.00000 
-0.50000000 0.80901699  -0.30901699 0.00000  
38 'point symmetry operation'   ? ? -0.50000000 0.80901699  0.30901699  0.00000 0.80901699  0.30901699  0.50000000  0.00000 
0.30901699  0.50000000  -0.80901699 0.00000  
39 'point symmetry operation'   ? ? 0.50000000  0.80901699  -0.30901699 0.00000 0.80901699  -0.30901699 0.50000000  0.00000 
0.30901699  -0.50000000 -0.80901699 0.00000  
40 'point symmetry operation'   ? ? 0.80901699  -0.30901699 -0.50000000 0.00000 0.30901699  -0.50000000 0.80901699  0.00000 
-0.50000000 -0.80901699 -0.30901699 0.00000  
41 'point symmetry operation'   ? ? 0.00000000  0.00000000  1.00000000  0.00000 -1.00000000 0.00000000  0.00000000  0.00000 
0.00000000  -1.00000000 0.00000000  0.00000  
42 'point symmetry operation'   ? ? 0.30901699  0.50000000  0.80901699  0.00000 -0.50000000 0.80901699  -0.30901699 0.00000 
-0.80901699 -0.30901699 0.50000000  0.00000  
43 'point symmetry operation'   ? ? 0.80901699  0.30901699  0.50000000  0.00000 0.30901699  0.50000000  -0.80901699 0.00000 
-0.50000000 0.80901699  0.30901699  0.00000  
44 'point symmetry operation'   ? ? 0.80901699  -0.30901699 0.50000000  0.00000 0.30901699  -0.50000000 -0.80901699 0.00000 
0.50000000  0.80901699  -0.30901699 0.00000  
45 'point symmetry operation'   ? ? 0.30901699  -0.50000000 0.80901699  0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 
0.80901699  -0.30901699 -0.50000000 0.00000  
46 'point symmetry operation'   ? ? 0.00000000  0.00000000  1.00000000  0.00000 1.00000000  0.00000000  0.00000000  0.00000 
0.00000000  1.00000000  0.00000000  0.00000  
47 'point symmetry operation'   ? ? 0.30901699  0.50000000  0.80901699  0.00000 0.50000000  -0.80901699 0.30901699  0.00000 
0.80901699  0.30901699  -0.50000000 0.00000  
48 'point symmetry operation'   ? ? 0.80901699  0.30901699  0.50000000  0.00000 -0.30901699 -0.50000000 0.80901699  0.00000 
0.50000000  -0.80901699 -0.30901699 0.00000  
49 'point symmetry operation'   ? ? 0.80901699  -0.30901699 0.50000000  0.00000 -0.30901699 0.50000000  0.80901699  0.00000 
-0.50000000 -0.80901699 0.30901699  0.00000  
50 'point symmetry operation'   ? ? 0.30901699  -0.50000000 0.80901699  0.00000 0.50000000  0.80901699  0.30901699  0.00000 
-0.80901699 0.30901699  0.50000000  0.00000  
51 'point symmetry operation'   ? ? 0.00000000  0.00000000  -1.00000000 0.00000 -1.00000000 0.00000000  0.00000000  0.00000 
0.00000000  1.00000000  0.00000000  0.00000  
52 'point symmetry operation'   ? ? -0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699  -0.30901699 0.00000 
0.80901699  0.30901699  -0.50000000 0.00000  
53 'point symmetry operation'   ? ? -0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699  0.50000000  -0.80901699 0.00000 
0.50000000  -0.80901699 -0.30901699 0.00000  
54 'point symmetry operation'   ? ? -0.80901699 0.30901699  -0.50000000 0.00000 0.30901699  -0.50000000 -0.80901699 0.00000 
-0.50000000 -0.80901699 0.30901699  0.00000  
55 'point symmetry operation'   ? ? -0.30901699 0.50000000  -0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 
-0.80901699 0.30901699  0.50000000  0.00000  
56 'point symmetry operation'   ? ? 0.00000000  0.00000000  -1.00000000 0.00000 1.00000000  0.00000000  0.00000000  0.00000 
0.00000000  -1.00000000 0.00000000  0.00000  
57 'point symmetry operation'   ? ? -0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000  -0.80901699 0.30901699  0.00000 
-0.80901699 -0.30901699 0.50000000  0.00000  
58 'point symmetry operation'   ? ? -0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699  0.00000 
-0.50000000 0.80901699  0.30901699  0.00000  
59 'point symmetry operation'   ? ? -0.80901699 0.30901699  -0.50000000 0.00000 -0.30901699 0.50000000  0.80901699  0.00000 
0.50000000  0.80901699  -0.30901699 0.00000  
60 'point symmetry operation'   ? ? -0.30901699 0.50000000  -0.80901699 0.00000 0.50000000  0.80901699  0.30901699  0.00000 
0.80901699  -0.30901699 -0.50000000 0.00000  
# 
_pdbx_point_symmetry.entry_id             1MVM 
_pdbx_point_symmetry.Schoenflies_symbol   I 
_pdbx_point_symmetry.H-M_notation         532 
_pdbx_point_symmetry.circular_symmetry    ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-02-25 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PURDUE 'model building' .                         ? 1 
NONE   refinement       .                         ? 2 
PURDUE 'data reduction' 'DATA PROCESSING PACKAGE' ? 3 
PURDUE 'data scaling'   'DATA PROCESSING PACKAGE' ? 4 
PURDUE phasing          'DATA PROCESSING PACKAGE' ? 5 
# 
_pdbx_database_remark.id     285 
_pdbx_database_remark.text   
;THE ENTRY PRESENTED HERE DOES NOT CONTAIN THE COMPLETE
CRYSTAL ASYMMETRIC UNIT. IN ADDITION, THE COORDINATES
ARE NOT PRESENTED IN THE STANDARD CRYSTAL FRAME.

IN ORDER TO GENERATE THE FULL CRYSTAL AU, APPLY THE
FOLLOWING TRANSFORMATION MATRIX OR MATRICES AND SELECTED
BIOMT RECORDS TO THE COORDINATES, AS SHOWN BELOW.
X0  1    0.868538   0.000000   0.495615    0.00000
X0  2    0.000000   1.000000   0.000000    0.00000
X0  3   -0.495443   0.000000   0.868469    0.00000
CRYSTAL AU =
(X0) * (BIOMT 1-10,21-25,31-35,41-50) * CHAINS A,B,C,D 
;
# 
_pdbx_entry_details.entry_id             1MVM 
_pdbx_entry_details.compound_details     
;SIXTEEN NUCLEOTIDES OF THE GENOMIC SINGLE-STRANDED DNA ARE
BOUND TO EACH OF THE 60 PROTOMERS OF THE CAPSID, TOGETHER
CONSTITUTING 20 PERCENT OF THE GENOME.  THE ELECTRON
DENSITY IS THE AVERAGE OF UP TO 60 DIFFERENT REGIONS OF THE
DNA SEQUENCE.  THUS, THE ELECTRON DENSITY FOR EACH BASE IS
EXPECTED TO BE BLURRED AS IT IS THE AVERAGE OF MANY BASES.
HOWEVER, FOR MANY OF THE NUCLEOTIDES, THE ELECTRON DENSITY
IS DISTINCTIVE FOR PURINE OR PYRIMIDINE, AND IN SOME CASES
FOR INDIVIDUAL BASE-TYPE.  THIS SHOWS THAT THERE IS SOME
SEQUENCE PREFERENCE.

INTERPRETABLE ELECTRON DENSITY BEGINS AT THE 39TH RESIDUE
OF VP2.  THERE IS DIFFUSE DENSITY, SUGGESTING THAT ONE IN
FIVE OF THE N-TERMINI IS ON THE OUTSIDE OF THE CAPSID, AND
THAT THE POLYPEPTIDE RUNS DOWN THE FIVE-FOLD AXIS TO JOIN
RESIDUE 39 ON THE INSIDE SURFACE.

ELECTRON DENSITY FOR RESIDUES 157 - 165 IS VERY WEAK.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A VAL 421 ? ? CD  A PRO 423 ? ? 1.33 
2  1 CG1 A VAL 374 ? ? N   A ARG 375 ? ? 1.43 
3  1 O   A TYR 376 ? ? CB  A ARG 395 ? ? 1.43 
4  1 O   A SER 373 ? ? N   A VAL 374 ? ? 1.46 
5  1 O   A ASN 431 ? ? CD2 A HIS 442 ? ? 1.50 
6  1 O   A PHE 403 ? ? N   A SER 405 ? ? 1.51 
7  1 OD2 A ASP 101 ? ? NH1 A ARG 219 ? ? 1.51 
8  1 O   A ARG 410 ? ? OD1 A ASP 411 ? ? 1.52 
9  1 O   A ASP 302 ? ? CG2 A THR 303 ? ? 1.54 
10 1 O   A ASP 411 ? ? O   A GLY 412 ? ? 1.54 
11 1 O   A ASN 227 ? ? O   A GLN 228 ? ? 1.54 
12 1 O   A PRO 581 ? ? CG2 A VAL 582 ? ? 1.56 
13 1 O   A TYR 53  ? ? O2  B DC  7   ? ? 1.57 
14 1 OE1 A GLU 552 ? ? N   A ASP 553 ? ? 1.59 
15 1 OD1 A ASP 159 ? ? N   A ALA 164 ? ? 1.60 
16 1 O   A ASN 385 ? ? N   A ALA 387 ? ? 1.61 
17 1 O   A ASP 218 ? ? O   A MET 237 ? ? 1.64 
18 1 O   A PHE 525 ? ? N   A PHE 526 ? ? 1.65 
19 1 CB  A ASP 181 ? ? NE2 A GLN 254 ? ? 1.66 
20 1 O   A VAL 362 ? ? O   A THR 363 ? ? 1.68 
21 1 O   A ASP 344 ? ? CD1 A PHE 345 ? ? 1.69 
22 1 O   A TYR 558 ? ? NZ  A LYS 563 ? ? 1.69 
23 1 O   A GLN 465 ? ? O   A GLY 466 ? ? 1.70 
24 1 CE1 A TYR 378 ? ? NE2 A GLN 465 ? ? 1.70 
25 1 NE1 A TRP 111 ? ? OE2 A GLU 251 ? ? 1.71 
26 1 O   A ASN 431 ? ? NE2 A HIS 442 ? ? 1.72 
27 1 OG  A SER 373 ? ? O   A TRP 398 ? ? 1.74 
28 1 O   A LYS 241 ? ? N   A MET 243 ? ? 1.74 
29 1 O   A VAL 561 ? ? N   A LYS 563 ? ? 1.77 
30 1 O   A VAL 336 ? ? NH2 A ARG 407 ? ? 1.78 
31 1 CA  A ASP 344 ? ? N   A PHE 345 ? ? 1.78 
32 1 O   A ASP 553 ? ? N   A ASN 554 ? ? 1.79 
33 1 O   A ALA 370 ? ? N   A GLY 372 ? ? 1.79 
34 1 C   A ASP 344 ? ? CA  A PHE 345 ? ? 1.80 
35 1 O   A ALA 301 ? ? OD1 A ASP 304 ? ? 1.85 
36 1 O   A ASP 367 ? ? N   A GLU 369 ? ? 1.87 
37 1 CA  A TYR 558 ? ? NZ  A LYS 563 ? ? 1.88 
38 1 CG1 A VAL 322 ? ? NE1 A TRP 324 ? ? 1.88 
39 1 OE2 A GLU 79  ? ? NH1 A ARG 518 ? ? 1.88 
40 1 NE1 A TRP 119 ? ? O   A GLN 467 ? ? 1.91 
41 1 CG  A ASP 101 ? ? NH1 A ARG 219 ? ? 1.92 
42 1 NE1 A TRP 128 ? ? OG1 A THR 579 ? ? 1.96 
43 1 O   A PRO 76  ? ? NH2 A ARG 518 ? ? 1.97 
44 1 CG  A ASP 181 ? ? NE2 A GLN 254 ? ? 1.98 
45 1 C   A TYR 558 ? ? NZ  A LYS 563 ? ? 1.98 
46 1 OG1 A THR 109 ? ? O   A TYR 211 ? ? 2.00 
47 1 O   A TRP 386 ? ? OD1 A ASN 571 ? ? 2.02 
48 1 NH2 A ARG 85  ? ? CG  A MET 237 ? ? 2.03 
49 1 O   A ASP 115 ? ? CD1 A LEU 198 ? ? 2.03 
50 1 O   A GLN 158 ? ? O   A ILE 165 ? ? 2.03 
51 1 O   A THR 401 ? ? N   A PHE 403 ? ? 2.04 
52 1 CD1 A TYR 378 ? ? NE2 A GLN 465 ? ? 2.04 
53 1 O   A TYR 53  ? ? C2  B DC  7   ? ? 2.05 
54 1 OG  A SER 142 ? ? OG1 A THR 532 ? ? 2.05 
55 1 CD1 A TYR 509 ? ? CD1 A LEU 516 ? ? 2.08 
56 1 OE1 A GLN 415 ? ? CD1 A LEU 419 ? ? 2.09 
57 1 O   A SER 182 ? ? N   A ASN 184 ? ? 2.09 
58 1 O   A VAL 421 ? ? N   A PRO 423 ? ? 2.12 
59 1 O   A LYS 95  ? ? O   A THR 224 ? ? 2.14 
60 1 OD1 A ASP 159 ? ? CA  A ALA 164 ? ? 2.14 
61 1 O   A GLY 390 ? ? N   A ALA 392 ? ? 2.15 
62 1 OD1 A ASN 385 ? ? NE2 A GLN 573 ? ? 2.15 
63 1 CB  A PRO 299 ? ? O   A ASP 304 ? ? 2.15 
64 1 O   A ASN 88  ? ? OG1 A THR 92  ? ? 2.16 
65 1 CE  A MET 98  ? ? N   A THR 224 ? ? 2.16 
66 1 ND2 A ASN 117 ? ? O   A TRP 469 ? ? 2.16 
67 1 CD2 A LEU 289 ? ? CB  A TYR 587 ? ? 2.16 
68 1 CE  A MET 98  ? ? CA  A VAL 223 ? ? 2.17 
69 1 OD1 A ASP 101 ? ? NH1 A ARG 219 ? ? 2.17 
70 1 O   A PRO 418 ? ? N   A VAL 420 ? ? 2.17 
71 1 O   A LYS 95  ? ? OG1 A THR 224 ? ? 2.17 
72 1 OD2 A ASP 361 ? ? CD1 A PHE 403 ? ? 2.18 
73 1 N   A SER 142 ? ? OG1 A THR 532 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 C     A CYS 175 ? ? N     A MET 176 ? ? 1.475 1.336 0.139  0.023 Y 
2  1 C     A ARG 330 ? ? N     A THR 331 ? ? 1.547 1.336 0.211  0.023 Y 
3  1 C     A ASP 344 ? ? N     A PHE 345 ? ? 0.741 1.336 -0.595 0.023 Y 
4  1 C     A SER 373 ? ? N     A VAL 374 ? ? 0.772 1.336 -0.564 0.023 Y 
5  1 C     A VAL 374 ? ? N     A ARG 375 ? ? 1.611 1.336 0.275  0.023 Y 
6  1 C     A PHE 525 ? ? N     A PHE 526 ? ? 0.869 1.336 -0.467 0.023 Y 
7  1 C     A ALA 539 ? ? N     A ASN 540 ? ? 1.531 1.336 0.195  0.023 Y 
8  1 C     A ASP 553 ? ? N     A ASN 554 ? ? 1.041 1.336 -0.295 0.023 Y 
9  1 CA    A GLY 555 ? ? C     A GLY 555 ? ? 1.128 1.514 -0.386 0.016 N 
10 1 C     A TYR 587 ? ? OXT   A TYR 587 ? ? 0.304 1.229 -0.925 0.019 N 
11 1 "C2'" B DC  1   ? ? "C1'" B DC  1   ? ? 1.439 1.518 -0.079 0.010 N 
12 1 "O3'" B DC  7   ? ? P     B DA  8   ? ? 1.684 1.607 0.077  0.012 Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE  A ARG 54  ? ? CZ A ARG 54  ? ? NH2 A ARG 54  ? ? 123.92 120.30 3.62   0.50 N 
2  1 NE  A ARG 69  ? ? CZ A ARG 69  ? ? NH2 A ARG 69  ? ? 123.97 120.30 3.67   0.50 N 
3  1 CG  A MET 75  ? ? SD A MET 75  ? ? CE  A MET 75  ? ? 110.00 100.20 9.80   1.60 N 
4  1 NE  A ARG 83  ? ? CZ A ARG 83  ? ? NH2 A ARG 83  ? ? 123.98 120.30 3.68   0.50 N 
5  1 NE  A ARG 85  ? ? CZ A ARG 85  ? ? NH2 A ARG 85  ? ? 124.05 120.30 3.75   0.50 N 
6  1 CG  A MET 98  ? ? SD A MET 98  ? ? CE  A MET 98  ? ? 110.02 100.20 9.82   1.60 N 
7  1 CG  A MET 135 ? ? SD A MET 135 ? ? CE  A MET 135 ? ? 110.00 100.20 9.80   1.60 N 
8  1 CG  A MET 176 ? ? SD A MET 176 ? ? CE  A MET 176 ? ? 110.02 100.20 9.82   1.60 N 
9  1 CG  A MET 195 ? ? SD A MET 195 ? ? CE  A MET 195 ? ? 110.00 100.20 9.80   1.60 N 
10 1 NE  A ARG 219 ? ? CZ A ARG 219 ? ? NH2 A ARG 219 ? ? 124.00 120.30 3.70   0.50 N 
11 1 CG  A MET 237 ? ? SD A MET 237 ? ? CE  A MET 237 ? ? 110.02 100.20 9.82   1.60 N 
12 1 CG  A MET 243 ? ? SD A MET 243 ? ? CE  A MET 243 ? ? 110.02 100.20 9.82   1.60 N 
13 1 NE  A ARG 287 ? ? CZ A ARG 287 ? ? NH2 A ARG 287 ? ? 123.95 120.30 3.65   0.50 N 
14 1 CG  A MET 320 ? ? SD A MET 320 ? ? CE  A MET 320 ? ? 110.00 100.20 9.80   1.60 N 
15 1 NE  A ARG 330 ? ? CZ A ARG 330 ? ? NH2 A ARG 330 ? ? 124.08 120.30 3.78   0.50 N 
16 1 NE  A ARG 332 ? ? CZ A ARG 332 ? ? NH2 A ARG 332 ? ? 124.02 120.30 3.72   0.50 N 
17 1 CA  A ASP 344 ? ? C  A ASP 344 ? ? N   A PHE 345 ? ? 101.98 117.20 -15.22 2.20 Y 
18 1 O   A ASP 344 ? ? C  A ASP 344 ? ? N   A PHE 345 ? ? 136.40 122.70 13.70  1.60 Y 
19 1 O   A PRO 356 ? ? C  A PRO 356 ? ? N   A LYS 357 ? ? 133.21 122.70 10.51  1.60 Y 
20 1 CG  A MET 366 ? ? SD A MET 366 ? ? CE  A MET 366 ? ? 109.94 100.20 9.74   1.60 N 
21 1 NE  A ARG 368 ? ? CZ A ARG 368 ? ? NH2 A ARG 368 ? ? 123.95 120.30 3.65   0.50 N 
22 1 CA  A SER 373 ? ? C  A SER 373 ? ? N   A VAL 374 ? ? 146.19 117.20 28.99  2.20 Y 
23 1 O   A SER 373 ? ? C  A SER 373 ? ? N   A VAL 374 ? ? 90.64  122.70 -32.06 1.60 Y 
24 1 C   A SER 373 ? ? N  A VAL 374 ? ? CA  A VAL 374 ? ? 152.90 121.70 31.20  2.50 Y 
25 1 CA  A VAL 374 ? ? C  A VAL 374 ? ? N   A ARG 375 ? ? 89.41  117.20 -27.79 2.20 Y 
26 1 O   A VAL 374 ? ? C  A VAL 374 ? ? N   A ARG 375 ? ? 145.94 122.70 23.24  1.60 Y 
27 1 C   A VAL 374 ? ? N  A ARG 375 ? ? CA  A ARG 375 ? ? 92.21  121.70 -29.49 2.50 Y 
28 1 NE  A ARG 375 ? ? CZ A ARG 375 ? ? NH2 A ARG 375 ? ? 124.01 120.30 3.71   0.50 N 
29 1 NE  A ARG 395 ? ? CZ A ARG 395 ? ? NH2 A ARG 395 ? ? 123.98 120.30 3.68   0.50 N 
30 1 NE  A ARG 407 ? ? CZ A ARG 407 ? ? NH2 A ARG 407 ? ? 124.03 120.30 3.73   0.50 N 
31 1 NE  A ARG 410 ? ? CZ A ARG 410 ? ? NH2 A ARG 410 ? ? 123.88 120.30 3.58   0.50 N 
32 1 NE  A ARG 480 ? ? CZ A ARG 480 ? ? NH2 A ARG 480 ? ? 123.99 120.30 3.69   0.50 N 
33 1 CG  A MET 497 ? ? SD A MET 497 ? ? CE  A MET 497 ? ? 109.95 100.20 9.75   1.60 N 
34 1 NE  A ARG 500 ? ? CZ A ARG 500 ? ? NH2 A ARG 500 ? ? 124.50 120.30 4.20   0.50 N 
35 1 O   A THR 524 ? ? C  A THR 524 ? ? N   A PHE 525 ? ? 134.36 122.70 11.66  1.60 Y 
36 1 O   A PHE 525 ? ? C  A PHE 525 ? ? N   A PHE 526 ? ? 101.56 122.70 -21.14 1.60 Y 
37 1 CG  A MET 533 ? ? SD A MET 533 ? ? CE  A MET 533 ? ? 109.88 100.20 9.68   1.60 N 
38 1 NE  A ARG 534 ? ? CZ A ARG 534 ? ? NH2 A ARG 534 ? ? 123.98 120.30 3.68   0.50 N 
39 1 NE  A ARG 538 ? ? CZ A ARG 538 ? ? NH2 A ARG 538 ? ? 124.05 120.30 3.75   0.50 N 
40 1 C   A ALA 539 ? ? N  A ASN 540 ? ? CA  A ASN 540 ? ? 90.87  121.70 -30.83 2.50 Y 
41 1 CA  A ASP 553 ? ? C  A ASP 553 ? ? N   A ASN 554 ? ? 135.70 117.20 18.50  2.20 Y 
42 1 O   A ASP 553 ? ? C  A ASP 553 ? ? N   A ASN 554 ? ? 103.17 122.70 -19.53 1.60 Y 
43 1 C   A ASP 553 ? ? N  A ASN 554 ? ? CA  A ASN 554 ? ? 144.33 121.70 22.63  2.50 Y 
44 1 N   A GLY 555 ? ? CA A GLY 555 ? ? C   A GLY 555 ? ? 129.55 113.10 16.45  2.50 N 
45 1 CG  A MET 559 ? ? SD A MET 559 ? ? CE  A MET 559 ? ? 109.97 100.20 9.77   1.60 N 
46 1 CG  A MET 572 ? ? SD A MET 572 ? ? CE  A MET 572 ? ? 110.08 100.20 9.88   1.60 N 
47 1 NE  A ARG 580 ? ? CZ A ARG 580 ? ? NH2 A ARG 580 ? ? 124.02 120.30 3.72   0.50 N 
48 1 NE  A ARG 584 ? ? CZ A ARG 584 ? ? NH2 A ARG 584 ? ? 124.10 120.30 3.80   0.50 N 
49 1 OP1 C DC  14  ? ? P  C DC  14  ? ? OP2 C DC  14  ? ? 89.56  119.60 -30.04 1.50 N 
50 1 C8  C DA  16  ? ? N9 C DA  16  ? ? C4  C DA  16  ? ? 103.04 105.80 -2.76  0.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 SER A 46  ? ? -106.68 -142.67 
2   1 TYR A 47  ? ? -165.57 102.01  
3   1 ASP A 58  ? ? 86.27   53.33   
4   1 ALA A 67  ? ? -174.31 129.85  
5   1 ASN A 88  ? ? -65.52  92.51   
6   1 THR A 89  ? ? -95.18  57.61   
7   1 THR A 90  ? ? -150.58 -2.42   
8   1 ASP A 91  ? ? -144.74 -1.18   
9   1 SER A 93  ? ? -108.59 62.72   
10  1 VAL A 94  ? ? -123.22 -84.02  
11  1 LYS A 95  ? ? 153.27  -22.75  
12  1 ALA A 99  ? ? -76.05  31.60   
13  1 ILE A 131 ? ? -75.03  -75.85  
14  1 THR A 134 ? ? -109.56 -62.14  
15  1 SER A 136 ? ? -78.08  -75.37  
16  1 VAL A 141 ? ? -101.69 -110.14 
17  1 LEU A 143 ? ? -164.39 110.03  
18  1 GLU A 157 ? ? -53.52  103.82  
19  1 ASP A 159 ? ? 113.25  50.86   
20  1 ALA A 164 ? ? 143.53  116.62  
21  1 LEU A 172 ? ? -64.81  18.65   
22  1 MET A 176 ? ? -157.68 78.19   
23  1 ASN A 183 ? ? -47.55  6.12    
24  1 ASN A 184 ? ? 28.25   55.34   
25  1 THR A 189 ? ? -108.57 79.01   
26  1 PRO A 190 ? ? -61.71  99.47   
27  1 SER A 194 ? ? -97.62  33.71   
28  1 THR A 197 ? ? -119.70 -156.05 
29  1 PRO A 202 ? ? -59.26  -6.95   
30  1 VAL A 217 ? ? -128.53 -98.72  
31  1 ASP A 218 ? ? 132.66  130.37  
32  1 THR A 224 ? ? 177.86  142.26  
33  1 GLU A 226 ? ? 25.63   -91.86  
34  1 GLN A 228 ? ? 24.05   165.30  
35  1 GLU A 233 ? ? 95.88   -80.36  
36  1 MET A 237 ? ? -75.58  -120.40 
37  1 MET A 243 ? ? -150.74 -40.87  
38  1 GLN A 246 ? ? -153.71 75.44   
39  1 GLU A 251 ? ? -78.91  30.69   
40  1 ASN A 252 ? ? -148.64 -36.61  
41  1 LEU A 258 ? ? -59.25  99.46   
42  1 ARG A 260 ? ? -98.81  -124.51 
43  1 TRP A 283 ? ? -172.39 11.03   
44  1 THR A 285 ? ? -63.97  -146.41 
45  1 GLN A 288 ? ? -145.10 55.78   
46  1 ALA A 301 ? ? 159.76  129.97  
47  1 ASP A 302 ? ? -19.80  116.56  
48  1 THR A 303 ? ? 101.56  65.73   
49  1 ASP A 304 ? ? 161.05  88.96   
50  1 ALA A 310 ? ? -15.04  111.28  
51  1 SER A 313 ? ? -148.26 -3.72   
52  1 TRP A 324 ? ? 166.41  109.74  
53  1 ARG A 330 ? ? -34.73  138.93  
54  1 ASP A 344 ? ? -52.53  -153.41 
55  1 PHE A 345 ? ? 161.97  95.76   
56  1 SER A 348 ? ? -174.82 -131.81 
57  1 ALA A 354 ? ? -46.70  157.77  
58  1 PRO A 356 ? ? -59.42  179.61  
59  1 ASP A 361 ? ? -28.28  175.68  
60  1 THR A 363 ? ? 11.54   162.61  
61  1 GLN A 364 ? ? -55.95  6.13    
62  1 MET A 366 ? ? 46.04   70.43   
63  1 ARG A 368 ? ? 10.77   -20.01  
64  1 ALA A 370 ? ? -78.50  -83.64  
65  1 ASN A 371 ? ? -46.76  45.29   
66  1 VAL A 374 ? ? -76.21  -153.67 
67  1 ARG A 375 ? ? 172.62  130.26  
68  1 LYS A 380 ? ? -4.91   -61.90  
69  1 GLN A 381 ? ? -64.46  27.76   
70  1 HIS A 382 ? ? -176.36 21.65   
71  1 GLU A 384 ? ? 60.04   150.17  
72  1 ASN A 385 ? ? -67.20  57.69   
73  1 TRP A 386 ? ? -4.82   19.52   
74  1 ALA A 387 ? ? -157.20 30.11   
75  1 PRO A 391 ? ? -60.12  56.07   
76  1 PRO A 393 ? ? -60.52  -177.07 
77  1 TYR A 396 ? ? -160.43 94.90   
78  1 GLU A 400 ? ? -35.12  164.78  
79  1 ASN A 402 ? ? -49.73  47.55   
80  1 PHE A 403 ? ? -40.37  -131.82 
81  1 ASP A 411 ? ? -163.05 12.68   
82  1 PHE A 413 ? ? 140.50  125.79  
83  1 ALA A 417 ? ? -26.87  -110.94 
84  1 PRO A 418 ? ? -57.03  92.05   
85  1 LEU A 419 ? ? -44.23  40.78   
86  1 PRO A 422 ? ? -57.79  70.05   
87  1 PRO A 424 ? ? -57.65  -168.22 
88  1 THR A 437 ? ? 97.54   2.86    
89  1 ASN A 439 ? ? -59.46  -79.36  
90  1 ASP A 440 ? ? -69.01  10.41   
91  1 PHE A 447 ? ? -43.74  157.69  
92  1 ASN A 448 ? ? -165.57 96.54   
93  1 PRO A 452 ? ? -60.11  10.68   
94  1 PHE A 456 ? ? 164.71  156.05  
95  1 TYR A 463 ? ? -15.67  -108.01 
96  1 GLN A 465 ? ? 59.10   -90.78  
97  1 ILE A 468 ? ? -129.17 -83.04  
98  1 LYS A 471 ? ? -36.80  -148.82 
99  1 ASP A 474 ? ? -70.43  49.43   
100 1 ASN A 491 ? ? -110.67 -161.61 
101 1 ASN A 492 ? ? -43.17  -177.51 
102 1 THR A 506 ? ? -105.07 -166.78 
103 1 TYR A 509 ? ? -178.50 83.02   
104 1 ASN A 512 ? ? -70.39  37.57   
105 1 THR A 542 ? ? -78.57  -154.88 
106 1 TRP A 543 ? ? -132.39 -41.24  
107 1 PRO A 545 ? ? -56.12  -177.97 
108 1 ASP A 553 ? ? -46.65  -131.58 
109 1 ASN A 556 ? ? -169.69 -4.38   
110 1 VAL A 561 ? ? -18.09  -99.42  
111 1 THR A 562 ? ? -0.60   -38.18  
112 1 TRP A 564 ? ? -101.13 -67.15  
113 1 PRO A 566 ? ? -60.44  -167.01 
114 1 ALA A 568 ? ? -25.33  -68.48  
115 1 THR A 569 ? ? -60.61  -107.86 
116 1 ARG A 580 ? ? 147.77  10.19   
117 1 PRO A 581 ? ? -61.09  89.54   
118 1 VAL A 582 ? ? 161.39  128.00  
119 1 ALA A 583 ? ? -49.11  -174.21 
120 1 ARG A 584 ? ? -174.44 18.62   
121 1 ASN A 585 ? ? 23.11   91.55   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   PHE 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    525 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PHE 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    526 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            149.29 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 SER A 373 ? ? -17.60 
2 1 PHE A 525 ? ? 28.70  
3 1 LEU A 537 ? ? 10.19  
4 1 ALA A 539 ? ? -13.21 
5 1 GLY A 555 ? ? -10.00 
# 
loop_
_pdbx_validate_polymer_linkage.id 
_pdbx_validate_polymer_linkage.PDB_model_num 
_pdbx_validate_polymer_linkage.auth_atom_id_1 
_pdbx_validate_polymer_linkage.auth_asym_id_1 
_pdbx_validate_polymer_linkage.auth_comp_id_1 
_pdbx_validate_polymer_linkage.auth_seq_id_1 
_pdbx_validate_polymer_linkage.PDB_ins_code_1 
_pdbx_validate_polymer_linkage.label_alt_id_1 
_pdbx_validate_polymer_linkage.auth_atom_id_2 
_pdbx_validate_polymer_linkage.auth_asym_id_2 
_pdbx_validate_polymer_linkage.auth_comp_id_2 
_pdbx_validate_polymer_linkage.auth_seq_id_2 
_pdbx_validate_polymer_linkage.PDB_ins_code_2 
_pdbx_validate_polymer_linkage.label_alt_id_2 
_pdbx_validate_polymer_linkage.dist 
1  1 C     A ALA 174 ? ? N A CYS 175 ? ? 1.84 
2  1 C     A ASP 344 ? ? N A PHE 345 ? ? 0.74 
3  1 C     A PRO 352 ? ? N A PHE 353 ? ? 2.03 
4  1 C     A SER 373 ? ? N A VAL 374 ? ? 0.77 
5  1 C     A VAL 374 ? ? N A ARG 375 ? ? 1.61 
6  1 C     A ILE 483 ? ? N A THR 484 ? ? 1.84 
7  1 C     A GLY 495 ? ? N A GLN 496 ? ? 1.20 
8  1 C     A PHE 525 ? ? N A PHE 526 ? ? 0.87 
9  1 C     A PHE 526 ? ? N A TRP 527 ? ? 1.78 
10 1 C     A ASP 553 ? ? N A ASN 554 ? ? 1.04 
11 1 "O3'" B DC  10  ? ? P B DA  11  ? ? 2.98 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1  ? A MET 1  
2  1 Y 1 A SER 2  ? A SER 2  
3  1 Y 1 A ASP 3  ? A ASP 3  
4  1 Y 1 A GLY 4  ? A GLY 4  
5  1 Y 1 A THR 5  ? A THR 5  
6  1 Y 1 A SER 6  ? A SER 6  
7  1 Y 1 A GLN 7  ? A GLN 7  
8  1 Y 1 A PRO 8  ? A PRO 8  
9  1 Y 1 A ASP 9  ? A ASP 9  
10 1 Y 1 A GLY 10 ? A GLY 10 
11 1 Y 1 A GLY 11 ? A GLY 11 
12 1 Y 1 A ASN 12 ? A ASN 12 
13 1 Y 1 A ALA 13 ? A ALA 13 
14 1 Y 1 A VAL 14 ? A VAL 14 
15 1 Y 1 A HIS 15 ? A HIS 15 
16 1 Y 1 A SER 16 ? A SER 16 
17 1 Y 1 A ALA 17 ? A ALA 17 
18 1 Y 1 A ALA 18 ? A ALA 18 
19 1 Y 1 A ARG 19 ? A ARG 19 
20 1 Y 1 A VAL 20 ? A VAL 20 
21 1 Y 1 A GLU 21 ? A GLU 21 
22 1 Y 1 A ARG 22 ? A ARG 22 
23 1 Y 1 A ALA 23 ? A ALA 23 
24 1 Y 1 A ALA 24 ? A ALA 24 
25 1 Y 1 A ASP 25 ? A ASP 25 
26 1 Y 1 A GLY 26 ? A GLY 26 
27 1 Y 1 A PRO 27 ? A PRO 27 
28 1 Y 1 A GLY 28 ? A GLY 28 
29 1 Y 1 A GLY 29 ? A GLY 29 
30 1 Y 1 A SER 30 ? A SER 30 
31 1 Y 1 A GLY 31 ? A GLY 31 
32 1 Y 1 A GLY 32 ? A GLY 32 
33 1 Y 1 A GLY 33 ? A GLY 33 
34 1 Y 1 A GLY 34 ? A GLY 34 
35 1 Y 1 A SER 35 ? A SER 35 
36 1 Y 1 A GLY 36 ? A GLY 36 
37 1 Y 1 A GLY 37 ? A GLY 37 
38 1 Y 1 A GLY 38 ? A GLY 38 
#